data_6DVD
# 
_entry.id   6DVD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.305 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6DVD         
WWPDB D_1000234375 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6DVD 
_pdbx_database_status.recvd_initial_deposition_date   2018-06-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Lin, W.'       1 ? 
'Das, K.'       2 ? 
'Feng, Y.'      3 ? 
'Ebright, R.H.' 4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            10 
_citation.language                  ? 
_citation.page_first                710 
_citation.page_last                 710 
_citation.title                     'Structural basis of ECF-sigma-factor-dependent transcription initiation.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-019-08443-3 
_citation.pdbx_database_id_PubMed   30755604 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lin, W.'       1 ?                   
primary 'Mandal, S.'    2 0000-0002-7752-0982 
primary 'Degen, D.'     3 ?                   
primary 'Cho, M.S.'     4 ?                   
primary 'Feng, Y.'      5 ?                   
primary 'Das, K.'       6 0000-0002-8897-324X 
primary 'Ebright, R.H.' 7 0000-0001-8915-7140 
# 
_cell.entry_id           6DVD 
_cell.length_a           142.135 
_cell.length_b           161.485 
_cell.length_c           239.367 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         6DVD 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA-directed RNA polymerase subunit alpha'                                               39315.027  2 2.7.7.6 ? 
? ? 
2 polymer     man 'DNA-directed RNA polymerase subunit beta'                                                130018.828 1 2.7.7.6 ? 
? ? 
3 polymer     man 
;DNA-directed RNA polymerase subunit beta'
;
146968.969 1 2.7.7.6 ? ? ? 
4 polymer     man 'DNA-directed RNA polymerase subunit omega'                                               11851.140  1 2.7.7.6 ? 
? ? 
5 polymer     man 'ECF RNA polymerase sigma factor SigL'                                                    19563.074  1 ?       ? 
? ? 
6 polymer     man 
;DNA (5'-D(*GP*CP*AP*TP*CP*CP*GP*TP*GP*A)-3')
;
3045.005   1 ?       ? ? ? 
7 polymer     man 
;DNA (5'-D(P*CP*GP*TP*GP*TP*CP*AP*GP*TP*AP*GP*CP*TP*GP*TP*CP*AP*CP*GP*GP*AP*TP*GP*C)-3')
;
7401.764   1 ?       ? ? ? 
8 non-polymer syn 'ZINC ION'                                                                                65.409     2 ?       ? 
? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha,RNA polymerase subunit alpha,Transcriptase subunit alpha'                                     
2 'RNAP subunit beta,RNA polymerase subunit beta,Transcriptase subunit beta'                                        
3 
;RNAP subunit beta',RNA polymerase subunit beta',Transcriptase subunit beta'
;
4 'RNAP omega subunit,RNA polymerase omega subunit,Transcriptase subunit omega'                                     
5 'ECF sigma factor SigL,Alternative RNA polymerase sigma factor SigL,RNA polymerase sigma-L factor,Sigma-L factor' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MGHHHHHHHHHHMLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPG
VKEDVTEIILNLKSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVP
AVQNRASGAEIGRIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELFGLARELNVE
AEGIEIGPSPAEADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSL
KDSPPSFDPSEVAGYDVATGTWSTEGAYDEQDYAETEQL
;
;MGHHHHHHHHHHMLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPG
VKEDVTEIILNLKSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVP
AVQNRASGAEIGRIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELFGLARELNVE
AEGIEIGPSPAEADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSL
KDSPPSFDPSEVAGYDVATGTWSTEGAYDEQDYAETEQL
;
A,B ? 
2 'polypeptide(L)'        no no 
;MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDV
NPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMM
TEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKA
LGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKL
GLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVV
RERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHY
GRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVL
VRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGD
VVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLL
VAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGD
ILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKIS
DGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLP
DELLEAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDK
IHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPES
FKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
;MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDV
NPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMM
TEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKA
LGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKL
GLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVV
RERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHY
GRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVL
VRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGD
VVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLL
VAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGD
ILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKIS
DGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLP
DELLEAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDK
IHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPES
FKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
C   ? 
3 'polypeptide(L)'        no no 
;MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERK
AVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENL
YRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQL
RPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAG
FYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDV
SQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQV
KVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVP
RGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHE
VLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARA
AAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
;MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERK
AVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENL
YRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQL
RPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAG
FYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDV
SQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQV
KVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVP
RGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHE
VLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARA
AAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
D   ? 
4 'polypeptide(L)'        no no 
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
E   ? 
5 'polypeptide(L)'        no no 
;MARVSGAAAAEAALMRALYDEHAAVLWRYALRLTGDAAQAEDVVQETLLRAWQHPEVIGDTARPARAWLFTVARNMIIDE
RRSARFRNVVGSTDQSGTPEQSTPDEVNAALDRLLIADALAQLSAEHRAVIQRSYYRGWSTAQIATDLGIAEGTVKSRLH
YAVRALRLTLQELGVTR
;
;MARVSGAAAAEAALMRALYDEHAAVLWRYALRLTGDAAQAEDVVQETLLRAWQHPEVIGDTARPARAWLFTVARNMIIDE
RRSARFRNVVGSTDQSGTPEQSTPDEVNAALDRLLIADALAQLSAEHRAVIQRSYYRGWSTAQIATDLGIAEGTVKSRLH
YAVRALRLTLQELGVTR
;
F   ? 
6 polydeoxyribonucleotide no no '(DG)(DC)(DA)(DT)(DC)(DC)(DG)(DT)(DG)(DA)' GCATCCGTGA G   ? 
7 polydeoxyribonucleotide no no 
;(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DT)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DC)(DG)(DG)
(DA)(DT)(DG)(DC)
;
CGTGTCAGTAGCTGTCACGGATGC H   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    GLY n 
1 3    HIS n 
1 4    HIS n 
1 5    HIS n 
1 6    HIS n 
1 7    HIS n 
1 8    HIS n 
1 9    HIS n 
1 10   HIS n 
1 11   HIS n 
1 12   HIS n 
1 13   MET n 
1 14   LEU n 
1 15   ILE n 
1 16   SER n 
1 17   GLN n 
1 18   ARG n 
1 19   PRO n 
1 20   THR n 
1 21   LEU n 
1 22   SER n 
1 23   GLU n 
1 24   ASP n 
1 25   VAL n 
1 26   LEU n 
1 27   THR n 
1 28   ASP n 
1 29   ASN n 
1 30   ARG n 
1 31   SER n 
1 32   GLN n 
1 33   PHE n 
1 34   VAL n 
1 35   ILE n 
1 36   GLU n 
1 37   PRO n 
1 38   LEU n 
1 39   GLU n 
1 40   PRO n 
1 41   GLY n 
1 42   PHE n 
1 43   GLY n 
1 44   TYR n 
1 45   THR n 
1 46   LEU n 
1 47   GLY n 
1 48   ASN n 
1 49   SER n 
1 50   LEU n 
1 51   ARG n 
1 52   ARG n 
1 53   THR n 
1 54   LEU n 
1 55   LEU n 
1 56   SER n 
1 57   SER n 
1 58   ILE n 
1 59   PRO n 
1 60   GLY n 
1 61   ALA n 
1 62   ALA n 
1 63   VAL n 
1 64   THR n 
1 65   SER n 
1 66   ILE n 
1 67   ARG n 
1 68   ILE n 
1 69   ASP n 
1 70   GLY n 
1 71   VAL n 
1 72   LEU n 
1 73   HIS n 
1 74   GLU n 
1 75   PHE n 
1 76   THR n 
1 77   THR n 
1 78   VAL n 
1 79   PRO n 
1 80   GLY n 
1 81   VAL n 
1 82   LYS n 
1 83   GLU n 
1 84   ASP n 
1 85   VAL n 
1 86   THR n 
1 87   GLU n 
1 88   ILE n 
1 89   ILE n 
1 90   LEU n 
1 91   ASN n 
1 92   LEU n 
1 93   LYS n 
1 94   SER n 
1 95   LEU n 
1 96   VAL n 
1 97   VAL n 
1 98   SER n 
1 99   SER n 
1 100  GLU n 
1 101  GLU n 
1 102  ASP n 
1 103  GLU n 
1 104  PRO n 
1 105  VAL n 
1 106  THR n 
1 107  MET n 
1 108  TYR n 
1 109  LEU n 
1 110  ARG n 
1 111  LYS n 
1 112  GLN n 
1 113  GLY n 
1 114  PRO n 
1 115  GLY n 
1 116  GLU n 
1 117  VAL n 
1 118  THR n 
1 119  ALA n 
1 120  GLY n 
1 121  ASP n 
1 122  ILE n 
1 123  VAL n 
1 124  PRO n 
1 125  PRO n 
1 126  ALA n 
1 127  GLY n 
1 128  VAL n 
1 129  THR n 
1 130  VAL n 
1 131  HIS n 
1 132  ASN n 
1 133  PRO n 
1 134  GLY n 
1 135  MET n 
1 136  HIS n 
1 137  ILE n 
1 138  ALA n 
1 139  THR n 
1 140  LEU n 
1 141  ASN n 
1 142  ASP n 
1 143  LYS n 
1 144  GLY n 
1 145  LYS n 
1 146  LEU n 
1 147  GLU n 
1 148  VAL n 
1 149  GLU n 
1 150  LEU n 
1 151  VAL n 
1 152  VAL n 
1 153  GLU n 
1 154  ARG n 
1 155  GLY n 
1 156  ARG n 
1 157  GLY n 
1 158  TYR n 
1 159  VAL n 
1 160  PRO n 
1 161  ALA n 
1 162  VAL n 
1 163  GLN n 
1 164  ASN n 
1 165  ARG n 
1 166  ALA n 
1 167  SER n 
1 168  GLY n 
1 169  ALA n 
1 170  GLU n 
1 171  ILE n 
1 172  GLY n 
1 173  ARG n 
1 174  ILE n 
1 175  PRO n 
1 176  VAL n 
1 177  ASP n 
1 178  SER n 
1 179  ILE n 
1 180  TYR n 
1 181  SER n 
1 182  PRO n 
1 183  VAL n 
1 184  LEU n 
1 185  LYS n 
1 186  VAL n 
1 187  THR n 
1 188  TYR n 
1 189  LYS n 
1 190  VAL n 
1 191  ASP n 
1 192  ALA n 
1 193  THR n 
1 194  ARG n 
1 195  VAL n 
1 196  GLU n 
1 197  GLN n 
1 198  ARG n 
1 199  THR n 
1 200  ASP n 
1 201  PHE n 
1 202  ASP n 
1 203  LYS n 
1 204  LEU n 
1 205  ILE n 
1 206  LEU n 
1 207  ASP n 
1 208  VAL n 
1 209  GLU n 
1 210  THR n 
1 211  LYS n 
1 212  ASN n 
1 213  SER n 
1 214  ILE n 
1 215  SER n 
1 216  PRO n 
1 217  ARG n 
1 218  ASP n 
1 219  ALA n 
1 220  LEU n 
1 221  ALA n 
1 222  SER n 
1 223  ALA n 
1 224  GLY n 
1 225  LYS n 
1 226  THR n 
1 227  LEU n 
1 228  VAL n 
1 229  GLU n 
1 230  LEU n 
1 231  PHE n 
1 232  GLY n 
1 233  LEU n 
1 234  ALA n 
1 235  ARG n 
1 236  GLU n 
1 237  LEU n 
1 238  ASN n 
1 239  VAL n 
1 240  GLU n 
1 241  ALA n 
1 242  GLU n 
1 243  GLY n 
1 244  ILE n 
1 245  GLU n 
1 246  ILE n 
1 247  GLY n 
1 248  PRO n 
1 249  SER n 
1 250  PRO n 
1 251  ALA n 
1 252  GLU n 
1 253  ALA n 
1 254  ASP n 
1 255  HIS n 
1 256  ILE n 
1 257  ALA n 
1 258  SER n 
1 259  PHE n 
1 260  ALA n 
1 261  LEU n 
1 262  PRO n 
1 263  ILE n 
1 264  ASP n 
1 265  ASP n 
1 266  LEU n 
1 267  ASP n 
1 268  LEU n 
1 269  THR n 
1 270  VAL n 
1 271  ARG n 
1 272  SER n 
1 273  TYR n 
1 274  ASN n 
1 275  CYS n 
1 276  LEU n 
1 277  LYS n 
1 278  ARG n 
1 279  GLU n 
1 280  GLY n 
1 281  VAL n 
1 282  HIS n 
1 283  THR n 
1 284  VAL n 
1 285  GLY n 
1 286  GLU n 
1 287  LEU n 
1 288  VAL n 
1 289  ALA n 
1 290  ARG n 
1 291  THR n 
1 292  GLU n 
1 293  SER n 
1 294  ASP n 
1 295  LEU n 
1 296  LEU n 
1 297  ASP n 
1 298  ILE n 
1 299  ARG n 
1 300  ASN n 
1 301  PHE n 
1 302  GLY n 
1 303  GLN n 
1 304  LYS n 
1 305  SER n 
1 306  ILE n 
1 307  ASP n 
1 308  GLU n 
1 309  VAL n 
1 310  LYS n 
1 311  ILE n 
1 312  LYS n 
1 313  LEU n 
1 314  HIS n 
1 315  GLN n 
1 316  LEU n 
1 317  GLY n 
1 318  LEU n 
1 319  SER n 
1 320  LEU n 
1 321  LYS n 
1 322  ASP n 
1 323  SER n 
1 324  PRO n 
1 325  PRO n 
1 326  SER n 
1 327  PHE n 
1 328  ASP n 
1 329  PRO n 
1 330  SER n 
1 331  GLU n 
1 332  VAL n 
1 333  ALA n 
1 334  GLY n 
1 335  TYR n 
1 336  ASP n 
1 337  VAL n 
1 338  ALA n 
1 339  THR n 
1 340  GLY n 
1 341  THR n 
1 342  TRP n 
1 343  SER n 
1 344  THR n 
1 345  GLU n 
1 346  GLY n 
1 347  ALA n 
1 348  TYR n 
1 349  ASP n 
1 350  GLU n 
1 351  GLN n 
1 352  ASP n 
1 353  TYR n 
1 354  ALA n 
1 355  GLU n 
1 356  THR n 
1 357  GLU n 
1 358  GLN n 
1 359  LEU n 
2 1    MET n 
2 2    LEU n 
2 3    GLU n 
2 4    GLY n 
2 5    CYS n 
2 6    ILE n 
2 7    LEU n 
2 8    ALA n 
2 9    ASP n 
2 10   SER n 
2 11   ARG n 
2 12   GLN n 
2 13   SER n 
2 14   LYS n 
2 15   THR n 
2 16   ALA n 
2 17   ALA n 
2 18   SER n 
2 19   PRO n 
2 20   SER n 
2 21   PRO n 
2 22   SER n 
2 23   ARG n 
2 24   PRO n 
2 25   GLN n 
2 26   SER n 
2 27   SER n 
2 28   SER n 
2 29   ASN n 
2 30   ASN n 
2 31   SER n 
2 32   VAL n 
2 33   PRO n 
2 34   GLY n 
2 35   ALA n 
2 36   PRO n 
2 37   ASN n 
2 38   ARG n 
2 39   VAL n 
2 40   SER n 
2 41   PHE n 
2 42   ALA n 
2 43   LYS n 
2 44   LEU n 
2 45   ARG n 
2 46   GLU n 
2 47   PRO n 
2 48   LEU n 
2 49   GLU n 
2 50   VAL n 
2 51   PRO n 
2 52   GLY n 
2 53   LEU n 
2 54   LEU n 
2 55   ASP n 
2 56   VAL n 
2 57   GLN n 
2 58   THR n 
2 59   ASP n 
2 60   SER n 
2 61   PHE n 
2 62   GLU n 
2 63   TRP n 
2 64   LEU n 
2 65   ILE n 
2 66   GLY n 
2 67   SER n 
2 68   PRO n 
2 69   ARG n 
2 70   TRP n 
2 71   ARG n 
2 72   GLU n 
2 73   SER n 
2 74   ALA n 
2 75   ALA n 
2 76   GLU n 
2 77   ARG n 
2 78   GLY n 
2 79   ASP n 
2 80   VAL n 
2 81   ASN n 
2 82   PRO n 
2 83   VAL n 
2 84   GLY n 
2 85   GLY n 
2 86   LEU n 
2 87   GLU n 
2 88   GLU n 
2 89   VAL n 
2 90   LEU n 
2 91   TYR n 
2 92   GLU n 
2 93   LEU n 
2 94   SER n 
2 95   PRO n 
2 96   ILE n 
2 97   GLU n 
2 98   ASP n 
2 99   PHE n 
2 100  SER n 
2 101  GLY n 
2 102  SER n 
2 103  MET n 
2 104  SER n 
2 105  LEU n 
2 106  SER n 
2 107  PHE n 
2 108  SER n 
2 109  ASP n 
2 110  PRO n 
2 111  ARG n 
2 112  PHE n 
2 113  ASP n 
2 114  ASP n 
2 115  VAL n 
2 116  LYS n 
2 117  ALA n 
2 118  PRO n 
2 119  VAL n 
2 120  ASP n 
2 121  GLU n 
2 122  CYS n 
2 123  LYS n 
2 124  ASP n 
2 125  LYS n 
2 126  ASP n 
2 127  MET n 
2 128  THR n 
2 129  TYR n 
2 130  ALA n 
2 131  ALA n 
2 132  PRO n 
2 133  LEU n 
2 134  PHE n 
2 135  VAL n 
2 136  THR n 
2 137  ALA n 
2 138  GLU n 
2 139  PHE n 
2 140  ILE n 
2 141  ASN n 
2 142  ASN n 
2 143  ASN n 
2 144  THR n 
2 145  GLY n 
2 146  GLU n 
2 147  ILE n 
2 148  LYS n 
2 149  SER n 
2 150  GLN n 
2 151  THR n 
2 152  VAL n 
2 153  PHE n 
2 154  MET n 
2 155  GLY n 
2 156  ASP n 
2 157  PHE n 
2 158  PRO n 
2 159  MET n 
2 160  MET n 
2 161  THR n 
2 162  GLU n 
2 163  LYS n 
2 164  GLY n 
2 165  THR n 
2 166  PHE n 
2 167  ILE n 
2 168  ILE n 
2 169  ASN n 
2 170  GLY n 
2 171  THR n 
2 172  GLU n 
2 173  ARG n 
2 174  VAL n 
2 175  VAL n 
2 176  VAL n 
2 177  SER n 
2 178  GLN n 
2 179  LEU n 
2 180  VAL n 
2 181  ARG n 
2 182  SER n 
2 183  PRO n 
2 184  GLY n 
2 185  VAL n 
2 186  TYR n 
2 187  PHE n 
2 188  ASP n 
2 189  GLU n 
2 190  THR n 
2 191  ILE n 
2 192  ASP n 
2 193  LYS n 
2 194  SER n 
2 195  THR n 
2 196  ASP n 
2 197  LYS n 
2 198  THR n 
2 199  LEU n 
2 200  HIS n 
2 201  SER n 
2 202  VAL n 
2 203  LYS n 
2 204  VAL n 
2 205  ILE n 
2 206  PRO n 
2 207  SER n 
2 208  ARG n 
2 209  GLY n 
2 210  ALA n 
2 211  TRP n 
2 212  LEU n 
2 213  GLU n 
2 214  PHE n 
2 215  ASP n 
2 216  VAL n 
2 217  ASP n 
2 218  LYS n 
2 219  ARG n 
2 220  ASP n 
2 221  THR n 
2 222  VAL n 
2 223  GLY n 
2 224  VAL n 
2 225  ARG n 
2 226  ILE n 
2 227  ASP n 
2 228  ARG n 
2 229  LYS n 
2 230  ARG n 
2 231  ARG n 
2 232  GLN n 
2 233  PRO n 
2 234  VAL n 
2 235  THR n 
2 236  VAL n 
2 237  LEU n 
2 238  LEU n 
2 239  LYS n 
2 240  ALA n 
2 241  LEU n 
2 242  GLY n 
2 243  TRP n 
2 244  THR n 
2 245  SER n 
2 246  GLU n 
2 247  GLN n 
2 248  ILE n 
2 249  VAL n 
2 250  GLU n 
2 251  ARG n 
2 252  PHE n 
2 253  GLY n 
2 254  PHE n 
2 255  SER n 
2 256  GLU n 
2 257  ILE n 
2 258  MET n 
2 259  ARG n 
2 260  SER n 
2 261  THR n 
2 262  LEU n 
2 263  GLU n 
2 264  LYS n 
2 265  ASP n 
2 266  ASN n 
2 267  THR n 
2 268  VAL n 
2 269  GLY n 
2 270  THR n 
2 271  ASP n 
2 272  GLU n 
2 273  ALA n 
2 274  LEU n 
2 275  LEU n 
2 276  ASP n 
2 277  ILE n 
2 278  TYR n 
2 279  ARG n 
2 280  LYS n 
2 281  LEU n 
2 282  ARG n 
2 283  PRO n 
2 284  GLY n 
2 285  GLU n 
2 286  PRO n 
2 287  PRO n 
2 288  THR n 
2 289  LYS n 
2 290  GLU n 
2 291  SER n 
2 292  ALA n 
2 293  GLN n 
2 294  THR n 
2 295  LEU n 
2 296  LEU n 
2 297  GLU n 
2 298  ASN n 
2 299  LEU n 
2 300  PHE n 
2 301  PHE n 
2 302  LYS n 
2 303  GLU n 
2 304  LYS n 
2 305  ARG n 
2 306  TYR n 
2 307  ASP n 
2 308  LEU n 
2 309  ALA n 
2 310  ARG n 
2 311  VAL n 
2 312  GLY n 
2 313  ARG n 
2 314  TYR n 
2 315  LYS n 
2 316  VAL n 
2 317  ASN n 
2 318  LYS n 
2 319  LYS n 
2 320  LEU n 
2 321  GLY n 
2 322  LEU n 
2 323  HIS n 
2 324  VAL n 
2 325  GLY n 
2 326  GLU n 
2 327  PRO n 
2 328  ILE n 
2 329  THR n 
2 330  SER n 
2 331  SER n 
2 332  THR n 
2 333  LEU n 
2 334  THR n 
2 335  GLU n 
2 336  GLU n 
2 337  ASP n 
2 338  VAL n 
2 339  VAL n 
2 340  ALA n 
2 341  THR n 
2 342  ILE n 
2 343  GLU n 
2 344  TYR n 
2 345  LEU n 
2 346  VAL n 
2 347  ARG n 
2 348  LEU n 
2 349  HIS n 
2 350  GLU n 
2 351  GLY n 
2 352  GLN n 
2 353  THR n 
2 354  THR n 
2 355  MET n 
2 356  THR n 
2 357  VAL n 
2 358  PRO n 
2 359  GLY n 
2 360  GLY n 
2 361  VAL n 
2 362  GLU n 
2 363  VAL n 
2 364  PRO n 
2 365  VAL n 
2 366  GLU n 
2 367  THR n 
2 368  ASP n 
2 369  ASP n 
2 370  ILE n 
2 371  ASP n 
2 372  HIS n 
2 373  PHE n 
2 374  GLY n 
2 375  ASN n 
2 376  ARG n 
2 377  ARG n 
2 378  LEU n 
2 379  ARG n 
2 380  THR n 
2 381  VAL n 
2 382  GLY n 
2 383  GLU n 
2 384  LEU n 
2 385  ILE n 
2 386  GLN n 
2 387  ASN n 
2 388  GLN n 
2 389  ILE n 
2 390  ARG n 
2 391  VAL n 
2 392  GLY n 
2 393  MET n 
2 394  SER n 
2 395  ARG n 
2 396  MET n 
2 397  GLU n 
2 398  ARG n 
2 399  VAL n 
2 400  VAL n 
2 401  ARG n 
2 402  GLU n 
2 403  ARG n 
2 404  MET n 
2 405  THR n 
2 406  THR n 
2 407  GLN n 
2 408  ASP n 
2 409  VAL n 
2 410  GLU n 
2 411  ALA n 
2 412  ILE n 
2 413  THR n 
2 414  PRO n 
2 415  GLN n 
2 416  THR n 
2 417  LEU n 
2 418  ILE n 
2 419  ASN n 
2 420  ILE n 
2 421  ARG n 
2 422  PRO n 
2 423  VAL n 
2 424  VAL n 
2 425  ALA n 
2 426  ALA n 
2 427  ILE n 
2 428  LYS n 
2 429  GLU n 
2 430  PHE n 
2 431  PHE n 
2 432  GLY n 
2 433  THR n 
2 434  SER n 
2 435  GLN n 
2 436  LEU n 
2 437  SER n 
2 438  GLN n 
2 439  PHE n 
2 440  MET n 
2 441  ASP n 
2 442  GLN n 
2 443  ASN n 
2 444  ASN n 
2 445  PRO n 
2 446  LEU n 
2 447  SER n 
2 448  GLY n 
2 449  LEU n 
2 450  THR n 
2 451  HIS n 
2 452  LYS n 
2 453  ARG n 
2 454  ARG n 
2 455  LEU n 
2 456  SER n 
2 457  ALA n 
2 458  LEU n 
2 459  GLY n 
2 460  PRO n 
2 461  GLY n 
2 462  GLY n 
2 463  LEU n 
2 464  SER n 
2 465  ARG n 
2 466  GLU n 
2 467  ARG n 
2 468  ALA n 
2 469  GLY n 
2 470  LEU n 
2 471  GLU n 
2 472  VAL n 
2 473  ARG n 
2 474  ASP n 
2 475  VAL n 
2 476  HIS n 
2 477  PRO n 
2 478  SER n 
2 479  HIS n 
2 480  TYR n 
2 481  GLY n 
2 482  ARG n 
2 483  MET n 
2 484  CYS n 
2 485  PRO n 
2 486  ILE n 
2 487  GLU n 
2 488  THR n 
2 489  PRO n 
2 490  GLU n 
2 491  GLY n 
2 492  PRO n 
2 493  ASN n 
2 494  ILE n 
2 495  GLY n 
2 496  LEU n 
2 497  ILE n 
2 498  GLY n 
2 499  SER n 
2 500  LEU n 
2 501  SER n 
2 502  VAL n 
2 503  TYR n 
2 504  ALA n 
2 505  ARG n 
2 506  VAL n 
2 507  ASN n 
2 508  PRO n 
2 509  PHE n 
2 510  GLY n 
2 511  PHE n 
2 512  ILE n 
2 513  GLU n 
2 514  THR n 
2 515  PRO n 
2 516  TYR n 
2 517  ARG n 
2 518  LYS n 
2 519  VAL n 
2 520  VAL n 
2 521  ASP n 
2 522  GLY n 
2 523  VAL n 
2 524  VAL n 
2 525  SER n 
2 526  ASP n 
2 527  GLU n 
2 528  ILE n 
2 529  VAL n 
2 530  TYR n 
2 531  LEU n 
2 532  THR n 
2 533  ALA n 
2 534  ASP n 
2 535  GLU n 
2 536  GLU n 
2 537  ASP n 
2 538  ARG n 
2 539  HIS n 
2 540  VAL n 
2 541  VAL n 
2 542  ALA n 
2 543  GLN n 
2 544  ALA n 
2 545  ASN n 
2 546  SER n 
2 547  PRO n 
2 548  ILE n 
2 549  ASP n 
2 550  ALA n 
2 551  ASP n 
2 552  GLY n 
2 553  ARG n 
2 554  PHE n 
2 555  VAL n 
2 556  GLU n 
2 557  PRO n 
2 558  ARG n 
2 559  VAL n 
2 560  LEU n 
2 561  VAL n 
2 562  ARG n 
2 563  ARG n 
2 564  LYS n 
2 565  ALA n 
2 566  GLY n 
2 567  GLU n 
2 568  VAL n 
2 569  GLU n 
2 570  TYR n 
2 571  VAL n 
2 572  PRO n 
2 573  SER n 
2 574  SER n 
2 575  GLU n 
2 576  VAL n 
2 577  ASP n 
2 578  TYR n 
2 579  MET n 
2 580  ASP n 
2 581  VAL n 
2 582  SER n 
2 583  PRO n 
2 584  ARG n 
2 585  GLN n 
2 586  MET n 
2 587  VAL n 
2 588  SER n 
2 589  VAL n 
2 590  ALA n 
2 591  THR n 
2 592  ALA n 
2 593  MET n 
2 594  ILE n 
2 595  PRO n 
2 596  PHE n 
2 597  LEU n 
2 598  GLU n 
2 599  HIS n 
2 600  ASP n 
2 601  ASP n 
2 602  ALA n 
2 603  ASN n 
2 604  ARG n 
2 605  ALA n 
2 606  LEU n 
2 607  MET n 
2 608  GLY n 
2 609  ALA n 
2 610  ASN n 
2 611  MET n 
2 612  GLN n 
2 613  ARG n 
2 614  GLN n 
2 615  ALA n 
2 616  VAL n 
2 617  PRO n 
2 618  LEU n 
2 619  VAL n 
2 620  ARG n 
2 621  SER n 
2 622  GLU n 
2 623  ALA n 
2 624  PRO n 
2 625  LEU n 
2 626  VAL n 
2 627  GLY n 
2 628  THR n 
2 629  GLY n 
2 630  MET n 
2 631  GLU n 
2 632  LEU n 
2 633  ARG n 
2 634  ALA n 
2 635  ALA n 
2 636  ILE n 
2 637  ASP n 
2 638  ALA n 
2 639  GLY n 
2 640  ASP n 
2 641  VAL n 
2 642  VAL n 
2 643  VAL n 
2 644  ALA n 
2 645  GLU n 
2 646  GLU n 
2 647  SER n 
2 648  GLY n 
2 649  VAL n 
2 650  ILE n 
2 651  GLU n 
2 652  GLU n 
2 653  VAL n 
2 654  SER n 
2 655  ALA n 
2 656  ASP n 
2 657  TYR n 
2 658  ILE n 
2 659  THR n 
2 660  VAL n 
2 661  MET n 
2 662  HIS n 
2 663  ASP n 
2 664  ASN n 
2 665  GLY n 
2 666  THR n 
2 667  ARG n 
2 668  ARG n 
2 669  THR n 
2 670  TYR n 
2 671  ARG n 
2 672  MET n 
2 673  ARG n 
2 674  LYS n 
2 675  PHE n 
2 676  ALA n 
2 677  ARG n 
2 678  SER n 
2 679  ASN n 
2 680  HIS n 
2 681  GLY n 
2 682  THR n 
2 683  CYS n 
2 684  ALA n 
2 685  ASN n 
2 686  GLN n 
2 687  CYS n 
2 688  PRO n 
2 689  ILE n 
2 690  VAL n 
2 691  ASP n 
2 692  ALA n 
2 693  GLY n 
2 694  ASP n 
2 695  ARG n 
2 696  VAL n 
2 697  GLU n 
2 698  ALA n 
2 699  GLY n 
2 700  GLN n 
2 701  VAL n 
2 702  ILE n 
2 703  ALA n 
2 704  ASP n 
2 705  GLY n 
2 706  PRO n 
2 707  CYS n 
2 708  THR n 
2 709  ASP n 
2 710  ASP n 
2 711  GLY n 
2 712  GLU n 
2 713  MET n 
2 714  ALA n 
2 715  LEU n 
2 716  GLY n 
2 717  LYS n 
2 718  ASN n 
2 719  LEU n 
2 720  LEU n 
2 721  VAL n 
2 722  ALA n 
2 723  ILE n 
2 724  MET n 
2 725  PRO n 
2 726  TRP n 
2 727  GLU n 
2 728  GLY n 
2 729  HIS n 
2 730  ASN n 
2 731  TYR n 
2 732  GLU n 
2 733  ASP n 
2 734  ALA n 
2 735  ILE n 
2 736  ILE n 
2 737  LEU n 
2 738  SER n 
2 739  ASN n 
2 740  ARG n 
2 741  LEU n 
2 742  VAL n 
2 743  GLU n 
2 744  GLU n 
2 745  ASP n 
2 746  VAL n 
2 747  LEU n 
2 748  THR n 
2 749  SER n 
2 750  ILE n 
2 751  HIS n 
2 752  ILE n 
2 753  GLU n 
2 754  GLU n 
2 755  HIS n 
2 756  GLU n 
2 757  ILE n 
2 758  ASP n 
2 759  ALA n 
2 760  ARG n 
2 761  ASP n 
2 762  THR n 
2 763  LYS n 
2 764  LEU n 
2 765  GLY n 
2 766  ALA n 
2 767  GLU n 
2 768  GLU n 
2 769  ILE n 
2 770  THR n 
2 771  ARG n 
2 772  ASP n 
2 773  ILE n 
2 774  PRO n 
2 775  ASN n 
2 776  ILE n 
2 777  SER n 
2 778  ASP n 
2 779  GLU n 
2 780  VAL n 
2 781  LEU n 
2 782  ALA n 
2 783  ASP n 
2 784  LEU n 
2 785  ASP n 
2 786  GLU n 
2 787  ARG n 
2 788  GLY n 
2 789  ILE n 
2 790  VAL n 
2 791  ARG n 
2 792  ILE n 
2 793  GLY n 
2 794  ALA n 
2 795  GLU n 
2 796  VAL n 
2 797  ARG n 
2 798  ASP n 
2 799  GLY n 
2 800  ASP n 
2 801  ILE n 
2 802  LEU n 
2 803  VAL n 
2 804  GLY n 
2 805  LYS n 
2 806  VAL n 
2 807  THR n 
2 808  PRO n 
2 809  LYS n 
2 810  GLY n 
2 811  GLU n 
2 812  THR n 
2 813  GLU n 
2 814  LEU n 
2 815  THR n 
2 816  PRO n 
2 817  GLU n 
2 818  GLU n 
2 819  ARG n 
2 820  LEU n 
2 821  LEU n 
2 822  ARG n 
2 823  ALA n 
2 824  ILE n 
2 825  PHE n 
2 826  GLY n 
2 827  GLU n 
2 828  LYS n 
2 829  ALA n 
2 830  ARG n 
2 831  GLU n 
2 832  VAL n 
2 833  ARG n 
2 834  ASP n 
2 835  THR n 
2 836  SER n 
2 837  LEU n 
2 838  LYS n 
2 839  VAL n 
2 840  PRO n 
2 841  HIS n 
2 842  GLY n 
2 843  GLU n 
2 844  SER n 
2 845  GLY n 
2 846  LYS n 
2 847  VAL n 
2 848  ILE n 
2 849  GLY n 
2 850  ILE n 
2 851  ARG n 
2 852  VAL n 
2 853  PHE n 
2 854  SER n 
2 855  ARG n 
2 856  GLU n 
2 857  ASP n 
2 858  GLU n 
2 859  ASP n 
2 860  GLU n 
2 861  LEU n 
2 862  PRO n 
2 863  ALA n 
2 864  GLY n 
2 865  VAL n 
2 866  ASN n 
2 867  GLU n 
2 868  LEU n 
2 869  VAL n 
2 870  ARG n 
2 871  VAL n 
2 872  TYR n 
2 873  VAL n 
2 874  ALA n 
2 875  GLN n 
2 876  LYS n 
2 877  ARG n 
2 878  LYS n 
2 879  ILE n 
2 880  SER n 
2 881  ASP n 
2 882  GLY n 
2 883  ASP n 
2 884  LYS n 
2 885  LEU n 
2 886  ALA n 
2 887  GLY n 
2 888  ARG n 
2 889  HIS n 
2 890  GLY n 
2 891  ASN n 
2 892  LYS n 
2 893  GLY n 
2 894  VAL n 
2 895  ILE n 
2 896  GLY n 
2 897  LYS n 
2 898  ILE n 
2 899  LEU n 
2 900  PRO n 
2 901  VAL n 
2 902  GLU n 
2 903  ASP n 
2 904  MET n 
2 905  PRO n 
2 906  PHE n 
2 907  LEU n 
2 908  ALA n 
2 909  ASP n 
2 910  GLY n 
2 911  THR n 
2 912  PRO n 
2 913  VAL n 
2 914  ASP n 
2 915  ILE n 
2 916  ILE n 
2 917  LEU n 
2 918  ASN n 
2 919  THR n 
2 920  HIS n 
2 921  GLY n 
2 922  VAL n 
2 923  PRO n 
2 924  ARG n 
2 925  ARG n 
2 926  MET n 
2 927  ASN n 
2 928  ILE n 
2 929  GLY n 
2 930  GLN n 
2 931  ILE n 
2 932  LEU n 
2 933  GLU n 
2 934  THR n 
2 935  HIS n 
2 936  LEU n 
2 937  GLY n 
2 938  TRP n 
2 939  CYS n 
2 940  ALA n 
2 941  HIS n 
2 942  SER n 
2 943  GLY n 
2 944  TRP n 
2 945  LYS n 
2 946  VAL n 
2 947  ASP n 
2 948  ALA n 
2 949  ALA n 
2 950  LYS n 
2 951  GLY n 
2 952  VAL n 
2 953  PRO n 
2 954  ASP n 
2 955  TRP n 
2 956  ALA n 
2 957  ALA n 
2 958  ARG n 
2 959  LEU n 
2 960  PRO n 
2 961  ASP n 
2 962  GLU n 
2 963  LEU n 
2 964  LEU n 
2 965  GLU n 
2 966  ALA n 
2 967  GLN n 
2 968  PRO n 
2 969  ASN n 
2 970  ALA n 
2 971  ILE n 
2 972  VAL n 
2 973  SER n 
2 974  THR n 
2 975  PRO n 
2 976  VAL n 
2 977  PHE n 
2 978  ASP n 
2 979  GLY n 
2 980  ALA n 
2 981  GLN n 
2 982  GLU n 
2 983  ALA n 
2 984  GLU n 
2 985  LEU n 
2 986  GLN n 
2 987  GLY n 
2 988  LEU n 
2 989  LEU n 
2 990  SER n 
2 991  CYS n 
2 992  THR n 
2 993  LEU n 
2 994  PRO n 
2 995  ASN n 
2 996  ARG n 
2 997  ASP n 
2 998  GLY n 
2 999  ASP n 
2 1000 VAL n 
2 1001 LEU n 
2 1002 VAL n 
2 1003 ASP n 
2 1004 ALA n 
2 1005 ASP n 
2 1006 GLY n 
2 1007 LYS n 
2 1008 ALA n 
2 1009 MET n 
2 1010 LEU n 
2 1011 PHE n 
2 1012 ASP n 
2 1013 GLY n 
2 1014 ARG n 
2 1015 SER n 
2 1016 GLY n 
2 1017 GLU n 
2 1018 PRO n 
2 1019 PHE n 
2 1020 PRO n 
2 1021 TYR n 
2 1022 PRO n 
2 1023 VAL n 
2 1024 THR n 
2 1025 VAL n 
2 1026 GLY n 
2 1027 TYR n 
2 1028 MET n 
2 1029 TYR n 
2 1030 ILE n 
2 1031 MET n 
2 1032 LYS n 
2 1033 LEU n 
2 1034 HIS n 
2 1035 HIS n 
2 1036 LEU n 
2 1037 VAL n 
2 1038 ASP n 
2 1039 ASP n 
2 1040 LYS n 
2 1041 ILE n 
2 1042 HIS n 
2 1043 ALA n 
2 1044 ARG n 
2 1045 SER n 
2 1046 THR n 
2 1047 GLY n 
2 1048 PRO n 
2 1049 TYR n 
2 1050 SER n 
2 1051 MET n 
2 1052 ILE n 
2 1053 THR n 
2 1054 GLN n 
2 1055 GLN n 
2 1056 PRO n 
2 1057 LEU n 
2 1058 GLY n 
2 1059 GLY n 
2 1060 LYS n 
2 1061 ALA n 
2 1062 GLN n 
2 1063 PHE n 
2 1064 GLY n 
2 1065 GLY n 
2 1066 GLN n 
2 1067 ARG n 
2 1068 PHE n 
2 1069 GLY n 
2 1070 GLU n 
2 1071 MET n 
2 1072 GLU n 
2 1073 CYS n 
2 1074 TRP n 
2 1075 ALA n 
2 1076 MET n 
2 1077 GLN n 
2 1078 ALA n 
2 1079 TYR n 
2 1080 GLY n 
2 1081 ALA n 
2 1082 ALA n 
2 1083 TYR n 
2 1084 THR n 
2 1085 LEU n 
2 1086 GLN n 
2 1087 GLU n 
2 1088 LEU n 
2 1089 LEU n 
2 1090 THR n 
2 1091 ILE n 
2 1092 LYS n 
2 1093 SER n 
2 1094 ASP n 
2 1095 ASP n 
2 1096 THR n 
2 1097 VAL n 
2 1098 GLY n 
2 1099 ARG n 
2 1100 VAL n 
2 1101 LYS n 
2 1102 VAL n 
2 1103 TYR n 
2 1104 GLU n 
2 1105 ALA n 
2 1106 ILE n 
2 1107 VAL n 
2 1108 LYS n 
2 1109 GLY n 
2 1110 GLU n 
2 1111 ASN n 
2 1112 ILE n 
2 1113 PRO n 
2 1114 GLU n 
2 1115 PRO n 
2 1116 GLY n 
2 1117 ILE n 
2 1118 PRO n 
2 1119 GLU n 
2 1120 SER n 
2 1121 PHE n 
2 1122 LYS n 
2 1123 VAL n 
2 1124 LEU n 
2 1125 LEU n 
2 1126 LYS n 
2 1127 GLU n 
2 1128 LEU n 
2 1129 GLN n 
2 1130 SER n 
2 1131 LEU n 
2 1132 CYS n 
2 1133 LEU n 
2 1134 ASN n 
2 1135 VAL n 
2 1136 GLU n 
2 1137 VAL n 
2 1138 LEU n 
2 1139 SER n 
2 1140 SER n 
2 1141 ASP n 
2 1142 GLY n 
2 1143 ALA n 
2 1144 ALA n 
2 1145 ILE n 
2 1146 GLU n 
2 1147 LEU n 
2 1148 ARG n 
2 1149 GLU n 
2 1150 GLY n 
2 1151 GLU n 
2 1152 ASP n 
2 1153 GLU n 
2 1154 ASP n 
2 1155 LEU n 
2 1156 GLU n 
2 1157 ARG n 
2 1158 ALA n 
2 1159 ALA n 
2 1160 ALA n 
2 1161 ASN n 
2 1162 LEU n 
2 1163 GLY n 
2 1164 ILE n 
2 1165 ASN n 
2 1166 LEU n 
2 1167 SER n 
2 1168 ARG n 
2 1169 ASN n 
2 1170 GLU n 
2 1171 SER n 
2 1172 ALA n 
2 1173 SER n 
2 1174 VAL n 
2 1175 GLU n 
2 1176 ASP n 
2 1177 LEU n 
2 1178 ALA n 
3 1    MET n 
3 2    LEU n 
3 3    ASP n 
3 4    VAL n 
3 5    ASN n 
3 6    PHE n 
3 7    PHE n 
3 8    ASP n 
3 9    GLU n 
3 10   LEU n 
3 11   ARG n 
3 12   ILE n 
3 13   GLY n 
3 14   LEU n 
3 15   ALA n 
3 16   THR n 
3 17   ALA n 
3 18   GLU n 
3 19   ASP n 
3 20   ILE n 
3 21   ARG n 
3 22   GLN n 
3 23   TRP n 
3 24   SER n 
3 25   TYR n 
3 26   GLY n 
3 27   GLU n 
3 28   VAL n 
3 29   LYS n 
3 30   LYS n 
3 31   PRO n 
3 32   GLU n 
3 33   THR n 
3 34   ILE n 
3 35   ASN n 
3 36   TYR n 
3 37   ARG n 
3 38   THR n 
3 39   LEU n 
3 40   LYS n 
3 41   PRO n 
3 42   GLU n 
3 43   LYS n 
3 44   ASP n 
3 45   GLY n 
3 46   LEU n 
3 47   PHE n 
3 48   CYS n 
3 49   GLU n 
3 50   LYS n 
3 51   ILE n 
3 52   PHE n 
3 53   GLY n 
3 54   PRO n 
3 55   THR n 
3 56   ARG n 
3 57   ASP n 
3 58   TRP n 
3 59   GLU n 
3 60   CYS n 
3 61   TYR n 
3 62   CYS n 
3 63   GLY n 
3 64   LYS n 
3 65   TYR n 
3 66   LYS n 
3 67   ARG n 
3 68   VAL n 
3 69   ARG n 
3 70   PHE n 
3 71   LYS n 
3 72   GLY n 
3 73   ILE n 
3 74   ILE n 
3 75   CYS n 
3 76   GLU n 
3 77   ARG n 
3 78   CYS n 
3 79   GLY n 
3 80   VAL n 
3 81   GLU n 
3 82   VAL n 
3 83   THR n 
3 84   ARG n 
3 85   ALA n 
3 86   LYS n 
3 87   VAL n 
3 88   ARG n 
3 89   ARG n 
3 90   GLU n 
3 91   ARG n 
3 92   MET n 
3 93   GLY n 
3 94   HIS n 
3 95   ILE n 
3 96   GLU n 
3 97   LEU n 
3 98   ALA n 
3 99   ALA n 
3 100  PRO n 
3 101  VAL n 
3 102  THR n 
3 103  HIS n 
3 104  ILE n 
3 105  TRP n 
3 106  TYR n 
3 107  PHE n 
3 108  LYS n 
3 109  GLY n 
3 110  VAL n 
3 111  PRO n 
3 112  SER n 
3 113  ARG n 
3 114  LEU n 
3 115  GLY n 
3 116  TYR n 
3 117  LEU n 
3 118  LEU n 
3 119  ASP n 
3 120  LEU n 
3 121  ALA n 
3 122  PRO n 
3 123  LYS n 
3 124  ASP n 
3 125  LEU n 
3 126  GLU n 
3 127  LYS n 
3 128  ILE n 
3 129  ILE n 
3 130  TYR n 
3 131  PHE n 
3 132  ALA n 
3 133  ALA n 
3 134  TYR n 
3 135  VAL n 
3 136  ILE n 
3 137  THR n 
3 138  SER n 
3 139  VAL n 
3 140  ASP n 
3 141  GLU n 
3 142  GLU n 
3 143  MET n 
3 144  ARG n 
3 145  HIS n 
3 146  ASN n 
3 147  GLU n 
3 148  LEU n 
3 149  SER n 
3 150  THR n 
3 151  LEU n 
3 152  GLU n 
3 153  ALA n 
3 154  GLU n 
3 155  MET n 
3 156  ALA n 
3 157  VAL n 
3 158  GLU n 
3 159  ARG n 
3 160  LYS n 
3 161  ALA n 
3 162  VAL n 
3 163  GLU n 
3 164  ASP n 
3 165  GLN n 
3 166  ARG n 
3 167  ASP n 
3 168  GLY n 
3 169  GLU n 
3 170  LEU n 
3 171  GLU n 
3 172  ALA n 
3 173  ARG n 
3 174  ALA n 
3 175  GLN n 
3 176  LYS n 
3 177  LEU n 
3 178  GLU n 
3 179  ALA n 
3 180  ASP n 
3 181  LEU n 
3 182  ALA n 
3 183  GLU n 
3 184  LEU n 
3 185  GLU n 
3 186  ALA n 
3 187  GLU n 
3 188  GLY n 
3 189  ALA n 
3 190  LYS n 
3 191  ALA n 
3 192  ASP n 
3 193  ALA n 
3 194  ARG n 
3 195  ARG n 
3 196  LYS n 
3 197  VAL n 
3 198  ARG n 
3 199  ASP n 
3 200  GLY n 
3 201  GLY n 
3 202  GLU n 
3 203  ARG n 
3 204  GLU n 
3 205  MET n 
3 206  ARG n 
3 207  GLN n 
3 208  ILE n 
3 209  ARG n 
3 210  ASP n 
3 211  ARG n 
3 212  ALA n 
3 213  GLN n 
3 214  ARG n 
3 215  GLU n 
3 216  LEU n 
3 217  ASP n 
3 218  ARG n 
3 219  LEU n 
3 220  GLU n 
3 221  ASP n 
3 222  ILE n 
3 223  TRP n 
3 224  SER n 
3 225  THR n 
3 226  PHE n 
3 227  THR n 
3 228  LYS n 
3 229  LEU n 
3 230  ALA n 
3 231  PRO n 
3 232  LYS n 
3 233  GLN n 
3 234  LEU n 
3 235  ILE n 
3 236  VAL n 
3 237  ASP n 
3 238  GLU n 
3 239  ASN n 
3 240  LEU n 
3 241  TYR n 
3 242  ARG n 
3 243  GLU n 
3 244  LEU n 
3 245  VAL n 
3 246  ASP n 
3 247  ARG n 
3 248  TYR n 
3 249  GLY n 
3 250  GLU n 
3 251  TYR n 
3 252  PHE n 
3 253  THR n 
3 254  GLY n 
3 255  ALA n 
3 256  MET n 
3 257  GLY n 
3 258  ALA n 
3 259  GLU n 
3 260  SER n 
3 261  ILE n 
3 262  GLN n 
3 263  LYS n 
3 264  LEU n 
3 265  ILE n 
3 266  GLU n 
3 267  ASN n 
3 268  PHE n 
3 269  ASP n 
3 270  ILE n 
3 271  ASP n 
3 272  ALA n 
3 273  GLU n 
3 274  ALA n 
3 275  GLU n 
3 276  SER n 
3 277  LEU n 
3 278  ARG n 
3 279  ASP n 
3 280  VAL n 
3 281  ILE n 
3 282  ARG n 
3 283  ASN n 
3 284  GLY n 
3 285  LYS n 
3 286  GLY n 
3 287  GLN n 
3 288  LYS n 
3 289  LYS n 
3 290  LEU n 
3 291  ARG n 
3 292  ALA n 
3 293  LEU n 
3 294  LYS n 
3 295  ARG n 
3 296  LEU n 
3 297  LYS n 
3 298  VAL n 
3 299  VAL n 
3 300  ALA n 
3 301  ALA n 
3 302  PHE n 
3 303  GLN n 
3 304  GLN n 
3 305  SER n 
3 306  GLY n 
3 307  ASN n 
3 308  SER n 
3 309  PRO n 
3 310  MET n 
3 311  GLY n 
3 312  MET n 
3 313  VAL n 
3 314  LEU n 
3 315  ASP n 
3 316  ALA n 
3 317  VAL n 
3 318  PRO n 
3 319  VAL n 
3 320  ILE n 
3 321  PRO n 
3 322  PRO n 
3 323  GLU n 
3 324  LEU n 
3 325  ARG n 
3 326  PRO n 
3 327  MET n 
3 328  VAL n 
3 329  GLN n 
3 330  LEU n 
3 331  ASP n 
3 332  GLY n 
3 333  GLY n 
3 334  ARG n 
3 335  PHE n 
3 336  ALA n 
3 337  THR n 
3 338  SER n 
3 339  ASP n 
3 340  LEU n 
3 341  ASN n 
3 342  ASP n 
3 343  LEU n 
3 344  TYR n 
3 345  ARG n 
3 346  ARG n 
3 347  VAL n 
3 348  ILE n 
3 349  ASN n 
3 350  ARG n 
3 351  ASN n 
3 352  ASN n 
3 353  ARG n 
3 354  LEU n 
3 355  LYS n 
3 356  ARG n 
3 357  LEU n 
3 358  ILE n 
3 359  ASP n 
3 360  LEU n 
3 361  GLY n 
3 362  ALA n 
3 363  PRO n 
3 364  GLU n 
3 365  ILE n 
3 366  ILE n 
3 367  VAL n 
3 368  ASN n 
3 369  ASN n 
3 370  GLU n 
3 371  LYS n 
3 372  ARG n 
3 373  MET n 
3 374  LEU n 
3 375  GLN n 
3 376  GLU n 
3 377  SER n 
3 378  VAL n 
3 379  ASP n 
3 380  ALA n 
3 381  LEU n 
3 382  PHE n 
3 383  ASP n 
3 384  ASN n 
3 385  GLY n 
3 386  ARG n 
3 387  ARG n 
3 388  GLY n 
3 389  ARG n 
3 390  PRO n 
3 391  VAL n 
3 392  THR n 
3 393  GLY n 
3 394  PRO n 
3 395  GLY n 
3 396  ASN n 
3 397  ARG n 
3 398  PRO n 
3 399  LEU n 
3 400  LYS n 
3 401  SER n 
3 402  LEU n 
3 403  SER n 
3 404  ASP n 
3 405  LEU n 
3 406  LEU n 
3 407  LYS n 
3 408  GLY n 
3 409  LYS n 
3 410  GLN n 
3 411  GLY n 
3 412  ARG n 
3 413  PHE n 
3 414  ARG n 
3 415  GLN n 
3 416  ASN n 
3 417  LEU n 
3 418  LEU n 
3 419  GLY n 
3 420  LYS n 
3 421  ARG n 
3 422  VAL n 
3 423  ASP n 
3 424  TYR n 
3 425  SER n 
3 426  GLY n 
3 427  ARG n 
3 428  SER n 
3 429  VAL n 
3 430  ILE n 
3 431  VAL n 
3 432  VAL n 
3 433  GLY n 
3 434  PRO n 
3 435  GLN n 
3 436  LEU n 
3 437  LYS n 
3 438  LEU n 
3 439  HIS n 
3 440  GLN n 
3 441  CYS n 
3 442  GLY n 
3 443  LEU n 
3 444  PRO n 
3 445  LYS n 
3 446  LEU n 
3 447  MET n 
3 448  ALA n 
3 449  LEU n 
3 450  GLU n 
3 451  LEU n 
3 452  PHE n 
3 453  LYS n 
3 454  PRO n 
3 455  PHE n 
3 456  VAL n 
3 457  MET n 
3 458  LYS n 
3 459  ARG n 
3 460  LEU n 
3 461  VAL n 
3 462  ASP n 
3 463  LEU n 
3 464  ASN n 
3 465  HIS n 
3 466  ALA n 
3 467  GLN n 
3 468  ASN n 
3 469  ILE n 
3 470  LYS n 
3 471  SER n 
3 472  ALA n 
3 473  LYS n 
3 474  ARG n 
3 475  MET n 
3 476  VAL n 
3 477  GLU n 
3 478  ARG n 
3 479  GLN n 
3 480  ARG n 
3 481  PRO n 
3 482  GLN n 
3 483  VAL n 
3 484  TRP n 
3 485  ASP n 
3 486  VAL n 
3 487  LEU n 
3 488  GLU n 
3 489  GLU n 
3 490  VAL n 
3 491  ILE n 
3 492  ALA n 
3 493  GLU n 
3 494  HIS n 
3 495  PRO n 
3 496  VAL n 
3 497  LEU n 
3 498  LEU n 
3 499  ASN n 
3 500  ARG n 
3 501  ALA n 
3 502  PRO n 
3 503  THR n 
3 504  LEU n 
3 505  HIS n 
3 506  ARG n 
3 507  LEU n 
3 508  GLY n 
3 509  ILE n 
3 510  GLN n 
3 511  ALA n 
3 512  PHE n 
3 513  GLU n 
3 514  PRO n 
3 515  MET n 
3 516  LEU n 
3 517  VAL n 
3 518  GLU n 
3 519  GLY n 
3 520  LYS n 
3 521  ALA n 
3 522  ILE n 
3 523  GLN n 
3 524  LEU n 
3 525  HIS n 
3 526  PRO n 
3 527  LEU n 
3 528  VAL n 
3 529  CYS n 
3 530  GLU n 
3 531  ALA n 
3 532  PHE n 
3 533  ASN n 
3 534  ALA n 
3 535  ASP n 
3 536  PHE n 
3 537  ASP n 
3 538  GLY n 
3 539  ASP n 
3 540  GLN n 
3 541  MET n 
3 542  ALA n 
3 543  VAL n 
3 544  HIS n 
3 545  LEU n 
3 546  PRO n 
3 547  LEU n 
3 548  SER n 
3 549  ALA n 
3 550  GLU n 
3 551  ALA n 
3 552  GLN n 
3 553  ALA n 
3 554  GLU n 
3 555  ALA n 
3 556  ARG n 
3 557  ILE n 
3 558  LEU n 
3 559  MET n 
3 560  LEU n 
3 561  SER n 
3 562  SER n 
3 563  ASN n 
3 564  ASN n 
3 565  ILE n 
3 566  LEU n 
3 567  SER n 
3 568  PRO n 
3 569  ALA n 
3 570  SER n 
3 571  GLY n 
3 572  ARG n 
3 573  PRO n 
3 574  LEU n 
3 575  ALA n 
3 576  MET n 
3 577  PRO n 
3 578  ARG n 
3 579  LEU n 
3 580  ASP n 
3 581  MET n 
3 582  VAL n 
3 583  THR n 
3 584  GLY n 
3 585  LEU n 
3 586  TYR n 
3 587  TYR n 
3 588  LEU n 
3 589  THR n 
3 590  THR n 
3 591  GLU n 
3 592  VAL n 
3 593  PRO n 
3 594  GLY n 
3 595  ASP n 
3 596  THR n 
3 597  GLY n 
3 598  GLU n 
3 599  TYR n 
3 600  GLN n 
3 601  PRO n 
3 602  ALA n 
3 603  SER n 
3 604  GLY n 
3 605  ASP n 
3 606  HIS n 
3 607  PRO n 
3 608  GLU n 
3 609  THR n 
3 610  GLY n 
3 611  VAL n 
3 612  TYR n 
3 613  SER n 
3 614  SER n 
3 615  PRO n 
3 616  ALA n 
3 617  GLU n 
3 618  ALA n 
3 619  ILE n 
3 620  MET n 
3 621  ALA n 
3 622  ALA n 
3 623  ASP n 
3 624  ARG n 
3 625  GLY n 
3 626  VAL n 
3 627  LEU n 
3 628  SER n 
3 629  VAL n 
3 630  ARG n 
3 631  ALA n 
3 632  LYS n 
3 633  ILE n 
3 634  LYS n 
3 635  VAL n 
3 636  ARG n 
3 637  LEU n 
3 638  THR n 
3 639  GLN n 
3 640  LEU n 
3 641  ARG n 
3 642  PRO n 
3 643  PRO n 
3 644  VAL n 
3 645  GLU n 
3 646  ILE n 
3 647  GLU n 
3 648  ALA n 
3 649  GLU n 
3 650  LEU n 
3 651  PHE n 
3 652  GLY n 
3 653  HIS n 
3 654  SER n 
3 655  GLY n 
3 656  TRP n 
3 657  GLN n 
3 658  PRO n 
3 659  GLY n 
3 660  ASP n 
3 661  ALA n 
3 662  TRP n 
3 663  MET n 
3 664  ALA n 
3 665  GLU n 
3 666  THR n 
3 667  THR n 
3 668  LEU n 
3 669  GLY n 
3 670  ARG n 
3 671  VAL n 
3 672  MET n 
3 673  PHE n 
3 674  ASN n 
3 675  GLU n 
3 676  LEU n 
3 677  LEU n 
3 678  PRO n 
3 679  LEU n 
3 680  GLY n 
3 681  TYR n 
3 682  PRO n 
3 683  PHE n 
3 684  VAL n 
3 685  ASN n 
3 686  LYS n 
3 687  GLN n 
3 688  MET n 
3 689  HIS n 
3 690  LYS n 
3 691  LYS n 
3 692  VAL n 
3 693  GLN n 
3 694  ALA n 
3 695  ALA n 
3 696  ILE n 
3 697  ILE n 
3 698  ASN n 
3 699  ASP n 
3 700  LEU n 
3 701  ALA n 
3 702  GLU n 
3 703  ARG n 
3 704  TYR n 
3 705  PRO n 
3 706  MET n 
3 707  ILE n 
3 708  VAL n 
3 709  VAL n 
3 710  ALA n 
3 711  GLN n 
3 712  THR n 
3 713  VAL n 
3 714  ASP n 
3 715  LYS n 
3 716  LEU n 
3 717  LYS n 
3 718  ASP n 
3 719  ALA n 
3 720  GLY n 
3 721  PHE n 
3 722  TYR n 
3 723  TRP n 
3 724  ALA n 
3 725  THR n 
3 726  ARG n 
3 727  SER n 
3 728  GLY n 
3 729  VAL n 
3 730  THR n 
3 731  VAL n 
3 732  SER n 
3 733  MET n 
3 734  ALA n 
3 735  ASP n 
3 736  VAL n 
3 737  LEU n 
3 738  VAL n 
3 739  PRO n 
3 740  PRO n 
3 741  ARG n 
3 742  LYS n 
3 743  LYS n 
3 744  GLU n 
3 745  ILE n 
3 746  LEU n 
3 747  ASP n 
3 748  HIS n 
3 749  TYR n 
3 750  GLU n 
3 751  GLU n 
3 752  ARG n 
3 753  ALA n 
3 754  ASP n 
3 755  LYS n 
3 756  VAL n 
3 757  GLU n 
3 758  LYS n 
3 759  GLN n 
3 760  PHE n 
3 761  GLN n 
3 762  ARG n 
3 763  GLY n 
3 764  ALA n 
3 765  LEU n 
3 766  ASN n 
3 767  HIS n 
3 768  ASP n 
3 769  GLU n 
3 770  ARG n 
3 771  ASN n 
3 772  GLU n 
3 773  ALA n 
3 774  LEU n 
3 775  VAL n 
3 776  GLU n 
3 777  ILE n 
3 778  TRP n 
3 779  LYS n 
3 780  GLU n 
3 781  ALA n 
3 782  THR n 
3 783  ASP n 
3 784  GLU n 
3 785  VAL n 
3 786  GLY n 
3 787  GLN n 
3 788  ALA n 
3 789  LEU n 
3 790  ARG n 
3 791  GLU n 
3 792  HIS n 
3 793  TYR n 
3 794  PRO n 
3 795  ASP n 
3 796  ASP n 
3 797  ASN n 
3 798  PRO n 
3 799  ILE n 
3 800  ILE n 
3 801  THR n 
3 802  ILE n 
3 803  VAL n 
3 804  ASP n 
3 805  SER n 
3 806  GLY n 
3 807  ALA n 
3 808  THR n 
3 809  GLY n 
3 810  ASN n 
3 811  PHE n 
3 812  THR n 
3 813  GLN n 
3 814  THR n 
3 815  ARG n 
3 816  THR n 
3 817  LEU n 
3 818  ALA n 
3 819  GLY n 
3 820  MET n 
3 821  LYS n 
3 822  GLY n 
3 823  LEU n 
3 824  VAL n 
3 825  THR n 
3 826  ASN n 
3 827  PRO n 
3 828  LYS n 
3 829  GLY n 
3 830  GLU n 
3 831  PHE n 
3 832  ILE n 
3 833  PRO n 
3 834  ARG n 
3 835  PRO n 
3 836  VAL n 
3 837  LYS n 
3 838  SER n 
3 839  SER n 
3 840  PHE n 
3 841  ARG n 
3 842  GLU n 
3 843  GLY n 
3 844  LEU n 
3 845  THR n 
3 846  VAL n 
3 847  LEU n 
3 848  GLU n 
3 849  TYR n 
3 850  PHE n 
3 851  ILE n 
3 852  ASN n 
3 853  THR n 
3 854  HIS n 
3 855  GLY n 
3 856  ALA n 
3 857  ARG n 
3 858  LYS n 
3 859  GLY n 
3 860  LEU n 
3 861  ALA n 
3 862  ASP n 
3 863  THR n 
3 864  ALA n 
3 865  LEU n 
3 866  ARG n 
3 867  THR n 
3 868  ALA n 
3 869  ASP n 
3 870  SER n 
3 871  GLY n 
3 872  TYR n 
3 873  LEU n 
3 874  THR n 
3 875  ARG n 
3 876  ARG n 
3 877  LEU n 
3 878  VAL n 
3 879  ASP n 
3 880  VAL n 
3 881  SER n 
3 882  GLN n 
3 883  ASP n 
3 884  VAL n 
3 885  ILE n 
3 886  VAL n 
3 887  ARG n 
3 888  GLU n 
3 889  HIS n 
3 890  ASP n 
3 891  CYS n 
3 892  GLN n 
3 893  THR n 
3 894  GLU n 
3 895  ARG n 
3 896  GLY n 
3 897  ILE n 
3 898  VAL n 
3 899  VAL n 
3 900  GLU n 
3 901  LEU n 
3 902  ALA n 
3 903  GLU n 
3 904  ARG n 
3 905  ALA n 
3 906  PRO n 
3 907  ASP n 
3 908  GLY n 
3 909  THR n 
3 910  LEU n 
3 911  ILE n 
3 912  ARG n 
3 913  ASP n 
3 914  PRO n 
3 915  TYR n 
3 916  ILE n 
3 917  GLU n 
3 918  THR n 
3 919  SER n 
3 920  ALA n 
3 921  TYR n 
3 922  ALA n 
3 923  ARG n 
3 924  THR n 
3 925  LEU n 
3 926  GLY n 
3 927  THR n 
3 928  ASP n 
3 929  ALA n 
3 930  VAL n 
3 931  ASP n 
3 932  GLU n 
3 933  ALA n 
3 934  GLY n 
3 935  ASN n 
3 936  VAL n 
3 937  ILE n 
3 938  VAL n 
3 939  GLU n 
3 940  ARG n 
3 941  GLY n 
3 942  GLN n 
3 943  ASP n 
3 944  LEU n 
3 945  GLY n 
3 946  ASP n 
3 947  PRO n 
3 948  GLU n 
3 949  ILE n 
3 950  ASP n 
3 951  ALA n 
3 952  LEU n 
3 953  LEU n 
3 954  ALA n 
3 955  ALA n 
3 956  GLY n 
3 957  ILE n 
3 958  THR n 
3 959  GLN n 
3 960  VAL n 
3 961  LYS n 
3 962  VAL n 
3 963  ARG n 
3 964  SER n 
3 965  VAL n 
3 966  LEU n 
3 967  THR n 
3 968  CYS n 
3 969  ALA n 
3 970  THR n 
3 971  SER n 
3 972  THR n 
3 973  GLY n 
3 974  VAL n 
3 975  CYS n 
3 976  ALA n 
3 977  THR n 
3 978  CYS n 
3 979  TYR n 
3 980  GLY n 
3 981  ARG n 
3 982  SER n 
3 983  MET n 
3 984  ALA n 
3 985  THR n 
3 986  GLY n 
3 987  LYS n 
3 988  LEU n 
3 989  VAL n 
3 990  ASP n 
3 991  ILE n 
3 992  GLY n 
3 993  GLU n 
3 994  ALA n 
3 995  VAL n 
3 996  GLY n 
3 997  ILE n 
3 998  VAL n 
3 999  ALA n 
3 1000 ALA n 
3 1001 GLN n 
3 1002 SER n 
3 1003 ILE n 
3 1004 GLY n 
3 1005 GLU n 
3 1006 PRO n 
3 1007 GLY n 
3 1008 THR n 
3 1009 GLN n 
3 1010 LEU n 
3 1011 THR n 
3 1012 MET n 
3 1013 ARG n 
3 1014 THR n 
3 1015 PHE n 
3 1016 HIS n 
3 1017 GLN n 
3 1018 GLY n 
3 1019 GLY n 
3 1020 VAL n 
3 1021 GLY n 
3 1022 GLU n 
3 1023 ASP n 
3 1024 ILE n 
3 1025 THR n 
3 1026 GLY n 
3 1027 GLY n 
3 1028 LEU n 
3 1029 PRO n 
3 1030 ARG n 
3 1031 VAL n 
3 1032 GLN n 
3 1033 GLU n 
3 1034 LEU n 
3 1035 PHE n 
3 1036 GLU n 
3 1037 ALA n 
3 1038 ARG n 
3 1039 VAL n 
3 1040 PRO n 
3 1041 ARG n 
3 1042 GLY n 
3 1043 LYS n 
3 1044 ALA n 
3 1045 PRO n 
3 1046 ILE n 
3 1047 ALA n 
3 1048 ASP n 
3 1049 VAL n 
3 1050 THR n 
3 1051 GLY n 
3 1052 ARG n 
3 1053 VAL n 
3 1054 ARG n 
3 1055 LEU n 
3 1056 GLU n 
3 1057 ASP n 
3 1058 GLY n 
3 1059 GLU n 
3 1060 ARG n 
3 1061 PHE n 
3 1062 TYR n 
3 1063 LYS n 
3 1064 ILE n 
3 1065 THR n 
3 1066 ILE n 
3 1067 VAL n 
3 1068 PRO n 
3 1069 ASP n 
3 1070 ASP n 
3 1071 GLY n 
3 1072 GLY n 
3 1073 GLU n 
3 1074 GLU n 
3 1075 VAL n 
3 1076 VAL n 
3 1077 TYR n 
3 1078 ASP n 
3 1079 LYS n 
3 1080 ILE n 
3 1081 SER n 
3 1082 LYS n 
3 1083 ARG n 
3 1084 GLN n 
3 1085 ARG n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 VAL n 
3 1089 PHE n 
3 1090 LYS n 
3 1091 HIS n 
3 1092 GLU n 
3 1093 ASP n 
3 1094 GLY n 
3 1095 SER n 
3 1096 GLU n 
3 1097 ARG n 
3 1098 VAL n 
3 1099 LEU n 
3 1100 SER n 
3 1101 ASP n 
3 1102 GLY n 
3 1103 ASP n 
3 1104 HIS n 
3 1105 VAL n 
3 1106 GLU n 
3 1107 VAL n 
3 1108 GLY n 
3 1109 GLN n 
3 1110 GLN n 
3 1111 LEU n 
3 1112 MET n 
3 1113 GLU n 
3 1114 GLY n 
3 1115 SER n 
3 1116 ALA n 
3 1117 ASP n 
3 1118 PRO n 
3 1119 HIS n 
3 1120 GLU n 
3 1121 VAL n 
3 1122 LEU n 
3 1123 ARG n 
3 1124 VAL n 
3 1125 GLN n 
3 1126 GLY n 
3 1127 PRO n 
3 1128 ARG n 
3 1129 GLU n 
3 1130 VAL n 
3 1131 GLN n 
3 1132 ILE n 
3 1133 HIS n 
3 1134 LEU n 
3 1135 VAL n 
3 1136 ARG n 
3 1137 GLU n 
3 1138 VAL n 
3 1139 GLN n 
3 1140 GLU n 
3 1141 VAL n 
3 1142 TYR n 
3 1143 ARG n 
3 1144 ALA n 
3 1145 GLN n 
3 1146 GLY n 
3 1147 VAL n 
3 1148 SER n 
3 1149 ILE n 
3 1150 HIS n 
3 1151 ASP n 
3 1152 LYS n 
3 1153 HIS n 
3 1154 ILE n 
3 1155 GLU n 
3 1156 VAL n 
3 1157 ILE n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 GLN n 
3 1161 MET n 
3 1162 LEU n 
3 1163 ARG n 
3 1164 ARG n 
3 1165 VAL n 
3 1166 THR n 
3 1167 ILE n 
3 1168 ILE n 
3 1169 ASP n 
3 1170 SER n 
3 1171 GLY n 
3 1172 SER n 
3 1173 THR n 
3 1174 GLU n 
3 1175 PHE n 
3 1176 LEU n 
3 1177 PRO n 
3 1178 GLY n 
3 1179 SER n 
3 1180 LEU n 
3 1181 ILE n 
3 1182 ASP n 
3 1183 ARG n 
3 1184 ALA n 
3 1185 GLU n 
3 1186 PHE n 
3 1187 GLU n 
3 1188 ALA n 
3 1189 GLU n 
3 1190 ASN n 
3 1191 ARG n 
3 1192 ARG n 
3 1193 VAL n 
3 1194 VAL n 
3 1195 ALA n 
3 1196 GLU n 
3 1197 GLY n 
3 1198 GLY n 
3 1199 GLU n 
3 1200 PRO n 
3 1201 ALA n 
3 1202 ALA n 
3 1203 GLY n 
3 1204 ARG n 
3 1205 PRO n 
3 1206 VAL n 
3 1207 LEU n 
3 1208 MET n 
3 1209 GLY n 
3 1210 ILE n 
3 1211 THR n 
3 1212 LYS n 
3 1213 ALA n 
3 1214 SER n 
3 1215 LEU n 
3 1216 ALA n 
3 1217 THR n 
3 1218 ASP n 
3 1219 SER n 
3 1220 TRP n 
3 1221 LEU n 
3 1222 SER n 
3 1223 ALA n 
3 1224 ALA n 
3 1225 SER n 
3 1226 PHE n 
3 1227 GLN n 
3 1228 GLU n 
3 1229 THR n 
3 1230 THR n 
3 1231 ARG n 
3 1232 VAL n 
3 1233 LEU n 
3 1234 THR n 
3 1235 ASP n 
3 1236 ALA n 
3 1237 ALA n 
3 1238 ILE n 
3 1239 ASN n 
3 1240 CYS n 
3 1241 ARG n 
3 1242 SER n 
3 1243 ASP n 
3 1244 LYS n 
3 1245 LEU n 
3 1246 ASN n 
3 1247 GLY n 
3 1248 LEU n 
3 1249 LYS n 
3 1250 GLU n 
3 1251 ASN n 
3 1252 VAL n 
3 1253 ILE n 
3 1254 ILE n 
3 1255 GLY n 
3 1256 LYS n 
3 1257 LEU n 
3 1258 ILE n 
3 1259 PRO n 
3 1260 ALA n 
3 1261 GLY n 
3 1262 THR n 
3 1263 GLY n 
3 1264 ILE n 
3 1265 ASN n 
3 1266 ARG n 
3 1267 TYR n 
3 1268 ARG n 
3 1269 ASN n 
3 1270 ILE n 
3 1271 ALA n 
3 1272 VAL n 
3 1273 GLN n 
3 1274 PRO n 
3 1275 THR n 
3 1276 GLU n 
3 1277 GLU n 
3 1278 ALA n 
3 1279 ARG n 
3 1280 ALA n 
3 1281 ALA n 
3 1282 ALA n 
3 1283 TYR n 
3 1284 THR n 
3 1285 ILE n 
3 1286 PRO n 
3 1287 SER n 
3 1288 TYR n 
3 1289 GLU n 
3 1290 ASP n 
3 1291 GLN n 
3 1292 TYR n 
3 1293 TYR n 
3 1294 SER n 
3 1295 PRO n 
3 1296 ASP n 
3 1297 PHE n 
3 1298 GLY n 
3 1299 ALA n 
3 1300 ALA n 
3 1301 THR n 
3 1302 GLY n 
3 1303 ALA n 
3 1304 ALA n 
3 1305 VAL n 
3 1306 PRO n 
3 1307 LEU n 
3 1308 ASP n 
3 1309 ASP n 
3 1310 TYR n 
3 1311 GLY n 
3 1312 TYR n 
3 1313 SER n 
3 1314 ASP n 
3 1315 TYR n 
3 1316 ARG n 
4 1    MET n 
4 2    SER n 
4 3    ILE n 
4 4    SER n 
4 5    GLN n 
4 6    SER n 
4 7    ASP n 
4 8    ALA n 
4 9    SER n 
4 10   LEU n 
4 11   ALA n 
4 12   ALA n 
4 13   VAL n 
4 14   PRO n 
4 15   ALA n 
4 16   VAL n 
4 17   ASP n 
4 18   GLN n 
4 19   PHE n 
4 20   ASP n 
4 21   PRO n 
4 22   SER n 
4 23   SER n 
4 24   GLY n 
4 25   ALA n 
4 26   SER n 
4 27   GLY n 
4 28   GLY n 
4 29   TYR n 
4 30   ASP n 
4 31   THR n 
4 32   PRO n 
4 33   LEU n 
4 34   GLY n 
4 35   ILE n 
4 36   THR n 
4 37   ASN n 
4 38   PRO n 
4 39   PRO n 
4 40   ILE n 
4 41   ASP n 
4 42   GLU n 
4 43   LEU n 
4 44   LEU n 
4 45   ASP n 
4 46   ARG n 
4 47   VAL n 
4 48   SER n 
4 49   SER n 
4 50   LYS n 
4 51   TYR n 
4 52   ALA n 
4 53   LEU n 
4 54   VAL n 
4 55   ILE n 
4 56   TYR n 
4 57   ALA n 
4 58   ALA n 
4 59   LYS n 
4 60   ARG n 
4 61   ALA n 
4 62   ARG n 
4 63   GLN n 
4 64   ILE n 
4 65   ASN n 
4 66   ASP n 
4 67   TYR n 
4 68   TYR n 
4 69   ASN n 
4 70   GLN n 
4 71   LEU n 
4 72   GLY n 
4 73   GLU n 
4 74   GLY n 
4 75   ILE n 
4 76   LEU n 
4 77   GLU n 
4 78   TYR n 
4 79   VAL n 
4 80   GLY n 
4 81   PRO n 
4 82   LEU n 
4 83   VAL n 
4 84   GLU n 
4 85   PRO n 
4 86   GLY n 
4 87   LEU n 
4 88   GLN n 
4 89   GLU n 
4 90   LYS n 
4 91   PRO n 
4 92   LEU n 
4 93   SER n 
4 94   ILE n 
4 95   ALA n 
4 96   LEU n 
4 97   ARG n 
4 98   GLU n 
4 99   ILE n 
4 100  HIS n 
4 101  ALA n 
4 102  ASP n 
4 103  LEU n 
4 104  LEU n 
4 105  GLU n 
4 106  HIS n 
4 107  THR n 
4 108  GLU n 
4 109  GLY n 
4 110  GLU n 
5 1    MET n 
5 2    ALA n 
5 3    ARG n 
5 4    VAL n 
5 5    SER n 
5 6    GLY n 
5 7    ALA n 
5 8    ALA n 
5 9    ALA n 
5 10   ALA n 
5 11   GLU n 
5 12   ALA n 
5 13   ALA n 
5 14   LEU n 
5 15   MET n 
5 16   ARG n 
5 17   ALA n 
5 18   LEU n 
5 19   TYR n 
5 20   ASP n 
5 21   GLU n 
5 22   HIS n 
5 23   ALA n 
5 24   ALA n 
5 25   VAL n 
5 26   LEU n 
5 27   TRP n 
5 28   ARG n 
5 29   TYR n 
5 30   ALA n 
5 31   LEU n 
5 32   ARG n 
5 33   LEU n 
5 34   THR n 
5 35   GLY n 
5 36   ASP n 
5 37   ALA n 
5 38   ALA n 
5 39   GLN n 
5 40   ALA n 
5 41   GLU n 
5 42   ASP n 
5 43   VAL n 
5 44   VAL n 
5 45   GLN n 
5 46   GLU n 
5 47   THR n 
5 48   LEU n 
5 49   LEU n 
5 50   ARG n 
5 51   ALA n 
5 52   TRP n 
5 53   GLN n 
5 54   HIS n 
5 55   PRO n 
5 56   GLU n 
5 57   VAL n 
5 58   ILE n 
5 59   GLY n 
5 60   ASP n 
5 61   THR n 
5 62   ALA n 
5 63   ARG n 
5 64   PRO n 
5 65   ALA n 
5 66   ARG n 
5 67   ALA n 
5 68   TRP n 
5 69   LEU n 
5 70   PHE n 
5 71   THR n 
5 72   VAL n 
5 73   ALA n 
5 74   ARG n 
5 75   ASN n 
5 76   MET n 
5 77   ILE n 
5 78   ILE n 
5 79   ASP n 
5 80   GLU n 
5 81   ARG n 
5 82   ARG n 
5 83   SER n 
5 84   ALA n 
5 85   ARG n 
5 86   PHE n 
5 87   ARG n 
5 88   ASN n 
5 89   VAL n 
5 90   VAL n 
5 91   GLY n 
5 92   SER n 
5 93   THR n 
5 94   ASP n 
5 95   GLN n 
5 96   SER n 
5 97   GLY n 
5 98   THR n 
5 99   PRO n 
5 100  GLU n 
5 101  GLN n 
5 102  SER n 
5 103  THR n 
5 104  PRO n 
5 105  ASP n 
5 106  GLU n 
5 107  VAL n 
5 108  ASN n 
5 109  ALA n 
5 110  ALA n 
5 111  LEU n 
5 112  ASP n 
5 113  ARG n 
5 114  LEU n 
5 115  LEU n 
5 116  ILE n 
5 117  ALA n 
5 118  ASP n 
5 119  ALA n 
5 120  LEU n 
5 121  ALA n 
5 122  GLN n 
5 123  LEU n 
5 124  SER n 
5 125  ALA n 
5 126  GLU n 
5 127  HIS n 
5 128  ARG n 
5 129  ALA n 
5 130  VAL n 
5 131  ILE n 
5 132  GLN n 
5 133  ARG n 
5 134  SER n 
5 135  TYR n 
5 136  TYR n 
5 137  ARG n 
5 138  GLY n 
5 139  TRP n 
5 140  SER n 
5 141  THR n 
5 142  ALA n 
5 143  GLN n 
5 144  ILE n 
5 145  ALA n 
5 146  THR n 
5 147  ASP n 
5 148  LEU n 
5 149  GLY n 
5 150  ILE n 
5 151  ALA n 
5 152  GLU n 
5 153  GLY n 
5 154  THR n 
5 155  VAL n 
5 156  LYS n 
5 157  SER n 
5 158  ARG n 
5 159  LEU n 
5 160  HIS n 
5 161  TYR n 
5 162  ALA n 
5 163  VAL n 
5 164  ARG n 
5 165  ALA n 
5 166  LEU n 
5 167  ARG n 
5 168  LEU n 
5 169  THR n 
5 170  LEU n 
5 171  GLN n 
5 172  GLU n 
5 173  LEU n 
5 174  GLY n 
5 175  VAL n 
5 176  THR n 
5 177  ARG n 
6 1    DG  n 
6 2    DC  n 
6 3    DA  n 
6 4    DT  n 
6 5    DC  n 
6 6    DC  n 
6 7    DG  n 
6 8    DT  n 
6 9    DG  n 
6 10   DA  n 
7 1    DC  n 
7 2    DG  n 
7 3    DT  n 
7 4    DG  n 
7 5    DT  n 
7 6    DC  n 
7 7    DA  n 
7 8    DG  n 
7 9    DT  n 
7 10   DA  n 
7 11   DG  n 
7 12   DC  n 
7 13   DT  n 
7 14   DG  n 
7 15   DT  n 
7 16   DC  n 
7 17   DA  n 
7 18   DC  n 
7 19   DG  n 
7 20   DG  n 
7 21   DA  n 
7 22   DT  n 
7 23   DG  n 
7 24   DC  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 359  ? ? 'rpoA, Rv3457c, MTCY13E12.10c' ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 1178 ? ? 'rpoB, Rv0667, MTCI376.08c'    ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 1316 ? ? 'rpoC, Rv0668, MTCI376.07c'    ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 110  ? ? 'rpoZ, Rv1390, MTCY21B4.07'    ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 177  ? ? 'sigL, Rv0735'                 ? 'ATCC 25618 / H37Rv' ? ? ? ? 
'Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)' 83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample 'Biological sequence' 1 10   ? ? ?                              ? ?                    ? ? ? ? 
'Mycobacterium tuberculosis H37Rv'                       83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7 1 sample 'Biological sequence' 1 24   ? ? ?                              ? ?                    ? ? ? ? 
'Mycobacterium tuberculosis H37Rv'                       83332 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RPOA_MYCTU P9WGZ1 ? 1 
;MLISQRPTLSEDVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNL
KSLVVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERGRGYVPAVQNRASGAEIG
RIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSISPRDALASAGKTLVELFGLARELNVEAEGIEIGPSPAE
ADHIASFALPIDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQLGLSLKDSPPSFDPSEV
AGYDVATGTWSTEGAYDEQDYAETEQL
;
1 
2 UNP RPOB_MYCTU P9WGY9 ? 2 
;MLEGCILADSRQSKTAASPSPSRPQSSSNNSVPGAPNRVSFAKLREPLEVPGLLDVQTDSFEWLIGSPRWRESAAERGDV
NPVGGLEEVLYELSPIEDFSGSMSLSFSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMM
TEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKA
LGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKL
GLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVV
RERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHY
GRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVL
VRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGD
VVVAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGPCTDDGEMALGKNLL
VAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGD
ILVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKIS
DGDKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWAARLP
DELLEAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLVDADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDK
IHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPES
FKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
;
1 
3 UNP RPOC_MYCTU P9WGY7 ? 3 
;MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGV
EVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERK
AVEDQRDGELEARAQKLEADLAELEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENL
YRELVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQQSGNSPMGMVLDAVPVI
PPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVERQR
PQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILML
SSNNILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQL
RPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPFVNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAG
FYWATRSGVTVSMADVLVPPRKKEILDHYEERADKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPDDNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDV
SQDVIVREHDCQTERGIVVELAERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQV
KVRSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARVP
RGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISKRQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHE
VLRVQGPREVQIHLVREVQEVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKENVIIGKLIPAGTGINRYRNIAVQPTEEARA
AAYTIPSYEDQYYSPDFGAATGAAVPLDDYGYSDYR
;
1 
4 UNP RPOZ_MYCTU P9WGY5 ? 4 
;MSISQSDASLAAVPAVDQFDPSSGASGGYDTPLGITNPPIDELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVG
PLVEPGLQEKPLSIALREIHADLLEHTEGE
;
1 
5 UNP SIGL_MYCTU P9WGH5 ? 5 
;MARVSGAAAAEAALMRALYDEHAAVLWRYALRLTGDAAQAEDVVQETLLRAWQHPEVIGDTARPARAWLFTVARNMIIDE
RRSARFRNVVGSTDQSGTPEQSTPDEVNAALDRLLIADALAQLSAEHRAVIQRSYYRGWSTAQIATDLGIAEGTVKSRLH
YAVRALRLTLQELGVTR
;
1 
6 PDB 6DVD       6DVD   ? 6 ? 1 
7 PDB 6DVD       6DVD   ? 7 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6DVD A 13 ? 359  ? P9WGZ1 1 ? 347  ? 1 347  
2 1 6DVD B 13 ? 359  ? P9WGZ1 1 ? 347  ? 1 347  
3 2 6DVD C 1  ? 1178 ? P9WGY9 1 ? 1178 ? 1 1178 
4 3 6DVD D 1  ? 1316 ? P9WGY7 1 ? 1316 ? 1 1316 
5 4 6DVD E 1  ? 110  ? P9WGY5 1 ? 110  ? 1 110  
6 5 6DVD F 1  ? 177  ? P9WGH5 1 ? 177  ? 1 177  
7 6 6DVD G 1  ? 10   ? 6DVD   4 ? 13   ? 4 13   
8 7 6DVD H 1  ? 24   ? 6DVD   2 ? 25   ? 2 25   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6DVD MET A 1  ? UNP P9WGZ1 ? ? 'initiating methionine' -11 1  
1 6DVD GLY A 2  ? UNP P9WGZ1 ? ? 'expression tag'        -10 2  
1 6DVD HIS A 3  ? UNP P9WGZ1 ? ? 'expression tag'        -9  3  
1 6DVD HIS A 4  ? UNP P9WGZ1 ? ? 'expression tag'        -8  4  
1 6DVD HIS A 5  ? UNP P9WGZ1 ? ? 'expression tag'        -7  5  
1 6DVD HIS A 6  ? UNP P9WGZ1 ? ? 'expression tag'        -6  6  
1 6DVD HIS A 7  ? UNP P9WGZ1 ? ? 'expression tag'        -5  7  
1 6DVD HIS A 8  ? UNP P9WGZ1 ? ? 'expression tag'        -4  8  
1 6DVD HIS A 9  ? UNP P9WGZ1 ? ? 'expression tag'        -3  9  
1 6DVD HIS A 10 ? UNP P9WGZ1 ? ? 'expression tag'        -2  10 
1 6DVD HIS A 11 ? UNP P9WGZ1 ? ? 'expression tag'        -1  11 
1 6DVD HIS A 12 ? UNP P9WGZ1 ? ? 'expression tag'        0   12 
2 6DVD MET B 1  ? UNP P9WGZ1 ? ? 'initiating methionine' -11 13 
2 6DVD GLY B 2  ? UNP P9WGZ1 ? ? 'expression tag'        -10 14 
2 6DVD HIS B 3  ? UNP P9WGZ1 ? ? 'expression tag'        -9  15 
2 6DVD HIS B 4  ? UNP P9WGZ1 ? ? 'expression tag'        -8  16 
2 6DVD HIS B 5  ? UNP P9WGZ1 ? ? 'expression tag'        -7  17 
2 6DVD HIS B 6  ? UNP P9WGZ1 ? ? 'expression tag'        -6  18 
2 6DVD HIS B 7  ? UNP P9WGZ1 ? ? 'expression tag'        -5  19 
2 6DVD HIS B 8  ? UNP P9WGZ1 ? ? 'expression tag'        -4  20 
2 6DVD HIS B 9  ? UNP P9WGZ1 ? ? 'expression tag'        -3  21 
2 6DVD HIS B 10 ? UNP P9WGZ1 ? ? 'expression tag'        -2  22 
2 6DVD HIS B 11 ? UNP P9WGZ1 ? ? 'expression tag'        -1  23 
2 6DVD HIS B 12 ? UNP P9WGZ1 ? ? 'expression tag'        0   24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6DVD 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.46 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         64.41 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.2 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM sodium citrate tribasic dihydrate, pH 6.2, 200 mM sodium acetate, and 10% PEG4000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-04-03 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     6DVD 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            3.900 
_reflns.number_obs                   44608 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         87.4 
_reflns.pdbx_Rmerge_I_obs            0.11000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        4.6000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              6.000 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             3.90 
_reflns_shell.d_res_low              3.97 
_reflns_shell.percent_possible_all   68.5 
_reflns_shell.Rmerge_I_obs           0.76800 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        4.90 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 6DVD 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     37593 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.899 
_refine.ls_d_res_high                            3.899 
_refine.ls_percent_reflns_obs                    73.78 
_refine.ls_R_factor_obs                          0.2216 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2202 
_refine.ls_R_factor_R_free                       0.2461 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.31 
_refine.ls_number_reflns_R_free                  1996 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.43 
_refine.pdbx_overall_phase_error                 23.12 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        24049 
_refine_hist.pdbx_number_atoms_nucleic_acid   693 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               24744 
_refine_hist.d_res_high                       3.899 
_refine_hist.d_res_low                        45.899 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.002  ? ? 25238 'X-RAY DIFFRACTION' ? 
f_angle_d          0.461  ? ? 34353 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 15.123 ? ? 15316 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.040  ? ? 3915  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 4415  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 3.8988 3.9963  1128 0.2841 33.00 0.2467 . . 63  . . 
'X-RAY DIFFRACTION' . 3.9963 4.1043  1373 0.2580 40.00 0.2682 . . 77  . . 
'X-RAY DIFFRACTION' . 4.1043 4.2250  1659 0.2356 49.00 0.3099 . . 94  . . 
'X-RAY DIFFRACTION' . 4.2250 4.3612  1922 0.2372 56.00 0.2903 . . 107 . . 
'X-RAY DIFFRACTION' . 4.3612 4.5170  2074 0.2216 61.00 0.2410 . . 116 . . 
'X-RAY DIFFRACTION' . 4.5170 4.6977  2275 0.2153 67.00 0.2605 . . 128 . . 
'X-RAY DIFFRACTION' . 4.6977 4.9112  2493 0.2207 73.00 0.2376 . . 140 . . 
'X-RAY DIFFRACTION' . 4.9112 5.1698  2629 0.2368 77.00 0.2606 . . 148 . . 
'X-RAY DIFFRACTION' . 5.1698 5.4932  2953 0.2364 86.00 0.2546 . . 166 . . 
'X-RAY DIFFRACTION' . 5.4932 5.9166  3305 0.2399 96.00 0.2397 . . 185 . . 
'X-RAY DIFFRACTION' . 5.9166 6.5105  3425 0.2406 99.00 0.2780 . . 193 . . 
'X-RAY DIFFRACTION' . 6.5105 7.4491  3400 0.2192 97.00 0.2432 . . 190 . . 
'X-RAY DIFFRACTION' . 7.4491 9.3719  3481 0.1810 99.00 0.2218 . . 196 . . 
'X-RAY DIFFRACTION' . 9.3719 45.9021 3480 0.1888 95.00 0.2065 . . 193 . . 
# 
_struct.entry_id                     6DVD 
_struct.title                        
;Crystal structure of Mycobacterium tuberculosis transcription initiation complex(ECF sigma factor L) with 6 nt spacer and bromine labelled in position "-11
;
_struct.pdbx_descriptor              'DNA-directed RNA polymerase/ECF RNA polymerase sigma factor SigL/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6DVD 
_struct_keywords.text            
'Mycobacterium tuberculosis, RNA polymerase, ECF sigma factor, TRANSFERASE, TRANSFERASE-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 8 ? 
J N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 PHE A 42   ? LEU A 55   ? PHE A 30   LEU A 43   1 ? 14 
HELX_P HELX_P2   AA2 ASP A 84   ? LYS A 93   ? ASP A 72   LYS A 81   1 ? 10 
HELX_P HELX_P3   AA3 GLY A 120  ? ILE A 122  ? GLY A 108  ILE A 110  5 ? 3  
HELX_P HELX_P4   AA4 SER A 215  ? GLY A 232  ? SER A 203  GLY A 220  1 ? 18 
HELX_P HELX_P5   AA5 GLY B 41   ? SER B 57   ? GLY B 29   SER B 45   1 ? 17 
HELX_P HELX_P6   AA6 ASP B 84   ? SER B 94   ? ASP B 72   SER B 82   1 ? 11 
HELX_P HELX_P7   AA7 ALA B 161  ? ARG B 165  ? ALA B 149  ARG B 153  5 ? 5  
HELX_P HELX_P8   AA8 SER B 215  ? GLU B 236  ? SER B 203  GLU B 224  1 ? 22 
HELX_P HELX_P9   AA9 LEU C 54   ? ILE C 65   ? LEU C 54   ILE C 65   1 ? 12 
HELX_P HELX_P10  AB1 SER C 67   ? ARG C 77   ? SER C 67   ARG C 77   1 ? 11 
HELX_P HELX_P11  AB2 GLY C 84   ? SER C 94   ? GLY C 84   SER C 94   1 ? 11 
HELX_P HELX_P12  AB3 PRO C 118  ? ASP C 126  ? PRO C 118  ASP C 126  1 ? 9  
HELX_P HELX_P13  AB4 VAL C 234  ? LEU C 241  ? VAL C 234  LEU C 241  1 ? 8  
HELX_P HELX_P14  AB5 THR C 244  ? PHE C 252  ? THR C 244  PHE C 252  1 ? 9  
HELX_P HELX_P15  AB6 SER C 255  ? ASP C 265  ? SER C 255  ASP C 265  1 ? 11 
HELX_P HELX_P16  AB7 GLY C 269  ? ARG C 282  ? GLY C 269  ARG C 282  1 ? 14 
HELX_P HELX_P17  AB8 SER C 291  ? LEU C 299  ? SER C 291  LEU C 299  1 ? 9  
HELX_P HELX_P18  AB9 ALA C 309  ? LEU C 320  ? ALA C 309  LEU C 320  1 ? 12 
HELX_P HELX_P19  AC1 THR C 334  ? GLU C 350  ? THR C 334  GLU C 350  1 ? 17 
HELX_P HELX_P20  AC2 THR C 380  ? THR C 405  ? THR C 380  THR C 405  1 ? 26 
HELX_P HELX_P21  AC3 THR C 413  ? ILE C 418  ? THR C 413  ILE C 418  1 ? 6  
HELX_P HELX_P22  AC4 ILE C 420  ? THR C 433  ? ILE C 420  THR C 433  1 ? 14 
HELX_P HELX_P23  AC5 ASN C 444  ? ARG C 453  ? ASN C 444  ARG C 453  1 ? 10 
HELX_P HELX_P24  AC6 SER C 464  ? ALA C 468  ? SER C 464  ALA C 468  5 ? 5  
HELX_P HELX_P25  AC7 HIS C 476  ? TYR C 480  ? HIS C 476  TYR C 480  5 ? 5  
HELX_P HELX_P26  AC8 THR C 532  ? ARG C 538  ? THR C 532  ARG C 538  1 ? 7  
HELX_P HELX_P27  AC9 PRO C 572  ? VAL C 576  ? PRO C 572  VAL C 576  5 ? 5  
HELX_P HELX_P28  AD1 SER C 582  ? VAL C 587  ? SER C 582  VAL C 587  5 ? 6  
HELX_P HELX_P29  AD2 SER C 588  ? MET C 593  ? SER C 588  MET C 593  1 ? 6  
HELX_P HELX_P30  AD3 PHE C 596  ? ASP C 600  ? PHE C 596  ASP C 600  5 ? 5  
HELX_P HELX_P31  AD4 ASP C 601  ? ARG C 613  ? ASP C 601  ARG C 613  1 ? 13 
HELX_P HELX_P32  AD5 GLY C 629  ? GLY C 639  ? GLY C 629  GLY C 639  1 ? 11 
HELX_P HELX_P33  AD6 ASN C 739  ? GLU C 744  ? ASN C 739  GLU C 744  1 ? 6  
HELX_P HELX_P34  AD7 GLU C 779  ? LEU C 784  ? GLU C 779  LEU C 784  5 ? 6  
HELX_P HELX_P35  AD8 GLY C 810  ? LEU C 814  ? GLY C 810  LEU C 814  5 ? 5  
HELX_P HELX_P36  AD9 THR C 815  ? ILE C 824  ? THR C 815  ILE C 824  1 ? 10 
HELX_P HELX_P37  AE1 GLU C 856  ? GLU C 858  ? GLU C 856  GLU C 858  5 ? 3  
HELX_P HELX_P38  AE2 ILE C 928  ? GLY C 943  ? ILE C 928  GLY C 943  1 ? 16 
HELX_P HELX_P39  AE3 PRO C 960  ? LEU C 963  ? PRO C 960  LEU C 963  5 ? 4  
HELX_P HELX_P40  AE4 GLN C 981  ? CYS C 991  ? GLN C 981  CYS C 991  1 ? 11 
HELX_P HELX_P41  AE5 LEU C 1036 ? ILE C 1041 ? LEU C 1036 ILE C 1041 1 ? 6  
HELX_P HELX_P42  AE6 GLY C 1069 ? GLY C 1080 ? GLY C 1069 GLY C 1080 1 ? 12 
HELX_P HELX_P43  AE7 ALA C 1081 ? THR C 1090 ? ALA C 1081 THR C 1090 1 ? 10 
HELX_P HELX_P44  AE8 ASP C 1095 ? LYS C 1108 ? ASP C 1095 LYS C 1108 1 ? 14 
HELX_P HELX_P45  AE9 PRO C 1118 ? LEU C 1131 ? PRO C 1118 LEU C 1131 1 ? 14 
HELX_P HELX_P46  AF1 THR D 16   ? SER D 24   ? THR D 16   SER D 24   1 ? 9  
HELX_P HELX_P47  AF2 ARG D 84   ? GLU D 90   ? ARG D 84   GLU D 90   5 ? 7  
HELX_P HELX_P48  AF3 HIS D 103  ? LYS D 108  ? HIS D 103  LYS D 108  1 ? 6  
HELX_P HELX_P49  AF4 SER D 112  ? ASP D 119  ? SER D 112  ASP D 119  1 ? 8  
HELX_P HELX_P50  AF5 ALA D 121  ? TYR D 130  ? ALA D 121  TYR D 130  1 ? 10 
HELX_P HELX_P51  AF6 ASP D 140  ? GLU D 147  ? ASP D 140  GLU D 147  1 ? 8  
HELX_P HELX_P52  AF7 GLU D 147  ? GLU D 187  ? GLU D 147  GLU D 187  1 ? 41 
HELX_P HELX_P53  AF8 LYS D 190  ? LYS D 228  ? LYS D 190  LYS D 228  1 ? 39 
HELX_P HELX_P54  AF9 ASP D 237  ? GLY D 249  ? ASP D 237  GLY D 249  1 ? 13 
HELX_P HELX_P55  AG1 MET D 256  ? ASN D 267  ? MET D 256  ASN D 267  1 ? 12 
HELX_P HELX_P56  AG2 ASP D 269  ? ASN D 283  ? ASP D 269  ASN D 283  1 ? 15 
HELX_P HELX_P57  AG3 LYS D 285  ? GLY D 306  ? LYS D 285  GLY D 306  1 ? 22 
HELX_P HELX_P58  AG4 SER D 308  ? GLY D 311  ? SER D 308  GLY D 311  5 ? 4  
HELX_P HELX_P59  AG5 PRO D 321  ? ARG D 325  ? PRO D 321  ARG D 325  5 ? 5  
HELX_P HELX_P60  AG6 SER D 338  ? GLY D 361  ? SER D 338  GLY D 361  1 ? 24 
HELX_P HELX_P61  AG7 PRO D 363  ? ASN D 384  ? PRO D 363  ASN D 384  1 ? 22 
HELX_P HELX_P62  AG8 LEU D 402  ? LEU D 406  ? LEU D 402  LEU D 406  5 ? 5  
HELX_P HELX_P63  AG9 GLY D 411  ? LEU D 417  ? GLY D 411  LEU D 417  1 ? 7  
HELX_P HELX_P64  AH1 LYS D 445  ? PHE D 452  ? LYS D 445  PHE D 452  1 ? 8  
HELX_P HELX_P65  AH2 PHE D 452  ? LEU D 463  ? PHE D 452  LEU D 463  1 ? 12 
HELX_P HELX_P66  AH3 ASN D 468  ? GLN D 479  ? ASN D 468  GLN D 479  1 ? 12 
HELX_P HELX_P67  AH4 PRO D 481  ? ILE D 491  ? PRO D 481  ILE D 491  1 ? 11 
HELX_P HELX_P68  AH5 HIS D 505  ? LEU D 507  ? HIS D 505  LEU D 507  5 ? 3  
HELX_P HELX_P69  AH6 VAL D 528  ? ASN D 533  ? VAL D 528  ASN D 533  1 ? 6  
HELX_P HELX_P70  AH7 SER D 548  ? LEU D 558  ? SER D 548  LEU D 558  1 ? 11 
HELX_P HELX_P71  AH8 LEU D 560  ? ASN D 564  ? LEU D 560  ASN D 564  5 ? 5  
HELX_P HELX_P72  AH9 LEU D 579  ? THR D 589  ? LEU D 579  THR D 589  1 ? 11 
HELX_P HELX_P73  AI1 SER D 614  ? GLY D 625  ? SER D 614  GLY D 625  1 ? 12 
HELX_P HELX_P74  AI2 PRO D 643  ? PHE D 651  ? PRO D 643  PHE D 651  1 ? 9  
HELX_P HELX_P75  AI3 THR D 667  ? LEU D 677  ? THR D 667  LEU D 677  1 ? 11 
HELX_P HELX_P76  AI4 HIS D 689  ? ARG D 703  ? HIS D 689  ARG D 703  1 ? 15 
HELX_P HELX_P77  AI5 PRO D 705  ? ARG D 726  ? PRO D 705  ARG D 726  1 ? 22 
HELX_P HELX_P78  AI6 ARG D 741  ? ARG D 762  ? ARG D 741  ARG D 762  1 ? 22 
HELX_P HELX_P79  AI7 ASN D 766  ? TYR D 793  ? ASN D 766  TYR D 793  1 ? 28 
HELX_P HELX_P80  AI8 ASN D 797  ? SER D 805  ? ASN D 797  SER D 805  1 ? 9  
HELX_P HELX_P81  AI9 ASN D 810  ? GLY D 819  ? ASN D 810  GLY D 819  1 ? 10 
HELX_P HELX_P82  AJ1 THR D 845  ? SER D 881  ? THR D 845  SER D 881  1 ? 37 
HELX_P HELX_P83  AJ2 TYR D 915  ? ALA D 920  ? TYR D 915  ALA D 920  1 ? 6  
HELX_P HELX_P84  AJ3 GLY D 945  ? ALA D 954  ? GLY D 945  ALA D 954  1 ? 10 
HELX_P HELX_P85  AJ4 ALA D 976  ? GLY D 980  ? ALA D 976  GLY D 980  1 ? 5  
HELX_P HELX_P86  AJ5 ALA D 994  ? GLU D 1005 ? ALA D 994  GLU D 1005 1 ? 12 
HELX_P HELX_P87  AJ6 PRO D 1006 ? GLN D 1009 ? PRO D 1006 GLN D 1009 5 ? 4  
HELX_P HELX_P88  AJ7 GLY D 1027 ? GLU D 1036 ? GLY D 1027 GLU D 1036 1 ? 10 
HELX_P HELX_P89  AJ8 ASP D 1117 ? GLY D 1126 ? ASP D 1117 GLY D 1126 1 ? 10 
HELX_P HELX_P90  AJ9 GLY D 1126 ? ALA D 1144 ? GLY D 1126 ALA D 1144 1 ? 19 
HELX_P HELX_P91  AK1 HIS D 1150 ? LEU D 1162 ? HIS D 1150 LEU D 1162 1 ? 13 
HELX_P HELX_P92  AK2 ALA D 1184 ? GLY D 1197 ? ALA D 1184 GLY D 1197 1 ? 14 
HELX_P HELX_P93  AK3 GLY D 1209 ? ALA D 1216 ? GLY D 1209 ALA D 1216 1 ? 8  
HELX_P HELX_P94  AK4 SER D 1219 ? SER D 1225 ? SER D 1219 SER D 1225 1 ? 7  
HELX_P HELX_P95  AK5 GLU D 1228 ? ASN D 1239 ? GLU D 1228 ASN D 1239 1 ? 12 
HELX_P HELX_P96  AK6 GLY D 1247 ? GLY D 1255 ? GLY D 1247 GLY D 1255 1 ? 9  
HELX_P HELX_P97  AK7 ALA D 1260 ? GLY D 1263 ? ALA D 1260 GLY D 1263 5 ? 4  
HELX_P HELX_P98  AK8 ILE D 1264 ? ASN D 1269 ? ILE D 1264 ASN D 1269 1 ? 6  
HELX_P HELX_P99  AK9 LEU E 33   ? ASN E 37   ? LEU E 33   ASN E 37   5 ? 5  
HELX_P HELX_P100 AL1 PRO E 39   ? LEU E 44   ? PRO E 39   LEU E 44   1 ? 6  
HELX_P HELX_P101 AL2 SER E 49   ? GLN E 70   ? SER E 49   GLN E 70   1 ? 22 
HELX_P HELX_P102 AL3 LYS E 90   ? ALA E 101  ? LYS E 90   ALA E 101  1 ? 12 
HELX_P HELX_P103 AL4 SER F 5    ? HIS F 22   ? SER F 5    HIS F 22   1 ? 18 
HELX_P HELX_P104 AL5 HIS F 22   ? GLY F 35   ? HIS F 22   GLY F 35   1 ? 14 
HELX_P HELX_P105 AL6 ASP F 36   ? TRP F 52   ? ASP F 36   TRP F 52   1 ? 17 
HELX_P HELX_P106 AL7 HIS F 54   ? ASP F 60   ? HIS F 54   ASP F 60   1 ? 7  
HELX_P HELX_P107 AL8 ALA F 65   ? ARG F 81   ? ALA F 65   ARG F 81   1 ? 17 
HELX_P HELX_P108 AL9 ARG F 82   ? VAL F 89   ? ARG F 82   VAL F 89   1 ? 8  
HELX_P HELX_P109 AM1 GLU F 106  ? GLN F 122  ? GLU F 106  GLN F 122  1 ? 17 
HELX_P HELX_P110 AM2 SER F 124  ? TYR F 135  ? SER F 124  TYR F 135  1 ? 12 
HELX_P HELX_P111 AM3 SER F 140  ? GLY F 149  ? SER F 140  GLY F 149  1 ? 10 
HELX_P HELX_P112 AM4 ALA F 151  ? GLU F 172  ? ALA F 151  GLU F 172  1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? D CYS 60  SG ? ? ? 1_555 J ZN .  ZN ? ? D CYS 60  D ZN 2002 1_555 ? ? ? ? ? ? ?            2.494 ? 
metalc2  metalc ? ? D CYS 62  SG ? ? ? 1_555 J ZN .  ZN ? ? D CYS 62  D ZN 2002 1_555 ? ? ? ? ? ? ?            2.380 ? 
metalc3  metalc ? ? D CYS 75  SG ? ? ? 1_555 J ZN .  ZN ? ? D CYS 75  D ZN 2002 1_555 ? ? ? ? ? ? ?            2.884 ? 
metalc4  metalc ? ? D CYS 78  SG ? ? ? 1_555 J ZN .  ZN ? ? D CYS 78  D ZN 2002 1_555 ? ? ? ? ? ? ?            2.396 ? 
metalc5  metalc ? ? D CYS 891 SG ? ? ? 1_555 I ZN .  ZN ? ? D CYS 891 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.471 ? 
metalc6  metalc ? ? D CYS 968 SG ? ? ? 1_555 I ZN .  ZN ? ? D CYS 968 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.380 ? 
metalc7  metalc ? ? D CYS 975 SG ? ? ? 1_555 I ZN .  ZN ? ? D CYS 975 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.409 ? 
metalc8  metalc ? ? D CYS 978 SG ? ? ? 1_555 I ZN .  ZN ? ? D CYS 978 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.401 ? 
hydrog1  hydrog ? ? G DG  1   N1 ? ? ? 1_555 H DC 24 N3 ? ? G DG  4   H DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? G DG  1   N2 ? ? ? 1_555 H DC 24 O2 ? ? G DG  4   H DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? G DG  1   O6 ? ? ? 1_555 H DC 24 N4 ? ? G DG  4   H DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? G DC  2   N3 ? ? ? 1_555 H DG 23 N1 ? ? G DC  5   H DG 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? G DC  2   N4 ? ? ? 1_555 H DG 23 O6 ? ? G DC  5   H DG 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? G DC  2   O2 ? ? ? 1_555 H DG 23 N2 ? ? G DC  5   H DG 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? G DA  3   N1 ? ? ? 1_555 H DT 22 N3 ? ? G DA  6   H DT 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? G DA  3   N6 ? ? ? 1_555 H DT 22 O4 ? ? G DA  6   H DT 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? G DT  4   N3 ? ? ? 1_555 H DA 21 N1 ? ? G DT  7   H DA 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? G DT  4   O4 ? ? ? 1_555 H DA 21 N6 ? ? G DT  7   H DA 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? G DC  5   N3 ? ? ? 1_555 H DG 20 N1 ? ? G DC  8   H DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? G DC  5   N4 ? ? ? 1_555 H DG 20 O6 ? ? G DC  8   H DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? G DC  5   O2 ? ? ? 1_555 H DG 20 N2 ? ? G DC  8   H DG 21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? G DC  6   N3 ? ? ? 1_555 H DG 19 N1 ? ? G DC  9   H DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? G DC  6   N4 ? ? ? 1_555 H DG 19 O6 ? ? G DC  9   H DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? G DC  6   O2 ? ? ? 1_555 H DG 19 N2 ? ? G DC  9   H DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? G DG  7   N1 ? ? ? 1_555 H DC 18 N3 ? ? G DG  10  H DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? G DG  7   N2 ? ? ? 1_555 H DC 18 O2 ? ? G DG  10  H DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? G DG  7   O6 ? ? ? 1_555 H DC 18 N4 ? ? G DG  10  H DC 19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? G DT  8   N3 ? ? ? 1_555 H DA 17 N1 ? ? G DT  11  H DA 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? G DT  8   O4 ? ? ? 1_555 H DA 17 N6 ? ? G DT  11  H DA 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? G DG  9   N1 ? ? ? 1_555 H DC 16 N3 ? ? G DG  12  H DC 17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? G DG  9   N2 ? ? ? 1_555 H DC 16 O2 ? ? G DG  12  H DC 17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? G DG  9   O6 ? ? ? 1_555 H DC 16 N4 ? ? G DG  12  H DC 17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? G DA  10  N1 ? ? ? 1_555 H DT 15 N3 ? ? G DA  13  H DT 16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? G DA  10  N6 ? ? ? 1_555 H DT 15 O4 ? ? G DA  13  H DT 16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 36  A . ? GLU 24  A PRO 37  A ? PRO 25  A 1 -3.06 
2 GLY 113 A . ? GLY 101 A PRO 114 A ? PRO 102 A 1 -0.62 
3 GLU 36  B . ? GLU 24  B PRO 37  B ? PRO 25  B 1 -5.94 
4 PRO 40  B . ? PRO 28  B GLY 41  B ? GLY 29  B 1 -1.35 
5 SER 94  C . ? SER 94  C PRO 95  C ? PRO 95  C 1 -3.45 
6 VAL 110 D . ? VAL 110 D PRO 111 D ? PRO 111 D 1 -4.97 
7 ALA 501 D . ? ALA 501 D PRO 502 D ? PRO 502 D 1 1.38  
8 ASN 37  E . ? ASN 37  E PRO 38  E ? PRO 38  E 1 -0.59 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 5 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 4 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 2 ? 
AB9 ? 3 ? 
AC1 ? 6 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 8 ? 
AC7 ? 5 ? 
AC8 ? 3 ? 
AC9 ? 2 ? 
AD1 ? 2 ? 
AD2 ? 8 ? 
AD3 ? 2 ? 
AD4 ? 2 ? 
AD5 ? 3 ? 
AD6 ? 2 ? 
AD7 ? 3 ? 
AD8 ? 3 ? 
AD9 ? 3 ? 
AE1 ? 2 ? 
AE2 ? 3 ? 
AE3 ? 2 ? 
AE4 ? 2 ? 
AE5 ? 4 ? 
AE6 ? 2 ? 
AE7 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? parallel      
AC1 4 5 ? anti-parallel 
AC1 5 6 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? parallel      
AC6 5 6 ? anti-parallel 
AC6 6 7 ? parallel      
AC6 7 8 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC7 4 5 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD2 4 5 ? anti-parallel 
AD2 5 6 ? parallel      
AD2 6 7 ? anti-parallel 
AD2 7 8 ? parallel      
AD3 1 2 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? parallel      
AD9 1 2 ? parallel      
AD9 2 3 ? anti-parallel 
AE1 1 2 ? parallel      
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A 20   ? THR A 27   ? THR A 8    THR A 15   
AA1 2 ARG A 30   ? LEU A 38   ? ARG A 18   LEU A 26   
AA1 3 ASP A 202  ? THR A 210  ? ASP A 190  THR A 198  
AA1 4 VAL A 183  ? ALA A 192  ? VAL A 171  ALA A 180  
AA2 1 VAL A 105  ? GLN A 112  ? VAL A 93   GLN A 100  
AA2 2 LYS A 145  ? ARG A 156  ? LYS A 133  ARG A 144  
AA2 3 PRO A 59   ? ILE A 68   ? PRO A 47   ILE A 56   
AA2 4 ILE A 174  ? PRO A 175  ? ILE A 162  PRO A 163  
AA3 1 VAL A 97   ? SER A 98   ? VAL A 85   SER A 86   
AA3 2 THR A 129  ? VAL A 130  ? THR A 117  VAL A 118  
AA4 1 GLY A 115  ? THR A 118  ? GLY A 103  THR A 106  
AA4 2 HIS A 136  ? LEU A 140  ? HIS A 124  LEU A 128  
AA5 1 TYR A 158  ? VAL A 159  ? TYR A 146  VAL A 147  
AA5 2 SER A 178  ? ILE A 179  ? SER A 166  ILE A 167  
AA6 1 THR B 20   ? THR B 27   ? THR B 8    THR B 15   
AA6 2 ARG B 30   ? LEU B 38   ? ARG B 18   LEU B 26   
AA6 3 PHE B 201  ? THR B 210  ? PHE B 189  THR B 198  
AA6 4 VAL B 183  ? THR B 193  ? VAL B 171  THR B 181  
AA7 1 ILE B 122  ? VAL B 123  ? ILE B 110  VAL B 111  
AA7 2 VAL B 105  ? GLN B 112  ? VAL B 93   GLN B 100  
AA7 3 LYS B 145  ? ARG B 156  ? LYS B 133  ARG B 144  
AA7 4 PRO B 59   ? ILE B 68   ? PRO B 47   ILE B 56   
AA7 5 ARG B 173  ? PRO B 175  ? ARG B 161  PRO B 163  
AA8 1 VAL B 97   ? SER B 99   ? VAL B 85   SER B 87   
AA8 2 VAL B 128  ? VAL B 130  ? VAL B 116  VAL B 118  
AA9 1 GLY B 115  ? THR B 118  ? GLY B 103  THR B 106  
AA9 2 HIS B 136  ? LEU B 140  ? HIS B 124  LEU B 128  
AB1 1 TYR B 158  ? VAL B 159  ? TYR B 146  VAL B 147  
AB1 2 SER B 178  ? ILE B 179  ? SER B 166  ILE B 167  
AB2 1 VAL C 39   ? SER C 40   ? VAL C 39   SER C 40   
AB2 2 VAL C 972  ? SER C 973  ? VAL C 972  SER C 973  
AB2 3 VAL C 626  ? GLY C 627  ? VAL C 626  GLY C 627  
AB3 1 ILE C 96   ? GLU C 97   ? ILE C 96   GLU C 97   
AB3 2 MET C 103  ? PHE C 112  ? MET C 103  PHE C 112  
AB3 3 ALA C 130  ? ASN C 141  ? ALA C 130  ASN C 141  
AB3 4 GLU C 146  ? PRO C 158  ? GLU C 146  PRO C 158  
AB4 1 PHE C 166  ? ILE C 168  ? PHE C 166  ILE C 168  
AB4 2 THR C 171  ? VAL C 175  ? THR C 171  VAL C 175  
AB4 3 SER C 437  ? PHE C 439  ? SER C 437  PHE C 439  
AB5 1 ARG C 376  ? ARG C 379  ? ARG C 376  ARG C 379  
AB5 2 SER C 177  ? ARG C 181  ? SER C 177  ARG C 181  
AB5 3 ARG C 454  ? SER C 456  ? ARG C 454  SER C 456  
AB5 4 ILE C 497  ? SER C 499  ? ILE C 497  SER C 499  
AB6 1 GLY C 184  ? ASP C 188  ? GLY C 184  ASP C 188  
AB6 2 HIS C 200  ? ILE C 205  ? HIS C 200  ILE C 205  
AB6 3 LEU C 212  ? VAL C 216  ? LEU C 212  VAL C 216  
AB6 4 VAL C 222  ? ILE C 226  ? VAL C 222  ILE C 226  
AB6 5 ARG C 231  ? PRO C 233  ? ARG C 231  PRO C 233  
AB7 1 ARG C 208  ? GLY C 209  ? ARG C 208  GLY C 209  
AB7 2 TYR C 306  ? ASP C 307  ? TYR C 306  ASP C 307  
AB8 1 THR C 354  ? THR C 356  ? THR C 354  THR C 356  
AB8 2 GLU C 362  ? PRO C 364  ? GLU C 362  PRO C 364  
AB9 1 ARG C 505  ? VAL C 506  ? ARG C 505  VAL C 506  
AB9 2 ILE C 512  ? VAL C 519  ? ILE C 512  VAL C 519  
AB9 3 VAL C 524  ? LEU C 531  ? VAL C 524  LEU C 531  
AC1 1 ARG C 505  ? VAL C 506  ? ARG C 505  VAL C 506  
AC1 2 ILE C 512  ? VAL C 519  ? ILE C 512  VAL C 519  
AC1 3 TYR C 578  ? ASP C 580  ? TYR C 578  ASP C 580  
AC1 4 VAL C 541  ? ALA C 542  ? VAL C 541  ALA C 542  
AC1 5 VAL C 559  ? ARG C 563  ? VAL C 559  ARG C 563  
AC1 6 GLU C 567  ? VAL C 571  ? GLU C 567  VAL C 571  
AC2 1 VAL C 642  ? VAL C 643  ? VAL C 642  VAL C 643  
AC2 2 VAL C 701  ? ASP C 704  ? VAL C 701  ASP C 704  
AC2 3 CYS C 687  ? PRO C 688  ? CYS C 687  PRO C 688  
AC3 1 ARG C 667  ? ARG C 671  ? ARG C 667  ARG C 671  
AC3 2 TYR C 657  ? HIS C 662  ? TYR C 657  HIS C 662  
AC3 3 GLY C 648  ? VAL C 653  ? GLY C 648  VAL C 653  
AC3 4 ARG C 695  ? VAL C 696  ? ARG C 695  VAL C 696  
AC4 1 ALA C 676  ? ARG C 677  ? ALA C 676  ARG C 677  
AC4 2 CYS C 683  ? ALA C 684  ? CYS C 683  ALA C 684  
AC5 1 THR C 708  ? ASP C 709  ? THR C 708  ASP C 709  
AC5 2 GLU C 712  ? MET C 713  ? GLU C 712  MET C 713  
AC6 1 LYS C 1007 ? ALA C 1008 ? LYS C 1007 ALA C 1008 
AC6 2 VAL C 1023 ? LYS C 1032 ? VAL C 1023 LYS C 1032 
AC6 3 LYS C 884  ? ALA C 886  ? LYS C 884  ALA C 886  
AC6 4 LYS C 892  ? LEU C 899  ? LYS C 892  LEU C 899  
AC6 5 ILE C 735  ? SER C 738  ? ILE C 735  SER C 738  
AC6 6 ILE C 915  ? LEU C 917  ? ILE C 915  LEU C 917  
AC6 7 LYS C 717  ? ILE C 723  ? LYS C 717  ILE C 723  
AC6 8 VAL C 1023 ? LYS C 1032 ? VAL C 1023 LYS C 1032 
AC7 1 GLY C 765  ? ALA C 766  ? GLY C 765  ALA C 766  
AC7 2 SER C 749  ? THR C 762  ? SER C 749  THR C 762  
AC7 3 VAL C 865  ? ARG C 877  ? VAL C 865  ARG C 877  
AC7 4 GLY C 845  ? SER C 854  ? GLY C 845  SER C 854  
AC7 5 GLU C 795  ? VAL C 796  ? GLU C 795  VAL C 796  
AC8 1 GLU C 768  ? ILE C 769  ? GLU C 768  ILE C 769  
AC8 2 LYS C 805  ? PRO C 808  ? LYS C 805  PRO C 808  
AC8 3 VAL C 832  ? ASP C 834  ? VAL C 832  ASP C 834  
AC9 1 ILE C 801  ? VAL C 803  ? ILE C 801  VAL C 803  
AC9 2 LEU C 837  ? LYS C 838  ? LEU C 837  LYS C 838  
AD1 1 TRP C 944  ? LYS C 945  ? TRP C 944  LYS C 945  
AD1 2 GLU C 965  ? ALA C 966  ? GLU C 965  ALA C 966  
AD2 1 HIS C 1042 ? ARG C 1044 ? HIS C 1042 ARG C 1044 
AD2 2 SER D 425  ? VAL D 432  ? SER D 425  VAL D 432  
AD2 3 GLN D 540  ? HIS D 544  ? GLN D 540  HIS D 544  
AD2 4 VAL D 496  ? ASN D 499  ? VAL D 496  ASN D 499  
AD2 5 ILE D 509  ? VAL D 517  ? ILE D 509  VAL D 517  
AD2 6 GLN D 440  ? PRO D 444  ? GLN D 440  PRO D 444  
AD2 7 ILE D 522  ? LEU D 524  ? ILE D 522  LEU D 524  
AD2 8 SER D 425  ? VAL D 432  ? SER D 425  VAL D 432  
AD3 1 TYR C 1049 ? SER C 1050 ? TYR C 1049 SER C 1050 
AD3 2 SER F 102  ? THR F 103  ? SER F 102  THR F 103  
AD4 1 ARG C 1067 ? PHE C 1068 ? ARG C 1067 PHE C 1068 
AD4 2 LYS D 420  ? ARG D 421  ? LYS D 420  ARG D 421  
AD5 1 LEU C 1133 ? VAL C 1137 ? LEU C 1133 VAL C 1137 
AD5 2 GLU D 9    ? LEU D 14   ? GLU D 9    LEU D 14   
AD5 3 SER D 1242 ? LYS D 1244 ? SER D 1242 LYS D 1244 
AD6 1 GLY D 93   ? THR D 102  ? GLY D 93   THR D 102  
AD6 2 VAL D 313  ? VAL D 319  ? VAL D 313  VAL D 319  
AD7 1 LEU D 234  ? ILE D 235  ? LEU D 234  ILE D 235  
AD7 2 TYR D 134  ? VAL D 139  ? TYR D 134  VAL D 139  
AD7 3 PHE D 252  ? ALA D 255  ? PHE D 252  ALA D 255  
AD8 1 MET D 327  ? GLN D 329  ? MET D 327  GLN D 329  
AD8 2 PHE D 335  ? THR D 337  ? PHE D 335  THR D 337  
AD8 3 GLY F 91   ? SER F 92   ? GLY F 91   SER F 92   
AD9 1 VAL D 611  ? TYR D 612  ? VAL D 611  TYR D 612  
AD9 2 LYS D 634  ? LEU D 637  ? LYS D 634  LEU D 637  
AD9 3 TRP D 662  ? ALA D 664  ? TRP D 662  ALA D 664  
AE1 1 VAL D 886  ? GLU D 888  ? VAL D 886  GLU D 888  
AE1 2 VAL D 974  ? CYS D 975  ? VAL D 974  CYS D 975  
AE2 1 ILE D 897  ? GLU D 900  ? ILE D 897  GLU D 900  
AE2 2 GLN D 959  ? ARG D 963  ? GLN D 959  ARG D 963  
AE2 3 THR D 924  ? LEU D 925  ? THR D 924  LEU D 925  
AE3 1 ALA D 902  ? ARG D 904  ? ALA D 902  ARG D 904  
AE3 2 LEU D 910  ? ARG D 912  ? LEU D 910  ARG D 912  
AE4 1 ARG D 981  ? SER D 982  ? ARG D 981  SER D 982  
AE4 2 LYS D 987  ? LEU D 988  ? LYS D 987  LEU D 988  
AE5 1 VAL D 1075 ? VAL D 1076 ? VAL D 1075 VAL D 1076 
AE5 2 TYR D 1062 ? PRO D 1068 ? TYR D 1062 PRO D 1068 
AE5 3 GLY D 1051 ? ASP D 1057 ? GLY D 1051 ASP D 1057 
AE5 4 HIS D 1104 ? VAL D 1105 ? HIS D 1104 VAL D 1105 
AE6 1 ARG D 1087 ? VAL D 1088 ? ARG D 1087 VAL D 1088 
AE6 2 ARG D 1097 ? VAL D 1098 ? ARG D 1097 VAL D 1098 
AE7 1 LEU D 1180 ? ASP D 1182 ? LEU D 1180 ASP D 1182 
AE7 2 ARG D 1164 ? THR D 1166 ? ARG D 1164 THR D 1166 
AE7 3 ARG D 1204 ? PRO D 1205 ? ARG D 1204 PRO D 1205 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ASP A 24   ? N ASP A 12   O GLN A 32   ? O GLN A 20   
AA1 2 3 N PHE A 33   ? N PHE A 21   O LEU A 206  ? O LEU A 194  
AA1 3 4 O GLU A 209  ? O GLU A 197  N LEU A 184  ? N LEU A 172  
AA2 1 2 N MET A 107  ? N MET A 95   O LEU A 150  ? O LEU A 138  
AA2 2 3 O VAL A 151  ? O VAL A 139  N SER A 65   ? N SER A 53   
AA2 3 4 N ILE A 66   ? N ILE A 54   O ILE A 174  ? O ILE A 162  
AA3 1 2 N SER A 98   ? N SER A 86   O THR A 129  ? O THR A 117  
AA4 1 2 N GLY A 115  ? N GLY A 103  O LEU A 140  ? O LEU A 128  
AA5 1 2 N VAL A 159  ? N VAL A 147  O SER A 178  ? O SER A 166  
AA6 1 2 N ASP B 24   ? N ASP B 12   O GLN B 32   ? O GLN B 20   
AA6 2 3 N PHE B 33   ? N PHE B 21   O LEU B 206  ? O LEU B 194  
AA6 3 4 O GLU B 209  ? O GLU B 197  N LYS B 185  ? N LYS B 173  
AA7 1 2 O VAL B 123  ? O VAL B 111  N TYR B 108  ? N TYR B 96   
AA7 2 3 N MET B 107  ? N MET B 95   O LEU B 150  ? O LEU B 138  
AA7 3 4 O VAL B 151  ? O VAL B 139  N THR B 64   ? N THR B 52   
AA7 4 5 N ILE B 66   ? N ILE B 54   O ILE B 174  ? O ILE B 162  
AA8 1 2 N SER B 98   ? N SER B 86   O THR B 129  ? O THR B 117  
AA9 1 2 N VAL B 117  ? N VAL B 105  O ALA B 138  ? O ALA B 126  
AB1 1 2 N VAL B 159  ? N VAL B 147  O SER B 178  ? O SER B 166  
AB2 1 2 N VAL C 39   ? N VAL C 39   O SER C 973  ? O SER C 973  
AB2 2 3 O VAL C 972  ? O VAL C 972  N GLY C 627  ? N GLY C 627  
AB3 1 2 N ILE C 96   ? N ILE C 96   O LEU C 105  ? O LEU C 105  
AB3 2 3 N ARG C 111  ? N ARG C 111  O PHE C 134  ? O PHE C 134  
AB3 3 4 N LEU C 133  ? N LEU C 133  O MET C 154  ? O MET C 154  
AB4 1 2 N PHE C 166  ? N PHE C 166  O ARG C 173  ? O ARG C 173  
AB4 2 3 N VAL C 174  ? N VAL C 174  O GLN C 438  ? O GLN C 438  
AB5 1 2 O ARG C 377  ? O ARG C 377  N VAL C 180  ? N VAL C 180  
AB5 2 3 N LEU C 179  ? N LEU C 179  O SER C 456  ? O SER C 456  
AB5 3 4 N LEU C 455  ? N LEU C 455  O GLY C 498  ? O GLY C 498  
AB6 1 2 N TYR C 186  ? N TYR C 186  O LYS C 203  ? O LYS C 203  
AB6 2 3 N VAL C 202  ? N VAL C 202  O PHE C 214  ? O PHE C 214  
AB6 3 4 N GLU C 213  ? N GLU C 213  O ARG C 225  ? O ARG C 225  
AB6 4 5 N VAL C 224  ? N VAL C 224  O GLN C 232  ? O GLN C 232  
AB7 1 2 N ARG C 208  ? N ARG C 208  O ASP C 307  ? O ASP C 307  
AB8 1 2 N MET C 355  ? N MET C 355  O VAL C 363  ? O VAL C 363  
AB9 1 2 N ARG C 505  ? N ARG C 505  O GLU C 513  ? O GLU C 513  
AB9 2 3 N LYS C 518  ? N LYS C 518  O GLU C 527  ? O GLU C 527  
AC1 1 2 N ARG C 505  ? N ARG C 505  O GLU C 513  ? O GLU C 513  
AC1 2 3 N ARG C 517  ? N ARG C 517  O MET C 579  ? O MET C 579  
AC1 3 4 O TYR C 578  ? O TYR C 578  N ALA C 542  ? N ALA C 542  
AC1 4 5 N VAL C 541  ? N VAL C 541  O ARG C 562  ? O ARG C 562  
AC1 5 6 N ARG C 563  ? N ARG C 563  O GLU C 567  ? O GLU C 567  
AC2 1 2 N VAL C 642  ? N VAL C 642  O ALA C 703  ? O ALA C 703  
AC2 2 3 O ASP C 704  ? O ASP C 704  N CYS C 687  ? N CYS C 687  
AC3 1 2 O TYR C 670  ? O TYR C 670  N ILE C 658  ? N ILE C 658  
AC3 2 3 O MET C 661  ? O MET C 661  N VAL C 649  ? N VAL C 649  
AC3 3 4 N GLY C 648  ? N GLY C 648  O VAL C 696  ? O VAL C 696  
AC4 1 2 N ALA C 676  ? N ALA C 676  O ALA C 684  ? O ALA C 684  
AC5 1 2 N ASP C 709  ? N ASP C 709  O GLU C 712  ? O GLU C 712  
AC6 1 2 N ALA C 1008 ? N ALA C 1008 O VAL C 1023 ? O VAL C 1023 
AC6 2 3 O MET C 1031 ? O MET C 1031 N ALA C 886  ? N ALA C 886  
AC6 3 4 N LEU C 885  ? N LEU C 885  O GLY C 893  ? O GLY C 893  
AC6 4 5 O GLY C 896  ? O GLY C 896  N ILE C 735  ? N ILE C 735  
AC6 5 6 N ILE C 736  ? N ILE C 736  O ILE C 916  ? O ILE C 916  
AC6 6 7 N ILE C 915  ? N ILE C 915  O LEU C 720  ? O LEU C 720  
AC6 7 8 N VAL C 721  ? N VAL C 721  O GLY C 1026 ? O GLY C 1026 
AC7 1 2 O GLY C 765  ? O GLY C 765  N THR C 762  ? N THR C 762  
AC7 2 3 N ALA C 759  ? N ALA C 759  O ASN C 866  ? O ASN C 866  
AC7 3 4 O LEU C 868  ? O LEU C 868  N PHE C 853  ? N PHE C 853  
AC7 4 5 O GLY C 845  ? O GLY C 845  N VAL C 796  ? N VAL C 796  
AC8 1 2 N GLU C 768  ? N GLU C 768  O VAL C 806  ? O VAL C 806  
AC8 2 3 N THR C 807  ? N THR C 807  O ARG C 833  ? O ARG C 833  
AC9 1 2 N LEU C 802  ? N LEU C 802  O LEU C 837  ? O LEU C 837  
AD1 1 2 N TRP C 944  ? N TRP C 944  O ALA C 966  ? O ALA C 966  
AD2 1 2 N HIS C 1042 ? N HIS C 1042 O ARG D 427  ? O ARG D 427  
AD2 2 3 N SER D 428  ? N SER D 428  O MET D 541  ? O MET D 541  
AD2 3 4 O ALA D 542  ? O ALA D 542  N ASN D 499  ? N ASN D 499  
AD2 4 5 N LEU D 498  ? N LEU D 498  O GLN D 510  ? O GLN D 510  
AD2 5 6 O GLU D 513  ? O GLU D 513  N CYS D 441  ? N CYS D 441  
AD2 6 7 N GLY D 442  ? N GLY D 442  O GLN D 523  ? O GLN D 523  
AD2 7 8 O ILE D 522  ? O ILE D 522  N VAL D 431  ? N VAL D 431  
AD3 1 2 N TYR C 1049 ? N TYR C 1049 O THR F 103  ? O THR F 103  
AD4 1 2 N PHE C 1068 ? N PHE C 1068 O LYS D 420  ? O LYS D 420  
AD5 1 2 N ASN C 1134 ? N ASN C 1134 O GLY D 13   ? O GLY D 13   
AD5 2 3 N LEU D 10   ? N LEU D 10   O ASP D 1243 ? O ASP D 1243 
AD6 1 2 N VAL D 101  ? N VAL D 101  O LEU D 314  ? O LEU D 314  
AD7 1 2 O ILE D 235  ? O ILE D 235  N TYR D 134  ? N TYR D 134  
AD7 2 3 N SER D 138  ? N SER D 138  O THR D 253  ? O THR D 253  
AD8 1 2 N VAL D 328  ? N VAL D 328  O ALA D 336  ? O ALA D 336  
AD8 2 3 N THR D 337  ? N THR D 337  O GLY F 91   ? O GLY F 91   
AD9 1 2 N TYR D 612  ? N TYR D 612  O LYS D 634  ? O LYS D 634  
AD9 2 3 N LEU D 637  ? N LEU D 637  O TRP D 662  ? O TRP D 662  
AE1 1 2 N ARG D 887  ? N ARG D 887  O VAL D 974  ? O VAL D 974  
AE2 1 2 N VAL D 899  ? N VAL D 899  O VAL D 960  ? O VAL D 960  
AE2 2 3 O ARG D 963  ? O ARG D 963  N THR D 924  ? N THR D 924  
AE3 1 2 N GLU D 903  ? N GLU D 903  O ILE D 911  ? O ILE D 911  
AE4 1 2 N SER D 982  ? N SER D 982  O LYS D 987  ? O LYS D 987  
AE5 1 2 O VAL D 1075 ? O VAL D 1075 N ILE D 1066 ? N ILE D 1066 
AE5 2 3 O THR D 1065 ? O THR D 1065 N ARG D 1054 ? N ARG D 1054 
AE5 3 4 N GLY D 1051 ? N GLY D 1051 O VAL D 1105 ? O VAL D 1105 
AE6 1 2 O VAL D 1088 ? O VAL D 1088 N ARG D 1097 ? N ARG D 1097 
AE7 1 2 O ILE D 1181 ? O ILE D 1181 N VAL D 1165 ? N VAL D 1165 
AE7 2 3 N THR D 1166 ? N THR D 1166 O ARG D 1204 ? O ARG D 1204 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software D ZN 2001 ? 4 'binding site for residue ZN D 2001' 
AC2 Software D ZN 2002 ? 4 'binding site for residue ZN D 2002' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS D 891 ? CYS D 891 . ? 1_555 ? 
2 AC1 4 CYS D 968 ? CYS D 968 . ? 1_555 ? 
3 AC1 4 CYS D 975 ? CYS D 975 . ? 1_555 ? 
4 AC1 4 CYS D 978 ? CYS D 978 . ? 1_555 ? 
5 AC2 4 CYS D 60  ? CYS D 60  . ? 1_555 ? 
6 AC2 4 CYS D 62  ? CYS D 62  . ? 1_555 ? 
7 AC2 4 CYS D 75  ? CYS D 75  . ? 1_555 ? 
8 AC2 4 CYS D 78  ? CYS D 78  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6DVD 
_atom_sites.fract_transf_matrix[1][1]   0.007036 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006193 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004178 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . LEU A 1 14   ? -30.882 9.206   -43.585 1.00 107.44 ?  2    LEU A N     1 
ATOM   2     C  CA    . LEU A 1 14   ? -30.245 9.572   -42.325 1.00 112.71 ?  2    LEU A CA    1 
ATOM   3     C  C     . LEU A 1 14   ? -28.976 10.388  -42.562 1.00 109.06 ?  2    LEU A C     1 
ATOM   4     O  O     . LEU A 1 14   ? -27.873 9.844   -42.597 1.00 103.94 ?  2    LEU A O     1 
ATOM   5     C  CB    . LEU A 1 14   ? -29.931 8.319   -41.500 1.00 103.49 ?  2    LEU A CB    1 
ATOM   6     C  CG    . LEU A 1 14   ? -29.884 6.967   -42.223 1.00 91.71  ?  2    LEU A CG    1 
ATOM   7     C  CD1   . LEU A 1 14   ? -28.623 6.812   -43.063 1.00 77.19  ?  2    LEU A CD1   1 
ATOM   8     C  CD2   . LEU A 1 14   ? -30.011 5.821   -41.228 1.00 76.41  ?  2    LEU A CD2   1 
ATOM   9     N  N     . ILE A 1 15   ? -29.139 11.703  -42.721 1.00 119.12 ?  3    ILE A N     1 
ATOM   10    C  CA    . ILE A 1 15   ? -28.028 12.605  -42.996 1.00 123.53 ?  3    ILE A CA    1 
ATOM   11    C  C     . ILE A 1 15   ? -28.177 13.848  -42.123 1.00 121.95 ?  3    ILE A C     1 
ATOM   12    O  O     . ILE A 1 15   ? -29.182 14.038  -41.436 1.00 112.78 ?  3    ILE A O     1 
ATOM   13    C  CB    . ILE A 1 15   ? -27.940 12.976  -44.495 1.00 125.37 ?  3    ILE A CB    1 
ATOM   14    C  CG1   . ILE A 1 15   ? -26.483 13.219  -44.903 1.00 122.23 ?  3    ILE A CG1   1 
ATOM   15    C  CG2   . ILE A 1 15   ? -28.825 14.175  -44.820 1.00 121.64 ?  3    ILE A CG2   1 
ATOM   16    C  CD1   . ILE A 1 15   ? -25.567 12.043  -44.621 1.00 93.44  ?  3    ILE A CD1   1 
ATOM   17    N  N     . SER A 1 16   ? -27.156 14.700  -42.164 1.00 123.18 ?  4    SER A N     1 
ATOM   18    C  CA    . SER A 1 16   ? -27.014 15.764  -41.179 1.00 121.60 ?  4    SER A CA    1 
ATOM   19    C  C     . SER A 1 16   ? -27.994 16.908  -41.412 1.00 114.75 ?  4    SER A C     1 
ATOM   20    O  O     . SER A 1 16   ? -28.282 17.288  -42.551 1.00 109.19 ?  4    SER A O     1 
ATOM   21    C  CB    . SER A 1 16   ? -25.587 16.310  -41.198 1.00 120.68 ?  4    SER A CB    1 
ATOM   22    O  OG    . SER A 1 16   ? -25.294 16.926  -42.440 1.00 108.65 ?  4    SER A OG    1 
ATOM   23    N  N     . GLN A 1 17   ? -28.506 17.449  -40.309 1.00 104.51 ?  5    GLN A N     1 
ATOM   24    C  CA    . GLN A 1 17   ? -29.147 18.756  -40.261 1.00 86.59  ?  5    GLN A CA    1 
ATOM   25    C  C     . GLN A 1 17   ? -28.547 19.501  -39.080 1.00 84.88  ?  5    GLN A C     1 
ATOM   26    O  O     . GLN A 1 17   ? -28.554 18.987  -37.957 1.00 87.88  ?  5    GLN A O     1 
ATOM   27    C  CB    . GLN A 1 17   ? -30.667 18.648  -40.109 1.00 76.85  ?  5    GLN A CB    1 
ATOM   28    C  CG    . GLN A 1 17   ? -31.348 19.985  -39.849 1.00 74.54  ?  5    GLN A CG    1 
ATOM   29    C  CD    . GLN A 1 17   ? -32.774 19.833  -39.357 1.00 82.82  ?  5    GLN A CD    1 
ATOM   30    O  OE1   . GLN A 1 17   ? -33.373 18.764  -39.475 1.00 84.97  ?  5    GLN A OE1   1 
ATOM   31    N  NE2   . GLN A 1 17   ? -33.324 20.904  -38.795 1.00 75.83  ?  5    GLN A NE2   1 
ATOM   32    N  N     . ARG A 1 18   ? -28.023 20.696  -39.331 1.00 90.34  ?  6    ARG A N     1 
ATOM   33    C  CA    . ARG A 1 18   ? -27.244 21.390  -38.314 1.00 85.46  ?  6    ARG A CA    1 
ATOM   34    C  C     . ARG A 1 18   ? -28.106 21.711  -37.096 1.00 86.50  ?  6    ARG A C     1 
ATOM   35    O  O     . ARG A 1 18   ? -29.231 22.207  -37.249 1.00 84.76  ?  6    ARG A O     1 
ATOM   36    C  CB    . ARG A 1 18   ? -26.629 22.666  -38.886 1.00 87.42  ?  6    ARG A CB    1 
ATOM   37    C  CG    . ARG A 1 18   ? -25.314 22.411  -39.601 1.00 91.01  ?  6    ARG A CG    1 
ATOM   38    C  CD    . ARG A 1 18   ? -24.587 23.694  -39.955 1.00 106.13 ?  6    ARG A CD    1 
ATOM   39    N  NE    . ARG A 1 18   ? -23.153 23.460  -40.106 1.00 122.87 ?  6    ARG A NE    1 
ATOM   40    C  CZ    . ARG A 1 18   ? -22.587 22.951  -41.196 1.00 128.67 ?  6    ARG A CZ    1 
ATOM   41    N  NH1   . ARG A 1 18   ? -21.274 22.772  -41.240 1.00 123.84 ?  6    ARG A NH1   1 
ATOM   42    N  NH2   . ARG A 1 18   ? -23.332 22.617  -42.241 1.00 124.51 ?  6    ARG A NH2   1 
ATOM   43    N  N     . PRO A 1 19   ? -27.623 21.442  -35.885 1.00 61.53  ?  7    PRO A N     1 
ATOM   44    C  CA    . PRO A 1 19   ? -28.455 21.635  -34.694 1.00 52.17  ?  7    PRO A CA    1 
ATOM   45    C  C     . PRO A 1 19   ? -28.662 23.108  -34.379 1.00 51.71  ?  7    PRO A C     1 
ATOM   46    O  O     . PRO A 1 19   ? -27.867 23.975  -34.748 1.00 48.76  ?  7    PRO A O     1 
ATOM   47    C  CB    . PRO A 1 19   ? -27.656 20.940  -33.588 1.00 50.08  ?  7    PRO A CB    1 
ATOM   48    C  CG    . PRO A 1 19   ? -26.240 21.021  -34.053 1.00 55.17  ?  7    PRO A CG    1 
ATOM   49    C  CD    . PRO A 1 19   ? -26.292 20.905  -35.552 1.00 53.37  ?  7    PRO A CD    1 
ATOM   50    N  N     . THR A 1 20   ? -29.759 23.379  -33.674 1.00 49.60  ?  8    THR A N     1 
ATOM   51    C  CA    . THR A 1 20   ? -30.162 24.733  -33.328 1.00 47.32  ?  8    THR A CA    1 
ATOM   52    C  C     . THR A 1 20   ? -30.372 24.838  -31.825 1.00 50.15  ?  8    THR A C     1 
ATOM   53    O  O     . THR A 1 20   ? -30.884 23.909  -31.193 1.00 48.25  ?  8    THR A O     1 
ATOM   54    C  CB    . THR A 1 20   ? -31.446 25.134  -34.064 1.00 45.65  ?  8    THR A CB    1 
ATOM   55    O  OG1   . THR A 1 20   ? -31.329 24.795  -35.452 1.00 63.70  ?  8    THR A OG1   1 
ATOM   56    C  CG2   . THR A 1 20   ? -31.692 26.631  -33.939 1.00 48.51  ?  8    THR A CG2   1 
ATOM   57    N  N     . LEU A 1 21   ? -29.973 25.975  -31.258 1.00 48.81  ?  9    LEU A N     1 
ATOM   58    C  CA    . LEU A 1 21   ? -30.131 26.260  -29.838 1.00 44.40  ?  9    LEU A CA    1 
ATOM   59    C  C     . LEU A 1 21   ? -31.056 27.458  -29.680 1.00 44.23  ?  9    LEU A C     1 
ATOM   60    O  O     . LEU A 1 21   ? -30.766 28.540  -30.201 1.00 52.07  ?  9    LEU A O     1 
ATOM   61    C  CB    . LEU A 1 21   ? -28.776 26.531  -29.181 1.00 46.20  ?  9    LEU A CB    1 
ATOM   62    C  CG    . LEU A 1 21   ? -28.776 27.235  -27.822 1.00 40.60  ?  9    LEU A CG    1 
ATOM   63    C  CD1   . LEU A 1 21   ? -29.532 26.426  -26.780 1.00 40.43  ?  9    LEU A CD1   1 
ATOM   64    C  CD2   . LEU A 1 21   ? -27.351 27.503  -27.366 1.00 33.84  ?  9    LEU A CD2   1 
ATOM   65    N  N     . SER A 1 22   ? -32.164 27.265  -28.966 1.00 39.65  ?  10   SER A N     1 
ATOM   66    C  CA    . SER A 1 22   ? -33.132 28.324  -28.716 1.00 47.33  ?  10   SER A CA    1 
ATOM   67    C  C     . SER A 1 22   ? -33.436 28.390  -27.227 1.00 47.82  ?  10   SER A C     1 
ATOM   68    O  O     . SER A 1 22   ? -33.629 27.358  -26.578 1.00 44.73  ?  10   SER A O     1 
ATOM   69    C  CB    . SER A 1 22   ? -34.424 28.102  -29.512 1.00 62.42  ?  10   SER A CB    1 
ATOM   70    O  OG    . SER A 1 22   ? -34.970 26.822  -29.258 1.00 61.97  ?  10   SER A OG    1 
ATOM   71    N  N     . GLU A 1 23   ? -33.486 29.609  -26.696 1.00 44.71  ?  11   GLU A N     1 
ATOM   72    C  CA    . GLU A 1 23   ? -33.625 29.832  -25.264 1.00 36.70  ?  11   GLU A CA    1 
ATOM   73    C  C     . GLU A 1 23   ? -35.086 30.006  -24.872 1.00 47.94  ?  11   GLU A C     1 
ATOM   74    O  O     . GLU A 1 23   ? -35.849 30.698  -25.553 1.00 59.32  ?  11   GLU A O     1 
ATOM   75    C  CB    . GLU A 1 23   ? -32.823 31.065  -24.840 1.00 42.94  ?  11   GLU A CB    1 
ATOM   76    C  CG    . GLU A 1 23   ? -33.045 31.497  -23.399 1.00 53.49  ?  11   GLU A CG    1 
ATOM   77    C  CD    . GLU A 1 23   ? -32.301 32.772  -23.055 1.00 60.48  ?  11   GLU A CD    1 
ATOM   78    O  OE1   . GLU A 1 23   ? -32.182 33.087  -21.853 1.00 55.78  ?  11   GLU A OE1   1 
ATOM   79    O  OE2   . GLU A 1 23   ? -31.835 33.459  -23.988 1.00 66.48  ?  11   GLU A OE2   1 
ATOM   80    N  N     . ASP A 1 24   ? -35.468 29.366  -23.770 1.00 47.52  ?  12   ASP A N     1 
ATOM   81    C  CA    . ASP A 1 24   ? -36.774 29.545  -23.149 1.00 49.76  ?  12   ASP A CA    1 
ATOM   82    C  C     . ASP A 1 24   ? -36.568 30.074  -21.739 1.00 49.15  ?  12   ASP A C     1 
ATOM   83    O  O     . ASP A 1 24   ? -35.735 29.549  -20.993 1.00 52.69  ?  12   ASP A O     1 
ATOM   84    C  CB    . ASP A 1 24   ? -37.560 28.232  -23.110 1.00 54.88  ?  12   ASP A CB    1 
ATOM   85    C  CG    . ASP A 1 24   ? -37.963 27.751  -24.489 1.00 76.33  ?  12   ASP A CG    1 
ATOM   86    O  OD1   . ASP A 1 24   ? -37.667 28.453  -25.478 1.00 73.00  ?  12   ASP A OD1   1 
ATOM   87    O  OD2   . ASP A 1 24   ? -38.580 26.669  -24.582 1.00 89.75  ?  12   ASP A OD2   1 
ATOM   88    N  N     . VAL A 1 25   ? -37.321 31.108  -21.375 1.00 57.17  ?  13   VAL A N     1 
ATOM   89    C  CA    . VAL A 1 25   ? -37.190 31.758  -20.076 1.00 50.82  ?  13   VAL A CA    1 
ATOM   90    C  C     . VAL A 1 25   ? -38.311 31.281  -19.164 1.00 50.19  ?  13   VAL A C     1 
ATOM   91    O  O     . VAL A 1 25   ? -39.474 31.198  -19.581 1.00 60.68  ?  13   VAL A O     1 
ATOM   92    C  CB    . VAL A 1 25   ? -37.203 33.291  -20.214 1.00 43.13  ?  13   VAL A CB    1 
ATOM   93    C  CG1   . VAL A 1 25   ? -35.901 33.777  -20.830 1.00 42.21  ?  13   VAL A CG1   1 
ATOM   94    C  CG2   . VAL A 1 25   ? -38.389 33.745  -21.054 1.00 65.02  ?  13   VAL A CG2   1 
ATOM   95    N  N     . LEU A 1 26   ? -37.961 30.955  -17.921 1.00 47.78  ?  14   LEU A N     1 
ATOM   96    C  CA    . LEU A 1 26   ? -38.928 30.608  -16.889 1.00 50.67  ?  14   LEU A CA    1 
ATOM   97    C  C     . LEU A 1 26   ? -39.072 31.708  -15.849 1.00 53.07  ?  14   LEU A C     1 
ATOM   98    O  O     . LEU A 1 26   ? -40.188 32.154  -15.564 1.00 60.51  ?  14   LEU A O     1 
ATOM   99    C  CB    . LEU A 1 26   ? -38.526 29.292  -16.205 1.00 50.30  ?  14   LEU A CB    1 
ATOM   100   C  CG    . LEU A 1 26   ? -38.222 28.095  -17.110 1.00 48.87  ?  14   LEU A CG    1 
ATOM   101   C  CD1   . LEU A 1 26   ? -38.060 26.827  -16.284 1.00 43.30  ?  14   LEU A CD1   1 
ATOM   102   C  CD2   . LEU A 1 26   ? -39.298 27.916  -18.171 1.00 53.76  ?  14   LEU A CD2   1 
ATOM   103   N  N     . THR A 1 27   ? -37.958 32.155  -15.270 1.00 55.24  ?  15   THR A N     1 
ATOM   104   C  CA    . THR A 1 27   ? -37.926 33.310  -14.384 1.00 57.84  ?  15   THR A CA    1 
ATOM   105   C  C     . THR A 1 27   ? -36.731 34.171  -14.772 1.00 54.99  ?  15   THR A C     1 
ATOM   106   O  O     . THR A 1 27   ? -36.019 33.882  -15.738 1.00 59.88  ?  15   THR A O     1 
ATOM   107   C  CB    . THR A 1 27   ? -37.855 32.892  -12.909 1.00 62.21  ?  15   THR A CB    1 
ATOM   108   O  OG1   . THR A 1 27   ? -36.844 31.890  -12.739 1.00 60.57  ?  15   THR A OG1   1 
ATOM   109   C  CG2   . THR A 1 27   ? -39.197 32.346  -12.437 1.00 63.72  ?  15   THR A CG2   1 
ATOM   110   N  N     . ASP A 1 28   ? -36.506 35.242  -14.007 1.00 58.23  ?  16   ASP A N     1 
ATOM   111   C  CA    . ASP A 1 28   ? -35.397 36.142  -14.305 1.00 66.82  ?  16   ASP A CA    1 
ATOM   112   C  C     . ASP A 1 28   ? -34.039 35.499  -14.057 1.00 61.04  ?  16   ASP A C     1 
ATOM   113   O  O     . ASP A 1 28   ? -33.028 36.014  -14.547 1.00 58.82  ?  16   ASP A O     1 
ATOM   114   C  CB    . ASP A 1 28   ? -35.520 37.427  -13.485 1.00 83.47  ?  16   ASP A CB    1 
ATOM   115   C  CG    . ASP A 1 28   ? -36.438 38.446  -14.131 1.00 95.38  ?  16   ASP A CG    1 
ATOM   116   O  OD1   . ASP A 1 28   ? -36.932 38.181  -15.248 1.00 100.19 ?  16   ASP A OD1   1 
ATOM   117   O  OD2   . ASP A 1 28   ? -36.662 39.515  -13.525 1.00 99.35  ?  16   ASP A OD2   1 
ATOM   118   N  N     . ASN A 1 29   ? -33.990 34.391  -13.315 1.00 61.01  ?  17   ASN A N     1 
ATOM   119   C  CA    . ASN A 1 29   ? -32.738 33.702  -13.026 1.00 58.72  ?  17   ASN A CA    1 
ATOM   120   C  C     . ASN A 1 29   ? -32.836 32.211  -13.334 1.00 55.63  ?  17   ASN A C     1 
ATOM   121   O  O     . ASN A 1 29   ? -32.159 31.396  -12.702 1.00 59.60  ?  17   ASN A O     1 
ATOM   122   C  CB    . ASN A 1 29   ? -32.310 33.926  -11.574 1.00 55.98  ?  17   ASN A CB    1 
ATOM   123   C  CG    . ASN A 1 29   ? -33.429 33.664  -10.581 1.00 63.37  ?  17   ASN A CG    1 
ATOM   124   O  OD1   . ASN A 1 29   ? -34.357 32.901  -10.852 1.00 68.63  ?  17   ASN A OD1   1 
ATOM   125   N  ND2   . ASN A 1 29   ? -33.344 34.302  -9.419  1.00 76.34  ?  17   ASN A ND2   1 
ATOM   126   N  N     . ARG A 1 30   ? -33.673 31.838  -14.300 1.00 50.38  ?  18   ARG A N     1 
ATOM   127   C  CA    . ARG A 1 30   ? -33.768 30.453  -14.741 1.00 46.32  ?  18   ARG A CA    1 
ATOM   128   C  C     . ARG A 1 30   ? -34.234 30.429  -16.187 1.00 49.25  ?  18   ARG A C     1 
ATOM   129   O  O     . ARG A 1 30   ? -35.196 31.117  -16.541 1.00 53.95  ?  18   ARG A O     1 
ATOM   130   C  CB    . ARG A 1 30   ? -34.726 29.642  -13.860 1.00 43.55  ?  18   ARG A CB    1 
ATOM   131   C  CG    . ARG A 1 30   ? -34.856 28.181  -14.278 1.00 42.57  ?  18   ARG A CG    1 
ATOM   132   C  CD    . ARG A 1 30   ? -34.803 27.251  -13.074 1.00 47.33  ?  18   ARG A CD    1 
ATOM   133   N  NE    . ARG A 1 30   ? -36.123 26.767  -12.679 1.00 46.68  ?  18   ARG A NE    1 
ATOM   134   C  CZ    . ARG A 1 30   ? -36.557 25.528  -12.888 1.00 45.00  ?  18   ARG A CZ    1 
ATOM   135   N  NH1   . ARG A 1 30   ? -35.775 24.641  -13.487 1.00 38.22  ?  18   ARG A NH1   1 
ATOM   136   N  NH2   . ARG A 1 30   ? -37.772 25.172  -12.494 1.00 56.02  ?  18   ARG A NH2   1 
ATOM   137   N  N     . SER A 1 31   ? -33.549 29.642  -17.014 1.00 51.44  ?  19   SER A N     1 
ATOM   138   C  CA    . SER A 1 31   ? -33.894 29.528  -18.422 1.00 50.19  ?  19   SER A CA    1 
ATOM   139   C  C     . SER A 1 31   ? -33.615 28.109  -18.891 1.00 46.84  ?  19   SER A C     1 
ATOM   140   O  O     . SER A 1 31   ? -32.644 27.483  -18.456 1.00 42.61  ?  19   SER A O     1 
ATOM   141   C  CB    . SER A 1 31   ? -33.110 30.531  -19.277 1.00 51.32  ?  19   SER A CB    1 
ATOM   142   O  OG    . SER A 1 31   ? -33.403 31.865  -18.902 1.00 56.43  ?  19   SER A OG    1 
ATOM   143   N  N     . GLN A 1 32   ? -34.473 27.608  -19.774 1.00 46.69  ?  20   GLN A N     1 
ATOM   144   C  CA    . GLN A 1 32   ? -34.280 26.308  -20.399 1.00 35.67  ?  20   GLN A CA    1 
ATOM   145   C  C     . GLN A 1 32   ? -33.715 26.492  -21.800 1.00 31.33  ?  20   GLN A C     1 
ATOM   146   O  O     . GLN A 1 32   ? -34.100 27.417  -22.521 1.00 42.63  ?  20   GLN A O     1 
ATOM   147   C  CB    . GLN A 1 32   ? -35.590 25.521  -20.464 1.00 29.60  ?  20   GLN A CB    1 
ATOM   148   C  CG    . GLN A 1 32   ? -36.111 25.061  -19.114 1.00 40.68  ?  20   GLN A CG    1 
ATOM   149   C  CD    . GLN A 1 32   ? -37.185 23.998  -19.240 1.00 43.78  ?  20   GLN A CD    1 
ATOM   150   O  OE1   . GLN A 1 32   ? -37.388 23.428  -20.312 1.00 49.02  ?  20   GLN A OE1   1 
ATOM   151   N  NE2   . GLN A 1 32   ? -37.878 23.723  -18.140 1.00 43.22  ?  20   GLN A NE2   1 
ATOM   152   N  N     . PHE A 1 33   ? -32.798 25.605  -22.180 1.00 25.26  ?  21   PHE A N     1 
ATOM   153   C  CA    . PHE A 1 33   ? -32.147 25.654  -23.484 1.00 27.00  ?  21   PHE A CA    1 
ATOM   154   C  C     . PHE A 1 33   ? -32.324 24.309  -24.168 1.00 40.64  ?  21   PHE A C     1 
ATOM   155   O  O     . PHE A 1 33   ? -31.942 23.274  -23.613 1.00 42.56  ?  21   PHE A O     1 
ATOM   156   C  CB    . PHE A 1 33   ? -30.661 25.997  -23.348 1.00 27.33  ?  21   PHE A CB    1 
ATOM   157   C  CG    . PHE A 1 33   ? -30.402 27.337  -22.723 1.00 35.87  ?  21   PHE A CG    1 
ATOM   158   C  CD1   . PHE A 1 33   ? -30.288 27.464  -21.349 1.00 42.26  ?  21   PHE A CD1   1 
ATOM   159   C  CD2   . PHE A 1 33   ? -30.270 28.469  -23.509 1.00 42.26  ?  21   PHE A CD2   1 
ATOM   160   C  CE1   . PHE A 1 33   ? -30.048 28.695  -20.770 1.00 38.13  ?  21   PHE A CE1   1 
ATOM   161   C  CE2   . PHE A 1 33   ? -30.029 29.703  -22.935 1.00 42.45  ?  21   PHE A CE2   1 
ATOM   162   C  CZ    . PHE A 1 33   ? -29.919 29.815  -21.564 1.00 42.26  ?  21   PHE A CZ    1 
ATOM   163   N  N     . VAL A 1 34   ? -32.898 24.323  -25.368 1.00 44.06  ?  22   VAL A N     1 
ATOM   164   C  CA    . VAL A 1 34   ? -33.122 23.117  -26.156 1.00 40.21  ?  22   VAL A CA    1 
ATOM   165   C  C     . VAL A 1 34   ? -32.133 23.103  -27.313 1.00 35.63  ?  22   VAL A C     1 
ATOM   166   O  O     . VAL A 1 34   ? -31.968 24.111  -28.012 1.00 41.47  ?  22   VAL A O     1 
ATOM   167   C  CB    . VAL A 1 34   ? -34.573 23.028  -26.660 1.00 30.43  ?  22   VAL A CB    1 
ATOM   168   C  CG1   . VAL A 1 34   ? -35.496 22.588  -25.535 1.00 40.71  ?  22   VAL A CG1   1 
ATOM   169   C  CG2   . VAL A 1 34   ? -35.028 24.365  -27.221 1.00 53.37  ?  22   VAL A CG2   1 
ATOM   170   N  N     . ILE A 1 35   ? -31.470 21.965  -27.507 1.00 22.42  ?  23   ILE A N     1 
ATOM   171   C  CA    . ILE A 1 35   ? -30.496 21.785  -28.578 1.00 34.53  ?  23   ILE A CA    1 
ATOM   172   C  C     . ILE A 1 35   ? -30.893 20.549  -29.371 1.00 44.86  ?  23   ILE A C     1 
ATOM   173   O  O     . ILE A 1 35   ? -30.932 19.440  -28.823 1.00 42.09  ?  23   ILE A O     1 
ATOM   174   C  CB    . ILE A 1 35   ? -29.061 21.650  -28.040 1.00 30.02  ?  23   ILE A CB    1 
ATOM   175   C  CG1   . ILE A 1 35   ? -28.578 22.988  -27.478 1.00 31.32  ?  23   ILE A CG1   1 
ATOM   176   C  CG2   . ILE A 1 35   ? -28.124 21.157  -29.132 1.00 31.22  ?  23   ILE A CG2   1 
ATOM   177   C  CD1   . ILE A 1 35   ? -27.119 22.994  -27.077 1.00 20.46  ?  23   ILE A CD1   1 
ATOM   178   N  N     . GLU A 1 36   ? -31.185 20.738  -30.657 1.00 46.80  ?  24   GLU A N     1 
ATOM   179   C  CA    . GLU A 1 36   ? -31.642 19.660  -31.522 1.00 40.96  ?  24   GLU A CA    1 
ATOM   180   C  C     . GLU A 1 36   ? -31.377 20.058  -32.965 1.00 39.75  ?  24   GLU A C     1 
ATOM   181   O  O     . GLU A 1 36   ? -31.363 21.254  -33.277 1.00 44.84  ?  24   GLU A O     1 
ATOM   182   C  CB    . GLU A 1 36   ? -33.137 19.378  -31.310 1.00 43.28  ?  24   GLU A CB    1 
ATOM   183   C  CG    . GLU A 1 36   ? -34.033 20.579  -31.559 1.00 46.95  ?  24   GLU A CG    1 
ATOM   184   C  CD    . GLU A 1 36   ? -35.504 20.247  -31.416 1.00 58.35  ?  24   GLU A CD    1 
ATOM   185   O  OE1   . GLU A 1 36   ? -35.867 19.065  -31.594 1.00 55.62  ?  24   GLU A OE1   1 
ATOM   186   O  OE2   . GLU A 1 36   ? -36.296 21.166  -31.119 1.00 58.96  ?  24   GLU A OE2   1 
ATOM   187   N  N     . PRO A 1 37   ? -31.163 19.088  -33.870 1.00 49.56  ?  25   PRO A N     1 
ATOM   188   C  CA    . PRO A 1 37   ? -31.099 17.654  -33.576 1.00 45.85  ?  25   PRO A CA    1 
ATOM   189   C  C     . PRO A 1 37   ? -29.691 17.171  -33.246 1.00 46.45  ?  25   PRO A C     1 
ATOM   190   O  O     . PRO A 1 37   ? -28.710 17.710  -33.759 1.00 44.00  ?  25   PRO A O     1 
ATOM   191   C  CB    . PRO A 1 37   ? -31.595 17.019  -34.873 1.00 44.56  ?  25   PRO A CB    1 
ATOM   192   C  CG    . PRO A 1 37   ? -31.120 17.958  -35.926 1.00 54.21  ?  25   PRO A CG    1 
ATOM   193   C  CD    . PRO A 1 37   ? -31.176 19.344  -35.322 1.00 58.46  ?  25   PRO A CD    1 
ATOM   194   N  N     . LEU A 1 38   ? -29.602 16.158  -32.391 1.00 42.33  ?  26   LEU A N     1 
ATOM   195   C  CA    . LEU A 1 38   ? -28.339 15.545  -32.019 1.00 44.32  ?  26   LEU A CA    1 
ATOM   196   C  C     . LEU A 1 38   ? -28.387 14.058  -32.341 1.00 45.55  ?  26   LEU A C     1 
ATOM   197   O  O     . LEU A 1 38   ? -29.460 13.452  -32.411 1.00 48.62  ?  26   LEU A O     1 
ATOM   198   C  CB    . LEU A 1 38   ? -28.036 15.751  -30.529 1.00 44.70  ?  26   LEU A CB    1 
ATOM   199   C  CG    . LEU A 1 38   ? -27.981 17.202  -30.047 1.00 43.04  ?  26   LEU A CG    1 
ATOM   200   C  CD1   . LEU A 1 38   ? -27.937 17.265  -28.529 1.00 38.30  ?  26   LEU A CD1   1 
ATOM   201   C  CD2   . LEU A 1 38   ? -26.786 17.923  -30.651 1.00 42.56  ?  26   LEU A CD2   1 
ATOM   202   N  N     . GLU A 1 39   ? -27.207 13.476  -32.540 1.00 53.78  ?  27   GLU A N     1 
ATOM   203   C  CA    . GLU A 1 39   ? -27.117 12.050  -32.805 1.00 53.15  ?  27   GLU A CA    1 
ATOM   204   C  C     . GLU A 1 39   ? -27.656 11.261  -31.611 1.00 57.58  ?  27   GLU A C     1 
ATOM   205   O  O     . GLU A 1 39   ? -27.640 11.749  -30.477 1.00 62.41  ?  27   GLU A O     1 
ATOM   206   C  CB    . GLU A 1 39   ? -25.670 11.652  -33.095 1.00 57.47  ?  27   GLU A CB    1 
ATOM   207   C  CG    . GLU A 1 39   ? -25.118 12.224  -34.391 1.00 72.68  ?  27   GLU A CG    1 
ATOM   208   C  CD    . GLU A 1 39   ? -25.682 11.541  -35.624 1.00 83.96  ?  27   GLU A CD    1 
ATOM   209   O  OE1   . GLU A 1 39   ? -26.263 10.444  -35.488 1.00 84.73  ?  27   GLU A OE1   1 
ATOM   210   O  OE2   . GLU A 1 39   ? -25.542 12.102  -36.731 1.00 84.23  ?  27   GLU A OE2   1 
ATOM   211   N  N     . PRO A 1 40   ? -28.158 10.048  -31.839 1.00 54.20  ?  28   PRO A N     1 
ATOM   212   C  CA    . PRO A 1 40   ? -28.692 9.256   -30.724 1.00 64.65  ?  28   PRO A CA    1 
ATOM   213   C  C     . PRO A 1 40   ? -27.608 8.922   -29.709 1.00 66.10  ?  28   PRO A C     1 
ATOM   214   O  O     . PRO A 1 40   ? -26.488 8.549   -30.065 1.00 63.75  ?  28   PRO A O     1 
ATOM   215   C  CB    . PRO A 1 40   ? -29.235 7.997   -31.409 1.00 62.53  ?  28   PRO A CB    1 
ATOM   216   C  CG    . PRO A 1 40   ? -28.516 7.932   -32.717 1.00 59.60  ?  28   PRO A CG    1 
ATOM   217   C  CD    . PRO A 1 40   ? -28.305 9.353   -33.129 1.00 51.96  ?  28   PRO A CD    1 
ATOM   218   N  N     . GLY A 1 41   ? -27.954 9.064   -28.429 1.00 57.26  ?  29   GLY A N     1 
ATOM   219   C  CA    . GLY A 1 41   ? -27.012 8.872   -27.347 1.00 58.93  ?  29   GLY A CA    1 
ATOM   220   C  C     . GLY A 1 41   ? -26.090 10.042  -27.087 1.00 52.52  ?  29   GLY A C     1 
ATOM   221   O  O     . GLY A 1 41   ? -25.317 9.997   -26.120 1.00 58.68  ?  29   GLY A O     1 
ATOM   222   N  N     . PHE A 1 42   ? -26.145 11.089  -27.909 1.00 43.39  ?  30   PHE A N     1 
ATOM   223   C  CA    . PHE A 1 42   ? -25.264 12.239  -27.758 1.00 41.38  ?  30   PHE A CA    1 
ATOM   224   C  C     . PHE A 1 42   ? -25.810 13.273  -26.783 1.00 40.53  ?  30   PHE A C     1 
ATOM   225   O  O     . PHE A 1 42   ? -25.038 14.087  -26.266 1.00 40.49  ?  30   PHE A O     1 
ATOM   226   C  CB    . PHE A 1 42   ? -25.039 12.894  -29.123 1.00 48.50  ?  30   PHE A CB    1 
ATOM   227   C  CG    . PHE A 1 42   ? -23.694 13.539  -29.282 1.00 49.57  ?  30   PHE A CG    1 
ATOM   228   C  CD1   . PHE A 1 42   ? -22.687 12.897  -29.979 1.00 57.90  ?  30   PHE A CD1   1 
ATOM   229   C  CD2   . PHE A 1 42   ? -23.440 14.792  -28.751 1.00 43.75  ?  30   PHE A CD2   1 
ATOM   230   C  CE1   . PHE A 1 42   ? -21.452 13.489  -30.137 1.00 54.56  ?  30   PHE A CE1   1 
ATOM   231   C  CE2   . PHE A 1 42   ? -22.203 15.386  -28.904 1.00 49.85  ?  30   PHE A CE2   1 
ATOM   232   C  CZ    . PHE A 1 42   ? -21.209 14.734  -29.598 1.00 53.00  ?  30   PHE A CZ    1 
ATOM   233   N  N     . GLY A 1 43   ? -27.117 13.250  -26.513 1.00 49.82  ?  31   GLY A N     1 
ATOM   234   C  CA    . GLY A 1 43   ? -27.726 14.325  -25.746 1.00 47.60  ?  31   GLY A CA    1 
ATOM   235   C  C     . GLY A 1 43   ? -27.283 14.359  -24.295 1.00 43.09  ?  31   GLY A C     1 
ATOM   236   O  O     . GLY A 1 43   ? -27.124 15.435  -23.712 1.00 39.57  ?  31   GLY A O     1 
ATOM   237   N  N     . TYR A 1 44   ? -27.080 13.187  -23.690 1.00 42.41  ?  32   TYR A N     1 
ATOM   238   C  CA    . TYR A 1 44   ? -26.723 13.143  -22.275 1.00 39.51  ?  32   TYR A CA    1 
ATOM   239   C  C     . TYR A 1 44   ? -25.314 13.672  -22.035 1.00 35.01  ?  32   TYR A C     1 
ATOM   240   O  O     . TYR A 1 44   ? -25.062 14.342  -21.026 1.00 34.16  ?  32   TYR A O     1 
ATOM   241   C  CB    . TYR A 1 44   ? -26.857 11.716  -21.744 1.00 35.12  ?  32   TYR A CB    1 
ATOM   242   C  CG    . TYR A 1 44   ? -28.269 11.342  -21.362 1.00 27.12  ?  32   TYR A CG    1 
ATOM   243   C  CD1   . TYR A 1 44   ? -29.088 12.243  -20.694 1.00 26.43  ?  32   TYR A CD1   1 
ATOM   244   C  CD2   . TYR A 1 44   ? -28.786 10.092  -21.672 1.00 34.70  ?  32   TYR A CD2   1 
ATOM   245   C  CE1   . TYR A 1 44   ? -30.381 11.908  -20.341 1.00 32.91  ?  32   TYR A CE1   1 
ATOM   246   C  CE2   . TYR A 1 44   ? -30.080 9.747   -21.325 1.00 41.41  ?  32   TYR A CE2   1 
ATOM   247   C  CZ    . TYR A 1 44   ? -30.872 10.659  -20.658 1.00 39.77  ?  32   TYR A CZ    1 
ATOM   248   O  OH    . TYR A 1 44   ? -32.160 10.323  -20.311 1.00 44.39  ?  32   TYR A OH    1 
ATOM   249   N  N     . THR A 1 45   ? -24.383 13.388  -22.947 1.00 27.87  ?  33   THR A N     1 
ATOM   250   C  CA    . THR A 1 45   ? -23.001 13.792  -22.721 1.00 27.05  ?  33   THR A CA    1 
ATOM   251   C  C     . THR A 1 45   ? -22.802 15.284  -22.958 1.00 27.79  ?  33   THR A C     1 
ATOM   252   O  O     . THR A 1 45   ? -21.919 15.895  -22.345 1.00 31.47  ?  33   THR A O     1 
ATOM   253   C  CB    . THR A 1 45   ? -22.063 12.982  -23.611 1.00 29.42  ?  33   THR A CB    1 
ATOM   254   O  OG1   . THR A 1 45   ? -22.565 11.648  -23.745 1.00 44.97  ?  33   THR A OG1   1 
ATOM   255   C  CG2   . THR A 1 45   ? -20.686 12.923  -22.984 1.00 24.00  ?  33   THR A CG2   1 
ATOM   256   N  N     . LEU A 1 46   ? -23.607 15.887  -23.836 1.00 36.45  ?  34   LEU A N     1 
ATOM   257   C  CA    . LEU A 1 46   ? -23.525 17.329  -24.046 1.00 32.77  ?  34   LEU A CA    1 
ATOM   258   C  C     . LEU A 1 46   ? -24.031 18.089  -22.828 1.00 34.53  ?  34   LEU A C     1 
ATOM   259   O  O     . LEU A 1 46   ? -23.382 19.031  -22.358 1.00 33.42  ?  34   LEU A O     1 
ATOM   260   C  CB    . LEU A 1 46   ? -24.316 17.729  -25.290 1.00 33.33  ?  34   LEU A CB    1 
ATOM   261   C  CG    . LEU A 1 46   ? -23.606 17.611  -26.635 1.00 51.56  ?  34   LEU A CG    1 
ATOM   262   C  CD1   . LEU A 1 46   ? -24.490 18.158  -27.739 1.00 62.74  ?  34   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A 1 46   ? -22.269 18.333  -26.608 1.00 45.32  ?  34   LEU A CD2   1 
ATOM   264   N  N     . GLY A 1 47   ? -25.197 17.698  -22.309 1.00 36.69  ?  35   GLY A N     1 
ATOM   265   C  CA    . GLY A 1 47   ? -25.754 18.386  -21.157 1.00 31.40  ?  35   GLY A CA    1 
ATOM   266   C  C     . GLY A 1 47   ? -24.878 18.293  -19.925 1.00 35.36  ?  35   GLY A C     1 
ATOM   267   O  O     . GLY A 1 47   ? -24.887 19.193  -19.083 1.00 40.25  ?  35   GLY A O     1 
ATOM   268   N  N     . ASN A 1 48   ? -24.107 17.211  -19.802 1.00 35.63  ?  36   ASN A N     1 
ATOM   269   C  CA    . ASN A 1 48   ? -23.220 17.057  -18.655 1.00 31.34  ?  36   ASN A CA    1 
ATOM   270   C  C     . ASN A 1 48   ? -21.976 17.925  -18.797 1.00 31.98  ?  36   ASN A C     1 
ATOM   271   O  O     . ASN A 1 48   ? -21.566 18.595  -17.843 1.00 36.83  ?  36   ASN A O     1 
ATOM   272   C  CB    . ASN A 1 48   ? -22.838 15.587  -18.482 1.00 29.91  ?  36   ASN A CB    1 
ATOM   273   C  CG    . ASN A 1 48   ? -22.075 15.329  -17.198 1.00 36.38  ?  36   ASN A CG    1 
ATOM   274   O  OD1   . ASN A 1 48   ? -21.001 14.729  -17.209 1.00 43.44  ?  36   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A 1 48   ? -22.627 15.788  -16.080 1.00 40.45  ?  36   ASN A ND2   1 
ATOM   276   N  N     . SER A 1 49   ? -21.365 17.928  -19.985 1.00 25.94  ?  37   SER A N     1 
ATOM   277   C  CA    . SER A 1 49   ? -20.186 18.761  -20.204 1.00 25.58  ?  37   SER A CA    1 
ATOM   278   C  C     . SER A 1 49   ? -20.502 20.238  -20.013 1.00 29.37  ?  37   SER A C     1 
ATOM   279   O  O     . SER A 1 49   ? -19.646 21.002  -19.551 1.00 36.19  ?  37   SER A O     1 
ATOM   280   C  CB    . SER A 1 49   ? -19.616 18.512  -21.600 1.00 29.34  ?  37   SER A CB    1 
ATOM   281   O  OG    . SER A 1 49   ? -19.189 17.168  -21.742 1.00 35.16  ?  37   SER A OG    1 
ATOM   282   N  N     . LEU A 1 50   ? -21.721 20.659  -20.358 1.00 28.93  ?  38   LEU A N     1 
ATOM   283   C  CA    . LEU A 1 50   ? -22.135 22.026  -20.065 1.00 29.73  ?  38   LEU A CA    1 
ATOM   284   C  C     . LEU A 1 50   ? -22.408 22.208  -18.578 1.00 23.36  ?  38   LEU A C     1 
ATOM   285   O  O     . LEU A 1 50   ? -21.995 23.210  -17.983 1.00 28.43  ?  38   LEU A O     1 
ATOM   286   C  CB    . LEU A 1 50   ? -23.371 22.391  -20.887 1.00 30.55  ?  38   LEU A CB    1 
ATOM   287   C  CG    . LEU A 1 50   ? -23.159 22.578  -22.390 1.00 19.95  ?  38   LEU A CG    1 
ATOM   288   C  CD1   . LEU A 1 50   ? -24.488 22.795  -23.091 1.00 18.64  ?  38   LEU A CD1   1 
ATOM   289   C  CD2   . LEU A 1 50   ? -22.218 23.743  -22.652 1.00 14.05  ?  38   LEU A CD2   1 
ATOM   290   N  N     . ARG A 1 51   ? -23.096 21.244  -17.959 1.00 25.25  ?  39   ARG A N     1 
ATOM   291   C  CA    . ARG A 1 51   ? -23.403 21.341  -16.536 1.00 31.28  ?  39   ARG A CA    1 
ATOM   292   C  C     . ARG A 1 51   ? -22.134 21.364  -15.692 1.00 31.14  ?  39   ARG A C     1 
ATOM   293   O  O     . ARG A 1 51   ? -22.023 22.155  -14.748 1.00 26.90  ?  39   ARG A O     1 
ATOM   294   C  CB    . ARG A 1 51   ? -24.303 20.180  -16.115 1.00 24.67  ?  39   ARG A CB    1 
ATOM   295   C  CG    . ARG A 1 51   ? -24.562 20.098  -14.622 1.00 23.67  ?  39   ARG A CG    1 
ATOM   296   C  CD    . ARG A 1 51   ? -25.363 18.857  -14.270 1.00 33.71  ?  39   ARG A CD    1 
ATOM   297   N  NE    . ARG A 1 51   ? -25.625 18.768  -12.837 1.00 33.51  ?  39   ARG A NE    1 
ATOM   298   C  CZ    . ARG A 1 51   ? -24.800 18.204  -11.962 1.00 32.11  ?  39   ARG A CZ    1 
ATOM   299   N  NH1   . ARG A 1 51   ? -23.654 17.675  -12.372 1.00 34.87  ?  39   ARG A NH1   1 
ATOM   300   N  NH2   . ARG A 1 51   ? -25.119 18.168  -10.675 1.00 22.80  ?  39   ARG A NH2   1 
ATOM   301   N  N     . ARG A 1 52   ? -21.167 20.502  -16.016 1.00 29.39  ?  40   ARG A N     1 
ATOM   302   C  CA    . ARG A 1 52   ? -19.936 20.451  -15.233 1.00 23.78  ?  40   ARG A CA    1 
ATOM   303   C  C     . ARG A 1 52   ? -19.138 21.741  -15.371 1.00 29.39  ?  40   ARG A C     1 
ATOM   304   O  O     . ARG A 1 52   ? -18.531 22.209  -14.401 1.00 38.47  ?  40   ARG A O     1 
ATOM   305   C  CB    . ARG A 1 52   ? -19.096 19.247  -15.656 1.00 27.81  ?  40   ARG A CB    1 
ATOM   306   C  CG    . ARG A 1 52   ? -19.743 17.909  -15.339 1.00 31.46  ?  40   ARG A CG    1 
ATOM   307   C  CD    . ARG A 1 52   ? -18.903 16.752  -15.846 1.00 34.62  ?  40   ARG A CD    1 
ATOM   308   N  NE    . ARG A 1 52   ? -17.568 16.748  -15.258 1.00 29.59  ?  40   ARG A NE    1 
ATOM   309   C  CZ    . ARG A 1 52   ? -17.267 16.211  -14.082 1.00 35.17  ?  40   ARG A CZ    1 
ATOM   310   N  NH1   . ARG A 1 52   ? -16.020 16.258  -13.630 1.00 38.13  ?  40   ARG A NH1   1 
ATOM   311   N  NH2   . ARG A 1 52   ? -18.210 15.631  -13.353 1.00 38.25  ?  40   ARG A NH2   1 
ATOM   312   N  N     . THR A 1 53   ? -19.131 22.334  -16.566 1.00 30.80  ?  41   THR A N     1 
ATOM   313   C  CA    . THR A 1 53   ? -18.454 23.613  -16.744 1.00 34.22  ?  41   THR A CA    1 
ATOM   314   C  C     . THR A 1 53   ? -19.237 24.753  -16.103 1.00 30.71  ?  41   THR A C     1 
ATOM   315   O  O     . THR A 1 53   ? -18.638 25.714  -15.609 1.00 34.87  ?  41   THR A O     1 
ATOM   316   C  CB    . THR A 1 53   ? -18.228 23.884  -18.233 1.00 33.96  ?  41   THR A CB    1 
ATOM   317   O  OG1   . THR A 1 53   ? -17.573 22.756  -18.827 1.00 36.29  ?  41   THR A OG1   1 
ATOM   318   C  CG2   . THR A 1 53   ? -17.361 25.120  -18.430 1.00 34.68  ?  41   THR A CG2   1 
ATOM   319   N  N     . LEU A 1 54   ? -20.569 24.659  -16.088 1.00 23.23  ?  42   LEU A N     1 
ATOM   320   C  CA    . LEU A 1 54   ? -21.379 25.699  -15.460 1.00 25.78  ?  42   LEU A CA    1 
ATOM   321   C  C     . LEU A 1 54   ? -21.174 25.723  -13.950 1.00 28.11  ?  42   LEU A C     1 
ATOM   322   O  O     . LEU A 1 54   ? -20.905 26.778  -13.366 1.00 30.78  ?  42   LEU A O     1 
ATOM   323   C  CB    . LEU A 1 54   ? -22.857 25.494  -15.796 1.00 29.82  ?  42   LEU A CB    1 
ATOM   324   C  CG    . LEU A 1 54   ? -23.333 25.962  -17.171 1.00 28.37  ?  42   LEU A CG    1 
ATOM   325   C  CD1   . LEU A 1 54   ? -24.792 25.594  -17.380 1.00 26.92  ?  42   LEU A CD1   1 
ATOM   326   C  CD2   . LEU A 1 54   ? -23.127 27.460  -17.326 1.00 27.39  ?  42   LEU A CD2   1 
ATOM   327   N  N     . LEU A 1 55   ? -21.290 24.566  -13.302 1.00 27.81  ?  43   LEU A N     1 
ATOM   328   C  CA    . LEU A 1 55   ? -21.194 24.492  -11.849 1.00 26.23  ?  43   LEU A CA    1 
ATOM   329   C  C     . LEU A 1 55   ? -19.786 24.737  -11.320 1.00 33.98  ?  43   LEU A C     1 
ATOM   330   O  O     . LEU A 1 55   ? -19.594 24.677  -10.101 1.00 40.42  ?  43   LEU A O     1 
ATOM   331   C  CB    . LEU A 1 55   ? -21.683 23.126  -11.362 1.00 22.30  ?  43   LEU A CB    1 
ATOM   332   C  CG    . LEU A 1 55   ? -23.127 22.725  -11.665 1.00 14.34  ?  43   LEU A CG    1 
ATOM   333   C  CD1   . LEU A 1 55   ? -23.354 21.274  -11.284 1.00 15.85  ?  43   LEU A CD1   1 
ATOM   334   C  CD2   . LEU A 1 55   ? -24.104 23.626  -10.930 1.00 26.05  ?  43   LEU A CD2   1 
ATOM   335   N  N     . SER A 1 56   ? -18.804 25.017  -12.177 1.00 34.93  ?  44   SER A N     1 
ATOM   336   C  CA    . SER A 1 56   ? -17.421 25.052  -11.718 1.00 33.74  ?  44   SER A CA    1 
ATOM   337   C  C     . SER A 1 56   ? -16.660 26.298  -12.155 1.00 37.94  ?  44   SER A C     1 
ATOM   338   O  O     . SER A 1 56   ? -16.054 26.978  -11.320 1.00 46.35  ?  44   SER A O     1 
ATOM   339   C  CB    . SER A 1 56   ? -16.679 23.803  -12.205 1.00 31.86  ?  44   SER A CB    1 
ATOM   340   O  OG    . SER A 1 56   ? -16.736 23.696  -13.617 1.00 28.78  ?  44   SER A OG    1 
ATOM   341   N  N     . SER A 1 57   ? -16.672 26.607  -13.449 1.00 28.21  ?  45   SER A N     1 
ATOM   342   C  CA    . SER A 1 57   ? -15.735 27.566  -14.024 1.00 28.47  ?  45   SER A CA    1 
ATOM   343   C  C     . SER A 1 57   ? -16.434 28.756  -14.671 1.00 33.40  ?  45   SER A C     1 
ATOM   344   O  O     . SER A 1 57   ? -15.999 29.261  -15.708 1.00 36.81  ?  45   SER A O     1 
ATOM   345   C  CB    . SER A 1 57   ? -14.823 26.878  -15.037 1.00 33.24  ?  45   SER A CB    1 
ATOM   346   O  OG    . SER A 1 57   ? -14.161 25.769  -14.452 1.00 30.24  ?  45   SER A OG    1 
ATOM   347   N  N     . ILE A 1 58   ? -17.515 29.235  -14.067 1.00 30.87  ?  46   ILE A N     1 
ATOM   348   C  CA    . ILE A 1 58   ? -18.191 30.446  -14.521 1.00 31.55  ?  46   ILE A CA    1 
ATOM   349   C  C     . ILE A 1 58   ? -17.663 31.613  -13.692 1.00 30.51  ?  46   ILE A C     1 
ATOM   350   O  O     . ILE A 1 58   ? -17.768 31.573  -12.456 1.00 32.64  ?  46   ILE A O     1 
ATOM   351   C  CB    . ILE A 1 58   ? -19.715 30.330  -14.398 1.00 26.70  ?  46   ILE A CB    1 
ATOM   352   C  CG1   . ILE A 1 58   ? -20.229 29.179  -15.264 1.00 22.64  ?  46   ILE A CG1   1 
ATOM   353   C  CG2   . ILE A 1 58   ? -20.380 31.630  -14.822 1.00 13.70  ?  46   ILE A CG2   1 
ATOM   354   C  CD1   . ILE A 1 58   ? -19.861 29.304  -16.727 1.00 28.78  ?  46   ILE A CD1   1 
ATOM   355   N  N     . PRO A 1 59   ? -17.096 32.647  -14.314 1.00 24.18  ?  47   PRO A N     1 
ATOM   356   C  CA    . PRO A 1 59   ? -16.502 33.742  -13.538 1.00 27.64  ?  47   PRO A CA    1 
ATOM   357   C  C     . PRO A 1 59   ? -17.546 34.487  -12.720 1.00 26.67  ?  47   PRO A C     1 
ATOM   358   O  O     . PRO A 1 59   ? -18.689 34.666  -13.146 1.00 24.70  ?  47   PRO A O     1 
ATOM   359   C  CB    . PRO A 1 59   ? -15.886 34.646  -14.614 1.00 25.83  ?  47   PRO A CB    1 
ATOM   360   C  CG    . PRO A 1 59   ? -15.731 33.767  -15.815 1.00 36.71  ?  47   PRO A CG    1 
ATOM   361   C  CD    . PRO A 1 59   ? -16.871 32.803  -15.759 1.00 34.70  ?  47   PRO A CD    1 
ATOM   362   N  N     . GLY A 1 60   ? -17.135 34.923  -11.531 1.00 20.18  ?  48   GLY A N     1 
ATOM   363   C  CA    . GLY A 1 60   ? -18.000 35.675  -10.642 1.00 25.63  ?  48   GLY A CA    1 
ATOM   364   C  C     . GLY A 1 60   ? -17.176 36.380  -9.589  1.00 29.99  ?  48   GLY A C     1 
ATOM   365   O  O     . GLY A 1 60   ? -15.985 36.114  -9.415  1.00 31.73  ?  48   GLY A O     1 
ATOM   366   N  N     . ALA A 1 61   ? -17.832 37.295  -8.882  1.00 31.63  ?  49   ALA A N     1 
ATOM   367   C  CA    . ALA A 1 61   ? -17.196 38.092  -7.844  1.00 21.04  ?  49   ALA A CA    1 
ATOM   368   C  C     . ALA A 1 61   ? -17.778 37.736  -6.485  1.00 26.83  ?  49   ALA A C     1 
ATOM   369   O  O     . ALA A 1 61   ? -18.986 37.512  -6.355  1.00 33.38  ?  49   ALA A O     1 
ATOM   370   C  CB    . ALA A 1 61   ? -17.370 39.589  -8.111  1.00 32.32  ?  49   ALA A CB    1 
ATOM   371   N  N     . ALA A 1 62   ? -16.914 37.683  -5.476  1.00 29.19  ?  50   ALA A N     1 
ATOM   372   C  CA    . ALA A 1 62   ? -17.340 37.386  -4.118  1.00 24.62  ?  50   ALA A CA    1 
ATOM   373   C  C     . ALA A 1 62   ? -16.444 38.143  -3.151  1.00 21.28  ?  50   ALA A C     1 
ATOM   374   O  O     . ALA A 1 62   ? -15.427 38.725  -3.537  1.00 20.41  ?  50   ALA A O     1 
ATOM   375   C  CB    . ALA A 1 62   ? -17.309 35.881  -3.834  1.00 28.95  ?  50   ALA A CB    1 
ATOM   376   N  N     . VAL A 1 63   ? -16.834 38.130  -1.882  1.00 18.28  ?  51   VAL A N     1 
ATOM   377   C  CA    . VAL A 1 63   ? -16.087 38.834  -0.848  1.00 22.82  ?  51   VAL A CA    1 
ATOM   378   C  C     . VAL A 1 63   ? -14.926 37.962  -0.388  1.00 25.72  ?  51   VAL A C     1 
ATOM   379   O  O     . VAL A 1 63   ? -15.115 36.802  -0.002  1.00 18.63  ?  51   VAL A O     1 
ATOM   380   C  CB    . VAL A 1 63   ? -17.007 39.213  0.325   1.00 16.72  ?  51   VAL A CB    1 
ATOM   381   C  CG1   . VAL A 1 63   ? -17.933 38.056  0.675   1.00 28.67  ?  51   VAL A CG1   1 
ATOM   382   C  CG2   . VAL A 1 63   ? -16.184 39.631  1.534   1.00 18.65  ?  51   VAL A CG2   1 
ATOM   383   N  N     . THR A 1 64   ? -13.714 38.517  -0.440  1.00 20.46  ?  52   THR A N     1 
ATOM   384   C  CA    . THR A 1 64   ? -12.534 37.787  0.010   1.00 22.63  ?  52   THR A CA    1 
ATOM   385   C  C     . THR A 1 64   ? -12.401 37.838  1.528   1.00 21.97  ?  52   THR A C     1 
ATOM   386   O  O     . THR A 1 64   ? -12.375 36.799  2.197   1.00 28.74  ?  52   THR A O     1 
ATOM   387   C  CB    . THR A 1 64   ? -11.276 38.353  -0.655  1.00 28.89  ?  52   THR A CB    1 
ATOM   388   O  OG1   . THR A 1 64   ? -11.334 38.122  -2.068  1.00 22.20  ?  52   THR A OG1   1 
ATOM   389   C  CG2   . THR A 1 64   ? -10.028 37.691  -0.087  1.00 36.55  ?  52   THR A CG2   1 
ATOM   390   N  N     . SER A 1 65   ? -12.318 39.043  2.085   1.00 22.87  ?  53   SER A N     1 
ATOM   391   C  CA    . SER A 1 65   ? -12.153 39.228  3.518   1.00 21.17  ?  53   SER A CA    1 
ATOM   392   C  C     . SER A 1 65   ? -13.050 40.362  3.993   1.00 18.85  ?  53   SER A C     1 
ATOM   393   O  O     . SER A 1 65   ? -13.556 41.157  3.198   1.00 23.17  ?  53   SER A O     1 
ATOM   394   C  CB    . SER A 1 65   ? -10.691 39.522  3.878   1.00 25.52  ?  53   SER A CB    1 
ATOM   395   O  OG    . SER A 1 65   ? -10.204 40.627  3.138   1.00 22.65  ?  53   SER A OG    1 
ATOM   396   N  N     . ILE A 1 66   ? -13.251 40.419  5.309   1.00 16.43  ?  54   ILE A N     1 
ATOM   397   C  CA    . ILE A 1 66   ? -13.999 41.492  5.945   1.00 14.89  ?  54   ILE A CA    1 
ATOM   398   C  C     . ILE A 1 66   ? -13.139 42.084  7.055   1.00 23.67  ?  54   ILE A C     1 
ATOM   399   O  O     . ILE A 1 66   ? -12.068 41.573  7.383   1.00 28.35  ?  54   ILE A O     1 
ATOM   400   C  CB    . ILE A 1 66   ? -15.356 41.022  6.508   1.00 14.62  ?  54   ILE A CB    1 
ATOM   401   C  CG1   . ILE A 1 66   ? -15.146 40.122  7.727   1.00 17.59  ?  54   ILE A CG1   1 
ATOM   402   C  CG2   . ILE A 1 66   ? -16.163 40.304  5.437   1.00 15.51  ?  54   ILE A CG2   1 
ATOM   403   C  CD1   . ILE A 1 66   ? -16.413 39.850  8.503   1.00 18.45  ?  54   ILE A CD1   1 
ATOM   404   N  N     . ARG A 1 67   ? -13.628 43.177  7.636   1.00 23.61  ?  55   ARG A N     1 
ATOM   405   C  CA    . ARG A 1 67   ? -12.906 43.854  8.710   1.00 23.07  ?  55   ARG A CA    1 
ATOM   406   C  C     . ARG A 1 67   ? -13.909 44.616  9.562   1.00 23.06  ?  55   ARG A C     1 
ATOM   407   O  O     . ARG A 1 67   ? -14.431 45.650  9.135   1.00 23.28  ?  55   ARG A O     1 
ATOM   408   C  CB    . ARG A 1 67   ? -11.837 44.788  8.149   1.00 25.86  ?  55   ARG A CB    1 
ATOM   409   C  CG    . ARG A 1 67   ? -10.932 45.389  9.210   1.00 33.96  ?  55   ARG A CG    1 
ATOM   410   C  CD    . ARG A 1 67   ? -9.574  45.755  8.634   1.00 43.84  ?  55   ARG A CD    1 
ATOM   411   N  NE    . ARG A 1 67   ? -8.615  46.098  9.681   1.00 66.57  ?  55   ARG A NE    1 
ATOM   412   C  CZ    . ARG A 1 67   ? -7.304  46.197  9.489   1.00 71.44  ?  55   ARG A CZ    1 
ATOM   413   N  NH1   . ARG A 1 67   ? -6.790  45.975  8.286   1.00 52.91  ?  55   ARG A NH1   1 
ATOM   414   N  NH2   . ARG A 1 67   ? -6.505  46.513  10.499  1.00 83.10  ?  55   ARG A NH2   1 
ATOM   415   N  N     . ILE A 1 68   ? -14.175 44.107  10.761  1.00 26.02  ?  56   ILE A N     1 
ATOM   416   C  CA    . ILE A 1 68   ? -15.028 44.776  11.736  1.00 26.08  ?  56   ILE A CA    1 
ATOM   417   C  C     . ILE A 1 68   ? -14.134 45.508  12.724  1.00 29.67  ?  56   ILE A C     1 
ATOM   418   O  O     . ILE A 1 68   ? -13.087 44.991  13.134  1.00 35.34  ?  56   ILE A O     1 
ATOM   419   C  CB    . ILE A 1 68   ? -15.954 43.770  12.448  1.00 25.67  ?  56   ILE A CB    1 
ATOM   420   C  CG1   . ILE A 1 68   ? -16.766 42.980  11.420  1.00 18.98  ?  56   ILE A CG1   1 
ATOM   421   C  CG2   . ILE A 1 68   ? -16.880 44.484  13.422  1.00 21.79  ?  56   ILE A CG2   1 
ATOM   422   C  CD1   . ILE A 1 68   ? -17.725 41.985  12.033  1.00 14.97  ?  56   ILE A CD1   1 
ATOM   423   N  N     . ASP A 1 69   ? -14.545 46.719  13.110  1.00 20.90  ?  57   ASP A N     1 
ATOM   424   C  CA    . ASP A 1 69   ? -13.673 47.586  13.897  1.00 41.26  ?  57   ASP A CA    1 
ATOM   425   C  C     . ASP A 1 69   ? -13.432 47.023  15.295  1.00 37.33  ?  57   ASP A C     1 
ATOM   426   O  O     . ASP A 1 69   ? -12.286 46.927  15.747  1.00 37.62  ?  57   ASP A O     1 
ATOM   427   C  CB    . ASP A 1 69   ? -14.268 48.993  13.981  1.00 42.29  ?  57   ASP A CB    1 
ATOM   428   C  CG    . ASP A 1 69   ? -15.682 48.999  14.531  1.00 51.78  ?  57   ASP A CG    1 
ATOM   429   O  OD1   . ASP A 1 69   ? -16.359 47.954  14.456  1.00 47.73  ?  57   ASP A OD1   1 
ATOM   430   O  OD2   . ASP A 1 69   ? -16.118 50.058  15.037  1.00 57.34  ?  57   ASP A OD2   1 
ATOM   431   N  N     . GLY A 1 70   ? -14.499 46.647  16.000  1.00 22.64  ?  58   GLY A N     1 
ATOM   432   C  CA    . GLY A 1 70   ? -14.356 46.256  17.389  1.00 26.56  ?  58   GLY A CA    1 
ATOM   433   C  C     . GLY A 1 70   ? -13.853 44.846  17.606  1.00 33.66  ?  58   GLY A C     1 
ATOM   434   O  O     . GLY A 1 70   ? -13.653 44.456  18.763  1.00 27.74  ?  58   GLY A O     1 
ATOM   435   N  N     . VAL A 1 71   ? -13.649 44.076  16.538  1.00 32.05  ?  59   VAL A N     1 
ATOM   436   C  CA    . VAL A 1 71   ? -13.234 42.687  16.655  1.00 26.31  ?  59   VAL A CA    1 
ATOM   437   C  C     . VAL A 1 71   ? -11.853 42.523  16.039  1.00 23.32  ?  59   VAL A C     1 
ATOM   438   O  O     . VAL A 1 71   ? -11.417 43.311  15.195  1.00 19.63  ?  59   VAL A O     1 
ATOM   439   C  CB    . VAL A 1 71   ? -14.240 41.722  15.993  1.00 20.72  ?  59   VAL A CB    1 
ATOM   440   C  CG1   . VAL A 1 71   ? -15.664 42.184  16.241  1.00 21.56  ?  59   VAL A CG1   1 
ATOM   441   C  CG2   . VAL A 1 71   ? -13.956 41.584  14.502  1.00 23.17  ?  59   VAL A CG2   1 
ATOM   442   N  N     . LEU A 1 72   ? -11.161 41.482  16.493  1.00 22.96  ?  60   LEU A N     1 
ATOM   443   C  CA    . LEU A 1 72   ? -9.865  41.106  15.961  1.00 22.20  ?  60   LEU A CA    1 
ATOM   444   C  C     . LEU A 1 72   ? -9.843  39.697  15.385  1.00 21.86  ?  60   LEU A C     1 
ATOM   445   O  O     . LEU A 1 72   ? -8.839  39.313  14.774  1.00 22.47  ?  60   LEU A O     1 
ATOM   446   C  CB    . LEU A 1 72   ? -8.778  41.225  17.044  1.00 25.25  ?  60   LEU A CB    1 
ATOM   447   C  CG    . LEU A 1 72   ? -8.523  42.608  17.658  1.00 28.38  ?  60   LEU A CG    1 
ATOM   448   C  CD1   . LEU A 1 72   ? -9.462  42.889  18.826  1.00 35.39  ?  60   LEU A CD1   1 
ATOM   449   C  CD2   . LEU A 1 72   ? -7.070  42.742  18.091  1.00 23.56  ?  60   LEU A CD2   1 
ATOM   450   N  N     . HIS A 1 73   ? -10.909 38.921  15.564  1.00 22.74  ?  61   HIS A N     1 
ATOM   451   C  CA    . HIS A 1 73   ? -11.012 37.586  14.989  1.00 21.31  ?  61   HIS A CA    1 
ATOM   452   C  C     . HIS A 1 73   ? -12.479 37.179  14.978  1.00 21.62  ?  61   HIS A C     1 
ATOM   453   O  O     . HIS A 1 73   ? -13.347 37.891  15.488  1.00 18.21  ?  61   HIS A O     1 
ATOM   454   C  CB    . HIS A 1 73   ? -10.159 36.573  15.760  1.00 23.91  ?  61   HIS A CB    1 
ATOM   455   C  CG    . HIS A 1 73   ? -10.406 36.574  17.235  1.00 25.34  ?  61   HIS A CG    1 
ATOM   456   N  ND1   . HIS A 1 73   ? -11.481 35.933  17.811  1.00 25.46  ?  61   HIS A ND1   1 
ATOM   457   C  CD2   . HIS A 1 73   ? -9.719  37.146  18.252  1.00 21.45  ?  61   HIS A CD2   1 
ATOM   458   C  CE1   . HIS A 1 73   ? -11.444 36.106  19.119  1.00 22.69  ?  61   HIS A CE1   1 
ATOM   459   N  NE2   . HIS A 1 73   ? -10.385 36.840  19.413  1.00 22.38  ?  61   HIS A NE2   1 
ATOM   460   N  N     . GLU A 1 74   ? -12.743 36.010  14.387  1.00 24.53  ?  62   GLU A N     1 
ATOM   461   C  CA    . GLU A 1 74   ? -14.121 35.565  14.195  1.00 18.75  ?  62   GLU A CA    1 
ATOM   462   C  C     . GLU A 1 74   ? -14.811 35.264  15.520  1.00 21.72  ?  62   GLU A C     1 
ATOM   463   O  O     . GLU A 1 74   ? -16.018 35.489  15.663  1.00 21.35  ?  62   GLU A O     1 
ATOM   464   C  CB    . GLU A 1 74   ? -14.148 34.325  13.301  1.00 25.69  ?  62   GLU A CB    1 
ATOM   465   C  CG    . GLU A 1 74   ? -13.698 34.567  11.877  1.00 41.47  ?  62   GLU A CG    1 
ATOM   466   C  CD    . GLU A 1 74   ? -12.973 33.376  11.286  1.00 55.45  ?  62   GLU A CD    1 
ATOM   467   O  OE1   . GLU A 1 74   ? -11.880 33.040  11.789  1.00 51.87  ?  62   GLU A OE1   1 
ATOM   468   O  OE2   . GLU A 1 74   ? -13.498 32.772  10.327  1.00 54.61  ?  62   GLU A OE2   1 
ATOM   469   N  N     . PHE A 1 75   ? -14.064 34.760  16.500  1.00 22.23  ?  63   PHE A N     1 
ATOM   470   C  CA    . PHE A 1 75   ? -14.659 34.146  17.688  1.00 14.80  ?  63   PHE A CA    1 
ATOM   471   C  C     . PHE A 1 75   ? -14.845 35.190  18.791  1.00 13.91  ?  63   PHE A C     1 
ATOM   472   O  O     . PHE A 1 75   ? -14.192 35.174  19.835  1.00 26.45  ?  63   PHE A O     1 
ATOM   473   C  CB    . PHE A 1 75   ? -13.801 32.980  18.157  1.00 14.15  ?  63   PHE A CB    1 
ATOM   474   C  CG    . PHE A 1 75   ? -13.292 32.116  17.035  1.00 16.86  ?  63   PHE A CG    1 
ATOM   475   C  CD1   . PHE A 1 75   ? -14.043 31.052  16.563  1.00 17.95  ?  63   PHE A CD1   1 
ATOM   476   C  CD2   . PHE A 1 75   ? -12.062 32.372  16.450  1.00 19.64  ?  63   PHE A CD2   1 
ATOM   477   C  CE1   . PHE A 1 75   ? -13.575 30.260  15.530  1.00 26.98  ?  63   PHE A CE1   1 
ATOM   478   C  CE2   . PHE A 1 75   ? -11.589 31.584  15.419  1.00 23.96  ?  63   PHE A CE2   1 
ATOM   479   C  CZ    . PHE A 1 75   ? -12.346 30.527  14.958  1.00 24.21  ?  63   PHE A CZ    1 
ATOM   480   N  N     . THR A 1 76   ? -15.781 36.101  18.544  1.00 23.25  ?  64   THR A N     1 
ATOM   481   C  CA    . THR A 1 76   ? -16.124 37.134  19.516  1.00 25.46  ?  64   THR A CA    1 
ATOM   482   C  C     . THR A 1 76   ? -17.496 37.697  19.168  1.00 22.15  ?  64   THR A C     1 
ATOM   483   O  O     . THR A 1 76   ? -18.136 37.276  18.200  1.00 27.71  ?  64   THR A O     1 
ATOM   484   C  CB    . THR A 1 76   ? -15.066 38.242  19.553  1.00 35.95  ?  64   THR A CB    1 
ATOM   485   O  OG1   . THR A 1 76   ? -15.428 39.218  20.539  1.00 50.14  ?  64   THR A OG1   1 
ATOM   486   C  CG2   . THR A 1 76   ? -14.961 38.916  18.196  1.00 21.19  ?  64   THR A CG2   1 
ATOM   487   N  N     . THR A 1 77   ? -17.942 38.660  19.970  1.00 24.20  ?  65   THR A N     1 
ATOM   488   C  CA    . THR A 1 77   ? -19.220 39.324  19.779  1.00 22.58  ?  65   THR A CA    1 
ATOM   489   C  C     . THR A 1 77   ? -19.008 40.823  19.607  1.00 23.71  ?  65   THR A C     1 
ATOM   490   O  O     . THR A 1 77   ? -17.953 41.370  19.943  1.00 33.21  ?  65   THR A O     1 
ATOM   491   C  CB    . THR A 1 77   ? -20.164 39.076  20.961  1.00 28.20  ?  65   THR A CB    1 
ATOM   492   O  OG1   . THR A 1 77   ? -19.660 39.737  22.129  1.00 27.97  ?  65   THR A OG1   1 
ATOM   493   C  CG2   . THR A 1 77   ? -20.287 37.587  21.246  1.00 30.10  ?  65   THR A CG2   1 
ATOM   494   N  N     . VAL A 1 78   ? -20.028 41.481  19.079  1.00 23.85  ?  66   VAL A N     1 
ATOM   495   C  CA    . VAL A 1 78   ? -20.080 42.937  18.967  1.00 21.76  ?  66   VAL A CA    1 
ATOM   496   C  C     . VAL A 1 78   ? -21.163 43.438  19.914  1.00 34.91  ?  66   VAL A C     1 
ATOM   497   O  O     . VAL A 1 78   ? -22.257 42.864  19.940  1.00 37.41  ?  66   VAL A O     1 
ATOM   498   C  CB    . VAL A 1 78   ? -20.370 43.393  17.523  1.00 19.39  ?  66   VAL A CB    1 
ATOM   499   C  CG1   . VAL A 1 78   ? -20.685 44.880  17.480  1.00 27.79  ?  66   VAL A CG1   1 
ATOM   500   C  CG2   . VAL A 1 78   ? -19.192 43.068  16.617  1.00 19.56  ?  66   VAL A CG2   1 
ATOM   501   N  N     . PRO A 1 79   ? -20.904 44.472  20.712  1.00 35.66  ?  67   PRO A N     1 
ATOM   502   C  CA    . PRO A 1 79   ? -21.920 44.943  21.663  1.00 31.22  ?  67   PRO A CA    1 
ATOM   503   C  C     . PRO A 1 79   ? -23.181 45.421  20.955  1.00 35.42  ?  67   PRO A C     1 
ATOM   504   O  O     . PRO A 1 79   ? -23.127 46.219  20.015  1.00 44.02  ?  67   PRO A O     1 
ATOM   505   C  CB    . PRO A 1 79   ? -21.214 46.091  22.395  1.00 26.94  ?  67   PRO A CB    1 
ATOM   506   C  CG    . PRO A 1 79   ? -19.755 45.803  22.230  1.00 32.80  ?  67   PRO A CG    1 
ATOM   507   C  CD    . PRO A 1 79   ? -19.627 45.187  20.871  1.00 31.63  ?  67   PRO A CD    1 
ATOM   508   N  N     . GLY A 1 80   ? -24.325 44.915  21.414  1.00 28.52  ?  68   GLY A N     1 
ATOM   509   C  CA    . GLY A 1 80   ? -25.612 45.342  20.927  1.00 28.67  ?  68   GLY A CA    1 
ATOM   510   C  C     . GLY A 1 80   ? -26.182 44.523  19.787  1.00 33.61  ?  68   GLY A C     1 
ATOM   511   O  O     . GLY A 1 80   ? -27.392 44.591  19.543  1.00 35.42  ?  68   GLY A O     1 
ATOM   512   N  N     . VAL A 1 81   ? -25.358 43.763  19.079  1.00 29.23  ?  69   VAL A N     1 
ATOM   513   C  CA    . VAL A 1 81   ? -25.845 42.935  17.983  1.00 28.80  ?  69   VAL A CA    1 
ATOM   514   C  C     . VAL A 1 81   ? -26.200 41.562  18.532  1.00 29.72  ?  69   VAL A C     1 
ATOM   515   O  O     . VAL A 1 81   ? -25.584 41.066  19.482  1.00 32.42  ?  69   VAL A O     1 
ATOM   516   C  CB    . VAL A 1 81   ? -24.812 42.848  16.839  1.00 25.19  ?  69   VAL A CB    1 
ATOM   517   C  CG1   . VAL A 1 81   ? -24.345 44.238  16.442  1.00 28.24  ?  69   VAL A CG1   1 
ATOM   518   C  CG2   . VAL A 1 81   ? -23.637 41.978  17.236  1.00 31.25  ?  69   VAL A CG2   1 
ATOM   519   N  N     . LYS A 1 82   ? -27.222 40.946  17.936  1.00 28.37  ?  70   LYS A N     1 
ATOM   520   C  CA    . LYS A 1 82   ? -27.720 39.671  18.438  1.00 25.71  ?  70   LYS A CA    1 
ATOM   521   C  C     . LYS A 1 82   ? -26.859 38.500  17.984  1.00 26.52  ?  70   LYS A C     1 
ATOM   522   O  O     . LYS A 1 82   ? -26.789 37.480  18.680  1.00 29.68  ?  70   LYS A O     1 
ATOM   523   C  CB    . LYS A 1 82   ? -29.170 39.468  17.993  1.00 24.38  ?  70   LYS A CB    1 
ATOM   524   C  CG    . LYS A 1 82   ? -29.835 38.227  18.560  1.00 24.80  ?  70   LYS A CG    1 
ATOM   525   C  CD    . LYS A 1 82   ? -31.206 38.012  17.947  1.00 35.74  ?  70   LYS A CD    1 
ATOM   526   C  CE    . LYS A 1 82   ? -31.787 36.671  18.361  1.00 45.10  ?  70   LYS A CE    1 
ATOM   527   N  NZ    . LYS A 1 82   ? -33.092 36.398  17.698  1.00 45.09  ?  70   LYS A NZ    1 
ATOM   528   N  N     . GLU A 1 83   ? -26.192 38.626  16.842  1.00 23.67  ?  71   GLU A N     1 
ATOM   529   C  CA    . GLU A 1 83   ? -25.382 37.552  16.287  1.00 21.06  ?  71   GLU A CA    1 
ATOM   530   C  C     . GLU A 1 83   ? -23.913 37.770  16.621  1.00 22.53  ?  71   GLU A C     1 
ATOM   531   O  O     . GLU A 1 83   ? -23.424 38.902  16.610  1.00 20.66  ?  71   GLU A O     1 
ATOM   532   C  CB    . GLU A 1 83   ? -25.554 37.464  14.768  1.00 21.07  ?  71   GLU A CB    1 
ATOM   533   C  CG    . GLU A 1 83   ? -26.984 37.238  14.294  1.00 38.35  ?  71   GLU A CG    1 
ATOM   534   C  CD    . GLU A 1 83   ? -27.791 38.521  14.207  1.00 41.07  ?  71   GLU A CD    1 
ATOM   535   O  OE1   . GLU A 1 83   ? -27.307 39.569  14.684  1.00 42.82  ?  71   GLU A OE1   1 
ATOM   536   O  OE2   . GLU A 1 83   ? -28.911 38.480  13.657  1.00 38.03  ?  71   GLU A OE2   1 
ATOM   537   N  N     . ASP A 1 84   ? -23.213 36.679  16.917  1.00 23.05  ?  72   ASP A N     1 
ATOM   538   C  CA    . ASP A 1 84   ? -21.769 36.754  17.054  1.00 19.56  ?  72   ASP A CA    1 
ATOM   539   C  C     . ASP A 1 84   ? -21.129 36.973  15.684  1.00 17.05  ?  72   ASP A C     1 
ATOM   540   O  O     . ASP A 1 84   ? -21.780 36.881  14.640  1.00 26.24  ?  72   ASP A O     1 
ATOM   541   C  CB    . ASP A 1 84   ? -21.221 35.487  17.710  1.00 24.75  ?  72   ASP A CB    1 
ATOM   542   C  CG    . ASP A 1 84   ? -21.779 34.221  17.092  1.00 36.08  ?  72   ASP A CG    1 
ATOM   543   O  OD1   . ASP A 1 84   ? -23.006 34.005  17.182  1.00 43.06  ?  72   ASP A OD1   1 
ATOM   544   O  OD2   . ASP A 1 84   ? -20.994 33.446  16.507  1.00 35.56  ?  72   ASP A OD2   1 
ATOM   545   N  N     . VAL A 1 85   ? -19.827 37.271  15.697  1.00 15.85  ?  73   VAL A N     1 
ATOM   546   C  CA    . VAL A 1 85   ? -19.121 37.553  14.451  1.00 20.00  ?  73   VAL A CA    1 
ATOM   547   C  C     . VAL A 1 85   ? -19.119 36.334  13.539  1.00 26.17  ?  73   VAL A C     1 
ATOM   548   O  O     . VAL A 1 85   ? -19.192 36.468  12.311  1.00 25.07  ?  73   VAL A O     1 
ATOM   549   C  CB    . VAL A 1 85   ? -17.691 38.041  14.751  1.00 18.13  ?  73   VAL A CB    1 
ATOM   550   C  CG1   . VAL A 1 85   ? -16.935 38.323  13.460  1.00 21.14  ?  73   VAL A CG1   1 
ATOM   551   C  CG2   . VAL A 1 85   ? -17.735 39.279  15.626  1.00 17.65  ?  73   VAL A CG2   1 
ATOM   552   N  N     . THR A 1 86   ? -19.051 35.132  14.113  1.00 21.85  ?  74   THR A N     1 
ATOM   553   C  CA    . THR A 1 86   ? -19.083 33.920  13.300  1.00 25.51  ?  74   THR A CA    1 
ATOM   554   C  C     . THR A 1 86   ? -20.418 33.782  12.577  1.00 27.61  ?  74   THR A C     1 
ATOM   555   O  O     . THR A 1 86   ? -20.460 33.491  11.375  1.00 29.16  ?  74   THR A O     1 
ATOM   556   C  CB    . THR A 1 86   ? -18.809 32.694  14.171  1.00 25.79  ?  74   THR A CB    1 
ATOM   557   O  OG1   . THR A 1 86   ? -17.450 32.723  14.623  1.00 22.91  ?  74   THR A OG1   1 
ATOM   558   C  CG2   . THR A 1 86   ? -19.051 31.415  13.384  1.00 25.76  ?  74   THR A CG2   1 
ATOM   559   N  N     . GLU A 1 87   ? -21.525 33.993  13.294  1.00 23.50  ?  75   GLU A N     1 
ATOM   560   C  CA    . GLU A 1 87   ? -22.836 33.923  12.657  1.00 24.26  ?  75   GLU A CA    1 
ATOM   561   C  C     . GLU A 1 87   ? -23.028 35.049  11.648  1.00 24.04  ?  75   GLU A C     1 
ATOM   562   O  O     . GLU A 1 87   ? -23.719 34.863  10.640  1.00 35.05  ?  75   GLU A O     1 
ATOM   563   C  CB    . GLU A 1 87   ? -23.940 33.958  13.714  1.00 27.89  ?  75   GLU A CB    1 
ATOM   564   C  CG    . GLU A 1 87   ? -25.337 33.730  13.156  1.00 39.12  ?  75   GLU A CG    1 
ATOM   565   C  CD    . GLU A 1 87   ? -26.411 33.777  14.226  1.00 58.28  ?  75   GLU A CD    1 
ATOM   566   O  OE1   . GLU A 1 87   ? -27.607 33.820  13.868  1.00 71.68  ?  75   GLU A OE1   1 
ATOM   567   O  OE2   . GLU A 1 87   ? -26.059 33.773  15.425  1.00 43.10  ?  75   GLU A OE2   1 
ATOM   568   N  N     . ILE A 1 88   ? -22.429 36.215  11.898  1.00 24.12  ?  76   ILE A N     1 
ATOM   569   C  CA    . ILE A 1 88   ? -22.497 37.309  10.932  1.00 23.04  ?  76   ILE A CA    1 
ATOM   570   C  C     . ILE A 1 88   ? -21.768 36.930  9.650   1.00 19.34  ?  76   ILE A C     1 
ATOM   571   O  O     . ILE A 1 88   ? -22.236 37.215  8.541   1.00 20.62  ?  76   ILE A O     1 
ATOM   572   C  CB    . ILE A 1 88   ? -21.930 38.603  11.547  1.00 22.28  ?  76   ILE A CB    1 
ATOM   573   C  CG1   . ILE A 1 88   ? -22.876 39.145  12.621  1.00 21.11  ?  76   ILE A CG1   1 
ATOM   574   C  CG2   . ILE A 1 88   ? -21.680 39.651  10.472  1.00 14.22  ?  76   ILE A CG2   1 
ATOM   575   C  CD1   . ILE A 1 88   ? -22.411 40.444  13.243  1.00 24.86  ?  76   ILE A CD1   1 
ATOM   576   N  N     . ILE A 1 89   ? -20.615 36.270  9.782   1.00 21.42  ?  77   ILE A N     1 
ATOM   577   C  CA    . ILE A 1 89   ? -19.846 35.869  8.608   1.00 21.63  ?  77   ILE A CA    1 
ATOM   578   C  C     . ILE A 1 89   ? -20.591 34.801  7.816   1.00 22.78  ?  77   ILE A C     1 
ATOM   579   O  O     . ILE A 1 89   ? -20.573 34.803  6.579   1.00 23.43  ?  77   ILE A O     1 
ATOM   580   C  CB    . ILE A 1 89   ? -18.444 35.397  9.034   1.00 20.69  ?  77   ILE A CB    1 
ATOM   581   C  CG1   . ILE A 1 89   ? -17.621 36.584  9.533   1.00 17.55  ?  77   ILE A CG1   1 
ATOM   582   C  CG2   . ILE A 1 89   ? -17.731 34.701  7.887   1.00 20.30  ?  77   ILE A CG2   1 
ATOM   583   C  CD1   . ILE A 1 89   ? -16.202 36.232  9.884   1.00 26.07  ?  77   ILE A CD1   1 
ATOM   584   N  N     . LEU A 1 90   ? -21.265 33.879  8.509   1.00 20.95  ?  78   LEU A N     1 
ATOM   585   C  CA    . LEU A 1 90   ? -22.045 32.864  7.807   1.00 26.68  ?  78   LEU A CA    1 
ATOM   586   C  C     . LEU A 1 90   ? -23.194 33.483  7.023   1.00 26.76  ?  78   LEU A C     1 
ATOM   587   O  O     . LEU A 1 90   ? -23.568 32.970  5.962   1.00 32.82  ?  78   LEU A O     1 
ATOM   588   C  CB    . LEU A 1 90   ? -22.573 31.823  8.795   1.00 28.49  ?  78   LEU A CB    1 
ATOM   589   C  CG    . LEU A 1 90   ? -21.784 30.515  8.884   1.00 39.03  ?  78   LEU A CG    1 
ATOM   590   C  CD1   . LEU A 1 90   ? -20.336 30.772  9.276   1.00 41.80  ?  78   LEU A CD1   1 
ATOM   591   C  CD2   . LEU A 1 90   ? -22.446 29.558  9.863   1.00 35.52  ?  78   LEU A CD2   1 
ATOM   592   N  N     . ASN A 1 91   ? -23.765 34.582  7.522   1.00 25.80  ?  79   ASN A N     1 
ATOM   593   C  CA    . ASN A 1 91   ? -24.784 35.290  6.757   1.00 24.77  ?  79   ASN A CA    1 
ATOM   594   C  C     . ASN A 1 91   ? -24.183 36.001  5.553   1.00 24.49  ?  79   ASN A C     1 
ATOM   595   O  O     . ASN A 1 91   ? -24.852 36.148  4.524   1.00 33.91  ?  79   ASN A O     1 
ATOM   596   C  CB    . ASN A 1 91   ? -25.517 36.288  7.654   1.00 21.46  ?  79   ASN A CB    1 
ATOM   597   C  CG    . ASN A 1 91   ? -26.320 35.611  8.745   1.00 30.47  ?  79   ASN A CG    1 
ATOM   598   O  OD1   . ASN A 1 91   ? -26.209 34.403  8.955   1.00 35.10  ?  79   ASN A OD1   1 
ATOM   599   N  ND2   . ASN A 1 91   ? -27.134 36.388  9.450   1.00 29.04  ?  79   ASN A ND2   1 
ATOM   600   N  N     . LEU A 1 92   ? -22.929 36.443  5.660   1.00 24.42  ?  80   LEU A N     1 
ATOM   601   C  CA    . LEU A 1 92   ? -22.255 37.114  4.556   1.00 20.11  ?  80   LEU A CA    1 
ATOM   602   C  C     . LEU A 1 92   ? -21.785 36.150  3.475   1.00 28.10  ?  80   LEU A C     1 
ATOM   603   O  O     . LEU A 1 92   ? -21.422 36.602  2.383   1.00 23.82  ?  80   LEU A O     1 
ATOM   604   C  CB    . LEU A 1 92   ? -21.069 37.926  5.082   1.00 16.23  ?  80   LEU A CB    1 
ATOM   605   C  CG    . LEU A 1 92   ? -21.436 39.128  5.957   1.00 12.37  ?  80   LEU A CG    1 
ATOM   606   C  CD1   . LEU A 1 92   ? -20.190 39.827  6.480   1.00 14.06  ?  80   LEU A CD1   1 
ATOM   607   C  CD2   . LEU A 1 92   ? -22.315 40.101  5.186   1.00 8.84   ?  80   LEU A CD2   1 
ATOM   608   N  N     . LYS A 1 93   ? -21.777 34.843  3.747   1.00 24.59  ?  81   LYS A N     1 
ATOM   609   C  CA    . LYS A 1 93   ? -21.513 33.872  2.693   1.00 25.17  ?  81   LYS A CA    1 
ATOM   610   C  C     . LYS A 1 93   ? -22.665 33.786  1.702   1.00 22.14  ?  81   LYS A C     1 
ATOM   611   O  O     . LYS A 1 93   ? -22.468 33.312  0.578   1.00 21.94  ?  81   LYS A O     1 
ATOM   612   C  CB    . LYS A 1 93   ? -21.238 32.494  3.297   1.00 28.26  ?  81   LYS A CB    1 
ATOM   613   C  CG    . LYS A 1 93   ? -20.058 32.460  4.255   1.00 36.80  ?  81   LYS A CG    1 
ATOM   614   C  CD    . LYS A 1 93   ? -19.881 31.079  4.867   1.00 47.92  ?  81   LYS A CD    1 
ATOM   615   C  CE    . LYS A 1 93   ? -19.449 30.062  3.825   1.00 40.91  ?  81   LYS A CE    1 
ATOM   616   N  NZ    . LYS A 1 93   ? -18.090 30.362  3.302   1.00 43.17  ?  81   LYS A NZ    1 
ATOM   617   N  N     . SER A 1 94   ? -23.858 34.234  2.094   1.00 25.00  ?  82   SER A N     1 
ATOM   618   C  CA    . SER A 1 94   ? -25.004 34.267  1.196   1.00 30.52  ?  82   SER A CA    1 
ATOM   619   C  C     . SER A 1 94   ? -24.970 35.451  0.239   1.00 27.81  ?  82   SER A C     1 
ATOM   620   O  O     . SER A 1 94   ? -25.772 35.487  -0.701  1.00 40.99  ?  82   SER A O     1 
ATOM   621   C  CB    . SER A 1 94   ? -26.304 34.306  2.005   1.00 33.54  ?  82   SER A CB    1 
ATOM   622   O  OG    . SER A 1 94   ? -26.351 33.254  2.953   1.00 34.06  ?  82   SER A OG    1 
ATOM   623   N  N     . LEU A 1 95   ? -24.072 36.411  0.457   1.00 25.26  ?  83   LEU A N     1 
ATOM   624   C  CA    . LEU A 1 95   ? -24.030 37.610  -0.371  1.00 29.24  ?  83   LEU A CA    1 
ATOM   625   C  C     . LEU A 1 95   ? -23.692 37.265  -1.814  1.00 31.37  ?  83   LEU A C     1 
ATOM   626   O  O     . LEU A 1 95   ? -22.750 36.514  -2.084  1.00 32.98  ?  83   LEU A O     1 
ATOM   627   C  CB    . LEU A 1 95   ? -23.005 38.601  0.181   1.00 23.47  ?  83   LEU A CB    1 
ATOM   628   C  CG    . LEU A 1 95   ? -23.544 39.858  0.866   1.00 20.43  ?  83   LEU A CG    1 
ATOM   629   C  CD1   . LEU A 1 95   ? -22.434 40.883  1.059   1.00 18.19  ?  83   LEU A CD1   1 
ATOM   630   C  CD2   . LEU A 1 95   ? -24.698 40.453  0.074   1.00 24.04  ?  83   LEU A CD2   1 
ATOM   631   N  N     . VAL A 1 96   ? -24.469 37.816  -2.741  1.00 27.25  ?  84   VAL A N     1 
ATOM   632   C  CA    . VAL A 1 96   ? -24.185 37.730  -4.167  1.00 39.13  ?  84   VAL A CA    1 
ATOM   633   C  C     . VAL A 1 96   ? -23.804 39.123  -4.647  1.00 35.49  ?  84   VAL A C     1 
ATOM   634   O  O     . VAL A 1 96   ? -24.451 40.114  -4.283  1.00 30.41  ?  84   VAL A O     1 
ATOM   635   C  CB    . VAL A 1 96   ? -25.378 37.158  -4.955  1.00 37.23  ?  84   VAL A CB    1 
ATOM   636   C  CG1   . VAL A 1 96   ? -26.629 37.994  -4.742  1.00 40.74  ?  84   VAL A CG1   1 
ATOM   637   C  CG2   . VAL A 1 96   ? -25.040 37.057  -6.433  1.00 43.99  ?  84   VAL A CG2   1 
ATOM   638   N  N     . VAL A 1 97   ? -22.737 39.202  -5.440  1.00 34.94  ?  85   VAL A N     1 
ATOM   639   C  CA    . VAL A 1 97   ? -22.176 40.482  -5.849  1.00 37.27  ?  85   VAL A CA    1 
ATOM   640   C  C     . VAL A 1 97   ? -21.418 40.262  -7.148  1.00 39.09  ?  85   VAL A C     1 
ATOM   641   O  O     . VAL A 1 97   ? -20.935 39.160  -7.422  1.00 46.70  ?  85   VAL A O     1 
ATOM   642   C  CB    . VAL A 1 97   ? -21.271 41.069  -4.733  1.00 28.99  ?  85   VAL A CB    1 
ATOM   643   C  CG1   . VAL A 1 97   ? -20.057 40.181  -4.502  1.00 23.78  ?  85   VAL A CG1   1 
ATOM   644   C  CG2   . VAL A 1 97   ? -20.852 42.498  -5.049  1.00 50.68  ?  85   VAL A CG2   1 
ATOM   645   N  N     . SER A 1 98   ? -21.339 41.309  -7.965  1.00 30.44  ?  86   SER A N     1 
ATOM   646   C  CA    . SER A 1 98   ? -20.566 41.293  -9.197  1.00 43.49  ?  86   SER A CA    1 
ATOM   647   C  C     . SER A 1 98   ? -19.688 42.533  -9.242  1.00 39.29  ?  86   SER A C     1 
ATOM   648   O  O     . SER A 1 98   ? -20.113 43.614  -8.828  1.00 38.29  ?  86   SER A O     1 
ATOM   649   C  CB    . SER A 1 98   ? -21.476 41.245  -10.429 1.00 56.85  ?  86   SER A CB    1 
ATOM   650   O  OG    . SER A 1 98   ? -22.363 42.350  -10.447 1.00 57.38  ?  86   SER A OG    1 
ATOM   651   N  N     . SER A 1 99   ? -18.465 42.372  -9.743  1.00 37.06  ?  87   SER A N     1 
ATOM   652   C  CA    . SER A 1 99   ? -17.487 43.451  -9.788  1.00 38.45  ?  87   SER A CA    1 
ATOM   653   C  C     . SER A 1 99   ? -16.949 43.608  -11.202 1.00 46.24  ?  87   SER A C     1 
ATOM   654   O  O     . SER A 1 99   ? -16.693 42.617  -11.892 1.00 49.99  ?  87   SER A O     1 
ATOM   655   C  CB    . SER A 1 99   ? -16.328 43.191  -8.818  1.00 35.69  ?  87   SER A CB    1 
ATOM   656   O  OG    . SER A 1 99   ? -15.327 44.186  -8.941  1.00 42.04  ?  87   SER A OG    1 
ATOM   657   N  N     . GLU A 1 100  ? -16.774 44.860  -11.628 1.00 54.42  ?  88   GLU A N     1 
ATOM   658   C  CA    . GLU A 1 100  ? -16.204 45.155  -12.936 1.00 57.74  ?  88   GLU A CA    1 
ATOM   659   C  C     . GLU A 1 100  ? -14.693 45.332  -12.902 1.00 62.54  ?  88   GLU A C     1 
ATOM   660   O  O     . GLU A 1 100  ? -14.055 45.291  -13.961 1.00 61.41  ?  88   GLU A O     1 
ATOM   661   C  CB    . GLU A 1 100  ? -16.823 46.431  -13.519 1.00 57.55  ?  88   GLU A CB    1 
ATOM   662   C  CG    . GLU A 1 100  ? -18.330 46.402  -13.691 1.00 62.33  ?  88   GLU A CG    1 
ATOM   663   C  CD    . GLU A 1 100  ? -18.878 47.733  -14.176 1.00 67.03  ?  88   GLU A CD    1 
ATOM   664   O  OE1   . GLU A 1 100  ? -18.088 48.546  -14.702 1.00 59.59  ?  88   GLU A OE1   1 
ATOM   665   O  OE2   . GLU A 1 100  ? -20.095 47.969  -14.026 1.00 74.15  ?  88   GLU A OE2   1 
ATOM   666   N  N     . GLU A 1 101  ? -14.109 45.522  -11.718 1.00 43.88  ?  89   GLU A N     1 
ATOM   667   C  CA    . GLU A 1 101  ? -12.718 45.951  -11.626 1.00 52.35  ?  89   GLU A CA    1 
ATOM   668   C  C     . GLU A 1 101  ? -11.728 44.817  -11.863 1.00 54.35  ?  89   GLU A C     1 
ATOM   669   O  O     . GLU A 1 101  ? -10.623 45.067  -12.357 1.00 60.16  ?  89   GLU A O     1 
ATOM   670   C  CB    . GLU A 1 101  ? -12.459 46.586  -10.258 1.00 57.96  ?  89   GLU A CB    1 
ATOM   671   C  CG    . GLU A 1 101  ? -13.232 47.873  -10.000 1.00 57.81  ?  89   GLU A CG    1 
ATOM   672   C  CD    . GLU A 1 101  ? -12.627 49.077  -10.701 1.00 78.00  ?  89   GLU A CD    1 
ATOM   673   O  OE1   . GLU A 1 101  ? -11.592 48.919  -11.382 1.00 82.37  ?  89   GLU A OE1   1 
ATOM   674   O  OE2   . GLU A 1 101  ? -13.186 50.186  -10.566 1.00 87.97  ?  89   GLU A OE2   1 
ATOM   675   N  N     . ASP A 1 102  ? -12.093 43.581  -11.515 1.00 52.48  ?  90   ASP A N     1 
ATOM   676   C  CA    . ASP A 1 102  ? -11.191 42.428  -11.557 1.00 65.94  ?  90   ASP A CA    1 
ATOM   677   C  C     . ASP A 1 102  ? -9.947  42.636  -10.698 1.00 61.35  ?  90   ASP A C     1 
ATOM   678   O  O     . ASP A 1 102  ? -8.921  41.982  -10.914 1.00 65.66  ?  90   ASP A O     1 
ATOM   679   C  CB    . ASP A 1 102  ? -10.782 42.077  -12.994 1.00 74.14  ?  90   ASP A CB    1 
ATOM   680   C  CG    . ASP A 1 102  ? -11.932 41.524  -13.811 1.00 76.46  ?  90   ASP A CG    1 
ATOM   681   O  OD1   . ASP A 1 102  ? -13.083 41.574  -13.333 1.00 64.87  ?  90   ASP A OD1   1 
ATOM   682   O  OD2   . ASP A 1 102  ? -11.681 41.034  -14.932 1.00 74.57  ?  90   ASP A OD2   1 
ATOM   683   N  N     . GLU A 1 103  ? -10.019 43.537  -9.728  1.00 66.42  ?  91   GLU A N     1 
ATOM   684   C  CA    . GLU A 1 103  ? -8.932  43.828  -8.809  1.00 59.33  ?  91   GLU A CA    1 
ATOM   685   C  C     . GLU A 1 103  ? -9.529  44.070  -7.433  1.00 53.68  ?  91   GLU A C     1 
ATOM   686   O  O     . GLU A 1 103  ? -10.719 44.383  -7.316  1.00 54.91  ?  91   GLU A O     1 
ATOM   687   C  CB    . GLU A 1 103  ? -8.116  45.047  -9.267  1.00 55.35  ?  91   GLU A CB    1 
ATOM   688   C  CG    . GLU A 1 103  ? -8.904  46.343  -9.349  1.00 71.33  ?  91   GLU A CG    1 
ATOM   689   C  CD    . GLU A 1 103  ? -8.053  47.508  -9.817  1.00 84.43  ?  91   GLU A CD    1 
ATOM   690   O  OE1   . GLU A 1 103  ? -6.858  47.293  -10.109 1.00 93.00  ?  91   GLU A OE1   1 
ATOM   691   O  OE2   . GLU A 1 103  ? -8.579  48.639  -9.893  1.00 86.31  ?  91   GLU A OE2   1 
ATOM   692   N  N     . PRO A 1 104  ? -8.738  43.909  -6.372  1.00 51.26  ?  92   PRO A N     1 
ATOM   693   C  CA    . PRO A 1 104  ? -9.274  44.099  -5.016  1.00 38.75  ?  92   PRO A CA    1 
ATOM   694   C  C     . PRO A 1 104  ? -9.900  45.475  -4.837  1.00 40.78  ?  92   PRO A C     1 
ATOM   695   O  O     . PRO A 1 104  ? -9.310  46.499  -5.190  1.00 52.25  ?  92   PRO A O     1 
ATOM   696   C  CB    . PRO A 1 104  ? -8.041  43.918  -4.124  1.00 39.53  ?  92   PRO A CB    1 
ATOM   697   C  CG    . PRO A 1 104  ? -7.156  43.013  -4.905  1.00 52.35  ?  92   PRO A CG    1 
ATOM   698   C  CD    . PRO A 1 104  ? -7.358  43.389  -6.348  1.00 58.85  ?  92   PRO A CD    1 
ATOM   699   N  N     . VAL A 1 105  ? -11.113 45.486  -4.285  1.00 41.59  ?  93   VAL A N     1 
ATOM   700   C  CA    . VAL A 1 105  ? -11.860 46.715  -4.047  1.00 41.26  ?  93   VAL A CA    1 
ATOM   701   C  C     . VAL A 1 105  ? -12.654 46.536  -2.759  1.00 40.01  ?  93   VAL A C     1 
ATOM   702   O  O     . VAL A 1 105  ? -13.001 45.416  -2.375  1.00 39.50  ?  93   VAL A O     1 
ATOM   703   C  CB    . VAL A 1 105  ? -12.770 47.061  -5.250  1.00 32.24  ?  93   VAL A CB    1 
ATOM   704   C  CG1   . VAL A 1 105  ? -13.957 46.114  -5.318  1.00 29.26  ?  93   VAL A CG1   1 
ATOM   705   C  CG2   . VAL A 1 105  ? -13.214 48.514  -5.196  1.00 53.17  ?  93   VAL A CG2   1 
ATOM   706   N  N     . THR A 1 106  ? -12.934 47.648  -2.084  1.00 32.28  ?  94   THR A N     1 
ATOM   707   C  CA    . THR A 1 106  ? -13.448 47.626  -0.721  1.00 29.13  ?  94   THR A CA    1 
ATOM   708   C  C     . THR A 1 106  ? -14.872 48.166  -0.667  1.00 29.15  ?  94   THR A C     1 
ATOM   709   O  O     . THR A 1 106  ? -15.144 49.268  -1.154  1.00 36.50  ?  94   THR A O     1 
ATOM   710   C  CB    . THR A 1 106  ? -12.547 48.441  0.210   1.00 38.70  ?  94   THR A CB    1 
ATOM   711   O  OG1   . THR A 1 106  ? -11.200 47.966  0.110   1.00 49.39  ?  94   THR A OG1   1 
ATOM   712   C  CG2   . THR A 1 106  ? -13.016 48.316  1.653   1.00 33.09  ?  94   THR A CG2   1 
ATOM   713   N  N     . MET A 1 107  ? -15.769 47.387  -0.070  1.00 27.81  ?  95   MET A N     1 
ATOM   714   C  CA    . MET A 1 107  ? -17.111 47.824  0.284   1.00 29.03  ?  95   MET A CA    1 
ATOM   715   C  C     . MET A 1 107  ? -17.144 48.262  1.745   1.00 31.53  ?  95   MET A C     1 
ATOM   716   O  O     . MET A 1 107  ? -16.294 47.877  2.552   1.00 33.28  ?  95   MET A O     1 
ATOM   717   C  CB    . MET A 1 107  ? -18.130 46.706  0.039   1.00 29.02  ?  95   MET A CB    1 
ATOM   718   C  CG    . MET A 1 107  ? -18.702 46.685  -1.372  1.00 36.48  ?  95   MET A CG    1 
ATOM   719   S  SD    . MET A 1 107  ? -19.145 45.042  -1.972  1.00 35.66  ?  95   MET A SD    1 
ATOM   720   C  CE    . MET A 1 107  ? -20.280 44.486  -0.705  1.00 26.27  ?  95   MET A CE    1 
ATOM   721   N  N     . TYR A 1 108  ? -18.138 49.080  2.080   1.00 28.31  ?  96   TYR A N     1 
ATOM   722   C  CA    . TYR A 1 108  ? -18.256 49.641  3.418   1.00 31.28  ?  96   TYR A CA    1 
ATOM   723   C  C     . TYR A 1 108  ? -19.679 49.480  3.931   1.00 28.60  ?  96   TYR A C     1 
ATOM   724   O  O     . TYR A 1 108  ? -20.633 49.354  3.159   1.00 34.77  ?  96   TYR A O     1 
ATOM   725   C  CB    . TYR A 1 108  ? -17.851 51.121  3.444   1.00 39.97  ?  96   TYR A CB    1 
ATOM   726   C  CG    . TYR A 1 108  ? -16.373 51.354  3.226   1.00 47.25  ?  96   TYR A CG    1 
ATOM   727   C  CD1   . TYR A 1 108  ? -15.846 51.441  1.944   1.00 46.99  ?  96   TYR A CD1   1 
ATOM   728   C  CD2   . TYR A 1 108  ? -15.505 51.487  4.302   1.00 46.36  ?  96   TYR A CD2   1 
ATOM   729   C  CE1   . TYR A 1 108  ? -14.495 51.653  1.740   1.00 46.71  ?  96   TYR A CE1   1 
ATOM   730   C  CE2   . TYR A 1 108  ? -14.153 51.699  4.108   1.00 51.97  ?  96   TYR A CE2   1 
ATOM   731   C  CZ    . TYR A 1 108  ? -13.653 51.782  2.825   1.00 53.58  ?  96   TYR A CZ    1 
ATOM   732   O  OH    . TYR A 1 108  ? -12.308 51.994  2.628   1.00 58.75  ?  96   TYR A OH    1 
ATOM   733   N  N     . LEU A 1 109  ? -19.810 49.490  5.256   1.00 32.65  ?  97   LEU A N     1 
ATOM   734   C  CA    . LEU A 1 109  ? -21.112 49.337  5.902   1.00 32.32  ?  97   LEU A CA    1 
ATOM   735   C  C     . LEU A 1 109  ? -21.053 49.968  7.283   1.00 32.07  ?  97   LEU A C     1 
ATOM   736   O  O     . LEU A 1 109  ? -20.286 49.513  8.138   1.00 30.31  ?  97   LEU A O     1 
ATOM   737   C  CB    . LEU A 1 109  ? -21.505 47.861  5.998   1.00 26.33  ?  97   LEU A CB    1 
ATOM   738   C  CG    . LEU A 1 109  ? -22.630 47.511  6.976   1.00 32.46  ?  97   LEU A CG    1 
ATOM   739   C  CD1   . LEU A 1 109  ? -23.916 48.236  6.615   1.00 39.73  ?  97   LEU A CD1   1 
ATOM   740   C  CD2   . LEU A 1 109  ? -22.853 46.008  7.018   1.00 35.86  ?  97   LEU A CD2   1 
ATOM   741   N  N     . ARG A 1 110  ? -21.855 51.008  7.498   1.00 36.74  ?  98   ARG A N     1 
ATOM   742   C  CA    . ARG A 1 110  ? -22.025 51.622  8.808   1.00 31.12  ?  98   ARG A CA    1 
ATOM   743   C  C     . ARG A 1 110  ? -23.511 51.705  9.117   1.00 38.52  ?  98   ARG A C     1 
ATOM   744   O  O     . ARG A 1 110  ? -24.296 52.161  8.280   1.00 48.93  ?  98   ARG A O     1 
ATOM   745   C  CB    . ARG A 1 110  ? -21.400 53.021  8.869   1.00 40.15  ?  98   ARG A CB    1 
ATOM   746   C  CG    . ARG A 1 110  ? -19.898 53.038  9.097   1.00 53.70  ?  98   ARG A CG    1 
ATOM   747   C  CD    . ARG A 1 110  ? -19.144 53.436  7.839   1.00 52.57  ?  98   ARG A CD    1 
ATOM   748   N  NE    . ARG A 1 110  ? -17.724 53.649  8.105   1.00 64.90  ?  98   ARG A NE    1 
ATOM   749   C  CZ    . ARG A 1 110  ? -16.838 54.018  7.185   1.00 75.59  ?  98   ARG A CZ    1 
ATOM   750   N  NH1   . ARG A 1 110  ? -17.223 54.217  5.932   1.00 77.65  ?  98   ARG A NH1   1 
ATOM   751   N  NH2   . ARG A 1 110  ? -15.566 54.189  7.519   1.00 82.24  ?  98   ARG A NH2   1 
ATOM   752   N  N     . LYS A 1 111  ? -23.894 51.265  10.314  1.00 27.27  ?  99   LYS A N     1 
ATOM   753   C  CA    . LYS A 1 111  ? -25.292 51.320  10.720  1.00 28.73  ?  99   LYS A CA    1 
ATOM   754   C  C     . LYS A 1 111  ? -25.365 51.363  12.238  1.00 34.27  ?  99   LYS A C     1 
ATOM   755   O  O     . LYS A 1 111  ? -24.673 50.598  12.918  1.00 39.05  ?  99   LYS A O     1 
ATOM   756   C  CB    . LYS A 1 111  ? -26.075 50.120  10.177  1.00 36.48  ?  99   LYS A CB    1 
ATOM   757   C  CG    . LYS A 1 111  ? -27.580 50.229  10.363  1.00 40.10  ?  99   LYS A CG    1 
ATOM   758   C  CD    . LYS A 1 111  ? -28.142 51.426  9.616   1.00 50.78  ?  99   LYS A CD    1 
ATOM   759   C  CE    . LYS A 1 111  ? -29.642 51.546  9.817   1.00 63.28  ?  99   LYS A CE    1 
ATOM   760   N  NZ    . LYS A 1 111  ? -30.367 50.337  9.337   1.00 53.53  ?  99   LYS A NZ    1 
ATOM   761   N  N     . GLN A 1 112  ? -26.198 52.258  12.759  1.00 36.90  ?  100  GLN A N     1 
ATOM   762   C  CA    . GLN A 1 112  ? -26.391 52.432  14.191  1.00 32.62  ?  100  GLN A CA    1 
ATOM   763   C  C     . GLN A 1 112  ? -27.758 51.888  14.582  1.00 35.78  ?  100  GLN A C     1 
ATOM   764   O  O     . GLN A 1 112  ? -28.753 52.150  13.898  1.00 42.28  ?  100  GLN A O     1 
ATOM   765   C  CB    . GLN A 1 112  ? -26.277 53.907  14.582  1.00 38.33  ?  100  GLN A CB    1 
ATOM   766   C  CG    . GLN A 1 112  ? -26.600 54.202  16.040  1.00 48.61  ?  100  GLN A CG    1 
ATOM   767   C  CD    . GLN A 1 112  ? -25.398 54.045  16.952  1.00 62.93  ?  100  GLN A CD    1 
ATOM   768   O  OE1   . GLN A 1 112  ? -24.253 54.109  16.506  1.00 62.00  ?  100  GLN A OE1   1 
ATOM   769   N  NE2   . GLN A 1 112  ? -25.655 53.841  18.240  1.00 64.49  ?  100  GLN A NE2   1 
ATOM   770   N  N     . GLY A 1 113  ? -27.803 51.135  15.677  1.00 37.69  ?  101  GLY A N     1 
ATOM   771   C  CA    . GLY A 1 113  ? -29.046 50.600  16.174  1.00 38.05  ?  101  GLY A CA    1 
ATOM   772   C  C     . GLY A 1 113  ? -29.937 51.681  16.754  1.00 37.64  ?  101  GLY A C     1 
ATOM   773   O  O     . GLY A 1 113  ? -29.501 52.813  16.986  1.00 36.43  ?  101  GLY A O     1 
ATOM   774   N  N     . PRO A 1 114  ? -31.215 51.354  17.004  1.00 43.87  ?  102  PRO A N     1 
ATOM   775   C  CA    . PRO A 1 114  ? -31.841 50.050  16.758  1.00 43.16  ?  102  PRO A CA    1 
ATOM   776   C  C     . PRO A 1 114  ? -32.122 49.799  15.281  1.00 48.28  ?  102  PRO A C     1 
ATOM   777   O  O     . PRO A 1 114  ? -31.934 50.695  14.458  1.00 53.30  ?  102  PRO A O     1 
ATOM   778   C  CB    . PRO A 1 114  ? -33.158 50.132  17.545  1.00 46.45  ?  102  PRO A CB    1 
ATOM   779   C  CG    . PRO A 1 114  ? -33.034 51.345  18.421  1.00 57.15  ?  102  PRO A CG    1 
ATOM   780   C  CD    . PRO A 1 114  ? -32.139 52.276  17.680  1.00 59.53  ?  102  PRO A CD    1 
ATOM   781   N  N     . GLY A 1 115  ? -32.564 48.593  14.956  1.00 52.01  ?  103  GLY A N     1 
ATOM   782   C  CA    . GLY A 1 115  ? -32.896 48.224  13.598  1.00 56.33  ?  103  GLY A CA    1 
ATOM   783   C  C     . GLY A 1 115  ? -32.093 47.030  13.119  1.00 50.07  ?  103  GLY A C     1 
ATOM   784   O  O     . GLY A 1 115  ? -31.209 46.516  13.804  1.00 47.88  ?  103  GLY A O     1 
ATOM   785   N  N     . GLU A 1 116  ? -32.424 46.597  11.907  1.00 37.08  ?  104  GLU A N     1 
ATOM   786   C  CA    . GLU A 1 116  ? -31.800 45.442  11.276  1.00 30.16  ?  104  GLU A CA    1 
ATOM   787   C  C     . GLU A 1 116  ? -30.909 45.905  10.133  1.00 31.23  ?  104  GLU A C     1 
ATOM   788   O  O     . GLU A 1 116  ? -31.320 46.736  9.316   1.00 36.63  ?  104  GLU A O     1 
ATOM   789   C  CB    . GLU A 1 116  ? -32.863 44.469  10.759  1.00 36.13  ?  104  GLU A CB    1 
ATOM   790   C  CG    . GLU A 1 116  ? -32.356 43.470  9.733   1.00 48.82  ?  104  GLU A CG    1 
ATOM   791   C  CD    . GLU A 1 116  ? -33.468 42.613  9.158   1.00 55.08  ?  104  GLU A CD    1 
ATOM   792   O  OE1   . GLU A 1 116  ? -33.290 42.064  8.051   1.00 47.45  ?  104  GLU A OE1   1 
ATOM   793   O  OE2   . GLU A 1 116  ? -34.523 42.492  9.815   1.00 67.52  ?  104  GLU A OE2   1 
ATOM   794   N  N     . VAL A 1 117  ? -29.692 45.372  10.079  1.00 29.65  ?  105  VAL A N     1 
ATOM   795   C  CA    . VAL A 1 117  ? -28.768 45.658  8.988   1.00 28.17  ?  105  VAL A CA    1 
ATOM   796   C  C     . VAL A 1 117  ? -28.987 44.632  7.886   1.00 25.77  ?  105  VAL A C     1 
ATOM   797   O  O     . VAL A 1 117  ? -28.915 43.421  8.127   1.00 25.69  ?  105  VAL A O     1 
ATOM   798   C  CB    . VAL A 1 117  ? -27.311 45.637  9.476   1.00 28.51  ?  105  VAL A CB    1 
ATOM   799   C  CG1   . VAL A 1 117  ? -26.366 45.947  8.326   1.00 20.89  ?  105  VAL A CG1   1 
ATOM   800   C  CG2   . VAL A 1 117  ? -27.118 46.625  10.608  1.00 35.70  ?  105  VAL A CG2   1 
ATOM   801   N  N     . THR A 1 118  ? -29.257 45.113  6.678   1.00 32.53  ?  106  THR A N     1 
ATOM   802   C  CA    . THR A 1 118  ? -29.479 44.258  5.522   1.00 31.72  ?  106  THR A CA    1 
ATOM   803   C  C     . THR A 1 118  ? -28.365 44.457  4.501   1.00 31.91  ?  106  THR A C     1 
ATOM   804   O  O     . THR A 1 118  ? -27.490 45.313  4.657   1.00 38.69  ?  106  THR A O     1 
ATOM   805   C  CB    . THR A 1 118  ? -30.844 44.539  4.884   1.00 33.38  ?  106  THR A CB    1 
ATOM   806   O  OG1   . THR A 1 118  ? -30.918 45.917  4.496   1.00 43.37  ?  106  THR A OG1   1 
ATOM   807   C  CG2   . THR A 1 118  ? -31.965 44.231  5.865   1.00 40.26  ?  106  THR A CG2   1 
ATOM   808   N  N     . ALA A 1 119  ? -28.409 43.647  3.441   1.00 27.81  ?  107  ALA A N     1 
ATOM   809   C  CA    . ALA A 1 119  ? -27.404 43.744  2.390   1.00 29.34  ?  107  ALA A CA    1 
ATOM   810   C  C     . ALA A 1 119  ? -27.490 45.063  1.634   1.00 33.24  ?  107  ALA A C     1 
ATOM   811   O  O     . ALA A 1 119  ? -26.494 45.491  1.039   1.00 36.28  ?  107  ALA A O     1 
ATOM   812   C  CB    . ALA A 1 119  ? -27.543 42.568  1.420   1.00 32.54  ?  107  ALA A CB    1 
ATOM   813   N  N     . GLY A 1 120  ? -28.653 45.717  1.645   1.00 29.93  ?  108  GLY A N     1 
ATOM   814   C  CA    . GLY A 1 120  ? -28.773 47.017  1.012   1.00 33.76  ?  108  GLY A CA    1 
ATOM   815   C  C     . GLY A 1 120  ? -28.089 48.133  1.768   1.00 47.86  ?  108  GLY A C     1 
ATOM   816   O  O     . GLY A 1 120  ? -27.793 49.177  1.177   1.00 61.99  ?  108  GLY A O     1 
ATOM   817   N  N     . ASP A 1 121  ? -27.828 47.938  3.063   1.00 37.71  ?  109  ASP A N     1 
ATOM   818   C  CA    . ASP A 1 121  ? -27.130 48.940  3.859   1.00 31.03  ?  109  ASP A CA    1 
ATOM   819   C  C     . ASP A 1 121  ? -25.656 49.060  3.496   1.00 31.45  ?  109  ASP A C     1 
ATOM   820   O  O     . ASP A 1 121  ? -24.977 49.948  4.023   1.00 40.03  ?  109  ASP A O     1 
ATOM   821   C  CB    . ASP A 1 121  ? -27.276 48.618  5.347   1.00 33.52  ?  109  ASP A CB    1 
ATOM   822   C  CG    . ASP A 1 121  ? -28.656 48.948  5.884   1.00 47.79  ?  109  ASP A CG    1 
ATOM   823   O  OD1   . ASP A 1 121  ? -29.084 50.114  5.752   1.00 63.03  ?  109  ASP A OD1   1 
ATOM   824   O  OD2   . ASP A 1 121  ? -29.315 48.040  6.432   1.00 44.16  ?  109  ASP A OD2   1 
ATOM   825   N  N     . ILE A 1 122  ? -25.148 48.198  2.621   1.00 35.66  ?  110  ILE A N     1 
ATOM   826   C  CA    . ILE A 1 122  ? -23.771 48.296  2.154   1.00 35.55  ?  110  ILE A CA    1 
ATOM   827   C  C     . ILE A 1 122  ? -23.683 49.380  1.089   1.00 33.39  ?  110  ILE A C     1 
ATOM   828   O  O     . ILE A 1 122  ? -24.565 49.501  0.230   1.00 41.66  ?  110  ILE A O     1 
ATOM   829   C  CB    . ILE A 1 122  ? -23.288 46.941  1.608   1.00 34.59  ?  110  ILE A CB    1 
ATOM   830   C  CG1   . ILE A 1 122  ? -23.622 45.816  2.590   1.00 35.75  ?  110  ILE A CG1   1 
ATOM   831   C  CG2   . ILE A 1 122  ? -21.796 46.982  1.332   1.00 29.76  ?  110  ILE A CG2   1 
ATOM   832   C  CD1   . ILE A 1 122  ? -23.299 44.431  2.063   1.00 26.97  ?  110  ILE A CD1   1 
ATOM   833   N  N     . VAL A 1 123  ? -22.621 50.178  1.145   1.00 34.32  ?  111  VAL A N     1 
ATOM   834   C  CA    . VAL A 1 123  ? -22.365 51.195  0.129   1.00 37.27  ?  111  VAL A CA    1 
ATOM   835   C  C     . VAL A 1 123  ? -21.264 50.686  -0.795  1.00 35.44  ?  111  VAL A C     1 
ATOM   836   O  O     . VAL A 1 123  ? -20.073 50.803  -0.471  1.00 35.38  ?  111  VAL A O     1 
ATOM   837   C  CB    . VAL A 1 123  ? -22.001 52.547  0.762   1.00 30.30  ?  111  VAL A CB    1 
ATOM   838   C  CG1   . VAL A 1 123  ? -23.263 53.319  1.112   1.00 35.20  ?  111  VAL A CG1   1 
ATOM   839   C  CG2   . VAL A 1 123  ? -21.148 52.346  2.008   1.00 49.23  ?  111  VAL A CG2   1 
ATOM   840   N  N     . PRO A 1 124  ? -21.609 50.112  -1.942  1.00 34.58  ?  112  PRO A N     1 
ATOM   841   C  CA    . PRO A 1 124  ? -20.592 49.542  -2.823  1.00 35.23  ?  112  PRO A CA    1 
ATOM   842   C  C     . PRO A 1 124  ? -19.891 50.627  -3.618  1.00 37.42  ?  112  PRO A C     1 
ATOM   843   O  O     . PRO A 1 124  ? -20.509 51.635  -3.994  1.00 39.54  ?  112  PRO A O     1 
ATOM   844   C  CB    . PRO A 1 124  ? -21.406 48.617  -3.737  1.00 36.18  ?  112  PRO A CB    1 
ATOM   845   C  CG    . PRO A 1 124  ? -22.737 49.275  -3.816  1.00 42.07  ?  112  PRO A CG    1 
ATOM   846   C  CD    . PRO A 1 124  ? -22.971 49.918  -2.471  1.00 30.87  ?  112  PRO A CD    1 
ATOM   847   N  N     . PRO A 1 125  ? -18.598 50.463  -3.891  1.00 32.91  ?  113  PRO A N     1 
ATOM   848   C  CA    . PRO A 1 125  ? -17.892 51.446  -4.721  1.00 37.03  ?  113  PRO A CA    1 
ATOM   849   C  C     . PRO A 1 125  ? -18.273 51.327  -6.187  1.00 41.95  ?  113  PRO A C     1 
ATOM   850   O  O     . PRO A 1 125  ? -19.088 50.477  -6.560  1.00 43.35  ?  113  PRO A O     1 
ATOM   851   C  CB    . PRO A 1 125  ? -16.417 51.100  -4.491  1.00 38.02  ?  113  PRO A CB    1 
ATOM   852   C  CG    . PRO A 1 125  ? -16.434 49.644  -4.185  1.00 35.71  ?  113  PRO A CG    1 
ATOM   853   C  CD    . PRO A 1 125  ? -17.701 49.397  -3.413  1.00 35.82  ?  113  PRO A CD    1 
ATOM   854   N  N     . ALA A 1 126  ? -17.684 52.176  -7.023  1.00 43.75  ?  114  ALA A N     1 
ATOM   855   C  CA    . ALA A 1 126  ? -17.977 52.145  -8.448  1.00 39.72  ?  114  ALA A CA    1 
ATOM   856   C  C     . ALA A 1 126  ? -17.506 50.833  -9.062  1.00 43.62  ?  114  ALA A C     1 
ATOM   857   O  O     . ALA A 1 126  ? -16.356 50.423  -8.877  1.00 49.14  ?  114  ALA A O     1 
ATOM   858   C  CB    . ALA A 1 126  ? -17.310 53.328  -9.148  1.00 54.11  ?  114  ALA A CB    1 
ATOM   859   N  N     . GLY A 1 127  ? -18.403 50.172  -9.789  1.00 47.56  ?  115  GLY A N     1 
ATOM   860   C  CA    . GLY A 1 127  ? -18.059 48.938  -10.465 1.00 48.60  ?  115  GLY A CA    1 
ATOM   861   C  C     . GLY A 1 127  ? -18.751 47.716  -9.899  1.00 40.01  ?  115  GLY A C     1 
ATOM   862   O  O     . GLY A 1 127  ? -19.183 46.838  -10.652 1.00 43.11  ?  115  GLY A O     1 
ATOM   863   N  N     . VAL A 1 128  ? -18.866 47.644  -8.577  1.00 48.16  ?  116  VAL A N     1 
ATOM   864   C  CA    . VAL A 1 128  ? -19.462 46.496  -7.918  1.00 52.09  ?  116  VAL A CA    1 
ATOM   865   C  C     . VAL A 1 128  ? -20.865 46.862  -7.455  1.00 47.82  ?  116  VAL A C     1 
ATOM   866   O  O     . VAL A 1 128  ? -21.206 48.034  -7.267  1.00 50.05  ?  116  VAL A O     1 
ATOM   867   C  CB    . VAL A 1 128  ? -18.595 45.992  -6.740  1.00 41.14  ?  116  VAL A CB    1 
ATOM   868   C  CG1   . VAL A 1 128  ? -17.132 46.311  -6.991  1.00 50.45  ?  116  VAL A CG1   1 
ATOM   869   C  CG2   . VAL A 1 128  ? -19.061 46.587  -5.424  1.00 41.25  ?  116  VAL A CG2   1 
ATOM   870   N  N     . THR A 1 129  ? -21.699 45.839  -7.272  1.00 49.02  ?  117  THR A N     1 
ATOM   871   C  CA    . THR A 1 129  ? -23.092 46.064  -6.918  1.00 57.60  ?  117  THR A CA    1 
ATOM   872   C  C     . THR A 1 129  ? -23.665 44.831  -6.231  1.00 50.75  ?  117  THR A C     1 
ATOM   873   O  O     . THR A 1 129  ? -23.317 43.699  -6.578  1.00 47.79  ?  117  THR A O     1 
ATOM   874   C  CB    . THR A 1 129  ? -23.926 46.409  -8.155  1.00 57.74  ?  117  THR A CB    1 
ATOM   875   O  OG1   . THR A 1 129  ? -25.307 46.456  -7.788  1.00 78.63  ?  117  THR A OG1   1 
ATOM   876   C  CG2   . THR A 1 129  ? -23.725 45.368  -9.250  1.00 44.14  ?  117  THR A CG2   1 
ATOM   877   N  N     . VAL A 1 130  ? -24.554 45.066  -5.264  1.00 44.12  ?  118  VAL A N     1 
ATOM   878   C  CA    . VAL A 1 130  ? -25.196 44.009  -4.490  1.00 45.96  ?  118  VAL A CA    1 
ATOM   879   C  C     . VAL A 1 130  ? -26.509 43.635  -5.161  1.00 48.93  ?  118  VAL A C     1 
ATOM   880   O  O     . VAL A 1 130  ? -27.272 44.510  -5.587  1.00 54.57  ?  118  VAL A O     1 
ATOM   881   C  CB    . VAL A 1 130  ? -25.419 44.461  -3.034  1.00 49.04  ?  118  VAL A CB    1 
ATOM   882   C  CG1   . VAL A 1 130  ? -26.099 43.365  -2.225  1.00 43.59  ?  118  VAL A CG1   1 
ATOM   883   C  CG2   . VAL A 1 130  ? -24.099 44.860  -2.397  1.00 41.35  ?  118  VAL A CG2   1 
ATOM   884   N  N     . HIS A 1 131  ? -26.783 42.331  -5.247  1.00 42.18  ?  119  HIS A N     1 
ATOM   885   C  CA    . HIS A 1 131  ? -27.903 41.818  -6.025  1.00 46.26  ?  119  HIS A CA    1 
ATOM   886   C  C     . HIS A 1 131  ? -29.037 41.249  -5.180  1.00 45.70  ?  119  HIS A C     1 
ATOM   887   O  O     . HIS A 1 131  ? -30.001 40.721  -5.745  1.00 49.64  ?  119  HIS A O     1 
ATOM   888   C  CB    . HIS A 1 131  ? -27.413 40.751  -7.011  1.00 45.04  ?  119  HIS A CB    1 
ATOM   889   C  CG    . HIS A 1 131  ? -26.474 41.278  -8.051  1.00 43.84  ?  119  HIS A CG    1 
ATOM   890   N  ND1   . HIS A 1 131  ? -26.885 42.107  -9.073  1.00 46.52  ?  119  HIS A ND1   1 
ATOM   891   C  CD2   . HIS A 1 131  ? -25.144 41.094  -8.229  1.00 47.52  ?  119  HIS A CD2   1 
ATOM   892   C  CE1   . HIS A 1 131  ? -25.849 42.413  -9.833  1.00 53.20  ?  119  HIS A CE1   1 
ATOM   893   N  NE2   . HIS A 1 131  ? -24.780 41.811  -9.343  1.00 48.83  ?  119  HIS A NE2   1 
ATOM   894   N  N     . ASN A 1 132  ? -28.956 41.333  -3.854  1.00 30.86  ?  120  ASN A N     1 
ATOM   895   C  CA    . ASN A 1 132  ? -30.072 40.967  -2.979  1.00 38.16  ?  120  ASN A CA    1 
ATOM   896   C  C     . ASN A 1 132  ? -30.044 41.854  -1.745  1.00 36.39  ?  120  ASN A C     1 
ATOM   897   O  O     . ASN A 1 132  ? -29.671 41.420  -0.648  1.00 33.25  ?  120  ASN A O     1 
ATOM   898   C  CB    . ASN A 1 132  ? -30.027 39.485  -2.598  1.00 34.99  ?  120  ASN A CB    1 
ATOM   899   C  CG    . ASN A 1 132  ? -28.645 39.026  -2.186  1.00 32.42  ?  120  ASN A CG    1 
ATOM   900   O  OD1   . ASN A 1 132  ? -27.742 39.836  -1.977  1.00 31.58  ?  120  ASN A OD1   1 
ATOM   901   N  ND2   . ASN A 1 132  ? -28.474 37.716  -2.064  1.00 35.74  ?  120  ASN A ND2   1 
ATOM   902   N  N     . PRO A 1 133  ? -30.456 43.119  -1.886  1.00 37.85  ?  121  PRO A N     1 
ATOM   903   C  CA    . PRO A 1 133  ? -30.324 44.076  -0.774  1.00 36.57  ?  121  PRO A CA    1 
ATOM   904   C  C     . PRO A 1 133  ? -31.164 43.741  0.450   1.00 36.56  ?  121  PRO A C     1 
ATOM   905   O  O     . PRO A 1 133  ? -31.006 44.411  1.480   1.00 43.80  ?  121  PRO A O     1 
ATOM   906   C  CB    . PRO A 1 133  ? -30.776 45.403  -1.401  1.00 43.48  ?  121  PRO A CB    1 
ATOM   907   C  CG    . PRO A 1 133  ? -30.624 45.204  -2.876  1.00 44.56  ?  121  PRO A CG    1 
ATOM   908   C  CD    . PRO A 1 133  ? -30.952 43.765  -3.111  1.00 36.88  ?  121  PRO A CD    1 
ATOM   909   N  N     . GLY A 1 134  ? -32.038 42.744  0.381   1.00 28.90  ?  122  GLY A N     1 
ATOM   910   C  CA    . GLY A 1 134  ? -32.895 42.407  1.497   1.00 34.33  ?  122  GLY A CA    1 
ATOM   911   C  C     . GLY A 1 134  ? -32.395 41.297  2.393   1.00 37.44  ?  122  GLY A C     1 
ATOM   912   O  O     . GLY A 1 134  ? -33.151 40.820  3.246   1.00 43.07  ?  122  GLY A O     1 
ATOM   913   N  N     . MET A 1 135  ? -31.145 40.874  2.236   1.00 29.22  ?  123  MET A N     1 
ATOM   914   C  CA    . MET A 1 135  ? -30.619 39.776  3.035   1.00 27.39  ?  123  MET A CA    1 
ATOM   915   C  C     . MET A 1 135  ? -30.346 40.225  4.463   1.00 31.30  ?  123  MET A C     1 
ATOM   916   O  O     . MET A 1 135  ? -29.741 41.276  4.689   1.00 26.70  ?  123  MET A O     1 
ATOM   917   C  CB    . MET A 1 135  ? -29.336 39.236  2.411   1.00 22.12  ?  123  MET A CB    1 
ATOM   918   C  CG    . MET A 1 135  ? -28.572 38.288  3.317   1.00 33.09  ?  123  MET A CG    1 
ATOM   919   S  SD    . MET A 1 135  ? -26.925 37.967  2.679   1.00 41.51  ?  123  MET A SD    1 
ATOM   920   C  CE    . MET A 1 135  ? -27.321 37.788  0.947   1.00 31.24  ?  123  MET A CE    1 
ATOM   921   N  N     . HIS A 1 136  ? -30.781 39.417  5.426   1.00 29.68  ?  124  HIS A N     1 
ATOM   922   C  CA    . HIS A 1 136  ? -30.481 39.685  6.824   1.00 29.10  ?  124  HIS A CA    1 
ATOM   923   C  C     . HIS A 1 136  ? -28.996 39.475  7.099   1.00 26.11  ?  124  HIS A C     1 
ATOM   924   O  O     . HIS A 1 136  ? -28.400 38.484  6.668   1.00 27.29  ?  124  HIS A O     1 
ATOM   925   C  CB    . HIS A 1 136  ? -31.311 38.775  7.729   1.00 31.06  ?  124  HIS A CB    1 
ATOM   926   C  CG    . HIS A 1 136  ? -31.137 39.050  9.190   1.00 26.80  ?  124  HIS A CG    1 
ATOM   927   N  ND1   . HIS A 1 136  ? -32.093 39.697  9.942   1.00 30.80  ?  124  HIS A ND1   1 
ATOM   928   C  CD2   . HIS A 1 136  ? -30.120 38.765  10.038  1.00 32.28  ?  124  HIS A CD2   1 
ATOM   929   C  CE1   . HIS A 1 136  ? -31.673 39.800  11.190  1.00 42.26  ?  124  HIS A CE1   1 
ATOM   930   N  NE2   . HIS A 1 136  ? -30.478 39.244  11.275  1.00 39.97  ?  124  HIS A NE2   1 
ATOM   931   N  N     . ILE A 1 137  ? -28.400 40.420  7.826   1.00 26.40  ?  125  ILE A N     1 
ATOM   932   C  CA    . ILE A 1 137  ? -27.000 40.350  8.227   1.00 23.30  ?  125  ILE A CA    1 
ATOM   933   C  C     . ILE A 1 137  ? -26.859 40.343  9.745   1.00 28.58  ?  125  ILE A C     1 
ATOM   934   O  O     . ILE A 1 137  ? -26.144 39.509  10.310  1.00 31.08  ?  125  ILE A O     1 
ATOM   935   C  CB    . ILE A 1 137  ? -26.178 41.503  7.607   1.00 19.60  ?  125  ILE A CB    1 
ATOM   936   C  CG1   . ILE A 1 137  ? -26.081 41.334  6.091   1.00 15.82  ?  125  ILE A CG1   1 
ATOM   937   C  CG2   . ILE A 1 137  ? -24.792 41.567  8.228   1.00 17.51  ?  125  ILE A CG2   1 
ATOM   938   C  CD1   . ILE A 1 137  ? -25.249 42.401  5.414   1.00 11.58  ?  125  ILE A CD1   1 
ATOM   939   N  N     . ALA A 1 138  ? -27.539 41.264  10.423  1.00 28.86  ?  126  ALA A N     1 
ATOM   940   C  CA    . ALA A 1 138  ? -27.469 41.339  11.875  1.00 26.91  ?  126  ALA A CA    1 
ATOM   941   C  C     . ALA A 1 138  ? -28.663 42.125  12.394  1.00 29.97  ?  126  ALA A C     1 
ATOM   942   O  O     . ALA A 1 138  ? -29.304 42.880  11.658  1.00 29.13  ?  126  ALA A O     1 
ATOM   943   C  CB    . ALA A 1 138  ? -26.159 41.982  12.342  1.00 28.85  ?  126  ALA A CB    1 
ATOM   944   N  N     . THR A 1 139  ? -28.953 41.931  13.678  1.00 35.20  ?  127  THR A N     1 
ATOM   945   C  CA    . THR A 1 139  ? -29.993 42.669  14.384  1.00 30.78  ?  127  THR A CA    1 
ATOM   946   C  C     . THR A 1 139  ? -29.333 43.516  15.465  1.00 29.45  ?  127  THR A C     1 
ATOM   947   O  O     . THR A 1 139  ? -28.600 42.989  16.309  1.00 36.18  ?  127  THR A O     1 
ATOM   948   C  CB    . THR A 1 139  ? -31.024 41.722  14.999  1.00 31.25  ?  127  THR A CB    1 
ATOM   949   O  OG1   . THR A 1 139  ? -31.690 40.997  13.958  1.00 44.39  ?  127  THR A OG1   1 
ATOM   950   C  CG2   . THR A 1 139  ? -32.054 42.505  15.801  1.00 37.52  ?  127  THR A CG2   1 
ATOM   951   N  N     . LEU A 1 140  ? -29.591 44.820  15.435  1.00 33.25  ?  128  LEU A N     1 
ATOM   952   C  CA    . LEU A 1 140  ? -28.970 45.772  16.346  1.00 34.19  ?  128  LEU A CA    1 
ATOM   953   C  C     . LEU A 1 140  ? -30.030 46.382  17.252  1.00 38.95  ?  128  LEU A C     1 
ATOM   954   O  O     . LEU A 1 140  ? -31.101 46.778  16.779  1.00 40.76  ?  128  LEU A O     1 
ATOM   955   C  CB    . LEU A 1 140  ? -28.244 46.879  15.575  1.00 25.23  ?  128  LEU A CB    1 
ATOM   956   C  CG    . LEU A 1 140  ? -26.835 46.618  15.034  1.00 23.18  ?  128  LEU A CG    1 
ATOM   957   C  CD1   . LEU A 1 140  ? -26.814 45.483  14.022  1.00 32.32  ?  128  LEU A CD1   1 
ATOM   958   C  CD2   . LEU A 1 140  ? -26.263 47.889  14.422  1.00 25.14  ?  128  LEU A CD2   1 
ATOM   959   N  N     . ASN A 1 141  ? -29.731 46.456  18.545  1.00 40.46  ?  129  ASN A N     1 
ATOM   960   C  CA    . ASN A 1 141  ? -30.610 47.104  19.502  1.00 44.76  ?  129  ASN A CA    1 
ATOM   961   C  C     . ASN A 1 141  ? -30.131 48.542  19.723  1.00 52.09  ?  129  ASN A C     1 
ATOM   962   O  O     . ASN A 1 141  ? -29.427 49.108  18.882  1.00 55.44  ?  129  ASN A O     1 
ATOM   963   C  CB    . ASN A 1 141  ? -30.675 46.278  20.797  1.00 46.62  ?  129  ASN A CB    1 
ATOM   964   C  CG    . ASN A 1 141  ? -29.314 46.078  21.447  1.00 41.74  ?  129  ASN A CG    1 
ATOM   965   O  OD1   . ASN A 1 141  ? -28.381 46.851  21.231  1.00 45.80  ?  129  ASN A OD1   1 
ATOM   966   N  ND2   . ASN A 1 141  ? -29.202 45.033  22.258  1.00 32.77  ?  129  ASN A ND2   1 
ATOM   967   N  N     . ASP A 1 142  ? -30.497 49.136  20.860  1.00 41.95  ?  130  ASP A N     1 
ATOM   968   C  CA    . ASP A 1 142  ? -30.162 50.536  21.106  1.00 41.62  ?  130  ASP A CA    1 
ATOM   969   C  C     . ASP A 1 142  ? -28.654 50.745  21.184  1.00 36.65  ?  130  ASP A C     1 
ATOM   970   O  O     . ASP A 1 142  ? -28.121 51.705  20.616  1.00 32.40  ?  130  ASP A O     1 
ATOM   971   C  CB    . ASP A 1 142  ? -30.834 51.008  22.394  1.00 45.90  ?  130  ASP A CB    1 
ATOM   972   C  CG    . ASP A 1 142  ? -32.285 50.584  22.479  1.00 64.06  ?  130  ASP A CG    1 
ATOM   973   O  OD1   . ASP A 1 142  ? -33.072 50.970  21.591  1.00 71.54  ?  130  ASP A OD1   1 
ATOM   974   O  OD2   . ASP A 1 142  ? -32.636 49.849  23.426  1.00 65.50  ?  130  ASP A OD2   1 
ATOM   975   N  N     . LYS A 1 143  ? -27.950 49.857  21.881  1.00 36.21  ?  131  LYS A N     1 
ATOM   976   C  CA    . LYS A 1 143  ? -26.519 50.010  22.111  1.00 33.21  ?  131  LYS A CA    1 
ATOM   977   C  C     . LYS A 1 143  ? -25.667 49.458  20.974  1.00 32.47  ?  131  LYS A C     1 
ATOM   978   O  O     . LYS A 1 143  ? -24.435 49.520  21.065  1.00 30.58  ?  131  LYS A O     1 
ATOM   979   C  CB    . LYS A 1 143  ? -26.129 49.320  23.420  1.00 28.94  ?  131  LYS A CB    1 
ATOM   980   C  CG    . LYS A 1 143  ? -27.077 49.597  24.577  1.00 35.05  ?  131  LYS A CG    1 
ATOM   981   C  CD    . LYS A 1 143  ? -26.729 48.749  25.790  1.00 50.59  ?  131  LYS A CD    1 
ATOM   982   C  CE    . LYS A 1 143  ? -27.712 48.978  26.927  1.00 59.70  ?  131  LYS A CE    1 
ATOM   983   N  NZ    . LYS A 1 143  ? -27.392 48.140  28.115  1.00 68.10  ?  131  LYS A NZ    1 
ATOM   984   N  N     . GLY A 1 144  ? -26.277 48.933  19.916  1.00 28.67  ?  132  GLY A N     1 
ATOM   985   C  CA    . GLY A 1 144  ? -25.538 48.239  18.877  1.00 31.38  ?  132  GLY A CA    1 
ATOM   986   C  C     . GLY A 1 144  ? -25.053 49.164  17.780  1.00 36.98  ?  132  GLY A C     1 
ATOM   987   O  O     . GLY A 1 144  ? -25.832 49.929  17.207  1.00 39.44  ?  132  GLY A O     1 
ATOM   988   N  N     . LYS A 1 145  ? -23.756 49.085  17.489  1.00 35.77  ?  133  LYS A N     1 
ATOM   989   C  CA    . LYS A 1 145  ? -23.142 49.807  16.383  1.00 31.23  ?  133  LYS A CA    1 
ATOM   990   C  C     . LYS A 1 145  ? -22.300 48.830  15.578  1.00 32.93  ?  133  LYS A C     1 
ATOM   991   O  O     . LYS A 1 145  ? -21.464 48.118  16.142  1.00 42.33  ?  133  LYS A O     1 
ATOM   992   C  CB    . LYS A 1 145  ? -22.276 50.970  16.881  1.00 44.73  ?  133  LYS A CB    1 
ATOM   993   C  CG    . LYS A 1 145  ? -21.210 51.409  15.887  1.00 50.16  ?  133  LYS A CG    1 
ATOM   994   C  CD    . LYS A 1 145  ? -20.306 52.483  16.470  1.00 55.99  ?  133  LYS A CD    1 
ATOM   995   C  CE    . LYS A 1 145  ? -19.030 52.636  15.652  1.00 61.17  ?  133  LYS A CE    1 
ATOM   996   N  NZ    . LYS A 1 145  ? -19.300 52.929  14.216  1.00 53.61  ?  133  LYS A NZ    1 
ATOM   997   N  N     . LEU A 1 146  ? -22.521 48.795  14.266  1.00 29.85  ?  134  LEU A N     1 
ATOM   998   C  CA    . LEU A 1 146  ? -21.821 47.880  13.375  1.00 26.36  ?  134  LEU A CA    1 
ATOM   999   C  C     . LEU A 1 146  ? -21.119 48.673  12.282  1.00 24.04  ?  134  LEU A C     1 
ATOM   1000  O  O     . LEU A 1 146  ? -21.754 49.464  11.577  1.00 28.05  ?  134  LEU A O     1 
ATOM   1001  C  CB    . LEU A 1 146  ? -22.788 46.862  12.763  1.00 30.52  ?  134  LEU A CB    1 
ATOM   1002  C  CG    . LEU A 1 146  ? -22.153 45.662  12.058  1.00 31.29  ?  134  LEU A CG    1 
ATOM   1003  C  CD1   . LEU A 1 146  ? -21.298 44.860  13.029  1.00 20.11  ?  134  LEU A CD1   1 
ATOM   1004  C  CD2   . LEU A 1 146  ? -23.219 44.782  11.426  1.00 33.63  ?  134  LEU A CD2   1 
ATOM   1005  N  N     . GLU A 1 147  ? -19.811 48.458  12.147  1.00 28.09  ?  135  GLU A N     1 
ATOM   1006  C  CA    . GLU A 1 147  ? -18.993 49.118  11.133  1.00 30.18  ?  135  GLU A CA    1 
ATOM   1007  C  C     . GLU A 1 147  ? -18.103 48.059  10.497  1.00 30.95  ?  135  GLU A C     1 
ATOM   1008  O  O     . GLU A 1 147  ? -17.198 47.533  11.153  1.00 36.30  ?  135  GLU A O     1 
ATOM   1009  C  CB    . GLU A 1 147  ? -18.159 50.246  11.742  1.00 34.36  ?  135  GLU A CB    1 
ATOM   1010  C  CG    . GLU A 1 147  ? -17.364 51.052  10.730  1.00 52.72  ?  135  GLU A CG    1 
ATOM   1011  C  CD    . GLU A 1 147  ? -16.701 52.267  11.349  1.00 69.29  ?  135  GLU A CD    1 
ATOM   1012  O  OE1   . GLU A 1 147  ? -15.647 52.698  10.836  1.00 72.60  ?  135  GLU A OE1   1 
ATOM   1013  O  OE2   . GLU A 1 147  ? -17.235 52.790  12.351  1.00 66.32  ?  135  GLU A OE2   1 
ATOM   1014  N  N     . VAL A 1 148  ? -18.359 47.743  9.228   1.00 25.45  ?  136  VAL A N     1 
ATOM   1015  C  CA    . VAL A 1 148  ? -17.728 46.614  8.556   1.00 22.49  ?  136  VAL A CA    1 
ATOM   1016  C  C     . VAL A 1 148  ? -17.150 47.075  7.225   1.00 21.87  ?  136  VAL A C     1 
ATOM   1017  O  O     . VAL A 1 148  ? -17.818 47.785  6.465   1.00 22.92  ?  136  VAL A O     1 
ATOM   1018  C  CB    . VAL A 1 148  ? -18.723 45.458  8.329   1.00 23.52  ?  136  VAL A CB    1 
ATOM   1019  C  CG1   . VAL A 1 148  ? -18.019 44.259  7.714   1.00 22.34  ?  136  VAL A CG1   1 
ATOM   1020  C  CG2   . VAL A 1 148  ? -19.407 45.071  9.630   1.00 21.62  ?  136  VAL A CG2   1 
ATOM   1021  N  N     . GLU A 1 149  ? -15.915 46.669  6.946   1.00 20.08  ?  137  GLU A N     1 
ATOM   1022  C  CA    . GLU A 1 149  ? -15.323 46.769  5.621   1.00 20.17  ?  137  GLU A CA    1 
ATOM   1023  C  C     . GLU A 1 149  ? -15.353 45.396  4.961   1.00 20.98  ?  137  GLU A C     1 
ATOM   1024  O  O     . GLU A 1 149  ? -15.230 44.368  5.630   1.00 26.83  ?  137  GLU A O     1 
ATOM   1025  C  CB    . GLU A 1 149  ? -13.884 47.282  5.691   1.00 24.59  ?  137  GLU A CB    1 
ATOM   1026  C  CG    . GLU A 1 149  ? -13.730 48.640  6.354   1.00 39.22  ?  137  GLU A CG    1 
ATOM   1027  C  CD    . GLU A 1 149  ? -12.284 49.095  6.410   1.00 53.88  ?  137  GLU A CD    1 
ATOM   1028  O  OE1   . GLU A 1 149  ? -11.460 48.552  5.645   1.00 48.46  ?  137  GLU A OE1   1 
ATOM   1029  O  OE2   . GLU A 1 149  ? -11.970 49.992  7.222   1.00 70.08  ?  137  GLU A OE2   1 
ATOM   1030  N  N     . LEU A 1 150  ? -15.528 45.383  3.641   1.00 20.29  ?  138  LEU A N     1 
ATOM   1031  C  CA    . LEU A 1 150  ? -15.663 44.132  2.896   1.00 14.69  ?  138  LEU A CA    1 
ATOM   1032  C  C     . LEU A 1 150  ? -14.848 44.228  1.614   1.00 15.65  ?  138  LEU A C     1 
ATOM   1033  O  O     . LEU A 1 150  ? -15.187 45.003  0.716   1.00 25.30  ?  138  LEU A O     1 
ATOM   1034  C  CB    . LEU A 1 150  ? -17.130 43.824  2.584   1.00 10.28  ?  138  LEU A CB    1 
ATOM   1035  C  CG    . LEU A 1 150  ? -18.101 43.675  3.761   1.00 10.52  ?  138  LEU A CG    1 
ATOM   1036  C  CD1   . LEU A 1 150  ? -18.719 45.015  4.140   1.00 21.88  ?  138  LEU A CD1   1 
ATOM   1037  C  CD2   . LEU A 1 150  ? -19.182 42.652  3.447   1.00 12.70  ?  138  LEU A CD2   1 
ATOM   1038  N  N     . VAL A 1 151  ? -13.781 43.438  1.529   1.00 15.14  ?  139  VAL A N     1 
ATOM   1039  C  CA    . VAL A 1 151  ? -12.972 43.363  0.318   1.00 20.76  ?  139  VAL A CA    1 
ATOM   1040  C  C     . VAL A 1 151  ? -13.610 42.368  -0.641  1.00 27.71  ?  139  VAL A C     1 
ATOM   1041  O  O     . VAL A 1 151  ? -13.910 41.229  -0.265  1.00 21.89  ?  139  VAL A O     1 
ATOM   1042  C  CB    . VAL A 1 151  ? -11.526 42.964  0.651   1.00 26.95  ?  139  VAL A CB    1 
ATOM   1043  C  CG1   . VAL A 1 151  ? -10.800 42.492  -0.601  1.00 28.24  ?  139  VAL A CG1   1 
ATOM   1044  C  CG2   . VAL A 1 151  ? -10.788 44.131  1.285   1.00 34.41  ?  139  VAL A CG2   1 
ATOM   1045  N  N     . VAL A 1 152  ? -13.818 42.794  -1.884  1.00 28.01  ?  140  VAL A N     1 
ATOM   1046  C  CA    . VAL A 1 152  ? -14.443 41.966  -2.909  1.00 18.36  ?  140  VAL A CA    1 
ATOM   1047  C  C     . VAL A 1 152  ? -13.502 41.884  -4.101  1.00 19.49  ?  140  VAL A C     1 
ATOM   1048  O  O     . VAL A 1 152  ? -13.205 42.903  -4.738  1.00 23.48  ?  140  VAL A O     1 
ATOM   1049  C  CB    . VAL A 1 152  ? -15.814 42.515  -3.330  1.00 14.63  ?  140  VAL A CB    1 
ATOM   1050  C  CG1   . VAL A 1 152  ? -16.332 41.767  -4.548  1.00 18.11  ?  140  VAL A CG1   1 
ATOM   1051  C  CG2   . VAL A 1 152  ? -16.798 42.405  -2.180  1.00 24.34  ?  140  VAL A CG2   1 
ATOM   1052  N  N     . GLU A 1 153  ? -13.032 40.677  -4.397  1.00 25.62  ?  141  GLU A N     1 
ATOM   1053  C  CA    . GLU A 1 153  ? -12.239 40.393  -5.581  1.00 26.49  ?  141  GLU A CA    1 
ATOM   1054  C  C     . GLU A 1 153  ? -13.110 39.654  -6.595  1.00 25.61  ?  141  GLU A C     1 
ATOM   1055  O  O     . GLU A 1 153  ? -14.328 39.525  -6.422  1.00 25.92  ?  141  GLU A O     1 
ATOM   1056  C  CB    . GLU A 1 153  ? -10.990 39.592  -5.204  1.00 32.85  ?  141  GLU A CB    1 
ATOM   1057  C  CG    . GLU A 1 153  ? -10.053 40.314  -4.249  1.00 42.07  ?  141  GLU A CG    1 
ATOM   1058  C  CD    . GLU A 1 153  ? -8.866  39.462  -3.841  1.00 50.22  ?  141  GLU A CD    1 
ATOM   1059  O  OE1   . GLU A 1 153  ? -8.786  38.297  -4.285  1.00 52.10  ?  141  GLU A OE1   1 
ATOM   1060  O  OE2   . GLU A 1 153  ? -8.012  39.957  -3.076  1.00 61.24  ?  141  GLU A OE2   1 
ATOM   1061  N  N     . ARG A 1 154  ? -12.483 39.160  -7.660  1.00 32.69  ?  142  ARG A N     1 
ATOM   1062  C  CA    . ARG A 1 154  ? -13.200 38.434  -8.702  1.00 28.90  ?  142  ARG A CA    1 
ATOM   1063  C  C     . ARG A 1 154  ? -12.374 37.233  -9.134  1.00 27.04  ?  142  ARG A C     1 
ATOM   1064  O  O     . ARG A 1 154  ? -11.221 37.384  -9.549  1.00 38.67  ?  142  ARG A O     1 
ATOM   1065  C  CB    . ARG A 1 154  ? -13.506 39.340  -9.898  1.00 38.71  ?  142  ARG A CB    1 
ATOM   1066  C  CG    . ARG A 1 154  ? -14.531 38.754  -10.854 1.00 50.27  ?  142  ARG A CG    1 
ATOM   1067  C  CD    . ARG A 1 154  ? -15.183 39.832  -11.697 1.00 54.37  ?  142  ARG A CD    1 
ATOM   1068  N  NE    . ARG A 1 154  ? -16.308 39.317  -12.472 1.00 63.02  ?  142  ARG A NE    1 
ATOM   1069  C  CZ    . ARG A 1 154  ? -16.209 38.845  -13.710 1.00 69.05  ?  142  ARG A CZ    1 
ATOM   1070  N  NH1   . ARG A 1 154  ? -15.033 38.821  -14.321 1.00 57.93  ?  142  ARG A NH1   1 
ATOM   1071  N  NH2   . ARG A 1 154  ? -17.287 38.396  -14.339 1.00 69.09  ?  142  ARG A NH2   1 
ATOM   1072  N  N     . GLY A 1 155  ? -12.967 36.046  -9.031  1.00 27.80  ?  143  GLY A N     1 
ATOM   1073  C  CA    . GLY A 1 155  ? -12.329 34.820  -9.466  1.00 37.77  ?  143  GLY A CA    1 
ATOM   1074  C  C     . GLY A 1 155  ? -13.325 33.851  -10.067 1.00 35.86  ?  143  GLY A C     1 
ATOM   1075  O  O     . GLY A 1 155  ? -14.246 34.263  -10.780 1.00 37.62  ?  143  GLY A O     1 
ATOM   1076  N  N     . ARG A 1 156  ? -13.157 32.559  -9.791  1.00 33.81  ?  144  ARG A N     1 
ATOM   1077  C  CA    . ARG A 1 156  ? -14.099 31.553  -10.256 1.00 41.65  ?  144  ARG A CA    1 
ATOM   1078  C  C     . ARG A 1 156  ? -14.049 30.354  -9.322  1.00 42.40  ?  144  ARG A C     1 
ATOM   1079  O  O     . ARG A 1 156  ? -13.033 30.097  -8.670  1.00 45.61  ?  144  ARG A O     1 
ATOM   1080  C  CB    . ARG A 1 156  ? -13.806 31.114  -11.695 1.00 48.88  ?  144  ARG A CB    1 
ATOM   1081  C  CG    . ARG A 1 156  ? -12.552 30.279  -11.838 1.00 53.29  ?  144  ARG A CG    1 
ATOM   1082  C  CD    . ARG A 1 156  ? -12.476 29.630  -13.207 1.00 55.28  ?  144  ARG A CD    1 
ATOM   1083  N  NE    . ARG A 1 156  ? -11.293 28.787  -13.325 1.00 59.91  ?  144  ARG A NE    1 
ATOM   1084  C  CZ    . ARG A 1 156  ? -10.097 29.234  -13.689 1.00 70.33  ?  144  ARG A CZ    1 
ATOM   1085  N  NH1   . ARG A 1 156  ? -9.929  30.517  -13.973 1.00 74.51  ?  144  ARG A NH1   1 
ATOM   1086  N  NH2   . ARG A 1 156  ? -9.069  28.403  -13.769 1.00 74.18  ?  144  ARG A NH2   1 
ATOM   1087  N  N     . GLY A 1 157  ? -15.161 29.625  -9.260  1.00 31.13  ?  145  GLY A N     1 
ATOM   1088  C  CA    . GLY A 1 157  ? -15.206 28.427  -8.438  1.00 39.61  ?  145  GLY A CA    1 
ATOM   1089  C  C     . GLY A 1 157  ? -15.247 28.760  -6.958  1.00 33.62  ?  145  GLY A C     1 
ATOM   1090  O  O     . GLY A 1 157  ? -15.862 29.742  -6.530  1.00 31.55  ?  145  GLY A O     1 
ATOM   1091  N  N     . TYR A 1 158  ? -14.581 27.926  -6.163  1.00 36.63  ?  146  TYR A N     1 
ATOM   1092  C  CA    . TYR A 1 158  ? -14.526 28.086  -4.716  1.00 31.95  ?  146  TYR A CA    1 
ATOM   1093  C  C     . TYR A 1 158  ? -13.074 28.070  -4.268  1.00 35.99  ?  146  TYR A C     1 
ATOM   1094  O  O     . TYR A 1 158  ? -12.336 27.130  -4.581  1.00 38.11  ?  146  TYR A O     1 
ATOM   1095  C  CB    . TYR A 1 158  ? -15.314 26.977  -4.006  1.00 32.29  ?  146  TYR A CB    1 
ATOM   1096  C  CG    . TYR A 1 158  ? -14.964 26.806  -2.542  1.00 29.36  ?  146  TYR A CG    1 
ATOM   1097  C  CD1   . TYR A 1 158  ? -14.077 25.818  -2.129  1.00 27.00  ?  146  TYR A CD1   1 
ATOM   1098  C  CD2   . TYR A 1 158  ? -15.521 27.631  -1.574  1.00 35.12  ?  146  TYR A CD2   1 
ATOM   1099  C  CE1   . TYR A 1 158  ? -13.754 25.660  -0.794  1.00 28.28  ?  146  TYR A CE1   1 
ATOM   1100  C  CE2   . TYR A 1 158  ? -15.204 27.478  -0.236  1.00 30.56  ?  146  TYR A CE2   1 
ATOM   1101  C  CZ    . TYR A 1 158  ? -14.321 26.492  0.148   1.00 25.29  ?  146  TYR A CZ    1 
ATOM   1102  O  OH    . TYR A 1 158  ? -14.003 26.337  1.478   1.00 28.04  ?  146  TYR A OH    1 
ATOM   1103  N  N     . VAL A 1 159  ? -12.668 29.103  -3.538  1.00 31.75  ?  147  VAL A N     1 
ATOM   1104  C  CA    . VAL A 1 159  ? -11.347 29.177  -2.926  1.00 30.36  ?  147  VAL A CA    1 
ATOM   1105  C  C     . VAL A 1 159  ? -11.541 29.355  -1.427  1.00 32.87  ?  147  VAL A C     1 
ATOM   1106  O  O     . VAL A 1 159  ? -12.371 30.167  -1.013  1.00 30.62  ?  147  VAL A O     1 
ATOM   1107  C  CB    . VAL A 1 159  ? -10.485 30.316  -3.503  1.00 22.25  ?  147  VAL A CB    1 
ATOM   1108  C  CG1   . VAL A 1 159  ? -11.174 31.664  -3.356  1.00 37.74  ?  147  VAL A CG1   1 
ATOM   1109  C  CG2   . VAL A 1 159  ? -9.112  30.338  -2.845  1.00 30.22  ?  147  VAL A CG2   1 
ATOM   1110  N  N     . PRO A 1 160  ? -10.843 28.598  -0.585  1.00 29.39  ?  148  PRO A N     1 
ATOM   1111  C  CA    . PRO A 1 160  ? -10.984 28.780  0.863   1.00 22.07  ?  148  PRO A CA    1 
ATOM   1112  C  C     . PRO A 1 160  ? -10.364 30.093  1.315   1.00 30.58  ?  148  PRO A C     1 
ATOM   1113  O  O     . PRO A 1 160  ? -9.744  30.829  0.545   1.00 36.67  ?  148  PRO A O     1 
ATOM   1114  C  CB    . PRO A 1 160  ? -10.241 27.576  1.453   1.00 27.37  ?  148  PRO A CB    1 
ATOM   1115  C  CG    . PRO A 1 160  ? -10.161 26.584  0.332   1.00 34.80  ?  148  PRO A CG    1 
ATOM   1116  C  CD    . PRO A 1 160  ? -10.042 27.408  -0.912  1.00 33.04  ?  148  PRO A CD    1 
ATOM   1117  N  N     . ALA A 1 161  ? -10.546 30.378  2.602   1.00 35.87  ?  149  ALA A N     1 
ATOM   1118  C  CA    . ALA A 1 161  ? -10.016 31.606  3.179   1.00 34.51  ?  149  ALA A CA    1 
ATOM   1119  C  C     . ALA A 1 161  ? -8.495  31.615  3.107   1.00 39.92  ?  149  ALA A C     1 
ATOM   1120  O  O     . ALA A 1 161  ? -7.834  30.662  3.531   1.00 37.55  ?  149  ALA A O     1 
ATOM   1121  C  CB    . ALA A 1 161  ? -10.482 31.750  4.627   1.00 30.20  ?  149  ALA A CB    1 
ATOM   1122  N  N     . VAL A 1 162  ? -7.943  32.693  2.561   1.00 42.87  ?  150  VAL A N     1 
ATOM   1123  C  CA    . VAL A 1 162  ? -6.497  32.830  2.434   1.00 53.88  ?  150  VAL A CA    1 
ATOM   1124  C  C     . VAL A 1 162  ? -5.909  33.152  3.801   1.00 66.38  ?  150  VAL A C     1 
ATOM   1125  O  O     . VAL A 1 162  ? -6.365  34.077  4.484   1.00 61.05  ?  150  VAL A O     1 
ATOM   1126  C  CB    . VAL A 1 162  ? -6.140  33.913  1.405   1.00 47.66  ?  150  VAL A CB    1 
ATOM   1127  C  CG1   . VAL A 1 162  ? -4.656  33.863  1.081   1.00 58.79  ?  150  VAL A CG1   1 
ATOM   1128  C  CG2   . VAL A 1 162  ? -6.975  33.745  0.144   1.00 41.13  ?  150  VAL A CG2   1 
ATOM   1129  N  N     . GLN A 1 163  ? -4.894  32.390  4.201   1.00 77.96  ?  151  GLN A N     1 
ATOM   1130  C  CA    . GLN A 1 163  ? -4.291  32.556  5.515   1.00 82.96  ?  151  GLN A CA    1 
ATOM   1131  C  C     . GLN A 1 163  ? -3.639  33.931  5.647   1.00 83.89  ?  151  GLN A C     1 
ATOM   1132  O  O     . GLN A 1 163  ? -3.268  34.575  4.662   1.00 83.12  ?  151  GLN A O     1 
ATOM   1133  C  CB    . GLN A 1 163  ? -3.248  31.467  5.764   1.00 94.15  ?  151  GLN A CB    1 
ATOM   1134  C  CG    . GLN A 1 163  ? -3.773  30.048  5.626   1.00 98.61  ?  151  GLN A CG    1 
ATOM   1135  C  CD    . GLN A 1 163  ? -2.662  29.017  5.656   1.00 112.57 ?  151  GLN A CD    1 
ATOM   1136  O  OE1   . GLN A 1 163  ? -1.497  29.337  5.416   1.00 111.78 ?  151  GLN A OE1   1 
ATOM   1137  N  NE2   . GLN A 1 163  ? -3.015  27.773  5.956   1.00 118.94 ?  151  GLN A NE2   1 
ATOM   1138  N  N     . ASN A 1 164  ? -3.505  34.381  6.897   1.00 83.77  ?  152  ASN A N     1 
ATOM   1139  C  CA    . ASN A 1 164  ? -2.791  35.621  7.176   1.00 81.53  ?  152  ASN A CA    1 
ATOM   1140  C  C     . ASN A 1 164  ? -1.282  35.457  7.073   1.00 86.70  ?  152  ASN A C     1 
ATOM   1141  O  O     . ASN A 1 164  ? -0.575  36.454  6.891   1.00 89.17  ?  152  ASN A O     1 
ATOM   1142  C  CB    . ASN A 1 164  ? -3.161  36.146  8.565   1.00 87.50  ?  152  ASN A CB    1 
ATOM   1143  C  CG    . ASN A 1 164  ? -4.548  36.757  8.606   1.00 83.17  ?  152  ASN A CG    1 
ATOM   1144  O  OD1   . ASN A 1 164  ? -5.339  36.587  7.680   1.00 84.13  ?  152  ASN A OD1   1 
ATOM   1145  N  ND2   . ASN A 1 164  ? -4.848  37.476  9.682   1.00 72.00  ?  152  ASN A ND2   1 
ATOM   1146  N  N     . ARG A 1 165  ? -0.775  34.228  7.191   1.00 90.99  ?  153  ARG A N     1 
ATOM   1147  C  CA    . ARG A 1 165  ? 0.648   33.983  6.990   1.00 92.06  ?  153  ARG A CA    1 
ATOM   1148  C  C     . ARG A 1 165  ? 1.023   34.012  5.515   1.00 87.44  ?  153  ARG A C     1 
ATOM   1149  O  O     . ARG A 1 165  ? 2.131   34.438  5.169   1.00 84.72  ?  153  ARG A O     1 
ATOM   1150  C  CB    . ARG A 1 165  ? 1.044   32.641  7.609   1.00 92.65  ?  153  ARG A CB    1 
ATOM   1151  C  CG    . ARG A 1 165  ? 0.888   32.574  9.121   1.00 92.04  ?  153  ARG A CG    1 
ATOM   1152  C  CD    . ARG A 1 165  ? 1.907   33.458  9.824   1.00 96.33  ?  153  ARG A CD    1 
ATOM   1153  N  NE    . ARG A 1 165  ? 3.276   33.016  9.573   1.00 109.46 ?  153  ARG A NE    1 
ATOM   1154  C  CZ    . ARG A 1 165  ? 4.356   33.582  10.104  1.00 112.05 ?  153  ARG A CZ    1 
ATOM   1155  N  NH1   . ARG A 1 165  ? 4.232   34.618  10.923  1.00 104.59 ?  153  ARG A NH1   1 
ATOM   1156  N  NH2   . ARG A 1 165  ? 5.562   33.110  9.818   1.00 110.09 ?  153  ARG A NH2   1 
ATOM   1157  N  N     . ALA A 1 166  ? 0.120   33.569  4.637   1.00 96.64  ?  154  ALA A N     1 
ATOM   1158  C  CA    . ALA A 1 166  ? 0.396   33.595  3.205   1.00 96.16  ?  154  ALA A CA    1 
ATOM   1159  C  C     . ALA A 1 166  ? 0.196   34.988  2.621   1.00 93.74  ?  154  ALA A C     1 
ATOM   1160  O  O     . ALA A 1 166  ? 0.974   35.422  1.764   1.00 89.02  ?  154  ALA A O     1 
ATOM   1161  C  CB    . ALA A 1 166  ? -0.491  32.582  2.479   1.00 89.71  ?  154  ALA A CB    1 
ATOM   1162  N  N     . SER A 1 167  ? -0.836  35.696  3.065   1.00 90.19  ?  155  SER A N     1 
ATOM   1163  C  CA    . SER A 1 167  ? -1.077  37.060  2.624   1.00 85.10  ?  155  SER A CA    1 
ATOM   1164  C  C     . SER A 1 167  ? -0.308  38.048  3.496   1.00 90.55  ?  155  SER A C     1 
ATOM   1165  O  O     . SER A 1 167  ? 0.273   37.696  4.524   1.00 97.14  ?  155  SER A O     1 
ATOM   1166  C  CB    . SER A 1 167  ? -2.572  37.381  2.654   1.00 87.41  ?  155  SER A CB    1 
ATOM   1167  O  OG    . SER A 1 167  ? -3.271  36.674  1.646   1.00 80.58  ?  155  SER A OG    1 
ATOM   1168  N  N     . GLY A 1 168  ? -0.307  39.305  3.065   1.00 100.63 ?  156  GLY A N     1 
ATOM   1169  C  CA    . GLY A 1 168  ? 0.247   40.391  3.841   1.00 99.04  ?  156  GLY A CA    1 
ATOM   1170  C  C     . GLY A 1 168  ? -0.726  41.015  4.814   1.00 90.90  ?  156  GLY A C     1 
ATOM   1171  O  O     . GLY A 1 168  ? -0.396  42.026  5.442   1.00 91.41  ?  156  GLY A O     1 
ATOM   1172  N  N     . ALA A 1 169  ? -1.918  40.441  4.956   1.00 75.19  ?  157  ALA A N     1 
ATOM   1173  C  CA    . ALA A 1 169  ? -2.924  40.997  5.849   1.00 76.95  ?  157  ALA A CA    1 
ATOM   1174  C  C     . ALA A 1 169  ? -2.468  40.892  7.297   1.00 69.21  ?  157  ALA A C     1 
ATOM   1175  O  O     . ALA A 1 169  ? -1.881  39.889  7.713   1.00 69.71  ?  157  ALA A O     1 
ATOM   1176  C  CB    . ALA A 1 169  ? -4.259  40.276  5.663   1.00 73.46  ?  157  ALA A CB    1 
ATOM   1177  N  N     . GLU A 1 170  ? -2.742  41.938  8.065   1.00 73.90  ?  158  GLU A N     1 
ATOM   1178  C  CA    . GLU A 1 170  ? -2.329  41.999  9.458   1.00 72.33  ?  158  GLU A CA    1 
ATOM   1179  C  C     . GLU A 1 170  ? -3.440  41.421  10.339  1.00 60.70  ?  158  GLU A C     1 
ATOM   1180  O  O     . GLU A 1 170  ? -4.338  40.724  9.855   1.00 61.54  ?  158  GLU A O     1 
ATOM   1181  C  CB    . GLU A 1 170  ? -1.935  43.434  9.812   1.00 76.76  ?  158  GLU A CB    1 
ATOM   1182  C  CG    . GLU A 1 170  ? -0.531  43.804  9.342   1.00 75.05  ?  158  GLU A CG    1 
ATOM   1183  C  CD    . GLU A 1 170  ? -0.266  45.296  9.380   1.00 95.13  ?  158  GLU A CD    1 
ATOM   1184  O  OE1   . GLU A 1 170  ? -1.181  46.069  9.027   1.00 103.73 ?  158  GLU A OE1   1 
ATOM   1185  O  OE2   . GLU A 1 170  ? 0.855   45.697  9.760   1.00 102.03 ?  158  GLU A OE2   1 
ATOM   1186  N  N     . ILE A 1 171  ? -3.394  41.708  11.641  1.00 39.01  ?  159  ILE A N     1 
ATOM   1187  C  CA    . ILE A 1 171  ? -4.214  40.974  12.601  1.00 40.50  ?  159  ILE A CA    1 
ATOM   1188  C  C     . ILE A 1 171  ? -5.694  41.296  12.422  1.00 37.38  ?  159  ILE A C     1 
ATOM   1189  O  O     . ILE A 1 171  ? -6.551  40.412  12.543  1.00 43.53  ?  159  ILE A O     1 
ATOM   1190  C  CB    . ILE A 1 171  ? -3.737  41.266  14.037  1.00 36.63  ?  159  ILE A CB    1 
ATOM   1191  C  CG1   . ILE A 1 171  ? -2.516  40.408  14.388  1.00 31.51  ?  159  ILE A CG1   1 
ATOM   1192  C  CG2   . ILE A 1 171  ? -4.860  41.053  15.046  1.00 32.16  ?  159  ILE A CG2   1 
ATOM   1193  C  CD1   . ILE A 1 171  ? -1.215  40.882  13.772  1.00 37.71  ?  159  ILE A CD1   1 
ATOM   1194  N  N     . GLY A 1 172  ? -6.018  42.554  12.114  1.00 30.69  ?  160  GLY A N     1 
ATOM   1195  C  CA    . GLY A 1 172  ? -7.409  42.975  12.114  1.00 38.50  ?  160  GLY A CA    1 
ATOM   1196  C  C     . GLY A 1 172  ? -8.254  42.346  11.025  1.00 40.78  ?  160  GLY A C     1 
ATOM   1197  O  O     . GLY A 1 172  ? -9.475  42.242  11.172  1.00 27.12  ?  160  GLY A O     1 
ATOM   1198  N  N     . ARG A 1 173  ? -7.633  41.919  9.930   1.00 40.31  ?  161  ARG A N     1 
ATOM   1199  C  CA    . ARG A 1 173  ? -8.376  41.414  8.785   1.00 31.58  ?  161  ARG A CA    1 
ATOM   1200  C  C     . ARG A 1 173  ? -8.861  39.992  9.035   1.00 23.62  ?  161  ARG A C     1 
ATOM   1201  O  O     . ARG A 1 173  ? -8.123  39.147  9.552   1.00 31.85  ?  161  ARG A O     1 
ATOM   1202  C  CB    . ARG A 1 173  ? -7.509  41.466  7.527   1.00 38.59  ?  161  ARG A CB    1 
ATOM   1203  C  CG    . ARG A 1 173  ? -8.192  40.920  6.282   1.00 37.23  ?  161  ARG A CG    1 
ATOM   1204  C  CD    . ARG A 1 173  ? -7.764  41.673  5.032   1.00 38.18  ?  161  ARG A CD    1 
ATOM   1205  N  NE    . ARG A 1 173  ? -8.395  42.988  4.939   1.00 43.71  ?  161  ARG A NE    1 
ATOM   1206  C  CZ    . ARG A 1 173  ? -7.821  44.125  5.320   1.00 56.80  ?  161  ARG A CZ    1 
ATOM   1207  N  NH1   . ARG A 1 173  ? -6.594  44.116  5.824   1.00 69.14  ?  161  ARG A NH1   1 
ATOM   1208  N  NH2   . ARG A 1 173  ? -8.473  45.272  5.195   1.00 53.70  ?  161  ARG A NH2   1 
ATOM   1209  N  N     . ILE A 1 174  ? -10.111 39.735  8.663   1.00 16.84  ?  162  ILE A N     1 
ATOM   1210  C  CA    . ILE A 1 174  ? -10.729 38.425  8.846   1.00 16.94  ?  162  ILE A CA    1 
ATOM   1211  C  C     . ILE A 1 174  ? -10.988 37.792  7.484   1.00 23.55  ?  162  ILE A C     1 
ATOM   1212  O  O     . ILE A 1 174  ? -11.921 38.203  6.778   1.00 31.74  ?  162  ILE A O     1 
ATOM   1213  C  CB    . ILE A 1 174  ? -12.031 38.531  9.654   1.00 15.93  ?  162  ILE A CB    1 
ATOM   1214  C  CG1   . ILE A 1 174  ? -11.750 39.059  11.060  1.00 22.19  ?  162  ILE A CG1   1 
ATOM   1215  C  CG2   . ILE A 1 174  ? -12.716 37.186  9.721   1.00 22.31  ?  162  ILE A CG2   1 
ATOM   1216  C  CD1   . ILE A 1 174  ? -12.980 39.113  11.937  1.00 20.19  ?  162  ILE A CD1   1 
ATOM   1217  N  N     . PRO A 1 175  ? -10.194 36.807  7.070   1.00 25.98  ?  163  PRO A N     1 
ATOM   1218  C  CA    . PRO A 1 175  ? -10.454 36.144  5.787   1.00 20.60  ?  163  PRO A CA    1 
ATOM   1219  C  C     . PRO A 1 175  ? -11.696 35.268  5.849   1.00 29.05  ?  163  PRO A C     1 
ATOM   1220  O  O     . PRO A 1 175  ? -11.995 34.648  6.872   1.00 34.85  ?  163  PRO A O     1 
ATOM   1221  C  CB    . PRO A 1 175  ? -9.192  35.304  5.555   1.00 21.36  ?  163  PRO A CB    1 
ATOM   1222  C  CG    . PRO A 1 175  ? -8.159  35.895  6.461   1.00 37.38  ?  163  PRO A CG    1 
ATOM   1223  C  CD    . PRO A 1 175  ? -8.908  36.395  7.653   1.00 34.86  ?  163  PRO A CD    1 
ATOM   1224  N  N     . VAL A 1 176  ? -12.421 35.223  4.732   1.00 29.94  ?  164  VAL A N     1 
ATOM   1225  C  CA    . VAL A 1 176  ? -13.629 34.420  4.595   1.00 28.94  ?  164  VAL A CA    1 
ATOM   1226  C  C     . VAL A 1 176  ? -13.505 33.580  3.331   1.00 29.27  ?  164  VAL A C     1 
ATOM   1227  O  O     . VAL A 1 176  ? -12.840 33.972  2.367   1.00 32.88  ?  164  VAL A O     1 
ATOM   1228  C  CB    . VAL A 1 176  ? -14.904 35.298  4.543   1.00 29.20  ?  164  VAL A CB    1 
ATOM   1229  C  CG1   . VAL A 1 176  ? -16.162 34.441  4.624   1.00 44.42  ?  164  VAL A CG1   1 
ATOM   1230  C  CG2   . VAL A 1 176  ? -14.891 36.336  5.655   1.00 23.90  ?  164  VAL A CG2   1 
ATOM   1231  N  N     . ASP A 1 177  ? -14.139 32.409  3.345   1.00 24.59  ?  165  ASP A N     1 
ATOM   1232  C  CA    . ASP A 1 177  ? -14.213 31.594  2.141   1.00 23.76  ?  165  ASP A CA    1 
ATOM   1233  C  C     . ASP A 1 177  ? -14.953 32.348  1.042   1.00 30.48  ?  165  ASP A C     1 
ATOM   1234  O  O     . ASP A 1 177  ? -15.877 33.124  1.303   1.00 37.55  ?  165  ASP A O     1 
ATOM   1235  C  CB    . ASP A 1 177  ? -14.915 30.268  2.433   1.00 33.61  ?  165  ASP A CB    1 
ATOM   1236  C  CG    . ASP A 1 177  ? -14.270 29.504  3.572   1.00 38.01  ?  165  ASP A CG    1 
ATOM   1237  O  OD1   . ASP A 1 177  ? -13.027 29.544  3.689   1.00 38.04  ?  165  ASP A OD1   1 
ATOM   1238  O  OD2   . ASP A 1 177  ? -15.008 28.866  4.352   1.00 41.14  ?  165  ASP A OD2   1 
ATOM   1239  N  N     . SER A 1 178  ? -14.537 32.118  -0.200  1.00 28.44  ?  166  SER A N     1 
ATOM   1240  C  CA    . SER A 1 178  ? -15.094 32.809  -1.355  1.00 19.86  ?  166  SER A CA    1 
ATOM   1241  C  C     . SER A 1 178  ? -15.770 31.796  -2.268  1.00 23.41  ?  166  SER A C     1 
ATOM   1242  O  O     . SER A 1 178  ? -15.140 30.824  -2.697  1.00 27.49  ?  166  SER A O     1 
ATOM   1243  C  CB    . SER A 1 178  ? -14.007 33.576  -2.112  1.00 21.62  ?  166  SER A CB    1 
ATOM   1244  O  OG    . SER A 1 178  ? -13.356 34.507  -1.264  1.00 34.28  ?  166  SER A OG    1 
ATOM   1245  N  N     . ILE A 1 179  ? -17.049 32.027  -2.559  1.00 30.56  ?  167  ILE A N     1 
ATOM   1246  C  CA    . ILE A 1 179  ? -17.800 31.197  -3.493  1.00 22.83  ?  167  ILE A CA    1 
ATOM   1247  C  C     . ILE A 1 179  ? -18.093 32.020  -4.740  1.00 24.25  ?  167  ILE A C     1 
ATOM   1248  O  O     . ILE A 1 179  ? -19.095 32.742  -4.799  1.00 23.60  ?  167  ILE A O     1 
ATOM   1249  C  CB    . ILE A 1 179  ? -19.098 30.669  -2.857  1.00 25.62  ?  167  ILE A CB    1 
ATOM   1250  C  CG1   . ILE A 1 179  ? -18.816 30.103  -1.464  1.00 31.01  ?  167  ILE A CG1   1 
ATOM   1251  C  CG2   . ILE A 1 179  ? -19.732 29.608  -3.743  1.00 27.97  ?  167  ILE A CG2   1 
ATOM   1252  C  CD1   . ILE A 1 179  ? -20.051 29.609  -0.746  1.00 30.05  ?  167  ILE A CD1   1 
ATOM   1253  N  N     . TYR A 1 180  ? -17.222 31.919  -5.743  1.00 32.06  ?  168  TYR A N     1 
ATOM   1254  C  CA    . TYR A 1 180  ? -17.315 32.756  -6.933  1.00 27.16  ?  168  TYR A CA    1 
ATOM   1255  C  C     . TYR A 1 180  ? -18.312 32.245  -7.966  1.00 32.89  ?  168  TYR A C     1 
ATOM   1256  O  O     . TYR A 1 180  ? -18.503 32.911  -8.989  1.00 36.91  ?  168  TYR A O     1 
ATOM   1257  C  CB    . TYR A 1 180  ? -15.946 32.883  -7.604  1.00 22.73  ?  168  TYR A CB    1 
ATOM   1258  C  CG    . TYR A 1 180  ? -14.891 33.600  -6.795  1.00 24.80  ?  168  TYR A CG    1 
ATOM   1259  C  CD1   . TYR A 1 180  ? -15.055 34.927  -6.421  1.00 30.99  ?  168  TYR A CD1   1 
ATOM   1260  C  CD2   . TYR A 1 180  ? -13.714 32.959  -6.435  1.00 27.13  ?  168  TYR A CD2   1 
ATOM   1261  C  CE1   . TYR A 1 180  ? -14.084 35.588  -5.691  1.00 27.51  ?  168  TYR A CE1   1 
ATOM   1262  C  CE2   . TYR A 1 180  ? -12.739 33.611  -5.710  1.00 24.01  ?  168  TYR A CE2   1 
ATOM   1263  C  CZ    . TYR A 1 180  ? -12.928 34.924  -5.339  1.00 22.80  ?  168  TYR A CZ    1 
ATOM   1264  O  OH    . TYR A 1 180  ? -11.955 35.572  -4.614  1.00 30.98  ?  168  TYR A OH    1 
ATOM   1265  N  N     . SER A 1 181  ? -18.944 31.094  -7.742  1.00 27.94  ?  169  SER A N     1 
ATOM   1266  C  CA    . SER A 1 181  ? -19.755 30.706  -8.891  1.00 24.24  ?  169  SER A CA    1 
ATOM   1267  C  C     . SER A 1 181  ? -21.125 31.378  -8.835  1.00 23.29  ?  169  SER A C     1 
ATOM   1268  O  O     . SER A 1 181  ? -21.764 31.398  -7.779  1.00 24.25  ?  169  SER A O     1 
ATOM   1269  C  CB    . SER A 1 181  ? -19.931 29.192  -8.945  1.00 37.73  ?  169  SER A CB    1 
ATOM   1270  O  OG    . SER A 1 181  ? -20.513 28.793  -10.174 1.00 30.34  ?  169  SER A OG    1 
ATOM   1271  N  N     . PRO A 1 182  ? -21.591 31.935  -9.956  1.00 26.67  ?  170  PRO A N     1 
ATOM   1272  C  CA    . PRO A 1 182  ? -22.893 32.609  -9.974  1.00 25.52  ?  170  PRO A CA    1 
ATOM   1273  C  C     . PRO A 1 182  ? -24.072 31.714  -10.319 1.00 25.00  ?  170  PRO A C     1 
ATOM   1274  O  O     . PRO A 1 182  ? -25.219 32.164  -10.185 1.00 30.27  ?  170  PRO A O     1 
ATOM   1275  C  CB    . PRO A 1 182  ? -22.704 33.690  -11.060 1.00 16.54  ?  170  PRO A CB    1 
ATOM   1276  C  CG    . PRO A 1 182  ? -21.356 33.394  -11.726 1.00 19.49  ?  170  PRO A CG    1 
ATOM   1277  C  CD    . PRO A 1 182  ? -20.907 32.050  -11.251 1.00 24.95  ?  170  PRO A CD    1 
ATOM   1278  N  N     . VAL A 1 183  ? -23.835 30.481  -10.757 1.00 27.74  ?  171  VAL A N     1 
ATOM   1279  C  CA    . VAL A 1 183  ? -24.910 29.561  -11.109 1.00 33.43  ?  171  VAL A CA    1 
ATOM   1280  C  C     . VAL A 1 183  ? -25.348 28.819  -9.855  1.00 36.04  ?  171  VAL A C     1 
ATOM   1281  O  O     . VAL A 1 183  ? -24.535 28.525  -8.968  1.00 37.66  ?  171  VAL A O     1 
ATOM   1282  C  CB    . VAL A 1 183  ? -24.464 28.594  -12.226 1.00 31.22  ?  171  VAL A CB    1 
ATOM   1283  C  CG1   . VAL A 1 183  ? -23.116 29.021  -12.790 1.00 25.77  ?  171  VAL A CG1   1 
ATOM   1284  C  CG2   . VAL A 1 183  ? -24.418 27.152  -11.736 1.00 34.53  ?  171  VAL A CG2   1 
ATOM   1285  N  N     . LEU A 1 184  ? -26.646 28.530  -9.767  1.00 31.16  ?  172  LEU A N     1 
ATOM   1286  C  CA    . LEU A 1 184  ? -27.237 27.935  -8.575  1.00 29.88  ?  172  LEU A CA    1 
ATOM   1287  C  C     . LEU A 1 184  ? -27.571 26.460  -8.753  1.00 38.69  ?  172  LEU A C     1 
ATOM   1288  O  O     . LEU A 1 184  ? -27.242 25.642  -7.888  1.00 48.66  ?  172  LEU A O     1 
ATOM   1289  C  CB    . LEU A 1 184  ? -28.499 28.710  -8.178  1.00 26.83  ?  172  LEU A CB    1 
ATOM   1290  C  CG    . LEU A 1 184  ? -29.215 28.256  -6.904  1.00 32.02  ?  172  LEU A CG    1 
ATOM   1291  C  CD1   . LEU A 1 184  ? -28.327 28.457  -5.685  1.00 39.53  ?  172  LEU A CD1   1 
ATOM   1292  C  CD2   . LEU A 1 184  ? -30.536 28.991  -6.738  1.00 30.43  ?  172  LEU A CD2   1 
ATOM   1293  N  N     . LYS A 1 185  ? -28.220 26.100  -9.859  1.00 35.96  ?  173  LYS A N     1 
ATOM   1294  C  CA    . LYS A 1 185  ? -28.677 24.731  -10.058 1.00 35.07  ?  173  LYS A CA    1 
ATOM   1295  C  C     . LYS A 1 185  ? -28.817 24.469  -11.550 1.00 38.76  ?  173  LYS A C     1 
ATOM   1296  O  O     . LYS A 1 185  ? -29.485 25.232  -12.254 1.00 38.84  ?  173  LYS A O     1 
ATOM   1297  C  CB    . LYS A 1 185  ? -30.009 24.497  -9.338  1.00 30.50  ?  173  LYS A CB    1 
ATOM   1298  C  CG    . LYS A 1 185  ? -30.467 23.053  -9.313  1.00 36.37  ?  173  LYS A CG    1 
ATOM   1299  C  CD    . LYS A 1 185  ? -31.488 22.842  -8.209  1.00 34.11  ?  173  LYS A CD    1 
ATOM   1300  C  CE    . LYS A 1 185  ? -30.903 23.217  -6.854  1.00 62.47  ?  173  LYS A CE    1 
ATOM   1301  N  NZ    . LYS A 1 185  ? -31.862 22.988  -5.738  1.00 64.76  ?  173  LYS A NZ    1 
ATOM   1302  N  N     . VAL A 1 186  ? -28.187 23.395  -12.024 1.00 36.63  ?  174  VAL A N     1 
ATOM   1303  C  CA    . VAL A 1 186  ? -28.178 23.040  -13.438 1.00 26.34  ?  174  VAL A CA    1 
ATOM   1304  C  C     . VAL A 1 186  ? -28.566 21.574  -13.574 1.00 32.20  ?  174  VAL A C     1 
ATOM   1305  O  O     . VAL A 1 186  ? -28.036 20.718  -12.857 1.00 38.32  ?  174  VAL A O     1 
ATOM   1306  C  CB    . VAL A 1 186  ? -26.802 23.296  -14.084 1.00 25.69  ?  174  VAL A CB    1 
ATOM   1307  C  CG1   . VAL A 1 186  ? -26.809 22.869  -15.543 1.00 26.23  ?  174  VAL A CG1   1 
ATOM   1308  C  CG2   . VAL A 1 186  ? -26.416 24.762  -13.958 1.00 28.83  ?  174  VAL A CG2   1 
ATOM   1309  N  N     . THR A 1 187  ? -29.488 21.289  -14.492 1.00 34.22  ?  175  THR A N     1 
ATOM   1310  C  CA    . THR A 1 187  ? -29.898 19.924  -14.790 1.00 34.34  ?  175  THR A CA    1 
ATOM   1311  C  C     . THR A 1 187  ? -30.222 19.831  -16.275 1.00 27.89  ?  175  THR A C     1 
ATOM   1312  O  O     . THR A 1 187  ? -30.165 20.823  -17.007 1.00 25.53  ?  175  THR A O     1 
ATOM   1313  C  CB    . THR A 1 187  ? -31.097 19.498  -13.939 1.00 27.77  ?  175  THR A CB    1 
ATOM   1314  O  OG1   . THR A 1 187  ? -31.384 18.113  -14.171 1.00 30.41  ?  175  THR A OG1   1 
ATOM   1315  C  CG2   . THR A 1 187  ? -32.322 20.327  -14.284 1.00 35.41  ?  175  THR A CG2   1 
ATOM   1316  N  N     . TYR A 1 188  ? -30.570 18.625  -16.719 1.00 28.05  ?  176  TYR A N     1 
ATOM   1317  C  CA    . TYR A 1 188  ? -30.916 18.415  -18.117 1.00 32.95  ?  176  TYR A CA    1 
ATOM   1318  C  C     . TYR A 1 188  ? -31.730 17.138  -18.255 1.00 35.21  ?  176  TYR A C     1 
ATOM   1319  O  O     . TYR A 1 188  ? -31.676 16.244  -17.405 1.00 31.04  ?  176  TYR A O     1 
ATOM   1320  C  CB    . TYR A 1 188  ? -29.668 18.354  -19.007 1.00 24.47  ?  176  TYR A CB    1 
ATOM   1321  C  CG    . TYR A 1 188  ? -28.638 17.338  -18.565 1.00 23.32  ?  176  TYR A CG    1 
ATOM   1322  C  CD1   . TYR A 1 188  ? -28.746 16.003  -18.934 1.00 27.45  ?  176  TYR A CD1   1 
ATOM   1323  C  CD2   . TYR A 1 188  ? -27.553 17.716  -17.786 1.00 28.41  ?  176  TYR A CD2   1 
ATOM   1324  C  CE1   . TYR A 1 188  ? -27.807 15.072  -18.533 1.00 28.83  ?  176  TYR A CE1   1 
ATOM   1325  C  CE2   . TYR A 1 188  ? -26.608 16.793  -17.381 1.00 29.97  ?  176  TYR A CE2   1 
ATOM   1326  C  CZ    . TYR A 1 188  ? -26.740 15.473  -17.758 1.00 28.78  ?  176  TYR A CZ    1 
ATOM   1327  O  OH    . TYR A 1 188  ? -25.802 14.551  -17.358 1.00 29.97  ?  176  TYR A OH    1 
ATOM   1328  N  N     . LYS A 1 189  ? -32.490 17.073  -19.345 1.00 40.95  ?  177  LYS A N     1 
ATOM   1329  C  CA    . LYS A 1 189  ? -33.209 15.875  -19.748 1.00 43.41  ?  177  LYS A CA    1 
ATOM   1330  C  C     . LYS A 1 189  ? -33.185 15.796  -21.266 1.00 43.12  ?  177  LYS A C     1 
ATOM   1331  O  O     . LYS A 1 189  ? -33.117 16.819  -21.951 1.00 39.45  ?  177  LYS A O     1 
ATOM   1332  C  CB    . LYS A 1 189  ? -34.659 15.874  -19.242 1.00 37.35  ?  177  LYS A CB    1 
ATOM   1333  C  CG    . LYS A 1 189  ? -35.522 16.982  -19.830 1.00 39.98  ?  177  LYS A CG    1 
ATOM   1334  C  CD    . LYS A 1 189  ? -36.998 16.753  -19.543 1.00 57.05  ?  177  LYS A CD    1 
ATOM   1335  C  CE    . LYS A 1 189  ? -37.293 16.814  -18.054 1.00 77.67  ?  177  LYS A CE    1 
ATOM   1336  N  NZ    . LYS A 1 189  ? -37.026 18.166  -17.491 1.00 81.68  ?  177  LYS A NZ    1 
ATOM   1337  N  N     . VAL A 1 190  ? -33.227 14.574  -21.790 1.00 45.09  ?  178  VAL A N     1 
ATOM   1338  C  CA    . VAL A 1 190  ? -33.239 14.371  -23.233 1.00 41.47  ?  178  VAL A CA    1 
ATOM   1339  C  C     . VAL A 1 190  ? -34.458 13.542  -23.608 1.00 48.87  ?  178  VAL A C     1 
ATOM   1340  O  O     . VAL A 1 190  ? -34.971 12.750  -22.810 1.00 55.24  ?  178  VAL A O     1 
ATOM   1341  C  CB    . VAL A 1 190  ? -31.942 13.702  -23.749 1.00 36.72  ?  178  VAL A CB    1 
ATOM   1342  C  CG1   . VAL A 1 190  ? -30.713 14.353  -23.126 1.00 40.62  ?  178  VAL A CG1   1 
ATOM   1343  C  CG2   . VAL A 1 190  ? -31.962 12.204  -23.494 1.00 35.33  ?  178  VAL A CG2   1 
ATOM   1344  N  N     . ASP A 1 191  ? -34.931 13.748  -24.835 1.00 51.67  ?  179  ASP A N     1 
ATOM   1345  C  CA    . ASP A 1 191  ? -36.033 12.984  -25.410 1.00 61.23  ?  179  ASP A CA    1 
ATOM   1346  C  C     . ASP A 1 191  ? -35.492 12.224  -26.613 1.00 59.70  ?  179  ASP A C     1 
ATOM   1347  O  O     . ASP A 1 191  ? -35.179 12.827  -27.646 1.00 54.47  ?  179  ASP A O     1 
ATOM   1348  C  CB    . ASP A 1 191  ? -37.192 13.896  -25.810 1.00 67.56  ?  179  ASP A CB    1 
ATOM   1349  C  CG    . ASP A 1 191  ? -37.885 14.518  -24.614 1.00 71.42  ?  179  ASP A CG    1 
ATOM   1350  O  OD1   . ASP A 1 191  ? -37.241 15.312  -23.898 1.00 65.11  ?  179  ASP A OD1   1 
ATOM   1351  O  OD2   . ASP A 1 191  ? -39.076 14.213  -24.392 1.00 76.53  ?  179  ASP A OD2   1 
ATOM   1352  N  N     . ALA A 1 192  ? -35.378 10.906  -26.478 1.00 72.43  ?  180  ALA A N     1 
ATOM   1353  C  CA    . ALA A 1 192  ? -34.853 10.061  -27.540 1.00 73.07  ?  180  ALA A CA    1 
ATOM   1354  C  C     . ALA A 1 192  ? -35.988 9.592   -28.440 1.00 89.80  ?  180  ALA A C     1 
ATOM   1355  O  O     . ALA A 1 192  ? -37.012 9.098   -27.955 1.00 90.36  ?  180  ALA A O     1 
ATOM   1356  C  CB    . ALA A 1 192  ? -34.110 8.859   -26.956 1.00 71.38  ?  180  ALA A CB    1 
ATOM   1357  N  N     . THR A 1 193  ? -35.805 9.752   -29.748 1.00 77.29  ?  181  THR A N     1 
ATOM   1358  C  CA    . THR A 1 193  ? -36.772 9.291   -30.743 1.00 74.56  ?  181  THR A CA    1 
ATOM   1359  C  C     . THR A 1 193  ? -36.319 7.908   -31.199 1.00 77.02  ?  181  THR A C     1 
ATOM   1360  O  O     . THR A 1 193  ? -35.564 7.763   -32.161 1.00 75.84  ?  181  THR A O     1 
ATOM   1361  C  CB    . THR A 1 193  ? -36.872 10.274  -31.905 1.00 72.12  ?  181  THR A CB    1 
ATOM   1362  O  OG1   . THR A 1 193  ? -37.215 11.572  -31.402 1.00 68.85  ?  181  THR A OG1   1 
ATOM   1363  C  CG2   . THR A 1 193  ? -37.939 9.826   -32.893 1.00 78.16  ?  181  THR A CG2   1 
ATOM   1364  N  N     . ARG A 1 194  ? -36.783 6.880   -30.488 1.00 87.54  ?  182  ARG A N     1 
ATOM   1365  C  CA    . ARG A 1 194  ? -36.386 5.503   -30.746 1.00 93.25  ?  182  ARG A CA    1 
ATOM   1366  C  C     . ARG A 1 194  ? -37.363 4.769   -31.657 1.00 100.28 ?  182  ARG A C     1 
ATOM   1367  O  O     . ARG A 1 194  ? -37.373 3.531   -31.672 1.00 107.42 ?  182  ARG A O     1 
ATOM   1368  C  CB    . ARG A 1 194  ? -36.222 4.745   -29.426 1.00 95.00  ?  182  ARG A CB    1 
ATOM   1369  C  CG    . ARG A 1 194  ? -34.780 4.401   -29.101 1.00 84.84  ?  182  ARG A CG    1 
ATOM   1370  C  CD    . ARG A 1 194  ? -33.892 5.633   -29.173 1.00 78.81  ?  182  ARG A CD    1 
ATOM   1371  N  NE    . ARG A 1 194  ? -32.474 5.290   -29.108 1.00 76.02  ?  182  ARG A NE    1 
ATOM   1372  C  CZ    . ARG A 1 194  ? -31.487 6.175   -29.195 1.00 71.81  ?  182  ARG A CZ    1 
ATOM   1373  N  NH1   . ARG A 1 194  ? -30.225 5.774   -29.126 1.00 67.45  ?  182  ARG A NH1   1 
ATOM   1374  N  NH2   . ARG A 1 194  ? -31.762 7.463   -29.350 1.00 58.33  ?  182  ARG A NH2   1 
ATOM   1375  N  N     . VAL A 1 195  ? -38.184 5.505   -32.408 1.00 101.29 ?  183  VAL A N     1 
ATOM   1376  C  CA    . VAL A 1 195  ? -39.071 4.868   -33.374 1.00 102.69 ?  183  VAL A CA    1 
ATOM   1377  C  C     . VAL A 1 195  ? -38.222 4.206   -34.448 1.00 108.05 ?  183  VAL A C     1 
ATOM   1378  O  O     . VAL A 1 195  ? -37.479 4.877   -35.175 1.00 98.94  ?  183  VAL A O     1 
ATOM   1379  C  CB    . VAL A 1 195  ? -40.046 5.887   -33.969 1.00 97.84  ?  183  VAL A CB    1 
ATOM   1380  C  CG1   . VAL A 1 195  ? -40.850 5.256   -35.095 1.00 114.43 ?  183  VAL A CG1   1 
ATOM   1381  C  CG2   . VAL A 1 195  ? -40.969 6.426   -32.889 1.00 91.53  ?  183  VAL A CG2   1 
ATOM   1382  N  N     . GLU A 1 196  ? -38.315 2.878   -34.539 1.00 111.88 ?  184  GLU A N     1 
ATOM   1383  C  CA    . GLU A 1 196  ? -37.518 2.108   -35.488 1.00 108.23 ?  184  GLU A CA    1 
ATOM   1384  C  C     . GLU A 1 196  ? -37.787 2.563   -36.916 1.00 107.00 ?  184  GLU A C     1 
ATOM   1385  O  O     . GLU A 1 196  ? -38.748 2.117   -37.550 1.00 102.16 ?  184  GLU A O     1 
ATOM   1386  C  CB    . GLU A 1 196  ? -37.805 0.614   -35.333 1.00 110.40 ?  184  GLU A CB    1 
ATOM   1387  C  CG    . GLU A 1 196  ? -37.439 0.058   -33.965 1.00 110.78 ?  184  GLU A CG    1 
ATOM   1388  C  CD    . GLU A 1 196  ? -37.821 -1.399  -33.800 1.00 113.12 ?  184  GLU A CD    1 
ATOM   1389  O  OE1   . GLU A 1 196  ? -38.373 -1.982  -34.757 1.00 113.12 ?  184  GLU A OE1   1 
ATOM   1390  O  OE2   . GLU A 1 196  ? -37.572 -1.960  -32.713 1.00 109.06 ?  184  GLU A OE2   1 
ATOM   1391  N  N     . GLN A 1 197  ? -36.938 3.451   -37.421 1.00 104.82 ?  185  GLN A N     1 
ATOM   1392  C  CA    . GLN A 1 197  ? -37.095 4.027   -38.749 1.00 103.24 ?  185  GLN A CA    1 
ATOM   1393  C  C     . GLN A 1 197  ? -35.747 4.609   -39.157 1.00 104.10 ?  185  GLN A C     1 
ATOM   1394  O  O     . GLN A 1 197  ? -34.769 4.537   -38.409 1.00 100.47 ?  185  GLN A O     1 
ATOM   1395  C  CB    . GLN A 1 197  ? -38.208 5.080   -38.761 1.00 100.10 ?  185  GLN A CB    1 
ATOM   1396  C  CG    . GLN A 1 197  ? -38.850 5.310   -40.117 1.00 95.30  ?  185  GLN A CG    1 
ATOM   1397  C  CD    . GLN A 1 197  ? -40.056 6.219   -40.034 1.00 97.02  ?  185  GLN A CD    1 
ATOM   1398  O  OE1   . GLN A 1 197  ? -40.748 6.258   -39.016 1.00 80.91  ?  185  GLN A OE1   1 
ATOM   1399  N  NE2   . GLN A 1 197  ? -40.314 6.961   -41.104 1.00 93.05  ?  185  GLN A NE2   1 
ATOM   1400  N  N     . ARG A 1 198  ? -35.700 5.194   -40.356 1.00 97.18  ?  186  ARG A N     1 
ATOM   1401  C  CA    . ARG A 1 198  ? -34.452 5.749   -40.867 1.00 99.08  ?  186  ARG A CA    1 
ATOM   1402  C  C     . ARG A 1 198  ? -33.978 6.959   -40.072 1.00 97.79  ?  186  ARG A C     1 
ATOM   1403  O  O     . ARG A 1 198  ? -32.807 7.338   -40.186 1.00 95.14  ?  186  ARG A O     1 
ATOM   1404  C  CB    . ARG A 1 198  ? -34.613 6.133   -42.338 1.00 106.04 ?  186  ARG A CB    1 
ATOM   1405  C  CG    . ARG A 1 198  ? -35.733 7.129   -42.597 1.00 109.21 ?  186  ARG A CG    1 
ATOM   1406  C  CD    . ARG A 1 198  ? -35.712 7.620   -44.034 1.00 104.32 ?  186  ARG A CD    1 
ATOM   1407  N  NE    . ARG A 1 198  ? -34.471 8.322   -44.348 1.00 105.12 ?  186  ARG A NE    1 
ATOM   1408  C  CZ    . ARG A 1 198  ? -34.154 8.777   -45.555 1.00 100.12 ?  186  ARG A CZ    1 
ATOM   1409  N  NH1   . ARG A 1 198  ? -34.988 8.604   -46.571 1.00 98.08  ?  186  ARG A NH1   1 
ATOM   1410  N  NH2   . ARG A 1 198  ? -33.002 9.405   -45.748 1.00 87.14  ?  186  ARG A NH2   1 
ATOM   1411  N  N     . THR A 1 199  ? -34.848 7.570   -39.270 1.00 88.82  ?  187  THR A N     1 
ATOM   1412  C  CA    . THR A 1 199  ? -34.538 8.813   -38.575 1.00 88.68  ?  187  THR A CA    1 
ATOM   1413  C  C     . THR A 1 199  ? -34.612 8.599   -37.070 1.00 88.24  ?  187  THR A C     1 
ATOM   1414  O  O     . THR A 1 199  ? -35.688 8.320   -36.531 1.00 83.52  ?  187  THR A O     1 
ATOM   1415  C  CB    . THR A 1 199  ? -35.495 9.929   -38.998 1.00 91.65  ?  187  THR A CB    1 
ATOM   1416  O  OG1   . THR A 1 199  ? -36.844 9.533   -38.722 1.00 84.72  ?  187  THR A OG1   1 
ATOM   1417  C  CG2   . THR A 1 199  ? -35.351 10.221  -40.484 1.00 96.27  ?  187  THR A CG2   1 
ATOM   1418  N  N     . ASP A 1 200  ? -33.468 8.737   -36.400 1.00 89.55  ?  188  ASP A N     1 
ATOM   1419  C  CA    . ASP A 1 200  ? -33.377 8.750   -34.946 1.00 66.27  ?  188  ASP A CA    1 
ATOM   1420  C  C     . ASP A 1 200  ? -32.547 9.951   -34.521 1.00 63.41  ?  188  ASP A C     1 
ATOM   1421  O  O     . ASP A 1 200  ? -31.541 10.273  -35.160 1.00 61.84  ?  188  ASP A O     1 
ATOM   1422  C  CB    . ASP A 1 200  ? -32.741 7.462   -34.400 1.00 65.50  ?  188  ASP A CB    1 
ATOM   1423  C  CG    . ASP A 1 200  ? -33.721 6.307   -34.325 1.00 81.41  ?  188  ASP A CG    1 
ATOM   1424  O  OD1   . ASP A 1 200  ? -34.913 6.509   -34.633 1.00 92.04  ?  188  ASP A OD1   1 
ATOM   1425  O  OD2   . ASP A 1 200  ? -33.296 5.193   -33.952 1.00 84.08  ?  188  ASP A OD2   1 
ATOM   1426  N  N     . PHE A 1 201  ? -32.966 10.612  -33.444 1.00 72.18  ?  189  PHE A N     1 
ATOM   1427  C  CA    . PHE A 1 201  ? -32.241 11.780  -32.961 1.00 59.31  ?  189  PHE A CA    1 
ATOM   1428  C  C     . PHE A 1 201  ? -32.592 12.024  -31.501 1.00 61.17  ?  189  PHE A C     1 
ATOM   1429  O  O     . PHE A 1 201  ? -33.648 11.607  -31.017 1.00 58.31  ?  189  PHE A O     1 
ATOM   1430  C  CB    . PHE A 1 201  ? -32.550 13.024  -33.803 1.00 52.24  ?  189  PHE A CB    1 
ATOM   1431  C  CG    . PHE A 1 201  ? -33.826 13.719  -33.418 1.00 54.60  ?  189  PHE A CG    1 
ATOM   1432  C  CD1   . PHE A 1 201  ? -35.056 13.143  -33.691 1.00 55.11  ?  189  PHE A CD1   1 
ATOM   1433  C  CD2   . PHE A 1 201  ? -33.794 14.956  -32.795 1.00 62.37  ?  189  PHE A CD2   1 
ATOM   1434  C  CE1   . PHE A 1 201  ? -36.230 13.785  -33.341 1.00 50.06  ?  189  PHE A CE1   1 
ATOM   1435  C  CE2   . PHE A 1 201  ? -34.964 15.603  -32.443 1.00 66.03  ?  189  PHE A CE2   1 
ATOM   1436  C  CZ    . PHE A 1 201  ? -36.184 15.016  -32.716 1.00 61.54  ?  189  PHE A CZ    1 
ATOM   1437  N  N     . ASP A 1 202  ? -31.687 12.710  -30.808 1.00 54.20  ?  190  ASP A N     1 
ATOM   1438  C  CA    . ASP A 1 202  ? -31.865 13.083  -29.411 1.00 47.91  ?  190  ASP A CA    1 
ATOM   1439  C  C     . ASP A 1 202  ? -31.987 14.596  -29.301 1.00 45.62  ?  190  ASP A C     1 
ATOM   1440  O  O     . ASP A 1 202  ? -31.215 15.332  -29.924 1.00 37.06  ?  190  ASP A O     1 
ATOM   1441  C  CB    . ASP A 1 202  ? -30.696 12.591  -28.553 1.00 48.68  ?  190  ASP A CB    1 
ATOM   1442  C  CG    . ASP A 1 202  ? -30.712 11.091  -28.347 1.00 55.95  ?  190  ASP A CG    1 
ATOM   1443  O  OD1   . ASP A 1 202  ? -31.621 10.423  -28.882 1.00 67.03  ?  190  ASP A OD1   1 
ATOM   1444  O  OD2   . ASP A 1 202  ? -29.815 10.580  -27.644 1.00 49.18  ?  190  ASP A OD2   1 
ATOM   1445  N  N     . LYS A 1 203  ? -32.951 15.053  -28.508 1.00 50.30  ?  191  LYS A N     1 
ATOM   1446  C  CA    . LYS A 1 203  ? -33.149 16.471  -28.235 1.00 47.88  ?  191  LYS A CA    1 
ATOM   1447  C  C     . LYS A 1 203  ? -32.760 16.748  -26.790 1.00 52.83  ?  191  LYS A C     1 
ATOM   1448  O  O     . LYS A 1 203  ? -33.350 16.180  -25.866 1.00 58.04  ?  191  LYS A O     1 
ATOM   1449  C  CB    . LYS A 1 203  ? -34.598 16.886  -28.491 1.00 50.30  ?  191  LYS A CB    1 
ATOM   1450  C  CG    . LYS A 1 203  ? -34.918 18.303  -28.036 1.00 50.07  ?  191  LYS A CG    1 
ATOM   1451  C  CD    . LYS A 1 203  ? -36.342 18.697  -28.393 1.00 54.56  ?  191  LYS A CD    1 
ATOM   1452  C  CE    . LYS A 1 203  ? -37.353 17.719  -27.818 1.00 66.19  ?  191  LYS A CE    1 
ATOM   1453  N  NZ    . LYS A 1 203  ? -37.274 17.638  -26.333 1.00 58.29  ?  191  LYS A NZ    1 
ATOM   1454  N  N     . LEU A 1 204  ? -31.773 17.618  -26.600 1.00 50.28  ?  192  LEU A N     1 
ATOM   1455  C  CA    . LEU A 1 204  ? -31.290 17.964  -25.272 1.00 44.81  ?  192  LEU A CA    1 
ATOM   1456  C  C     . LEU A 1 204  ? -32.022 19.191  -24.744 1.00 40.29  ?  192  LEU A C     1 
ATOM   1457  O  O     . LEU A 1 204  ? -32.246 20.158  -25.477 1.00 42.46  ?  192  LEU A O     1 
ATOM   1458  C  CB    . LEU A 1 204  ? -29.783 18.224  -25.302 1.00 45.22  ?  192  LEU A CB    1 
ATOM   1459  C  CG    . LEU A 1 204  ? -29.145 18.819  -24.045 1.00 36.76  ?  192  LEU A CG    1 
ATOM   1460  C  CD1   . LEU A 1 204  ? -29.316 17.889  -22.853 1.00 42.14  ?  192  LEU A CD1   1 
ATOM   1461  C  CD2   . LEU A 1 204  ? -27.676 19.124  -24.289 1.00 33.96  ?  192  LEU A CD2   1 
ATOM   1462  N  N     . ILE A 1 205  ? -32.398 19.142  -23.469 1.00 35.90  ?  193  ILE A N     1 
ATOM   1463  C  CA    . ILE A 1 205  ? -33.070 20.246  -22.791 1.00 40.28  ?  193  ILE A CA    1 
ATOM   1464  C  C     . ILE A 1 205  ? -32.212 20.607  -21.586 1.00 39.31  ?  193  ILE A C     1 
ATOM   1465  O  O     . ILE A 1 205  ? -32.236 19.909  -20.566 1.00 36.52  ?  193  ILE A O     1 
ATOM   1466  C  CB    . ILE A 1 205  ? -34.499 19.889  -22.368 1.00 41.12  ?  193  ILE A CB    1 
ATOM   1467  C  CG1   . ILE A 1 205  ? -35.316 19.410  -23.569 1.00 42.32  ?  193  ILE A CG1   1 
ATOM   1468  C  CG2   . ILE A 1 205  ? -35.174 21.085  -21.712 1.00 30.93  ?  193  ILE A CG2   1 
ATOM   1469  C  CD1   . ILE A 1 205  ? -36.726 18.989  -23.215 1.00 46.47  ?  193  ILE A CD1   1 
ATOM   1470  N  N     . LEU A 1 206  ? -31.454 21.696  -21.693 1.00 27.18  ?  194  LEU A N     1 
ATOM   1471  C  CA    . LEU A 1 206  ? -30.586 22.142  -20.612 1.00 21.85  ?  194  LEU A CA    1 
ATOM   1472  C  C     . LEU A 1 206  ? -31.318 23.156  -19.742 1.00 23.05  ?  194  LEU A C     1 
ATOM   1473  O  O     . LEU A 1 206  ? -31.881 24.130  -20.252 1.00 29.99  ?  194  LEU A O     1 
ATOM   1474  C  CB    . LEU A 1 206  ? -29.299 22.755  -21.166 1.00 20.45  ?  194  LEU A CB    1 
ATOM   1475  C  CG    . LEU A 1 206  ? -28.265 23.177  -20.119 1.00 22.34  ?  194  LEU A CG    1 
ATOM   1476  C  CD1   . LEU A 1 206  ? -27.757 21.966  -19.352 1.00 22.55  ?  194  LEU A CD1   1 
ATOM   1477  C  CD2   . LEU A 1 206  ? -27.114 23.929  -20.765 1.00 18.82  ?  194  LEU A CD2   1 
ATOM   1478  N  N     . ASP A 1 207  ? -31.305 22.924  -18.433 1.00 25.03  ?  195  ASP A N     1 
ATOM   1479  C  CA    . ASP A 1 207  ? -31.945 23.802  -17.462 1.00 24.13  ?  195  ASP A CA    1 
ATOM   1480  C  C     . ASP A 1 207  ? -30.859 24.475  -16.633 1.00 25.75  ?  195  ASP A C     1 
ATOM   1481  O  O     . ASP A 1 207  ? -30.030 23.794  -16.021 1.00 31.60  ?  195  ASP A O     1 
ATOM   1482  C  CB    . ASP A 1 207  ? -32.908 23.015  -16.572 1.00 25.13  ?  195  ASP A CB    1 
ATOM   1483  C  CG    . ASP A 1 207  ? -33.856 23.909  -15.794 1.00 38.28  ?  195  ASP A CG    1 
ATOM   1484  O  OD1   . ASP A 1 207  ? -33.422 24.973  -15.303 1.00 39.14  ?  195  ASP A OD1   1 
ATOM   1485  O  OD2   . ASP A 1 207  ? -35.044 23.544  -15.670 1.00 46.40  ?  195  ASP A OD2   1 
ATOM   1486  N  N     . VAL A 1 208  ? -30.864 25.807  -16.618 1.00 30.96  ?  196  VAL A N     1 
ATOM   1487  C  CA    . VAL A 1 208  ? -29.838 26.596  -15.945 1.00 25.32  ?  196  VAL A CA    1 
ATOM   1488  C  C     . VAL A 1 208  ? -30.518 27.577  -15.000 1.00 28.21  ?  196  VAL A C     1 
ATOM   1489  O  O     . VAL A 1 208  ? -31.453 28.281  -15.397 1.00 31.90  ?  196  VAL A O     1 
ATOM   1490  C  CB    . VAL A 1 208  ? -28.947 27.350  -16.952 1.00 25.16  ?  196  VAL A CB    1 
ATOM   1491  C  CG1   . VAL A 1 208  ? -27.865 28.134  -16.226 1.00 21.78  ?  196  VAL A CG1   1 
ATOM   1492  C  CG2   . VAL A 1 208  ? -28.332 26.382  -17.951 1.00 26.83  ?  196  VAL A CG2   1 
ATOM   1493  N  N     . GLU A 1 209  ? -30.047 27.623  -13.754 1.00 39.34  ?  197  GLU A N     1 
ATOM   1494  C  CA    . GLU A 1 209  ? -30.541 28.562  -12.754 1.00 39.02  ?  197  GLU A CA    1 
ATOM   1495  C  C     . GLU A 1 209  ? -29.356 29.285  -12.132 1.00 35.81  ?  197  GLU A C     1 
ATOM   1496  O  O     . GLU A 1 209  ? -28.401 28.643  -11.683 1.00 42.63  ?  197  GLU A O     1 
ATOM   1497  C  CB    . GLU A 1 209  ? -31.358 27.848  -11.670 1.00 29.17  ?  197  GLU A CB    1 
ATOM   1498  C  CG    . GLU A 1 209  ? -32.033 28.787  -10.678 1.00 32.41  ?  197  GLU A CG    1 
ATOM   1499  C  CD    . GLU A 1 209  ? -32.788 28.045  -9.591  1.00 54.58  ?  197  GLU A CD    1 
ATOM   1500  O  OE1   . GLU A 1 209  ? -32.409 26.896  -9.281  1.00 57.32  ?  197  GLU A OE1   1 
ATOM   1501  O  OE2   . GLU A 1 209  ? -33.762 28.609  -9.049  1.00 61.37  ?  197  GLU A OE2   1 
ATOM   1502  N  N     . THR A 1 210  ? -29.420 30.613  -12.106 1.00 31.65  ?  198  THR A N     1 
ATOM   1503  C  CA    . THR A 1 210  ? -28.354 31.452  -11.580 1.00 34.64  ?  198  THR A CA    1 
ATOM   1504  C  C     . THR A 1 210  ? -28.811 32.137  -10.295 1.00 39.50  ?  198  THR A C     1 
ATOM   1505  O  O     . THR A 1 210  ? -29.906 31.889  -9.782  1.00 42.54  ?  198  THR A O     1 
ATOM   1506  C  CB    . THR A 1 210  ? -27.913 32.480  -12.625 1.00 37.16  ?  198  THR A CB    1 
ATOM   1507  O  OG1   . THR A 1 210  ? -29.014 33.339  -12.947 1.00 49.53  ?  198  THR A OG1   1 
ATOM   1508  C  CG2   . THR A 1 210  ? -27.437 31.780  -13.890 1.00 37.54  ?  198  THR A CG2   1 
ATOM   1509  N  N     . LYS A 1 211  ? -27.954 33.014  -9.777  1.00 37.82  ?  199  LYS A N     1 
ATOM   1510  C  CA    . LYS A 1 211  ? -28.174 33.688  -8.503  1.00 41.44  ?  199  LYS A CA    1 
ATOM   1511  C  C     . LYS A 1 211  ? -28.267 35.199  -8.688  1.00 47.14  ?  199  LYS A C     1 
ATOM   1512  O  O     . LYS A 1 211  ? -27.714 35.975  -7.906  1.00 58.09  ?  199  LYS A O     1 
ATOM   1513  C  CB    . LYS A 1 211  ? -27.073 33.331  -7.506  1.00 31.38  ?  199  LYS A CB    1 
ATOM   1514  C  CG    . LYS A 1 211  ? -26.892 31.831  -7.306  1.00 41.10  ?  199  LYS A CG    1 
ATOM   1515  C  CD    . LYS A 1 211  ? -25.977 31.506  -6.130  1.00 42.26  ?  199  LYS A CD    1 
ATOM   1516  C  CE    . LYS A 1 211  ? -24.571 32.048  -6.336  1.00 33.65  ?  199  LYS A CE    1 
ATOM   1517  N  NZ    . LYS A 1 211  ? -23.648 31.636  -5.238  1.00 34.25  ?  199  LYS A NZ    1 
ATOM   1518  N  N     . ASN A 1 212  ? -28.958 35.627  -9.748  1.00 45.94  ?  200  ASN A N     1 
ATOM   1519  C  CA    . ASN A 1 212  ? -29.233 37.036  -10.021 1.00 49.44  ?  200  ASN A CA    1 
ATOM   1520  C  C     . ASN A 1 212  ? -27.970 37.855  -10.270 1.00 45.15  ?  200  ASN A C     1 
ATOM   1521  O  O     . ASN A 1 212  ? -28.054 39.063  -10.514 1.00 43.98  ?  200  ASN A O     1 
ATOM   1522  C  CB    . ASN A 1 212  ? -30.042 37.659  -8.877  1.00 42.25  ?  200  ASN A CB    1 
ATOM   1523  C  CG    . ASN A 1 212  ? -31.506 37.274  -8.925  1.00 48.07  ?  200  ASN A CG    1 
ATOM   1524  O  OD1   . ASN A 1 212  ? -32.009 36.842  -9.962  1.00 57.06  ?  200  ASN A OD1   1 
ATOM   1525  N  ND2   . ASN A 1 212  ? -32.202 37.436  -7.804  1.00 48.84  ?  200  ASN A ND2   1 
ATOM   1526  N  N     . SER A 1 213  ? -26.798 37.221  -10.216 1.00 46.94  ?  201  SER A N     1 
ATOM   1527  C  CA    . SER A 1 213  ? -25.576 37.933  -10.571 1.00 51.40  ?  201  SER A CA    1 
ATOM   1528  C  C     . SER A 1 213  ? -25.448 38.076  -12.081 1.00 49.53  ?  201  SER A C     1 
ATOM   1529  O  O     . SER A 1 213  ? -25.106 39.154  -12.581 1.00 45.85  ?  201  SER A O     1 
ATOM   1530  C  CB    . SER A 1 213  ? -24.356 37.216  -9.997  1.00 59.99  ?  201  SER A CB    1 
ATOM   1531  O  OG    . SER A 1 213  ? -23.176 37.961  -10.241 1.00 64.12  ?  201  SER A OG    1 
ATOM   1532  N  N     . ILE A 1 214  ? -25.716 36.998  -12.819 1.00 50.50  ?  202  ILE A N     1 
ATOM   1533  C  CA    . ILE A 1 214  ? -25.761 37.015  -14.273 1.00 45.87  ?  202  ILE A CA    1 
ATOM   1534  C  C     . ILE A 1 214  ? -27.003 36.254  -14.716 1.00 46.67  ?  202  ILE A C     1 
ATOM   1535  O  O     . ILE A 1 214  ? -27.550 35.427  -13.984 1.00 50.37  ?  202  ILE A O     1 
ATOM   1536  C  CB    . ILE A 1 214  ? -24.498 36.399  -14.914 1.00 41.49  ?  202  ILE A CB    1 
ATOM   1537  C  CG1   . ILE A 1 214  ? -24.337 34.941  -14.481 1.00 31.29  ?  202  ILE A CG1   1 
ATOM   1538  C  CG2   . ILE A 1 214  ? -23.259 37.208  -14.555 1.00 50.82  ?  202  ILE A CG2   1 
ATOM   1539  C  CD1   . ILE A 1 214  ? -23.109 34.270  -15.051 1.00 41.76  ?  202  ILE A CD1   1 
ATOM   1540  N  N     . SER A 1 215  ? -27.449 36.550  -15.932 1.00 53.53  ?  203  SER A N     1 
ATOM   1541  C  CA    . SER A 1 215  ? -28.591 35.855  -16.502 1.00 57.64  ?  203  SER A CA    1 
ATOM   1542  C  C     . SER A 1 215  ? -28.179 34.462  -16.974 1.00 47.24  ?  203  SER A C     1 
ATOM   1543  O  O     . SER A 1 215  ? -26.998 34.208  -17.226 1.00 48.14  ?  203  SER A O     1 
ATOM   1544  C  CB    . SER A 1 215  ? -29.176 36.666  -17.655 1.00 63.60  ?  203  SER A CB    1 
ATOM   1545  O  OG    . SER A 1 215  ? -28.219 36.873  -18.676 1.00 58.50  ?  203  SER A OG    1 
ATOM   1546  N  N     . PRO A 1 216  ? -29.136 33.532  -17.084 1.00 44.93  ?  204  PRO A N     1 
ATOM   1547  C  CA    . PRO A 1 216  ? -28.765 32.151  -17.445 1.00 42.62  ?  204  PRO A CA    1 
ATOM   1548  C  C     . PRO A 1 216  ? -28.056 32.032  -18.782 1.00 45.62  ?  204  PRO A C     1 
ATOM   1549  O  O     . PRO A 1 216  ? -27.156 31.194  -18.925 1.00 45.60  ?  204  PRO A O     1 
ATOM   1550  C  CB    . PRO A 1 216  ? -30.116 31.422  -17.454 1.00 41.46  ?  204  PRO A CB    1 
ATOM   1551  C  CG    . PRO A 1 216  ? -30.975 32.214  -16.535 1.00 44.40  ?  204  PRO A CG    1 
ATOM   1552  C  CD    . PRO A 1 216  ? -30.564 33.643  -16.736 1.00 52.28  ?  204  PRO A CD    1 
ATOM   1553  N  N     . ARG A 1 217  ? -28.434 32.843  -19.772 1.00 49.09  ?  205  ARG A N     1 
ATOM   1554  C  CA    . ARG A 1 217  ? -27.791 32.744  -21.077 1.00 50.24  ?  205  ARG A CA    1 
ATOM   1555  C  C     . ARG A 1 217  ? -26.361 33.271  -21.042 1.00 47.84  ?  205  ARG A C     1 
ATOM   1556  O  O     . ARG A 1 217  ? -25.510 32.794  -21.801 1.00 42.82  ?  205  ARG A O     1 
ATOM   1557  C  CB    . ARG A 1 217  ? -28.613 33.486  -22.131 1.00 56.08  ?  205  ARG A CB    1 
ATOM   1558  C  CG    . ARG A 1 217  ? -28.825 34.963  -21.849 1.00 63.82  ?  205  ARG A CG    1 
ATOM   1559  C  CD    . ARG A 1 217  ? -29.609 35.615  -22.974 1.00 62.63  ?  205  ARG A CD    1 
ATOM   1560  N  NE    . ARG A 1 217  ? -28.937 35.463  -24.262 1.00 84.96  ?  205  ARG A NE    1 
ATOM   1561  C  CZ    . ARG A 1 217  ? -29.485 35.773  -25.432 1.00 89.98  ?  205  ARG A CZ    1 
ATOM   1562  N  NH1   . ARG A 1 217  ? -30.722 36.250  -25.483 1.00 93.89  ?  205  ARG A NH1   1 
ATOM   1563  N  NH2   . ARG A 1 217  ? -28.799 35.602  -26.554 1.00 70.39  ?  205  ARG A NH2   1 
ATOM   1564  N  N     . ASP A 1 218  ? -26.077 34.244  -20.173 1.00 42.25  ?  206  ASP A N     1 
ATOM   1565  C  CA    . ASP A 1 218  ? -24.706 34.725  -20.033 1.00 43.30  ?  206  ASP A CA    1 
ATOM   1566  C  C     . ASP A 1 218  ? -23.804 33.646  -19.448 1.00 44.44  ?  206  ASP A C     1 
ATOM   1567  O  O     . ASP A 1 218  ? -22.638 33.521  -19.841 1.00 47.01  ?  206  ASP A O     1 
ATOM   1568  C  CB    . ASP A 1 218  ? -24.673 35.981  -19.163 1.00 51.55  ?  206  ASP A CB    1 
ATOM   1569  C  CG    . ASP A 1 218  ? -25.469 37.125  -19.758 1.00 65.10  ?  206  ASP A CG    1 
ATOM   1570  O  OD1   . ASP A 1 218  ? -25.470 37.271  -20.998 1.00 65.50  ?  206  ASP A OD1   1 
ATOM   1571  O  OD2   . ASP A 1 218  ? -26.101 37.875  -18.985 1.00 67.56  ?  206  ASP A OD2   1 
ATOM   1572  N  N     . ALA A 1 219  ? -24.327 32.856  -18.508 1.00 42.98  ?  207  ALA A N     1 
ATOM   1573  C  CA    . ALA A 1 219  ? -23.541 31.773  -17.925 1.00 34.70  ?  207  ALA A CA    1 
ATOM   1574  C  C     . ALA A 1 219  ? -23.267 30.682  -18.952 1.00 39.11  ?  207  ALA A C     1 
ATOM   1575  O  O     . ALA A 1 219  ? -22.130 30.217  -19.091 1.00 33.37  ?  207  ALA A O     1 
ATOM   1576  C  CB    . ALA A 1 219  ? -24.262 31.198  -16.706 1.00 29.78  ?  207  ALA A CB    1 
ATOM   1577  N  N     . LEU A 1 220  ? -24.304 30.258  -19.681 1.00 33.62  ?  208  LEU A N     1 
ATOM   1578  C  CA    . LEU A 1 220  ? -24.115 29.258  -20.727 1.00 30.66  ?  208  LEU A CA    1 
ATOM   1579  C  C     . LEU A 1 220  ? -23.174 29.761  -21.814 1.00 29.64  ?  208  LEU A C     1 
ATOM   1580  O  O     . LEU A 1 220  ? -22.446 28.968  -22.422 1.00 27.70  ?  208  LEU A O     1 
ATOM   1581  C  CB    . LEU A 1 220  ? -25.466 28.865  -21.326 1.00 32.44  ?  208  LEU A CB    1 
ATOM   1582  C  CG    . LEU A 1 220  ? -25.454 27.855  -22.475 1.00 34.54  ?  208  LEU A CG    1 
ATOM   1583  C  CD1   . LEU A 1 220  ? -24.753 26.571  -22.060 1.00 30.72  ?  208  LEU A CD1   1 
ATOM   1584  C  CD2   . LEU A 1 220  ? -26.869 27.568  -22.945 1.00 29.82  ?  208  LEU A CD2   1 
ATOM   1585  N  N     . ALA A 1 221  ? -23.171 31.072  -22.068 1.00 35.66  ?  209  ALA A N     1 
ATOM   1586  C  CA    . ALA A 1 221  ? -22.219 31.636  -23.018 1.00 38.90  ?  209  ALA A CA    1 
ATOM   1587  C  C     . ALA A 1 221  ? -20.793 31.532  -22.493 1.00 45.94  ?  209  ALA A C     1 
ATOM   1588  O  O     . ALA A 1 221  ? -19.862 31.260  -23.260 1.00 44.65  ?  209  ALA A O     1 
ATOM   1589  C  CB    . ALA A 1 221  ? -22.576 33.091  -23.318 1.00 43.08  ?  209  ALA A CB    1 
ATOM   1590  N  N     . SER A 1 222  ? -20.604 31.744  -21.188 1.00 40.29  ?  210  SER A N     1 
ATOM   1591  C  CA    . SER A 1 222  ? -19.273 31.612  -20.606 1.00 39.83  ?  210  SER A CA    1 
ATOM   1592  C  C     . SER A 1 222  ? -18.793 30.168  -20.655 1.00 38.65  ?  210  SER A C     1 
ATOM   1593  O  O     . SER A 1 222  ? -17.623 29.906  -20.958 1.00 36.34  ?  210  SER A O     1 
ATOM   1594  C  CB    . SER A 1 222  ? -19.273 32.129  -19.169 1.00 33.40  ?  210  SER A CB    1 
ATOM   1595  O  OG    . SER A 1 222  ? -17.969 32.079  -18.619 1.00 33.85  ?  210  SER A OG    1 
ATOM   1596  N  N     . ALA A 1 223  ? -19.681 29.216  -20.358 1.00 36.10  ?  211  ALA A N     1 
ATOM   1597  C  CA    . ALA A 1 223  ? -19.328 27.810  -20.517 1.00 36.82  ?  211  ALA A CA    1 
ATOM   1598  C  C     . ALA A 1 223  ? -19.138 27.449  -21.983 1.00 35.53  ?  211  ALA A C     1 
ATOM   1599  O  O     . ALA A 1 223  ? -18.357 26.545  -22.302 1.00 33.77  ?  211  ALA A O     1 
ATOM   1600  C  CB    . ALA A 1 223  ? -20.398 26.922  -19.883 1.00 35.85  ?  211  ALA A CB    1 
ATOM   1601  N  N     . GLY A 1 224  ? -19.837 28.142  -22.884 1.00 33.11  ?  212  GLY A N     1 
ATOM   1602  C  CA    . GLY A 1 224  ? -19.649 27.888  -24.304 1.00 36.73  ?  212  GLY A CA    1 
ATOM   1603  C  C     . GLY A 1 224  ? -18.264 28.281  -24.780 1.00 37.29  ?  212  GLY A C     1 
ATOM   1604  O  O     . GLY A 1 224  ? -17.576 27.500  -25.442 1.00 38.17  ?  212  GLY A O     1 
ATOM   1605  N  N     . LYS A 1 225  ? -17.834 29.500  -24.447 1.00 39.67  ?  213  LYS A N     1 
ATOM   1606  C  CA    . LYS A 1 225  ? -16.488 29.940  -24.796 1.00 37.63  ?  213  LYS A CA    1 
ATOM   1607  C  C     . LYS A 1 225  ? -15.421 29.135  -24.066 1.00 34.79  ?  213  LYS A C     1 
ATOM   1608  O  O     . LYS A 1 225  ? -14.291 29.035  -24.556 1.00 39.74  ?  213  LYS A O     1 
ATOM   1609  C  CB    . LYS A 1 225  ? -16.328 31.431  -24.494 1.00 45.58  ?  213  LYS A CB    1 
ATOM   1610  C  CG    . LYS A 1 225  ? -15.079 32.061  -25.092 1.00 58.68  ?  213  LYS A CG    1 
ATOM   1611  C  CD    . LYS A 1 225  ? -15.085 33.573  -24.925 1.00 76.05  ?  213  LYS A CD    1 
ATOM   1612  C  CE    . LYS A 1 225  ? -13.855 34.203  -25.560 1.00 89.05  ?  213  LYS A CE    1 
ATOM   1613  N  NZ    . LYS A 1 225  ? -13.881 35.689  -25.463 1.00 91.06  ?  213  LYS A NZ    1 
ATOM   1614  N  N     . THR A 1 226  ? -15.758 28.557  -22.911 1.00 42.72  ?  214  THR A N     1 
ATOM   1615  C  CA    . THR A 1 226  ? -14.817 27.687  -22.212 1.00 42.46  ?  214  THR A CA    1 
ATOM   1616  C  C     . THR A 1 226  ? -14.539 26.427  -23.021 1.00 41.69  ?  214  THR A C     1 
ATOM   1617  O  O     . THR A 1 226  ? -13.380 26.066  -23.257 1.00 42.28  ?  214  THR A O     1 
ATOM   1618  C  CB    . THR A 1 226  ? -15.365 27.315  -20.833 1.00 49.61  ?  214  THR A CB    1 
ATOM   1619  O  OG1   . THR A 1 226  ? -15.967 28.463  -20.225 1.00 44.20  ?  214  THR A OG1   1 
ATOM   1620  C  CG2   . THR A 1 226  ? -14.252 26.788  -19.934 1.00 47.31  ?  214  THR A CG2   1 
ATOM   1621  N  N     . LEU A 1 227  ? -15.599 25.750  -23.464 1.00 38.83  ?  215  LEU A N     1 
ATOM   1622  C  CA    . LEU A 1 227  ? -15.448 24.472  -24.146 1.00 36.97  ?  215  LEU A CA    1 
ATOM   1623  C  C     . LEU A 1 227  ? -15.067 24.642  -25.611 1.00 42.25  ?  215  LEU A C     1 
ATOM   1624  O  O     . LEU A 1 227  ? -14.355 23.794  -26.160 1.00 43.81  ?  215  LEU A O     1 
ATOM   1625  C  CB    . LEU A 1 227  ? -16.739 23.665  -24.010 1.00 31.93  ?  215  LEU A CB    1 
ATOM   1626  C  CG    . LEU A 1 227  ? -17.183 23.510  -22.553 1.00 32.22  ?  215  LEU A CG    1 
ATOM   1627  C  CD1   . LEU A 1 227  ? -18.565 22.891  -22.448 1.00 30.96  ?  215  LEU A CD1   1 
ATOM   1628  C  CD2   . LEU A 1 227  ? -16.166 22.694  -21.769 1.00 37.15  ?  215  LEU A CD2   1 
ATOM   1629  N  N     . VAL A 1 228  ? -15.527 25.716  -26.258 1.00 48.95  ?  216  VAL A N     1 
ATOM   1630  C  CA    . VAL A 1 228  ? -15.076 26.015  -27.615 1.00 46.74  ?  216  VAL A CA    1 
ATOM   1631  C  C     . VAL A 1 228  ? -13.563 26.188  -27.637 1.00 47.82  ?  216  VAL A C     1 
ATOM   1632  O  O     . VAL A 1 228  ? -12.867 25.656  -28.511 1.00 53.59  ?  216  VAL A O     1 
ATOM   1633  C  CB    . VAL A 1 228  ? -15.795 27.263  -28.159 1.00 43.67  ?  216  VAL A CB    1 
ATOM   1634  C  CG1   . VAL A 1 228  ? -15.019 27.868  -29.320 1.00 44.62  ?  216  VAL A CG1   1 
ATOM   1635  C  CG2   . VAL A 1 228  ? -17.201 26.909  -28.597 1.00 44.82  ?  216  VAL A CG2   1 
ATOM   1636  N  N     . GLU A 1 229  ? -13.032 26.930  -26.664 1.00 50.27  ?  217  GLU A N     1 
ATOM   1637  C  CA    . GLU A 1 229  ? -11.587 27.098  -26.564 1.00 55.67  ?  217  GLU A CA    1 
ATOM   1638  C  C     . GLU A 1 229  ? -10.898 25.782  -26.222 1.00 50.66  ?  217  GLU A C     1 
ATOM   1639  O  O     . GLU A 1 229  ? -9.817  25.486  -26.743 1.00 49.81  ?  217  GLU A O     1 
ATOM   1640  C  CB    . GLU A 1 229  ? -11.259 28.156  -25.513 1.00 54.59  ?  217  GLU A CB    1 
ATOM   1641  C  CG    . GLU A 1 229  ? -9.776  28.397  -25.332 1.00 75.23  ?  217  GLU A CG    1 
ATOM   1642  C  CD    . GLU A 1 229  ? -9.208  29.314  -26.393 1.00 89.79  ?  217  GLU A CD    1 
ATOM   1643  O  OE1   . GLU A 1 229  ? -9.901  30.281  -26.774 1.00 94.56  ?  217  GLU A OE1   1 
ATOM   1644  O  OE2   . GLU A 1 229  ? -8.071  29.068  -26.847 1.00 97.48  ?  217  GLU A OE2   1 
ATOM   1645  N  N     . LEU A 1 230  ? -11.515 24.976  -25.357 1.00 43.54  ?  218  LEU A N     1 
ATOM   1646  C  CA    . LEU A 1 230  ? -10.859 23.777  -24.849 1.00 47.77  ?  218  LEU A CA    1 
ATOM   1647  C  C     . LEU A 1 230  ? -10.843 22.660  -25.886 1.00 48.77  ?  218  LEU A C     1 
ATOM   1648  O  O     . LEU A 1 230  ? -9.794  22.059  -26.143 1.00 50.83  ?  218  LEU A O     1 
ATOM   1649  C  CB    . LEU A 1 230  ? -11.547 23.314  -23.564 1.00 45.69  ?  218  LEU A CB    1 
ATOM   1650  C  CG    . LEU A 1 230  ? -10.665 22.601  -22.541 1.00 40.50  ?  218  LEU A CG    1 
ATOM   1651  C  CD1   . LEU A 1 230  ? -9.324  23.302  -22.419 1.00 29.32  ?  218  LEU A CD1   1 
ATOM   1652  C  CD2   . LEU A 1 230  ? -11.368 22.565  -21.195 1.00 49.81  ?  218  LEU A CD2   1 
ATOM   1653  N  N     . PHE A 1 231  ? -11.993 22.371  -26.500 1.00 42.93  ?  219  PHE A N     1 
ATOM   1654  C  CA    . PHE A 1 231  ? -12.044 21.314  -27.504 1.00 38.65  ?  219  PHE A CA    1 
ATOM   1655  C  C     . PHE A 1 231  ? -11.205 21.644  -28.732 1.00 52.28  ?  219  PHE A C     1 
ATOM   1656  O  O     . PHE A 1 231  ? -10.948 20.754  -29.550 1.00 57.45  ?  219  PHE A O     1 
ATOM   1657  C  CB    . PHE A 1 231  ? -13.493 21.044  -27.912 1.00 33.69  ?  219  PHE A CB    1 
ATOM   1658  C  CG    . PHE A 1 231  ? -14.254 20.217  -26.920 1.00 37.00  ?  219  PHE A CG    1 
ATOM   1659  C  CD1   . PHE A 1 231  ? -14.155 18.836  -26.932 1.00 33.64  ?  219  PHE A CD1   1 
ATOM   1660  C  CD2   . PHE A 1 231  ? -15.063 20.816  -25.970 1.00 37.11  ?  219  PHE A CD2   1 
ATOM   1661  C  CE1   . PHE A 1 231  ? -14.852 18.070  -26.019 1.00 32.60  ?  219  PHE A CE1   1 
ATOM   1662  C  CE2   . PHE A 1 231  ? -15.759 20.056  -25.055 1.00 30.94  ?  219  PHE A CE2   1 
ATOM   1663  C  CZ    . PHE A 1 231  ? -15.658 18.682  -25.083 1.00 29.49  ?  219  PHE A CZ    1 
ATOM   1664  N  N     . GLY A 1 232  ? -10.758 22.893  -28.870 1.00 67.90  ?  220  GLY A N     1 
ATOM   1665  C  CA    . GLY A 1 232  ? -9.945  23.301  -30.001 1.00 73.68  ?  220  GLY A CA    1 
ATOM   1666  C  C     . GLY A 1 232  ? -8.531  22.758  -29.928 1.00 78.34  ?  220  GLY A C     1 
ATOM   1667  O  O     . GLY A 1 232  ? -7.709  22.977  -30.826 1.00 85.46  ?  220  GLY A O     1 
ATOM   1668  N  N     . LEU A 1 233  ? -8.238  22.048  -28.839 1.00 80.20  ?  221  LEU A N     1 
ATOM   1669  C  CA    . LEU A 1 233  ? -6.951  21.384  -28.683 1.00 84.21  ?  221  LEU A CA    1 
ATOM   1670  C  C     . LEU A 1 233  ? -6.865  20.068  -29.446 1.00 84.84  ?  221  LEU A C     1 
ATOM   1671  O  O     . LEU A 1 233  ? -5.759  19.643  -29.796 1.00 92.05  ?  221  LEU A O     1 
ATOM   1672  C  CB    . LEU A 1 233  ? -6.662  21.139  -27.201 1.00 78.28  ?  221  LEU A CB    1 
ATOM   1673  C  CG    . LEU A 1 233  ? -6.562  22.380  -26.315 1.00 82.10  ?  221  LEU A CG    1 
ATOM   1674  C  CD1   . LEU A 1 233  ? -6.423  21.964  -24.864 1.00 80.70  ?  221  LEU A CD1   1 
ATOM   1675  C  CD2   . LEU A 1 233  ? -5.395  23.264  -26.731 1.00 87.65  ?  221  LEU A CD2   1 
ATOM   1676  N  N     . ALA A 1 234  ? -7.996  19.413  -29.711 1.00 76.19  ?  222  ALA A N     1 
ATOM   1677  C  CA    . ALA A 1 234  ? -7.989  18.205  -30.524 1.00 75.97  ?  222  ALA A CA    1 
ATOM   1678  C  C     . ALA A 1 234  ? -7.982  18.508  -32.015 1.00 83.06  ?  222  ALA A C     1 
ATOM   1679  O  O     . ALA A 1 234  ? -7.647  17.625  -32.813 1.00 79.29  ?  222  ALA A O     1 
ATOM   1680  C  CB    . ALA A 1 234  ? -9.197  17.328  -30.185 1.00 69.64  ?  222  ALA A CB    1 
ATOM   1681  N  N     . ARG A 1 235  ? -8.334  19.735  -32.405 1.00 96.32  ?  223  ARG A N     1 
ATOM   1682  C  CA    . ARG A 1 235  ? -8.378  20.096  -33.817 1.00 97.17  ?  223  ARG A CA    1 
ATOM   1683  C  C     . ARG A 1 235  ? -6.992  20.405  -34.371 1.00 102.19 ?  223  ARG A C     1 
ATOM   1684  O  O     . ARG A 1 235  ? -6.736  20.167  -35.558 1.00 106.31 ?  223  ARG A O     1 
ATOM   1685  C  CB    . ARG A 1 235  ? -9.315  21.291  -34.014 1.00 93.10  ?  223  ARG A CB    1 
ATOM   1686  C  CG    . ARG A 1 235  ? -9.424  21.800  -35.439 1.00 105.72 ?  223  ARG A CG    1 
ATOM   1687  C  CD    . ARG A 1 235  ? -10.551 22.812  -35.565 1.00 106.21 ?  223  ARG A CD    1 
ATOM   1688  N  NE    . ARG A 1 235  ? -10.686 23.624  -34.359 1.00 111.51 ?  223  ARG A NE    1 
ATOM   1689  C  CZ    . ARG A 1 235  ? -9.996  24.734  -34.120 1.00 112.42 ?  223  ARG A CZ    1 
ATOM   1690  N  NH1   . ARG A 1 235  ? -9.113  25.173  -35.008 1.00 127.38 ?  223  ARG A NH1   1 
ATOM   1691  N  NH2   . ARG A 1 235  ? -10.186 25.405  -32.993 1.00 89.53  ?  223  ARG A NH2   1 
ATOM   1692  N  N     . GLU A 1 236  ? -6.091  20.920  -33.539 1.00 109.62 ?  224  GLU A N     1 
ATOM   1693  C  CA    . GLU A 1 236  ? -4.735  21.198  -33.989 1.00 119.01 ?  224  GLU A CA    1 
ATOM   1694  C  C     . GLU A 1 236  ? -3.985  19.891  -34.223 1.00 125.33 ?  224  GLU A C     1 
ATOM   1695  O  O     . GLU A 1 236  ? -4.057  18.964  -33.410 1.00 111.35 ?  224  GLU A O     1 
ATOM   1696  C  CB    . GLU A 1 236  ? -4.001  22.072  -32.969 1.00 118.45 ?  224  GLU A CB    1 
ATOM   1697  C  CG    . GLU A 1 236  ? -3.860  21.459  -31.584 1.00 114.75 ?  224  GLU A CG    1 
ATOM   1698  C  CD    . GLU A 1 236  ? -3.362  22.450  -30.550 1.00 119.30 ?  224  GLU A CD    1 
ATOM   1699  O  OE1   . GLU A 1 236  ? -3.656  23.656  -30.691 1.00 117.23 ?  224  GLU A OE1   1 
ATOM   1700  O  OE2   . GLU A 1 236  ? -2.675  22.024  -29.597 1.00 121.71 ?  224  GLU A OE2   1 
ATOM   1701  N  N     . LEU A 1 237  ? -3.278  19.813  -35.345 1.00 140.12 ?  225  LEU A N     1 
ATOM   1702  C  CA    . LEU A 1 237  ? -2.574  18.593  -35.701 1.00 142.07 ?  225  LEU A CA    1 
ATOM   1703  C  C     . LEU A 1 237  ? -1.233  18.520  -34.974 1.00 146.84 ?  225  LEU A C     1 
ATOM   1704  O  O     . LEU A 1 237  ? -0.806  19.458  -34.295 1.00 146.01 ?  225  LEU A O     1 
ATOM   1705  C  CB    . LEU A 1 237  ? -2.374  18.510  -37.214 1.00 134.00 ?  225  LEU A CB    1 
ATOM   1706  C  CG    . LEU A 1 237  ? -3.631  18.634  -38.081 1.00 133.34 ?  225  LEU A CG    1 
ATOM   1707  C  CD1   . LEU A 1 237  ? -3.331  18.243  -39.521 1.00 127.45 ?  225  LEU A CD1   1 
ATOM   1708  C  CD2   . LEU A 1 237  ? -4.778  17.803  -37.521 1.00 120.85 ?  225  LEU A CD2   1 
ATOM   1709  N  N     . ASN A 1 238  ? -0.565  17.381  -35.123 1.00 150.82 ?  226  ASN A N     1 
ATOM   1710  C  CA    . ASN A 1 238  ? 0.698   17.143  -34.436 1.00 150.30 ?  226  ASN A CA    1 
ATOM   1711  C  C     . ASN A 1 238  ? 1.882   17.537  -35.314 1.00 146.24 ?  226  ASN A C     1 
ATOM   1712  O  O     . ASN A 1 238  ? 2.840   18.150  -34.842 1.00 141.85 ?  226  ASN A O     1 
ATOM   1713  C  CB    . ASN A 1 238  ? 0.810   15.675  -34.023 1.00 147.55 ?  226  ASN A CB    1 
ATOM   1714  C  CG    . ASN A 1 238  ? 1.738   15.472  -32.843 1.00 148.50 ?  226  ASN A CG    1 
ATOM   1715  O  OD1   . ASN A 1 238  ? 1.950   16.382  -32.041 1.00 146.53 ?  226  ASN A OD1   1 
ATOM   1716  N  ND2   . ASN A 1 238  ? 2.296   14.272  -32.728 1.00 148.46 ?  226  ASN A ND2   1 
ATOM   1717  N  N     . MET B 1 13   ? -12.370 35.165  -16.043 1.00 92.36  ?  1    MET B N     1 
ATOM   1718  C  CA    . MET B 1 13   ? -11.969 34.443  -14.841 1.00 99.21  ?  1    MET B CA    1 
ATOM   1719  C  C     . MET B 1 13   ? -10.470 34.576  -14.598 1.00 109.92 ?  1    MET B C     1 
ATOM   1720  O  O     . MET B 1 13   ? -9.966  35.669  -14.341 1.00 114.84 ?  1    MET B O     1 
ATOM   1721  C  CB    . MET B 1 13   ? -12.352 32.965  -14.949 1.00 84.83  ?  1    MET B CB    1 
ATOM   1722  N  N     . LEU B 1 14   ? -9.765  33.450  -14.677 1.00 102.00 ?  2    LEU B N     1 
ATOM   1723  C  CA    . LEU B 1 14   ? -8.320  33.415  -14.514 1.00 107.40 ?  2    LEU B CA    1 
ATOM   1724  C  C     . LEU B 1 14   ? -7.727  32.524  -15.596 1.00 112.55 ?  2    LEU B C     1 
ATOM   1725  O  O     . LEU B 1 14   ? -8.408  31.669  -16.168 1.00 106.99 ?  2    LEU B O     1 
ATOM   1726  C  CB    . LEU B 1 14   ? -7.918  32.914  -13.119 1.00 93.38  ?  2    LEU B CB    1 
ATOM   1727  C  CG    . LEU B 1 14   ? -8.456  33.702  -11.922 1.00 87.62  ?  2    LEU B CG    1 
ATOM   1728  C  CD1   . LEU B 1 14   ? -8.201  32.953  -10.624 1.00 79.11  ?  2    LEU B CD1   1 
ATOM   1729  C  CD2   . LEU B 1 14   ? -7.839  35.092  -11.870 1.00 85.59  ?  2    LEU B CD2   1 
ATOM   1730  N  N     . ILE B 1 15   ? -6.444  32.732  -15.870 1.00 115.11 ?  3    ILE B N     1 
ATOM   1731  C  CA    . ILE B 1 15   ? -5.770  32.035  -16.960 1.00 113.13 ?  3    ILE B CA    1 
ATOM   1732  C  C     . ILE B 1 15   ? -5.437  30.611  -16.534 1.00 114.03 ?  3    ILE B C     1 
ATOM   1733  O  O     . ILE B 1 15   ? -4.980  30.368  -15.411 1.00 110.03 ?  3    ILE B O     1 
ATOM   1734  C  CB    . ILE B 1 15   ? -4.506  32.802  -17.388 1.00 115.70 ?  3    ILE B CB    1 
ATOM   1735  C  CG1   . ILE B 1 15   ? -4.867  34.223  -17.823 1.00 113.18 ?  3    ILE B CG1   1 
ATOM   1736  C  CG2   . ILE B 1 15   ? -3.786  32.070  -18.512 1.00 108.37 ?  3    ILE B CG2   1 
ATOM   1737  C  CD1   . ILE B 1 15   ? -3.682  35.033  -18.304 1.00 98.81  ?  3    ILE B CD1   1 
ATOM   1738  N  N     . SER B 1 16   ? -5.675  29.662  -17.439 1.00 129.73 ?  4    SER B N     1 
ATOM   1739  C  CA    . SER B 1 16   ? -5.303  28.260  -17.255 1.00 123.32 ?  4    SER B CA    1 
ATOM   1740  C  C     . SER B 1 16   ? -4.594  27.821  -18.532 1.00 128.52 ?  4    SER B C     1 
ATOM   1741  O  O     . SER B 1 16   ? -5.247  27.468  -19.519 1.00 128.20 ?  4    SER B O     1 
ATOM   1742  C  CB    . SER B 1 16   ? -6.524  27.393  -16.968 1.00 111.63 ?  4    SER B CB    1 
ATOM   1743  O  OG    . SER B 1 16   ? -7.450  27.447  -18.040 1.00 113.68 ?  4    SER B OG    1 
ATOM   1744  N  N     . GLN B 1 17   ? -3.266  27.841  -18.516 1.00 131.88 ?  5    GLN B N     1 
ATOM   1745  C  CA    . GLN B 1 17   ? -2.474  27.676  -19.725 1.00 126.89 ?  5    GLN B CA    1 
ATOM   1746  C  C     . GLN B 1 17   ? -1.750  26.332  -19.731 1.00 115.79 ?  5    GLN B C     1 
ATOM   1747  O  O     . GLN B 1 17   ? -1.819  25.546  -18.781 1.00 112.70 ?  5    GLN B O     1 
ATOM   1748  C  CB    . GLN B 1 17   ? -1.474  28.826  -19.872 1.00 130.51 ?  5    GLN B CB    1 
ATOM   1749  C  CG    . GLN B 1 17   ? -0.352  28.808  -18.848 1.00 124.59 ?  5    GLN B CG    1 
ATOM   1750  C  CD    . GLN B 1 17   ? 0.734   29.818  -19.161 1.00 125.98 ?  5    GLN B CD    1 
ATOM   1751  O  OE1   . GLN B 1 17   ? 0.676   30.515  -20.175 1.00 132.80 ?  5    GLN B OE1   1 
ATOM   1752  N  NE2   . GLN B 1 17   ? 1.733   29.901  -18.291 1.00 118.22 ?  5    GLN B NE2   1 
ATOM   1753  N  N     . ARG B 1 18   ? -1.060  26.081  -20.848 1.00 94.59  ?  6    ARG B N     1 
ATOM   1754  C  CA    . ARG B 1 18   ? -0.225  24.923  -21.154 1.00 94.02  ?  6    ARG B CA    1 
ATOM   1755  C  C     . ARG B 1 18   ? -0.957  23.586  -21.301 1.00 92.42  ?  6    ARG B C     1 
ATOM   1756  O  O     . ARG B 1 18   ? -0.387  22.557  -20.923 1.00 99.27  ?  6    ARG B O     1 
ATOM   1757  C  CB    . ARG B 1 18   ? 0.861   24.774  -20.083 1.00 93.16  ?  6    ARG B CB    1 
ATOM   1758  N  N     . PRO B 1 19   ? -2.187  23.518  -21.869 1.00 82.10  ?  7    PRO B N     1 
ATOM   1759  C  CA    . PRO B 1 19   ? -2.749  22.192  -22.158 1.00 68.17  ?  7    PRO B CA    1 
ATOM   1760  C  C     . PRO B 1 19   ? -2.378  21.725  -23.558 1.00 61.81  ?  7    PRO B C     1 
ATOM   1761  O  O     . PRO B 1 19   ? -2.741  22.362  -24.551 1.00 73.85  ?  7    PRO B O     1 
ATOM   1762  C  CB    . PRO B 1 19   ? -4.256  22.413  -22.003 1.00 58.87  ?  7    PRO B CB    1 
ATOM   1763  C  CG    . PRO B 1 19   ? -4.458  23.823  -22.433 1.00 66.47  ?  7    PRO B CG    1 
ATOM   1764  C  CD    . PRO B 1 19   ? -3.166  24.577  -22.185 1.00 75.15  ?  7    PRO B CD    1 
ATOM   1765  N  N     . THR B 1 20   ? -1.645  20.618  -23.651 1.00 55.58  ?  8    THR B N     1 
ATOM   1766  C  CA    . THR B 1 20   ? -1.096  20.157  -24.915 1.00 58.17  ?  8    THR B CA    1 
ATOM   1767  C  C     . THR B 1 20   ? -1.622  18.768  -25.257 1.00 62.67  ?  8    THR B C     1 
ATOM   1768  O  O     . THR B 1 20   ? -2.045  18.004  -24.385 1.00 56.01  ?  8    THR B O     1 
ATOM   1769  C  CB    . THR B 1 20   ? 0.438   20.133  -24.877 1.00 55.81  ?  8    THR B CB    1 
ATOM   1770  O  OG1   . THR B 1 20   ? 0.880   19.201  -23.883 1.00 56.58  ?  8    THR B OG1   1 
ATOM   1771  C  CG2   . THR B 1 20   ? 0.981   21.516  -24.544 1.00 66.80  ?  8    THR B CG2   1 
ATOM   1772  N  N     . LEU B 1 21   ? -1.584  18.453  -26.550 1.00 62.72  ?  9    LEU B N     1 
ATOM   1773  C  CA    . LEU B 1 21   ? -2.037  17.171  -27.076 1.00 53.39  ?  9    LEU B CA    1 
ATOM   1774  C  C     . LEU B 1 21   ? -0.849  16.436  -27.678 1.00 51.62  ?  9    LEU B C     1 
ATOM   1775  O  O     . LEU B 1 21   ? -0.175  16.963  -28.570 1.00 54.35  ?  9    LEU B O     1 
ATOM   1776  C  CB    . LEU B 1 21   ? -3.137  17.365  -28.122 1.00 39.94  ?  9    LEU B CB    1 
ATOM   1777  C  CG    . LEU B 1 21   ? -3.496  16.155  -28.988 1.00 32.55  ?  9    LEU B CG    1 
ATOM   1778  C  CD1   . LEU B 1 21   ? -3.960  14.984  -28.135 1.00 46.29  ?  9    LEU B CD1   1 
ATOM   1779  C  CD2   . LEU B 1 21   ? -4.556  16.527  -30.013 1.00 42.61  ?  9    LEU B CD2   1 
ATOM   1780  N  N     . SER B 1 22   ? -0.595  15.224  -27.191 1.00 41.55  ?  10   SER B N     1 
ATOM   1781  C  CA    . SER B 1 22   ? 0.457   14.365  -27.708 1.00 48.45  ?  10   SER B CA    1 
ATOM   1782  C  C     . SER B 1 22   ? -0.159  13.080  -28.246 1.00 51.03  ?  10   SER B C     1 
ATOM   1783  O  O     . SER B 1 22   ? -1.270  12.696  -27.871 1.00 45.79  ?  10   SER B O     1 
ATOM   1784  C  CB    . SER B 1 22   ? 1.497   14.042  -26.627 1.00 54.87  ?  10   SER B CB    1 
ATOM   1785  O  OG    . SER B 1 22   ? 2.016   15.226  -26.047 1.00 63.18  ?  10   SER B OG    1 
ATOM   1786  N  N     . GLU B 1 23   ? 0.575   12.414  -29.135 1.00 64.04  ?  11   GLU B N     1 
ATOM   1787  C  CA    . GLU B 1 23   ? 0.088   11.204  -29.784 1.00 59.92  ?  11   GLU B CA    1 
ATOM   1788  C  C     . GLU B 1 23   ? 1.168   10.135  -29.786 1.00 63.26  ?  11   GLU B C     1 
ATOM   1789  O  O     . GLU B 1 23   ? 2.312   10.400  -30.170 1.00 71.42  ?  11   GLU B O     1 
ATOM   1790  C  CB    . GLU B 1 23   ? -0.361  11.484  -31.222 1.00 67.75  ?  11   GLU B CB    1 
ATOM   1791  C  CG    . GLU B 1 23   ? -0.788  10.233  -31.974 1.00 69.15  ?  11   GLU B CG    1 
ATOM   1792  C  CD    . GLU B 1 23   ? -1.073  10.498  -33.436 1.00 69.94  ?  11   GLU B CD    1 
ATOM   1793  O  OE1   . GLU B 1 23   ? -0.876  11.648  -33.882 1.00 69.60  ?  11   GLU B OE1   1 
ATOM   1794  O  OE2   . GLU B 1 23   ? -1.492  9.554   -34.139 1.00 68.96  ?  11   GLU B OE2   1 
ATOM   1795  N  N     . ASP B 1 24   ? 0.797   8.931   -29.361 1.00 67.93  ?  12   ASP B N     1 
ATOM   1796  C  CA    . ASP B 1 24   ? 1.622   7.741   -29.508 1.00 75.01  ?  12   ASP B CA    1 
ATOM   1797  C  C     . ASP B 1 24   ? 0.923   6.787   -30.465 1.00 75.32  ?  12   ASP B C     1 
ATOM   1798  O  O     . ASP B 1 24   ? -0.265  6.493   -30.297 1.00 73.64  ?  12   ASP B O     1 
ATOM   1799  C  CB    . ASP B 1 24   ? 1.867   7.064   -28.158 1.00 78.43  ?  12   ASP B CB    1 
ATOM   1800  C  CG    . ASP B 1 24   ? 2.800   7.860   -27.270 1.00 101.92 ?  12   ASP B CG    1 
ATOM   1801  O  OD1   . ASP B 1 24   ? 3.317   8.900   -27.731 1.00 106.69 ?  12   ASP B OD1   1 
ATOM   1802  O  OD2   . ASP B 1 24   ? 3.017   7.448   -26.111 1.00 108.70 ?  12   ASP B OD2   1 
ATOM   1803  N  N     . VAL B 1 25   ? 1.655   6.315   -31.467 1.00 73.14  ?  13   VAL B N     1 
ATOM   1804  C  CA    . VAL B 1 25   ? 1.089   5.515   -32.546 1.00 64.34  ?  13   VAL B CA    1 
ATOM   1805  C  C     . VAL B 1 25   ? 1.374   4.048   -32.253 1.00 67.16  ?  13   VAL B C     1 
ATOM   1806  O  O     . VAL B 1 25   ? 2.506   3.580   -32.412 1.00 74.07  ?  13   VAL B O     1 
ATOM   1807  C  CB    . VAL B 1 25   ? 1.655   5.934   -33.909 1.00 62.62  ?  13   VAL B CB    1 
ATOM   1808  C  CG1   . VAL B 1 25   ? 1.034   5.106   -35.019 1.00 73.03  ?  13   VAL B CG1   1 
ATOM   1809  C  CG2   . VAL B 1 25   ? 1.411   7.416   -34.143 1.00 66.19  ?  13   VAL B CG2   1 
ATOM   1810  N  N     . LEU B 1 26   ? 0.343   3.318   -31.824 1.00 69.88  ?  14   LEU B N     1 
ATOM   1811  C  CA    . LEU B 1 26   ? 0.481   1.878   -31.623 1.00 71.72  ?  14   LEU B CA    1 
ATOM   1812  C  C     . LEU B 1 26   ? 0.546   1.151   -32.961 1.00 80.07  ?  14   LEU B C     1 
ATOM   1813  O  O     . LEU B 1 26   ? 1.568   0.545   -33.305 1.00 84.43  ?  14   LEU B O     1 
ATOM   1814  C  CB    . LEU B 1 26   ? -0.677  1.348   -30.773 1.00 70.68  ?  14   LEU B CB    1 
ATOM   1815  C  CG    . LEU B 1 26   ? -0.637  1.572   -29.257 1.00 69.92  ?  14   LEU B CG    1 
ATOM   1816  C  CD1   . LEU B 1 26   ? 0.685   1.088   -28.674 1.00 81.82  ?  14   LEU B CD1   1 
ATOM   1817  C  CD2   . LEU B 1 26   ? -0.896  3.029   -28.889 1.00 63.05  ?  14   LEU B CD2   1 
ATOM   1818  N  N     . THR B 1 27   ? -0.540  1.197   -33.727 1.00 83.16  ?  15   THR B N     1 
ATOM   1819  C  CA    . THR B 1 27   ? -0.586  0.672   -35.084 1.00 78.88  ?  15   THR B CA    1 
ATOM   1820  C  C     . THR B 1 27   ? -0.946  1.799   -36.044 1.00 77.92  ?  15   THR B C     1 
ATOM   1821  O  O     . THR B 1 27   ? -1.227  2.930   -35.637 1.00 81.96  ?  15   THR B O     1 
ATOM   1822  C  CB    . THR B 1 27   ? -1.595  -0.475  -35.214 1.00 78.26  ?  15   THR B CB    1 
ATOM   1823  O  OG1   . THR B 1 27   ? -2.928  0.048   -35.142 1.00 79.67  ?  15   THR B OG1   1 
ATOM   1824  C  CG2   . THR B 1 27   ? -1.395  -1.498  -34.103 1.00 71.24  ?  15   THR B CG2   1 
ATOM   1825  N  N     . ASP B 1 28   ? -0.950  1.476   -37.340 1.00 74.57  ?  16   ASP B N     1 
ATOM   1826  C  CA    . ASP B 1 28   ? -1.220  2.489   -38.352 1.00 90.15  ?  16   ASP B CA    1 
ATOM   1827  C  C     . ASP B 1 28   ? -2.637  3.037   -38.253 1.00 85.67  ?  16   ASP B C     1 
ATOM   1828  O  O     . ASP B 1 28   ? -2.891  4.163   -38.696 1.00 83.66  ?  16   ASP B O     1 
ATOM   1829  C  CB    . ASP B 1 28   ? -0.979  1.911   -39.747 1.00 94.60  ?  16   ASP B CB    1 
ATOM   1830  C  CG    . ASP B 1 28   ? 0.407   1.326   -39.904 1.00 102.39 ?  16   ASP B CG    1 
ATOM   1831  O  OD1   . ASP B 1 28   ? 1.148   1.272   -38.901 1.00 99.89  ?  16   ASP B OD1   1 
ATOM   1832  O  OD2   . ASP B 1 28   ? 0.756   0.920   -41.030 1.00 109.81 ?  16   ASP B OD2   1 
ATOM   1833  N  N     . ASN B 1 29   ? -3.562  2.273   -37.679 1.00 90.49  ?  17   ASN B N     1 
ATOM   1834  C  CA    . ASN B 1 29   ? -4.954  2.680   -37.533 1.00 92.30  ?  17   ASN B CA    1 
ATOM   1835  C  C     . ASN B 1 29   ? -5.405  2.554   -36.083 1.00 77.41  ?  17   ASN B C     1 
ATOM   1836  O  O     . ASN B 1 29   ? -6.544  2.174   -35.795 1.00 69.62  ?  17   ASN B O     1 
ATOM   1837  C  CB    . ASN B 1 29   ? -5.858  1.873   -38.464 1.00 86.25  ?  17   ASN B CB    1 
ATOM   1838  C  CG    . ASN B 1 29   ? -5.419  0.427   -38.602 1.00 90.02  ?  17   ASN B CG    1 
ATOM   1839  O  OD1   . ASN B 1 29   ? -4.261  0.091   -38.352 1.00 97.38  ?  17   ASN B OD1   1 
ATOM   1840  N  ND2   . ASN B 1 29   ? -6.342  -0.435  -39.013 1.00 80.09  ?  17   ASN B ND2   1 
ATOM   1841  N  N     . ARG B 1 30   ? -4.509  2.875   -35.151 1.00 78.48  ?  18   ARG B N     1 
ATOM   1842  C  CA    . ARG B 1 30   ? -4.838  2.918   -33.727 1.00 75.93  ?  18   ARG B CA    1 
ATOM   1843  C  C     . ARG B 1 30   ? -3.753  3.705   -33.012 1.00 73.12  ?  18   ARG B C     1 
ATOM   1844  O  O     . ARG B 1 30   ? -2.580  3.323   -33.061 1.00 73.00  ?  18   ARG B O     1 
ATOM   1845  C  CB    . ARG B 1 30   ? -4.962  1.513   -33.136 1.00 71.05  ?  18   ARG B CB    1 
ATOM   1846  C  CG    . ARG B 1 30   ? -5.027  1.497   -31.618 1.00 60.64  ?  18   ARG B CG    1 
ATOM   1847  C  CD    . ARG B 1 30   ? -5.361  0.116   -31.081 1.00 71.77  ?  18   ARG B CD    1 
ATOM   1848  N  NE    . ARG B 1 30   ? -5.256  0.068   -29.626 1.00 69.70  ?  18   ARG B NE    1 
ATOM   1849  C  CZ    . ARG B 1 30   ? -5.651  -0.957  -28.878 1.00 70.21  ?  18   ARG B CZ    1 
ATOM   1850  N  NH1   . ARG B 1 30   ? -6.187  -2.029  -29.446 1.00 75.67  ?  18   ARG B NH1   1 
ATOM   1851  N  NH2   . ARG B 1 30   ? -5.513  -0.909  -27.561 1.00 64.44  ?  18   ARG B NH2   1 
ATOM   1852  N  N     . SER B 1 31   ? -4.138  4.793   -32.348 1.00 65.13  ?  19   SER B N     1 
ATOM   1853  C  CA    . SER B 1 31   ? -3.190  5.641   -31.642 1.00 62.58  ?  19   SER B CA    1 
ATOM   1854  C  C     . SER B 1 31   ? -3.768  6.030   -30.289 1.00 65.02  ?  19   SER B C     1 
ATOM   1855  O  O     . SER B 1 31   ? -4.984  6.006   -30.079 1.00 64.23  ?  19   SER B O     1 
ATOM   1856  C  CB    . SER B 1 31   ? -2.846  6.899   -32.453 1.00 62.88  ?  19   SER B CB    1 
ATOM   1857  O  OG    . SER B 1 31   ? -2.286  6.558   -33.709 1.00 71.81  ?  19   SER B OG    1 
ATOM   1858  N  N     . GLN B 1 32   ? -2.876  6.383   -29.368 1.00 67.62  ?  20   GLN B N     1 
ATOM   1859  C  CA    . GLN B 1 32   ? -3.251  6.876   -28.050 1.00 52.82  ?  20   GLN B CA    1 
ATOM   1860  C  C     . GLN B 1 32   ? -2.946  8.364   -27.964 1.00 53.27  ?  20   GLN B C     1 
ATOM   1861  O  O     . GLN B 1 32   ? -1.864  8.805   -28.365 1.00 57.53  ?  20   GLN B O     1 
ATOM   1862  C  CB    . GLN B 1 32   ? -2.513  6.124   -26.940 1.00 50.18  ?  20   GLN B CB    1 
ATOM   1863  C  CG    . GLN B 1 32   ? -3.211  4.858   -26.476 1.00 65.09  ?  20   GLN B CG    1 
ATOM   1864  C  CD    . GLN B 1 32   ? -2.645  4.332   -25.172 1.00 77.30  ?  20   GLN B CD    1 
ATOM   1865  O  OE1   . GLN B 1 32   ? -1.676  4.873   -24.640 1.00 77.52  ?  20   GLN B OE1   1 
ATOM   1866  N  NE2   . GLN B 1 32   ? -3.253  3.274   -24.647 1.00 71.14  ?  20   GLN B NE2   1 
ATOM   1867  N  N     . PHE B 1 33   ? -3.898  9.130   -27.440 1.00 44.97  ?  21   PHE B N     1 
ATOM   1868  C  CA    . PHE B 1 33   ? -3.765  10.571  -27.298 1.00 45.47  ?  21   PHE B CA    1 
ATOM   1869  C  C     . PHE B 1 33   ? -3.861  10.950  -25.828 1.00 41.68  ?  21   PHE B C     1 
ATOM   1870  O  O     . PHE B 1 33   ? -4.619  10.340  -25.067 1.00 43.60  ?  21   PHE B O     1 
ATOM   1871  C  CB    . PHE B 1 33   ? -4.843  11.307  -28.101 1.00 44.87  ?  21   PHE B CB    1 
ATOM   1872  C  CG    . PHE B 1 33   ? -4.771  11.059  -29.580 1.00 50.63  ?  21   PHE B CG    1 
ATOM   1873  C  CD1   . PHE B 1 33   ? -5.407  9.967   -30.145 1.00 49.13  ?  21   PHE B CD1   1 
ATOM   1874  C  CD2   . PHE B 1 33   ? -4.069  11.920  -30.406 1.00 57.12  ?  21   PHE B CD2   1 
ATOM   1875  C  CE1   . PHE B 1 33   ? -5.342  9.737   -31.505 1.00 51.80  ?  21   PHE B CE1   1 
ATOM   1876  C  CE2   . PHE B 1 33   ? -4.002  11.695  -31.767 1.00 55.49  ?  21   PHE B CE2   1 
ATOM   1877  C  CZ    . PHE B 1 33   ? -4.639  10.602  -32.317 1.00 56.58  ?  21   PHE B CZ    1 
ATOM   1878  N  N     . VAL B 1 34   ? -3.088  11.959  -25.432 1.00 35.86  ?  22   VAL B N     1 
ATOM   1879  C  CA    . VAL B 1 34   ? -3.073  12.446  -24.058 1.00 35.14  ?  22   VAL B CA    1 
ATOM   1880  C  C     . VAL B 1 34   ? -3.251  13.958  -24.079 1.00 35.10  ?  22   VAL B C     1 
ATOM   1881  O  O     . VAL B 1 34   ? -2.489  14.669  -24.745 1.00 38.77  ?  22   VAL B O     1 
ATOM   1882  C  CB    . VAL B 1 34   ? -1.782  12.056  -23.316 1.00 33.89  ?  22   VAL B CB    1 
ATOM   1883  C  CG1   . VAL B 1 34   ? -1.847  10.603  -22.874 1.00 29.21  ?  22   VAL B CG1   1 
ATOM   1884  C  CG2   . VAL B 1 34   ? -0.564  12.282  -24.199 1.00 50.55  ?  22   VAL B CG2   1 
ATOM   1885  N  N     . ILE B 1 35   ? -4.260  14.444  -23.364 1.00 39.36  ?  23   ILE B N     1 
ATOM   1886  C  CA    . ILE B 1 35   ? -4.517  15.871  -23.211 1.00 42.26  ?  23   ILE B CA    1 
ATOM   1887  C  C     . ILE B 1 35   ? -4.109  16.245  -21.794 1.00 44.42  ?  23   ILE B C     1 
ATOM   1888  O  O     . ILE B 1 35   ? -4.799  15.901  -20.826 1.00 43.39  ?  23   ILE B O     1 
ATOM   1889  C  CB    . ILE B 1 35   ? -5.984  16.223  -23.487 1.00 40.25  ?  23   ILE B CB    1 
ATOM   1890  C  CG1   . ILE B 1 35   ? -6.387  15.750  -24.885 1.00 33.33  ?  23   ILE B CG1   1 
ATOM   1891  C  CG2   . ILE B 1 35   ? -6.206  17.719  -23.347 1.00 41.48  ?  23   ILE B CG2   1 
ATOM   1892  C  CD1   . ILE B 1 35   ? -7.816  16.077  -25.254 1.00 35.57  ?  23   ILE B CD1   1 
ATOM   1893  N  N     . GLU B 1 36   ? -2.985  16.955  -21.667 1.00 59.15  ?  24   GLU B N     1 
ATOM   1894  C  CA    . GLU B 1 36   ? -2.359  17.165  -20.376 1.00 59.07  ?  24   GLU B CA    1 
ATOM   1895  C  C     . GLU B 1 36   ? -1.625  18.499  -20.332 1.00 62.27  ?  24   GLU B C     1 
ATOM   1896  O  O     . GLU B 1 36   ? -0.908  18.827  -21.292 1.00 65.19  ?  24   GLU B O     1 
ATOM   1897  C  CB    . GLU B 1 36   ? -1.384  16.023  -20.085 1.00 54.87  ?  24   GLU B CB    1 
ATOM   1898  C  CG    . GLU B 1 36   ? -0.545  16.192  -18.832 1.00 62.88  ?  24   GLU B CG    1 
ATOM   1899  C  CD    . GLU B 1 36   ? 0.588   15.186  -18.760 1.00 74.89  ?  24   GLU B CD    1 
ATOM   1900  O  OE1   . GLU B 1 36   ? 1.071   14.757  -19.830 1.00 72.47  ?  24   GLU B OE1   1 
ATOM   1901  O  OE2   . GLU B 1 36   ? 0.993   14.820  -17.637 1.00 76.13  ?  24   GLU B OE2   1 
ATOM   1902  N  N     . PRO B 1 37   ? -1.777  19.284  -19.254 1.00 66.98  ?  25   PRO B N     1 
ATOM   1903  C  CA    . PRO B 1 37   ? -2.698  19.024  -18.146 1.00 64.63  ?  25   PRO B CA    1 
ATOM   1904  C  C     . PRO B 1 37   ? -3.993  19.825  -18.239 1.00 58.75  ?  25   PRO B C     1 
ATOM   1905  O  O     . PRO B 1 37   ? -3.994  20.950  -18.739 1.00 59.90  ?  25   PRO B O     1 
ATOM   1906  C  CB    . PRO B 1 37   ? -1.891  19.455  -16.910 1.00 62.75  ?  25   PRO B CB    1 
ATOM   1907  C  CG    . PRO B 1 37   ? -0.614  20.106  -17.441 1.00 63.37  ?  25   PRO B CG    1 
ATOM   1908  C  CD    . PRO B 1 37   ? -0.819  20.339  -18.900 1.00 68.67  ?  25   PRO B CD    1 
ATOM   1909  N  N     . LEU B 1 38   ? -5.084  19.240  -17.754 1.00 62.58  ?  26   LEU B N     1 
ATOM   1910  C  CA    . LEU B 1 38   ? -6.373  19.906  -17.674 1.00 65.01  ?  26   LEU B CA    1 
ATOM   1911  C  C     . LEU B 1 38   ? -6.681  20.265  -16.226 1.00 66.15  ?  26   LEU B C     1 
ATOM   1912  O  O     . LEU B 1 38   ? -6.175  19.644  -15.287 1.00 69.07  ?  26   LEU B O     1 
ATOM   1913  C  CB    . LEU B 1 38   ? -7.490  19.023  -18.242 1.00 69.86  ?  26   LEU B CB    1 
ATOM   1914  C  CG    . LEU B 1 38   ? -7.384  18.647  -19.721 1.00 55.51  ?  26   LEU B CG    1 
ATOM   1915  C  CD1   . LEU B 1 38   ? -8.518  17.718  -20.131 1.00 41.05  ?  26   LEU B CD1   1 
ATOM   1916  C  CD2   . LEU B 1 38   ? -7.369  19.894  -20.590 1.00 63.10  ?  26   LEU B CD2   1 
ATOM   1917  N  N     . GLU B 1 39   ? -7.525  21.279  -16.056 1.00 58.52  ?  27   GLU B N     1 
ATOM   1918  C  CA    . GLU B 1 39   ? -7.905  21.708  -14.722 1.00 58.15  ?  27   GLU B CA    1 
ATOM   1919  C  C     . GLU B 1 39   ? -8.804  20.669  -14.055 1.00 62.44  ?  27   GLU B C     1 
ATOM   1920  O  O     . GLU B 1 39   ? -9.552  19.956  -14.729 1.00 66.45  ?  27   GLU B O     1 
ATOM   1921  C  CB    . GLU B 1 39   ? -8.628  23.051  -14.772 1.00 63.96  ?  27   GLU B CB    1 
ATOM   1922  C  CG    . GLU B 1 39   ? -7.709  24.245  -14.916 1.00 74.30  ?  27   GLU B CG    1 
ATOM   1923  C  CD    . GLU B 1 39   ? -8.410  25.546  -14.602 1.00 75.66  ?  27   GLU B CD    1 
ATOM   1924  O  OE1   . GLU B 1 39   ? -9.647  25.605  -14.759 1.00 67.92  ?  27   GLU B OE1   1 
ATOM   1925  O  OE2   . GLU B 1 39   ? -7.730  26.506  -14.183 1.00 86.36  ?  27   GLU B OE2   1 
ATOM   1926  N  N     . PRO B 1 40   ? -8.747  20.564  -12.725 1.00 68.34  ?  28   PRO B N     1 
ATOM   1927  C  CA    . PRO B 1 40   ? -9.658  19.660  -12.006 1.00 64.74  ?  28   PRO B CA    1 
ATOM   1928  C  C     . PRO B 1 40   ? -11.061 20.248  -11.959 1.00 65.76  ?  28   PRO B C     1 
ATOM   1929  O  O     . PRO B 1 40   ? -11.260 21.363  -11.473 1.00 74.95  ?  28   PRO B O     1 
ATOM   1930  C  CB    . PRO B 1 40   ? -9.038  19.570  -10.604 1.00 72.71  ?  28   PRO B CB    1 
ATOM   1931  C  CG    . PRO B 1 40   ? -7.666  20.193  -10.722 1.00 75.06  ?  28   PRO B CG    1 
ATOM   1932  C  CD    . PRO B 1 40   ? -7.766  21.187  -11.825 1.00 72.67  ?  28   PRO B CD    1 
ATOM   1933  N  N     . GLY B 1 41   ? -12.033 19.500  -12.472 1.00 52.64  ?  29   GLY B N     1 
ATOM   1934  C  CA    . GLY B 1 41   ? -11.782 18.204  -13.075 1.00 51.86  ?  29   GLY B CA    1 
ATOM   1935  C  C     . GLY B 1 41   ? -12.307 18.124  -14.495 1.00 52.03  ?  29   GLY B C     1 
ATOM   1936  O  O     . GLY B 1 41   ? -13.270 17.409  -14.774 1.00 42.74  ?  29   GLY B O     1 
ATOM   1937  N  N     . PHE B 1 42   ? -11.666 18.870  -15.399 1.00 49.76  ?  30   PHE B N     1 
ATOM   1938  C  CA    . PHE B 1 42   ? -12.127 18.929  -16.781 1.00 40.19  ?  30   PHE B CA    1 
ATOM   1939  C  C     . PHE B 1 42   ? -11.846 17.647  -17.553 1.00 39.36  ?  30   PHE B C     1 
ATOM   1940  O  O     . PHE B 1 42   ? -12.441 17.440  -18.616 1.00 44.78  ?  30   PHE B O     1 
ATOM   1941  C  CB    . PHE B 1 42   ? -11.489 20.114  -17.507 1.00 40.31  ?  30   PHE B CB    1 
ATOM   1942  C  CG    . PHE B 1 42   ? -12.276 21.388  -17.396 1.00 47.86  ?  30   PHE B CG    1 
ATOM   1943  C  CD1   . PHE B 1 42   ? -13.570 21.460  -17.886 1.00 53.61  ?  30   PHE B CD1   1 
ATOM   1944  C  CD2   . PHE B 1 42   ? -11.720 22.515  -16.817 1.00 52.66  ?  30   PHE B CD2   1 
ATOM   1945  C  CE1   . PHE B 1 42   ? -14.299 22.630  -17.791 1.00 55.32  ?  30   PHE B CE1   1 
ATOM   1946  C  CE2   . PHE B 1 42   ? -12.444 23.690  -16.720 1.00 53.59  ?  30   PHE B CE2   1 
ATOM   1947  C  CZ    . PHE B 1 42   ? -13.735 23.746  -17.208 1.00 51.51  ?  30   PHE B CZ    1 
ATOM   1948  N  N     . GLY B 1 43   ? -10.956 16.788  -17.050 1.00 37.49  ?  31   GLY B N     1 
ATOM   1949  C  CA    . GLY B 1 43   ? -10.665 15.545  -17.745 1.00 36.38  ?  31   GLY B CA    1 
ATOM   1950  C  C     . GLY B 1 43   ? -11.885 14.667  -17.934 1.00 37.21  ?  31   GLY B C     1 
ATOM   1951  O  O     . GLY B 1 43   ? -11.977 13.928  -18.919 1.00 36.68  ?  31   GLY B O     1 
ATOM   1952  N  N     . TYR B 1 44   ? -12.836 14.732  -17.004 1.00 37.52  ?  32   TYR B N     1 
ATOM   1953  C  CA    . TYR B 1 44   ? -14.071 13.969  -17.128 1.00 32.04  ?  32   TYR B CA    1 
ATOM   1954  C  C     . TYR B 1 44   ? -15.137 14.705  -17.926 1.00 32.47  ?  32   TYR B C     1 
ATOM   1955  O  O     . TYR B 1 44   ? -16.010 14.058  -18.519 1.00 41.28  ?  32   TYR B O     1 
ATOM   1956  C  CB    . TYR B 1 44   ? -14.621 13.620  -15.743 1.00 40.18  ?  32   TYR B CB    1 
ATOM   1957  C  CG    . TYR B 1 44   ? -13.977 12.408  -15.107 1.00 41.35  ?  32   TYR B CG    1 
ATOM   1958  C  CD1   . TYR B 1 44   ? -14.507 11.139  -15.299 1.00 38.70  ?  32   TYR B CD1   1 
ATOM   1959  C  CD2   . TYR B 1 44   ? -12.845 12.532  -14.312 1.00 49.67  ?  32   TYR B CD2   1 
ATOM   1960  C  CE1   . TYR B 1 44   ? -13.928 10.028  -14.721 1.00 47.79  ?  32   TYR B CE1   1 
ATOM   1961  C  CE2   . TYR B 1 44   ? -12.258 11.424  -13.728 1.00 49.89  ?  32   TYR B CE2   1 
ATOM   1962  C  CZ    . TYR B 1 44   ? -12.805 10.175  -13.937 1.00 52.93  ?  32   TYR B CZ    1 
ATOM   1963  O  OH    . TYR B 1 44   ? -12.228 9.066   -13.360 1.00 57.53  ?  32   TYR B OH    1 
ATOM   1964  N  N     . THR B 1 45   ? -15.091 16.039  -17.956 1.00 34.63  ?  33   THR B N     1 
ATOM   1965  C  CA    . THR B 1 45   ? -16.071 16.799  -18.727 1.00 38.35  ?  33   THR B CA    1 
ATOM   1966  C  C     . THR B 1 45   ? -15.936 16.501  -20.215 1.00 37.85  ?  33   THR B C     1 
ATOM   1967  O  O     . THR B 1 45   ? -16.877 16.021  -20.857 1.00 41.00  ?  33   THR B O     1 
ATOM   1968  C  CB    . THR B 1 45   ? -15.906 18.298  -18.470 1.00 35.54  ?  33   THR B CB    1 
ATOM   1969  O  OG1   . THR B 1 45   ? -14.788 18.791  -19.217 1.00 41.51  ?  33   THR B OG1   1 
ATOM   1970  C  CG2   . THR B 1 45   ? -15.673 18.570  -16.997 1.00 33.97  ?  33   THR B CG2   1 
ATOM   1971  N  N     . LEU B 1 46   ? -14.765 16.782  -20.781 1.00 25.66  ?  34   LEU B N     1 
ATOM   1972  C  CA    . LEU B 1 46   ? -14.488 16.518  -22.185 1.00 31.44  ?  34   LEU B CA    1 
ATOM   1973  C  C     . LEU B 1 46   ? -13.975 15.103  -22.426 1.00 31.80  ?  34   LEU B C     1 
ATOM   1974  O  O     . LEU B 1 46   ? -13.455 14.819  -23.509 1.00 36.32  ?  34   LEU B O     1 
ATOM   1975  C  CB    . LEU B 1 46   ? -13.489 17.546  -22.727 1.00 33.77  ?  34   LEU B CB    1 
ATOM   1976  C  CG    . LEU B 1 46   ? -12.069 17.588  -22.163 1.00 28.93  ?  34   LEU B CG    1 
ATOM   1977  C  CD1   . LEU B 1 46   ? -11.081 16.999  -23.155 1.00 25.64  ?  34   LEU B CD1   1 
ATOM   1978  C  CD2   . LEU B 1 46   ? -11.686 19.013  -21.815 1.00 31.37  ?  34   LEU B CD2   1 
ATOM   1979  N  N     . GLY B 1 47   ? -14.117 14.212  -21.448 1.00 35.15  ?  35   GLY B N     1 
ATOM   1980  C  CA    . GLY B 1 47   ? -13.697 12.836  -21.614 1.00 33.17  ?  35   GLY B CA    1 
ATOM   1981  C  C     . GLY B 1 47   ? -14.719 11.996  -22.350 1.00 33.47  ?  35   GLY B C     1 
ATOM   1982  O  O     . GLY B 1 47   ? -14.444 11.483  -23.439 1.00 33.48  ?  35   GLY B O     1 
ATOM   1983  N  N     . ASN B 1 48   ? -15.909 11.847  -21.763 1.00 39.51  ?  36   ASN B N     1 
ATOM   1984  C  CA    . ASN B 1 48   ? -16.967 11.085  -22.414 1.00 41.88  ?  36   ASN B CA    1 
ATOM   1985  C  C     . ASN B 1 48   ? -17.505 11.793  -23.650 1.00 36.89  ?  36   ASN B C     1 
ATOM   1986  O  O     . ASN B 1 48   ? -18.066 11.134  -24.532 1.00 40.60  ?  36   ASN B O     1 
ATOM   1987  C  CB    . ASN B 1 48   ? -18.103 10.814  -21.425 1.00 46.76  ?  36   ASN B CB    1 
ATOM   1988  C  CG    . ASN B 1 48   ? -19.110 9.806   -21.950 1.00 44.30  ?  36   ASN B CG    1 
ATOM   1989  O  OD1   . ASN B 1 48   ? -18.779 8.949   -22.769 1.00 55.75  ?  36   ASN B OD1   1 
ATOM   1990  N  ND2   . ASN B 1 48   ? -20.347 9.906   -21.478 1.00 35.69  ?  36   ASN B ND2   1 
ATOM   1991  N  N     . SER B 1 49   ? -17.344 13.115  -23.736 1.00 37.27  ?  37   SER B N     1 
ATOM   1992  C  CA    . SER B 1 49   ? -17.828 13.844  -24.904 1.00 30.82  ?  37   SER B CA    1 
ATOM   1993  C  C     . SER B 1 49   ? -16.955 13.578  -26.125 1.00 29.74  ?  37   SER B C     1 
ATOM   1994  O  O     . SER B 1 49   ? -17.469 13.416  -27.237 1.00 33.94  ?  37   SER B O     1 
ATOM   1995  C  CB    . SER B 1 49   ? -17.896 15.340  -24.597 1.00 36.00  ?  37   SER B CB    1 
ATOM   1996  O  OG    . SER B 1 49   ? -18.837 15.604  -23.570 1.00 35.44  ?  37   SER B OG    1 
ATOM   1997  N  N     . LEU B 1 50   ? -15.634 13.527  -25.939 1.00 27.12  ?  38   LEU B N     1 
ATOM   1998  C  CA    . LEU B 1 50   ? -14.747 13.231  -27.059 1.00 22.54  ?  38   LEU B CA    1 
ATOM   1999  C  C     . LEU B 1 50   ? -14.951 11.814  -27.577 1.00 24.06  ?  38   LEU B C     1 
ATOM   2000  O  O     . LEU B 1 50   ? -14.831 11.575  -28.784 1.00 36.54  ?  38   LEU B O     1 
ATOM   2001  C  CB    . LEU B 1 50   ? -13.290 13.445  -26.656 1.00 20.21  ?  38   LEU B CB    1 
ATOM   2002  C  CG    . LEU B 1 50   ? -12.758 14.865  -26.844 1.00 28.77  ?  38   LEU B CG    1 
ATOM   2003  C  CD1   . LEU B 1 50   ? -11.315 14.963  -26.379 1.00 27.44  ?  38   LEU B CD1   1 
ATOM   2004  C  CD2   . LEU B 1 50   ? -12.883 15.288  -28.301 1.00 19.47  ?  38   LEU B CD2   1 
ATOM   2005  N  N     . ARG B 1 51   ? -15.266 10.867  -26.693 1.00 32.19  ?  39   ARG B N     1 
ATOM   2006  C  CA    . ARG B 1 51   ? -15.499 9.498   -27.142 1.00 33.42  ?  39   ARG B CA    1 
ATOM   2007  C  C     . ARG B 1 51   ? -16.789 9.393   -27.944 1.00 35.86  ?  39   ARG B C     1 
ATOM   2008  O  O     . ARG B 1 51   ? -16.805 8.823   -29.042 1.00 37.21  ?  39   ARG B O     1 
ATOM   2009  C  CB    . ARG B 1 51   ? -15.536 8.543   -25.950 1.00 32.40  ?  39   ARG B CB    1 
ATOM   2010  C  CG    . ARG B 1 51   ? -16.052 7.162   -26.314 1.00 33.75  ?  39   ARG B CG    1 
ATOM   2011  C  CD    . ARG B 1 51   ? -15.928 6.179   -25.166 1.00 27.75  ?  39   ARG B CD    1 
ATOM   2012  N  NE    . ARG B 1 51   ? -16.325 4.836   -25.577 1.00 37.09  ?  39   ARG B NE    1 
ATOM   2013  C  CZ    . ARG B 1 51   ? -17.565 4.366   -25.494 1.00 50.00  ?  39   ARG B CZ    1 
ATOM   2014  N  NH1   . ARG B 1 51   ? -18.533 5.130   -25.008 1.00 53.22  ?  39   ARG B NH1   1 
ATOM   2015  N  NH2   . ARG B 1 51   ? -17.837 3.132   -25.897 1.00 47.61  ?  39   ARG B NH2   1 
ATOM   2016  N  N     . ARG B 1 52   ? -17.885 9.941   -27.412 1.00 34.42  ?  40   ARG B N     1 
ATOM   2017  C  CA    . ARG B 1 52   ? -19.169 9.830   -28.097 1.00 36.45  ?  40   ARG B CA    1 
ATOM   2018  C  C     . ARG B 1 52   ? -19.176 10.606  -29.408 1.00 39.16  ?  40   ARG B C     1 
ATOM   2019  O  O     . ARG B 1 52   ? -19.916 10.249  -30.332 1.00 42.55  ?  40   ARG B O     1 
ATOM   2020  C  CB    . ARG B 1 52   ? -20.298 10.313  -27.186 1.00 39.52  ?  40   ARG B CB    1 
ATOM   2021  C  CG    . ARG B 1 52   ? -21.673 9.801   -27.587 1.00 44.87  ?  40   ARG B CG    1 
ATOM   2022  C  CD    . ARG B 1 52   ? -21.729 8.281   -27.525 1.00 53.52  ?  40   ARG B CD    1 
ATOM   2023  N  NE    . ARG B 1 52   ? -21.718 7.782   -26.152 1.00 55.74  ?  40   ARG B NE    1 
ATOM   2024  C  CZ    . ARG B 1 52   ? -22.779 7.270   -25.535 1.00 61.33  ?  40   ARG B CZ    1 
ATOM   2025  N  NH1   . ARG B 1 52   ? -23.938 7.178   -26.171 1.00 59.06  ?  40   ARG B NH1   1 
ATOM   2026  N  NH2   . ARG B 1 52   ? -22.679 6.842   -24.284 1.00 63.52  ?  40   ARG B NH2   1 
ATOM   2027  N  N     . THR B 1 53   ? -18.364 11.661  -29.511 1.00 33.47  ?  41   THR B N     1 
ATOM   2028  C  CA    . THR B 1 53   ? -18.273 12.397  -30.768 1.00 33.01  ?  41   THR B CA    1 
ATOM   2029  C  C     . THR B 1 53   ? -17.548 11.580  -31.828 1.00 35.87  ?  41   THR B C     1 
ATOM   2030  O  O     . THR B 1 53   ? -17.924 11.603  -33.006 1.00 45.20  ?  41   THR B O     1 
ATOM   2031  C  CB    . THR B 1 53   ? -17.569 13.734  -30.549 1.00 27.78  ?  41   THR B CB    1 
ATOM   2032  O  OG1   . THR B 1 53   ? -18.136 14.392  -29.410 1.00 34.21  ?  41   THR B OG1   1 
ATOM   2033  C  CG2   . THR B 1 53   ? -17.733 14.625  -31.771 1.00 30.23  ?  41   THR B CG2   1 
ATOM   2034  N  N     . LEU B 1 54   ? -16.504 10.853  -31.427 1.00 28.77  ?  42   LEU B N     1 
ATOM   2035  C  CA    . LEU B 1 54   ? -15.804 9.978   -32.361 1.00 31.01  ?  42   LEU B CA    1 
ATOM   2036  C  C     . LEU B 1 54   ? -16.700 8.834   -32.817 1.00 37.34  ?  42   LEU B C     1 
ATOM   2037  O  O     . LEU B 1 54   ? -16.833 8.575   -34.019 1.00 51.35  ?  42   LEU B O     1 
ATOM   2038  C  CB    . LEU B 1 54   ? -14.532 9.434   -31.709 1.00 31.82  ?  42   LEU B CB    1 
ATOM   2039  C  CG    . LEU B 1 54   ? -13.413 10.428  -31.405 1.00 23.84  ?  42   LEU B CG    1 
ATOM   2040  C  CD1   . LEU B 1 54   ? -12.476 9.860   -30.354 1.00 21.03  ?  42   LEU B CD1   1 
ATOM   2041  C  CD2   . LEU B 1 54   ? -12.650 10.756  -32.670 1.00 39.69  ?  42   LEU B CD2   1 
ATOM   2042  N  N     . LEU B 1 55   ? -17.340 8.149   -31.866 1.00 38.36  ?  43   LEU B N     1 
ATOM   2043  C  CA    . LEU B 1 55   ? -18.075 6.928   -32.173 1.00 40.20  ?  43   LEU B CA    1 
ATOM   2044  C  C     . LEU B 1 55   ? -19.386 7.182   -32.906 1.00 41.54  ?  43   LEU B C     1 
ATOM   2045  O  O     . LEU B 1 55   ? -19.944 6.242   -33.481 1.00 43.68  ?  43   LEU B O     1 
ATOM   2046  C  CB    . LEU B 1 55   ? -18.360 6.154   -30.885 1.00 46.55  ?  43   LEU B CB    1 
ATOM   2047  C  CG    . LEU B 1 55   ? -17.625 4.828   -30.688 1.00 41.11  ?  43   LEU B CG    1 
ATOM   2048  C  CD1   . LEU B 1 55   ? -16.129 5.027   -30.822 1.00 39.94  ?  43   LEU B CD1   1 
ATOM   2049  C  CD2   . LEU B 1 55   ? -17.967 4.224   -29.334 1.00 39.96  ?  43   LEU B CD2   1 
ATOM   2050  N  N     . SER B 1 56   ? -19.896 8.417   -32.906 1.00 39.34  ?  44   SER B N     1 
ATOM   2051  C  CA    . SER B 1 56   ? -21.250 8.637   -33.398 1.00 44.77  ?  44   SER B CA    1 
ATOM   2052  C  C     . SER B 1 56   ? -21.421 9.895   -34.243 1.00 48.68  ?  44   SER B C     1 
ATOM   2053  O  O     . SER B 1 56   ? -22.565 10.267  -34.532 1.00 54.78  ?  44   SER B O     1 
ATOM   2054  C  CB    . SER B 1 56   ? -22.234 8.687   -32.221 1.00 53.26  ?  44   SER B CB    1 
ATOM   2055  O  OG    . SER B 1 56   ? -22.096 7.550   -31.386 1.00 50.40  ?  44   SER B OG    1 
ATOM   2056  N  N     . SER B 1 57   ? -20.344 10.564  -34.659 1.00 47.58  ?  45   SER B N     1 
ATOM   2057  C  CA    . SER B 1 57   ? -20.502 11.812  -35.400 1.00 53.87  ?  45   SER B CA    1 
ATOM   2058  C  C     . SER B 1 57   ? -19.343 12.023  -36.368 1.00 48.52  ?  45   SER B C     1 
ATOM   2059  O  O     . SER B 1 57   ? -18.787 13.122  -36.465 1.00 47.39  ?  45   SER B O     1 
ATOM   2060  C  CB    . SER B 1 57   ? -20.637 13.009  -34.455 1.00 55.22  ?  45   SER B CB    1 
ATOM   2061  O  OG    . SER B 1 57   ? -21.008 14.177  -35.166 1.00 66.01  ?  45   SER B OG    1 
ATOM   2062  N  N     . ILE B 1 58   ? -18.968 10.974  -37.103 1.00 51.20  ?  46   ILE B N     1 
ATOM   2063  C  CA    . ILE B 1 58   ? -18.009 11.077  -38.189 1.00 51.39  ?  46   ILE B CA    1 
ATOM   2064  C  C     . ILE B 1 58   ? -18.635 10.422  -39.418 1.00 57.38  ?  46   ILE B C     1 
ATOM   2065  O  O     . ILE B 1 58   ? -18.994 9.242   -39.364 1.00 61.98  ?  46   ILE B O     1 
ATOM   2066  C  CB    . ILE B 1 58   ? -16.656 10.422  -37.865 1.00 50.86  ?  46   ILE B CB    1 
ATOM   2067  C  CG1   . ILE B 1 58   ? -16.064 11.015  -36.586 1.00 55.47  ?  46   ILE B CG1   1 
ATOM   2068  C  CG2   . ILE B 1 58   ? -15.685 10.616  -39.019 1.00 36.16  ?  46   ILE B CG2   1 
ATOM   2069  C  CD1   . ILE B 1 58   ? -14.680 10.496  -36.260 1.00 46.19  ?  46   ILE B CD1   1 
ATOM   2070  N  N     . PRO B 1 59   ? -18.791 11.133  -40.531 1.00 45.06  ?  47   PRO B N     1 
ATOM   2071  C  CA    . PRO B 1 59   ? -19.473 10.546  -41.693 1.00 35.64  ?  47   PRO B CA    1 
ATOM   2072  C  C     . PRO B 1 59   ? -18.639 9.445   -42.332 1.00 36.70  ?  47   PRO B C     1 
ATOM   2073  O  O     . PRO B 1 59   ? -17.463 9.638   -42.647 1.00 33.05  ?  47   PRO B O     1 
ATOM   2074  C  CB    . PRO B 1 59   ? -19.656 11.739  -42.638 1.00 47.06  ?  47   PRO B CB    1 
ATOM   2075  C  CG    . PRO B 1 59   ? -18.569 12.688  -42.253 1.00 53.60  ?  47   PRO B CG    1 
ATOM   2076  C  CD    . PRO B 1 59   ? -18.389 12.530  -40.769 1.00 50.45  ?  47   PRO B CD    1 
ATOM   2077  N  N     . GLY B 1 60   ? -19.264 8.285   -42.520 1.00 37.81  ?  48   GLY B N     1 
ATOM   2078  C  CA    . GLY B 1 60   ? -18.622 7.154   -43.155 1.00 44.68  ?  48   GLY B CA    1 
ATOM   2079  C  C     . GLY B 1 60   ? -19.630 6.369   -43.966 1.00 48.32  ?  48   GLY B C     1 
ATOM   2080  O  O     . GLY B 1 60   ? -20.822 6.680   -43.983 1.00 51.09  ?  48   GLY B O     1 
ATOM   2081  N  N     . ALA B 1 61   ? -19.136 5.335   -44.641 1.00 43.39  ?  49   ALA B N     1 
ATOM   2082  C  CA    . ALA B 1 61   ? -19.962 4.502   -45.500 1.00 39.51  ?  49   ALA B CA    1 
ATOM   2083  C  C     . ALA B 1 61   ? -19.775 3.036   -45.137 1.00 41.07  ?  49   ALA B C     1 
ATOM   2084  O  O     . ALA B 1 61   ? -18.686 2.609   -44.742 1.00 42.09  ?  49   ALA B O     1 
ATOM   2085  C  CB    . ALA B 1 61   ? -19.629 4.719   -46.982 1.00 49.61  ?  49   ALA B CB    1 
ATOM   2086  N  N     . ALA B 1 62   ? -20.855 2.272   -45.275 1.00 43.19  ?  50   ALA B N     1 
ATOM   2087  C  CA    . ALA B 1 62   ? -20.836 0.841   -45.009 1.00 45.48  ?  50   ALA B CA    1 
ATOM   2088  C  C     . ALA B 1 62   ? -22.010 0.203   -45.736 1.00 44.27  ?  50   ALA B C     1 
ATOM   2089  O  O     . ALA B 1 62   ? -22.893 0.891   -46.256 1.00 36.45  ?  50   ALA B O     1 
ATOM   2090  C  CB    . ALA B 1 62   ? -20.889 0.546   -43.507 1.00 45.33  ?  50   ALA B CB    1 
ATOM   2091  N  N     . VAL B 1 63   ? -22.010 -1.129  -45.764 1.00 49.71  ?  51   VAL B N     1 
ATOM   2092  C  CA    . VAL B 1 63   ? -23.060 -1.864  -46.458 1.00 41.49  ?  51   VAL B CA    1 
ATOM   2093  C  C     . VAL B 1 63   ? -24.362 -1.753  -45.676 1.00 45.49  ?  51   VAL B C     1 
ATOM   2094  O  O     . VAL B 1 63   ? -24.407 -2.020  -44.468 1.00 48.80  ?  51   VAL B O     1 
ATOM   2095  C  CB    . VAL B 1 63   ? -22.653 -3.331  -46.656 1.00 34.27  ?  51   VAL B CB    1 
ATOM   2096  C  CG1   . VAL B 1 63   ? -23.735 -4.080  -47.415 1.00 46.04  ?  51   VAL B CG1   1 
ATOM   2097  C  CG2   . VAL B 1 63   ? -21.324 -3.416  -47.390 1.00 34.11  ?  51   VAL B CG2   1 
ATOM   2098  N  N     . THR B 1 64   ? -25.430 -1.357  -46.366 1.00 41.79  ?  52   THR B N     1 
ATOM   2099  C  CA    . THR B 1 64   ? -26.745 -1.216  -45.753 1.00 45.87  ?  52   THR B CA    1 
ATOM   2100  C  C     . THR B 1 64   ? -27.568 -2.494  -45.854 1.00 54.88  ?  52   THR B C     1 
ATOM   2101  O  O     . THR B 1 64   ? -28.193 -2.909  -44.871 1.00 55.26  ?  52   THR B O     1 
ATOM   2102  C  CB    . THR B 1 64   ? -27.501 -0.052  -46.402 1.00 55.19  ?  52   THR B CB    1 
ATOM   2103  O  OG1   . THR B 1 64   ? -26.839 1.180   -46.087 1.00 56.55  ?  52   THR B OG1   1 
ATOM   2104  C  CG2   . THR B 1 64   ? -28.937 0.007   -45.906 1.00 63.27  ?  52   THR B CG2   1 
ATOM   2105  N  N     . SER B 1 65   ? -27.577 -3.130  -47.023 1.00 50.17  ?  53   SER B N     1 
ATOM   2106  C  CA    . SER B 1 65   ? -28.306 -4.373  -47.218 1.00 49.76  ?  53   SER B CA    1 
ATOM   2107  C  C     . SER B 1 65   ? -27.645 -5.159  -48.339 1.00 44.39  ?  53   SER B C     1 
ATOM   2108  O  O     . SER B 1 65   ? -26.992 -4.592  -49.219 1.00 42.99  ?  53   SER B O     1 
ATOM   2109  C  CB    . SER B 1 65   ? -29.784 -4.117  -47.538 1.00 53.38  ?  53   SER B CB    1 
ATOM   2110  O  OG    . SER B 1 65   ? -29.927 -3.389  -48.745 1.00 57.79  ?  53   SER B OG    1 
ATOM   2111  N  N     . ILE B 1 66   ? -27.814 -6.481  -48.293 1.00 49.71  ?  54   ILE B N     1 
ATOM   2112  C  CA    . ILE B 1 66   ? -27.283 -7.367  -49.318 1.00 55.17  ?  54   ILE B CA    1 
ATOM   2113  C  C     . ILE B 1 66   ? -28.409 -8.250  -49.836 1.00 58.78  ?  54   ILE B C     1 
ATOM   2114  O  O     . ILE B 1 66   ? -29.471 -8.374  -49.222 1.00 58.13  ?  54   ILE B O     1 
ATOM   2115  C  CB    . ILE B 1 66   ? -26.112 -8.238  -48.809 1.00 44.10  ?  54   ILE B CB    1 
ATOM   2116  C  CG1   . ILE B 1 66   ? -26.631 -9.404  -47.970 1.00 39.37  ?  54   ILE B CG1   1 
ATOM   2117  C  CG2   . ILE B 1 66   ? -25.133 -7.407  -47.999 1.00 36.86  ?  54   ILE B CG2   1 
ATOM   2118  C  CD1   . ILE B 1 66   ? -25.551 -10.371 -47.542 1.00 41.34  ?  54   ILE B CD1   1 
ATOM   2119  N  N     . ARG B 1 67   ? -28.160 -8.866  -50.991 1.00 67.31  ?  55   ARG B N     1 
ATOM   2120  C  CA    . ARG B 1 67   ? -29.113 -9.782  -51.609 1.00 64.71  ?  55   ARG B CA    1 
ATOM   2121  C  C     . ARG B 1 67   ? -28.330 -10.878 -52.312 1.00 59.71  ?  55   ARG B C     1 
ATOM   2122  O  O     . ARG B 1 67   ? -27.568 -10.596 -53.242 1.00 59.09  ?  55   ARG B O     1 
ATOM   2123  C  CB    . ARG B 1 67   ? -30.028 -9.049  -52.593 1.00 68.76  ?  55   ARG B CB    1 
ATOM   2124  C  CG    . ARG B 1 67   ? -31.097 -9.932  -53.213 1.00 75.26  ?  55   ARG B CG    1 
ATOM   2125  C  CD    . ARG B 1 67   ? -32.085 -9.117  -54.031 1.00 77.60  ?  55   ARG B CD    1 
ATOM   2126  N  NE    . ARG B 1 67   ? -31.447 -8.425  -55.146 1.00 72.82  ?  55   ARG B NE    1 
ATOM   2127  C  CZ    . ARG B 1 67   ? -32.097 -7.667  -56.023 1.00 76.42  ?  55   ARG B CZ    1 
ATOM   2128  N  NH1   . ARG B 1 67   ? -33.408 -7.503  -55.915 1.00 88.95  ?  55   ARG B NH1   1 
ATOM   2129  N  NH2   . ARG B 1 67   ? -31.439 -7.073  -57.008 1.00 82.76  ?  55   ARG B NH2   1 
ATOM   2130  N  N     . ILE B 1 68   ? -28.514 -12.118 -51.870 1.00 52.22  ?  56   ILE B N     1 
ATOM   2131  C  CA    . ILE B 1 68   ? -27.749 -13.257 -52.366 1.00 58.64  ?  56   ILE B CA    1 
ATOM   2132  C  C     . ILE B 1 68   ? -28.620 -14.037 -53.340 1.00 66.95  ?  56   ILE B C     1 
ATOM   2133  O  O     . ILE B 1 68   ? -29.736 -14.446 -52.998 1.00 68.71  ?  56   ILE B O     1 
ATOM   2134  C  CB    . ILE B 1 68   ? -27.270 -14.154 -51.215 1.00 57.75  ?  56   ILE B CB    1 
ATOM   2135  C  CG1   . ILE B 1 68   ? -26.450 -13.339 -50.214 1.00 62.73  ?  56   ILE B CG1   1 
ATOM   2136  C  CG2   . ILE B 1 68   ? -26.454 -15.321 -51.753 1.00 57.61  ?  56   ILE B CG2   1 
ATOM   2137  C  CD1   . ILE B 1 68   ? -25.954 -14.141 -49.032 1.00 59.98  ?  56   ILE B CD1   1 
ATOM   2138  N  N     . ASP B 1 69   ? -28.110 -14.244 -54.553 1.00 65.15  ?  57   ASP B N     1 
ATOM   2139  C  CA    . ASP B 1 69   ? -28.832 -15.028 -55.546 1.00 64.94  ?  57   ASP B CA    1 
ATOM   2140  C  C     . ASP B 1 69   ? -28.890 -16.487 -55.111 1.00 58.00  ?  57   ASP B C     1 
ATOM   2141  O  O     . ASP B 1 69   ? -27.877 -17.067 -54.707 1.00 58.14  ?  57   ASP B O     1 
ATOM   2142  C  CB    . ASP B 1 69   ? -28.160 -14.906 -56.913 1.00 72.59  ?  57   ASP B CB    1 
ATOM   2143  C  CG    . ASP B 1 69   ? -29.032 -15.424 -58.042 1.00 75.69  ?  57   ASP B CG    1 
ATOM   2144  O  OD1   . ASP B 1 69   ? -30.230 -15.680 -57.803 1.00 77.19  ?  57   ASP B OD1   1 
ATOM   2145  O  OD2   . ASP B 1 69   ? -28.517 -15.577 -59.171 1.00 74.07  ?  57   ASP B OD2   1 
ATOM   2146  N  N     . GLY B 1 70   ? -30.078 -17.081 -55.196 1.00 55.09  ?  58   GLY B N     1 
ATOM   2147  C  CA    . GLY B 1 70   ? -30.296 -18.425 -54.710 1.00 57.67  ?  58   GLY B CA    1 
ATOM   2148  C  C     . GLY B 1 70   ? -30.761 -18.511 -53.273 1.00 60.62  ?  58   GLY B C     1 
ATOM   2149  O  O     . GLY B 1 70   ? -30.954 -19.624 -52.767 1.00 58.51  ?  58   GLY B O     1 
ATOM   2150  N  N     . VAL B 1 71   ? -30.944 -17.378 -52.601 1.00 70.18  ?  59   VAL B N     1 
ATOM   2151  C  CA    . VAL B 1 71   ? -31.422 -17.329 -51.224 1.00 64.81  ?  59   VAL B CA    1 
ATOM   2152  C  C     . VAL B 1 71   ? -32.691 -16.487 -51.219 1.00 71.09  ?  59   VAL B C     1 
ATOM   2153  O  O     . VAL B 1 71   ? -32.634 -15.266 -51.413 1.00 70.53  ?  59   VAL B O     1 
ATOM   2154  C  CB    . VAL B 1 71   ? -30.370 -16.752 -50.269 1.00 63.17  ?  59   VAL B CB    1 
ATOM   2155  C  CG1   . VAL B 1 71   ? -30.914 -16.694 -48.851 1.00 83.98  ?  59   VAL B CG1   1 
ATOM   2156  C  CG2   . VAL B 1 71   ? -29.093 -17.580 -50.322 1.00 69.48  ?  59   VAL B CG2   1 
ATOM   2157  N  N     . LEU B 1 72   ? -33.837 -17.135 -50.998 1.00 80.99  ?  60   LEU B N     1 
ATOM   2158  C  CA    . LEU B 1 72   ? -35.128 -16.452 -51.036 1.00 85.45  ?  60   LEU B CA    1 
ATOM   2159  C  C     . LEU B 1 72   ? -35.855 -16.557 -49.702 1.00 82.73  ?  60   LEU B C     1 
ATOM   2160  O  O     . LEU B 1 72   ? -36.037 -15.538 -49.032 1.00 81.35  ?  60   LEU B O     1 
ATOM   2161  C  CB    . LEU B 1 72   ? -35.982 -17.005 -52.179 1.00 88.41  ?  60   LEU B CB    1 
ATOM   2162  C  CG    . LEU B 1 72   ? -35.551 -16.623 -53.594 1.00 76.05  ?  60   LEU B CG    1 
ATOM   2163  C  CD1   . LEU B 1 72   ? -36.428 -17.314 -54.625 1.00 84.51  ?  60   LEU B CD1   1 
ATOM   2164  C  CD2   . LEU B 1 72   ? -35.599 -15.114 -53.772 1.00 75.43  ?  60   LEU B CD2   1 
ATOM   2165  N  N     . HIS B 1 73   ? -36.288 -17.750 -49.296 1.00 80.72  ?  61   HIS B N     1 
ATOM   2166  C  CA    . HIS B 1 73   ? -37.067 -17.925 -48.077 1.00 85.32  ?  61   HIS B CA    1 
ATOM   2167  C  C     . HIS B 1 73   ? -36.335 -18.737 -47.016 1.00 88.07  ?  61   HIS B C     1 
ATOM   2168  O  O     . HIS B 1 73   ? -36.922 -19.040 -45.971 1.00 94.22  ?  61   HIS B O     1 
ATOM   2169  C  CB    . HIS B 1 73   ? -38.408 -18.592 -48.396 1.00 91.93  ?  61   HIS B CB    1 
ATOM   2170  C  CG    . HIS B 1 73   ? -39.270 -17.807 -49.335 1.00 96.60  ?  61   HIS B CG    1 
ATOM   2171  N  ND1   . HIS B 1 73   ? -38.943 -17.611 -50.659 1.00 95.97  ?  61   HIS B ND1   1 
ATOM   2172  C  CD2   . HIS B 1 73   ? -40.453 -17.176 -49.143 1.00 91.85  ?  61   HIS B CD2   1 
ATOM   2173  C  CE1   . HIS B 1 73   ? -39.884 -16.890 -51.242 1.00 93.32  ?  61   HIS B CE1   1 
ATOM   2174  N  NE2   . HIS B 1 73   ? -40.812 -16.613 -50.343 1.00 96.27  ?  61   HIS B NE2   1 
ATOM   2175  N  N     . GLU B 1 74   ? -35.073 -19.093 -47.251 1.00 86.47  ?  62   GLU B N     1 
ATOM   2176  C  CA    . GLU B 1 74   ? -34.360 -19.986 -46.344 1.00 91.05  ?  62   GLU B CA    1 
ATOM   2177  C  C     . GLU B 1 74   ? -33.516 -19.218 -45.333 1.00 99.52  ?  62   GLU B C     1 
ATOM   2178  O  O     . GLU B 1 74   ? -33.802 -19.243 -44.131 1.00 97.71  ?  62   GLU B O     1 
ATOM   2179  C  CB    . GLU B 1 74   ? -33.479 -20.953 -47.139 1.00 82.52  ?  62   GLU B CB    1 
ATOM   2180  N  N     . PHE B 1 75   ? -32.473 -18.543 -45.816 1.00 101.24 ?  63   PHE B N     1 
ATOM   2181  C  CA    . PHE B 1 75   ? -31.483 -17.825 -45.016 1.00 92.09  ?  63   PHE B CA    1 
ATOM   2182  C  C     . PHE B 1 75   ? -30.708 -18.738 -44.075 1.00 91.94  ?  63   PHE B C     1 
ATOM   2183  O  O     . PHE B 1 75   ? -30.066 -18.250 -43.139 1.00 86.34  ?  63   PHE B O     1 
ATOM   2184  C  CB    . PHE B 1 75   ? -32.118 -16.684 -44.212 1.00 74.10  ?  63   PHE B CB    1 
ATOM   2185  C  CG    . PHE B 1 75   ? -33.113 -15.877 -44.988 1.00 81.38  ?  63   PHE B CG    1 
ATOM   2186  C  CD1   . PHE B 1 75   ? -32.696 -14.984 -45.962 1.00 77.46  ?  63   PHE B CD1   1 
ATOM   2187  C  CD2   . PHE B 1 75   ? -34.470 -16.011 -44.742 1.00 89.04  ?  63   PHE B CD2   1 
ATOM   2188  C  CE1   . PHE B 1 75   ? -33.616 -14.244 -46.678 1.00 82.50  ?  63   PHE B CE1   1 
ATOM   2189  C  CE2   . PHE B 1 75   ? -35.391 -15.272 -45.455 1.00 95.47  ?  63   PHE B CE2   1 
ATOM   2190  C  CZ    . PHE B 1 75   ? -34.963 -14.386 -46.420 1.00 92.39  ?  63   PHE B CZ    1 
ATOM   2191  N  N     . THR B 1 76   ? -30.737 -20.050 -44.306 1.00 93.28  ?  64   THR B N     1 
ATOM   2192  C  CA    . THR B 1 76   ? -30.008 -21.001 -43.476 1.00 83.49  ?  64   THR B CA    1 
ATOM   2193  C  C     . THR B 1 76   ? -28.657 -21.366 -44.084 1.00 83.12  ?  64   THR B C     1 
ATOM   2194  O  O     . THR B 1 76   ? -27.635 -21.348 -43.391 1.00 83.38  ?  64   THR B O     1 
ATOM   2195  C  CB    . THR B 1 76   ? -30.845 -22.265 -43.261 1.00 86.38  ?  64   THR B CB    1 
ATOM   2196  O  OG1   . THR B 1 76   ? -32.068 -21.926 -42.594 1.00 95.41  ?  64   THR B OG1   1 
ATOM   2197  C  CG2   . THR B 1 76   ? -30.080 -23.282 -42.423 1.00 80.04  ?  64   THR B CG2   1 
ATOM   2198  N  N     . THR B 1 77   ? -28.636 -21.693 -45.375 1.00 87.74  ?  65   THR B N     1 
ATOM   2199  C  CA    . THR B 1 77   ? -27.420 -22.116 -46.052 1.00 83.89  ?  65   THR B CA    1 
ATOM   2200  C  C     . THR B 1 77   ? -27.435 -21.601 -47.484 1.00 80.56  ?  65   THR B C     1 
ATOM   2201  O  O     . THR B 1 77   ? -28.496 -21.469 -48.101 1.00 84.81  ?  65   THR B O     1 
ATOM   2202  C  CB    . THR B 1 77   ? -27.275 -23.648 -46.047 1.00 81.43  ?  65   THR B CB    1 
ATOM   2203  O  OG1   . THR B 1 77   ? -27.548 -24.152 -44.733 1.00 93.94  ?  65   THR B OG1   1 
ATOM   2204  C  CG2   . THR B 1 77   ? -25.867 -24.061 -46.450 1.00 76.85  ?  65   THR B CG2   1 
ATOM   2205  N  N     . VAL B 1 78   ? -26.251 -21.300 -48.000 1.00 74.72  ?  66   VAL B N     1 
ATOM   2206  C  CA    . VAL B 1 78   ? -26.056 -20.908 -49.392 1.00 79.81  ?  66   VAL B CA    1 
ATOM   2207  C  C     . VAL B 1 78   ? -25.412 -22.083 -50.120 1.00 88.14  ?  66   VAL B C     1 
ATOM   2208  O  O     . VAL B 1 78   ? -24.328 -22.529 -49.722 1.00 81.23  ?  66   VAL B O     1 
ATOM   2209  C  CB    . VAL B 1 78   ? -25.189 -19.645 -49.516 1.00 70.09  ?  66   VAL B CB    1 
ATOM   2210  C  CG1   . VAL B 1 78   ? -25.006 -19.272 -50.980 1.00 73.51  ?  66   VAL B CG1   1 
ATOM   2211  C  CG2   . VAL B 1 78   ? -25.808 -18.495 -48.745 1.00 71.45  ?  66   VAL B CG2   1 
ATOM   2212  N  N     . PRO B 1 79   ? -26.032 -22.615 -51.171 1.00 103.18 ?  67   PRO B N     1 
ATOM   2213  C  CA    . PRO B 1 79   ? -25.423 -23.739 -51.892 1.00 102.09 ?  67   PRO B CA    1 
ATOM   2214  C  C     . PRO B 1 79   ? -24.224 -23.286 -52.711 1.00 95.12  ?  67   PRO B C     1 
ATOM   2215  O  O     . PRO B 1 79   ? -24.231 -22.214 -53.322 1.00 82.30  ?  67   PRO B O     1 
ATOM   2216  C  CB    . PRO B 1 79   ? -26.556 -24.243 -52.796 1.00 97.99  ?  67   PRO B CB    1 
ATOM   2217  C  CG    . PRO B 1 79   ? -27.813 -23.599 -52.265 1.00 91.63  ?  67   PRO B CG    1 
ATOM   2218  C  CD    . PRO B 1 79   ? -27.376 -22.299 -51.677 1.00 90.13  ?  67   PRO B CD    1 
ATOM   2219  N  N     . GLY B 1 80   ? -23.188 -24.122 -52.722 1.00 91.73  ?  68   GLY B N     1 
ATOM   2220  C  CA    . GLY B 1 80   ? -21.987 -23.837 -53.476 1.00 93.24  ?  68   GLY B CA    1 
ATOM   2221  C  C     . GLY B 1 80   ? -20.885 -23.147 -52.705 1.00 92.97  ?  68   GLY B C     1 
ATOM   2222  O  O     . GLY B 1 80   ? -19.823 -22.883 -53.282 1.00 91.10  ?  68   GLY B O     1 
ATOM   2223  N  N     . VAL B 1 81   ? -21.101 -22.835 -51.428 1.00 98.68  ?  69   VAL B N     1 
ATOM   2224  C  CA    . VAL B 1 81   ? -20.081 -22.228 -50.582 1.00 94.91  ?  69   VAL B CA    1 
ATOM   2225  C  C     . VAL B 1 81   ? -20.123 -22.897 -49.216 1.00 95.40  ?  69   VAL B C     1 
ATOM   2226  O  O     . VAL B 1 81   ? -21.159 -23.410 -48.784 1.00 91.21  ?  69   VAL B O     1 
ATOM   2227  C  CB    . VAL B 1 81   ? -20.264 -20.699 -50.441 1.00 84.55  ?  69   VAL B CB    1 
ATOM   2228  C  CG1   . VAL B 1 81   ? -20.030 -20.004 -51.774 1.00 89.37  ?  69   VAL B CG1   1 
ATOM   2229  C  CG2   . VAL B 1 81   ? -21.644 -20.377 -49.900 1.00 84.08  ?  69   VAL B CG2   1 
ATOM   2230  N  N     . LYS B 1 82   ? -18.976 -22.886 -48.532 1.00 90.22  ?  70   LYS B N     1 
ATOM   2231  C  CA    . LYS B 1 82   ? -18.896 -23.514 -47.217 1.00 89.99  ?  70   LYS B CA    1 
ATOM   2232  C  C     . LYS B 1 82   ? -19.580 -22.664 -46.154 1.00 88.93  ?  70   LYS B C     1 
ATOM   2233  O  O     . LYS B 1 82   ? -20.276 -23.195 -45.281 1.00 92.96  ?  70   LYS B O     1 
ATOM   2234  C  CB    . LYS B 1 82   ? -17.435 -23.768 -46.847 1.00 90.60  ?  70   LYS B CB    1 
ATOM   2235  C  CG    . LYS B 1 82   ? -16.687 -24.629 -47.852 1.00 94.84  ?  70   LYS B CG    1 
ATOM   2236  C  CD    . LYS B 1 82   ? -17.268 -26.032 -47.922 1.00 102.31 ?  70   LYS B CD    1 
ATOM   2237  C  CE    . LYS B 1 82   ? -16.716 -26.799 -49.113 1.00 107.74 ?  70   LYS B CE    1 
ATOM   2238  N  NZ    . LYS B 1 82   ? -15.227 -26.813 -49.131 1.00 98.62  ?  70   LYS B NZ    1 
ATOM   2239  N  N     . GLU B 1 83   ? -19.395 -21.347 -46.209 1.00 84.07  ?  71   GLU B N     1 
ATOM   2240  C  CA    . GLU B 1 83   ? -20.019 -20.465 -45.233 1.00 77.07  ?  71   GLU B CA    1 
ATOM   2241  C  C     . GLU B 1 83   ? -21.532 -20.450 -45.413 1.00 76.87  ?  71   GLU B C     1 
ATOM   2242  O  O     . GLU B 1 83   ? -22.042 -20.467 -46.537 1.00 80.10  ?  71   GLU B O     1 
ATOM   2243  C  CB    . GLU B 1 83   ? -19.470 -19.043 -45.361 1.00 78.98  ?  71   GLU B CB    1 
ATOM   2244  C  CG    . GLU B 1 83   ? -18.006 -18.881 -44.975 1.00 84.37  ?  71   GLU B CG    1 
ATOM   2245  C  CD    . GLU B 1 83   ? -17.061 -19.102 -46.140 1.00 82.99  ?  71   GLU B CD    1 
ATOM   2246  O  OE1   . GLU B 1 83   ? -17.531 -19.517 -47.220 1.00 87.17  ?  71   GLU B OE1   1 
ATOM   2247  O  OE2   . GLU B 1 83   ? -15.848 -18.854 -45.977 1.00 81.82  ?  71   GLU B OE2   1 
ATOM   2248  N  N     . ASP B 1 84   ? -22.252 -20.421 -44.294 1.00 78.18  ?  72   ASP B N     1 
ATOM   2249  C  CA    . ASP B 1 84   ? -23.701 -20.280 -44.325 1.00 83.05  ?  72   ASP B CA    1 
ATOM   2250  C  C     . ASP B 1 84   ? -24.052 -18.808 -44.540 1.00 78.89  ?  72   ASP B C     1 
ATOM   2251  O  O     . ASP B 1 84   ? -23.188 -17.974 -44.823 1.00 74.69  ?  72   ASP B O     1 
ATOM   2252  C  CB    . ASP B 1 84   ? -24.321 -20.856 -43.053 1.00 85.31  ?  72   ASP B CB    1 
ATOM   2253  C  CG    . ASP B 1 84   ? -23.689 -20.306 -41.791 1.00 91.84  ?  72   ASP B CG    1 
ATOM   2254  O  OD1   . ASP B 1 84   ? -22.662 -19.606 -41.895 1.00 89.52  ?  72   ASP B OD1   1 
ATOM   2255  O  OD2   . ASP B 1 84   ? -24.220 -20.576 -40.693 1.00 102.74 ?  72   ASP B OD2   1 
ATOM   2256  N  N     . VAL B 1 85   ? -25.334 -18.469 -44.399 1.00 80.93  ?  73   VAL B N     1 
ATOM   2257  C  CA    . VAL B 1 85   ? -25.789 -17.122 -44.734 1.00 80.49  ?  73   VAL B CA    1 
ATOM   2258  C  C     . VAL B 1 85   ? -25.228 -16.101 -43.751 1.00 72.75  ?  73   VAL B C     1 
ATOM   2259  O  O     . VAL B 1 85   ? -24.702 -15.056 -44.149 1.00 62.38  ?  73   VAL B O     1 
ATOM   2260  C  CB    . VAL B 1 85   ? -27.327 -17.074 -44.780 1.00 78.27  ?  73   VAL B CB    1 
ATOM   2261  C  CG1   . VAL B 1 85   ? -27.806 -15.660 -45.070 1.00 68.26  ?  73   VAL B CG1   1 
ATOM   2262  C  CG2   . VAL B 1 85   ? -27.853 -18.044 -45.822 1.00 84.48  ?  73   VAL B CG2   1 
ATOM   2263  N  N     . THR B 1 86   ? -25.329 -16.389 -42.451 1.00 80.40  ?  74   THR B N     1 
ATOM   2264  C  CA    . THR B 1 86   ? -24.948 -15.400 -41.447 1.00 74.70  ?  74   THR B CA    1 
ATOM   2265  C  C     . THR B 1 86   ? -23.443 -15.171 -41.408 1.00 67.58  ?  74   THR B C     1 
ATOM   2266  O  O     . THR B 1 86   ? -22.998 -14.059 -41.102 1.00 65.99  ?  74   THR B O     1 
ATOM   2267  C  CB    . THR B 1 86   ? -25.460 -15.826 -40.073 1.00 63.65  ?  74   THR B CB    1 
ATOM   2268  O  OG1   . THR B 1 86   ? -25.027 -17.162 -39.790 1.00 66.44  ?  74   THR B OG1   1 
ATOM   2269  C  CG2   . THR B 1 86   ? -26.977 -15.772 -40.044 1.00 73.06  ?  74   THR B CG2   1 
ATOM   2270  N  N     . GLU B 1 87   ? -22.643 -16.197 -41.708 1.00 59.91  ?  75   GLU B N     1 
ATOM   2271  C  CA    . GLU B 1 87   ? -21.198 -15.999 -41.746 1.00 59.60  ?  75   GLU B CA    1 
ATOM   2272  C  C     . GLU B 1 87   ? -20.792 -15.114 -42.916 1.00 59.14  ?  75   GLU B C     1 
ATOM   2273  O  O     . GLU B 1 87   ? -19.785 -14.403 -42.832 1.00 55.92  ?  75   GLU B O     1 
ATOM   2274  C  CB    . GLU B 1 87   ? -20.482 -17.348 -41.814 1.00 68.49  ?  75   GLU B CB    1 
ATOM   2275  C  CG    . GLU B 1 87   ? -19.054 -17.324 -41.292 1.00 77.12  ?  75   GLU B CG    1 
ATOM   2276  C  CD    . GLU B 1 87   ? -18.475 -18.715 -41.126 1.00 90.40  ?  75   GLU B CD    1 
ATOM   2277  O  OE1   . GLU B 1 87   ? -19.159 -19.693 -41.495 1.00 91.53  ?  75   GLU B OE1   1 
ATOM   2278  O  OE2   . GLU B 1 87   ? -17.337 -18.832 -40.623 1.00 93.55  ?  75   GLU B OE2   1 
ATOM   2279  N  N     . ILE B 1 88   ? -21.562 -15.138 -44.006 1.00 66.08  ?  76   ILE B N     1 
ATOM   2280  C  CA    . ILE B 1 88   ? -21.315 -14.223 -45.116 1.00 66.25  ?  76   ILE B CA    1 
ATOM   2281  C  C     . ILE B 1 88   ? -21.595 -12.787 -44.693 1.00 59.42  ?  76   ILE B C     1 
ATOM   2282  O  O     . ILE B 1 88   ? -20.861 -11.860 -45.058 1.00 58.41  ?  76   ILE B O     1 
ATOM   2283  C  CB    . ILE B 1 88   ? -22.161 -14.628 -46.338 1.00 63.40  ?  76   ILE B CB    1 
ATOM   2284  C  CG1   . ILE B 1 88   ? -21.743 -16.006 -46.850 1.00 65.90  ?  76   ILE B CG1   1 
ATOM   2285  C  CG2   . ILE B 1 88   ? -22.045 -13.589 -47.445 1.00 55.13  ?  76   ILE B CG2   1 
ATOM   2286  C  CD1   . ILE B 1 88   ? -20.326 -16.060 -47.360 1.00 65.54  ?  76   ILE B CD1   1 
ATOM   2287  N  N     . ILE B 1 89   ? -22.657 -12.582 -43.909 1.00 56.60  ?  77   ILE B N     1 
ATOM   2288  C  CA    . ILE B 1 89   ? -23.047 -11.236 -43.504 1.00 54.85  ?  77   ILE B CA    1 
ATOM   2289  C  C     . ILE B 1 89   ? -21.990 -10.603 -42.606 1.00 53.71  ?  77   ILE B C     1 
ATOM   2290  O  O     . ILE B 1 89   ? -21.780 -9.384  -42.647 1.00 50.54  ?  77   ILE B O     1 
ATOM   2291  C  CB    . ILE B 1 89   ? -24.425 -11.279 -42.815 1.00 49.43  ?  77   ILE B CB    1 
ATOM   2292  C  CG1   . ILE B 1 89   ? -25.472 -11.876 -43.757 1.00 41.83  ?  77   ILE B CG1   1 
ATOM   2293  C  CG2   . ILE B 1 89   ? -24.849 -9.893  -42.360 1.00 44.87  ?  77   ILE B CG2   1 
ATOM   2294  C  CD1   . ILE B 1 89   ? -26.849 -12.000 -43.141 1.00 49.32  ?  77   ILE B CD1   1 
ATOM   2295  N  N     . LEU B 1 90   ? -21.296 -11.409 -41.799 1.00 52.87  ?  78   LEU B N     1 
ATOM   2296  C  CA    . LEU B 1 90   ? -20.344 -10.859 -40.838 1.00 56.90  ?  78   LEU B CA    1 
ATOM   2297  C  C     . LEU B 1 90   ? -19.146 -10.228 -41.540 1.00 59.12  ?  78   LEU B C     1 
ATOM   2298  O  O     . LEU B 1 90   ? -18.882 -9.030  -41.384 1.00 58.65  ?  78   LEU B O     1 
ATOM   2299  C  CB    . LEU B 1 90   ? -19.892 -11.947 -39.862 1.00 55.10  ?  78   LEU B CB    1 
ATOM   2300  C  CG    . LEU B 1 90   ? -20.975 -12.494 -38.930 1.00 49.08  ?  78   LEU B CG    1 
ATOM   2301  C  CD1   . LEU B 1 90   ? -20.357 -13.337 -37.825 1.00 41.89  ?  78   LEU B CD1   1 
ATOM   2302  C  CD2   . LEU B 1 90   ? -21.812 -11.363 -38.348 1.00 44.47  ?  78   LEU B CD2   1 
ATOM   2303  N  N     . ASN B 1 91   ? -18.402 -11.020 -42.317 1.00 53.07  ?  79   ASN B N     1 
ATOM   2304  C  CA    . ASN B 1 91   ? -17.241 -10.473 -43.012 1.00 53.81  ?  79   ASN B CA    1 
ATOM   2305  C  C     . ASN B 1 91   ? -17.627 -9.432  -44.056 1.00 49.01  ?  79   ASN B C     1 
ATOM   2306  O  O     . ASN B 1 91   ? -16.792 -8.598  -44.421 1.00 48.47  ?  79   ASN B O     1 
ATOM   2307  C  CB    . ASN B 1 91   ? -16.422 -11.592 -43.660 1.00 55.74  ?  79   ASN B CB    1 
ATOM   2308  C  CG    . ASN B 1 91   ? -17.270 -12.771 -44.081 1.00 59.27  ?  79   ASN B CG    1 
ATOM   2309  O  OD1   . ASN B 1 91   ? -17.189 -13.848 -43.490 1.00 60.44  ?  79   ASN B OD1   1 
ATOM   2310  N  ND2   . ASN B 1 91   ? -18.091 -12.576 -45.106 1.00 65.34  ?  79   ASN B ND2   1 
ATOM   2311  N  N     . LEU B 1 92   ? -18.870 -9.459  -44.545 1.00 53.15  ?  80   LEU B N     1 
ATOM   2312  C  CA    . LEU B 1 92   ? -19.350 -8.366  -45.383 1.00 54.10  ?  80   LEU B CA    1 
ATOM   2313  C  C     . LEU B 1 92   ? -19.593 -7.105  -44.564 1.00 47.04  ?  80   LEU B C     1 
ATOM   2314  O  O     . LEU B 1 92   ? -19.390 -5.992  -45.062 1.00 46.94  ?  80   LEU B O     1 
ATOM   2315  C  CB    . LEU B 1 92   ? -20.627 -8.775  -46.115 1.00 59.03  ?  80   LEU B CB    1 
ATOM   2316  C  CG    . LEU B 1 92   ? -20.460 -9.469  -47.467 1.00 49.77  ?  80   LEU B CG    1 
ATOM   2317  C  CD1   . LEU B 1 92   ? -21.820 -9.746  -48.088 1.00 44.66  ?  80   LEU B CD1   1 
ATOM   2318  C  CD2   . LEU B 1 92   ? -19.604 -8.623  -48.397 1.00 41.36  ?  80   LEU B CD2   1 
ATOM   2319  N  N     . LYS B 1 93   ? -20.025 -7.259  -43.311 1.00 48.25  ?  81   LYS B N     1 
ATOM   2320  C  CA    . LYS B 1 93   ? -20.238 -6.099  -42.454 1.00 56.31  ?  81   LYS B CA    1 
ATOM   2321  C  C     . LYS B 1 93   ? -18.925 -5.398  -42.134 1.00 52.04  ?  81   LYS B C     1 
ATOM   2322  O  O     . LYS B 1 93   ? -18.891 -4.168  -42.006 1.00 48.13  ?  81   LYS B O     1 
ATOM   2323  C  CB    . LYS B 1 93   ? -20.941 -6.527  -41.166 1.00 49.55  ?  81   LYS B CB    1 
ATOM   2324  C  CG    . LYS B 1 93   ? -22.084 -5.624  -40.745 1.00 46.13  ?  81   LYS B CG    1 
ATOM   2325  C  CD    . LYS B 1 93   ? -22.722 -6.107  -39.451 1.00 46.47  ?  81   LYS B CD    1 
ATOM   2326  C  CE    . LYS B 1 93   ? -23.231 -7.535  -39.583 1.00 52.88  ?  81   LYS B CE    1 
ATOM   2327  N  NZ    . LYS B 1 93   ? -23.830 -8.034  -38.314 1.00 53.14  ?  81   LYS B NZ    1 
ATOM   2328  N  N     . SER B 1 94   ? -17.838 -6.158  -42.012 1.00 51.48  ?  82   SER B N     1 
ATOM   2329  C  CA    . SER B 1 94   ? -16.525 -5.594  -41.732 1.00 52.94  ?  82   SER B CA    1 
ATOM   2330  C  C     . SER B 1 94   ? -15.839 -5.042  -42.974 1.00 54.88  ?  82   SER B C     1 
ATOM   2331  O  O     . SER B 1 94   ? -14.718 -4.534  -42.864 1.00 60.32  ?  82   SER B O     1 
ATOM   2332  C  CB    . SER B 1 94   ? -15.630 -6.649  -41.075 1.00 65.03  ?  82   SER B CB    1 
ATOM   2333  O  OG    . SER B 1 94   ? -15.559 -7.823  -41.866 1.00 66.00  ?  82   SER B OG    1 
ATOM   2334  N  N     . LEU B 1 95   ? -16.471 -5.134  -44.142 1.00 50.58  ?  83   LEU B N     1 
ATOM   2335  C  CA    . LEU B 1 95   ? -15.901 -4.561  -45.354 1.00 53.99  ?  83   LEU B CA    1 
ATOM   2336  C  C     . LEU B 1 95   ? -15.818 -3.047  -45.223 1.00 51.14  ?  83   LEU B C     1 
ATOM   2337  O  O     . LEU B 1 95   ? -16.834 -2.375  -45.019 1.00 51.58  ?  83   LEU B O     1 
ATOM   2338  C  CB    . LEU B 1 95   ? -16.745 -4.952  -46.568 1.00 53.69  ?  83   LEU B CB    1 
ATOM   2339  C  CG    . LEU B 1 95   ? -16.361 -4.387  -47.939 1.00 50.07  ?  83   LEU B CG    1 
ATOM   2340  C  CD1   . LEU B 1 95   ? -16.516 -5.453  -49.010 1.00 50.40  ?  83   LEU B CD1   1 
ATOM   2341  C  CD2   . LEU B 1 95   ? -17.204 -3.167  -48.289 1.00 44.59  ?  83   LEU B CD2   1 
ATOM   2342  N  N     . VAL B 1 96   ? -14.612 -2.514  -45.335 1.00 47.89  ?  84   VAL B N     1 
ATOM   2343  C  CA    . VAL B 1 96   ? -14.387 -1.079  -45.227 1.00 57.56  ?  84   VAL B CA    1 
ATOM   2344  C  C     . VAL B 1 96   ? -14.577 -0.451  -46.599 1.00 57.84  ?  84   VAL B C     1 
ATOM   2345  O  O     . VAL B 1 96   ? -14.120 -0.989  -47.615 1.00 49.33  ?  84   VAL B O     1 
ATOM   2346  C  CB    . VAL B 1 96   ? -12.989 -0.786  -44.649 1.00 51.92  ?  84   VAL B CB    1 
ATOM   2347  C  CG1   . VAL B 1 96   ? -12.865 -1.387  -43.264 1.00 51.49  ?  84   VAL B CG1   1 
ATOM   2348  C  CG2   . VAL B 1 96   ? -11.904 -1.348  -45.542 1.00 60.71  ?  84   VAL B CG2   1 
ATOM   2349  N  N     . VAL B 1 97   ? -15.280 0.680   -46.639 1.00 53.02  ?  85   VAL B N     1 
ATOM   2350  C  CA    . VAL B 1 97   ? -15.623 1.325   -47.900 1.00 50.90  ?  85   VAL B CA    1 
ATOM   2351  C  C     . VAL B 1 97   ? -15.845 2.810   -47.647 1.00 53.30  ?  85   VAL B C     1 
ATOM   2352  O  O     . VAL B 1 97   ? -16.213 3.224   -46.544 1.00 63.32  ?  85   VAL B O     1 
ATOM   2353  C  CB    . VAL B 1 97   ? -16.867 0.667   -48.549 1.00 50.64  ?  85   VAL B CB    1 
ATOM   2354  C  CG1   . VAL B 1 97   ? -18.143 1.064   -47.814 1.00 47.30  ?  85   VAL B CG1   1 
ATOM   2355  C  CG2   . VAL B 1 97   ? -16.954 1.009   -50.031 1.00 61.22  ?  85   VAL B CG2   1 
ATOM   2356  N  N     . SER B 1 98   ? -15.600 3.613   -48.681 1.00 54.33  ?  86   SER B N     1 
ATOM   2357  C  CA    . SER B 1 98   ? -15.835 5.048   -48.652 1.00 63.81  ?  86   SER B CA    1 
ATOM   2358  C  C     . SER B 1 98   ? -16.539 5.448   -49.939 1.00 67.53  ?  86   SER B C     1 
ATOM   2359  O  O     . SER B 1 98   ? -16.283 4.875   -50.999 1.00 72.00  ?  86   SER B O     1 
ATOM   2360  C  CB    . SER B 1 98   ? -14.526 5.833   -48.501 1.00 68.82  ?  86   SER B CB    1 
ATOM   2361  O  OG    . SER B 1 98   ? -14.711 7.197   -48.838 1.00 81.74  ?  86   SER B OG    1 
ATOM   2362  N  N     . SER B 1 99   ? -17.427 6.437   -49.844 1.00 76.70  ?  87   SER B N     1 
ATOM   2363  C  CA    . SER B 1 99   ? -18.223 6.873   -50.983 1.00 74.01  ?  87   SER B CA    1 
ATOM   2364  C  C     . SER B 1 99   ? -18.226 8.391   -51.075 1.00 80.97  ?  87   SER B C     1 
ATOM   2365  O  O     . SER B 1 99   ? -18.276 9.084   -50.055 1.00 85.91  ?  87   SER B O     1 
ATOM   2366  C  CB    . SER B 1 99   ? -19.666 6.362   -50.884 1.00 68.89  ?  87   SER B CB    1 
ATOM   2367  O  OG    . SER B 1 99   ? -19.711 4.946   -50.919 1.00 81.92  ?  87   SER B OG    1 
ATOM   2368  N  N     . GLU B 1 100  ? -18.170 8.900   -52.304 1.00 79.82  ?  88   GLU B N     1 
ATOM   2369  C  CA    . GLU B 1 100  ? -18.321 10.326  -52.560 1.00 86.25  ?  88   GLU B CA    1 
ATOM   2370  C  C     . GLU B 1 100  ? -19.756 10.718  -52.881 1.00 83.08  ?  88   GLU B C     1 
ATOM   2371  O  O     . GLU B 1 100  ? -20.038 11.912  -53.027 1.00 80.92  ?  88   GLU B O     1 
ATOM   2372  C  CB    . GLU B 1 100  ? -17.411 10.767  -53.712 1.00 90.25  ?  88   GLU B CB    1 
ATOM   2373  C  CG    . GLU B 1 100  ? -15.923 10.623  -53.441 1.00 100.54 ?  88   GLU B CG    1 
ATOM   2374  C  CD    . GLU B 1 100  ? -15.076 11.346  -54.472 1.00 114.27 ?  88   GLU B CD    1 
ATOM   2375  O  OE1   . GLU B 1 100  ? -14.046 11.939  -54.087 1.00 116.81 ?  88   GLU B OE1   1 
ATOM   2376  O  OE2   . GLU B 1 100  ? -15.447 11.333  -55.665 1.00 116.21 ?  88   GLU B OE2   1 
ATOM   2377  N  N     . GLU B 1 101  ? -20.662 9.751   -52.996 1.00 87.07  ?  89   GLU B N     1 
ATOM   2378  C  CA    . GLU B 1 101  ? -22.059 10.004  -53.321 1.00 88.95  ?  89   GLU B CA    1 
ATOM   2379  C  C     . GLU B 1 101  ? -22.909 9.832   -52.070 1.00 91.15  ?  89   GLU B C     1 
ATOM   2380  O  O     . GLU B 1 101  ? -22.782 8.828   -51.361 1.00 90.16  ?  89   GLU B O     1 
ATOM   2381  C  CB    . GLU B 1 101  ? -22.544 9.063   -54.425 1.00 88.27  ?  89   GLU B CB    1 
ATOM   2382  N  N     . ASP B 1 102  ? -23.777 10.812  -51.806 1.00 106.17 ?  90   ASP B N     1 
ATOM   2383  C  CA    . ASP B 1 102  ? -24.627 10.748  -50.622 1.00 106.36 ?  90   ASP B CA    1 
ATOM   2384  C  C     . ASP B 1 102  ? -25.718 9.699   -50.785 1.00 98.29  ?  90   ASP B C     1 
ATOM   2385  O  O     . ASP B 1 102  ? -26.017 8.953   -49.844 1.00 88.70  ?  90   ASP B O     1 
ATOM   2386  C  CB    . ASP B 1 102  ? -25.248 12.118  -50.340 1.00 116.96 ?  90   ASP B CB    1 
ATOM   2387  C  CG    . ASP B 1 102  ? -24.489 13.257  -50.999 1.00 124.94 ?  90   ASP B CG    1 
ATOM   2388  O  OD1   . ASP B 1 102  ? -23.610 12.990  -51.845 1.00 119.77 ?  90   ASP B OD1   1 
ATOM   2389  O  OD2   . ASP B 1 102  ? -24.776 14.427  -50.669 1.00 130.87 ?  90   ASP B OD2   1 
ATOM   2390  N  N     . GLU B 1 103  ? -26.324 9.631   -51.968 1.00 103.21 ?  91   GLU B N     1 
ATOM   2391  C  CA    . GLU B 1 103  ? -27.390 8.682   -52.228 1.00 92.01  ?  91   GLU B CA    1 
ATOM   2392  C  C     . GLU B 1 103  ? -26.857 7.251   -52.182 1.00 84.24  ?  91   GLU B C     1 
ATOM   2393  O  O     . GLU B 1 103  ? -25.662 7.016   -52.379 1.00 86.19  ?  91   GLU B O     1 
ATOM   2394  C  CB    . GLU B 1 103  ? -28.024 8.967   -53.588 1.00 90.00  ?  91   GLU B CB    1 
ATOM   2395  N  N     . PRO B 1 104  ? -27.727 6.277   -51.908 1.00 64.10  ?  92   PRO B N     1 
ATOM   2396  C  CA    . PRO B 1 104  ? -27.284 4.878   -51.893 1.00 63.73  ?  92   PRO B CA    1 
ATOM   2397  C  C     . PRO B 1 104  ? -26.723 4.448   -53.241 1.00 78.14  ?  92   PRO B C     1 
ATOM   2398  O  O     . PRO B 1 104  ? -27.151 4.915   -54.298 1.00 98.53  ?  92   PRO B O     1 
ATOM   2399  C  CB    . PRO B 1 104  ? -28.561 4.102   -51.546 1.00 61.92  ?  92   PRO B CB    1 
ATOM   2400  C  CG    . PRO B 1 104  ? -29.688 5.053   -51.811 1.00 72.99  ?  92   PRO B CG    1 
ATOM   2401  C  CD    . PRO B 1 104  ? -29.139 6.409   -51.515 1.00 62.15  ?  92   PRO B CD    1 
ATOM   2402  N  N     . VAL B 1 105  ? -25.747 3.545   -53.187 1.00 62.55  ?  93   VAL B N     1 
ATOM   2403  C  CA    . VAL B 1 105  ? -25.065 3.034   -54.369 1.00 64.38  ?  93   VAL B CA    1 
ATOM   2404  C  C     . VAL B 1 105  ? -25.045 1.514   -54.294 1.00 64.08  ?  93   VAL B C     1 
ATOM   2405  O  O     . VAL B 1 105  ? -24.603 0.945   -53.290 1.00 64.22  ?  93   VAL B O     1 
ATOM   2406  C  CB    . VAL B 1 105  ? -23.633 3.590   -54.487 1.00 52.33  ?  93   VAL B CB    1 
ATOM   2407  C  CG1   . VAL B 1 105  ? -22.822 2.765   -55.468 1.00 53.13  ?  93   VAL B CG1   1 
ATOM   2408  C  CG2   . VAL B 1 105  ? -23.665 5.048   -54.917 1.00 57.11  ?  93   VAL B CG2   1 
ATOM   2409  N  N     . THR B 1 106  ? -25.521 0.862   -55.352 1.00 57.30  ?  94   THR B N     1 
ATOM   2410  C  CA    . THR B 1 106  ? -25.560 -0.592  -55.410 1.00 54.37  ?  94   THR B CA    1 
ATOM   2411  C  C     . THR B 1 106  ? -24.283 -1.128  -56.041 1.00 45.65  ?  94   THR B C     1 
ATOM   2412  O  O     . THR B 1 106  ? -23.834 -0.627  -57.077 1.00 46.48  ?  94   THR B O     1 
ATOM   2413  C  CB    . THR B 1 106  ? -26.773 -1.077  -56.205 1.00 47.99  ?  94   THR B CB    1 
ATOM   2414  O  OG1   . THR B 1 106  ? -26.822 -0.401  -57.468 1.00 73.84  ?  94   THR B OG1   1 
ATOM   2415  C  CG2   . THR B 1 106  ? -28.049 -0.808  -55.438 1.00 57.23  ?  94   THR B CG2   1 
ATOM   2416  N  N     . MET B 1 107  ? -23.704 -2.146  -55.413 1.00 48.14  ?  95   MET B N     1 
ATOM   2417  C  CA    . MET B 1 107  ? -22.546 -2.847  -55.943 1.00 51.16  ?  95   MET B CA    1 
ATOM   2418  C  C     . MET B 1 107  ? -22.894 -4.317  -56.125 1.00 54.57  ?  95   MET B C     1 
ATOM   2419  O  O     . MET B 1 107  ? -23.743 -4.863  -55.415 1.00 54.36  ?  95   MET B O     1 
ATOM   2420  C  CB    . MET B 1 107  ? -21.330 -2.708  -55.018 1.00 60.62  ?  95   MET B CB    1 
ATOM   2421  C  CG    . MET B 1 107  ? -21.038 -1.284  -54.575 1.00 63.43  ?  95   MET B CG    1 
ATOM   2422  S  SD    . MET B 1 107  ? -19.456 -1.133  -53.723 1.00 80.08  ?  95   MET B SD    1 
ATOM   2423  C  CE    . MET B 1 107  ? -19.656 -2.339  -52.414 1.00 69.64  ?  95   MET B CE    1 
ATOM   2424  N  N     . TYR B 1 108  ? -22.236 -4.954  -57.088 1.00 63.77  ?  96   TYR B N     1 
ATOM   2425  C  CA    . TYR B 1 108  ? -22.441 -6.366  -57.371 1.00 62.94  ?  96   TYR B CA    1 
ATOM   2426  C  C     . TYR B 1 108  ? -21.136 -7.123  -57.176 1.00 62.57  ?  96   TYR B C     1 
ATOM   2427  O  O     . TYR B 1 108  ? -20.058 -6.619  -57.508 1.00 63.83  ?  96   TYR B O     1 
ATOM   2428  C  CB    . TYR B 1 108  ? -22.966 -6.579  -58.796 1.00 63.28  ?  96   TYR B CB    1 
ATOM   2429  C  CG    . TYR B 1 108  ? -24.372 -6.064  -59.020 1.00 59.62  ?  96   TYR B CG    1 
ATOM   2430  C  CD1   . TYR B 1 108  ? -25.473 -6.770  -58.553 1.00 63.87  ?  96   TYR B CD1   1 
ATOM   2431  C  CD2   . TYR B 1 108  ? -24.598 -4.878  -59.707 1.00 48.88  ?  96   TYR B CD2   1 
ATOM   2432  C  CE1   . TYR B 1 108  ? -26.760 -6.307  -58.757 1.00 72.02  ?  96   TYR B CE1   1 
ATOM   2433  C  CE2   . TYR B 1 108  ? -25.882 -4.406  -59.917 1.00 54.17  ?  96   TYR B CE2   1 
ATOM   2434  C  CZ    . TYR B 1 108  ? -26.959 -5.125  -59.439 1.00 73.48  ?  96   TYR B CZ    1 
ATOM   2435  O  OH    . TYR B 1 108  ? -28.238 -4.661  -59.645 1.00 72.70  ?  96   TYR B OH    1 
ATOM   2436  N  N     . LEU B 1 109  ? -21.238 -8.331  -56.627 1.00 57.34  ?  97   LEU B N     1 
ATOM   2437  C  CA    . LEU B 1 109  ? -20.091 -9.209  -56.427 1.00 58.63  ?  97   LEU B CA    1 
ATOM   2438  C  C     . LEU B 1 109  ? -20.417 -10.565 -57.032 1.00 62.90  ?  97   LEU B C     1 
ATOM   2439  O  O     . LEU B 1 109  ? -21.393 -11.207 -56.630 1.00 55.88  ?  97   LEU B O     1 
ATOM   2440  C  CB    . LEU B 1 109  ? -19.748 -9.349  -54.942 1.00 60.82  ?  97   LEU B CB    1 
ATOM   2441  C  CG    . LEU B 1 109  ? -18.755 -10.458 -54.584 1.00 67.28  ?  97   LEU B CG    1 
ATOM   2442  C  CD1   . LEU B 1 109  ? -17.393 -10.189 -55.203 1.00 75.69  ?  97   LEU B CD1   1 
ATOM   2443  C  CD2   . LEU B 1 109  ? -18.643 -10.619 -53.075 1.00 59.47  ?  97   LEU B CD2   1 
ATOM   2444  N  N     . ARG B 1 110  ? -19.604 -10.997 -57.995 1.00 54.07  ?  98   ARG B N     1 
ATOM   2445  C  CA    . ARG B 1 110  ? -19.838 -12.250 -58.700 1.00 49.46  ?  98   ARG B CA    1 
ATOM   2446  C  C     . ARG B 1 110  ? -18.514 -12.931 -59.006 1.00 47.57  ?  98   ARG B C     1 
ATOM   2447  O  O     . ARG B 1 110  ? -17.572 -12.285 -59.477 1.00 53.64  ?  98   ARG B O     1 
ATOM   2448  C  CB    . ARG B 1 110  ? -20.620 -12.017 -59.999 1.00 45.52  ?  98   ARG B CB    1 
ATOM   2449  C  CG    . ARG B 1 110  ? -22.096 -11.716 -59.796 1.00 54.45  ?  98   ARG B CG    1 
ATOM   2450  C  CD    . ARG B 1 110  ? -22.817 -11.558 -61.124 1.00 46.23  ?  98   ARG B CD    1 
ATOM   2451  N  NE    . ARG B 1 110  ? -22.650 -10.221 -61.684 1.00 43.81  ?  98   ARG B NE    1 
ATOM   2452  C  CZ    . ARG B 1 110  ? -23.561 -9.257  -61.593 1.00 46.13  ?  98   ARG B CZ    1 
ATOM   2453  N  NH1   . ARG B 1 110  ? -24.709 -9.484  -60.969 1.00 37.55  ?  98   ARG B NH1   1 
ATOM   2454  N  NH2   . ARG B 1 110  ? -23.326 -8.067  -62.130 1.00 48.72  ?  98   ARG B NH2   1 
ATOM   2455  N  N     . LYS B 1 111  ? -18.451 -14.233 -58.737 1.00 51.03  ?  99   LYS B N     1 
ATOM   2456  C  CA    . LYS B 1 111  ? -17.308 -15.053 -59.111 1.00 65.45  ?  99   LYS B CA    1 
ATOM   2457  C  C     . LYS B 1 111  ? -17.739 -16.512 -59.104 1.00 79.29  ?  99   LYS B C     1 
ATOM   2458  O  O     . LYS B 1 111  ? -18.420 -16.957 -58.177 1.00 67.65  ?  99   LYS B O     1 
ATOM   2459  C  CB    . LYS B 1 111  ? -16.117 -14.845 -58.167 1.00 65.60  ?  99   LYS B CB    1 
ATOM   2460  C  CG    . LYS B 1 111  ? -14.877 -15.628 -58.576 1.00 81.59  ?  99   LYS B CG    1 
ATOM   2461  C  CD    . LYS B 1 111  ? -13.766 -15.517 -57.546 1.00 83.31  ?  99   LYS B CD    1 
ATOM   2462  C  CE    . LYS B 1 111  ? -12.577 -16.384 -57.935 1.00 84.35  ?  99   LYS B CE    1 
ATOM   2463  N  NZ    . LYS B 1 111  ? -11.505 -16.362 -56.902 1.00 97.09  ?  99   LYS B NZ    1 
ATOM   2464  N  N     . GLN B 1 112  ? -17.334 -17.246 -60.134 1.00 79.34  ?  100  GLN B N     1 
ATOM   2465  C  CA    . GLN B 1 112  ? -17.713 -18.639 -60.315 1.00 79.84  ?  100  GLN B CA    1 
ATOM   2466  C  C     . GLN B 1 112  ? -16.483 -19.535 -60.208 1.00 80.98  ?  100  GLN B C     1 
ATOM   2467  O  O     . GLN B 1 112  ? -15.342 -19.068 -60.152 1.00 75.17  ?  100  GLN B O     1 
ATOM   2468  C  CB    . GLN B 1 112  ? -18.413 -18.831 -61.668 1.00 85.87  ?  100  GLN B CB    1 
ATOM   2469  C  CG    . GLN B 1 112  ? -19.262 -20.092 -61.781 1.00 90.50  ?  100  GLN B CG    1 
ATOM   2470  C  CD    . GLN B 1 112  ? -20.008 -20.178 -63.097 1.00 101.48 ?  100  GLN B CD    1 
ATOM   2471  O  OE1   . GLN B 1 112  ? -20.066 -19.210 -63.855 1.00 102.90 ?  100  GLN B OE1   1 
ATOM   2472  N  NE2   . GLN B 1 112  ? -20.584 -21.342 -63.376 1.00 101.19 ?  100  GLN B NE2   1 
ATOM   2473  N  N     . GLY B 1 113  ? -16.731 -20.842 -60.165 1.00 95.88  ?  101  GLY B N     1 
ATOM   2474  C  CA    . GLY B 1 113  ? -15.674 -21.824 -60.133 1.00 93.57  ?  101  GLY B CA    1 
ATOM   2475  C  C     . GLY B 1 113  ? -15.096 -22.006 -58.746 1.00 88.15  ?  101  GLY B C     1 
ATOM   2476  O  O     . GLY B 1 113  ? -15.188 -21.122 -57.888 1.00 87.89  ?  101  GLY B O     1 
ATOM   2477  N  N     . PRO B 1 114  ? -14.494 -23.167 -58.496 1.00 92.23  ?  102  PRO B N     1 
ATOM   2478  C  CA    . PRO B 1 114  ? -13.853 -23.396 -57.196 1.00 95.67  ?  102  PRO B CA    1 
ATOM   2479  C  C     . PRO B 1 114  ? -12.711 -22.417 -56.967 1.00 92.17  ?  102  PRO B C     1 
ATOM   2480  O  O     . PRO B 1 114  ? -11.914 -22.138 -57.865 1.00 88.83  ?  102  PRO B O     1 
ATOM   2481  C  CB    . PRO B 1 114  ? -13.352 -24.842 -57.294 1.00 93.27  ?  102  PRO B CB    1 
ATOM   2482  C  CG    . PRO B 1 114  ? -13.280 -25.128 -58.761 1.00 90.62  ?  102  PRO B CG    1 
ATOM   2483  C  CD    . PRO B 1 114  ? -14.392 -24.339 -59.381 1.00 90.91  ?  102  PRO B CD    1 
ATOM   2484  N  N     . GLY B 1 115  ? -12.646 -21.891 -55.753 1.00 92.30  ?  103  GLY B N     1 
ATOM   2485  C  CA    . GLY B 1 115  ? -11.636 -20.907 -55.398 1.00 89.37  ?  103  GLY B CA    1 
ATOM   2486  C  C     . GLY B 1 115  ? -12.031 -20.180 -54.123 1.00 81.58  ?  103  GLY B C     1 
ATOM   2487  O  O     . GLY B 1 115  ? -12.675 -20.751 -53.243 1.00 76.56  ?  103  GLY B O     1 
ATOM   2488  N  N     . GLU B 1 116  ? -11.634 -18.911 -54.052 1.00 76.38  ?  104  GLU B N     1 
ATOM   2489  C  CA    . GLU B 1 116  ? -11.910 -18.084 -52.888 1.00 75.95  ?  104  GLU B CA    1 
ATOM   2490  C  C     . GLU B 1 116  ? -12.343 -16.697 -53.337 1.00 73.64  ?  104  GLU B C     1 
ATOM   2491  O  O     . GLU B 1 116  ? -11.780 -16.139 -54.283 1.00 66.34  ?  104  GLU B O     1 
ATOM   2492  C  CB    . GLU B 1 116  ? -10.684 -17.974 -51.973 1.00 83.72  ?  104  GLU B CB    1 
ATOM   2493  C  CG    . GLU B 1 116  ? -10.976 -17.342 -50.620 1.00 87.01  ?  104  GLU B CG    1 
ATOM   2494  C  CD    . GLU B 1 116  ? -9.726  -16.823 -49.936 1.00 85.89  ?  104  GLU B CD    1 
ATOM   2495  O  OE1   . GLU B 1 116  ? -8.910  -16.161 -50.611 1.00 78.38  ?  104  GLU B OE1   1 
ATOM   2496  O  OE2   . GLU B 1 116  ? -9.558  -17.079 -48.725 1.00 86.59  ?  104  GLU B OE2   1 
ATOM   2497  N  N     . VAL B 1 117  ? -13.340 -16.148 -52.652 1.00 66.14  ?  105  VAL B N     1 
ATOM   2498  C  CA    . VAL B 1 117  ? -13.814 -14.795 -52.908 1.00 66.10  ?  105  VAL B CA    1 
ATOM   2499  C  C     . VAL B 1 117  ? -13.076 -13.835 -51.988 1.00 68.22  ?  105  VAL B C     1 
ATOM   2500  O  O     . VAL B 1 117  ? -12.741 -14.165 -50.846 1.00 66.82  ?  105  VAL B O     1 
ATOM   2501  C  CB    . VAL B 1 117  ? -15.341 -14.690 -52.713 1.00 60.70  ?  105  VAL B CB    1 
ATOM   2502  C  CG1   . VAL B 1 117  ? -15.872 -13.400 -53.325 1.00 62.66  ?  105  VAL B CG1   1 
ATOM   2503  C  CG2   . VAL B 1 117  ? -16.039 -15.895 -53.308 1.00 63.44  ?  105  VAL B CG2   1 
ATOM   2504  N  N     . THR B 1 118  ? -12.810 -12.634 -52.494 1.00 64.81  ?  106  THR B N     1 
ATOM   2505  C  CA    . THR B 1 118  ? -12.197 -11.568 -51.718 1.00 60.21  ?  106  THR B CA    1 
ATOM   2506  C  C     . THR B 1 118  ? -12.966 -10.277 -51.959 1.00 62.81  ?  106  THR B C     1 
ATOM   2507  O  O     . THR B 1 118  ? -13.821 -10.193 -52.845 1.00 71.72  ?  106  THR B O     1 
ATOM   2508  C  CB    . THR B 1 118  ? -10.717 -11.372 -52.079 1.00 62.87  ?  106  THR B CB    1 
ATOM   2509  O  OG1   . THR B 1 118  ? -10.598 -11.088 -53.479 1.00 74.63  ?  106  THR B OG1   1 
ATOM   2510  C  CG2   . THR B 1 118  ? -9.907  -12.615 -51.744 1.00 63.80  ?  106  THR B CG2   1 
ATOM   2511  N  N     . ALA B 1 119  ? -12.654 -9.261  -51.158 1.00 59.20  ?  107  ALA B N     1 
ATOM   2512  C  CA    . ALA B 1 119  ? -13.184 -7.926  -51.395 1.00 57.93  ?  107  ALA B CA    1 
ATOM   2513  C  C     . ALA B 1 119  ? -12.487 -7.220  -52.549 1.00 66.37  ?  107  ALA B C     1 
ATOM   2514  O  O     . ALA B 1 119  ? -12.831 -6.073  -52.853 1.00 67.80  ?  107  ALA B O     1 
ATOM   2515  C  CB    . ALA B 1 119  ? -13.080 -7.079  -50.125 1.00 60.59  ?  107  ALA B CB    1 
ATOM   2516  N  N     . GLY B 1 120  ? -11.514 -7.870  -53.183 1.00 69.93  ?  108  GLY B N     1 
ATOM   2517  C  CA    . GLY B 1 120  ? -10.904 -7.357  -54.392 1.00 68.44  ?  108  GLY B CA    1 
ATOM   2518  C  C     . GLY B 1 120  ? -11.599 -7.900  -55.623 1.00 69.75  ?  108  GLY B C     1 
ATOM   2519  O  O     . GLY B 1 120  ? -11.583 -7.272  -56.685 1.00 69.85  ?  108  GLY B O     1 
ATOM   2520  N  N     . ASP B 1 121  ? -12.218 -9.075  -55.487 1.00 67.53  ?  109  ASP B N     1 
ATOM   2521  C  CA    . ASP B 1 121  ? -13.035 -9.645  -56.553 1.00 71.72  ?  109  ASP B CA    1 
ATOM   2522  C  C     . ASP B 1 121  ? -14.346 -8.898  -56.754 1.00 68.88  ?  109  ASP B C     1 
ATOM   2523  O  O     . ASP B 1 121  ? -15.135 -9.286  -57.623 1.00 79.93  ?  109  ASP B O     1 
ATOM   2524  C  CB    . ASP B 1 121  ? -13.320 -11.122 -56.265 1.00 75.04  ?  109  ASP B CB    1 
ATOM   2525  C  CG    . ASP B 1 121  ? -12.080 -11.990 -56.375 1.00 83.92  ?  109  ASP B CG    1 
ATOM   2526  O  OD1   . ASP B 1 121  ? -11.180 -11.645 -57.169 1.00 88.05  ?  109  ASP B OD1   1 
ATOM   2527  O  OD2   . ASP B 1 121  ? -12.007 -13.018 -55.670 1.00 81.25  ?  109  ASP B OD2   1 
ATOM   2528  N  N     . ILE B 1 122  ? -14.600 -7.855  -55.972 1.00 66.71  ?  110  ILE B N     1 
ATOM   2529  C  CA    . ILE B 1 122  ? -15.781 -7.023  -56.149 1.00 69.67  ?  110  ILE B CA    1 
ATOM   2530  C  C     . ILE B 1 122  ? -15.483 -5.976  -57.212 1.00 71.00  ?  110  ILE B C     1 
ATOM   2531  O  O     . ILE B 1 122  ? -14.327 -5.594  -57.433 1.00 70.20  ?  110  ILE B O     1 
ATOM   2532  C  CB    . ILE B 1 122  ? -16.195 -6.377  -54.810 1.00 77.41  ?  110  ILE B CB    1 
ATOM   2533  C  CG1   . ILE B 1 122  ? -17.681 -6.026  -54.818 1.00 76.64  ?  110  ILE B CG1   1 
ATOM   2534  C  CG2   . ILE B 1 122  ? -15.366 -5.128  -54.532 1.00 75.70  ?  110  ILE B CG2   1 
ATOM   2535  C  CD1   . ILE B 1 122  ? -18.151 -5.417  -53.525 1.00 64.13  ?  110  ILE B CD1   1 
ATOM   2536  N  N     . VAL B 1 123  ? -16.526 -5.520  -57.895 1.00 74.57  ?  111  VAL B N     1 
ATOM   2537  C  CA    . VAL B 1 123  ? -16.407 -4.458  -58.886 1.00 75.87  ?  111  VAL B CA    1 
ATOM   2538  C  C     . VAL B 1 123  ? -17.015 -3.193  -58.281 1.00 74.48  ?  111  VAL B C     1 
ATOM   2539  O  O     . VAL B 1 123  ? -18.232 -3.135  -58.051 1.00 75.12  ?  111  VAL B O     1 
ATOM   2540  C  CB    . VAL B 1 123  ? -17.076 -4.833  -60.216 1.00 67.82  ?  111  VAL B CB    1 
ATOM   2541  C  CG1   . VAL B 1 123  ? -18.417 -5.519  -59.986 1.00 68.09  ?  111  VAL B CG1   1 
ATOM   2542  C  CG2   . VAL B 1 123  ? -17.236 -3.601  -61.098 1.00 61.45  ?  111  VAL B CG2   1 
ATOM   2543  N  N     . PRO B 1 124  ? -16.215 -2.174  -57.985 1.00 65.83  ?  112  PRO B N     1 
ATOM   2544  C  CA    . PRO B 1 124  ? -16.744 -0.979  -57.335 1.00 64.13  ?  112  PRO B CA    1 
ATOM   2545  C  C     . PRO B 1 124  ? -17.140 0.069   -58.357 1.00 57.11  ?  112  PRO B C     1 
ATOM   2546  O  O     . PRO B 1 124  ? -16.317 0.482   -59.189 1.00 63.22  ?  112  PRO B O     1 
ATOM   2547  C  CB    . PRO B 1 124  ? -15.566 -0.497  -56.470 1.00 66.72  ?  112  PRO B CB    1 
ATOM   2548  C  CG    . PRO B 1 124  ? -14.361 -1.356  -56.882 1.00 65.47  ?  112  PRO B CG    1 
ATOM   2549  C  CD    . PRO B 1 124  ? -14.753 -2.115  -58.110 1.00 63.03  ?  112  PRO B CD    1 
ATOM   2550  N  N     . PRO B 1 125  ? -18.393 0.521   -58.334 1.00 47.33  ?  113  PRO B N     1 
ATOM   2551  C  CA    . PRO B 1 125  ? -18.788 1.637   -59.197 1.00 52.98  ?  113  PRO B CA    1 
ATOM   2552  C  C     . PRO B 1 125  ? -18.016 2.902   -58.850 1.00 52.68  ?  113  PRO B C     1 
ATOM   2553  O  O     . PRO B 1 125  ? -17.439 3.037   -57.769 1.00 55.61  ?  113  PRO B O     1 
ATOM   2554  C  CB    . PRO B 1 125  ? -20.288 1.798   -58.915 1.00 48.38  ?  113  PRO B CB    1 
ATOM   2555  C  CG    . PRO B 1 125  ? -20.516 1.097   -57.612 1.00 49.08  ?  113  PRO B CG    1 
ATOM   2556  C  CD    . PRO B 1 125  ? -19.528 -0.023  -57.573 1.00 50.48  ?  113  PRO B CD    1 
ATOM   2557  N  N     . ALA B 1 126  ? -18.011 3.837   -59.798 1.00 59.66  ?  114  ALA B N     1 
ATOM   2558  C  CA    . ALA B 1 126  ? -17.230 5.058   -59.646 1.00 62.25  ?  114  ALA B CA    1 
ATOM   2559  C  C     . ALA B 1 126  ? -17.729 5.875   -58.462 1.00 68.88  ?  114  ALA B C     1 
ATOM   2560  O  O     . ALA B 1 126  ? -18.932 6.103   -58.308 1.00 65.61  ?  114  ALA B O     1 
ATOM   2561  C  CB    . ALA B 1 126  ? -17.295 5.886   -60.929 1.00 60.70  ?  114  ALA B CB    1 
ATOM   2562  N  N     . GLY B 1 127  ? -16.791 6.317   -57.620 1.00 69.78  ?  115  GLY B N     1 
ATOM   2563  C  CA    . GLY B 1 127  ? -17.084 7.093   -56.435 1.00 70.37  ?  115  GLY B CA    1 
ATOM   2564  C  C     . GLY B 1 127  ? -16.825 6.350   -55.139 1.00 71.45  ?  115  GLY B C     1 
ATOM   2565  O  O     . GLY B 1 127  ? -16.548 6.987   -54.114 1.00 73.95  ?  115  GLY B O     1 
ATOM   2566  N  N     . VAL B 1 128  ? -16.906 5.023   -55.161 1.00 77.23  ?  116  VAL B N     1 
ATOM   2567  C  CA    . VAL B 1 128  ? -16.682 4.212   -53.973 1.00 77.40  ?  116  VAL B CA    1 
ATOM   2568  C  C     . VAL B 1 128  ? -15.316 3.545   -54.081 1.00 78.69  ?  116  VAL B C     1 
ATOM   2569  O  O     . VAL B 1 128  ? -14.755 3.375   -55.168 1.00 80.33  ?  116  VAL B O     1 
ATOM   2570  C  CB    . VAL B 1 128  ? -17.796 3.165   -53.762 1.00 68.81  ?  116  VAL B CB    1 
ATOM   2571  C  CG1   . VAL B 1 128  ? -19.160 3.770   -54.067 1.00 64.96  ?  116  VAL B CG1   1 
ATOM   2572  C  CG2   . VAL B 1 128  ? -17.546 1.927   -54.608 1.00 71.03  ?  116  VAL B CG2   1 
ATOM   2573  N  N     . THR B 1 129  ? -14.773 3.167   -52.924 1.00 64.60  ?  117  THR B N     1 
ATOM   2574  C  CA    . THR B 1 129  ? -13.446 2.568   -52.852 1.00 58.50  ?  117  THR B CA    1 
ATOM   2575  C  C     . THR B 1 129  ? -13.421 1.517   -51.754 1.00 51.85  ?  117  THR B C     1 
ATOM   2576  O  O     . THR B 1 129  ? -13.794 1.800   -50.612 1.00 60.18  ?  117  THR B O     1 
ATOM   2577  C  CB    . THR B 1 129  ? -12.370 3.628   -52.585 1.00 59.43  ?  117  THR B CB    1 
ATOM   2578  O  OG1   . THR B 1 129  ? -12.405 4.622   -53.616 1.00 64.09  ?  117  THR B OG1   1 
ATOM   2579  C  CG2   . THR B 1 129  ? -10.990 2.989   -52.550 1.00 55.40  ?  117  THR B CG2   1 
ATOM   2580  N  N     . VAL B 1 130  ? -12.979 0.312   -52.101 1.00 55.82  ?  118  VAL B N     1 
ATOM   2581  C  CA    . VAL B 1 130  ? -12.817 -0.770  -51.137 1.00 59.99  ?  118  VAL B CA    1 
ATOM   2582  C  C     . VAL B 1 130  ? -11.378 -0.748  -50.637 1.00 64.36  ?  118  VAL B C     1 
ATOM   2583  O  O     . VAL B 1 130  ? -10.438 -0.935  -51.417 1.00 60.47  ?  118  VAL B O     1 
ATOM   2584  C  CB    . VAL B 1 130  ? -13.167 -2.129  -51.760 1.00 53.53  ?  118  VAL B CB    1 
ATOM   2585  C  CG1   . VAL B 1 130  ? -12.928 -3.247  -50.759 1.00 59.04  ?  118  VAL B CG1   1 
ATOM   2586  C  CG2   . VAL B 1 130  ? -14.611 -2.133  -52.241 1.00 53.49  ?  118  VAL B CG2   1 
ATOM   2587  N  N     . HIS B 1 131  ? -11.204 -0.521  -49.336 1.00 58.49  ?  119  HIS B N     1 
ATOM   2588  C  CA    . HIS B 1 131  ? -9.875  -0.330  -48.771 1.00 55.98  ?  119  HIS B CA    1 
ATOM   2589  C  C     . HIS B 1 131  ? -9.222  -1.622  -48.293 1.00 55.10  ?  119  HIS B C     1 
ATOM   2590  O  O     . HIS B 1 131  ? -8.038  -1.599  -47.943 1.00 56.18  ?  119  HIS B O     1 
ATOM   2591  C  CB    . HIS B 1 131  ? -9.930  0.665   -47.605 1.00 52.28  ?  119  HIS B CB    1 
ATOM   2592  C  CG    . HIS B 1 131  ? -10.491 2.004   -47.974 1.00 56.54  ?  119  HIS B CG    1 
ATOM   2593  N  ND1   . HIS B 1 131  ? -9.694  3.101   -48.224 1.00 56.18  ?  119  HIS B ND1   1 
ATOM   2594  C  CD2   . HIS B 1 131  ? -11.768 2.425   -48.127 1.00 57.72  ?  119  HIS B CD2   1 
ATOM   2595  C  CE1   . HIS B 1 131  ? -10.456 4.138   -48.519 1.00 52.37  ?  119  HIS B CE1   1 
ATOM   2596  N  NE2   . HIS B 1 131  ? -11.719 3.755   -48.467 1.00 59.88  ?  119  HIS B NE2   1 
ATOM   2597  N  N     . ASN B 1 132  ? -9.947  -2.740  -48.267 1.00 58.31  ?  120  ASN B N     1 
ATOM   2598  C  CA    . ASN B 1 132  ? -9.395  -4.028  -47.843 1.00 64.83  ?  120  ASN B CA    1 
ATOM   2599  C  C     . ASN B 1 132  ? -9.660  -5.080  -48.916 1.00 69.39  ?  120  ASN B C     1 
ATOM   2600  O  O     . ASN B 1 132  ? -10.482 -5.986  -48.732 1.00 67.54  ?  120  ASN B O     1 
ATOM   2601  C  CB    . ASN B 1 132  ? -9.967  -4.454  -46.488 1.00 61.18  ?  120  ASN B CB    1 
ATOM   2602  C  CG    . ASN B 1 132  ? -11.484 -4.551  -46.488 1.00 62.45  ?  120  ASN B CG    1 
ATOM   2603  O  OD1   . ASN B 1 132  ? -12.155 -4.008  -47.365 1.00 65.80  ?  120  ASN B OD1   1 
ATOM   2604  N  ND2   . ASN B 1 132  ? -12.031 -5.246  -45.496 1.00 56.95  ?  120  ASN B ND2   1 
ATOM   2605  N  N     . PRO B 1 133  ? -8.961  -5.000  -50.051 1.00 69.53  ?  121  PRO B N     1 
ATOM   2606  C  CA    . PRO B 1 133  ? -9.195  -5.983  -51.122 1.00 68.54  ?  121  PRO B CA    1 
ATOM   2607  C  C     . PRO B 1 133  ? -8.822  -7.404  -50.739 1.00 73.42  ?  121  PRO B C     1 
ATOM   2608  O  O     . PRO B 1 133  ? -9.363  -8.349  -51.327 1.00 74.76  ?  121  PRO B O     1 
ATOM   2609  C  CB    . PRO B 1 133  ? -8.317  -5.467  -52.274 1.00 67.33  ?  121  PRO B CB    1 
ATOM   2610  C  CG    . PRO B 1 133  ? -8.032  -4.034  -51.938 1.00 67.16  ?  121  PRO B CG    1 
ATOM   2611  C  CD    . PRO B 1 133  ? -7.966  -3.989  -50.445 1.00 69.15  ?  121  PRO B CD    1 
ATOM   2612  N  N     . GLY B 1 134  ? -7.920  -7.590  -49.778 1.00 70.07  ?  122  GLY B N     1 
ATOM   2613  C  CA    . GLY B 1 134  ? -7.512  -8.916  -49.365 1.00 73.63  ?  122  GLY B CA    1 
ATOM   2614  C  C     . GLY B 1 134  ? -8.391  -9.583  -48.335 1.00 67.51  ?  122  GLY B C     1 
ATOM   2615  O  O     . GLY B 1 134  ? -8.065  -10.681 -47.876 1.00 62.14  ?  122  GLY B O     1 
ATOM   2616  N  N     . MET B 1 135  ? -9.502  -8.955  -47.956 1.00 69.38  ?  123  MET B N     1 
ATOM   2617  C  CA    . MET B 1 135  ? -10.380 -9.520  -46.940 1.00 70.09  ?  123  MET B CA    1 
ATOM   2618  C  C     . MET B 1 135  ? -11.117 -10.733 -47.491 1.00 62.92  ?  123  MET B C     1 
ATOM   2619  O  O     . MET B 1 135  ? -11.777 -10.652 -48.532 1.00 70.74  ?  123  MET B O     1 
ATOM   2620  C  CB    . MET B 1 135  ? -11.379 -8.470  -46.462 1.00 68.48  ?  123  MET B CB    1 
ATOM   2621  C  CG    . MET B 1 135  ? -12.344 -8.975  -45.404 1.00 61.73  ?  123  MET B CG    1 
ATOM   2622  S  SD    . MET B 1 135  ? -13.698 -7.824  -45.110 1.00 68.85  ?  123  MET B SD    1 
ATOM   2623  C  CE    . MET B 1 135  ? -14.489 -7.830  -46.716 1.00 74.62  ?  123  MET B CE    1 
ATOM   2624  N  N     . HIS B 1 136  ? -11.003 -11.858 -46.791 1.00 53.21  ?  124  HIS B N     1 
ATOM   2625  C  CA    . HIS B 1 136  ? -11.733 -13.057 -47.178 1.00 57.93  ?  124  HIS B CA    1 
ATOM   2626  C  C     . HIS B 1 136  ? -13.231 -12.848 -46.995 1.00 60.22  ?  124  HIS B C     1 
ATOM   2627  O  O     . HIS B 1 136  ? -13.675 -12.229 -46.025 1.00 65.47  ?  124  HIS B O     1 
ATOM   2628  C  CB    . HIS B 1 136  ? -11.263 -14.254 -46.352 1.00 61.01  ?  124  HIS B CB    1 
ATOM   2629  C  CG    . HIS B 1 136  ? -12.141 -15.458 -46.482 1.00 62.82  ?  124  HIS B CG    1 
ATOM   2630  N  ND1   . HIS B 1 136  ? -12.057 -16.331 -47.545 1.00 64.33  ?  124  HIS B ND1   1 
ATOM   2631  C  CD2   . HIS B 1 136  ? -13.128 -15.932 -45.684 1.00 68.39  ?  124  HIS B CD2   1 
ATOM   2632  C  CE1   . HIS B 1 136  ? -12.951 -17.291 -47.395 1.00 67.53  ?  124  HIS B CE1   1 
ATOM   2633  N  NE2   . HIS B 1 136  ? -13.614 -17.073 -46.274 1.00 68.15  ?  124  HIS B NE2   1 
ATOM   2634  N  N     . ILE B 1 137  ? -14.015 -13.370 -47.941 1.00 54.75  ?  125  ILE B N     1 
ATOM   2635  C  CA    . ILE B 1 137  ? -15.467 -13.249 -47.923 1.00 52.51  ?  125  ILE B CA    1 
ATOM   2636  C  C     . ILE B 1 137  ? -16.142 -14.615 -47.944 1.00 54.04  ?  125  ILE B C     1 
ATOM   2637  O  O     . ILE B 1 137  ? -17.047 -14.886 -47.148 1.00 56.91  ?  125  ILE B O     1 
ATOM   2638  C  CB    . ILE B 1 137  ? -15.974 -12.371 -49.089 1.00 52.74  ?  125  ILE B CB    1 
ATOM   2639  C  CG1   . ILE B 1 137  ? -15.372 -10.967 -49.001 1.00 48.62  ?  125  ILE B CG1   1 
ATOM   2640  C  CG2   . ILE B 1 137  ? -17.493 -12.299 -49.080 1.00 43.72  ?  125  ILE B CG2   1 
ATOM   2641  C  CD1   . ILE B 1 137  ? -15.925 -9.999  -50.022 1.00 40.37  ?  125  ILE B CD1   1 
ATOM   2642  N  N     . ALA B 1 138  ? -15.712 -15.495 -48.847 1.00 67.22  ?  126  ALA B N     1 
ATOM   2643  C  CA    . ALA B 1 138  ? -16.338 -16.803 -48.970 1.00 68.44  ?  126  ALA B CA    1 
ATOM   2644  C  C     . ALA B 1 138  ? -15.392 -17.762 -49.677 1.00 66.78  ?  126  ALA B C     1 
ATOM   2645  O  O     . ALA B 1 138  ? -14.559 -17.350 -50.489 1.00 64.33  ?  126  ALA B O     1 
ATOM   2646  C  CB    . ALA B 1 138  ? -17.666 -16.718 -49.731 1.00 70.11  ?  126  ALA B CB    1 
ATOM   2647  N  N     . THR B 1 139  ? -15.536 -19.045 -49.356 1.00 75.23  ?  127  THR B N     1 
ATOM   2648  C  CA    . THR B 1 139  ? -14.833 -20.120 -50.045 1.00 80.17  ?  127  THR B CA    1 
ATOM   2649  C  C     . THR B 1 139  ? -15.797 -20.775 -51.026 1.00 83.05  ?  127  THR B C     1 
ATOM   2650  O  O     . THR B 1 139  ? -16.880 -21.221 -50.633 1.00 78.26  ?  127  THR B O     1 
ATOM   2651  C  CB    . THR B 1 139  ? -14.291 -21.155 -49.058 1.00 74.53  ?  127  THR B CB    1 
ATOM   2652  O  OG1   . THR B 1 139  ? -15.338 -21.570 -48.172 1.00 83.52  ?  127  THR B OG1   1 
ATOM   2653  C  CG2   . THR B 1 139  ? -13.142 -20.577 -48.248 1.00 69.06  ?  127  THR B CG2   1 
ATOM   2654  N  N     . LEU B 1 140  ? -15.405 -20.830 -52.296 1.00 81.40  ?  128  LEU B N     1 
ATOM   2655  C  CA    . LEU B 1 140  ? -16.256 -21.374 -53.345 1.00 79.00  ?  128  LEU B CA    1 
ATOM   2656  C  C     . LEU B 1 140  ? -16.046 -22.877 -53.468 1.00 87.79  ?  128  LEU B C     1 
ATOM   2657  O  O     . LEU B 1 140  ? -14.913 -23.342 -53.631 1.00 87.91  ?  128  LEU B O     1 
ATOM   2658  C  CB    . LEU B 1 140  ? -15.967 -20.687 -54.680 1.00 79.24  ?  128  LEU B CB    1 
ATOM   2659  C  CG    . LEU B 1 140  ? -16.270 -19.188 -54.719 1.00 72.85  ?  128  LEU B CG    1 
ATOM   2660  C  CD1   . LEU B 1 140  ? -15.850 -18.575 -56.045 1.00 83.40  ?  128  LEU B CD1   1 
ATOM   2661  C  CD2   . LEU B 1 140  ? -17.746 -18.937 -54.455 1.00 70.71  ?  128  LEU B CD2   1 
ATOM   2662  N  N     . ASN B 1 141  ? -17.140 -23.631 -53.390 1.00 98.50  ?  129  ASN B N     1 
ATOM   2663  C  CA    . ASN B 1 141  ? -17.082 -25.073 -53.557 1.00 111.29 ?  129  ASN B CA    1 
ATOM   2664  C  C     . ASN B 1 141  ? -16.768 -25.421 -55.013 1.00 118.81 ?  129  ASN B C     1 
ATOM   2665  O  O     . ASN B 1 141  ? -16.761 -24.563 -55.901 1.00 116.77 ?  129  ASN B O     1 
ATOM   2666  C  CB    . ASN B 1 141  ? -18.402 -25.711 -53.118 1.00 111.23 ?  129  ASN B CB    1 
ATOM   2667  C  CG    . ASN B 1 141  ? -18.270 -27.193 -52.817 1.00 119.84 ?  129  ASN B CG    1 
ATOM   2668  O  OD1   . ASN B 1 141  ? -17.491 -27.903 -53.451 1.00 124.83 ?  129  ASN B OD1   1 
ATOM   2669  N  ND2   . ASN B 1 141  ? -19.039 -27.667 -51.842 1.00 118.71 ?  129  ASN B ND2   1 
ATOM   2670  N  N     . ASP B 1 142  ? -16.496 -26.703 -55.251 1.00 121.17 ?  130  ASP B N     1 
ATOM   2671  C  CA    . ASP B 1 142  ? -16.213 -27.172 -56.601 1.00 115.36 ?  130  ASP B CA    1 
ATOM   2672  C  C     . ASP B 1 142  ? -17.407 -26.912 -57.510 1.00 118.24 ?  130  ASP B C     1 
ATOM   2673  O  O     . ASP B 1 142  ? -18.544 -27.262 -57.177 1.00 115.63 ?  130  ASP B O     1 
ATOM   2674  C  CB    . ASP B 1 142  ? -15.871 -28.661 -56.583 1.00 119.32 ?  130  ASP B CB    1 
ATOM   2675  N  N     . LYS B 1 143  ? -17.142 -26.289 -58.661 1.00 108.16 ?  131  LYS B N     1 
ATOM   2676  C  CA    . LYS B 1 143  ? -18.189 -25.865 -59.591 1.00 104.57 ?  131  LYS B CA    1 
ATOM   2677  C  C     . LYS B 1 143  ? -19.194 -24.947 -58.896 1.00 101.89 ?  131  LYS B C     1 
ATOM   2678  O  O     . LYS B 1 143  ? -20.401 -25.017 -59.136 1.00 96.42  ?  131  LYS B O     1 
ATOM   2679  C  CB    . LYS B 1 143  ? -18.891 -27.068 -60.226 1.00 101.23 ?  131  LYS B CB    1 
ATOM   2680  N  N     . GLY B 1 144  ? -18.688 -24.080 -58.026 1.00 98.22  ?  132  GLY B N     1 
ATOM   2681  C  CA    . GLY B 1 144  ? -19.520 -23.184 -57.248 1.00 95.33  ?  132  GLY B CA    1 
ATOM   2682  C  C     . GLY B 1 144  ? -19.626 -21.806 -57.873 1.00 90.53  ?  132  GLY B C     1 
ATOM   2683  O  O     . GLY B 1 144  ? -18.710 -21.336 -58.543 1.00 89.01  ?  132  GLY B O     1 
ATOM   2684  N  N     . LYS B 1 145  ? -20.766 -21.159 -57.638 1.00 88.56  ?  133  LYS B N     1 
ATOM   2685  C  CA    . LYS B 1 145  ? -21.043 -19.832 -58.165 1.00 84.09  ?  133  LYS B CA    1 
ATOM   2686  C  C     . LYS B 1 145  ? -21.745 -19.012 -57.094 1.00 81.26  ?  133  LYS B C     1 
ATOM   2687  O  O     . LYS B 1 145  ? -22.620 -19.521 -56.389 1.00 80.99  ?  133  LYS B O     1 
ATOM   2688  C  CB    . LYS B 1 145  ? -21.907 -19.907 -59.431 1.00 90.63  ?  133  LYS B CB    1 
ATOM   2689  C  CG    . LYS B 1 145  ? -22.296 -18.561 -60.017 1.00 93.51  ?  133  LYS B CG    1 
ATOM   2690  C  CD    . LYS B 1 145  ? -23.031 -18.739 -61.336 1.00 106.50 ?  133  LYS B CD    1 
ATOM   2691  C  CE    . LYS B 1 145  ? -23.744 -17.465 -61.757 1.00 104.98 ?  133  LYS B CE    1 
ATOM   2692  N  NZ    . LYS B 1 145  ? -22.814 -16.312 -61.905 1.00 95.29  ?  133  LYS B NZ    1 
ATOM   2693  N  N     . LEU B 1 146  ? -21.358 -17.743 -56.973 1.00 72.06  ?  134  LEU B N     1 
ATOM   2694  C  CA    . LEU B 1 146  ? -21.930 -16.856 -55.965 1.00 64.01  ?  134  LEU B CA    1 
ATOM   2695  C  C     . LEU B 1 146  ? -22.201 -15.498 -56.589 1.00 57.77  ?  134  LEU B C     1 
ATOM   2696  O  O     . LEU B 1 146  ? -21.285 -14.859 -57.117 1.00 48.89  ?  134  LEU B O     1 
ATOM   2697  C  CB    . LEU B 1 146  ? -20.997 -16.716 -54.757 1.00 67.89  ?  134  LEU B CB    1 
ATOM   2698  C  CG    . LEU B 1 146  ? -21.506 -15.846 -53.604 1.00 70.87  ?  134  LEU B CG    1 
ATOM   2699  C  CD1   . LEU B 1 146  ? -21.374 -16.580 -52.280 1.00 65.53  ?  134  LEU B CD1   1 
ATOM   2700  C  CD2   . LEU B 1 146  ? -20.764 -14.519 -53.556 1.00 66.84  ?  134  LEU B CD2   1 
ATOM   2701  N  N     . GLU B 1 147  ? -23.457 -15.063 -56.529 1.00 62.46  ?  135  GLU B N     1 
ATOM   2702  C  CA    . GLU B 1 147  ? -23.865 -13.732 -56.955 1.00 62.67  ?  135  GLU B CA    1 
ATOM   2703  C  C     . GLU B 1 147  ? -24.518 -13.026 -55.777 1.00 60.91  ?  135  GLU B C     1 
ATOM   2704  O  O     . GLU B 1 147  ? -25.450 -13.562 -55.169 1.00 57.34  ?  135  GLU B O     1 
ATOM   2705  C  CB    . GLU B 1 147  ? -24.836 -13.794 -58.138 1.00 70.51  ?  135  GLU B CB    1 
ATOM   2706  C  CG    . GLU B 1 147  ? -24.284 -14.480 -59.377 1.00 69.64  ?  135  GLU B CG    1 
ATOM   2707  C  CD    . GLU B 1 147  ? -25.141 -14.231 -60.605 1.00 76.64  ?  135  GLU B CD    1 
ATOM   2708  O  OE1   . GLU B 1 147  ? -26.322 -13.858 -60.441 1.00 78.42  ?  135  GLU B OE1   1 
ATOM   2709  O  OE2   . GLU B 1 147  ? -24.632 -14.397 -61.733 1.00 81.92  ?  135  GLU B OE2   1 
ATOM   2710  N  N     . VAL B 1 148  ? -24.029 -11.832 -55.453 1.00 54.29  ?  136  VAL B N     1 
ATOM   2711  C  CA    . VAL B 1 148  ? -24.556 -11.071 -54.326 1.00 53.44  ?  136  VAL B CA    1 
ATOM   2712  C  C     . VAL B 1 148  ? -24.478 -9.587  -54.659 1.00 47.60  ?  136  VAL B C     1 
ATOM   2713  O  O     . VAL B 1 148  ? -23.492 -9.112  -55.230 1.00 38.68  ?  136  VAL B O     1 
ATOM   2714  C  CB    . VAL B 1 148  ? -23.806 -11.409 -53.017 1.00 52.36  ?  136  VAL B CB    1 
ATOM   2715  C  CG1   . VAL B 1 148  ? -22.315 -11.156 -53.164 1.00 56.21  ?  136  VAL B CG1   1 
ATOM   2716  C  CG2   . VAL B 1 148  ? -24.380 -10.624 -51.846 1.00 51.39  ?  136  VAL B CG2   1 
ATOM   2717  N  N     . GLU B 1 149  ? -25.537 -8.861  -54.311 1.00 50.32  ?  137  GLU B N     1 
ATOM   2718  C  CA    . GLU B 1 149  ? -25.643 -7.428  -54.549 1.00 57.24  ?  137  GLU B CA    1 
ATOM   2719  C  C     . GLU B 1 149  ? -25.522 -6.691  -53.223 1.00 62.13  ?  137  GLU B C     1 
ATOM   2720  O  O     . GLU B 1 149  ? -26.169 -7.067  -52.240 1.00 58.55  ?  137  GLU B O     1 
ATOM   2721  C  CB    . GLU B 1 149  ? -26.972 -7.090  -55.228 1.00 61.03  ?  137  GLU B CB    1 
ATOM   2722  C  CG    . GLU B 1 149  ? -27.297 -5.608  -55.283 1.00 68.32  ?  137  GLU B CG    1 
ATOM   2723  C  CD    . GLU B 1 149  ? -28.670 -5.340  -55.869 1.00 77.98  ?  137  GLU B CD    1 
ATOM   2724  O  OE1   . GLU B 1 149  ? -29.317 -6.303  -56.331 1.00 69.95  ?  137  GLU B OE1   1 
ATOM   2725  O  OE2   . GLU B 1 149  ? -29.103 -4.168  -55.866 1.00 87.46  ?  137  GLU B OE2   1 
ATOM   2726  N  N     . LEU B 1 150  ? -24.698 -5.646  -53.196 1.00 57.94  ?  138  LEU B N     1 
ATOM   2727  C  CA    . LEU B 1 150  ? -24.432 -4.884  -51.985 1.00 45.29  ?  138  LEU B CA    1 
ATOM   2728  C  C     . LEU B 1 150  ? -24.925 -3.453  -52.150 1.00 49.25  ?  138  LEU B C     1 
ATOM   2729  O  O     . LEU B 1 150  ? -24.792 -2.861  -53.225 1.00 59.31  ?  138  LEU B O     1 
ATOM   2730  C  CB    . LEU B 1 150  ? -22.936 -4.881  -51.650 1.00 39.37  ?  138  LEU B CB    1 
ATOM   2731  C  CG    . LEU B 1 150  ? -22.207 -6.227  -51.681 1.00 47.94  ?  138  LEU B CG    1 
ATOM   2732  C  CD1   . LEU B 1 150  ? -20.790 -6.073  -51.157 1.00 54.83  ?  138  LEU B CD1   1 
ATOM   2733  C  CD2   . LEU B 1 150  ? -22.959 -7.282  -50.888 1.00 54.66  ?  138  LEU B CD2   1 
ATOM   2734  N  N     . VAL B 1 151  ? -25.491 -2.903  -51.078 1.00 50.54  ?  139  VAL B N     1 
ATOM   2735  C  CA    . VAL B 1 151  ? -25.994 -1.533  -51.053 1.00 48.05  ?  139  VAL B CA    1 
ATOM   2736  C  C     . VAL B 1 151  ? -25.153 -0.743  -50.061 1.00 47.93  ?  139  VAL B C     1 
ATOM   2737  O  O     . VAL B 1 151  ? -25.033 -1.130  -48.892 1.00 54.14  ?  139  VAL B O     1 
ATOM   2738  C  CB    . VAL B 1 151  ? -27.483 -1.481  -50.676 1.00 51.92  ?  139  VAL B CB    1 
ATOM   2739  C  CG1   . VAL B 1 151  ? -27.961 -0.038  -50.601 1.00 62.10  ?  139  VAL B CG1   1 
ATOM   2740  C  CG2   . VAL B 1 151  ? -28.313 -2.273  -51.674 1.00 51.32  ?  139  VAL B CG2   1 
ATOM   2741  N  N     . VAL B 1 152  ? -24.576 0.365   -50.521 1.00 47.99  ?  140  VAL B N     1 
ATOM   2742  C  CA    . VAL B 1 152  ? -23.700 1.202   -49.709 1.00 49.11  ?  140  VAL B CA    1 
ATOM   2743  C  C     . VAL B 1 152  ? -24.343 2.573   -49.557 1.00 53.50  ?  140  VAL B C     1 
ATOM   2744  O  O     . VAL B 1 152  ? -24.817 3.154   -50.541 1.00 60.35  ?  140  VAL B O     1 
ATOM   2745  C  CB    . VAL B 1 152  ? -22.296 1.321   -50.329 1.00 48.04  ?  140  VAL B CB    1 
ATOM   2746  C  CG1   . VAL B 1 152  ? -21.391 2.163   -49.443 1.00 53.72  ?  140  VAL B CG1   1 
ATOM   2747  C  CG2   . VAL B 1 152  ? -21.700 -0.056  -50.547 1.00 46.17  ?  140  VAL B CG2   1 
ATOM   2748  N  N     . GLU B 1 153  ? -24.360 3.085   -48.328 1.00 51.26  ?  141  GLU B N     1 
ATOM   2749  C  CA    . GLU B 1 153  ? -24.934 4.390   -48.034 1.00 48.22  ?  141  GLU B CA    1 
ATOM   2750  C  C     . GLU B 1 153  ? -24.022 5.135   -47.070 1.00 55.19  ?  141  GLU B C     1 
ATOM   2751  O  O     . GLU B 1 153  ? -23.213 4.534   -46.358 1.00 52.82  ?  141  GLU B O     1 
ATOM   2752  C  CB    . GLU B 1 153  ? -26.341 4.272   -47.431 1.00 47.39  ?  141  GLU B CB    1 
ATOM   2753  C  CG    . GLU B 1 153  ? -27.326 3.484   -48.277 1.00 51.89  ?  141  GLU B CG    1 
ATOM   2754  C  CD    . GLU B 1 153  ? -28.642 3.239   -47.565 1.00 68.35  ?  141  GLU B CD    1 
ATOM   2755  O  OE1   . GLU B 1 153  ? -28.819 3.762   -46.445 1.00 77.80  ?  141  GLU B OE1   1 
ATOM   2756  O  OE2   . GLU B 1 153  ? -29.497 2.519   -48.122 1.00 79.90  ?  141  GLU B OE2   1 
ATOM   2757  N  N     . ARG B 1 154  ? -24.162 6.456   -47.052 1.00 60.19  ?  142  ARG B N     1 
ATOM   2758  C  CA    . ARG B 1 154  ? -23.442 7.278   -46.093 1.00 51.57  ?  142  ARG B CA    1 
ATOM   2759  C  C     . ARG B 1 154  ? -24.250 7.419   -44.807 1.00 56.55  ?  142  ARG B C     1 
ATOM   2760  O  O     . ARG B 1 154  ? -25.469 7.237   -44.784 1.00 56.08  ?  142  ARG B O     1 
ATOM   2761  C  CB    . ARG B 1 154  ? -23.135 8.662   -46.668 1.00 60.97  ?  142  ARG B CB    1 
ATOM   2762  C  CG    . ARG B 1 154  ? -22.236 8.657   -47.893 1.00 64.81  ?  142  ARG B CG    1 
ATOM   2763  C  CD    . ARG B 1 154  ? -21.408 9.933   -47.969 1.00 64.45  ?  142  ARG B CD    1 
ATOM   2764  N  NE    . ARG B 1 154  ? -20.189 9.838   -47.169 1.00 58.06  ?  142  ARG B NE    1 
ATOM   2765  C  CZ    . ARG B 1 154  ? -19.384 10.862  -46.905 1.00 66.50  ?  142  ARG B CZ    1 
ATOM   2766  N  NH1   . ARG B 1 154  ? -19.668 12.072  -47.368 1.00 76.90  ?  142  ARG B NH1   1 
ATOM   2767  N  NH2   . ARG B 1 154  ? -18.294 10.677  -46.171 1.00 70.83  ?  142  ARG B NH2   1 
ATOM   2768  N  N     . GLY B 1 155  ? -23.549 7.749   -43.731 1.00 59.49  ?  143  GLY B N     1 
ATOM   2769  C  CA    . GLY B 1 155  ? -24.192 7.928   -42.446 1.00 59.49  ?  143  GLY B CA    1 
ATOM   2770  C  C     . GLY B 1 155  ? -23.158 8.067   -41.351 1.00 51.37  ?  143  GLY B C     1 
ATOM   2771  O  O     . GLY B 1 155  ? -21.949 8.093   -41.600 1.00 47.88  ?  143  GLY B O     1 
ATOM   2772  N  N     . ARG B 1 156  ? -23.662 8.152   -40.121 1.00 51.10  ?  144  ARG B N     1 
ATOM   2773  C  CA    . ARG B 1 156  ? -22.821 8.346   -38.949 1.00 56.79  ?  144  ARG B CA    1 
ATOM   2774  C  C     . ARG B 1 156  ? -23.237 7.394   -37.838 1.00 47.33  ?  144  ARG B C     1 
ATOM   2775  O  O     . ARG B 1 156  ? -24.429 7.142   -37.636 1.00 37.96  ?  144  ARG B O     1 
ATOM   2776  C  CB    . ARG B 1 156  ? -22.893 9.794   -38.446 1.00 53.33  ?  144  ARG B CB    1 
ATOM   2777  C  CG    . ARG B 1 156  ? -22.321 10.813  -39.416 1.00 62.94  ?  144  ARG B CG    1 
ATOM   2778  C  CD    . ARG B 1 156  ? -22.084 12.152  -38.739 1.00 67.30  ?  144  ARG B CD    1 
ATOM   2779  N  NE    . ARG B 1 156  ? -23.330 12.803  -38.351 1.00 76.15  ?  144  ARG B NE    1 
ATOM   2780  C  CZ    . ARG B 1 156  ? -23.978 13.679  -39.111 1.00 85.11  ?  144  ARG B CZ    1 
ATOM   2781  N  NH1   . ARG B 1 156  ? -23.495 14.008  -40.301 1.00 80.58  ?  144  ARG B NH1   1 
ATOM   2782  N  NH2   . ARG B 1 156  ? -25.107 14.227  -38.681 1.00 92.33  ?  144  ARG B NH2   1 
ATOM   2783  N  N     . GLY B 1 157  ? -22.244 6.870   -37.122 1.00 37.40  ?  145  GLY B N     1 
ATOM   2784  C  CA    . GLY B 1 157  ? -22.517 6.024   -35.976 1.00 40.62  ?  145  GLY B CA    1 
ATOM   2785  C  C     . GLY B 1 157  ? -22.810 4.583   -36.365 1.00 38.33  ?  145  GLY B C     1 
ATOM   2786  O  O     . GLY B 1 157  ? -22.299 4.058   -37.355 1.00 48.15  ?  145  GLY B O     1 
ATOM   2787  N  N     . TYR B 1 158  ? -23.650 3.940   -35.556 1.00 34.16  ?  146  TYR B N     1 
ATOM   2788  C  CA    . TYR B 1 158  ? -24.046 2.552   -35.760 1.00 33.46  ?  146  TYR B CA    1 
ATOM   2789  C  C     . TYR B 1 158  ? -25.565 2.481   -35.731 1.00 49.87  ?  146  TYR B C     1 
ATOM   2790  O  O     . TYR B 1 158  ? -26.188 2.905   -34.753 1.00 49.10  ?  146  TYR B O     1 
ATOM   2791  C  CB    . TYR B 1 158  ? -23.434 1.644   -34.689 1.00 37.28  ?  146  TYR B CB    1 
ATOM   2792  C  CG    . TYR B 1 158  ? -23.882 0.200   -34.753 1.00 32.06  ?  146  TYR B CG    1 
ATOM   2793  C  CD1   . TYR B 1 158  ? -24.949 -0.251  -33.985 1.00 31.59  ?  146  TYR B CD1   1 
ATOM   2794  C  CD2   . TYR B 1 158  ? -23.232 -0.715  -35.571 1.00 38.59  ?  146  TYR B CD2   1 
ATOM   2795  C  CE1   . TYR B 1 158  ? -25.360 -1.568  -34.036 1.00 31.92  ?  146  TYR B CE1   1 
ATOM   2796  C  CE2   . TYR B 1 158  ? -23.636 -2.037  -35.628 1.00 37.09  ?  146  TYR B CE2   1 
ATOM   2797  C  CZ    . TYR B 1 158  ? -24.701 -2.457  -34.858 1.00 33.70  ?  146  TYR B CZ    1 
ATOM   2798  O  OH    . TYR B 1 158  ? -25.110 -3.769  -34.906 1.00 30.99  ?  146  TYR B OH    1 
ATOM   2799  N  N     . VAL B 1 159  ? -26.154 1.949   -36.796 1.00 59.49  ?  147  VAL B N     1 
ATOM   2800  C  CA    . VAL B 1 159  ? -27.600 1.869   -36.955 1.00 56.41  ?  147  VAL B CA    1 
ATOM   2801  C  C     . VAL B 1 159  ? -27.976 0.397   -37.082 1.00 55.00  ?  147  VAL B C     1 
ATOM   2802  O  O     . VAL B 1 159  ? -27.341 -0.326  -37.851 1.00 47.78  ?  147  VAL B O     1 
ATOM   2803  C  CB    . VAL B 1 159  ? -28.100 2.660   -38.177 1.00 55.25  ?  147  VAL B CB    1 
ATOM   2804  C  CG1   . VAL B 1 159  ? -27.088 2.584   -39.294 1.00 59.37  ?  147  VAL B CG1   1 
ATOM   2805  C  CG2   . VAL B 1 159  ? -29.445 2.137   -38.653 1.00 70.62  ?  147  VAL B CG2   1 
ATOM   2806  N  N     . PRO B 1 160  ? -28.983 -0.081  -36.355 1.00 56.85  ?  148  PRO B N     1 
ATOM   2807  C  CA    . PRO B 1 160  ? -29.348 -1.501  -36.431 1.00 58.58  ?  148  PRO B CA    1 
ATOM   2808  C  C     . PRO B 1 160  ? -29.913 -1.864  -37.797 1.00 75.91  ?  148  PRO B C     1 
ATOM   2809  O  O     . PRO B 1 160  ? -30.247 -1.013  -38.622 1.00 79.61  ?  148  PRO B O     1 
ATOM   2810  C  CB    . PRO B 1 160  ? -30.409 -1.659  -35.335 1.00 64.37  ?  148  PRO B CB    1 
ATOM   2811  C  CG    . PRO B 1 160  ? -30.261 -0.449  -34.463 1.00 58.92  ?  148  PRO B CG    1 
ATOM   2812  C  CD    . PRO B 1 160  ? -29.792 0.644   -35.363 1.00 64.00  ?  148  PRO B CD    1 
ATOM   2813  N  N     . ALA B 1 161  ? -30.021 -3.175  -38.022 1.00 75.51  ?  149  ALA B N     1 
ATOM   2814  C  CA    . ALA B 1 161  ? -30.592 -3.681  -39.264 1.00 77.96  ?  149  ALA B CA    1 
ATOM   2815  C  C     . ALA B 1 161  ? -32.104 -3.511  -39.319 1.00 83.38  ?  149  ALA B C     1 
ATOM   2816  O  O     . ALA B 1 161  ? -32.671 -3.459  -40.416 1.00 89.44  ?  149  ALA B O     1 
ATOM   2817  C  CB    . ALA B 1 161  ? -30.233 -5.155  -39.444 1.00 78.08  ?  149  ALA B CB    1 
ATOM   2818  N  N     . VAL B 1 162  ? -32.764 -3.414  -38.162 1.00 107.48 ?  150  VAL B N     1 
ATOM   2819  C  CA    . VAL B 1 162  ? -34.221 -3.312  -38.138 1.00 114.13 ?  150  VAL B CA    1 
ATOM   2820  C  C     . VAL B 1 162  ? -34.685 -2.026  -38.804 1.00 117.32 ?  150  VAL B C     1 
ATOM   2821  O  O     . VAL B 1 162  ? -35.751 -1.991  -39.430 1.00 118.13 ?  150  VAL B O     1 
ATOM   2822  C  CB    . VAL B 1 162  ? -34.740 -3.414  -36.690 1.00 116.59 ?  150  VAL B CB    1 
ATOM   2823  C  CG1   . VAL B 1 162  ? -36.254 -3.577  -36.670 1.00 115.65 ?  150  VAL B CG1   1 
ATOM   2824  C  CG2   . VAL B 1 162  ? -34.062 -4.565  -35.963 1.00 109.93 ?  150  VAL B CG2   1 
ATOM   2825  N  N     . GLN B 1 163  ? -33.901 -0.953  -38.688 1.00 110.47 ?  151  GLN B N     1 
ATOM   2826  C  CA    . GLN B 1 163  ? -34.260 0.299   -39.343 1.00 110.74 ?  151  GLN B CA    1 
ATOM   2827  C  C     . GLN B 1 163  ? -34.055 0.240   -40.851 1.00 98.72  ?  151  GLN B C     1 
ATOM   2828  O  O     . GLN B 1 163  ? -34.597 1.085   -41.572 1.00 105.89 ?  151  GLN B O     1 
ATOM   2829  C  CB    . GLN B 1 163  ? -33.456 1.454   -38.741 1.00 107.71 ?  151  GLN B CB    1 
ATOM   2830  C  CG    . GLN B 1 163  ? -33.699 1.650   -37.250 1.00 102.26 ?  151  GLN B CG    1 
ATOM   2831  C  CD    . GLN B 1 163  ? -32.989 2.867   -36.691 1.00 107.94 ?  151  GLN B CD    1 
ATOM   2832  O  OE1   . GLN B 1 163  ? -32.033 3.369   -37.281 1.00 106.08 ?  151  GLN B OE1   1 
ATOM   2833  N  NE2   . GLN B 1 163  ? -33.462 3.355   -35.551 1.00 114.07 ?  151  GLN B NE2   1 
ATOM   2834  N  N     . ASN B 1 164  ? -33.294 -0.735  -41.342 1.00 84.42  ?  152  ASN B N     1 
ATOM   2835  C  CA    . ASN B 1 164  ? -33.105 -0.941  -42.771 1.00 97.32  ?  152  ASN B CA    1 
ATOM   2836  C  C     . ASN B 1 164  ? -34.074 -1.964  -43.351 1.00 106.64 ?  152  ASN B C     1 
ATOM   2837  O  O     . ASN B 1 164  ? -33.852 -2.444  -44.468 1.00 112.30 ?  152  ASN B O     1 
ATOM   2838  C  CB    . ASN B 1 164  ? -31.664 -1.372  -43.058 1.00 97.20  ?  152  ASN B CB    1 
ATOM   2839  C  CG    . ASN B 1 164  ? -30.676 -0.233  -42.918 1.00 96.13  ?  152  ASN B CG    1 
ATOM   2840  O  OD1   . ASN B 1 164  ? -31.008 0.926   -43.166 1.00 97.70  ?  152  ASN B OD1   1 
ATOM   2841  N  ND2   . ASN B 1 164  ? -29.450 -0.557  -42.523 1.00 85.06  ?  152  ASN B ND2   1 
ATOM   2842  N  N     . ARG B 1 165  ? -35.139 -2.309  -42.621 1.00 110.82 ?  153  ARG B N     1 
ATOM   2843  C  CA    . ARG B 1 165  ? -36.104 -3.277  -43.132 1.00 112.76 ?  153  ARG B CA    1 
ATOM   2844  C  C     . ARG B 1 165  ? -36.843 -2.744  -44.353 1.00 130.44 ?  153  ARG B C     1 
ATOM   2845  O  O     . ARG B 1 165  ? -37.254 -3.526  -45.217 1.00 128.74 ?  153  ARG B O     1 
ATOM   2846  C  CB    . ARG B 1 165  ? -37.098 -3.660  -42.034 1.00 107.08 ?  153  ARG B CB    1 
ATOM   2847  C  CG    . ARG B 1 165  ? -37.992 -2.516  -41.578 1.00 108.04 ?  153  ARG B CG    1 
ATOM   2848  C  CD    . ARG B 1 165  ? -38.872 -2.920  -40.409 1.00 112.17 ?  153  ARG B CD    1 
ATOM   2849  N  NE    . ARG B 1 165  ? -39.657 -1.794  -39.911 1.00 116.89 ?  153  ARG B NE    1 
ATOM   2850  C  CZ    . ARG B 1 165  ? -40.505 -1.866  -38.890 1.00 123.70 ?  153  ARG B CZ    1 
ATOM   2851  N  NH1   . ARG B 1 165  ? -41.175 -0.788  -38.506 1.00 124.81 ?  153  ARG B NH1   1 
ATOM   2852  N  NH2   . ARG B 1 165  ? -40.683 -3.014  -38.252 1.00 122.33 ?  153  ARG B NH2   1 
ATOM   2853  N  N     . ALA B 1 166  ? -37.016 -1.424  -44.445 1.00 143.37 ?  154  ALA B N     1 
ATOM   2854  C  CA    . ALA B 1 166  ? -37.680 -0.826  -45.595 1.00 148.09 ?  154  ALA B CA    1 
ATOM   2855  C  C     . ALA B 1 166  ? -36.746 -0.650  -46.784 1.00 143.69 ?  154  ALA B C     1 
ATOM   2856  O  O     . ALA B 1 166  ? -37.224 -0.526  -47.916 1.00 143.49 ?  154  ALA B O     1 
ATOM   2857  C  CB    . ALA B 1 166  ? -38.284 0.526   -45.211 1.00 146.15 ?  154  ALA B CB    1 
ATOM   2858  N  N     . SER B 1 167  ? -35.431 -0.637  -46.552 1.00 133.23 ?  155  SER B N     1 
ATOM   2859  C  CA    . SER B 1 167  ? -34.475 -0.478  -47.642 1.00 133.83 ?  155  SER B CA    1 
ATOM   2860  C  C     . SER B 1 167  ? -34.376 -1.720  -48.517 1.00 137.94 ?  155  SER B C     1 
ATOM   2861  O  O     . SER B 1 167  ? -33.898 -1.626  -49.652 1.00 135.02 ?  155  SER B O     1 
ATOM   2862  C  CB    . SER B 1 167  ? -33.094 -0.132  -47.084 1.00 123.01 ?  155  SER B CB    1 
ATOM   2863  O  OG    . SER B 1 167  ? -32.111 -0.161  -48.104 1.00 111.18 ?  155  SER B OG    1 
ATOM   2864  N  N     . GLY B 1 168  ? -34.812 -2.877  -48.018 1.00 150.51 ?  156  GLY B N     1 
ATOM   2865  C  CA    . GLY B 1 168  ? -34.723 -4.111  -48.774 1.00 145.27 ?  156  GLY B CA    1 
ATOM   2866  C  C     . GLY B 1 168  ? -35.977 -4.356  -49.589 1.00 154.10 ?  156  GLY B C     1 
ATOM   2867  O  O     . GLY B 1 168  ? -37.095 -4.249  -49.076 1.00 151.03 ?  156  GLY B O     1 
ATOM   2868  N  N     . ALA B 1 169  ? -35.785 -4.684  -50.863 1.00 160.17 ?  157  ALA B N     1 
ATOM   2869  C  CA    . ALA B 1 169  ? -36.904 -4.997  -51.738 1.00 153.56 ?  157  ALA B CA    1 
ATOM   2870  C  C     . ALA B 1 169  ? -37.477 -6.369  -51.403 1.00 147.92 ?  157  ALA B C     1 
ATOM   2871  O  O     . ALA B 1 169  ? -36.773 -7.262  -50.922 1.00 143.16 ?  157  ALA B O     1 
ATOM   2872  C  CB    . ALA B 1 169  ? -36.468 -4.953  -53.202 1.00 129.07 ?  157  ALA B CB    1 
ATOM   2873  N  N     . GLU B 1 170  ? -38.772 -6.535  -51.668 1.00 135.51 ?  158  GLU B N     1 
ATOM   2874  C  CA    . GLU B 1 170  ? -39.448 -7.796  -51.383 1.00 134.73 ?  158  GLU B CA    1 
ATOM   2875  C  C     . GLU B 1 170  ? -39.038 -8.863  -52.392 1.00 131.37 ?  158  GLU B C     1 
ATOM   2876  O  O     . GLU B 1 170  ? -39.861 -9.322  -53.191 1.00 136.16 ?  158  GLU B O     1 
ATOM   2877  C  CB    . GLU B 1 170  ? -40.967 -7.604  -51.387 1.00 137.32 ?  158  GLU B CB    1 
ATOM   2878  C  CG    . GLU B 1 170  ? -41.748 -8.765  -50.781 1.00 132.26 ?  158  GLU B CG    1 
ATOM   2879  C  CD    . GLU B 1 170  ? -43.247 -8.608  -50.944 1.00 127.32 ?  158  GLU B CD    1 
ATOM   2880  O  OE1   . GLU B 1 170  ? -43.695 -7.498  -51.298 1.00 131.34 ?  158  GLU B OE1   1 
ATOM   2881  O  OE2   . GLU B 1 170  ? -43.977 -9.597  -50.721 1.00 113.30 ?  158  GLU B OE2   1 
ATOM   2882  N  N     . ILE B 1 171  ? -37.766 -9.257  -52.362 1.00 125.51 ?  159  ILE B N     1 
ATOM   2883  C  CA    . ILE B 1 171  ? -37.243 -10.282 -53.259 1.00 113.25 ?  159  ILE B CA    1 
ATOM   2884  C  C     . ILE B 1 171  ? -35.910 -10.781 -52.702 1.00 97.76  ?  159  ILE B C     1 
ATOM   2885  O  O     . ILE B 1 171  ? -34.840 -10.534 -53.270 1.00 85.51  ?  159  ILE B O     1 
ATOM   2886  C  CB    . ILE B 1 171  ? -37.132 -9.747  -54.705 1.00 114.80 ?  159  ILE B CB    1 
ATOM   2887  C  CG1   . ILE B 1 171  ? -36.546 -10.802 -55.655 1.00 108.00 ?  159  ILE B CG1   1 
ATOM   2888  C  CG2   . ILE B 1 171  ? -36.388 -8.406  -54.753 1.00 115.14 ?  159  ILE B CG2   1 
ATOM   2889  C  CD1   . ILE B 1 171  ? -37.192 -12.163 -55.526 1.00 98.88  ?  159  ILE B CD1   1 
ATOM   2890  N  N     . GLY B 1 172  ? -35.971 -11.478 -51.570 1.00 90.06  ?  160  GLY B N     1 
ATOM   2891  C  CA    . GLY B 1 172  ? -34.779 -12.079 -50.994 1.00 84.98  ?  160  GLY B CA    1 
ATOM   2892  C  C     . GLY B 1 172  ? -33.714 -11.093 -50.571 1.00 87.12  ?  160  GLY B C     1 
ATOM   2893  O  O     . GLY B 1 172  ? -32.533 -11.454 -50.517 1.00 81.72  ?  160  GLY B O     1 
ATOM   2894  N  N     . ARG B 1 173  ? -34.094 -9.854  -50.273 1.00 89.82  ?  161  ARG B N     1 
ATOM   2895  C  CA    . ARG B 1 173  ? -33.162 -8.837  -49.804 1.00 76.85  ?  161  ARG B CA    1 
ATOM   2896  C  C     . ARG B 1 173  ? -33.187 -8.798  -48.283 1.00 74.43  ?  161  ARG B C     1 
ATOM   2897  O  O     . ARG B 1 173  ? -34.262 -8.754  -47.676 1.00 77.51  ?  161  ARG B O     1 
ATOM   2898  C  CB    . ARG B 1 173  ? -33.516 -7.464  -50.377 1.00 82.54  ?  161  ARG B CB    1 
ATOM   2899  N  N     . ILE B 1 174  ? -32.007 -8.811  -47.672 1.00 66.17  ?  162  ILE B N     1 
ATOM   2900  C  CA    . ILE B 1 174  ? -31.859 -8.865  -46.224 1.00 62.93  ?  162  ILE B CA    1 
ATOM   2901  C  C     . ILE B 1 174  ? -31.152 -7.596  -45.767 1.00 61.41  ?  162  ILE B C     1 
ATOM   2902  O  O     . ILE B 1 174  ? -30.155 -7.203  -46.375 1.00 51.76  ?  162  ILE B O     1 
ATOM   2903  C  CB    . ILE B 1 174  ? -31.083 -10.109 -45.755 1.00 50.72  ?  162  ILE B CB    1 
ATOM   2904  C  CG1   . ILE B 1 174  ? -29.811 -10.299 -46.583 1.00 49.97  ?  162  ILE B CG1   1 
ATOM   2905  C  CG2   . ILE B 1 174  ? -31.956 -11.341 -45.851 1.00 59.79  ?  162  ILE B CG2   1 
ATOM   2906  C  CD1   . ILE B 1 174  ? -29.017 -11.528 -46.205 1.00 53.57  ?  162  ILE B CD1   1 
ATOM   2907  N  N     . PRO B 1 175  ? -31.632 -6.925  -44.724 1.00 63.06  ?  163  PRO B N     1 
ATOM   2908  C  CA    . PRO B 1 175  ? -30.912 -5.777  -44.170 1.00 59.63  ?  163  PRO B CA    1 
ATOM   2909  C  C     . PRO B 1 175  ? -29.867 -6.210  -43.155 1.00 60.15  ?  163  PRO B C     1 
ATOM   2910  O  O     . PRO B 1 175  ? -29.979 -7.250  -42.503 1.00 54.23  ?  163  PRO B O     1 
ATOM   2911  C  CB    . PRO B 1 175  ? -32.025 -4.956  -43.496 1.00 67.45  ?  163  PRO B CB    1 
ATOM   2912  C  CG    . PRO B 1 175  ? -33.308 -5.774  -43.639 1.00 65.70  ?  163  PRO B CG    1 
ATOM   2913  C  CD    . PRO B 1 175  ? -32.905 -7.156  -44.028 1.00 61.01  ?  163  PRO B CD    1 
ATOM   2914  N  N     . VAL B 1 176  ? -28.826 -5.386  -43.030 1.00 65.38  ?  164  VAL B N     1 
ATOM   2915  C  CA    . VAL B 1 176  ? -27.701 -5.685  -42.155 1.00 62.33  ?  164  VAL B CA    1 
ATOM   2916  C  C     . VAL B 1 176  ? -27.412 -4.480  -41.272 1.00 65.07  ?  164  VAL B C     1 
ATOM   2917  O  O     . VAL B 1 176  ? -27.821 -3.352  -41.558 1.00 63.95  ?  164  VAL B O     1 
ATOM   2918  C  CB    . VAL B 1 176  ? -26.433 -6.078  -42.946 1.00 49.12  ?  164  VAL B CB    1 
ATOM   2919  C  CG1   . VAL B 1 176  ? -26.729 -7.220  -43.905 1.00 50.48  ?  164  VAL B CG1   1 
ATOM   2920  C  CG2   . VAL B 1 176  ? -25.877 -4.874  -43.691 1.00 37.26  ?  164  VAL B CG2   1 
ATOM   2921  N  N     . ASP B 1 177  ? -26.701 -4.739  -40.177 1.00 51.93  ?  165  ASP B N     1 
ATOM   2922  C  CA    . ASP B 1 177  ? -26.204 -3.659  -39.339 1.00 42.59  ?  165  ASP B CA    1 
ATOM   2923  C  C     . ASP B 1 177  ? -25.192 -2.831  -40.120 1.00 41.79  ?  165  ASP B C     1 
ATOM   2924  O  O     . ASP B 1 177  ? -24.329 -3.370  -40.818 1.00 46.68  ?  165  ASP B O     1 
ATOM   2925  C  CB    . ASP B 1 177  ? -25.562 -4.227  -38.073 1.00 52.23  ?  165  ASP B CB    1 
ATOM   2926  C  CG    . ASP B 1 177  ? -26.440 -5.259  -37.384 1.00 55.18  ?  165  ASP B CG    1 
ATOM   2927  O  OD1   . ASP B 1 177  ? -27.605 -4.938  -37.067 1.00 46.26  ?  165  ASP B OD1   1 
ATOM   2928  O  OD2   . ASP B 1 177  ? -25.965 -6.394  -37.166 1.00 61.49  ?  165  ASP B OD2   1 
ATOM   2929  N  N     . SER B 1 178  ? -25.304 -1.511  -40.012 1.00 50.06  ?  166  SER B N     1 
ATOM   2930  C  CA    . SER B 1 178  ? -24.445 -0.592  -40.752 1.00 55.87  ?  166  SER B CA    1 
ATOM   2931  C  C     . SER B 1 178  ? -23.461 0.046   -39.780 1.00 53.85  ?  166  SER B C     1 
ATOM   2932  O  O     . SER B 1 178  ? -23.861 0.820   -38.904 1.00 52.56  ?  166  SER B O     1 
ATOM   2933  C  CB    . SER B 1 178  ? -25.276 0.470   -41.474 1.00 54.36  ?  166  SER B CB    1 
ATOM   2934  O  OG    . SER B 1 178  ? -26.210 -0.123  -42.356 1.00 53.57  ?  166  SER B OG    1 
ATOM   2935  N  N     . ILE B 1 179  ? -22.184 -0.288  -39.935 1.00 42.60  ?  167  ILE B N     1 
ATOM   2936  C  CA    . ILE B 1 179  ? -21.120 0.337   -39.138 1.00 36.44  ?  167  ILE B CA    1 
ATOM   2937  C  C     . ILE B 1 179  ? -20.642 1.548   -39.931 1.00 37.72  ?  167  ILE B C     1 
ATOM   2938  O  O     . ILE B 1 179  ? -19.600 1.537   -40.593 1.00 31.60  ?  167  ILE B O     1 
ATOM   2939  C  CB    . ILE B 1 179  ? -19.992 -0.649  -38.819 1.00 37.18  ?  167  ILE B CB    1 
ATOM   2940  C  CG1   . ILE B 1 179  ? -20.565 -1.895  -38.133 1.00 33.52  ?  167  ILE B CG1   1 
ATOM   2941  C  CG2   . ILE B 1 179  ? -18.941 -0.003  -37.932 1.00 43.41  ?  167  ILE B CG2   1 
ATOM   2942  C  CD1   . ILE B 1 179  ? -19.524 -2.907  -37.722 1.00 31.49  ?  167  ILE B CD1   1 
ATOM   2943  N  N     . TYR B 1 180  ? -21.437 2.624   -39.870 1.00 40.57  ?  168  TYR B N     1 
ATOM   2944  C  CA    . TYR B 1 180  ? -21.097 3.841   -40.598 1.00 50.03  ?  168  TYR B CA    1 
ATOM   2945  C  C     . TYR B 1 180  ? -19.820 4.477   -40.056 1.00 50.24  ?  168  TYR B C     1 
ATOM   2946  O  O     . TYR B 1 180  ? -18.985 4.969   -40.827 1.00 53.43  ?  168  TYR B O     1 
ATOM   2947  C  CB    . TYR B 1 180  ? -22.249 4.838   -40.517 1.00 48.91  ?  168  TYR B CB    1 
ATOM   2948  C  CG    . TYR B 1 180  ? -23.460 4.502   -41.361 1.00 57.48  ?  168  TYR B CG    1 
ATOM   2949  C  CD1   . TYR B 1 180  ? -23.334 3.800   -42.552 1.00 58.50  ?  168  TYR B CD1   1 
ATOM   2950  C  CD2   . TYR B 1 180  ? -24.732 4.901   -40.969 1.00 59.23  ?  168  TYR B CD2   1 
ATOM   2951  C  CE1   . TYR B 1 180  ? -24.441 3.502   -43.326 1.00 53.38  ?  168  TYR B CE1   1 
ATOM   2952  C  CE2   . TYR B 1 180  ? -25.840 4.613   -41.737 1.00 66.29  ?  168  TYR B CE2   1 
ATOM   2953  C  CZ    . TYR B 1 180  ? -25.691 3.911   -42.909 1.00 55.02  ?  168  TYR B CZ    1 
ATOM   2954  O  OH    . TYR B 1 180  ? -26.797 3.620   -43.667 1.00 48.19  ?  168  TYR B OH    1 
ATOM   2955  N  N     . SER B 1 181  ? -19.653 4.471   -38.737 1.00 49.08  ?  169  SER B N     1 
ATOM   2956  C  CA    . SER B 1 181  ? -18.582 5.230   -38.109 1.00 51.96  ?  169  SER B CA    1 
ATOM   2957  C  C     . SER B 1 181  ? -17.219 4.693   -38.534 1.00 50.50  ?  169  SER B C     1 
ATOM   2958  O  O     . SER B 1 181  ? -17.015 3.471   -38.550 1.00 54.82  ?  169  SER B O     1 
ATOM   2959  C  CB    . SER B 1 181  ? -18.718 5.176   -36.588 1.00 51.42  ?  169  SER B CB    1 
ATOM   2960  O  OG    . SER B 1 181  ? -17.667 5.885   -35.961 1.00 53.10  ?  169  SER B OG    1 
ATOM   2961  N  N     . PRO B 1 182  ? -16.270 5.561   -38.895 1.00 42.35  ?  170  PRO B N     1 
ATOM   2962  C  CA    . PRO B 1 182  ? -14.941 5.064   -39.280 1.00 39.00  ?  170  PRO B CA    1 
ATOM   2963  C  C     . PRO B 1 182  ? -14.140 4.521   -38.112 1.00 49.67  ?  170  PRO B C     1 
ATOM   2964  O  O     . PRO B 1 182  ? -13.257 3.683   -38.326 1.00 50.04  ?  170  PRO B O     1 
ATOM   2965  C  CB    . PRO B 1 182  ? -14.269 6.300   -39.899 1.00 33.09  ?  170  PRO B CB    1 
ATOM   2966  C  CG    . PRO B 1 182  ? -15.392 7.231   -40.230 1.00 39.98  ?  170  PRO B CG    1 
ATOM   2967  C  CD    . PRO B 1 182  ? -16.416 7.000   -39.166 1.00 43.23  ?  170  PRO B CD    1 
ATOM   2968  N  N     . VAL B 1 183  ? -14.410 4.974   -36.888 1.00 43.92  ?  171  VAL B N     1 
ATOM   2969  C  CA    . VAL B 1 183  ? -13.706 4.476   -35.712 1.00 41.51  ?  171  VAL B CA    1 
ATOM   2970  C  C     . VAL B 1 183  ? -14.444 3.260   -35.172 1.00 40.70  ?  171  VAL B C     1 
ATOM   2971  O  O     . VAL B 1 183  ? -15.671 3.150   -35.270 1.00 38.99  ?  171  VAL B O     1 
ATOM   2972  C  CB    . VAL B 1 183  ? -13.556 5.575   -34.639 1.00 44.83  ?  171  VAL B CB    1 
ATOM   2973  C  CG1   . VAL B 1 183  ? -12.735 6.734   -35.184 1.00 38.56  ?  171  VAL B CG1   1 
ATOM   2974  C  CG2   . VAL B 1 183  ? -14.920 6.052   -34.176 1.00 45.93  ?  171  VAL B CG2   1 
ATOM   2975  N  N     . LEU B 1 184  ? -13.685 2.333   -34.594 1.00 47.24  ?  172  LEU B N     1 
ATOM   2976  C  CA    . LEU B 1 184  ? -14.208 1.049   -34.142 1.00 46.69  ?  172  LEU B CA    1 
ATOM   2977  C  C     . LEU B 1 184  ? -14.320 0.931   -32.632 1.00 53.90  ?  172  LEU B C     1 
ATOM   2978  O  O     . LEU B 1 184  ? -15.313 0.396   -32.133 1.00 52.07  ?  172  LEU B O     1 
ATOM   2979  C  CB    . LEU B 1 184  ? -13.325 -0.087  -34.668 1.00 47.97  ?  172  LEU B CB    1 
ATOM   2980  C  CG    . LEU B 1 184  ? -13.199 -0.182  -36.189 1.00 44.25  ?  172  LEU B CG    1 
ATOM   2981  C  CD1   . LEU B 1 184  ? -12.095 -1.152  -36.576 1.00 46.52  ?  172  LEU B CD1   1 
ATOM   2982  C  CD2   . LEU B 1 184  ? -14.527 -0.602  -36.800 1.00 52.12  ?  172  LEU B CD2   1 
ATOM   2983  N  N     . LYS B 1 185  ? -13.330 1.416   -31.885 1.00 52.41  ?  173  LYS B N     1 
ATOM   2984  C  CA    . LYS B 1 185  ? -13.314 1.243   -30.439 1.00 41.82  ?  173  LYS B CA    1 
ATOM   2985  C  C     . LYS B 1 185  ? -12.554 2.398   -29.807 1.00 41.25  ?  173  LYS B C     1 
ATOM   2986  O  O     . LYS B 1 185  ? -11.406 2.661   -30.176 1.00 37.33  ?  173  LYS B O     1 
ATOM   2987  C  CB    . LYS B 1 185  ? -12.671 -0.096  -30.062 1.00 35.89  ?  173  LYS B CB    1 
ATOM   2988  C  CG    . LYS B 1 185  ? -12.753 -0.444  -28.588 1.00 49.17  ?  173  LYS B CG    1 
ATOM   2989  C  CD    . LYS B 1 185  ? -12.189 -1.832  -28.332 1.00 48.05  ?  173  LYS B CD    1 
ATOM   2990  C  CE    . LYS B 1 185  ? -12.336 -2.234  -26.875 1.00 69.11  ?  173  LYS B CE    1 
ATOM   2991  N  NZ    . LYS B 1 185  ? -11.836 -3.616  -26.631 1.00 74.91  ?  173  LYS B NZ    1 
ATOM   2992  N  N     . VAL B 1 186  ? -13.197 3.084   -28.864 1.00 47.28  ?  174  VAL B N     1 
ATOM   2993  C  CA    . VAL B 1 186  ? -12.599 4.210   -28.158 1.00 43.13  ?  174  VAL B CA    1 
ATOM   2994  C  C     . VAL B 1 186  ? -12.844 4.033   -26.666 1.00 39.49  ?  174  VAL B C     1 
ATOM   2995  O  O     . VAL B 1 186  ? -13.984 3.821   -26.240 1.00 39.50  ?  174  VAL B O     1 
ATOM   2996  C  CB    . VAL B 1 186  ? -13.163 5.561   -28.642 1.00 40.94  ?  174  VAL B CB    1 
ATOM   2997  C  CG1   . VAL B 1 186  ? -12.736 6.681   -27.706 1.00 34.44  ?  174  VAL B CG1   1 
ATOM   2998  C  CG2   . VAL B 1 186  ? -12.695 5.852   -30.058 1.00 49.11  ?  174  VAL B CG2   1 
ATOM   2999  N  N     . THR B 1 187  ? -11.772 4.110   -25.878 1.00 47.94  ?  175  THR B N     1 
ATOM   3000  C  CA    . THR B 1 187  ? -11.847 4.061   -24.426 1.00 44.55  ?  175  THR B CA    1 
ATOM   3001  C  C     . THR B 1 187  ? -11.051 5.224   -23.852 1.00 42.41  ?  175  THR B C     1 
ATOM   3002  O  O     . THR B 1 187  ? -10.107 5.716   -24.476 1.00 41.96  ?  175  THR B O     1 
ATOM   3003  C  CB    . THR B 1 187  ? -11.307 2.735   -23.868 1.00 38.85  ?  175  THR B CB    1 
ATOM   3004  O  OG1   . THR B 1 187  ? -9.944  2.561   -24.274 1.00 42.05  ?  175  THR B OG1   1 
ATOM   3005  C  CG2   . THR B 1 187  ? -12.137 1.563   -24.374 1.00 53.27  ?  175  THR B CG2   1 
ATOM   3006  N  N     . TYR B 1 188  ? -11.436 5.663   -22.655 1.00 34.94  ?  176  TYR B N     1 
ATOM   3007  C  CA    . TYR B 1 188  ? -10.784 6.813   -22.047 1.00 40.38  ?  176  TYR B CA    1 
ATOM   3008  C  C     . TYR B 1 188  ? -10.727 6.641   -20.538 1.00 42.21  ?  176  TYR B C     1 
ATOM   3009  O  O     . TYR B 1 188  ? -11.635 6.074   -19.925 1.00 40.65  ?  176  TYR B O     1 
ATOM   3010  C  CB    . TYR B 1 188  ? -11.504 8.120   -22.400 1.00 37.46  ?  176  TYR B CB    1 
ATOM   3011  C  CG    . TYR B 1 188  ? -12.754 8.382   -21.591 1.00 35.97  ?  176  TYR B CG    1 
ATOM   3012  C  CD1   . TYR B 1 188  ? -13.925 7.676   -21.834 1.00 38.81  ?  176  TYR B CD1   1 
ATOM   3013  C  CD2   . TYR B 1 188  ? -12.766 9.345   -20.590 1.00 41.30  ?  176  TYR B CD2   1 
ATOM   3014  C  CE1   . TYR B 1 188  ? -15.070 7.916   -21.097 1.00 44.48  ?  176  TYR B CE1   1 
ATOM   3015  C  CE2   . TYR B 1 188  ? -13.906 9.593   -19.849 1.00 47.11  ?  176  TYR B CE2   1 
ATOM   3016  C  CZ    . TYR B 1 188  ? -15.054 8.876   -20.107 1.00 47.84  ?  176  TYR B CZ    1 
ATOM   3017  O  OH    . TYR B 1 188  ? -16.192 9.119   -19.372 1.00 50.69  ?  176  TYR B OH    1 
ATOM   3018  N  N     . LYS B 1 189  ? -9.641  7.139   -19.950 1.00 41.52  ?  177  LYS B N     1 
ATOM   3019  C  CA    . LYS B 1 189  ? -9.469  7.184   -18.507 1.00 49.88  ?  177  LYS B CA    1 
ATOM   3020  C  C     . LYS B 1 189  ? -8.782  8.493   -18.150 1.00 43.47  ?  177  LYS B C     1 
ATOM   3021  O  O     . LYS B 1 189  ? -8.157  9.138   -18.997 1.00 43.01  ?  177  LYS B O     1 
ATOM   3022  C  CB    . LYS B 1 189  ? -8.652  5.992   -17.988 1.00 53.70  ?  177  LYS B CB    1 
ATOM   3023  C  CG    . LYS B 1 189  ? -7.148  6.190   -18.083 1.00 58.97  ?  177  LYS B CG    1 
ATOM   3024  C  CD    . LYS B 1 189  ? -6.407  4.866   -18.019 1.00 84.88  ?  177  LYS B CD    1 
ATOM   3025  C  CE    . LYS B 1 189  ? -6.693  4.025   -19.254 1.00 107.89 ?  177  LYS B CE    1 
ATOM   3026  N  NZ    . LYS B 1 189  ? -5.915  2.755   -19.271 1.00 113.53 ?  177  LYS B NZ    1 
ATOM   3027  N  N     . VAL B 1 190  ? -8.906  8.886   -16.886 1.00 42.86  ?  178  VAL B N     1 
ATOM   3028  C  CA    . VAL B 1 190  ? -8.351  10.141  -16.393 1.00 43.11  ?  178  VAL B CA    1 
ATOM   3029  C  C     . VAL B 1 190  ? -7.422  9.836   -15.228 1.00 51.00  ?  178  VAL B C     1 
ATOM   3030  O  O     . VAL B 1 190  ? -7.796  9.105   -14.303 1.00 54.14  ?  178  VAL B O     1 
ATOM   3031  C  CB    . VAL B 1 190  ? -9.455  11.125  -15.964 1.00 40.32  ?  178  VAL B CB    1 
ATOM   3032  C  CG1   . VAL B 1 190  ? -8.856  12.486  -15.652 1.00 47.29  ?  178  VAL B CG1   1 
ATOM   3033  C  CG2   . VAL B 1 190  ? -10.523 11.236  -17.042 1.00 45.49  ?  178  VAL B CG2   1 
ATOM   3034  N  N     . ASP B 1 191  ? -6.216  10.393  -15.276 1.00 50.38  ?  179  ASP B N     1 
ATOM   3035  C  CA    . ASP B 1 191  ? -5.234  10.277  -14.211 1.00 55.00  ?  179  ASP B CA    1 
ATOM   3036  C  C     . ASP B 1 191  ? -5.021  11.642  -13.561 1.00 67.70  ?  179  ASP B C     1 
ATOM   3037  O  O     . ASP B 1 191  ? -5.798  12.583  -13.765 1.00 71.04  ?  179  ASP B O     1 
ATOM   3038  C  CB    . ASP B 1 191  ? -3.927  9.696   -14.757 1.00 67.18  ?  179  ASP B CB    1 
ATOM   3039  C  CG    . ASP B 1 191  ? -4.018  8.207   -15.028 1.00 79.08  ?  179  ASP B CG    1 
ATOM   3040  O  OD1   . ASP B 1 191  ? -5.073  7.609   -14.727 1.00 72.13  ?  179  ASP B OD1   1 
ATOM   3041  O  OD2   . ASP B 1 191  ? -3.034  7.634   -15.540 1.00 91.38  ?  179  ASP B OD2   1 
ATOM   3042  N  N     . ALA B 1 192  ? -3.956  11.752  -12.773 1.00 60.84  ?  180  ALA B N     1 
ATOM   3043  C  CA    . ALA B 1 192  ? -3.618  12.984  -12.080 1.00 58.41  ?  180  ALA B CA    1 
ATOM   3044  C  C     . ALA B 1 192  ? -2.211  13.426  -12.459 1.00 65.42  ?  180  ALA B C     1 
ATOM   3045  O  O     . ALA B 1 192  ? -1.332  12.600  -12.724 1.00 76.93  ?  180  ALA B O     1 
ATOM   3046  C  CB    . ALA B 1 192  ? -3.718  12.814  -10.559 1.00 71.63  ?  180  ALA B CB    1 
ATOM   3047  N  N     . THR B 1 193  ? -2.009  14.740  -12.486 1.00 72.39  ?  181  THR B N     1 
ATOM   3048  C  CA    . THR B 1 193  ? -0.699  15.308  -12.765 1.00 85.85  ?  181  THR B CA    1 
ATOM   3049  C  C     . THR B 1 193  ? -0.567  16.615  -11.997 1.00 90.05  ?  181  THR B C     1 
ATOM   3050  O  O     . THR B 1 193  ? -1.563  17.244  -11.631 1.00 90.71  ?  181  THR B O     1 
ATOM   3051  C  CB    . THR B 1 193  ? -0.484  15.535  -14.268 1.00 78.44  ?  181  THR B CB    1 
ATOM   3052  O  OG1   . THR B 1 193  ? 0.892   15.853  -14.514 1.00 84.92  ?  181  THR B OG1   1 
ATOM   3053  C  CG2   . THR B 1 193  ? -1.356  16.674  -14.768 1.00 68.76  ?  181  THR B CG2   1 
ATOM   3054  N  N     . ARG B 1 194  ? 0.678   17.012  -11.746 1.00 90.69  ?  182  ARG B N     1 
ATOM   3055  C  CA    . ARG B 1 194  ? 0.982   18.191  -10.943 1.00 96.08  ?  182  ARG B CA    1 
ATOM   3056  C  C     . ARG B 1 194  ? 1.588   19.265  -11.840 1.00 96.46  ?  182  ARG B C     1 
ATOM   3057  O  O     . ARG B 1 194  ? 2.679   19.081  -12.391 1.00 97.55  ?  182  ARG B O     1 
ATOM   3058  C  CB    . ARG B 1 194  ? 1.916   17.835  -9.787  1.00 104.51 ?  182  ARG B CB    1 
ATOM   3059  C  CG    . ARG B 1 194  ? 3.032   16.873  -10.153 1.00 107.01 ?  182  ARG B CG    1 
ATOM   3060  C  CD    . ARG B 1 194  ? 3.816   16.446  -8.924  1.00 91.21  ?  182  ARG B CD    1 
ATOM   3061  N  NE    . ARG B 1 194  ? 4.889   15.517  -9.265  1.00 88.62  ?  182  ARG B NE    1 
ATOM   3062  C  CZ    . ARG B 1 194  ? 6.132   15.887  -9.555  1.00 88.63  ?  182  ARG B CZ    1 
ATOM   3063  N  NH1   . ARG B 1 194  ? 6.464   17.170  -9.541  1.00 86.57  ?  182  ARG B NH1   1 
ATOM   3064  N  NH2   . ARG B 1 194  ? 7.044   14.973  -9.857  1.00 83.99  ?  182  ARG B NH2   1 
ATOM   3065  N  N     . VAL B 1 195  ? 0.875   20.382  -11.984 1.00 106.06 ?  183  VAL B N     1 
ATOM   3066  C  CA    . VAL B 1 195  ? 1.377   21.494  -12.785 1.00 115.42 ?  183  VAL B CA    1 
ATOM   3067  C  C     . VAL B 1 195  ? 2.362   22.334  -11.981 1.00 124.70 ?  183  VAL B C     1 
ATOM   3068  O  O     . VAL B 1 195  ? 3.463   22.644  -12.449 1.00 125.97 ?  183  VAL B O     1 
ATOM   3069  C  CB    . VAL B 1 195  ? 0.203   22.340  -13.316 1.00 98.28  ?  183  VAL B CB    1 
ATOM   3070  C  CG1   . VAL B 1 195  ? -0.849  22.544  -12.233 1.00 100.47 ?  183  VAL B CG1   1 
ATOM   3071  C  CG2   . VAL B 1 195  ? 0.704   23.679  -13.839 1.00 92.51  ?  183  VAL B CG2   1 
ATOM   3072  N  N     . GLU B 1 196  ? 1.985   22.708  -10.759 1.00 103.62 ?  184  GLU B N     1 
ATOM   3073  C  CA    . GLU B 1 196  ? 2.855   23.486  -9.887  1.00 100.64 ?  184  GLU B CA    1 
ATOM   3074  C  C     . GLU B 1 196  ? 2.962   22.799  -8.533  1.00 95.03  ?  184  GLU B C     1 
ATOM   3075  O  O     . GLU B 1 196  ? 3.920   22.062  -8.273  1.00 93.64  ?  184  GLU B O     1 
ATOM   3076  C  CB    . GLU B 1 196  ? 2.321   24.911  -9.726  1.00 100.48 ?  184  GLU B CB    1 
ATOM   3077  C  CG    . GLU B 1 196  ? 3.396   25.955  -9.480  1.00 106.72 ?  184  GLU B CG    1 
ATOM   3078  C  CD    . GLU B 1 196  ? 3.725   26.752  -10.727 1.00 108.15 ?  184  GLU B CD    1 
ATOM   3079  O  OE1   . GLU B 1 196  ? 3.696   27.999  -10.662 1.00 104.02 ?  184  GLU B OE1   1 
ATOM   3080  O  OE2   . GLU B 1 196  ? 4.001   26.132  -11.775 1.00 100.13 ?  184  GLU B OE2   1 
ATOM   3081  N  N     . GLN B 1 197  ? 1.980   23.039  -7.664  1.00 104.12 ?  185  GLN B N     1 
ATOM   3082  C  CA    . GLN B 1 197  ? 1.851   22.314  -6.410  1.00 108.26 ?  185  GLN B CA    1 
ATOM   3083  C  C     . GLN B 1 197  ? 0.554   21.527  -6.300  1.00 106.32 ?  185  GLN B C     1 
ATOM   3084  O  O     . GLN B 1 197  ? 0.484   20.602  -5.483  1.00 98.43  ?  185  GLN B O     1 
ATOM   3085  C  CB    . GLN B 1 197  ? 1.953   23.276  -5.215  1.00 104.21 ?  185  GLN B CB    1 
ATOM   3086  C  CG    . GLN B 1 197  ? 3.200   24.153  -5.217  1.00 105.88 ?  185  GLN B CG    1 
ATOM   3087  C  CD    . GLN B 1 197  ? 4.482   23.372  -4.984  1.00 95.88  ?  185  GLN B CD    1 
ATOM   3088  O  OE1   . GLN B 1 197  ? 4.454   22.190  -4.640  1.00 90.05  ?  185  GLN B OE1   1 
ATOM   3089  N  NE2   . GLN B 1 197  ? 5.618   24.036  -5.170  1.00 84.46  ?  185  GLN B NE2   1 
ATOM   3090  N  N     . ARG B 1 198  ? -0.464  21.867  -7.088  1.00 114.47 ?  186  ARG B N     1 
ATOM   3091  C  CA    . ARG B 1 198  ? -1.688  21.080  -7.132  1.00 105.51 ?  186  ARG B CA    1 
ATOM   3092  C  C     . ARG B 1 198  ? -1.403  19.720  -7.754  1.00 100.83 ?  186  ARG B C     1 
ATOM   3093  O  O     . ARG B 1 198  ? -0.737  19.631  -8.789  1.00 103.21 ?  186  ARG B O     1 
ATOM   3094  C  CB    . ARG B 1 198  ? -2.755  21.814  -7.941  1.00 100.98 ?  186  ARG B CB    1 
ATOM   3095  C  CG    . ARG B 1 198  ? -3.011  23.248  -7.502  1.00 88.11  ?  186  ARG B CG    1 
ATOM   3096  C  CD    . ARG B 1 198  ? -3.956  23.313  -6.312  1.00 88.39  ?  186  ARG B CD    1 
ATOM   3097  N  NE    . ARG B 1 198  ? -5.274  22.766  -6.627  1.00 95.57  ?  186  ARG B NE    1 
ATOM   3098  C  CZ    . ARG B 1 198  ? -5.683  21.551  -6.277  1.00 98.71  ?  186  ARG B CZ    1 
ATOM   3099  N  NH1   . ARG B 1 198  ? -4.877  20.750  -5.593  1.00 96.59  ?  186  ARG B NH1   1 
ATOM   3100  N  NH2   . ARG B 1 198  ? -6.897  21.136  -6.609  1.00 85.42  ?  186  ARG B NH2   1 
ATOM   3101  N  N     . THR B 1 199  ? -1.908  18.658  -7.129  1.00 95.09  ?  187  THR B N     1 
ATOM   3102  C  CA    . THR B 1 199  ? -1.682  17.300  -7.609  1.00 99.15  ?  187  THR B CA    1 
ATOM   3103  C  C     . THR B 1 199  ? -2.941  16.657  -8.176  1.00 94.02  ?  187  THR B C     1 
ATOM   3104  O  O     . THR B 1 199  ? -2.956  15.443  -8.406  1.00 89.88  ?  187  THR B O     1 
ATOM   3105  C  CB    . THR B 1 199  ? -1.114  16.425  -6.488  1.00 101.88 ?  187  THR B CB    1 
ATOM   3106  O  OG1   . THR B 1 199  ? -0.766  15.138  -7.014  1.00 102.70 ?  187  THR B OG1   1 
ATOM   3107  C  CG2   . THR B 1 199  ? -2.140  16.245  -5.387  1.00 89.20  ?  187  THR B CG2   1 
ATOM   3108  N  N     . ASP B 1 200  ? -3.995  17.437  -8.413  1.00 104.87 ?  188  ASP B N     1 
ATOM   3109  C  CA    . ASP B 1 200  ? -5.253  16.906  -8.921  1.00 105.54 ?  188  ASP B CA    1 
ATOM   3110  C  C     . ASP B 1 200  ? -5.585  17.401  -10.323 1.00 101.66 ?  188  ASP B C     1 
ATOM   3111  O  O     . ASP B 1 200  ? -6.687  17.135  -10.815 1.00 96.53  ?  188  ASP B O     1 
ATOM   3112  C  CB    . ASP B 1 200  ? -6.394  17.241  -7.959  1.00 106.38 ?  188  ASP B CB    1 
ATOM   3113  C  CG    . ASP B 1 200  ? -6.456  16.290  -6.781  1.00 118.53 ?  188  ASP B CG    1 
ATOM   3114  O  OD1   . ASP B 1 200  ? -5.468  16.216  -6.021  1.00 120.33 ?  188  ASP B OD1   1 
ATOM   3115  O  OD2   . ASP B 1 200  ? -7.494  15.614  -6.616  1.00 125.61 ?  188  ASP B OD2   1 
ATOM   3116  N  N     . PHE B 1 201  ? -4.669  18.116  -10.974 1.00 98.03  ?  189  PHE B N     1 
ATOM   3117  C  CA    . PHE B 1 201  ? -4.878  18.497  -12.365 1.00 81.71  ?  189  PHE B CA    1 
ATOM   3118  C  C     . PHE B 1 201  ? -4.954  17.247  -13.233 1.00 83.73  ?  189  PHE B C     1 
ATOM   3119  O  O     . PHE B 1 201  ? -4.127  16.339  -13.110 1.00 91.47  ?  189  PHE B O     1 
ATOM   3120  C  CB    . PHE B 1 201  ? -3.756  19.422  -12.838 1.00 75.47  ?  189  PHE B CB    1 
ATOM   3121  C  CG    . PHE B 1 201  ? -4.002  20.876  -12.538 1.00 81.47  ?  189  PHE B CG    1 
ATOM   3122  C  CD1   . PHE B 1 201  ? -4.116  21.320  -11.230 1.00 85.67  ?  189  PHE B CD1   1 
ATOM   3123  C  CD2   . PHE B 1 201  ? -4.113  21.800  -13.564 1.00 76.67  ?  189  PHE B CD2   1 
ATOM   3124  C  CE1   . PHE B 1 201  ? -4.343  22.657  -10.954 1.00 86.13  ?  189  PHE B CE1   1 
ATOM   3125  C  CE2   . PHE B 1 201  ? -4.338  23.137  -13.293 1.00 73.09  ?  189  PHE B CE2   1 
ATOM   3126  C  CZ    . PHE B 1 201  ? -4.453  23.566  -11.987 1.00 78.59  ?  189  PHE B CZ    1 
ATOM   3127  N  N     . ASP B 1 202  ? -5.957  17.200  -14.105 1.00 66.75  ?  190  ASP B N     1 
ATOM   3128  C  CA    . ASP B 1 202  ? -6.311  15.964  -14.785 1.00 63.01  ?  190  ASP B CA    1 
ATOM   3129  C  C     . ASP B 1 202  ? -5.460  15.735  -16.028 1.00 56.89  ?  190  ASP B C     1 
ATOM   3130  O  O     . ASP B 1 202  ? -5.108  16.676  -16.746 1.00 48.05  ?  190  ASP B O     1 
ATOM   3131  C  CB    . ASP B 1 202  ? -7.790  15.976  -15.170 1.00 61.30  ?  190  ASP B CB    1 
ATOM   3132  C  CG    . ASP B 1 202  ? -8.706  15.856  -13.968 1.00 67.17  ?  190  ASP B CG    1 
ATOM   3133  O  OD1   . ASP B 1 202  ? -8.195  15.765  -12.833 1.00 78.18  ?  190  ASP B OD1   1 
ATOM   3134  O  OD2   . ASP B 1 202  ? -9.940  15.848  -14.161 1.00 59.43  ?  190  ASP B OD2   1 
ATOM   3135  N  N     . LYS B 1 203  ? -5.129  14.468  -16.270 1.00 47.53  ?  191  LYS B N     1 
ATOM   3136  C  CA    . LYS B 1 203  ? -4.508  14.021  -17.510 1.00 47.47  ?  191  LYS B CA    1 
ATOM   3137  C  C     . LYS B 1 203  ? -5.460  13.043  -18.181 1.00 48.45  ?  191  LYS B C     1 
ATOM   3138  O  O     . LYS B 1 203  ? -5.758  11.982  -17.622 1.00 50.60  ?  191  LYS B O     1 
ATOM   3139  C  CB    . LYS B 1 203  ? -3.151  13.362  -17.253 1.00 52.10  ?  191  LYS B CB    1 
ATOM   3140  C  CG    . LYS B 1 203  ? -2.457  12.876  -18.518 1.00 53.37  ?  191  LYS B CG    1 
ATOM   3141  C  CD    . LYS B 1 203  ? -1.151  12.159  -18.211 1.00 53.78  ?  191  LYS B CD    1 
ATOM   3142  C  CE    . LYS B 1 203  ? -1.393  10.826  -17.524 1.00 55.80  ?  191  LYS B CE    1 
ATOM   3143  N  NZ    . LYS B 1 203  ? -0.119  10.092  -17.286 1.00 64.88  ?  191  LYS B NZ    1 
ATOM   3144  N  N     . LEU B 1 204  ? -5.941  13.403  -19.367 1.00 46.34  ?  192  LEU B N     1 
ATOM   3145  C  CA    . LEU B 1 204  ? -6.895  12.586  -20.106 1.00 41.35  ?  192  LEU B CA    1 
ATOM   3146  C  C     . LEU B 1 204  ? -6.154  11.710  -21.106 1.00 36.96  ?  192  LEU B C     1 
ATOM   3147  O  O     . LEU B 1 204  ? -5.267  12.189  -21.820 1.00 36.13  ?  192  LEU B O     1 
ATOM   3148  C  CB    . LEU B 1 204  ? -7.920  13.463  -20.827 1.00 37.02  ?  192  LEU B CB    1 
ATOM   3149  C  CG    . LEU B 1 204  ? -9.003  12.714  -21.604 1.00 32.95  ?  192  LEU B CG    1 
ATOM   3150  C  CD1   . LEU B 1 204  ? -9.711  11.713  -20.706 1.00 34.41  ?  192  LEU B CD1   1 
ATOM   3151  C  CD2   . LEU B 1 204  ? -10.000 13.688  -22.205 1.00 23.31  ?  192  LEU B CD2   1 
ATOM   3152  N  N     . ILE B 1 205  ? -6.522  10.433  -21.157 1.00 33.20  ?  193  ILE B N     1 
ATOM   3153  C  CA    . ILE B 1 205  ? -5.897  9.457   -22.042 1.00 33.68  ?  193  ILE B CA    1 
ATOM   3154  C  C     . ILE B 1 205  ? -6.975  8.899   -22.962 1.00 44.43  ?  193  ILE B C     1 
ATOM   3155  O  O     . ILE B 1 205  ? -7.944  8.292   -22.492 1.00 44.35  ?  193  ILE B O     1 
ATOM   3156  C  CB    . ILE B 1 205  ? -5.211  8.329   -21.255 1.00 40.42  ?  193  ILE B CB    1 
ATOM   3157  C  CG1   . ILE B 1 205  ? -4.198  8.909   -20.266 1.00 46.83  ?  193  ILE B CG1   1 
ATOM   3158  C  CG2   . ILE B 1 205  ? -4.532  7.354   -22.201 1.00 38.65  ?  193  ILE B CG2   1 
ATOM   3159  C  CD1   . ILE B 1 205  ? -3.528  7.866   -19.400 1.00 53.14  ?  193  ILE B CD1   1 
ATOM   3160  N  N     . LEU B 1 206  ? -6.807  9.104   -24.266 1.00 40.80  ?  194  LEU B N     1 
ATOM   3161  C  CA    . LEU B 1 206  ? -7.746  8.626   -25.272 1.00 29.51  ?  194  LEU B CA    1 
ATOM   3162  C  C     . LEU B 1 206  ? -7.100  7.524   -26.100 1.00 33.99  ?  194  LEU B C     1 
ATOM   3163  O  O     . LEU B 1 206  ? -6.027  7.725   -26.678 1.00 38.91  ?  194  LEU B O     1 
ATOM   3164  C  CB    . LEU B 1 206  ? -8.207  9.764   -26.183 1.00 26.26  ?  194  LEU B CB    1 
ATOM   3165  C  CG    . LEU B 1 206  ? -9.463  10.520  -25.747 1.00 23.54  ?  194  LEU B CG    1 
ATOM   3166  C  CD1   . LEU B 1 206  ? -9.786  11.623  -26.738 1.00 26.05  ?  194  LEU B CD1   1 
ATOM   3167  C  CD2   . LEU B 1 206  ? -10.634 9.562   -25.612 1.00 25.65  ?  194  LEU B CD2   1 
ATOM   3168  N  N     . ASP B 1 207  ? -7.758  6.368   -26.155 1.00 39.40  ?  195  ASP B N     1 
ATOM   3169  C  CA    . ASP B 1 207  ? -7.322  5.229   -26.958 1.00 46.82  ?  195  ASP B CA    1 
ATOM   3170  C  C     . ASP B 1 207  ? -8.367  4.997   -28.041 1.00 51.99  ?  195  ASP B C     1 
ATOM   3171  O  O     . ASP B 1 207  ? -9.462  4.503   -27.754 1.00 53.79  ?  195  ASP B O     1 
ATOM   3172  C  CB    . ASP B 1 207  ? -7.140  3.984   -26.088 1.00 47.39  ?  195  ASP B CB    1 
ATOM   3173  C  CG    . ASP B 1 207  ? -6.527  2.817   -26.846 1.00 55.29  ?  195  ASP B CG    1 
ATOM   3174  O  OD1   . ASP B 1 207  ? -7.054  2.436   -27.914 1.00 59.90  ?  195  ASP B OD1   1 
ATOM   3175  O  OD2   . ASP B 1 207  ? -5.510  2.276   -26.367 1.00 62.53  ?  195  ASP B OD2   1 
ATOM   3176  N  N     . VAL B 1 208  ? -8.030  5.344   -29.280 1.00 52.85  ?  196  VAL B N     1 
ATOM   3177  C  CA    . VAL B 1 208  ? -8.954  5.245   -30.404 1.00 48.11  ?  196  VAL B CA    1 
ATOM   3178  C  C     . VAL B 1 208  ? -8.390  4.254   -31.412 1.00 52.96  ?  196  VAL B C     1 
ATOM   3179  O  O     . VAL B 1 208  ? -7.254  4.408   -31.879 1.00 51.03  ?  196  VAL B O     1 
ATOM   3180  C  CB    . VAL B 1 208  ? -9.206  6.614   -31.057 1.00 41.21  ?  196  VAL B CB    1 
ATOM   3181  C  CG1   . VAL B 1 208  ? -7.909  7.398   -31.170 1.00 48.45  ?  196  VAL B CG1   1 
ATOM   3182  C  CG2   . VAL B 1 208  ? -9.848  6.440   -32.426 1.00 49.10  ?  196  VAL B CG2   1 
ATOM   3183  N  N     . GLU B 1 209  ? -9.178  3.233   -31.737 1.00 68.16  ?  197  GLU B N     1 
ATOM   3184  C  CA    . GLU B 1 209  ? -8.864  2.290   -32.801 1.00 60.98  ?  197  GLU B CA    1 
ATOM   3185  C  C     . GLU B 1 209  ? -9.832  2.521   -33.952 1.00 59.80  ?  197  GLU B C     1 
ATOM   3186  O  O     . GLU B 1 209  ? -11.050 2.541   -33.748 1.00 65.30  ?  197  GLU B O     1 
ATOM   3187  C  CB    . GLU B 1 209  ? -8.953  0.844   -32.307 1.00 66.58  ?  197  GLU B CB    1 
ATOM   3188  C  CG    . GLU B 1 209  ? -8.739  -0.198  -33.394 1.00 71.52  ?  197  GLU B CG    1 
ATOM   3189  C  CD    . GLU B 1 209  ? -8.791  -1.617  -32.861 1.00 88.40  ?  197  GLU B CD    1 
ATOM   3190  O  OE1   . GLU B 1 209  ? -8.647  -1.797  -31.633 1.00 88.19  ?  197  GLU B OE1   1 
ATOM   3191  O  OE2   . GLU B 1 209  ? -8.978  -2.552  -33.668 1.00 84.54  ?  197  GLU B OE2   1 
ATOM   3192  N  N     . THR B 1 210  ? -9.291  2.700   -35.153 1.00 61.90  ?  198  THR B N     1 
ATOM   3193  C  CA    . THR B 1 210  ? -10.084 3.075   -36.311 1.00 58.42  ?  198  THR B CA    1 
ATOM   3194  C  C     . THR B 1 210  ? -9.838  2.101   -37.453 1.00 59.51  ?  198  THR B C     1 
ATOM   3195  O  O     . THR B 1 210  ? -8.908  1.290   -37.426 1.00 62.13  ?  198  THR B O     1 
ATOM   3196  C  CB    . THR B 1 210  ? -9.760  4.504   -36.770 1.00 52.61  ?  198  THR B CB    1 
ATOM   3197  O  OG1   . THR B 1 210  ? -10.525 4.817   -37.940 1.00 60.19  ?  198  THR B OG1   1 
ATOM   3198  C  CG2   . THR B 1 210  ? -8.280  4.631   -37.092 1.00 54.31  ?  198  THR B CG2   1 
ATOM   3199  N  N     . LYS B 1 211  ? -10.697 2.189   -38.464 1.00 60.32  ?  199  LYS B N     1 
ATOM   3200  C  CA    . LYS B 1 211  ? -10.480 1.477   -39.710 1.00 54.94  ?  199  LYS B CA    1 
ATOM   3201  C  C     . LYS B 1 211  ? -9.428  2.204   -40.544 1.00 62.39  ?  199  LYS B C     1 
ATOM   3202  O  O     . LYS B 1 211  ? -8.998  3.315   -40.222 1.00 66.19  ?  199  LYS B O     1 
ATOM   3203  C  CB    . LYS B 1 211  ? -11.791 1.340   -40.485 1.00 44.05  ?  199  LYS B CB    1 
ATOM   3204  C  CG    . LYS B 1 211  ? -12.840 0.499   -39.771 1.00 58.91  ?  199  LYS B CG    1 
ATOM   3205  C  CD    . LYS B 1 211  ? -14.151 0.413   -40.542 1.00 55.05  ?  199  LYS B CD    1 
ATOM   3206  C  CE    . LYS B 1 211  ? -14.877 1.744   -40.581 1.00 50.59  ?  199  LYS B CE    1 
ATOM   3207  N  NZ    . LYS B 1 211  ? -16.211 1.633   -41.238 1.00 34.16  ?  199  LYS B NZ    1 
ATOM   3208  N  N     . ASN B 1 212  ? -9.007  1.563   -41.630 1.00 55.87  ?  200  ASN B N     1 
ATOM   3209  C  CA    . ASN B 1 212  ? -8.023  2.159   -42.524 1.00 50.87  ?  200  ASN B CA    1 
ATOM   3210  C  C     . ASN B 1 212  ? -8.618  3.230   -43.433 1.00 45.33  ?  200  ASN B C     1 
ATOM   3211  O  O     . ASN B 1 212  ? -7.919  3.720   -44.326 1.00 45.70  ?  200  ASN B O     1 
ATOM   3212  C  CB    . ASN B 1 212  ? -7.346  1.071   -43.361 1.00 47.46  ?  200  ASN B CB    1 
ATOM   3213  C  CG    . ASN B 1 212  ? -8.297  -0.039  -43.752 1.00 60.53  ?  200  ASN B CG    1 
ATOM   3214  O  OD1   . ASN B 1 212  ? -9.512  0.156   -43.799 1.00 64.11  ?  200  ASN B OD1   1 
ATOM   3215  N  ND2   . ASN B 1 212  ? -7.749  -1.217  -44.028 1.00 60.53  ?  200  ASN B ND2   1 
ATOM   3216  N  N     . SER B 1 213  ? -9.884  3.601   -43.226 1.00 48.60  ?  201  SER B N     1 
ATOM   3217  C  CA    . SER B 1 213  ? -10.468 4.699   -43.989 1.00 47.98  ?  201  SER B CA    1 
ATOM   3218  C  C     . SER B 1 213  ? -9.792  6.021   -43.649 1.00 52.47  ?  201  SER B C     1 
ATOM   3219  O  O     . SER B 1 213  ? -9.496  6.823   -44.542 1.00 48.92  ?  201  SER B O     1 
ATOM   3220  C  CB    . SER B 1 213  ? -11.971 4.780   -43.725 1.00 44.43  ?  201  SER B CB    1 
ATOM   3221  O  OG    . SER B 1 213  ? -12.598 3.530   -43.954 1.00 44.33  ?  201  SER B OG    1 
ATOM   3222  N  N     . ILE B 1 214  ? -9.539  6.264   -42.361 1.00 52.97  ?  202  ILE B N     1 
ATOM   3223  C  CA    . ILE B 1 214  ? -8.831  7.451   -41.901 1.00 55.64  ?  202  ILE B CA    1 
ATOM   3224  C  C     . ILE B 1 214  ? -7.958  7.072   -40.712 1.00 51.02  ?  202  ILE B C     1 
ATOM   3225  O  O     . ILE B 1 214  ? -8.183  6.063   -40.041 1.00 49.59  ?  202  ILE B O     1 
ATOM   3226  C  CB    . ILE B 1 214  ? -9.789  8.607   -41.523 1.00 54.82  ?  202  ILE B CB    1 
ATOM   3227  C  CG1   . ILE B 1 214  ? -11.078 8.067   -40.894 1.00 42.07  ?  202  ILE B CG1   1 
ATOM   3228  C  CG2   . ILE B 1 214  ? -10.094 9.472   -42.738 1.00 60.93  ?  202  ILE B CG2   1 
ATOM   3229  C  CD1   . ILE B 1 214  ? -10.969 7.754   -39.415 1.00 45.02  ?  202  ILE B CD1   1 
ATOM   3230  N  N     . SER B 1 215  ? -6.951  7.900   -40.460 1.00 67.16  ?  203  SER B N     1 
ATOM   3231  C  CA    . SER B 1 215  ? -6.041  7.683   -39.349 1.00 65.00  ?  203  SER B CA    1 
ATOM   3232  C  C     . SER B 1 215  ? -6.654  8.197   -38.049 1.00 62.10  ?  203  SER B C     1 
ATOM   3233  O  O     . SER B 1 215  ? -7.589  9.001   -38.069 1.00 58.96  ?  203  SER B O     1 
ATOM   3234  C  CB    . SER B 1 215  ? -4.712  8.381   -39.623 1.00 68.72  ?  203  SER B CB    1 
ATOM   3235  O  OG    . SER B 1 215  ? -4.893  9.774   -39.802 1.00 72.44  ?  203  SER B OG    1 
ATOM   3236  N  N     . PRO B 1 216  ? -6.154  7.735   -36.898 1.00 54.21  ?  204  PRO B N     1 
ATOM   3237  C  CA    . PRO B 1 216  ? -6.672  8.259   -35.622 1.00 52.44  ?  204  PRO B CA    1 
ATOM   3238  C  C     . PRO B 1 216  ? -6.476  9.756   -35.461 1.00 46.18  ?  204  PRO B C     1 
ATOM   3239  O  O     . PRO B 1 216  ? -7.241  10.395  -34.728 1.00 44.60  ?  204  PRO B O     1 
ATOM   3240  C  CB    . PRO B 1 216  ? -5.877  7.471   -34.572 1.00 56.51  ?  204  PRO B CB    1 
ATOM   3241  C  CG    . PRO B 1 216  ? -5.465  6.223   -35.268 1.00 52.75  ?  204  PRO B CG    1 
ATOM   3242  C  CD    . PRO B 1 216  ? -5.214  6.619   -36.692 1.00 58.90  ?  204  PRO B CD    1 
ATOM   3243  N  N     . ARG B 1 217  ? -5.472  10.333  -36.125 1.00 46.54  ?  205  ARG B N     1 
ATOM   3244  C  CA    . ARG B 1 217  ? -5.252  11.774  -36.042 1.00 41.83  ?  205  ARG B CA    1 
ATOM   3245  C  C     . ARG B 1 217  ? -6.443  12.543  -36.599 1.00 49.22  ?  205  ARG B C     1 
ATOM   3246  O  O     . ARG B 1 217  ? -7.018  13.402  -35.921 1.00 46.11  ?  205  ARG B O     1 
ATOM   3247  C  CB    . ARG B 1 217  ? -3.980  12.154  -36.798 1.00 49.61  ?  205  ARG B CB    1 
ATOM   3248  C  CG    . ARG B 1 217  ? -2.761  11.330  -36.442 1.00 56.86  ?  205  ARG B CG    1 
ATOM   3249  C  CD    . ARG B 1 217  ? -1.613  11.631  -37.392 1.00 66.97  ?  205  ARG B CD    1 
ATOM   3250  N  NE    . ARG B 1 217  ? -0.368  10.991  -36.980 1.00 82.86  ?  205  ARG B NE    1 
ATOM   3251  C  CZ    . ARG B 1 217  ? -0.033  9.741   -37.281 1.00 86.29  ?  205  ARG B CZ    1 
ATOM   3252  N  NH1   . ARG B 1 217  ? 1.124   9.246   -36.866 1.00 86.74  ?  205  ARG B NH1   1 
ATOM   3253  N  NH2   . ARG B 1 217  ? -0.857  8.984   -37.993 1.00 75.81  ?  205  ARG B NH2   1 
ATOM   3254  N  N     . ASP B 1 218  ? -6.826  12.245  -37.843 1.00 54.40  ?  206  ASP B N     1 
ATOM   3255  C  CA    . ASP B 1 218  ? -7.904  12.985  -38.488 1.00 54.22  ?  206  ASP B CA    1 
ATOM   3256  C  C     . ASP B 1 218  ? -9.253  12.700  -37.843 1.00 50.50  ?  206  ASP B C     1 
ATOM   3257  O  O     . ASP B 1 218  ? -10.131 13.571  -37.839 1.00 47.99  ?  206  ASP B O     1 
ATOM   3258  C  CB    . ASP B 1 218  ? -7.945  12.654  -39.980 1.00 53.25  ?  206  ASP B CB    1 
ATOM   3259  C  CG    . ASP B 1 218  ? -6.649  12.995  -40.687 1.00 56.76  ?  206  ASP B CG    1 
ATOM   3260  O  OD1   . ASP B 1 218  ? -5.649  12.276  -40.480 1.00 47.61  ?  206  ASP B OD1   1 
ATOM   3261  O  OD2   . ASP B 1 218  ? -6.629  13.985  -41.449 1.00 70.10  ?  206  ASP B OD2   1 
ATOM   3262  N  N     . ALA B 1 219  ? -9.441  11.493  -37.302 1.00 41.29  ?  207  ALA B N     1 
ATOM   3263  C  CA    . ALA B 1 219  ? -10.684 11.184  -36.604 1.00 37.93  ?  207  ALA B CA    1 
ATOM   3264  C  C     . ALA B 1 219  ? -10.861 12.075  -35.382 1.00 42.48  ?  207  ALA B C     1 
ATOM   3265  O  O     . ALA B 1 219  ? -11.947 12.617  -35.150 1.00 41.94  ?  207  ALA B O     1 
ATOM   3266  C  CB    . ALA B 1 219  ? -10.712 9.709   -36.206 1.00 39.54  ?  207  ALA B CB    1 
ATOM   3267  N  N     . LEU B 1 220  ? -9.798  12.243  -34.591 1.00 41.23  ?  208  LEU B N     1 
ATOM   3268  C  CA    . LEU B 1 220  ? -9.867  13.127  -33.433 1.00 40.17  ?  208  LEU B CA    1 
ATOM   3269  C  C     . LEU B 1 220  ? -10.036 14.582  -33.856 1.00 41.72  ?  208  LEU B C     1 
ATOM   3270  O  O     . LEU B 1 220  ? -10.791 15.332  -33.228 1.00 41.71  ?  208  LEU B O     1 
ATOM   3271  C  CB    . LEU B 1 220  ? -8.617  12.959  -32.571 1.00 42.92  ?  208  LEU B CB    1 
ATOM   3272  C  CG    . LEU B 1 220  ? -8.519  13.856  -31.337 1.00 40.56  ?  208  LEU B CG    1 
ATOM   3273  C  CD1   . LEU B 1 220  ? -9.705  13.629  -30.413 1.00 35.06  ?  208  LEU B CD1   1 
ATOM   3274  C  CD2   . LEU B 1 220  ? -7.211  13.618  -30.602 1.00 29.21  ?  208  LEU B CD2   1 
ATOM   3275  N  N     . ALA B 1 221  ? -9.339  14.999  -34.918 1.00 46.65  ?  209  ALA B N     1 
ATOM   3276  C  CA    . ALA B 1 221  ? -9.496  16.362  -35.411 1.00 45.69  ?  209  ALA B CA    1 
ATOM   3277  C  C     . ALA B 1 221  ? -10.896 16.592  -35.965 1.00 47.67  ?  209  ALA B C     1 
ATOM   3278  O  O     . ALA B 1 221  ? -11.436 17.700  -35.855 1.00 44.52  ?  209  ALA B O     1 
ATOM   3279  C  CB    . ALA B 1 221  ? -8.440  16.663  -36.475 1.00 51.05  ?  209  ALA B CB    1 
ATOM   3280  N  N     . SER B 1 222  ? -11.501 15.559  -36.558 1.00 47.65  ?  210  SER B N     1 
ATOM   3281  C  CA    . SER B 1 222  ? -12.880 15.669  -37.022 1.00 52.85  ?  210  SER B CA    1 
ATOM   3282  C  C     . SER B 1 222  ? -13.837 15.872  -35.856 1.00 51.40  ?  210  SER B C     1 
ATOM   3283  O  O     . SER B 1 222  ? -14.784 16.662  -35.952 1.00 46.56  ?  210  SER B O     1 
ATOM   3284  C  CB    . SER B 1 222  ? -13.267 14.424  -37.819 1.00 51.62  ?  210  SER B CB    1 
ATOM   3285  O  OG    . SER B 1 222  ? -14.674 14.342  -37.981 1.00 54.47  ?  210  SER B OG    1 
ATOM   3286  N  N     . ALA B 1 223  ? -13.609 15.164  -34.747 1.00 50.92  ?  211  ALA B N     1 
ATOM   3287  C  CA    . ALA B 1 223  ? -14.470 15.319  -33.581 1.00 46.56  ?  211  ALA B CA    1 
ATOM   3288  C  C     . ALA B 1 223  ? -14.304 16.689  -32.938 1.00 43.67  ?  211  ALA B C     1 
ATOM   3289  O  O     . ALA B 1 223  ? -15.254 17.212  -32.345 1.00 40.72  ?  211  ALA B O     1 
ATOM   3290  C  CB    . ALA B 1 223  ? -14.179 14.217  -32.563 1.00 35.40  ?  211  ALA B CB    1 
ATOM   3291  N  N     . GLY B 1 224  ? -13.115 17.284  -33.045 1.00 38.05  ?  212  GLY B N     1 
ATOM   3292  C  CA    . GLY B 1 224  ? -12.903 18.596  -32.458 1.00 42.71  ?  212  GLY B CA    1 
ATOM   3293  C  C     . GLY B 1 224  ? -13.671 19.690  -33.174 1.00 43.50  ?  212  GLY B C     1 
ATOM   3294  O  O     . GLY B 1 224  ? -14.246 20.575  -32.535 1.00 44.31  ?  212  GLY B O     1 
ATOM   3295  N  N     . LYS B 1 225  ? -13.697 19.643  -34.508 1.00 59.69  ?  213  LYS B N     1 
ATOM   3296  C  CA    . LYS B 1 225  ? -14.407 20.663  -35.272 1.00 66.38  ?  213  LYS B CA    1 
ATOM   3297  C  C     . LYS B 1 225  ? -15.907 20.604  -35.005 1.00 60.72  ?  213  LYS B C     1 
ATOM   3298  O  O     . LYS B 1 225  ? -16.548 21.633  -34.760 1.00 59.97  ?  213  LYS B O     1 
ATOM   3299  C  CB    . LYS B 1 225  ? -14.119 20.494  -36.764 1.00 72.44  ?  213  LYS B CB    1 
ATOM   3300  C  CG    . LYS B 1 225  ? -14.804 21.525  -37.646 1.00 74.31  ?  213  LYS B CG    1 
ATOM   3301  C  CD    . LYS B 1 225  ? -14.816 21.086  -39.100 1.00 79.75  ?  213  LYS B CD    1 
ATOM   3302  C  CE    . LYS B 1 225  ? -13.415 20.762  -39.592 1.00 93.25  ?  213  LYS B CE    1 
ATOM   3303  N  NZ    . LYS B 1 225  ? -13.425 20.255  -40.991 1.00 90.13  ?  213  LYS B NZ    1 
ATOM   3304  N  N     . THR B 1 226  ? -16.484 19.400  -35.045 1.00 47.80  ?  214  THR B N     1 
ATOM   3305  C  CA    . THR B 1 226  ? -17.914 19.245  -34.798 1.00 50.84  ?  214  THR B CA    1 
ATOM   3306  C  C     . THR B 1 226  ? -18.298 19.612  -33.370 1.00 43.22  ?  214  THR B C     1 
ATOM   3307  O  O     . THR B 1 226  ? -19.452 19.978  -33.126 1.00 47.74  ?  214  THR B O     1 
ATOM   3308  C  CB    . THR B 1 226  ? -18.351 17.809  -35.101 1.00 50.94  ?  214  THR B CB    1 
ATOM   3309  O  OG1   . THR B 1 226  ? -17.647 16.906  -34.241 1.00 50.62  ?  214  THR B OG1   1 
ATOM   3310  C  CG2   . THR B 1 226  ? -18.051 17.450  -36.553 1.00 54.01  ?  214  THR B CG2   1 
ATOM   3311  N  N     . LEU B 1 227  ? -17.361 19.524  -32.426 1.00 50.95  ?  215  LEU B N     1 
ATOM   3312  C  CA    . LEU B 1 227  ? -17.660 19.903  -31.050 1.00 49.84  ?  215  LEU B CA    1 
ATOM   3313  C  C     . LEU B 1 227  ? -17.515 21.404  -30.837 1.00 46.11  ?  215  LEU B C     1 
ATOM   3314  O  O     . LEU B 1 227  ? -18.301 22.005  -30.096 1.00 44.83  ?  215  LEU B O     1 
ATOM   3315  C  CB    . LEU B 1 227  ? -16.760 19.135  -30.083 1.00 39.06  ?  215  LEU B CB    1 
ATOM   3316  C  CG    . LEU B 1 227  ? -17.226 17.714  -29.760 1.00 34.94  ?  215  LEU B CG    1 
ATOM   3317  C  CD1   . LEU B 1 227  ? -16.121 16.906  -29.099 1.00 30.94  ?  215  LEU B CD1   1 
ATOM   3318  C  CD2   . LEU B 1 227  ? -18.461 17.754  -28.875 1.00 35.73  ?  215  LEU B CD2   1 
ATOM   3319  N  N     . VAL B 1 228  ? -16.515 22.025  -31.468 1.00 42.72  ?  216  VAL B N     1 
ATOM   3320  C  CA    . VAL B 1 228  ? -16.388 23.479  -31.398 1.00 39.07  ?  216  VAL B CA    1 
ATOM   3321  C  C     . VAL B 1 228  ? -17.600 24.145  -32.037 1.00 51.92  ?  216  VAL B C     1 
ATOM   3322  O  O     . VAL B 1 228  ? -18.108 25.157  -31.539 1.00 49.99  ?  216  VAL B O     1 
ATOM   3323  C  CB    . VAL B 1 228  ? -15.070 23.934  -32.055 1.00 35.30  ?  216  VAL B CB    1 
ATOM   3324  C  CG1   . VAL B 1 228  ? -15.034 25.447  -32.195 1.00 44.27  ?  216  VAL B CG1   1 
ATOM   3325  C  CG2   . VAL B 1 228  ? -13.881 23.453  -31.238 1.00 41.93  ?  216  VAL B CG2   1 
ATOM   3326  N  N     . GLU B 1 229  ? -18.092 23.579  -33.143 1.00 58.76  ?  217  GLU B N     1 
ATOM   3327  C  CA    . GLU B 1 229  ? -19.326 24.078  -33.742 1.00 62.01  ?  217  GLU B CA    1 
ATOM   3328  C  C     . GLU B 1 229  ? -20.511 23.880  -32.806 1.00 59.49  ?  217  GLU B C     1 
ATOM   3329  O  O     . GLU B 1 229  ? -21.396 24.739  -32.722 1.00 58.45  ?  217  GLU B O     1 
ATOM   3330  C  CB    . GLU B 1 229  ? -19.584 23.381  -35.078 1.00 66.02  ?  217  GLU B CB    1 
ATOM   3331  C  CG    . GLU B 1 229  ? -18.641 23.785  -36.196 1.00 81.23  ?  217  GLU B CG    1 
ATOM   3332  C  CD    . GLU B 1 229  ? -18.960 23.084  -37.503 1.00 95.15  ?  217  GLU B CD    1 
ATOM   3333  O  OE1   . GLU B 1 229  ? -19.219 21.862  -37.477 1.00 86.83  ?  217  GLU B OE1   1 
ATOM   3334  O  OE2   . GLU B 1 229  ? -18.962 23.757  -38.555 1.00 97.53  ?  217  GLU B OE2   1 
ATOM   3335  N  N     . LEU B 1 230  ? -20.546 22.750  -32.097 1.00 37.71  ?  218  LEU B N     1 
ATOM   3336  C  CA    . LEU B 1 230  ? -21.661 22.464  -31.200 1.00 38.52  ?  218  LEU B CA    1 
ATOM   3337  C  C     . LEU B 1 230  ? -21.707 23.462  -30.050 1.00 38.75  ?  218  LEU B C     1 
ATOM   3338  O  O     . LEU B 1 230  ? -22.715 24.148  -29.843 1.00 40.97  ?  218  LEU B O     1 
ATOM   3339  C  CB    . LEU B 1 230  ? -21.552 21.033  -30.674 1.00 37.05  ?  218  LEU B CB    1 
ATOM   3340  C  CG    . LEU B 1 230  ? -22.676 20.089  -31.095 1.00 44.27  ?  218  LEU B CG    1 
ATOM   3341  C  CD1   . LEU B 1 230  ? -22.366 18.674  -30.646 1.00 43.75  ?  218  LEU B CD1   1 
ATOM   3342  C  CD2   . LEU B 1 230  ? -24.007 20.559  -30.528 1.00 36.42  ?  218  LEU B CD2   1 
ATOM   3343  N  N     . PHE B 1 231  ? -20.618 23.557  -29.287 1.00 48.13  ?  219  PHE B N     1 
ATOM   3344  C  CA    . PHE B 1 231  ? -20.558 24.524  -28.199 1.00 41.55  ?  219  PHE B CA    1 
ATOM   3345  C  C     . PHE B 1 231  ? -20.470 25.958  -28.696 1.00 48.89  ?  219  PHE B C     1 
ATOM   3346  O  O     . PHE B 1 231  ? -20.643 26.885  -27.897 1.00 46.59  ?  219  PHE B O     1 
ATOM   3347  C  CB    . PHE B 1 231  ? -19.375 24.209  -27.282 1.00 40.34  ?  219  PHE B CB    1 
ATOM   3348  C  CG    . PHE B 1 231  ? -19.485 22.878  -26.597 1.00 37.13  ?  219  PHE B CG    1 
ATOM   3349  C  CD1   . PHE B 1 231  ? -20.391 22.688  -25.567 1.00 34.82  ?  219  PHE B CD1   1 
ATOM   3350  C  CD2   . PHE B 1 231  ? -18.686 21.815  -26.984 1.00 36.79  ?  219  PHE B CD2   1 
ATOM   3351  C  CE1   . PHE B 1 231  ? -20.500 21.463  -24.937 1.00 27.39  ?  219  PHE B CE1   1 
ATOM   3352  C  CE2   . PHE B 1 231  ? -18.790 20.589  -26.357 1.00 33.86  ?  219  PHE B CE2   1 
ATOM   3353  C  CZ    . PHE B 1 231  ? -19.696 20.414  -25.330 1.00 29.83  ?  219  PHE B CZ    1 
ATOM   3354  N  N     . GLY B 1 232  ? -20.201 26.164  -29.987 1.00 56.67  ?  220  GLY B N     1 
ATOM   3355  C  CA    . GLY B 1 232  ? -20.277 27.503  -30.542 1.00 55.07  ?  220  GLY B CA    1 
ATOM   3356  C  C     . GLY B 1 232  ? -21.681 28.068  -30.506 1.00 55.88  ?  220  GLY B C     1 
ATOM   3357  O  O     . GLY B 1 232  ? -21.862 29.286  -30.429 1.00 50.98  ?  220  GLY B O     1 
ATOM   3358  N  N     . LEU B 1 233  ? -22.693 27.196  -30.556 1.00 57.50  ?  221  LEU B N     1 
ATOM   3359  C  CA    . LEU B 1 233  ? -24.074 27.654  -30.442 1.00 57.76  ?  221  LEU B CA    1 
ATOM   3360  C  C     . LEU B 1 233  ? -24.313 28.348  -29.108 1.00 55.08  ?  221  LEU B C     1 
ATOM   3361  O  O     . LEU B 1 233  ? -25.032 29.352  -29.040 1.00 60.36  ?  221  LEU B O     1 
ATOM   3362  C  CB    . LEU B 1 233  ? -25.034 26.476  -30.613 1.00 56.07  ?  221  LEU B CB    1 
ATOM   3363  C  CG    . LEU B 1 233  ? -24.874 25.631  -31.879 1.00 63.49  ?  221  LEU B CG    1 
ATOM   3364  C  CD1   . LEU B 1 233  ? -25.931 24.537  -31.930 1.00 61.75  ?  221  LEU B CD1   1 
ATOM   3365  C  CD2   . LEU B 1 233  ? -24.936 26.503  -33.124 1.00 70.31  ?  221  LEU B CD2   1 
ATOM   3366  N  N     . ALA B 1 234  ? -23.716 27.829  -28.033 1.00 52.88  ?  222  ALA B N     1 
ATOM   3367  C  CA    . ALA B 1 234  ? -23.833 28.488  -26.737 1.00 48.77  ?  222  ALA B CA    1 
ATOM   3368  C  C     . ALA B 1 234  ? -22.952 29.729  -26.669 1.00 48.03  ?  222  ALA B C     1 
ATOM   3369  O  O     . ALA B 1 234  ? -23.324 30.728  -26.041 1.00 44.43  ?  222  ALA B O     1 
ATOM   3370  C  CB    . ALA B 1 234  ? -23.478 27.509  -25.618 1.00 42.64  ?  222  ALA B CB    1 
ATOM   3371  N  N     . ARG B 1 235  ? -21.785 29.686  -27.317 1.00 48.85  ?  223  ARG B N     1 
ATOM   3372  C  CA    . ARG B 1 235  ? -20.872 30.825  -27.300 1.00 48.64  ?  223  ARG B CA    1 
ATOM   3373  C  C     . ARG B 1 235  ? -21.475 32.044  -27.986 1.00 55.30  ?  223  ARG B C     1 
ATOM   3374  O  O     . ARG B 1 235  ? -21.232 33.180  -27.562 1.00 59.82  ?  223  ARG B O     1 
ATOM   3375  C  CB    . ARG B 1 235  ? -19.549 30.440  -27.964 1.00 50.26  ?  223  ARG B CB    1 
ATOM   3376  C  CG    . ARG B 1 235  ? -18.541 31.572  -28.071 1.00 50.13  ?  223  ARG B CG    1 
ATOM   3377  C  CD    . ARG B 1 235  ? -17.244 31.092  -28.704 1.00 60.28  ?  223  ARG B CD    1 
ATOM   3378  N  NE    . ARG B 1 235  ? -16.268 32.167  -28.847 1.00 77.42  ?  223  ARG B NE    1 
ATOM   3379  C  CZ    . ARG B 1 235  ? -16.083 32.866  -29.962 1.00 75.20  ?  223  ARG B CZ    1 
ATOM   3380  N  NH1   . ARG B 1 235  ? -16.811 32.603  -31.040 1.00 73.36  ?  223  ARG B NH1   1 
ATOM   3381  N  NH2   . ARG B 1 235  ? -15.169 33.825  -30.003 1.00 63.13  ?  223  ARG B NH2   1 
ATOM   3382  N  N     . GLU B 1 236  ? -22.271 31.830  -29.035 1.00 59.69  ?  224  GLU B N     1 
ATOM   3383  C  CA    . GLU B 1 236  ? -22.870 32.930  -29.781 1.00 58.80  ?  224  GLU B CA    1 
ATOM   3384  C  C     . GLU B 1 236  ? -23.917 33.696  -28.982 1.00 55.26  ?  224  GLU B C     1 
ATOM   3385  O  O     . GLU B 1 236  ? -24.417 34.713  -29.473 1.00 62.74  ?  224  GLU B O     1 
ATOM   3386  C  CB    . GLU B 1 236  ? -23.507 32.407  -31.071 1.00 67.36  ?  224  GLU B CB    1 
ATOM   3387  C  CG    . GLU B 1 236  ? -22.521 31.857  -32.089 1.00 76.06  ?  224  GLU B CG    1 
ATOM   3388  C  CD    . GLU B 1 236  ? -23.211 31.126  -33.228 1.00 77.55  ?  224  GLU B CD    1 
ATOM   3389  O  OE1   . GLU B 1 236  ? -24.460 31.122  -33.264 1.00 80.97  ?  224  GLU B OE1   1 
ATOM   3390  O  OE2   . GLU B 1 236  ? -22.504 30.554  -34.085 1.00 70.84  ?  224  GLU B OE2   1 
ATOM   3391  N  N     . LEU B 1 237  ? -24.257 33.242  -27.774 1.00 45.78  ?  225  LEU B N     1 
ATOM   3392  C  CA    . LEU B 1 237  ? -25.348 33.867  -27.033 1.00 43.51  ?  225  LEU B CA    1 
ATOM   3393  C  C     . LEU B 1 237  ? -24.972 35.246  -26.503 1.00 47.91  ?  225  LEU B C     1 
ATOM   3394  O  O     . LEU B 1 237  ? -25.826 36.138  -26.454 1.00 55.17  ?  225  LEU B O     1 
ATOM   3395  C  CB    . LEU B 1 237  ? -25.789 32.962  -25.883 1.00 39.89  ?  225  LEU B CB    1 
ATOM   3396  C  CG    . LEU B 1 237  ? -26.685 31.781  -26.259 1.00 41.34  ?  225  LEU B CG    1 
ATOM   3397  C  CD1   . LEU B 1 237  ? -26.919 30.889  -25.052 1.00 41.39  ?  225  LEU B CD1   1 
ATOM   3398  C  CD2   . LEU B 1 237  ? -28.007 32.275  -26.826 1.00 54.69  ?  225  LEU B CD2   1 
ATOM   3399  N  N     . ASN B 1 238  ? -23.716 35.447  -26.105 1.00 43.50  ?  226  ASN B N     1 
ATOM   3400  C  CA    . ASN B 1 238  ? -23.348 36.704  -25.462 1.00 52.38  ?  226  ASN B CA    1 
ATOM   3401  C  C     . ASN B 1 238  ? -21.896 37.086  -25.722 1.00 54.59  ?  226  ASN B C     1 
ATOM   3402  O  O     . ASN B 1 238  ? -21.554 38.273  -25.710 1.00 61.59  ?  226  ASN B O     1 
ATOM   3403  C  CB    . ASN B 1 238  ? -23.606 36.612  -23.956 1.00 66.24  ?  226  ASN B CB    1 
ATOM   3404  C  CG    . ASN B 1 238  ? -23.458 37.947  -23.255 1.00 74.44  ?  226  ASN B CG    1 
ATOM   3405  O  OD1   . ASN B 1 238  ? -23.558 39.004  -23.878 1.00 77.49  ?  226  ASN B OD1   1 
ATOM   3406  N  ND2   . ASN B 1 238  ? -23.223 37.906  -21.949 1.00 72.48  ?  226  ASN B ND2   1 
ATOM   3407  N  N     . VAL B 1 239  ? -21.042 36.089  -25.964 1.00 53.23  ?  227  VAL B N     1 
ATOM   3408  C  CA    . VAL B 1 239  ? -19.601 36.285  -26.113 1.00 67.43  ?  227  VAL B CA    1 
ATOM   3409  C  C     . VAL B 1 239  ? -19.069 36.989  -24.869 1.00 76.15  ?  227  VAL B C     1 
ATOM   3410  O  O     . VAL B 1 239  ? -18.491 38.080  -24.953 1.00 65.53  ?  227  VAL B O     1 
ATOM   3411  C  CB    . VAL B 1 239  ? -19.259 37.068  -27.398 1.00 53.21  ?  227  VAL B CB    1 
ATOM   3412  C  CG1   . VAL B 1 239  ? -17.777 36.933  -27.736 1.00 54.01  ?  227  VAL B CG1   1 
ATOM   3413  C  CG2   . VAL B 1 239  ? -20.114 36.588  -28.562 1.00 38.79  ?  227  VAL B CG2   1 
ATOM   3414  N  N     . GLU B 1 240  ? -19.276 36.378  -23.706 1.00 74.90  ?  228  GLU B N     1 
ATOM   3415  C  CA    . GLU B 1 240  ? -18.759 36.905  -22.454 1.00 67.34  ?  228  GLU B CA    1 
ATOM   3416  C  C     . GLU B 1 240  ? -17.348 36.371  -22.207 1.00 76.26  ?  228  GLU B C     1 
ATOM   3417  O  O     . GLU B 1 240  ? -16.875 35.451  -22.877 1.00 73.85  ?  228  GLU B O     1 
ATOM   3418  C  CB    . GLU B 1 240  ? -19.690 36.546  -21.293 1.00 64.11  ?  228  GLU B CB    1 
ATOM   3419  C  CG    . GLU B 1 240  ? -19.575 37.470  -20.082 1.00 74.77  ?  228  GLU B CG    1 
ATOM   3420  C  CD    . GLU B 1 240  ? -20.439 37.027  -18.917 1.00 73.66  ?  228  GLU B CD    1 
ATOM   3421  O  OE1   . GLU B 1 240  ? -21.259 36.103  -19.102 1.00 84.59  ?  228  GLU B OE1   1 
ATOM   3422  O  OE2   . GLU B 1 240  ? -20.297 37.600  -17.816 1.00 51.42  ?  228  GLU B OE2   1 
ATOM   3423  N  N     . ALA B 1 241  ? -16.672 36.965  -21.228 1.00 78.08  ?  229  ALA B N     1 
ATOM   3424  C  CA    . ALA B 1 241  ? -15.283 36.637  -20.956 1.00 81.07  ?  229  ALA B CA    1 
ATOM   3425  C  C     . ALA B 1 241  ? -15.160 35.293  -20.241 1.00 63.87  ?  229  ALA B C     1 
ATOM   3426  O  O     . ALA B 1 241  ? -16.088 34.819  -19.578 1.00 36.71  ?  229  ALA B O     1 
ATOM   3427  C  CB    . ALA B 1 241  ? -14.628 37.735  -20.118 1.00 76.56  ?  229  ALA B CB    1 
ATOM   3428  N  N     . GLU B 1 242  ? -13.985 34.683  -20.387 1.00 72.17  ?  230  GLU B N     1 
ATOM   3429  C  CA    . GLU B 1 242  ? -13.635 33.435  -19.723 1.00 67.40  ?  230  GLU B CA    1 
ATOM   3430  C  C     . GLU B 1 242  ? -12.143 33.201  -19.906 1.00 82.90  ?  230  GLU B C     1 
ATOM   3431  O  O     . GLU B 1 242  ? -11.601 33.456  -20.985 1.00 86.01  ?  230  GLU B O     1 
ATOM   3432  C  CB    . GLU B 1 242  ? -14.438 32.253  -20.284 1.00 54.87  ?  230  GLU B CB    1 
ATOM   3433  C  CG    . GLU B 1 242  ? -14.561 31.071  -19.334 1.00 61.99  ?  230  GLU B CG    1 
ATOM   3434  C  CD    . GLU B 1 242  ? -13.296 30.239  -19.254 1.00 71.08  ?  230  GLU B CD    1 
ATOM   3435  O  OE1   . GLU B 1 242  ? -12.698 30.163  -18.160 1.00 65.24  ?  230  GLU B OE1   1 
ATOM   3436  O  OE2   . GLU B 1 242  ? -12.896 29.667  -20.289 1.00 64.50  ?  230  GLU B OE2   1 
ATOM   3437  N  N     . GLY B 1 243  ? -11.490 32.718  -18.852 1.00 99.66  ?  231  GLY B N     1 
ATOM   3438  C  CA    . GLY B 1 243  ? -10.048 32.550  -18.893 1.00 103.74 ?  231  GLY B CA    1 
ATOM   3439  C  C     . GLY B 1 243  ? -9.630  31.423  -19.822 1.00 90.97  ?  231  GLY B C     1 
ATOM   3440  O  O     . GLY B 1 243  ? -10.211 30.337  -19.822 1.00 80.43  ?  231  GLY B O     1 
ATOM   3441  N  N     . ILE B 1 244  ? -8.597  31.689  -20.615 1.00 82.87  ?  232  ILE B N     1 
ATOM   3442  C  CA    . ILE B 1 244  ? -8.094  30.715  -21.576 1.00 89.18  ?  232  ILE B CA    1 
ATOM   3443  C  C     . ILE B 1 244  ? -6.938  29.924  -20.976 1.00 86.68  ?  232  ILE B C     1 
ATOM   3444  O  O     . ILE B 1 244  ? -5.807  30.407  -20.915 1.00 84.09  ?  232  ILE B O     1 
ATOM   3445  C  CB    . ILE B 1 244  ? -7.661  31.399  -22.885 1.00 89.55  ?  232  ILE B CB    1 
ATOM   3446  C  CG1   . ILE B 1 244  ? -8.822  32.202  -23.482 1.00 88.57  ?  232  ILE B CG1   1 
ATOM   3447  C  CG2   . ILE B 1 244  ? -7.121  30.374  -23.871 1.00 74.00  ?  232  ILE B CG2   1 
ATOM   3448  C  CD1   . ILE B 1 244  ? -10.134 31.447  -23.550 1.00 84.56  ?  232  ILE B CD1   1 
ATOM   3449  N  N     . SER C 2 28   ? -49.074 15.933  18.643  1.00 107.61 ?  28   SER C N     1 
ATOM   3450  C  CA    . SER C 2 28   ? -47.884 16.704  18.984  1.00 108.65 ?  28   SER C CA    1 
ATOM   3451  C  C     . SER C 2 28   ? -47.052 15.984  20.041  1.00 118.19 ?  28   SER C C     1 
ATOM   3452  O  O     . SER C 2 28   ? -47.563 15.138  20.775  1.00 121.00 ?  28   SER C O     1 
ATOM   3453  C  CB    . SER C 2 28   ? -48.271 18.099  19.476  1.00 112.12 ?  28   SER C CB    1 
ATOM   3454  N  N     . ASN C 2 29   ? -45.767 16.325  20.116  1.00 112.09 ?  29   ASN C N     1 
ATOM   3455  C  CA    . ASN C 2 29   ? -44.841 15.705  21.054  1.00 111.43 ?  29   ASN C CA    1 
ATOM   3456  C  C     . ASN C 2 29   ? -44.306 16.755  22.016  1.00 112.60 ?  29   ASN C C     1 
ATOM   3457  O  O     . ASN C 2 29   ? -43.820 17.808  21.586  1.00 115.35 ?  29   ASN C O     1 
ATOM   3458  C  CB    . ASN C 2 29   ? -43.681 15.025  20.319  1.00 94.33  ?  29   ASN C CB    1 
ATOM   3459  N  N     . ASN C 2 30   ? -44.402 16.462  23.314  1.00 110.30 ?  30   ASN C N     1 
ATOM   3460  C  CA    . ASN C 2 30   ? -43.835 17.293  24.376  1.00 109.44 ?  30   ASN C CA    1 
ATOM   3461  C  C     . ASN C 2 30   ? -44.407 18.712  24.337  1.00 95.19  ?  30   ASN C C     1 
ATOM   3462  O  O     . ASN C 2 30   ? -43.696 19.698  24.131  1.00 86.15  ?  30   ASN C O     1 
ATOM   3463  C  CB    . ASN C 2 30   ? -42.305 17.310  24.295  1.00 105.97 ?  30   ASN C CB    1 
ATOM   3464  C  CG    . ASN C 2 30   ? -41.706 15.917  24.258  1.00 108.85 ?  30   ASN C CG    1 
ATOM   3465  O  OD1   . ASN C 2 30   ? -42.304 14.958  24.746  1.00 120.24 ?  30   ASN C OD1   1 
ATOM   3466  N  ND2   . ASN C 2 30   ? -40.516 15.800  23.679  1.00 93.38  ?  30   ASN C ND2   1 
ATOM   3467  N  N     . SER C 2 31   ? -45.720 18.798  24.545  1.00 97.38  ?  31   SER C N     1 
ATOM   3468  C  CA    . SER C 2 31   ? -46.411 20.087  24.603  1.00 101.94 ?  31   SER C CA    1 
ATOM   3469  C  C     . SER C 2 31   ? -46.498 20.548  26.058  1.00 101.42 ?  31   SER C C     1 
ATOM   3470  O  O     . SER C 2 31   ? -47.567 20.629  26.667  1.00 99.58  ?  31   SER C O     1 
ATOM   3471  C  CB    . SER C 2 31   ? -47.788 19.984  23.959  1.00 99.02  ?  31   SER C CB    1 
ATOM   3472  O  OG    . SER C 2 31   ? -47.686 19.686  22.577  1.00 90.40  ?  31   SER C OG    1 
ATOM   3473  N  N     . VAL C 2 32   ? -45.330 20.851  26.616  1.00 75.66  ?  32   VAL C N     1 
ATOM   3474  C  CA    . VAL C 2 32   ? -45.236 21.295  28.005  1.00 67.94  ?  32   VAL C CA    1 
ATOM   3475  C  C     . VAL C 2 32   ? -44.317 22.510  28.162  1.00 70.49  ?  32   VAL C C     1 
ATOM   3476  O  O     . VAL C 2 32   ? -44.624 23.380  28.991  1.00 78.98  ?  32   VAL C O     1 
ATOM   3477  C  CB    . VAL C 2 32   ? -44.825 20.126  28.928  1.00 64.88  ?  32   VAL C CB    1 
ATOM   3478  C  CG1   . VAL C 2 32   ? -43.771 19.228  28.287  1.00 68.64  ?  32   VAL C CG1   1 
ATOM   3479  C  CG2   . VAL C 2 32   ? -44.365 20.627  30.296  1.00 59.33  ?  32   VAL C CG2   1 
ATOM   3480  N  N     . PRO C 2 33   ? -43.198 22.666  27.399  1.00 51.18  ?  33   PRO C N     1 
ATOM   3481  C  CA    . PRO C 2 33   ? -42.368 23.860  27.613  1.00 52.66  ?  33   PRO C CA    1 
ATOM   3482  C  C     . PRO C 2 33   ? -42.588 24.969  26.592  1.00 44.21  ?  33   PRO C C     1 
ATOM   3483  O  O     . PRO C 2 33   ? -42.187 26.114  26.825  1.00 39.95  ?  33   PRO C O     1 
ATOM   3484  C  CB    . PRO C 2 33   ? -40.937 23.307  27.521  1.00 50.42  ?  33   PRO C CB    1 
ATOM   3485  C  CG    . PRO C 2 33   ? -41.070 21.912  26.896  1.00 27.89  ?  33   PRO C CG    1 
ATOM   3486  C  CD    . PRO C 2 33   ? -42.502 21.747  26.483  1.00 44.72  ?  33   PRO C CD    1 
ATOM   3487  N  N     . GLY C 2 34   ? -43.217 24.652  25.462  1.00 42.77  ?  34   GLY C N     1 
ATOM   3488  C  CA    . GLY C 2 34   ? -43.339 25.603  24.374  1.00 41.59  ?  34   GLY C CA    1 
ATOM   3489  C  C     . GLY C 2 34   ? -42.291 25.371  23.305  1.00 49.31  ?  34   GLY C C     1 
ATOM   3490  O  O     . GLY C 2 34   ? -41.737 26.319  22.740  1.00 37.79  ?  34   GLY C O     1 
ATOM   3491  N  N     . ALA C 2 35   ? -42.016 24.107  23.024  1.00 61.31  ?  35   ALA C N     1 
ATOM   3492  C  CA    . ALA C 2 35   ? -40.968 23.700  22.099  1.00 43.97  ?  35   ALA C CA    1 
ATOM   3493  C  C     . ALA C 2 35   ? -41.513 23.631  20.681  1.00 37.76  ?  35   ALA C C     1 
ATOM   3494  O  O     . ALA C 2 35   ? -42.721 23.748  20.458  1.00 45.70  ?  35   ALA C O     1 
ATOM   3495  C  CB    . ALA C 2 35   ? -40.403 22.353  22.542  1.00 47.35  ?  35   ALA C CB    1 
ATOM   3496  N  N     . PRO C 2 36   ? -40.642 23.463  19.680  1.00 48.22  ?  36   PRO C N     1 
ATOM   3497  C  CA    . PRO C 2 36   ? -41.135 23.255  18.314  1.00 47.26  ?  36   PRO C CA    1 
ATOM   3498  C  C     . PRO C 2 36   ? -42.034 22.031  18.221  1.00 43.49  ?  36   PRO C C     1 
ATOM   3499  O  O     . PRO C 2 36   ? -41.876 21.055  18.959  1.00 38.85  ?  36   PRO C O     1 
ATOM   3500  C  CB    . PRO C 2 36   ? -39.852 23.075  17.490  1.00 42.87  ?  36   PRO C CB    1 
ATOM   3501  C  CG    . PRO C 2 36   ? -38.760 22.841  18.494  1.00 38.10  ?  36   PRO C CG    1 
ATOM   3502  C  CD    . PRO C 2 36   ? -39.177 23.616  19.698  1.00 50.29  ?  36   PRO C CD    1 
ATOM   3503  N  N     . ASN C 2 37   ? -42.987 22.096  17.294  1.00 43.30  ?  37   ASN C N     1 
ATOM   3504  C  CA    . ASN C 2 37   ? -44.018 21.070  17.154  1.00 46.23  ?  37   ASN C CA    1 
ATOM   3505  C  C     . ASN C 2 37   ? -43.475 19.915  16.322  1.00 41.44  ?  37   ASN C C     1 
ATOM   3506  O  O     . ASN C 2 37   ? -43.502 19.949  15.090  1.00 37.21  ?  37   ASN C O     1 
ATOM   3507  C  CB    . ASN C 2 37   ? -45.274 21.663  16.526  1.00 45.63  ?  37   ASN C CB    1 
ATOM   3508  C  CG    . ASN C 2 37   ? -46.369 20.634  16.332  1.00 50.61  ?  37   ASN C CG    1 
ATOM   3509  O  OD1   . ASN C 2 37   ? -46.454 19.654  17.071  1.00 55.28  ?  37   ASN C OD1   1 
ATOM   3510  N  ND2   . ASN C 2 37   ? -47.208 20.847  15.325  1.00 45.43  ?  37   ASN C ND2   1 
ATOM   3511  N  N     . ARG C 2 38   ? -42.983 18.883  16.998  1.00 43.45  ?  38   ARG C N     1 
ATOM   3512  C  CA    . ARG C 2 38   ? -42.567 17.649  16.348  1.00 37.64  ?  38   ARG C CA    1 
ATOM   3513  C  C     . ARG C 2 38   ? -43.710 16.645  16.432  1.00 44.78  ?  38   ARG C C     1 
ATOM   3514  O  O     . ARG C 2 38   ? -44.234 16.384  17.520  1.00 50.10  ?  38   ARG C O     1 
ATOM   3515  C  CB    . ARG C 2 38   ? -41.300 17.091  16.998  1.00 32.38  ?  38   ARG C CB    1 
ATOM   3516  C  CG    . ARG C 2 38   ? -40.573 16.048  16.167  1.00 28.72  ?  38   ARG C CG    1 
ATOM   3517  C  CD    . ARG C 2 38   ? -39.222 15.689  16.777  1.00 23.00  ?  38   ARG C CD    1 
ATOM   3518  N  NE    . ARG C 2 38   ? -38.211 16.717  16.542  1.00 23.86  ?  38   ARG C NE    1 
ATOM   3519  C  CZ    . ARG C 2 38   ? -37.294 16.655  15.582  1.00 26.95  ?  38   ARG C CZ    1 
ATOM   3520  N  NH1   . ARG C 2 38   ? -36.413 17.635  15.438  1.00 26.31  ?  38   ARG C NH1   1 
ATOM   3521  N  NH2   . ARG C 2 38   ? -37.255 15.609  14.768  1.00 25.28  ?  38   ARG C NH2   1 
ATOM   3522  N  N     . VAL C 2 39   ? -44.103 16.099  15.287  1.00 47.80  ?  39   VAL C N     1 
ATOM   3523  C  CA    . VAL C 2 39   ? -45.287 15.250  15.192  1.00 43.50  ?  39   VAL C CA    1 
ATOM   3524  C  C     . VAL C 2 39   ? -44.871 13.795  15.370  1.00 39.08  ?  39   VAL C C     1 
ATOM   3525  O  O     . VAL C 2 39   ? -44.001 13.295  14.649  1.00 36.78  ?  39   VAL C O     1 
ATOM   3526  C  CB    . VAL C 2 39   ? -46.008 15.459  13.851  1.00 37.54  ?  39   VAL C CB    1 
ATOM   3527  C  CG1   . VAL C 2 39   ? -47.511 15.397  14.049  1.00 50.42  ?  39   VAL C CG1   1 
ATOM   3528  C  CG2   . VAL C 2 39   ? -45.600 16.788  13.232  1.00 32.83  ?  39   VAL C CG2   1 
ATOM   3529  N  N     . SER C 2 40   ? -45.505 13.109  16.318  1.00 44.37  ?  40   SER C N     1 
ATOM   3530  C  CA    . SER C 2 40   ? -45.103 11.765  16.708  1.00 41.87  ?  40   SER C CA    1 
ATOM   3531  C  C     . SER C 2 40   ? -46.038 10.720  16.115  1.00 47.66  ?  40   SER C C     1 
ATOM   3532  O  O     . SER C 2 40   ? -47.253 10.924  16.042  1.00 51.87  ?  40   SER C O     1 
ATOM   3533  C  CB    . SER C 2 40   ? -45.077 11.627  18.232  1.00 47.05  ?  40   SER C CB    1 
ATOM   3534  O  OG    . SER C 2 40   ? -44.695 10.316  18.618  1.00 48.34  ?  40   SER C OG    1 
ATOM   3535  N  N     . PHE C 2 41   ? -45.457 9.595   15.699  1.00 48.53  ?  41   PHE C N     1 
ATOM   3536  C  CA    . PHE C 2 41   ? -46.219 8.449   15.218  1.00 44.79  ?  41   PHE C CA    1 
ATOM   3537  C  C     . PHE C 2 41   ? -46.642 7.581   16.398  1.00 52.01  ?  41   PHE C C     1 
ATOM   3538  O  O     . PHE C 2 41   ? -46.460 6.360   16.374  1.00 56.73  ?  41   PHE C O     1 
ATOM   3539  C  CB    . PHE C 2 41   ? -45.392 7.621   14.226  1.00 38.11  ?  41   PHE C CB    1 
ATOM   3540  C  CG    . PHE C 2 41   ? -45.196 8.277   12.884  1.00 42.69  ?  41   PHE C CG    1 
ATOM   3541  C  CD1   . PHE C 2 41   ? -44.583 9.516   12.779  1.00 51.71  ?  41   PHE C CD1   1 
ATOM   3542  C  CD2   . PHE C 2 41   ? -45.598 7.636   11.722  1.00 38.29  ?  41   PHE C CD2   1 
ATOM   3543  C  CE1   . PHE C 2 41   ? -44.397 10.113  11.547  1.00 46.07  ?  41   PHE C CE1   1 
ATOM   3544  C  CE2   . PHE C 2 41   ? -45.411 8.228   10.485  1.00 38.07  ?  41   PHE C CE2   1 
ATOM   3545  C  CZ    . PHE C 2 41   ? -44.810 9.468   10.399  1.00 40.63  ?  41   PHE C CZ    1 
ATOM   3546  N  N     . ALA C 2 42   ? -47.204 8.202   17.433  1.00 52.84  ?  42   ALA C N     1 
ATOM   3547  C  CA    . ALA C 2 42   ? -47.455 7.529   18.701  1.00 59.20  ?  42   ALA C CA    1 
ATOM   3548  C  C     . ALA C 2 42   ? -48.869 6.965   18.724  1.00 74.32  ?  42   ALA C C     1 
ATOM   3549  O  O     . ALA C 2 42   ? -49.842 7.702   18.528  1.00 86.92  ?  42   ALA C O     1 
ATOM   3550  C  CB    . ALA C 2 42   ? -47.242 8.490   19.869  1.00 68.88  ?  42   ALA C CB    1 
ATOM   3551  N  N     . LYS C 2 43   ? -48.980 5.659   18.966  1.00 65.34  ?  43   LYS C N     1 
ATOM   3552  C  CA    . LYS C 2 43   ? -50.273 5.018   19.155  1.00 70.29  ?  43   LYS C CA    1 
ATOM   3553  C  C     . LYS C 2 43   ? -50.617 4.807   20.622  1.00 73.35  ?  43   LYS C C     1 
ATOM   3554  O  O     . LYS C 2 43   ? -51.786 4.566   20.940  1.00 78.79  ?  43   LYS C O     1 
ATOM   3555  C  CB    . LYS C 2 43   ? -50.313 3.663   18.437  1.00 75.99  ?  43   LYS C CB    1 
ATOM   3556  C  CG    . LYS C 2 43   ? -49.716 3.665   17.039  1.00 66.73  ?  43   LYS C CG    1 
ATOM   3557  C  CD    . LYS C 2 43   ? -50.364 4.707   16.144  1.00 72.89  ?  43   LYS C CD    1 
ATOM   3558  C  CE    . LYS C 2 43   ? -49.912 4.541   14.702  1.00 69.52  ?  43   LYS C CE    1 
ATOM   3559  N  NZ    . LYS C 2 43   ? -48.434 4.409   14.587  1.00 65.94  ?  43   LYS C NZ    1 
ATOM   3560  N  N     . LEU C 2 44   ? -49.632 4.891   21.511  1.00 79.78  ?  44   LEU C N     1 
ATOM   3561  C  CA    . LEU C 2 44   ? -49.827 4.693   22.940  1.00 81.76  ?  44   LEU C CA    1 
ATOM   3562  C  C     . LEU C 2 44   ? -49.589 6.010   23.665  1.00 83.11  ?  44   LEU C C     1 
ATOM   3563  O  O     . LEU C 2 44   ? -48.581 6.682   23.424  1.00 85.21  ?  44   LEU C O     1 
ATOM   3564  C  CB    . LEU C 2 44   ? -48.879 3.618   23.477  1.00 74.85  ?  44   LEU C CB    1 
ATOM   3565  C  CG    . LEU C 2 44   ? -48.765 2.324   22.669  1.00 75.45  ?  44   LEU C CG    1 
ATOM   3566  C  CD1   . LEU C 2 44   ? -47.787 1.368   23.332  1.00 69.85  ?  44   LEU C CD1   1 
ATOM   3567  C  CD2   . LEU C 2 44   ? -50.126 1.669   22.493  1.00 78.20  ?  44   LEU C CD2   1 
ATOM   3568  N  N     . ARG C 2 45   ? -50.514 6.372   24.548  1.00 80.85  ?  45   ARG C N     1 
ATOM   3569  C  CA    . ARG C 2 45   ? -50.375 7.602   25.312  1.00 84.47  ?  45   ARG C CA    1 
ATOM   3570  C  C     . ARG C 2 45   ? -49.302 7.449   26.386  1.00 86.05  ?  45   ARG C C     1 
ATOM   3571  O  O     . ARG C 2 45   ? -49.020 6.348   26.865  1.00 89.77  ?  45   ARG C O     1 
ATOM   3572  C  CB    . ARG C 2 45   ? -51.709 7.986   25.951  1.00 89.43  ?  45   ARG C CB    1 
ATOM   3573  C  CG    . ARG C 2 45   ? -52.318 6.891   26.812  1.00 95.90  ?  45   ARG C CG    1 
ATOM   3574  C  CD    . ARG C 2 45   ? -53.699 7.279   27.312  1.00 96.81  ?  45   ARG C CD    1 
ATOM   3575  N  NE    . ARG C 2 45   ? -53.666 8.476   28.147  1.00 92.99  ?  45   ARG C NE    1 
ATOM   3576  C  CZ    . ARG C 2 45   ? -53.503 8.462   29.466  1.00 96.11  ?  45   ARG C CZ    1 
ATOM   3577  N  NH1   . ARG C 2 45   ? -53.359 7.310   30.106  1.00 94.56  ?  45   ARG C NH1   1 
ATOM   3578  N  NH2   . ARG C 2 45   ? -53.486 9.601   30.145  1.00 100.02 ?  45   ARG C NH2   1 
ATOM   3579  N  N     . GLU C 2 46   ? -48.697 8.577   26.759  1.00 82.28  ?  46   GLU C N     1 
ATOM   3580  C  CA    . GLU C 2 46   ? -47.675 8.593   27.794  1.00 82.80  ?  46   GLU C CA    1 
ATOM   3581  C  C     . GLU C 2 46   ? -48.314 8.961   29.123  1.00 75.68  ?  46   GLU C C     1 
ATOM   3582  O  O     . GLU C 2 46   ? -48.718 10.120  29.304  1.00 79.48  ?  46   GLU C O     1 
ATOM   3583  C  CB    . GLU C 2 46   ? -46.567 9.585   27.442  1.00 92.10  ?  46   GLU C CB    1 
ATOM   3584  C  CG    . GLU C 2 46   ? -45.625 9.103   26.349  1.00 92.58  ?  46   GLU C CG    1 
ATOM   3585  C  CD    . GLU C 2 46   ? -44.279 8.663   26.894  1.00 82.90  ?  46   GLU C CD    1 
ATOM   3586  O  OE1   . GLU C 2 46   ? -43.715 9.387   27.742  1.00 79.45  ?  46   GLU C OE1   1 
ATOM   3587  O  OE2   . GLU C 2 46   ? -43.786 7.593   26.478  1.00 72.82  ?  46   GLU C OE2   1 
ATOM   3588  N  N     . PRO C 2 47   ? -48.434 8.029   30.074  1.00 55.13  ?  47   PRO C N     1 
ATOM   3589  C  CA    . PRO C 2 47   ? -49.091 8.381   31.343  1.00 53.68  ?  47   PRO C CA    1 
ATOM   3590  C  C     . PRO C 2 47   ? -48.225 9.234   32.252  1.00 48.34  ?  47   PRO C C     1 
ATOM   3591  O  O     . PRO C 2 47   ? -48.745 10.128  32.933  1.00 46.49  ?  47   PRO C O     1 
ATOM   3592  C  CB    . PRO C 2 47   ? -49.397 7.011   31.961  1.00 59.04  ?  47   PRO C CB    1 
ATOM   3593  C  CG    . PRO C 2 47   ? -48.332 6.118   31.417  1.00 59.77  ?  47   PRO C CG    1 
ATOM   3594  C  CD    . PRO C 2 47   ? -48.045 6.609   30.021  1.00 54.71  ?  47   PRO C CD    1 
ATOM   3595  N  N     . LEU C 2 48   ? -46.917 8.989   32.284  1.00 55.53  ?  48   LEU C N     1 
ATOM   3596  C  CA    . LEU C 2 48   ? -45.998 9.704   33.159  1.00 50.60  ?  48   LEU C CA    1 
ATOM   3597  C  C     . LEU C 2 48   ? -44.878 10.302  32.322  1.00 50.35  ?  48   LEU C C     1 
ATOM   3598  O  O     . LEU C 2 48   ? -44.219 9.586   31.561  1.00 51.32  ?  48   LEU C O     1 
ATOM   3599  C  CB    . LEU C 2 48   ? -45.433 8.769   34.237  1.00 36.07  ?  48   LEU C CB    1 
ATOM   3600  C  CG    . LEU C 2 48   ? -44.302 9.266   35.138  1.00 44.91  ?  48   LEU C CG    1 
ATOM   3601  C  CD1   . LEU C 2 48   ? -44.556 8.851   36.576  1.00 53.00  ?  48   LEU C CD1   1 
ATOM   3602  C  CD2   . LEU C 2 48   ? -42.971 8.713   34.664  1.00 53.08  ?  48   LEU C CD2   1 
ATOM   3603  N  N     . GLU C 2 49   ? -44.666 11.607  32.461  1.00 54.92  ?  49   GLU C N     1 
ATOM   3604  C  CA    . GLU C 2 49   ? -43.627 12.277  31.697  1.00 57.80  ?  49   GLU C CA    1 
ATOM   3605  C  C     . GLU C 2 49   ? -42.250 11.968  32.278  1.00 50.54  ?  49   GLU C C     1 
ATOM   3606  O  O     . GLU C 2 49   ? -42.110 11.534  33.423  1.00 49.46  ?  49   GLU C O     1 
ATOM   3607  C  CB    . GLU C 2 49   ? -43.865 13.788  31.661  1.00 63.86  ?  49   GLU C CB    1 
ATOM   3608  C  CG    . GLU C 2 49   ? -43.921 14.457  33.025  1.00 73.21  ?  49   GLU C CG    1 
ATOM   3609  C  CD    . GLU C 2 49   ? -44.174 15.951  32.928  1.00 92.34  ?  49   GLU C CD    1 
ATOM   3610  O  OE1   . GLU C 2 49   ? -44.319 16.459  31.796  1.00 95.26  ?  49   GLU C OE1   1 
ATOM   3611  O  OE2   . GLU C 2 49   ? -44.226 16.617  33.984  1.00 98.71  ?  49   GLU C OE2   1 
ATOM   3612  N  N     . VAL C 2 50   ? -41.229 12.201  31.460  1.00 50.68  ?  50   VAL C N     1 
ATOM   3613  C  CA    . VAL C 2 50   ? -39.845 11.881  31.829  1.00 43.60  ?  50   VAL C CA    1 
ATOM   3614  C  C     . VAL C 2 50   ? -39.467 12.645  33.091  1.00 41.45  ?  50   VAL C C     1 
ATOM   3615  O  O     . VAL C 2 50   ? -39.727 13.862  33.186  1.00 45.83  ?  50   VAL C O     1 
ATOM   3616  C  CB    . VAL C 2 50   ? -38.885 12.222  30.676  1.00 45.80  ?  50   VAL C CB    1 
ATOM   3617  C  CG1   . VAL C 2 50   ? -37.445 11.923  31.069  1.00 40.77  ?  50   VAL C CG1   1 
ATOM   3618  C  CG2   . VAL C 2 50   ? -39.277 11.453  29.422  1.00 58.39  ?  50   VAL C CG2   1 
ATOM   3619  N  N     . PRO C 2 51   ? -38.863 11.996  34.089  1.00 31.37  ?  51   PRO C N     1 
ATOM   3620  C  CA    . PRO C 2 51   ? -38.436 12.724  35.290  1.00 32.76  ?  51   PRO C CA    1 
ATOM   3621  C  C     . PRO C 2 51   ? -37.261 13.645  35.008  1.00 33.47  ?  51   PRO C C     1 
ATOM   3622  O  O     . PRO C 2 51   ? -36.804 13.753  33.866  1.00 34.65  ?  51   PRO C O     1 
ATOM   3623  C  CB    . PRO C 2 51   ? -38.053 11.600  36.260  1.00 30.60  ?  51   PRO C CB    1 
ATOM   3624  C  CG    . PRO C 2 51   ? -37.640 10.476  35.370  1.00 27.93  ?  51   PRO C CG    1 
ATOM   3625  C  CD    . PRO C 2 51   ? -38.547 10.560  34.172  1.00 34.75  ?  51   PRO C CD    1 
ATOM   3626  N  N     . GLY C 2 52   ? -36.773 14.323  36.042  1.00 40.30  ?  52   GLY C N     1 
ATOM   3627  C  CA    . GLY C 2 52   ? -35.569 15.113  35.901  1.00 38.75  ?  52   GLY C CA    1 
ATOM   3628  C  C     . GLY C 2 52   ? -34.370 14.231  35.626  1.00 35.64  ?  52   GLY C C     1 
ATOM   3629  O  O     . GLY C 2 52   ? -33.919 13.497  36.509  1.00 38.67  ?  52   GLY C O     1 
ATOM   3630  N  N     . LEU C 2 53   ? -33.845 14.290  34.399  1.00 31.25  ?  53   LEU C N     1 
ATOM   3631  C  CA    . LEU C 2 53   ? -32.722 13.442  34.017  1.00 32.93  ?  53   LEU C CA    1 
ATOM   3632  C  C     . LEU C 2 53   ? -31.472 13.704  34.846  1.00 33.72  ?  53   LEU C C     1 
ATOM   3633  O  O     . LEU C 2 53   ? -30.511 12.934  34.745  1.00 31.62  ?  53   LEU C O     1 
ATOM   3634  C  CB    . LEU C 2 53   ? -32.409 13.629  32.531  1.00 24.86  ?  53   LEU C CB    1 
ATOM   3635  C  CG    . LEU C 2 53   ? -33.505 13.197  31.554  1.00 22.25  ?  53   LEU C CG    1 
ATOM   3636  C  CD1   . LEU C 2 53   ? -33.135 13.581  30.130  1.00 25.72  ?  53   LEU C CD1   1 
ATOM   3637  C  CD2   . LEU C 2 53   ? -33.759 11.701  31.659  1.00 19.04  ?  53   LEU C CD2   1 
ATOM   3638  N  N     . LEU C 2 54   ? -31.462 14.759  35.659  1.00 30.51  ?  54   LEU C N     1 
ATOM   3639  C  CA    . LEU C 2 54   ? -30.342 15.077  36.533  1.00 27.52  ?  54   LEU C CA    1 
ATOM   3640  C  C     . LEU C 2 54   ? -30.653 14.807  38.001  1.00 26.03  ?  54   LEU C C     1 
ATOM   3641  O  O     . LEU C 2 54   ? -29.899 15.249  38.874  1.00 20.09  ?  54   LEU C O     1 
ATOM   3642  C  CB    . LEU C 2 54   ? -29.932 16.539  36.342  1.00 27.56  ?  54   LEU C CB    1 
ATOM   3643  C  CG    . LEU C 2 54   ? -28.492 16.814  35.912  1.00 26.11  ?  54   LEU C CG    1 
ATOM   3644  C  CD1   . LEU C 2 54   ? -28.111 15.938  34.734  1.00 21.60  ?  54   LEU C CD1   1 
ATOM   3645  C  CD2   . LEU C 2 54   ? -28.326 18.282  35.559  1.00 21.77  ?  54   LEU C CD2   1 
ATOM   3646  N  N     . ASP C 2 55   ? -31.741 14.088  38.294  1.00 31.39  ?  55   ASP C N     1 
ATOM   3647  C  CA    . ASP C 2 55   ? -32.141 13.875  39.683  1.00 25.40  ?  55   ASP C CA    1 
ATOM   3648  C  C     . ASP C 2 55   ? -31.161 12.984  40.435  1.00 24.56  ?  55   ASP C C     1 
ATOM   3649  O  O     . ASP C 2 55   ? -31.036 13.105  41.659  1.00 28.29  ?  55   ASP C O     1 
ATOM   3650  C  CB    . ASP C 2 55   ? -33.544 13.271  39.745  1.00 28.48  ?  55   ASP C CB    1 
ATOM   3651  C  CG    . ASP C 2 55   ? -34.633 14.298  39.511  1.00 37.14  ?  55   ASP C CG    1 
ATOM   3652  O  OD1   . ASP C 2 55   ? -34.302 15.454  39.175  1.00 39.34  ?  55   ASP C OD1   1 
ATOM   3653  O  OD2   . ASP C 2 55   ? -35.822 13.949  39.670  1.00 40.81  ?  55   ASP C OD2   1 
ATOM   3654  N  N     . VAL C 2 56   ? -30.468 12.086  39.731  1.00 23.36  ?  56   VAL C N     1 
ATOM   3655  C  CA    . VAL C 2 56   ? -29.538 11.175  40.397  1.00 17.81  ?  56   VAL C CA    1 
ATOM   3656  C  C     . VAL C 2 56   ? -28.415 11.957  41.065  1.00 28.23  ?  56   VAL C C     1 
ATOM   3657  O  O     . VAL C 2 56   ? -28.063 11.707  42.225  1.00 32.27  ?  56   VAL C O     1 
ATOM   3658  C  CB    . VAL C 2 56   ? -28.990 10.142  39.398  1.00 20.53  ?  56   VAL C CB    1 
ATOM   3659  C  CG1   . VAL C 2 56   ? -27.928 9.276   40.060  1.00 24.44  ?  56   VAL C CG1   1 
ATOM   3660  C  CG2   . VAL C 2 56   ? -30.119 9.286   38.861  1.00 30.33  ?  56   VAL C CG2   1 
ATOM   3661  N  N     . GLN C 2 57   ? -27.834 12.917  40.343  1.00 24.99  ?  57   GLN C N     1 
ATOM   3662  C  CA    . GLN C 2 57   ? -26.803 13.755  40.942  1.00 26.16  ?  57   GLN C CA    1 
ATOM   3663  C  C     . GLN C 2 57   ? -27.401 14.790  41.886  1.00 26.00  ?  57   GLN C C     1 
ATOM   3664  O  O     . GLN C 2 57   ? -26.791 15.119  42.908  1.00 22.07  ?  57   GLN C O     1 
ATOM   3665  C  CB    . GLN C 2 57   ? -25.988 14.444  39.848  1.00 17.67  ?  57   GLN C CB    1 
ATOM   3666  C  CG    . GLN C 2 57   ? -25.233 13.488  38.939  1.00 12.58  ?  57   GLN C CG    1 
ATOM   3667  C  CD    . GLN C 2 57   ? -23.923 13.020  39.542  1.00 22.89  ?  57   GLN C CD    1 
ATOM   3668  O  OE1   . GLN C 2 57   ? -23.127 13.825  40.027  1.00 22.00  ?  57   GLN C OE1   1 
ATOM   3669  N  NE2   . GLN C 2 57   ? -23.691 11.713  39.513  1.00 29.06  ?  57   GLN C NE2   1 
ATOM   3670  N  N     . THR C 2 58   ? -28.594 15.297  41.571  1.00 26.43  ?  58   THR C N     1 
ATOM   3671  C  CA    . THR C 2 58   ? -29.180 16.377  42.358  1.00 19.87  ?  58   THR C CA    1 
ATOM   3672  C  C     . THR C 2 58   ? -29.662 15.879  43.716  1.00 29.46  ?  58   THR C C     1 
ATOM   3673  O  O     . THR C 2 58   ? -29.223 16.372  44.761  1.00 33.62  ?  58   THR C O     1 
ATOM   3674  C  CB    . THR C 2 58   ? -30.330 17.022  41.584  1.00 20.71  ?  58   THR C CB    1 
ATOM   3675  O  OG1   . THR C 2 58   ? -29.814 17.681  40.420  1.00 26.55  ?  58   THR C OG1   1 
ATOM   3676  C  CG2   . THR C 2 58   ? -31.055 18.033  42.456  1.00 26.71  ?  58   THR C CG2   1 
ATOM   3677  N  N     . ASP C 2 59   ? -30.572 14.900  43.719  1.00 37.23  ?  59   ASP C N     1 
ATOM   3678  C  CA    . ASP C 2 59   ? -31.189 14.459  44.968  1.00 33.73  ?  59   ASP C CA    1 
ATOM   3679  C  C     . ASP C 2 59   ? -30.154 13.926  45.949  1.00 33.18  ?  59   ASP C C     1 
ATOM   3680  O  O     . ASP C 2 59   ? -30.280 14.123  47.164  1.00 28.31  ?  59   ASP C O     1 
ATOM   3681  C  CB    . ASP C 2 59   ? -32.247 13.393  44.683  1.00 39.76  ?  59   ASP C CB    1 
ATOM   3682  C  CG    . ASP C 2 59   ? -33.418 13.933  43.888  1.00 45.11  ?  59   ASP C CG    1 
ATOM   3683  O  OD1   . ASP C 2 59   ? -33.489 15.164  43.694  1.00 45.54  ?  59   ASP C OD1   1 
ATOM   3684  O  OD2   . ASP C 2 59   ? -34.266 13.124  43.457  1.00 41.09  ?  59   ASP C OD2   1 
ATOM   3685  N  N     . SER C 2 60   ? -29.121 13.249  45.442  1.00 28.99  ?  60   SER C N     1 
ATOM   3686  C  CA    . SER C 2 60   ? -28.118 12.660  46.322  1.00 26.03  ?  60   SER C CA    1 
ATOM   3687  C  C     . SER C 2 60   ? -27.370 13.729  47.107  1.00 24.97  ?  60   SER C C     1 
ATOM   3688  O  O     . SER C 2 60   ? -27.043 13.532  48.283  1.00 30.23  ?  60   SER C O     1 
ATOM   3689  C  CB    . SER C 2 60   ? -27.142 11.814  45.506  1.00 26.29  ?  60   SER C CB    1 
ATOM   3690  O  OG    . SER C 2 60   ? -26.174 11.205  46.341  1.00 23.65  ?  60   SER C OG    1 
ATOM   3691  N  N     . PHE C 2 61   ? -27.095 14.871  46.476  1.00 30.91  ?  61   PHE C N     1 
ATOM   3692  C  CA    . PHE C 2 61   ? -26.356 15.929  47.153  1.00 26.85  ?  61   PHE C CA    1 
ATOM   3693  C  C     . PHE C 2 61   ? -27.252 16.764  48.060  1.00 32.76  ?  61   PHE C C     1 
ATOM   3694  O  O     . PHE C 2 61   ? -26.783 17.273  49.084  1.00 36.93  ?  61   PHE C O     1 
ATOM   3695  C  CB    . PHE C 2 61   ? -25.663 16.825  46.126  1.00 24.89  ?  61   PHE C CB    1 
ATOM   3696  C  CG    . PHE C 2 61   ? -24.622 17.729  46.717  1.00 22.36  ?  61   PHE C CG    1 
ATOM   3697  C  CD1   . PHE C 2 61   ? -24.906 19.059  46.977  1.00 18.49  ?  61   PHE C CD1   1 
ATOM   3698  C  CD2   . PHE C 2 61   ? -23.359 17.246  47.018  1.00 24.73  ?  61   PHE C CD2   1 
ATOM   3699  C  CE1   . PHE C 2 61   ? -23.949 19.892  47.522  1.00 25.78  ?  61   PHE C CE1   1 
ATOM   3700  C  CE2   . PHE C 2 61   ? -22.398 18.074  47.564  1.00 24.26  ?  61   PHE C CE2   1 
ATOM   3701  C  CZ    . PHE C 2 61   ? -22.693 19.399  47.816  1.00 30.51  ?  61   PHE C CZ    1 
ATOM   3702  N  N     . GLU C 2 62   ? -28.532 16.915  47.707  1.00 29.22  ?  62   GLU C N     1 
ATOM   3703  C  CA    . GLU C 2 62   ? -29.445 17.672  48.559  1.00 33.19  ?  62   GLU C CA    1 
ATOM   3704  C  C     . GLU C 2 62   ? -29.675 16.963  49.887  1.00 40.25  ?  62   GLU C C     1 
ATOM   3705  O  O     . GLU C 2 62   ? -29.808 17.612  50.931  1.00 44.68  ?  62   GLU C O     1 
ATOM   3706  C  CB    . GLU C 2 62   ? -30.771 17.902  47.835  1.00 35.11  ?  62   GLU C CB    1 
ATOM   3707  C  CG    . GLU C 2 62   ? -30.632 18.603  46.495  1.00 40.21  ?  62   GLU C CG    1 
ATOM   3708  C  CD    . GLU C 2 62   ? -31.972 18.966  45.888  1.00 57.56  ?  62   GLU C CD    1 
ATOM   3709  O  OE1   . GLU C 2 62   ? -32.358 20.151  45.968  1.00 67.71  ?  62   GLU C OE1   1 
ATOM   3710  O  OE2   . GLU C 2 62   ? -32.643 18.065  45.342  1.00 58.60  ?  62   GLU C OE2   1 
ATOM   3711  N  N     . TRP C 2 63   ? -29.726 15.629  49.867  1.00 41.39  ?  63   TRP C N     1 
ATOM   3712  C  CA    . TRP C 2 63   ? -29.837 14.872  51.109  1.00 34.71  ?  63   TRP C CA    1 
ATOM   3713  C  C     . TRP C 2 63   ? -28.569 14.983  51.945  1.00 36.51  ?  63   TRP C C     1 
ATOM   3714  O  O     . TRP C 2 63   ? -28.640 14.999  53.179  1.00 46.13  ?  63   TRP C O     1 
ATOM   3715  C  CB    . TRP C 2 63   ? -30.146 13.406  50.805  1.00 37.85  ?  63   TRP C CB    1 
ATOM   3716  C  CG    . TRP C 2 63   ? -29.754 12.470  51.908  1.00 35.80  ?  63   TRP C CG    1 
ATOM   3717  C  CD1   . TRP C 2 63   ? -30.489 12.152  53.013  1.00 42.93  ?  63   TRP C CD1   1 
ATOM   3718  C  CD2   . TRP C 2 63   ? -28.532 11.729  52.013  1.00 34.96  ?  63   TRP C CD2   1 
ATOM   3719  N  NE1   . TRP C 2 63   ? -29.799 11.261  53.800  1.00 50.65  ?  63   TRP C NE1   1 
ATOM   3720  C  CE2   . TRP C 2 63   ? -28.595 10.985  53.208  1.00 44.85  ?  63   TRP C CE2   1 
ATOM   3721  C  CE3   . TRP C 2 63   ? -27.389 11.624  51.213  1.00 35.01  ?  63   TRP C CE3   1 
ATOM   3722  C  CZ2   . TRP C 2 63   ? -27.561 10.148  53.622  1.00 45.57  ?  63   TRP C CZ2   1 
ATOM   3723  C  CZ3   . TRP C 2 63   ? -26.364 10.792  51.626  1.00 43.08  ?  63   TRP C CZ3   1 
ATOM   3724  C  CH2   . TRP C 2 63   ? -26.457 10.065  52.819  1.00 42.07  ?  63   TRP C CH2   1 
ATOM   3725  N  N     . LEU C 2 64   ? -27.407 15.063  51.295  1.00 31.33  ?  64   LEU C N     1 
ATOM   3726  C  CA    . LEU C 2 64   ? -26.146 15.098  52.029  1.00 28.08  ?  64   LEU C CA    1 
ATOM   3727  C  C     . LEU C 2 64   ? -26.022 16.366  52.864  1.00 31.35  ?  64   LEU C C     1 
ATOM   3728  O  O     . LEU C 2 64   ? -25.553 16.322  54.008  1.00 37.29  ?  64   LEU C O     1 
ATOM   3729  C  CB    . LEU C 2 64   ? -24.974 14.984  51.057  1.00 26.65  ?  64   LEU C CB    1 
ATOM   3730  C  CG    . LEU C 2 64   ? -23.575 15.203  51.635  1.00 26.90  ?  64   LEU C CG    1 
ATOM   3731  C  CD1   . LEU C 2 64   ? -23.207 14.092  52.606  1.00 39.28  ?  64   LEU C CD1   1 
ATOM   3732  C  CD2   . LEU C 2 64   ? -22.555 15.308  50.516  1.00 34.52  ?  64   LEU C CD2   1 
ATOM   3733  N  N     . ILE C 2 65   ? -26.438 17.506  52.312  1.00 36.32  ?  65   ILE C N     1 
ATOM   3734  C  CA    . ILE C 2 65   ? -26.291 18.791  52.985  1.00 38.29  ?  65   ILE C CA    1 
ATOM   3735  C  C     . ILE C 2 65   ? -27.600 19.264  53.610  1.00 38.67  ?  65   ILE C C     1 
ATOM   3736  O  O     . ILE C 2 65   ? -27.670 20.390  54.112  1.00 43.04  ?  65   ILE C O     1 
ATOM   3737  C  CB    . ILE C 2 65   ? -25.723 19.852  52.029  1.00 43.79  ?  65   ILE C CB    1 
ATOM   3738  C  CG1   . ILE C 2 65   ? -26.609 19.992  50.790  1.00 33.02  ?  65   ILE C CG1   1 
ATOM   3739  C  CG2   . ILE C 2 65   ? -24.298 19.499  51.632  1.00 46.15  ?  65   ILE C CG2   1 
ATOM   3740  C  CD1   . ILE C 2 65   ? -27.434 21.258  50.768  1.00 36.20  ?  65   ILE C CD1   1 
ATOM   3741  N  N     . GLY C 2 66   ? -28.638 18.430  53.592  1.00 38.76  ?  66   GLY C N     1 
ATOM   3742  C  CA    . GLY C 2 66   ? -29.897 18.753  54.237  1.00 49.00  ?  66   GLY C CA    1 
ATOM   3743  C  C     . GLY C 2 66   ? -30.560 20.012  53.717  1.00 47.69  ?  66   GLY C C     1 
ATOM   3744  O  O     . GLY C 2 66   ? -30.979 20.869  54.500  1.00 56.07  ?  66   GLY C O     1 
ATOM   3745  N  N     . SER C 2 67   ? -30.661 20.133  52.395  1.00 41.97  ?  67   SER C N     1 
ATOM   3746  C  CA    . SER C 2 67   ? -31.263 21.307  51.793  1.00 50.38  ?  67   SER C CA    1 
ATOM   3747  C  C     . SER C 2 67   ? -32.763 21.342  52.075  1.00 49.09  ?  67   SER C C     1 
ATOM   3748  O  O     . SER C 2 67   ? -33.376 20.311  52.363  1.00 51.14  ?  67   SER C O     1 
ATOM   3749  C  CB    . SER C 2 67   ? -31.016 21.316  50.287  1.00 53.88  ?  67   SER C CB    1 
ATOM   3750  O  OG    . SER C 2 67   ? -31.766 20.302  49.645  1.00 55.09  ?  67   SER C OG    1 
ATOM   3751  N  N     . PRO C 2 68   ? -33.377 22.527  52.011  1.00 44.76  ?  68   PRO C N     1 
ATOM   3752  C  CA    . PRO C 2 68   ? -34.834 22.601  52.204  1.00 44.79  ?  68   PRO C CA    1 
ATOM   3753  C  C     . PRO C 2 68   ? -35.623 21.832  51.160  1.00 55.32  ?  68   PRO C C     1 
ATOM   3754  O  O     . PRO C 2 68   ? -36.723 21.352  51.463  1.00 63.40  ?  68   PRO C O     1 
ATOM   3755  C  CB    . PRO C 2 68   ? -35.120 24.107  52.132  1.00 47.46  ?  68   PRO C CB    1 
ATOM   3756  C  CG    . PRO C 2 68   ? -33.827 24.756  52.494  1.00 50.82  ?  68   PRO C CG    1 
ATOM   3757  C  CD    . PRO C 2 68   ? -32.762 23.863  51.933  1.00 51.87  ?  68   PRO C CD    1 
ATOM   3758  N  N     . ARG C 2 69   ? -35.101 21.702  49.938  1.00 52.29  ?  69   ARG C N     1 
ATOM   3759  C  CA    . ARG C 2 69   ? -35.806 20.939  48.911  1.00 53.94  ?  69   ARG C CA    1 
ATOM   3760  C  C     . ARG C 2 69   ? -35.938 19.476  49.313  1.00 51.79  ?  69   ARG C C     1 
ATOM   3761  O  O     . ARG C 2 69   ? -37.025 18.892  49.232  1.00 59.97  ?  69   ARG C O     1 
ATOM   3762  C  CB    . ARG C 2 69   ? -35.082 21.056  47.570  1.00 56.38  ?  69   ARG C CB    1 
ATOM   3763  C  CG    . ARG C 2 69   ? -34.978 22.463  47.011  1.00 61.40  ?  69   ARG C CG    1 
ATOM   3764  C  CD    . ARG C 2 69   ? -34.884 22.414  45.495  1.00 73.10  ?  69   ARG C CD    1 
ATOM   3765  N  NE    . ARG C 2 69   ? -34.410 21.112  45.030  1.00 72.65  ?  69   ARG C NE    1 
ATOM   3766  C  CZ    . ARG C 2 69   ? -34.447 20.709  43.765  1.00 74.28  ?  69   ARG C CZ    1 
ATOM   3767  N  NH1   . ARG C 2 69   ? -34.938 21.505  42.826  1.00 81.02  ?  69   ARG C NH1   1 
ATOM   3768  N  NH2   . ARG C 2 69   ? -33.995 19.505  43.438  1.00 66.10  ?  69   ARG C NH2   1 
ATOM   3769  N  N     . TRP C 2 70   ? -34.832 18.865  49.746  1.00 54.97  ?  70   TRP C N     1 
ATOM   3770  C  CA    . TRP C 2 70   ? -34.875 17.471  50.173  1.00 58.22  ?  70   TRP C CA    1 
ATOM   3771  C  C     . TRP C 2 70   ? -35.754 17.296  51.405  1.00 58.04  ?  70   TRP C C     1 
ATOM   3772  O  O     . TRP C 2 70   ? -36.473 16.297  51.526  1.00 57.66  ?  70   TRP C O     1 
ATOM   3773  C  CB    . TRP C 2 70   ? -33.459 16.964  50.449  1.00 54.08  ?  70   TRP C CB    1 
ATOM   3774  C  CG    . TRP C 2 70   ? -33.421 15.786  51.372  1.00 49.56  ?  70   TRP C CG    1 
ATOM   3775  C  CD1   . TRP C 2 70   ? -33.540 14.471  51.030  1.00 48.34  ?  70   TRP C CD1   1 
ATOM   3776  C  CD2   . TRP C 2 70   ? -33.255 15.817  52.795  1.00 56.67  ?  70   TRP C CD2   1 
ATOM   3777  N  NE1   . TRP C 2 70   ? -33.459 13.681  52.151  1.00 53.42  ?  70   TRP C NE1   1 
ATOM   3778  C  CE2   . TRP C 2 70   ? -33.285 14.484  53.248  1.00 57.00  ?  70   TRP C CE2   1 
ATOM   3779  C  CE3   . TRP C 2 70   ? -33.088 16.844  53.730  1.00 52.77  ?  70   TRP C CE3   1 
ATOM   3780  C  CZ2   . TRP C 2 70   ? -33.150 14.150  54.594  1.00 51.35  ?  70   TRP C CZ2   1 
ATOM   3781  C  CZ3   . TRP C 2 70   ? -32.954 16.510  55.065  1.00 48.56  ?  70   TRP C CZ3   1 
ATOM   3782  C  CH2   . TRP C 2 70   ? -32.987 15.175  55.484  1.00 44.60  ?  70   TRP C CH2   1 
ATOM   3783  N  N     . ARG C 2 71   ? -35.709 18.256  52.330  1.00 59.51  ?  71   ARG C N     1 
ATOM   3784  C  CA    . ARG C 2 71   ? -36.511 18.154  53.545  1.00 60.74  ?  71   ARG C CA    1 
ATOM   3785  C  C     . ARG C 2 71   ? -38.001 18.206  53.226  1.00 65.14  ?  71   ARG C C     1 
ATOM   3786  O  O     . ARG C 2 71   ? -38.788 17.415  53.760  1.00 68.77  ?  71   ARG C O     1 
ATOM   3787  C  CB    . ARG C 2 71   ? -36.127 19.264  54.523  1.00 57.67  ?  71   ARG C CB    1 
ATOM   3788  C  CG    . ARG C 2 71   ? -36.944 19.270  55.804  1.00 63.61  ?  71   ARG C CG    1 
ATOM   3789  C  CD    . ARG C 2 71   ? -36.404 20.284  56.798  1.00 61.19  ?  71   ARG C CD    1 
ATOM   3790  N  NE    . ARG C 2 71   ? -35.005 20.027  57.124  1.00 58.37  ?  71   ARG C NE    1 
ATOM   3791  C  CZ    . ARG C 2 71   ? -34.600 19.159  58.045  1.00 62.87  ?  71   ARG C CZ    1 
ATOM   3792  N  NH1   . ARG C 2 71   ? -35.489 18.458  58.736  1.00 54.25  ?  71   ARG C NH1   1 
ATOM   3793  N  NH2   . ARG C 2 71   ? -33.305 18.989  58.275  1.00 61.08  ?  71   ARG C NH2   1 
ATOM   3794  N  N     . GLU C 2 72   ? -38.407 19.133  52.356  1.00 59.32  ?  72   GLU C N     1 
ATOM   3795  C  CA    . GLU C 2 72   ? -39.808 19.196  51.951  1.00 63.12  ?  72   GLU C CA    1 
ATOM   3796  C  C     . GLU C 2 72   ? -40.214 17.943  51.188  1.00 64.02  ?  72   GLU C C     1 
ATOM   3797  O  O     . GLU C 2 72   ? -41.351 17.471  51.312  1.00 67.08  ?  72   GLU C O     1 
ATOM   3798  C  CB    . GLU C 2 72   ? -40.058 20.446  51.107  1.00 65.41  ?  72   GLU C CB    1 
ATOM   3799  C  CG    . GLU C 2 72   ? -39.929 21.752  51.874  1.00 82.74  ?  72   GLU C CG    1 
ATOM   3800  C  CD    . GLU C 2 72   ? -40.178 22.967  51.001  1.00 97.16  ?  72   GLU C CD    1 
ATOM   3801  O  OE1   . GLU C 2 72   ? -40.155 22.825  49.760  1.00 84.57  ?  72   GLU C OE1   1 
ATOM   3802  O  OE2   . GLU C 2 72   ? -40.400 24.064  51.555  1.00 103.61 ?  72   GLU C OE2   1 
ATOM   3803  N  N     . SER C 2 73   ? -39.296 17.387  50.394  1.00 65.08  ?  73   SER C N     1 
ATOM   3804  C  CA    . SER C 2 73   ? -39.580 16.135  49.700  1.00 70.26  ?  73   SER C CA    1 
ATOM   3805  C  C     . SER C 2 73   ? -39.744 14.985  50.686  1.00 67.13  ?  73   SER C C     1 
ATOM   3806  O  O     . SER C 2 73   ? -40.649 14.157  50.539  1.00 73.03  ?  73   SER C O     1 
ATOM   3807  C  CB    . SER C 2 73   ? -38.471 15.830  48.694  1.00 72.50  ?  73   SER C CB    1 
ATOM   3808  O  OG    . SER C 2 73   ? -38.625 14.533  48.143  1.00 81.19  ?  73   SER C OG    1 
ATOM   3809  N  N     . ALA C 2 74   ? -38.879 14.920  51.700  1.00 69.08  ?  74   ALA C N     1 
ATOM   3810  C  CA    . ALA C 2 74   ? -39.002 13.890  52.724  1.00 69.85  ?  74   ALA C CA    1 
ATOM   3811  C  C     . ALA C 2 74   ? -40.215 14.109  53.618  1.00 68.74  ?  74   ALA C C     1 
ATOM   3812  O  O     . ALA C 2 74   ? -40.724 13.146  54.200  1.00 69.82  ?  74   ALA C O     1 
ATOM   3813  C  CB    . ALA C 2 74   ? -37.733 13.836  53.572  1.00 60.65  ?  74   ALA C CB    1 
ATOM   3814  N  N     . ALA C 2 75   ? -40.691 15.350  53.734  1.00 67.08  ?  75   ALA C N     1 
ATOM   3815  C  CA    . ALA C 2 75   ? -41.863 15.617  54.562  1.00 68.65  ?  75   ALA C CA    1 
ATOM   3816  C  C     . ALA C 2 75   ? -43.110 14.968  53.974  1.00 73.00  ?  75   ALA C C     1 
ATOM   3817  O  O     . ALA C 2 75   ? -43.832 14.244  54.670  1.00 81.97  ?  75   ALA C O     1 
ATOM   3818  C  CB    . ALA C 2 75   ? -42.064 17.123  54.721  1.00 60.83  ?  75   ALA C CB    1 
ATOM   3819  N  N     . GLU C 2 76   ? -43.379 15.216  52.691  1.00 81.69  ?  76   GLU C N     1 
ATOM   3820  C  CA    . GLU C 2 76   ? -44.512 14.581  52.031  1.00 85.93  ?  76   GLU C CA    1 
ATOM   3821  C  C     . GLU C 2 76   ? -44.287 13.095  51.787  1.00 80.70  ?  76   GLU C C     1 
ATOM   3822  O  O     . GLU C 2 76   ? -45.250 12.381  51.488  1.00 85.61  ?  76   GLU C O     1 
ATOM   3823  C  CB    . GLU C 2 76   ? -44.815 15.281  50.704  1.00 88.17  ?  76   GLU C CB    1 
ATOM   3824  C  CG    . GLU C 2 76   ? -43.726 15.132  49.655  1.00 97.17  ?  76   GLU C CG    1 
ATOM   3825  C  CD    . GLU C 2 76   ? -44.120 15.733  48.320  1.00 109.55 ?  76   GLU C CD    1 
ATOM   3826  O  OE1   . GLU C 2 76   ? -45.211 16.336  48.237  1.00 112.56 ?  76   GLU C OE1   1 
ATOM   3827  O  OE2   . GLU C 2 76   ? -43.341 15.600  47.353  1.00 108.86 ?  76   GLU C OE2   1 
ATOM   3828  N  N     . ARG C 2 77   ? -43.047 12.617  51.906  1.00 74.14  ?  77   ARG C N     1 
ATOM   3829  C  CA    . ARG C 2 77   ? -42.753 11.197  51.769  1.00 78.05  ?  77   ARG C CA    1 
ATOM   3830  C  C     . ARG C 2 77   ? -43.235 10.384  52.965  1.00 83.89  ?  77   ARG C C     1 
ATOM   3831  O  O     . ARG C 2 77   ? -43.219 9.150   52.903  1.00 80.73  ?  77   ARG C O     1 
ATOM   3832  C  CB    . ARG C 2 77   ? -41.246 11.005  51.564  1.00 81.02  ?  77   ARG C CB    1 
ATOM   3833  C  CG    . ARG C 2 77   ? -40.837 9.650   51.001  1.00 75.37  ?  77   ARG C CG    1 
ATOM   3834  C  CD    . ARG C 2 77   ? -39.455 9.712   50.365  1.00 85.08  ?  77   ARG C CD    1 
ATOM   3835  N  NE    . ARG C 2 77   ? -38.425 10.134  51.311  1.00 86.62  ?  77   ARG C NE    1 
ATOM   3836  C  CZ    . ARG C 2 77   ? -37.169 10.412  50.972  1.00 87.93  ?  77   ARG C CZ    1 
ATOM   3837  N  NH1   . ARG C 2 77   ? -36.785 10.318  49.706  1.00 92.56  ?  77   ARG C NH1   1 
ATOM   3838  N  NH2   . ARG C 2 77   ? -36.298 10.788  51.899  1.00 79.45  ?  77   ARG C NH2   1 
ATOM   3839  N  N     . GLY C 2 78   ? -43.675 11.041  54.037  1.00 77.56  ?  78   GLY C N     1 
ATOM   3840  C  CA    . GLY C 2 78   ? -44.115 10.364  55.238  1.00 75.54  ?  78   GLY C CA    1 
ATOM   3841  C  C     . GLY C 2 78   ? -43.076 10.279  56.332  1.00 73.30  ?  78   GLY C C     1 
ATOM   3842  O  O     . GLY C 2 78   ? -43.383 9.771   57.418  1.00 72.47  ?  78   GLY C O     1 
ATOM   3843  N  N     . ASP C 2 79   ? -41.861 10.762  56.082  1.00 72.63  ?  79   ASP C N     1 
ATOM   3844  C  CA    . ASP C 2 79   ? -40.797 10.692  57.071  1.00 78.76  ?  79   ASP C CA    1 
ATOM   3845  C  C     . ASP C 2 79   ? -41.135 11.539  58.293  1.00 72.84  ?  79   ASP C C     1 
ATOM   3846  O  O     . ASP C 2 79   ? -41.790 12.580  58.198  1.00 69.34  ?  79   ASP C O     1 
ATOM   3847  C  CB    . ASP C 2 79   ? -39.477 11.162  56.459  1.00 78.03  ?  79   ASP C CB    1 
ATOM   3848  C  CG    . ASP C 2 79   ? -38.878 10.143  55.512  1.00 79.72  ?  79   ASP C CG    1 
ATOM   3849  O  OD1   . ASP C 2 79   ? -37.937 9.429   55.921  1.00 81.47  ?  79   ASP C OD1   1 
ATOM   3850  O  OD2   . ASP C 2 79   ? -39.359 10.042  54.365  1.00 77.54  ?  79   ASP C OD2   1 
ATOM   3851  N  N     . VAL C 2 80   ? -40.679 11.075  59.452  1.00 73.03  ?  80   VAL C N     1 
ATOM   3852  C  CA    . VAL C 2 80   ? -40.822 11.794  60.712  1.00 71.56  ?  80   VAL C CA    1 
ATOM   3853  C  C     . VAL C 2 80   ? -39.425 12.011  61.276  1.00 70.16  ?  80   VAL C C     1 
ATOM   3854  O  O     . VAL C 2 80   ? -38.691 11.044  61.522  1.00 72.43  ?  80   VAL C O     1 
ATOM   3855  C  CB    . VAL C 2 80   ? -41.720 11.040  61.706  1.00 66.49  ?  80   VAL C CB    1 
ATOM   3856  C  CG1   . VAL C 2 80   ? -41.513 9.540   61.580  1.00 68.74  ?  80   VAL C CG1   1 
ATOM   3857  C  CG2   . VAL C 2 80   ? -41.451 11.506  63.130  1.00 65.31  ?  80   VAL C CG2   1 
ATOM   3858  N  N     . ASN C 2 81   ? -39.060 13.278  61.468  1.00 70.77  ?  81   ASN C N     1 
ATOM   3859  C  CA    . ASN C 2 81   ? -37.724 13.692  61.884  1.00 72.31  ?  81   ASN C CA    1 
ATOM   3860  C  C     . ASN C 2 81   ? -36.663 13.125  60.947  1.00 71.87  ?  81   ASN C C     1 
ATOM   3861  O  O     . ASN C 2 81   ? -35.861 12.279  61.362  1.00 67.77  ?  81   ASN C O     1 
ATOM   3862  C  CB    . ASN C 2 81   ? -37.448 13.258  63.326  1.00 84.27  ?  81   ASN C CB    1 
ATOM   3863  C  CG    . ASN C 2 81   ? -38.381 13.918  64.320  1.00 78.51  ?  81   ASN C CG    1 
ATOM   3864  O  OD1   . ASN C 2 81   ? -38.898 15.007  64.073  1.00 74.16  ?  81   ASN C OD1   1 
ATOM   3865  N  ND2   . ASN C 2 81   ? -38.598 13.263  65.455  1.00 77.76  ?  81   ASN C ND2   1 
ATOM   3866  N  N     . PRO C 2 82   ? -36.618 13.555  59.687  1.00 70.81  ?  82   PRO C N     1 
ATOM   3867  C  CA    . PRO C 2 82   ? -35.567 13.073  58.787  1.00 60.52  ?  82   PRO C CA    1 
ATOM   3868  C  C     . PRO C 2 82   ? -34.235 13.736  59.097  1.00 59.44  ?  82   PRO C C     1 
ATOM   3869  O  O     . PRO C 2 82   ? -34.164 14.819  59.683  1.00 58.82  ?  82   PRO C O     1 
ATOM   3870  C  CB    . PRO C 2 82   ? -36.078 13.470  57.400  1.00 65.52  ?  82   PRO C CB    1 
ATOM   3871  C  CG    . PRO C 2 82   ? -36.893 14.687  57.653  1.00 58.58  ?  82   PRO C CG    1 
ATOM   3872  C  CD    . PRO C 2 82   ? -37.530 14.496  59.009  1.00 68.60  ?  82   PRO C CD    1 
ATOM   3873  N  N     . VAL C 2 83   ? -33.163 13.061  58.693  1.00 52.87  ?  83   VAL C N     1 
ATOM   3874  C  CA    . VAL C 2 83   ? -31.804 13.490  58.997  1.00 57.42  ?  83   VAL C CA    1 
ATOM   3875  C  C     . VAL C 2 83   ? -30.990 13.491  57.712  1.00 55.25  ?  83   VAL C C     1 
ATOM   3876  O  O     . VAL C 2 83   ? -30.928 12.476  57.009  1.00 47.75  ?  83   VAL C O     1 
ATOM   3877  C  CB    . VAL C 2 83   ? -31.144 12.585  60.054  1.00 55.73  ?  83   VAL C CB    1 
ATOM   3878  C  CG1   . VAL C 2 83   ? -29.657 12.839  60.110  1.00 61.25  ?  83   VAL C CG1   1 
ATOM   3879  C  CG2   . VAL C 2 83   ? -31.765 12.833  61.410  1.00 58.97  ?  83   VAL C CG2   1 
ATOM   3880  N  N     . GLY C 2 84   ? -30.363 14.625  57.413  1.00 49.14  ?  84   GLY C N     1 
ATOM   3881  C  CA    . GLY C 2 84   ? -29.513 14.726  56.247  1.00 45.95  ?  84   GLY C CA    1 
ATOM   3882  C  C     . GLY C 2 84   ? -28.217 13.953  56.409  1.00 48.65  ?  84   GLY C C     1 
ATOM   3883  O  O     . GLY C 2 84   ? -27.888 13.426  57.472  1.00 55.64  ?  84   GLY C O     1 
ATOM   3884  N  N     . GLY C 2 85   ? -27.463 13.893  55.309  1.00 53.76  ?  85   GLY C N     1 
ATOM   3885  C  CA    . GLY C 2 85   ? -26.217 13.141  55.317  1.00 51.08  ?  85   GLY C CA    1 
ATOM   3886  C  C     . GLY C 2 85   ? -25.203 13.687  56.305  1.00 49.48  ?  85   GLY C C     1 
ATOM   3887  O  O     . GLY C 2 85   ? -24.551 12.925  57.023  1.00 43.42  ?  85   GLY C O     1 
ATOM   3888  N  N     . LEU C 2 86   ? -25.055 15.012  56.355  1.00 30.46  ?  86   LEU C N     1 
ATOM   3889  C  CA    . LEU C 2 86   ? -24.122 15.614  57.303  1.00 33.89  ?  86   LEU C CA    1 
ATOM   3890  C  C     . LEU C 2 86   ? -24.604 15.437  58.736  1.00 44.83  ?  86   LEU C C     1 
ATOM   3891  O  O     . LEU C 2 86   ? -23.822 15.082  59.626  1.00 39.85  ?  86   LEU C O     1 
ATOM   3892  C  CB    . LEU C 2 86   ? -23.923 17.094  56.984  1.00 38.01  ?  86   LEU C CB    1 
ATOM   3893  C  CG    . LEU C 2 86   ? -22.799 17.426  56.004  1.00 35.95  ?  86   LEU C CG    1 
ATOM   3894  C  CD1   . LEU C 2 86   ? -22.600 18.927  55.928  1.00 33.30  ?  86   LEU C CD1   1 
ATOM   3895  C  CD2   . LEU C 2 86   ? -21.512 16.733  56.418  1.00 29.29  ?  86   LEU C CD2   1 
ATOM   3896  N  N     . GLU C 2 87   ? -25.893 15.687  58.980  1.00 51.86  ?  87   GLU C N     1 
ATOM   3897  C  CA    . GLU C 2 87   ? -26.443 15.494  60.317  1.00 46.31  ?  87   GLU C CA    1 
ATOM   3898  C  C     . GLU C 2 87   ? -26.340 14.039  60.755  1.00 44.75  ?  87   GLU C C     1 
ATOM   3899  O  O     . GLU C 2 87   ? -26.227 13.756  61.953  1.00 53.42  ?  87   GLU C O     1 
ATOM   3900  C  CB    . GLU C 2 87   ? -27.899 15.959  60.354  1.00 45.78  ?  87   GLU C CB    1 
ATOM   3901  C  CG    . GLU C 2 87   ? -28.149 17.279  59.643  1.00 62.23  ?  87   GLU C CG    1 
ATOM   3902  C  CD    . GLU C 2 87   ? -29.623 17.530  59.387  1.00 72.98  ?  87   GLU C CD    1 
ATOM   3903  O  OE1   . GLU C 2 87   ? -30.457 16.759  59.908  1.00 71.88  ?  87   GLU C OE1   1 
ATOM   3904  O  OE2   . GLU C 2 87   ? -29.947 18.492  58.660  1.00 73.62  ?  87   GLU C OE2   1 
ATOM   3905  N  N     . GLU C 2 88   ? -26.371 13.107  59.799  1.00 48.55  ?  88   GLU C N     1 
ATOM   3906  C  CA    . GLU C 2 88   ? -26.229 11.693  60.129  1.00 46.94  ?  88   GLU C CA    1 
ATOM   3907  C  C     . GLU C 2 88   ? -24.817 11.368  60.596  1.00 48.17  ?  88   GLU C C     1 
ATOM   3908  O  O     . GLU C 2 88   ? -24.635 10.506  61.463  1.00 52.55  ?  88   GLU C O     1 
ATOM   3909  C  CB    . GLU C 2 88   ? -26.606 10.840  58.918  1.00 51.61  ?  88   GLU C CB    1 
ATOM   3910  C  CG    . GLU C 2 88   ? -26.558 9.342   59.152  1.00 55.41  ?  88   GLU C CG    1 
ATOM   3911  C  CD    . GLU C 2 88   ? -26.992 8.556   57.930  1.00 72.03  ?  88   GLU C CD    1 
ATOM   3912  O  OE1   . GLU C 2 88   ? -27.525 9.174   56.985  1.00 75.69  ?  88   GLU C OE1   1 
ATOM   3913  O  OE2   . GLU C 2 88   ? -26.798 7.322   57.913  1.00 73.88  ?  88   GLU C OE2   1 
ATOM   3914  N  N     . VAL C 2 89   ? -23.811 12.048  60.043  1.00 40.14  ?  89   VAL C N     1 
ATOM   3915  C  CA    . VAL C 2 89   ? -22.433 11.809  60.460  1.00 39.74  ?  89   VAL C CA    1 
ATOM   3916  C  C     . VAL C 2 89   ? -22.191 12.359  61.860  1.00 43.63  ?  89   VAL C C     1 
ATOM   3917  O  O     . VAL C 2 89   ? -21.533 11.719  62.689  1.00 51.44  ?  89   VAL C O     1 
ATOM   3918  C  CB    . VAL C 2 89   ? -21.457 12.413  59.434  1.00 40.49  ?  89   VAL C CB    1 
ATOM   3919  C  CG1   . VAL C 2 89   ? -20.041 12.433  59.986  1.00 38.00  ?  89   VAL C CG1   1 
ATOM   3920  C  CG2   . VAL C 2 89   ? -21.508 11.628  58.135  1.00 44.56  ?  89   VAL C CG2   1 
ATOM   3921  N  N     . LEU C 2 90   ? -22.725 13.548  62.152  1.00 43.42  ?  90   LEU C N     1 
ATOM   3922  C  CA    . LEU C 2 90   ? -22.471 14.173  63.445  1.00 40.14  ?  90   LEU C CA    1 
ATOM   3923  C  C     . LEU C 2 90   ? -23.132 13.407  64.585  1.00 53.13  ?  90   LEU C C     1 
ATOM   3924  O  O     . LEU C 2 90   ? -22.580 13.344  65.689  1.00 59.75  ?  90   LEU C O     1 
ATOM   3925  C  CB    . LEU C 2 90   ? -22.949 15.624  63.426  1.00 37.97  ?  90   LEU C CB    1 
ATOM   3926  C  CG    . LEU C 2 90   ? -22.329 16.516  62.347  1.00 30.06  ?  90   LEU C CG    1 
ATOM   3927  C  CD1   . LEU C 2 90   ? -22.815 17.948  62.495  1.00 33.02  ?  90   LEU C CD1   1 
ATOM   3928  C  CD2   . LEU C 2 90   ? -20.808 16.449  62.394  1.00 29.87  ?  90   LEU C CD2   1 
ATOM   3929  N  N     . TYR C 2 91   ? -24.301 12.813  64.339  1.00 64.67  ?  91   TYR C N     1 
ATOM   3930  C  CA    . TYR C 2 91   ? -24.984 12.071  65.393  1.00 59.45  ?  91   TYR C CA    1 
ATOM   3931  C  C     . TYR C 2 91   ? -24.311 10.728  65.655  1.00 58.17  ?  91   TYR C C     1 
ATOM   3932  O  O     . TYR C 2 91   ? -24.228 10.288  66.807  1.00 78.59  ?  91   TYR C O     1 
ATOM   3933  C  CB    . TYR C 2 91   ? -26.459 11.873  65.041  1.00 62.58  ?  91   TYR C CB    1 
ATOM   3934  C  CG    . TYR C 2 91   ? -27.306 13.124  65.162  1.00 74.40  ?  91   TYR C CG    1 
ATOM   3935  C  CD1   . TYR C 2 91   ? -26.738 14.344  65.513  1.00 71.89  ?  91   TYR C CD1   1 
ATOM   3936  C  CD2   . TYR C 2 91   ? -28.677 13.082  64.938  1.00 81.37  ?  91   TYR C CD2   1 
ATOM   3937  C  CE1   . TYR C 2 91   ? -27.508 15.486  65.624  1.00 79.98  ?  91   TYR C CE1   1 
ATOM   3938  C  CE2   . TYR C 2 91   ? -29.456 14.221  65.050  1.00 80.24  ?  91   TYR C CE2   1 
ATOM   3939  C  CZ    . TYR C 2 91   ? -28.866 15.418  65.393  1.00 84.85  ?  91   TYR C CZ    1 
ATOM   3940  O  OH    . TYR C 2 91   ? -29.639 16.552  65.505  1.00 85.78  ?  91   TYR C OH    1 
ATOM   3941  N  N     . GLU C 2 92   ? -23.829 10.063  64.601  1.00 51.32  ?  92   GLU C N     1 
ATOM   3942  C  CA    . GLU C 2 92   ? -23.074 8.829   64.794  1.00 61.93  ?  92   GLU C CA    1 
ATOM   3943  C  C     . GLU C 2 92   ? -21.767 9.082   65.530  1.00 66.44  ?  92   GLU C C     1 
ATOM   3944  O  O     . GLU C 2 92   ? -21.321 8.233   66.312  1.00 71.12  ?  92   GLU C O     1 
ATOM   3945  C  CB    . GLU C 2 92   ? -22.798 8.157   63.448  1.00 69.37  ?  92   GLU C CB    1 
ATOM   3946  C  CG    . GLU C 2 92   ? -24.037 7.656   62.725  1.00 81.20  ?  92   GLU C CG    1 
ATOM   3947  C  CD    . GLU C 2 92   ? -23.702 6.963   61.417  1.00 92.60  ?  92   GLU C CD    1 
ATOM   3948  O  OE1   . GLU C 2 92   ? -22.557 6.481   61.272  1.00 96.18  ?  92   GLU C OE1   1 
ATOM   3949  O  OE2   . GLU C 2 92   ? -24.581 6.905   60.530  1.00 87.58  ?  92   GLU C OE2   1 
ATOM   3950  N  N     . LEU C 2 93   ? -21.143 10.236  65.294  1.00 69.00  ?  93   LEU C N     1 
ATOM   3951  C  CA    . LEU C 2 93   ? -19.890 10.572  65.961  1.00 70.37  ?  93   LEU C CA    1 
ATOM   3952  C  C     . LEU C 2 93   ? -20.123 10.995  67.407  1.00 77.56  ?  93   LEU C C     1 
ATOM   3953  O  O     . LEU C 2 93   ? -19.411 10.549  68.315  1.00 81.71  ?  93   LEU C O     1 
ATOM   3954  C  CB    . LEU C 2 93   ? -19.171 11.683  65.192  1.00 64.73  ?  93   LEU C CB    1 
ATOM   3955  C  CG    . LEU C 2 93   ? -18.045 12.427  65.916  1.00 72.08  ?  93   LEU C CG    1 
ATOM   3956  C  CD1   . LEU C 2 93   ? -16.884 11.498  66.226  1.00 83.95  ?  93   LEU C CD1   1 
ATOM   3957  C  CD2   . LEU C 2 93   ? -17.576 13.620  65.095  1.00 62.53  ?  93   LEU C CD2   1 
ATOM   3958  N  N     . SER C 2 94   ? -21.115 11.848  67.637  1.00 80.22  ?  94   SER C N     1 
ATOM   3959  C  CA    . SER C 2 94   ? -21.350 12.372  68.974  1.00 86.96  ?  94   SER C CA    1 
ATOM   3960  C  C     . SER C 2 94   ? -21.878 11.270  69.892  1.00 88.20  ?  94   SER C C     1 
ATOM   3961  O  O     . SER C 2 94   ? -22.712 10.459  69.476  1.00 79.22  ?  94   SER C O     1 
ATOM   3962  C  CB    . SER C 2 94   ? -22.344 13.532  68.925  1.00 86.58  ?  94   SER C CB    1 
ATOM   3963  O  OG    . SER C 2 94   ? -22.604 14.039  70.222  1.00 97.29  ?  94   SER C OG    1 
ATOM   3964  N  N     . PRO C 2 95   ? -21.414 11.214  71.151  1.00 81.16  ?  95   PRO C N     1 
ATOM   3965  C  CA    . PRO C 2 95   ? -20.376 12.104  71.675  1.00 80.29  ?  95   PRO C CA    1 
ATOM   3966  C  C     . PRO C 2 95   ? -18.994 11.456  71.716  1.00 81.45  ?  95   PRO C C     1 
ATOM   3967  O  O     . PRO C 2 95   ? -18.851 10.276  71.390  1.00 83.21  ?  95   PRO C O     1 
ATOM   3968  C  CB    . PRO C 2 95   ? -20.873 12.398  73.086  1.00 78.99  ?  95   PRO C CB    1 
ATOM   3969  C  CG    . PRO C 2 95   ? -21.522 11.108  73.496  1.00 87.36  ?  95   PRO C CG    1 
ATOM   3970  C  CD    . PRO C 2 95   ? -22.079 10.469  72.234  1.00 81.88  ?  95   PRO C CD    1 
ATOM   3971  N  N     . ILE C 2 96   ? -17.989 12.230  72.118  1.00 85.52  ?  96   ILE C N     1 
ATOM   3972  C  CA    . ILE C 2 96   ? -16.620 11.749  72.272  1.00 94.54  ?  96   ILE C CA    1 
ATOM   3973  C  C     . ILE C 2 96   ? -16.272 11.812  73.752  1.00 106.04 ?  96   ILE C C     1 
ATOM   3974  O  O     . ILE C 2 96   ? -16.370 12.877  74.374  1.00 107.57 ?  96   ILE C O     1 
ATOM   3975  C  CB    . ILE C 2 96   ? -15.630 12.574  71.438  1.00 98.16  ?  96   ILE C CB    1 
ATOM   3976  C  CG1   . ILE C 2 96   ? -16.244 12.951  70.090  1.00 95.01  ?  96   ILE C CG1   1 
ATOM   3977  C  CG2   . ILE C 2 96   ? -14.348 11.795  71.220  1.00 96.25  ?  96   ILE C CG2   1 
ATOM   3978  C  CD1   . ILE C 2 96   ? -15.339 13.810  69.232  1.00 83.93  ?  96   ILE C CD1   1 
ATOM   3979  N  N     . GLU C 2 97   ? -15.866 10.677  74.317  1.00 109.07 ?  97   GLU C N     1 
ATOM   3980  C  CA    . GLU C 2 97   ? -15.568 10.589  75.738  1.00 113.80 ?  97   GLU C CA    1 
ATOM   3981  C  C     . GLU C 2 97   ? -14.302 9.773   75.947  1.00 114.92 ?  97   GLU C C     1 
ATOM   3982  O  O     . GLU C 2 97   ? -13.942 8.930   75.121  1.00 108.94 ?  97   GLU C O     1 
ATOM   3983  C  CB    . GLU C 2 97   ? -16.730 9.958   76.520  1.00 109.94 ?  97   GLU C CB    1 
ATOM   3984  C  CG    . GLU C 2 97   ? -18.016 10.766  76.486  1.00 103.80 ?  97   GLU C CG    1 
ATOM   3985  C  CD    . GLU C 2 97   ? -19.210 9.977   76.982  1.00 106.85 ?  97   GLU C CD    1 
ATOM   3986  O  OE1   . GLU C 2 97   ? -19.059 8.761   77.224  1.00 106.61 ?  97   GLU C OE1   1 
ATOM   3987  O  OE2   . GLU C 2 97   ? -20.299 10.571  77.127  1.00 110.71 ?  97   GLU C OE2   1 
ATOM   3988  N  N     . ASP C 2 98   ? -13.630 10.034  77.065  1.00 126.83 ?  98   ASP C N     1 
ATOM   3989  C  CA    . ASP C 2 98   ? -12.432 9.300   77.435  1.00 130.77 ?  98   ASP C CA    1 
ATOM   3990  C  C     . ASP C 2 98   ? -12.821 8.064   78.245  1.00 136.59 ?  98   ASP C C     1 
ATOM   3991  O  O     . ASP C 2 98   ? -14.001 7.738   78.401  1.00 138.36 ?  98   ASP C O     1 
ATOM   3992  C  CB    . ASP C 2 98   ? -11.472 10.213  78.197  1.00 129.93 ?  98   ASP C CB    1 
ATOM   3993  C  CG    . ASP C 2 98   ? -12.113 10.852  79.413  1.00 136.89 ?  98   ASP C CG    1 
ATOM   3994  O  OD1   . ASP C 2 98   ? -13.313 11.194  79.347  1.00 135.35 ?  98   ASP C OD1   1 
ATOM   3995  O  OD2   . ASP C 2 98   ? -11.415 11.015  80.436  1.00 136.96 ?  98   ASP C OD2   1 
ATOM   3996  N  N     . PHE C 2 99   ? -11.818 7.357   78.770  1.00 151.74 ?  99   PHE C N     1 
ATOM   3997  C  CA    . PHE C 2 99   ? -12.081 6.145   79.540  1.00 160.27 ?  99   PHE C CA    1 
ATOM   3998  C  C     . PHE C 2 99   ? -12.838 6.444   80.826  1.00 160.23 ?  99   PHE C C     1 
ATOM   3999  O  O     . PHE C 2 99   ? -13.594 5.595   81.314  1.00 160.20 ?  99   PHE C O     1 
ATOM   4000  C  CB    . PHE C 2 99   ? -10.766 5.431   79.859  1.00 170.33 ?  99   PHE C CB    1 
ATOM   4001  C  CG    . PHE C 2 99   ? -9.847  6.222   80.751  1.00 175.62 ?  99   PHE C CG    1 
ATOM   4002  C  CD1   . PHE C 2 99   ? -9.699  5.888   82.087  1.00 179.04 ?  99   PHE C CD1   1 
ATOM   4003  C  CD2   . PHE C 2 99   ? -9.134  7.302   80.254  1.00 174.67 ?  99   PHE C CD2   1 
ATOM   4004  C  CE1   . PHE C 2 99   ? -8.854  6.614   82.908  1.00 182.67 ?  99   PHE C CE1   1 
ATOM   4005  C  CE2   . PHE C 2 99   ? -8.290  8.030   81.068  1.00 184.45 ?  99   PHE C CE2   1 
ATOM   4006  C  CZ    . PHE C 2 99   ? -8.150  7.687   82.397  1.00 191.21 ?  99   PHE C CZ    1 
ATOM   4007  N  N     . SER C 2 100  ? -12.652 7.639   81.389  1.00 152.98 ?  100  SER C N     1 
ATOM   4008  C  CA    . SER C 2 100  ? -13.303 7.978   82.649  1.00 143.38 ?  100  SER C CA    1 
ATOM   4009  C  C     . SER C 2 100  ? -14.720 8.493   82.431  1.00 133.89 ?  100  SER C C     1 
ATOM   4010  O  O     . SER C 2 100  ? -15.638 8.129   83.175  1.00 137.93 ?  100  SER C O     1 
ATOM   4011  C  CB    . SER C 2 100  ? -12.475 9.019   83.402  1.00 140.78 ?  100  SER C CB    1 
ATOM   4012  O  OG    . SER C 2 100  ? -12.371 10.220  82.656  1.00 127.49 ?  100  SER C OG    1 
ATOM   4013  N  N     . GLY C 2 101  ? -14.917 9.330   81.419  1.00 112.49 ?  101  GLY C N     1 
ATOM   4014  C  CA    . GLY C 2 101  ? -16.177 10.009  81.217  1.00 113.23 ?  101  GLY C CA    1 
ATOM   4015  C  C     . GLY C 2 101  ? -16.237 11.411  81.774  1.00 108.42 ?  101  GLY C C     1 
ATOM   4016  O  O     . GLY C 2 101  ? -17.329 11.987  81.839  1.00 102.79 ?  101  GLY C O     1 
ATOM   4017  N  N     . SER C 2 102  ? -15.100 11.978  82.183  1.00 113.71 ?  102  SER C N     1 
ATOM   4018  C  CA    . SER C 2 102  ? -15.071 13.327  82.731  1.00 116.94 ?  102  SER C CA    1 
ATOM   4019  C  C     . SER C 2 102  ? -15.128 14.401  81.655  1.00 123.75 ?  102  SER C C     1 
ATOM   4020  O  O     . SER C 2 102  ? -15.474 15.547  81.960  1.00 123.58 ?  102  SER C O     1 
ATOM   4021  C  CB    . SER C 2 102  ? -13.811 13.518  83.579  1.00 122.32 ?  102  SER C CB    1 
ATOM   4022  O  OG    . SER C 2 102  ? -13.684 14.861  84.013  1.00 126.78 ?  102  SER C OG    1 
ATOM   4023  N  N     . MET C 2 103  ? -14.802 14.059  80.412  1.00 130.63 ?  103  MET C N     1 
ATOM   4024  C  CA    . MET C 2 103  ? -14.779 15.006  79.308  1.00 122.82 ?  103  MET C CA    1 
ATOM   4025  C  C     . MET C 2 103  ? -15.674 14.501  78.185  1.00 127.29 ?  103  MET C C     1 
ATOM   4026  O  O     . MET C 2 103  ? -15.704 13.301  77.895  1.00 124.91 ?  103  MET C O     1 
ATOM   4027  C  CB    . MET C 2 103  ? -13.350 15.214  78.799  1.00 121.53 ?  103  MET C CB    1 
ATOM   4028  C  CG    . MET C 2 103  ? -12.398 15.741  79.861  1.00 122.34 ?  103  MET C CG    1 
ATOM   4029  S  SD    . MET C 2 103  ? -10.676 15.741  79.335  1.00 129.65 ?  103  MET C SD    1 
ATOM   4030  C  CE    . MET C 2 103  ? -10.380 13.984  79.159  1.00 128.90 ?  103  MET C CE    1 
ATOM   4031  N  N     . SER C 2 104  ? -16.402 15.421  77.556  1.00 124.29 ?  104  SER C N     1 
ATOM   4032  C  CA    . SER C 2 104  ? -17.341 15.062  76.503  1.00 118.84 ?  104  SER C CA    1 
ATOM   4033  C  C     . SER C 2 104  ? -17.389 16.168  75.459  1.00 112.55 ?  104  SER C C     1 
ATOM   4034  O  O     . SER C 2 104  ? -17.331 17.354  75.797  1.00 111.86 ?  104  SER C O     1 
ATOM   4035  C  CB    . SER C 2 104  ? -18.743 14.808  77.070  1.00 115.98 ?  104  SER C CB    1 
ATOM   4036  O  OG    . SER C 2 104  ? -19.664 14.502  76.037  1.00 110.23 ?  104  SER C OG    1 
ATOM   4037  N  N     . LEU C 2 105  ? -17.494 15.768  74.192  1.00 97.19  ?  105  LEU C N     1 
ATOM   4038  C  CA    . LEU C 2 105  ? -17.624 16.687  73.071  1.00 90.07  ?  105  LEU C CA    1 
ATOM   4039  C  C     . LEU C 2 105  ? -18.759 16.220  72.172  1.00 78.24  ?  105  LEU C C     1 
ATOM   4040  O  O     . LEU C 2 105  ? -18.951 15.016  71.978  1.00 74.52  ?  105  LEU C O     1 
ATOM   4041  C  CB    . LEU C 2 105  ? -16.319 16.783  72.267  1.00 79.87  ?  105  LEU C CB    1 
ATOM   4042  C  CG    . LEU C 2 105  ? -16.300 17.776  71.101  1.00 74.93  ?  105  LEU C CG    1 
ATOM   4043  C  CD1   . LEU C 2 105  ? -16.567 19.188  71.592  1.00 76.23  ?  105  LEU C CD1   1 
ATOM   4044  C  CD2   . LEU C 2 105  ? -14.979 17.711  70.354  1.00 81.51  ?  105  LEU C CD2   1 
ATOM   4045  N  N     . SER C 2 106  ? -19.509 17.174  71.626  1.00 70.90  ?  106  SER C N     1 
ATOM   4046  C  CA    . SER C 2 106  ? -20.668 16.868  70.801  1.00 75.30  ?  106  SER C CA    1 
ATOM   4047  C  C     . SER C 2 106  ? -20.783 17.889  69.679  1.00 78.43  ?  106  SER C C     1 
ATOM   4048  O  O     . SER C 2 106  ? -20.326 19.027  69.805  1.00 77.04  ?  106  SER C O     1 
ATOM   4049  C  CB    . SER C 2 106  ? -21.957 16.854  71.634  1.00 85.59  ?  106  SER C CB    1 
ATOM   4050  O  OG    . SER C 2 106  ? -22.063 18.025  72.423  1.00 93.34  ?  106  SER C OG    1 
ATOM   4051  N  N     . PHE C 2 107  ? -21.402 17.466  68.578  1.00 67.96  ?  107  PHE C N     1 
ATOM   4052  C  CA    . PHE C 2 107  ? -21.613 18.315  67.415  1.00 57.08  ?  107  PHE C CA    1 
ATOM   4053  C  C     . PHE C 2 107  ? -23.088 18.315  67.042  1.00 51.93  ?  107  PHE C C     1 
ATOM   4054  O  O     . PHE C 2 107  ? -23.793 17.320  67.234  1.00 51.68  ?  107  PHE C O     1 
ATOM   4055  C  CB    . PHE C 2 107  ? -20.781 17.849  66.214  1.00 48.94  ?  107  PHE C CB    1 
ATOM   4056  C  CG    . PHE C 2 107  ? -19.301 17.855  66.461  1.00 48.49  ?  107  PHE C CG    1 
ATOM   4057  C  CD1   . PHE C 2 107  ? -18.581 19.035  66.394  1.00 52.46  ?  107  PHE C CD1   1 
ATOM   4058  C  CD2   . PHE C 2 107  ? -18.628 16.679  66.749  1.00 52.29  ?  107  PHE C CD2   1 
ATOM   4059  C  CE1   . PHE C 2 107  ? -17.220 19.044  66.616  1.00 55.52  ?  107  PHE C CE1   1 
ATOM   4060  C  CE2   . PHE C 2 107  ? -17.264 16.683  66.972  1.00 55.50  ?  107  PHE C CE2   1 
ATOM   4061  C  CZ    . PHE C 2 107  ? -16.559 17.867  66.906  1.00 54.40  ?  107  PHE C CZ    1 
ATOM   4062  N  N     . SER C 2 108  ? -23.545 19.439  66.495  1.00 60.01  ?  108  SER C N     1 
ATOM   4063  C  CA    . SER C 2 108  ? -24.939 19.584  66.097  1.00 64.51  ?  108  SER C CA    1 
ATOM   4064  C  C     . SER C 2 108  ? -25.072 20.807  65.202  1.00 63.75  ?  108  SER C C     1 
ATOM   4065  O  O     . SER C 2 108  ? -24.197 21.678  65.176  1.00 66.37  ?  108  SER C O     1 
ATOM   4066  C  CB    . SER C 2 108  ? -25.864 19.709  67.313  1.00 77.74  ?  108  SER C CB    1 
ATOM   4067  O  OG    . SER C 2 108  ? -25.500 20.817  68.118  1.00 74.99  ?  108  SER C OG    1 
ATOM   4068  N  N     . ASP C 2 109  ? -26.184 20.852  64.466  1.00 60.95  ?  109  ASP C N     1 
ATOM   4069  C  CA    . ASP C 2 109  ? -26.582 21.972  63.619  1.00 66.21  ?  109  ASP C CA    1 
ATOM   4070  C  C     . ASP C 2 109  ? -25.513 22.321  62.589  1.00 73.74  ?  109  ASP C C     1 
ATOM   4071  O  O     . ASP C 2 109  ? -24.792 23.313  62.760  1.00 77.27  ?  109  ASP C O     1 
ATOM   4072  C  CB    . ASP C 2 109  ? -26.893 23.205  64.472  1.00 69.10  ?  109  ASP C CB    1 
ATOM   4073  C  CG    . ASP C 2 109  ? -27.805 24.193  63.763  1.00 78.22  ?  109  ASP C CG    1 
ATOM   4074  O  OD1   . ASP C 2 109  ? -28.706 24.750  64.426  1.00 79.90  ?  109  ASP C OD1   1 
ATOM   4075  O  OD2   . ASP C 2 109  ? -27.636 24.399  62.543  1.00 74.52  ?  109  ASP C OD2   1 
ATOM   4076  N  N     . PRO C 2 110  ? -25.376 21.548  61.513  1.00 63.34  ?  110  PRO C N     1 
ATOM   4077  C  CA    . PRO C 2 110  ? -24.496 21.969  60.419  1.00 53.23  ?  110  PRO C CA    1 
ATOM   4078  C  C     . PRO C 2 110  ? -25.201 22.952  59.496  1.00 50.40  ?  110  PRO C C     1 
ATOM   4079  O  O     . PRO C 2 110  ? -26.358 22.759  59.113  1.00 46.26  ?  110  PRO C O     1 
ATOM   4080  C  CB    . PRO C 2 110  ? -24.178 20.654  59.698  1.00 48.83  ?  110  PRO C CB    1 
ATOM   4081  C  CG    . PRO C 2 110  ? -25.388 19.815  59.933  1.00 57.98  ?  110  PRO C CG    1 
ATOM   4082  C  CD    . PRO C 2 110  ? -25.916 20.193  61.299  1.00 60.78  ?  110  PRO C CD    1 
ATOM   4083  N  N     . ARG C 2 111  ? -24.492 24.022  59.146  1.00 45.87  ?  111  ARG C N     1 
ATOM   4084  C  CA    . ARG C 2 111  ? -25.043 25.067  58.297  1.00 49.03  ?  111  ARG C CA    1 
ATOM   4085  C  C     . ARG C 2 111  ? -23.950 25.607  57.388  1.00 51.03  ?  111  ARG C C     1 
ATOM   4086  O  O     . ARG C 2 111  ? -22.757 25.498  57.682  1.00 50.14  ?  111  ARG C O     1 
ATOM   4087  C  CB    . ARG C 2 111  ? -25.660 26.200  59.129  1.00 51.62  ?  111  ARG C CB    1 
ATOM   4088  C  CG    . ARG C 2 111  ? -24.728 26.775  60.179  1.00 59.62  ?  111  ARG C CG    1 
ATOM   4089  C  CD    . ARG C 2 111  ? -25.494 27.607  61.193  1.00 67.85  ?  111  ARG C CD    1 
ATOM   4090  N  NE    . ARG C 2 111  ? -24.642 28.051  62.292  1.00 74.93  ?  111  ARG C NE    1 
ATOM   4091  C  CZ    . ARG C 2 111  ? -24.339 27.305  63.349  1.00 73.75  ?  111  ARG C CZ    1 
ATOM   4092  N  NH1   . ARG C 2 111  ? -24.816 26.072  63.453  1.00 66.97  ?  111  ARG C NH1   1 
ATOM   4093  N  NH2   . ARG C 2 111  ? -23.557 27.790  64.303  1.00 79.70  ?  111  ARG C NH2   1 
ATOM   4094  N  N     . PHE C 2 112  ? -24.375 26.198  56.274  1.00 47.91  ?  112  PHE C N     1 
ATOM   4095  C  CA    . PHE C 2 112  ? -23.471 26.701  55.250  1.00 45.06  ?  112  PHE C CA    1 
ATOM   4096  C  C     . PHE C 2 112  ? -23.663 28.198  55.071  1.00 44.81  ?  112  PHE C C     1 
ATOM   4097  O  O     . PHE C 2 112  ? -24.799 28.678  54.990  1.00 47.61  ?  112  PHE C O     1 
ATOM   4098  C  CB    . PHE C 2 112  ? -23.702 25.996  53.911  1.00 42.09  ?  112  PHE C CB    1 
ATOM   4099  C  CG    . PHE C 2 112  ? -23.396 24.531  53.936  1.00 32.18  ?  112  PHE C CG    1 
ATOM   4100  C  CD1   . PHE C 2 112  ? -22.094 24.082  53.801  1.00 35.32  ?  112  PHE C CD1   1 
ATOM   4101  C  CD2   . PHE C 2 112  ? -24.410 23.601  54.084  1.00 28.51  ?  112  PHE C CD2   1 
ATOM   4102  C  CE1   . PHE C 2 112  ? -21.807 22.733  53.820  1.00 38.35  ?  112  PHE C CE1   1 
ATOM   4103  C  CE2   . PHE C 2 112  ? -24.130 22.251  54.104  1.00 29.85  ?  112  PHE C CE2   1 
ATOM   4104  C  CZ    . PHE C 2 112  ? -22.827 21.817  53.971  1.00 34.45  ?  112  PHE C CZ    1 
ATOM   4105  N  N     . ASP C 2 113  ? -22.554 28.928  55.006  1.00 42.49  ?  113  ASP C N     1 
ATOM   4106  C  CA    . ASP C 2 113  ? -22.582 30.311  54.566  1.00 57.13  ?  113  ASP C CA    1 
ATOM   4107  C  C     . ASP C 2 113  ? -22.659 30.341  53.040  1.00 51.85  ?  113  ASP C C     1 
ATOM   4108  O  O     . ASP C 2 113  ? -22.702 29.301  52.375  1.00 58.65  ?  113  ASP C O     1 
ATOM   4109  C  CB    . ASP C 2 113  ? -21.357 31.057  55.094  1.00 62.77  ?  113  ASP C CB    1 
ATOM   4110  C  CG    . ASP C 2 113  ? -21.542 32.563  55.098  1.00 73.09  ?  113  ASP C CG    1 
ATOM   4111  O  OD1   . ASP C 2 113  ? -22.590 33.040  54.615  1.00 68.47  ?  113  ASP C OD1   1 
ATOM   4112  O  OD2   . ASP C 2 113  ? -20.636 33.270  55.589  1.00 76.12  ?  113  ASP C OD2   1 
ATOM   4113  N  N     . ASP C 2 114  ? -22.681 31.542  52.470  1.00 61.14  ?  114  ASP C N     1 
ATOM   4114  C  CA    . ASP C 2 114  ? -22.766 31.669  51.023  1.00 65.99  ?  114  ASP C CA    1 
ATOM   4115  C  C     . ASP C 2 114  ? -21.510 31.105  50.359  1.00 63.75  ?  114  ASP C C     1 
ATOM   4116  O  O     . ASP C 2 114  ? -20.478 30.876  50.997  1.00 58.72  ?  114  ASP C O     1 
ATOM   4117  C  CB    . ASP C 2 114  ? -22.977 33.128  50.626  1.00 72.39  ?  114  ASP C CB    1 
ATOM   4118  C  CG    . ASP C 2 114  ? -24.378 33.617  50.934  1.00 75.05  ?  114  ASP C CG    1 
ATOM   4119  O  OD1   . ASP C 2 114  ? -25.333 32.828  50.768  1.00 68.12  ?  114  ASP C OD1   1 
ATOM   4120  O  OD2   . ASP C 2 114  ? -24.526 34.787  51.346  1.00 81.33  ?  114  ASP C OD2   1 
ATOM   4121  N  N     . VAL C 2 115  ? -21.614 30.874  49.049  1.00 52.40  ?  115  VAL C N     1 
ATOM   4122  C  CA    . VAL C 2 115  ? -20.509 30.294  48.299  1.00 46.04  ?  115  VAL C CA    1 
ATOM   4123  C  C     . VAL C 2 115  ? -19.353 31.283  48.244  1.00 48.54  ?  115  VAL C C     1 
ATOM   4124  O  O     . VAL C 2 115  ? -19.555 32.502  48.148  1.00 52.79  ?  115  VAL C O     1 
ATOM   4125  C  CB    . VAL C 2 115  ? -20.970 29.895  46.888  1.00 48.34  ?  115  VAL C CB    1 
ATOM   4126  C  CG1   . VAL C 2 115  ? -20.032 28.855  46.300  1.00 44.86  ?  115  VAL C CG1   1 
ATOM   4127  C  CG2   . VAL C 2 115  ? -22.402 29.378  46.923  1.00 47.12  ?  115  VAL C CG2   1 
ATOM   4128  N  N     . LYS C 2 116  ? -18.126 30.757  48.304  1.00 50.91  ?  116  LYS C N     1 
ATOM   4129  C  CA    . LYS C 2 116  ? -16.950 31.619  48.368  1.00 52.90  ?  116  LYS C CA    1 
ATOM   4130  C  C     . LYS C 2 116  ? -16.775 32.425  47.087  1.00 52.50  ?  116  LYS C C     1 
ATOM   4131  O  O     . LYS C 2 116  ? -16.463 33.620  47.137  1.00 52.77  ?  116  LYS C O     1 
ATOM   4132  C  CB    . LYS C 2 116  ? -15.702 30.783  48.652  1.00 53.20  ?  116  LYS C CB    1 
ATOM   4133  C  CG    . LYS C 2 116  ? -15.769 29.988  49.947  1.00 58.99  ?  116  LYS C CG    1 
ATOM   4134  C  CD    . LYS C 2 116  ? -14.459 29.270  50.228  1.00 55.35  ?  116  LYS C CD    1 
ATOM   4135  C  CE    . LYS C 2 116  ? -13.326 30.258  50.457  1.00 65.51  ?  116  LYS C CE    1 
ATOM   4136  N  NZ    . LYS C 2 116  ? -12.046 29.572  50.790  1.00 61.09  ?  116  LYS C NZ    1 
ATOM   4137  N  N     . ALA C 2 117  ? -16.967 31.793  45.932  1.00 61.92  ?  117  ALA C N     1 
ATOM   4138  C  CA    . ALA C 2 117  ? -16.805 32.460  44.650  1.00 59.68  ?  117  ALA C CA    1 
ATOM   4139  C  C     . ALA C 2 117  ? -17.822 31.893  43.674  1.00 62.61  ?  117  ALA C C     1 
ATOM   4140  O  O     . ALA C 2 117  ? -18.204 30.723  43.794  1.00 66.28  ?  117  ALA C O     1 
ATOM   4141  C  CB    . ALA C 2 117  ? -15.383 32.284  44.098  1.00 60.77  ?  117  ALA C CB    1 
ATOM   4142  N  N     . PRO C 2 118  ? -18.283 32.690  42.710  1.00 62.74  ?  118  PRO C N     1 
ATOM   4143  C  CA    . PRO C 2 118  ? -19.247 32.186  41.724  1.00 61.43  ?  118  PRO C CA    1 
ATOM   4144  C  C     . PRO C 2 118  ? -18.676 31.033  40.910  1.00 60.53  ?  118  PRO C C     1 
ATOM   4145  O  O     . PRO C 2 118  ? -17.485 30.716  40.954  1.00 55.97  ?  118  PRO C O     1 
ATOM   4146  C  CB    . PRO C 2 118  ? -19.530 33.408  40.846  1.00 58.55  ?  118  PRO C CB    1 
ATOM   4147  C  CG    . PRO C 2 118  ? -19.233 34.575  41.725  1.00 65.31  ?  118  PRO C CG    1 
ATOM   4148  C  CD    . PRO C 2 118  ? -18.079 34.144  42.587  1.00 65.63  ?  118  PRO C CD    1 
ATOM   4149  N  N     . VAL C 2 119  ? -19.566 30.402  40.142  1.00 54.23  ?  119  VAL C N     1 
ATOM   4150  C  CA    . VAL C 2 119  ? -19.205 29.194  39.406  1.00 54.03  ?  119  VAL C CA    1 
ATOM   4151  C  C     . VAL C 2 119  ? -18.169 29.506  38.331  1.00 48.81  ?  119  VAL C C     1 
ATOM   4152  O  O     . VAL C 2 119  ? -17.164 28.799  38.191  1.00 42.28  ?  119  VAL C O     1 
ATOM   4153  C  CB    . VAL C 2 119  ? -20.466 28.538  38.810  1.00 54.42  ?  119  VAL C CB    1 
ATOM   4154  C  CG1   . VAL C 2 119  ? -21.408 29.597  38.255  1.00 62.64  ?  119  VAL C CG1   1 
ATOM   4155  C  CG2   . VAL C 2 119  ? -20.092 27.540  37.728  1.00 44.90  ?  119  VAL C CG2   1 
ATOM   4156  N  N     . ASP C 2 120  ? -18.392 30.573  37.561  1.00 47.77  ?  120  ASP C N     1 
ATOM   4157  C  CA    . ASP C 2 120  ? -17.485 30.899  36.468  1.00 52.88  ?  120  ASP C CA    1 
ATOM   4158  C  C     . ASP C 2 120  ? -16.166 31.484  36.956  1.00 47.09  ?  120  ASP C C     1 
ATOM   4159  O  O     . ASP C 2 120  ? -15.162 31.388  36.242  1.00 43.90  ?  120  ASP C O     1 
ATOM   4160  C  CB    . ASP C 2 120  ? -18.160 31.868  35.497  1.00 52.05  ?  120  ASP C CB    1 
ATOM   4161  C  CG    . ASP C 2 120  ? -18.698 33.103  36.188  1.00 65.32  ?  120  ASP C CG    1 
ATOM   4162  O  OD1   . ASP C 2 120  ? -19.030 33.015  37.389  1.00 65.76  ?  120  ASP C OD1   1 
ATOM   4163  O  OD2   . ASP C 2 120  ? -18.793 34.161  35.531  1.00 74.38  ?  120  ASP C OD2   1 
ATOM   4164  N  N     . GLU C 2 121  ? -16.141 32.085  38.147  1.00 50.47  ?  121  GLU C N     1 
ATOM   4165  C  CA    . GLU C 2 121  ? -14.890 32.628  38.667  1.00 54.52  ?  121  GLU C CA    1 
ATOM   4166  C  C     . GLU C 2 121  ? -13.923 31.515  39.051  1.00 50.84  ?  121  GLU C C     1 
ATOM   4167  O  O     . GLU C 2 121  ? -12.707 31.652  38.873  1.00 49.57  ?  121  GLU C O     1 
ATOM   4168  C  CB    . GLU C 2 121  ? -15.167 33.541  39.863  1.00 58.29  ?  121  GLU C CB    1 
ATOM   4169  C  CG    . GLU C 2 121  ? -13.914 34.116  40.510  1.00 68.25  ?  121  GLU C CG    1 
ATOM   4170  C  CD    . GLU C 2 121  ? -14.225 35.062  41.653  1.00 76.23  ?  121  GLU C CD    1 
ATOM   4171  O  OE1   . GLU C 2 121  ? -15.343 35.617  41.680  1.00 78.62  ?  121  GLU C OE1   1 
ATOM   4172  O  OE2   . GLU C 2 121  ? -13.352 35.248  42.527  1.00 64.73  ?  121  GLU C OE2   1 
ATOM   4173  N  N     . CYS C 2 122  ? -14.444 30.402  39.576  1.00 43.20  ?  122  CYS C N     1 
ATOM   4174  C  CA    . CYS C 2 122  ? -13.578 29.290  39.953  1.00 46.69  ?  122  CYS C CA    1 
ATOM   4175  C  C     . CYS C 2 122  ? -12.923 28.658  38.731  1.00 51.36  ?  122  CYS C C     1 
ATOM   4176  O  O     . CYS C 2 122  ? -11.752 28.264  38.782  1.00 49.47  ?  122  CYS C O     1 
ATOM   4177  C  CB    . CYS C 2 122  ? -14.371 28.246  40.738  1.00 42.30  ?  122  CYS C CB    1 
ATOM   4178  S  SG    . CYS C 2 122  ? -14.910 28.799  42.372  1.00 56.68  ?  122  CYS C SG    1 
ATOM   4179  N  N     . LYS C 2 123  ? -13.663 28.550  37.624  1.00 54.50  ?  123  LYS C N     1 
ATOM   4180  C  CA    . LYS C 2 123  ? -13.075 28.030  36.394  1.00 48.50  ?  123  LYS C CA    1 
ATOM   4181  C  C     . LYS C 2 123  ? -11.946 28.927  35.904  1.00 46.74  ?  123  LYS C C     1 
ATOM   4182  O  O     . LYS C 2 123  ? -10.942 28.440  35.371  1.00 45.64  ?  123  LYS C O     1 
ATOM   4183  C  CB    . LYS C 2 123  ? -14.145 27.893  35.311  1.00 43.32  ?  123  LYS C CB    1 
ATOM   4184  C  CG    . LYS C 2 123  ? -15.175 26.805  35.556  1.00 34.23  ?  123  LYS C CG    1 
ATOM   4185  C  CD    . LYS C 2 123  ? -16.134 26.708  34.379  1.00 35.71  ?  123  LYS C CD    1 
ATOM   4186  C  CE    . LYS C 2 123  ? -17.146 25.592  34.566  1.00 47.12  ?  123  LYS C CE    1 
ATOM   4187  N  NZ    . LYS C 2 123  ? -18.072 25.489  33.403  1.00 59.74  ?  123  LYS C NZ    1 
ATOM   4188  N  N     . ASP C 2 124  ? -12.091 30.241  36.080  1.00 46.46  ?  124  ASP C N     1 
ATOM   4189  C  CA    . ASP C 2 124  ? -11.091 31.173  35.572  1.00 51.12  ?  124  ASP C CA    1 
ATOM   4190  C  C     . ASP C 2 124  ? -9.832  31.154  36.430  1.00 51.20  ?  124  ASP C C     1 
ATOM   4191  O  O     . ASP C 2 124  ? -8.717  31.021  35.911  1.00 46.48  ?  124  ASP C O     1 
ATOM   4192  C  CB    . ASP C 2 124  ? -11.681 32.582  35.504  1.00 54.35  ?  124  ASP C CB    1 
ATOM   4193  C  CG    . ASP C 2 124  ? -10.673 33.614  35.042  1.00 63.51  ?  124  ASP C CG    1 
ATOM   4194  O  OD1   . ASP C 2 124  ? -10.213 33.522  33.885  1.00 64.89  ?  124  ASP C OD1   1 
ATOM   4195  O  OD2   . ASP C 2 124  ? -10.343 34.520  35.837  1.00 69.89  ?  124  ASP C OD2   1 
ATOM   4196  N  N     . LYS C 2 125  ? -9.988  31.281  37.745  1.00 67.37  ?  125  LYS C N     1 
ATOM   4197  C  CA    . LYS C 2 125  ? -8.859  31.373  38.660  1.00 66.52  ?  125  LYS C CA    1 
ATOM   4198  C  C     . LYS C 2 125  ? -8.419  30.018  39.203  1.00 63.52  ?  125  LYS C C     1 
ATOM   4199  O  O     . LYS C 2 125  ? -7.598  29.973  40.125  1.00 65.62  ?  125  LYS C O     1 
ATOM   4200  C  CB    . LYS C 2 125  ? -9.199  32.322  39.813  1.00 61.91  ?  125  LYS C CB    1 
ATOM   4201  C  CG    . LYS C 2 125  ? -9.553  33.728  39.348  1.00 63.04  ?  125  LYS C CG    1 
ATOM   4202  C  CD    . LYS C 2 125  ? -9.743  34.684  40.513  1.00 76.71  ?  125  LYS C CD    1 
ATOM   4203  C  CE    . LYS C 2 125  ? -10.052 36.090  40.018  1.00 82.16  ?  125  LYS C CE    1 
ATOM   4204  N  NZ    . LYS C 2 125  ? -10.173 37.065  41.136  1.00 87.38  ?  125  LYS C NZ    1 
ATOM   4205  N  N     . ASP C 2 126  ? -8.946  28.921  38.652  1.00 55.48  ?  126  ASP C N     1 
ATOM   4206  C  CA    . ASP C 2 126  ? -8.510  27.565  38.997  1.00 52.54  ?  126  ASP C CA    1 
ATOM   4207  C  C     . ASP C 2 126  ? -8.666  27.277  40.489  1.00 49.01  ?  126  ASP C C     1 
ATOM   4208  O  O     . ASP C 2 126  ? -7.801  26.660  41.114  1.00 46.99  ?  126  ASP C O     1 
ATOM   4209  C  CB    . ASP C 2 126  ? -7.068  27.317  38.545  1.00 49.13  ?  126  ASP C CB    1 
ATOM   4210  C  CG    . ASP C 2 126  ? -6.965  27.016  37.063  1.00 64.72  ?  126  ASP C CG    1 
ATOM   4211  O  OD1   . ASP C 2 126  ? -7.429  27.844  36.251  1.00 66.73  ?  126  ASP C OD1   1 
ATOM   4212  O  OD2   . ASP C 2 126  ? -6.416  25.951  36.710  1.00 71.31  ?  126  ASP C OD2   1 
ATOM   4213  N  N     . MET C 2 127  ? -9.776  27.724  41.066  1.00 59.09  ?  127  MET C N     1 
ATOM   4214  C  CA    . MET C 2 127  ? -10.110 27.423  42.447  1.00 55.40  ?  127  MET C CA    1 
ATOM   4215  C  C     . MET C 2 127  ? -11.258 26.416  42.488  1.00 47.24  ?  127  MET C C     1 
ATOM   4216  O  O     . MET C 2 127  ? -11.672 25.869  41.458  1.00 48.46  ?  127  MET C O     1 
ATOM   4217  C  CB    . MET C 2 127  ? -10.441 28.709  43.210  1.00 54.56  ?  127  MET C CB    1 
ATOM   4218  C  CG    . MET C 2 127  ? -10.873 29.872  42.336  1.00 58.89  ?  127  MET C CG    1 
ATOM   4219  S  SD    . MET C 2 127  ? -11.190 31.361  43.303  1.00 57.11  ?  127  MET C SD    1 
ATOM   4220  C  CE    . MET C 2 127  ? -9.672  31.480  44.248  1.00 59.44  ?  127  MET C CE    1 
ATOM   4221  N  N     . THR C 2 128  ? -11.776 26.168  43.687  1.00 50.24  ?  128  THR C N     1 
ATOM   4222  C  CA    . THR C 2 128  ? -12.779 25.137  43.914  1.00 36.04  ?  128  THR C CA    1 
ATOM   4223  C  C     . THR C 2 128  ? -14.070 25.767  44.418  1.00 32.91  ?  128  THR C C     1 
ATOM   4224  O  O     . THR C 2 128  ? -14.063 26.496  45.415  1.00 45.86  ?  128  THR C O     1 
ATOM   4225  C  CB    . THR C 2 128  ? -12.272 24.092  44.913  1.00 31.48  ?  128  THR C CB    1 
ATOM   4226  O  OG1   . THR C 2 128  ? -11.199 23.347  44.322  1.00 32.83  ?  128  THR C OG1   1 
ATOM   4227  C  CG2   . THR C 2 128  ? -13.391 23.140  45.309  1.00 28.05  ?  128  THR C CG2   1 
ATOM   4228  N  N     . TYR C 2 129  ? -15.171 25.479  43.724  1.00 30.26  ?  129  TYR C N     1 
ATOM   4229  C  CA    . TYR C 2 129  ? -16.497 25.936  44.121  1.00 31.34  ?  129  TYR C CA    1 
ATOM   4230  C  C     . TYR C 2 129  ? -16.884 25.319  45.459  1.00 42.69  ?  129  TYR C C     1 
ATOM   4231  O  O     . TYR C 2 129  ? -17.114 24.108  45.544  1.00 46.45  ?  129  TYR C O     1 
ATOM   4232  C  CB    . TYR C 2 129  ? -17.519 25.577  43.039  1.00 30.38  ?  129  TYR C CB    1 
ATOM   4233  C  CG    . TYR C 2 129  ? -18.839 26.309  43.133  1.00 30.24  ?  129  TYR C CG    1 
ATOM   4234  C  CD1   . TYR C 2 129  ? -18.948 27.637  42.742  1.00 31.00  ?  129  TYR C CD1   1 
ATOM   4235  C  CD2   . TYR C 2 129  ? -19.983 25.665  43.588  1.00 29.41  ?  129  TYR C CD2   1 
ATOM   4236  C  CE1   . TYR C 2 129  ? -20.154 28.309  42.816  1.00 35.68  ?  129  TYR C CE1   1 
ATOM   4237  C  CE2   . TYR C 2 129  ? -21.195 26.328  43.665  1.00 30.08  ?  129  TYR C CE2   1 
ATOM   4238  C  CZ    . TYR C 2 129  ? -21.274 27.649  43.278  1.00 31.36  ?  129  TYR C CZ    1 
ATOM   4239  O  OH    . TYR C 2 129  ? -22.477 28.314  43.353  1.00 28.40  ?  129  TYR C OH    1 
ATOM   4240  N  N     . ALA C 2 130  ? -16.954 26.134  46.511  1.00 43.62  ?  130  ALA C N     1 
ATOM   4241  C  CA    . ALA C 2 130  ? -17.189 25.608  47.847  1.00 37.15  ?  130  ALA C CA    1 
ATOM   4242  C  C     . ALA C 2 130  ? -17.855 26.666  48.713  1.00 41.98  ?  130  ALA C C     1 
ATOM   4243  O  O     . ALA C 2 130  ? -17.792 27.865  48.429  1.00 45.67  ?  130  ALA C O     1 
ATOM   4244  C  CB    . ALA C 2 130  ? -15.884 25.136  48.499  1.00 42.97  ?  130  ALA C CB    1 
ATOM   4245  N  N     . ALA C 2 131  ? -18.493 26.199  49.786  1.00 41.59  ?  131  ALA C N     1 
ATOM   4246  C  CA    . ALA C 2 131  ? -19.123 27.046  50.783  1.00 46.42  ?  131  ALA C CA    1 
ATOM   4247  C  C     . ALA C 2 131  ? -18.649 26.638  52.171  1.00 54.47  ?  131  ALA C C     1 
ATOM   4248  O  O     . ALA C 2 131  ? -18.574 25.441  52.475  1.00 51.57  ?  131  ALA C O     1 
ATOM   4249  C  CB    . ALA C 2 131  ? -20.654 26.954  50.706  1.00 36.53  ?  131  ALA C CB    1 
ATOM   4250  N  N     . PRO C 2 132  ? -18.321 27.602  53.030  1.00 48.97  ?  132  PRO C N     1 
ATOM   4251  C  CA    . PRO C 2 132  ? -17.812 27.257  54.363  1.00 42.73  ?  132  PRO C CA    1 
ATOM   4252  C  C     . PRO C 2 132  ? -18.878 26.584  55.215  1.00 46.13  ?  132  PRO C C     1 
ATOM   4253  O  O     . PRO C 2 132  ? -20.039 27.000  55.239  1.00 41.67  ?  132  PRO C O     1 
ATOM   4254  C  CB    . PRO C 2 132  ? -17.397 28.612  54.947  1.00 48.69  ?  132  PRO C CB    1 
ATOM   4255  C  CG    . PRO C 2 132  ? -18.202 29.613  54.193  1.00 46.92  ?  132  PRO C CG    1 
ATOM   4256  C  CD    . PRO C 2 132  ? -18.366 29.058  52.810  1.00 45.28  ?  132  PRO C CD    1 
ATOM   4257  N  N     . LEU C 2 133  ? -18.465 25.535  55.921  1.00 48.91  ?  133  LEU C N     1 
ATOM   4258  C  CA    . LEU C 2 133  ? -19.358 24.729  56.743  1.00 48.92  ?  133  LEU C CA    1 
ATOM   4259  C  C     . LEU C 2 133  ? -19.166 25.092  58.211  1.00 52.72  ?  133  LEU C C     1 
ATOM   4260  O  O     . LEU C 2 133  ? -18.045 25.031  58.728  1.00 51.32  ?  133  LEU C O     1 
ATOM   4261  C  CB    . LEU C 2 133  ? -19.099 23.239  56.519  1.00 44.05  ?  133  LEU C CB    1 
ATOM   4262  C  CG    . LEU C 2 133  ? -19.761 22.258  57.489  1.00 40.68  ?  133  LEU C CG    1 
ATOM   4263  C  CD1   . LEU C 2 133  ? -21.274 22.405  57.465  1.00 39.18  ?  133  LEU C CD1   1 
ATOM   4264  C  CD2   . LEU C 2 133  ? -19.353 20.830  57.159  1.00 34.56  ?  133  LEU C CD2   1 
ATOM   4265  N  N     . PHE C 2 134  ? -20.257 25.464  58.875  1.00 54.74  ?  134  PHE C N     1 
ATOM   4266  C  CA    . PHE C 2 134  ? -20.255 25.785  60.295  1.00 56.78  ?  134  PHE C CA    1 
ATOM   4267  C  C     . PHE C 2 134  ? -21.049 24.737  61.062  1.00 58.54  ?  134  PHE C C     1 
ATOM   4268  O  O     . PHE C 2 134  ? -22.113 24.298  60.613  1.00 52.69  ?  134  PHE C O     1 
ATOM   4269  C  CB    . PHE C 2 134  ? -20.855 27.170  60.553  1.00 60.24  ?  134  PHE C CB    1 
ATOM   4270  C  CG    . PHE C 2 134  ? -20.051 28.303  59.981  1.00 56.42  ?  134  PHE C CG    1 
ATOM   4271  C  CD1   . PHE C 2 134  ? -18.677 28.200  59.846  1.00 50.09  ?  134  PHE C CD1   1 
ATOM   4272  C  CD2   . PHE C 2 134  ? -20.673 29.474  59.580  1.00 58.41  ?  134  PHE C CD2   1 
ATOM   4273  C  CE1   . PHE C 2 134  ? -17.939 29.246  59.321  1.00 51.19  ?  134  PHE C CE1   1 
ATOM   4274  C  CE2   . PHE C 2 134  ? -19.941 30.521  59.054  1.00 60.66  ?  134  PHE C CE2   1 
ATOM   4275  C  CZ    . PHE C 2 134  ? -18.572 30.407  58.924  1.00 54.41  ?  134  PHE C CZ    1 
ATOM   4276  N  N     . VAL C 2 135  ? -20.528 24.337  62.222  1.00 57.50  ?  135  VAL C N     1 
ATOM   4277  C  CA    . VAL C 2 135  ? -21.214 23.421  63.122  1.00 54.19  ?  135  VAL C CA    1 
ATOM   4278  C  C     . VAL C 2 135  ? -21.216 24.031  64.519  1.00 60.34  ?  135  VAL C C     1 
ATOM   4279  O  O     . VAL C 2 135  ? -20.535 25.019  64.793  1.00 64.05  ?  135  VAL C O     1 
ATOM   4280  C  CB    . VAL C 2 135  ? -20.573 22.017  63.148  1.00 52.82  ?  135  VAL C CB    1 
ATOM   4281  C  CG1   . VAL C 2 135  ? -20.551 21.410  61.752  1.00 53.51  ?  135  VAL C CG1   1 
ATOM   4282  C  CG2   . VAL C 2 135  ? -19.174 22.083  63.739  1.00 50.61  ?  135  VAL C CG2   1 
ATOM   4283  N  N     . THR C 2 136  ? -21.998 23.422  65.405  1.00 71.93  ?  136  THR C N     1 
ATOM   4284  C  CA    . THR C 2 136  ? -22.104 23.852  66.794  1.00 70.22  ?  136  THR C CA    1 
ATOM   4285  C  C     . THR C 2 136  ? -21.535 22.758  67.687  1.00 68.28  ?  136  THR C C     1 
ATOM   4286  O  O     . THR C 2 136  ? -22.076 21.648  67.735  1.00 62.10  ?  136  THR C O     1 
ATOM   4287  C  CB    . THR C 2 136  ? -23.555 24.155  67.170  1.00 63.01  ?  136  THR C CB    1 
ATOM   4288  O  OG1   . THR C 2 136  ? -24.116 25.066  66.217  1.00 64.42  ?  136  THR C OG1   1 
ATOM   4289  C  CG2   . THR C 2 136  ? -23.625 24.775  68.556  1.00 74.91  ?  136  THR C CG2   1 
ATOM   4290  N  N     . ALA C 2 137  ? -20.448 23.072  68.387  1.00 78.18  ?  137  ALA C N     1 
ATOM   4291  C  CA    . ALA C 2 137  ? -19.784 22.131  69.275  1.00 82.73  ?  137  ALA C CA    1 
ATOM   4292  C  C     . ALA C 2 137  ? -19.757 22.683  70.693  1.00 93.86  ?  137  ALA C C     1 
ATOM   4293  O  O     . ALA C 2 137  ? -19.755 23.900  70.904  1.00 93.28  ?  137  ALA C O     1 
ATOM   4294  C  CB    . ALA C 2 137  ? -18.356 21.831  68.803  1.00 79.11  ?  137  ALA C CB    1 
ATOM   4295  N  N     . GLU C 2 138  ? -19.735 21.774  71.666  1.00 102.46 ?  138  GLU C N     1 
ATOM   4296  C  CA    . GLU C 2 138  ? -19.732 22.158  73.069  1.00 104.79 ?  138  GLU C CA    1 
ATOM   4297  C  C     . GLU C 2 138  ? -19.004 21.098  73.882  1.00 105.21 ?  138  GLU C C     1 
ATOM   4298  O  O     . GLU C 2 138  ? -19.027 19.911  73.545  1.00 92.55  ?  138  GLU C O     1 
ATOM   4299  C  CB    . GLU C 2 138  ? -21.157 22.351  73.602  1.00 100.24 ?  138  GLU C CB    1 
ATOM   4300  C  CG    . GLU C 2 138  ? -22.023 21.106  73.536  1.00 97.85  ?  138  GLU C CG    1 
ATOM   4301  C  CD    . GLU C 2 138  ? -23.445 21.363  73.991  1.00 105.57 ?  138  GLU C CD    1 
ATOM   4302  O  OE1   . GLU C 2 138  ? -23.844 22.545  74.054  1.00 100.52 ?  138  GLU C OE1   1 
ATOM   4303  O  OE2   . GLU C 2 138  ? -24.162 20.385  74.288  1.00 109.54 ?  138  GLU C OE2   1 
ATOM   4304  N  N     . PHE C 2 139  ? -18.362 21.541  74.958  1.00 114.78 ?  139  PHE C N     1 
ATOM   4305  C  CA    . PHE C 2 139  ? -17.605 20.665  75.843  1.00 116.01 ?  139  PHE C CA    1 
ATOM   4306  C  C     . PHE C 2 139  ? -18.413 20.419  77.111  1.00 119.24 ?  139  PHE C C     1 
ATOM   4307  O  O     . PHE C 2 139  ? -18.753 21.365  77.829  1.00 119.14 ?  139  PHE C O     1 
ATOM   4308  C  CB    . PHE C 2 139  ? -16.245 21.278  76.180  1.00 111.95 ?  139  PHE C CB    1 
ATOM   4309  C  CG    . PHE C 2 139  ? -15.363 20.384  77.005  1.00 109.92 ?  139  PHE C CG    1 
ATOM   4310  C  CD1   . PHE C 2 139  ? -15.310 20.519  78.382  1.00 112.81 ?  139  PHE C CD1   1 
ATOM   4311  C  CD2   . PHE C 2 139  ? -14.586 19.410  76.401  1.00 113.43 ?  139  PHE C CD2   1 
ATOM   4312  C  CE1   . PHE C 2 139  ? -14.499 19.698  79.142  1.00 117.99 ?  139  PHE C CE1   1 
ATOM   4313  C  CE2   . PHE C 2 139  ? -13.773 18.587  77.155  1.00 114.78 ?  139  PHE C CE2   1 
ATOM   4314  C  CZ    . PHE C 2 139  ? -13.729 18.731  78.527  1.00 114.04 ?  139  PHE C CZ    1 
ATOM   4315  N  N     . ILE C 2 140  ? -18.716 19.152  77.383  1.00 122.51 ?  140  ILE C N     1 
ATOM   4316  C  CA    . ILE C 2 140  ? -19.484 18.751  78.556  1.00 121.56 ?  140  ILE C CA    1 
ATOM   4317  C  C     . ILE C 2 140  ? -18.520 18.140  79.563  1.00 125.08 ?  140  ILE C C     1 
ATOM   4318  O  O     . ILE C 2 140  ? -17.856 17.138  79.269  1.00 122.29 ?  140  ILE C O     1 
ATOM   4319  C  CB    . ILE C 2 140  ? -20.603 17.764  78.191  1.00 126.83 ?  140  ILE C CB    1 
ATOM   4320  C  CG1   . ILE C 2 140  ? -21.468 18.335  77.066  1.00 126.92 ?  140  ILE C CG1   1 
ATOM   4321  C  CG2   . ILE C 2 140  ? -21.452 17.447  79.414  1.00 124.33 ?  140  ILE C CG2   1 
ATOM   4322  C  CD1   . ILE C 2 140  ? -22.564 17.401  76.601  1.00 128.09 ?  140  ILE C CD1   1 
ATOM   4323  N  N     . ASN C 2 141  ? -18.445 18.740  80.748  1.00 141.32 ?  141  ASN C N     1 
ATOM   4324  C  CA    . ASN C 2 141  ? -17.542 18.305  81.808  1.00 138.23 ?  141  ASN C CA    1 
ATOM   4325  C  C     . ASN C 2 141  ? -18.379 17.773  82.965  1.00 133.12 ?  141  ASN C C     1 
ATOM   4326  O  O     . ASN C 2 141  ? -19.086 18.536  83.631  1.00 135.12 ?  141  ASN C O     1 
ATOM   4327  C  CB    . ASN C 2 141  ? -16.643 19.455  82.258  1.00 133.06 ?  141  ASN C CB    1 
ATOM   4328  C  CG    . ASN C 2 141  ? -15.464 18.990  83.093  1.00 131.46 ?  141  ASN C CG    1 
ATOM   4329  O  OD1   . ASN C 2 141  ? -15.487 17.908  83.681  1.00 126.93 ?  141  ASN C OD1   1 
ATOM   4330  N  ND2   . ASN C 2 141  ? -14.426 19.815  83.154  1.00 129.64 ?  141  ASN C ND2   1 
ATOM   4331  N  N     . ASN C 2 142  ? -18.293 16.463  83.204  1.00 134.97 ?  142  ASN C N     1 
ATOM   4332  C  CA    . ASN C 2 142  ? -19.054 15.848  84.286  1.00 141.49 ?  142  ASN C CA    1 
ATOM   4333  C  C     . ASN C 2 142  ? -18.457 16.149  85.654  1.00 144.08 ?  142  ASN C C     1 
ATOM   4334  O  O     . ASN C 2 142  ? -19.192 16.193  86.647  1.00 144.33 ?  142  ASN C O     1 
ATOM   4335  C  CB    . ASN C 2 142  ? -19.139 14.335  84.076  1.00 138.85 ?  142  ASN C CB    1 
ATOM   4336  C  CG    . ASN C 2 142  ? -19.933 13.961  82.840  1.00 140.03 ?  142  ASN C CG    1 
ATOM   4337  O  OD1   . ASN C 2 142  ? -19.408 13.962  81.726  1.00 136.65 ?  142  ASN C OD1   1 
ATOM   4338  N  ND2   . ASN C 2 142  ? -21.205 13.635  83.031  1.00 135.77 ?  142  ASN C ND2   1 
ATOM   4339  N  N     . ASN C 2 143  ? -17.144 16.360  85.730  1.00 134.41 ?  143  ASN C N     1 
ATOM   4340  C  CA    . ASN C 2 143  ? -16.475 16.572  87.006  1.00 131.14 ?  143  ASN C CA    1 
ATOM   4341  C  C     . ASN C 2 143  ? -16.455 18.030  87.447  1.00 128.59 ?  143  ASN C C     1 
ATOM   4342  O  O     . ASN C 2 143  ? -16.015 18.312  88.567  1.00 133.70 ?  143  ASN C O     1 
ATOM   4343  C  CB    . ASN C 2 143  ? -15.039 16.035  86.947  1.00 128.12 ?  143  ASN C CB    1 
ATOM   4344  C  CG    . ASN C 2 143  ? -14.983 14.516  86.950  1.00 123.63 ?  143  ASN C CG    1 
ATOM   4345  O  OD1   . ASN C 2 143  ? -15.996 13.846  86.741  1.00 120.60 ?  143  ASN C OD1   1 
ATOM   4346  N  ND2   . ASN C 2 143  ? -13.798 13.966  87.188  1.00 112.83 ?  143  ASN C ND2   1 
ATOM   4347  N  N     . THR C 2 144  ? -16.909 18.962  86.606  1.00 123.85 ?  144  THR C N     1 
ATOM   4348  C  CA    . THR C 2 144  ? -17.024 20.362  87.001  1.00 124.53 ?  144  THR C CA    1 
ATOM   4349  C  C     . THR C 2 144  ? -18.416 20.945  86.810  1.00 130.40 ?  144  THR C C     1 
ATOM   4350  O  O     . THR C 2 144  ? -18.708 21.990  87.406  1.00 132.59 ?  144  THR C O     1 
ATOM   4351  C  CB    . THR C 2 144  ? -16.017 21.236  86.234  1.00 125.54 ?  144  THR C CB    1 
ATOM   4352  O  OG1   . THR C 2 144  ? -16.370 21.277  84.846  1.00 138.16 ?  144  THR C OG1   1 
ATOM   4353  C  CG2   . THR C 2 144  ? -14.604 20.688  86.382  1.00 121.80 ?  144  THR C CG2   1 
ATOM   4354  N  N     . GLY C 2 145  ? -19.276 20.324  86.010  1.00 121.62 ?  145  GLY C N     1 
ATOM   4355  C  CA    . GLY C 2 145  ? -20.651 20.775  85.880  1.00 124.18 ?  145  GLY C CA    1 
ATOM   4356  C  C     . GLY C 2 145  ? -20.838 22.109  85.188  1.00 132.10 ?  145  GLY C C     1 
ATOM   4357  O  O     . GLY C 2 145  ? -21.632 22.936  85.654  1.00 134.31 ?  145  GLY C O     1 
ATOM   4358  N  N     . GLU C 2 146  ? -20.129 22.339  84.085  1.00 140.25 ?  146  GLU C N     1 
ATOM   4359  C  CA    . GLU C 2 146  ? -20.284 23.563  83.312  1.00 140.49 ?  146  GLU C CA    1 
ATOM   4360  C  C     . GLU C 2 146  ? -19.877 23.289  81.871  1.00 142.56 ?  146  GLU C C     1 
ATOM   4361  O  O     . GLU C 2 146  ? -18.988 22.475  81.607  1.00 135.93 ?  146  GLU C O     1 
ATOM   4362  C  CB    . GLU C 2 146  ? -19.466 24.716  83.911  1.00 139.94 ?  146  GLU C CB    1 
ATOM   4363  C  CG    . GLU C 2 146  ? -18.075 24.327  84.384  1.00 143.49 ?  146  GLU C CG    1 
ATOM   4364  C  CD    . GLU C 2 146  ? -17.067 24.273  83.256  1.00 139.85 ?  146  GLU C CD    1 
ATOM   4365  O  OE1   . GLU C 2 146  ? -17.127 25.143  82.362  1.00 134.90 ?  146  GLU C OE1   1 
ATOM   4366  O  OE2   . GLU C 2 146  ? -16.218 23.357  83.260  1.00 136.23 ?  146  GLU C OE2   1 
ATOM   4367  N  N     . ILE C 2 147  ? -20.542 23.974  80.942  1.00 134.24 ?  147  ILE C N     1 
ATOM   4368  C  CA    . ILE C 2 147  ? -20.418 23.701  79.515  1.00 127.37 ?  147  ILE C CA    1 
ATOM   4369  C  C     . ILE C 2 147  ? -20.158 25.004  78.771  1.00 127.45 ?  147  ILE C C     1 
ATOM   4370  O  O     . ILE C 2 147  ? -20.784 26.031  79.057  1.00 120.96 ?  147  ILE C O     1 
ATOM   4371  C  CB    . ILE C 2 147  ? -21.682 23.003  78.967  1.00 122.53 ?  147  ILE C CB    1 
ATOM   4372  C  CG1   . ILE C 2 147  ? -21.855 21.626  79.612  1.00 115.61 ?  147  ILE C CG1   1 
ATOM   4373  C  CG2   . ILE C 2 147  ? -21.627 22.880  77.451  1.00 122.32 ?  147  ILE C CG2   1 
ATOM   4374  C  CD1   . ILE C 2 147  ? -23.107 20.900  79.174  1.00 108.50 ?  147  ILE C CD1   1 
ATOM   4375  N  N     . LYS C 2 148  ? -19.231 24.958  77.816  1.00 125.05 ?  148  LYS C N     1 
ATOM   4376  C  CA    . LYS C 2 148  ? -18.940 26.073  76.923  1.00 120.59 ?  148  LYS C CA    1 
ATOM   4377  C  C     . LYS C 2 148  ? -19.309 25.662  75.503  1.00 113.94 ?  148  LYS C C     1 
ATOM   4378  O  O     . LYS C 2 148  ? -18.735 24.710  74.962  1.00 109.58 ?  148  LYS C O     1 
ATOM   4379  C  CB    . LYS C 2 148  ? -17.466 26.472  77.002  1.00 115.25 ?  148  LYS C CB    1 
ATOM   4380  C  CG    . LYS C 2 148  ? -16.986 26.816  78.402  1.00 114.12 ?  148  LYS C CG    1 
ATOM   4381  C  CD    . LYS C 2 148  ? -15.480 27.027  78.430  1.00 111.11 ?  148  LYS C CD    1 
ATOM   4382  C  CE    . LYS C 2 148  ? -14.983 27.282  79.843  1.00 115.49 ?  148  LYS C CE    1 
ATOM   4383  N  NZ    . LYS C 2 148  ? -13.499 27.398  79.898  1.00 112.98 ?  148  LYS C NZ    1 
ATOM   4384  N  N     . SER C 2 149  ? -20.261 26.374  74.906  1.00 113.65 ?  149  SER C N     1 
ATOM   4385  C  CA    . SER C 2 149  ? -20.750 26.074  73.568  1.00 106.23 ?  149  SER C CA    1 
ATOM   4386  C  C     . SER C 2 149  ? -20.449 27.238  72.634  1.00 102.91 ?  149  SER C C     1 
ATOM   4387  O  O     . SER C 2 149  ? -20.534 28.403  73.033  1.00 102.94 ?  149  SER C O     1 
ATOM   4388  C  CB    . SER C 2 149  ? -22.256 25.790  73.581  1.00 107.84 ?  149  SER C CB    1 
ATOM   4389  O  OG    . SER C 2 149  ? -22.721 25.440  72.289  1.00 99.04  ?  149  SER C OG    1 
ATOM   4390  N  N     . GLN C 2 150  ? -20.103 26.917  71.391  1.00 99.88  ?  150  GLN C N     1 
ATOM   4391  C  CA    . GLN C 2 150  ? -19.766 27.932  70.400  1.00 94.88  ?  150  GLN C CA    1 
ATOM   4392  C  C     . GLN C 2 150  ? -19.912 27.327  69.009  1.00 88.91  ?  150  GLN C C     1 
ATOM   4393  O  O     . GLN C 2 150  ? -20.269 26.156  68.852  1.00 83.56  ?  150  GLN C O     1 
ATOM   4394  C  CB    . GLN C 2 150  ? -18.353 28.476  70.627  1.00 86.53  ?  150  GLN C CB    1 
ATOM   4395  C  CG    . GLN C 2 150  ? -17.283 27.401  70.704  1.00 88.52  ?  150  GLN C CG    1 
ATOM   4396  C  CD    . GLN C 2 150  ? -15.881 27.975  70.702  1.00 91.21  ?  150  GLN C CD    1 
ATOM   4397  O  OE1   . GLN C 2 150  ? -14.944 27.360  71.210  1.00 81.27  ?  150  GLN C OE1   1 
ATOM   4398  N  NE2   . GLN C 2 150  ? -15.730 29.161  70.124  1.00 96.59  ?  150  GLN C NE2   1 
ATOM   4399  N  N     . THR C 2 151  ? -19.629 28.142  67.997  1.00 73.99  ?  151  THR C N     1 
ATOM   4400  C  CA    . THR C 2 151  ? -19.697 27.732  66.601  1.00 64.64  ?  151  THR C CA    1 
ATOM   4401  C  C     . THR C 2 151  ? -18.289 27.495  66.074  1.00 60.23  ?  151  THR C C     1 
ATOM   4402  O  O     . THR C 2 151  ? -17.415 28.356  66.216  1.00 62.57  ?  151  THR C O     1 
ATOM   4403  C  CB    . THR C 2 151  ? -20.402 28.794  65.754  1.00 55.21  ?  151  THR C CB    1 
ATOM   4404  O  OG1   . THR C 2 151  ? -21.780 28.881  66.139  1.00 53.42  ?  151  THR C OG1   1 
ATOM   4405  C  CG2   . THR C 2 151  ? -20.310 28.448  64.274  1.00 60.06  ?  151  THR C CG2   1 
ATOM   4406  N  N     . VAL C 2 152  ? -18.072 26.331  65.464  1.00 62.67  ?  152  VAL C N     1 
ATOM   4407  C  CA    . VAL C 2 152  ? -16.767 25.945  64.942  1.00 69.29  ?  152  VAL C CA    1 
ATOM   4408  C  C     . VAL C 2 152  ? -16.870 25.766  63.435  1.00 70.00  ?  152  VAL C C     1 
ATOM   4409  O  O     . VAL C 2 152  ? -17.749 25.046  62.947  1.00 65.23  ?  152  VAL C O     1 
ATOM   4410  C  CB    . VAL C 2 152  ? -16.242 24.658  65.605  1.00 75.00  ?  152  VAL C CB    1 
ATOM   4411  C  CG1   . VAL C 2 152  ? -14.861 24.322  65.064  1.00 65.54  ?  152  VAL C CG1   1 
ATOM   4412  C  CG2   . VAL C 2 152  ? -16.209 24.815  67.116  1.00 76.18  ?  152  VAL C CG2   1 
ATOM   4413  N  N     . PHE C 2 153  ? -15.969 26.418  62.705  1.00 77.55  ?  153  PHE C N     1 
ATOM   4414  C  CA    . PHE C 2 153  ? -15.874 26.258  61.260  1.00 67.09  ?  153  PHE C CA    1 
ATOM   4415  C  C     . PHE C 2 153  ? -15.139 24.959  60.945  1.00 68.30  ?  153  PHE C C     1 
ATOM   4416  O  O     . PHE C 2 153  ? -14.017 24.742  61.417  1.00 59.42  ?  153  PHE C O     1 
ATOM   4417  C  CB    . PHE C 2 153  ? -15.158 27.464  60.655  1.00 64.67  ?  153  PHE C CB    1 
ATOM   4418  C  CG    . PHE C 2 153  ? -14.601 27.226  59.282  1.00 69.60  ?  153  PHE C CG    1 
ATOM   4419  C  CD1   . PHE C 2 153  ? -15.416 27.285  58.165  1.00 70.90  ?  153  PHE C CD1   1 
ATOM   4420  C  CD2   . PHE C 2 153  ? -13.251 26.970  59.106  1.00 69.42  ?  153  PHE C CD2   1 
ATOM   4421  C  CE1   . PHE C 2 153  ? -14.899 27.077  56.902  1.00 65.46  ?  153  PHE C CE1   1 
ATOM   4422  C  CE2   . PHE C 2 153  ? -12.728 26.760  57.846  1.00 60.10  ?  153  PHE C CE2   1 
ATOM   4423  C  CZ    . PHE C 2 153  ? -13.553 26.818  56.742  1.00 63.99  ?  153  PHE C CZ    1 
ATOM   4424  N  N     . MET C 2 154  ? -15.770 24.094  60.150  1.00 59.16  ?  154  MET C N     1 
ATOM   4425  C  CA    . MET C 2 154  ? -15.196 22.787  59.853  1.00 61.39  ?  154  MET C CA    1 
ATOM   4426  C  C     . MET C 2 154  ? -14.329 22.791  58.601  1.00 64.41  ?  154  MET C C     1 
ATOM   4427  O  O     . MET C 2 154  ? -13.260 22.171  58.590  1.00 69.34  ?  154  MET C O     1 
ATOM   4428  C  CB    . MET C 2 154  ? -16.304 21.742  59.707  1.00 63.06  ?  154  MET C CB    1 
ATOM   4429  C  CG    . MET C 2 154  ? -16.939 21.325  61.021  1.00 67.04  ?  154  MET C CG    1 
ATOM   4430  S  SD    . MET C 2 154  ? -15.730 20.714  62.212  1.00 69.84  ?  154  MET C SD    1 
ATOM   4431  C  CE    . MET C 2 154  ? -15.014 19.348  61.301  1.00 57.79  ?  154  MET C CE    1 
ATOM   4432  N  N     . GLY C 2 155  ? -14.763 23.462  57.539  1.00 59.54  ?  155  GLY C N     1 
ATOM   4433  C  CA    . GLY C 2 155  ? -13.979 23.490  56.321  1.00 52.39  ?  155  GLY C CA    1 
ATOM   4434  C  C     . GLY C 2 155  ? -14.741 23.978  55.108  1.00 53.30  ?  155  GLY C C     1 
ATOM   4435  O  O     . GLY C 2 155  ? -15.976 23.980  55.098  1.00 52.19  ?  155  GLY C O     1 
ATOM   4436  N  N     . ASP C 2 156  ? -14.011 24.405  54.079  1.00 46.85  ?  156  ASP C N     1 
ATOM   4437  C  CA    . ASP C 2 156  ? -14.629 24.795  52.816  1.00 44.25  ?  156  ASP C CA    1 
ATOM   4438  C  C     . ASP C 2 156  ? -15.168 23.548  52.127  1.00 40.86  ?  156  ASP C C     1 
ATOM   4439  O  O     . ASP C 2 156  ? -14.399 22.680  51.701  1.00 31.81  ?  156  ASP C O     1 
ATOM   4440  C  CB    . ASP C 2 156  ? -13.621 25.527  51.937  1.00 46.72  ?  156  ASP C CB    1 
ATOM   4441  C  CG    . ASP C 2 156  ? -13.227 26.878  52.505  1.00 49.74  ?  156  ASP C CG    1 
ATOM   4442  O  OD1   . ASP C 2 156  ? -14.062 27.496  53.200  1.00 54.60  ?  156  ASP C OD1   1 
ATOM   4443  O  OD2   . ASP C 2 156  ? -12.086 27.323  52.259  1.00 49.26  ?  156  ASP C OD2   1 
ATOM   4444  N  N     . PHE C 2 157  ? -16.492 23.457  52.020  1.00 46.54  ?  157  PHE C N     1 
ATOM   4445  C  CA    . PHE C 2 157  ? -17.149 22.237  51.579  1.00 38.25  ?  157  PHE C CA    1 
ATOM   4446  C  C     . PHE C 2 157  ? -17.458 22.320  50.095  1.00 37.34  ?  157  PHE C C     1 
ATOM   4447  O  O     . PHE C 2 157  ? -18.193 23.230  49.680  1.00 40.28  ?  157  PHE C O     1 
ATOM   4448  C  CB    . PHE C 2 157  ? -18.429 22.015  52.373  1.00 35.38  ?  157  PHE C CB    1 
ATOM   4449  C  CG    . PHE C 2 157  ? -19.026 20.655  52.189  1.00 33.57  ?  157  PHE C CG    1 
ATOM   4450  C  CD1   . PHE C 2 157  ? -20.165 20.480  51.421  1.00 39.39  ?  157  PHE C CD1   1 
ATOM   4451  C  CD2   . PHE C 2 157  ? -18.446 19.548  52.781  1.00 29.22  ?  157  PHE C CD2   1 
ATOM   4452  C  CE1   . PHE C 2 157  ? -20.715 19.225  51.252  1.00 39.20  ?  157  PHE C CE1   1 
ATOM   4453  C  CE2   . PHE C 2 157  ? -18.989 18.294  52.615  1.00 37.99  ?  157  PHE C CE2   1 
ATOM   4454  C  CZ    . PHE C 2 157  ? -20.126 18.130  51.849  1.00 40.27  ?  157  PHE C CZ    1 
ATOM   4455  N  N     . PRO C 2 158  ? -16.942 21.409  49.271  1.00 31.23  ?  158  PRO C N     1 
ATOM   4456  C  CA    . PRO C 2 158  ? -17.222 21.468  47.829  1.00 22.53  ?  158  PRO C CA    1 
ATOM   4457  C  C     . PRO C 2 158  ? -18.715 21.369  47.550  1.00 22.98  ?  158  PRO C C     1 
ATOM   4458  O  O     . PRO C 2 158  ? -19.398 20.464  48.034  1.00 26.22  ?  158  PRO C O     1 
ATOM   4459  C  CB    . PRO C 2 158  ? -16.460 20.259  47.271  1.00 26.20  ?  158  PRO C CB    1 
ATOM   4460  C  CG    . PRO C 2 158  ? -15.407 19.966  48.292  1.00 30.81  ?  158  PRO C CG    1 
ATOM   4461  C  CD    . PRO C 2 158  ? -16.026 20.308  49.613  1.00 30.48  ?  158  PRO C CD    1 
ATOM   4462  N  N     . MET C 2 159  ? -19.218 22.316  46.763  1.00 25.70  ?  159  MET C N     1 
ATOM   4463  C  CA    . MET C 2 159  ? -20.634 22.413  46.449  1.00 22.66  ?  159  MET C CA    1 
ATOM   4464  C  C     . MET C 2 159  ? -20.903 21.946  45.025  1.00 20.64  ?  159  MET C C     1 
ATOM   4465  O  O     . MET C 2 159  ? -20.058 22.080  44.135  1.00 28.95  ?  159  MET C O     1 
ATOM   4466  C  CB    . MET C 2 159  ? -21.139 23.847  46.627  1.00 28.47  ?  159  MET C CB    1 
ATOM   4467  C  CG    . MET C 2 159  ? -21.313 24.261  48.075  1.00 38.47  ?  159  MET C CG    1 
ATOM   4468  S  SD    . MET C 2 159  ? -22.584 23.287  48.903  1.00 48.56  ?  159  MET C SD    1 
ATOM   4469  C  CE    . MET C 2 159  ? -24.013 23.680  47.898  1.00 36.20  ?  159  MET C CE    1 
ATOM   4470  N  N     . MET C 2 160  ? -22.100 21.402  44.820  1.00 28.60  ?  160  MET C N     1 
ATOM   4471  C  CA    . MET C 2 160  ? -22.515 20.890  43.522  1.00 29.48  ?  160  MET C CA    1 
ATOM   4472  C  C     . MET C 2 160  ? -23.236 21.977  42.736  1.00 30.67  ?  160  MET C C     1 
ATOM   4473  O  O     . MET C 2 160  ? -24.128 22.649  43.266  1.00 26.00  ?  160  MET C O     1 
ATOM   4474  C  CB    . MET C 2 160  ? -23.421 19.670  43.690  1.00 27.37  ?  160  MET C CB    1 
ATOM   4475  C  CG    . MET C 2 160  ? -24.106 19.235  42.407  1.00 31.94  ?  160  MET C CG    1 
ATOM   4476  S  SD    . MET C 2 160  ? -25.119 17.759  42.607  1.00 37.30  ?  160  MET C SD    1 
ATOM   4477  C  CE    . MET C 2 160  ? -23.858 16.510  42.835  1.00 30.87  ?  160  MET C CE    1 
ATOM   4478  N  N     . THR C 2 161  ? -22.850 22.143  41.473  1.00 23.73  ?  161  THR C N     1 
ATOM   4479  C  CA    . THR C 2 161  ? -23.485 23.130  40.616  1.00 22.16  ?  161  THR C CA    1 
ATOM   4480  C  C     . THR C 2 161  ? -24.900 22.687  40.248  1.00 25.14  ?  161  THR C C     1 
ATOM   4481  O  O     . THR C 2 161  ? -25.295 21.535  40.445  1.00 23.32  ?  161  THR C O     1 
ATOM   4482  C  CB    . THR C 2 161  ? -22.661 23.351  39.347  1.00 24.40  ?  161  THR C CB    1 
ATOM   4483  O  OG1   . THR C 2 161  ? -22.606 22.133  38.593  1.00 29.91  ?  161  THR C OG1   1 
ATOM   4484  C  CG2   . THR C 2 161  ? -21.246 23.786  39.700  1.00 24.81  ?  161  THR C CG2   1 
ATOM   4485  N  N     . GLU C 2 162  ? -25.669 23.631  39.701  1.00 23.96  ?  162  GLU C N     1 
ATOM   4486  C  CA    . GLU C 2 162  ? -27.030 23.320  39.278  1.00 21.48  ?  162  GLU C CA    1 
ATOM   4487  C  C     . GLU C 2 162  ? -27.045 22.294  38.152  1.00 25.49  ?  162  GLU C C     1 
ATOM   4488  O  O     . GLU C 2 162  ? -28.027 21.561  37.994  1.00 18.21  ?  162  GLU C O     1 
ATOM   4489  C  CB    . GLU C 2 162  ? -27.746 24.600  38.846  1.00 23.21  ?  162  GLU C CB    1 
ATOM   4490  C  CG    . GLU C 2 162  ? -27.927 25.615  39.963  1.00 53.76  ?  162  GLU C CG    1 
ATOM   4491  C  CD    . GLU C 2 162  ? -28.096 27.028  39.440  1.00 77.78  ?  162  GLU C CD    1 
ATOM   4492  O  OE1   . GLU C 2 162  ? -27.131 27.562  38.853  1.00 78.96  ?  162  GLU C OE1   1 
ATOM   4493  O  OE2   . GLU C 2 162  ? -29.193 27.600  39.606  1.00 83.37  ?  162  GLU C OE2   1 
ATOM   4494  N  N     . LYS C 2 163  ? -25.970 22.222  37.368  1.00 35.86  ?  163  LYS C N     1 
ATOM   4495  C  CA    . LYS C 2 163  ? -25.848 21.235  36.303  1.00 27.44  ?  163  LYS C CA    1 
ATOM   4496  C  C     . LYS C 2 163  ? -25.428 19.862  36.813  1.00 23.34  ?  163  LYS C C     1 
ATOM   4497  O  O     . LYS C 2 163  ? -25.174 18.967  35.999  1.00 27.28  ?  163  LYS C O     1 
ATOM   4498  C  CB    . LYS C 2 163  ? -24.855 21.724  35.243  1.00 33.67  ?  163  LYS C CB    1 
ATOM   4499  C  CG    . LYS C 2 163  ? -25.332 22.941  34.463  1.00 32.62  ?  163  LYS C CG    1 
ATOM   4500  C  CD    . LYS C 2 163  ? -24.339 23.348  33.385  1.00 55.90  ?  163  LYS C CD    1 
ATOM   4501  C  CE    . LYS C 2 163  ? -23.048 23.880  33.985  1.00 65.70  ?  163  LYS C CE    1 
ATOM   4502  N  NZ    . LYS C 2 163  ? -22.094 24.335  32.935  1.00 56.20  ?  163  LYS C NZ    1 
ATOM   4503  N  N     . GLY C 2 164  ? -25.349 19.675  38.129  1.00 24.47  ?  164  GLY C N     1 
ATOM   4504  C  CA    . GLY C 2 164  ? -24.987 18.390  38.690  1.00 20.98  ?  164  GLY C CA    1 
ATOM   4505  C  C     . GLY C 2 164  ? -23.507 18.091  38.709  1.00 16.28  ?  164  GLY C C     1 
ATOM   4506  O  O     . GLY C 2 164  ? -23.127 16.927  38.872  1.00 20.12  ?  164  GLY C O     1 
ATOM   4507  N  N     . THR C 2 165  ? -22.657 19.102  38.555  1.00 18.98  ?  165  THR C N     1 
ATOM   4508  C  CA    . THR C 2 165  ? -21.216 18.914  38.525  1.00 25.70  ?  165  THR C CA    1 
ATOM   4509  C  C     . THR C 2 165  ? -20.561 19.622  39.705  1.00 25.03  ?  165  THR C C     1 
ATOM   4510  O  O     . THR C 2 165  ? -21.153 20.495  40.346  1.00 26.13  ?  165  THR C O     1 
ATOM   4511  C  CB    . THR C 2 165  ? -20.607 19.441  37.217  1.00 27.23  ?  165  THR C CB    1 
ATOM   4512  O  OG1   . THR C 2 165  ? -20.753 20.867  37.158  1.00 27.99  ?  165  THR C OG1   1 
ATOM   4513  C  CG2   . THR C 2 165  ? -21.301 18.820  36.015  1.00 31.70  ?  165  THR C CG2   1 
ATOM   4514  N  N     . PHE C 2 166  ? -19.326 19.222  39.987  1.00 21.63  ?  166  PHE C N     1 
ATOM   4515  C  CA    . PHE C 2 166  ? -18.462 19.910  40.932  1.00 22.79  ?  166  PHE C CA    1 
ATOM   4516  C  C     . PHE C 2 166  ? -17.332 20.596  40.176  1.00 32.66  ?  166  PHE C C     1 
ATOM   4517  O  O     . PHE C 2 166  ? -16.987 20.216  39.055  1.00 38.02  ?  166  PHE C O     1 
ATOM   4518  C  CB    . PHE C 2 166  ? -17.879 18.941  41.966  1.00 27.02  ?  166  PHE C CB    1 
ATOM   4519  C  CG    . PHE C 2 166  ? -18.905 18.319  42.866  1.00 30.28  ?  166  PHE C CG    1 
ATOM   4520  C  CD1   . PHE C 2 166  ? -19.431 17.072  42.577  1.00 25.82  ?  166  PHE C CD1   1 
ATOM   4521  C  CD2   . PHE C 2 166  ? -19.337 18.977  44.005  1.00 31.03  ?  166  PHE C CD2   1 
ATOM   4522  C  CE1   . PHE C 2 166  ? -20.371 16.493  43.406  1.00 28.80  ?  166  PHE C CE1   1 
ATOM   4523  C  CE2   . PHE C 2 166  ? -20.278 18.403  44.837  1.00 27.25  ?  166  PHE C CE2   1 
ATOM   4524  C  CZ    . PHE C 2 166  ? -20.796 17.160  44.537  1.00 31.20  ?  166  PHE C CZ    1 
ATOM   4525  N  N     . ILE C 2 167  ? -16.756 21.617  40.803  1.00 37.07  ?  167  ILE C N     1 
ATOM   4526  C  CA    . ILE C 2 167  ? -15.625 22.347  40.242  1.00 32.01  ?  167  ILE C CA    1 
ATOM   4527  C  C     . ILE C 2 167  ? -14.466 22.221  41.219  1.00 23.97  ?  167  ILE C C     1 
ATOM   4528  O  O     . ILE C 2 167  ? -14.480 22.836  42.293  1.00 33.66  ?  167  ILE C O     1 
ATOM   4529  C  CB    . ILE C 2 167  ? -15.958 23.819  39.969  1.00 25.67  ?  167  ILE C CB    1 
ATOM   4530  C  CG1   . ILE C 2 167  ? -17.117 23.929  38.978  1.00 28.85  ?  167  ILE C CG1   1 
ATOM   4531  C  CG2   . ILE C 2 167  ? -14.734 24.549  39.435  1.00 31.28  ?  167  ILE C CG2   1 
ATOM   4532  C  CD1   . ILE C 2 167  ? -17.389 25.342  38.522  1.00 35.18  ?  167  ILE C CD1   1 
ATOM   4533  N  N     . ILE C 2 168  ? -13.467 21.424  40.854  1.00 28.85  ?  168  ILE C N     1 
ATOM   4534  C  CA    . ILE C 2 168  ? -12.261 21.241  41.651  1.00 33.71  ?  168  ILE C CA    1 
ATOM   4535  C  C     . ILE C 2 168  ? -11.101 21.816  40.850  1.00 39.06  ?  168  ILE C C     1 
ATOM   4536  O  O     . ILE C 2 168  ? -10.746 21.290  39.787  1.00 45.71  ?  168  ILE C O     1 
ATOM   4537  C  CB    . ILE C 2 168  ? -12.021 19.767  42.011  1.00 31.51  ?  168  ILE C CB    1 
ATOM   4538  C  CG1   . ILE C 2 168  ? -12.940 19.333  43.156  1.00 36.42  ?  168  ILE C CG1   1 
ATOM   4539  C  CG2   . ILE C 2 168  ? -10.567 19.534  42.400  1.00 38.40  ?  168  ILE C CG2   1 
ATOM   4540  C  CD1   . ILE C 2 168  ? -14.362 19.029  42.743  1.00 37.77  ?  168  ILE C CD1   1 
ATOM   4541  N  N     . ASN C 2 169  ? -10.526 22.911  41.352  1.00 36.08  ?  169  ASN C N     1 
ATOM   4542  C  CA    . ASN C 2 169  ? -9.393  23.581  40.713  1.00 40.48  ?  169  ASN C CA    1 
ATOM   4543  C  C     . ASN C 2 169  ? -9.725  24.011  39.285  1.00 46.04  ?  169  ASN C C     1 
ATOM   4544  O  O     . ASN C 2 169  ? -8.924  23.845  38.362  1.00 50.02  ?  169  ASN C O     1 
ATOM   4545  C  CB    . ASN C 2 169  ? -8.142  22.701  40.744  1.00 41.63  ?  169  ASN C CB    1 
ATOM   4546  C  CG    . ASN C 2 169  ? -7.706  22.367  42.155  1.00 41.85  ?  169  ASN C CG    1 
ATOM   4547  O  OD1   . ASN C 2 169  ? -7.894  23.160  43.078  1.00 41.69  ?  169  ASN C OD1   1 
ATOM   4548  N  ND2   . ASN C 2 169  ? -7.125  21.187  42.332  1.00 33.46  ?  169  ASN C ND2   1 
ATOM   4549  N  N     . GLY C 2 170  ? -10.921 24.566  39.101  1.00 42.23  ?  170  GLY C N     1 
ATOM   4550  C  CA    . GLY C 2 170  ? -11.292 25.140  37.823  1.00 35.64  ?  170  GLY C CA    1 
ATOM   4551  C  C     . GLY C 2 170  ? -11.637 24.152  36.734  1.00 37.65  ?  170  GLY C C     1 
ATOM   4552  O  O     . GLY C 2 170  ? -11.569 24.502  35.554  1.00 56.06  ?  170  GLY C O     1 
ATOM   4553  N  N     . THR C 2 171  ? -12.005 22.923  37.090  1.00 30.84  ?  171  THR C N     1 
ATOM   4554  C  CA    . THR C 2 171  ? -12.390 21.905  36.118  1.00 40.13  ?  171  THR C CA    1 
ATOM   4555  C  C     . THR C 2 171  ? -13.677 21.245  36.587  1.00 39.78  ?  171  THR C C     1 
ATOM   4556  O  O     . THR C 2 171  ? -13.732 20.713  37.700  1.00 40.70  ?  171  THR C O     1 
ATOM   4557  C  CB    . THR C 2 171  ? -11.288 20.854  35.939  1.00 36.72  ?  171  THR C CB    1 
ATOM   4558  O  OG1   . THR C 2 171  ? -10.966 20.271  37.208  1.00 36.98  ?  171  THR C OG1   1 
ATOM   4559  C  CG2   . THR C 2 171  ? -10.037 21.480  35.336  1.00 46.76  ?  171  THR C CG2   1 
ATOM   4560  N  N     . GLU C 2 172  ? -14.705 21.281  35.742  1.00 35.73  ?  172  GLU C N     1 
ATOM   4561  C  CA    . GLU C 2 172  ? -15.975 20.649  36.080  1.00 22.29  ?  172  GLU C CA    1 
ATOM   4562  C  C     . GLU C 2 172  ? -15.796 19.138  36.165  1.00 24.80  ?  172  GLU C C     1 
ATOM   4563  O  O     . GLU C 2 172  ? -15.366 18.498  35.199  1.00 27.05  ?  172  GLU C O     1 
ATOM   4564  C  CB    . GLU C 2 172  ? -17.045 21.007  35.051  1.00 16.61  ?  172  GLU C CB    1 
ATOM   4565  C  CG    . GLU C 2 172  ? -17.939 22.168  35.464  1.00 36.05  ?  172  GLU C CG    1 
ATOM   4566  C  CD    . GLU C 2 172  ? -19.098 22.384  34.508  1.00 45.03  ?  172  GLU C CD    1 
ATOM   4567  O  OE1   . GLU C 2 172  ? -19.280 21.552  33.595  1.00 50.41  ?  172  GLU C OE1   1 
ATOM   4568  O  OE2   . GLU C 2 172  ? -19.828 23.385  34.670  1.00 47.11  ?  172  GLU C OE2   1 
ATOM   4569  N  N     . ARG C 2 173  ? -16.124 18.571  37.321  1.00 32.32  ?  173  ARG C N     1 
ATOM   4570  C  CA    . ARG C 2 173  ? -15.985 17.146  37.569  1.00 25.60  ?  173  ARG C CA    1 
ATOM   4571  C  C     . ARG C 2 173  ? -17.344 16.543  37.892  1.00 24.28  ?  173  ARG C C     1 
ATOM   4572  O  O     . ARG C 2 173  ? -18.230 17.214  38.430  1.00 23.04  ?  173  ARG C O     1 
ATOM   4573  C  CB    . ARG C 2 173  ? -15.005 16.876  38.715  1.00 16.84  ?  173  ARG C CB    1 
ATOM   4574  C  CG    . ARG C 2 173  ? -13.612 17.436  38.477  1.00 23.18  ?  173  ARG C CG    1 
ATOM   4575  C  CD    . ARG C 2 173  ? -12.655 17.014  39.577  1.00 26.82  ?  173  ARG C CD    1 
ATOM   4576  N  NE    . ARG C 2 173  ? -11.416 16.469  39.033  1.00 31.52  ?  173  ARG C NE    1 
ATOM   4577  C  CZ    . ARG C 2 173  ? -11.258 15.200  38.670  1.00 35.91  ?  173  ARG C CZ    1 
ATOM   4578  N  NH1   . ARG C 2 173  ? -12.264 14.345  38.793  1.00 37.05  ?  173  ARG C NH1   1 
ATOM   4579  N  NH2   . ARG C 2 173  ? -10.097 14.785  38.183  1.00 43.41  ?  173  ARG C NH2   1 
ATOM   4580  N  N     . VAL C 2 174  ? -17.500 15.265  37.557  1.00 15.75  ?  174  VAL C N     1 
ATOM   4581  C  CA    . VAL C 2 174  ? -18.748 14.539  37.759  1.00 16.20  ?  174  VAL C CA    1 
ATOM   4582  C  C     . VAL C 2 174  ? -18.466 13.353  38.668  1.00 24.82  ?  174  VAL C C     1 
ATOM   4583  O  O     . VAL C 2 174  ? -17.604 12.519  38.362  1.00 27.94  ?  174  VAL C O     1 
ATOM   4584  C  CB    . VAL C 2 174  ? -19.359 14.073  36.428  1.00 9.42   ?  174  VAL C CB    1 
ATOM   4585  C  CG1   . VAL C 2 174  ? -20.532 13.139  36.684  1.00 14.68  ?  174  VAL C CG1   1 
ATOM   4586  C  CG2   . VAL C 2 174  ? -19.797 15.269  35.600  1.00 17.10  ?  174  VAL C CG2   1 
ATOM   4587  N  N     . VAL C 2 175  ? -19.186 13.281  39.783  1.00 20.14  ?  175  VAL C N     1 
ATOM   4588  C  CA    . VAL C 2 175  ? -19.132 12.114  40.657  1.00 21.75  ?  175  VAL C CA    1 
ATOM   4589  C  C     . VAL C 2 175  ? -20.095 11.069  40.107  1.00 20.91  ?  175  VAL C C     1 
ATOM   4590  O  O     . VAL C 2 175  ? -21.299 11.320  39.992  1.00 17.83  ?  175  VAL C O     1 
ATOM   4591  C  CB    . VAL C 2 175  ? -19.479 12.485  42.105  1.00 25.06  ?  175  VAL C CB    1 
ATOM   4592  C  CG1   . VAL C 2 175  ? -19.494 11.242  42.980  1.00 22.84  ?  175  VAL C CG1   1 
ATOM   4593  C  CG2   . VAL C 2 175  ? -18.487 13.506  42.642  1.00 14.93  ?  175  VAL C CG2   1 
ATOM   4594  N  N     . VAL C 2 176  ? -19.566 9.899   39.763  1.00 20.43  ?  176  VAL C N     1 
ATOM   4595  C  CA    . VAL C 2 176  ? -20.322 8.858   39.076  1.00 22.66  ?  176  VAL C CA    1 
ATOM   4596  C  C     . VAL C 2 176  ? -20.876 7.882   40.105  1.00 25.79  ?  176  VAL C C     1 
ATOM   4597  O  O     . VAL C 2 176  ? -20.163 7.468   41.028  1.00 16.86  ?  176  VAL C O     1 
ATOM   4598  C  CB    . VAL C 2 176  ? -19.446 8.132   38.041  1.00 22.28  ?  176  VAL C CB    1 
ATOM   4599  C  CG1   . VAL C 2 176  ? -20.230 7.022   37.360  1.00 27.32  ?  176  VAL C CG1   1 
ATOM   4600  C  CG2   . VAL C 2 176  ? -18.918 9.122   37.017  1.00 27.70  ?  176  VAL C CG2   1 
ATOM   4601  N  N     . SER C 2 177  ? -22.147 7.517   39.946  1.00 18.99  ?  177  SER C N     1 
ATOM   4602  C  CA    . SER C 2 177  ? -22.767 6.547   40.836  1.00 17.43  ?  177  SER C CA    1 
ATOM   4603  C  C     . SER C 2 177  ? -22.097 5.186   40.685  1.00 19.65  ?  177  SER C C     1 
ATOM   4604  O  O     . SER C 2 177  ? -21.782 4.750   39.574  1.00 25.14  ?  177  SER C O     1 
ATOM   4605  C  CB    . SER C 2 177  ? -24.262 6.439   40.534  1.00 22.79  ?  177  SER C CB    1 
ATOM   4606  O  OG    . SER C 2 177  ? -24.863 7.721   40.475  1.00 31.25  ?  177  SER C OG    1 
ATOM   4607  N  N     . GLN C 2 178  ? -21.877 4.513   41.812  1.00 27.02  ?  178  GLN C N     1 
ATOM   4608  C  CA    . GLN C 2 178  ? -21.138 3.259   41.845  1.00 27.26  ?  178  GLN C CA    1 
ATOM   4609  C  C     . GLN C 2 178  ? -22.066 2.106   42.200  1.00 33.46  ?  178  GLN C C     1 
ATOM   4610  O  O     . GLN C 2 178  ? -22.867 2.212   43.135  1.00 40.84  ?  178  GLN C O     1 
ATOM   4611  C  CB    . GLN C 2 178  ? -19.984 3.327   42.848  1.00 21.87  ?  178  GLN C CB    1 
ATOM   4612  C  CG    . GLN C 2 178  ? -19.132 2.066   42.894  1.00 25.10  ?  178  GLN C CG    1 
ATOM   4613  C  CD    . GLN C 2 178  ? -18.072 2.114   43.977  1.00 40.57  ?  178  GLN C CD    1 
ATOM   4614  O  OE1   . GLN C 2 178  ? -18.186 2.872   44.939  1.00 39.65  ?  178  GLN C OE1   1 
ATOM   4615  N  NE2   . GLN C 2 178  ? -17.032 1.302   43.823  1.00 48.46  ?  178  GLN C NE2   1 
ATOM   4616  N  N     . LEU C 2 179  ? -21.950 1.009   41.454  1.00 33.97  ?  179  LEU C N     1 
ATOM   4617  C  CA    . LEU C 2 179  ? -22.648 -0.229  41.769  1.00 29.03  ?  179  LEU C CA    1 
ATOM   4618  C  C     . LEU C 2 179  ? -21.783 -1.070  42.699  1.00 34.08  ?  179  LEU C C     1 
ATOM   4619  O  O     . LEU C 2 179  ? -20.626 -1.366  42.382  1.00 36.55  ?  179  LEU C O     1 
ATOM   4620  C  CB    . LEU C 2 179  ? -22.969 -1.015  40.497  1.00 31.11  ?  179  LEU C CB    1 
ATOM   4621  C  CG    . LEU C 2 179  ? -24.086 -0.499  39.589  1.00 35.82  ?  179  LEU C CG    1 
ATOM   4622  C  CD1   . LEU C 2 179  ? -24.136 -1.311  38.306  1.00 37.44  ?  179  LEU C CD1   1 
ATOM   4623  C  CD2   . LEU C 2 179  ? -25.425 -0.553  40.306  1.00 36.73  ?  179  LEU C CD2   1 
ATOM   4624  N  N     . VAL C 2 180  ? -22.343 -1.446  43.849  1.00 41.76  ?  180  VAL C N     1 
ATOM   4625  C  CA    . VAL C 2 180  ? -21.636 -2.256  44.832  1.00 45.41  ?  180  VAL C CA    1 
ATOM   4626  C  C     . VAL C 2 180  ? -22.568 -3.347  45.340  1.00 48.03  ?  180  VAL C C     1 
ATOM   4627  O  O     . VAL C 2 180  ? -23.790 -3.276  45.193  1.00 48.33  ?  180  VAL C O     1 
ATOM   4628  C  CB    . VAL C 2 180  ? -21.104 -1.418  46.018  1.00 47.55  ?  180  VAL C CB    1 
ATOM   4629  C  CG1   . VAL C 2 180  ? -19.966 -0.514  45.566  1.00 51.70  ?  180  VAL C CG1   1 
ATOM   4630  C  CG2   . VAL C 2 180  ? -22.227 -0.603  46.639  1.00 46.37  ?  180  VAL C CG2   1 
ATOM   4631  N  N     . ARG C 2 181  ? -21.967 -4.369  45.941  1.00 62.01  ?  181  ARG C N     1 
ATOM   4632  C  CA    . ARG C 2 181  ? -22.733 -5.455  46.537  1.00 66.00  ?  181  ARG C CA    1 
ATOM   4633  C  C     . ARG C 2 181  ? -23.408 -4.956  47.810  1.00 67.35  ?  181  ARG C C     1 
ATOM   4634  O  O     . ARG C 2 181  ? -22.737 -4.469  48.726  1.00 63.96  ?  181  ARG C O     1 
ATOM   4635  C  CB    . ARG C 2 181  ? -21.815 -6.639  46.829  1.00 66.64  ?  181  ARG C CB    1 
ATOM   4636  C  CG    . ARG C 2 181  ? -22.521 -7.975  46.991  1.00 69.47  ?  181  ARG C CG    1 
ATOM   4637  C  CD    . ARG C 2 181  ? -21.508 -9.110  46.982  1.00 86.39  ?  181  ARG C CD    1 
ATOM   4638  N  NE    . ARG C 2 181  ? -22.105 -10.399 47.323  1.00 97.01  ?  181  ARG C NE    1 
ATOM   4639  C  CZ    . ARG C 2 181  ? -21.409 -11.517 47.506  1.00 102.11 ?  181  ARG C CZ    1 
ATOM   4640  N  NH1   . ARG C 2 181  ? -20.089 -11.506 47.382  1.00 107.10 ?  181  ARG C NH1   1 
ATOM   4641  N  NH2   . ARG C 2 181  ? -22.032 -12.646 47.814  1.00 101.57 ?  181  ARG C NH2   1 
ATOM   4642  N  N     . SER C 2 182  ? -24.734 -5.068  47.861  1.00 60.86  ?  182  SER C N     1 
ATOM   4643  C  CA    . SER C 2 182  ? -25.493 -4.539  48.982  1.00 62.57  ?  182  SER C CA    1 
ATOM   4644  C  C     . SER C 2 182  ? -25.125 -5.260  50.278  1.00 62.89  ?  182  SER C C     1 
ATOM   4645  O  O     . SER C 2 182  ? -24.814 -6.453  50.269  1.00 64.20  ?  182  SER C O     1 
ATOM   4646  C  CB    . SER C 2 182  ? -26.991 -4.679  48.725  1.00 60.28  ?  182  SER C CB    1 
ATOM   4647  O  OG    . SER C 2 182  ? -27.746 -4.191  49.820  1.00 67.06  ?  182  SER C OG    1 
ATOM   4648  N  N     . PRO C 2 183  ? -25.146 -4.552  51.406  1.00 67.49  ?  183  PRO C N     1 
ATOM   4649  C  CA    . PRO C 2 183  ? -24.904 -5.215  52.691  1.00 69.22  ?  183  PRO C CA    1 
ATOM   4650  C  C     . PRO C 2 183  ? -26.017 -6.197  53.020  1.00 75.72  ?  183  PRO C C     1 
ATOM   4651  O  O     . PRO C 2 183  ? -27.201 -5.910  52.829  1.00 78.32  ?  183  PRO C O     1 
ATOM   4652  C  CB    . PRO C 2 183  ? -24.867 -4.053  53.692  1.00 69.46  ?  183  PRO C CB    1 
ATOM   4653  C  CG    . PRO C 2 183  ? -24.588 -2.837  52.863  1.00 73.68  ?  183  PRO C CG    1 
ATOM   4654  C  CD    . PRO C 2 183  ? -25.255 -3.091  51.549  1.00 70.75  ?  183  PRO C CD    1 
ATOM   4655  N  N     . GLY C 2 184  ? -25.626 -7.360  53.515  1.00 72.02  ?  184  GLY C N     1 
ATOM   4656  C  CA    . GLY C 2 184  ? -26.586 -8.384  53.871  1.00 68.49  ?  184  GLY C CA    1 
ATOM   4657  C  C     . GLY C 2 184  ? -25.918 -9.738  53.966  1.00 66.68  ?  184  GLY C C     1 
ATOM   4658  O  O     . GLY C 2 184  ? -24.706 -9.877  53.803  1.00 70.13  ?  184  GLY C O     1 
ATOM   4659  N  N     . VAL C 2 185  ? -26.747 -10.741 54.238  1.00 76.04  ?  185  VAL C N     1 
ATOM   4660  C  CA    . VAL C 2 185  ? -26.303 -12.125 54.356  1.00 79.89  ?  185  VAL C CA    1 
ATOM   4661  C  C     . VAL C 2 185  ? -26.658 -12.850 53.063  1.00 75.40  ?  185  VAL C C     1 
ATOM   4662  O  O     . VAL C 2 185  ? -27.825 -12.875 52.653  1.00 76.03  ?  185  VAL C O     1 
ATOM   4663  C  CB    . VAL C 2 185  ? -26.929 -12.812 55.581  1.00 82.02  ?  185  VAL C CB    1 
ATOM   4664  C  CG1   . VAL C 2 185  ? -28.420 -12.499 55.678  1.00 80.12  ?  185  VAL C CG1   1 
ATOM   4665  C  CG2   . VAL C 2 185  ? -26.691 -14.310 55.530  1.00 86.72  ?  185  VAL C CG2   1 
ATOM   4666  N  N     . TYR C 2 186  ? -25.652 -13.432 52.414  1.00 74.04  ?  186  TYR C N     1 
ATOM   4667  C  CA    . TYR C 2 186  ? -25.813 -14.029 51.097  1.00 82.06  ?  186  TYR C CA    1 
ATOM   4668  C  C     . TYR C 2 186  ? -25.356 -15.481 51.113  1.00 85.38  ?  186  TYR C C     1 
ATOM   4669  O  O     . TYR C 2 186  ? -24.416 -15.847 51.824  1.00 85.00  ?  186  TYR C O     1 
ATOM   4670  C  CB    . TYR C 2 186  ? -25.036 -13.239 50.039  1.00 91.39  ?  186  TYR C CB    1 
ATOM   4671  C  CG    . TYR C 2 186  ? -25.479 -11.799 49.934  1.00 92.30  ?  186  TYR C CG    1 
ATOM   4672  C  CD1   . TYR C 2 186  ? -26.823 -11.461 50.020  1.00 96.20  ?  186  TYR C CD1   1 
ATOM   4673  C  CD2   . TYR C 2 186  ? -24.556 -10.776 49.768  1.00 86.66  ?  186  TYR C CD2   1 
ATOM   4674  C  CE1   . TYR C 2 186  ? -27.239 -10.148 49.933  1.00 91.24  ?  186  TYR C CE1   1 
ATOM   4675  C  CE2   . TYR C 2 186  ? -24.962 -9.458  49.679  1.00 86.31  ?  186  TYR C CE2   1 
ATOM   4676  C  CZ    . TYR C 2 186  ? -26.305 -9.149  49.763  1.00 85.48  ?  186  TYR C CZ    1 
ATOM   4677  O  OH    . TYR C 2 186  ? -26.718 -7.839  49.677  1.00 86.09  ?  186  TYR C OH    1 
ATOM   4678  N  N     . PHE C 2 187  ? -26.031 -16.302 50.312  1.00 93.68  ?  187  PHE C N     1 
ATOM   4679  C  CA    . PHE C 2 187  ? -25.804 -17.739 50.262  1.00 97.12  ?  187  PHE C CA    1 
ATOM   4680  C  C     . PHE C 2 187  ? -25.466 -18.154 48.838  1.00 103.20 ?  187  PHE C C     1 
ATOM   4681  O  O     . PHE C 2 187  ? -26.004 -17.600 47.874  1.00 106.66 ?  187  PHE C O     1 
ATOM   4682  C  CB    . PHE C 2 187  ? -27.036 -18.505 50.763  1.00 105.14 ?  187  PHE C CB    1 
ATOM   4683  C  CG    . PHE C 2 187  ? -27.462 -18.120 52.153  1.00 101.96 ?  187  PHE C CG    1 
ATOM   4684  C  CD1   . PHE C 2 187  ? -28.260 -17.007 52.366  1.00 101.21 ?  187  PHE C CD1   1 
ATOM   4685  C  CD2   . PHE C 2 187  ? -27.064 -18.870 53.245  1.00 90.37  ?  187  PHE C CD2   1 
ATOM   4686  C  CE1   . PHE C 2 187  ? -28.649 -16.650 53.643  1.00 103.48 ?  187  PHE C CE1   1 
ATOM   4687  C  CE2   . PHE C 2 187  ? -27.450 -18.518 54.525  1.00 95.77  ?  187  PHE C CE2   1 
ATOM   4688  C  CZ    . PHE C 2 187  ? -28.243 -17.405 54.724  1.00 103.52 ?  187  PHE C CZ    1 
ATOM   4689  N  N     . ASP C 2 188  ? -24.574 -19.135 48.710  1.00 95.63  ?  188  ASP C N     1 
ATOM   4690  C  CA    . ASP C 2 188  ? -24.065 -19.577 47.420  1.00 104.49 ?  188  ASP C CA    1 
ATOM   4691  C  C     . ASP C 2 188  ? -24.079 -21.096 47.347  1.00 106.41 ?  188  ASP C C     1 
ATOM   4692  O  O     . ASP C 2 188  ? -23.778 -21.775 48.333  1.00 109.43 ?  188  ASP C O     1 
ATOM   4693  C  CB    . ASP C 2 188  ? -22.641 -19.053 47.184  1.00 108.64 ?  188  ASP C CB    1 
ATOM   4694  C  CG    . ASP C 2 188  ? -21.918 -19.803 46.084  1.00 122.33 ?  188  ASP C CG    1 
ATOM   4695  O  OD1   . ASP C 2 188  ? -22.323 -19.676 44.909  1.00 125.56 ?  188  ASP C OD1   1 
ATOM   4696  O  OD2   . ASP C 2 188  ? -20.942 -20.518 46.395  1.00 125.62 ?  188  ASP C OD2   1 
ATOM   4697  N  N     . GLU C 2 189  ? -24.430 -21.622 46.177  1.00 95.60  ?  189  GLU C N     1 
ATOM   4698  C  CA    . GLU C 2 189  ? -24.435 -23.060 45.914  1.00 94.96  ?  189  GLU C CA    1 
ATOM   4699  C  C     . GLU C 2 189  ? -23.296 -23.355 44.939  1.00 102.59 ?  189  GLU C C     1 
ATOM   4700  O  O     . GLU C 2 189  ? -23.466 -23.285 43.720  1.00 109.50 ?  189  GLU C O     1 
ATOM   4701  C  CB    . GLU C 2 189  ? -25.784 -23.518 45.362  1.00 102.67 ?  189  GLU C CB    1 
ATOM   4702  C  CG    . GLU C 2 189  ? -25.844 -24.996 45.005  1.00 109.01 ?  189  GLU C CG    1 
ATOM   4703  C  CD    . GLU C 2 189  ? -27.223 -25.434 44.554  1.00 115.02 ?  189  GLU C CD    1 
ATOM   4704  O  OE1   . GLU C 2 189  ? -27.684 -26.504 45.003  1.00 116.90 ?  189  GLU C OE1   1 
ATOM   4705  O  OE2   . GLU C 2 189  ? -27.849 -24.705 43.755  1.00 118.12 ?  189  GLU C OE2   1 
ATOM   4706  N  N     . THR C 2 190  ? -22.131 -23.680 45.487  1.00 120.80 ?  190  THR C N     1 
ATOM   4707  C  CA    . THR C 2 190  ? -20.961 -24.033 44.697  1.00 124.40 ?  190  THR C CA    1 
ATOM   4708  C  C     . THR C 2 190  ? -20.834 -25.549 44.588  1.00 131.27 ?  190  THR C C     1 
ATOM   4709  O  O     . THR C 2 190  ? -21.348 -26.303 45.418  1.00 138.10 ?  190  THR C O     1 
ATOM   4710  C  CB    . THR C 2 190  ? -19.688 -23.442 45.311  1.00 124.08 ?  190  THR C CB    1 
ATOM   4711  O  OG1   . THR C 2 190  ? -18.544 -23.894 44.575  1.00 121.48 ?  190  THR C OG1   1 
ATOM   4712  C  CG2   . THR C 2 190  ? -19.548 -23.862 46.767  1.00 125.94 ?  190  THR C CG2   1 
ATOM   4713  N  N     . ILE C 2 191  ? -20.141 -25.988 43.541  1.00 130.29 ?  191  ILE C N     1 
ATOM   4714  C  CA    . ILE C 2 191  ? -19.920 -27.403 43.268  1.00 138.24 ?  191  ILE C CA    1 
ATOM   4715  C  C     . ILE C 2 191  ? -18.439 -27.699 43.455  1.00 139.01 ?  191  ILE C C     1 
ATOM   4716  O  O     . ILE C 2 191  ? -17.584 -26.984 42.917  1.00 134.93 ?  191  ILE C O     1 
ATOM   4717  C  CB    . ILE C 2 191  ? -20.388 -27.785 41.853  1.00 135.47 ?  191  ILE C CB    1 
ATOM   4718  C  CG1   . ILE C 2 191  ? -21.793 -27.238 41.590  1.00 130.62 ?  191  ILE C CG1   1 
ATOM   4719  C  CG2   . ILE C 2 191  ? -20.370 -29.295 41.675  1.00 134.59 ?  191  ILE C CG2   1 
ATOM   4720  C  CD1   . ILE C 2 191  ? -22.843 -27.753 42.551  1.00 132.18 ?  191  ILE C CD1   1 
ATOM   4721  N  N     . ASP C 2 192  ? -18.138 -28.748 44.216  1.00 144.64 ?  192  ASP C N     1 
ATOM   4722  C  CA    . ASP C 2 192  ? -16.758 -29.080 44.534  1.00 149.66 ?  192  ASP C CA    1 
ATOM   4723  C  C     . ASP C 2 192  ? -16.042 -29.653 43.312  1.00 145.64 ?  192  ASP C C     1 
ATOM   4724  O  O     . ASP C 2 192  ? -16.656 -30.205 42.395  1.00 142.97 ?  192  ASP C O     1 
ATOM   4725  C  CB    . ASP C 2 192  ? -16.705 -30.064 45.705  1.00 150.00 ?  192  ASP C CB    1 
ATOM   4726  C  CG    . ASP C 2 192  ? -15.287 -30.406 46.120  1.00 146.57 ?  192  ASP C CG    1 
ATOM   4727  O  OD1   . ASP C 2 192  ? -14.841 -31.540 45.843  1.00 144.75 ?  192  ASP C OD1   1 
ATOM   4728  O  OD2   . ASP C 2 192  ? -14.611 -29.532 46.703  1.00 149.99 ?  192  ASP C OD2   1 
ATOM   4729  N  N     . LYS C 2 193  ? -14.714 -29.509 43.311  1.00 125.08 ?  193  LYS C N     1 
ATOM   4730  C  CA    . LYS C 2 193  ? -13.913 -29.904 42.158  1.00 128.06 ?  193  LYS C CA    1 
ATOM   4731  C  C     . LYS C 2 193  ? -13.608 -31.399 42.165  1.00 123.49 ?  193  LYS C C     1 
ATOM   4732  O  O     . LYS C 2 193  ? -13.774 -32.078 41.145  1.00 121.55 ?  193  LYS C O     1 
ATOM   4733  C  CB    . LYS C 2 193  ? -12.610 -29.101 42.128  1.00 131.29 ?  193  LYS C CB    1 
ATOM   4734  C  CG    . LYS C 2 193  ? -12.787 -27.603 42.315  1.00 132.09 ?  193  LYS C CG    1 
ATOM   4735  C  CD    . LYS C 2 193  ? -11.438 -26.901 42.388  1.00 123.18 ?  193  LYS C CD    1 
ATOM   4736  C  CE    . LYS C 2 193  ? -11.596 -25.421 42.693  1.00 119.11 ?  193  LYS C CE    1 
ATOM   4737  N  NZ    . LYS C 2 193  ? -12.375 -24.715 41.640  1.00 120.56 ?  193  LYS C NZ    1 
ATOM   4738  N  N     . SER C 2 194  ? -13.160 -31.927 43.304  1.00 148.75 ?  194  SER C N     1 
ATOM   4739  C  CA    . SER C 2 194  ? -12.639 -33.289 43.362  1.00 151.81 ?  194  SER C CA    1 
ATOM   4740  C  C     . SER C 2 194  ? -13.704 -34.328 43.696  1.00 153.26 ?  194  SER C C     1 
ATOM   4741  O  O     . SER C 2 194  ? -13.702 -35.418 43.115  1.00 148.67 ?  194  SER C O     1 
ATOM   4742  C  CB    . SER C 2 194  ? -11.501 -33.368 44.384  1.00 152.66 ?  194  SER C CB    1 
ATOM   4743  O  OG    . SER C 2 194  ? -11.932 -32.940 45.664  1.00 154.22 ?  194  SER C OG    1 
ATOM   4744  N  N     . THR C 2 195  ? -14.613 -34.022 44.623  1.00 151.22 ?  195  THR C N     1 
ATOM   4745  C  CA    . THR C 2 195  ? -15.612 -34.987 45.066  1.00 148.25 ?  195  THR C CA    1 
ATOM   4746  C  C     . THR C 2 195  ? -16.952 -34.844 44.353  1.00 145.93 ?  195  THR C C     1 
ATOM   4747  O  O     . THR C 2 195  ? -17.805 -35.726 44.500  1.00 145.04 ?  195  THR C O     1 
ATOM   4748  C  CB    . THR C 2 195  ? -15.827 -34.873 46.581  1.00 148.05 ?  195  THR C CB    1 
ATOM   4749  O  OG1   . THR C 2 195  ? -16.203 -33.531 46.915  1.00 147.23 ?  195  THR C OG1   1 
ATOM   4750  C  CG2   . THR C 2 195  ? -14.552 -35.240 47.328  1.00 145.11 ?  195  THR C CG2   1 
ATOM   4751  N  N     . ASP C 2 196  ? -17.156 -33.762 43.598  1.00 137.54 ?  196  ASP C N     1 
ATOM   4752  C  CA    . ASP C 2 196  ? -18.360 -33.569 42.784  1.00 139.38 ?  196  ASP C CA    1 
ATOM   4753  C  C     . ASP C 2 196  ? -19.630 -33.585 43.633  1.00 137.97 ?  196  ASP C C     1 
ATOM   4754  O  O     . ASP C 2 196  ? -20.662 -34.123 43.228  1.00 135.85 ?  196  ASP C O     1 
ATOM   4755  C  CB    . ASP C 2 196  ? -18.444 -34.611 41.666  1.00 140.41 ?  196  ASP C CB    1 
ATOM   4756  C  CG    . ASP C 2 196  ? -17.257 -34.555 40.727  1.00 140.04 ?  196  ASP C CG    1 
ATOM   4757  O  OD1   . ASP C 2 196  ? -16.666 -33.465 40.578  1.00 142.24 ?  196  ASP C OD1   1 
ATOM   4758  O  OD2   . ASP C 2 196  ? -16.915 -35.601 40.137  1.00 133.38 ?  196  ASP C OD2   1 
ATOM   4759  N  N     . LYS C 2 197  ? -19.558 -32.990 44.820  1.00 138.82 ?  197  LYS C N     1 
ATOM   4760  C  CA    . LYS C 2 197  ? -20.715 -32.840 45.688  1.00 138.45 ?  197  LYS C CA    1 
ATOM   4761  C  C     . LYS C 2 197  ? -21.091 -31.367 45.796  1.00 136.56 ?  197  LYS C C     1 
ATOM   4762  O  O     . LYS C 2 197  ? -20.239 -30.481 45.690  1.00 134.87 ?  197  LYS C O     1 
ATOM   4763  C  CB    . LYS C 2 197  ? -20.449 -33.420 47.082  1.00 132.94 ?  197  LYS C CB    1 
ATOM   4764  C  CG    . LYS C 2 197  ? -19.348 -32.722 47.862  1.00 134.36 ?  197  LYS C CG    1 
ATOM   4765  C  CD    . LYS C 2 197  ? -19.228 -33.292 49.267  1.00 124.00 ?  197  LYS C CD    1 
ATOM   4766  C  CE    . LYS C 2 197  ? -18.929 -34.782 49.238  1.00 121.34 ?  197  LYS C CE    1 
ATOM   4767  N  NZ    . LYS C 2 197  ? -18.825 -35.353 50.609  1.00 124.79 ?  197  LYS C NZ    1 
ATOM   4768  N  N     . THR C 2 198  ? -22.382 -31.115 46.001  1.00 141.87 ?  198  THR C N     1 
ATOM   4769  C  CA    . THR C 2 198  ? -22.905 -29.754 46.048  1.00 136.99 ?  198  THR C CA    1 
ATOM   4770  C  C     . THR C 2 198  ? -22.590 -29.140 47.407  1.00 137.09 ?  198  THR C C     1 
ATOM   4771  O  O     . THR C 2 198  ? -23.106 -29.590 48.435  1.00 135.37 ?  198  THR C O     1 
ATOM   4772  C  CB    . THR C 2 198  ? -24.407 -29.749 45.779  1.00 135.51 ?  198  THR C CB    1 
ATOM   4773  O  OG1   . THR C 2 198  ? -25.081 -30.487 46.807  1.00 140.50 ?  198  THR C OG1   1 
ATOM   4774  C  CG2   . THR C 2 198  ? -24.708 -30.385 44.429  1.00 133.40 ?  198  THR C CG2   1 
ATOM   4775  N  N     . LEU C 2 199  ? -21.747 -28.113 47.413  1.00 144.86 ?  199  LEU C N     1 
ATOM   4776  C  CA    . LEU C 2 199  ? -21.386 -27.396 48.626  1.00 137.42 ?  199  LEU C CA    1 
ATOM   4777  C  C     . LEU C 2 199  ? -22.236 -26.137 48.771  1.00 135.22 ?  199  LEU C C     1 
ATOM   4778  O  O     . LEU C 2 199  ? -22.971 -25.741 47.863  1.00 136.04 ?  199  LEU C O     1 
ATOM   4779  C  CB    . LEU C 2 199  ? -19.897 -27.036 48.617  1.00 130.29 ?  199  LEU C CB    1 
ATOM   4780  C  CG    . LEU C 2 199  ? -18.908 -28.183 48.405  1.00 137.72 ?  199  LEU C CG    1 
ATOM   4781  C  CD1   . LEU C 2 199  ? -17.476 -27.670 48.450  1.00 140.01 ?  199  LEU C CD1   1 
ATOM   4782  C  CD2   . LEU C 2 199  ? -19.124 -29.277 49.437  1.00 135.52 ?  199  LEU C CD2   1 
ATOM   4783  N  N     . HIS C 2 200  ? -22.125 -25.506 49.938  1.00 130.50 ?  200  HIS C N     1 
ATOM   4784  C  CA    . HIS C 2 200  ? -22.856 -24.280 50.219  1.00 125.11 ?  200  HIS C CA    1 
ATOM   4785  C  C     . HIS C 2 200  ? -22.012 -23.394 51.125  1.00 118.35 ?  200  HIS C C     1 
ATOM   4786  O  O     . HIS C 2 200  ? -21.277 -23.884 51.986  1.00 120.88 ?  200  HIS C O     1 
ATOM   4787  C  CB    . HIS C 2 200  ? -24.218 -24.566 50.866  1.00 118.14 ?  200  HIS C CB    1 
ATOM   4788  C  CG    . HIS C 2 200  ? -25.183 -25.265 49.958  1.00 116.03 ?  200  HIS C CG    1 
ATOM   4789  N  ND1   . HIS C 2 200  ? -25.187 -26.632 49.785  1.00 125.17 ?  200  HIS C ND1   1 
ATOM   4790  C  CD2   . HIS C 2 200  ? -26.173 -24.784 49.169  1.00 116.21 ?  200  HIS C CD2   1 
ATOM   4791  C  CE1   . HIS C 2 200  ? -26.139 -26.964 48.930  1.00 125.87 ?  200  HIS C CE1   1 
ATOM   4792  N  NE2   . HIS C 2 200  ? -26.752 -25.860 48.542  1.00 115.62 ?  200  HIS C NE2   1 
ATOM   4793  N  N     . SER C 2 201  ? -22.127 -22.083 50.919  1.00 114.06 ?  201  SER C N     1 
ATOM   4794  C  CA    . SER C 2 201  ? -21.346 -21.108 51.665  1.00 111.25 ?  201  SER C CA    1 
ATOM   4795  C  C     . SER C 2 201  ? -22.201 -19.882 51.955  1.00 110.88 ?  201  SER C C     1 
ATOM   4796  O  O     . SER C 2 201  ? -23.143 -19.574 51.220  1.00 109.69 ?  201  SER C O     1 
ATOM   4797  C  CB    . SER C 2 201  ? -20.079 -20.697 50.902  1.00 112.69 ?  201  SER C CB    1 
ATOM   4798  O  OG    . SER C 2 201  ? -20.400 -20.144 49.637  1.00 114.58 ?  201  SER C OG    1 
ATOM   4799  N  N     . VAL C 2 202  ? -21.859 -19.187 53.039  1.00 111.66 ?  202  VAL C N     1 
ATOM   4800  C  CA    . VAL C 2 202  ? -22.565 -17.986 53.467  1.00 111.05 ?  202  VAL C CA    1 
ATOM   4801  C  C     . VAL C 2 202  ? -21.561 -16.852 53.599  1.00 111.58 ?  202  VAL C C     1 
ATOM   4802  O  O     . VAL C 2 202  ? -20.393 -17.067 53.939  1.00 111.50 ?  202  VAL C O     1 
ATOM   4803  C  CB    . VAL C 2 202  ? -23.313 -18.200 54.803  1.00 117.44 ?  202  VAL C CB    1 
ATOM   4804  C  CG1   . VAL C 2 202  ? -24.298 -17.068 55.055  1.00 112.18 ?  202  VAL C CG1   1 
ATOM   4805  C  CG2   . VAL C 2 202  ? -24.017 -19.541 54.813  1.00 120.41 ?  202  VAL C CG2   1 
ATOM   4806  N  N     . LYS C 2 203  ? -22.022 -15.633 53.324  1.00 92.20  ?  203  LYS C N     1 
ATOM   4807  C  CA    . LYS C 2 203  ? -21.221 -14.431 53.499  1.00 89.48  ?  203  LYS C CA    1 
ATOM   4808  C  C     . LYS C 2 203  ? -22.055 -13.365 54.193  1.00 83.53  ?  203  LYS C C     1 
ATOM   4809  O  O     . LYS C 2 203  ? -23.219 -13.150 53.843  1.00 81.86  ?  203  LYS C O     1 
ATOM   4810  C  CB    . LYS C 2 203  ? -20.700 -13.897 52.159  1.00 103.24 ?  203  LYS C CB    1 
ATOM   4811  C  CG    . LYS C 2 203  ? -19.636 -14.767 51.511  1.00 107.16 ?  203  LYS C CG    1 
ATOM   4812  C  CD    . LYS C 2 203  ? -19.134 -14.148 50.217  1.00 116.74 ?  203  LYS C CD    1 
ATOM   4813  C  CE    . LYS C 2 203  ? -18.049 -15.001 49.582  1.00 126.07 ?  203  LYS C CE    1 
ATOM   4814  N  NZ    . LYS C 2 203  ? -17.573 -14.424 48.294  1.00 120.99 ?  203  LYS C NZ    1 
ATOM   4815  N  N     . VAL C 2 204  ? -21.455 -12.706 55.179  1.00 80.53  ?  204  VAL C N     1 
ATOM   4816  C  CA    . VAL C 2 204  ? -22.090 -11.615 55.911  1.00 80.82  ?  204  VAL C CA    1 
ATOM   4817  C  C     . VAL C 2 204  ? -21.265 -10.367 55.625  1.00 86.89  ?  204  VAL C C     1 
ATOM   4818  O  O     . VAL C 2 204  ? -20.220 -10.144 56.249  1.00 94.72  ?  204  VAL C O     1 
ATOM   4819  C  CB    . VAL C 2 204  ? -22.181 -11.896 57.415  1.00 83.50  ?  204  VAL C CB    1 
ATOM   4820  C  CG1   . VAL C 2 204  ? -22.850 -10.733 58.133  1.00 72.17  ?  204  VAL C CG1   1 
ATOM   4821  C  CG2   . VAL C 2 204  ? -22.938 -13.192 57.666  1.00 87.75  ?  204  VAL C CG2   1 
ATOM   4822  N  N     . ILE C 2 205  ? -21.727 -9.552  54.681  1.00 75.10  ?  205  ILE C N     1 
ATOM   4823  C  CA    . ILE C 2 205  ? -20.999 -8.370  54.229  1.00 73.85  ?  205  ILE C CA    1 
ATOM   4824  C  C     . ILE C 2 205  ? -21.545 -7.167  54.987  1.00 69.11  ?  205  ILE C C     1 
ATOM   4825  O  O     . ILE C 2 205  ? -22.690 -6.753  54.732  1.00 64.47  ?  205  ILE C O     1 
ATOM   4826  C  CB    . ILE C 2 205  ? -21.128 -8.176  52.713  1.00 66.31  ?  205  ILE C CB    1 
ATOM   4827  C  CG1   . ILE C 2 205  ? -20.698 -9.447  51.980  1.00 65.56  ?  205  ILE C CG1   1 
ATOM   4828  C  CG2   . ILE C 2 205  ? -20.298 -6.986  52.256  1.00 80.05  ?  205  ILE C CG2   1 
ATOM   4829  C  CD1   . ILE C 2 205  ? -20.893 -9.381  50.487  1.00 86.74  ?  205  ILE C CD1   1 
ATOM   4830  N  N     . PRO C 2 206  ? -20.791 -6.577  55.911  1.00 74.83  ?  206  PRO C N     1 
ATOM   4831  C  CA    . PRO C 2 206  ? -21.274 -5.394  56.620  1.00 73.73  ?  206  PRO C CA    1 
ATOM   4832  C  C     . PRO C 2 206  ? -21.036 -4.121  55.822  1.00 79.50  ?  206  PRO C C     1 
ATOM   4833  O  O     . PRO C 2 206  ? -20.198 -4.060  54.921  1.00 84.77  ?  206  PRO C O     1 
ATOM   4834  C  CB    . PRO C 2 206  ? -20.442 -5.396  57.905  1.00 82.74  ?  206  PRO C CB    1 
ATOM   4835  C  CG    . PRO C 2 206  ? -19.148 -6.004  57.482  1.00 88.09  ?  206  PRO C CG    1 
ATOM   4836  C  CD    . PRO C 2 206  ? -19.492 -7.039  56.433  1.00 87.18  ?  206  PRO C CD    1 
ATOM   4837  N  N     . SER C 2 207  ? -21.801 -3.087  56.178  1.00 82.63  ?  207  SER C N     1 
ATOM   4838  C  CA    . SER C 2 207  ? -21.565 -1.766  55.607  1.00 81.71  ?  207  SER C CA    1 
ATOM   4839  C  C     . SER C 2 207  ? -20.223 -1.192  56.045  1.00 78.04  ?  207  SER C C     1 
ATOM   4840  O  O     . SER C 2 207  ? -19.709 -0.278  55.391  1.00 81.89  ?  207  SER C O     1 
ATOM   4841  C  CB    . SER C 2 207  ? -22.700 -0.814  55.988  1.00 82.95  ?  207  SER C CB    1 
ATOM   4842  O  OG    . SER C 2 207  ? -22.576 0.428   55.317  1.00 90.12  ?  207  SER C OG    1 
ATOM   4843  N  N     . ARG C 2 208  ? -19.648 -1.715  57.126  1.00 99.20  ?  208  ARG C N     1 
ATOM   4844  C  CA    . ARG C 2 208  ? -18.323 -1.355  57.610  1.00 103.27 ?  208  ARG C CA    1 
ATOM   4845  C  C     . ARG C 2 208  ? -17.914 -2.374  58.663  1.00 100.49 ?  208  ARG C C     1 
ATOM   4846  O  O     . ARG C 2 208  ? -18.757 -2.880  59.410  1.00 94.65  ?  208  ARG C O     1 
ATOM   4847  C  CB    . ARG C 2 208  ? -18.291 0.068   58.190  1.00 99.96  ?  208  ARG C CB    1 
ATOM   4848  C  CG    . ARG C 2 208  ? -17.815 0.150   59.630  1.00 99.14  ?  208  ARG C CG    1 
ATOM   4849  C  CD    . ARG C 2 208  ? -17.431 1.568   60.014  1.00 103.52 ?  208  ARG C CD    1 
ATOM   4850  N  NE    . ARG C 2 208  ? -18.573 2.476   60.009  1.00 110.52 ?  208  ARG C NE    1 
ATOM   4851  C  CZ    . ARG C 2 208  ? -19.304 2.762   61.081  1.00 110.60 ?  208  ARG C CZ    1 
ATOM   4852  N  NH1   . ARG C 2 208  ? -19.014 2.209   62.251  1.00 110.66 ?  208  ARG C NH1   1 
ATOM   4853  N  NH2   . ARG C 2 208  ? -20.324 3.603   60.985  1.00 109.33 ?  208  ARG C NH2   1 
ATOM   4854  N  N     . GLY C 2 209  ? -16.621 -2.688  58.699  1.00 100.52 ?  209  GLY C N     1 
ATOM   4855  C  CA    . GLY C 2 209  ? -16.095 -3.559  59.731  1.00 105.78 ?  209  GLY C CA    1 
ATOM   4856  C  C     . GLY C 2 209  ? -15.532 -4.868  59.217  1.00 109.25 ?  209  GLY C C     1 
ATOM   4857  O  O     . GLY C 2 209  ? -15.190 -4.993  58.037  1.00 118.05 ?  209  GLY C O     1 
ATOM   4858  N  N     . ALA C 2 210  ? -15.439 -5.857  60.099  1.00 108.26 ?  210  ALA C N     1 
ATOM   4859  C  CA    . ALA C 2 210  ? -14.846 -7.139  59.755  1.00 113.27 ?  210  ALA C CA    1 
ATOM   4860  C  C     . ALA C 2 210  ? -15.846 -8.023  59.021  1.00 107.21 ?  210  ALA C C     1 
ATOM   4861  O  O     . ALA C 2 210  ? -17.063 -7.905  59.195  1.00 98.39  ?  210  ALA C O     1 
ATOM   4862  C  CB    . ALA C 2 210  ? -14.349 -7.850  61.011  1.00 108.14 ?  210  ALA C CB    1 
ATOM   4863  N  N     . TRP C 2 211  ? -15.316 -8.924  58.205  1.00 114.50 ?  211  TRP C N     1 
ATOM   4864  C  CA    . TRP C 2 211  ? -16.132 -9.852  57.443  1.00 112.86 ?  211  TRP C CA    1 
ATOM   4865  C  C     . TRP C 2 211  ? -16.285 -11.176 58.185  1.00 107.65 ?  211  TRP C C     1 
ATOM   4866  O  O     . TRP C 2 211  ? -15.533 -11.495 59.110  1.00 113.79 ?  211  TRP C O     1 
ATOM   4867  C  CB    . TRP C 2 211  ? -15.528 -10.086 56.058  1.00 124.04 ?  211  TRP C CB    1 
ATOM   4868  C  CG    . TRP C 2 211  ? -15.741 -8.937  55.123  1.00 133.98 ?  211  TRP C CG    1 
ATOM   4869  C  CD1   . TRP C 2 211  ? -16.356 -7.755  55.407  1.00 129.79 ?  211  TRP C CD1   1 
ATOM   4870  C  CD2   . TRP C 2 211  ? -15.342 -8.861  53.750  1.00 140.53 ?  211  TRP C CD2   1 
ATOM   4871  N  NE1   . TRP C 2 211  ? -16.365 -6.945  54.299  1.00 127.40 ?  211  TRP C NE1   1 
ATOM   4872  C  CE2   . TRP C 2 211  ? -15.747 -7.601  53.267  1.00 138.03 ?  211  TRP C CE2   1 
ATOM   4873  C  CE3   . TRP C 2 211  ? -14.680 -9.734  52.884  1.00 140.66 ?  211  TRP C CE3   1 
ATOM   4874  C  CZ2   . TRP C 2 211  ? -15.513 -7.194  51.957  1.00 144.78 ?  211  TRP C CZ2   1 
ATOM   4875  C  CZ3   . TRP C 2 211  ? -14.448 -9.328  51.588  1.00 140.03 ?  211  TRP C CZ3   1 
ATOM   4876  C  CH2   . TRP C 2 211  ? -14.866 -8.071  51.134  1.00 145.11 ?  211  TRP C CH2   1 
ATOM   4877  N  N     . LEU C 2 212  ? -17.281 -11.949 57.761  1.00 111.92 ?  212  LEU C N     1 
ATOM   4878  C  CA    . LEU C 2 212  ? -17.624 -13.199 58.435  1.00 112.47 ?  212  LEU C CA    1 
ATOM   4879  C  C     . LEU C 2 212  ? -18.311 -14.108 57.431  1.00 107.89 ?  212  LEU C C     1 
ATOM   4880  O  O     . LEU C 2 212  ? -19.380 -13.761 56.919  1.00 103.11 ?  212  LEU C O     1 
ATOM   4881  C  CB    . LEU C 2 212  ? -18.531 -12.930 59.637  1.00 114.09 ?  212  LEU C CB    1 
ATOM   4882  C  CG    . LEU C 2 212  ? -18.789 -14.075 60.614  1.00 117.14 ?  212  LEU C CG    1 
ATOM   4883  C  CD1   . LEU C 2 212  ? -17.511 -14.435 61.346  1.00 121.48 ?  212  LEU C CD1   1 
ATOM   4884  C  CD2   . LEU C 2 212  ? -19.883 -13.691 61.596  1.00 105.08 ?  212  LEU C CD2   1 
ATOM   4885  N  N     . GLU C 2 213  ? -17.710 -15.262 57.148  1.00 116.58 ?  213  GLU C N     1 
ATOM   4886  C  CA    . GLU C 2 213  ? -18.236 -16.183 56.147  1.00 117.23 ?  213  GLU C CA    1 
ATOM   4887  C  C     . GLU C 2 213  ? -18.214 -17.603 56.693  1.00 123.80 ?  213  GLU C C     1 
ATOM   4888  O  O     . GLU C 2 213  ? -17.153 -18.114 57.069  1.00 124.44 ?  213  GLU C O     1 
ATOM   4889  C  CB    . GLU C 2 213  ? -17.443 -16.087 54.838  1.00 127.24 ?  213  GLU C CB    1 
ATOM   4890  C  CG    . GLU C 2 213  ? -15.931 -16.112 54.996  1.00 134.42 ?  213  GLU C CG    1 
ATOM   4891  C  CD    . GLU C 2 213  ? -15.205 -15.929 53.677  1.00 139.29 ?  213  GLU C CD    1 
ATOM   4892  O  OE1   . GLU C 2 213  ? -14.003 -15.588 53.700  1.00 147.83 ?  213  GLU C OE1   1 
ATOM   4893  O  OE2   . GLU C 2 213  ? -15.836 -16.121 52.616  1.00 131.03 ?  213  GLU C OE2   1 
ATOM   4894  N  N     . PHE C 2 214  ? -19.385 -18.229 56.743  1.00 127.60 ?  214  PHE C N     1 
ATOM   4895  C  CA    . PHE C 2 214  ? -19.536 -19.634 57.092  1.00 124.67 ?  214  PHE C CA    1 
ATOM   4896  C  C     . PHE C 2 214  ? -19.589 -20.474 55.821  1.00 127.37 ?  214  PHE C C     1 
ATOM   4897  O  O     . PHE C 2 214  ? -19.918 -19.982 54.739  1.00 127.77 ?  214  PHE C O     1 
ATOM   4898  C  CB    . PHE C 2 214  ? -20.805 -19.858 57.922  1.00 117.87 ?  214  PHE C CB    1 
ATOM   4899  C  CG    . PHE C 2 214  ? -20.880 -19.013 59.166  1.00 119.97 ?  214  PHE C CG    1 
ATOM   4900  C  CD1   . PHE C 2 214  ? -20.502 -19.530 60.393  1.00 120.35 ?  214  PHE C CD1   1 
ATOM   4901  C  CD2   . PHE C 2 214  ? -21.339 -17.707 59.108  1.00 124.81 ?  214  PHE C CD2   1 
ATOM   4902  C  CE1   . PHE C 2 214  ? -20.572 -18.758 61.539  1.00 117.36 ?  214  PHE C CE1   1 
ATOM   4903  C  CE2   . PHE C 2 214  ? -21.411 -16.930 60.249  1.00 113.95 ?  214  PHE C CE2   1 
ATOM   4904  C  CZ    . PHE C 2 214  ? -21.028 -17.456 61.466  1.00 110.00 ?  214  PHE C CZ    1 
ATOM   4905  N  N     . ASP C 2 215  ? -19.262 -21.756 55.961  1.00 120.28 ?  215  ASP C N     1 
ATOM   4906  C  CA    . ASP C 2 215  ? -19.237 -22.636 54.801  1.00 119.85 ?  215  ASP C CA    1 
ATOM   4907  C  C     . ASP C 2 215  ? -19.320 -24.084 55.256  1.00 124.78 ?  215  ASP C C     1 
ATOM   4908  O  O     . ASP C 2 215  ? -18.972 -24.423 56.390  1.00 135.20 ?  215  ASP C O     1 
ATOM   4909  C  CB    . ASP C 2 215  ? -17.976 -22.412 53.956  1.00 127.25 ?  215  ASP C CB    1 
ATOM   4910  C  CG    . ASP C 2 215  ? -16.706 -22.798 54.690  1.00 132.71 ?  215  ASP C CG    1 
ATOM   4911  O  OD1   . ASP C 2 215  ? -16.337 -23.991 54.659  1.00 133.14 ?  215  ASP C OD1   1 
ATOM   4912  O  OD2   . ASP C 2 215  ? -16.077 -21.907 55.299  1.00 132.23 ?  215  ASP C OD2   1 
ATOM   4913  N  N     . VAL C 2 216  ? -19.791 -24.933 54.346  1.00 120.07 ?  216  VAL C N     1 
ATOM   4914  C  CA    . VAL C 2 216  ? -19.816 -26.380 54.528  1.00 129.28 ?  216  VAL C CA    1 
ATOM   4915  C  C     . VAL C 2 216  ? -18.882 -26.975 53.483  1.00 135.69 ?  216  VAL C C     1 
ATOM   4916  O  O     . VAL C 2 216  ? -19.189 -26.954 52.284  1.00 138.94 ?  216  VAL C O     1 
ATOM   4917  C  CB    . VAL C 2 216  ? -21.233 -26.955 54.397  1.00 130.41 ?  216  VAL C CB    1 
ATOM   4918  C  CG1   . VAL C 2 216  ? -21.206 -28.469 54.546  1.00 136.13 ?  216  VAL C CG1   1 
ATOM   4919  C  CG2   . VAL C 2 216  ? -22.161 -26.328 55.429  1.00 128.47 ?  216  VAL C CG2   1 
ATOM   4920  N  N     . ASP C 2 217  ? -17.744 -27.501 53.931  1.00 134.00 ?  217  ASP C N     1 
ATOM   4921  C  CA    . ASP C 2 217  ? -16.744 -28.057 53.029  1.00 140.80 ?  217  ASP C CA    1 
ATOM   4922  C  C     . ASP C 2 217  ? -17.216 -29.413 52.504  1.00 142.41 ?  217  ASP C C     1 
ATOM   4923  O  O     . ASP C 2 217  ? -18.371 -29.808 52.681  1.00 146.23 ?  217  ASP C O     1 
ATOM   4924  C  CB    . ASP C 2 217  ? -15.390 -28.138 53.731  1.00 138.28 ?  217  ASP C CB    1 
ATOM   4925  C  CG    . ASP C 2 217  ? -15.470 -28.811 55.092  1.00 142.62 ?  217  ASP C CG    1 
ATOM   4926  O  OD1   . ASP C 2 217  ? -16.514 -29.425 55.400  1.00 141.71 ?  217  ASP C OD1   1 
ATOM   4927  O  OD2   . ASP C 2 217  ? -14.488 -28.721 55.856  1.00 145.74 ?  217  ASP C OD2   1 
ATOM   4928  N  N     . LYS C 2 218  ? -16.320 -30.146 51.846  1.00 140.26 ?  218  LYS C N     1 
ATOM   4929  C  CA    . LYS C 2 218  ? -16.663 -31.437 51.261  1.00 142.30 ?  218  LYS C CA    1 
ATOM   4930  C  C     . LYS C 2 218  ? -16.600 -32.584 52.261  1.00 143.71 ?  218  LYS C C     1 
ATOM   4931  O  O     . LYS C 2 218  ? -16.862 -33.731 51.880  1.00 146.19 ?  218  LYS C O     1 
ATOM   4932  C  CB    . LYS C 2 218  ? -15.740 -31.739 50.075  1.00 145.28 ?  218  LYS C CB    1 
ATOM   4933  C  CG    . LYS C 2 218  ? -14.262 -31.757 50.425  1.00 145.63 ?  218  LYS C CG    1 
ATOM   4934  C  CD    . LYS C 2 218  ? -13.417 -32.094 49.208  1.00 147.23 ?  218  LYS C CD    1 
ATOM   4935  C  CE    . LYS C 2 218  ? -11.938 -32.136 49.553  1.00 146.18 ?  218  LYS C CE    1 
ATOM   4936  N  NZ    . LYS C 2 218  ? -11.110 -32.507 48.372  1.00 152.35 ?  218  LYS C NZ    1 
ATOM   4937  N  N     . ARG C 2 219  ? -16.265 -32.312 53.523  1.00 140.17 ?  219  ARG C N     1 
ATOM   4938  C  CA    . ARG C 2 219  ? -16.191 -33.338 54.553  1.00 142.74 ?  219  ARG C CA    1 
ATOM   4939  C  C     . ARG C 2 219  ? -17.397 -33.314 55.486  1.00 145.14 ?  219  ARG C C     1 
ATOM   4940  O  O     . ARG C 2 219  ? -17.339 -33.891 56.578  1.00 144.04 ?  219  ARG C O     1 
ATOM   4941  C  CB    . ARG C 2 219  ? -14.896 -33.189 55.353  1.00 142.83 ?  219  ARG C CB    1 
ATOM   4942  C  CG    . ARG C 2 219  ? -13.641 -33.267 54.501  1.00 146.33 ?  219  ARG C CG    1 
ATOM   4943  C  CD    . ARG C 2 219  ? -13.612 -34.550 53.687  1.00 153.57 ?  219  ARG C CD    1 
ATOM   4944  N  NE    . ARG C 2 219  ? -12.605 -34.510 52.631  1.00 162.35 ?  219  ARG C NE    1 
ATOM   4945  C  CZ    . ARG C 2 219  ? -12.405 -35.488 51.754  1.00 161.95 ?  219  ARG C CZ    1 
ATOM   4946  N  NH1   . ARG C 2 219  ? -13.142 -36.589 51.806  1.00 162.53 ?  219  ARG C NH1   1 
ATOM   4947  N  NH2   . ARG C 2 219  ? -11.467 -35.366 50.824  1.00 153.43 ?  219  ARG C NH2   1 
ATOM   4948  N  N     . ASP C 2 220  ? -18.484 -32.656 55.075  1.00 142.05 ?  220  ASP C N     1 
ATOM   4949  C  CA    . ASP C 2 220  ? -19.722 -32.587 55.855  1.00 140.18 ?  220  ASP C CA    1 
ATOM   4950  C  C     . ASP C 2 220  ? -19.481 -31.989 57.240  1.00 138.44 ?  220  ASP C C     1 
ATOM   4951  O  O     . ASP C 2 220  ? -20.062 -32.423 58.237  1.00 141.79 ?  220  ASP C O     1 
ATOM   4952  C  CB    . ASP C 2 220  ? -20.387 -33.962 55.956  1.00 138.26 ?  220  ASP C CB    1 
ATOM   4953  C  CG    . ASP C 2 220  ? -21.216 -34.299 54.730  1.00 136.12 ?  220  ASP C CG    1 
ATOM   4954  O  OD1   . ASP C 2 220  ? -22.255 -33.638 54.515  1.00 129.13 ?  220  ASP C OD1   1 
ATOM   4955  O  OD2   . ASP C 2 220  ? -20.824 -35.212 53.973  1.00 131.15 ?  220  ASP C OD2   1 
ATOM   4956  N  N     . THR C 2 221  ? -18.613 -30.981 57.300  1.00 138.59 ?  221  THR C N     1 
ATOM   4957  C  CA    . THR C 2 221  ? -18.351 -30.233 58.520  1.00 136.96 ?  221  THR C CA    1 
ATOM   4958  C  C     . THR C 2 221  ? -18.565 -28.751 58.249  1.00 130.17 ?  221  THR C C     1 
ATOM   4959  O  O     . THR C 2 221  ? -18.417 -28.283 57.117  1.00 137.65 ?  221  THR C O     1 
ATOM   4960  C  CB    . THR C 2 221  ? -16.925 -30.470 59.044  1.00 138.87 ?  221  THR C CB    1 
ATOM   4961  O  OG1   . THR C 2 221  ? -15.972 -30.032 58.068  1.00 137.23 ?  221  THR C OG1   1 
ATOM   4962  C  CG2   . THR C 2 221  ? -16.700 -31.948 59.338  1.00 142.91 ?  221  THR C CG2   1 
ATOM   4963  N  N     . VAL C 2 222  ? -18.918 -28.016 59.300  1.00 132.17 ?  222  VAL C N     1 
ATOM   4964  C  CA    . VAL C 2 222  ? -19.238 -26.597 59.202  1.00 129.60 ?  222  VAL C CA    1 
ATOM   4965  C  C     . VAL C 2 222  ? -18.132 -25.801 59.880  1.00 133.89 ?  222  VAL C C     1 
ATOM   4966  O  O     . VAL C 2 222  ? -17.697 -26.144 60.987  1.00 135.30 ?  222  VAL C O     1 
ATOM   4967  C  CB    . VAL C 2 222  ? -20.611 -26.284 59.824  1.00 133.49 ?  222  VAL C CB    1 
ATOM   4968  C  CG1   . VAL C 2 222  ? -21.033 -24.854 59.500  1.00 137.02 ?  222  VAL C CG1   1 
ATOM   4969  C  CG2   . VAL C 2 222  ? -21.653 -27.277 59.327  1.00 139.51 ?  222  VAL C CG2   1 
ATOM   4970  N  N     . GLY C 2 223  ? -17.673 -24.742 59.210  1.00 134.62 ?  223  GLY C N     1 
ATOM   4971  C  CA    . GLY C 2 223  ? -16.637 -23.881 59.738  1.00 138.65 ?  223  GLY C CA    1 
ATOM   4972  C  C     . GLY C 2 223  ? -16.953 -22.424 59.462  1.00 131.07 ?  223  GLY C C     1 
ATOM   4973  O  O     . GLY C 2 223  ? -17.962 -22.097 58.832  1.00 128.48 ?  223  GLY C O     1 
ATOM   4974  N  N     . VAL C 2 224  ? -16.063 -21.555 59.937  1.00 129.61 ?  224  VAL C N     1 
ATOM   4975  C  CA    . VAL C 2 224  ? -16.259 -20.112 59.830  1.00 130.65 ?  224  VAL C CA    1 
ATOM   4976  C  C     . VAL C 2 224  ? -14.908 -19.417 59.726  1.00 140.31 ?  224  VAL C C     1 
ATOM   4977  O  O     . VAL C 2 224  ? -14.026 -19.616 60.566  1.00 140.82 ?  224  VAL C O     1 
ATOM   4978  C  CB    . VAL C 2 224  ? -17.067 -19.567 61.024  1.00 121.56 ?  224  VAL C CB    1 
ATOM   4979  C  CG1   . VAL C 2 224  ? -16.574 -20.167 62.328  1.00 129.29 ?  224  VAL C CG1   1 
ATOM   4980  C  CG2   . VAL C 2 224  ? -17.003 -18.052 61.067  1.00 124.74 ?  224  VAL C CG2   1 
ATOM   4981  N  N     . ARG C 2 225  ? -14.752 -18.598 58.690  1.00 136.12 ?  225  ARG C N     1 
ATOM   4982  C  CA    . ARG C 2 225  ? -13.596 -17.725 58.540  1.00 134.34 ?  225  ARG C CA    1 
ATOM   4983  C  C     . ARG C 2 225  ? -13.967 -16.336 59.042  1.00 128.59 ?  225  ARG C C     1 
ATOM   4984  O  O     . ARG C 2 225  ? -14.978 -15.767 58.616  1.00 122.73 ?  225  ARG C O     1 
ATOM   4985  C  CB    . ARG C 2 225  ? -13.142 -17.659 57.079  1.00 133.64 ?  225  ARG C CB    1 
ATOM   4986  C  CG    . ARG C 2 225  ? -12.843 -19.015 56.458  1.00 133.70 ?  225  ARG C CG    1 
ATOM   4987  C  CD    . ARG C 2 225  ? -12.600 -18.923 54.954  1.00 137.12 ?  225  ARG C CD    1 
ATOM   4988  N  NE    . ARG C 2 225  ? -11.213 -18.602 54.622  1.00 139.22 ?  225  ARG C NE    1 
ATOM   4989  C  CZ    . ARG C 2 225  ? -10.800 -17.415 54.188  1.00 146.52 ?  225  ARG C CZ    1 
ATOM   4990  N  NH1   . ARG C 2 225  ? -11.667 -16.426 54.026  1.00 146.78 ?  225  ARG C NH1   1 
ATOM   4991  N  NH2   . ARG C 2 225  ? -9.518  -17.219 53.910  1.00 150.07 ?  225  ARG C NH2   1 
ATOM   4992  N  N     . ILE C 2 226  ? -13.158 -15.799 59.949  1.00 133.67 ?  226  ILE C N     1 
ATOM   4993  C  CA    . ILE C 2 226  ? -13.413 -14.502 60.566  1.00 134.74 ?  226  ILE C CA    1 
ATOM   4994  C  C     . ILE C 2 226  ? -12.357 -13.531 60.059  1.00 139.59 ?  226  ILE C C     1 
ATOM   4995  O  O     . ILE C 2 226  ? -11.183 -13.629 60.433  1.00 142.76 ?  226  ILE C O     1 
ATOM   4996  C  CB    . ILE C 2 226  ? -13.399 -14.585 62.098  1.00 130.41 ?  226  ILE C CB    1 
ATOM   4997  C  CG1   . ILE C 2 226  ? -14.352 -15.680 62.580  1.00 126.96 ?  226  ILE C CG1   1 
ATOM   4998  C  CG2   . ILE C 2 226  ? -13.768 -13.241 62.708  1.00 126.53 ?  226  ILE C CG2   1 
ATOM   4999  C  CD1   . ILE C 2 226  ? -14.447 -15.787 64.085  1.00 121.47 ?  226  ILE C CD1   1 
ATOM   5000  N  N     . ASP C 2 227  ? -12.776 -12.591 59.208  1.00 123.09 ?  227  ASP C N     1 
ATOM   5001  C  CA    . ASP C 2 227  ? -11.888 -11.567 58.654  1.00 128.68 ?  227  ASP C CA    1 
ATOM   5002  C  C     . ASP C 2 227  ? -10.713 -12.205 57.912  1.00 131.74 ?  227  ASP C C     1 
ATOM   5003  O  O     . ASP C 2 227  ? -9.547  -11.898 58.169  1.00 132.06 ?  227  ASP C O     1 
ATOM   5004  C  CB    . ASP C 2 227  ? -11.399 -10.615 59.751  1.00 133.96 ?  227  ASP C CB    1 
ATOM   5005  C  CG    . ASP C 2 227  ? -10.897 -9.290  59.201  1.00 143.57 ?  227  ASP C CG    1 
ATOM   5006  O  OD1   . ASP C 2 227  ? -10.647 -9.199  57.981  1.00 154.50 ?  227  ASP C OD1   1 
ATOM   5007  O  OD2   . ASP C 2 227  ? -10.749 -8.337  59.996  1.00 139.29 ?  227  ASP C OD2   1 
ATOM   5008  N  N     . ARG C 2 228  ? -11.039 -13.134 57.005  1.00 133.80 ?  228  ARG C N     1 
ATOM   5009  C  CA    . ARG C 2 228  ? -10.073 -13.785 56.120  1.00 134.90 ?  228  ARG C CA    1 
ATOM   5010  C  C     . ARG C 2 228  ? -9.150  -14.736 56.884  1.00 133.62 ?  228  ARG C C     1 
ATOM   5011  O  O     . ARG C 2 228  ? -8.458  -15.560 56.275  1.00 136.74 ?  228  ARG C O     1 
ATOM   5012  C  CB    . ARG C 2 228  ? -9.276  -12.722 55.346  1.00 146.88 ?  228  ARG C CB    1 
ATOM   5013  C  CG    . ARG C 2 228  ? -8.088  -13.223 54.532  1.00 154.07 ?  228  ARG C CG    1 
ATOM   5014  C  CD    . ARG C 2 228  ? -8.264  -12.946 53.052  1.00 161.35 ?  228  ARG C CD    1 
ATOM   5015  N  NE    . ARG C 2 228  ? -8.867  -11.640 52.812  1.00 168.34 ?  228  ARG C NE    1 
ATOM   5016  C  CZ    . ARG C 2 228  ? -8.927  -11.054 51.621  1.00 170.25 ?  228  ARG C CZ    1 
ATOM   5017  N  NH1   . ARG C 2 228  ? -8.408  -11.652 50.558  1.00 169.56 ?  228  ARG C NH1   1 
ATOM   5018  N  NH2   . ARG C 2 228  ? -9.499  -9.867  51.495  1.00 169.33 ?  228  ARG C NH2   1 
ATOM   5019  N  N     . LYS C 2 229  ? -9.166  -14.669 58.214  1.00 132.13 ?  229  LYS C N     1 
ATOM   5020  C  CA    . LYS C 2 229  ? -8.274  -15.482 59.028  1.00 135.50 ?  229  LYS C CA    1 
ATOM   5021  C  C     . LYS C 2 229  ? -8.614  -16.968 58.883  1.00 134.87 ?  229  LYS C C     1 
ATOM   5022  O  O     . LYS C 2 229  ? -9.486  -17.369 58.106  1.00 129.31 ?  229  LYS C O     1 
ATOM   5023  C  CB    . LYS C 2 229  ? -8.345  -15.046 60.490  1.00 133.24 ?  229  LYS C CB    1 
ATOM   5024  C  CG    . LYS C 2 229  ? -7.930  -13.601 60.734  1.00 128.04 ?  229  LYS C CG    1 
ATOM   5025  C  CD    . LYS C 2 229  ? -6.481  -13.361 60.340  1.00 127.01 ?  229  LYS C CD    1 
ATOM   5026  C  CE    . LYS C 2 229  ? -6.047  -11.940 60.665  1.00 116.33 ?  229  LYS C CE    1 
ATOM   5027  N  NZ    . LYS C 2 229  ? -6.862  -10.926 59.940  1.00 118.05 ?  229  LYS C NZ    1 
ATOM   5028  N  N     . ARG C 2 230  ? -7.909  -17.792 59.657  1.00 144.47 ?  230  ARG C N     1 
ATOM   5029  C  CA    . ARG C 2 230  ? -8.026  -19.239 59.528  1.00 145.46 ?  230  ARG C CA    1 
ATOM   5030  C  C     . ARG C 2 230  ? -9.450  -19.708 59.808  1.00 140.53 ?  230  ARG C C     1 
ATOM   5031  O  O     . ARG C 2 230  ? -10.194 -19.096 60.579  1.00 136.56 ?  230  ARG C O     1 
ATOM   5032  C  CB    . ARG C 2 230  ? -7.048  -19.937 60.474  1.00 150.15 ?  230  ARG C CB    1 
ATOM   5033  C  CG    . ARG C 2 230  ? -5.614  -19.952 59.972  1.00 151.41 ?  230  ARG C CG    1 
ATOM   5034  C  CD    . ARG C 2 230  ? -5.533  -20.583 58.590  1.00 150.64 ?  230  ARG C CD    1 
ATOM   5035  N  NE    . ARG C 2 230  ? -6.105  -21.926 58.570  1.00 157.99 ?  230  ARG C NE    1 
ATOM   5036  C  CZ    . ARG C 2 230  ? -6.290  -22.645 57.468  1.00 156.36 ?  230  ARG C CZ    1 
ATOM   5037  N  NH1   . ARG C 2 230  ? -5.950  -22.151 56.285  1.00 154.36 ?  230  ARG C NH1   1 
ATOM   5038  N  NH2   . ARG C 2 230  ? -6.818  -23.859 57.547  1.00 152.40 ?  230  ARG C NH2   1 
ATOM   5039  N  N     . ARG C 2 231  ? -9.820  -20.815 59.167  1.00 144.56 ?  231  ARG C N     1 
ATOM   5040  C  CA    . ARG C 2 231  ? -11.171 -21.359 59.248  1.00 141.73 ?  231  ARG C CA    1 
ATOM   5041  C  C     . ARG C 2 231  ? -11.269 -22.264 60.471  1.00 146.64 ?  231  ARG C C     1 
ATOM   5042  O  O     . ARG C 2 231  ? -10.705 -23.363 60.487  1.00 144.91 ?  231  ARG C O     1 
ATOM   5043  C  CB    . ARG C 2 231  ? -11.519 -22.120 57.972  1.00 139.21 ?  231  ARG C CB    1 
ATOM   5044  C  CG    . ARG C 2 231  ? -13.008 -22.351 57.771  1.00 140.88 ?  231  ARG C CG    1 
ATOM   5045  C  CD    . ARG C 2 231  ? -13.276 -23.126 56.492  1.00 143.27 ?  231  ARG C CD    1 
ATOM   5046  N  NE    . ARG C 2 231  ? -13.116 -24.564 56.683  1.00 143.64 ?  231  ARG C NE    1 
ATOM   5047  C  CZ    . ARG C 2 231  ? -14.126 -25.404 56.880  1.00 140.46 ?  231  ARG C CZ    1 
ATOM   5048  N  NH1   . ARG C 2 231  ? -15.372 -24.951 56.904  1.00 132.86 ?  231  ARG C NH1   1 
ATOM   5049  N  NH2   . ARG C 2 231  ? -13.893 -26.699 57.047  1.00 146.91 ?  231  ARG C NH2   1 
ATOM   5050  N  N     . GLN C 2 232  ? -11.984 -21.803 61.489  1.00 155.03 ?  232  GLN C N     1 
ATOM   5051  C  CA    . GLN C 2 232  ? -12.223 -22.551 62.711  1.00 151.74 ?  232  GLN C CA    1 
ATOM   5052  C  C     . GLN C 2 232  ? -13.495 -23.376 62.584  1.00 150.54 ?  232  GLN C C     1 
ATOM   5053  O  O     . GLN C 2 232  ? -14.370 -23.065 61.771  1.00 147.15 ?  232  GLN C O     1 
ATOM   5054  C  CB    . GLN C 2 232  ? -12.345 -21.591 63.894  1.00 144.69 ?  232  GLN C CB    1 
ATOM   5055  C  CG    . GLN C 2 232  ? -11.215 -20.580 64.002  1.00 141.08 ?  232  GLN C CG    1 
ATOM   5056  C  CD    . GLN C 2 232  ? -9.985  -21.148 64.678  1.00 147.58 ?  232  GLN C CD    1 
ATOM   5057  O  OE1   . GLN C 2 232  ? -8.897  -21.162 64.103  1.00 146.69 ?  232  GLN C OE1   1 
ATOM   5058  N  NE2   . GLN C 2 232  ? -10.149 -21.612 65.912  1.00 151.59 ?  232  GLN C NE2   1 
ATOM   5059  N  N     . PRO C 2 233  ? -13.625 -24.451 63.363  1.00 147.61 ?  233  PRO C N     1 
ATOM   5060  C  CA    . PRO C 2 233  ? -14.909 -25.158 63.423  1.00 140.04 ?  233  PRO C CA    1 
ATOM   5061  C  C     . PRO C 2 233  ? -16.017 -24.225 63.891  1.00 139.25 ?  233  PRO C C     1 
ATOM   5062  O  O     . PRO C 2 233  ? -15.798 -23.327 64.708  1.00 142.43 ?  233  PRO C O     1 
ATOM   5063  C  CB    . PRO C 2 233  ? -14.651 -26.281 64.434  1.00 139.89 ?  233  PRO C CB    1 
ATOM   5064  C  CG    . PRO C 2 233  ? -13.179 -26.513 64.359  1.00 138.70 ?  233  PRO C CG    1 
ATOM   5065  C  CD    . PRO C 2 233  ? -12.567 -25.162 64.104  1.00 146.70 ?  233  PRO C CD    1 
ATOM   5066  N  N     . VAL C 2 234  ? -17.222 -24.448 63.359  1.00 135.93 ?  234  VAL C N     1 
ATOM   5067  C  CA    . VAL C 2 234  ? -18.328 -23.531 63.613  1.00 135.32 ?  234  VAL C CA    1 
ATOM   5068  C  C     . VAL C 2 234  ? -18.734 -23.514 65.082  1.00 142.14 ?  234  VAL C C     1 
ATOM   5069  O  O     . VAL C 2 234  ? -19.314 -22.526 65.548  1.00 140.07 ?  234  VAL C O     1 
ATOM   5070  C  CB    . VAL C 2 234  ? -19.533 -23.882 62.717  1.00 131.70 ?  234  VAL C CB    1 
ATOM   5071  C  CG1   . VAL C 2 234  ? -20.281 -25.090 63.262  1.00 146.06 ?  234  VAL C CG1   1 
ATOM   5072  C  CG2   . VAL C 2 234  ? -20.462 -22.685 62.573  1.00 126.29 ?  234  VAL C CG2   1 
ATOM   5073  N  N     . THR C 2 235  ? -18.437 -24.575 65.832  1.00 158.29 ?  235  THR C N     1 
ATOM   5074  C  CA    . THR C 2 235  ? -18.769 -24.612 67.249  1.00 153.94 ?  235  THR C CA    1 
ATOM   5075  C  C     . THR C 2 235  ? -17.738 -23.905 68.117  1.00 155.31 ?  235  THR C C     1 
ATOM   5076  O  O     . THR C 2 235  ? -18.023 -23.632 69.287  1.00 157.33 ?  235  THR C O     1 
ATOM   5077  C  CB    . THR C 2 235  ? -18.931 -26.060 67.719  1.00 158.81 ?  235  THR C CB    1 
ATOM   5078  O  OG1   . THR C 2 235  ? -17.764 -26.813 67.368  1.00 161.43 ?  235  THR C OG1   1 
ATOM   5079  C  CG2   . THR C 2 235  ? -20.155 -26.694 67.075  1.00 155.75 ?  235  THR C CG2   1 
ATOM   5080  N  N     . VAL C 2 236  ? -16.554 -23.607 67.579  1.00 154.25 ?  236  VAL C N     1 
ATOM   5081  C  CA    . VAL C 2 236  ? -15.583 -22.806 68.318  1.00 151.88 ?  236  VAL C CA    1 
ATOM   5082  C  C     . VAL C 2 236  ? -16.114 -21.394 68.530  1.00 150.93 ?  236  VAL C C     1 
ATOM   5083  O  O     . VAL C 2 236  ? -15.867 -20.771 69.571  1.00 146.26 ?  236  VAL C O     1 
ATOM   5084  C  CB    . VAL C 2 236  ? -14.230 -22.803 67.584  1.00 149.49 ?  236  VAL C CB    1 
ATOM   5085  C  CG1   . VAL C 2 236  ? -13.227 -21.907 68.299  1.00 149.05 ?  236  VAL C CG1   1 
ATOM   5086  C  CG2   . VAL C 2 236  ? -13.692 -24.219 67.466  1.00 155.98 ?  236  VAL C CG2   1 
ATOM   5087  N  N     . LEU C 2 237  ? -16.858 -20.870 67.553  1.00 153.87 ?  237  LEU C N     1 
ATOM   5088  C  CA    . LEU C 2 237  ? -17.447 -19.543 67.701  1.00 153.62 ?  237  LEU C CA    1 
ATOM   5089  C  C     . LEU C 2 237  ? -18.636 -19.571 68.655  1.00 155.11 ?  237  LEU C C     1 
ATOM   5090  O  O     . LEU C 2 237  ? -18.844 -18.626 69.424  1.00 156.34 ?  237  LEU C O     1 
ATOM   5091  C  CB    . LEU C 2 237  ? -17.863 -19.003 66.333  1.00 147.85 ?  237  LEU C CB    1 
ATOM   5092  C  CG    . LEU C 2 237  ? -18.550 -17.637 66.304  1.00 138.60 ?  237  LEU C CG    1 
ATOM   5093  C  CD1   . LEU C 2 237  ? -17.627 -16.556 66.850  1.00 136.16 ?  237  LEU C CD1   1 
ATOM   5094  C  CD2   . LEU C 2 237  ? -19.009 -17.297 64.895  1.00 121.24 ?  237  LEU C CD2   1 
ATOM   5095  N  N     . LEU C 2 238  ? -19.422 -20.651 68.627  1.00 149.40 ?  238  LEU C N     1 
ATOM   5096  C  CA    . LEU C 2 238  ? -20.590 -20.743 69.498  1.00 155.71 ?  238  LEU C CA    1 
ATOM   5097  C  C     . LEU C 2 238  ? -20.184 -20.869 70.961  1.00 157.50 ?  238  LEU C C     1 
ATOM   5098  O  O     . LEU C 2 238  ? -20.822 -20.276 71.839  1.00 152.10 ?  238  LEU C O     1 
ATOM   5099  C  CB    . LEU C 2 238  ? -21.462 -21.926 69.077  1.00 154.92 ?  238  LEU C CB    1 
ATOM   5100  C  CG    . LEU C 2 238  ? -22.049 -21.878 67.665  1.00 144.68 ?  238  LEU C CG    1 
ATOM   5101  C  CD1   . LEU C 2 238  ? -22.765 -23.179 67.337  1.00 146.99 ?  238  LEU C CD1   1 
ATOM   5102  C  CD2   . LEU C 2 238  ? -22.992 -20.694 67.515  1.00 135.00 ?  238  LEU C CD2   1 
ATOM   5103  N  N     . LYS C 2 239  ? -19.130 -21.638 71.245  1.00 152.40 ?  239  LYS C N     1 
ATOM   5104  C  CA    . LYS C 2 239  ? -18.671 -21.782 72.623  1.00 154.30 ?  239  LYS C CA    1 
ATOM   5105  C  C     . LYS C 2 239  ? -18.070 -20.488 73.156  1.00 156.83 ?  239  LYS C C     1 
ATOM   5106  O  O     . LYS C 2 239  ? -18.140 -20.224 74.361  1.00 163.08 ?  239  LYS C O     1 
ATOM   5107  C  CB    . LYS C 2 239  ? -17.652 -22.917 72.724  1.00 154.22 ?  239  LYS C CB    1 
ATOM   5108  C  CG    . LYS C 2 239  ? -18.216 -24.293 72.411  1.00 151.55 ?  239  LYS C CG    1 
ATOM   5109  C  CD    . LYS C 2 239  ? -17.110 -25.334 72.340  1.00 150.96 ?  239  LYS C CD    1 
ATOM   5110  C  CE    . LYS C 2 239  ? -17.666 -26.706 72.005  1.00 149.93 ?  239  LYS C CE    1 
ATOM   5111  N  NZ    . LYS C 2 239  ? -16.587 -27.719 71.841  1.00 151.99 ?  239  LYS C NZ    1 
ATOM   5112  N  N     . ALA C 2 240  ? -17.482 -19.671 72.279  1.00 152.01 ?  240  ALA C N     1 
ATOM   5113  C  CA    . ALA C 2 240  ? -16.860 -18.429 72.726  1.00 149.69 ?  240  ALA C CA    1 
ATOM   5114  C  C     . ALA C 2 240  ? -17.897 -17.381 73.111  1.00 152.61 ?  240  ALA C C     1 
ATOM   5115  O  O     . ALA C 2 240  ? -17.612 -16.504 73.934  1.00 151.48 ?  240  ALA C O     1 
ATOM   5116  C  CB    . ALA C 2 240  ? -15.936 -17.883 71.638  1.00 143.00 ?  240  ALA C CB    1 
ATOM   5117  N  N     . LEU C 2 241  ? -19.096 -17.453 72.534  1.00 154.41 ?  241  LEU C N     1 
ATOM   5118  C  CA    . LEU C 2 241  ? -20.150 -16.489 72.820  1.00 154.83 ?  241  LEU C CA    1 
ATOM   5119  C  C     . LEU C 2 241  ? -20.924 -16.809 74.092  1.00 155.69 ?  241  LEU C C     1 
ATOM   5120  O  O     . LEU C 2 241  ? -21.783 -16.015 74.490  1.00 150.60 ?  241  LEU C O     1 
ATOM   5121  C  CB    . LEU C 2 241  ? -21.119 -16.407 71.637  1.00 156.14 ?  241  LEU C CB    1 
ATOM   5122  C  CG    . LEU C 2 241  ? -20.531 -15.931 70.307  1.00 149.48 ?  241  LEU C CG    1 
ATOM   5123  C  CD1   . LEU C 2 241  ? -21.561 -16.036 69.193  1.00 146.51 ?  241  LEU C CD1   1 
ATOM   5124  C  CD2   . LEU C 2 241  ? -20.013 -14.507 70.429  1.00 147.86 ?  241  LEU C CD2   1 
ATOM   5125  N  N     . GLY C 2 242  ? -20.649 -17.939 74.733  1.00 153.20 ?  242  GLY C N     1 
ATOM   5126  C  CA    . GLY C 2 242  ? -21.346 -18.322 75.940  1.00 157.93 ?  242  GLY C CA    1 
ATOM   5127  C  C     . GLY C 2 242  ? -22.413 -19.381 75.773  1.00 155.91 ?  242  GLY C C     1 
ATOM   5128  O  O     . GLY C 2 242  ? -23.301 -19.473 76.628  1.00 152.31 ?  242  GLY C O     1 
ATOM   5129  N  N     . TRP C 2 243  ? -22.360 -20.175 74.708  1.00 145.61 ?  243  TRP C N     1 
ATOM   5130  C  CA    . TRP C 2 243  ? -23.320 -21.247 74.480  1.00 146.33 ?  243  TRP C CA    1 
ATOM   5131  C  C     . TRP C 2 243  ? -22.724 -22.574 74.928  1.00 150.48 ?  243  TRP C C     1 
ATOM   5132  O  O     . TRP C 2 243  ? -21.617 -22.936 74.514  1.00 145.53 ?  243  TRP C O     1 
ATOM   5133  C  CB    . TRP C 2 243  ? -23.726 -21.321 73.007  1.00 138.17 ?  243  TRP C CB    1 
ATOM   5134  C  CG    . TRP C 2 243  ? -24.983 -20.572 72.698  1.00 135.69 ?  243  TRP C CG    1 
ATOM   5135  C  CD1   . TRP C 2 243  ? -25.424 -19.427 73.294  1.00 133.01 ?  243  TRP C CD1   1 
ATOM   5136  C  CD2   . TRP C 2 243  ? -25.977 -20.929 71.730  1.00 133.92 ?  243  TRP C CD2   1 
ATOM   5137  N  NE1   . TRP C 2 243  ? -26.625 -19.042 72.750  1.00 131.75 ?  243  TRP C NE1   1 
ATOM   5138  C  CE2   . TRP C 2 243  ? -26.987 -19.948 71.788  1.00 131.15 ?  243  TRP C CE2   1 
ATOM   5139  C  CE3   . TRP C 2 243  ? -26.108 -21.980 70.818  1.00 128.42 ?  243  TRP C CE3   1 
ATOM   5140  C  CZ2   . TRP C 2 243  ? -28.113 -19.987 70.968  1.00 125.67 ?  243  TRP C CZ2   1 
ATOM   5141  C  CZ3   . TRP C 2 243  ? -27.226 -22.017 70.004  1.00 128.16 ?  243  TRP C CZ3   1 
ATOM   5142  C  CH2   . TRP C 2 243  ? -28.214 -21.027 70.085  1.00 128.74 ?  243  TRP C CH2   1 
ATOM   5143  N  N     . THR C 2 244  ? -23.461 -23.293 75.769  1.00 148.27 ?  244  THR C N     1 
ATOM   5144  C  CA    . THR C 2 244  ? -22.997 -24.575 76.272  1.00 145.45 ?  244  THR C CA    1 
ATOM   5145  C  C     . THR C 2 244  ? -23.020 -25.626 75.165  1.00 143.43 ?  244  THR C C     1 
ATOM   5146  O  O     . THR C 2 244  ? -23.719 -25.495 74.156  1.00 144.87 ?  244  THR C O     1 
ATOM   5147  C  CB    . THR C 2 244  ? -23.862 -25.036 77.446  1.00 140.07 ?  244  THR C CB    1 
ATOM   5148  O  OG1   . THR C 2 244  ? -25.218 -25.196 77.010  1.00 136.49 ?  244  THR C OG1   1 
ATOM   5149  C  CG2   . THR C 2 244  ? -23.816 -24.015 78.572  1.00 129.79 ?  244  THR C CG2   1 
ATOM   5150  N  N     . SER C 2 245  ? -22.237 -26.689 75.368  1.00 133.63 ?  245  SER C N     1 
ATOM   5151  C  CA    . SER C 2 245  ? -22.202 -27.778 74.400  1.00 130.57 ?  245  SER C CA    1 
ATOM   5152  C  C     . SER C 2 245  ? -23.515 -28.549 74.351  1.00 133.10 ?  245  SER C C     1 
ATOM   5153  O  O     . SER C 2 245  ? -23.743 -29.300 73.396  1.00 126.06 ?  245  SER C O     1 
ATOM   5154  C  CB    . SER C 2 245  ? -21.054 -28.736 74.722  1.00 122.57 ?  245  SER C CB    1 
ATOM   5155  O  OG    . SER C 2 245  ? -19.804 -28.073 74.636  1.00 116.19 ?  245  SER C OG    1 
ATOM   5156  N  N     . GLU C 2 246  ? -24.380 -28.386 75.356  1.00 149.76 ?  246  GLU C N     1 
ATOM   5157  C  CA    . GLU C 2 246  ? -25.674 -29.057 75.336  1.00 146.64 ?  246  GLU C CA    1 
ATOM   5158  C  C     . GLU C 2 246  ? -26.704 -28.251 74.552  1.00 144.10 ?  246  GLU C C     1 
ATOM   5159  O  O     . GLU C 2 246  ? -27.489 -28.820 73.785  1.00 142.61 ?  246  GLU C O     1 
ATOM   5160  C  CB    . GLU C 2 246  ? -26.160 -29.296 76.764  1.00 145.25 ?  246  GLU C CB    1 
ATOM   5161  C  CG    . GLU C 2 246  ? -26.492 -30.750 77.070  1.00 146.84 ?  246  GLU C CG    1 
ATOM   5162  C  CD    . GLU C 2 246  ? -25.256 -31.629 77.151  1.00 148.34 ?  246  GLU C CD    1 
ATOM   5163  O  OE1   . GLU C 2 246  ? -24.144 -31.088 77.335  1.00 148.97 ?  246  GLU C OE1   1 
ATOM   5164  O  OE2   . GLU C 2 246  ? -25.400 -32.863 77.035  1.00 144.34 ?  246  GLU C OE2   1 
ATOM   5165  N  N     . GLN C 2 247  ? -26.709 -26.926 74.727  1.00 137.44 ?  247  GLN C N     1 
ATOM   5166  C  CA    . GLN C 2 247  ? -27.635 -26.072 73.994  1.00 137.32 ?  247  GLN C CA    1 
ATOM   5167  C  C     . GLN C 2 247  ? -27.344 -26.060 72.499  1.00 138.48 ?  247  GLN C C     1 
ATOM   5168  O  O     . GLN C 2 247  ? -28.235 -25.734 71.709  1.00 136.37 ?  247  GLN C O     1 
ATOM   5169  C  CB    . GLN C 2 247  ? -27.585 -24.654 74.564  1.00 134.75 ?  247  GLN C CB    1 
ATOM   5170  C  CG    . GLN C 2 247  ? -28.746 -23.767 74.147  1.00 134.65 ?  247  GLN C CG    1 
ATOM   5171  C  CD    . GLN C 2 247  ? -28.699 -22.398 74.799  1.00 134.80 ?  247  GLN C CD    1 
ATOM   5172  O  OE1   . GLN C 2 247  ? -27.757 -22.072 75.522  1.00 133.71 ?  247  GLN C OE1   1 
ATOM   5173  N  NE2   . GLN C 2 247  ? -29.721 -21.589 74.546  1.00 128.88 ?  247  GLN C NE2   1 
ATOM   5174  N  N     . ILE C 2 248  ? -26.120 -26.409 72.097  1.00 157.22 ?  248  ILE C N     1 
ATOM   5175  C  CA    . ILE C 2 248  ? -25.795 -26.490 70.676  1.00 155.94 ?  248  ILE C CA    1 
ATOM   5176  C  C     . ILE C 2 248  ? -26.439 -27.722 70.050  1.00 152.91 ?  248  ILE C C     1 
ATOM   5177  O  O     . ILE C 2 248  ? -26.983 -27.660 68.941  1.00 151.82 ?  248  ILE C O     1 
ATOM   5178  C  CB    . ILE C 2 248  ? -24.268 -26.479 70.479  1.00 155.55 ?  248  ILE C CB    1 
ATOM   5179  C  CG1   . ILE C 2 248  ? -23.679 -25.145 70.945  1.00 155.93 ?  248  ILE C CG1   1 
ATOM   5180  C  CG2   . ILE C 2 248  ? -23.909 -26.741 69.024  1.00 142.82 ?  248  ILE C CG2   1 
ATOM   5181  C  CD1   . ILE C 2 248  ? -22.169 -25.078 70.855  1.00 148.94 ?  248  ILE C CD1   1 
ATOM   5182  N  N     . VAL C 2 249  ? -26.392 -28.860 70.750  1.00 147.19 ?  249  VAL C N     1 
ATOM   5183  C  CA    . VAL C 2 249  ? -27.040 -30.069 70.247  1.00 144.34 ?  249  VAL C CA    1 
ATOM   5184  C  C     . VAL C 2 249  ? -28.552 -29.887 70.192  1.00 142.85 ?  249  VAL C C     1 
ATOM   5185  O  O     . VAL C 2 249  ? -29.228 -30.484 69.346  1.00 143.93 ?  249  VAL C O     1 
ATOM   5186  C  CB    . VAL C 2 249  ? -26.648 -31.282 71.114  1.00 141.92 ?  249  VAL C CB    1 
ATOM   5187  C  CG1   . VAL C 2 249  ? -27.183 -32.574 70.513  1.00 138.25 ?  249  VAL C CG1   1 
ATOM   5188  C  CG2   . VAL C 2 249  ? -25.140 -31.354 71.276  1.00 144.08 ?  249  VAL C CG2   1 
ATOM   5189  N  N     . GLU C 2 250  ? -29.105 -29.057 71.081  1.00 130.18 ?  250  GLU C N     1 
ATOM   5190  C  CA    . GLU C 2 250  ? -30.543 -28.814 71.088  1.00 132.98 ?  250  GLU C CA    1 
ATOM   5191  C  C     . GLU C 2 250  ? -30.999 -28.067 69.839  1.00 134.45 ?  250  GLU C C     1 
ATOM   5192  O  O     . GLU C 2 250  ? -32.123 -28.276 69.369  1.00 131.34 ?  250  GLU C O     1 
ATOM   5193  C  CB    . GLU C 2 250  ? -30.924 -28.038 72.350  1.00 134.35 ?  250  GLU C CB    1 
ATOM   5194  C  CG    . GLU C 2 250  ? -32.350 -27.511 72.378  1.00 135.44 ?  250  GLU C CG    1 
ATOM   5195  C  CD    . GLU C 2 250  ? -32.650 -26.720 73.636  1.00 136.33 ?  250  GLU C CD    1 
ATOM   5196  O  OE1   . GLU C 2 250  ? -33.447 -27.201 74.468  1.00 138.27 ?  250  GLU C OE1   1 
ATOM   5197  O  OE2   . GLU C 2 250  ? -32.081 -25.619 73.796  1.00 135.95 ?  250  GLU C OE2   1 
ATOM   5198  N  N     . ARG C 2 251  ? -30.142 -27.213 69.280  1.00 148.27 ?  251  ARG C N     1 
ATOM   5199  C  CA    . ARG C 2 251  ? -30.523 -26.366 68.156  1.00 140.11 ?  251  ARG C CA    1 
ATOM   5200  C  C     . ARG C 2 251  ? -30.225 -27.003 66.803  1.00 133.68 ?  251  ARG C C     1 
ATOM   5201  O  O     . ARG C 2 251  ? -30.995 -26.818 65.854  1.00 132.95 ?  251  ARG C O     1 
ATOM   5202  C  CB    . ARG C 2 251  ? -29.809 -25.015 68.258  1.00 136.19 ?  251  ARG C CB    1 
ATOM   5203  C  CG    . ARG C 2 251  ? -30.220 -23.998 67.207  1.00 134.84 ?  251  ARG C CG    1 
ATOM   5204  C  CD    . ARG C 2 251  ? -31.686 -23.622 67.340  1.00 136.55 ?  251  ARG C CD    1 
ATOM   5205  N  NE    . ARG C 2 251  ? -32.044 -22.519 66.455  1.00 135.20 ?  251  ARG C NE    1 
ATOM   5206  C  CZ    . ARG C 2 251  ? -31.981 -21.237 66.799  1.00 129.44 ?  251  ARG C CZ    1 
ATOM   5207  N  NH1   . ARG C 2 251  ? -31.573 -20.893 68.013  1.00 128.15 ?  251  ARG C NH1   1 
ATOM   5208  N  NH2   . ARG C 2 251  ? -32.324 -20.298 65.929  1.00 121.55 ?  251  ARG C NH2   1 
ATOM   5209  N  N     . PHE C 2 252  ? -29.126 -27.749 66.690  1.00 144.93 ?  252  PHE C N     1 
ATOM   5210  C  CA    . PHE C 2 252  ? -28.672 -28.297 65.417  1.00 156.58 ?  252  PHE C CA    1 
ATOM   5211  C  C     . PHE C 2 252  ? -28.744 -29.822 65.385  1.00 159.23 ?  252  PHE C C     1 
ATOM   5212  O  O     . PHE C 2 252  ? -27.949 -30.471 64.702  1.00 160.25 ?  252  PHE C O     1 
ATOM   5213  C  CB    . PHE C 2 252  ? -27.247 -27.832 65.117  1.00 161.39 ?  252  PHE C CB    1 
ATOM   5214  C  CG    . PHE C 2 252  ? -27.054 -26.345 65.223  1.00 157.16 ?  252  PHE C CG    1 
ATOM   5215  C  CD1   . PHE C 2 252  ? -27.217 -25.531 64.115  1.00 150.84 ?  252  PHE C CD1   1 
ATOM   5216  C  CD2   . PHE C 2 252  ? -26.701 -25.762 66.430  1.00 157.36 ?  252  PHE C CD2   1 
ATOM   5217  C  CE1   . PHE C 2 252  ? -27.037 -24.165 64.209  1.00 144.23 ?  252  PHE C CE1   1 
ATOM   5218  C  CE2   . PHE C 2 252  ? -26.522 -24.396 66.531  1.00 153.03 ?  252  PHE C CE2   1 
ATOM   5219  C  CZ    . PHE C 2 252  ? -26.689 -23.596 65.419  1.00 143.49 ?  252  PHE C CZ    1 
ATOM   5220  N  N     . GLY C 2 253  ? -29.697 -30.409 66.113  1.00 157.28 ?  253  GLY C N     1 
ATOM   5221  C  CA    . GLY C 2 253  ? -29.770 -31.856 66.208  1.00 160.14 ?  253  GLY C CA    1 
ATOM   5222  C  C     . GLY C 2 253  ? -30.431 -32.545 65.033  1.00 163.08 ?  253  GLY C C     1 
ATOM   5223  O  O     . GLY C 2 253  ? -30.201 -33.740 64.824  1.00 163.36 ?  253  GLY C O     1 
ATOM   5224  N  N     . PHE C 2 254  ? -31.240 -31.821 64.258  1.00 150.58 ?  254  PHE C N     1 
ATOM   5225  C  CA    . PHE C 2 254  ? -31.975 -32.430 63.155  1.00 149.72 ?  254  PHE C CA    1 
ATOM   5226  C  C     . PHE C 2 254  ? -31.088 -32.796 61.971  1.00 150.83 ?  254  PHE C C     1 
ATOM   5227  O  O     . PHE C 2 254  ? -31.550 -33.512 61.076  1.00 149.82 ?  254  PHE C O     1 
ATOM   5228  C  CB    . PHE C 2 254  ? -33.096 -31.495 62.691  1.00 152.23 ?  254  PHE C CB    1 
ATOM   5229  C  CG    . PHE C 2 254  ? -32.628 -30.110 62.339  1.00 154.80 ?  254  PHE C CG    1 
ATOM   5230  C  CD1   . PHE C 2 254  ? -32.576 -29.116 63.303  1.00 147.01 ?  254  PHE C CD1   1 
ATOM   5231  C  CD2   . PHE C 2 254  ? -32.245 -29.800 61.044  1.00 152.38 ?  254  PHE C CD2   1 
ATOM   5232  C  CE1   . PHE C 2 254  ? -32.147 -27.843 62.984  1.00 144.27 ?  254  PHE C CE1   1 
ATOM   5233  C  CE2   . PHE C 2 254  ? -31.815 -28.528 60.719  1.00 141.79 ?  254  PHE C CE2   1 
ATOM   5234  C  CZ    . PHE C 2 254  ? -31.766 -27.548 61.691  1.00 139.17 ?  254  PHE C CZ    1 
ATOM   5235  N  N     . SER C 2 255  ? -29.843 -32.330 61.939  1.00 147.38 ?  255  SER C N     1 
ATOM   5236  C  CA    . SER C 2 255  ? -28.921 -32.621 60.851  1.00 155.87 ?  255  SER C CA    1 
ATOM   5237  C  C     . SER C 2 255  ? -27.760 -33.457 61.368  1.00 157.74 ?  255  SER C C     1 
ATOM   5238  O  O     . SER C 2 255  ? -27.275 -33.241 62.483  1.00 154.11 ?  255  SER C O     1 
ATOM   5239  C  CB    . SER C 2 255  ? -28.388 -31.334 60.218  1.00 153.75 ?  255  SER C CB    1 
ATOM   5240  O  OG    . SER C 2 255  ? -27.562 -30.625 61.126  1.00 147.36 ?  255  SER C OG    1 
ATOM   5241  N  N     . GLU C 2 256  ? -27.317 -34.414 60.552  1.00 167.43 ?  256  GLU C N     1 
ATOM   5242  C  CA    . GLU C 2 256  ? -26.183 -35.247 60.925  1.00 167.49 ?  256  GLU C CA    1 
ATOM   5243  C  C     . GLU C 2 256  ? -24.847 -34.578 60.632  1.00 165.38 ?  256  GLU C C     1 
ATOM   5244  O  O     . GLU C 2 256  ? -23.821 -35.015 61.164  1.00 163.98 ?  256  GLU C O     1 
ATOM   5245  C  CB    . GLU C 2 256  ? -26.256 -36.595 60.204  1.00 168.27 ?  256  GLU C CB    1 
ATOM   5246  C  CG    . GLU C 2 256  ? -25.584 -37.734 60.956  1.00 162.15 ?  256  GLU C CG    1 
ATOM   5247  C  CD    . GLU C 2 256  ? -26.299 -38.074 62.249  1.00 162.38 ?  256  GLU C CD    1 
ATOM   5248  O  OE1   . GLU C 2 256  ? -27.548 -38.030 62.267  1.00 160.83 ?  256  GLU C OE1   1 
ATOM   5249  O  OE2   . GLU C 2 256  ? -25.615 -38.377 63.250  1.00 158.13 ?  256  GLU C OE2   1 
ATOM   5250  N  N     . ILE C 2 257  ? -24.835 -33.532 59.803  1.00 166.95 ?  257  ILE C N     1 
ATOM   5251  C  CA    . ILE C 2 257  ? -23.588 -32.833 59.510  1.00 165.81 ?  257  ILE C CA    1 
ATOM   5252  C  C     . ILE C 2 257  ? -23.178 -31.899 60.641  1.00 157.72 ?  257  ILE C C     1 
ATOM   5253  O  O     . ILE C 2 257  ? -22.006 -31.509 60.717  1.00 149.89 ?  257  ILE C O     1 
ATOM   5254  C  CB    . ILE C 2 257  ? -23.690 -32.050 58.189  1.00 165.45 ?  257  ILE C CB    1 
ATOM   5255  C  CG1   . ILE C 2 257  ? -24.502 -30.768 58.378  1.00 162.16 ?  257  ILE C CG1   1 
ATOM   5256  C  CG2   . ILE C 2 257  ? -24.317 -32.915 57.106  1.00 161.59 ?  257  ILE C CG2   1 
ATOM   5257  C  CD1   . ILE C 2 257  ? -24.522 -29.877 57.153  1.00 156.61 ?  257  ILE C CD1   1 
ATOM   5258  N  N     . MET C 2 258  ? -24.108 -31.527 61.521  1.00 158.52 ?  258  MET C N     1 
ATOM   5259  C  CA    . MET C 2 258  ? -23.771 -30.734 62.697  1.00 161.35 ?  258  MET C CA    1 
ATOM   5260  C  C     . MET C 2 258  ? -23.399 -31.599 63.891  1.00 166.15 ?  258  MET C C     1 
ATOM   5261  O  O     . MET C 2 258  ? -22.606 -31.167 64.736  1.00 163.23 ?  258  MET C O     1 
ATOM   5262  C  CB    . MET C 2 258  ? -24.936 -29.813 63.070  1.00 161.61 ?  258  MET C CB    1 
ATOM   5263  C  CG    . MET C 2 258  ? -25.006 -28.538 62.247  1.00 162.72 ?  258  MET C CG    1 
ATOM   5264  S  SD    . MET C 2 258  ? -23.568 -27.478 62.499  1.00 164.20 ?  258  MET C SD    1 
ATOM   5265  C  CE    . MET C 2 258  ? -23.673 -27.175 64.261  1.00 142.54 ?  258  MET C CE    1 
ATOM   5266  N  N     . ARG C 2 259  ? -23.959 -32.808 63.984  1.00 171.04 ?  259  ARG C N     1 
ATOM   5267  C  CA    . ARG C 2 259  ? -23.516 -33.751 65.004  1.00 168.59 ?  259  ARG C CA    1 
ATOM   5268  C  C     . ARG C 2 259  ? -22.071 -34.175 64.774  1.00 166.36 ?  259  ARG C C     1 
ATOM   5269  O  O     . ARG C 2 259  ? -21.359 -34.495 65.733  1.00 170.40 ?  259  ARG C O     1 
ATOM   5270  C  CB    . ARG C 2 259  ? -24.432 -34.975 65.024  1.00 169.60 ?  259  ARG C CB    1 
ATOM   5271  C  CG    . ARG C 2 259  ? -25.834 -34.699 65.545  1.00 166.12 ?  259  ARG C CG    1 
ATOM   5272  C  CD    . ARG C 2 259  ? -25.835 -34.493 67.051  1.00 164.32 ?  259  ARG C CD    1 
ATOM   5273  N  NE    . ARG C 2 259  ? -27.158 -34.134 67.554  1.00 165.57 ?  259  ARG C NE    1 
ATOM   5274  C  CZ    . ARG C 2 259  ? -28.099 -35.014 67.879  1.00 156.38 ?  259  ARG C CZ    1 
ATOM   5275  N  NH1   . ARG C 2 259  ? -27.869 -36.314 67.754  1.00 147.29 ?  259  ARG C NH1   1 
ATOM   5276  N  NH2   . ARG C 2 259  ? -29.274 -34.594 68.329  1.00 145.75 ?  259  ARG C NH2   1 
ATOM   5277  N  N     . SER C 2 260  ? -21.625 -34.183 63.517  1.00 160.81 ?  260  SER C N     1 
ATOM   5278  C  CA    . SER C 2 260  ? -20.241 -34.496 63.188  1.00 162.12 ?  260  SER C CA    1 
ATOM   5279  C  C     . SER C 2 260  ? -19.302 -33.314 63.387  1.00 164.90 ?  260  SER C C     1 
ATOM   5280  O  O     . SER C 2 260  ? -18.083 -33.495 63.309  1.00 162.27 ?  260  SER C O     1 
ATOM   5281  C  CB    . SER C 2 260  ? -20.145 -34.988 61.741  1.00 154.12 ?  260  SER C CB    1 
ATOM   5282  O  OG    . SER C 2 260  ? -18.797 -35.217 61.369  1.00 147.84 ?  260  SER C OG    1 
ATOM   5283  N  N     . THR C 2 261  ? -19.833 -32.117 63.637  1.00 173.03 ?  261  THR C N     1 
ATOM   5284  C  CA    . THR C 2 261  ? -19.002 -30.938 63.847  1.00 169.68 ?  261  THR C CA    1 
ATOM   5285  C  C     . THR C 2 261  ? -18.599 -30.781 65.310  1.00 166.06 ?  261  THR C C     1 
ATOM   5286  O  O     . THR C 2 261  ? -17.421 -30.566 65.612  1.00 164.27 ?  261  THR C O     1 
ATOM   5287  C  CB    . THR C 2 261  ? -19.735 -29.682 63.365  1.00 164.48 ?  261  THR C CB    1 
ATOM   5288  O  OG1   . THR C 2 261  ? -20.037 -29.808 61.970  1.00 160.61 ?  261  THR C OG1   1 
ATOM   5289  C  CG2   . THR C 2 261  ? -18.871 -28.449 63.580  1.00 157.41 ?  261  THR C CG2   1 
ATOM   5290  N  N     . LEU C 2 262  ? -19.564 -30.886 66.227  1.00 153.09 ?  262  LEU C N     1 
ATOM   5291  C  CA    . LEU C 2 262  ? -19.251 -30.789 67.648  1.00 152.33 ?  262  LEU C CA    1 
ATOM   5292  C  C     . LEU C 2 262  ? -18.424 -31.971 68.136  1.00 153.09 ?  262  LEU C C     1 
ATOM   5293  O  O     . LEU C 2 262  ? -17.705 -31.840 69.132  1.00 154.60 ?  262  LEU C O     1 
ATOM   5294  C  CB    . LEU C 2 262  ? -20.541 -30.679 68.465  1.00 151.35 ?  262  LEU C CB    1 
ATOM   5295  C  CG    . LEU C 2 262  ? -20.388 -30.270 69.932  1.00 152.02 ?  262  LEU C CG    1 
ATOM   5296  C  CD1   . LEU C 2 262  ? -19.828 -28.862 70.037  1.00 147.69 ?  262  LEU C CD1   1 
ATOM   5297  C  CD2   . LEU C 2 262  ? -21.712 -30.376 70.667  1.00 150.25 ?  262  LEU C CD2   1 
ATOM   5298  N  N     . GLU C 2 263  ? -18.505 -33.117 67.456  1.00 160.22 ?  263  GLU C N     1 
ATOM   5299  C  CA    . GLU C 2 263  ? -17.708 -34.274 67.848  1.00 168.12 ?  263  GLU C CA    1 
ATOM   5300  C  C     . GLU C 2 263  ? -16.272 -34.146 67.353  1.00 167.01 ?  263  GLU C C     1 
ATOM   5301  O  O     . GLU C 2 263  ? -15.323 -34.342 68.120  1.00 169.77 ?  263  GLU C O     1 
ATOM   5302  C  CB    . GLU C 2 263  ? -18.350 -35.558 67.319  1.00 172.06 ?  263  GLU C CB    1 
ATOM   5303  C  CG    . GLU C 2 263  ? -18.393 -36.694 68.332  1.00 178.41 ?  263  GLU C CG    1 
ATOM   5304  C  CD    . GLU C 2 263  ? -17.014 -37.135 68.780  1.00 182.12 ?  263  GLU C CD    1 
ATOM   5305  O  OE1   . GLU C 2 263  ? -16.090 -37.156 67.941  1.00 178.89 ?  263  GLU C OE1   1 
ATOM   5306  O  OE2   . GLU C 2 263  ? -16.853 -37.459 69.976  1.00 182.66 ?  263  GLU C OE2   1 
ATOM   5307  N  N     . LYS C 2 264  ? -16.094 -33.811 66.072  1.00 166.15 ?  264  LYS C N     1 
ATOM   5308  C  CA    . LYS C 2 264  ? -14.761 -33.582 65.525  1.00 162.21 ?  264  LYS C CA    1 
ATOM   5309  C  C     . LYS C 2 264  ? -14.098 -32.332 66.088  1.00 163.64 ?  264  LYS C C     1 
ATOM   5310  O  O     . LYS C 2 264  ? -12.928 -32.084 65.776  1.00 157.71 ?  264  LYS C O     1 
ATOM   5311  C  CB    . LYS C 2 264  ? -14.823 -33.475 63.999  1.00 162.02 ?  264  LYS C CB    1 
ATOM   5312  C  CG    . LYS C 2 264  ? -15.156 -34.770 63.279  1.00 161.45 ?  264  LYS C CG    1 
ATOM   5313  C  CD    . LYS C 2 264  ? -15.222 -34.543 61.775  1.00 156.78 ?  264  LYS C CD    1 
ATOM   5314  C  CE    . LYS C 2 264  ? -15.557 -35.822 61.027  1.00 152.48 ?  264  LYS C CE    1 
ATOM   5315  N  NZ    . LYS C 2 264  ? -15.635 -35.594 59.557  1.00 145.15 ?  264  LYS C NZ    1 
ATOM   5316  N  N     . ASP C 2 265  ? -14.812 -31.546 66.892  1.00 169.35 ?  265  ASP C N     1 
ATOM   5317  C  CA    . ASP C 2 265  ? -14.251 -30.329 67.461  1.00 170.20 ?  265  ASP C CA    1 
ATOM   5318  C  C     . ASP C 2 265  ? -13.030 -30.648 68.315  1.00 174.25 ?  265  ASP C C     1 
ATOM   5319  O  O     . ASP C 2 265  ? -12.919 -31.724 68.909  1.00 174.32 ?  265  ASP C O     1 
ATOM   5320  C  CB    . ASP C 2 265  ? -15.307 -29.603 68.297  1.00 169.08 ?  265  ASP C CB    1 
ATOM   5321  C  CG    . ASP C 2 265  ? -14.854 -28.226 68.748  1.00 171.02 ?  265  ASP C CG    1 
ATOM   5322  O  OD1   . ASP C 2 265  ? -13.824 -27.735 68.239  1.00 169.58 ?  265  ASP C OD1   1 
ATOM   5323  O  OD2   . ASP C 2 265  ? -15.531 -27.634 69.615  1.00 170.02 ?  265  ASP C OD2   1 
ATOM   5324  N  N     . ASN C 2 266  ? -12.104 -29.691 68.373  1.00 171.01 ?  266  ASN C N     1 
ATOM   5325  C  CA    . ASN C 2 266  ? -10.842 -29.881 69.080  1.00 169.58 ?  266  ASN C CA    1 
ATOM   5326  C  C     . ASN C 2 266  ? -10.944 -29.468 70.547  1.00 164.07 ?  266  ASN C C     1 
ATOM   5327  O  O     . ASN C 2 266  ? -10.683 -30.275 71.445  1.00 165.00 ?  266  ASN C O     1 
ATOM   5328  C  CB    . ASN C 2 266  ? -9.729  -29.098 68.376  1.00 172.34 ?  266  ASN C CB    1 
ATOM   5329  C  CG    . ASN C 2 266  ? -8.368  -29.333 68.998  1.00 172.24 ?  266  ASN C CG    1 
ATOM   5330  O  OD1   . ASN C 2 266  ? -8.134  -30.357 69.639  1.00 171.91 ?  266  ASN C OD1   1 
ATOM   5331  N  ND2   . ASN C 2 266  ? -7.460  -28.381 68.812  1.00 171.25 ?  266  ASN C ND2   1 
ATOM   5332  N  N     . THR C 2 267  ? -11.322 -28.219 70.802  1.00 161.45 ?  267  THR C N     1 
ATOM   5333  C  CA    . THR C 2 267  ? -11.360 -27.670 72.148  1.00 165.05 ?  267  THR C CA    1 
ATOM   5334  C  C     . THR C 2 267  ? -12.795 -27.395 72.578  1.00 160.65 ?  267  THR C C     1 
ATOM   5335  O  O     . THR C 2 267  ? -13.660 -27.075 71.757  1.00 153.38 ?  267  THR C O     1 
ATOM   5336  C  CB    . THR C 2 267  ? -10.540 -26.378 72.239  1.00 164.04 ?  267  THR C CB    1 
ATOM   5337  O  OG1   . THR C 2 267  ? -11.067 -25.410 71.324  1.00 157.57 ?  267  THR C OG1   1 
ATOM   5338  C  CG2   . THR C 2 267  ? -9.082  -26.649 71.899  1.00 160.77 ?  267  THR C CG2   1 
ATOM   5339  N  N     . VAL C 2 268  ? -13.037 -27.521 73.882  1.00 169.20 ?  268  VAL C N     1 
ATOM   5340  C  CA    . VAL C 2 268  ? -14.344 -27.277 74.475  1.00 166.48 ?  268  VAL C CA    1 
ATOM   5341  C  C     . VAL C 2 268  ? -14.171 -26.352 75.671  1.00 160.84 ?  268  VAL C C     1 
ATOM   5342  O  O     . VAL C 2 268  ? -13.163 -26.406 76.383  1.00 153.17 ?  268  VAL C O     1 
ATOM   5343  C  CB    . VAL C 2 268  ? -15.044 -28.597 74.886  1.00 158.62 ?  268  VAL C CB    1 
ATOM   5344  C  CG1   . VAL C 2 268  ? -14.257 -29.313 75.977  1.00 144.51 ?  268  VAL C CG1   1 
ATOM   5345  C  CG2   . VAL C 2 268  ? -16.481 -28.339 75.324  1.00 146.31 ?  268  VAL C CG2   1 
ATOM   5346  N  N     . GLY C 2 269  ? -15.157 -25.482 75.878  1.00 152.02 ?  269  GLY C N     1 
ATOM   5347  C  CA    . GLY C 2 269  ? -15.118 -24.541 76.980  1.00 150.12 ?  269  GLY C CA    1 
ATOM   5348  C  C     . GLY C 2 269  ? -15.397 -23.116 76.548  1.00 153.30 ?  269  GLY C C     1 
ATOM   5349  O  O     . GLY C 2 269  ? -14.964 -22.692 75.472  1.00 152.77 ?  269  GLY C O     1 
ATOM   5350  N  N     . THR C 2 270  ? -16.123 -22.367 77.381  1.00 147.90 ?  270  THR C N     1 
ATOM   5351  C  CA    . THR C 2 270  ? -16.440 -20.983 77.039  1.00 147.18 ?  270  THR C CA    1 
ATOM   5352  C  C     . THR C 2 270  ? -15.192 -20.109 77.065  1.00 148.27 ?  270  THR C C     1 
ATOM   5353  O  O     . THR C 2 270  ? -15.005 -19.260 76.186  1.00 146.69 ?  270  THR C O     1 
ATOM   5354  C  CB    . THR C 2 270  ? -17.503 -20.437 77.993  1.00 151.96 ?  270  THR C CB    1 
ATOM   5355  O  OG1   . THR C 2 270  ? -18.674 -21.262 77.929  1.00 152.96 ?  270  THR C OG1   1 
ATOM   5356  C  CG2   . THR C 2 270  ? -17.879 -19.010 77.618  1.00 144.89 ?  270  THR C CG2   1 
ATOM   5357  N  N     . ASP C 2 271  ? -14.327 -20.303 78.058  1.00 166.72 ?  271  ASP C N     1 
ATOM   5358  C  CA    . ASP C 2 271  ? -13.077 -19.563 78.160  1.00 164.98 ?  271  ASP C CA    1 
ATOM   5359  C  C     . ASP C 2 271  ? -11.934 -20.231 77.405  1.00 163.43 ?  271  ASP C C     1 
ATOM   5360  O  O     . ASP C 2 271  ? -10.800 -19.746 77.471  1.00 157.70 ?  271  ASP C O     1 
ATOM   5361  C  CB    . ASP C 2 271  ? -12.688 -19.383 79.631  1.00 168.19 ?  271  ASP C CB    1 
ATOM   5362  C  CG    . ASP C 2 271  ? -13.799 -18.766 80.458  1.00 167.81 ?  271  ASP C CG    1 
ATOM   5363  O  OD1   . ASP C 2 271  ? -14.747 -19.495 80.820  1.00 168.66 ?  271  ASP C OD1   1 
ATOM   5364  O  OD2   . ASP C 2 271  ? -13.727 -17.553 80.746  1.00 162.74 ?  271  ASP C OD2   1 
ATOM   5365  N  N     . GLU C 2 272  ? -12.204 -21.326 76.696  1.00 157.05 ?  272  GLU C N     1 
ATOM   5366  C  CA    . GLU C 2 272  ? -11.192 -22.041 75.927  1.00 156.44 ?  272  GLU C CA    1 
ATOM   5367  C  C     . GLU C 2 272  ? -11.269 -21.728 74.438  1.00 153.68 ?  272  GLU C C     1 
ATOM   5368  O  O     . GLU C 2 272  ? -10.264 -21.348 73.831  1.00 148.97 ?  272  GLU C O     1 
ATOM   5369  C  CB    . GLU C 2 272  ? -11.332 -23.550 76.155  1.00 158.69 ?  272  GLU C CB    1 
ATOM   5370  C  CG    . GLU C 2 272  ? -11.440 -23.942 77.619  1.00 161.81 ?  272  GLU C CG    1 
ATOM   5371  C  CD    . GLU C 2 272  ? -10.222 -23.537 78.426  1.00 170.43 ?  272  GLU C CD    1 
ATOM   5372  O  OE1   . GLU C 2 272  ? -9.102  -23.573 77.874  1.00 173.73 ?  272  GLU C OE1   1 
ATOM   5373  O  OE2   . GLU C 2 272  ? -10.384 -23.179 79.611  1.00 163.57 ?  272  GLU C OE2   1 
ATOM   5374  N  N     . ALA C 2 273  ? -12.449 -21.884 73.832  1.00 157.62 ?  273  ALA C N     1 
ATOM   5375  C  CA    . ALA C 2 273  ? -12.626 -21.492 72.440  1.00 154.99 ?  273  ALA C CA    1 
ATOM   5376  C  C     . ALA C 2 273  ? -12.608 -19.979 72.266  1.00 149.32 ?  273  ALA C C     1 
ATOM   5377  O  O     . ALA C 2 273  ? -12.463 -19.499 71.137  1.00 147.04 ?  273  ALA C O     1 
ATOM   5378  C  CB    . ALA C 2 273  ? -13.932 -22.065 71.890  1.00 151.82 ?  273  ALA C CB    1 
ATOM   5379  N  N     . LEU C 2 274  ? -12.764 -19.220 73.355  1.00 141.96 ?  274  LEU C N     1 
ATOM   5380  C  CA    . LEU C 2 274  ? -12.646 -17.769 73.276  1.00 139.04 ?  274  LEU C CA    1 
ATOM   5381  C  C     . LEU C 2 274  ? -11.193 -17.337 73.130  1.00 138.56 ?  274  LEU C C     1 
ATOM   5382  O  O     . LEU C 2 274  ? -10.905 -16.354 72.438  1.00 139.16 ?  274  LEU C O     1 
ATOM   5383  C  CB    . LEU C 2 274  ? -13.281 -17.130 74.511  1.00 138.35 ?  274  LEU C CB    1 
ATOM   5384  C  CG    . LEU C 2 274  ? -13.303 -15.603 74.591  1.00 140.37 ?  274  LEU C CG    1 
ATOM   5385  C  CD1   . LEU C 2 274  ? -14.003 -15.011 73.381  1.00 142.47 ?  274  LEU C CD1   1 
ATOM   5386  C  CD2   . LEU C 2 274  ? -13.975 -15.153 75.877  1.00 141.78 ?  274  LEU C CD2   1 
ATOM   5387  N  N     . LEU C 2 275  ? -10.266 -18.054 73.772  1.00 142.09 ?  275  LEU C N     1 
ATOM   5388  C  CA    . LEU C 2 275  ? -8.847  -17.797 73.564  1.00 143.30 ?  275  LEU C CA    1 
ATOM   5389  C  C     . LEU C 2 275  ? -8.355  -18.392 72.252  1.00 140.47 ?  275  LEU C C     1 
ATOM   5390  O  O     . LEU C 2 275  ? -7.409  -17.865 71.654  1.00 139.53 ?  275  LEU C O     1 
ATOM   5391  C  CB    . LEU C 2 275  ? -8.031  -18.355 74.731  1.00 141.20 ?  275  LEU C CB    1 
ATOM   5392  C  CG    . LEU C 2 275  ? -8.397  -17.858 76.130  1.00 144.79 ?  275  LEU C CG    1 
ATOM   5393  C  CD1   . LEU C 2 275  ? -7.448  -18.441 77.166  1.00 145.44 ?  275  LEU C CD1   1 
ATOM   5394  C  CD2   . LEU C 2 275  ? -8.392  -16.339 76.184  1.00 143.18 ?  275  LEU C CD2   1 
ATOM   5395  N  N     . ASP C 2 276  ? -8.976  -19.484 71.797  1.00 140.03 ?  276  ASP C N     1 
ATOM   5396  C  CA    . ASP C 2 276  ? -8.623  -20.057 70.502  1.00 141.57 ?  276  ASP C CA    1 
ATOM   5397  C  C     . ASP C 2 276  ? -8.882  -19.063 69.378  1.00 138.30 ?  276  ASP C C     1 
ATOM   5398  O  O     . ASP C 2 276  ? -8.108  -18.983 68.418  1.00 134.23 ?  276  ASP C O     1 
ATOM   5399  C  CB    . ASP C 2 276  ? -9.408  -21.349 70.271  1.00 143.89 ?  276  ASP C CB    1 
ATOM   5400  C  CG    . ASP C 2 276  ? -8.988  -22.073 69.005  1.00 146.76 ?  276  ASP C CG    1 
ATOM   5401  O  OD1   . ASP C 2 276  ? -7.877  -21.806 68.501  1.00 144.56 ?  276  ASP C OD1   1 
ATOM   5402  O  OD2   . ASP C 2 276  ? -9.774  -22.908 68.511  1.00 148.53 ?  276  ASP C OD2   1 
ATOM   5403  N  N     . ILE C 2 277  ? -9.966  -18.292 69.482  1.00 145.40 ?  277  ILE C N     1 
ATOM   5404  C  CA    . ILE C 2 277  ? -10.237 -17.259 68.489  1.00 134.90 ?  277  ILE C CA    1 
ATOM   5405  C  C     . ILE C 2 277  ? -9.246  -16.110 68.625  1.00 132.77 ?  277  ILE C C     1 
ATOM   5406  O  O     . ILE C 2 277  ? -8.840  -15.507 67.623  1.00 134.96 ?  277  ILE C O     1 
ATOM   5407  C  CB    . ILE C 2 277  ? -11.696 -16.777 68.617  1.00 131.91 ?  277  ILE C CB    1 
ATOM   5408  C  CG1   . ILE C 2 277  ? -12.661 -17.895 68.214  1.00 134.82 ?  277  ILE C CG1   1 
ATOM   5409  C  CG2   . ILE C 2 277  ? -11.939 -15.531 67.777  1.00 127.63 ?  277  ILE C CG2   1 
ATOM   5410  C  CD1   . ILE C 2 277  ? -14.118 -17.489 68.251  1.00 135.74 ?  277  ILE C CD1   1 
ATOM   5411  N  N     . TYR C 2 278  ? -8.820  -15.801 69.854  1.00 130.39 ?  278  TYR C N     1 
ATOM   5412  C  CA    . TYR C 2 278  ? -7.908  -14.681 70.068  1.00 129.77 ?  278  TYR C CA    1 
ATOM   5413  C  C     . TYR C 2 278  ? -6.550  -14.935 69.425  1.00 130.43 ?  278  TYR C C     1 
ATOM   5414  O  O     . TYR C 2 278  ? -5.951  -14.021 68.846  1.00 133.22 ?  278  TYR C O     1 
ATOM   5415  C  CB    . TYR C 2 278  ? -7.748  -14.417 71.567  1.00 136.54 ?  278  TYR C CB    1 
ATOM   5416  C  CG    . TYR C 2 278  ? -7.020  -13.132 71.904  1.00 135.27 ?  278  TYR C CG    1 
ATOM   5417  C  CD1   . TYR C 2 278  ? -7.722  -11.974 72.203  1.00 134.21 ?  278  TYR C CD1   1 
ATOM   5418  C  CD2   . TYR C 2 278  ? -5.631  -13.078 71.929  1.00 137.29 ?  278  TYR C CD2   1 
ATOM   5419  C  CE1   . TYR C 2 278  ? -7.067  -10.798 72.514  1.00 135.21 ?  278  TYR C CE1   1 
ATOM   5420  C  CE2   . TYR C 2 278  ? -4.966  -11.905 72.237  1.00 139.85 ?  278  TYR C CE2   1 
ATOM   5421  C  CZ    . TYR C 2 278  ? -5.690  -10.768 72.529  1.00 138.63 ?  278  TYR C CZ    1 
ATOM   5422  O  OH    . TYR C 2 278  ? -5.039  -9.596  72.838  1.00 145.83 ?  278  TYR C OH    1 
ATOM   5423  N  N     . ARG C 2 279  ? -6.045  -16.166 69.515  1.00 131.40 ?  279  ARG C N     1 
ATOM   5424  C  CA    . ARG C 2 279  ? -4.706  -16.464 69.023  1.00 132.95 ?  279  ARG C CA    1 
ATOM   5425  C  C     . ARG C 2 279  ? -4.648  -16.632 67.509  1.00 132.82 ?  279  ARG C C     1 
ATOM   5426  O  O     . ARG C 2 279  ? -3.553  -16.585 66.939  1.00 131.05 ?  279  ARG C O     1 
ATOM   5427  C  CB    . ARG C 2 279  ? -4.163  -17.719 69.712  1.00 141.21 ?  279  ARG C CB    1 
ATOM   5428  C  CG    . ARG C 2 279  ? -5.030  -18.955 69.545  1.00 141.50 ?  279  ARG C CG    1 
ATOM   5429  C  CD    . ARG C 2 279  ? -4.588  -20.079 70.476  1.00 146.31 ?  279  ARG C CD    1 
ATOM   5430  N  NE    . ARG C 2 279  ? -4.956  -19.825 71.868  1.00 151.03 ?  279  ARG C NE    1 
ATOM   5431  C  CZ    . ARG C 2 279  ? -4.133  -19.326 72.785  1.00 147.82 ?  279  ARG C CZ    1 
ATOM   5432  N  NH1   . ARG C 2 279  ? -2.882  -19.024 72.467  1.00 141.80 ?  279  ARG C NH1   1 
ATOM   5433  N  NH2   . ARG C 2 279  ? -4.561  -19.131 74.025  1.00 141.56 ?  279  ARG C NH2   1 
ATOM   5434  N  N     . LYS C 2 280  ? -5.790  -16.826 66.847  1.00 140.60 ?  280  LYS C N     1 
ATOM   5435  C  CA    . LYS C 2 280  ? -5.836  -16.886 65.391  1.00 135.58 ?  280  LYS C CA    1 
ATOM   5436  C  C     . LYS C 2 280  ? -6.202  -15.553 64.753  1.00 127.83 ?  280  LYS C C     1 
ATOM   5437  O  O     . LYS C 2 280  ? -5.939  -15.361 63.561  1.00 127.49 ?  280  LYS C O     1 
ATOM   5438  C  CB    . LYS C 2 280  ? -6.842  -17.947 64.927  1.00 131.05 ?  280  LYS C CB    1 
ATOM   5439  C  CG    . LYS C 2 280  ? -6.745  -19.280 65.648  1.00 136.41 ?  280  LYS C CG    1 
ATOM   5440  C  CD    . LYS C 2 280  ? -5.750  -20.224 65.002  1.00 140.35 ?  280  LYS C CD    1 
ATOM   5441  C  CE    . LYS C 2 280  ? -5.802  -21.585 65.678  1.00 137.42 ?  280  LYS C CE    1 
ATOM   5442  N  NZ    . LYS C 2 280  ? -4.951  -22.593 64.991  1.00 134.98 ?  280  LYS C NZ    1 
ATOM   5443  N  N     . LEU C 2 281  ? -6.801  -14.639 65.517  1.00 129.61 ?  281  LEU C N     1 
ATOM   5444  C  CA    . LEU C 2 281  ? -7.232  -13.332 65.037  1.00 131.32 ?  281  LEU C CA    1 
ATOM   5445  C  C     . LEU C 2 281  ? -6.181  -12.252 65.264  1.00 139.11 ?  281  LEU C C     1 
ATOM   5446  O  O     . LEU C 2 281  ? -5.856  -11.502 64.340  1.00 148.30 ?  281  LEU C O     1 
ATOM   5447  C  CB    . LEU C 2 281  ? -8.550  -12.938 65.719  1.00 129.61 ?  281  LEU C CB    1 
ATOM   5448  C  CG    . LEU C 2 281  ? -9.486  -11.942 65.029  1.00 133.54 ?  281  LEU C CG    1 
ATOM   5449  C  CD1   . LEU C 2 281  ? -10.910 -12.146 65.522  1.00 127.19 ?  281  LEU C CD1   1 
ATOM   5450  C  CD2   . LEU C 2 281  ? -9.054  -10.501 65.258  1.00 143.53 ?  281  LEU C CD2   1 
ATOM   5451  N  N     . ARG C 2 282  ? -5.650  -12.150 66.484  1.00 134.78 ?  282  ARG C N     1 
ATOM   5452  C  CA    . ARG C 2 282  ? -4.598  -11.196 66.830  1.00 133.87 ?  282  ARG C CA    1 
ATOM   5453  C  C     . ARG C 2 282  ? -3.413  -11.972 67.395  1.00 133.43 ?  282  ARG C C     1 
ATOM   5454  O  O     . ARG C 2 282  ? -3.206  -12.008 68.617  1.00 133.62 ?  282  ARG C O     1 
ATOM   5455  C  CB    . ARG C 2 282  ? -5.098  -10.149 67.824  1.00 136.88 ?  282  ARG C CB    1 
ATOM   5456  C  CG    . ARG C 2 282  ? -5.774  -8.946  67.181  1.00 148.38 ?  282  ARG C CG    1 
ATOM   5457  C  CD    . ARG C 2 282  ? -6.832  -8.348  68.095  1.00 155.77 ?  282  ARG C CD    1 
ATOM   5458  N  NE    . ARG C 2 282  ? -7.074  -6.936  67.811  1.00 161.35 ?  282  ARG C NE    1 
ATOM   5459  C  CZ    . ARG C 2 282  ? -7.829  -6.488  66.813  1.00 159.62 ?  282  ARG C CZ    1 
ATOM   5460  N  NH1   . ARG C 2 282  ? -8.420  -7.340  65.987  1.00 154.53 ?  282  ARG C NH1   1 
ATOM   5461  N  NH2   . ARG C 2 282  ? -7.990  -5.184  66.637  1.00 160.72 ?  282  ARG C NH2   1 
ATOM   5462  N  N     . PRO C 2 283  ? -2.614  -12.604 66.538  1.00 138.66 ?  283  PRO C N     1 
ATOM   5463  C  CA    . PRO C 2 283  ? -1.488  -13.404 67.031  1.00 142.78 ?  283  PRO C CA    1 
ATOM   5464  C  C     . PRO C 2 283  ? -0.390  -12.530 67.619  1.00 141.51 ?  283  PRO C C     1 
ATOM   5465  O  O     . PRO C 2 283  ? -0.262  -11.342 67.313  1.00 139.28 ?  283  PRO C O     1 
ATOM   5466  C  CB    . PRO C 2 283  ? -0.995  -14.142 65.780  1.00 137.74 ?  283  PRO C CB    1 
ATOM   5467  C  CG    . PRO C 2 283  ? -2.104  -14.011 64.775  1.00 131.89 ?  283  PRO C CG    1 
ATOM   5468  C  CD    . PRO C 2 283  ? -2.753  -12.699 65.076  1.00 131.35 ?  283  PRO C CD    1 
ATOM   5469  N  N     . GLY C 2 284  ? 0.414   -13.148 68.480  1.00 148.60 ?  284  GLY C N     1 
ATOM   5470  C  CA    . GLY C 2 284  ? 1.528   -12.473 69.111  1.00 149.17 ?  284  GLY C CA    1 
ATOM   5471  C  C     . GLY C 2 284  ? 1.195   -11.691 70.361  1.00 151.37 ?  284  GLY C C     1 
ATOM   5472  O  O     . GLY C 2 284  ? 2.056   -10.954 70.856  1.00 147.82 ?  284  GLY C O     1 
ATOM   5473  N  N     . GLU C 2 285  ? -0.019  -11.826 70.890  1.00 154.36 ?  285  GLU C N     1 
ATOM   5474  C  CA    . GLU C 2 285  ? -0.442  -11.099 72.074  1.00 157.08 ?  285  GLU C CA    1 
ATOM   5475  C  C     . GLU C 2 285  ? -0.827  -12.066 73.188  1.00 158.62 ?  285  GLU C C     1 
ATOM   5476  O  O     . GLU C 2 285  ? -1.293  -13.177 72.916  1.00 159.30 ?  285  GLU C O     1 
ATOM   5477  C  CB    . GLU C 2 285  ? -1.632  -10.181 71.760  1.00 157.76 ?  285  GLU C CB    1 
ATOM   5478  C  CG    . GLU C 2 285  ? -1.272  -8.964  70.924  1.00 156.72 ?  285  GLU C CG    1 
ATOM   5479  C  CD    . GLU C 2 285  ? -2.485  -8.143  70.537  1.00 174.48 ?  285  GLU C CD    1 
ATOM   5480  O  OE1   . GLU C 2 285  ? -2.647  -7.850  69.333  1.00 175.32 ?  285  GLU C OE1   1 
ATOM   5481  O  OE2   . GLU C 2 285  ? -3.281  -7.796  71.435  1.00 181.47 ?  285  GLU C OE2   1 
ATOM   5482  N  N     . PRO C 2 286  ? -0.638  -11.678 74.447  1.00 141.45 ?  286  PRO C N     1 
ATOM   5483  C  CA    . PRO C 2 286  ? -1.032  -12.548 75.560  1.00 144.84 ?  286  PRO C CA    1 
ATOM   5484  C  C     . PRO C 2 286  ? -2.539  -12.714 75.610  1.00 146.65 ?  286  PRO C C     1 
ATOM   5485  O  O     . PRO C 2 286  ? -3.283  -11.722 75.643  1.00 145.54 ?  286  PRO C O     1 
ATOM   5486  C  CB    . PRO C 2 286  ? -0.509  -11.801 76.797  1.00 142.52 ?  286  PRO C CB    1 
ATOM   5487  C  CG    . PRO C 2 286  ? -0.402  -10.379 76.364  1.00 133.59 ?  286  PRO C CG    1 
ATOM   5488  C  CD    . PRO C 2 286  ? -0.016  -10.427 74.915  1.00 137.01 ?  286  PRO C CD    1 
ATOM   5489  N  N     . PRO C 2 287  ? -3.033  -13.954 75.619  1.00 153.06 ?  287  PRO C N     1 
ATOM   5490  C  CA    . PRO C 2 287  ? -4.484  -14.168 75.591  1.00 151.36 ?  287  PRO C CA    1 
ATOM   5491  C  C     . PRO C 2 287  ? -5.112  -14.189 76.976  1.00 149.08 ?  287  PRO C C     1 
ATOM   5492  O  O     . PRO C 2 287  ? -4.931  -15.144 77.737  1.00 151.25 ?  287  PRO C O     1 
ATOM   5493  C  CB    . PRO C 2 287  ? -4.618  -15.527 74.892  1.00 149.24 ?  287  PRO C CB    1 
ATOM   5494  C  CG    . PRO C 2 287  ? -3.269  -16.215 75.087  1.00 146.74 ?  287  PRO C CG    1 
ATOM   5495  C  CD    . PRO C 2 287  ? -2.296  -15.225 75.682  1.00 150.23 ?  287  PRO C CD    1 
ATOM   5496  N  N     . THR C 2 288  ? -5.851  -13.136 77.309  1.00 147.17 ?  288  THR C N     1 
ATOM   5497  C  CA    . THR C 2 288  ? -6.589  -13.050 78.559  1.00 152.60 ?  288  THR C CA    1 
ATOM   5498  C  C     . THR C 2 288  ? -8.060  -13.348 78.298  1.00 150.00 ?  288  THR C C     1 
ATOM   5499  O  O     . THR C 2 288  ? -8.594  -13.020 77.235  1.00 150.01 ?  288  THR C O     1 
ATOM   5500  C  CB    . THR C 2 288  ? -6.435  -11.662 79.191  1.00 153.19 ?  288  THR C CB    1 
ATOM   5501  O  OG1   . THR C 2 288  ? -5.044  -11.335 79.296  1.00 150.68 ?  288  THR C OG1   1 
ATOM   5502  C  CG2   . THR C 2 288  ? -7.058  -11.620 80.579  1.00 150.69 ?  288  THR C CG2   1 
ATOM   5503  N  N     . LYS C 2 289  ? -8.711  -13.985 79.277  1.00 155.16 ?  289  LYS C N     1 
ATOM   5504  C  CA    . LYS C 2 289  ? -10.133 -14.291 79.157  1.00 156.70 ?  289  LYS C CA    1 
ATOM   5505  C  C     . LYS C 2 289  ? -10.977 -13.043 78.936  1.00 157.16 ?  289  LYS C C     1 
ATOM   5506  O  O     . LYS C 2 289  ? -12.086 -13.146 78.400  1.00 152.46 ?  289  LYS C O     1 
ATOM   5507  C  CB    . LYS C 2 289  ? -10.625 -15.026 80.405  1.00 157.70 ?  289  LYS C CB    1 
ATOM   5508  C  CG    . LYS C 2 289  ? -10.012 -16.399 80.614  1.00 154.98 ?  289  LYS C CG    1 
ATOM   5509  C  CD    . LYS C 2 289  ? -10.602 -17.070 81.844  1.00 151.74 ?  289  LYS C CD    1 
ATOM   5510  C  CE    . LYS C 2 289  ? -10.018 -18.455 82.058  1.00 151.12 ?  289  LYS C CE    1 
ATOM   5511  N  NZ    . LYS C 2 289  ? -10.606 -19.120 83.254  1.00 139.09 ?  289  LYS C NZ    1 
ATOM   5512  N  N     . GLU C 2 290  ? -10.482 -11.871 79.334  1.00 165.17 ?  290  GLU C N     1 
ATOM   5513  C  CA    . GLU C 2 290  ? -11.203 -10.623 79.150  1.00 163.57 ?  290  GLU C CA    1 
ATOM   5514  C  C     . GLU C 2 290  ? -10.628 -9.752  78.044  1.00 163.32 ?  290  GLU C C     1 
ATOM   5515  O  O     . GLU C 2 290  ? -11.222 -8.716  77.727  1.00 164.49 ?  290  GLU C O     1 
ATOM   5516  C  CB    . GLU C 2 290  ? -11.232 -9.830  80.465  1.00 164.51 ?  290  GLU C CB    1 
ATOM   5517  C  CG    . GLU C 2 290  ? -11.769 -10.632 81.639  1.00 172.11 ?  290  GLU C CG    1 
ATOM   5518  C  CD    . GLU C 2 290  ? -13.119 -11.264 81.345  1.00 174.44 ?  290  GLU C CD    1 
ATOM   5519  O  OE1   . GLU C 2 290  ? -13.993 -10.574 80.778  1.00 170.21 ?  290  GLU C OE1   1 
ATOM   5520  O  OE2   . GLU C 2 290  ? -13.305 -12.454 81.677  1.00 175.12 ?  290  GLU C OE2   1 
ATOM   5521  N  N     . SER C 2 291  ? -9.492  -10.133 77.455  1.00 163.03 ?  291  SER C N     1 
ATOM   5522  C  CA    . SER C 2 291  ? -8.999  -9.426  76.280  1.00 161.42 ?  291  SER C CA    1 
ATOM   5523  C  C     . SER C 2 291  ? -9.631  -9.962  75.002  1.00 158.13 ?  291  SER C C     1 
ATOM   5524  O  O     . SER C 2 291  ? -9.726  -9.232  74.009  1.00 156.33 ?  291  SER C O     1 
ATOM   5525  C  CB    . SER C 2 291  ? -7.474  -9.528  76.197  1.00 162.81 ?  291  SER C CB    1 
ATOM   5526  O  OG    . SER C 2 291  ? -7.055  -10.873 76.047  1.00 165.23 ?  291  SER C OG    1 
ATOM   5527  N  N     . ALA C 2 292  ? -10.054 -11.228 75.006  1.00 145.41 ?  292  ALA C N     1 
ATOM   5528  C  CA    . ALA C 2 292  ? -10.851 -11.782 73.918  1.00 140.43 ?  292  ALA C CA    1 
ATOM   5529  C  C     . ALA C 2 292  ? -12.338 -11.524 74.110  1.00 139.40 ?  292  ALA C C     1 
ATOM   5530  O  O     . ALA C 2 292  ? -13.072 -11.397 73.124  1.00 134.71 ?  292  ALA C O     1 
ATOM   5531  C  CB    . ALA C 2 292  ? -10.595 -13.286 73.789  1.00 133.76 ?  292  ALA C CB    1 
ATOM   5532  N  N     . GLN C 2 293  ? -12.794 -11.442 75.362  1.00 137.78 ?  293  GLN C N     1 
ATOM   5533  C  CA    . GLN C 2 293  ? -14.167 -11.038 75.639  1.00 141.00 ?  293  GLN C CA    1 
ATOM   5534  C  C     . GLN C 2 293  ? -14.432 -9.602  75.203  1.00 138.49 ?  293  GLN C C     1 
ATOM   5535  O  O     . GLN C 2 293  ? -15.593 -9.225  75.011  1.00 137.56 ?  293  GLN C O     1 
ATOM   5536  C  CB    . GLN C 2 293  ? -14.462 -11.207 77.134  1.00 145.12 ?  293  GLN C CB    1 
ATOM   5537  C  CG    . GLN C 2 293  ? -15.907 -10.956 77.544  1.00 147.37 ?  293  GLN C CG    1 
ATOM   5538  C  CD    . GLN C 2 293  ? -16.857 -12.024 77.041  1.00 145.02 ?  293  GLN C CD    1 
ATOM   5539  O  OE1   . GLN C 2 293  ? -16.438 -13.121 76.669  1.00 139.99 ?  293  GLN C OE1   1 
ATOM   5540  N  NE2   . GLN C 2 293  ? -18.147 -11.709 77.027  1.00 138.55 ?  293  GLN C NE2   1 
ATOM   5541  N  N     . THR C 2 294  ? -13.382 -8.800  75.028  1.00 142.58 ?  294  THR C N     1 
ATOM   5542  C  CA    . THR C 2 294  ? -13.527 -7.404  74.637  1.00 139.54 ?  294  THR C CA    1 
ATOM   5543  C  C     . THR C 2 294  ? -13.599 -7.222  73.124  1.00 137.84 ?  294  THR C C     1 
ATOM   5544  O  O     . THR C 2 294  ? -14.430 -6.447  72.638  1.00 137.06 ?  294  THR C O     1 
ATOM   5545  C  CB    . THR C 2 294  ? -12.369 -6.577  75.206  1.00 137.69 ?  294  THR C CB    1 
ATOM   5546  O  OG1   . THR C 2 294  ? -12.338 -6.712  76.633  1.00 145.58 ?  294  THR C OG1   1 
ATOM   5547  C  CG2   . THR C 2 294  ? -12.533 -5.106  74.850  1.00 133.87 ?  294  THR C CG2   1 
ATOM   5548  N  N     . LEU C 2 295  ? -12.755 -7.923  72.362  1.00 126.17 ?  295  LEU C N     1 
ATOM   5549  C  CA    . LEU C 2 295  ? -12.739 -7.711  70.917  1.00 124.36 ?  295  LEU C CA    1 
ATOM   5550  C  C     . LEU C 2 295  ? -13.879 -8.451  70.225  1.00 122.58 ?  295  LEU C C     1 
ATOM   5551  O  O     . LEU C 2 295  ? -14.437 -7.946  69.244  1.00 119.53 ?  295  LEU C O     1 
ATOM   5552  C  CB    . LEU C 2 295  ? -11.385 -8.121  70.329  1.00 122.46 ?  295  LEU C CB    1 
ATOM   5553  C  CG    . LEU C 2 295  ? -10.984 -9.588  70.136  1.00 122.91 ?  295  LEU C CG    1 
ATOM   5554  C  CD1   . LEU C 2 295  ? -11.450 -10.136 68.793  1.00 120.37 ?  295  LEU C CD1   1 
ATOM   5555  C  CD2   . LEU C 2 295  ? -9.482  -9.721  70.255  1.00 122.96 ?  295  LEU C CD2   1 
ATOM   5556  N  N     . LEU C 2 296  ? -14.239 -9.642  70.710  1.00 108.01 ?  296  LEU C N     1 
ATOM   5557  C  CA    . LEU C 2 296  ? -15.361 -10.363 70.117  1.00 105.95 ?  296  LEU C CA    1 
ATOM   5558  C  C     . LEU C 2 296  ? -16.686 -9.640  70.315  1.00 108.17 ?  296  LEU C C     1 
ATOM   5559  O  O     . LEU C 2 296  ? -17.673 -10.001 69.665  1.00 98.83  ?  296  LEU C O     1 
ATOM   5560  C  CB    . LEU C 2 296  ? -15.450 -11.783 70.684  1.00 104.95 ?  296  LEU C CB    1 
ATOM   5561  C  CG    . LEU C 2 296  ? -14.692 -12.867 69.909  1.00 108.46 ?  296  LEU C CG    1 
ATOM   5562  C  CD1   . LEU C 2 296  ? -13.222 -12.916 70.303  1.00 112.42 ?  296  LEU C CD1   1 
ATOM   5563  C  CD2   . LEU C 2 296  ? -15.350 -14.228 70.086  1.00 103.60 ?  296  LEU C CD2   1 
ATOM   5564  N  N     . GLU C 2 297  ? -16.735 -8.638  71.194  1.00 114.40 ?  297  GLU C N     1 
ATOM   5565  C  CA    . GLU C 2 297  ? -17.894 -7.763  71.303  1.00 112.35 ?  297  GLU C CA    1 
ATOM   5566  C  C     . GLU C 2 297  ? -17.736 -6.502  70.462  1.00 109.96 ?  297  GLU C C     1 
ATOM   5567  O  O     . GLU C 2 297  ? -18.713 -6.020  69.879  1.00 109.63 ?  297  GLU C O     1 
ATOM   5568  C  CB    . GLU C 2 297  ? -18.135 -7.378  72.766  1.00 119.63 ?  297  GLU C CB    1 
ATOM   5569  C  CG    . GLU C 2 297  ? -18.422 -8.546  73.692  1.00 123.93 ?  297  GLU C CG    1 
ATOM   5570  C  CD    . GLU C 2 297  ? -18.677 -8.099  75.119  1.00 137.58 ?  297  GLU C CD    1 
ATOM   5571  O  OE1   . GLU C 2 297  ? -19.169 -6.967  75.308  1.00 136.11 ?  297  GLU C OE1   1 
ATOM   5572  O  OE2   . GLU C 2 297  ? -18.378 -8.875  76.051  1.00 138.66 ?  297  GLU C OE2   1 
ATOM   5573  N  N     . ASN C 2 298  ? -16.517 -5.961  70.384  1.00 113.90 ?  298  ASN C N     1 
ATOM   5574  C  CA    . ASN C 2 298  ? -16.290 -4.724  69.645  1.00 117.36 ?  298  ASN C CA    1 
ATOM   5575  C  C     . ASN C 2 298  ? -16.237 -4.947  68.138  1.00 114.40 ?  298  ASN C C     1 
ATOM   5576  O  O     . ASN C 2 298  ? -16.581 -4.041  67.372  1.00 113.17 ?  298  ASN C O     1 
ATOM   5577  C  CB    . ASN C 2 298  ? -14.994 -4.058  70.113  1.00 116.78 ?  298  ASN C CB    1 
ATOM   5578  C  CG    . ASN C 2 298  ? -15.043 -3.636  71.570  1.00 114.03 ?  298  ASN C CG    1 
ATOM   5579  O  OD1   . ASN C 2 298  ? -16.117 -3.429  72.134  1.00 116.13 ?  298  ASN C OD1   1 
ATOM   5580  N  ND2   . ASN C 2 298  ? -13.874 -3.501  72.186  1.00 110.61 ?  298  ASN C ND2   1 
ATOM   5581  N  N     . LEU C 2 299  ? -15.811 -6.132  67.694  1.00 119.52 ?  299  LEU C N     1 
ATOM   5582  C  CA    . LEU C 2 299  ? -15.655 -6.385  66.266  1.00 120.72 ?  299  LEU C CA    1 
ATOM   5583  C  C     . LEU C 2 299  ? -16.965 -6.727  65.569  1.00 116.41 ?  299  LEU C C     1 
ATOM   5584  O  O     . LEU C 2 299  ? -17.023 -6.666  64.337  1.00 118.16 ?  299  LEU C O     1 
ATOM   5585  C  CB    . LEU C 2 299  ? -14.652 -7.518  66.032  1.00 120.92 ?  299  LEU C CB    1 
ATOM   5586  C  CG    . LEU C 2 299  ? -13.169 -7.143  66.039  1.00 127.37 ?  299  LEU C CG    1 
ATOM   5587  C  CD1   . LEU C 2 299  ? -12.312 -8.357  65.717  1.00 113.28 ?  299  LEU C CD1   1 
ATOM   5588  C  CD2   . LEU C 2 299  ? -12.900 -6.020  65.051  1.00 129.62 ?  299  LEU C CD2   1 
ATOM   5589  N  N     . PHE C 2 300  ? -18.011 -7.086  66.315  1.00 114.10 ?  300  PHE C N     1 
ATOM   5590  C  CA    . PHE C 2 300  ? -19.262 -7.505  65.692  1.00 106.15 ?  300  PHE C CA    1 
ATOM   5591  C  C     . PHE C 2 300  ? -20.519 -6.962  66.354  1.00 110.76 ?  300  PHE C C     1 
ATOM   5592  O  O     . PHE C 2 300  ? -21.584 -7.035  65.734  1.00 105.98 ?  300  PHE C O     1 
ATOM   5593  C  CB    . PHE C 2 300  ? -19.354 -9.038  65.660  1.00 104.41 ?  300  PHE C CB    1 
ATOM   5594  C  CG    . PHE C 2 300  ? -18.356 -9.688  64.746  1.00 108.26 ?  300  PHE C CG    1 
ATOM   5595  C  CD1   . PHE C 2 300  ? -18.671 -9.937  63.420  1.00 114.11 ?  300  PHE C CD1   1 
ATOM   5596  C  CD2   . PHE C 2 300  ? -17.104 -10.055 65.213  1.00 105.22 ?  300  PHE C CD2   1 
ATOM   5597  C  CE1   . PHE C 2 300  ? -17.755 -10.537 62.576  1.00 115.95 ?  300  PHE C CE1   1 
ATOM   5598  C  CE2   . PHE C 2 300  ? -16.184 -10.655 64.373  1.00 109.18 ?  300  PHE C CE2   1 
ATOM   5599  C  CZ    . PHE C 2 300  ? -16.510 -10.896 63.053  1.00 114.99 ?  300  PHE C CZ    1 
ATOM   5600  N  N     . PHE C 2 301  ? -20.451 -6.422  67.572  1.00 115.37 ?  301  PHE C N     1 
ATOM   5601  C  CA    . PHE C 2 301  ? -21.652 -6.026  68.294  1.00 113.67 ?  301  PHE C CA    1 
ATOM   5602  C  C     . PHE C 2 301  ? -21.597 -4.621  68.878  1.00 113.52 ?  301  PHE C C     1 
ATOM   5603  O  O     . PHE C 2 301  ? -22.630 -4.134  69.351  1.00 114.59 ?  301  PHE C O     1 
ATOM   5604  C  CB    . PHE C 2 301  ? -21.949 -7.036  69.413  1.00 97.98  ?  301  PHE C CB    1 
ATOM   5605  C  CG    . PHE C 2 301  ? -21.939 -8.466  68.945  1.00 98.57  ?  301  PHE C CG    1 
ATOM   5606  C  CD1   . PHE C 2 301  ? -23.053 -9.017  68.332  1.00 104.74 ?  301  PHE C CD1   1 
ATOM   5607  C  CD2   . PHE C 2 301  ? -20.810 -9.254  69.099  1.00 97.70  ?  301  PHE C CD2   1 
ATOM   5608  C  CE1   . PHE C 2 301  ? -23.044 -10.327 67.892  1.00 103.83 ?  301  PHE C CE1   1 
ATOM   5609  C  CE2   . PHE C 2 301  ? -20.795 -10.565 68.661  1.00 101.47 ?  301  PHE C CE2   1 
ATOM   5610  C  CZ    . PHE C 2 301  ? -21.914 -11.102 68.057  1.00 99.30  ?  301  PHE C CZ    1 
ATOM   5611  N  N     . LYS C 2 302  ? -20.444 -3.958  68.861  1.00 113.12 ?  302  LYS C N     1 
ATOM   5612  C  CA    . LYS C 2 302  ? -20.331 -2.550  69.216  1.00 118.45 ?  302  LYS C CA    1 
ATOM   5613  C  C     . LYS C 2 302  ? -20.312 -1.716  67.941  1.00 116.71 ?  302  LYS C C     1 
ATOM   5614  O  O     . LYS C 2 302  ? -19.673 -2.093  66.956  1.00 112.98 ?  302  LYS C O     1 
ATOM   5615  C  CB    . LYS C 2 302  ? -19.071 -2.289  70.046  1.00 124.60 ?  302  LYS C CB    1 
ATOM   5616  C  CG    . LYS C 2 302  ? -19.169 -2.750  71.495  1.00 116.87 ?  302  LYS C CG    1 
ATOM   5617  C  CD    . LYS C 2 302  ? -19.416 -1.579  72.435  1.00 117.37 ?  302  LYS C CD    1 
ATOM   5618  C  CE    . LYS C 2 302  ? -18.240 -0.612  72.440  1.00 122.95 ?  302  LYS C CE    1 
ATOM   5619  N  NZ    . LYS C 2 302  ? -18.434 0.487   73.427  1.00 116.32 ?  302  LYS C NZ    1 
ATOM   5620  N  N     . GLU C 2 303  ? -21.014 -0.578  67.964  1.00 120.15 ?  303  GLU C N     1 
ATOM   5621  C  CA    . GLU C 2 303  ? -21.224 0.229   66.763  1.00 122.81 ?  303  GLU C CA    1 
ATOM   5622  C  C     . GLU C 2 303  ? -19.946 0.954   66.356  1.00 123.44 ?  303  GLU C C     1 
ATOM   5623  O  O     . GLU C 2 303  ? -19.919 1.670   65.348  1.00 121.16 ?  303  GLU C O     1 
ATOM   5624  C  CB    . GLU C 2 303  ? -22.353 1.240   66.983  1.00 123.54 ?  303  GLU C CB    1 
ATOM   5625  C  CG    . GLU C 2 303  ? -23.733 0.629   67.098  1.00 127.33 ?  303  GLU C CG    1 
ATOM   5626  C  CD    . GLU C 2 303  ? -24.812 1.674   67.296  1.00 138.26 ?  303  GLU C CD    1 
ATOM   5627  O  OE1   . GLU C 2 303  ? -24.494 2.774   67.799  1.00 139.34 ?  303  GLU C OE1   1 
ATOM   5628  O  OE2   . GLU C 2 303  ? -25.977 1.392   66.943  1.00 140.69 ?  303  GLU C OE2   1 
ATOM   5629  N  N     . LYS C 2 304  ? -18.881 0.773   67.139  1.00 118.80 ?  304  LYS C N     1 
ATOM   5630  C  CA    . LYS C 2 304  ? -17.608 1.420   66.850  1.00 118.44 ?  304  LYS C CA    1 
ATOM   5631  C  C     . LYS C 2 304  ? -16.917 0.782   65.650  1.00 110.98 ?  304  LYS C C     1 
ATOM   5632  O  O     . LYS C 2 304  ? -16.552 1.474   64.693  1.00 112.50 ?  304  LYS C O     1 
ATOM   5633  C  CB    . LYS C 2 304  ? -16.709 1.364   68.084  1.00 128.13 ?  304  LYS C CB    1 
ATOM   5634  C  CG    . LYS C 2 304  ? -17.239 2.152   69.272  1.00 131.35 ?  304  LYS C CG    1 
ATOM   5635  C  CD    . LYS C 2 304  ? -16.293 2.059   70.457  1.00 128.35 ?  304  LYS C CD    1 
ATOM   5636  C  CE    . LYS C 2 304  ? -16.816 2.833   71.657  1.00 115.62 ?  304  LYS C CE    1 
ATOM   5637  N  NZ    . LYS C 2 304  ? -15.910 2.692   72.830  1.00 107.58 ?  304  LYS C NZ    1 
ATOM   5638  N  N     . ARG C 2 305  ? -16.730 -0.539  65.683  1.00 124.50 ?  305  ARG C N     1 
ATOM   5639  C  CA    . ARG C 2 305  ? -15.979 -1.249  64.655  1.00 130.62 ?  305  ARG C CA    1 
ATOM   5640  C  C     . ARG C 2 305  ? -16.856 -2.205  63.847  1.00 122.60 ?  305  ARG C C     1 
ATOM   5641  O  O     . ARG C 2 305  ? -16.339 -3.098  63.169  1.00 115.79 ?  305  ARG C O     1 
ATOM   5642  C  CB    . ARG C 2 305  ? -14.802 -1.993  65.294  1.00 130.90 ?  305  ARG C CB    1 
ATOM   5643  C  CG    . ARG C 2 305  ? -13.682 -2.381  64.334  1.00 138.58 ?  305  ARG C CG    1 
ATOM   5644  C  CD    . ARG C 2 305  ? -13.356 -1.255  63.365  1.00 147.71 ?  305  ARG C CD    1 
ATOM   5645  N  NE    . ARG C 2 305  ? -12.468 -1.703  62.296  1.00 151.68 ?  305  ARG C NE    1 
ATOM   5646  C  CZ    . ARG C 2 305  ? -12.123 -0.959  61.251  1.00 147.47 ?  305  ARG C CZ    1 
ATOM   5647  N  NH1   . ARG C 2 305  ? -12.592 0.275   61.128  1.00 145.33 ?  305  ARG C NH1   1 
ATOM   5648  N  NH2   . ARG C 2 305  ? -11.310 -1.451  60.326  1.00 146.84 ?  305  ARG C NH2   1 
ATOM   5649  N  N     . TYR C 2 306  ? -18.175 -2.031  63.895  1.00 114.68 ?  306  TYR C N     1 
ATOM   5650  C  CA    . TYR C 2 306  ? -19.070 -2.844  63.083  1.00 106.67 ?  306  TYR C CA    1 
ATOM   5651  C  C     . TYR C 2 306  ? -20.377 -2.089  62.898  1.00 115.10 ?  306  TYR C C     1 
ATOM   5652  O  O     . TYR C 2 306  ? -20.866 -1.450  63.833  1.00 120.57 ?  306  TYR C O     1 
ATOM   5653  C  CB    . TYR C 2 306  ? -19.332 -4.213  63.723  1.00 104.96 ?  306  TYR C CB    1 
ATOM   5654  C  CG    . TYR C 2 306  ? -19.879 -5.238  62.755  1.00 104.03 ?  306  TYR C CG    1 
ATOM   5655  C  CD1   . TYR C 2 306  ? -21.242 -5.335  62.509  1.00 98.30  ?  306  TYR C CD1   1 
ATOM   5656  C  CD2   . TYR C 2 306  ? -19.030 -6.107  62.083  1.00 109.86 ?  306  TYR C CD2   1 
ATOM   5657  C  CE1   . TYR C 2 306  ? -21.743 -6.269  61.622  1.00 94.75  ?  306  TYR C CE1   1 
ATOM   5658  C  CE2   . TYR C 2 306  ? -19.521 -7.046  61.197  1.00 104.63 ?  306  TYR C CE2   1 
ATOM   5659  C  CZ    . TYR C 2 306  ? -20.878 -7.123  60.971  1.00 99.26  ?  306  TYR C CZ    1 
ATOM   5660  O  OH    . TYR C 2 306  ? -21.371 -8.055  60.088  1.00 95.59  ?  306  TYR C OH    1 
ATOM   5661  N  N     . ASP C 2 307  ? -20.937 -2.171  61.690  1.00 115.39 ?  307  ASP C N     1 
ATOM   5662  C  CA    . ASP C 2 307  ? -22.171 -1.458  61.390  1.00 110.87 ?  307  ASP C CA    1 
ATOM   5663  C  C     . ASP C 2 307  ? -22.832 -1.981  60.120  1.00 107.45 ?  307  ASP C C     1 
ATOM   5664  O  O     . ASP C 2 307  ? -22.249 -1.912  59.033  1.00 106.50 ?  307  ASP C O     1 
ATOM   5665  C  CB    . ASP C 2 307  ? -21.897 0.043   61.255  1.00 111.94 ?  307  ASP C CB    1 
ATOM   5666  C  CG    . ASP C 2 307  ? -23.155 0.887   61.384  1.00 115.19 ?  307  ASP C CG    1 
ATOM   5667  O  OD1   . ASP C 2 307  ? -24.232 0.446   60.930  1.00 114.14 ?  307  ASP C OD1   1 
ATOM   5668  O  OD2   . ASP C 2 307  ? -23.065 1.999   61.944  1.00 120.76 ?  307  ASP C OD2   1 
ATOM   5669  N  N     . LEU C 2 308  ? -24.045 -2.509  60.252  1.00 103.25 ?  308  LEU C N     1 
ATOM   5670  C  CA    . LEU C 2 308  ? -24.919 -2.728  59.109  1.00 99.54  ?  308  LEU C CA    1 
ATOM   5671  C  C     . LEU C 2 308  ? -25.776 -1.484  58.926  1.00 103.66 ?  308  LEU C C     1 
ATOM   5672  O  O     . LEU C 2 308  ? -26.446 -1.045  59.866  1.00 113.09 ?  308  LEU C O     1 
ATOM   5673  C  CB    . LEU C 2 308  ? -25.811 -3.954  59.311  1.00 98.96  ?  308  LEU C CB    1 
ATOM   5674  C  CG    . LEU C 2 308  ? -25.188 -5.290  59.721  1.00 94.01  ?  308  LEU C CG    1 
ATOM   5675  C  CD1   . LEU C 2 308  ? -26.242 -6.388  59.705  1.00 86.44  ?  308  LEU C CD1   1 
ATOM   5676  C  CD2   . LEU C 2 308  ? -24.029 -5.653  58.819  1.00 91.25  ?  308  LEU C CD2   1 
ATOM   5677  N  N     . ALA C 2 309  ? -25.747 -0.913  57.724  1.00 81.68  ?  309  ALA C N     1 
ATOM   5678  C  CA    . ALA C 2 309  ? -26.526 0.286   57.461  1.00 84.63  ?  309  ALA C CA    1 
ATOM   5679  C  C     . ALA C 2 309  ? -28.020 -0.008  57.597  1.00 84.83  ?  309  ALA C C     1 
ATOM   5680  O  O     . ALA C 2 309  ? -28.447 -1.153  57.775  1.00 86.48  ?  309  ALA C O     1 
ATOM   5681  C  CB    . ALA C 2 309  ? -26.214 0.833   56.069  1.00 96.82  ?  309  ALA C CB    1 
ATOM   5682  N  N     . ARG C 2 310  ? -28.822 1.058   57.517  1.00 92.38  ?  310  ARG C N     1 
ATOM   5683  C  CA    . ARG C 2 310  ? -30.272 0.890   57.544  1.00 95.15  ?  310  ARG C CA    1 
ATOM   5684  C  C     . ARG C 2 310  ? -30.747 -0.034  56.430  1.00 96.57  ?  310  ARG C C     1 
ATOM   5685  O  O     . ARG C 2 310  ? -31.784 -0.692  56.568  1.00 100.47 ?  310  ARG C O     1 
ATOM   5686  C  CB    . ARG C 2 310  ? -30.966 2.248   57.440  1.00 100.31 ?  310  ARG C CB    1 
ATOM   5687  C  CG    . ARG C 2 310  ? -31.079 2.997   58.757  1.00 98.04  ?  310  ARG C CG    1 
ATOM   5688  C  CD    . ARG C 2 310  ? -32.020 4.183   58.624  1.00 111.07 ?  310  ARG C CD    1 
ATOM   5689  N  NE    . ARG C 2 310  ? -33.297 3.791   58.033  1.00 124.91 ?  310  ARG C NE    1 
ATOM   5690  C  CZ    . ARG C 2 310  ? -34.348 3.375   58.730  1.00 126.08 ?  310  ARG C CZ    1 
ATOM   5691  N  NH1   . ARG C 2 310  ? -34.281 3.297   60.052  1.00 128.78 ?  310  ARG C NH1   1 
ATOM   5692  N  NH2   . ARG C 2 310  ? -35.469 3.037   58.106  1.00 120.99 ?  310  ARG C NH2   1 
ATOM   5693  N  N     . VAL C 2 311  ? -30.002 -0.096  55.326  1.00 98.06  ?  311  VAL C N     1 
ATOM   5694  C  CA    . VAL C 2 311  ? -30.305 -1.059  54.275  1.00 96.78  ?  311  VAL C CA    1 
ATOM   5695  C  C     . VAL C 2 311  ? -29.690 -2.420  54.593  1.00 95.26  ?  311  VAL C C     1 
ATOM   5696  O  O     . VAL C 2 311  ? -30.265 -3.460  54.252  1.00 93.80  ?  311  VAL C O     1 
ATOM   5697  C  CB    . VAL C 2 311  ? -29.830 -0.519  52.914  1.00 100.11 ?  311  VAL C CB    1 
ATOM   5698  C  CG1   . VAL C 2 311  ? -28.342 -0.194  52.951  1.00 90.01  ?  311  VAL C CG1   1 
ATOM   5699  C  CG2   . VAL C 2 311  ? -30.139 -1.508  51.804  1.00 95.12  ?  311  VAL C CG2   1 
ATOM   5700  N  N     . GLY C 2 312  ? -28.533 -2.441  55.260  1.00 95.64  ?  312  GLY C N     1 
ATOM   5701  C  CA    . GLY C 2 312  ? -27.912 -3.710  55.602  1.00 93.76  ?  312  GLY C CA    1 
ATOM   5702  C  C     . GLY C 2 312  ? -28.690 -4.479  56.653  1.00 94.86  ?  312  GLY C C     1 
ATOM   5703  O  O     . GLY C 2 312  ? -28.835 -5.701  56.559  1.00 90.96  ?  312  GLY C O     1 
ATOM   5704  N  N     . ARG C 2 313  ? -29.196 -3.778  57.669  1.00 98.83  ?  313  ARG C N     1 
ATOM   5705  C  CA    . ARG C 2 313  ? -30.029 -4.430  58.674  1.00 100.57 ?  313  ARG C CA    1 
ATOM   5706  C  C     . ARG C 2 313  ? -31.339 -4.915  58.069  1.00 99.16  ?  313  ARG C C     1 
ATOM   5707  O  O     . ARG C 2 313  ? -31.818 -6.006  58.400  1.00 97.27  ?  313  ARG C O     1 
ATOM   5708  C  CB    . ARG C 2 313  ? -30.298 -3.470  59.833  1.00 100.56 ?  313  ARG C CB    1 
ATOM   5709  C  CG    . ARG C 2 313  ? -31.137 -4.062  60.953  1.00 104.04 ?  313  ARG C CG    1 
ATOM   5710  C  CD    . ARG C 2 313  ? -30.338 -5.061  61.773  1.00 105.09 ?  313  ARG C CD    1 
ATOM   5711  N  NE    . ARG C 2 313  ? -30.835 -6.423  61.616  1.00 103.29 ?  313  ARG C NE    1 
ATOM   5712  C  CZ    . ARG C 2 313  ? -30.329 -7.478  62.246  1.00 108.19 ?  313  ARG C CZ    1 
ATOM   5713  N  NH1   . ARG C 2 313  ? -29.307 -7.329  63.078  1.00 107.88 ?  313  ARG C NH1   1 
ATOM   5714  N  NH2   . ARG C 2 313  ? -30.845 -8.682  62.043  1.00 109.59 ?  313  ARG C NH2   1 
ATOM   5715  N  N     . TYR C 2 314  ? -31.929 -4.119  57.174  1.00 89.56  ?  314  TYR C N     1 
ATOM   5716  C  CA    . TYR C 2 314  ? -33.194 -4.499  56.555  1.00 89.49  ?  314  TYR C CA    1 
ATOM   5717  C  C     . TYR C 2 314  ? -33.019 -5.690  55.621  1.00 93.45  ?  314  TYR C C     1 
ATOM   5718  O  O     . TYR C 2 314  ? -33.901 -6.553  55.536  1.00 93.63  ?  314  TYR C O     1 
ATOM   5719  C  CB    . TYR C 2 314  ? -33.783 -3.304  55.807  1.00 96.39  ?  314  TYR C CB    1 
ATOM   5720  C  CG    . TYR C 2 314  ? -35.002 -3.627  54.976  1.00 102.84 ?  314  TYR C CG    1 
ATOM   5721  C  CD1   . TYR C 2 314  ? -36.201 -3.987  55.577  1.00 105.43 ?  314  TYR C CD1   1 
ATOM   5722  C  CD2   . TYR C 2 314  ? -34.959 -3.557  53.590  1.00 99.93  ?  314  TYR C CD2   1 
ATOM   5723  C  CE1   . TYR C 2 314  ? -37.320 -4.279  54.820  1.00 106.07 ?  314  TYR C CE1   1 
ATOM   5724  C  CE2   . TYR C 2 314  ? -36.072 -3.845  52.825  1.00 99.26  ?  314  TYR C CE2   1 
ATOM   5725  C  CZ    . TYR C 2 314  ? -37.250 -4.205  53.444  1.00 106.49 ?  314  TYR C CZ    1 
ATOM   5726  O  OH    . TYR C 2 314  ? -38.361 -4.494  52.686  1.00 104.93 ?  314  TYR C OH    1 
ATOM   5727  N  N     . LYS C 2 315  ? -31.888 -5.758  54.914  1.00 90.22  ?  315  LYS C N     1 
ATOM   5728  C  CA    . LYS C 2 315  ? -31.639 -6.882  54.020  1.00 88.76  ?  315  LYS C CA    1 
ATOM   5729  C  C     . LYS C 2 315  ? -31.419 -8.183  54.781  1.00 84.78  ?  315  LYS C C     1 
ATOM   5730  O  O     . LYS C 2 315  ? -31.615 -9.262  54.211  1.00 85.04  ?  315  LYS C O     1 
ATOM   5731  C  CB    . LYS C 2 315  ? -30.434 -6.587  53.124  1.00 82.08  ?  315  LYS C CB    1 
ATOM   5732  C  CG    . LYS C 2 315  ? -30.392 -7.411  51.847  1.00 77.20  ?  315  LYS C CG    1 
ATOM   5733  C  CD    . LYS C 2 315  ? -31.610 -7.132  50.978  1.00 73.85  ?  315  LYS C CD    1 
ATOM   5734  C  CE    . LYS C 2 315  ? -31.607 -7.984  49.720  1.00 70.73  ?  315  LYS C CE    1 
ATOM   5735  N  NZ    . LYS C 2 315  ? -32.795 -7.710  48.865  1.00 78.71  ?  315  LYS C NZ    1 
ATOM   5736  N  N     . VAL C 2 316  ? -31.018 -8.106  56.051  1.00 87.05  ?  316  VAL C N     1 
ATOM   5737  C  CA    . VAL C 2 316  ? -30.873 -9.310  56.862  1.00 89.81  ?  316  VAL C CA    1 
ATOM   5738  C  C     . VAL C 2 316  ? -32.214 -9.722  57.456  1.00 94.25  ?  316  VAL C C     1 
ATOM   5739  O  O     . VAL C 2 316  ? -32.532 -10.914 57.534  1.00 89.25  ?  316  VAL C O     1 
ATOM   5740  C  CB    . VAL C 2 316  ? -29.811 -9.087  57.955  1.00 83.57  ?  316  VAL C CB    1 
ATOM   5741  C  CG1   . VAL C 2 316  ? -29.755 -10.277 58.901  1.00 81.96  ?  316  VAL C CG1   1 
ATOM   5742  C  CG2   . VAL C 2 316  ? -28.449 -8.841  57.327  1.00 77.16  ?  316  VAL C CG2   1 
ATOM   5743  N  N     . ASN C 2 317  ? -33.024 -8.745  57.871  1.00 101.45 ?  317  ASN C N     1 
ATOM   5744  C  CA    . ASN C 2 317  ? -34.306 -9.047  58.496  1.00 98.66  ?  317  ASN C CA    1 
ATOM   5745  C  C     . ASN C 2 317  ? -35.311 -9.641  57.516  1.00 100.03 ?  317  ASN C C     1 
ATOM   5746  O  O     . ASN C 2 317  ? -36.304 -10.233 57.953  1.00 108.71 ?  317  ASN C O     1 
ATOM   5747  C  CB    . ASN C 2 317  ? -34.879 -7.785  59.143  1.00 100.81 ?  317  ASN C CB    1 
ATOM   5748  C  CG    . ASN C 2 317  ? -33.993 -7.248  60.251  1.00 106.66 ?  317  ASN C CG    1 
ATOM   5749  O  OD1   . ASN C 2 317  ? -33.149 -7.966  60.789  1.00 101.89 ?  317  ASN C OD1   1 
ATOM   5750  N  ND2   . ASN C 2 317  ? -34.182 -5.981  60.600  1.00 107.58 ?  317  ASN C ND2   1 
ATOM   5751  N  N     . LYS C 2 318  ? -35.084 -9.497  56.211  1.00 84.96  ?  318  LYS C N     1 
ATOM   5752  C  CA    . LYS C 2 318  ? -35.919 -10.168 55.222  1.00 87.60  ?  318  LYS C CA    1 
ATOM   5753  C  C     . LYS C 2 318  ? -35.339 -11.511 54.799  1.00 89.93  ?  318  LYS C C     1 
ATOM   5754  O  O     . LYS C 2 318  ? -36.091 -12.464 54.570  1.00 86.68  ?  318  LYS C O     1 
ATOM   5755  C  CB    . LYS C 2 318  ? -36.104 -9.287  53.984  1.00 86.39  ?  318  LYS C CB    1 
ATOM   5756  C  CG    . LYS C 2 318  ? -37.070 -8.133  54.157  1.00 84.93  ?  318  LYS C CG    1 
ATOM   5757  C  CD    . LYS C 2 318  ? -37.513 -7.610  52.800  1.00 99.02  ?  318  LYS C CD    1 
ATOM   5758  C  CE    . LYS C 2 318  ? -36.315 -7.289  51.917  1.00 105.36 ?  318  LYS C CE    1 
ATOM   5759  N  NZ    . LYS C 2 318  ? -36.720 -6.871  50.546  1.00 99.10  ?  318  LYS C NZ    1 
ATOM   5760  N  N     . LYS C 2 319  ? -34.012 -11.599 54.685  1.00 108.36 ?  319  LYS C N     1 
ATOM   5761  C  CA    . LYS C 2 319  ? -33.389 -12.837 54.231  1.00 101.30 ?  319  LYS C CA    1 
ATOM   5762  C  C     . LYS C 2 319  ? -33.533 -13.951 55.259  1.00 100.31 ?  319  LYS C C     1 
ATOM   5763  O  O     . LYS C 2 319  ? -33.660 -15.122 54.887  1.00 96.52  ?  319  LYS C O     1 
ATOM   5764  C  CB    . LYS C 2 319  ? -31.914 -12.595 53.908  1.00 91.84  ?  319  LYS C CB    1 
ATOM   5765  C  CG    . LYS C 2 319  ? -31.213 -13.795 53.299  1.00 79.96  ?  319  LYS C CG    1 
ATOM   5766  C  CD    . LYS C 2 319  ? -31.984 -14.323 52.101  1.00 84.08  ?  319  LYS C CD    1 
ATOM   5767  C  CE    . LYS C 2 319  ? -31.394 -15.625 51.592  1.00 84.97  ?  319  LYS C CE    1 
ATOM   5768  N  NZ    . LYS C 2 319  ? -32.207 -16.206 50.489  1.00 91.31  ?  319  LYS C NZ    1 
ATOM   5769  N  N     . LEU C 2 320  ? -33.525 -13.612 56.548  1.00 99.67  ?  320  LEU C N     1 
ATOM   5770  C  CA    . LEU C 2 320  ? -33.694 -14.609 57.596  1.00 100.56 ?  320  LEU C CA    1 
ATOM   5771  C  C     . LEU C 2 320  ? -35.130 -14.733 58.089  1.00 109.70 ?  320  LEU C C     1 
ATOM   5772  O  O     . LEU C 2 320  ? -35.491 -15.783 58.632  1.00 112.07 ?  320  LEU C O     1 
ATOM   5773  C  CB    . LEU C 2 320  ? -32.783 -14.290 58.787  1.00 92.45  ?  320  LEU C CB    1 
ATOM   5774  C  CG    . LEU C 2 320  ? -31.281 -14.370 58.514  1.00 89.70  ?  320  LEU C CG    1 
ATOM   5775  C  CD1   . LEU C 2 320  ? -30.488 -13.992 59.755  1.00 100.07 ?  320  LEU C CD1   1 
ATOM   5776  C  CD2   . LEU C 2 320  ? -30.896 -15.760 58.030  1.00 89.18  ?  320  LEU C CD2   1 
ATOM   5777  N  N     . GLY C 2 321  ? -35.950 -13.701 57.912  1.00 106.50 ?  321  GLY C N     1 
ATOM   5778  C  CA    . GLY C 2 321  ? -37.323 -13.743 58.379  1.00 107.08 ?  321  GLY C CA    1 
ATOM   5779  C  C     . GLY C 2 321  ? -37.488 -13.463 59.857  1.00 113.67 ?  321  GLY C C     1 
ATOM   5780  O  O     . GLY C 2 321  ? -38.252 -14.161 60.537  1.00 118.42 ?  321  GLY C O     1 
ATOM   5781  N  N     . LEU C 2 322  ? -36.783 -12.462 60.382  1.00 115.48 ?  322  LEU C N     1 
ATOM   5782  C  CA    . LEU C 2 322  ? -36.873 -12.100 61.789  1.00 114.76 ?  322  LEU C CA    1 
ATOM   5783  C  C     . LEU C 2 322  ? -36.891 -10.583 61.921  1.00 118.57 ?  322  LEU C C     1 
ATOM   5784  O  O     . LEU C 2 322  ? -36.253 -9.871  61.141  1.00 123.58 ?  322  LEU C O     1 
ATOM   5785  C  CB    . LEU C 2 322  ? -35.711 -12.704 62.599  1.00 109.03 ?  322  LEU C CB    1 
ATOM   5786  C  CG    . LEU C 2 322  ? -34.313 -12.697 61.966  1.00 109.78 ?  322  LEU C CG    1 
ATOM   5787  C  CD1   . LEU C 2 322  ? -33.593 -11.375 62.204  1.00 116.34 ?  322  LEU C CD1   1 
ATOM   5788  C  CD2   . LEU C 2 322  ? -33.471 -13.867 62.469  1.00 111.35 ?  322  LEU C CD2   1 
ATOM   5789  N  N     . HIS C 2 323  ? -37.636 -10.096 62.919  1.00 120.47 ?  323  HIS C N     1 
ATOM   5790  C  CA    . HIS C 2 323  ? -37.779 -8.661  63.177  1.00 121.76 ?  323  HIS C CA    1 
ATOM   5791  C  C     . HIS C 2 323  ? -38.324 -7.919  61.960  1.00 127.51 ?  323  HIS C C     1 
ATOM   5792  O  O     . HIS C 2 323  ? -37.991 -6.752  61.735  1.00 131.81 ?  323  HIS C O     1 
ATOM   5793  C  CB    . HIS C 2 323  ? -36.450 -8.038  63.622  1.00 120.00 ?  323  HIS C CB    1 
ATOM   5794  C  CG    . HIS C 2 323  ? -35.915 -8.593  64.905  1.00 130.08 ?  323  HIS C CG    1 
ATOM   5795  N  ND1   . HIS C 2 323  ? -35.988 -7.906  66.098  1.00 133.24 ?  323  HIS C ND1   1 
ATOM   5796  C  CD2   . HIS C 2 323  ? -35.292 -9.764  65.182  1.00 129.60 ?  323  HIS C CD2   1 
ATOM   5797  C  CE1   . HIS C 2 323  ? -35.435 -8.632  67.054  1.00 128.67 ?  323  HIS C CE1   1 
ATOM   5798  N  NE2   . HIS C 2 323  ? -35.005 -9.763  66.525  1.00 132.34 ?  323  HIS C NE2   1 
ATOM   5799  N  N     . VAL C 2 324  ? -39.175 -8.580  61.174  1.00 130.95 ?  324  VAL C N     1 
ATOM   5800  C  CA    . VAL C 2 324  ? -39.611 -8.052  59.884  1.00 132.24 ?  324  VAL C CA    1 
ATOM   5801  C  C     . VAL C 2 324  ? -40.725 -7.036  60.121  1.00 135.20 ?  324  VAL C C     1 
ATOM   5802  O  O     . VAL C 2 324  ? -41.244 -6.414  59.183  1.00 130.42 ?  324  VAL C O     1 
ATOM   5803  C  CB    . VAL C 2 324  ? -40.080 -9.187  58.957  1.00 126.97 ?  324  VAL C CB    1 
ATOM   5804  C  CG1   . VAL C 2 324  ? -41.480 -9.655  59.340  1.00 126.40 ?  324  VAL C CG1   1 
ATOM   5805  C  CG2   . VAL C 2 324  ? -40.020 -8.746  57.499  1.00 122.75 ?  324  VAL C CG2   1 
ATOM   5806  N  N     . GLY C 2 325  ? -41.096 -6.858  61.387  1.00 131.90 ?  325  GLY C N     1 
ATOM   5807  C  CA    . GLY C 2 325  ? -42.130 -5.909  61.752  1.00 127.02 ?  325  GLY C CA    1 
ATOM   5808  C  C     . GLY C 2 325  ? -41.623 -4.810  62.662  1.00 126.46 ?  325  GLY C C     1 
ATOM   5809  O  O     . GLY C 2 325  ? -42.248 -3.753  62.783  1.00 124.70 ?  325  GLY C O     1 
ATOM   5810  N  N     . GLU C 2 326  ? -40.486 -5.055  63.306  1.00 127.84 ?  326  GLU C N     1 
ATOM   5811  C  CA    . GLU C 2 326  ? -39.920 -4.084  64.229  1.00 126.78 ?  326  GLU C CA    1 
ATOM   5812  C  C     . GLU C 2 326  ? -39.392 -2.874  63.460  1.00 139.69 ?  326  GLU C C     1 
ATOM   5813  O  O     . GLU C 2 326  ? -38.861 -3.026  62.356  1.00 139.70 ?  326  GLU C O     1 
ATOM   5814  C  CB    . GLU C 2 326  ? -38.794 -4.727  65.041  1.00 127.17 ?  326  GLU C CB    1 
ATOM   5815  C  CG    . GLU C 2 326  ? -38.021 -3.773  65.932  1.00 130.17 ?  326  GLU C CG    1 
ATOM   5816  C  CD    . GLU C 2 326  ? -36.832 -4.435  66.598  1.00 136.29 ?  326  GLU C CD    1 
ATOM   5817  O  OE1   . GLU C 2 326  ? -36.771 -5.682  66.599  1.00 137.15 ?  326  GLU C OE1   1 
ATOM   5818  O  OE2   . GLU C 2 326  ? -35.956 -3.714  67.121  1.00 137.10 ?  326  GLU C OE2   1 
ATOM   5819  N  N     . PRO C 2 327  ? -39.543 -1.664  63.999  1.00 127.43 ?  327  PRO C N     1 
ATOM   5820  C  CA    . PRO C 2 327  ? -38.931 -0.496  63.354  1.00 131.31 ?  327  PRO C CA    1 
ATOM   5821  C  C     . PRO C 2 327  ? -37.416 -0.622  63.325  1.00 131.18 ?  327  PRO C C     1 
ATOM   5822  O  O     . PRO C 2 327  ? -36.794 -1.110  64.272  1.00 129.31 ?  327  PRO C O     1 
ATOM   5823  C  CB    . PRO C 2 327  ? -39.386 0.675   64.232  1.00 122.44 ?  327  PRO C CB    1 
ATOM   5824  C  CG    . PRO C 2 327  ? -39.728 0.048   65.547  1.00 113.36 ?  327  PRO C CG    1 
ATOM   5825  C  CD    . PRO C 2 327  ? -40.296 -1.292  65.208  1.00 109.66 ?  327  PRO C CD    1 
ATOM   5826  N  N     . ILE C 2 328  ? -36.824 -0.181  62.217  1.00 133.42 ?  328  ILE C N     1 
ATOM   5827  C  CA    . ILE C 2 328  ? -35.387 -0.312  62.004  1.00 131.59 ?  328  ILE C CA    1 
ATOM   5828  C  C     . ILE C 2 328  ? -34.643 0.573   62.994  1.00 125.92 ?  328  ILE C C     1 
ATOM   5829  O  O     . ILE C 2 328  ? -34.460 1.773   62.759  1.00 120.85 ?  328  ILE C O     1 
ATOM   5830  C  CB    . ILE C 2 328  ? -34.996 0.036   60.556  1.00 124.26 ?  328  ILE C CB    1 
ATOM   5831  C  CG1   . ILE C 2 328  ? -35.827 -0.774  59.556  1.00 130.06 ?  328  ILE C CG1   1 
ATOM   5832  C  CG2   . ILE C 2 328  ? -33.511 -0.213  60.333  1.00 105.24 ?  328  ILE C CG2   1 
ATOM   5833  C  CD1   . ILE C 2 328  ? -37.017 -0.024  58.988  1.00 128.33 ?  328  ILE C CD1   1 
ATOM   5834  N  N     . THR C 2 329  ? -34.210 -0.014  64.107  1.00 122.78 ?  329  THR C N     1 
ATOM   5835  C  CA    . THR C 2 329  ? -33.430 0.693   65.113  1.00 124.89 ?  329  THR C CA    1 
ATOM   5836  C  C     . THR C 2 329  ? -32.066 0.076   65.372  1.00 124.59 ?  329  THR C C     1 
ATOM   5837  O  O     . THR C 2 329  ? -31.134 0.804   65.722  1.00 122.56 ?  329  THR C O     1 
ATOM   5838  C  CB    . THR C 2 329  ? -34.199 0.761   66.443  1.00 133.85 ?  329  THR C CB    1 
ATOM   5839  O  OG1   . THR C 2 329  ? -33.345 1.293   67.464  1.00 134.00 ?  329  THR C OG1   1 
ATOM   5840  C  CG2   . THR C 2 329  ? -34.681 -0.622  66.858  1.00 126.02 ?  329  THR C CG2   1 
ATOM   5841  N  N     . SER C 2 330  ? -31.919 -1.236  65.205  1.00 125.87 ?  330  SER C N     1 
ATOM   5842  C  CA    . SER C 2 330  ? -30.647 -1.909  65.443  1.00 118.83 ?  330  SER C CA    1 
ATOM   5843  C  C     . SER C 2 330  ? -29.717 -1.648  64.265  1.00 114.52 ?  330  SER C C     1 
ATOM   5844  O  O     . SER C 2 330  ? -29.926 -2.176  63.169  1.00 113.97 ?  330  SER C O     1 
ATOM   5845  C  CB    . SER C 2 330  ? -30.866 -3.404  65.648  1.00 113.15 ?  330  SER C CB    1 
ATOM   5846  O  OG    . SER C 2 330  ? -29.631 -4.084  65.795  1.00 104.47 ?  330  SER C OG    1 
ATOM   5847  N  N     . SER C 2 331  ? -28.690 -0.828  64.487  1.00 120.41 ?  331  SER C N     1 
ATOM   5848  C  CA    . SER C 2 331  ? -27.661 -0.579  63.486  1.00 118.08 ?  331  SER C CA    1 
ATOM   5849  C  C     . SER C 2 331  ? -26.480 -1.529  63.621  1.00 111.64 ?  331  SER C C     1 
ATOM   5850  O  O     . SER C 2 331  ? -25.363 -1.184  63.212  1.00 109.83 ?  331  SER C O     1 
ATOM   5851  C  CB    . SER C 2 331  ? -27.185 0.872   63.572  1.00 115.97 ?  331  SER C CB    1 
ATOM   5852  O  OG    . SER C 2 331  ? -28.269 1.776   63.459  1.00 111.06 ?  331  SER C OG    1 
ATOM   5853  N  N     . THR C 2 332  ? -26.695 -2.717  64.185  1.00 110.58 ?  332  THR C N     1 
ATOM   5854  C  CA    . THR C 2 332  ? -25.607 -3.616  64.536  1.00 108.86 ?  332  THR C CA    1 
ATOM   5855  C  C     . THR C 2 332  ? -26.032 -5.061  64.321  1.00 102.69 ?  332  THR C C     1 
ATOM   5856  O  O     . THR C 2 332  ? -27.222 -5.388  64.346  1.00 103.93 ?  332  THR C O     1 
ATOM   5857  C  CB    . THR C 2 332  ? -25.175 -3.425  65.998  1.00 111.95 ?  332  THR C CB    1 
ATOM   5858  O  OG1   . THR C 2 332  ? -25.295 -2.043  66.356  1.00 123.57 ?  332  THR C OG1   1 
ATOM   5859  C  CG2   . THR C 2 332  ? -23.733 -3.861  66.193  1.00 102.08 ?  332  THR C CG2   1 
ATOM   5860  N  N     . LEU C 2 333  ? -25.042 -5.922  64.105  1.00 103.50 ?  333  LEU C N     1 
ATOM   5861  C  CA    . LEU C 2 333  ? -25.277 -7.358  64.101  1.00 102.03 ?  333  LEU C CA    1 
ATOM   5862  C  C     . LEU C 2 333  ? -25.519 -7.846  65.525  1.00 111.46 ?  333  LEU C C     1 
ATOM   5863  O  O     . LEU C 2 333  ? -24.930 -7.334  66.481  1.00 106.41 ?  333  LEU C O     1 
ATOM   5864  C  CB    . LEU C 2 333  ? -24.081 -8.085  63.486  1.00 100.42 ?  333  LEU C CB    1 
ATOM   5865  C  CG    . LEU C 2 333  ? -24.087 -9.614  63.462  1.00 97.90  ?  333  LEU C CG    1 
ATOM   5866  C  CD1   . LEU C 2 333  ? -25.133 -10.132 62.491  1.00 90.02  ?  333  LEU C CD1   1 
ATOM   5867  C  CD2   . LEU C 2 333  ? -22.707 -10.148 63.110  1.00 88.94  ?  333  LEU C CD2   1 
ATOM   5868  N  N     . THR C 2 334  ? -26.398 -8.835  65.668  1.00 126.89 ?  334  THR C N     1 
ATOM   5869  C  CA    . THR C 2 334  ? -26.732 -9.398  66.966  1.00 128.19 ?  334  THR C CA    1 
ATOM   5870  C  C     . THR C 2 334  ? -26.359 -10.874 67.008  1.00 125.20 ?  334  THR C C     1 
ATOM   5871  O  O     . THR C 2 334  ? -26.122 -11.507 65.975  1.00 117.12 ?  334  THR C O     1 
ATOM   5872  C  CB    . THR C 2 334  ? -28.225 -9.230  67.286  1.00 129.77 ?  334  THR C CB    1 
ATOM   5873  O  OG1   . THR C 2 334  ? -29.004 -10.018 66.377  1.00 124.40 ?  334  THR C OG1   1 
ATOM   5874  C  CG2   . THR C 2 334  ? -28.637 -7.770  67.163  1.00 126.18 ?  334  THR C CG2   1 
ATOM   5875  N  N     . GLU C 2 335  ? -26.306 -11.420 68.227  1.00 122.82 ?  335  GLU C N     1 
ATOM   5876  C  CA    . GLU C 2 335  ? -25.999 -12.837 68.387  1.00 118.94 ?  335  GLU C CA    1 
ATOM   5877  C  C     . GLU C 2 335  ? -27.100 -13.716 67.809  1.00 118.64 ?  335  GLU C C     1 
ATOM   5878  O  O     . GLU C 2 335  ? -26.824 -14.821 67.330  1.00 116.40 ?  335  GLU C O     1 
ATOM   5879  C  CB    . GLU C 2 335  ? -25.786 -13.170 69.864  1.00 118.64 ?  335  GLU C CB    1 
ATOM   5880  C  CG    . GLU C 2 335  ? -24.890 -12.193 70.607  1.00 128.62 ?  335  GLU C CG    1 
ATOM   5881  C  CD    . GLU C 2 335  ? -24.637 -12.614 72.042  1.00 142.07 ?  335  GLU C CD    1 
ATOM   5882  O  OE1   . GLU C 2 335  ? -24.318 -13.801 72.267  1.00 136.17 ?  335  GLU C OE1   1 
ATOM   5883  O  OE2   . GLU C 2 335  ? -24.766 -11.762 72.945  1.00 144.75 ?  335  GLU C OE2   1 
ATOM   5884  N  N     . GLU C 2 336  ? -28.348 -13.243 67.852  1.00 111.35 ?  336  GLU C N     1 
ATOM   5885  C  CA    . GLU C 2 336  ? -29.460 -13.999 67.286  1.00 108.66 ?  336  GLU C CA    1 
ATOM   5886  C  C     . GLU C 2 336  ? -29.273 -14.226 65.791  1.00 110.54 ?  336  GLU C C     1 
ATOM   5887  O  O     . GLU C 2 336  ? -29.606 -15.297 65.270  1.00 106.71 ?  336  GLU C O     1 
ATOM   5888  C  CB    . GLU C 2 336  ? -30.771 -13.263 67.559  1.00 110.47 ?  336  GLU C CB    1 
ATOM   5889  C  CG    . GLU C 2 336  ? -31.944 -13.721 66.714  1.00 121.32 ?  336  GLU C CG    1 
ATOM   5890  C  CD    . GLU C 2 336  ? -32.955 -12.615 66.490  1.00 127.89 ?  336  GLU C CD    1 
ATOM   5891  O  OE1   . GLU C 2 336  ? -33.800 -12.754 65.581  1.00 129.15 ?  336  GLU C OE1   1 
ATOM   5892  O  OE2   . GLU C 2 336  ? -32.897 -11.601 67.217  1.00 128.04 ?  336  GLU C OE2   1 
ATOM   5893  N  N     . ASP C 2 337  ? -28.734 -13.228 65.087  1.00 126.93 ?  337  ASP C N     1 
ATOM   5894  C  CA    . ASP C 2 337  ? -28.558 -13.347 63.643  1.00 120.63 ?  337  ASP C CA    1 
ATOM   5895  C  C     . ASP C 2 337  ? -27.501 -14.388 63.295  1.00 111.00 ?  337  ASP C C     1 
ATOM   5896  O  O     . ASP C 2 337  ? -27.629 -15.097 62.290  1.00 111.38 ?  337  ASP C O     1 
ATOM   5897  C  CB    . ASP C 2 337  ? -28.186 -11.990 63.049  1.00 119.70 ?  337  ASP C CB    1 
ATOM   5898  C  CG    . ASP C 2 337  ? -29.178 -10.903 63.412  1.00 129.19 ?  337  ASP C CG    1 
ATOM   5899  O  OD1   . ASP C 2 337  ? -30.391 -11.195 63.472  1.00 132.65 ?  337  ASP C OD1   1 
ATOM   5900  O  OD2   . ASP C 2 337  ? -28.743 -9.754  63.640  1.00 124.95 ?  337  ASP C OD2   1 
ATOM   5901  N  N     . VAL C 2 338  ? -26.448 -14.492 64.111  1.00 112.56 ?  338  VAL C N     1 
ATOM   5902  C  CA    . VAL C 2 338  ? -25.377 -15.444 63.828  1.00 112.05 ?  338  VAL C CA    1 
ATOM   5903  C  C     . VAL C 2 338  ? -25.905 -16.871 63.876  1.00 113.65 ?  338  VAL C C     1 
ATOM   5904  O  O     . VAL C 2 338  ? -25.563 -17.705 63.029  1.00 111.50 ?  338  VAL C O     1 
ATOM   5905  C  CB    . VAL C 2 338  ? -24.206 -15.238 64.807  1.00 108.57 ?  338  VAL C CB    1 
ATOM   5906  C  CG1   . VAL C 2 338  ? -23.062 -16.186 64.477  1.00 96.94  ?  338  VAL C CG1   1 
ATOM   5907  C  CG2   . VAL C 2 338  ? -23.735 -13.792 64.775  1.00 106.63 ?  338  VAL C CG2   1 
ATOM   5908  N  N     . VAL C 2 339  ? -26.753 -17.174 64.860  1.00 117.99 ?  339  VAL C N     1 
ATOM   5909  C  CA    . VAL C 2 339  ? -27.309 -18.518 64.976  1.00 123.40 ?  339  VAL C CA    1 
ATOM   5910  C  C     . VAL C 2 339  ? -28.283 -18.792 63.836  1.00 122.42 ?  339  VAL C C     1 
ATOM   5911  O  O     . VAL C 2 339  ? -28.247 -19.857 63.209  1.00 120.50 ?  339  VAL C O     1 
ATOM   5912  C  CB    . VAL C 2 339  ? -27.979 -18.704 66.349  1.00 120.57 ?  339  VAL C CB    1 
ATOM   5913  C  CG1   . VAL C 2 339  ? -28.491 -20.129 66.502  1.00 130.84 ?  339  VAL C CG1   1 
ATOM   5914  C  CG2   . VAL C 2 339  ? -27.005 -18.357 67.464  1.00 116.80 ?  339  VAL C CG2   1 
ATOM   5915  N  N     . ALA C 2 340  ? -29.167 -17.831 63.548  1.00 109.36 ?  340  ALA C N     1 
ATOM   5916  C  CA    . ALA C 2 340  ? -30.134 -18.015 62.469  1.00 112.14 ?  340  ALA C CA    1 
ATOM   5917  C  C     . ALA C 2 340  ? -29.449 -18.129 61.114  1.00 112.39 ?  340  ALA C C     1 
ATOM   5918  O  O     . ALA C 2 340  ? -29.994 -18.748 60.193  1.00 110.90 ?  340  ALA C O     1 
ATOM   5919  C  CB    . ALA C 2 340  ? -31.141 -16.866 62.463  1.00 118.89 ?  340  ALA C CB    1 
ATOM   5920  N  N     . THR C 2 341  ? -28.261 -17.538 60.971  1.00 125.94 ?  341  THR C N     1 
ATOM   5921  C  CA    . THR C 2 341  ? -27.501 -17.692 59.735  1.00 125.27 ?  341  THR C CA    1 
ATOM   5922  C  C     . THR C 2 341  ? -26.973 -19.115 59.595  1.00 126.67 ?  341  THR C C     1 
ATOM   5923  O  O     . THR C 2 341  ? -27.089 -19.730 58.528  1.00 123.95 ?  341  THR C O     1 
ATOM   5924  C  CB    . THR C 2 341  ? -26.353 -16.682 59.695  1.00 117.51 ?  341  THR C CB    1 
ATOM   5925  O  OG1   . THR C 2 341  ? -26.886 -15.357 59.573  1.00 109.57 ?  341  THR C OG1   1 
ATOM   5926  C  CG2   . THR C 2 341  ? -25.430 -16.963 58.521  1.00 116.34 ?  341  THR C CG2   1 
ATOM   5927  N  N     . ILE C 2 342  ? -26.390 -19.657 60.668  1.00 116.25 ?  342  ILE C N     1 
ATOM   5928  C  CA    . ILE C 2 342  ? -25.939 -21.045 60.648  1.00 118.57 ?  342  ILE C CA    1 
ATOM   5929  C  C     . ILE C 2 342  ? -27.124 -21.987 60.489  1.00 119.96 ?  342  ILE C C     1 
ATOM   5930  O  O     . ILE C 2 342  ? -27.002 -23.057 59.880  1.00 116.59 ?  342  ILE C O     1 
ATOM   5931  C  CB    . ILE C 2 342  ? -25.129 -21.358 61.922  1.00 108.36 ?  342  ILE C CB    1 
ATOM   5932  C  CG1   . ILE C 2 342  ? -24.021 -20.322 62.113  1.00 105.17 ?  342  ILE C CG1   1 
ATOM   5933  C  CG2   . ILE C 2 342  ? -24.528 -22.753 61.848  1.00 109.39 ?  342  ILE C CG2   1 
ATOM   5934  C  CD1   . ILE C 2 342  ? -23.280 -20.459 63.423  1.00 102.47 ?  342  ILE C CD1   1 
ATOM   5935  N  N     . GLU C 2 343  ? -28.287 -21.606 61.023  1.00 116.25 ?  343  GLU C N     1 
ATOM   5936  C  CA    . GLU C 2 343  ? -29.492 -22.406 60.829  1.00 121.59 ?  343  GLU C CA    1 
ATOM   5937  C  C     . GLU C 2 343  ? -29.947 -22.372 59.375  1.00 122.33 ?  343  GLU C C     1 
ATOM   5938  O  O     . GLU C 2 343  ? -30.393 -23.390 58.833  1.00 122.68 ?  343  GLU C O     1 
ATOM   5939  C  CB    . GLU C 2 343  ? -30.602 -21.905 61.754  1.00 127.01 ?  343  GLU C CB    1 
ATOM   5940  C  CG    . GLU C 2 343  ? -31.892 -22.705 61.683  1.00 131.12 ?  343  GLU C CG    1 
ATOM   5941  C  CD    . GLU C 2 343  ? -32.984 -22.125 62.561  1.00 140.65 ?  343  GLU C CD    1 
ATOM   5942  O  OE1   . GLU C 2 343  ? -32.840 -20.965 63.003  1.00 142.57 ?  343  GLU C OE1   1 
ATOM   5943  O  OE2   . GLU C 2 343  ? -33.985 -22.828 62.812  1.00 142.59 ?  343  GLU C OE2   1 
ATOM   5944  N  N     . TYR C 2 344  ? -29.839 -21.208 58.729  1.00 114.67 ?  344  TYR C N     1 
ATOM   5945  C  CA    . TYR C 2 344  ? -30.210 -21.095 57.322  1.00 117.37 ?  344  TYR C CA    1 
ATOM   5946  C  C     . TYR C 2 344  ? -29.294 -21.939 56.443  1.00 115.16 ?  344  TYR C C     1 
ATOM   5947  O  O     . TYR C 2 344  ? -29.739 -22.524 55.448  1.00 113.50 ?  344  TYR C O     1 
ATOM   5948  C  CB    . TYR C 2 344  ? -30.158 -19.626 56.897  1.00 108.93 ?  344  TYR C CB    1 
ATOM   5949  C  CG    . TYR C 2 344  ? -30.980 -19.266 55.676  1.00 105.25 ?  344  TYR C CG    1 
ATOM   5950  C  CD1   . TYR C 2 344  ? -32.104 -18.460 55.790  1.00 107.14 ?  344  TYR C CD1   1 
ATOM   5951  C  CD2   . TYR C 2 344  ? -30.624 -19.714 54.410  1.00 107.25 ?  344  TYR C CD2   1 
ATOM   5952  C  CE1   . TYR C 2 344  ? -32.855 -18.118 54.684  1.00 109.97 ?  344  TYR C CE1   1 
ATOM   5953  C  CE2   . TYR C 2 344  ? -31.368 -19.373 53.295  1.00 104.65 ?  344  TYR C CE2   1 
ATOM   5954  C  CZ    . TYR C 2 344  ? -32.483 -18.576 53.440  1.00 106.35 ?  344  TYR C CZ    1 
ATOM   5955  O  OH    . TYR C 2 344  ? -33.231 -18.234 52.337  1.00 106.43 ?  344  TYR C OH    1 
ATOM   5956  N  N     . LEU C 2 345  ? -28.011 -22.021 56.803  1.00 119.00 ?  345  LEU C N     1 
ATOM   5957  C  CA    . LEU C 2 345  ? -27.037 -22.710 55.962  1.00 120.72 ?  345  LEU C CA    1 
ATOM   5958  C  C     . LEU C 2 345  ? -27.222 -24.221 56.012  1.00 126.49 ?  345  LEU C C     1 
ATOM   5959  O  O     . LEU C 2 345  ? -27.265 -24.886 54.970  1.00 119.49 ?  345  LEU C O     1 
ATOM   5960  C  CB    . LEU C 2 345  ? -25.620 -22.331 56.393  1.00 113.26 ?  345  LEU C CB    1 
ATOM   5961  C  CG    . LEU C 2 345  ? -24.471 -23.193 55.861  1.00 109.08 ?  345  LEU C CG    1 
ATOM   5962  C  CD1   . LEU C 2 345  ? -24.393 -23.138 54.342  1.00 118.46 ?  345  LEU C CD1   1 
ATOM   5963  C  CD2   . LEU C 2 345  ? -23.149 -22.770 56.486  1.00 111.16 ?  345  LEU C CD2   1 
ATOM   5964  N  N     . VAL C 2 346  ? -27.326 -24.783 57.219  1.00 137.85 ?  346  VAL C N     1 
ATOM   5965  C  CA    . VAL C 2 346  ? -27.338 -26.235 57.369  1.00 135.28 ?  346  VAL C CA    1 
ATOM   5966  C  C     . VAL C 2 346  ? -28.568 -26.847 56.710  1.00 134.97 ?  346  VAL C C     1 
ATOM   5967  O  O     . VAL C 2 346  ? -28.513 -27.974 56.200  1.00 138.80 ?  346  VAL C O     1 
ATOM   5968  C  CB    . VAL C 2 346  ? -27.237 -26.612 58.863  1.00 132.42 ?  346  VAL C CB    1 
ATOM   5969  C  CG1   . VAL C 2 346  ? -28.406 -26.031 59.649  1.00 137.46 ?  346  VAL C CG1   1 
ATOM   5970  C  CG2   . VAL C 2 346  ? -27.158 -28.120 59.036  1.00 151.92 ?  346  VAL C CG2   1 
ATOM   5971  N  N     . ARG C 2 347  ? -29.687 -26.119 56.687  1.00 126.79 ?  347  ARG C N     1 
ATOM   5972  C  CA    . ARG C 2 347  ? -30.895 -26.655 56.068  1.00 133.51 ?  347  ARG C CA    1 
ATOM   5973  C  C     . ARG C 2 347  ? -30.764 -26.702 54.550  1.00 131.64 ?  347  ARG C C     1 
ATOM   5974  O  O     . ARG C 2 347  ? -31.185 -27.676 53.916  1.00 132.23 ?  347  ARG C O     1 
ATOM   5975  C  CB    . ARG C 2 347  ? -32.110 -25.825 56.480  1.00 136.13 ?  347  ARG C CB    1 
ATOM   5976  C  CG    . ARG C 2 347  ? -32.355 -25.793 57.980  1.00 141.25 ?  347  ARG C CG    1 
ATOM   5977  C  CD    . ARG C 2 347  ? -33.655 -25.081 58.309  1.00 141.60 ?  347  ARG C CD    1 
ATOM   5978  N  NE    . ARG C 2 347  ? -33.810 -24.845 59.741  1.00 145.16 ?  347  ARG C NE    1 
ATOM   5979  C  CZ    . ARG C 2 347  ? -34.378 -25.701 60.584  1.00 140.11 ?  347  ARG C CZ    1 
ATOM   5980  N  NH1   . ARG C 2 347  ? -34.845 -26.860 60.142  1.00 139.29 ?  347  ARG C NH1   1 
ATOM   5981  N  NH2   . ARG C 2 347  ? -34.477 -25.399 61.872  1.00 140.81 ?  347  ARG C NH2   1 
ATOM   5982  N  N     . LEU C 2 348  ? -30.173 -25.665 53.952  1.00 126.35 ?  348  LEU C N     1 
ATOM   5983  C  CA    . LEU C 2 348  ? -30.012 -25.638 52.502  1.00 130.83 ?  348  LEU C CA    1 
ATOM   5984  C  C     . LEU C 2 348  ? -29.091 -26.748 52.011  1.00 131.27 ?  348  LEU C C     1 
ATOM   5985  O  O     . LEU C 2 348  ? -29.256 -27.234 50.887  1.00 130.37 ?  348  LEU C O     1 
ATOM   5986  C  CB    . LEU C 2 348  ? -29.477 -24.277 52.058  1.00 122.61 ?  348  LEU C CB    1 
ATOM   5987  C  CG    . LEU C 2 348  ? -29.367 -24.045 50.551  1.00 116.94 ?  348  LEU C CG    1 
ATOM   5988  C  CD1   . LEU C 2 348  ? -30.708 -24.279 49.874  1.00 112.80 ?  348  LEU C CD1   1 
ATOM   5989  C  CD2   . LEU C 2 348  ? -28.856 -22.644 50.266  1.00 108.94 ?  348  LEU C CD2   1 
ATOM   5990  N  N     . HIS C 2 349  ? -28.125 -27.163 52.835  1.00 129.76 ?  349  HIS C N     1 
ATOM   5991  C  CA    . HIS C 2 349  ? -27.157 -28.164 52.396  1.00 131.53 ?  349  HIS C CA    1 
ATOM   5992  C  C     . HIS C 2 349  ? -27.824 -29.510 52.142  1.00 137.08 ?  349  HIS C C     1 
ATOM   5993  O  O     . HIS C 2 349  ? -27.488 -30.204 51.175  1.00 135.09 ?  349  HIS C O     1 
ATOM   5994  C  CB    . HIS C 2 349  ? -26.041 -28.306 53.432  1.00 133.72 ?  349  HIS C CB    1 
ATOM   5995  C  CG    . HIS C 2 349  ? -24.938 -29.227 53.012  1.00 141.21 ?  349  HIS C CG    1 
ATOM   5996  N  ND1   . HIS C 2 349  ? -24.855 -30.535 53.441  1.00 150.09 ?  349  HIS C ND1   1 
ATOM   5997  C  CD2   . HIS C 2 349  ? -23.869 -29.029 52.204  1.00 138.09 ?  349  HIS C CD2   1 
ATOM   5998  C  CE1   . HIS C 2 349  ? -23.784 -31.102 52.914  1.00 151.89 ?  349  HIS C CE1   1 
ATOM   5999  N  NE2   . HIS C 2 349  ? -23.168 -30.209 52.160  1.00 142.98 ?  349  HIS C NE2   1 
ATOM   6000  N  N     . GLU C 2 350  ? -28.775 -29.895 52.991  1.00 132.65 ?  350  GLU C N     1 
ATOM   6001  C  CA    . GLU C 2 350  ? -29.442 -31.191 52.883  1.00 137.93 ?  350  GLU C CA    1 
ATOM   6002  C  C     . GLU C 2 350  ? -30.833 -31.078 52.268  1.00 134.05 ?  350  GLU C C     1 
ATOM   6003  O  O     . GLU C 2 350  ? -31.750 -31.815 52.640  1.00 138.82 ?  350  GLU C O     1 
ATOM   6004  C  CB    . GLU C 2 350  ? -29.505 -31.871 54.247  1.00 134.63 ?  350  GLU C CB    1 
ATOM   6005  C  CG    . GLU C 2 350  ? -30.038 -31.000 55.369  1.00 137.18 ?  350  GLU C CG    1 
ATOM   6006  C  CD    . GLU C 2 350  ? -29.868 -31.646 56.730  1.00 150.67 ?  350  GLU C CD    1 
ATOM   6007  O  OE1   . GLU C 2 350  ? -29.140 -32.658 56.821  1.00 156.66 ?  350  GLU C OE1   1 
ATOM   6008  O  OE2   . GLU C 2 350  ? -30.462 -31.145 57.707  1.00 150.47 ?  350  GLU C OE2   1 
ATOM   6009  N  N     . GLY C 2 351  ? -31.016 -30.154 51.327  1.00 114.62 ?  351  GLY C N     1 
ATOM   6010  C  CA    . GLY C 2 351  ? -32.195 -30.139 50.486  1.00 111.32 ?  351  GLY C CA    1 
ATOM   6011  C  C     . GLY C 2 351  ? -33.415 -29.435 51.040  1.00 106.21 ?  351  GLY C C     1 
ATOM   6012  O  O     . GLY C 2 351  ? -34.450 -29.416 50.361  1.00 97.97  ?  351  GLY C O     1 
ATOM   6013  N  N     . GLN C 2 352  ? -33.345 -28.860 52.238  1.00 110.83 ?  352  GLN C N     1 
ATOM   6014  C  CA    . GLN C 2 352  ? -34.496 -28.139 52.764  1.00 112.12 ?  352  GLN C CA    1 
ATOM   6015  C  C     . GLN C 2 352  ? -34.747 -26.870 51.958  1.00 112.87 ?  352  GLN C C     1 
ATOM   6016  O  O     . GLN C 2 352  ? -33.825 -26.257 51.414  1.00 117.78 ?  352  GLN C O     1 
ATOM   6017  C  CB    . GLN C 2 352  ? -34.297 -27.788 54.238  1.00 115.35 ?  352  GLN C CB    1 
ATOM   6018  C  CG    . GLN C 2 352  ? -34.299 -28.983 55.173  1.00 123.71 ?  352  GLN C CG    1 
ATOM   6019  C  CD    . GLN C 2 352  ? -34.536 -28.584 56.616  1.00 122.00 ?  352  GLN C CD    1 
ATOM   6020  O  OE1   . GLN C 2 352  ? -35.168 -27.564 56.892  1.00 114.83 ?  352  GLN C OE1   1 
ATOM   6021  N  NE2   . GLN C 2 352  ? -34.028 -29.385 57.544  1.00 123.21 ?  352  GLN C NE2   1 
ATOM   6022  N  N     . THR C 2 353  ? -36.020 -26.478 51.883  1.00 102.72 ?  353  THR C N     1 
ATOM   6023  C  CA    . THR C 2 353  ? -36.432 -25.331 51.088  1.00 108.86 ?  353  THR C CA    1 
ATOM   6024  C  C     . THR C 2 353  ? -37.190 -24.277 51.883  1.00 107.95 ?  353  THR C C     1 
ATOM   6025  O  O     . THR C 2 353  ? -37.589 -23.259 51.304  1.00 111.55 ?  353  THR C O     1 
ATOM   6026  C  CB    . THR C 2 353  ? -37.302 -25.785 49.906  1.00 106.54 ?  353  THR C CB    1 
ATOM   6027  O  OG1   . THR C 2 353  ? -38.492 -26.415 50.400  1.00 113.05 ?  353  THR C OG1   1 
ATOM   6028  C  CG2   . THR C 2 353  ? -36.544 -26.767 49.024  1.00 102.44 ?  353  THR C CG2   1 
ATOM   6029  N  N     . THR C 2 354  ? -37.407 -24.483 53.181  1.00 109.48 ?  354  THR C N     1 
ATOM   6030  C  CA    . THR C 2 354  ? -38.186 -23.548 53.981  1.00 110.21 ?  354  THR C CA    1 
ATOM   6031  C  C     . THR C 2 354  ? -37.686 -23.580 55.419  1.00 111.88 ?  354  THR C C     1 
ATOM   6032  O  O     . THR C 2 354  ? -37.327 -24.643 55.933  1.00 115.55 ?  354  THR C O     1 
ATOM   6033  C  CB    . THR C 2 354  ? -39.682 -23.883 53.930  1.00 116.90 ?  354  THR C CB    1 
ATOM   6034  O  OG1   . THR C 2 354  ? -40.085 -24.088 52.570  1.00 112.87 ?  354  THR C OG1   1 
ATOM   6035  C  CG2   . THR C 2 354  ? -40.499 -22.749 54.514  1.00 115.23 ?  354  THR C CG2   1 
ATOM   6036  N  N     . MET C 2 355  ? -37.665 -22.412 56.061  1.00 111.42 ?  355  MET C N     1 
ATOM   6037  C  CA    . MET C 2 355  ? -37.187 -22.292 57.431  1.00 105.04 ?  355  MET C CA    1 
ATOM   6038  C  C     . MET C 2 355  ? -37.837 -21.089 58.099  1.00 112.28 ?  355  MET C C     1 
ATOM   6039  O  O     . MET C 2 355  ? -38.005 -20.039 57.474  1.00 117.77 ?  355  MET C O     1 
ATOM   6040  C  CB    . MET C 2 355  ? -35.662 -22.146 57.483  1.00 109.78 ?  355  MET C CB    1 
ATOM   6041  C  CG    . MET C 2 355  ? -35.104 -21.882 58.874  1.00 124.04 ?  355  MET C CG    1 
ATOM   6042  S  SD    . MET C 2 355  ? -33.667 -20.796 58.854  1.00 123.77 ?  355  MET C SD    1 
ATOM   6043  C  CE    . MET C 2 355  ? -34.421 -19.264 58.312  1.00 118.18 ?  355  MET C CE    1 
ATOM   6044  N  N     . THR C 2 356  ? -38.198 -21.254 59.371  1.00 115.63 ?  356  THR C N     1 
ATOM   6045  C  CA    . THR C 2 356  ? -38.652 -20.159 60.218  1.00 117.19 ?  356  THR C CA    1 
ATOM   6046  C  C     . THR C 2 356  ? -37.746 -20.083 61.438  1.00 115.84 ?  356  THR C C     1 
ATOM   6047  O  O     . THR C 2 356  ? -37.559 -21.083 62.139  1.00 111.25 ?  356  THR C O     1 
ATOM   6048  C  CB    . THR C 2 356  ? -40.107 -20.347 60.663  1.00 112.50 ?  356  THR C CB    1 
ATOM   6049  O  OG1   . THR C 2 356  ? -40.145 -21.156 61.845  1.00 128.78 ?  356  THR C OG1   1 
ATOM   6050  C  CG2   . THR C 2 356  ? -40.919 -21.026 59.575  1.00 109.62 ?  356  THR C CG2   1 
ATOM   6051  N  N     . VAL C 2 357  ? -37.184 -18.907 61.683  1.00 118.18 ?  357  VAL C N     1 
ATOM   6052  C  CA    . VAL C 2 357  ? -36.341 -18.712 62.869  1.00 122.44 ?  357  VAL C CA    1 
ATOM   6053  C  C     . VAL C 2 357  ? -37.213 -18.792 64.116  1.00 118.53 ?  357  VAL C C     1 
ATOM   6054  O  O     . VAL C 2 357  ? -38.360 -18.310 64.092  1.00 117.65 ?  357  VAL C O     1 
ATOM   6055  C  CB    . VAL C 2 357  ? -35.614 -17.365 62.785  1.00 123.18 ?  357  VAL C CB    1 
ATOM   6056  C  CG1   . VAL C 2 357  ? -34.668 -17.178 63.964  1.00 112.54 ?  357  VAL C CG1   1 
ATOM   6057  C  CG2   . VAL C 2 357  ? -34.857 -17.256 61.471  1.00 118.16 ?  357  VAL C CG2   1 
ATOM   6058  N  N     . PRO C 2 358  ? -36.742 -19.419 65.211  1.00 112.72 ?  358  PRO C N     1 
ATOM   6059  C  CA    . PRO C 2 358  ? -37.517 -19.415 66.462  1.00 110.80 ?  358  PRO C CA    1 
ATOM   6060  C  C     . PRO C 2 358  ? -37.986 -18.025 66.860  1.00 108.36 ?  358  PRO C C     1 
ATOM   6061  O  O     . PRO C 2 358  ? -37.188 -17.183 67.284  1.00 101.72 ?  358  PRO C O     1 
ATOM   6062  C  CB    . PRO C 2 358  ? -36.527 -19.989 67.480  1.00 108.43 ?  358  PRO C CB    1 
ATOM   6063  C  CG    . PRO C 2 358  ? -35.683 -20.915 66.673  1.00 106.42 ?  358  PRO C CG    1 
ATOM   6064  C  CD    . PRO C 2 358  ? -35.558 -20.292 65.302  1.00 110.62 ?  358  PRO C CD    1 
ATOM   6065  N  N     . GLY C 2 359  ? -39.286 -17.779 66.719  1.00 102.77 ?  359  GLY C N     1 
ATOM   6066  C  CA    . GLY C 2 359  ? -39.821 -16.450 66.925  1.00 102.81 ?  359  GLY C CA    1 
ATOM   6067  C  C     . GLY C 2 359  ? -39.748 -15.565 65.703  1.00 98.94  ?  359  GLY C C     1 
ATOM   6068  O  O     . GLY C 2 359  ? -39.721 -14.337 65.837  1.00 93.54  ?  359  GLY C O     1 
ATOM   6069  N  N     . GLY C 2 360  ? -39.714 -16.154 64.508  1.00 113.29 ?  360  GLY C N     1 
ATOM   6070  C  CA    . GLY C 2 360  ? -39.590 -15.381 63.291  1.00 115.29 ?  360  GLY C CA    1 
ATOM   6071  C  C     . GLY C 2 360  ? -40.535 -15.887 62.219  1.00 112.26 ?  360  GLY C C     1 
ATOM   6072  O  O     . GLY C 2 360  ? -41.029 -17.016 62.270  1.00 110.86 ?  360  GLY C O     1 
ATOM   6073  N  N     . VAL C 2 361  ? -40.773 -15.018 61.234  1.00 116.13 ?  361  VAL C N     1 
ATOM   6074  C  CA    . VAL C 2 361  ? -41.698 -15.346 60.156  1.00 114.89 ?  361  VAL C CA    1 
ATOM   6075  C  C     . VAL C 2 361  ? -41.059 -16.356 59.204  1.00 113.61 ?  361  VAL C C     1 
ATOM   6076  O  O     . VAL C 2 361  ? -39.839 -16.561 59.184  1.00 113.19 ?  361  VAL C O     1 
ATOM   6077  C  CB    . VAL C 2 361  ? -42.130 -14.068 59.415  1.00 113.97 ?  361  VAL C CB    1 
ATOM   6078  C  CG1   . VAL C 2 361  ? -41.035 -13.601 58.464  1.00 118.26 ?  361  VAL C CG1   1 
ATOM   6079  C  CG2   . VAL C 2 361  ? -43.455 -14.274 58.683  1.00 102.98 ?  361  VAL C CG2   1 
ATOM   6080  N  N     . GLU C 2 362  ? -41.906 -17.004 58.409  1.00 107.99 ?  362  GLU C N     1 
ATOM   6081  C  CA    . GLU C 2 362  ? -41.439 -18.003 57.458  1.00 114.48 ?  362  GLU C CA    1 
ATOM   6082  C  C     . GLU C 2 362  ? -40.719 -17.337 56.291  1.00 122.99 ?  362  GLU C C     1 
ATOM   6083  O  O     . GLU C 2 362  ? -41.102 -16.253 55.840  1.00 123.30 ?  362  GLU C O     1 
ATOM   6084  C  CB    . GLU C 2 362  ? -42.620 -18.832 56.953  1.00 113.86 ?  362  GLU C CB    1 
ATOM   6085  C  CG    . GLU C 2 362  ? -42.245 -20.180 56.368  1.00 111.88 ?  362  GLU C CG    1 
ATOM   6086  C  CD    . GLU C 2 362  ? -43.288 -21.241 56.664  1.00 121.01 ?  362  GLU C CD    1 
ATOM   6087  O  OE1   . GLU C 2 362  ? -44.359 -20.886 57.197  1.00 128.43 ?  362  GLU C OE1   1 
ATOM   6088  O  OE2   . GLU C 2 362  ? -43.037 -22.429 56.372  1.00 120.98 ?  362  GLU C OE2   1 
ATOM   6089  N  N     . VAL C 2 363  ? -39.671 -17.993 55.801  1.00 125.61 ?  363  VAL C N     1 
ATOM   6090  C  CA    . VAL C 2 363  ? -38.850 -17.456 54.717  1.00 114.93 ?  363  VAL C CA    1 
ATOM   6091  C  C     . VAL C 2 363  ? -38.247 -18.616 53.931  1.00 114.75 ?  363  VAL C C     1 
ATOM   6092  O  O     . VAL C 2 363  ? -37.845 -19.626 54.528  1.00 116.64 ?  363  VAL C O     1 
ATOM   6093  C  CB    . VAL C 2 363  ? -37.770 -16.506 55.264  1.00 116.30 ?  363  VAL C CB    1 
ATOM   6094  C  CG1   . VAL C 2 363  ? -36.410 -16.793 54.643  1.00 116.28 ?  363  VAL C CG1   1 
ATOM   6095  C  CG2   . VAL C 2 363  ? -38.169 -15.057 55.021  1.00 120.60 ?  363  VAL C CG2   1 
ATOM   6096  N  N     . PRO C 2 364  ? -38.175 -18.527 52.603  1.00 111.91 ?  364  PRO C N     1 
ATOM   6097  C  CA    . PRO C 2 364  ? -37.620 -19.634 51.817  1.00 113.35 ?  364  PRO C CA    1 
ATOM   6098  C  C     . PRO C 2 364  ? -36.111 -19.739 51.975  1.00 108.53 ?  364  PRO C C     1 
ATOM   6099  O  O     . PRO C 2 364  ? -35.414 -18.770 52.284  1.00 109.13 ?  364  PRO C O     1 
ATOM   6100  C  CB    . PRO C 2 364  ? -38.003 -19.273 50.379  1.00 98.19  ?  364  PRO C CB    1 
ATOM   6101  C  CG    . PRO C 2 364  ? -38.094 -17.784 50.390  1.00 101.44 ?  364  PRO C CG    1 
ATOM   6102  C  CD    . PRO C 2 364  ? -38.627 -17.414 51.750  1.00 104.49 ?  364  PRO C CD    1 
ATOM   6103  N  N     . VAL C 2 365  ? -35.609 -20.950 51.748  1.00 104.42 ?  365  VAL C N     1 
ATOM   6104  C  CA    . VAL C 2 365  ? -34.190 -21.261 51.873  1.00 102.03 ?  365  VAL C CA    1 
ATOM   6105  C  C     . VAL C 2 365  ? -33.641 -21.466 50.467  1.00 113.47 ?  365  VAL C C     1 
ATOM   6106  O  O     . VAL C 2 365  ? -33.940 -22.474 49.815  1.00 112.74 ?  365  VAL C O     1 
ATOM   6107  C  CB    . VAL C 2 365  ? -33.953 -22.495 52.752  1.00 109.87 ?  365  VAL C CB    1 
ATOM   6108  C  CG1   . VAL C 2 365  ? -32.471 -22.698 52.992  1.00 113.70 ?  365  VAL C CG1   1 
ATOM   6109  C  CG2   . VAL C 2 365  ? -34.686 -22.348 54.069  1.00 119.23 ?  365  VAL C CG2   1 
ATOM   6110  N  N     . GLU C 2 366  ? -32.835 -20.516 50.000  1.00 107.81 ?  366  GLU C N     1 
ATOM   6111  C  CA    . GLU C 2 366  ? -32.320 -20.554 48.638  1.00 97.12  ?  366  GLU C CA    1 
ATOM   6112  C  C     . GLU C 2 366  ? -31.036 -19.740 48.567  1.00 94.37  ?  366  GLU C C     1 
ATOM   6113  O  O     . GLU C 2 366  ? -30.652 -19.059 49.521  1.00 91.13  ?  366  GLU C O     1 
ATOM   6114  C  CB    . GLU C 2 366  ? -33.358 -20.027 47.642  1.00 87.81  ?  366  GLU C CB    1 
ATOM   6115  C  CG    . GLU C 2 366  ? -33.926 -18.666 48.016  1.00 92.84  ?  366  GLU C CG    1 
ATOM   6116  C  CD    . GLU C 2 366  ? -35.035 -18.218 47.086  1.00 93.62  ?  366  GLU C CD    1 
ATOM   6117  O  OE1   . GLU C 2 366  ? -35.140 -18.773 45.972  1.00 90.97  ?  366  GLU C OE1   1 
ATOM   6118  O  OE2   . GLU C 2 366  ? -35.805 -17.312 47.471  1.00 95.15  ?  366  GLU C OE2   1 
ATOM   6119  N  N     . THR C 2 367  ? -30.373 -19.825 47.417  1.00 91.09  ?  367  THR C N     1 
ATOM   6120  C  CA    . THR C 2 367  ? -29.164 -19.058 47.162  1.00 84.39  ?  367  THR C CA    1 
ATOM   6121  C  C     . THR C 2 367  ? -29.508 -17.768 46.429  1.00 86.13  ?  367  THR C C     1 
ATOM   6122  O  O     . THR C 2 367  ? -30.521 -17.678 45.731  1.00 83.25  ?  367  THR C O     1 
ATOM   6123  C  CB    . THR C 2 367  ? -28.161 -19.874 46.346  1.00 83.30  ?  367  THR C CB    1 
ATOM   6124  O  OG1   . THR C 2 367  ? -28.797 -20.374 45.162  1.00 94.06  ?  367  THR C OG1   1 
ATOM   6125  C  CG2   . THR C 2 367  ? -27.641 -21.039 47.167  1.00 81.74  ?  367  THR C CG2   1 
ATOM   6126  N  N     . ASP C 2 368  ? -28.650 -16.767 46.593  1.00 86.79  ?  368  ASP C N     1 
ATOM   6127  C  CA    . ASP C 2 368  ? -28.906 -15.433 46.073  1.00 90.90  ?  368  ASP C CA    1 
ATOM   6128  C  C     . ASP C 2 368  ? -28.033 -15.151 44.856  1.00 94.11  ?  368  ASP C C     1 
ATOM   6129  O  O     . ASP C 2 368  ? -26.984 -15.768 44.653  1.00 93.91  ?  368  ASP C O     1 
ATOM   6130  C  CB    . ASP C 2 368  ? -28.671 -14.376 47.157  1.00 87.60  ?  368  ASP C CB    1 
ATOM   6131  C  CG    . ASP C 2 368  ? -29.179 -14.819 48.515  1.00 85.96  ?  368  ASP C CG    1 
ATOM   6132  O  OD1   . ASP C 2 368  ? -28.482 -14.580 49.521  1.00 89.04  ?  368  ASP C OD1   1 
ATOM   6133  O  OD2   . ASP C 2 368  ? -30.265 -15.434 48.572  1.00 93.35  ?  368  ASP C OD2   1 
ATOM   6134  N  N     . ASP C 2 369  ? -28.488 -14.193 44.045  1.00 74.03  ?  369  ASP C N     1 
ATOM   6135  C  CA    . ASP C 2 369  ? -27.839 -13.909 42.770  1.00 75.87  ?  369  ASP C CA    1 
ATOM   6136  C  C     . ASP C 2 369  ? -26.602 -13.034 42.940  1.00 79.95  ?  369  ASP C C     1 
ATOM   6137  O  O     . ASP C 2 369  ? -25.604 -13.234 42.240  1.00 84.50  ?  369  ASP C O     1 
ATOM   6138  C  CB    . ASP C 2 369  ? -28.829 -13.232 41.821  1.00 74.29  ?  369  ASP C CB    1 
ATOM   6139  C  CG    . ASP C 2 369  ? -28.474 -13.434 40.359  1.00 77.37  ?  369  ASP C CG    1 
ATOM   6140  O  OD1   . ASP C 2 369  ? -29.357 -13.865 39.588  1.00 73.97  ?  369  ASP C OD1   1 
ATOM   6141  O  OD2   . ASP C 2 369  ? -27.312 -13.179 39.983  1.00 77.31  ?  369  ASP C OD2   1 
ATOM   6142  N  N     . ILE C 2 370  ? -26.663 -12.055 43.851  1.00 77.59  ?  370  ILE C N     1 
ATOM   6143  C  CA    . ILE C 2 370  ? -25.667 -11.000 44.076  1.00 82.73  ?  370  ILE C CA    1 
ATOM   6144  C  C     . ILE C 2 370  ? -25.478 -10.137 42.829  1.00 73.45  ?  370  ILE C C     1 
ATOM   6145  O  O     . ILE C 2 370  ? -24.858 -9.069  42.894  1.00 72.85  ?  370  ILE C O     1 
ATOM   6146  C  CB    . ILE C 2 370  ? -24.314 -11.553 44.581  1.00 87.70  ?  370  ILE C CB    1 
ATOM   6147  C  CG1   . ILE C 2 370  ? -23.320 -11.783 43.436  1.00 75.01  ?  370  ILE C CG1   1 
ATOM   6148  C  CG2   . ILE C 2 370  ? -24.506 -12.805 45.442  1.00 93.50  ?  370  ILE C CG2   1 
ATOM   6149  C  CD1   . ILE C 2 370  ? -21.982 -12.325 43.891  1.00 79.58  ?  370  ILE C CD1   1 
ATOM   6150  N  N     . ASP C 2 371  ? -26.013 -10.580 41.690  1.00 73.18  ?  371  ASP C N     1 
ATOM   6151  C  CA    . ASP C 2 371  ? -26.136 -9.738  40.507  1.00 70.18  ?  371  ASP C CA    1 
ATOM   6152  C  C     . ASP C 2 371  ? -27.532 -9.157  40.347  1.00 67.07  ?  371  ASP C C     1 
ATOM   6153  O  O     . ASP C 2 371  ? -27.701 -8.182  39.606  1.00 64.38  ?  371  ASP C O     1 
ATOM   6154  C  CB    . ASP C 2 371  ? -25.774 -10.527 39.241  1.00 72.69  ?  371  ASP C CB    1 
ATOM   6155  C  CG    . ASP C 2 371  ? -24.305 -10.896 39.181  1.00 75.55  ?  371  ASP C CG    1 
ATOM   6156  O  OD1   . ASP C 2 371  ? -23.528 -10.394 40.019  1.00 82.88  ?  371  ASP C OD1   1 
ATOM   6157  O  OD2   . ASP C 2 371  ? -23.928 -11.690 38.293  1.00 68.21  ?  371  ASP C OD2   1 
ATOM   6158  N  N     . HIS C 2 372  ? -28.526 -9.741  41.014  1.00 62.86  ?  372  HIS C N     1 
ATOM   6159  C  CA    . HIS C 2 372  ? -29.872 -9.187  41.023  1.00 57.67  ?  372  HIS C CA    1 
ATOM   6160  C  C     . HIS C 2 372  ? -29.848 -7.767  41.575  1.00 55.94  ?  372  HIS C C     1 
ATOM   6161  O  O     . HIS C 2 372  ? -29.175 -7.482  42.570  1.00 56.44  ?  372  HIS C O     1 
ATOM   6162  C  CB    . HIS C 2 372  ? -30.787 -10.076 41.869  1.00 59.27  ?  372  HIS C CB    1 
ATOM   6163  C  CG    . HIS C 2 372  ? -32.245 -9.765  41.729  1.00 52.84  ?  372  HIS C CG    1 
ATOM   6164  N  ND1   . HIS C 2 372  ? -32.873 -8.790  42.472  1.00 59.41  ?  372  HIS C ND1   1 
ATOM   6165  C  CD2   . HIS C 2 372  ? -33.202 -10.316 40.945  1.00 50.08  ?  372  HIS C CD2   1 
ATOM   6166  C  CE1   . HIS C 2 372  ? -34.152 -8.745  42.144  1.00 61.27  ?  372  HIS C CE1   1 
ATOM   6167  N  NE2   . HIS C 2 372  ? -34.377 -9.661  41.220  1.00 59.89  ?  372  HIS C NE2   1 
ATOM   6168  N  N     . PHE C 2 373  ? -30.587 -6.866  40.922  1.00 51.83  ?  373  PHE C N     1 
ATOM   6169  C  CA    . PHE C 2 373  ? -30.578 -5.462  41.347  1.00 52.60  ?  373  PHE C CA    1 
ATOM   6170  C  C     . PHE C 2 373  ? -31.260 -5.232  42.697  1.00 53.53  ?  373  PHE C C     1 
ATOM   6171  O  O     . PHE C 2 373  ? -31.389 -4.070  43.106  1.00 56.30  ?  373  PHE C O     1 
ATOM   6172  C  CB    . PHE C 2 373  ? -31.225 -4.578  40.280  1.00 54.41  ?  373  PHE C CB    1 
ATOM   6173  C  CG    . PHE C 2 373  ? -30.233 -3.864  39.403  1.00 49.31  ?  373  PHE C CG    1 
ATOM   6174  C  CD1   . PHE C 2 373  ? -30.650 -2.899  38.501  1.00 41.56  ?  373  PHE C CD1   1 
ATOM   6175  C  CD2   . PHE C 2 373  ? -28.881 -4.160  39.481  1.00 47.57  ?  373  PHE C CD2   1 
ATOM   6176  C  CE1   . PHE C 2 373  ? -29.738 -2.241  37.696  1.00 37.30  ?  373  PHE C CE1   1 
ATOM   6177  C  CE2   . PHE C 2 373  ? -27.965 -3.507  38.678  1.00 42.28  ?  373  PHE C CE2   1 
ATOM   6178  C  CZ    . PHE C 2 373  ? -28.394 -2.546  37.784  1.00 40.63  ?  373  PHE C CZ    1 
ATOM   6179  N  N     . GLY C 2 374  ? -31.702 -6.284  43.382  1.00 54.50  ?  374  GLY C N     1 
ATOM   6180  C  CA    . GLY C 2 374  ? -32.194 -6.167  44.740  1.00 61.52  ?  374  GLY C CA    1 
ATOM   6181  C  C     . GLY C 2 374  ? -31.109 -6.519  45.735  1.00 58.97  ?  374  GLY C C     1 
ATOM   6182  O  O     . GLY C 2 374  ? -31.171 -6.132  46.905  1.00 53.98  ?  374  GLY C O     1 
ATOM   6183  N  N     . ASN C 2 375  ? -30.107 -7.268  45.272  1.00 50.99  ?  375  ASN C N     1 
ATOM   6184  C  CA    . ASN C 2 375  ? -28.918 -7.559  46.057  1.00 53.20  ?  375  ASN C CA    1 
ATOM   6185  C  C     . ASN C 2 375  ? -27.698 -6.774  45.600  1.00 51.44  ?  375  ASN C C     1 
ATOM   6186  O  O     . ASN C 2 375  ? -26.667 -6.811  46.280  1.00 51.80  ?  375  ASN C O     1 
ATOM   6187  C  CB    . ASN C 2 375  ? -28.600 -9.061  46.014  1.00 58.61  ?  375  ASN C CB    1 
ATOM   6188  C  CG    . ASN C 2 375  ? -29.740 -9.914  46.540  1.00 70.56  ?  375  ASN C CG    1 
ATOM   6189  O  OD1   . ASN C 2 375  ? -29.947 -10.017 47.749  1.00 72.47  ?  375  ASN C OD1   1 
ATOM   6190  N  ND2   . ASN C 2 375  ? -30.481 -10.537 45.631  1.00 68.41  ?  375  ASN C ND2   1 
ATOM   6191  N  N     . ARG C 2 376  ? -27.785 -6.075  44.471  1.00 55.09  ?  376  ARG C N     1 
ATOM   6192  C  CA    . ARG C 2 376  ? -26.730 -5.198  43.981  1.00 51.37  ?  376  ARG C CA    1 
ATOM   6193  C  C     . ARG C 2 376  ? -27.167 -3.759  44.224  1.00 45.80  ?  376  ARG C C     1 
ATOM   6194  O  O     . ARG C 2 376  ? -28.226 -3.341  43.742  1.00 42.87  ?  376  ARG C O     1 
ATOM   6195  C  CB    . ARG C 2 376  ? -26.461 -5.444  42.497  1.00 48.62  ?  376  ARG C CB    1 
ATOM   6196  C  CG    . ARG C 2 376  ? -25.264 -4.697  41.934  1.00 46.04  ?  376  ARG C CG    1 
ATOM   6197  C  CD    . ARG C 2 376  ? -24.115 -5.646  41.637  1.00 50.75  ?  376  ARG C CD    1 
ATOM   6198  N  NE    . ARG C 2 376  ? -23.113 -5.033  40.770  1.00 48.94  ?  376  ARG C NE    1 
ATOM   6199  C  CZ    . ARG C 2 376  ? -23.170 -5.044  39.442  1.00 48.87  ?  376  ARG C CZ    1 
ATOM   6200  N  NH1   . ARG C 2 376  ? -24.184 -5.637  38.826  1.00 40.27  ?  376  ARG C NH1   1 
ATOM   6201  N  NH2   . ARG C 2 376  ? -22.216 -4.462  38.730  1.00 48.13  ?  376  ARG C NH2   1 
ATOM   6202  N  N     . ARG C 2 377  ? -26.360 -3.010  44.966  1.00 47.96  ?  377  ARG C N     1 
ATOM   6203  C  CA    . ARG C 2 377  ? -26.746 -1.693  45.448  1.00 42.97  ?  377  ARG C CA    1 
ATOM   6204  C  C     . ARG C 2 377  ? -25.982 -0.598  44.713  1.00 39.66  ?  377  ARG C C     1 
ATOM   6205  O  O     . ARG C 2 377  ? -24.830 -0.780  44.309  1.00 39.99  ?  377  ARG C O     1 
ATOM   6206  C  CB    . ARG C 2 377  ? -26.505 -1.581  46.956  1.00 42.93  ?  377  ARG C CB    1 
ATOM   6207  C  CG    . ARG C 2 377  ? -27.088 -0.338  47.600  1.00 42.06  ?  377  ARG C CG    1 
ATOM   6208  C  CD    . ARG C 2 377  ? -26.930 -0.386  49.106  1.00 49.29  ?  377  ARG C CD    1 
ATOM   6209  N  NE    . ARG C 2 377  ? -27.117 0.928   49.709  1.00 50.79  ?  377  ARG C NE    1 
ATOM   6210  C  CZ    . ARG C 2 377  ? -26.146 1.822   49.855  1.00 47.32  ?  377  ARG C CZ    1 
ATOM   6211  N  NH1   . ARG C 2 377  ? -24.918 1.541   49.441  1.00 42.56  ?  377  ARG C NH1   1 
ATOM   6212  N  NH2   . ARG C 2 377  ? -26.402 2.997   50.414  1.00 51.27  ?  377  ARG C NH2   1 
ATOM   6213  N  N     . LEU C 2 378  ? -26.643 0.545   44.547  1.00 35.12  ?  378  LEU C N     1 
ATOM   6214  C  CA    . LEU C 2 378  ? -26.077 1.714   43.885  1.00 34.54  ?  378  LEU C CA    1 
ATOM   6215  C  C     . LEU C 2 378  ? -25.968 2.844   44.898  1.00 35.27  ?  378  LEU C C     1 
ATOM   6216  O  O     . LEU C 2 378  ? -26.983 3.285   45.448  1.00 42.26  ?  378  LEU C O     1 
ATOM   6217  C  CB    . LEU C 2 378  ? -26.943 2.140   42.698  1.00 30.91  ?  378  LEU C CB    1 
ATOM   6218  C  CG    . LEU C 2 378  ? -26.501 3.382   41.923  1.00 27.35  ?  378  LEU C CG    1 
ATOM   6219  C  CD1   . LEU C 2 378  ? -25.336 3.048   41.007  1.00 31.16  ?  378  LEU C CD1   1 
ATOM   6220  C  CD2   . LEU C 2 378  ? -27.662 3.972   41.137  1.00 25.66  ?  378  LEU C CD2   1 
ATOM   6221  N  N     . ARG C 2 379  ? -24.748 3.312   45.145  1.00 26.61  ?  379  ARG C N     1 
ATOM   6222  C  CA    . ARG C 2 379  ? -24.513 4.439   46.037  1.00 31.16  ?  379  ARG C CA    1 
ATOM   6223  C  C     . ARG C 2 379  ? -24.099 5.653   45.217  1.00 29.19  ?  379  ARG C C     1 
ATOM   6224  O  O     . ARG C 2 379  ? -23.174 5.574   44.401  1.00 27.28  ?  379  ARG C O     1 
ATOM   6225  C  CB    . ARG C 2 379  ? -23.461 4.106   47.098  1.00 33.47  ?  379  ARG C CB    1 
ATOM   6226  C  CG    . ARG C 2 379  ? -22.179 3.462   46.600  1.00 26.52  ?  379  ARG C CG    1 
ATOM   6227  C  CD    . ARG C 2 379  ? -21.303 3.107   47.795  1.00 32.91  ?  379  ARG C CD    1 
ATOM   6228  N  NE    . ARG C 2 379  ? -19.964 2.667   47.418  1.00 33.40  ?  379  ARG C NE    1 
ATOM   6229  C  CZ    . ARG C 2 379  ? -18.989 2.434   48.290  1.00 29.17  ?  379  ARG C CZ    1 
ATOM   6230  N  NH1   . ARG C 2 379  ? -19.206 2.601   49.588  1.00 20.00  ?  379  ARG C NH1   1 
ATOM   6231  N  NH2   . ARG C 2 379  ? -17.797 2.036   47.868  1.00 40.50  ?  379  ARG C NH2   1 
ATOM   6232  N  N     . THR C 2 380  ? -24.785 6.768   45.439  1.00 28.85  ?  380  THR C N     1 
ATOM   6233  C  CA    . THR C 2 380  ? -24.701 7.943   44.590  1.00 27.02  ?  380  THR C CA    1 
ATOM   6234  C  C     . THR C 2 380  ? -23.716 8.961   45.173  1.00 28.94  ?  380  THR C C     1 
ATOM   6235  O  O     . THR C 2 380  ? -22.808 8.605   45.932  1.00 24.81  ?  380  THR C O     1 
ATOM   6236  C  CB    . THR C 2 380  ? -26.108 8.523   44.406  1.00 27.88  ?  380  THR C CB    1 
ATOM   6237  O  OG1   . THR C 2 380  ? -26.741 8.656   45.685  1.00 30.47  ?  380  THR C OG1   1 
ATOM   6238  C  CG2   . THR C 2 380  ? -26.947 7.615   43.521  1.00 29.77  ?  380  THR C CG2   1 
ATOM   6239  N  N     . VAL C 2 381  ? -23.900 10.237  44.827  1.00 27.88  ?  381  VAL C N     1 
ATOM   6240  C  CA    . VAL C 2 381  ? -22.911 11.261  45.155  1.00 22.13  ?  381  VAL C CA    1 
ATOM   6241  C  C     . VAL C 2 381  ? -22.881 11.524  46.655  1.00 27.54  ?  381  VAL C C     1 
ATOM   6242  O  O     . VAL C 2 381  ? -21.810 11.575  47.270  1.00 30.11  ?  381  VAL C O     1 
ATOM   6243  C  CB    . VAL C 2 381  ? -23.198 12.550  44.366  1.00 21.74  ?  381  VAL C CB    1 
ATOM   6244  C  CG1   . VAL C 2 381  ? -22.081 13.561  44.572  1.00 21.50  ?  381  VAL C CG1   1 
ATOM   6245  C  CG2   . VAL C 2 381  ? -23.386 12.238  42.892  1.00 26.45  ?  381  VAL C CG2   1 
ATOM   6246  N  N     . GLY C 2 382  ? -24.056 11.701  47.264  1.00 26.52  ?  382  GLY C N     1 
ATOM   6247  C  CA    . GLY C 2 382  ? -24.104 12.066  48.672  1.00 28.57  ?  382  GLY C CA    1 
ATOM   6248  C  C     . GLY C 2 382  ? -23.456 11.035  49.577  1.00 33.20  ?  382  GLY C C     1 
ATOM   6249  O  O     . GLY C 2 382  ? -22.724 11.385  50.506  1.00 37.51  ?  382  GLY C O     1 
ATOM   6250  N  N     . GLU C 2 383  ? -23.713 9.751   49.318  1.00 25.90  ?  383  GLU C N     1 
ATOM   6251  C  CA    . GLU C 2 383  ? -23.126 8.703   50.147  1.00 23.95  ?  383  GLU C CA    1 
ATOM   6252  C  C     . GLU C 2 383  ? -21.621 8.605   49.930  1.00 26.13  ?  383  GLU C C     1 
ATOM   6253  O  O     . GLU C 2 383  ? -20.857 8.465   50.893  1.00 35.04  ?  383  GLU C O     1 
ATOM   6254  C  CB    . GLU C 2 383  ? -23.798 7.362   49.859  1.00 27.27  ?  383  GLU C CB    1 
ATOM   6255  C  CG    . GLU C 2 383  ? -23.186 6.197   50.620  1.00 29.85  ?  383  GLU C CG    1 
ATOM   6256  C  CD    . GLU C 2 383  ? -23.888 4.885   50.342  1.00 34.52  ?  383  GLU C CD    1 
ATOM   6257  O  OE1   . GLU C 2 383  ? -25.054 4.918   49.895  1.00 31.92  ?  383  GLU C OE1   1 
ATOM   6258  O  OE2   . GLU C 2 383  ? -23.272 3.821   50.560  1.00 36.38  ?  383  GLU C OE2   1 
ATOM   6259  N  N     . LEU C 2 384  ? -21.176 8.677   48.672  1.00 22.49  ?  384  LEU C N     1 
ATOM   6260  C  CA    . LEU C 2 384  ? -19.745 8.617   48.389  1.00 22.12  ?  384  LEU C CA    1 
ATOM   6261  C  C     . LEU C 2 384  ? -18.994 9.762   49.053  1.00 25.17  ?  384  LEU C C     1 
ATOM   6262  O  O     . LEU C 2 384  ? -17.827 9.603   49.429  1.00 27.87  ?  384  LEU C O     1 
ATOM   6263  C  CB    . LEU C 2 384  ? -19.506 8.626   46.879  1.00 26.27  ?  384  LEU C CB    1 
ATOM   6264  C  CG    . LEU C 2 384  ? -19.901 7.359   46.119  1.00 19.05  ?  384  LEU C CG    1 
ATOM   6265  C  CD1   . LEU C 2 384  ? -19.831 7.586   44.617  1.00 28.14  ?  384  LEU C CD1   1 
ATOM   6266  C  CD2   . LEU C 2 384  ? -19.019 6.191   46.527  1.00 16.52  ?  384  LEU C CD2   1 
ATOM   6267  N  N     . ILE C 2 385  ? -19.640 10.918  49.206  1.00 28.33  ?  385  ILE C N     1 
ATOM   6268  C  CA    . ILE C 2 385  ? -19.028 12.015  49.946  1.00 35.43  ?  385  ILE C CA    1 
ATOM   6269  C  C     . ILE C 2 385  ? -19.184 11.801  51.447  1.00 42.51  ?  385  ILE C C     1 
ATOM   6270  O  O     . ILE C 2 385  ? -18.273 12.106  52.225  1.00 43.21  ?  385  ILE C O     1 
ATOM   6271  C  CB    . ILE C 2 385  ? -19.628 13.361  49.498  1.00 32.98  ?  385  ILE C CB    1 
ATOM   6272  C  CG1   . ILE C 2 385  ? -19.439 13.559  47.994  1.00 28.56  ?  385  ILE C CG1   1 
ATOM   6273  C  CG2   . ILE C 2 385  ? -18.989 14.512  50.257  1.00 31.06  ?  385  ILE C CG2   1 
ATOM   6274  C  CD1   . ILE C 2 385  ? -20.120 14.800  47.458  1.00 20.50  ?  385  ILE C CD1   1 
ATOM   6275  N  N     . GLN C 2 386  ? -20.331 11.265  51.875  1.00 39.73  ?  386  GLN C N     1 
ATOM   6276  C  CA    . GLN C 2 386  ? -20.569 11.051  53.301  1.00 32.55  ?  386  GLN C CA    1 
ATOM   6277  C  C     . GLN C 2 386  ? -19.545 10.095  53.898  1.00 34.43  ?  386  GLN C C     1 
ATOM   6278  O  O     . GLN C 2 386  ? -19.051 10.318  55.010  1.00 41.60  ?  386  GLN C O     1 
ATOM   6279  C  CB    . GLN C 2 386  ? -21.985 10.521  53.525  1.00 28.95  ?  386  GLN C CB    1 
ATOM   6280  C  CG    . GLN C 2 386  ? -22.269 10.115  54.962  1.00 40.59  ?  386  GLN C CG    1 
ATOM   6281  C  CD    . GLN C 2 386  ? -23.656 9.532   55.145  1.00 43.47  ?  386  GLN C CD    1 
ATOM   6282  O  OE1   . GLN C 2 386  ? -24.592 10.235  55.525  1.00 38.37  ?  386  GLN C OE1   1 
ATOM   6283  N  NE2   . GLN C 2 386  ? -23.794 8.239   54.877  1.00 42.47  ?  386  GLN C NE2   1 
ATOM   6284  N  N     . ASN C 2 387  ? -19.216 9.022   53.175  1.00 30.30  ?  387  ASN C N     1 
ATOM   6285  C  CA    . ASN C 2 387  ? -18.236 8.065   53.677  1.00 37.67  ?  387  ASN C CA    1 
ATOM   6286  C  C     . ASN C 2 387  ? -16.868 8.713   53.846  1.00 38.67  ?  387  ASN C C     1 
ATOM   6287  O  O     . ASN C 2 387  ? -16.151 8.424   54.811  1.00 44.05  ?  387  ASN C O     1 
ATOM   6288  C  CB    . ASN C 2 387  ? -18.152 6.863   52.738  1.00 36.74  ?  387  ASN C CB    1 
ATOM   6289  C  CG    . ASN C 2 387  ? -19.466 6.117   52.633  1.00 44.99  ?  387  ASN C CG    1 
ATOM   6290  O  OD1   . ASN C 2 387  ? -20.517 6.633   53.014  1.00 46.37  ?  387  ASN C OD1   1 
ATOM   6291  N  ND2   . ASN C 2 387  ? -19.414 4.896   52.116  1.00 52.77  ?  387  ASN C ND2   1 
ATOM   6292  N  N     . GLN C 2 388  ? -16.489 9.597   52.920  1.00 37.04  ?  388  GLN C N     1 
ATOM   6293  C  CA    . GLN C 2 388  ? -15.217 10.299  53.053  1.00 39.55  ?  388  GLN C CA    1 
ATOM   6294  C  C     . GLN C 2 388  ? -15.259 11.305  54.195  1.00 41.05  ?  388  GLN C C     1 
ATOM   6295  O  O     . GLN C 2 388  ? -14.264 11.488  54.905  1.00 45.22  ?  388  GLN C O     1 
ATOM   6296  C  CB    . GLN C 2 388  ? -14.856 10.985  51.737  1.00 40.81  ?  388  GLN C CB    1 
ATOM   6297  C  CG    . GLN C 2 388  ? -14.414 10.020  50.654  1.00 38.51  ?  388  GLN C CG    1 
ATOM   6298  C  CD    . GLN C 2 388  ? -13.185 9.229   51.054  1.00 46.50  ?  388  GLN C CD    1 
ATOM   6299  O  OE1   . GLN C 2 388  ? -12.182 9.795   51.490  1.00 47.94  ?  388  GLN C OE1   1 
ATOM   6300  N  NE2   . GLN C 2 388  ? -13.259 7.910   50.918  1.00 51.98  ?  388  GLN C NE2   1 
ATOM   6301  N  N     . ILE C 2 389  ? -16.401 11.972  54.384  1.00 36.89  ?  389  ILE C N     1 
ATOM   6302  C  CA    . ILE C 2 389  ? -16.561 12.848  55.540  1.00 37.67  ?  389  ILE C CA    1 
ATOM   6303  C  C     . ILE C 2 389  ? -16.476 12.040  56.827  1.00 45.66  ?  389  ILE C C     1 
ATOM   6304  O  O     . ILE C 2 389  ? -15.819 12.448  57.793  1.00 47.21  ?  389  ILE C O     1 
ATOM   6305  C  CB    . ILE C 2 389  ? -17.889 13.623  55.448  1.00 31.57  ?  389  ILE C CB    1 
ATOM   6306  C  CG1   . ILE C 2 389  ? -17.905 14.520  54.212  1.00 46.03  ?  389  ILE C CG1   1 
ATOM   6307  C  CG2   . ILE C 2 389  ? -18.115 14.450  56.705  1.00 28.84  ?  389  ILE C CG2   1 
ATOM   6308  C  CD1   . ILE C 2 389  ? -19.259 15.122  53.932  1.00 39.35  ?  389  ILE C CD1   1 
ATOM   6309  N  N     . ARG C 2 390  ? -17.132 10.876  56.856  1.00 46.65  ?  390  ARG C N     1 
ATOM   6310  C  CA    . ARG C 2 390  ? -17.104 10.030  58.045  1.00 43.26  ?  390  ARG C CA    1 
ATOM   6311  C  C     . ARG C 2 390  ? -15.683 9.609   58.396  1.00 45.06  ?  390  ARG C C     1 
ATOM   6312  O  O     . ARG C 2 390  ? -15.291 9.636   59.568  1.00 56.77  ?  390  ARG C O     1 
ATOM   6313  C  CB    . ARG C 2 390  ? -17.992 8.803   57.834  1.00 39.66  ?  390  ARG C CB    1 
ATOM   6314  C  CG    . ARG C 2 390  ? -17.828 7.733   58.899  1.00 47.26  ?  390  ARG C CG    1 
ATOM   6315  C  CD    . ARG C 2 390  ? -18.780 6.564   58.689  1.00 61.23  ?  390  ARG C CD    1 
ATOM   6316  N  NE    . ARG C 2 390  ? -20.180 6.955   58.840  1.00 61.91  ?  390  ARG C NE    1 
ATOM   6317  C  CZ    . ARG C 2 390  ? -21.055 7.008   57.841  1.00 65.84  ?  390  ARG C CZ    1 
ATOM   6318  N  NH1   . ARG C 2 390  ? -20.681 6.687   56.610  1.00 58.61  ?  390  ARG C NH1   1 
ATOM   6319  N  NH2   . ARG C 2 390  ? -22.308 7.375   58.075  1.00 68.99  ?  390  ARG C NH2   1 
ATOM   6320  N  N     . VAL C 2 391  ? -14.894 9.218   57.392  1.00 42.45  ?  391  VAL C N     1 
ATOM   6321  C  CA    . VAL C 2 391  ? -13.505 8.843   57.644  1.00 43.43  ?  391  VAL C CA    1 
ATOM   6322  C  C     . VAL C 2 391  ? -12.710 10.049  58.129  1.00 48.34  ?  391  VAL C C     1 
ATOM   6323  O  O     . VAL C 2 391  ? -11.885 9.940   59.045  1.00 59.69  ?  391  VAL C O     1 
ATOM   6324  C  CB    . VAL C 2 391  ? -12.882 8.219   56.381  1.00 43.36  ?  391  VAL C CB    1 
ATOM   6325  C  CG1   . VAL C 2 391  ? -11.391 7.991   56.578  1.00 44.68  ?  391  VAL C CG1   1 
ATOM   6326  C  CG2   . VAL C 2 391  ? -13.579 6.911   56.041  1.00 43.42  ?  391  VAL C CG2   1 
ATOM   6327  N  N     . GLY C 2 392  ? -12.951 11.217  57.532  1.00 42.77  ?  392  GLY C N     1 
ATOM   6328  C  CA    . GLY C 2 392  ? -12.271 12.420  57.984  1.00 51.95  ?  392  GLY C CA    1 
ATOM   6329  C  C     . GLY C 2 392  ? -12.663 12.817  59.395  1.00 56.95  ?  392  GLY C C     1 
ATOM   6330  O  O     . GLY C 2 392  ? -11.837 13.324  60.159  1.00 62.11  ?  392  GLY C O     1 
ATOM   6331  N  N     . MET C 2 393  ? -13.927 12.591  59.762  1.00 52.18  ?  393  MET C N     1 
ATOM   6332  C  CA    . MET C 2 393  ? -14.365 12.886  61.122  1.00 48.59  ?  393  MET C CA    1 
ATOM   6333  C  C     . MET C 2 393  ? -13.721 11.939  62.128  1.00 50.93  ?  393  MET C C     1 
ATOM   6334  O  O     . MET C 2 393  ? -13.334 12.359  63.225  1.00 56.53  ?  393  MET C O     1 
ATOM   6335  C  CB    . MET C 2 393  ? -15.889 12.806  61.217  1.00 41.42  ?  393  MET C CB    1 
ATOM   6336  C  CG    . MET C 2 393  ? -16.640 13.884  60.450  1.00 41.62  ?  393  MET C CG    1 
ATOM   6337  S  SD    . MET C 2 393  ? -16.504 15.525  61.182  1.00 55.61  ?  393  MET C SD    1 
ATOM   6338  C  CE    . MET C 2 393  ? -17.697 16.429  60.199  1.00 33.70  ?  393  MET C CE    1 
ATOM   6339  N  N     . SER C 2 394  ? -13.600 10.656  61.773  1.00 55.90  ?  394  SER C N     1 
ATOM   6340  C  CA    . SER C 2 394  ? -13.026 9.683   62.698  1.00 59.30  ?  394  SER C CA    1 
ATOM   6341  C  C     . SER C 2 394  ? -11.558 9.972   62.980  1.00 69.26  ?  394  SER C C     1 
ATOM   6342  O  O     . SER C 2 394  ? -11.073 9.691   64.082  1.00 81.98  ?  394  SER C O     1 
ATOM   6343  C  CB    . SER C 2 394  ? -13.185 8.267   62.145  1.00 57.54  ?  394  SER C CB    1 
ATOM   6344  O  OG    . SER C 2 394  ? -12.247 8.015   61.112  1.00 58.36  ?  394  SER C OG    1 
ATOM   6345  N  N     . ARG C 2 395  ? -10.836 10.526  62.003  1.00 71.56  ?  395  ARG C N     1 
ATOM   6346  C  CA    . ARG C 2 395  ? -9.448  10.900  62.241  1.00 74.15  ?  395  ARG C CA    1 
ATOM   6347  C  C     . ARG C 2 395  ? -9.350  12.137  63.125  1.00 73.22  ?  395  ARG C C     1 
ATOM   6348  O  O     . ARG C 2 395  ? -8.391  12.274  63.892  1.00 76.57  ?  395  ARG C O     1 
ATOM   6349  C  CB    . ARG C 2 395  ? -8.729  11.127  60.912  1.00 78.79  ?  395  ARG C CB    1 
ATOM   6350  C  CG    . ARG C 2 395  ? -8.773  9.919   59.991  1.00 78.48  ?  395  ARG C CG    1 
ATOM   6351  C  CD    . ARG C 2 395  ? -7.856  10.083  58.791  1.00 79.39  ?  395  ARG C CD    1 
ATOM   6352  N  NE    . ARG C 2 395  ? -7.834  8.878   57.965  1.00 86.28  ?  395  ARG C NE    1 
ATOM   6353  C  CZ    . ARG C 2 395  ? -7.085  7.811   58.222  1.00 95.96  ?  395  ARG C CZ    1 
ATOM   6354  N  NH1   . ARG C 2 395  ? -6.294  7.793   59.286  1.00 91.46  ?  395  ARG C NH1   1 
ATOM   6355  N  NH2   . ARG C 2 395  ? -7.129  6.758   57.417  1.00 101.21 ?  395  ARG C NH2   1 
ATOM   6356  N  N     . MET C 2 396  ? -10.328 13.041  63.033  1.00 59.80  ?  396  MET C N     1 
ATOM   6357  C  CA    . MET C 2 396  ? -10.374 14.173  63.952  1.00 60.99  ?  396  MET C CA    1 
ATOM   6358  C  C     . MET C 2 396  ? -10.802 13.739  65.347  1.00 69.84  ?  396  MET C C     1 
ATOM   6359  O  O     . MET C 2 396  ? -10.359 14.326  66.341  1.00 73.03  ?  396  MET C O     1 
ATOM   6360  C  CB    . MET C 2 396  ? -11.321 15.247  63.417  1.00 63.09  ?  396  MET C CB    1 
ATOM   6361  C  CG    . MET C 2 396  ? -11.486 16.445  64.338  1.00 63.53  ?  396  MET C CG    1 
ATOM   6362  S  SD    . MET C 2 396  ? -12.769 17.578  63.781  1.00 73.43  ?  396  MET C SD    1 
ATOM   6363  C  CE    . MET C 2 396  ? -14.194 16.494  63.783  1.00 66.38  ?  396  MET C CE    1 
ATOM   6364  N  N     . GLU C 2 397  ? -11.658 12.717  65.439  1.00 84.04  ?  397  GLU C N     1 
ATOM   6365  C  CA    . GLU C 2 397  ? -12.090 12.220  66.742  1.00 84.51  ?  397  GLU C CA    1 
ATOM   6366  C  C     . GLU C 2 397  ? -10.904 11.741  67.570  1.00 84.14  ?  397  GLU C C     1 
ATOM   6367  O  O     . GLU C 2 397  ? -10.859 11.956  68.787  1.00 88.70  ?  397  GLU C O     1 
ATOM   6368  C  CB    . GLU C 2 397  ? -13.111 11.096  66.561  1.00 83.28  ?  397  GLU C CB    1 
ATOM   6369  C  CG    . GLU C 2 397  ? -13.527 10.418  67.858  1.00 95.47  ?  397  GLU C CG    1 
ATOM   6370  C  CD    . GLU C 2 397  ? -14.452 9.237   67.631  1.00 99.82  ?  397  GLU C CD    1 
ATOM   6371  O  OE1   . GLU C 2 397  ? -15.592 9.264   68.141  1.00 97.51  ?  397  GLU C OE1   1 
ATOM   6372  O  OE2   . GLU C 2 397  ? -14.039 8.283   66.939  1.00 96.03  ?  397  GLU C OE2   1 
ATOM   6373  N  N     . ARG C 2 398  ? -9.930  11.092  66.926  1.00 88.60  ?  398  ARG C N     1 
ATOM   6374  C  CA    . ARG C 2 398  ? -8.717  10.700  67.634  1.00 86.30  ?  398  ARG C CA    1 
ATOM   6375  C  C     . ARG C 2 398  ? -7.908  11.915  68.066  1.00 96.23  ?  398  ARG C C     1 
ATOM   6376  O  O     . ARG C 2 398  ? -7.272  11.890  69.127  1.00 103.92 ?  398  ARG C O     1 
ATOM   6377  C  CB    . ARG C 2 398  ? -7.870  9.780   66.755  1.00 91.79  ?  398  ARG C CB    1 
ATOM   6378  C  CG    . ARG C 2 398  ? -6.641  9.224   67.450  1.00 105.58 ?  398  ARG C CG    1 
ATOM   6379  C  CD    . ARG C 2 398  ? -5.864  8.304   66.530  1.00 115.38 ?  398  ARG C CD    1 
ATOM   6380  N  NE    . ARG C 2 398  ? -4.754  7.654   67.219  1.00 124.90 ?  398  ARG C NE    1 
ATOM   6381  C  CZ    . ARG C 2 398  ? -3.948  6.763   66.654  1.00 120.54 ?  398  ARG C CZ    1 
ATOM   6382  N  NH1   . ARG C 2 398  ? -4.128  6.417   65.387  1.00 123.55 ?  398  ARG C NH1   1 
ATOM   6383  N  NH2   . ARG C 2 398  ? -2.962  6.219   67.352  1.00 103.97 ?  398  ARG C NH2   1 
ATOM   6384  N  N     . VAL C 2 399  ? -7.917  12.981  67.262  1.00 88.35  ?  399  VAL C N     1 
ATOM   6385  C  CA    . VAL C 2 399  ? -7.260  14.221  67.664  1.00 84.47  ?  399  VAL C CA    1 
ATOM   6386  C  C     . VAL C 2 399  ? -7.951  14.813  68.886  1.00 91.83  ?  399  VAL C C     1 
ATOM   6387  O  O     . VAL C 2 399  ? -7.302  15.373  69.777  1.00 99.83  ?  399  VAL C O     1 
ATOM   6388  C  CB    . VAL C 2 399  ? -7.231  15.216  66.487  1.00 90.30  ?  399  VAL C CB    1 
ATOM   6389  C  CG1   . VAL C 2 399  ? -6.716  16.574  66.940  1.00 88.49  ?  399  VAL C CG1   1 
ATOM   6390  C  CG2   . VAL C 2 399  ? -6.377  14.670  65.354  1.00 94.46  ?  399  VAL C CG2   1 
ATOM   6391  N  N     . VAL C 2 400  ? -9.278  14.683  68.953  1.00 92.12  ?  400  VAL C N     1 
ATOM   6392  C  CA    . VAL C 2 400  ? -10.024 15.220  70.087  1.00 92.68  ?  400  VAL C CA    1 
ATOM   6393  C  C     . VAL C 2 400  ? -9.642  14.495  71.372  1.00 97.01  ?  400  VAL C C     1 
ATOM   6394  O  O     . VAL C 2 400  ? -9.249  15.124  72.362  1.00 103.33 ?  400  VAL C O     1 
ATOM   6395  C  CB    . VAL C 2 400  ? -11.538 15.134  69.822  1.00 89.67  ?  400  VAL C CB    1 
ATOM   6396  C  CG1   . VAL C 2 400  ? -12.311 15.395  71.104  1.00 88.18  ?  400  VAL C CG1   1 
ATOM   6397  C  CG2   . VAL C 2 400  ? -11.941 16.124  68.741  1.00 92.79  ?  400  VAL C CG2   1 
ATOM   6398  N  N     . ARG C 2 401  ? -9.748  13.162  71.376  1.00 91.94  ?  401  ARG C N     1 
ATOM   6399  C  CA    . ARG C 2 401  ? -9.445  12.396  72.582  1.00 91.73  ?  401  ARG C CA    1 
ATOM   6400  C  C     . ARG C 2 401  ? -8.011  12.614  73.048  1.00 100.79 ?  401  ARG C C     1 
ATOM   6401  O  O     . ARG C 2 401  ? -7.740  12.584  74.254  1.00 108.45 ?  401  ARG C O     1 
ATOM   6402  C  CB    . ARG C 2 401  ? -9.699  10.907  72.342  1.00 84.34  ?  401  ARG C CB    1 
ATOM   6403  C  CG    . ARG C 2 401  ? -11.162 10.551  72.154  1.00 79.14  ?  401  ARG C CG    1 
ATOM   6404  C  CD    . ARG C 2 401  ? -11.348 9.067   71.880  1.00 80.11  ?  401  ARG C CD    1 
ATOM   6405  N  NE    . ARG C 2 401  ? -12.744 8.735   71.608  1.00 91.35  ?  401  ARG C NE    1 
ATOM   6406  C  CZ    . ARG C 2 401  ? -13.174 7.521   71.279  1.00 98.00  ?  401  ARG C CZ    1 
ATOM   6407  N  NH1   . ARG C 2 401  ? -12.315 6.515   71.181  1.00 96.65  ?  401  ARG C NH1   1 
ATOM   6408  N  NH2   . ARG C 2 401  ? -14.462 7.312   71.048  1.00 96.60  ?  401  ARG C NH2   1 
ATOM   6409  N  N     . GLU C 2 402  ? -7.083  12.837  72.115  1.00 108.88 ?  402  GLU C N     1 
ATOM   6410  C  CA    . GLU C 2 402  ? -5.697  13.070  72.506  1.00 111.58 ?  402  GLU C CA    1 
ATOM   6411  C  C     . GLU C 2 402  ? -5.508  14.477  73.059  1.00 108.72 ?  402  GLU C C     1 
ATOM   6412  O  O     . GLU C 2 402  ? -4.761  14.676  74.024  1.00 109.84 ?  402  GLU C O     1 
ATOM   6413  C  CB    . GLU C 2 402  ? -4.771  12.825  71.316  1.00 117.13 ?  402  GLU C CB    1 
ATOM   6414  C  CG    . GLU C 2 402  ? -3.288  13.009  71.617  1.00 127.38 ?  402  GLU C CG    1 
ATOM   6415  C  CD    . GLU C 2 402  ? -2.681  11.845  72.384  1.00 131.03 ?  402  GLU C CD    1 
ATOM   6416  O  OE1   . GLU C 2 402  ? -3.428  10.929  72.793  1.00 127.75 ?  402  GLU C OE1   1 
ATOM   6417  O  OE2   . GLU C 2 402  ? -1.447  11.844  72.571  1.00 127.83 ?  402  GLU C OE2   1 
ATOM   6418  N  N     . ARG C 2 403  ? -6.186  15.466  72.471  1.00 110.21 ?  403  ARG C N     1 
ATOM   6419  C  CA    . ARG C 2 403  ? -6.075  16.840  72.944  1.00 114.91 ?  403  ARG C CA    1 
ATOM   6420  C  C     . ARG C 2 403  ? -6.841  17.085  74.237  1.00 118.69 ?  403  ARG C C     1 
ATOM   6421  O  O     . ARG C 2 403  ? -6.588  18.092  74.906  1.00 122.47 ?  403  ARG C O     1 
ATOM   6422  C  CB    . ARG C 2 403  ? -6.558  17.811  71.863  1.00 119.34 ?  403  ARG C CB    1 
ATOM   6423  C  CG    . ARG C 2 403  ? -5.614  17.938  70.676  1.00 112.40 ?  403  ARG C CG    1 
ATOM   6424  C  CD    . ARG C 2 403  ? -6.037  19.061  69.745  1.00 104.54 ?  403  ARG C CD    1 
ATOM   6425  N  NE    . ARG C 2 403  ? -5.110  19.222  68.629  1.00 96.61  ?  403  ARG C NE    1 
ATOM   6426  C  CZ    . ARG C 2 403  ? -5.172  20.211  67.743  1.00 97.05  ?  403  ARG C CZ    1 
ATOM   6427  N  NH1   . ARG C 2 403  ? -6.118  21.134  67.843  1.00 94.34  ?  403  ARG C NH1   1 
ATOM   6428  N  NH2   . ARG C 2 403  ? -4.286  20.279  66.759  1.00 91.01  ?  403  ARG C NH2   1 
ATOM   6429  N  N     . MET C 2 404  ? -7.764  16.195  74.606  1.00 118.98 ?  404  MET C N     1 
ATOM   6430  C  CA    . MET C 2 404  ? -8.480  16.352  75.868  1.00 124.19 ?  404  MET C CA    1 
ATOM   6431  C  C     . MET C 2 404  ? -7.601  15.973  77.054  1.00 124.42 ?  404  MET C C     1 
ATOM   6432  O  O     . MET C 2 404  ? -7.507  16.723  78.032  1.00 125.50 ?  404  MET C O     1 
ATOM   6433  C  CB    . MET C 2 404  ? -9.757  15.508  75.866  1.00 119.34 ?  404  MET C CB    1 
ATOM   6434  C  CG    . MET C 2 404  ? -10.841 15.988  74.917  1.00 117.34 ?  404  MET C CG    1 
ATOM   6435  S  SD    . MET C 2 404  ? -12.399 15.110  75.164  1.00 124.88 ?  404  MET C SD    1 
ATOM   6436  C  CE    . MET C 2 404  ? -11.829 13.412  75.222  1.00 116.65 ?  404  MET C CE    1 
ATOM   6437  N  N     . THR C 2 405  ? -6.950  14.813  76.982  1.00 110.44 ?  405  THR C N     1 
ATOM   6438  C  CA    . THR C 2 405  ? -6.153  14.296  78.088  1.00 108.69 ?  405  THR C CA    1 
ATOM   6439  C  C     . THR C 2 405  ? -4.818  15.012  78.256  1.00 108.67 ?  405  THR C C     1 
ATOM   6440  O  O     . THR C 2 405  ? -4.098  14.720  79.218  1.00 113.51 ?  405  THR C O     1 
ATOM   6441  C  CB    . THR C 2 405  ? -5.907  12.795  77.903  1.00 104.58 ?  405  THR C CB    1 
ATOM   6442  O  OG1   . THR C 2 405  ? -5.191  12.572  76.682  1.00 105.80 ?  405  THR C OG1   1 
ATOM   6443  C  CG2   . THR C 2 405  ? -7.230  12.042  77.852  1.00 111.96 ?  405  THR C CG2   1 
ATOM   6444  N  N     . THR C 2 406  ? -4.467  15.932  77.358  1.00 112.89 ?  406  THR C N     1 
ATOM   6445  C  CA    . THR C 2 406  ? -3.230  16.697  77.460  1.00 111.75 ?  406  THR C CA    1 
ATOM   6446  C  C     . THR C 2 406  ? -3.456  18.097  78.020  1.00 120.85 ?  406  THR C C     1 
ATOM   6447  O  O     . THR C 2 406  ? -2.742  18.525  78.931  1.00 127.48 ?  406  THR C O     1 
ATOM   6448  C  CB    . THR C 2 406  ? -2.549  16.788  76.087  1.00 109.10 ?  406  THR C CB    1 
ATOM   6449  O  OG1   . THR C 2 406  ? -2.148  15.479  75.662  1.00 108.85 ?  406  THR C OG1   1 
ATOM   6450  C  CG2   . THR C 2 406  ? -1.326  17.691  76.152  1.00 105.95 ?  406  THR C CG2   1 
ATOM   6451  N  N     . GLN C 2 407  ? -4.445  18.816  77.496  1.00 121.35 ?  407  GLN C N     1 
ATOM   6452  C  CA    . GLN C 2 407  ? -4.745  20.163  77.950  1.00 122.49 ?  407  GLN C CA    1 
ATOM   6453  C  C     . GLN C 2 407  ? -5.465  20.126  79.299  1.00 124.96 ?  407  GLN C C     1 
ATOM   6454  O  O     . GLN C 2 407  ? -5.893  19.074  79.780  1.00 120.36 ?  407  GLN C O     1 
ATOM   6455  C  CB    . GLN C 2 407  ? -5.591  20.894  76.909  1.00 122.55 ?  407  GLN C CB    1 
ATOM   6456  C  CG    . GLN C 2 407  ? -4.987  20.882  75.514  1.00 119.57 ?  407  GLN C CG    1 
ATOM   6457  C  CD    . GLN C 2 407  ? -5.987  21.261  74.439  1.00 119.54 ?  407  GLN C CD    1 
ATOM   6458  O  OE1   . GLN C 2 407  ? -7.145  21.561  74.730  1.00 121.48 ?  407  GLN C OE1   1 
ATOM   6459  N  NE2   . GLN C 2 407  ? -5.545  21.243  73.187  1.00 110.21 ?  407  GLN C NE2   1 
ATOM   6460  N  N     . ASP C 2 408  ? -5.594  21.300  79.913  1.00 128.82 ?  408  ASP C N     1 
ATOM   6461  C  CA    . ASP C 2 408  ? -6.284  21.403  81.188  1.00 126.60 ?  408  ASP C CA    1 
ATOM   6462  C  C     . ASP C 2 408  ? -7.792  21.289  80.988  1.00 124.28 ?  408  ASP C C     1 
ATOM   6463  O  O     . ASP C 2 408  ? -8.317  21.480  79.889  1.00 128.41 ?  408  ASP C O     1 
ATOM   6464  C  CB    . ASP C 2 408  ? -5.944  22.720  81.887  1.00 124.71 ?  408  ASP C CB    1 
ATOM   6465  C  CG    . ASP C 2 408  ? -6.502  23.926  81.161  1.00 124.64 ?  408  ASP C CG    1 
ATOM   6466  O  OD1   . ASP C 2 408  ? -6.426  23.960  79.915  1.00 127.99 ?  408  ASP C OD1   1 
ATOM   6467  O  OD2   . ASP C 2 408  ? -7.023  24.837  81.839  1.00 118.68 ?  408  ASP C OD2   1 
ATOM   6468  N  N     . VAL C 2 409  ? -8.493  20.983  82.078  1.00 116.64 ?  409  VAL C N     1 
ATOM   6469  C  CA    . VAL C 2 409  ? -9.922  20.694  82.009  1.00 114.36 ?  409  VAL C CA    1 
ATOM   6470  C  C     . VAL C 2 409  ? -10.729 21.932  82.381  1.00 112.81 ?  409  VAL C C     1 
ATOM   6471  O  O     . VAL C 2 409  ? -11.864 21.826  82.860  1.00 108.36 ?  409  VAL C O     1 
ATOM   6472  C  CB    . VAL C 2 409  ? -10.285 19.503  82.916  1.00 110.27 ?  409  VAL C CB    1 
ATOM   6473  C  CG1   . VAL C 2 409  ? -11.441 18.713  82.321  1.00 111.77 ?  409  VAL C CG1   1 
ATOM   6474  C  CG2   . VAL C 2 409  ? -9.074  18.608  83.127  1.00 103.72 ?  409  VAL C CG2   1 
ATOM   6475  N  N     . GLU C 2 410  ? -10.154 23.115  82.162  1.00 115.68 ?  410  GLU C N     1 
ATOM   6476  C  CA    . GLU C 2 410  ? -10.871 24.362  82.421  1.00 123.29 ?  410  GLU C CA    1 
ATOM   6477  C  C     . GLU C 2 410  ? -10.644 25.448  81.383  1.00 121.94 ?  410  GLU C C     1 
ATOM   6478  O  O     . GLU C 2 410  ? -11.470 26.364  81.298  1.00 119.54 ?  410  GLU C O     1 
ATOM   6479  C  CB    . GLU C 2 410  ? -10.508 24.918  83.803  1.00 131.21 ?  410  GLU C CB    1 
ATOM   6480  C  CG    . GLU C 2 410  ? -11.443 24.461  84.911  1.00 133.08 ?  410  GLU C CG    1 
ATOM   6481  C  CD    . GLU C 2 410  ? -12.903 24.680  84.562  1.00 137.34 ?  410  GLU C CD    1 
ATOM   6482  O  OE1   . GLU C 2 410  ? -13.673 23.696  84.574  1.00 132.43 ?  410  GLU C OE1   1 
ATOM   6483  O  OE2   . GLU C 2 410  ? -13.280 25.834  84.266  1.00 139.91 ?  410  GLU C OE2   1 
ATOM   6484  N  N     . ALA C 2 411  ? -9.571  25.402  80.597  1.00 131.62 ?  411  ALA C N     1 
ATOM   6485  C  CA    . ALA C 2 411  ? -9.368  26.335  79.499  1.00 135.62 ?  411  ALA C CA    1 
ATOM   6486  C  C     . ALA C 2 411  ? -9.688  25.713  78.147  1.00 136.42 ?  411  ALA C C     1 
ATOM   6487  O  O     . ALA C 2 411  ? -9.323  26.279  77.112  1.00 125.51 ?  411  ALA C O     1 
ATOM   6488  C  CB    . ALA C 2 411  ? -7.932  26.864  79.508  1.00 127.77 ?  411  ALA C CB    1 
ATOM   6489  N  N     . ILE C 2 412  ? -10.360 24.566  78.134  1.00 128.77 ?  412  ILE C N     1 
ATOM   6490  C  CA    . ILE C 2 412  ? -10.682 23.877  76.891  1.00 113.58 ?  412  ILE C CA    1 
ATOM   6491  C  C     . ILE C 2 412  ? -11.936 24.489  76.283  1.00 118.19 ?  412  ILE C C     1 
ATOM   6492  O  O     . ILE C 2 412  ? -12.955 24.664  76.963  1.00 117.02 ?  412  ILE C O     1 
ATOM   6493  C  CB    . ILE C 2 412  ? -10.860 22.368  77.133  1.00 108.31 ?  412  ILE C CB    1 
ATOM   6494  C  CG1   . ILE C 2 412  ? -9.517  21.647  77.006  1.00 109.49 ?  412  ILE C CG1   1 
ATOM   6495  C  CG2   . ILE C 2 412  ? -11.873 21.775  76.164  1.00 118.16 ?  412  ILE C CG2   1 
ATOM   6496  C  CD1   . ILE C 2 412  ? -9.611  20.147  77.189  1.00 112.99 ?  412  ILE C CD1   1 
ATOM   6497  N  N     . THR C 2 413  ? -11.857 24.826  75.004  1.00 117.36 ?  413  THR C N     1 
ATOM   6498  C  CA    . THR C 2 413  ? -12.984 25.252  74.195  1.00 116.10 ?  413  THR C CA    1 
ATOM   6499  C  C     . THR C 2 413  ? -13.108 24.319  72.998  1.00 115.16 ?  413  THR C C     1 
ATOM   6500  O  O     . THR C 2 413  ? -12.154 23.611  72.655  1.00 108.65 ?  413  THR C O     1 
ATOM   6501  C  CB    . THR C 2 413  ? -12.809 26.700  73.711  1.00 108.48 ?  413  THR C CB    1 
ATOM   6502  O  OG1   . THR C 2 413  ? -11.653 26.788  72.868  1.00 106.93 ?  413  THR C OG1   1 
ATOM   6503  C  CG2   . THR C 2 413  ? -12.642 27.643  74.893  1.00 110.60 ?  413  THR C CG2   1 
ATOM   6504  N  N     . PRO C 2 414  ? -14.277 24.269  72.354  1.00 105.10 ?  414  PRO C N     1 
ATOM   6505  C  CA    . PRO C 2 414  ? -14.381 23.489  71.109  1.00 100.07 ?  414  PRO C CA    1 
ATOM   6506  C  C     . PRO C 2 414  ? -13.364 23.892  70.054  1.00 96.64  ?  414  PRO C C     1 
ATOM   6507  O  O     . PRO C 2 414  ? -12.989 23.058  69.221  1.00 97.33  ?  414  PRO C O     1 
ATOM   6508  C  CB    . PRO C 2 414  ? -15.818 23.767  70.651  1.00 100.22 ?  414  PRO C CB    1 
ATOM   6509  C  CG    . PRO C 2 414  ? -16.560 24.005  71.920  1.00 92.18  ?  414  PRO C CG    1 
ATOM   6510  C  CD    . PRO C 2 414  ? -15.597 24.716  72.835  1.00 98.46  ?  414  PRO C CD    1 
ATOM   6511  N  N     . GLN C 2 415  ? -12.895 25.143  70.070  1.00 95.95  ?  415  GLN C N     1 
ATOM   6512  C  CA    . GLN C 2 415  ? -11.880 25.566  69.110  1.00 95.61  ?  415  GLN C CA    1 
ATOM   6513  C  C     . GLN C 2 415  ? -10.541 24.883  69.361  1.00 96.31  ?  415  GLN C C     1 
ATOM   6514  O  O     . GLN C 2 415  ? -9.787  24.634  68.413  1.00 104.97 ?  415  GLN C O     1 
ATOM   6515  C  CB    . GLN C 2 415  ? -11.709 27.085  69.159  1.00 95.95  ?  415  GLN C CB    1 
ATOM   6516  C  CG    . GLN C 2 415  ? -12.941 27.876  68.748  1.00 101.86 ?  415  GLN C CG    1 
ATOM   6517  C  CD    . GLN C 2 415  ? -13.109 27.973  67.244  1.00 99.84  ?  415  GLN C CD    1 
ATOM   6518  O  OE1   . GLN C 2 415  ? -12.299 27.447  66.480  1.00 92.21  ?  415  GLN C OE1   1 
ATOM   6519  N  NE2   . GLN C 2 415  ? -14.163 28.654  66.810  1.00 97.20  ?  415  GLN C NE2   1 
ATOM   6520  N  N     . THR C 2 416  ? -10.228 24.573  70.621  1.00 93.00  ?  416  THR C N     1 
ATOM   6521  C  CA    . THR C 2 416  ? -8.936  23.976  70.943  1.00 96.59  ?  416  THR C CA    1 
ATOM   6522  C  C     . THR C 2 416  ? -8.912  22.475  70.685  1.00 93.89  ?  416  THR C C     1 
ATOM   6523  O  O     . THR C 2 416  ? -7.849  21.921  70.384  1.00 97.65  ?  416  THR C O     1 
ATOM   6524  C  CB    . THR C 2 416  ? -8.576  24.257  72.402  1.00 97.90  ?  416  THR C CB    1 
ATOM   6525  O  OG1   . THR C 2 416  ? -9.567  23.679  73.261  1.00 102.78 ?  416  THR C OG1   1 
ATOM   6526  C  CG2   . THR C 2 416  ? -8.507  25.755  72.654  1.00 92.39  ?  416  THR C CG2   1 
ATOM   6527  N  N     . LEU C 2 417  ? -10.059 21.805  70.796  1.00 93.55  ?  417  LEU C N     1 
ATOM   6528  C  CA    . LEU C 2 417  ? -10.111 20.361  70.607  1.00 99.00  ?  417  LEU C CA    1 
ATOM   6529  C  C     . LEU C 2 417  ? -10.206 19.957  69.143  1.00 100.12 ?  417  LEU C C     1 
ATOM   6530  O  O     . LEU C 2 417  ? -9.944  18.794  68.818  1.00 97.16  ?  417  LEU C O     1 
ATOM   6531  C  CB    . LEU C 2 417  ? -11.305 19.773  71.360  1.00 105.12 ?  417  LEU C CB    1 
ATOM   6532  C  CG    . LEU C 2 417  ? -11.406 20.036  72.860  1.00 102.99 ?  417  LEU C CG    1 
ATOM   6533  C  CD1   . LEU C 2 417  ? -12.729 19.508  73.383  1.00 103.81 ?  417  LEU C CD1   1 
ATOM   6534  C  CD2   . LEU C 2 417  ? -10.242 19.396  73.597  1.00 104.60 ?  417  LEU C CD2   1 
ATOM   6535  N  N     . ILE C 2 418  ? -10.570 20.881  68.260  1.00 101.56 ?  418  ILE C N     1 
ATOM   6536  C  CA    . ILE C 2 418  ? -10.915 20.560  66.881  1.00 89.56  ?  418  ILE C CA    1 
ATOM   6537  C  C     . ILE C 2 418  ? -9.759  20.952  65.972  1.00 85.67  ?  418  ILE C C     1 
ATOM   6538  O  O     . ILE C 2 418  ? -9.380  22.127  65.901  1.00 80.13  ?  418  ILE C O     1 
ATOM   6539  C  CB    . ILE C 2 418  ? -12.217 21.257  66.461  1.00 86.48  ?  418  ILE C CB    1 
ATOM   6540  C  CG1   . ILE C 2 418  ? -13.404 20.620  67.186  1.00 86.88  ?  418  ILE C CG1   1 
ATOM   6541  C  CG2   . ILE C 2 418  ? -12.398 21.192  64.954  1.00 87.75  ?  418  ILE C CG2   1 
ATOM   6542  C  CD1   . ILE C 2 418  ? -14.699 21.366  67.019  1.00 84.70  ?  418  ILE C CD1   1 
ATOM   6543  N  N     . ASN C 2 419  ? -9.202  19.963  65.278  1.00 80.53  ?  419  ASN C N     1 
ATOM   6544  C  CA    . ASN C 2 419  ? -8.171  20.166  64.263  1.00 78.71  ?  419  ASN C CA    1 
ATOM   6545  C  C     . ASN C 2 419  ? -8.750  19.670  62.942  1.00 78.78  ?  419  ASN C C     1 
ATOM   6546  O  O     . ASN C 2 419  ? -8.847  18.460  62.713  1.00 79.41  ?  419  ASN C O     1 
ATOM   6547  C  CB    . ASN C 2 419  ? -6.882  19.436  64.633  1.00 81.78  ?  419  ASN C CB    1 
ATOM   6548  C  CG    . ASN C 2 419  ? -5.759  19.702  63.651  1.00 80.31  ?  419  ASN C CG    1 
ATOM   6549  O  OD1   . ASN C 2 419  ? -5.337  18.810  62.916  1.00 77.61  ?  419  ASN C OD1   1 
ATOM   6550  N  ND2   . ASN C 2 419  ? -5.272  20.938  63.631  1.00 82.51  ?  419  ASN C ND2   1 
ATOM   6551  N  N     . ILE C 2 420  ? -9.141  20.611  62.075  1.00 75.24  ?  420  ILE C N     1 
ATOM   6552  C  CA    . ILE C 2 420  ? -9.861  20.271  60.848  1.00 67.99  ?  420  ILE C CA    1 
ATOM   6553  C  C     . ILE C 2 420  ? -8.949  19.847  59.711  1.00 62.26  ?  420  ILE C C     1 
ATOM   6554  O  O     . ILE C 2 420  ? -9.437  19.629  58.594  1.00 56.62  ?  420  ILE C O     1 
ATOM   6555  C  CB    . ILE C 2 420  ? -10.721 21.460  60.376  1.00 58.23  ?  420  ILE C CB    1 
ATOM   6556  C  CG1   . ILE C 2 420  ? -9.834  22.667  60.066  1.00 55.91  ?  420  ILE C CG1   1 
ATOM   6557  C  CG2   . ILE C 2 420  ? -11.763 21.812  61.426  1.00 54.52  ?  420  ILE C CG2   1 
ATOM   6558  C  CD1   . ILE C 2 420  ? -10.600 23.894  59.619  1.00 54.87  ?  420  ILE C CD1   1 
ATOM   6559  N  N     . ARG C 2 421  ? -7.643  19.726  59.952  1.00 66.94  ?  421  ARG C N     1 
ATOM   6560  C  CA    . ARG C 2 421  ? -6.729  19.318  58.887  1.00 62.60  ?  421  ARG C CA    1 
ATOM   6561  C  C     . ARG C 2 421  ? -7.052  17.938  58.325  1.00 67.81  ?  421  ARG C C     1 
ATOM   6562  O  O     . ARG C 2 421  ? -7.097  17.799  57.090  1.00 72.60  ?  421  ARG C O     1 
ATOM   6563  C  CB    . ARG C 2 421  ? -5.281  19.403  59.388  1.00 67.90  ?  421  ARG C CB    1 
ATOM   6564  C  CG    . ARG C 2 421  ? -4.281  18.628  58.540  1.00 83.02  ?  421  ARG C CG    1 
ATOM   6565  C  CD    . ARG C 2 421  ? -2.839  18.968  58.901  1.00 92.94  ?  421  ARG C CD    1 
ATOM   6566  N  NE    . ARG C 2 421  ? -2.580  18.880  60.336  1.00 99.80  ?  421  ARG C NE    1 
ATOM   6567  C  CZ    . ARG C 2 421  ? -2.407  19.932  61.130  1.00 93.71  ?  421  ARG C CZ    1 
ATOM   6568  N  NH1   . ARG C 2 421  ? -2.460  21.159  60.629  1.00 88.99  ?  421  ARG C NH1   1 
ATOM   6569  N  NH2   . ARG C 2 421  ? -2.178  19.759  62.425  1.00 89.17  ?  421  ARG C NH2   1 
ATOM   6570  N  N     . PRO C 2 422  ? -7.286  16.892  59.130  1.00 66.69  ?  422  PRO C N     1 
ATOM   6571  C  CA    . PRO C 2 422  ? -7.662  15.596  58.540  1.00 65.39  ?  422  PRO C CA    1 
ATOM   6572  C  C     . PRO C 2 422  ? -9.043  15.584  57.905  1.00 64.64  ?  422  PRO C C     1 
ATOM   6573  O  O     . PRO C 2 422  ? -9.353  14.638  57.169  1.00 62.75  ?  422  PRO C O     1 
ATOM   6574  C  CB    . PRO C 2 422  ? -7.600  14.631  59.734  1.00 65.35  ?  422  PRO C CB    1 
ATOM   6575  C  CG    . PRO C 2 422  ? -6.766  15.325  60.754  1.00 80.34  ?  422  PRO C CG    1 
ATOM   6576  C  CD    . PRO C 2 422  ? -7.080  16.773  60.584  1.00 74.17  ?  422  PRO C CD    1 
ATOM   6577  N  N     . VAL C 2 423  ? -9.877  16.591  58.159  1.00 54.52  ?  423  VAL C N     1 
ATOM   6578  C  CA    . VAL C 2 423  ? -11.230 16.600  57.607  1.00 51.52  ?  423  VAL C CA    1 
ATOM   6579  C  C     . VAL C 2 423  ? -11.225 17.118  56.175  1.00 50.92  ?  423  VAL C C     1 
ATOM   6580  O  O     . VAL C 2 423  ? -11.689 16.443  55.249  1.00 48.35  ?  423  VAL C O     1 
ATOM   6581  C  CB    . VAL C 2 423  ? -12.170 17.431  58.498  1.00 62.50  ?  423  VAL C CB    1 
ATOM   6582  C  CG1   . VAL C 2 423  ? -13.576 17.438  57.918  1.00 61.73  ?  423  VAL C CG1   1 
ATOM   6583  C  CG2   . VAL C 2 423  ? -12.174 16.888  59.917  1.00 66.30  ?  423  VAL C CG2   1 
ATOM   6584  N  N     . VAL C 2 424  ? -10.701 18.329  55.974  1.00 56.55  ?  424  VAL C N     1 
ATOM   6585  C  CA    . VAL C 2 424  ? -10.685 18.913  54.637  1.00 55.50  ?  424  VAL C CA    1 
ATOM   6586  C  C     . VAL C 2 424  ? -9.729  18.151  53.726  1.00 51.75  ?  424  VAL C C     1 
ATOM   6587  O  O     . VAL C 2 424  ? -9.925  18.109  52.505  1.00 53.28  ?  424  VAL C O     1 
ATOM   6588  C  CB    . VAL C 2 424  ? -10.325 20.408  54.712  1.00 49.19  ?  424  VAL C CB    1 
ATOM   6589  C  CG1   . VAL C 2 424  ? -10.649 21.102  53.397  1.00 43.10  ?  424  VAL C CG1   1 
ATOM   6590  C  CG2   . VAL C 2 424  ? -11.060 21.070  55.868  1.00 65.10  ?  424  VAL C CG2   1 
ATOM   6591  N  N     . ALA C 2 425  ? -8.690  17.531  54.291  1.00 41.77  ?  425  ALA C N     1 
ATOM   6592  C  CA    . ALA C 2 425  ? -7.797  16.705  53.489  1.00 42.64  ?  425  ALA C CA    1 
ATOM   6593  C  C     . ALA C 2 425  ? -8.421  15.369  53.112  1.00 42.39  ?  425  ALA C C     1 
ATOM   6594  O  O     . ALA C 2 425  ? -7.854  14.652  52.281  1.00 46.13  ?  425  ALA C O     1 
ATOM   6595  C  CB    . ALA C 2 425  ? -6.481  16.469  54.231  1.00 53.74  ?  425  ALA C CB    1 
ATOM   6596  N  N     . ALA C 2 426  ? -9.562  15.015  53.705  1.00 43.22  ?  426  ALA C N     1 
ATOM   6597  C  CA    . ALA C 2 426  ? -10.272 13.796  53.342  1.00 45.05  ?  426  ALA C CA    1 
ATOM   6598  C  C     . ALA C 2 426  ? -11.226 14.021  52.177  1.00 39.53  ?  426  ALA C C     1 
ATOM   6599  O  O     . ALA C 2 426  ? -11.359 13.152  51.308  1.00 37.33  ?  426  ALA C O     1 
ATOM   6600  C  CB    . ALA C 2 426  ? -11.037 13.251  54.550  1.00 49.61  ?  426  ALA C CB    1 
ATOM   6601  N  N     . ILE C 2 427  ? -11.897 15.173  52.142  1.00 38.87  ?  427  ILE C N     1 
ATOM   6602  C  CA    . ILE C 2 427  ? -12.721 15.505  50.986  1.00 36.44  ?  427  ILE C CA    1 
ATOM   6603  C  C     . ILE C 2 427  ? -11.851 15.943  49.813  1.00 40.04  ?  427  ILE C C     1 
ATOM   6604  O  O     . ILE C 2 427  ? -12.242 15.780  48.652  1.00 38.97  ?  427  ILE C O     1 
ATOM   6605  C  CB    . ILE C 2 427  ? -13.763 16.577  51.355  1.00 29.53  ?  427  ILE C CB    1 
ATOM   6606  C  CG1   . ILE C 2 427  ? -13.090 17.814  51.960  1.00 41.21  ?  427  ILE C CG1   1 
ATOM   6607  C  CG2   . ILE C 2 427  ? -14.792 16.008  52.320  1.00 32.89  ?  427  ILE C CG2   1 
ATOM   6608  C  CD1   . ILE C 2 427  ? -12.847 18.941  50.971  1.00 41.68  ?  427  ILE C CD1   1 
ATOM   6609  N  N     . LYS C 2 428  ? -10.669 16.498  50.090  1.00 47.50  ?  428  LYS C N     1 
ATOM   6610  C  CA    . LYS C 2 428  ? -9.747  16.852  49.016  1.00 41.64  ?  428  LYS C CA    1 
ATOM   6611  C  C     . LYS C 2 428  ? -9.177  15.607  48.349  1.00 36.12  ?  428  LYS C C     1 
ATOM   6612  O  O     . LYS C 2 428  ? -9.057  15.553  47.120  1.00 39.62  ?  428  LYS C O     1 
ATOM   6613  C  CB    . LYS C 2 428  ? -8.625  17.734  49.562  1.00 41.46  ?  428  LYS C CB    1 
ATOM   6614  C  CG    . LYS C 2 428  ? -7.466  17.944  48.605  1.00 38.07  ?  428  LYS C CG    1 
ATOM   6615  C  CD    . LYS C 2 428  ? -6.402  18.836  49.223  1.00 54.65  ?  428  LYS C CD    1 
ATOM   6616  C  CE    . LYS C 2 428  ? -5.229  19.030  48.278  1.00 52.94  ?  428  LYS C CE    1 
ATOM   6617  N  NZ    . LYS C 2 428  ? -4.226  19.985  48.826  1.00 57.18  ?  428  LYS C NZ    1 
ATOM   6618  N  N     . GLU C 2 429  ? -8.823  14.595  49.146  1.00 37.30  ?  429  GLU C N     1 
ATOM   6619  C  CA    . GLU C 2 429  ? -8.322  13.346  48.582  1.00 41.36  ?  429  GLU C CA    1 
ATOM   6620  C  C     . GLU C 2 429  ? -9.368  12.667  47.710  1.00 41.49  ?  429  GLU C C     1 
ATOM   6621  O  O     . GLU C 2 429  ? -9.023  12.024  46.712  1.00 47.09  ?  429  GLU C O     1 
ATOM   6622  C  CB    . GLU C 2 429  ? -7.880  12.407  49.705  1.00 55.01  ?  429  GLU C CB    1 
ATOM   6623  C  CG    . GLU C 2 429  ? -7.344  11.070  49.223  1.00 65.62  ?  429  GLU C CG    1 
ATOM   6624  C  CD    . GLU C 2 429  ? -7.517  9.972   50.253  1.00 83.36  ?  429  GLU C CD    1 
ATOM   6625  O  OE1   . GLU C 2 429  ? -8.115  10.242  51.315  1.00 79.63  ?  429  GLU C OE1   1 
ATOM   6626  O  OE2   . GLU C 2 429  ? -7.059  8.839   49.997  1.00 90.44  ?  429  GLU C OE2   1 
ATOM   6627  N  N     . PHE C 2 430  ? -10.647 12.802  48.063  1.00 44.79  ?  430  PHE C N     1 
ATOM   6628  C  CA    . PHE C 2 430  ? -11.709 12.169  47.287  1.00 42.97  ?  430  PHE C CA    1 
ATOM   6629  C  C     . PHE C 2 430  ? -11.879 12.846  45.932  1.00 38.35  ?  430  PHE C C     1 
ATOM   6630  O  O     . PHE C 2 430  ? -11.671 12.225  44.884  1.00 35.40  ?  430  PHE C O     1 
ATOM   6631  C  CB    . PHE C 2 430  ? -13.019 12.197  48.076  1.00 37.21  ?  430  PHE C CB    1 
ATOM   6632  C  CG    . PHE C 2 430  ? -14.218 11.793  47.270  1.00 31.91  ?  430  PHE C CG    1 
ATOM   6633  C  CD1   . PHE C 2 430  ? -14.398 10.476  46.882  1.00 27.46  ?  430  PHE C CD1   1 
ATOM   6634  C  CD2   . PHE C 2 430  ? -15.170 12.730  46.903  1.00 30.39  ?  430  PHE C CD2   1 
ATOM   6635  C  CE1   . PHE C 2 430  ? -15.501 10.101  46.141  1.00 19.04  ?  430  PHE C CE1   1 
ATOM   6636  C  CE2   . PHE C 2 430  ? -16.276 12.361  46.163  1.00 22.36  ?  430  PHE C CE2   1 
ATOM   6637  C  CZ    . PHE C 2 430  ? -16.442 11.045  45.781  1.00 17.79  ?  430  PHE C CZ    1 
ATOM   6638  N  N     . PHE C 2 431  ? -12.261 14.126  45.934  1.00 28.61  ?  431  PHE C N     1 
ATOM   6639  C  CA    . PHE C 2 431  ? -12.472 14.831  44.673  1.00 30.08  ?  431  PHE C CA    1 
ATOM   6640  C  C     . PHE C 2 431  ? -11.185 14.953  43.869  1.00 34.87  ?  431  PHE C C     1 
ATOM   6641  O  O     . PHE C 2 431  ? -11.231 15.069  42.639  1.00 32.25  ?  431  PHE C O     1 
ATOM   6642  C  CB    . PHE C 2 431  ? -13.065 16.215  44.935  1.00 26.04  ?  431  PHE C CB    1 
ATOM   6643  C  CG    . PHE C 2 431  ? -14.517 16.191  45.316  1.00 23.70  ?  431  PHE C CG    1 
ATOM   6644  C  CD1   . PHE C 2 431  ? -15.498 16.075  44.346  1.00 27.00  ?  431  PHE C CD1   1 
ATOM   6645  C  CD2   . PHE C 2 431  ? -14.902 16.291  46.642  1.00 27.34  ?  431  PHE C CD2   1 
ATOM   6646  C  CE1   . PHE C 2 431  ? -16.836 16.055  44.691  1.00 29.19  ?  431  PHE C CE1   1 
ATOM   6647  C  CE2   . PHE C 2 431  ? -16.238 16.272  46.994  1.00 29.89  ?  431  PHE C CE2   1 
ATOM   6648  C  CZ    . PHE C 2 431  ? -17.205 16.154  46.016  1.00 22.97  ?  431  PHE C CZ    1 
ATOM   6649  N  N     . GLY C 2 432  ? -10.035 14.925  44.535  1.00 39.86  ?  432  GLY C N     1 
ATOM   6650  C  CA    . GLY C 2 432  ? -8.765  15.030  43.845  1.00 36.21  ?  432  GLY C CA    1 
ATOM   6651  C  C     . GLY C 2 432  ? -8.327  13.736  43.190  1.00 31.82  ?  432  GLY C C     1 
ATOM   6652  O  O     . GLY C 2 432  ? -7.814  13.745  42.067  1.00 47.64  ?  432  GLY C O     1 
ATOM   6653  N  N     . THR C 2 433  ? -8.527  12.613  43.879  1.00 29.75  ?  433  THR C N     1 
ATOM   6654  C  CA    . THR C 2 433  ? -8.089  11.307  43.386  1.00 39.92  ?  433  THR C CA    1 
ATOM   6655  C  C     . THR C 2 433  ? -9.153  10.276  43.747  1.00 42.71  ?  433  THR C C     1 
ATOM   6656  O  O     . THR C 2 433  ? -9.248  9.853   44.903  1.00 49.64  ?  433  THR C O     1 
ATOM   6657  C  CB    . THR C 2 433  ? -6.734  10.922  43.967  1.00 46.84  ?  433  THR C CB    1 
ATOM   6658  O  OG1   . THR C 2 433  ? -5.766  11.925  43.631  1.00 51.01  ?  433  THR C OG1   1 
ATOM   6659  C  CG2   . THR C 2 433  ? -6.280  9.580   43.413  1.00 49.25  ?  433  THR C CG2   1 
ATOM   6660  N  N     . SER C 2 434  ? -9.943  9.872   42.756  1.00 40.31  ?  434  SER C N     1 
ATOM   6661  C  CA    . SER C 2 434  ? -10.946 8.838   42.954  1.00 39.77  ?  434  SER C CA    1 
ATOM   6662  C  C     . SER C 2 434  ? -11.414 8.341   41.596  1.00 37.77  ?  434  SER C C     1 
ATOM   6663  O  O     . SER C 2 434  ? -11.547 9.124   40.652  1.00 39.16  ?  434  SER C O     1 
ATOM   6664  C  CB    . SER C 2 434  ? -12.142 9.350   43.766  1.00 36.24  ?  434  SER C CB    1 
ATOM   6665  O  OG    . SER C 2 434  ? -13.089 8.319   43.984  1.00 39.93  ?  434  SER C OG    1 
ATOM   6666  N  N     . GLN C 2 435  ? -11.659 7.033   41.512  1.00 42.00  ?  435  GLN C N     1 
ATOM   6667  C  CA    . GLN C 2 435  ? -12.230 6.453   40.304  1.00 43.01  ?  435  GLN C CA    1 
ATOM   6668  C  C     . GLN C 2 435  ? -13.659 6.923   40.069  1.00 40.59  ?  435  GLN C C     1 
ATOM   6669  O  O     . GLN C 2 435  ? -14.173 6.777   38.955  1.00 45.33  ?  435  GLN C O     1 
ATOM   6670  C  CB    . GLN C 2 435  ? -12.179 4.927   40.392  1.00 51.73  ?  435  GLN C CB    1 
ATOM   6671  C  CG    . GLN C 2 435  ? -11.710 4.234   39.124  1.00 60.38  ?  435  GLN C CG    1 
ATOM   6672  C  CD    . GLN C 2 435  ? -11.307 2.791   39.370  1.00 76.64  ?  435  GLN C CD    1 
ATOM   6673  O  OE1   . GLN C 2 435  ? -10.906 2.425   40.476  1.00 77.71  ?  435  GLN C OE1   1 
ATOM   6674  N  NE2   . GLN C 2 435  ? -11.413 1.963   38.338  1.00 62.29  ?  435  GLN C NE2   1 
ATOM   6675  N  N     . LEU C 2 436  ? -14.304 7.486   41.091  1.00 31.39  ?  436  LEU C N     1 
ATOM   6676  C  CA    . LEU C 2 436  ? -15.655 8.015   40.964  1.00 33.68  ?  436  LEU C CA    1 
ATOM   6677  C  C     . LEU C 2 436  ? -15.676 9.506   40.655  1.00 31.71  ?  436  LEU C C     1 
ATOM   6678  O  O     . LEU C 2 436  ? -16.632 9.987   40.038  1.00 29.29  ?  436  LEU C O     1 
ATOM   6679  C  CB    . LEU C 2 436  ? -16.455 7.746   42.245  1.00 35.53  ?  436  LEU C CB    1 
ATOM   6680  C  CG    . LEU C 2 436  ? -16.828 6.292   42.558  1.00 32.18  ?  436  LEU C CG    1 
ATOM   6681  C  CD1   . LEU C 2 436  ? -17.352 5.589   41.312  1.00 39.87  ?  436  LEU C CD1   1 
ATOM   6682  C  CD2   . LEU C 2 436  ? -15.671 5.512   43.180  1.00 31.61  ?  436  LEU C CD2   1 
ATOM   6683  N  N     . SER C 2 437  ? -14.654 10.247  41.076  1.00 28.31  ?  437  SER C N     1 
ATOM   6684  C  CA    . SER C 2 437  ? -14.491 11.645  40.685  1.00 26.64  ?  437  SER C CA    1 
ATOM   6685  C  C     . SER C 2 437  ? -13.832 11.667  39.312  1.00 33.88  ?  437  SER C C     1 
ATOM   6686  O  O     . SER C 2 437  ? -12.623 11.461  39.187  1.00 38.58  ?  437  SER C O     1 
ATOM   6687  C  CB    . SER C 2 437  ? -13.659 12.401  41.713  1.00 32.37  ?  437  SER C CB    1 
ATOM   6688  O  OG    . SER C 2 437  ? -13.371 13.713  41.266  1.00 31.28  ?  437  SER C OG    1 
ATOM   6689  N  N     . GLN C 2 438  ? -14.623 11.915  38.273  1.00 29.52  ?  438  GLN C N     1 
ATOM   6690  C  CA    . GLN C 2 438  ? -14.176 11.735  36.900  1.00 29.25  ?  438  GLN C CA    1 
ATOM   6691  C  C     . GLN C 2 438  ? -14.182 13.059  36.149  1.00 30.69  ?  438  GLN C C     1 
ATOM   6692  O  O     . GLN C 2 438  ? -15.106 13.867  36.295  1.00 27.46  ?  438  GLN C O     1 
ATOM   6693  C  CB    . GLN C 2 438  ? -15.055 10.714  36.170  1.00 27.55  ?  438  GLN C CB    1 
ATOM   6694  C  CG    . GLN C 2 438  ? -14.972 9.312   36.748  1.00 27.93  ?  438  GLN C CG    1 
ATOM   6695  C  CD    . GLN C 2 438  ? -15.744 8.298   35.932  1.00 35.33  ?  438  GLN C CD    1 
ATOM   6696  O  OE1   . GLN C 2 438  ? -16.415 8.647   34.960  1.00 38.38  ?  438  GLN C OE1   1 
ATOM   6697  N  NE2   . GLN C 2 438  ? -15.654 7.033   36.323  1.00 44.30  ?  438  GLN C NE2   1 
ATOM   6698  N  N     . PHE C 2 439  ? -13.133 13.271  35.356  1.00 28.41  ?  439  PHE C N     1 
ATOM   6699  C  CA    . PHE C 2 439  ? -13.064 14.391  34.427  1.00 26.06  ?  439  PHE C CA    1 
ATOM   6700  C  C     . PHE C 2 439  ? -14.255 14.347  33.477  1.00 27.45  ?  439  PHE C C     1 
ATOM   6701  O  O     . PHE C 2 439  ? -14.410 13.393  32.708  1.00 35.89  ?  439  PHE C O     1 
ATOM   6702  C  CB    . PHE C 2 439  ? -11.741 14.319  33.661  1.00 39.67  ?  439  PHE C CB    1 
ATOM   6703  C  CG    . PHE C 2 439  ? -11.435 15.535  32.838  1.00 48.21  ?  439  PHE C CG    1 
ATOM   6704  C  CD1   . PHE C 2 439  ? -11.734 16.804  33.304  1.00 46.37  ?  439  PHE C CD1   1 
ATOM   6705  C  CD2   . PHE C 2 439  ? -10.813 15.407  31.607  1.00 47.07  ?  439  PHE C CD2   1 
ATOM   6706  C  CE1   . PHE C 2 439  ? -11.439 17.921  32.546  1.00 44.37  ?  439  PHE C CE1   1 
ATOM   6707  C  CE2   . PHE C 2 439  ? -10.515 16.517  30.845  1.00 42.88  ?  439  PHE C CE2   1 
ATOM   6708  C  CZ    . PHE C 2 439  ? -10.826 17.776  31.316  1.00 41.41  ?  439  PHE C CZ    1 
ATOM   6709  N  N     . MET C 2 440  ? -15.096 15.378  33.537  1.00 24.08  ?  440  MET C N     1 
ATOM   6710  C  CA    . MET C 2 440  ? -16.391 15.336  32.868  1.00 21.50  ?  440  MET C CA    1 
ATOM   6711  C  C     . MET C 2 440  ? -16.239 15.225  31.356  1.00 33.01  ?  440  MET C C     1 
ATOM   6712  O  O     . MET C 2 440  ? -15.473 15.968  30.736  1.00 42.91  ?  440  MET C O     1 
ATOM   6713  C  CB    . MET C 2 440  ? -17.209 16.578  33.220  1.00 12.46  ?  440  MET C CB    1 
ATOM   6714  C  CG    . MET C 2 440  ? -18.526 16.677  32.466  1.00 12.27  ?  440  MET C CG    1 
ATOM   6715  S  SD    . MET C 2 440  ? -19.498 18.125  32.916  1.00 23.24  ?  440  MET C SD    1 
ATOM   6716  C  CE    . MET C 2 440  ? -20.889 17.963  31.800  1.00 29.29  ?  440  MET C CE    1 
ATOM   6717  N  N     . ASP C 2 441  ? -16.980 14.287  30.768  1.00 28.70  ?  441  ASP C N     1 
ATOM   6718  C  CA    . ASP C 2 441  ? -17.028 14.117  29.319  1.00 28.16  ?  441  ASP C CA    1 
ATOM   6719  C  C     . ASP C 2 441  ? -17.851 15.250  28.716  1.00 26.64  ?  441  ASP C C     1 
ATOM   6720  O  O     . ASP C 2 441  ? -19.065 15.329  28.935  1.00 26.48  ?  441  ASP C O     1 
ATOM   6721  C  CB    . ASP C 2 441  ? -17.627 12.754  28.983  1.00 35.54  ?  441  ASP C CB    1 
ATOM   6722  C  CG    . ASP C 2 441  ? -17.125 12.197  27.665  1.00 52.28  ?  441  ASP C CG    1 
ATOM   6723  O  OD1   . ASP C 2 441  ? -16.307 12.866  27.003  1.00 53.60  ?  441  ASP C OD1   1 
ATOM   6724  O  OD2   . ASP C 2 441  ? -17.552 11.085  27.288  1.00 45.03  ?  441  ASP C OD2   1 
ATOM   6725  N  N     . GLN C 2 442  ? -17.201 16.134  27.960  1.00 33.32  ?  442  GLN C N     1 
ATOM   6726  C  CA    . GLN C 2 442  ? -17.836 17.343  27.446  1.00 34.78  ?  442  GLN C CA    1 
ATOM   6727  C  C     . GLN C 2 442  ? -17.674 17.461  25.937  1.00 40.34  ?  442  GLN C C     1 
ATOM   6728  O  O     . GLN C 2 442  ? -17.399 18.542  25.407  1.00 35.39  ?  442  GLN C O     1 
ATOM   6729  C  CB    . GLN C 2 442  ? -17.282 18.590  28.132  1.00 33.92  ?  442  GLN C CB    1 
ATOM   6730  C  CG    . GLN C 2 442  ? -17.970 18.957  29.436  1.00 38.14  ?  442  GLN C CG    1 
ATOM   6731  C  CD    . GLN C 2 442  ? -17.508 20.301  29.970  1.00 34.14  ?  442  GLN C CD    1 
ATOM   6732  O  OE1   . GLN C 2 442  ? -16.566 20.897  29.448  1.00 26.57  ?  442  GLN C OE1   1 
ATOM   6733  N  NE2   . GLN C 2 442  ? -18.172 20.785  31.014  1.00 42.25  ?  442  GLN C NE2   1 
ATOM   6734  N  N     . ASN C 2 443  ? -17.846 16.354  25.214  1.00 23.56  ?  443  ASN C N     1 
ATOM   6735  C  CA    . ASN C 2 443  ? -17.851 16.431  23.757  1.00 13.59  ?  443  ASN C CA    1 
ATOM   6736  C  C     . ASN C 2 443  ? -19.102 17.144  23.256  1.00 13.17  ?  443  ASN C C     1 
ATOM   6737  O  O     . ASN C 2 443  ? -19.022 18.045  22.414  1.00 14.43  ?  443  ASN C O     1 
ATOM   6738  C  CB    . ASN C 2 443  ? -17.745 15.031  23.154  1.00 17.86  ?  443  ASN C CB    1 
ATOM   6739  C  CG    . ASN C 2 443  ? -16.310 14.572  23.002  1.00 28.25  ?  443  ASN C CG    1 
ATOM   6740  O  OD1   . ASN C 2 443  ? -15.468 15.299  22.475  1.00 26.92  ?  443  ASN C OD1   1 
ATOM   6741  N  ND2   . ASN C 2 443  ? -16.021 13.365  23.471  1.00 41.61  ?  443  ASN C ND2   1 
ATOM   6742  N  N     . ASN C 2 444  ? -20.261 16.759  23.772  1.00 19.22  ?  444  ASN C N     1 
ATOM   6743  C  CA    . ASN C 2 444  ? -21.525 17.384  23.410  1.00 21.10  ?  444  ASN C CA    1 
ATOM   6744  C  C     . ASN C 2 444  ? -22.451 17.285  24.611  1.00 21.67  ?  444  ASN C C     1 
ATOM   6745  O  O     . ASN C 2 444  ? -22.162 16.557  25.568  1.00 23.57  ?  444  ASN C O     1 
ATOM   6746  C  CB    . ASN C 2 444  ? -22.144 16.718  22.175  1.00 22.93  ?  444  ASN C CB    1 
ATOM   6747  C  CG    . ASN C 2 444  ? -22.255 15.216  22.315  1.00 24.33  ?  444  ASN C CG    1 
ATOM   6748  O  OD1   . ASN C 2 444  ? -23.070 14.711  23.086  1.00 22.87  ?  444  ASN C OD1   1 
ATOM   6749  N  ND2   . ASN C 2 444  ? -21.440 14.490  21.557  1.00 23.11  ?  444  ASN C ND2   1 
ATOM   6750  N  N     . PRO C 2 445  ? -23.563 18.033  24.607  1.00 17.80  ?  445  PRO C N     1 
ATOM   6751  C  CA    . PRO C 2 445  ? -24.497 17.949  25.745  1.00 25.41  ?  445  PRO C CA    1 
ATOM   6752  C  C     . PRO C 2 445  ? -24.956 16.539  26.081  1.00 21.54  ?  445  PRO C C     1 
ATOM   6753  O  O     . PRO C 2 445  ? -25.103 16.216  27.266  1.00 25.44  ?  445  PRO C O     1 
ATOM   6754  C  CB    . PRO C 2 445  ? -25.664 18.832  25.288  1.00 27.22  ?  445  PRO C CB    1 
ATOM   6755  C  CG    . PRO C 2 445  ? -25.018 19.857  24.448  1.00 24.34  ?  445  PRO C CG    1 
ATOM   6756  C  CD    . PRO C 2 445  ? -23.908 19.151  23.710  1.00 19.88  ?  445  PRO C CD    1 
ATOM   6757  N  N     . LEU C 2 446  ? -25.193 15.690  25.078  1.00 16.67  ?  446  LEU C N     1 
ATOM   6758  C  CA    . LEU C 2 446  ? -25.571 14.310  25.369  1.00 19.17  ?  446  LEU C CA    1 
ATOM   6759  C  C     . LEU C 2 446  ? -24.453 13.581  26.102  1.00 19.54  ?  446  LEU C C     1 
ATOM   6760  O  O     . LEU C 2 446  ? -24.713 12.759  26.988  1.00 19.10  ?  446  LEU C O     1 
ATOM   6761  C  CB    . LEU C 2 446  ? -25.940 13.575  24.081  1.00 21.49  ?  446  LEU C CB    1 
ATOM   6762  C  CG    . LEU C 2 446  ? -26.255 12.083  24.231  1.00 21.34  ?  446  LEU C CG    1 
ATOM   6763  C  CD1   . LEU C 2 446  ? -27.325 11.858  25.290  1.00 22.66  ?  446  LEU C CD1   1 
ATOM   6764  C  CD2   . LEU C 2 446  ? -26.685 11.485  22.903  1.00 24.95  ?  446  LEU C CD2   1 
ATOM   6765  N  N     . SER C 2 447  ? -23.200 13.878  25.752  1.00 22.20  ?  447  SER C N     1 
ATOM   6766  C  CA    . SER C 2 447  ? -22.076 13.268  26.452  1.00 26.22  ?  447  SER C CA    1 
ATOM   6767  C  C     . SER C 2 447  ? -22.030 13.712  27.909  1.00 26.60  ?  447  SER C C     1 
ATOM   6768  O  O     . SER C 2 447  ? -21.691 12.922  28.798  1.00 24.08  ?  447  SER C O     1 
ATOM   6769  C  CB    . SER C 2 447  ? -20.770 13.613  25.740  1.00 26.10  ?  447  SER C CB    1 
ATOM   6770  O  OG    . SER C 2 447  ? -19.661 13.045  26.409  1.00 27.55  ?  447  SER C OG    1 
ATOM   6771  N  N     . GLY C 2 448  ? -22.374 14.973  28.174  1.00 33.86  ?  448  GLY C N     1 
ATOM   6772  C  CA    . GLY C 2 448  ? -22.374 15.455  29.546  1.00 28.64  ?  448  GLY C CA    1 
ATOM   6773  C  C     . GLY C 2 448  ? -23.536 14.916  30.357  1.00 24.71  ?  448  GLY C C     1 
ATOM   6774  O  O     . GLY C 2 448  ? -23.396 14.639  31.552  1.00 19.01  ?  448  GLY C O     1 
ATOM   6775  N  N     . LEU C 2 449  ? -24.701 14.761  29.724  1.00 21.38  ?  449  LEU C N     1 
ATOM   6776  C  CA    . LEU C 2 449  ? -25.860 14.221  30.428  1.00 18.78  ?  449  LEU C CA    1 
ATOM   6777  C  C     . LEU C 2 449  ? -25.694 12.732  30.704  1.00 15.24  ?  449  LEU C C     1 
ATOM   6778  O  O     . LEU C 2 449  ? -26.101 12.242  31.764  1.00 18.31  ?  449  LEU C O     1 
ATOM   6779  C  CB    . LEU C 2 449  ? -27.132 14.484  29.622  1.00 13.18  ?  449  LEU C CB    1 
ATOM   6780  C  CG    . LEU C 2 449  ? -28.433 13.862  30.134  1.00 11.87  ?  449  LEU C CG    1 
ATOM   6781  C  CD1   . LEU C 2 449  ? -28.715 14.294  31.562  1.00 24.50  ?  449  LEU C CD1   1 
ATOM   6782  C  CD2   . LEU C 2 449  ? -29.593 14.231  29.224  1.00 15.54  ?  449  LEU C CD2   1 
ATOM   6783  N  N     . THR C 2 450  ? -25.099 11.996  29.762  1.00 19.50  ?  450  THR C N     1 
ATOM   6784  C  CA    . THR C 2 450  ? -24.887 10.566  29.962  1.00 23.29  ?  450  THR C CA    1 
ATOM   6785  C  C     . THR C 2 450  ? -23.885 10.307  31.080  1.00 21.04  ?  450  THR C C     1 
ATOM   6786  O  O     . THR C 2 450  ? -24.082 9.401   31.900  1.00 30.83  ?  450  THR C O     1 
ATOM   6787  C  CB    . THR C 2 450  ? -24.415 9.919   28.658  1.00 28.69  ?  450  THR C CB    1 
ATOM   6788  O  OG1   . THR C 2 450  ? -25.498 9.878   27.721  1.00 27.63  ?  450  THR C OG1   1 
ATOM   6789  C  CG2   . THR C 2 450  ? -23.909 8.505   28.908  1.00 33.87  ?  450  THR C CG2   1 
ATOM   6790  N  N     . HIS C 2 451  ? -22.813 11.102  31.136  1.00 22.05  ?  451  HIS C N     1 
ATOM   6791  C  CA    . HIS C 2 451  ? -21.765 10.876  32.126  1.00 24.26  ?  451  HIS C CA    1 
ATOM   6792  C  C     . HIS C 2 451  ? -22.306 10.981  33.547  1.00 23.73  ?  451  HIS C C     1 
ATOM   6793  O  O     . HIS C 2 451  ? -21.885 10.231  34.436  1.00 23.79  ?  451  HIS C O     1 
ATOM   6794  C  CB    . HIS C 2 451  ? -20.625 11.871  31.912  1.00 22.77  ?  451  HIS C CB    1 
ATOM   6795  C  CG    . HIS C 2 451  ? -19.387 11.549  32.690  1.00 16.58  ?  451  HIS C CG    1 
ATOM   6796  N  ND1   . HIS C 2 451  ? -18.320 12.415  32.783  1.00 14.71  ?  451  HIS C ND1   1 
ATOM   6797  C  CD2   . HIS C 2 451  ? -19.044 10.452  33.406  1.00 22.21  ?  451  HIS C CD2   1 
ATOM   6798  C  CE1   . HIS C 2 451  ? -17.374 11.868  33.525  1.00 18.65  ?  451  HIS C CE1   1 
ATOM   6799  N  NE2   . HIS C 2 451  ? -17.789 10.676  33.916  1.00 24.12  ?  451  HIS C NE2   1 
ATOM   6800  N  N     . LYS C 2 452  ? -23.242 11.902  33.781  1.00 18.26  ?  452  LYS C N     1 
ATOM   6801  C  CA    . LYS C 2 452  ? -23.792 12.065  35.122  1.00 18.63  ?  452  LYS C CA    1 
ATOM   6802  C  C     . LYS C 2 452  ? -24.722 10.918  35.492  1.00 24.67  ?  452  LYS C C     1 
ATOM   6803  O  O     . LYS C 2 452  ? -24.870 10.599  36.677  1.00 32.30  ?  452  LYS C O     1 
ATOM   6804  C  CB    . LYS C 2 452  ? -24.521 13.403  35.227  1.00 13.72  ?  452  LYS C CB    1 
ATOM   6805  C  CG    . LYS C 2 452  ? -23.651 14.591  34.861  1.00 16.47  ?  452  LYS C CG    1 
ATOM   6806  C  CD    . LYS C 2 452  ? -24.472 15.851  34.672  1.00 20.64  ?  452  LYS C CD    1 
ATOM   6807  C  CE    . LYS C 2 452  ? -23.631 16.945  34.039  1.00 13.65  ?  452  LYS C CE    1 
ATOM   6808  N  NZ    . LYS C 2 452  ? -24.394 18.205  33.827  1.00 16.39  ?  452  LYS C NZ    1 
ATOM   6809  N  N     . ARG C 2 453  ? -25.351 10.287  34.502  1.00 14.79  ?  453  ARG C N     1 
ATOM   6810  C  CA    . ARG C 2 453  ? -26.228 9.151   34.739  1.00 19.62  ?  453  ARG C CA    1 
ATOM   6811  C  C     . ARG C 2 453  ? -25.505 7.815   34.606  1.00 21.36  ?  453  ARG C C     1 
ATOM   6812  O  O     . ARG C 2 453  ? -26.163 6.775   34.490  1.00 21.53  ?  453  ARG C O     1 
ATOM   6813  C  CB    . ARG C 2 453  ? -27.424 9.199   33.784  1.00 13.17  ?  453  ARG C CB    1 
ATOM   6814  C  CG    . ARG C 2 453  ? -28.126 10.549  33.746  1.00 15.08  ?  453  ARG C CG    1 
ATOM   6815  C  CD    . ARG C 2 453  ? -29.347 10.536  32.836  1.00 20.30  ?  453  ARG C CD    1 
ATOM   6816  N  NE    . ARG C 2 453  ? -30.590 10.369  33.586  1.00 21.27  ?  453  ARG C NE    1 
ATOM   6817  C  CZ    . ARG C 2 453  ? -31.253 9.223   33.696  1.00 31.26  ?  453  ARG C CZ    1 
ATOM   6818  N  NH1   . ARG C 2 453  ? -30.798 8.130   33.100  1.00 34.49  ?  453  ARG C NH1   1 
ATOM   6819  N  NH2   . ARG C 2 453  ? -32.375 9.170   34.402  1.00 31.47  ?  453  ARG C NH2   1 
ATOM   6820  N  N     . ARG C 2 454  ? -24.174 7.818   34.623  1.00 16.45  ?  454  ARG C N     1 
ATOM   6821  C  CA    . ARG C 2 454  ? -23.424 6.576   34.496  1.00 20.25  ?  454  ARG C CA    1 
ATOM   6822  C  C     . ARG C 2 454  ? -23.478 5.775   35.790  1.00 21.44  ?  454  ARG C C     1 
ATOM   6823  O  O     . ARG C 2 454  ? -23.453 6.333   36.891  1.00 25.24  ?  454  ARG C O     1 
ATOM   6824  C  CB    . ARG C 2 454  ? -21.968 6.858   34.126  1.00 17.93  ?  454  ARG C CB    1 
ATOM   6825  C  CG    . ARG C 2 454  ? -21.764 7.326   32.700  1.00 29.67  ?  454  ARG C CG    1 
ATOM   6826  C  CD    . ARG C 2 454  ? -22.588 6.498   31.734  1.00 34.81  ?  454  ARG C CD    1 
ATOM   6827  N  NE    . ARG C 2 454  ? -21.785 5.965   30.639  1.00 43.99  ?  454  ARG C NE    1 
ATOM   6828  C  CZ    . ARG C 2 454  ? -22.284 5.271   29.623  1.00 51.41  ?  454  ARG C CZ    1 
ATOM   6829  N  NH1   . ARG C 2 454  ? -23.586 5.031   29.562  1.00 53.85  ?  454  ARG C NH1   1 
ATOM   6830  N  NH2   . ARG C 2 454  ? -21.484 4.818   28.667  1.00 48.99  ?  454  ARG C NH2   1 
ATOM   6831  N  N     . LEU C 2 455  ? -23.548 4.454   35.649  1.00 23.49  ?  455  LEU C N     1 
ATOM   6832  C  CA    . LEU C 2 455  ? -23.526 3.526   36.775  1.00 22.01  ?  455  LEU C CA    1 
ATOM   6833  C  C     . LEU C 2 455  ? -22.314 2.621   36.601  1.00 25.92  ?  455  LEU C C     1 
ATOM   6834  O  O     . LEU C 2 455  ? -22.311 1.743   35.731  1.00 32.10  ?  455  LEU C O     1 
ATOM   6835  C  CB    . LEU C 2 455  ? -24.819 2.714   36.845  1.00 17.83  ?  455  LEU C CB    1 
ATOM   6836  C  CG    . LEU C 2 455  ? -26.127 3.499   36.721  1.00 18.34  ?  455  LEU C CG    1 
ATOM   6837  C  CD1   . LEU C 2 455  ? -27.322 2.566   36.841  1.00 18.43  ?  455  LEU C CD1   1 
ATOM   6838  C  CD2   . LEU C 2 455  ? -26.203 4.612   37.757  1.00 28.18  ?  455  LEU C CD2   1 
ATOM   6839  N  N     . SER C 2 456  ? -21.288 2.837   37.418  1.00 15.94  ?  456  SER C N     1 
ATOM   6840  C  CA    . SER C 2 456  ? -20.024 2.127   37.287  1.00 19.41  ?  456  SER C CA    1 
ATOM   6841  C  C     . SER C 2 456  ? -19.900 1.051   38.355  1.00 17.69  ?  456  SER C C     1 
ATOM   6842  O  O     . SER C 2 456  ? -20.219 1.280   39.525  1.00 27.41  ?  456  SER C O     1 
ATOM   6843  C  CB    . SER C 2 456  ? -18.842 3.094   37.389  1.00 25.97  ?  456  SER C CB    1 
ATOM   6844  O  OG    . SER C 2 456  ? -17.610 2.395   37.335  1.00 35.87  ?  456  SER C OG    1 
ATOM   6845  N  N     . ALA C 2 457  ? -19.433 -0.126  37.944  1.00 28.87  ?  457  ALA C N     1 
ATOM   6846  C  CA    . ALA C 2 457  ? -19.153 -1.208  38.876  1.00 34.06  ?  457  ALA C CA    1 
ATOM   6847  C  C     . ALA C 2 457  ? -17.729 -1.170  39.412  1.00 41.70  ?  457  ALA C C     1 
ATOM   6848  O  O     . ALA C 2 457  ? -17.432 -1.863  40.390  1.00 54.18  ?  457  ALA C O     1 
ATOM   6849  C  CB    . ALA C 2 457  ? -19.410 -2.564  38.209  1.00 38.23  ?  457  ALA C CB    1 
ATOM   6850  N  N     . LEU C 2 458  ? -16.853 -0.377  38.802  1.00 46.73  ?  458  LEU C N     1 
ATOM   6851  C  CA    . LEU C 2 458  ? -15.466 -0.289  39.221  1.00 57.06  ?  458  LEU C CA    1 
ATOM   6852  C  C     . LEU C 2 458  ? -15.307 0.727   40.349  1.00 54.77  ?  458  LEU C C     1 
ATOM   6853  O  O     . LEU C 2 458  ? -16.182 1.561   40.601  1.00 49.56  ?  458  LEU C O     1 
ATOM   6854  C  CB    . LEU C 2 458  ? -14.579 0.097   38.038  1.00 57.98  ?  458  LEU C CB    1 
ATOM   6855  C  CG    . LEU C 2 458  ? -14.755 -0.762  36.785  1.00 49.27  ?  458  LEU C CG    1 
ATOM   6856  C  CD1   . LEU C 2 458  ? -14.163 -0.067  35.572  1.00 44.78  ?  458  LEU C CD1   1 
ATOM   6857  C  CD2   . LEU C 2 458  ? -14.124 -2.132  36.981  1.00 53.98  ?  458  LEU C CD2   1 
ATOM   6858  N  N     . GLY C 2 459  ? -14.167 0.649   41.031  1.00 54.15  ?  459  GLY C N     1 
ATOM   6859  C  CA    . GLY C 2 459  ? -13.866 1.551   42.115  1.00 56.53  ?  459  GLY C CA    1 
ATOM   6860  C  C     . GLY C 2 459  ? -13.720 0.836   43.442  1.00 63.65  ?  459  GLY C C     1 
ATOM   6861  O  O     . GLY C 2 459  ? -13.904 -0.382  43.542  1.00 66.22  ?  459  GLY C O     1 
ATOM   6862  N  N     . PRO C 2 460  ? -13.376 1.584   44.490  1.00 57.98  ?  460  PRO C N     1 
ATOM   6863  C  CA    . PRO C 2 460  ? -13.235 0.972   45.817  1.00 55.76  ?  460  PRO C CA    1 
ATOM   6864  C  C     . PRO C 2 460  ? -14.565 0.426   46.316  1.00 60.41  ?  460  PRO C C     1 
ATOM   6865  O  O     . PRO C 2 460  ? -15.622 1.028   46.114  1.00 56.86  ?  460  PRO C O     1 
ATOM   6866  C  CB    . PRO C 2 460  ? -12.736 2.128   46.692  1.00 58.40  ?  460  PRO C CB    1 
ATOM   6867  C  CG    . PRO C 2 460  ? -12.160 3.122   45.729  1.00 63.53  ?  460  PRO C CG    1 
ATOM   6868  C  CD    . PRO C 2 460  ? -12.996 3.006   44.493  1.00 58.74  ?  460  PRO C CD    1 
ATOM   6869  N  N     . GLY C 2 461  ? -14.502 -0.733  46.974  1.00 71.17  ?  461  GLY C N     1 
ATOM   6870  C  CA    . GLY C 2 461  ? -15.685 -1.413  47.451  1.00 71.77  ?  461  GLY C CA    1 
ATOM   6871  C  C     . GLY C 2 461  ? -16.424 -2.223  46.410  1.00 75.16  ?  461  GLY C C     1 
ATOM   6872  O  O     . GLY C 2 461  ? -17.198 -3.116  46.777  1.00 75.66  ?  461  GLY C O     1 
ATOM   6873  N  N     . GLY C 2 462  ? -16.215 -1.947  45.125  1.00 73.35  ?  462  GLY C N     1 
ATOM   6874  C  CA    . GLY C 2 462  ? -16.861 -2.701  44.071  1.00 67.97  ?  462  GLY C CA    1 
ATOM   6875  C  C     . GLY C 2 462  ? -16.081 -3.937  43.675  1.00 76.56  ?  462  GLY C C     1 
ATOM   6876  O  O     . GLY C 2 462  ? -16.087 -4.940  44.395  1.00 80.77  ?  462  GLY C O     1 
ATOM   6877  N  N     . LEU C 2 463  ? -15.399 -3.876  42.534  1.00 90.45  ?  463  LEU C N     1 
ATOM   6878  C  CA    . LEU C 2 463  ? -14.623 -5.009  42.051  1.00 96.07  ?  463  LEU C CA    1 
ATOM   6879  C  C     . LEU C 2 463  ? -13.456 -4.504  41.217  1.00 98.68  ?  463  LEU C C     1 
ATOM   6880  O  O     . LEU C 2 463  ? -13.490 -3.403  40.662  1.00 95.12  ?  463  LEU C O     1 
ATOM   6881  C  CB    . LEU C 2 463  ? -15.491 -5.980  41.236  1.00 92.74  ?  463  LEU C CB    1 
ATOM   6882  C  CG    . LEU C 2 463  ? -16.387 -5.434  40.115  1.00 82.59  ?  463  LEU C CG    1 
ATOM   6883  C  CD1   . LEU C 2 463  ? -15.617 -5.174  38.823  1.00 91.22  ?  463  LEU C CD1   1 
ATOM   6884  C  CD2   . LEU C 2 463  ? -17.552 -6.379  39.859  1.00 79.58  ?  463  LEU C CD2   1 
ATOM   6885  N  N     . SER C 2 464  ? -12.417 -5.330  41.138  1.00 104.35 ?  464  SER C N     1 
ATOM   6886  C  CA    . SER C 2 464  ? -11.309 -5.069  40.235  1.00 108.31 ?  464  SER C CA    1 
ATOM   6887  C  C     . SER C 2 464  ? -11.663 -5.542  38.831  1.00 103.23 ?  464  SER C C     1 
ATOM   6888  O  O     . SER C 2 464  ? -12.467 -6.461  38.647  1.00 109.27 ?  464  SER C O     1 
ATOM   6889  C  CB    . SER C 2 464  ? -10.039 -5.769  40.721  1.00 117.90 ?  464  SER C CB    1 
ATOM   6890  O  OG    . SER C 2 464  ? -8.974  -5.592  39.803  1.00 126.69 ?  464  SER C OG    1 
ATOM   6891  N  N     . ARG C 2 465  ? -11.058 -4.896  37.831  1.00 85.35  ?  465  ARG C N     1 
ATOM   6892  C  CA    . ARG C 2 465  ? -11.317 -5.286  36.448  1.00 93.98  ?  465  ARG C CA    1 
ATOM   6893  C  C     . ARG C 2 465  ? -10.842 -6.706  36.171  1.00 103.86 ?  465  ARG C C     1 
ATOM   6894  O  O     . ARG C 2 465  ? -11.457 -7.422  35.372  1.00 105.59 ?  465  ARG C O     1 
ATOM   6895  C  CB    . ARG C 2 465  ? -10.652 -4.299  35.488  1.00 90.51  ?  465  ARG C CB    1 
ATOM   6896  C  CG    . ARG C 2 465  ? -10.908 -4.600  34.018  1.00 90.42  ?  465  ARG C CG    1 
ATOM   6897  C  CD    . ARG C 2 465  ? -10.274 -3.562  33.104  1.00 88.53  ?  465  ARG C CD    1 
ATOM   6898  N  NE    . ARG C 2 465  ? -11.032 -2.314  33.063  1.00 75.29  ?  465  ARG C NE    1 
ATOM   6899  C  CZ    . ARG C 2 465  ? -10.738 -1.235  33.781  1.00 88.89  ?  465  ARG C CZ    1 
ATOM   6900  N  NH1   . ARG C 2 465  ? -9.697  -1.243  34.602  1.00 89.38  ?  465  ARG C NH1   1 
ATOM   6901  N  NH2   . ARG C 2 465  ? -11.484 -0.144  33.675  1.00 90.63  ?  465  ARG C NH2   1 
ATOM   6902  N  N     . GLU C 2 466  ? -9.761  -7.134  36.824  1.00 120.59 ?  466  GLU C N     1 
ATOM   6903  C  CA    . GLU C 2 466  ? -9.284  -8.503  36.679  1.00 125.64 ?  466  GLU C CA    1 
ATOM   6904  C  C     . GLU C 2 466  ? -10.131 -9.503  37.456  1.00 118.14 ?  466  GLU C C     1 
ATOM   6905  O  O     . GLU C 2 466  ? -10.030 -10.709 37.202  1.00 122.36 ?  466  GLU C O     1 
ATOM   6906  C  CB    . GLU C 2 466  ? -7.823  -8.599  37.125  1.00 134.31 ?  466  GLU C CB    1 
ATOM   6907  C  CG    . GLU C 2 466  ? -6.884  -7.686  36.350  1.00 148.85 ?  466  GLU C CG    1 
ATOM   6908  C  CD    . GLU C 2 466  ? -5.468  -7.706  36.891  1.00 156.77 ?  466  GLU C CD    1 
ATOM   6909  O  OE1   . GLU C 2 466  ? -5.226  -8.393  37.905  1.00 163.68 ?  466  GLU C OE1   1 
ATOM   6910  O  OE2   . GLU C 2 466  ? -4.596  -7.033  36.301  1.00 148.16 ?  466  GLU C OE2   1 
ATOM   6911  N  N     . ARG C 2 467  ? -10.957 -9.035  38.393  1.00 129.86 ?  467  ARG C N     1 
ATOM   6912  C  CA    . ARG C 2 467  ? -11.857 -9.912  39.134  1.00 129.00 ?  467  ARG C CA    1 
ATOM   6913  C  C     . ARG C 2 467  ? -13.302 -9.705  38.701  1.00 128.02 ?  467  ARG C C     1 
ATOM   6914  O  O     . ARG C 2 467  ? -14.178 -9.468  39.539  1.00 126.52 ?  467  ARG C O     1 
ATOM   6915  C  CB    . ARG C 2 467  ? -11.735 -9.674  40.640  1.00 129.89 ?  467  ARG C CB    1 
ATOM   6916  C  CG    . ARG C 2 467  ? -10.639 -10.467 41.324  1.00 135.98 ?  467  ARG C CG    1 
ATOM   6917  C  CD    . ARG C 2 467  ? -10.818 -10.421 42.832  1.00 143.97 ?  467  ARG C CD    1 
ATOM   6918  N  NE    . ARG C 2 467  ? -9.603  -9.992  43.515  1.00 156.93 ?  467  ARG C NE    1 
ATOM   6919  C  CZ    . ARG C 2 467  ? -8.694  -10.822 44.012  1.00 160.08 ?  467  ARG C CZ    1 
ATOM   6920  N  NH1   . ARG C 2 467  ? -8.865  -12.133 43.910  1.00 150.85 ?  467  ARG C NH1   1 
ATOM   6921  N  NH2   . ARG C 2 467  ? -7.617  -10.343 44.619  1.00 167.45 ?  467  ARG C NH2   1 
ATOM   6922  N  N     . ALA C 2 468  ? -13.563 -9.792  37.399  1.00 108.55 ?  468  ALA C N     1 
ATOM   6923  C  CA    . ALA C 2 468  ? -14.909 -9.613  36.862  1.00 100.03 ?  468  ALA C CA    1 
ATOM   6924  C  C     . ALA C 2 468  ? -15.103 -10.605 35.726  1.00 98.92  ?  468  ALA C C     1 
ATOM   6925  O  O     . ALA C 2 468  ? -14.548 -10.422 34.638  1.00 90.21  ?  468  ALA C O     1 
ATOM   6926  C  CB    . ALA C 2 468  ? -15.129 -8.179  36.380  1.00 88.60  ?  468  ALA C CB    1 
ATOM   6927  N  N     . GLY C 2 469  ? -15.885 -11.653 35.977  1.00 82.06  ?  469  GLY C N     1 
ATOM   6928  C  CA    . GLY C 2 469  ? -16.165 -12.648 34.967  1.00 79.57  ?  469  GLY C CA    1 
ATOM   6929  C  C     . GLY C 2 469  ? -17.221 -12.189 33.980  1.00 76.25  ?  469  GLY C C     1 
ATOM   6930  O  O     . GLY C 2 469  ? -17.713 -11.062 34.015  1.00 72.76  ?  469  GLY C O     1 
ATOM   6931  N  N     . LEU C 2 470  ? -17.576 -13.101 33.076  1.00 75.53  ?  470  LEU C N     1 
ATOM   6932  C  CA    . LEU C 2 470  ? -18.589 -12.836 32.057  1.00 69.65  ?  470  LEU C CA    1 
ATOM   6933  C  C     . LEU C 2 470  ? -20.009 -12.819 32.616  1.00 73.23  ?  470  LEU C C     1 
ATOM   6934  O  O     . LEU C 2 470  ? -20.962 -12.700 31.832  1.00 79.15  ?  470  LEU C O     1 
ATOM   6935  C  CB    . LEU C 2 470  ? -18.486 -13.873 30.936  1.00 71.28  ?  470  LEU C CB    1 
ATOM   6936  C  CG    . LEU C 2 470  ? -17.106 -14.059 30.299  1.00 70.13  ?  470  LEU C CG    1 
ATOM   6937  C  CD1   . LEU C 2 470  ? -17.161 -15.091 29.182  1.00 74.01  ?  470  LEU C CD1   1 
ATOM   6938  C  CD2   . LEU C 2 470  ? -16.563 -12.734 29.785  1.00 77.74  ?  470  LEU C CD2   1 
ATOM   6939  N  N     . GLU C 2 471  ? -20.173 -12.932 33.934  1.00 69.51  ?  471  GLU C N     1 
ATOM   6940  C  CA    . GLU C 2 471  ? -21.488 -12.944 34.562  1.00 71.53  ?  471  GLU C CA    1 
ATOM   6941  C  C     . GLU C 2 471  ? -21.884 -11.597 35.151  1.00 72.64  ?  471  GLU C C     1 
ATOM   6942  O  O     . GLU C 2 471  ? -23.076 -11.272 35.178  1.00 73.50  ?  471  GLU C O     1 
ATOM   6943  C  CB    . GLU C 2 471  ? -21.531 -14.012 35.661  1.00 81.97  ?  471  GLU C CB    1 
ATOM   6944  C  CG    . GLU C 2 471  ? -22.896 -14.205 36.297  1.00 99.78  ?  471  GLU C CG    1 
ATOM   6945  C  CD    . GLU C 2 471  ? -22.895 -15.292 37.350  1.00 116.12 ?  471  GLU C CD    1 
ATOM   6946  O  OE1   . GLU C 2 471  ? -21.859 -15.974 37.497  1.00 125.46 ?  471  GLU C OE1   1 
ATOM   6947  O  OE2   . GLU C 2 471  ? -23.928 -15.463 38.031  1.00 116.02 ?  471  GLU C OE2   1 
ATOM   6948  N  N     . VAL C 2 472  ? -20.917 -10.804 35.619  1.00 68.34  ?  472  VAL C N     1 
ATOM   6949  C  CA    . VAL C 2 472  ? -21.228 -9.480  36.143  1.00 63.73  ?  472  VAL C CA    1 
ATOM   6950  C  C     . VAL C 2 472  ? -21.583 -8.509  35.028  1.00 59.91  ?  472  VAL C C     1 
ATOM   6951  O  O     . VAL C 2 472  ? -22.280 -7.516  35.268  1.00 54.39  ?  472  VAL C O     1 
ATOM   6952  C  CB    . VAL C 2 472  ? -20.043 -8.930  36.960  1.00 63.17  ?  472  VAL C CB    1 
ATOM   6953  C  CG1   . VAL C 2 472  ? -20.507 -7.848  37.923  1.00 58.32  ?  472  VAL C CG1   1 
ATOM   6954  C  CG2   . VAL C 2 472  ? -19.324 -10.052 37.695  1.00 77.60  ?  472  VAL C CG2   1 
ATOM   6955  N  N     . ARG C 2 473  ? -21.130 -8.778  33.806  1.00 55.84  ?  473  ARG C N     1 
ATOM   6956  C  CA    . ARG C 2 473  ? -21.198 -7.803  32.727  1.00 47.55  ?  473  ARG C CA    1 
ATOM   6957  C  C     . ARG C 2 473  ? -22.446 -7.940  31.865  1.00 50.59  ?  473  ARG C C     1 
ATOM   6958  O  O     . ARG C 2 473  ? -22.907 -6.940  31.305  1.00 55.45  ?  473  ARG C O     1 
ATOM   6959  C  CB    . ARG C 2 473  ? -19.952 -7.924  31.846  1.00 34.57  ?  473  ARG C CB    1 
ATOM   6960  C  CG    . ARG C 2 473  ? -18.678 -8.205  32.634  1.00 32.55  ?  473  ARG C CG    1 
ATOM   6961  C  CD    . ARG C 2 473  ? -17.528 -8.620  31.728  1.00 34.93  ?  473  ARG C CD    1 
ATOM   6962  N  NE    . ARG C 2 473  ? -16.822 -7.474  31.165  1.00 29.68  ?  473  ARG C NE    1 
ATOM   6963  C  CZ    . ARG C 2 473  ? -15.687 -6.982  31.653  1.00 33.92  ?  473  ARG C CZ    1 
ATOM   6964  N  NH1   . ARG C 2 473  ? -15.124 -7.540  32.717  1.00 35.77  ?  473  ARG C NH1   1 
ATOM   6965  N  NH2   . ARG C 2 473  ? -15.113 -5.936  31.076  1.00 44.10  ?  473  ARG C NH2   1 
ATOM   6966  N  N     . ASP C 2 474  ? -23.007 -9.140  31.739  1.00 44.23  ?  474  ASP C N     1 
ATOM   6967  C  CA    . ASP C 2 474  ? -24.124 -9.329  30.826  1.00 49.98  ?  474  ASP C CA    1 
ATOM   6968  C  C     . ASP C 2 474  ? -25.433 -8.842  31.452  1.00 36.86  ?  474  ASP C C     1 
ATOM   6969  O  O     . ASP C 2 474  ? -25.511 -8.520  32.641  1.00 35.44  ?  474  ASP C O     1 
ATOM   6970  C  CB    . ASP C 2 474  ? -24.231 -10.794 30.404  1.00 52.21  ?  474  ASP C CB    1 
ATOM   6971  C  CG    . ASP C 2 474  ? -24.174 -11.746 31.579  1.00 61.97  ?  474  ASP C CG    1 
ATOM   6972  O  OD1   . ASP C 2 474  ? -24.300 -11.285 32.731  1.00 58.80  ?  474  ASP C OD1   1 
ATOM   6973  O  OD2   . ASP C 2 474  ? -23.995 -12.960 31.348  1.00 69.57  ?  474  ASP C OD2   1 
ATOM   6974  N  N     . VAL C 2 475  ? -26.474 -8.794  30.618  1.00 30.94  ?  475  VAL C N     1 
ATOM   6975  C  CA    . VAL C 2 475  ? -27.747 -8.213  31.024  1.00 29.20  ?  475  VAL C CA    1 
ATOM   6976  C  C     . VAL C 2 475  ? -28.482 -9.162  31.959  1.00 37.98  ?  475  VAL C C     1 
ATOM   6977  O  O     . VAL C 2 475  ? -28.549 -10.376 31.721  1.00 55.05  ?  475  VAL C O     1 
ATOM   6978  C  CB    . VAL C 2 475  ? -28.601 -7.885  29.786  1.00 32.20  ?  475  VAL C CB    1 
ATOM   6979  C  CG1   . VAL C 2 475  ? -29.920 -7.249  30.196  1.00 36.22  ?  475  VAL C CG1   1 
ATOM   6980  C  CG2   . VAL C 2 475  ? -27.836 -6.977  28.839  1.00 29.14  ?  475  VAL C CG2   1 
ATOM   6981  N  N     . HIS C 2 476  ? -29.045 -8.605  33.036  1.00 40.10  ?  476  HIS C N     1 
ATOM   6982  C  CA    . HIS C 2 476  ? -29.845 -9.312  34.021  1.00 43.50  ?  476  HIS C CA    1 
ATOM   6983  C  C     . HIS C 2 476  ? -31.320 -8.960  33.855  1.00 45.19  ?  476  HIS C C     1 
ATOM   6984  O  O     . HIS C 2 476  ? -31.646 -7.815  33.519  1.00 46.26  ?  476  HIS C O     1 
ATOM   6985  C  CB    . HIS C 2 476  ? -29.392 -8.958  35.442  1.00 47.35  ?  476  HIS C CB    1 
ATOM   6986  C  CG    . HIS C 2 476  ? -29.858 -9.922  36.488  1.00 46.37  ?  476  HIS C CG    1 
ATOM   6987  N  ND1   . HIS C 2 476  ? -31.037 -9.754  37.182  1.00 43.55  ?  476  HIS C ND1   1 
ATOM   6988  C  CD2   . HIS C 2 476  ? -29.304 -11.064 36.957  1.00 48.64  ?  476  HIS C CD2   1 
ATOM   6989  C  CE1   . HIS C 2 476  ? -31.189 -10.752 38.034  1.00 54.70  ?  476  HIS C CE1   1 
ATOM   6990  N  NE2   . HIS C 2 476  ? -30.151 -11.561 37.918  1.00 58.67  ?  476  HIS C NE2   1 
ATOM   6991  N  N     . PRO C 2 477  ? -32.232 -9.913  34.068  1.00 45.62  ?  477  PRO C N     1 
ATOM   6992  C  CA    . PRO C 2 477  ? -33.664 -9.603  33.909  1.00 44.25  ?  477  PRO C CA    1 
ATOM   6993  C  C     . PRO C 2 477  ? -34.171 -8.539  34.867  1.00 40.91  ?  477  PRO C C     1 
ATOM   6994  O  O     . PRO C 2 477  ? -35.181 -7.891  34.566  1.00 42.57  ?  477  PRO C O     1 
ATOM   6995  C  CB    . PRO C 2 477  ? -34.348 -10.956 34.158  1.00 44.06  ?  477  PRO C CB    1 
ATOM   6996  C  CG    . PRO C 2 477  ? -33.339 -11.767 34.910  1.00 43.76  ?  477  PRO C CG    1 
ATOM   6997  C  CD    . PRO C 2 477  ? -32.008 -11.333 34.384  1.00 41.21  ?  477  PRO C CD    1 
ATOM   6998  N  N     . SER C 2 478  ? -33.509 -8.335  36.007  1.00 35.59  ?  478  SER C N     1 
ATOM   6999  C  CA    . SER C 2 478  ? -33.903 -7.276  36.926  1.00 38.16  ?  478  SER C CA    1 
ATOM   7000  C  C     . SER C 2 478  ? -33.485 -5.893  36.446  1.00 42.64  ?  478  SER C C     1 
ATOM   7001  O  O     . SER C 2 478  ? -33.941 -4.895  37.015  1.00 40.73  ?  478  SER C O     1 
ATOM   7002  C  CB    . SER C 2 478  ? -33.316 -7.534  38.317  1.00 44.97  ?  478  SER C CB    1 
ATOM   7003  O  OG    . SER C 2 478  ? -31.900 -7.476  38.293  1.00 47.72  ?  478  SER C OG    1 
ATOM   7004  N  N     . HIS C 2 479  ? -32.636 -5.808  35.421  1.00 35.03  ?  479  HIS C N     1 
ATOM   7005  C  CA    . HIS C 2 479  ? -32.226 -4.525  34.864  1.00 31.00  ?  479  HIS C CA    1 
ATOM   7006  C  C     . HIS C 2 479  ? -33.316 -3.866  34.029  1.00 32.96  ?  479  HIS C C     1 
ATOM   7007  O  O     . HIS C 2 479  ? -33.105 -2.748  33.546  1.00 31.83  ?  479  HIS C O     1 
ATOM   7008  C  CB    . HIS C 2 479  ? -30.963 -4.697  34.015  1.00 29.69  ?  479  HIS C CB    1 
ATOM   7009  C  CG    . HIS C 2 479  ? -29.769 -5.160  34.791  1.00 33.31  ?  479  HIS C CG    1 
ATOM   7010  N  ND1   . HIS C 2 479  ? -28.586 -5.526  34.186  1.00 33.30  ?  479  HIS C ND1   1 
ATOM   7011  C  CD2   . HIS C 2 479  ? -29.572 -5.312  36.122  1.00 37.79  ?  479  HIS C CD2   1 
ATOM   7012  C  CE1   . HIS C 2 479  ? -27.713 -5.886  35.110  1.00 38.64  ?  479  HIS C CE1   1 
ATOM   7013  N  NE2   . HIS C 2 479  ? -28.287 -5.765  36.293  1.00 40.32  ?  479  HIS C NE2   1 
ATOM   7014  N  N     . TYR C 2 480  ? -34.459 -4.524  33.844  1.00 33.75  ?  480  TYR C N     1 
ATOM   7015  C  CA    . TYR C 2 480  ? -35.548 -3.949  33.065  1.00 34.09  ?  480  TYR C CA    1 
ATOM   7016  C  C     . TYR C 2 480  ? -36.056 -2.677  33.730  1.00 34.53  ?  480  TYR C C     1 
ATOM   7017  O  O     . TYR C 2 480  ? -36.462 -2.694  34.896  1.00 35.18  ?  480  TYR C O     1 
ATOM   7018  C  CB    . TYR C 2 480  ? -36.678 -4.969  32.919  1.00 37.13  ?  480  TYR C CB    1 
ATOM   7019  C  CG    . TYR C 2 480  ? -37.753 -4.574  31.930  1.00 38.35  ?  480  TYR C CG    1 
ATOM   7020  C  CD1   . TYR C 2 480  ? -38.768 -3.695  32.289  1.00 41.43  ?  480  TYR C CD1   1 
ATOM   7021  C  CD2   . TYR C 2 480  ? -37.760 -5.090  30.641  1.00 33.40  ?  480  TYR C CD2   1 
ATOM   7022  C  CE1   . TYR C 2 480  ? -39.751 -3.333  31.389  1.00 37.21  ?  480  TYR C CE1   1 
ATOM   7023  C  CE2   . TYR C 2 480  ? -38.743 -4.736  29.735  1.00 38.13  ?  480  TYR C CE2   1 
ATOM   7024  C  CZ    . TYR C 2 480  ? -39.736 -3.858  30.116  1.00 41.84  ?  480  TYR C CZ    1 
ATOM   7025  O  OH    . TYR C 2 480  ? -40.717 -3.501  29.220  1.00 55.01  ?  480  TYR C OH    1 
ATOM   7026  N  N     . GLY C 2 481  ? -36.030 -1.573  32.986  1.00 32.40  ?  481  GLY C N     1 
ATOM   7027  C  CA    . GLY C 2 481  ? -36.482 -0.300  33.510  1.00 34.69  ?  481  GLY C CA    1 
ATOM   7028  C  C     . GLY C 2 481  ? -35.582 0.331   34.546  1.00 29.84  ?  481  GLY C C     1 
ATOM   7029  O  O     . GLY C 2 481  ? -35.960 1.348   35.134  1.00 22.39  ?  481  GLY C O     1 
ATOM   7030  N  N     . ARG C 2 482  ? -34.400 -0.235  34.788  1.00 30.59  ?  482  ARG C N     1 
ATOM   7031  C  CA    . ARG C 2 482  ? -33.471 0.298   35.780  1.00 30.35  ?  482  ARG C CA    1 
ATOM   7032  C  C     . ARG C 2 482  ? -32.126 0.652   35.162  1.00 33.23  ?  482  ARG C C     1 
ATOM   7033  O  O     . ARG C 2 482  ? -31.734 1.823   35.185  1.00 32.50  ?  482  ARG C O     1 
ATOM   7034  C  CB    . ARG C 2 482  ? -33.306 -0.705  36.929  1.00 32.23  ?  482  ARG C CB    1 
ATOM   7035  C  CG    . ARG C 2 482  ? -34.600 -0.961  37.682  1.00 37.94  ?  482  ARG C CG    1 
ATOM   7036  C  CD    . ARG C 2 482  ? -34.432 -1.961  38.811  1.00 44.73  ?  482  ARG C CD    1 
ATOM   7037  N  NE    . ARG C 2 482  ? -35.681 -2.129  39.547  1.00 43.72  ?  482  ARG C NE    1 
ATOM   7038  C  CZ    . ARG C 2 482  ? -36.650 -2.965  39.190  1.00 47.98  ?  482  ARG C CZ    1 
ATOM   7039  N  NH1   . ARG C 2 482  ? -36.514 -3.718  38.107  1.00 44.47  ?  482  ARG C NH1   1 
ATOM   7040  N  NH2   . ARG C 2 482  ? -37.757 -3.049  39.914  1.00 53.80  ?  482  ARG C NH2   1 
ATOM   7041  N  N     . MET C 2 483  ? -31.406 -0.319  34.609  1.00 32.25  ?  483  MET C N     1 
ATOM   7042  C  CA    . MET C 2 483  ? -30.176 -0.060  33.877  1.00 26.05  ?  483  MET C CA    1 
ATOM   7043  C  C     . MET C 2 483  ? -30.375 -0.436  32.415  1.00 29.68  ?  483  MET C C     1 
ATOM   7044  O  O     . MET C 2 483  ? -31.041 -1.429  32.104  1.00 27.82  ?  483  MET C O     1 
ATOM   7045  C  CB    . MET C 2 483  ? -28.996 -0.839  34.465  1.00 22.40  ?  483  MET C CB    1 
ATOM   7046  C  CG    . MET C 2 483  ? -27.643 -0.214  34.159  1.00 20.57  ?  483  MET C CG    1 
ATOM   7047  S  SD    . MET C 2 483  ? -26.244 -1.247  34.632  1.00 26.80  ?  483  MET C SD    1 
ATOM   7048  C  CE    . MET C 2 483  ? -26.350 -2.542  33.399  1.00 43.85  ?  483  MET C CE    1 
ATOM   7049  N  N     . CYS C 2 484  ? -29.802 0.363   31.524  1.00 28.22  ?  484  CYS C N     1 
ATOM   7050  C  CA    . CYS C 2 484  ? -30.004 0.145   30.101  1.00 23.08  ?  484  CYS C CA    1 
ATOM   7051  C  C     . CYS C 2 484  ? -29.300 -1.133  29.652  1.00 25.47  ?  484  CYS C C     1 
ATOM   7052  O  O     . CYS C 2 484  ? -28.176 -1.409  30.083  1.00 23.87  ?  484  CYS C O     1 
ATOM   7053  C  CB    . CYS C 2 484  ? -29.482 1.335   29.299  1.00 27.11  ?  484  CYS C CB    1 
ATOM   7054  S  SG    . CYS C 2 484  ? -29.674 1.187   27.506  1.00 29.51  ?  484  CYS C SG    1 
ATOM   7055  N  N     . PRO C 2 485  ? -29.936 -1.937  28.801  1.00 25.83  ?  485  PRO C N     1 
ATOM   7056  C  CA    . PRO C 2 485  ? -29.267 -3.106  28.220  1.00 23.75  ?  485  PRO C CA    1 
ATOM   7057  C  C     . PRO C 2 485  ? -28.473 -2.813  26.957  1.00 23.77  ?  485  PRO C C     1 
ATOM   7058  O  O     . PRO C 2 485  ? -27.822 -3.726  26.436  1.00 24.82  ?  485  PRO C O     1 
ATOM   7059  C  CB    . PRO C 2 485  ? -30.450 -4.030  27.907  1.00 23.36  ?  485  PRO C CB    1 
ATOM   7060  C  CG    . PRO C 2 485  ? -31.542 -3.088  27.545  1.00 16.95  ?  485  PRO C CG    1 
ATOM   7061  C  CD    . PRO C 2 485  ? -31.360 -1.875  28.426  1.00 22.51  ?  485  PRO C CD    1 
ATOM   7062  N  N     . ILE C 2 486  ? -28.507 -1.579  26.458  1.00 25.39  ?  486  ILE C N     1 
ATOM   7063  C  CA    . ILE C 2 486  ? -27.832 -1.205  25.217  1.00 28.05  ?  486  ILE C CA    1 
ATOM   7064  C  C     . ILE C 2 486  ? -26.633 -0.300  25.489  1.00 28.39  ?  486  ILE C C     1 
ATOM   7065  O  O     . ILE C 2 486  ? -25.509 -0.610  25.090  1.00 29.03  ?  486  ILE C O     1 
ATOM   7066  C  CB    . ILE C 2 486  ? -28.816 -0.546  24.225  1.00 25.05  ?  486  ILE C CB    1 
ATOM   7067  C  CG1   . ILE C 2 486  ? -29.951 -1.508  23.879  1.00 26.01  ?  486  ILE C CG1   1 
ATOM   7068  C  CG2   . ILE C 2 486  ? -28.087 -0.115  22.962  1.00 22.29  ?  486  ILE C CG2   1 
ATOM   7069  C  CD1   . ILE C 2 486  ? -29.494 -2.737  23.130  1.00 31.85  ?  486  ILE C CD1   1 
ATOM   7070  N  N     . GLU C 2 487  ? -26.854 0.827   26.165  1.00 26.25  ?  487  GLU C N     1 
ATOM   7071  C  CA    . GLU C 2 487  ? -25.796 1.817   26.341  1.00 27.29  ?  487  GLU C CA    1 
ATOM   7072  C  C     . GLU C 2 487  ? -24.763 1.307   27.337  1.00 27.66  ?  487  GLU C C     1 
ATOM   7073  O  O     . GLU C 2 487  ? -25.023 1.243   28.543  1.00 38.55  ?  487  GLU C O     1 
ATOM   7074  C  CB    . GLU C 2 487  ? -26.369 3.155   26.796  1.00 34.77  ?  487  GLU C CB    1 
ATOM   7075  C  CG    . GLU C 2 487  ? -25.301 4.235   26.905  1.00 39.65  ?  487  GLU C CG    1 
ATOM   7076  C  CD    . GLU C 2 487  ? -25.871 5.629   27.052  1.00 40.04  ?  487  GLU C CD    1 
ATOM   7077  O  OE1   . GLU C 2 487  ? -27.015 5.763   27.531  1.00 36.96  ?  487  GLU C OE1   1 
ATOM   7078  O  OE2   . GLU C 2 487  ? -25.171 6.594   26.681  1.00 38.64  ?  487  GLU C OE2   1 
ATOM   7079  N  N     . THR C 2 488  ? -23.590 0.953   26.825  1.00 28.04  ?  488  THR C N     1 
ATOM   7080  C  CA    . THR C 2 488  ? -22.426 0.527   27.587  1.00 37.04  ?  488  THR C CA    1 
ATOM   7081  C  C     . THR C 2 488  ? -21.248 0.471   26.623  1.00 35.10  ?  488  THR C C     1 
ATOM   7082  O  O     . THR C 2 488  ? -21.429 0.115   25.452  1.00 27.44  ?  488  THR C O     1 
ATOM   7083  C  CB    . THR C 2 488  ? -22.658 -0.833  28.254  1.00 29.24  ?  488  THR C CB    1 
ATOM   7084  O  OG1   . THR C 2 488  ? -21.421 -1.330  28.779  1.00 24.96  ?  488  THR C OG1   1 
ATOM   7085  C  CG2   . THR C 2 488  ? -23.221 -1.833  27.258  1.00 22.92  ?  488  THR C CG2   1 
ATOM   7086  N  N     . PRO C 2 489  ? -20.041 0.832   27.057  1.00 37.60  ?  489  PRO C N     1 
ATOM   7087  C  CA    . PRO C 2 489  ? -18.896 0.795   26.140  1.00 39.12  ?  489  PRO C CA    1 
ATOM   7088  C  C     . PRO C 2 489  ? -18.629 -0.619  25.648  1.00 39.52  ?  489  PRO C C     1 
ATOM   7089  O  O     . PRO C 2 489  ? -18.974 -1.604  26.303  1.00 46.32  ?  489  PRO C O     1 
ATOM   7090  C  CB    . PRO C 2 489  ? -17.737 1.323   26.994  1.00 42.48  ?  489  PRO C CB    1 
ATOM   7091  C  CG    . PRO C 2 489  ? -18.175 1.110   28.410  1.00 34.18  ?  489  PRO C CG    1 
ATOM   7092  C  CD    . PRO C 2 489  ? -19.661 1.301   28.399  1.00 33.95  ?  489  PRO C CD    1 
ATOM   7093  N  N     . GLU C 2 490  ? -18.022 -0.713  24.467  1.00 36.13  ?  490  GLU C N     1 
ATOM   7094  C  CA    . GLU C 2 490  ? -17.675 -1.998  23.877  1.00 39.85  ?  490  GLU C CA    1 
ATOM   7095  C  C     . GLU C 2 490  ? -16.210 -2.358  24.080  1.00 35.19  ?  490  GLU C C     1 
ATOM   7096  O  O     . GLU C 2 490  ? -15.751 -3.371  23.542  1.00 39.35  ?  490  GLU C O     1 
ATOM   7097  C  CB    . GLU C 2 490  ? -18.014 -2.010  22.386  1.00 35.48  ?  490  GLU C CB    1 
ATOM   7098  C  CG    . GLU C 2 490  ? -17.356 -0.905  21.582  1.00 47.69  ?  490  GLU C CG    1 
ATOM   7099  C  CD    . GLU C 2 490  ? -17.580 -1.069  20.093  1.00 66.41  ?  490  GLU C CD    1 
ATOM   7100  O  OE1   . GLU C 2 490  ? -17.919 -2.192  19.665  1.00 63.48  ?  490  GLU C OE1   1 
ATOM   7101  O  OE2   . GLU C 2 490  ? -17.421 -0.076  19.352  1.00 74.72  ?  490  GLU C OE2   1 
ATOM   7102  N  N     . GLY C 2 491  ? -15.469 -1.557  24.839  1.00 32.51  ?  491  GLY C N     1 
ATOM   7103  C  CA    . GLY C 2 491  ? -14.087 -1.851  25.128  1.00 41.67  ?  491  GLY C CA    1 
ATOM   7104  C  C     . GLY C 2 491  ? -13.950 -2.818  26.286  1.00 36.46  ?  491  GLY C C     1 
ATOM   7105  O  O     . GLY C 2 491  ? -14.808 -3.677  26.514  1.00 40.94  ?  491  GLY C O     1 
ATOM   7106  N  N     . PRO C 2 492  ? -12.860 -2.692  27.049  1.00 30.23  ?  492  PRO C N     1 
ATOM   7107  C  CA    . PRO C 2 492  ? -12.659 -3.586  28.200  1.00 36.62  ?  492  PRO C CA    1 
ATOM   7108  C  C     . PRO C 2 492  ? -13.612 -3.327  29.354  1.00 34.93  ?  492  PRO C C     1 
ATOM   7109  O  O     . PRO C 2 492  ? -13.641 -4.128  30.297  1.00 38.95  ?  492  PRO C O     1 
ATOM   7110  C  CB    . PRO C 2 492  ? -11.207 -3.308  28.608  1.00 47.54  ?  492  PRO C CB    1 
ATOM   7111  C  CG    . PRO C 2 492  ? -10.957 -1.910  28.148  1.00 44.19  ?  492  PRO C CG    1 
ATOM   7112  C  CD    . PRO C 2 492  ? -11.744 -1.746  26.877  1.00 39.91  ?  492  PRO C CD    1 
ATOM   7113  N  N     . ASN C 2 493  ? -14.389 -2.243  29.316  1.00 37.06  ?  493  ASN C N     1 
ATOM   7114  C  CA    . ASN C 2 493  ? -15.326 -1.906  30.380  1.00 38.84  ?  493  ASN C CA    1 
ATOM   7115  C  C     . ASN C 2 493  ? -16.767 -2.246  30.015  1.00 40.28  ?  493  ASN C C     1 
ATOM   7116  O  O     . ASN C 2 493  ? -17.700 -1.627  30.536  1.00 41.75  ?  493  ASN C O     1 
ATOM   7117  C  CB    . ASN C 2 493  ? -15.208 -0.425  30.740  1.00 35.02  ?  493  ASN C CB    1 
ATOM   7118  C  CG    . ASN C 2 493  ? -13.844 -0.065  31.287  1.00 43.14  ?  493  ASN C CG    1 
ATOM   7119  O  OD1   . ASN C 2 493  ? -13.166 -0.898  31.887  1.00 47.65  ?  493  ASN C OD1   1 
ATOM   7120  N  ND2   . ASN C 2 493  ? -13.435 1.182   31.083  1.00 51.05  ?  493  ASN C ND2   1 
ATOM   7121  N  N     . ILE C 2 494  ? -16.968 -3.221  29.128  1.00 34.28  ?  494  ILE C N     1 
ATOM   7122  C  CA    . ILE C 2 494  ? -18.317 -3.584  28.710  1.00 34.41  ?  494  ILE C CA    1 
ATOM   7123  C  C     . ILE C 2 494  ? -19.043 -4.256  29.866  1.00 34.00  ?  494  ILE C C     1 
ATOM   7124  O  O     . ILE C 2 494  ? -18.505 -5.157  30.525  1.00 33.73  ?  494  ILE C O     1 
ATOM   7125  C  CB    . ILE C 2 494  ? -18.276 -4.484  27.465  1.00 34.19  ?  494  ILE C CB    1 
ATOM   7126  C  CG1   . ILE C 2 494  ? -19.683 -4.971  27.112  1.00 33.78  ?  494  ILE C CG1   1 
ATOM   7127  C  CG2   . ILE C 2 494  ? -17.319 -5.652  27.666  1.00 38.77  ?  494  ILE C CG2   1 
ATOM   7128  C  CD1   . ILE C 2 494  ? -19.742 -5.802  25.853  1.00 39.81  ?  494  ILE C CD1   1 
ATOM   7129  N  N     . GLY C 2 495  ? -20.267 -3.807  30.132  1.00 29.49  ?  495  GLY C N     1 
ATOM   7130  C  CA    . GLY C 2 495  ? -21.069 -4.373  31.198  1.00 36.93  ?  495  GLY C CA    1 
ATOM   7131  C  C     . GLY C 2 495  ? -20.739 -3.811  32.566  1.00 28.83  ?  495  GLY C C     1 
ATOM   7132  O  O     . GLY C 2 495  ? -21.606 -3.739  33.442  1.00 32.24  ?  495  GLY C O     1 
ATOM   7133  N  N     . LEU C 2 496  ? -19.482 -3.412  32.762  1.00 34.44  ?  496  LEU C N     1 
ATOM   7134  C  CA    . LEU C 2 496  ? -19.074 -2.842  34.039  1.00 33.24  ?  496  LEU C CA    1 
ATOM   7135  C  C     . LEU C 2 496  ? -19.579 -1.418  34.223  1.00 33.44  ?  496  LEU C C     1 
ATOM   7136  O  O     . LEU C 2 496  ? -19.649 -0.940  35.360  1.00 37.40  ?  496  LEU C O     1 
ATOM   7137  C  CB    . LEU C 2 496  ? -17.550 -2.878  34.164  1.00 33.33  ?  496  LEU C CB    1 
ATOM   7138  C  CG    . LEU C 2 496  ? -16.897 -4.252  33.997  1.00 31.61  ?  496  LEU C CG    1 
ATOM   7139  C  CD1   . LEU C 2 496  ? -15.385 -4.143  34.108  1.00 37.77  ?  496  LEU C CD1   1 
ATOM   7140  C  CD2   . LEU C 2 496  ? -17.443 -5.239  35.018  1.00 30.43  ?  496  LEU C CD2   1 
ATOM   7141  N  N     . ILE C 2 497  ? -19.927 -0.732  33.136  1.00 25.57  ?  497  ILE C N     1 
ATOM   7142  C  CA    . ILE C 2 497  ? -20.431 0.635   33.185  1.00 22.64  ?  497  ILE C CA    1 
ATOM   7143  C  C     . ILE C 2 497  ? -21.735 0.680   32.404  1.00 23.24  ?  497  ILE C C     1 
ATOM   7144  O  O     . ILE C 2 497  ? -21.759 0.355   31.211  1.00 26.68  ?  497  ILE C O     1 
ATOM   7145  C  CB    . ILE C 2 497  ? -19.424 1.645   32.610  1.00 23.70  ?  497  ILE C CB    1 
ATOM   7146  C  CG1   . ILE C 2 497  ? -18.060 1.485   33.283  1.00 30.21  ?  497  ILE C CG1   1 
ATOM   7147  C  CG2   . ILE C 2 497  ? -19.941 3.065   32.784  1.00 22.03  ?  497  ILE C CG2   1 
ATOM   7148  C  CD1   . ILE C 2 497  ? -16.970 2.323   32.656  1.00 40.82  ?  497  ILE C CD1   1 
ATOM   7149  N  N     . GLY C 2 498  ? -22.818 1.080   33.075  1.00 21.18  ?  498  GLY C N     1 
ATOM   7150  C  CA    . GLY C 2 498  ? -24.115 1.194   32.452  1.00 24.65  ?  498  GLY C CA    1 
ATOM   7151  C  C     . GLY C 2 498  ? -24.697 2.587   32.639  1.00 21.52  ?  498  GLY C C     1 
ATOM   7152  O  O     . GLY C 2 498  ? -24.173 3.416   33.393  1.00 25.39  ?  498  GLY C O     1 
ATOM   7153  N  N     . SER C 2 499  ? -25.794 2.834   31.932  1.00 19.13  ?  499  SER C N     1 
ATOM   7154  C  CA    . SER C 2 499  ? -26.525 4.089   32.022  1.00 22.52  ?  499  SER C CA    1 
ATOM   7155  C  C     . SER C 2 499  ? -27.882 3.829   32.659  1.00 22.24  ?  499  SER C C     1 
ATOM   7156  O  O     . SER C 2 499  ? -28.562 2.860   32.305  1.00 26.46  ?  499  SER C O     1 
ATOM   7157  C  CB    . SER C 2 499  ? -26.694 4.726   30.639  1.00 32.13  ?  499  SER C CB    1 
ATOM   7158  O  OG    . SER C 2 499  ? -27.231 6.034   30.737  1.00 37.39  ?  499  SER C OG    1 
ATOM   7159  N  N     . LEU C 2 500  ? -28.263 4.684   33.603  1.00 20.53  ?  500  LEU C N     1 
ATOM   7160  C  CA    . LEU C 2 500  ? -29.552 4.535   34.264  1.00 22.16  ?  500  LEU C CA    1 
ATOM   7161  C  C     . LEU C 2 500  ? -30.683 4.679   33.254  1.00 25.92  ?  500  LEU C C     1 
ATOM   7162  O  O     . LEU C 2 500  ? -30.639 5.536   32.367  1.00 34.45  ?  500  LEU C O     1 
ATOM   7163  C  CB    . LEU C 2 500  ? -29.706 5.575   35.371  1.00 25.23  ?  500  LEU C CB    1 
ATOM   7164  C  CG    . LEU C 2 500  ? -30.971 5.449   36.224  1.00 28.87  ?  500  LEU C CG    1 
ATOM   7165  C  CD1   . LEU C 2 500  ? -30.725 4.546   37.424  1.00 21.18  ?  500  LEU C CD1   1 
ATOM   7166  C  CD2   . LEU C 2 500  ? -31.481 6.812   36.658  1.00 20.69  ?  500  LEU C CD2   1 
ATOM   7167  N  N     . SER C 2 501  ? -31.699 3.830   33.392  1.00 31.07  ?  501  SER C N     1 
ATOM   7168  C  CA    . SER C 2 501  ? -32.859 3.911   32.520  1.00 29.88  ?  501  SER C CA    1 
ATOM   7169  C  C     . SER C 2 501  ? -33.551 5.263   32.679  1.00 30.35  ?  501  SER C C     1 
ATOM   7170  O  O     . SER C 2 501  ? -33.350 5.985   33.661  1.00 37.10  ?  501  SER C O     1 
ATOM   7171  C  CB    . SER C 2 501  ? -33.835 2.773   32.817  1.00 31.84  ?  501  SER C CB    1 
ATOM   7172  O  OG    . SER C 2 501  ? -33.276 1.520   32.463  1.00 38.31  ?  501  SER C OG    1 
ATOM   7173  N  N     . VAL C 2 502  ? -34.377 5.599   31.687  1.00 27.97  ?  502  VAL C N     1 
ATOM   7174  C  CA    . VAL C 2 502  ? -34.970 6.935   31.615  1.00 35.23  ?  502  VAL C CA    1 
ATOM   7175  C  C     . VAL C 2 502  ? -35.797 7.224   32.862  1.00 41.15  ?  502  VAL C C     1 
ATOM   7176  O  O     . VAL C 2 502  ? -35.513 8.162   33.616  1.00 39.37  ?  502  VAL C O     1 
ATOM   7177  C  CB    . VAL C 2 502  ? -35.812 7.081   30.336  1.00 37.04  ?  502  VAL C CB    1 
ATOM   7178  C  CG1   . VAL C 2 502  ? -36.552 8.409   30.339  1.00 39.47  ?  502  VAL C CG1   1 
ATOM   7179  C  CG2   . VAL C 2 502  ? -34.928 6.963   29.105  1.00 40.67  ?  502  VAL C CG2   1 
ATOM   7180  N  N     . TYR C 2 503  ? -36.830 6.420   33.099  1.00 32.79  ?  503  TYR C N     1 
ATOM   7181  C  CA    . TYR C 2 503  ? -37.748 6.671   34.202  1.00 30.75  ?  503  TYR C CA    1 
ATOM   7182  C  C     . TYR C 2 503  ? -37.235 6.164   35.544  1.00 31.68  ?  503  TYR C C     1 
ATOM   7183  O  O     . TYR C 2 503  ? -37.931 6.326   36.552  1.00 27.19  ?  503  TYR C O     1 
ATOM   7184  C  CB    . TYR C 2 503  ? -39.108 6.036   33.903  1.00 29.13  ?  503  TYR C CB    1 
ATOM   7185  C  CG    . TYR C 2 503  ? -39.743 6.527   32.624  1.00 26.68  ?  503  TYR C CG    1 
ATOM   7186  C  CD1   . TYR C 2 503  ? -40.339 7.779   32.559  1.00 28.95  ?  503  TYR C CD1   1 
ATOM   7187  C  CD2   . TYR C 2 503  ? -39.752 5.737   31.482  1.00 31.07  ?  503  TYR C CD2   1 
ATOM   7188  C  CE1   . TYR C 2 503  ? -40.924 8.232   31.394  1.00 37.02  ?  503  TYR C CE1   1 
ATOM   7189  C  CE2   . TYR C 2 503  ? -40.334 6.183   30.311  1.00 37.24  ?  503  TYR C CE2   1 
ATOM   7190  C  CZ    . TYR C 2 503  ? -40.919 7.431   30.273  1.00 41.50  ?  503  TYR C CZ    1 
ATOM   7191  O  OH    . TYR C 2 503  ? -41.501 7.881   29.111  1.00 35.06  ?  503  TYR C OH    1 
ATOM   7192  N  N     . ALA C 2 504  ? -36.047 5.569   35.587  1.00 36.47  ?  504  ALA C N     1 
ATOM   7193  C  CA    . ALA C 2 504  ? -35.556 4.975   36.819  1.00 30.10  ?  504  ALA C CA    1 
ATOM   7194  C  C     . ALA C 2 504  ? -35.142 6.050   37.822  1.00 34.70  ?  504  ALA C C     1 
ATOM   7195  O  O     . ALA C 2 504  ? -34.844 7.194   37.468  1.00 41.71  ?  504  ALA C O     1 
ATOM   7196  C  CB    . ALA C 2 504  ? -34.378 4.044   36.533  1.00 26.89  ?  504  ALA C CB    1 
ATOM   7197  N  N     . ARG C 2 505  ? -35.132 5.661   39.095  1.00 34.35  ?  505  ARG C N     1 
ATOM   7198  C  CA    . ARG C 2 505  ? -34.687 6.530   40.174  1.00 32.67  ?  505  ARG C CA    1 
ATOM   7199  C  C     . ARG C 2 505  ? -34.112 5.659   41.282  1.00 32.65  ?  505  ARG C C     1 
ATOM   7200  O  O     . ARG C 2 505  ? -34.225 4.432   41.256  1.00 32.50  ?  505  ARG C O     1 
ATOM   7201  C  CB    . ARG C 2 505  ? -35.828 7.405   40.705  1.00 32.24  ?  505  ARG C CB    1 
ATOM   7202  C  CG    . ARG C 2 505  ? -36.830 6.655   41.566  1.00 38.68  ?  505  ARG C CG    1 
ATOM   7203  C  CD    . ARG C 2 505  ? -37.922 7.579   42.076  1.00 49.92  ?  505  ARG C CD    1 
ATOM   7204  N  NE    . ARG C 2 505  ? -38.834 6.891   42.985  1.00 52.17  ?  505  ARG C NE    1 
ATOM   7205  C  CZ    . ARG C 2 505  ? -39.932 7.437   43.495  1.00 50.91  ?  505  ARG C CZ    1 
ATOM   7206  N  NH1   . ARG C 2 505  ? -40.262 8.683   43.183  1.00 49.26  ?  505  ARG C NH1   1 
ATOM   7207  N  NH2   . ARG C 2 505  ? -40.704 6.737   44.316  1.00 50.40  ?  505  ARG C NH2   1 
ATOM   7208  N  N     . VAL C 2 506  ? -33.495 6.309   42.265  1.00 26.94  ?  506  VAL C N     1 
ATOM   7209  C  CA    . VAL C 2 506  ? -32.839 5.627   43.374  1.00 32.58  ?  506  VAL C CA    1 
ATOM   7210  C  C     . VAL C 2 506  ? -33.566 5.983   44.662  1.00 38.09  ?  506  VAL C C     1 
ATOM   7211  O  O     . VAL C 2 506  ? -33.873 7.157   44.904  1.00 41.21  ?  506  VAL C O     1 
ATOM   7212  C  CB    . VAL C 2 506  ? -31.348 6.000   43.469  1.00 29.91  ?  506  VAL C CB    1 
ATOM   7213  C  CG1   . VAL C 2 506  ? -30.593 4.967   44.292  1.00 36.13  ?  506  VAL C CG1   1 
ATOM   7214  C  CG2   . VAL C 2 506  ? -30.742 6.140   42.081  1.00 21.74  ?  506  VAL C CG2   1 
ATOM   7215  N  N     . ASN C 2 507  ? -33.843 4.971   45.485  1.00 44.23  ?  507  ASN C N     1 
ATOM   7216  C  CA    . ASN C 2 507  ? -34.450 5.181   46.789  1.00 46.78  ?  507  ASN C CA    1 
ATOM   7217  C  C     . ASN C 2 507  ? -33.378 5.480   47.830  1.00 46.29  ?  507  ASN C C     1 
ATOM   7218  O  O     . ASN C 2 507  ? -32.188 5.245   47.593  1.00 43.25  ?  507  ASN C O     1 
ATOM   7219  C  CB    . ASN C 2 507  ? -35.269 3.951   47.192  1.00 46.28  ?  507  ASN C CB    1 
ATOM   7220  C  CG    . ASN C 2 507  ? -34.471 2.657   47.135  1.00 50.10  ?  507  ASN C CG    1 
ATOM   7221  O  OD1   . ASN C 2 507  ? -33.241 2.664   47.103  1.00 52.16  ?  507  ASN C OD1   1 
ATOM   7222  N  ND2   . ASN C 2 507  ? -35.179 1.533   47.129  1.00 51.47  ?  507  ASN C ND2   1 
ATOM   7223  N  N     . PRO C 2 508  ? -33.760 6.015   48.995  1.00 52.69  ?  508  PRO C N     1 
ATOM   7224  C  CA    . PRO C 2 508  ? -32.756 6.306   50.035  1.00 57.33  ?  508  PRO C CA    1 
ATOM   7225  C  C     . PRO C 2 508  ? -31.980 5.088   50.518  1.00 60.03  ?  508  PRO C C     1 
ATOM   7226  O  O     . PRO C 2 508  ? -31.017 5.260   51.277  1.00 65.41  ?  508  PRO C O     1 
ATOM   7227  C  CB    . PRO C 2 508  ? -33.593 6.910   51.169  1.00 53.92  ?  508  PRO C CB    1 
ATOM   7228  C  CG    . PRO C 2 508  ? -34.761 7.513   50.478  1.00 65.02  ?  508  PRO C CG    1 
ATOM   7229  C  CD    . PRO C 2 508  ? -35.075 6.587   49.336  1.00 52.28  ?  508  PRO C CD    1 
ATOM   7230  N  N     . PHE C 2 509  ? -32.357 3.874   50.114  1.00 56.78  ?  509  PHE C N     1 
ATOM   7231  C  CA    . PHE C 2 509  ? -31.594 2.696   50.513  1.00 64.64  ?  509  PHE C CA    1 
ATOM   7232  C  C     . PHE C 2 509  ? -30.418 2.441   49.578  1.00 61.72  ?  509  PHE C C     1 
ATOM   7233  O  O     . PHE C 2 509  ? -29.339 2.042   50.030  1.00 64.70  ?  509  PHE C O     1 
ATOM   7234  C  CB    . PHE C 2 509  ? -32.505 1.471   50.565  1.00 77.26  ?  509  PHE C CB    1 
ATOM   7235  C  CG    . PHE C 2 509  ? -33.228 1.308   51.873  1.00 86.67  ?  509  PHE C CG    1 
ATOM   7236  C  CD1   . PHE C 2 509  ? -32.816 2.001   53.001  1.00 77.11  ?  509  PHE C CD1   1 
ATOM   7237  C  CD2   . PHE C 2 509  ? -34.313 0.457   51.977  1.00 89.60  ?  509  PHE C CD2   1 
ATOM   7238  C  CE1   . PHE C 2 509  ? -33.478 1.849   54.207  1.00 81.18  ?  509  PHE C CE1   1 
ATOM   7239  C  CE2   . PHE C 2 509  ? -34.980 0.300   53.177  1.00 91.95  ?  509  PHE C CE2   1 
ATOM   7240  C  CZ    . PHE C 2 509  ? -34.562 0.997   54.294  1.00 92.15  ?  509  PHE C CZ    1 
ATOM   7241  N  N     . GLY C 2 510  ? -30.603 2.664   48.279  1.00 54.29  ?  510  GLY C N     1 
ATOM   7242  C  CA    . GLY C 2 510  ? -29.538 2.443   47.319  1.00 53.25  ?  510  GLY C CA    1 
ATOM   7243  C  C     . GLY C 2 510  ? -29.980 1.628   46.121  1.00 52.15  ?  510  GLY C C     1 
ATOM   7244  O  O     . GLY C 2 510  ? -29.242 1.507   45.139  1.00 42.75  ?  510  GLY C O     1 
ATOM   7245  N  N     . PHE C 2 511  ? -31.180 1.063   46.190  1.00 59.85  ?  511  PHE C N     1 
ATOM   7246  C  CA    . PHE C 2 511  ? -31.721 0.284   45.088  1.00 55.07  ?  511  PHE C CA    1 
ATOM   7247  C  C     . PHE C 2 511  ? -32.406 1.199   44.077  1.00 48.27  ?  511  PHE C C     1 
ATOM   7248  O  O     . PHE C 2 511  ? -32.744 2.349   44.369  1.00 45.05  ?  511  PHE C O     1 
ATOM   7249  C  CB    . PHE C 2 511  ? -32.702 -0.771  45.602  1.00 59.55  ?  511  PHE C CB    1 
ATOM   7250  C  CG    . PHE C 2 511  ? -32.170 -1.584  46.748  1.00 62.90  ?  511  PHE C CG    1 
ATOM   7251  C  CD1   . PHE C 2 511  ? -31.093 -2.436  46.569  1.00 54.49  ?  511  PHE C CD1   1 
ATOM   7252  C  CD2   . PHE C 2 511  ? -32.748 -1.497  48.003  1.00 65.76  ?  511  PHE C CD2   1 
ATOM   7253  C  CE1   . PHE C 2 511  ? -30.599 -3.183  47.621  1.00 56.96  ?  511  PHE C CE1   1 
ATOM   7254  C  CE2   . PHE C 2 511  ? -32.261 -2.244  49.058  1.00 67.41  ?  511  PHE C CE2   1 
ATOM   7255  C  CZ    . PHE C 2 511  ? -31.185 -3.089  48.866  1.00 67.50  ?  511  PHE C CZ    1 
ATOM   7256  N  N     . ILE C 2 512  ? -32.605 0.673   42.872  1.00 35.30  ?  512  ILE C N     1 
ATOM   7257  C  CA    . ILE C 2 512  ? -33.172 1.435   41.766  1.00 33.66  ?  512  ILE C CA    1 
ATOM   7258  C  C     . ILE C 2 512  ? -34.645 1.080   41.625  1.00 31.35  ?  512  ILE C C     1 
ATOM   7259  O  O     . ILE C 2 512  ? -35.004 -0.102  41.551  1.00 32.95  ?  512  ILE C O     1 
ATOM   7260  C  CB    . ILE C 2 512  ? -32.410 1.169   40.458  1.00 33.98  ?  512  ILE C CB    1 
ATOM   7261  C  CG1   . ILE C 2 512  ? -30.921 1.469   40.644  1.00 27.65  ?  512  ILE C CG1   1 
ATOM   7262  C  CG2   . ILE C 2 512  ? -32.981 2.012   39.330  1.00 33.25  ?  512  ILE C CG2   1 
ATOM   7263  C  CD1   . ILE C 2 512  ? -30.095 1.263   39.395  1.00 34.46  ?  512  ILE C CD1   1 
ATOM   7264  N  N     . GLU C 2 513  ? -35.496 2.101   41.589  1.00 31.07  ?  513  GLU C N     1 
ATOM   7265  C  CA    . GLU C 2 513  ? -36.933 1.934   41.439  1.00 37.88  ?  513  GLU C CA    1 
ATOM   7266  C  C     . GLU C 2 513  ? -37.366 2.330   40.033  1.00 39.36  ?  513  GLU C C     1 
ATOM   7267  O  O     . GLU C 2 513  ? -36.789 3.232   39.418  1.00 37.62  ?  513  GLU C O     1 
ATOM   7268  C  CB    . GLU C 2 513  ? -37.696 2.773   42.467  1.00 43.80  ?  513  GLU C CB    1 
ATOM   7269  C  CG    . GLU C 2 513  ? -37.425 2.395   43.912  1.00 50.88  ?  513  GLU C CG    1 
ATOM   7270  C  CD    . GLU C 2 513  ? -38.168 3.281   44.891  1.00 59.31  ?  513  GLU C CD    1 
ATOM   7271  O  OE1   . GLU C 2 513  ? -38.689 4.333   44.464  1.00 51.45  ?  513  GLU C OE1   1 
ATOM   7272  O  OE2   . GLU C 2 513  ? -38.234 2.925   46.086  1.00 59.00  ?  513  GLU C OE2   1 
ATOM   7273  N  N     . THR C 2 514  ? -38.392 1.646   39.530  1.00 36.40  ?  514  THR C N     1 
ATOM   7274  C  CA    . THR C 2 514  ? -38.968 1.943   38.229  1.00 34.56  ?  514  THR C CA    1 
ATOM   7275  C  C     . THR C 2 514  ? -40.484 2.032   38.349  1.00 39.04  ?  514  THR C C     1 
ATOM   7276  O  O     . THR C 2 514  ? -41.101 1.229   39.060  1.00 44.08  ?  514  THR C O     1 
ATOM   7277  C  CB    . THR C 2 514  ? -38.581 0.878   37.190  1.00 35.28  ?  514  THR C CB    1 
ATOM   7278  O  OG1   . THR C 2 514  ? -39.351 1.064   35.996  1.00 34.89  ?  514  THR C OG1   1 
ATOM   7279  C  CG2   . THR C 2 514  ? -38.815 -0.525  37.736  1.00 40.73  ?  514  THR C CG2   1 
ATOM   7280  N  N     . PRO C 2 515  ? -41.109 2.995   37.679  1.00 39.22  ?  515  PRO C N     1 
ATOM   7281  C  CA    . PRO C 2 515  ? -42.550 3.203   37.851  1.00 45.28  ?  515  PRO C CA    1 
ATOM   7282  C  C     . PRO C 2 515  ? -43.382 2.182   37.088  1.00 47.83  ?  515  PRO C C     1 
ATOM   7283  O  O     . PRO C 2 515  ? -42.948 1.588   36.099  1.00 51.53  ?  515  PRO C O     1 
ATOM   7284  C  CB    . PRO C 2 515  ? -42.767 4.613   37.292  1.00 50.07  ?  515  PRO C CB    1 
ATOM   7285  C  CG    . PRO C 2 515  ? -41.703 4.758   36.261  1.00 43.32  ?  515  PRO C CG    1 
ATOM   7286  C  CD    . PRO C 2 515  ? -40.508 4.001   36.785  1.00 41.81  ?  515  PRO C CD    1 
ATOM   7287  N  N     . TYR C 2 516  ? -44.606 1.992   37.576  1.00 58.01  ?  516  TYR C N     1 
ATOM   7288  C  CA    . TYR C 2 516  ? -45.570 1.096   36.952  1.00 56.19  ?  516  TYR C CA    1 
ATOM   7289  C  C     . TYR C 2 516  ? -46.974 1.626   37.202  1.00 66.47  ?  516  TYR C C     1 
ATOM   7290  O  O     . TYR C 2 516  ? -47.229 2.298   38.204  1.00 70.85  ?  516  TYR C O     1 
ATOM   7291  C  CB    . TYR C 2 516  ? -45.455 -0.337  37.489  1.00 50.05  ?  516  TYR C CB    1 
ATOM   7292  C  CG    . TYR C 2 516  ? -44.198 -1.065  37.075  1.00 55.10  ?  516  TYR C CG    1 
ATOM   7293  C  CD1   . TYR C 2 516  ? -44.012 -1.476  35.762  1.00 60.67  ?  516  TYR C CD1   1 
ATOM   7294  C  CD2   . TYR C 2 516  ? -43.204 -1.357  38.000  1.00 46.81  ?  516  TYR C CD2   1 
ATOM   7295  C  CE1   . TYR C 2 516  ? -42.867 -2.146  35.379  1.00 55.72  ?  516  TYR C CE1   1 
ATOM   7296  C  CE2   . TYR C 2 516  ? -42.055 -2.029  37.626  1.00 45.77  ?  516  TYR C CE2   1 
ATOM   7297  C  CZ    . TYR C 2 516  ? -41.892 -2.421  36.314  1.00 50.71  ?  516  TYR C CZ    1 
ATOM   7298  O  OH    . TYR C 2 516  ? -40.752 -3.089  35.933  1.00 51.57  ?  516  TYR C OH    1 
ATOM   7299  N  N     . ARG C 2 517  ? -47.882 1.315   36.280  1.00 72.52  ?  517  ARG C N     1 
ATOM   7300  C  CA    . ARG C 2 517  ? -49.293 1.645   36.439  1.00 75.50  ?  517  ARG C CA    1 
ATOM   7301  C  C     . ARG C 2 517  ? -50.004 0.474   37.104  1.00 85.50  ?  517  ARG C C     1 
ATOM   7302  O  O     . ARG C 2 517  ? -50.022 -0.637  36.563  1.00 85.64  ?  517  ARG C O     1 
ATOM   7303  C  CB    . ARG C 2 517  ? -49.937 1.972   35.092  1.00 74.21  ?  517  ARG C CB    1 
ATOM   7304  C  CG    . ARG C 2 517  ? -49.780 3.422   34.667  1.00 82.58  ?  517  ARG C CG    1 
ATOM   7305  C  CD    . ARG C 2 517  ? -50.723 3.777   33.526  1.00 75.64  ?  517  ARG C CD    1 
ATOM   7306  N  NE    . ARG C 2 517  ? -50.381 3.081   32.289  1.00 79.33  ?  517  ARG C NE    1 
ATOM   7307  C  CZ    . ARG C 2 517  ? -50.988 3.288   31.124  1.00 85.32  ?  517  ARG C CZ    1 
ATOM   7308  N  NH1   . ARG C 2 517  ? -51.971 4.173   31.034  1.00 85.09  ?  517  ARG C NH1   1 
ATOM   7309  N  NH2   . ARG C 2 517  ? -50.610 2.611   30.048  1.00 81.64  ?  517  ARG C NH2   1 
ATOM   7310  N  N     . LYS C 2 518  ? -50.591 0.723   38.272  1.00 88.82  ?  518  LYS C N     1 
ATOM   7311  C  CA    . LYS C 2 518  ? -51.230 -0.342  39.035  1.00 89.93  ?  518  LYS C CA    1 
ATOM   7312  C  C     . LYS C 2 518  ? -52.545 -0.745  38.378  1.00 93.52  ?  518  LYS C C     1 
ATOM   7313  O  O     . LYS C 2 518  ? -53.428 0.093   38.169  1.00 94.20  ?  518  LYS C O     1 
ATOM   7314  C  CB    . LYS C 2 518  ? -51.462 0.103   40.476  1.00 92.48  ?  518  LYS C CB    1 
ATOM   7315  C  CG    . LYS C 2 518  ? -52.059 -0.978  41.362  1.00 92.94  ?  518  LYS C CG    1 
ATOM   7316  C  CD    . LYS C 2 518  ? -51.950 -0.619  42.834  1.00 86.80  ?  518  LYS C CD    1 
ATOM   7317  C  CE    . LYS C 2 518  ? -52.447 -1.756  43.713  1.00 93.06  ?  518  LYS C CE    1 
ATOM   7318  N  NZ    . LYS C 2 518  ? -52.212 -1.491  45.160  1.00 94.62  ?  518  LYS C NZ    1 
ATOM   7319  N  N     . VAL C 2 519  ? -52.671 -2.027  38.053  1.00 102.16 ?  519  VAL C N     1 
ATOM   7320  C  CA    . VAL C 2 519  ? -53.888 -2.585  37.476  1.00 104.38 ?  519  VAL C CA    1 
ATOM   7321  C  C     . VAL C 2 519  ? -54.646 -3.296  38.588  1.00 105.74 ?  519  VAL C C     1 
ATOM   7322  O  O     . VAL C 2 519  ? -54.161 -4.287  39.147  1.00 103.15 ?  519  VAL C O     1 
ATOM   7323  C  CB    . VAL C 2 519  ? -53.574 -3.541  36.314  1.00 96.99  ?  519  VAL C CB    1 
ATOM   7324  C  CG1   . VAL C 2 519  ? -54.841 -4.230  35.837  1.00 103.13 ?  519  VAL C CG1   1 
ATOM   7325  C  CG2   . VAL C 2 519  ? -52.912 -2.784  35.172  1.00 96.17  ?  519  VAL C CG2   1 
ATOM   7326  N  N     . VAL C 2 520  ? -55.834 -2.789  38.914  1.00 108.70 ?  520  VAL C N     1 
ATOM   7327  C  CA    . VAL C 2 520  ? -56.632 -3.318  40.015  1.00 111.73 ?  520  VAL C CA    1 
ATOM   7328  C  C     . VAL C 2 520  ? -57.141 -4.709  39.663  1.00 123.41 ?  520  VAL C C     1 
ATOM   7329  O  O     . VAL C 2 520  ? -56.613 -5.717  40.147  1.00 124.76 ?  520  VAL C O     1 
ATOM   7330  C  CB    . VAL C 2 520  ? -57.799 -2.373  40.360  1.00 101.68 ?  520  VAL C CB    1 
ATOM   7331  C  CG1   . VAL C 2 520  ? -58.605 -2.925  41.528  1.00 97.87  ?  520  VAL C CG1   1 
ATOM   7332  C  CG2   . VAL C 2 520  ? -57.276 -0.981  40.680  1.00 98.12  ?  520  VAL C CG2   1 
ATOM   7333  N  N     . ASP C 2 521  ? -58.179 -4.776  38.820  1.00 131.38 ?  521  ASP C N     1 
ATOM   7334  C  CA    . ASP C 2 521  ? -58.781 -6.040  38.386  1.00 122.73 ?  521  ASP C CA    1 
ATOM   7335  C  C     . ASP C 2 521  ? -58.940 -5.980  36.869  1.00 122.04 ?  521  ASP C C     1 
ATOM   7336  O  O     . ASP C 2 521  ? -60.039 -5.771  36.349  1.00 124.88 ?  521  ASP C O     1 
ATOM   7337  C  CB    . ASP C 2 521  ? -60.115 -6.293  39.089  1.00 126.95 ?  521  ASP C CB    1 
ATOM   7338  C  CG    . ASP C 2 521  ? -59.948 -7.013  40.411  1.00 133.94 ?  521  ASP C CG    1 
ATOM   7339  O  OD1   . ASP C 2 521  ? -59.053 -7.880  40.505  1.00 140.20 ?  521  ASP C OD1   1 
ATOM   7340  O  OD2   . ASP C 2 521  ? -60.708 -6.713  41.354  1.00 127.39 ?  521  ASP C OD2   1 
ATOM   7341  N  N     . GLY C 2 522  ? -57.832 -6.173  36.157  1.00 109.69 ?  522  GLY C N     1 
ATOM   7342  C  CA    . GLY C 2 522  ? -57.853 -6.045  34.712  1.00 109.14 ?  522  GLY C CA    1 
ATOM   7343  C  C     . GLY C 2 522  ? -58.260 -4.671  34.236  1.00 109.84 ?  522  GLY C C     1 
ATOM   7344  O  O     . GLY C 2 522  ? -58.775 -4.533  33.123  1.00 104.65 ?  522  GLY C O     1 
ATOM   7345  N  N     . VAL C 2 523  ? -58.048 -3.646  35.058  1.00 115.57 ?  523  VAL C N     1 
ATOM   7346  C  CA    . VAL C 2 523  ? -58.439 -2.276  34.749  1.00 111.81 ?  523  VAL C CA    1 
ATOM   7347  C  C     . VAL C 2 523  ? -57.213 -1.391  34.906  1.00 114.94 ?  523  VAL C C     1 
ATOM   7348  O  O     . VAL C 2 523  ? -56.637 -1.311  35.998  1.00 111.33 ?  523  VAL C O     1 
ATOM   7349  C  CB    . VAL C 2 523  ? -59.579 -1.783  35.655  1.00 111.89 ?  523  VAL C CB    1 
ATOM   7350  C  CG1   . VAL C 2 523  ? -59.868 -0.315  35.391  1.00 113.22 ?  523  VAL C CG1   1 
ATOM   7351  C  CG2   . VAL C 2 523  ? -60.829 -2.625  35.445  1.00 115.42 ?  523  VAL C CG2   1 
ATOM   7352  N  N     . VAL C 2 524  ? -56.814 -0.729  33.821  1.00 105.94 ?  524  VAL C N     1 
ATOM   7353  C  CA    . VAL C 2 524  ? -55.665 0.164   33.867  1.00 101.74 ?  524  VAL C CA    1 
ATOM   7354  C  C     . VAL C 2 524  ? -56.026 1.416   34.651  1.00 104.65 ?  524  VAL C C     1 
ATOM   7355  O  O     . VAL C 2 524  ? -57.011 2.101   34.344  1.00 104.49 ?  524  VAL C O     1 
ATOM   7356  C  CB    . VAL C 2 524  ? -55.196 0.512   32.447  1.00 104.43 ?  524  VAL C CB    1 
ATOM   7357  C  CG1   . VAL C 2 524  ? -54.212 1.670   32.483  1.00 104.31 ?  524  VAL C CG1   1 
ATOM   7358  C  CG2   . VAL C 2 524  ? -54.568 -0.704  31.791  1.00 103.38 ?  524  VAL C CG2   1 
ATOM   7359  N  N     . SER C 2 525  ? -55.230 1.719   35.671  1.00 100.91 ?  525  SER C N     1 
ATOM   7360  C  CA    . SER C 2 525  ? -55.427 2.894   36.503  1.00 98.59  ?  525  SER C CA    1 
ATOM   7361  C  C     . SER C 2 525  ? -54.291 3.884   36.281  1.00 95.17  ?  525  SER C C     1 
ATOM   7362  O  O     . SER C 2 525  ? -53.155 3.498   35.990  1.00 97.39  ?  525  SER C O     1 
ATOM   7363  C  CB    . SER C 2 525  ? -55.499 2.514   37.985  1.00 95.96  ?  525  SER C CB    1 
ATOM   7364  O  OG    . SER C 2 525  ? -56.436 1.473   38.200  1.00 102.78 ?  525  SER C OG    1 
ATOM   7365  N  N     . ASP C 2 526  ? -54.611 5.168   36.418  1.00 89.98  ?  526  ASP C N     1 
ATOM   7366  C  CA    . ASP C 2 526  ? -53.605 6.217   36.328  1.00 87.29  ?  526  ASP C CA    1 
ATOM   7367  C  C     . ASP C 2 526  ? -52.769 6.340   37.595  1.00 88.24  ?  526  ASP C C     1 
ATOM   7368  O  O     . ASP C 2 526  ? -51.884 7.200   37.654  1.00 85.56  ?  526  ASP C O     1 
ATOM   7369  C  CB    . ASP C 2 526  ? -54.272 7.557   36.008  1.00 96.99  ?  526  ASP C CB    1 
ATOM   7370  C  CG    . ASP C 2 526  ? -54.969 7.551   34.661  1.00 107.71 ?  526  ASP C CG    1 
ATOM   7371  O  OD1   . ASP C 2 526  ? -54.485 6.853   33.744  1.00 103.64 ?  526  ASP C OD1   1 
ATOM   7372  O  OD2   . ASP C 2 526  ? -56.000 8.241   34.518  1.00 111.64 ?  526  ASP C OD2   1 
ATOM   7373  N  N     . GLU C 2 527  ? -53.029 5.509   38.602  1.00 93.65  ?  527  GLU C N     1 
ATOM   7374  C  CA    . GLU C 2 527  ? -52.202 5.493   39.799  1.00 91.61  ?  527  GLU C CA    1 
ATOM   7375  C  C     . GLU C 2 527  ? -50.869 4.820   39.496  1.00 83.75  ?  527  GLU C C     1 
ATOM   7376  O  O     . GLU C 2 527  ? -50.830 3.700   38.977  1.00 75.77  ?  527  GLU C O     1 
ATOM   7377  C  CB    . GLU C 2 527  ? -52.923 4.764   40.932  1.00 95.08  ?  527  GLU C CB    1 
ATOM   7378  C  CG    . GLU C 2 527  ? -52.131 4.677   42.226  1.00 94.05  ?  527  GLU C CG    1 
ATOM   7379  C  CD    . GLU C 2 527  ? -52.873 3.921   43.312  1.00 97.45  ?  527  GLU C CD    1 
ATOM   7380  O  OE1   . GLU C 2 527  ? -53.982 3.419   43.037  1.00 97.22  ?  527  GLU C OE1   1 
ATOM   7381  O  OE2   . GLU C 2 527  ? -52.347 3.830   44.442  1.00 100.66 ?  527  GLU C OE2   1 
ATOM   7382  N  N     . ILE C 2 528  ? -49.776 5.505   39.819  1.00 80.94  ?  528  ILE C N     1 
ATOM   7383  C  CA    . ILE C 2 528  ? -48.429 5.041   39.515  1.00 72.07  ?  528  ILE C CA    1 
ATOM   7384  C  C     . ILE C 2 528  ? -47.660 4.878   40.818  1.00 65.52  ?  528  ILE C C     1 
ATOM   7385  O  O     . ILE C 2 528  ? -47.741 5.731   41.709  1.00 65.37  ?  528  ILE C O     1 
ATOM   7386  C  CB    . ILE C 2 528  ? -47.702 6.013   38.563  1.00 64.74  ?  528  ILE C CB    1 
ATOM   7387  C  CG1   . ILE C 2 528  ? -48.518 6.201   37.282  1.00 71.40  ?  528  ILE C CG1   1 
ATOM   7388  C  CG2   . ILE C 2 528  ? -46.302 5.510   38.243  1.00 56.53  ?  528  ILE C CG2   1 
ATOM   7389  C  CD1   . ILE C 2 528  ? -47.946 7.226   36.335  1.00 73.11  ?  528  ILE C CD1   1 
ATOM   7390  N  N     . VAL C 2 529  ? -46.916 3.780   40.926  1.00 45.05  ?  529  VAL C N     1 
ATOM   7391  C  CA    . VAL C 2 529  ? -46.127 3.476   42.113  1.00 50.59  ?  529  VAL C CA    1 
ATOM   7392  C  C     . VAL C 2 529  ? -44.779 2.920   41.671  1.00 48.47  ?  529  VAL C C     1 
ATOM   7393  O  O     . VAL C 2 529  ? -44.693 2.176   40.688  1.00 43.26  ?  529  VAL C O     1 
ATOM   7394  C  CB    . VAL C 2 529  ? -46.867 2.488   43.043  1.00 49.53  ?  529  VAL C CB    1 
ATOM   7395  C  CG1   . VAL C 2 529  ? -47.210 1.204   42.303  1.00 49.47  ?  529  VAL C CG1   1 
ATOM   7396  C  CG2   . VAL C 2 529  ? -46.046 2.196   44.292  1.00 44.26  ?  529  VAL C CG2   1 
ATOM   7397  N  N     . TYR C 2 530  ? -43.724 3.301   42.387  1.00 53.35  ?  530  TYR C N     1 
ATOM   7398  C  CA    . TYR C 2 530  ? -42.375 2.834   42.097  1.00 45.19  ?  530  TYR C CA    1 
ATOM   7399  C  C     . TYR C 2 530  ? -42.087 1.563   42.886  1.00 49.59  ?  530  TYR C C     1 
ATOM   7400  O  O     . TYR C 2 530  ? -42.342 1.502   44.093  1.00 63.47  ?  530  TYR C O     1 
ATOM   7401  C  CB    . TYR C 2 530  ? -41.346 3.914   42.433  1.00 48.53  ?  530  TYR C CB    1 
ATOM   7402  C  CG    . TYR C 2 530  ? -41.284 5.042   41.426  1.00 48.85  ?  530  TYR C CG    1 
ATOM   7403  C  CD1   . TYR C 2 530  ? -42.275 6.015   41.379  1.00 45.30  ?  530  TYR C CD1   1 
ATOM   7404  C  CD2   . TYR C 2 530  ? -40.231 5.138   40.526  1.00 48.36  ?  530  TYR C CD2   1 
ATOM   7405  C  CE1   . TYR C 2 530  ? -42.221 7.047   40.460  1.00 44.08  ?  530  TYR C CE1   1 
ATOM   7406  C  CE2   . TYR C 2 530  ? -40.168 6.167   39.604  1.00 48.74  ?  530  TYR C CE2   1 
ATOM   7407  C  CZ    . TYR C 2 530  ? -41.165 7.118   39.575  1.00 50.20  ?  530  TYR C CZ    1 
ATOM   7408  O  OH    . TYR C 2 530  ? -41.108 8.144   38.660  1.00 60.99  ?  530  TYR C OH    1 
ATOM   7409  N  N     . LEU C 2 531  ? -41.555 0.553   42.202  1.00 47.66  ?  531  LEU C N     1 
ATOM   7410  C  CA    . LEU C 2 531  ? -41.235 -0.730  42.807  1.00 51.11  ?  531  LEU C CA    1 
ATOM   7411  C  C     . LEU C 2 531  ? -39.736 -0.983  42.725  1.00 52.93  ?  531  LEU C C     1 
ATOM   7412  O  O     . LEU C 2 531  ? -39.075 -0.587  41.760  1.00 44.91  ?  531  LEU C O     1 
ATOM   7413  C  CB    . LEU C 2 531  ? -41.986 -1.884  42.120  1.00 44.08  ?  531  LEU C CB    1 
ATOM   7414  C  CG    . LEU C 2 531  ? -43.495 -2.040  42.332  1.00 48.52  ?  531  LEU C CG    1 
ATOM   7415  C  CD1   . LEU C 2 531  ? -44.289 -0.988  41.569  1.00 58.23  ?  531  LEU C CD1   1 
ATOM   7416  C  CD2   . LEU C 2 531  ? -43.939 -3.439  41.930  1.00 58.26  ?  531  LEU C CD2   1 
ATOM   7417  N  N     . THR C 2 532  ? -39.204 -1.649  43.747  1.00 64.94  ?  532  THR C N     1 
ATOM   7418  C  CA    . THR C 2 532  ? -37.805 -2.041  43.739  1.00 58.92  ?  532  THR C CA    1 
ATOM   7419  C  C     . THR C 2 532  ? -37.641 -3.344  42.958  1.00 56.59  ?  532  THR C C     1 
ATOM   7420  O  O     . THR C 2 532  ? -38.600 -3.902  42.418  1.00 50.12  ?  532  THR C O     1 
ATOM   7421  C  CB    . THR C 2 532  ? -37.274 -2.182  45.164  1.00 57.73  ?  532  THR C CB    1 
ATOM   7422  O  OG1   . THR C 2 532  ? -37.707 -3.430  45.718  1.00 63.60  ?  532  THR C OG1   1 
ATOM   7423  C  CG2   . THR C 2 532  ? -37.783 -1.043  46.037  1.00 61.74  ?  532  THR C CG2   1 
ATOM   7424  N  N     . ALA C 2 533  ? -36.403 -3.838  42.896  1.00 62.56  ?  533  ALA C N     1 
ATOM   7425  C  CA    . ALA C 2 533  ? -36.121 -5.031  42.103  1.00 64.11  ?  533  ALA C CA    1 
ATOM   7426  C  C     . ALA C 2 533  ? -36.827 -6.255  42.674  1.00 67.79  ?  533  ALA C C     1 
ATOM   7427  O  O     . ALA C 2 533  ? -37.520 -6.979  41.949  1.00 66.51  ?  533  ALA C O     1 
ATOM   7428  C  CB    . ALA C 2 533  ? -34.614 -5.263  42.022  1.00 64.87  ?  533  ALA C CB    1 
ATOM   7429  N  N     . ASP C 2 534  ? -36.664 -6.505  43.976  1.00 64.65  ?  534  ASP C N     1 
ATOM   7430  C  CA    . ASP C 2 534  ? -37.334 -7.648  44.586  1.00 59.98  ?  534  ASP C CA    1 
ATOM   7431  C  C     . ASP C 2 534  ? -38.828 -7.399  44.759  1.00 60.38  ?  534  ASP C C     1 
ATOM   7432  O  O     . ASP C 2 534  ? -39.611 -8.355  44.801  1.00 62.71  ?  534  ASP C O     1 
ATOM   7433  C  CB    . ASP C 2 534  ? -36.687 -7.987  45.929  1.00 67.15  ?  534  ASP C CB    1 
ATOM   7434  C  CG    . ASP C 2 534  ? -36.363 -6.756  46.748  1.00 73.53  ?  534  ASP C CG    1 
ATOM   7435  O  OD1   . ASP C 2 534  ? -37.266 -5.916  46.944  1.00 68.84  ?  534  ASP C OD1   1 
ATOM   7436  O  OD2   . ASP C 2 534  ? -35.206 -6.632  47.204  1.00 79.85  ?  534  ASP C OD2   1 
ATOM   7437  N  N     . GLU C 2 535  ? -39.243 -6.133  44.863  1.00 63.21  ?  535  GLU C N     1 
ATOM   7438  C  CA    . GLU C 2 535  ? -40.670 -5.831  44.919  1.00 64.02  ?  535  GLU C CA    1 
ATOM   7439  C  C     . GLU C 2 535  ? -41.357 -6.133  43.594  1.00 70.66  ?  535  GLU C C     1 
ATOM   7440  O  O     . GLU C 2 535  ? -42.531 -6.522  43.580  1.00 75.55  ?  535  GLU C O     1 
ATOM   7441  C  CB    . GLU C 2 535  ? -40.890 -4.367  45.301  1.00 62.47  ?  535  GLU C CB    1 
ATOM   7442  C  CG    . GLU C 2 535  ? -40.618 -4.045  46.759  1.00 72.99  ?  535  GLU C CG    1 
ATOM   7443  C  CD    . GLU C 2 535  ? -40.885 -2.589  47.089  1.00 79.94  ?  535  GLU C CD    1 
ATOM   7444  O  OE1   . GLU C 2 535  ? -41.590 -1.920  46.304  1.00 68.86  ?  535  GLU C OE1   1 
ATOM   7445  O  OE2   . GLU C 2 535  ? -40.386 -2.112  48.129  1.00 86.81  ?  535  GLU C OE2   1 
ATOM   7446  N  N     . GLU C 2 536  ? -40.647 -5.959  42.478  1.00 55.10  ?  536  GLU C N     1 
ATOM   7447  C  CA    . GLU C 2 536  ? -41.226 -6.253  41.172  1.00 54.74  ?  536  GLU C CA    1 
ATOM   7448  C  C     . GLU C 2 536  ? -41.467 -7.746  40.986  1.00 66.05  ?  536  GLU C C     1 
ATOM   7449  O  O     . GLU C 2 536  ? -42.422 -8.139  40.305  1.00 73.64  ?  536  GLU C O     1 
ATOM   7450  C  CB    . GLU C 2 536  ? -40.314 -5.711  40.070  1.00 54.50  ?  536  GLU C CB    1 
ATOM   7451  C  CG    . GLU C 2 536  ? -40.749 -6.048  38.654  1.00 48.61  ?  536  GLU C CG    1 
ATOM   7452  C  CD    . GLU C 2 536  ? -39.829 -5.450  37.609  1.00 47.05  ?  536  GLU C CD    1 
ATOM   7453  O  OE1   . GLU C 2 536  ? -39.401 -4.289  37.785  1.00 34.78  ?  536  GLU C OE1   1 
ATOM   7454  O  OE2   . GLU C 2 536  ? -39.526 -6.142  36.615  1.00 57.56  ?  536  GLU C OE2   1 
ATOM   7455  N  N     . ASP C 2 537  ? -40.627 -8.590  41.590  1.00 58.36  ?  537  ASP C N     1 
ATOM   7456  C  CA    . ASP C 2 537  ? -40.778 -10.031 41.415  1.00 60.70  ?  537  ASP C CA    1 
ATOM   7457  C  C     . ASP C 2 537  ? -42.003 -10.569 42.144  1.00 63.99  ?  537  ASP C C     1 
ATOM   7458  O  O     . ASP C 2 537  ? -42.594 -11.562 41.703  1.00 70.34  ?  537  ASP C O     1 
ATOM   7459  C  CB    . ASP C 2 537  ? -39.518 -10.753 41.891  1.00 65.16  ?  537  ASP C CB    1 
ATOM   7460  C  CG    . ASP C 2 537  ? -38.295 -10.384 41.077  1.00 68.71  ?  537  ASP C CG    1 
ATOM   7461  O  OD1   . ASP C 2 537  ? -38.452 -10.065 39.879  1.00 67.42  ?  537  ASP C OD1   1 
ATOM   7462  O  OD2   . ASP C 2 537  ? -37.178 -10.410 41.634  1.00 66.08  ?  537  ASP C OD2   1 
ATOM   7463  N  N     . ARG C 2 538  ? -42.402 -9.937  43.249  1.00 72.92  ?  538  ARG C N     1 
ATOM   7464  C  CA    . ARG C 2 538  ? -43.579 -10.386 43.987  1.00 71.49  ?  538  ARG C CA    1 
ATOM   7465  C  C     . ARG C 2 538  ? -44.884 -10.087 43.262  1.00 71.81  ?  538  ARG C C     1 
ATOM   7466  O  O     . ARG C 2 538  ? -45.954 -10.397 43.798  1.00 74.79  ?  538  ARG C O     1 
ATOM   7467  C  CB    . ARG C 2 538  ? -43.601 -9.758  45.383  1.00 68.46  ?  538  ARG C CB    1 
ATOM   7468  C  CG    . ARG C 2 538  ? -42.553 -10.328 46.330  1.00 68.41  ?  538  ARG C CG    1 
ATOM   7469  C  CD    . ARG C 2 538  ? -42.781 -9.895  47.774  1.00 73.99  ?  538  ARG C CD    1 
ATOM   7470  N  NE    . ARG C 2 538  ? -42.509 -8.476  47.986  1.00 75.75  ?  538  ARG C NE    1 
ATOM   7471  C  CZ    . ARG C 2 538  ? -43.447 -7.540  48.092  1.00 82.67  ?  538  ARG C CZ    1 
ATOM   7472  N  NH1   . ARG C 2 538  ? -43.103 -6.274  48.285  1.00 82.18  ?  538  ARG C NH1   1 
ATOM   7473  N  NH2   . ARG C 2 538  ? -44.729 -7.870  48.009  1.00 86.38  ?  538  ARG C NH2   1 
ATOM   7474  N  N     . HIS C 2 539  ? -44.825 -9.497  42.070  1.00 66.35  ?  539  HIS C N     1 
ATOM   7475  C  CA    . HIS C 2 539  ? -45.998 -9.262  41.243  1.00 67.88  ?  539  HIS C CA    1 
ATOM   7476  C  C     . HIS C 2 539  ? -45.661 -9.661  39.813  1.00 70.31  ?  539  HIS C C     1 
ATOM   7477  O  O     . HIS C 2 539  ? -44.544 -10.095 39.512  1.00 70.97  ?  539  HIS C O     1 
ATOM   7478  C  CB    . HIS C 2 539  ? -46.449 -7.797  41.312  1.00 64.08  ?  539  HIS C CB    1 
ATOM   7479  C  CG    . HIS C 2 539  ? -46.630 -7.283  42.706  1.00 66.36  ?  539  HIS C CG    1 
ATOM   7480  N  ND1   . HIS C 2 539  ? -47.868 -7.148  43.296  1.00 67.52  ?  539  HIS C ND1   1 
ATOM   7481  C  CD2   . HIS C 2 539  ? -45.728 -6.866  43.626  1.00 69.00  ?  539  HIS C CD2   1 
ATOM   7482  C  CE1   . HIS C 2 539  ? -47.722 -6.672  44.520  1.00 68.90  ?  539  HIS C CE1   1 
ATOM   7483  N  NE2   . HIS C 2 539  ? -46.433 -6.492  44.745  1.00 64.53  ?  539  HIS C NE2   1 
ATOM   7484  N  N     . VAL C 2 540  ? -46.639 -9.515  38.924  1.00 62.59  ?  540  VAL C N     1 
ATOM   7485  C  CA    . VAL C 2 540  ? -46.442 -9.716  37.495  1.00 67.81  ?  540  VAL C CA    1 
ATOM   7486  C  C     . VAL C 2 540  ? -46.906 -8.460  36.774  1.00 74.89  ?  540  VAL C C     1 
ATOM   7487  O  O     . VAL C 2 540  ? -47.933 -7.871  37.130  1.00 76.74  ?  540  VAL C O     1 
ATOM   7488  C  CB    . VAL C 2 540  ? -47.187 -10.966 36.979  1.00 73.16  ?  540  VAL C CB    1 
ATOM   7489  C  CG1   . VAL C 2 540  ? -46.554 -12.230 37.543  1.00 76.27  ?  540  VAL C CG1   1 
ATOM   7490  C  CG2   . VAL C 2 540  ? -48.661 -10.904 37.337  1.00 77.04  ?  540  VAL C CG2   1 
ATOM   7491  N  N     . VAL C 2 541  ? -46.140 -8.039  35.772  1.00 83.02  ?  541  VAL C N     1 
ATOM   7492  C  CA    . VAL C 2 541  ? -46.379 -6.786  35.069  1.00 71.12  ?  541  VAL C CA    1 
ATOM   7493  C  C     . VAL C 2 541  ? -46.598 -7.076  33.591  1.00 70.78  ?  541  VAL C C     1 
ATOM   7494  O  O     . VAL C 2 541  ? -45.939 -7.947  33.012  1.00 75.03  ?  541  VAL C O     1 
ATOM   7495  C  CB    . VAL C 2 541  ? -45.213 -5.795  35.268  1.00 68.03  ?  541  VAL C CB    1 
ATOM   7496  C  CG1   . VAL C 2 541  ? -45.170 -5.315  36.707  1.00 71.94  ?  541  VAL C CG1   1 
ATOM   7497  C  CG2   . VAL C 2 541  ? -43.896 -6.446  34.894  1.00 68.57  ?  541  VAL C CG2   1 
ATOM   7498  N  N     . ALA C 2 542  ? -47.527 -6.344  32.986  1.00 80.48  ?  542  ALA C N     1 
ATOM   7499  C  CA    . ALA C 2 542  ? -47.844 -6.509  31.576  1.00 83.46  ?  542  ALA C CA    1 
ATOM   7500  C  C     . ALA C 2 542  ? -46.955 -5.616  30.721  1.00 77.09  ?  542  ALA C C     1 
ATOM   7501  O  O     . ALA C 2 542  ? -46.516 -4.546  31.152  1.00 75.59  ?  542  ALA C O     1 
ATOM   7502  C  CB    . ALA C 2 542  ? -49.315 -6.186  31.310  1.00 89.89  ?  542  ALA C CB    1 
ATOM   7503  N  N     . GLN C 2 543  ? -46.689 -6.072  29.499  1.00 72.52  ?  543  GLN C N     1 
ATOM   7504  C  CA    . GLN C 2 543  ? -45.883 -5.294  28.571  1.00 70.39  ?  543  GLN C CA    1 
ATOM   7505  C  C     . GLN C 2 543  ? -46.593 -3.988  28.227  1.00 75.29  ?  543  GLN C C     1 
ATOM   7506  O  O     . GLN C 2 543  ? -47.824 -3.901  28.245  1.00 82.70  ?  543  GLN C O     1 
ATOM   7507  C  CB    . GLN C 2 543  ? -45.602 -6.107  27.306  1.00 68.43  ?  543  GLN C CB    1 
ATOM   7508  C  CG    . GLN C 2 543  ? -44.489 -5.552  26.431  1.00 70.84  ?  543  GLN C CG    1 
ATOM   7509  C  CD    . GLN C 2 543  ? -44.097 -6.502  25.317  1.00 75.60  ?  543  GLN C CD    1 
ATOM   7510  O  OE1   . GLN C 2 543  ? -43.388 -6.126  24.384  1.00 70.77  ?  543  GLN C OE1   1 
ATOM   7511  N  NE2   . GLN C 2 543  ? -44.555 -7.746  25.412  1.00 77.60  ?  543  GLN C NE2   1 
ATOM   7512  N  N     . ALA C 2 544  ? -45.796 -2.962  27.916  1.00 69.22  ?  544  ALA C N     1 
ATOM   7513  C  CA    . ALA C 2 544  ? -46.342 -1.618  27.747  1.00 68.73  ?  544  ALA C CA    1 
ATOM   7514  C  C     . ALA C 2 544  ? -47.335 -1.550  26.593  1.00 72.53  ?  544  ALA C C     1 
ATOM   7515  O  O     . ALA C 2 544  ? -48.352 -0.852  26.681  1.00 65.85  ?  544  ALA C O     1 
ATOM   7516  C  CB    . ALA C 2 544  ? -45.208 -0.616  27.534  1.00 60.83  ?  544  ALA C CB    1 
ATOM   7517  N  N     . ASN C 2 545  ? -47.062 -2.264  25.505  1.00 79.09  ?  545  ASN C N     1 
ATOM   7518  C  CA    . ASN C 2 545  ? -47.907 -2.204  24.312  1.00 81.98  ?  545  ASN C CA    1 
ATOM   7519  C  C     . ASN C 2 545  ? -49.069 -3.192  24.385  1.00 78.04  ?  545  ASN C C     1 
ATOM   7520  O  O     . ASN C 2 545  ? -49.320 -3.959  23.456  1.00 79.25  ?  545  ASN C O     1 
ATOM   7521  C  CB    . ASN C 2 545  ? -47.061 -2.440  23.065  1.00 84.99  ?  545  ASN C CB    1 
ATOM   7522  C  CG    . ASN C 2 545  ? -46.199 -3.686  23.165  1.00 80.46  ?  545  ASN C CG    1 
ATOM   7523  O  OD1   . ASN C 2 545  ? -46.481 -4.593  23.947  1.00 79.61  ?  545  ASN C OD1   1 
ATOM   7524  N  ND2   . ASN C 2 545  ? -45.138 -3.733  22.367  1.00 70.39  ?  545  ASN C ND2   1 
ATOM   7525  N  N     . SER C 2 546  ? -49.792 -3.174  25.501  1.00 79.69  ?  546  SER C N     1 
ATOM   7526  C  CA    . SER C 2 546  ? -50.946 -4.060  25.594  1.00 83.37  ?  546  SER C CA    1 
ATOM   7527  C  C     . SER C 2 546  ? -52.190 -3.369  25.042  1.00 90.66  ?  546  SER C C     1 
ATOM   7528  O  O     . SER C 2 546  ? -52.397 -2.177  25.286  1.00 92.27  ?  546  SER C O     1 
ATOM   7529  C  CB    . SER C 2 546  ? -51.197 -4.475  27.040  1.00 83.16  ?  546  SER C CB    1 
ATOM   7530  O  OG    . SER C 2 546  ? -50.079 -5.158  27.580  1.00 86.66  ?  546  SER C OG    1 
ATOM   7531  N  N     . PRO C 2 547  ? -53.019 -4.085  24.281  1.00 94.64  ?  547  PRO C N     1 
ATOM   7532  C  CA    . PRO C 2 547  ? -54.298 -3.513  23.829  1.00 98.55  ?  547  PRO C CA    1 
ATOM   7533  C  C     . PRO C 2 547  ? -55.221 -3.289  25.017  1.00 95.24  ?  547  PRO C C     1 
ATOM   7534  O  O     . PRO C 2 547  ? -55.550 -4.225  25.749  1.00 96.05  ?  547  PRO C O     1 
ATOM   7535  C  CB    . PRO C 2 547  ? -54.847 -4.578  22.872  1.00 104.49 ?  547  PRO C CB    1 
ATOM   7536  C  CG    . PRO C 2 547  ? -53.653 -5.397  22.478  1.00 100.75 ?  547  PRO C CG    1 
ATOM   7537  C  CD    . PRO C 2 547  ? -52.764 -5.405  23.683  1.00 90.66  ?  547  PRO C CD    1 
ATOM   7538  N  N     . ILE C 2 548  ? -55.639 -2.039  25.208  1.00 83.43  ?  548  ILE C N     1 
ATOM   7539  C  CA    . ILE C 2 548  ? -56.380 -1.628  26.395  1.00 96.10  ?  548  ILE C CA    1 
ATOM   7540  C  C     . ILE C 2 548  ? -57.654 -0.912  25.970  1.00 99.24  ?  548  ILE C C     1 
ATOM   7541  O  O     . ILE C 2 548  ? -57.638 -0.082  25.054  1.00 90.70  ?  548  ILE C O     1 
ATOM   7542  C  CB    . ILE C 2 548  ? -55.523 -0.722  27.305  1.00 92.93  ?  548  ILE C CB    1 
ATOM   7543  C  CG1   . ILE C 2 548  ? -54.249 -1.450  27.734  1.00 89.69  ?  548  ILE C CG1   1 
ATOM   7544  C  CG2   . ILE C 2 548  ? -56.310 -0.284  28.526  1.00 86.46  ?  548  ILE C CG2   1 
ATOM   7545  C  CD1   . ILE C 2 548  ? -53.230 -0.556  28.403  1.00 88.47  ?  548  ILE C CD1   1 
ATOM   7546  N  N     . ASP C 2 549  ? -58.760 -1.243  26.636  1.00 102.30 ?  549  ASP C N     1 
ATOM   7547  C  CA    . ASP C 2 549  ? -60.012 -0.530  26.435  1.00 105.98 ?  549  ASP C CA    1 
ATOM   7548  C  C     . ASP C 2 549  ? -59.866 0.924   26.879  1.00 103.81 ?  549  ASP C C     1 
ATOM   7549  O  O     . ASP C 2 549  ? -59.016 1.267   27.706  1.00 101.38 ?  549  ASP C O     1 
ATOM   7550  C  CB    . ASP C 2 549  ? -61.139 -1.212  27.217  1.00 107.45 ?  549  ASP C CB    1 
ATOM   7551  C  CG    . ASP C 2 549  ? -62.491 -0.549  27.012  1.00 109.49 ?  549  ASP C CG    1 
ATOM   7552  O  OD1   . ASP C 2 549  ? -62.634 0.256   26.068  1.00 109.78 ?  549  ASP C OD1   1 
ATOM   7553  O  OD2   . ASP C 2 549  ? -63.415 -0.835  27.804  1.00 103.47 ?  549  ASP C OD2   1 
ATOM   7554  N  N     . ALA C 2 550  ? -60.711 1.788   26.310  1.00 108.88 ?  550  ALA C N     1 
ATOM   7555  C  CA    . ALA C 2 550  ? -60.734 3.185   26.732  1.00 108.25 ?  550  ALA C CA    1 
ATOM   7556  C  C     . ALA C 2 550  ? -61.052 3.315   28.216  1.00 114.46 ?  550  ALA C C     1 
ATOM   7557  O  O     . ALA C 2 550  ? -60.622 4.277   28.861  1.00 111.53 ?  550  ALA C O     1 
ATOM   7558  C  CB    . ALA C 2 550  ? -61.747 3.971   25.898  1.00 102.41 ?  550  ALA C CB    1 
ATOM   7559  N  N     . ASP C 2 551  ? -61.798 2.358   28.772  1.00 116.54 ?  551  ASP C N     1 
ATOM   7560  C  CA    . ASP C 2 551  ? -62.039 2.339   30.209  1.00 115.43 ?  551  ASP C CA    1 
ATOM   7561  C  C     . ASP C 2 551  ? -60.856 1.757   30.972  1.00 113.84 ?  551  ASP C C     1 
ATOM   7562  O  O     . ASP C 2 551  ? -60.597 2.165   32.110  1.00 113.79 ?  551  ASP C O     1 
ATOM   7563  C  CB    . ASP C 2 551  ? -63.310 1.546   30.518  1.00 117.52 ?  551  ASP C CB    1 
ATOM   7564  C  CG    . ASP C 2 551  ? -64.532 2.106   29.815  1.00 122.08 ?  551  ASP C CG    1 
ATOM   7565  O  OD1   . ASP C 2 551  ? -64.568 3.329   29.564  1.00 119.42 ?  551  ASP C OD1   1 
ATOM   7566  O  OD2   . ASP C 2 551  ? -65.457 1.323   29.513  1.00 123.05 ?  551  ASP C OD2   1 
ATOM   7567  N  N     . GLY C 2 552  ? -60.132 0.814   30.372  1.00 105.73 ?  552  GLY C N     1 
ATOM   7568  C  CA    . GLY C 2 552  ? -58.937 0.276   30.991  1.00 102.30 ?  552  GLY C CA    1 
ATOM   7569  C  C     . GLY C 2 552  ? -58.798 -1.231  30.911  1.00 100.87 ?  552  GLY C C     1 
ATOM   7570  O  O     . GLY C 2 552  ? -57.752 -1.778  31.274  1.00 101.03 ?  552  GLY C O     1 
ATOM   7571  N  N     . ARG C 2 553  ? -59.834 -1.916  30.434  1.00 117.05 ?  553  ARG C N     1 
ATOM   7572  C  CA    . ARG C 2 553  ? -59.834 -3.372  30.423  1.00 113.60 ?  553  ARG C CA    1 
ATOM   7573  C  C     . ARG C 2 553  ? -59.021 -3.911  29.253  1.00 106.34 ?  553  ARG C C     1 
ATOM   7574  O  O     . ARG C 2 553  ? -59.111 -3.408  28.131  1.00 101.58 ?  553  ARG C O     1 
ATOM   7575  C  CB    . ARG C 2 553  ? -61.265 -3.906  30.367  1.00 117.73 ?  553  ARG C CB    1 
ATOM   7576  C  CG    . ARG C 2 553  ? -61.787 -4.390  31.713  1.00 115.26 ?  553  ARG C CG    1 
ATOM   7577  C  CD    . ARG C 2 553  ? -63.296 -4.557  31.708  1.00 110.04 ?  553  ARG C CD    1 
ATOM   7578  N  NE    . ARG C 2 553  ? -63.977 -3.273  31.577  1.00 116.07 ?  553  ARG C NE    1 
ATOM   7579  C  CZ    . ARG C 2 553  ? -64.252 -2.468  32.598  1.00 117.70 ?  553  ARG C CZ    1 
ATOM   7580  N  NH1   . ARG C 2 553  ? -63.904 -2.813  33.831  1.00 111.49 ?  553  ARG C NH1   1 
ATOM   7581  N  NH2   . ARG C 2 553  ? -64.874 -1.316  32.388  1.00 116.76 ?  553  ARG C NH2   1 
ATOM   7582  N  N     . PHE C 2 554  ? -58.219 -4.939  29.529  1.00 94.92  ?  554  PHE C N     1 
ATOM   7583  C  CA    . PHE C 2 554  ? -57.419 -5.568  28.488  1.00 97.76  ?  554  PHE C CA    1 
ATOM   7584  C  C     . PHE C 2 554  ? -58.319 -6.221  27.447  1.00 102.76 ?  554  PHE C C     1 
ATOM   7585  O  O     . PHE C 2 554  ? -59.372 -6.777  27.770  1.00 109.12 ?  554  PHE C O     1 
ATOM   7586  C  CB    . PHE C 2 554  ? -56.479 -6.611  29.098  1.00 100.38 ?  554  PHE C CB    1 
ATOM   7587  C  CG    . PHE C 2 554  ? -55.382 -6.026  29.943  1.00 98.07  ?  554  PHE C CG    1 
ATOM   7588  C  CD1   . PHE C 2 554  ? -54.090 -5.928  29.452  1.00 97.22  ?  554  PHE C CD1   1 
ATOM   7589  C  CD2   . PHE C 2 554  ? -55.639 -5.578  31.229  1.00 94.34  ?  554  PHE C CD2   1 
ATOM   7590  C  CE1   . PHE C 2 554  ? -53.077 -5.392  30.225  1.00 94.06  ?  554  PHE C CE1   1 
ATOM   7591  C  CE2   . PHE C 2 554  ? -54.630 -5.040  32.007  1.00 85.96  ?  554  PHE C CE2   1 
ATOM   7592  C  CZ    . PHE C 2 554  ? -53.348 -4.947  31.503  1.00 86.31  ?  554  PHE C CZ    1 
ATOM   7593  N  N     . VAL C 2 555  ? -57.897 -6.150  26.184  1.00 94.85  ?  555  VAL C N     1 
ATOM   7594  C  CA    . VAL C 2 555  ? -58.685 -6.739  25.107  1.00 94.32  ?  555  VAL C CA    1 
ATOM   7595  C  C     . VAL C 2 555  ? -58.541 -8.255  25.099  1.00 96.01  ?  555  VAL C C     1 
ATOM   7596  O  O     . VAL C 2 555  ? -59.530 -8.983  24.956  1.00 96.63  ?  555  VAL C O     1 
ATOM   7597  C  CB    . VAL C 2 555  ? -58.282 -6.122  23.756  1.00 89.76  ?  555  VAL C CB    1 
ATOM   7598  C  CG1   . VAL C 2 555  ? -59.107 -6.727  22.631  1.00 84.15  ?  555  VAL C CG1   1 
ATOM   7599  C  CG2   . VAL C 2 555  ? -58.449 -4.610  23.794  1.00 89.23  ?  555  VAL C CG2   1 
ATOM   7600  N  N     . GLU C 2 556  ? -57.318 -8.756  25.252  1.00 99.38  ?  556  GLU C N     1 
ATOM   7601  C  CA    . GLU C 2 556  ? -57.167 -10.204 25.274  1.00 98.46  ?  556  GLU C CA    1 
ATOM   7602  C  C     . GLU C 2 556  ? -57.136 -10.719 26.706  1.00 104.26 ?  556  GLU C C     1 
ATOM   7603  O  O     . GLU C 2 556  ? -56.572 -10.063 27.590  1.00 103.31 ?  556  GLU C O     1 
ATOM   7604  C  CB    . GLU C 2 556  ? -55.885 -10.637 24.561  1.00 88.57  ?  556  GLU C CB    1 
ATOM   7605  C  CG    . GLU C 2 556  ? -55.914 -10.480 23.049  1.00 88.60  ?  556  GLU C CG    1 
ATOM   7606  C  CD    . GLU C 2 556  ? -55.755 -9.041  22.605  1.00 91.01  ?  556  GLU C CD    1 
ATOM   7607  O  OE1   . GLU C 2 556  ? -55.221 -8.230  23.391  1.00 95.03  ?  556  GLU C OE1   1 
ATOM   7608  O  OE2   . GLU C 2 556  ? -56.165 -8.720  21.470  1.00 88.66  ?  556  GLU C OE2   1 
ATOM   7609  N  N     . PRO C 2 557  ? -57.742 -11.880 26.964  1.00 105.92 ?  557  PRO C N     1 
ATOM   7610  C  CA    . PRO C 2 557  ? -57.585 -12.492 28.293  1.00 100.76 ?  557  PRO C CA    1 
ATOM   7611  C  C     . PRO C 2 557  ? -56.142 -12.844 28.601  1.00 99.65  ?  557  PRO C C     1 
ATOM   7612  O  O     . PRO C 2 557  ? -55.665 -12.589 29.713  1.00 89.23  ?  557  PRO C O     1 
ATOM   7613  C  CB    . PRO C 2 557  ? -58.476 -13.741 28.212  1.00 102.67 ?  557  PRO C CB    1 
ATOM   7614  C  CG    . PRO C 2 557  ? -59.427 -13.468 27.088  1.00 102.05 ?  557  PRO C CG    1 
ATOM   7615  C  CD    . PRO C 2 557  ? -58.658 -12.645 26.103  1.00 102.87 ?  557  PRO C CD    1 
ATOM   7616  N  N     . ARG C 2 558  ? -55.430 -13.414 27.634  1.00 107.78 ?  558  ARG C N     1 
ATOM   7617  C  CA    . ARG C 2 558  ? -54.030 -13.784 27.788  1.00 107.72 ?  558  ARG C CA    1 
ATOM   7618  C  C     . ARG C 2 558  ? -53.155 -12.694 27.179  1.00 110.08 ?  558  ARG C C     1 
ATOM   7619  O  O     . ARG C 2 558  ? -53.312 -12.353 26.002  1.00 105.58 ?  558  ARG C O     1 
ATOM   7620  C  CB    . ARG C 2 558  ? -53.756 -15.133 27.123  1.00 108.75 ?  558  ARG C CB    1 
ATOM   7621  C  CG    . ARG C 2 558  ? -54.370 -16.322 27.845  1.00 106.13 ?  558  ARG C CG    1 
ATOM   7622  C  CD    . ARG C 2 558  ? -55.015 -17.288 26.865  1.00 114.66 ?  558  ARG C CD    1 
ATOM   7623  N  NE    . ARG C 2 558  ? -56.371 -16.878 26.509  1.00 119.87 ?  558  ARG C NE    1 
ATOM   7624  C  CZ    . ARG C 2 558  ? -57.093 -17.438 25.544  1.00 123.85 ?  558  ARG C CZ    1 
ATOM   7625  N  NH1   . ARG C 2 558  ? -56.587 -18.430 24.824  1.00 120.51 ?  558  ARG C NH1   1 
ATOM   7626  N  NH2   . ARG C 2 558  ? -58.320 -17.001 25.293  1.00 121.69 ?  558  ARG C NH2   1 
ATOM   7627  N  N     . VAL C 2 559  ? -52.237 -12.153 27.979  1.00 115.02 ?  559  VAL C N     1 
ATOM   7628  C  CA    . VAL C 2 559  ? -51.352 -11.079 27.547  1.00 110.68 ?  559  VAL C CA    1 
ATOM   7629  C  C     . VAL C 2 559  ? -49.918 -11.431 27.915  1.00 104.78 ?  559  VAL C C     1 
ATOM   7630  O  O     . VAL C 2 559  ? -49.661 -12.118 28.909  1.00 100.27 ?  559  VAL C O     1 
ATOM   7631  C  CB    . VAL C 2 559  ? -51.751 -9.719  28.164  1.00 107.44 ?  559  VAL C CB    1 
ATOM   7632  C  CG1   . VAL C 2 559  ? -53.049 -9.217  27.553  1.00 110.97 ?  559  VAL C CG1   1 
ATOM   7633  C  CG2   . VAL C 2 559  ? -51.884 -9.840  29.674  1.00 94.07  ?  559  VAL C CG2   1 
ATOM   7634  N  N     . LEU C 2 560  ? -48.979 -10.954 27.097  1.00 107.85 ?  560  LEU C N     1 
ATOM   7635  C  CA    . LEU C 2 560  ? -47.562 -11.139 27.383  1.00 99.17  ?  560  LEU C CA    1 
ATOM   7636  C  C     . LEU C 2 560  ? -47.199 -10.432 28.682  1.00 97.85  ?  560  LEU C C     1 
ATOM   7637  O  O     . LEU C 2 560  ? -47.375 -9.216  28.809  1.00 97.69  ?  560  LEU C O     1 
ATOM   7638  C  CB    . LEU C 2 560  ? -46.717 -10.604 26.227  1.00 98.28  ?  560  LEU C CB    1 
ATOM   7639  C  CG    . LEU C 2 560  ? -46.786 -11.372 24.905  1.00 111.70 ?  560  LEU C CG    1 
ATOM   7640  C  CD1   . LEU C 2 560  ? -46.066 -10.611 23.801  1.00 95.89  ?  560  LEU C CD1   1 
ATOM   7641  C  CD2   . LEU C 2 560  ? -46.195 -12.763 25.068  1.00 110.14 ?  560  LEU C CD2   1 
ATOM   7642  N  N     . VAL C 2 561  ? -46.695 -11.196 29.648  1.00 88.21  ?  561  VAL C N     1 
ATOM   7643  C  CA    . VAL C 2 561  ? -46.444 -10.695 30.994  1.00 76.10  ?  561  VAL C CA    1 
ATOM   7644  C  C     . VAL C 2 561  ? -45.091 -11.206 31.471  1.00 73.27  ?  561  VAL C C     1 
ATOM   7645  O  O     . VAL C 2 561  ? -44.753 -12.378 31.275  1.00 72.28  ?  561  VAL C O     1 
ATOM   7646  C  CB    . VAL C 2 561  ? -47.569 -11.116 31.965  1.00 83.69  ?  561  VAL C CB    1 
ATOM   7647  C  CG1   . VAL C 2 561  ? -47.147 -10.907 33.405  1.00 80.18  ?  561  VAL C CG1   1 
ATOM   7648  C  CG2   . VAL C 2 561  ? -48.842 -10.339 31.670  1.00 90.91  ?  561  VAL C CG2   1 
ATOM   7649  N  N     . ARG C 2 562  ? -44.315 -10.320 32.091  1.00 83.03  ?  562  ARG C N     1 
ATOM   7650  C  CA    . ARG C 2 562  ? -43.035 -10.684 32.679  1.00 83.29  ?  562  ARG C CA    1 
ATOM   7651  C  C     . ARG C 2 562  ? -43.244 -11.215 34.091  1.00 86.01  ?  562  ARG C C     1 
ATOM   7652  O  O     . ARG C 2 562  ? -44.063 -10.689 34.851  1.00 78.93  ?  562  ARG C O     1 
ATOM   7653  C  CB    . ARG C 2 562  ? -42.093 -9.480  32.708  1.00 75.58  ?  562  ARG C CB    1 
ATOM   7654  C  CG    . ARG C 2 562  ? -40.675 -9.775  32.246  1.00 74.86  ?  562  ARG C CG    1 
ATOM   7655  C  CD    . ARG C 2 562  ? -39.756 -8.574  32.446  1.00 58.05  ?  562  ARG C CD    1 
ATOM   7656  N  NE    . ARG C 2 562  ? -40.465 -7.303  32.315  1.00 59.68  ?  562  ARG C NE    1 
ATOM   7657  C  CZ    . ARG C 2 562  ? -40.725 -6.485  33.330  1.00 51.45  ?  562  ARG C CZ    1 
ATOM   7658  N  NH1   . ARG C 2 562  ? -41.380 -5.352  33.123  1.00 48.96  ?  562  ARG C NH1   1 
ATOM   7659  N  NH2   . ARG C 2 562  ? -40.328 -6.801  34.555  1.00 44.42  ?  562  ARG C NH2   1 
ATOM   7660  N  N     . ARG C 2 563  ? -42.498 -12.261 34.437  1.00 76.52  ?  563  ARG C N     1 
ATOM   7661  C  CA    . ARG C 2 563  ? -42.580 -12.885 35.749  1.00 83.59  ?  563  ARG C CA    1 
ATOM   7662  C  C     . ARG C 2 563  ? -41.181 -12.979 36.345  1.00 88.53  ?  563  ARG C C     1 
ATOM   7663  O  O     . ARG C 2 563  ? -40.179 -12.685 35.686  1.00 80.52  ?  563  ARG C O     1 
ATOM   7664  C  CB    . ARG C 2 563  ? -43.237 -14.275 35.664  1.00 87.01  ?  563  ARG C CB    1 
ATOM   7665  C  CG    . ARG C 2 563  ? -43.791 -14.802 36.985  1.00 88.95  ?  563  ARG C CG    1 
ATOM   7666  C  CD    . ARG C 2 563  ? -44.376 -16.196 36.834  1.00 94.24  ?  563  ARG C CD    1 
ATOM   7667  N  NE    . ARG C 2 563  ? -45.621 -16.184 36.075  1.00 95.39  ?  563  ARG C NE    1 
ATOM   7668  C  CZ    . ARG C 2 563  ? -46.822 -16.005 36.616  1.00 98.54  ?  563  ARG C CZ    1 
ATOM   7669  N  NH1   . ARG C 2 563  ? -46.942 -15.823 37.924  1.00 89.80  ?  563  ARG C NH1   1 
ATOM   7670  N  NH2   . ARG C 2 563  ? -47.903 -16.009 35.851  1.00 102.47 ?  563  ARG C NH2   1 
ATOM   7671  N  N     . LYS C 2 564  ? -41.129 -13.378 37.616  1.00 91.17  ?  564  LYS C N     1 
ATOM   7672  C  CA    . LYS C 2 564  ? -39.866 -13.552 38.321  1.00 90.24  ?  564  LYS C CA    1 
ATOM   7673  C  C     . LYS C 2 564  ? -38.958 -14.516 37.565  1.00 93.66  ?  564  LYS C C     1 
ATOM   7674  O  O     . LYS C 2 564  ? -39.423 -15.429 36.876  1.00 99.42  ?  564  LYS C O     1 
ATOM   7675  C  CB    . LYS C 2 564  ? -40.134 -14.071 39.738  1.00 88.04  ?  564  LYS C CB    1 
ATOM   7676  C  CG    . LYS C 2 564  ? -38.896 -14.312 40.589  1.00 90.90  ?  564  LYS C CG    1 
ATOM   7677  C  CD    . LYS C 2 564  ? -39.265 -14.994 41.899  1.00 86.36  ?  564  LYS C CD    1 
ATOM   7678  C  CE    . LYS C 2 564  ? -38.026 -15.396 42.682  1.00 73.19  ?  564  LYS C CE    1 
ATOM   7679  N  NZ    . LYS C 2 564  ? -38.370 -16.121 43.936  1.00 57.13  ?  564  LYS C NZ    1 
ATOM   7680  N  N     . ALA C 2 565  ? -37.648 -14.288 37.687  1.00 79.72  ?  565  ALA C N     1 
ATOM   7681  C  CA    . ALA C 2 565  ? -36.613 -15.125 37.084  1.00 84.46  ?  565  ALA C CA    1 
ATOM   7682  C  C     . ALA C 2 565  ? -36.620 -15.047 35.561  1.00 83.95  ?  565  ALA C C     1 
ATOM   7683  O  O     . ALA C 2 565  ? -36.159 -15.972 34.886  1.00 81.60  ?  565  ALA C O     1 
ATOM   7684  C  CB    . ALA C 2 565  ? -36.728 -16.587 37.539  1.00 82.56  ?  565  ALA C CB    1 
ATOM   7685  N  N     . GLY C 2 566  ? -37.137 -13.950 35.012  1.00 75.02  ?  566  GLY C N     1 
ATOM   7686  C  CA    . GLY C 2 566  ? -37.100 -13.712 33.582  1.00 80.81  ?  566  GLY C CA    1 
ATOM   7687  C  C     . GLY C 2 566  ? -37.915 -14.692 32.766  1.00 83.82  ?  566  GLY C C     1 
ATOM   7688  O  O     . GLY C 2 566  ? -37.402 -15.301 31.822  1.00 73.77  ?  566  GLY C O     1 
ATOM   7689  N  N     . GLU C 2 567  ? -39.185 -14.859 33.122  1.00 95.08  ?  567  GLU C N     1 
ATOM   7690  C  CA    . GLU C 2 567  ? -40.099 -15.734 32.402  1.00 94.44  ?  567  GLU C CA    1 
ATOM   7691  C  C     . GLU C 2 567  ? -41.160 -14.892 31.708  1.00 90.75  ?  567  GLU C C     1 
ATOM   7692  O  O     . GLU C 2 567  ? -41.760 -14.007 32.327  1.00 90.17  ?  567  GLU C O     1 
ATOM   7693  C  CB    . GLU C 2 567  ? -40.759 -16.742 33.346  1.00 101.50 ?  567  GLU C CB    1 
ATOM   7694  C  CG    . GLU C 2 567  ? -41.752 -17.669 32.660  1.00 111.13 ?  567  GLU C CG    1 
ATOM   7695  C  CD    . GLU C 2 567  ? -42.511 -18.543 33.640  1.00 117.31 ?  567  GLU C CD    1 
ATOM   7696  O  OE1   . GLU C 2 567  ? -42.347 -18.351 34.863  1.00 112.68 ?  567  GLU C OE1   1 
ATOM   7697  O  OE2   . GLU C 2 567  ? -43.273 -19.423 33.185  1.00 120.68 ?  567  GLU C OE2   1 
ATOM   7698  N  N     . VAL C 2 568  ? -41.385 -15.167 30.426  1.00 99.94  ?  568  VAL C N     1 
ATOM   7699  C  CA    . VAL C 2 568  ? -42.392 -14.478 29.629  1.00 96.28  ?  568  VAL C CA    1 
ATOM   7700  C  C     . VAL C 2 568  ? -43.415 -15.506 29.169  1.00 99.85  ?  568  VAL C C     1 
ATOM   7701  O  O     . VAL C 2 568  ? -43.047 -16.548 28.614  1.00 102.72 ?  568  VAL C O     1 
ATOM   7702  C  CB    . VAL C 2 568  ? -41.765 -13.751 28.425  1.00 92.35  ?  568  VAL C CB    1 
ATOM   7703  C  CG1   . VAL C 2 568  ? -42.845 -13.097 27.578  1.00 95.93  ?  568  VAL C CG1   1 
ATOM   7704  C  CG2   . VAL C 2 568  ? -40.751 -12.719 28.899  1.00 86.44  ?  568  VAL C CG2   1 
ATOM   7705  N  N     . GLU C 2 569  ? -44.692 -15.214 29.402  1.00 94.98  ?  569  GLU C N     1 
ATOM   7706  C  CA    . GLU C 2 569  ? -45.765 -16.128 29.032  1.00 103.70 ?  569  GLU C CA    1 
ATOM   7707  C  C     . GLU C 2 569  ? -47.086 -15.377 29.078  1.00 106.17 ?  569  GLU C C     1 
ATOM   7708  O  O     . GLU C 2 569  ? -47.203 -14.326 29.715  1.00 105.45 ?  569  GLU C O     1 
ATOM   7709  C  CB    . GLU C 2 569  ? -45.813 -17.346 29.960  1.00 104.59 ?  569  GLU C CB    1 
ATOM   7710  C  CG    . GLU C 2 569  ? -46.060 -16.993 31.417  1.00 109.87 ?  569  GLU C CG    1 
ATOM   7711  C  CD    . GLU C 2 569  ? -46.091 -18.213 32.314  1.00 114.04 ?  569  GLU C CD    1 
ATOM   7712  O  OE1   . GLU C 2 569  ? -45.926 -19.337 31.796  1.00 118.88 ?  569  GLU C OE1   1 
ATOM   7713  O  OE2   . GLU C 2 569  ? -46.281 -18.046 33.537  1.00 106.90 ?  569  GLU C OE2   1 
ATOM   7714  N  N     . TYR C 2 570  ? -48.080 -15.934 28.391  1.00 104.02 ?  570  TYR C N     1 
ATOM   7715  C  CA    . TYR C 2 570  ? -49.432 -15.403 28.467  1.00 105.59 ?  570  TYR C CA    1 
ATOM   7716  C  C     . TYR C 2 570  ? -50.060 -15.755 29.812  1.00 102.99 ?  570  TYR C C     1 
ATOM   7717  O  O     . TYR C 2 570  ? -49.719 -16.762 30.438  1.00 98.93  ?  570  TYR C O     1 
ATOM   7718  C  CB    . TYR C 2 570  ? -50.286 -15.947 27.322  1.00 106.52 ?  570  TYR C CB    1 
ATOM   7719  C  CG    . TYR C 2 570  ? -49.969 -15.341 25.971  1.00 110.83 ?  570  TYR C CG    1 
ATOM   7720  C  CD1   . TYR C 2 570  ? -50.763 -14.334 25.436  1.00 111.46 ?  570  TYR C CD1   1 
ATOM   7721  C  CD2   . TYR C 2 570  ? -48.875 -15.773 25.231  1.00 107.90 ?  570  TYR C CD2   1 
ATOM   7722  C  CE1   . TYR C 2 570  ? -50.479 -13.777 24.202  1.00 104.99 ?  570  TYR C CE1   1 
ATOM   7723  C  CE2   . TYR C 2 570  ? -48.583 -15.221 23.997  1.00 103.35 ?  570  TYR C CE2   1 
ATOM   7724  C  CZ    . TYR C 2 570  ? -49.388 -14.224 23.488  1.00 99.89  ?  570  TYR C CZ    1 
ATOM   7725  O  OH    . TYR C 2 570  ? -49.100 -13.673 22.260  1.00 94.62  ?  570  TYR C OH    1 
ATOM   7726  N  N     . VAL C 2 571  ? -50.986 -14.910 30.256  1.00 94.04  ?  571  VAL C N     1 
ATOM   7727  C  CA    . VAL C 2 571  ? -51.574 -15.051 31.586  1.00 95.57  ?  571  VAL C CA    1 
ATOM   7728  C  C     . VAL C 2 571  ? -52.929 -14.349 31.602  1.00 97.44  ?  571  VAL C C     1 
ATOM   7729  O  O     . VAL C 2 571  ? -53.134 -13.395 30.836  1.00 96.07  ?  571  VAL C O     1 
ATOM   7730  C  CB    . VAL C 2 571  ? -50.618 -14.504 32.662  1.00 96.15  ?  571  VAL C CB    1 
ATOM   7731  C  CG1   . VAL C 2 571  ? -51.187 -13.263 33.339  1.00 98.36  ?  571  VAL C CG1   1 
ATOM   7732  C  CG2   . VAL C 2 571  ? -50.288 -15.586 33.680  1.00 92.66  ?  571  VAL C CG2   1 
ATOM   7733  N  N     . PRO C 2 572  ? -53.881 -14.785 32.431  1.00 101.18 ?  572  PRO C N     1 
ATOM   7734  C  CA    . PRO C 2 572  ? -55.217 -14.177 32.410  1.00 97.35  ?  572  PRO C CA    1 
ATOM   7735  C  C     . PRO C 2 572  ? -55.184 -12.694 32.752  1.00 92.98  ?  572  PRO C C     1 
ATOM   7736  O  O     . PRO C 2 572  ? -54.274 -12.195 33.418  1.00 92.52  ?  572  PRO C O     1 
ATOM   7737  C  CB    . PRO C 2 572  ? -55.991 -14.974 33.468  1.00 95.38  ?  572  PRO C CB    1 
ATOM   7738  C  CG    . PRO C 2 572  ? -54.939 -15.593 34.330  1.00 95.73  ?  572  PRO C CG    1 
ATOM   7739  C  CD    . PRO C 2 572  ? -53.802 -15.887 33.405  1.00 95.84  ?  572  PRO C CD    1 
ATOM   7740  N  N     . SER C 2 573  ? -56.211 -11.985 32.274  1.00 96.93  ?  573  SER C N     1 
ATOM   7741  C  CA    . SER C 2 573  ? -56.300 -10.547 32.506  1.00 98.16  ?  573  SER C CA    1 
ATOM   7742  C  C     . SER C 2 573  ? -56.517 -10.222 33.978  1.00 96.57  ?  573  SER C C     1 
ATOM   7743  O  O     . SER C 2 573  ? -56.131 -9.140  34.435  1.00 93.86  ?  573  SER C O     1 
ATOM   7744  C  CB    . SER C 2 573  ? -57.426 -9.949  31.662  1.00 98.59  ?  573  SER C CB    1 
ATOM   7745  O  OG    . SER C 2 573  ? -57.603 -8.573  31.950  1.00 100.79 ?  573  SER C OG    1 
ATOM   7746  N  N     . SER C 2 574  ? -57.127 -11.134 34.731  1.00 107.86 ?  574  SER C N     1 
ATOM   7747  C  CA    . SER C 2 574  ? -57.349 -10.945 36.158  1.00 109.87 ?  574  SER C CA    1 
ATOM   7748  C  C     . SER C 2 574  ? -56.100 -11.212 36.991  1.00 109.07 ?  574  SER C C     1 
ATOM   7749  O  O     . SER C 2 574  ? -56.177 -11.180 38.224  1.00 96.36  ?  574  SER C O     1 
ATOM   7750  C  CB    . SER C 2 574  ? -58.493 -11.844 36.634  1.00 109.30 ?  574  SER C CB    1 
ATOM   7751  O  OG    . SER C 2 574  ? -58.229 -13.203 36.335  1.00 109.61 ?  574  SER C OG    1 
ATOM   7752  N  N     . GLU C 2 575  ? -54.961 -11.475 36.348  1.00 112.05 ?  575  GLU C N     1 
ATOM   7753  C  CA    . GLU C 2 575  ? -53.705 -11.713 37.043  1.00 109.61 ?  575  GLU C CA    1 
ATOM   7754  C  C     . GLU C 2 575  ? -52.736 -10.543 36.952  1.00 108.18 ?  575  GLU C C     1 
ATOM   7755  O  O     . GLU C 2 575  ? -51.813 -10.462 37.769  1.00 107.74 ?  575  GLU C O     1 
ATOM   7756  C  CB    . GLU C 2 575  ? -53.025 -12.975 36.485  1.00 110.61 ?  575  GLU C CB    1 
ATOM   7757  C  CG    . GLU C 2 575  ? -51.899 -13.541 37.342  1.00 114.24 ?  575  GLU C CG    1 
ATOM   7758  C  CD    . GLU C 2 575  ? -52.404 -14.362 38.514  1.00 122.32 ?  575  GLU C CD    1 
ATOM   7759  O  OE1   . GLU C 2 575  ? -53.632 -14.396 38.742  1.00 126.89 ?  575  GLU C OE1   1 
ATOM   7760  O  OE2   . GLU C 2 575  ? -51.569 -14.981 39.207  1.00 119.90 ?  575  GLU C OE2   1 
ATOM   7761  N  N     . VAL C 2 576  ? -52.932 -9.635  35.999  1.00 102.00 ?  576  VAL C N     1 
ATOM   7762  C  CA    . VAL C 2 576  ? -52.020 -8.513  35.804  1.00 92.53  ?  576  VAL C CA    1 
ATOM   7763  C  C     . VAL C 2 576  ? -52.138 -7.557  36.985  1.00 90.43  ?  576  VAL C C     1 
ATOM   7764  O  O     . VAL C 2 576  ? -53.196 -6.962  37.219  1.00 89.30  ?  576  VAL C O     1 
ATOM   7765  C  CB    . VAL C 2 576  ? -52.315 -7.798  34.479  1.00 91.08  ?  576  VAL C CB    1 
ATOM   7766  C  CG1   . VAL C 2 576  ? -51.443 -6.566  34.336  1.00 88.25  ?  576  VAL C CG1   1 
ATOM   7767  C  CG2   . VAL C 2 576  ? -52.105 -8.747  33.308  1.00 89.70  ?  576  VAL C CG2   1 
ATOM   7768  N  N     . ASP C 2 577  ? -51.044 -7.403  37.733  1.00 94.38  ?  577  ASP C N     1 
ATOM   7769  C  CA    . ASP C 2 577  ? -51.009 -6.484  38.865  1.00 92.52  ?  577  ASP C CA    1 
ATOM   7770  C  C     . ASP C 2 577  ? -50.589 -5.078  38.455  1.00 89.24  ?  577  ASP C C     1 
ATOM   7771  O  O     . ASP C 2 577  ? -51.206 -4.098  38.887  1.00 85.14  ?  577  ASP C O     1 
ATOM   7772  C  CB    . ASP C 2 577  ? -50.063 -7.012  39.947  1.00 91.27  ?  577  ASP C CB    1 
ATOM   7773  C  CG    . ASP C 2 577  ? -50.566 -8.290  40.589  1.00 102.40 ?  577  ASP C CG    1 
ATOM   7774  O  OD1   . ASP C 2 577  ? -51.791 -8.529  40.559  1.00 116.02 ?  577  ASP C OD1   1 
ATOM   7775  O  OD2   . ASP C 2 577  ? -49.737 -9.052  41.129  1.00 99.97  ?  577  ASP C OD2   1 
ATOM   7776  N  N     . TYR C 2 578  ? -49.548 -4.958  37.634  1.00 84.09  ?  578  TYR C N     1 
ATOM   7777  C  CA    . TYR C 2 578  ? -49.065 -3.670  37.157  1.00 75.09  ?  578  TYR C CA    1 
ATOM   7778  C  C     . TYR C 2 578  ? -48.763 -3.785  35.669  1.00 72.14  ?  578  TYR C C     1 
ATOM   7779  O  O     . TYR C 2 578  ? -48.891 -4.856  35.069  1.00 74.01  ?  578  TYR C O     1 
ATOM   7780  C  CB    . TYR C 2 578  ? -47.822 -3.215  37.932  1.00 67.76  ?  578  TYR C CB    1 
ATOM   7781  C  CG    . TYR C 2 578  ? -47.996 -3.168  39.434  1.00 69.91  ?  578  TYR C CG    1 
ATOM   7782  C  CD1   . TYR C 2 578  ? -48.392 -2.000  40.069  1.00 68.86  ?  578  TYR C CD1   1 
ATOM   7783  C  CD2   . TYR C 2 578  ? -47.753 -4.289  40.217  1.00 73.93  ?  578  TYR C CD2   1 
ATOM   7784  C  CE1   . TYR C 2 578  ? -48.551 -1.950  41.440  1.00 69.13  ?  578  TYR C CE1   1 
ATOM   7785  C  CE2   . TYR C 2 578  ? -47.909 -4.248  41.590  1.00 76.23  ?  578  TYR C CE2   1 
ATOM   7786  C  CZ    . TYR C 2 578  ? -48.307 -3.076  42.196  1.00 72.64  ?  578  TYR C CZ    1 
ATOM   7787  O  OH    . TYR C 2 578  ? -48.464 -3.027  43.562  1.00 75.48  ?  578  TYR C OH    1 
ATOM   7788  N  N     . MET C 2 579  ? -48.360 -2.669  35.067  1.00 69.18  ?  579  MET C N     1 
ATOM   7789  C  CA    . MET C 2 579  ? -47.905 -2.676  33.684  1.00 65.35  ?  579  MET C CA    1 
ATOM   7790  C  C     . MET C 2 579  ? -46.928 -1.528  33.484  1.00 62.02  ?  579  MET C C     1 
ATOM   7791  O  O     . MET C 2 579  ? -46.879 -0.582  34.275  1.00 61.74  ?  579  MET C O     1 
ATOM   7792  C  CB    . MET C 2 579  ? -49.071 -2.576  32.692  1.00 67.04  ?  579  MET C CB    1 
ATOM   7793  C  CG    . MET C 2 579  ? -49.598 -1.170  32.470  1.00 72.98  ?  579  MET C CG    1 
ATOM   7794  S  SD    . MET C 2 579  ? -50.760 -1.092  31.093  1.00 92.70  ?  579  MET C SD    1 
ATOM   7795  C  CE    . MET C 2 579  ? -49.746 -1.717  29.756  1.00 67.18  ?  579  MET C CE    1 
ATOM   7796  N  N     . ASP C 2 580  ? -46.147 -1.626  32.412  1.00 69.20  ?  580  ASP C N     1 
ATOM   7797  C  CA    . ASP C 2 580  ? -45.097 -0.653  32.153  1.00 59.28  ?  580  ASP C CA    1 
ATOM   7798  C  C     . ASP C 2 580  ? -45.686 0.720   31.847  1.00 55.51  ?  580  ASP C C     1 
ATOM   7799  O  O     . ASP C 2 580  ? -46.786 0.846   31.303  1.00 49.61  ?  580  ASP C O     1 
ATOM   7800  C  CB    . ASP C 2 580  ? -44.218 -1.114  30.991  1.00 58.37  ?  580  ASP C CB    1 
ATOM   7801  C  CG    . ASP C 2 580  ? -43.509 -2.423  31.279  1.00 65.90  ?  580  ASP C CG    1 
ATOM   7802  O  OD1   . ASP C 2 580  ? -43.631 -2.932  32.414  1.00 66.43  ?  580  ASP C OD1   1 
ATOM   7803  O  OD2   . ASP C 2 580  ? -42.830 -2.944  30.370  1.00 67.68  ?  580  ASP C OD2   1 
ATOM   7804  N  N     . VAL C 2 581  ? -44.932 1.758   32.209  1.00 45.90  ?  581  VAL C N     1 
ATOM   7805  C  CA    . VAL C 2 581  ? -45.381 3.128   31.974  1.00 39.87  ?  581  VAL C CA    1 
ATOM   7806  C  C     . VAL C 2 581  ? -45.299 3.465   30.491  1.00 40.27  ?  581  VAL C C     1 
ATOM   7807  O  O     . VAL C 2 581  ? -46.295 3.842   29.863  1.00 49.00  ?  581  VAL C O     1 
ATOM   7808  C  CB    . VAL C 2 581  ? -44.555 4.115   32.817  1.00 39.38  ?  581  VAL C CB    1 
ATOM   7809  C  CG1   . VAL C 2 581  ? -44.858 5.547   32.409  1.00 48.37  ?  581  VAL C CG1   1 
ATOM   7810  C  CG2   . VAL C 2 581  ? -44.832 3.907   34.296  1.00 38.52  ?  581  VAL C CG2   1 
ATOM   7811  N  N     . SER C 2 582  ? -44.112 3.332   29.915  1.00 51.77  ?  582  SER C N     1 
ATOM   7812  C  CA    . SER C 2 582  ? -43.857 3.654   28.523  1.00 47.76  ?  582  SER C CA    1 
ATOM   7813  C  C     . SER C 2 582  ? -43.138 2.493   27.855  1.00 42.22  ?  582  SER C C     1 
ATOM   7814  O  O     . SER C 2 582  ? -42.454 1.714   28.527  1.00 48.88  ?  582  SER C O     1 
ATOM   7815  C  CB    . SER C 2 582  ? -43.009 4.930   28.403  1.00 48.15  ?  582  SER C CB    1 
ATOM   7816  O  OG    . SER C 2 582  ? -42.616 5.177   27.065  1.00 55.64  ?  582  SER C OG    1 
ATOM   7817  N  N     . PRO C 2 583  ? -43.292 2.337   26.537  1.00 38.08  ?  583  PRO C N     1 
ATOM   7818  C  CA    . PRO C 2 583  ? -42.517 1.294   25.844  1.00 46.15  ?  583  PRO C CA    1 
ATOM   7819  C  C     . PRO C 2 583  ? -41.015 1.449   26.015  1.00 49.47  ?  583  PRO C C     1 
ATOM   7820  O  O     . PRO C 2 583  ? -40.297 0.446   26.108  1.00 50.06  ?  583  PRO C O     1 
ATOM   7821  C  CB    . PRO C 2 583  ? -42.937 1.469   24.380  1.00 41.66  ?  583  PRO C CB    1 
ATOM   7822  C  CG    . PRO C 2 583  ? -44.307 2.046   24.459  1.00 51.34  ?  583  PRO C CG    1 
ATOM   7823  C  CD    . PRO C 2 583  ? -44.277 2.972   25.644  1.00 47.60  ?  583  PRO C CD    1 
ATOM   7824  N  N     . ARG C 2 584  ? -40.519 2.687   26.069  1.00 52.90  ?  584  ARG C N     1 
ATOM   7825  C  CA    . ARG C 2 584  ? -39.085 2.951   26.124  1.00 50.24  ?  584  ARG C CA    1 
ATOM   7826  C  C     . ARG C 2 584  ? -38.598 2.917   27.570  1.00 42.16  ?  584  ARG C C     1 
ATOM   7827  O  O     . ARG C 2 584  ? -37.554 3.491   27.901  1.00 44.16  ?  584  ARG C O     1 
ATOM   7828  C  CB    . ARG C 2 584  ? -38.781 4.293   25.474  1.00 48.66  ?  584  ARG C CB    1 
ATOM   7829  C  CG    . ARG C 2 584  ? -39.416 5.468   26.208  1.00 51.89  ?  584  ARG C CG    1 
ATOM   7830  C  CD    . ARG C 2 584  ? -39.386 6.745   25.384  1.00 56.47  ?  584  ARG C CD    1 
ATOM   7831  N  NE    . ARG C 2 584  ? -39.841 7.896   26.159  1.00 47.93  ?  584  ARG C NE    1 
ATOM   7832  C  CZ    . ARG C 2 584  ? -40.090 9.096   25.645  1.00 54.24  ?  584  ARG C CZ    1 
ATOM   7833  N  NH1   . ARG C 2 584  ? -39.935 9.308   24.345  1.00 65.76  ?  584  ARG C NH1   1 
ATOM   7834  N  NH2   . ARG C 2 584  ? -40.499 10.084  26.430  1.00 52.77  ?  584  ARG C NH2   1 
ATOM   7835  N  N     . GLN C 2 585  ? -39.346 2.229   28.437  1.00 36.74  ?  585  GLN C N     1 
ATOM   7836  C  CA    . GLN C 2 585  ? -39.025 2.218   29.856  1.00 39.63  ?  585  GLN C CA    1 
ATOM   7837  C  C     . GLN C 2 585  ? -37.689 1.547   30.144  1.00 38.26  ?  585  GLN C C     1 
ATOM   7838  O  O     . GLN C 2 585  ? -37.058 1.862   31.158  1.00 42.73  ?  585  GLN C O     1 
ATOM   7839  C  CB    . GLN C 2 585  ? -40.154 1.519   30.619  1.00 40.89  ?  585  GLN C CB    1 
ATOM   7840  C  CG    . GLN C 2 585  ? -40.002 1.529   32.131  1.00 44.16  ?  585  GLN C CG    1 
ATOM   7841  C  CD    . GLN C 2 585  ? -41.253 1.055   32.846  1.00 47.09  ?  585  GLN C CD    1 
ATOM   7842  O  OE1   . GLN C 2 585  ? -42.366 1.173   32.330  1.00 49.79  ?  585  GLN C OE1   1 
ATOM   7843  N  NE2   . GLN C 2 585  ? -41.075 0.519   34.047  1.00 47.61  ?  585  GLN C NE2   1 
ATOM   7844  N  N     . MET C 2 586  ? -37.230 0.657   29.266  1.00 33.02  ?  586  MET C N     1 
ATOM   7845  C  CA    . MET C 2 586  ? -36.030 -0.124  29.525  1.00 33.12  ?  586  MET C CA    1 
ATOM   7846  C  C     . MET C 2 586  ? -34.753 0.525   29.007  1.00 36.69  ?  586  MET C C     1 
ATOM   7847  O  O     . MET C 2 586  ? -33.663 0.138   29.442  1.00 37.47  ?  586  MET C O     1 
ATOM   7848  C  CB    . MET C 2 586  ? -36.172 -1.511  28.899  1.00 31.76  ?  586  MET C CB    1 
ATOM   7849  C  CG    . MET C 2 586  ? -36.769 -1.489  27.505  1.00 33.92  ?  586  MET C CG    1 
ATOM   7850  S  SD    . MET C 2 586  ? -36.605 -3.058  26.636  1.00 40.60  ?  586  MET C SD    1 
ATOM   7851  C  CE    . MET C 2 586  ? -34.870 -3.019  26.198  1.00 28.21  ?  586  MET C CE    1 
ATOM   7852  N  N     . VAL C 2 587  ? -34.851 1.496   28.107  1.00 32.59  ?  587  VAL C N     1 
ATOM   7853  C  CA    . VAL C 2 587  ? -33.675 2.034   27.439  1.00 28.98  ?  587  VAL C CA    1 
ATOM   7854  C  C     . VAL C 2 587  ? -33.166 3.259   28.188  1.00 37.33  ?  587  VAL C C     1 
ATOM   7855  O  O     . VAL C 2 587  ? -33.844 3.831   29.045  1.00 37.89  ?  587  VAL C O     1 
ATOM   7856  C  CB    . VAL C 2 587  ? -33.973 2.376   25.966  1.00 23.71  ?  587  VAL C CB    1 
ATOM   7857  C  CG1   . VAL C 2 587  ? -34.509 1.153   25.242  1.00 35.08  ?  587  VAL C CG1   1 
ATOM   7858  C  CG2   . VAL C 2 587  ? -34.966 3.521   25.892  1.00 20.40  ?  587  VAL C CG2   1 
ATOM   7859  N  N     . SER C 2 588  ? -31.946 3.668   27.848  1.00 38.06  ?  588  SER C N     1 
ATOM   7860  C  CA    . SER C 2 588  ? -31.330 4.849   28.426  1.00 32.63  ?  588  SER C CA    1 
ATOM   7861  C  C     . SER C 2 588  ? -31.713 6.091   27.622  1.00 26.91  ?  588  SER C C     1 
ATOM   7862  O  O     . SER C 2 588  ? -32.468 6.029   26.648  1.00 25.94  ?  588  SER C O     1 
ATOM   7863  C  CB    . SER C 2 588  ? -29.813 4.690   28.474  1.00 37.14  ?  588  SER C CB    1 
ATOM   7864  O  OG    . SER C 2 588  ? -29.178 5.934   28.730  1.00 49.90  ?  588  SER C OG    1 
ATOM   7865  N  N     . VAL C 2 589  ? -31.173 7.239   28.034  1.00 35.51  ?  589  VAL C N     1 
ATOM   7866  C  CA    . VAL C 2 589  ? -31.467 8.488   27.339  1.00 29.10  ?  589  VAL C CA    1 
ATOM   7867  C  C     . VAL C 2 589  ? -30.854 8.475   25.945  1.00 26.36  ?  589  VAL C C     1 
ATOM   7868  O  O     . VAL C 2 589  ? -31.538 8.729   24.946  1.00 27.08  ?  589  VAL C O     1 
ATOM   7869  C  CB    . VAL C 2 589  ? -30.970 9.690   28.161  1.00 32.06  ?  589  VAL C CB    1 
ATOM   7870  C  CG1   . VAL C 2 589  ? -31.403 10.990  27.499  1.00 22.05  ?  589  VAL C CG1   1 
ATOM   7871  C  CG2   . VAL C 2 589  ? -31.486 9.609   29.587  1.00 32.89  ?  589  VAL C CG2   1 
ATOM   7872  N  N     . ALA C 2 590  ? -29.556 8.177   25.857  1.00 31.72  ?  590  ALA C N     1 
ATOM   7873  C  CA    . ALA C 2 590  ? -28.894 8.126   24.558  1.00 31.47  ?  590  ALA C CA    1 
ATOM   7874  C  C     . ALA C 2 590  ? -29.428 6.979   23.710  1.00 29.98  ?  590  ALA C C     1 
ATOM   7875  O  O     . ALA C 2 590  ? -29.529 7.101   22.484  1.00 29.27  ?  590  ALA C O     1 
ATOM   7876  C  CB    . ALA C 2 590  ? -27.383 7.999   24.743  1.00 32.36  ?  590  ALA C CB    1 
ATOM   7877  N  N     . THR C 2 591  ? -29.774 5.858   24.346  1.00 32.24  ?  591  THR C N     1 
ATOM   7878  C  CA    . THR C 2 591  ? -30.351 4.739   23.609  1.00 23.50  ?  591  THR C CA    1 
ATOM   7879  C  C     . THR C 2 591  ? -31.723 5.098   23.053  1.00 21.35  ?  591  THR C C     1 
ATOM   7880  O  O     . THR C 2 591  ? -32.072 4.697   21.936  1.00 22.38  ?  591  THR C O     1 
ATOM   7881  C  CB    . THR C 2 591  ? -30.439 3.507   24.511  1.00 29.83  ?  591  THR C CB    1 
ATOM   7882  O  OG1   . THR C 2 591  ? -29.136 3.190   25.018  1.00 37.72  ?  591  THR C OG1   1 
ATOM   7883  C  CG2   . THR C 2 591  ? -30.973 2.316   23.738  1.00 23.62  ?  591  THR C CG2   1 
ATOM   7884  N  N     . ALA C 2 592  ? -32.510 5.866   23.810  1.00 23.93  ?  592  ALA C N     1 
ATOM   7885  C  CA    . ALA C 2 592  ? -33.832 6.277   23.353  1.00 21.36  ?  592  ALA C CA    1 
ATOM   7886  C  C     . ALA C 2 592  ? -33.779 7.269   22.201  1.00 23.12  ?  592  ALA C C     1 
ATOM   7887  O  O     . ALA C 2 592  ? -34.820 7.535   21.591  1.00 28.41  ?  592  ALA C O     1 
ATOM   7888  C  CB    . ALA C 2 592  ? -34.627 6.887   24.509  1.00 15.65  ?  592  ALA C CB    1 
ATOM   7889  N  N     . MET C 2 593  ? -32.609 7.820   21.892  1.00 17.51  ?  593  MET C N     1 
ATOM   7890  C  CA    . MET C 2 593  ? -32.468 8.797   20.822  1.00 22.14  ?  593  MET C CA    1 
ATOM   7891  C  C     . MET C 2 593  ? -32.212 8.161   19.464  1.00 24.12  ?  593  MET C C     1 
ATOM   7892  O  O     . MET C 2 593  ? -32.015 8.886   18.483  1.00 21.20  ?  593  MET C O     1 
ATOM   7893  C  CB    . MET C 2 593  ? -31.342 9.780   21.155  1.00 22.15  ?  593  MET C CB    1 
ATOM   7894  C  CG    . MET C 2 593  ? -31.793 11.228  21.211  1.00 25.28  ?  593  MET C CG    1 
ATOM   7895  S  SD    . MET C 2 593  ? -30.580 12.293  22.007  1.00 30.43  ?  593  MET C SD    1 
ATOM   7896  C  CE    . MET C 2 593  ? -30.485 11.521  23.619  1.00 26.60  ?  593  MET C CE    1 
ATOM   7897  N  N     . ILE C 2 594  ? -32.216 6.833   19.379  1.00 27.02  ?  594  ILE C N     1 
ATOM   7898  C  CA    . ILE C 2 594  ? -31.986 6.123   18.128  1.00 22.39  ?  594  ILE C CA    1 
ATOM   7899  C  C     . ILE C 2 594  ? -33.356 5.817   17.507  1.00 22.59  ?  594  ILE C C     1 
ATOM   7900  O  O     . ILE C 2 594  ? -34.069 4.947   18.033  1.00 24.32  ?  594  ILE C O     1 
ATOM   7901  C  CB    . ILE C 2 594  ? -31.182 4.838   18.347  1.00 17.50  ?  594  ILE C CB    1 
ATOM   7902  C  CG1   . ILE C 2 594  ? -29.812 5.162   18.947  1.00 19.33  ?  594  ILE C CG1   1 
ATOM   7903  C  CG2   . ILE C 2 594  ? -31.038 4.068   17.042  1.00 24.40  ?  594  ILE C CG2   1 
ATOM   7904  C  CD1   . ILE C 2 594  ? -28.980 3.940   19.265  1.00 13.89  ?  594  ILE C CD1   1 
ATOM   7905  N  N     . PRO C 2 595  ? -33.743 6.489   16.430  1.00 22.87  ?  595  PRO C N     1 
ATOM   7906  C  CA    . PRO C 2 595  ? -35.030 6.173   15.799  1.00 27.90  ?  595  PRO C CA    1 
ATOM   7907  C  C     . PRO C 2 595  ? -34.994 4.806   15.137  1.00 28.33  ?  595  PRO C C     1 
ATOM   7908  O  O     . PRO C 2 595  ? -33.956 4.356   14.646  1.00 25.38  ?  595  PRO C O     1 
ATOM   7909  C  CB    . PRO C 2 595  ? -35.201 7.291   14.765  1.00 23.63  ?  595  PRO C CB    1 
ATOM   7910  C  CG    . PRO C 2 595  ? -33.806 7.705   14.439  1.00 20.97  ?  595  PRO C CG    1 
ATOM   7911  C  CD    . PRO C 2 595  ? -33.021 7.553   15.714  1.00 21.56  ?  595  PRO C CD    1 
ATOM   7912  N  N     . PHE C 2 596  ? -36.153 4.146   15.131  1.00 33.33  ?  596  PHE C N     1 
ATOM   7913  C  CA    . PHE C 2 596  ? -36.278 2.784   14.611  1.00 30.79  ?  596  PHE C CA    1 
ATOM   7914  C  C     . PHE C 2 596  ? -35.276 1.847   15.281  1.00 31.89  ?  596  PHE C C     1 
ATOM   7915  O  O     . PHE C 2 596  ? -34.642 1.012   14.632  1.00 29.69  ?  596  PHE C O     1 
ATOM   7916  C  CB    . PHE C 2 596  ? -36.117 2.751   13.089  1.00 28.54  ?  596  PHE C CB    1 
ATOM   7917  C  CG    . PHE C 2 596  ? -37.143 3.559   12.349  1.00 30.55  ?  596  PHE C CG    1 
ATOM   7918  C  CD1   . PHE C 2 596  ? -38.478 3.192   12.368  1.00 37.72  ?  596  PHE C CD1   1 
ATOM   7919  C  CD2   . PHE C 2 596  ? -36.770 4.676   11.619  1.00 31.13  ?  596  PHE C CD2   1 
ATOM   7920  C  CE1   . PHE C 2 596  ? -39.425 3.931   11.683  1.00 39.94  ?  596  PHE C CE1   1 
ATOM   7921  C  CE2   . PHE C 2 596  ? -37.711 5.419   10.931  1.00 29.40  ?  596  PHE C CE2   1 
ATOM   7922  C  CZ    . PHE C 2 596  ? -39.040 5.046   10.963  1.00 30.89  ?  596  PHE C CZ    1 
ATOM   7923  N  N     . LEU C 2 597  ? -35.124 1.999   16.599  1.00 34.27  ?  597  LEU C N     1 
ATOM   7924  C  CA    . LEU C 2 597  ? -34.191 1.155   17.339  1.00 34.15  ?  597  LEU C CA    1 
ATOM   7925  C  C     . LEU C 2 597  ? -34.609 -0.307  17.304  1.00 34.76  ?  597  LEU C C     1 
ATOM   7926  O  O     . LEU C 2 597  ? -33.752 -1.198  17.295  1.00 34.12  ?  597  LEU C O     1 
ATOM   7927  C  CB    . LEU C 2 597  ? -34.078 1.638   18.786  1.00 29.56  ?  597  LEU C CB    1 
ATOM   7928  C  CG    . LEU C 2 597  ? -33.192 0.798   19.709  1.00 28.69  ?  597  LEU C CG    1 
ATOM   7929  C  CD1   . LEU C 2 597  ? -31.762 0.774   19.198  1.00 26.98  ?  597  LEU C CD1   1 
ATOM   7930  C  CD2   . LEU C 2 597  ? -33.243 1.317   21.134  1.00 27.99  ?  597  LEU C CD2   1 
ATOM   7931  N  N     . GLU C 2 598  ? -35.915 -0.576  17.271  1.00 33.98  ?  598  GLU C N     1 
ATOM   7932  C  CA    . GLU C 2 598  ? -36.405 -1.949  17.258  1.00 32.96  ?  598  GLU C CA    1 
ATOM   7933  C  C     . GLU C 2 598  ? -36.029 -2.699  15.986  1.00 36.47  ?  598  GLU C C     1 
ATOM   7934  O  O     . GLU C 2 598  ? -36.248 -3.913  15.918  1.00 40.00  ?  598  GLU C O     1 
ATOM   7935  C  CB    . GLU C 2 598  ? -37.925 -1.966  17.439  1.00 35.21  ?  598  GLU C CB    1 
ATOM   7936  C  CG    . GLU C 2 598  ? -38.699 -1.197  16.377  1.00 37.57  ?  598  GLU C CG    1 
ATOM   7937  C  CD    . GLU C 2 598  ? -38.773 0.293   16.659  1.00 40.70  ?  598  GLU C CD    1 
ATOM   7938  O  OE1   . GLU C 2 598  ? -38.237 0.734   17.698  1.00 38.70  ?  598  GLU C OE1   1 
ATOM   7939  O  OE2   . GLU C 2 598  ? -39.371 1.022   15.840  1.00 46.63  ?  598  GLU C OE2   1 
ATOM   7940  N  N     . HIS C 2 599  ? -35.474 -2.017  14.986  1.00 31.32  ?  599  HIS C N     1 
ATOM   7941  C  CA    . HIS C 2 599  ? -35.046 -2.651  13.748  1.00 30.29  ?  599  HIS C CA    1 
ATOM   7942  C  C     . HIS C 2 599  ? -33.539 -2.859  13.679  1.00 34.25  ?  599  HIS C C     1 
ATOM   7943  O  O     . HIS C 2 599  ? -33.047 -3.391  12.679  1.00 36.39  ?  599  HIS C O     1 
ATOM   7944  C  CB    . HIS C 2 599  ? -35.506 -1.820  12.546  1.00 33.82  ?  599  HIS C CB    1 
ATOM   7945  C  CG    . HIS C 2 599  ? -36.980 -1.562  12.519  1.00 32.44  ?  599  HIS C CG    1 
ATOM   7946  N  ND1   . HIS C 2 599  ? -37.867 -2.382  11.855  1.00 41.84  ?  599  HIS C ND1   1 
ATOM   7947  C  CD2   . HIS C 2 599  ? -37.723 -0.575  13.072  1.00 34.49  ?  599  HIS C CD2   1 
ATOM   7948  C  CE1   . HIS C 2 599  ? -39.092 -1.911  12.001  1.00 47.47  ?  599  HIS C CE1   1 
ATOM   7949  N  NE2   . HIS C 2 599  ? -39.033 -0.815  12.736  1.00 37.89  ?  599  HIS C NE2   1 
ATOM   7950  N  N     . ASP C 2 600  ? -32.799 -2.458  14.708  1.00 28.68  ?  600  ASP C N     1 
ATOM   7951  C  CA    . ASP C 2 600  ? -31.350 -2.587  14.738  1.00 30.80  ?  600  ASP C CA    1 
ATOM   7952  C  C     . ASP C 2 600  ? -30.941 -3.631  15.768  1.00 30.50  ?  600  ASP C C     1 
ATOM   7953  O  O     . ASP C 2 600  ? -31.511 -3.694  16.862  1.00 30.55  ?  600  ASP C O     1 
ATOM   7954  C  CB    . ASP C 2 600  ? -30.683 -1.247  15.065  1.00 32.08  ?  600  ASP C CB    1 
ATOM   7955  C  CG    . ASP C 2 600  ? -31.069 -0.148  14.093  1.00 36.56  ?  600  ASP C CG    1 
ATOM   7956  O  OD1   . ASP C 2 600  ? -31.428 -0.467  12.940  1.00 37.41  ?  600  ASP C OD1   1 
ATOM   7957  O  OD2   . ASP C 2 600  ? -31.009 1.038   14.483  1.00 32.06  ?  600  ASP C OD2   1 
ATOM   7958  N  N     . ASP C 2 601  ? -29.951 -4.446  15.415  1.00 29.42  ?  601  ASP C N     1 
ATOM   7959  C  CA    . ASP C 2 601  ? -29.428 -5.430  16.348  1.00 33.43  ?  601  ASP C CA    1 
ATOM   7960  C  C     . ASP C 2 601  ? -28.677 -4.734  17.481  1.00 29.79  ?  601  ASP C C     1 
ATOM   7961  O  O     . ASP C 2 601  ? -28.219 -3.596  17.353  1.00 30.60  ?  601  ASP C O     1 
ATOM   7962  C  CB    . ASP C 2 601  ? -28.509 -6.419  15.630  1.00 34.62  ?  601  ASP C CB    1 
ATOM   7963  C  CG    . ASP C 2 601  ? -28.210 -7.648  16.466  1.00 52.39  ?  601  ASP C CG    1 
ATOM   7964  O  OD1   . ASP C 2 601  ? -29.059 -8.563  16.503  1.00 56.58  ?  601  ASP C OD1   1 
ATOM   7965  O  OD2   . ASP C 2 601  ? -27.130 -7.696  17.091  1.00 49.19  ?  601  ASP C OD2   1 
ATOM   7966  N  N     . ALA C 2 602  ? -28.551 -5.443  18.606  1.00 25.46  ?  602  ALA C N     1 
ATOM   7967  C  CA    . ALA C 2 602  ? -27.966 -4.841  19.801  1.00 26.03  ?  602  ALA C CA    1 
ATOM   7968  C  C     . ALA C 2 602  ? -26.492 -4.502  19.614  1.00 28.59  ?  602  ALA C C     1 
ATOM   7969  O  O     . ALA C 2 602  ? -25.976 -3.608  20.294  1.00 26.18  ?  602  ALA C O     1 
ATOM   7970  C  CB    . ALA C 2 602  ? -28.145 -5.773  20.998  1.00 35.56  ?  602  ALA C CB    1 
ATOM   7971  N  N     . ASN C 2 603  ? -25.800 -5.198  18.710  1.00 33.23  ?  603  ASN C N     1 
ATOM   7972  C  CA    . ASN C 2 603  ? -24.384 -4.923  18.485  1.00 31.13  ?  603  ASN C CA    1 
ATOM   7973  C  C     . ASN C 2 603  ? -24.177 -3.516  17.936  1.00 28.68  ?  603  ASN C C     1 
ATOM   7974  O  O     . ASN C 2 603  ? -23.432 -2.713  18.509  1.00 24.96  ?  603  ASN C O     1 
ATOM   7975  C  CB    . ASN C 2 603  ? -23.790 -5.968  17.539  1.00 41.59  ?  603  ASN C CB    1 
ATOM   7976  C  CG    . ASN C 2 603  ? -23.409 -7.250  18.252  1.00 50.53  ?  603  ASN C CG    1 
ATOM   7977  O  OD1   . ASN C 2 603  ? -23.709 -7.431  19.432  1.00 44.29  ?  603  ASN C OD1   1 
ATOM   7978  N  ND2   . ASN C 2 603  ? -22.743 -8.149  17.536  1.00 64.44  ?  603  ASN C ND2   1 
ATOM   7979  N  N     . ARG C 2 604  ? -24.831 -3.198  16.815  1.00 38.32  ?  604  ARG C N     1 
ATOM   7980  C  CA    . ARG C 2 604  ? -24.662 -1.873  16.230  1.00 36.55  ?  604  ARG C CA    1 
ATOM   7981  C  C     . ARG C 2 604  ? -25.436 -0.815  17.006  1.00 34.11  ?  604  ARG C C     1 
ATOM   7982  O  O     . ARG C 2 604  ? -25.052 0.360   16.999  1.00 36.92  ?  604  ARG C O     1 
ATOM   7983  C  CB    . ARG C 2 604  ? -25.100 -1.881  14.767  1.00 37.09  ?  604  ARG C CB    1 
ATOM   7984  C  CG    . ARG C 2 604  ? -24.664 -3.114  13.994  1.00 43.85  ?  604  ARG C CG    1 
ATOM   7985  C  CD    . ARG C 2 604  ? -23.151 -3.249  13.918  1.00 37.38  ?  604  ARG C CD    1 
ATOM   7986  N  NE    . ARG C 2 604  ? -22.526 -2.108  13.257  1.00 30.61  ?  604  ARG C NE    1 
ATOM   7987  C  CZ    . ARG C 2 604  ? -21.322 -2.140  12.695  1.00 31.99  ?  604  ARG C CZ    1 
ATOM   7988  N  NH1   . ARG C 2 604  ? -20.613 -3.261  12.703  1.00 37.29  ?  604  ARG C NH1   1 
ATOM   7989  N  NH2   . ARG C 2 604  ? -20.829 -1.053  12.117  1.00 20.99  ?  604  ARG C NH2   1 
ATOM   7990  N  N     . ALA C 2 605  ? -26.523 -1.207  17.678  1.00 24.52  ?  605  ALA C N     1 
ATOM   7991  C  CA    . ALA C 2 605  ? -27.268 -0.253  18.493  1.00 25.48  ?  605  ALA C CA    1 
ATOM   7992  C  C     . ALA C 2 605  ? -26.417 0.262   19.645  1.00 25.42  ?  605  ALA C C     1 
ATOM   7993  O  O     . ALA C 2 605  ? -26.516 1.434   20.025  1.00 19.75  ?  605  ALA C O     1 
ATOM   7994  C  CB    . ALA C 2 605  ? -28.550 -0.898  19.018  1.00 30.98  ?  605  ALA C CB    1 
ATOM   7995  N  N     . LEU C 2 606  ? -25.579 -0.605  20.218  1.00 25.18  ?  606  LEU C N     1 
ATOM   7996  C  CA    . LEU C 2 606  ? -24.640 -0.169  21.245  1.00 20.20  ?  606  LEU C CA    1 
ATOM   7997  C  C     . LEU C 2 606  ? -23.683 0.881   20.693  1.00 25.74  ?  606  LEU C C     1 
ATOM   7998  O  O     . LEU C 2 606  ? -23.436 1.912   21.331  1.00 29.43  ?  606  LEU C O     1 
ATOM   7999  C  CB    . LEU C 2 606  ? -23.876 -1.379  21.789  1.00 14.45  ?  606  LEU C CB    1 
ATOM   8000  C  CG    . LEU C 2 606  ? -22.796 -1.199  22.857  1.00 15.05  ?  606  LEU C CG    1 
ATOM   8001  C  CD1   . LEU C 2 606  ? -22.736 -2.437  23.731  1.00 25.49  ?  606  LEU C CD1   1 
ATOM   8002  C  CD2   . LEU C 2 606  ? -21.434 -0.945  22.231  1.00 33.62  ?  606  LEU C CD2   1 
ATOM   8003  N  N     . MET C 2 607  ? -23.134 0.634   19.501  1.00 27.51  ?  607  MET C N     1 
ATOM   8004  C  CA    . MET C 2 607  ? -22.248 1.610   18.875  1.00 24.16  ?  607  MET C CA    1 
ATOM   8005  C  C     . MET C 2 607  ? -22.993 2.885   18.505  1.00 22.18  ?  607  MET C C     1 
ATOM   8006  O  O     . MET C 2 607  ? -22.396 3.967   18.486  1.00 23.40  ?  607  MET C O     1 
ATOM   8007  C  CB    . MET C 2 607  ? -21.590 1.007   17.633  1.00 29.76  ?  607  MET C CB    1 
ATOM   8008  C  CG    . MET C 2 607  ? -20.876 -0.313  17.871  1.00 35.37  ?  607  MET C CG    1 
ATOM   8009  S  SD    . MET C 2 607  ? -20.178 -0.988  16.349  1.00 39.38  ?  607  MET C SD    1 
ATOM   8010  C  CE    . MET C 2 607  ? -19.559 -2.567  16.922  1.00 54.44  ?  607  MET C CE    1 
ATOM   8011  N  N     . GLY C 2 608  ? -24.289 2.779   18.206  1.00 20.64  ?  608  GLY C N     1 
ATOM   8012  C  CA    . GLY C 2 608  ? -25.055 3.962   17.851  1.00 23.10  ?  608  GLY C CA    1 
ATOM   8013  C  C     . GLY C 2 608  ? -25.198 4.938   19.004  1.00 21.26  ?  608  GLY C C     1 
ATOM   8014  O  O     . GLY C 2 608  ? -25.071 6.151   18.821  1.00 20.29  ?  608  GLY C O     1 
ATOM   8015  N  N     . ALA C 2 609  ? -25.464 4.424   20.205  1.00 18.28  ?  609  ALA C N     1 
ATOM   8016  C  CA    . ALA C 2 609  ? -25.587 5.287   21.373  1.00 21.75  ?  609  ALA C CA    1 
ATOM   8017  C  C     . ALA C 2 609  ? -24.231 5.752   21.886  1.00 24.16  ?  609  ALA C C     1 
ATOM   8018  O  O     . ALA C 2 609  ? -24.112 6.883   22.372  1.00 33.05  ?  609  ALA C O     1 
ATOM   8019  C  CB    . ALA C 2 609  ? -26.351 4.567   22.484  1.00 29.59  ?  609  ALA C CB    1 
ATOM   8020  N  N     . ASN C 2 610  ? -23.201 4.908   21.786  1.00 17.05  ?  610  ASN C N     1 
ATOM   8021  C  CA    . ASN C 2 610  ? -21.880 5.305   22.263  1.00 22.33  ?  610  ASN C CA    1 
ATOM   8022  C  C     . ASN C 2 610  ? -21.278 6.395   21.388  1.00 22.03  ?  610  ASN C C     1 
ATOM   8023  O  O     . ASN C 2 610  ? -20.614 7.308   21.894  1.00 22.45  ?  610  ASN C O     1 
ATOM   8024  C  CB    . ASN C 2 610  ? -20.949 4.095   22.321  1.00 22.60  ?  610  ASN C CB    1 
ATOM   8025  C  CG    . ASN C 2 610  ? -21.111 3.296   23.598  1.00 31.82  ?  610  ASN C CG    1 
ATOM   8026  O  OD1   . ASN C 2 610  ? -21.566 3.817   24.617  1.00 37.07  ?  610  ASN C OD1   1 
ATOM   8027  N  ND2   . ASN C 2 610  ? -20.729 2.026   23.553  1.00 33.50  ?  610  ASN C ND2   1 
ATOM   8028  N  N     . MET C 2 611  ? -21.496 6.320   20.075  1.00 22.28  ?  611  MET C N     1 
ATOM   8029  C  CA    . MET C 2 611  ? -20.945 7.320   19.171  1.00 20.79  ?  611  MET C CA    1 
ATOM   8030  C  C     . MET C 2 611  ? -21.744 8.616   19.170  1.00 20.31  ?  611  MET C C     1 
ATOM   8031  O  O     . MET C 2 611  ? -21.222 9.647   18.732  1.00 22.76  ?  611  MET C O     1 
ATOM   8032  C  CB    . MET C 2 611  ? -20.853 6.759   17.750  1.00 17.82  ?  611  MET C CB    1 
ATOM   8033  C  CG    . MET C 2 611  ? -19.822 5.649   17.594  1.00 21.93  ?  611  MET C CG    1 
ATOM   8034  S  SD    . MET C 2 611  ? -19.584 5.130   15.884  1.00 23.41  ?  611  MET C SD    1 
ATOM   8035  C  CE    . MET C 2 611  ? -21.252 4.662   15.434  1.00 25.74  ?  611  MET C CE    1 
ATOM   8036  N  N     . GLN C 2 612  ? -22.992 8.593   19.646  1.00 18.27  ?  612  GLN C N     1 
ATOM   8037  C  CA    . GLN C 2 612  ? -23.738 9.839   19.798  1.00 18.89  ?  612  GLN C CA    1 
ATOM   8038  C  C     . GLN C 2 612  ? -23.066 10.758  20.809  1.00 15.62  ?  612  GLN C C     1 
ATOM   8039  O  O     . GLN C 2 612  ? -23.062 11.983  20.641  1.00 16.47  ?  612  GLN C O     1 
ATOM   8040  C  CB    . GLN C 2 612  ? -25.179 9.548   20.214  1.00 18.76  ?  612  GLN C CB    1 
ATOM   8041  C  CG    . GLN C 2 612  ? -26.103 9.199   19.063  1.00 21.32  ?  612  GLN C CG    1 
ATOM   8042  C  CD    . GLN C 2 612  ? -27.547 9.065   19.501  1.00 22.51  ?  612  GLN C CD    1 
ATOM   8043  O  OE1   . GLN C 2 612  ? -28.404 9.853   19.102  1.00 29.05  ?  612  GLN C OE1   1 
ATOM   8044  N  NE2   . GLN C 2 612  ? -27.824 8.063   20.326  1.00 15.26  ?  612  GLN C NE2   1 
ATOM   8045  N  N     . ARG C 2 613  ? -22.490 10.184  21.868  1.00 19.04  ?  613  ARG C N     1 
ATOM   8046  C  CA    . ARG C 2 613  ? -21.742 10.979  22.833  1.00 20.02  ?  613  ARG C CA    1 
ATOM   8047  C  C     . ARG C 2 613  ? -20.438 11.509  22.255  1.00 22.58  ?  613  ARG C C     1 
ATOM   8048  O  O     . ARG C 2 613  ? -19.849 12.431  22.829  1.00 25.04  ?  613  ARG C O     1 
ATOM   8049  C  CB    . ARG C 2 613  ? -21.448 10.151  24.084  1.00 25.84  ?  613  ARG C CB    1 
ATOM   8050  C  CG    . ARG C 2 613  ? -22.676 9.706   24.856  1.00 23.70  ?  613  ARG C CG    1 
ATOM   8051  C  CD    . ARG C 2 613  ? -22.436 8.341   25.473  1.00 20.05  ?  613  ARG C CD    1 
ATOM   8052  N  NE    . ARG C 2 613  ? -21.069 8.210   25.970  1.00 26.71  ?  613  ARG C NE    1 
ATOM   8053  C  CZ    . ARG C 2 613  ? -20.462 7.048   26.184  1.00 34.15  ?  613  ARG C CZ    1 
ATOM   8054  N  NH1   . ARG C 2 613  ? -21.097 5.911   25.937  1.00 36.10  ?  613  ARG C NH1   1 
ATOM   8055  N  NH2   . ARG C 2 613  ? -19.215 7.022   26.636  1.00 44.44  ?  613  ARG C NH2   1 
ATOM   8056  N  N     . GLN C 2 614  ? -19.974 10.947  21.143  1.00 20.14  ?  614  GLN C N     1 
ATOM   8057  C  CA    . GLN C 2 614  ? -18.727 11.366  20.518  1.00 16.72  ?  614  GLN C CA    1 
ATOM   8058  C  C     . GLN C 2 614  ? -18.927 12.423  19.440  1.00 16.27  ?  614  GLN C C     1 
ATOM   8059  O  O     . GLN C 2 614  ? -17.954 12.799  18.777  1.00 14.11  ?  614  GLN C O     1 
ATOM   8060  C  CB    . GLN C 2 614  ? -18.004 10.152  19.925  1.00 10.64  ?  614  GLN C CB    1 
ATOM   8061  C  CG    . GLN C 2 614  ? -17.575 9.121   20.956  1.00 12.42  ?  614  GLN C CG    1 
ATOM   8062  C  CD    . GLN C 2 614  ? -16.848 7.945   20.334  1.00 20.32  ?  614  GLN C CD    1 
ATOM   8063  O  OE1   . GLN C 2 614  ? -17.131 7.555   19.201  1.00 28.32  ?  614  GLN C OE1   1 
ATOM   8064  N  NE2   . GLN C 2 614  ? -15.900 7.379   21.071  1.00 21.91  ?  614  GLN C NE2   1 
ATOM   8065  N  N     . ALA C 2 615  ? -20.151 12.907  19.250  1.00 15.82  ?  615  ALA C N     1 
ATOM   8066  C  CA    . ALA C 2 615  ? -20.412 13.931  18.250  1.00 14.49  ?  615  ALA C CA    1 
ATOM   8067  C  C     . ALA C 2 615  ? -19.702 15.232  18.609  1.00 18.29  ?  615  ALA C C     1 
ATOM   8068  O  O     . ALA C 2 615  ? -19.460 15.534  19.780  1.00 21.77  ?  615  ALA C O     1 
ATOM   8069  C  CB    . ALA C 2 615  ? -21.915 14.177  18.116  1.00 12.87  ?  615  ALA C CB    1 
ATOM   8070  N  N     . VAL C 2 616  ? -19.371 16.002  17.585  1.00 20.01  ?  616  VAL C N     1 
ATOM   8071  C  CA    . VAL C 2 616  ? -18.651 17.266  17.728  1.00 12.68  ?  616  VAL C CA    1 
ATOM   8072  C  C     . VAL C 2 616  ? -19.637 18.403  17.499  1.00 12.29  ?  616  VAL C C     1 
ATOM   8073  O  O     . VAL C 2 616  ? -20.405 18.355  16.531  1.00 23.50  ?  616  VAL C O     1 
ATOM   8074  C  CB    . VAL C 2 616  ? -17.470 17.367  16.743  1.00 13.11  ?  616  VAL C CB    1 
ATOM   8075  C  CG1   . VAL C 2 616  ? -16.758 18.697  16.896  1.00 19.12  ?  616  VAL C CG1   1 
ATOM   8076  C  CG2   . VAL C 2 616  ? -16.502 16.229  16.970  1.00 14.18  ?  616  VAL C CG2   1 
ATOM   8077  N  N     . PRO C 2 617  ? -19.658 19.428  18.353  1.00 10.89  ?  617  PRO C N     1 
ATOM   8078  C  CA    . PRO C 2 617  ? -20.543 20.579  18.119  1.00 17.66  ?  617  PRO C CA    1 
ATOM   8079  C  C     . PRO C 2 617  ? -20.104 21.355  16.886  1.00 14.29  ?  617  PRO C C     1 
ATOM   8080  O  O     . PRO C 2 617  ? -18.968 21.827  16.804  1.00 10.85  ?  617  PRO C O     1 
ATOM   8081  C  CB    . PRO C 2 617  ? -20.391 21.410  19.398  1.00 12.46  ?  617  PRO C CB    1 
ATOM   8082  C  CG    . PRO C 2 617  ? -19.066 21.009  19.953  1.00 10.12  ?  617  PRO C CG    1 
ATOM   8083  C  CD    . PRO C 2 617  ? -18.906 19.558  19.613  1.00 15.81  ?  617  PRO C CD    1 
ATOM   8084  N  N     . LEU C 2 618  ? -21.013 21.483  15.926  1.00 12.58  ?  618  LEU C N     1 
ATOM   8085  C  CA    . LEU C 2 618  ? -20.713 22.162  14.678  1.00 12.50  ?  618  LEU C CA    1 
ATOM   8086  C  C     . LEU C 2 618  ? -20.889 23.671  14.836  1.00 14.38  ?  618  LEU C C     1 
ATOM   8087  O  O     . LEU C 2 618  ? -21.364 24.167  15.861  1.00 18.39  ?  618  LEU C O     1 
ATOM   8088  C  CB    . LEU C 2 618  ? -21.604 21.626  13.561  1.00 13.94  ?  618  LEU C CB    1 
ATOM   8089  C  CG    . LEU C 2 618  ? -21.596 20.101  13.429  1.00 12.04  ?  618  LEU C CG    1 
ATOM   8090  C  CD1   . LEU C 2 618  ? -22.659 19.632  12.453  1.00 17.76  ?  618  LEU C CD1   1 
ATOM   8091  C  CD2   . LEU C 2 618  ? -20.221 19.609  13.004  1.00 14.87  ?  618  LEU C CD2   1 
ATOM   8092  N  N     . VAL C 2 619  ? -20.487 24.408  13.797  1.00 9.74   ?  619  VAL C N     1 
ATOM   8093  C  CA    . VAL C 2 619  ? -20.638 25.862  13.807  1.00 7.29   ?  619  VAL C CA    1 
ATOM   8094  C  C     . VAL C 2 619  ? -22.110 26.235  13.934  1.00 17.37  ?  619  VAL C C     1 
ATOM   8095  O  O     . VAL C 2 619  ? -22.521 26.923  14.876  1.00 22.79  ?  619  VAL C O     1 
ATOM   8096  C  CB    . VAL C 2 619  ? -20.007 26.480  12.548  1.00 15.29  ?  619  VAL C CB    1 
ATOM   8097  C  CG1   . VAL C 2 619  ? -20.244 27.980  12.518  1.00 34.92  ?  619  VAL C CG1   1 
ATOM   8098  C  CG2   . VAL C 2 619  ? -18.518 26.171  12.496  1.00 13.75  ?  619  VAL C CG2   1 
ATOM   8099  N  N     . ARG C 2 620  ? -22.921 25.786  12.983  1.00 19.10  ?  620  ARG C N     1 
ATOM   8100  C  CA    . ARG C 2 620  ? -24.370 25.859  13.078  1.00 21.53  ?  620  ARG C CA    1 
ATOM   8101  C  C     . ARG C 2 620  ? -24.912 24.449  13.273  1.00 21.28  ?  620  ARG C C     1 
ATOM   8102  O  O     . ARG C 2 620  ? -24.280 23.468  12.875  1.00 22.91  ?  620  ARG C O     1 
ATOM   8103  C  CB    . ARG C 2 620  ? -24.976 26.502  11.826  1.00 12.24  ?  620  ARG C CB    1 
ATOM   8104  C  CG    . ARG C 2 620  ? -26.428 26.929  11.979  1.00 29.47  ?  620  ARG C CG    1 
ATOM   8105  C  CD    . ARG C 2 620  ? -26.604 28.412  11.685  1.00 44.64  ?  620  ARG C CD    1 
ATOM   8106  N  NE    . ARG C 2 620  ? -26.252 28.745  10.308  1.00 47.47  ?  620  ARG C NE    1 
ATOM   8107  C  CZ    . ARG C 2 620  ? -26.289 29.974  9.805   1.00 59.84  ?  620  ARG C CZ    1 
ATOM   8108  N  NH1   . ARG C 2 620  ? -25.951 30.185  8.540   1.00 52.99  ?  620  ARG C NH1   1 
ATOM   8109  N  NH2   . ARG C 2 620  ? -26.662 30.994  10.566  1.00 57.69  ?  620  ARG C NH2   1 
ATOM   8110  N  N     . SER C 2 621  ? -26.078 24.348  13.905  1.00 16.12  ?  621  SER C N     1 
ATOM   8111  C  CA    . SER C 2 621  ? -26.670 23.060  14.237  1.00 20.88  ?  621  SER C CA    1 
ATOM   8112  C  C     . SER C 2 621  ? -28.057 22.940  13.623  1.00 23.50  ?  621  SER C C     1 
ATOM   8113  O  O     . SER C 2 621  ? -28.822 23.909  13.593  1.00 30.67  ?  621  SER C O     1 
ATOM   8114  C  CB    . SER C 2 621  ? -26.752 22.865  15.755  1.00 18.04  ?  621  SER C CB    1 
ATOM   8115  O  OG    . SER C 2 621  ? -25.459 22.760  16.326  1.00 31.58  ?  621  SER C OG    1 
ATOM   8116  N  N     . GLU C 2 622  ? -28.373 21.743  13.135  1.00 22.99  ?  622  GLU C N     1 
ATOM   8117  C  CA    . GLU C 2 622  ? -29.675 21.433  12.561  1.00 19.49  ?  622  GLU C CA    1 
ATOM   8118  C  C     . GLU C 2 622  ? -30.330 20.328  13.375  1.00 19.81  ?  622  GLU C C     1 
ATOM   8119  O  O     . GLU C 2 622  ? -29.711 19.289  13.627  1.00 26.60  ?  622  GLU C O     1 
ATOM   8120  C  CB    . GLU C 2 622  ? -29.555 20.988  11.101  1.00 13.16  ?  622  GLU C CB    1 
ATOM   8121  C  CG    . GLU C 2 622  ? -29.056 22.048  10.137  1.00 38.86  ?  622  GLU C CG    1 
ATOM   8122  C  CD    . GLU C 2 622  ? -28.873 21.498  8.735   1.00 40.78  ?  622  GLU C CD    1 
ATOM   8123  O  OE1   . GLU C 2 622  ? -29.255 20.330  8.503   1.00 28.62  ?  622  GLU C OE1   1 
ATOM   8124  O  OE2   . GLU C 2 622  ? -28.347 22.226  7.868   1.00 43.75  ?  622  GLU C OE2   1 
ATOM   8125  N  N     . ALA C 2 623  ? -31.575 20.551  13.781  1.00 22.09  ?  623  ALA C N     1 
ATOM   8126  C  CA    . ALA C 2 623  ? -32.334 19.490  14.421  1.00 20.21  ?  623  ALA C CA    1 
ATOM   8127  C  C     . ALA C 2 623  ? -32.654 18.402  13.398  1.00 20.80  ?  623  ALA C C     1 
ATOM   8128  O  O     . ALA C 2 623  ? -32.892 18.704  12.224  1.00 27.22  ?  623  ALA C O     1 
ATOM   8129  C  CB    . ALA C 2 623  ? -33.623 20.040  15.030  1.00 28.61  ?  623  ALA C CB    1 
ATOM   8130  N  N     . PRO C 2 624  ? -32.656 17.133  13.802  1.00 16.38  ?  624  PRO C N     1 
ATOM   8131  C  CA    . PRO C 2 624  ? -32.891 16.058  12.830  1.00 20.60  ?  624  PRO C CA    1 
ATOM   8132  C  C     . PRO C 2 624  ? -34.329 16.046  12.340  1.00 24.12  ?  624  PRO C C     1 
ATOM   8133  O  O     . PRO C 2 624  ? -35.264 16.337  13.089  1.00 25.12  ?  624  PRO C O     1 
ATOM   8134  C  CB    . PRO C 2 624  ? -32.558 14.787  13.620  1.00 15.36  ?  624  PRO C CB    1 
ATOM   8135  C  CG    . PRO C 2 624  ? -32.795 15.163  15.044  1.00 13.53  ?  624  PRO C CG    1 
ATOM   8136  C  CD    . PRO C 2 624  ? -32.396 16.610  15.154  1.00 17.87  ?  624  PRO C CD    1 
ATOM   8137  N  N     . LEU C 2 625  ? -34.497 15.713  11.058  1.00 21.07  ?  625  LEU C N     1 
ATOM   8138  C  CA    . LEU C 2 625  ? -35.839 15.552  10.507  1.00 16.70  ?  625  LEU C CA    1 
ATOM   8139  C  C     . LEU C 2 625  ? -36.546 14.362  11.142  1.00 22.33  ?  625  LEU C C     1 
ATOM   8140  O  O     . LEU C 2 625  ? -37.715 14.456  11.535  1.00 22.97  ?  625  LEU C O     1 
ATOM   8141  C  CB    . LEU C 2 625  ? -35.771 15.392  8.989   1.00 11.11  ?  625  LEU C CB    1 
ATOM   8142  C  CG    . LEU C 2 625  ? -35.519 16.660  8.171   1.00 13.37  ?  625  LEU C CG    1 
ATOM   8143  C  CD1   . LEU C 2 625  ? -35.352 16.319  6.698   1.00 11.01  ?  625  LEU C CD1   1 
ATOM   8144  C  CD2   . LEU C 2 625  ? -36.655 17.651  8.366   1.00 17.14  ?  625  LEU C CD2   1 
ATOM   8145  N  N     . VAL C 2 626  ? -35.852 13.235  11.253  1.00 20.36  ?  626  VAL C N     1 
ATOM   8146  C  CA    . VAL C 2 626  ? -36.384 12.052  11.917  1.00 20.04  ?  626  VAL C CA    1 
ATOM   8147  C  C     . VAL C 2 626  ? -35.934 12.083  13.370  1.00 19.60  ?  626  VAL C C     1 
ATOM   8148  O  O     . VAL C 2 626  ? -34.732 12.084  13.658  1.00 18.71  ?  626  VAL C O     1 
ATOM   8149  C  CB    . VAL C 2 626  ? -35.918 10.765  11.220  1.00 21.14  ?  626  VAL C CB    1 
ATOM   8150  C  CG1   . VAL C 2 626  ? -36.510 9.547   11.912  1.00 26.24  ?  626  VAL C CG1   1 
ATOM   8151  C  CG2   . VAL C 2 626  ? -36.302 10.791  9.752   1.00 23.12  ?  626  VAL C CG2   1 
ATOM   8152  N  N     . GLY C 2 627  ? -36.899 12.114  14.290  1.00 20.96  ?  627  GLY C N     1 
ATOM   8153  C  CA    . GLY C 2 627  ? -36.608 12.205  15.704  1.00 22.94  ?  627  GLY C CA    1 
ATOM   8154  C  C     . GLY C 2 627  ? -37.309 11.112  16.492  1.00 26.70  ?  627  GLY C C     1 
ATOM   8155  O  O     . GLY C 2 627  ? -37.972 10.237  15.933  1.00 29.06  ?  627  GLY C O     1 
ATOM   8156  N  N     . THR C 2 628  ? -37.136 11.189  17.811  1.00 26.13  ?  628  THR C N     1 
ATOM   8157  C  CA    . THR C 2 628  ? -37.759 10.260  18.740  1.00 18.62  ?  628  THR C CA    1 
ATOM   8158  C  C     . THR C 2 628  ? -38.517 10.960  19.857  1.00 22.66  ?  628  THR C C     1 
ATOM   8159  O  O     . THR C 2 628  ? -39.140 10.280  20.680  1.00 31.34  ?  628  THR C O     1 
ATOM   8160  C  CB    . THR C 2 628  ? -36.703 9.336   19.361  1.00 19.70  ?  628  THR C CB    1 
ATOM   8161  O  OG1   . THR C 2 628  ? -37.311 8.520   20.370  1.00 38.53  ?  628  THR C OG1   1 
ATOM   8162  C  CG2   . THR C 2 628  ? -35.603 10.166  19.989  1.00 20.02  ?  628  THR C CG2   1 
ATOM   8163  N  N     . GLY C 2 629  ? -38.484 12.291  19.911  1.00 31.35  ?  629  GLY C N     1 
ATOM   8164  C  CA    . GLY C 2 629  ? -39.050 13.049  21.000  1.00 40.39  ?  629  GLY C CA    1 
ATOM   8165  C  C     . GLY C 2 629  ? -38.097 13.277  22.156  1.00 38.38  ?  629  GLY C C     1 
ATOM   8166  O  O     . GLY C 2 629  ? -38.250 14.257  22.892  1.00 49.18  ?  629  GLY C O     1 
ATOM   8167  N  N     . MET C 2 630  ? -37.109 12.395  22.326  1.00 30.87  ?  630  MET C N     1 
ATOM   8168  C  CA    . MET C 2 630  ? -36.151 12.525  23.418  1.00 20.81  ?  630  MET C CA    1 
ATOM   8169  C  C     . MET C 2 630  ? -35.210 13.709  23.229  1.00 31.43  ?  630  MET C C     1 
ATOM   8170  O  O     . MET C 2 630  ? -34.656 14.204  24.217  1.00 27.46  ?  630  MET C O     1 
ATOM   8171  C  CB    . MET C 2 630  ? -35.349 11.226  23.555  1.00 28.28  ?  630  MET C CB    1 
ATOM   8172  C  CG    . MET C 2 630  ? -34.373 11.186  24.723  1.00 30.27  ?  630  MET C CG    1 
ATOM   8173  S  SD    . MET C 2 630  ? -35.179 11.303  26.332  1.00 42.03  ?  630  MET C SD    1 
ATOM   8174  C  CE    . MET C 2 630  ? -36.162 9.806   26.331  1.00 50.73  ?  630  MET C CE    1 
ATOM   8175  N  N     . GLU C 2 631  ? -35.035 14.186  21.992  1.00 38.21  ?  631  GLU C N     1 
ATOM   8176  C  CA    . GLU C 2 631  ? -34.058 15.239  21.727  1.00 33.76  ?  631  GLU C CA    1 
ATOM   8177  C  C     . GLU C 2 631  ? -34.352 16.510  22.514  1.00 31.02  ?  631  GLU C C     1 
ATOM   8178  O  O     . GLU C 2 631  ? -33.424 17.244  22.871  1.00 26.97  ?  631  GLU C O     1 
ATOM   8179  C  CB    . GLU C 2 631  ? -34.009 15.555  20.231  1.00 24.70  ?  631  GLU C CB    1 
ATOM   8180  C  CG    . GLU C 2 631  ? -33.597 14.389  19.351  1.00 24.06  ?  631  GLU C CG    1 
ATOM   8181  C  CD    . GLU C 2 631  ? -34.772 13.527  18.935  1.00 33.44  ?  631  GLU C CD    1 
ATOM   8182  O  OE1   . GLU C 2 631  ? -35.902 13.792  19.398  1.00 31.04  ?  631  GLU C OE1   1 
ATOM   8183  O  OE2   . GLU C 2 631  ? -34.564 12.587  18.140  1.00 35.79  ?  631  GLU C OE2   1 
ATOM   8184  N  N     . LEU C 2 632  ? -35.626 16.789  22.792  1.00 32.23  ?  632  LEU C N     1 
ATOM   8185  C  CA    . LEU C 2 632  ? -35.972 17.998  23.531  1.00 28.29  ?  632  LEU C CA    1 
ATOM   8186  C  C     . LEU C 2 632  ? -35.549 17.891  24.992  1.00 29.98  ?  632  LEU C C     1 
ATOM   8187  O  O     . LEU C 2 632  ? -34.777 18.718  25.491  1.00 28.55  ?  632  LEU C O     1 
ATOM   8188  C  CB    . LEU C 2 632  ? -37.473 18.269  23.428  1.00 37.67  ?  632  LEU C CB    1 
ATOM   8189  C  CG    . LEU C 2 632  ? -37.951 19.421  24.313  1.00 37.62  ?  632  LEU C CG    1 
ATOM   8190  C  CD1   . LEU C 2 632  ? -37.409 20.749  23.807  1.00 23.29  ?  632  LEU C CD1   1 
ATOM   8191  C  CD2   . LEU C 2 632  ? -39.464 19.449  24.404  1.00 55.00  ?  632  LEU C CD2   1 
ATOM   8192  N  N     . ARG C 2 633  ? -36.053 16.875  25.696  1.00 30.21  ?  633  ARG C N     1 
ATOM   8193  C  CA    . ARG C 2 633  ? -35.757 16.743  27.119  1.00 27.40  ?  633  ARG C CA    1 
ATOM   8194  C  C     . ARG C 2 633  ? -34.294 16.400  27.366  1.00 25.69  ?  633  ARG C C     1 
ATOM   8195  O  O     . ARG C 2 633  ? -33.755 16.733  28.428  1.00 32.17  ?  633  ARG C O     1 
ATOM   8196  C  CB    . ARG C 2 633  ? -36.665 15.688  27.749  1.00 35.64  ?  633  ARG C CB    1 
ATOM   8197  C  CG    . ARG C 2 633  ? -38.103 16.141  27.932  1.00 46.33  ?  633  ARG C CG    1 
ATOM   8198  C  CD    . ARG C 2 633  ? -38.192 17.299  28.913  1.00 35.59  ?  633  ARG C CD    1 
ATOM   8199  N  NE    . ARG C 2 633  ? -37.633 16.950  30.215  1.00 33.31  ?  633  ARG C NE    1 
ATOM   8200  C  CZ    . ARG C 2 633  ? -38.322 16.369  31.191  1.00 38.08  ?  633  ARG C CZ    1 
ATOM   8201  N  NH1   . ARG C 2 633  ? -39.602 16.071  31.014  1.00 41.80  ?  633  ARG C NH1   1 
ATOM   8202  N  NH2   . ARG C 2 633  ? -37.733 16.085  32.345  1.00 32.36  ?  633  ARG C NH2   1 
ATOM   8203  N  N     . ALA C 2 634  ? -33.636 15.739  26.411  1.00 20.85  ?  634  ALA C N     1 
ATOM   8204  C  CA    . ALA C 2 634  ? -32.219 15.435  26.578  1.00 22.52  ?  634  ALA C CA    1 
ATOM   8205  C  C     . ALA C 2 634  ? -31.367 16.697  26.541  1.00 20.25  ?  634  ALA C C     1 
ATOM   8206  O  O     . ALA C 2 634  ? -30.330 16.763  27.209  1.00 21.65  ?  634  ALA C O     1 
ATOM   8207  C  CB    . ALA C 2 634  ? -31.757 14.452  25.505  1.00 22.38  ?  634  ALA C CB    1 
ATOM   8208  N  N     . ALA C 2 635  ? -31.786 17.705  25.775  1.00 23.27  ?  635  ALA C N     1 
ATOM   8209  C  CA    . ALA C 2 635  ? -31.025 18.947  25.696  1.00 20.63  ?  635  ALA C CA    1 
ATOM   8210  C  C     . ALA C 2 635  ? -31.295 19.846  26.897  1.00 27.60  ?  635  ALA C C     1 
ATOM   8211  O  O     . ALA C 2 635  ? -30.360 20.419  27.468  1.00 34.94  ?  635  ALA C O     1 
ATOM   8212  C  CB    . ALA C 2 635  ? -31.351 19.681  24.396  1.00 19.89  ?  635  ALA C CB    1 
ATOM   8213  N  N     . ILE C 2 636  ? -32.561 19.973  27.295  1.00 23.56  ?  636  ILE C N     1 
ATOM   8214  C  CA    . ILE C 2 636  ? -32.910 20.870  28.394  1.00 15.20  ?  636  ILE C CA    1 
ATOM   8215  C  C     . ILE C 2 636  ? -32.337 20.356  29.708  1.00 19.58  ?  636  ILE C C     1 
ATOM   8216  O  O     . ILE C 2 636  ? -31.691 21.100  30.456  1.00 28.45  ?  636  ILE C O     1 
ATOM   8217  C  CB    . ILE C 2 636  ? -34.436 21.050  28.477  1.00 14.40  ?  636  ILE C CB    1 
ATOM   8218  C  CG1   . ILE C 2 636  ? -34.968 21.689  27.194  1.00 17.81  ?  636  ILE C CG1   1 
ATOM   8219  C  CG2   . ILE C 2 636  ? -34.809 21.890  29.690  1.00 17.86  ?  636  ILE C CG2   1 
ATOM   8220  C  CD1   . ILE C 2 636  ? -36.461 21.921  27.208  1.00 13.15  ?  636  ILE C CD1   1 
ATOM   8221  N  N     . ASP C 2 637  ? -32.560 19.074  30.009  1.00 20.25  ?  637  ASP C N     1 
ATOM   8222  C  CA    . ASP C 2 637  ? -32.088 18.517  31.271  1.00 25.43  ?  637  ASP C CA    1 
ATOM   8223  C  C     . ASP C 2 637  ? -30.568 18.449  31.347  1.00 28.91  ?  637  ASP C C     1 
ATOM   8224  O  O     . ASP C 2 637  ? -30.020 18.388  32.453  1.00 34.04  ?  637  ASP C O     1 
ATOM   8225  C  CB    . ASP C 2 637  ? -32.677 17.122  31.491  1.00 30.43  ?  637  ASP C CB    1 
ATOM   8226  C  CG    . ASP C 2 637  ? -34.183 17.145  31.664  1.00 31.82  ?  637  ASP C CG    1 
ATOM   8227  O  OD1   . ASP C 2 637  ? -34.815 18.148  31.271  1.00 26.81  ?  637  ASP C OD1   1 
ATOM   8228  O  OD2   . ASP C 2 637  ? -34.735 16.162  32.202  1.00 28.78  ?  637  ASP C OD2   1 
ATOM   8229  N  N     . ALA C 2 638  ? -29.876 18.457  30.205  1.00 21.76  ?  638  ALA C N     1 
ATOM   8230  C  CA    . ALA C 2 638  ? -28.418 18.400  30.228  1.00 22.73  ?  638  ALA C CA    1 
ATOM   8231  C  C     . ALA C 2 638  ? -27.813 19.661  30.829  1.00 28.12  ?  638  ALA C C     1 
ATOM   8232  O  O     . ALA C 2 638  ? -26.719 19.608  31.402  1.00 22.46  ?  638  ALA C O     1 
ATOM   8233  C  CB    . ALA C 2 638  ? -27.875 18.171  28.818  1.00 16.46  ?  638  ALA C CB    1 
ATOM   8234  N  N     . GLY C 2 639  ? -28.498 20.793  30.709  1.00 22.48  ?  639  GLY C N     1 
ATOM   8235  C  CA    . GLY C 2 639  ? -28.041 22.028  31.311  1.00 31.35  ?  639  GLY C CA    1 
ATOM   8236  C  C     . GLY C 2 639  ? -27.106 22.863  30.467  1.00 30.50  ?  639  GLY C C     1 
ATOM   8237  O  O     . GLY C 2 639  ? -26.485 23.790  31.000  1.00 38.29  ?  639  GLY C O     1 
ATOM   8238  N  N     . ASP C 2 640  ? -26.981 22.571  29.173  1.00 19.71  ?  640  ASP C N     1 
ATOM   8239  C  CA    . ASP C 2 640  ? -26.139 23.362  28.287  1.00 27.73  ?  640  ASP C CA    1 
ATOM   8240  C  C     . ASP C 2 640  ? -26.915 24.415  27.508  1.00 22.57  ?  640  ASP C C     1 
ATOM   8241  O  O     . ASP C 2 640  ? -26.296 25.231  26.818  1.00 16.41  ?  640  ASP C O     1 
ATOM   8242  C  CB    . ASP C 2 640  ? -25.388 22.449  27.310  1.00 26.70  ?  640  ASP C CB    1 
ATOM   8243  C  CG    . ASP C 2 640  ? -24.259 21.690  27.980  1.00 40.42  ?  640  ASP C CG    1 
ATOM   8244  O  OD1   . ASP C 2 640  ? -24.115 21.811  29.215  1.00 30.21  ?  640  ASP C OD1   1 
ATOM   8245  O  OD2   . ASP C 2 640  ? -23.514 20.978  27.274  1.00 44.90  ?  640  ASP C OD2   1 
ATOM   8246  N  N     . VAL C 2 641  ? -28.244 24.417  27.598  1.00 28.87  ?  641  VAL C N     1 
ATOM   8247  C  CA    . VAL C 2 641  ? -29.056 25.471  27.002  1.00 18.14  ?  641  VAL C CA    1 
ATOM   8248  C  C     . VAL C 2 641  ? -29.295 26.543  28.057  1.00 18.53  ?  641  VAL C C     1 
ATOM   8249  O  O     . VAL C 2 641  ? -28.702 26.503  29.141  1.00 24.86  ?  641  VAL C O     1 
ATOM   8250  C  CB    . VAL C 2 641  ? -30.384 24.920  26.453  1.00 15.34  ?  641  VAL C CB    1 
ATOM   8251  C  CG1   . VAL C 2 641  ? -30.121 23.873  25.383  1.00 21.06  ?  641  VAL C CG1   1 
ATOM   8252  C  CG2   . VAL C 2 641  ? -31.226 24.339  27.579  1.00 16.49  ?  641  VAL C CG2   1 
ATOM   8253  N  N     . VAL C 2 642  ? -30.159 27.508  27.750  1.00 30.61  ?  642  VAL C N     1 
ATOM   8254  C  CA    . VAL C 2 642  ? -30.503 28.588  28.671  1.00 25.19  ?  642  VAL C CA    1 
ATOM   8255  C  C     . VAL C 2 642  ? -32.024 28.641  28.751  1.00 27.49  ?  642  VAL C C     1 
ATOM   8256  O  O     . VAL C 2 642  ? -32.683 29.153  27.839  1.00 26.84  ?  642  VAL C O     1 
ATOM   8257  C  CB    . VAL C 2 642  ? -29.925 29.939  28.236  1.00 18.88  ?  642  VAL C CB    1 
ATOM   8258  C  CG1   . VAL C 2 642  ? -30.344 31.031  29.208  1.00 24.21  ?  642  VAL C CG1   1 
ATOM   8259  C  CG2   . VAL C 2 642  ? -28.408 29.864  28.138  1.00 19.68  ?  642  VAL C CG2   1 
ATOM   8260  N  N     . VAL C 2 643  ? -32.584 28.117  29.836  1.00 26.52  ?  643  VAL C N     1 
ATOM   8261  C  CA    . VAL C 2 643  ? -34.026 28.117  30.051  1.00 29.70  ?  643  VAL C CA    1 
ATOM   8262  C  C     . VAL C 2 643  ? -34.405 29.331  30.884  1.00 28.76  ?  643  VAL C C     1 
ATOM   8263  O  O     . VAL C 2 643  ? -33.622 29.822  31.705  1.00 35.79  ?  643  VAL C O     1 
ATOM   8264  C  CB    . VAL C 2 643  ? -34.488 26.807  30.722  1.00 22.24  ?  643  VAL C CB    1 
ATOM   8265  C  CG1   . VAL C 2 643  ? -34.355 25.642  29.755  1.00 26.22  ?  643  VAL C CG1   1 
ATOM   8266  C  CG2   . VAL C 2 643  ? -33.688 26.546  31.989  1.00 34.10  ?  643  VAL C CG2   1 
ATOM   8267  N  N     . ALA C 2 644  ? -35.621 29.825  30.669  1.00 34.91  ?  644  ALA C N     1 
ATOM   8268  C  CA    . ALA C 2 644  ? -36.122 30.976  31.408  1.00 34.21  ?  644  ALA C CA    1 
ATOM   8269  C  C     . ALA C 2 644  ? -36.652 30.518  32.761  1.00 42.04  ?  644  ALA C C     1 
ATOM   8270  O  O     . ALA C 2 644  ? -37.509 29.630  32.830  1.00 41.96  ?  644  ALA C O     1 
ATOM   8271  C  CB    . ALA C 2 644  ? -37.213 31.688  30.611  1.00 29.60  ?  644  ALA C CB    1 
ATOM   8272  N  N     . GLU C 2 645  ? -36.139 31.117  33.838  1.00 47.20  ?  645  GLU C N     1 
ATOM   8273  C  CA    . GLU C 2 645  ? -36.564 30.711  35.174  1.00 46.99  ?  645  GLU C CA    1 
ATOM   8274  C  C     . GLU C 2 645  ? -37.976 31.196  35.475  1.00 44.27  ?  645  GLU C C     1 
ATOM   8275  O  O     . GLU C 2 645  ? -38.798 30.444  36.013  1.00 49.72  ?  645  GLU C O     1 
ATOM   8276  C  CB    . GLU C 2 645  ? -35.583 31.237  36.222  1.00 55.88  ?  645  GLU C CB    1 
ATOM   8277  C  CG    . GLU C 2 645  ? -34.139 30.825  35.985  1.00 67.82  ?  645  GLU C CG    1 
ATOM   8278  C  CD    . GLU C 2 645  ? -33.199 31.357  37.051  1.00 86.17  ?  645  GLU C CD    1 
ATOM   8279  O  OE1   . GLU C 2 645  ? -33.675 31.672  38.162  1.00 92.11  ?  645  GLU C OE1   1 
ATOM   8280  O  OE2   . GLU C 2 645  ? -31.986 31.465  36.775  1.00 80.01  ?  645  GLU C OE2   1 
ATOM   8281  N  N     . GLU C 2 646  ? -38.279 32.445  35.130  1.00 42.26  ?  646  GLU C N     1 
ATOM   8282  C  CA    . GLU C 2 646  ? -39.577 33.041  35.399  1.00 41.90  ?  646  GLU C CA    1 
ATOM   8283  C  C     . GLU C 2 646  ? -40.152 33.616  34.113  1.00 39.43  ?  646  GLU C C     1 
ATOM   8284  O  O     . GLU C 2 646  ? -39.415 34.044  33.220  1.00 37.72  ?  646  GLU C O     1 
ATOM   8285  C  CB    . GLU C 2 646  ? -39.476 34.139  36.467  1.00 51.55  ?  646  GLU C CB    1 
ATOM   8286  C  CG    . GLU C 2 646  ? -38.765 33.701  37.739  1.00 60.01  ?  646  GLU C CG    1 
ATOM   8287  C  CD    . GLU C 2 646  ? -38.592 34.833  38.733  1.00 79.33  ?  646  GLU C CD    1 
ATOM   8288  O  OE1   . GLU C 2 646  ? -39.376 35.803  38.672  1.00 75.08  ?  646  GLU C OE1   1 
ATOM   8289  O  OE2   . GLU C 2 646  ? -37.668 34.757  39.571  1.00 89.76  ?  646  GLU C OE2   1 
ATOM   8290  N  N     . SER C 2 647  ? -41.480 33.620  34.030  1.00 42.61  ?  647  SER C N     1 
ATOM   8291  C  CA    . SER C 2 647  ? -42.162 34.156  32.861  1.00 45.43  ?  647  SER C CA    1 
ATOM   8292  C  C     . SER C 2 647  ? -41.974 35.667  32.774  1.00 42.01  ?  647  SER C C     1 
ATOM   8293  O  O     . SER C 2 647  ? -41.884 36.366  33.787  1.00 52.91  ?  647  SER C O     1 
ATOM   8294  C  CB    . SER C 2 647  ? -43.653 33.821  32.912  1.00 52.52  ?  647  SER C CB    1 
ATOM   8295  O  OG    . SER C 2 647  ? -43.860 32.429  33.077  1.00 55.59  ?  647  SER C OG    1 
ATOM   8296  N  N     . GLY C 2 648  ? -41.914 36.169  31.546  1.00 35.13  ?  648  GLY C N     1 
ATOM   8297  C  CA    . GLY C 2 648  ? -41.746 37.595  31.342  1.00 42.77  ?  648  GLY C CA    1 
ATOM   8298  C  C     . GLY C 2 648  ? -41.560 37.917  29.872  1.00 39.32  ?  648  GLY C C     1 
ATOM   8299  O  O     . GLY C 2 648  ? -41.838 37.093  29.000  1.00 44.21  ?  648  GLY C O     1 
ATOM   8300  N  N     . VAL C 2 649  ? -41.088 39.136  29.620  1.00 32.91  ?  649  VAL C N     1 
ATOM   8301  C  CA    . VAL C 2 649  ? -40.845 39.627  28.271  1.00 34.89  ?  649  VAL C CA    1 
ATOM   8302  C  C     . VAL C 2 649  ? -39.367 39.971  28.141  1.00 41.02  ?  649  VAL C C     1 
ATOM   8303  O  O     . VAL C 2 649  ? -38.683 40.251  29.132  1.00 44.39  ?  649  VAL C O     1 
ATOM   8304  C  CB    . VAL C 2 649  ? -41.735 40.848  27.937  1.00 37.55  ?  649  VAL C CB    1 
ATOM   8305  C  CG1   . VAL C 2 649  ? -41.241 42.089  28.664  1.00 47.94  ?  649  VAL C CG1   1 
ATOM   8306  C  CG2   . VAL C 2 649  ? -41.806 41.080  26.429  1.00 44.93  ?  649  VAL C CG2   1 
ATOM   8307  N  N     . ILE C 2 650  ? -38.872 39.941  26.907  1.00 36.38  ?  650  ILE C N     1 
ATOM   8308  C  CA    . ILE C 2 650  ? -37.459 40.188  26.638  1.00 39.45  ?  650  ILE C CA    1 
ATOM   8309  C  C     . ILE C 2 650  ? -37.225 41.695  26.623  1.00 35.13  ?  650  ILE C C     1 
ATOM   8310  O  O     . ILE C 2 650  ? -37.695 42.398  25.727  1.00 35.23  ?  650  ILE C O     1 
ATOM   8311  C  CB    . ILE C 2 650  ? -37.018 39.545  25.319  1.00 38.78  ?  650  ILE C CB    1 
ATOM   8312  C  CG1   . ILE C 2 650  ? -37.301 38.044  25.348  1.00 26.88  ?  650  ILE C CG1   1 
ATOM   8313  C  CG2   . ILE C 2 650  ? -35.540 39.810  25.065  1.00 32.68  ?  650  ILE C CG2   1 
ATOM   8314  C  CD1   . ILE C 2 650  ? -36.700 37.335  26.544  1.00 26.72  ?  650  ILE C CD1   1 
ATOM   8315  N  N     . GLU C 2 651  ? -36.491 42.191  27.620  1.00 28.02  ?  651  GLU C N     1 
ATOM   8316  C  CA    . GLU C 2 651  ? -36.179 43.614  27.689  1.00 34.08  ?  651  GLU C CA    1 
ATOM   8317  C  C     . GLU C 2 651  ? -35.076 43.985  26.702  1.00 26.93  ?  651  GLU C C     1 
ATOM   8318  O  O     . GLU C 2 651  ? -35.274 44.827  25.820  1.00 20.43  ?  651  GLU C O     1 
ATOM   8319  C  CB    . GLU C 2 651  ? -35.782 43.991  29.119  1.00 35.17  ?  651  GLU C CB    1 
ATOM   8320  C  CG    . GLU C 2 651  ? -35.157 45.369  29.258  1.00 40.00  ?  651  GLU C CG    1 
ATOM   8321  C  CD    . GLU C 2 651  ? -35.042 45.807  30.704  1.00 54.01  ?  651  GLU C CD    1 
ATOM   8322  O  OE1   . GLU C 2 651  ? -36.022 45.629  31.457  1.00 58.53  ?  651  GLU C OE1   1 
ATOM   8323  O  OE2   . GLU C 2 651  ? -33.971 46.322  31.090  1.00 52.46  ?  651  GLU C OE2   1 
ATOM   8324  N  N     . GLU C 2 652  ? -33.908 43.361  26.836  1.00 31.76  ?  652  GLU C N     1 
ATOM   8325  C  CA    . GLU C 2 652  ? -32.787 43.607  25.938  1.00 35.91  ?  652  GLU C CA    1 
ATOM   8326  C  C     . GLU C 2 652  ? -32.110 42.284  25.623  1.00 36.89  ?  652  GLU C C     1 
ATOM   8327  O  O     . GLU C 2 652  ? -31.813 41.504  26.532  1.00 39.15  ?  652  GLU C O     1 
ATOM   8328  C  CB    . GLU C 2 652  ? -31.780 44.585  26.555  1.00 48.62  ?  652  GLU C CB    1 
ATOM   8329  C  CG    . GLU C 2 652  ? -30.517 44.782  25.728  1.00 67.56  ?  652  GLU C CG    1 
ATOM   8330  C  CD    . GLU C 2 652  ? -29.584 45.819  26.323  1.00 71.33  ?  652  GLU C CD    1 
ATOM   8331  O  OE1   . GLU C 2 652  ? -30.058 46.669  27.105  1.00 66.73  ?  652  GLU C OE1   1 
ATOM   8332  O  OE2   . GLU C 2 652  ? -28.374 45.783  26.011  1.00 74.86  ?  652  GLU C OE2   1 
ATOM   8333  N  N     . VAL C 2 653  ? -31.871 42.034  24.339  1.00 37.08  ?  653  VAL C N     1 
ATOM   8334  C  CA    . VAL C 2 653  ? -31.236 40.806  23.879  1.00 30.68  ?  653  VAL C CA    1 
ATOM   8335  C  C     . VAL C 2 653  ? -30.000 41.176  23.073  1.00 34.40  ?  653  VAL C C     1 
ATOM   8336  O  O     . VAL C 2 653  ? -30.055 42.052  22.202  1.00 39.50  ?  653  VAL C O     1 
ATOM   8337  C  CB    . VAL C 2 653  ? -32.205 39.939  23.051  1.00 32.14  ?  653  VAL C CB    1 
ATOM   8338  C  CG1   . VAL C 2 653  ? -32.886 40.769  21.971  1.00 39.23  ?  653  VAL C CG1   1 
ATOM   8339  C  CG2   . VAL C 2 653  ? -31.472 38.751  22.443  1.00 28.11  ?  653  VAL C CG2   1 
ATOM   8340  N  N     . SER C 2 654  ? -28.885 40.520  23.378  1.00 33.81  ?  654  SER C N     1 
ATOM   8341  C  CA    . SER C 2 654  ? -27.637 40.720  22.663  1.00 34.03  ?  654  SER C CA    1 
ATOM   8342  C  C     . SER C 2 654  ? -26.931 39.380  22.538  1.00 35.55  ?  654  SER C C     1 
ATOM   8343  O  O     . SER C 2 654  ? -27.327 38.385  23.152  1.00 37.42  ?  654  SER C O     1 
ATOM   8344  C  CB    . SER C 2 654  ? -26.737 41.742  23.371  1.00 39.64  ?  654  SER C CB    1 
ATOM   8345  O  OG    . SER C 2 654  ? -25.455 41.795  22.770  1.00 43.10  ?  654  SER C OG    1 
ATOM   8346  N  N     . ALA C 2 655  ? -25.873 39.357  21.727  1.00 34.17  ?  655  ALA C N     1 
ATOM   8347  C  CA    . ALA C 2 655  ? -25.040 38.166  21.638  1.00 30.87  ?  655  ALA C CA    1 
ATOM   8348  C  C     . ALA C 2 655  ? -24.290 37.886  22.933  1.00 29.90  ?  655  ALA C C     1 
ATOM   8349  O  O     . ALA C 2 655  ? -23.712 36.804  23.074  1.00 26.16  ?  655  ALA C O     1 
ATOM   8350  C  CB    . ALA C 2 655  ? -24.049 38.301  20.481  1.00 31.26  ?  655  ALA C CB    1 
ATOM   8351  N  N     . ASP C 2 656  ? -24.294 38.828  23.876  1.00 30.94  ?  656  ASP C N     1 
ATOM   8352  C  CA    . ASP C 2 656  ? -23.596 38.694  25.147  1.00 26.92  ?  656  ASP C CA    1 
ATOM   8353  C  C     . ASP C 2 656  ? -24.512 38.292  26.294  1.00 32.78  ?  656  ASP C C     1 
ATOM   8354  O  O     . ASP C 2 656  ? -24.124 37.463  27.123  1.00 30.26  ?  656  ASP C O     1 
ATOM   8355  C  CB    . ASP C 2 656  ? -22.891 40.008  25.495  1.00 35.84  ?  656  ASP C CB    1 
ATOM   8356  C  CG    . ASP C 2 656  ? -21.819 40.377  24.489  1.00 48.31  ?  656  ASP C CG    1 
ATOM   8357  O  OD1   . ASP C 2 656  ? -20.931 39.537  24.232  1.00 47.98  ?  656  ASP C OD1   1 
ATOM   8358  O  OD2   . ASP C 2 656  ? -21.870 41.501  23.946  1.00 48.53  ?  656  ASP C OD2   1 
ATOM   8359  N  N     . TYR C 2 657  ? -25.718 38.852  26.369  1.00 39.64  ?  657  TYR C N     1 
ATOM   8360  C  CA    . TYR C 2 657  ? -26.623 38.524  27.463  1.00 34.62  ?  657  TYR C CA    1 
ATOM   8361  C  C     . TYR C 2 657  ? -28.062 38.763  27.031  1.00 35.58  ?  657  TYR C C     1 
ATOM   8362  O  O     . TYR C 2 657  ? -28.335 39.504  26.083  1.00 41.11  ?  657  TYR C O     1 
ATOM   8363  C  CB    . TYR C 2 657  ? -26.298 39.335  28.724  1.00 35.43  ?  657  TYR C CB    1 
ATOM   8364  C  CG    . TYR C 2 657  ? -26.471 40.833  28.576  1.00 46.72  ?  657  TYR C CG    1 
ATOM   8365  C  CD1   . TYR C 2 657  ? -27.685 41.446  28.863  1.00 50.05  ?  657  TYR C CD1   1 
ATOM   8366  C  CD2   . TYR C 2 657  ? -25.416 41.636  28.162  1.00 50.58  ?  657  TYR C CD2   1 
ATOM   8367  C  CE1   . TYR C 2 657  ? -27.845 42.813  28.736  1.00 62.53  ?  657  TYR C CE1   1 
ATOM   8368  C  CE2   . TYR C 2 657  ? -25.568 43.005  28.032  1.00 63.06  ?  657  TYR C CE2   1 
ATOM   8369  C  CZ    . TYR C 2 657  ? -26.784 43.587  28.320  1.00 70.91  ?  657  TYR C CZ    1 
ATOM   8370  O  OH    . TYR C 2 657  ? -26.940 44.948  28.192  1.00 73.61  ?  657  TYR C OH    1 
ATOM   8371  N  N     . ILE C 2 658  ? -28.979 38.121  27.752  1.00 31.60  ?  658  ILE C N     1 
ATOM   8372  C  CA    . ILE C 2 658  ? -30.416 38.270  27.553  1.00 28.95  ?  658  ILE C CA    1 
ATOM   8373  C  C     . ILE C 2 658  ? -31.027 38.740  28.865  1.00 34.69  ?  658  ILE C C     1 
ATOM   8374  O  O     . ILE C 2 658  ? -30.765 38.152  29.920  1.00 37.77  ?  658  ILE C O     1 
ATOM   8375  C  CB    . ILE C 2 658  ? -31.072 36.953  27.099  1.00 29.16  ?  658  ILE C CB    1 
ATOM   8376  C  CG1   . ILE C 2 658  ? -30.353 36.377  25.880  1.00 36.20  ?  658  ILE C CG1   1 
ATOM   8377  C  CG2   . ILE C 2 658  ? -32.549 37.170  26.798  1.00 24.66  ?  658  ILE C CG2   1 
ATOM   8378  C  CD1   . ILE C 2 658  ? -30.852 35.004  25.487  1.00 31.97  ?  658  ILE C CD1   1 
ATOM   8379  N  N     . THR C 2 659  ? -31.844 39.787  28.798  1.00 32.95  ?  659  THR C N     1 
ATOM   8380  C  CA    . THR C 2 659  ? -32.519 40.339  29.966  1.00 33.42  ?  659  THR C CA    1 
ATOM   8381  C  C     . THR C 2 659  ? -34.017 40.095  29.847  1.00 36.68  ?  659  THR C C     1 
ATOM   8382  O  O     . THR C 2 659  ? -34.616 40.383  28.806  1.00 33.95  ?  659  THR C O     1 
ATOM   8383  C  CB    . THR C 2 659  ? -32.236 41.836  30.109  1.00 34.99  ?  659  THR C CB    1 
ATOM   8384  O  OG1   . THR C 2 659  ? -30.827 42.046  30.263  1.00 34.07  ?  659  THR C OG1   1 
ATOM   8385  C  CG2   . THR C 2 659  ? -32.962 42.404  31.320  1.00 39.76  ?  659  THR C CG2   1 
ATOM   8386  N  N     . VAL C 2 660  ? -34.616 39.567  30.912  1.00 33.63  ?  660  VAL C N     1 
ATOM   8387  C  CA    . VAL C 2 660  ? -36.038 39.246  30.949  1.00 32.28  ?  660  VAL C CA    1 
ATOM   8388  C  C     . VAL C 2 660  ? -36.713 40.146  31.975  1.00 40.43  ?  660  VAL C C     1 
ATOM   8389  O  O     . VAL C 2 660  ? -36.298 40.191  33.139  1.00 43.38  ?  660  VAL C O     1 
ATOM   8390  C  CB    . VAL C 2 660  ? -36.273 37.763  31.282  1.00 29.45  ?  660  VAL C CB    1 
ATOM   8391  C  CG1   . VAL C 2 660  ? -37.763 37.459  31.331  1.00 36.62  ?  660  VAL C CG1   1 
ATOM   8392  C  CG2   . VAL C 2 660  ? -35.574 36.875  30.264  1.00 31.62  ?  660  VAL C CG2   1 
ATOM   8393  N  N     . MET C 2 661  ? -37.750 40.859  31.542  1.00 48.68  ?  661  MET C N     1 
ATOM   8394  C  CA    . MET C 2 661  ? -38.546 41.703  32.427  1.00 49.50  ?  661  MET C CA    1 
ATOM   8395  C  C     . MET C 2 661  ? -39.738 40.891  32.922  1.00 48.72  ?  661  MET C C     1 
ATOM   8396  O  O     . MET C 2 661  ? -40.667 40.608  32.158  1.00 48.50  ?  661  MET C O     1 
ATOM   8397  C  CB    . MET C 2 661  ? -38.998 42.969  31.704  1.00 53.32  ?  661  MET C CB    1 
ATOM   8398  C  CG    . MET C 2 661  ? -39.946 43.844  32.509  1.00 55.63  ?  661  MET C CG    1 
ATOM   8399  S  SD    . MET C 2 661  ? -39.244 44.400  34.074  1.00 73.18  ?  661  MET C SD    1 
ATOM   8400  C  CE    . MET C 2 661  ? -40.560 45.457  34.673  1.00 83.93  ?  661  MET C CE    1 
ATOM   8401  N  N     . HIS C 2 662  ? -39.711 40.516  34.198  1.00 39.42  ?  662  HIS C N     1 
ATOM   8402  C  CA    . HIS C 2 662  ? -40.750 39.671  34.761  1.00 41.75  ?  662  HIS C CA    1 
ATOM   8403  C  C     . HIS C 2 662  ? -42.056 40.449  34.915  1.00 47.84  ?  662  HIS C C     1 
ATOM   8404  O  O     . HIS C 2 662  ? -42.113 41.672  34.751  1.00 50.94  ?  662  HIS C O     1 
ATOM   8405  C  CB    . HIS C 2 662  ? -40.304 39.106  36.109  1.00 42.36  ?  662  HIS C CB    1 
ATOM   8406  C  CG    . HIS C 2 662  ? -39.026 38.328  36.043  1.00 46.93  ?  662  HIS C CG    1 
ATOM   8407  N  ND1   . HIS C 2 662  ? -38.059 38.402  37.022  1.00 50.96  ?  662  HIS C ND1   1 
ATOM   8408  C  CD2   . HIS C 2 662  ? -38.559 37.459  35.116  1.00 45.78  ?  662  HIS C CD2   1 
ATOM   8409  C  CE1   . HIS C 2 662  ? -37.049 37.613  36.700  1.00 53.22  ?  662  HIS C CE1   1 
ATOM   8410  N  NE2   . HIS C 2 662  ? -37.328 37.029  35.548  1.00 47.34  ?  662  HIS C NE2   1 
ATOM   8411  N  N     . ASP C 2 663  ? -43.123 39.714  35.238  1.00 50.20  ?  663  ASP C N     1 
ATOM   8412  C  CA    . ASP C 2 663  ? -44.429 40.343  35.412  1.00 54.94  ?  663  ASP C CA    1 
ATOM   8413  C  C     . ASP C 2 663  ? -44.481 41.170  36.690  1.00 56.06  ?  663  ASP C C     1 
ATOM   8414  O  O     . ASP C 2 663  ? -45.081 42.251  36.712  1.00 54.68  ?  663  ASP C O     1 
ATOM   8415  C  CB    . ASP C 2 663  ? -45.528 39.280  35.415  1.00 62.22  ?  663  ASP C CB    1 
ATOM   8416  C  CG    . ASP C 2 663  ? -45.776 38.695  34.040  1.00 65.50  ?  663  ASP C CG    1 
ATOM   8417  O  OD1   . ASP C 2 663  ? -45.723 39.457  33.051  1.00 58.30  ?  663  ASP C OD1   1 
ATOM   8418  O  OD2   . ASP C 2 663  ? -46.024 37.475  33.946  1.00 72.12  ?  663  ASP C OD2   1 
ATOM   8419  N  N     . ASN C 2 664  ? -43.861 40.678  37.767  1.00 48.79  ?  664  ASN C N     1 
ATOM   8420  C  CA    . ASN C 2 664  ? -43.870 41.420  39.024  1.00 46.59  ?  664  ASN C CA    1 
ATOM   8421  C  C     . ASN C 2 664  ? -43.088 42.722  38.904  1.00 50.06  ?  664  ASN C C     1 
ATOM   8422  O  O     . ASN C 2 664  ? -43.478 43.742  39.485  1.00 60.20  ?  664  ASN C O     1 
ATOM   8423  C  CB    . ASN C 2 664  ? -43.307 40.552  40.150  1.00 47.76  ?  664  ASN C CB    1 
ATOM   8424  C  CG    . ASN C 2 664  ? -41.931 40.003  39.830  1.00 52.50  ?  664  ASN C CG    1 
ATOM   8425  O  OD1   . ASN C 2 664  ? -40.925 40.701  39.963  1.00 48.08  ?  664  ASN C OD1   1 
ATOM   8426  N  ND2   . ASN C 2 664  ? -41.878 38.744  39.411  1.00 63.43  ?  664  ASN C ND2   1 
ATOM   8427  N  N     . GLY C 2 665  ? -41.989 42.711  38.154  1.00 54.63  ?  665  GLY C N     1 
ATOM   8428  C  CA    . GLY C 2 665  ? -41.204 43.913  37.954  1.00 49.15  ?  665  GLY C CA    1 
ATOM   8429  C  C     . GLY C 2 665  ? -39.707 43.683  37.987  1.00 45.32  ?  665  GLY C C     1 
ATOM   8430  O  O     . GLY C 2 665  ? -38.937 44.513  37.495  1.00 40.86  ?  665  GLY C O     1 
ATOM   8431  N  N     . THR C 2 666  ? -39.282 42.562  38.563  1.00 41.00  ?  666  THR C N     1 
ATOM   8432  C  CA    . THR C 2 666  ? -37.861 42.273  38.674  1.00 46.25  ?  666  THR C CA    1 
ATOM   8433  C  C     . THR C 2 666  ? -37.283 41.868  37.320  1.00 50.06  ?  666  THR C C     1 
ATOM   8434  O  O     . THR C 2 666  ? -38.002 41.509  36.384  1.00 47.11  ?  666  THR C O     1 
ATOM   8435  C  CB    . THR C 2 666  ? -37.614 41.166  39.700  1.00 46.40  ?  666  THR C CB    1 
ATOM   8436  O  OG1   . THR C 2 666  ? -38.418 40.024  39.379  1.00 47.03  ?  666  THR C OG1   1 
ATOM   8437  C  CG2   . THR C 2 666  ? -37.961 41.651  41.100  1.00 44.38  ?  666  THR C CG2   1 
ATOM   8438  N  N     . ARG C 2 667  ? -35.956 41.932  37.226  1.00 48.58  ?  667  ARG C N     1 
ATOM   8439  C  CA    . ARG C 2 667  ? -35.239 41.594  36.005  1.00 40.88  ?  667  ARG C CA    1 
ATOM   8440  C  C     . ARG C 2 667  ? -34.198 40.529  36.307  1.00 43.87  ?  667  ARG C C     1 
ATOM   8441  O  O     . ARG C 2 667  ? -33.470 40.631  37.300  1.00 48.18  ?  667  ARG C O     1 
ATOM   8442  C  CB    . ARG C 2 667  ? -34.558 42.825  35.395  1.00 37.22  ?  667  ARG C CB    1 
ATOM   8443  C  CG    . ARG C 2 667  ? -35.500 43.959  35.043  1.00 50.01  ?  667  ARG C CG    1 
ATOM   8444  C  CD    . ARG C 2 667  ? -34.763 45.067  34.308  1.00 49.05  ?  667  ARG C CD    1 
ATOM   8445  N  NE    . ARG C 2 667  ? -33.641 45.593  35.081  1.00 46.88  ?  667  ARG C NE    1 
ATOM   8446  C  CZ    . ARG C 2 667  ? -32.821 46.546  34.651  1.00 57.03  ?  667  ARG C CZ    1 
ATOM   8447  N  NH1   . ARG C 2 667  ? -32.995 47.081  33.450  1.00 56.09  ?  667  ARG C NH1   1 
ATOM   8448  N  NH2   . ARG C 2 667  ? -31.826 46.965  35.421  1.00 55.67  ?  667  ARG C NH2   1 
ATOM   8449  N  N     . ARG C 2 668  ? -34.130 39.513  35.452  1.00 39.67  ?  668  ARG C N     1 
ATOM   8450  C  CA    . ARG C 2 668  ? -33.088 38.499  35.508  1.00 35.68  ?  668  ARG C CA    1 
ATOM   8451  C  C     . ARG C 2 668  ? -32.371 38.474  34.167  1.00 31.84  ?  668  ARG C C     1 
ATOM   8452  O  O     . ARG C 2 668  ? -33.016 38.418  33.115  1.00 36.37  ?  668  ARG C O     1 
ATOM   8453  C  CB    . ARG C 2 668  ? -33.664 37.119  35.834  1.00 34.16  ?  668  ARG C CB    1 
ATOM   8454  C  CG    . ARG C 2 668  ? -32.611 36.073  36.165  1.00 33.24  ?  668  ARG C CG    1 
ATOM   8455  C  CD    . ARG C 2 668  ? -33.252 34.763  36.583  1.00 45.80  ?  668  ARG C CD    1 
ATOM   8456  N  NE    . ARG C 2 668  ? -34.189 34.945  37.689  1.00 69.73  ?  668  ARG C NE    1 
ATOM   8457  C  CZ    . ARG C 2 668  ? -33.870 34.806  38.971  1.00 81.16  ?  668  ARG C CZ    1 
ATOM   8458  N  NH1   . ARG C 2 668  ? -32.633 34.479  39.319  1.00 82.50  ?  668  ARG C NH1   1 
ATOM   8459  N  NH2   . ARG C 2 668  ? -34.790 34.993  39.908  1.00 72.22  ?  668  ARG C NH2   1 
ATOM   8460  N  N     . THR C 2 669  ? -31.042 38.527  34.207  1.00 28.93  ?  669  THR C N     1 
ATOM   8461  C  CA    . THR C 2 669  ? -30.222 38.604  33.005  1.00 39.00  ?  669  THR C CA    1 
ATOM   8462  C  C     . THR C 2 669  ? -29.339 37.368  32.918  1.00 43.90  ?  669  THR C C     1 
ATOM   8463  O  O     . THR C 2 669  ? -28.581 37.075  33.849  1.00 41.23  ?  669  THR C O     1 
ATOM   8464  C  CB    . THR C 2 669  ? -29.373 39.875  32.999  1.00 32.58  ?  669  THR C CB    1 
ATOM   8465  O  OG1   . THR C 2 669  ? -30.224 41.019  32.863  1.00 27.47  ?  669  THR C OG1   1 
ATOM   8466  C  CG2   . THR C 2 669  ? -28.388 39.844  31.849  1.00 25.26  ?  669  THR C CG2   1 
ATOM   8467  N  N     . TYR C 2 670  ? -29.435 36.654  31.799  1.00 36.61  ?  670  TYR C N     1 
ATOM   8468  C  CA    . TYR C 2 670  ? -28.660 35.443  31.561  1.00 33.94  ?  670  TYR C CA    1 
ATOM   8469  C  C     . TYR C 2 670  ? -27.522 35.767  30.601  1.00 31.86  ?  670  TYR C C     1 
ATOM   8470  O  O     . TYR C 2 670  ? -27.761 36.254  29.491  1.00 28.97  ?  670  TYR C O     1 
ATOM   8471  C  CB    . TYR C 2 670  ? -29.542 34.334  30.988  1.00 29.38  ?  670  TYR C CB    1 
ATOM   8472  C  CG    . TYR C 2 670  ? -30.847 34.132  31.725  1.00 33.16  ?  670  TYR C CG    1 
ATOM   8473  C  CD1   . TYR C 2 670  ? -30.949 33.215  32.762  1.00 37.57  ?  670  TYR C CD1   1 
ATOM   8474  C  CD2   . TYR C 2 670  ? -31.981 34.856  31.378  1.00 29.65  ?  670  TYR C CD2   1 
ATOM   8475  C  CE1   . TYR C 2 670  ? -32.143 33.028  33.436  1.00 34.08  ?  670  TYR C CE1   1 
ATOM   8476  C  CE2   . TYR C 2 670  ? -33.177 34.677  32.045  1.00 28.87  ?  670  TYR C CE2   1 
ATOM   8477  C  CZ    . TYR C 2 670  ? -33.253 33.762  33.073  1.00 32.10  ?  670  TYR C CZ    1 
ATOM   8478  O  OH    . TYR C 2 670  ? -34.444 33.582  33.738  1.00 33.99  ?  670  TYR C OH    1 
ATOM   8479  N  N     . ARG C 2 671  ? -26.292 35.496  31.028  1.00 36.83  ?  671  ARG C N     1 
ATOM   8480  C  CA    . ARG C 2 671  ? -25.117 35.731  30.203  1.00 34.05  ?  671  ARG C CA    1 
ATOM   8481  C  C     . ARG C 2 671  ? -24.833 34.508  29.340  1.00 32.51  ?  671  ARG C C     1 
ATOM   8482  O  O     . ARG C 2 671  ? -24.995 33.368  29.783  1.00 33.98  ?  671  ARG C O     1 
ATOM   8483  C  CB    . ARG C 2 671  ? -23.905 36.053  31.077  1.00 37.59  ?  671  ARG C CB    1 
ATOM   8484  C  CG    . ARG C 2 671  ? -24.110 37.243  31.998  1.00 39.78  ?  671  ARG C CG    1 
ATOM   8485  C  CD    . ARG C 2 671  ? -23.001 37.332  33.028  1.00 44.67  ?  671  ARG C CD    1 
ATOM   8486  N  NE    . ARG C 2 671  ? -21.688 37.451  32.402  1.00 42.24  ?  671  ARG C NE    1 
ATOM   8487  C  CZ    . ARG C 2 671  ? -20.537 37.315  33.052  1.00 47.81  ?  671  ARG C CZ    1 
ATOM   8488  N  NH1   . ARG C 2 671  ? -20.534 37.048  34.351  1.00 40.18  ?  671  ARG C NH1   1 
ATOM   8489  N  NH2   . ARG C 2 671  ? -19.388 37.440  32.402  1.00 53.42  ?  671  ARG C NH2   1 
ATOM   8490  N  N     . MET C 2 672  ? -24.407 34.753  28.104  1.00 29.36  ?  672  MET C N     1 
ATOM   8491  C  CA    . MET C 2 672  ? -24.171 33.683  27.145  1.00 28.47  ?  672  MET C CA    1 
ATOM   8492  C  C     . MET C 2 672  ? -22.721 33.220  27.200  1.00 26.14  ?  672  MET C C     1 
ATOM   8493  O  O     . MET C 2 672  ? -21.796 34.036  27.244  1.00 28.29  ?  672  MET C O     1 
ATOM   8494  C  CB    . MET C 2 672  ? -24.517 34.145  25.729  1.00 25.55  ?  672  MET C CB    1 
ATOM   8495  C  CG    . MET C 2 672  ? -25.910 34.742  25.576  1.00 21.81  ?  672  MET C CG    1 
ATOM   8496  S  SD    . MET C 2 672  ? -27.245 33.530  25.658  1.00 32.79  ?  672  MET C SD    1 
ATOM   8497  C  CE    . MET C 2 672  ? -27.723 33.634  27.382  1.00 24.43  ?  672  MET C CE    1 
ATOM   8498  N  N     . ARG C 2 673  ? -22.533 31.903  27.195  1.00 17.36  ?  673  ARG C N     1 
ATOM   8499  C  CA    . ARG C 2 673  ? -21.200 31.310  27.172  1.00 17.92  ?  673  ARG C CA    1 
ATOM   8500  C  C     . ARG C 2 673  ? -20.725 31.252  25.725  1.00 24.19  ?  673  ARG C C     1 
ATOM   8501  O  O     . ARG C 2 673  ? -21.198 30.422  24.941  1.00 34.16  ?  673  ARG C O     1 
ATOM   8502  C  CB    . ARG C 2 673  ? -21.227 29.926  27.815  1.00 23.54  ?  673  ARG C CB    1 
ATOM   8503  C  CG    . ARG C 2 673  ? -19.863 29.279  27.986  1.00 40.61  ?  673  ARG C CG    1 
ATOM   8504  C  CD    . ARG C 2 673  ? -19.908 28.167  29.026  1.00 42.63  ?  673  ARG C CD    1 
ATOM   8505  N  NE    . ARG C 2 673  ? -21.004 27.232  28.788  1.00 56.21  ?  673  ARG C NE    1 
ATOM   8506  C  CZ    . ARG C 2 673  ? -21.251 26.162  29.536  1.00 72.02  ?  673  ARG C CZ    1 
ATOM   8507  N  NH1   . ARG C 2 673  ? -20.476 25.882  30.575  1.00 71.49  ?  673  ARG C NH1   1 
ATOM   8508  N  NH2   . ARG C 2 673  ? -22.273 25.368  29.244  1.00 64.38  ?  673  ARG C NH2   1 
ATOM   8509  N  N     . LYS C 2 674  ? -19.793 32.132  25.367  1.00 24.62  ?  674  LYS C N     1 
ATOM   8510  C  CA    . LYS C 2 674  ? -19.397 32.350  23.980  1.00 20.87  ?  674  LYS C CA    1 
ATOM   8511  C  C     . LYS C 2 674  ? -17.982 31.836  23.753  1.00 18.41  ?  674  LYS C C     1 
ATOM   8512  O  O     . LYS C 2 674  ? -17.030 32.340  24.359  1.00 16.19  ?  674  LYS C O     1 
ATOM   8513  C  CB    . LYS C 2 674  ? -19.487 33.834  23.622  1.00 17.75  ?  674  LYS C CB    1 
ATOM   8514  C  CG    . LYS C 2 674  ? -20.867 34.437  23.819  1.00 18.47  ?  674  LYS C CG    1 
ATOM   8515  C  CD    . LYS C 2 674  ? -21.870 33.844  22.845  1.00 23.20  ?  674  LYS C CD    1 
ATOM   8516  C  CE    . LYS C 2 674  ? -21.467 34.122  21.407  1.00 25.51  ?  674  LYS C CE    1 
ATOM   8517  N  NZ    . LYS C 2 674  ? -22.467 33.603  20.434  1.00 24.99  ?  674  LYS C NZ    1 
ATOM   8518  N  N     . PHE C 2 675  ? -17.853 30.841  22.871  1.00 19.34  ?  675  PHE C N     1 
ATOM   8519  C  CA    . PHE C 2 675  ? -16.557 30.320  22.428  1.00 17.73  ?  675  PHE C CA    1 
ATOM   8520  C  C     . PHE C 2 675  ? -15.693 29.882  23.610  1.00 17.12  ?  675  PHE C C     1 
ATOM   8521  O  O     . PHE C 2 675  ? -14.551 30.318  23.773  1.00 17.10  ?  675  PHE C O     1 
ATOM   8522  C  CB    . PHE C 2 675  ? -15.823 31.346  21.561  1.00 14.55  ?  675  PHE C CB    1 
ATOM   8523  C  CG    . PHE C 2 675  ? -16.611 31.806  20.368  1.00 16.92  ?  675  PHE C CG    1 
ATOM   8524  C  CD1   . PHE C 2 675  ? -16.806 30.967  19.284  1.00 18.48  ?  675  PHE C CD1   1 
ATOM   8525  C  CD2   . PHE C 2 675  ? -17.152 33.081  20.328  1.00 18.52  ?  675  PHE C CD2   1 
ATOM   8526  C  CE1   . PHE C 2 675  ? -17.529 31.388  18.184  1.00 22.09  ?  675  PHE C CE1   1 
ATOM   8527  C  CE2   . PHE C 2 675  ? -17.876 33.508  19.231  1.00 17.19  ?  675  PHE C CE2   1 
ATOM   8528  C  CZ    . PHE C 2 675  ? -18.064 32.660  18.157  1.00 20.24  ?  675  PHE C CZ    1 
ATOM   8529  N  N     . ALA C 2 676  ? -16.249 29.006  24.439  1.00 15.91  ?  676  ALA C N     1 
ATOM   8530  C  CA    . ALA C 2 676  ? -15.551 28.480  25.602  1.00 16.01  ?  676  ALA C CA    1 
ATOM   8531  C  C     . ALA C 2 676  ? -15.024 27.082  25.307  1.00 15.81  ?  676  ALA C C     1 
ATOM   8532  O  O     . ALA C 2 676  ? -15.735 26.245  24.742  1.00 22.26  ?  676  ALA C O     1 
ATOM   8533  C  CB    . ALA C 2 676  ? -16.469 28.446  26.824  1.00 24.09  ?  676  ALA C CB    1 
ATOM   8534  N  N     . ARG C 2 677  ? -13.774 26.838  25.691  1.00 22.40  ?  677  ARG C N     1 
ATOM   8535  C  CA    . ARG C 2 677  ? -13.170 25.529  25.491  1.00 17.46  ?  677  ARG C CA    1 
ATOM   8536  C  C     . ARG C 2 677  ? -13.784 24.516  26.448  1.00 21.07  ?  677  ARG C C     1 
ATOM   8537  O  O     . ARG C 2 677  ? -13.867 24.759  27.656  1.00 26.68  ?  677  ARG C O     1 
ATOM   8538  C  CB    . ARG C 2 677  ? -11.659 25.604  25.703  1.00 14.65  ?  677  ARG C CB    1 
ATOM   8539  C  CG    . ARG C 2 677  ? -10.927 24.295  25.444  1.00 22.89  ?  677  ARG C CG    1 
ATOM   8540  C  CD    . ARG C 2 677  ? -9.488  24.367  25.931  1.00 30.36  ?  677  ARG C CD    1 
ATOM   8541  N  NE    . ARG C 2 677  ? -8.670  23.280  25.401  1.00 34.29  ?  677  ARG C NE    1 
ATOM   8542  C  CZ    . ARG C 2 677  ? -8.557  22.081  25.964  1.00 37.98  ?  677  ARG C CZ    1 
ATOM   8543  N  NH1   . ARG C 2 677  ? -9.216  21.805  27.081  1.00 36.43  ?  677  ARG C NH1   1 
ATOM   8544  N  NH2   . ARG C 2 677  ? -7.786  21.157  25.408  1.00 44.28  ?  677  ARG C NH2   1 
ATOM   8545  N  N     . SER C 2 678  ? -14.216 23.380  25.909  1.00 18.22  ?  678  SER C N     1 
ATOM   8546  C  CA    . SER C 2 678  ? -14.767 22.322  26.739  1.00 22.19  ?  678  SER C CA    1 
ATOM   8547  C  C     . SER C 2 678  ? -13.638 21.490  27.340  1.00 28.95  ?  678  SER C C     1 
ATOM   8548  O  O     . SER C 2 678  ? -12.450 21.759  27.138  1.00 31.57  ?  678  SER C O     1 
ATOM   8549  C  CB    . SER C 2 678  ? -15.718 21.447  25.927  1.00 24.91  ?  678  SER C CB    1 
ATOM   8550  O  OG    . SER C 2 678  ? -15.007 20.669  24.980  1.00 28.42  ?  678  SER C OG    1 
ATOM   8551  N  N     . ASN C 2 679  ? -14.019 20.457  28.094  1.00 29.29  ?  679  ASN C N     1 
ATOM   8552  C  CA    . ASN C 2 679  ? -13.031 19.560  28.680  1.00 30.98  ?  679  ASN C CA    1 
ATOM   8553  C  C     . ASN C 2 679  ? -12.248 18.795  27.625  1.00 31.12  ?  679  ASN C C     1 
ATOM   8554  O  O     . ASN C 2 679  ? -11.123 18.360  27.896  1.00 34.45  ?  679  ASN C O     1 
ATOM   8555  C  CB    . ASN C 2 679  ? -13.713 18.579  29.633  1.00 33.70  ?  679  ASN C CB    1 
ATOM   8556  C  CG    . ASN C 2 679  ? -14.241 19.254  30.884  1.00 36.27  ?  679  ASN C CG    1 
ATOM   8557  O  OD1   . ASN C 2 679  ? -13.717 20.280  31.319  1.00 40.60  ?  679  ASN C OD1   1 
ATOM   8558  N  ND2   . ASN C 2 679  ? -15.279 18.673  31.476  1.00 32.66  ?  679  ASN C ND2   1 
ATOM   8559  N  N     . HIS C 2 680  ? -12.811 18.624  26.431  1.00 25.99  ?  680  HIS C N     1 
ATOM   8560  C  CA    . HIS C 2 680  ? -12.178 17.854  25.369  1.00 27.60  ?  680  HIS C CA    1 
ATOM   8561  C  C     . HIS C 2 680  ? -11.928 18.704  24.129  1.00 23.84  ?  680  HIS C C     1 
ATOM   8562  O  O     . HIS C 2 680  ? -11.873 18.185  23.014  1.00 25.34  ?  680  HIS C O     1 
ATOM   8563  C  CB    . HIS C 2 680  ? -13.021 16.629  25.022  1.00 24.95  ?  680  HIS C CB    1 
ATOM   8564  C  CG    . HIS C 2 680  ? -13.296 15.739  26.192  1.00 36.39  ?  680  HIS C CG    1 
ATOM   8565  N  ND1   . HIS C 2 680  ? -12.380 15.533  27.202  1.00 39.65  ?  680  HIS C ND1   1 
ATOM   8566  C  CD2   . HIS C 2 680  ? -14.390 15.014  26.523  1.00 38.94  ?  680  HIS C CD2   1 
ATOM   8567  C  CE1   . HIS C 2 680  ? -12.895 14.712  28.099  1.00 45.76  ?  680  HIS C CE1   1 
ATOM   8568  N  NE2   . HIS C 2 680  ? -14.114 14.382  27.711  1.00 47.79  ?  680  HIS C NE2   1 
ATOM   8569  N  N     . GLY C 2 681  ? -11.775 20.014  24.308  1.00 21.48  ?  681  GLY C N     1 
ATOM   8570  C  CA    . GLY C 2 681  ? -11.418 20.882  23.205  1.00 22.02  ?  681  GLY C CA    1 
ATOM   8571  C  C     . GLY C 2 681  ? -12.525 21.193  22.227  1.00 17.77  ?  681  GLY C C     1 
ATOM   8572  O  O     . GLY C 2 681  ? -12.248 21.756  21.163  1.00 18.66  ?  681  GLY C O     1 
ATOM   8573  N  N     . THR C 2 682  ? -13.768 20.846  22.539  1.00 17.46  ?  682  THR C N     1 
ATOM   8574  C  CA    . THR C 2 682  ? -14.885 21.194  21.676  1.00 18.79  ?  682  THR C CA    1 
ATOM   8575  C  C     . THR C 2 682  ? -15.376 22.603  21.996  1.00 17.91  ?  682  THR C C     1 
ATOM   8576  O  O     . THR C 2 682  ? -15.075 23.170  23.049  1.00 16.25  ?  682  THR C O     1 
ATOM   8577  C  CB    . THR C 2 682  ? -16.028 20.189  21.825  1.00 20.66  ?  682  THR C CB    1 
ATOM   8578  O  OG1   . THR C 2 682  ? -16.644 20.344  23.109  1.00 25.20  ?  682  THR C OG1   1 
ATOM   8579  C  CG2   . THR C 2 682  ? -15.505 18.766  21.691  1.00 19.44  ?  682  THR C CG2   1 
ATOM   8580  N  N     . CYS C 2 683  ? -16.142 23.166  21.066  1.00 13.59  ?  683  CYS C N     1 
ATOM   8581  C  CA    . CYS C 2 683  ? -16.595 24.550  21.164  1.00 13.96  ?  683  CYS C CA    1 
ATOM   8582  C  C     . CYS C 2 683  ? -17.949 24.590  21.862  1.00 18.70  ?  683  CYS C C     1 
ATOM   8583  O  O     . CYS C 2 683  ? -18.955 24.126  21.313  1.00 23.76  ?  683  CYS C O     1 
ATOM   8584  C  CB    . CYS C 2 683  ? -16.672 25.188  19.780  1.00 19.76  ?  683  CYS C CB    1 
ATOM   8585  S  SG    . CYS C 2 683  ? -17.126 26.938  19.791  1.00 33.04  ?  683  CYS C SG    1 
ATOM   8586  N  N     . ALA C 2 684  ? -17.976 25.147  23.069  1.00 18.35  ?  684  ALA C N     1 
ATOM   8587  C  CA    . ALA C 2 684  ? -19.212 25.361  23.818  1.00 17.96  ?  684  ALA C CA    1 
ATOM   8588  C  C     . ALA C 2 684  ? -19.638 26.807  23.594  1.00 18.26  ?  684  ALA C C     1 
ATOM   8589  O  O     . ALA C 2 684  ? -19.126 27.724  24.242  1.00 21.64  ?  684  ALA C O     1 
ATOM   8590  C  CB    . ALA C 2 684  ? -19.013 25.052  25.299  1.00 27.49  ?  684  ALA C CB    1 
ATOM   8591  N  N     . ASN C 2 685  ? -20.575 27.010  22.670  1.00 21.46  ?  685  ASN C N     1 
ATOM   8592  C  CA    . ASN C 2 685  ? -21.018 28.344  22.282  1.00 20.14  ?  685  ASN C CA    1 
ATOM   8593  C  C     . ASN C 2 685  ? -22.537 28.395  22.319  1.00 20.96  ?  685  ASN C C     1 
ATOM   8594  O  O     . ASN C 2 685  ? -23.202 27.685  21.558  1.00 26.67  ?  685  ASN C O     1 
ATOM   8595  C  CB    . ASN C 2 685  ? -20.502 28.710  20.886  1.00 18.10  ?  685  ASN C CB    1 
ATOM   8596  C  CG    . ASN C 2 685  ? -20.717 30.173  20.549  1.00 22.31  ?  685  ASN C CG    1 
ATOM   8597  O  OD1   . ASN C 2 685  ? -19.816 30.996  20.710  1.00 25.84  ?  685  ASN C OD1   1 
ATOM   8598  N  ND2   . ASN C 2 685  ? -21.914 30.504  20.077  1.00 30.15  ?  685  ASN C ND2   1 
ATOM   8599  N  N     . GLN C 2 686  ? -23.079 29.230  23.198  1.00 21.78  ?  686  GLN C N     1 
ATOM   8600  C  CA    . GLN C 2 686  ? -24.513 29.450  23.277  1.00 20.02  ?  686  GLN C CA    1 
ATOM   8601  C  C     . GLN C 2 686  ? -24.916 30.625  22.392  1.00 24.34  ?  686  GLN C C     1 
ATOM   8602  O  O     . GLN C 2 686  ? -24.108 31.502  22.075  1.00 26.62  ?  686  GLN C O     1 
ATOM   8603  C  CB    . GLN C 2 686  ? -24.941 29.708  24.724  1.00 16.13  ?  686  GLN C CB    1 
ATOM   8604  C  CG    . GLN C 2 686  ? -24.634 28.567  25.683  1.00 20.23  ?  686  GLN C CG    1 
ATOM   8605  C  CD    . GLN C 2 686  ? -24.921 28.928  27.129  1.00 26.94  ?  686  GLN C CD    1 
ATOM   8606  O  OE1   . GLN C 2 686  ? -24.855 30.095  27.514  1.00 30.58  ?  686  GLN C OE1   1 
ATOM   8607  N  NE2   . GLN C 2 686  ? -25.247 27.924  27.936  1.00 23.16  ?  686  GLN C NE2   1 
ATOM   8608  N  N     . CYS C 2 687  ? -26.187 30.632  21.987  1.00 22.08  ?  687  CYS C N     1 
ATOM   8609  C  CA    . CYS C 2 687  ? -26.712 31.702  21.155  1.00 18.49  ?  687  CYS C CA    1 
ATOM   8610  C  C     . CYS C 2 687  ? -28.168 31.960  21.505  1.00 20.01  ?  687  CYS C C     1 
ATOM   8611  O  O     . CYS C 2 687  ? -28.928 31.002  21.708  1.00 18.65  ?  687  CYS C O     1 
ATOM   8612  C  CB    . CYS C 2 687  ? -26.588 31.381  19.662  1.00 17.64  ?  687  CYS C CB    1 
ATOM   8613  S  SG    . CYS C 2 687  ? -24.995 31.830  18.934  1.00 52.92  ?  687  CYS C SG    1 
ATOM   8614  N  N     . PRO C 2 688  ? -28.579 33.225  21.588  1.00 30.61  ?  688  PRO C N     1 
ATOM   8615  C  CA    . PRO C 2 688  ? -29.978 33.527  21.908  1.00 28.06  ?  688  PRO C CA    1 
ATOM   8616  C  C     . PRO C 2 688  ? -30.926 33.040  20.823  1.00 35.63  ?  688  PRO C C     1 
ATOM   8617  O  O     . PRO C 2 688  ? -30.560 32.903  19.655  1.00 33.53  ?  688  PRO C O     1 
ATOM   8618  C  CB    . PRO C 2 688  ? -29.994 35.057  22.014  1.00 23.18  ?  688  PRO C CB    1 
ATOM   8619  C  CG    . PRO C 2 688  ? -28.575 35.434  22.302  1.00 29.13  ?  688  PRO C CG    1 
ATOM   8620  C  CD    . PRO C 2 688  ? -27.744 34.436  21.554  1.00 36.31  ?  688  PRO C CD    1 
ATOM   8621  N  N     . ILE C 2 689  ? -32.164 32.775  21.231  1.00 33.58  ?  689  ILE C N     1 
ATOM   8622  C  CA    . ILE C 2 689  ? -33.226 32.376  20.322  1.00 26.04  ?  689  ILE C CA    1 
ATOM   8623  C  C     . ILE C 2 689  ? -34.315 33.438  20.236  1.00 34.26  ?  689  ILE C C     1 
ATOM   8624  O  O     . ILE C 2 689  ? -34.809 33.739  19.146  1.00 48.19  ?  689  ILE C O     1 
ATOM   8625  C  CB    . ILE C 2 689  ? -33.816 31.010  20.740  1.00 27.53  ?  689  ILE C CB    1 
ATOM   8626  C  CG1   . ILE C 2 689  ? -32.809 29.891  20.472  1.00 28.03  ?  689  ILE C CG1   1 
ATOM   8627  C  CG2   . ILE C 2 689  ? -35.131 30.742  20.021  1.00 32.72  ?  689  ILE C CG2   1 
ATOM   8628  C  CD1   . ILE C 2 689  ? -33.311 28.515  20.847  1.00 27.39  ?  689  ILE C CD1   1 
ATOM   8629  N  N     . VAL C 2 690  ? -34.687 34.028  21.375  1.00 37.39  ?  690  VAL C N     1 
ATOM   8630  C  CA    . VAL C 2 690  ? -35.739 35.031  21.387  1.00 37.59  ?  690  VAL C CA    1 
ATOM   8631  C  C     . VAL C 2 690  ? -35.224 36.348  20.815  1.00 40.73  ?  690  VAL C C     1 
ATOM   8632  O  O     . VAL C 2 690  ? -34.018 36.577  20.673  1.00 41.26  ?  690  VAL C O     1 
ATOM   8633  C  CB    . VAL C 2 690  ? -36.278 35.219  22.812  1.00 37.27  ?  690  VAL C CB    1 
ATOM   8634  C  CG1   . VAL C 2 690  ? -36.914 33.935  23.310  1.00 38.57  ?  690  VAL C CG1   1 
ATOM   8635  C  CG2   . VAL C 2 690  ? -35.148 35.645  23.735  1.00 31.98  ?  690  VAL C CG2   1 
ATOM   8636  N  N     . ASP C 2 691  ? -36.163 37.228  20.488  1.00 37.09  ?  691  ASP C N     1 
ATOM   8637  C  CA    . ASP C 2 691  ? -35.877 38.562  19.983  1.00 41.71  ?  691  ASP C CA    1 
ATOM   8638  C  C     . ASP C 2 691  ? -36.412 39.604  20.960  1.00 41.82  ?  691  ASP C C     1 
ATOM   8639  O  O     . ASP C 2 691  ? -36.952 39.280  22.020  1.00 42.05  ?  691  ASP C O     1 
ATOM   8640  C  CB    . ASP C 2 691  ? -36.473 38.757  18.586  1.00 48.22  ?  691  ASP C CB    1 
ATOM   8641  C  CG    . ASP C 2 691  ? -35.477 38.467  17.484  1.00 64.16  ?  691  ASP C CG    1 
ATOM   8642  O  OD1   . ASP C 2 691  ? -34.333 38.963  17.576  1.00 61.34  ?  691  ASP C OD1   1 
ATOM   8643  O  OD2   . ASP C 2 691  ? -35.830 37.741  16.532  1.00 70.14  ?  691  ASP C OD2   1 
ATOM   8644  N  N     . ALA C 2 692  ? -36.255 40.872  20.587  1.00 40.75  ?  692  ALA C N     1 
ATOM   8645  C  CA    . ALA C 2 692  ? -36.642 41.975  21.459  1.00 38.23  ?  692  ALA C CA    1 
ATOM   8646  C  C     . ALA C 2 692  ? -38.159 42.049  21.579  1.00 36.64  ?  692  ALA C C     1 
ATOM   8647  O  O     . ALA C 2 692  ? -38.864 42.191  20.573  1.00 42.87  ?  692  ALA C O     1 
ATOM   8648  C  CB    . ALA C 2 692  ? -36.079 43.288  20.923  1.00 48.51  ?  692  ALA C CB    1 
ATOM   8649  N  N     . GLY C 2 693  ? -38.660 41.954  22.806  1.00 33.67  ?  693  GLY C N     1 
ATOM   8650  C  CA    . GLY C 2 693  ? -40.084 42.081  23.051  1.00 35.78  ?  693  GLY C CA    1 
ATOM   8651  C  C     . GLY C 2 693  ? -40.890 40.830  22.785  1.00 34.91  ?  693  GLY C C     1 
ATOM   8652  O  O     . GLY C 2 693  ? -42.004 40.917  22.253  1.00 38.60  ?  693  GLY C O     1 
ATOM   8653  N  N     . ASP C 2 694  ? -40.364 39.663  23.144  1.00 40.57  ?  694  ASP C N     1 
ATOM   8654  C  CA    . ASP C 2 694  ? -41.050 38.393  22.947  1.00 43.19  ?  694  ASP C CA    1 
ATOM   8655  C  C     . ASP C 2 694  ? -41.545 37.878  24.292  1.00 33.76  ?  694  ASP C C     1 
ATOM   8656  O  O     . ASP C 2 694  ? -40.750 37.695  25.221  1.00 36.93  ?  694  ASP C O     1 
ATOM   8657  C  CB    . ASP C 2 694  ? -40.128 37.366  22.290  1.00 45.12  ?  694  ASP C CB    1 
ATOM   8658  C  CG    . ASP C 2 694  ? -39.690 37.780  20.902  1.00 49.07  ?  694  ASP C CG    1 
ATOM   8659  O  OD1   . ASP C 2 694  ? -40.032 38.905  20.481  1.00 50.47  ?  694  ASP C OD1   1 
ATOM   8660  O  OD2   . ASP C 2 694  ? -39.007 36.980  20.230  1.00 46.88  ?  694  ASP C OD2   1 
ATOM   8661  N  N     . ARG C 2 695  ? -42.851 37.647  24.394  1.00 44.09  ?  695  ARG C N     1 
ATOM   8662  C  CA    . ARG C 2 695  ? -43.415 37.033  25.589  1.00 45.00  ?  695  ARG C CA    1 
ATOM   8663  C  C     . ARG C 2 695  ? -42.970 35.577  25.668  1.00 43.78  ?  695  ARG C C     1 
ATOM   8664  O  O     . ARG C 2 695  ? -43.282 34.776  24.781  1.00 55.79  ?  695  ARG C O     1 
ATOM   8665  C  CB    . ARG C 2 695  ? -44.938 37.135  25.571  1.00 55.01  ?  695  ARG C CB    1 
ATOM   8666  C  CG    . ARG C 2 695  ? -45.634 36.285  26.625  1.00 60.40  ?  695  ARG C CG    1 
ATOM   8667  C  CD    . ARG C 2 695  ? -45.352 36.781  28.035  1.00 57.84  ?  695  ARG C CD    1 
ATOM   8668  N  NE    . ARG C 2 695  ? -45.910 35.885  29.046  1.00 63.38  ?  695  ARG C NE    1 
ATOM   8669  C  CZ    . ARG C 2 695  ? -45.931 36.146  30.349  1.00 64.14  ?  695  ARG C CZ    1 
ATOM   8670  N  NH1   . ARG C 2 695  ? -45.429 37.283  30.808  1.00 52.73  ?  695  ARG C NH1   1 
ATOM   8671  N  NH2   . ARG C 2 695  ? -46.459 35.270  31.193  1.00 72.02  ?  695  ARG C NH2   1 
ATOM   8672  N  N     . VAL C 2 696  ? -42.237 35.237  26.726  1.00 40.40  ?  696  VAL C N     1 
ATOM   8673  C  CA    . VAL C 2 696  ? -41.668 33.907  26.903  1.00 45.97  ?  696  VAL C CA    1 
ATOM   8674  C  C     . VAL C 2 696  ? -42.119 33.362  28.252  1.00 53.79  ?  696  VAL C C     1 
ATOM   8675  O  O     . VAL C 2 696  ? -42.025 34.056  29.270  1.00 49.70  ?  696  VAL C O     1 
ATOM   8676  C  CB    . VAL C 2 696  ? -40.130 33.930  26.803  1.00 43.19  ?  696  VAL C CB    1 
ATOM   8677  C  CG1   . VAL C 2 696  ? -39.568 35.161  27.498  1.00 44.32  ?  696  VAL C CG1   1 
ATOM   8678  C  CG2   . VAL C 2 696  ? -39.534 32.663  27.395  1.00 57.40  ?  696  VAL C CG2   1 
ATOM   8679  N  N     . GLU C 2 697  ? -42.610 32.124  28.255  1.00 60.85  ?  697  GLU C N     1 
ATOM   8680  C  CA    . GLU C 2 697  ? -43.119 31.497  29.464  1.00 54.18  ?  697  GLU C CA    1 
ATOM   8681  C  C     . GLU C 2 697  ? -41.975 30.912  30.292  1.00 48.42  ?  697  GLU C C     1 
ATOM   8682  O  O     . GLU C 2 697  ? -40.823 30.842  29.855  1.00 47.82  ?  697  GLU C O     1 
ATOM   8683  C  CB    . GLU C 2 697  ? -44.133 30.410  29.112  1.00 65.86  ?  697  GLU C CB    1 
ATOM   8684  C  CG    . GLU C 2 697  ? -45.326 30.917  28.321  1.00 88.02  ?  697  GLU C CG    1 
ATOM   8685  C  CD    . GLU C 2 697  ? -46.209 29.795  27.811  1.00 109.57 ?  697  GLU C CD    1 
ATOM   8686  O  OE1   . GLU C 2 697  ? -45.786 28.622  27.885  1.00 112.57 ?  697  GLU C OE1   1 
ATOM   8687  O  OE2   . GLU C 2 697  ? -47.326 30.087  27.337  1.00 111.95 ?  697  GLU C OE2   1 
ATOM   8688  N  N     . ALA C 2 698  ? -42.308 30.487  31.507  1.00 46.42  ?  698  ALA C N     1 
ATOM   8689  C  CA    . ALA C 2 698  ? -41.301 29.948  32.410  1.00 41.70  ?  698  ALA C CA    1 
ATOM   8690  C  C     . ALA C 2 698  ? -40.880 28.553  31.971  1.00 41.95  ?  698  ALA C C     1 
ATOM   8691  O  O     . ALA C 2 698  ? -41.687 27.777  31.454  1.00 47.62  ?  698  ALA C O     1 
ATOM   8692  C  CB    . ALA C 2 698  ? -41.829 29.919  33.843  1.00 42.46  ?  698  ALA C CB    1 
ATOM   8693  N  N     . GLY C 2 699  ? -39.605 28.237  32.184  1.00 39.85  ?  699  GLY C N     1 
ATOM   8694  C  CA    . GLY C 2 699  ? -39.066 26.960  31.761  1.00 38.91  ?  699  GLY C CA    1 
ATOM   8695  C  C     . GLY C 2 699  ? -38.850 26.817  30.273  1.00 38.53  ?  699  GLY C C     1 
ATOM   8696  O  O     . GLY C 2 699  ? -38.536 25.716  29.812  1.00 37.55  ?  699  GLY C O     1 
ATOM   8697  N  N     . GLN C 2 700  ? -39.003 27.894  29.507  1.00 47.42  ?  700  GLN C N     1 
ATOM   8698  C  CA    . GLN C 2 700  ? -38.844 27.852  28.062  1.00 39.88  ?  700  GLN C CA    1 
ATOM   8699  C  C     . GLN C 2 700  ? -37.408 28.184  27.674  1.00 42.59  ?  700  GLN C C     1 
ATOM   8700  O  O     . GLN C 2 700  ? -36.736 28.989  28.325  1.00 51.92  ?  700  GLN C O     1 
ATOM   8701  C  CB    . GLN C 2 700  ? -39.806 28.832  27.386  1.00 38.05  ?  700  GLN C CB    1 
ATOM   8702  C  CG    . GLN C 2 700  ? -39.780 28.792  25.867  1.00 52.17  ?  700  GLN C CG    1 
ATOM   8703  C  CD    . GLN C 2 700  ? -40.349 30.050  25.242  1.00 50.37  ?  700  GLN C CD    1 
ATOM   8704  O  OE1   . GLN C 2 700  ? -41.464 30.466  25.557  1.00 50.64  ?  700  GLN C OE1   1 
ATOM   8705  N  NE2   . GLN C 2 700  ? -39.577 30.670  24.356  1.00 42.06  ?  700  GLN C NE2   1 
ATOM   8706  N  N     . VAL C 2 701  ? -36.941 27.550  26.600  1.00 25.80  ?  701  VAL C N     1 
ATOM   8707  C  CA    . VAL C 2 701  ? -35.580 27.758  26.115  1.00 23.82  ?  701  VAL C CA    1 
ATOM   8708  C  C     . VAL C 2 701  ? -35.514 29.120  25.429  1.00 27.76  ?  701  VAL C C     1 
ATOM   8709  O  O     . VAL C 2 701  ? -36.121 29.324  24.374  1.00 29.93  ?  701  VAL C O     1 
ATOM   8710  C  CB    . VAL C 2 701  ? -35.146 26.636  25.166  1.00 16.77  ?  701  VAL C CB    1 
ATOM   8711  C  CG1   . VAL C 2 701  ? -33.755 26.916  24.615  1.00 14.63  ?  701  VAL C CG1   1 
ATOM   8712  C  CG2   . VAL C 2 701  ? -35.181 25.295  25.881  1.00 13.12  ?  701  VAL C CG2   1 
ATOM   8713  N  N     . ILE C 2 702  ? -34.780 30.058  26.031  1.00 27.34  ?  702  ILE C N     1 
ATOM   8714  C  CA    . ILE C 2 702  ? -34.535 31.356  25.409  1.00 31.09  ?  702  ILE C CA    1 
ATOM   8715  C  C     . ILE C 2 702  ? -33.206 31.400  24.672  1.00 27.31  ?  702  ILE C C     1 
ATOM   8716  O  O     . ILE C 2 702  ? -32.940 32.379  23.955  1.00 28.22  ?  702  ILE C O     1 
ATOM   8717  C  CB    . ILE C 2 702  ? -34.589 32.497  26.446  1.00 36.23  ?  702  ILE C CB    1 
ATOM   8718  C  CG1   . ILE C 2 702  ? -33.400 32.406  27.402  1.00 35.21  ?  702  ILE C CG1   1 
ATOM   8719  C  CG2   . ILE C 2 702  ? -35.895 32.451  27.218  1.00 36.13  ?  702  ILE C CG2   1 
ATOM   8720  C  CD1   . ILE C 2 702  ? -33.362 33.514  28.427  1.00 32.25  ?  702  ILE C CD1   1 
ATOM   8721  N  N     . ALA C 2 703  ? -32.365 30.381  24.826  1.00 26.34  ?  703  ALA C N     1 
ATOM   8722  C  CA    . ALA C 2 703  ? -31.074 30.304  24.160  1.00 29.00  ?  703  ALA C CA    1 
ATOM   8723  C  C     . ALA C 2 703  ? -30.574 28.872  24.258  1.00 29.62  ?  703  ALA C C     1 
ATOM   8724  O  O     . ALA C 2 703  ? -30.713 28.236  25.305  1.00 34.96  ?  703  ALA C O     1 
ATOM   8725  C  CB    . ALA C 2 703  ? -30.058 31.267  24.787  1.00 30.99  ?  703  ALA C CB    1 
ATOM   8726  N  N     . ASP C 2 704  ? -30.001 28.373  23.168  1.00 14.87  ?  704  ASP C N     1 
ATOM   8727  C  CA    . ASP C 2 704  ? -29.492 27.012  23.114  1.00 28.94  ?  704  ASP C CA    1 
ATOM   8728  C  C     . ASP C 2 704  ? -27.993 27.025  22.847  1.00 22.37  ?  704  ASP C C     1 
ATOM   8729  O  O     . ASP C 2 704  ? -27.464 27.947  22.219  1.00 20.56  ?  704  ASP C O     1 
ATOM   8730  C  CB    . ASP C 2 704  ? -30.218 26.188  22.044  1.00 35.05  ?  704  ASP C CB    1 
ATOM   8731  C  CG    . ASP C 2 704  ? -30.177 26.836  20.675  1.00 36.89  ?  704  ASP C CG    1 
ATOM   8732  O  OD1   . ASP C 2 704  ? -29.763 28.010  20.577  1.00 51.50  ?  704  ASP C OD1   1 
ATOM   8733  O  OD2   . ASP C 2 704  ? -30.561 26.166  19.693  1.00 28.58  ?  704  ASP C OD2   1 
ATOM   8734  N  N     . GLY C 2 705  ? -27.314 25.991  23.335  1.00 19.93  ?  705  GLY C N     1 
ATOM   8735  C  CA    . GLY C 2 705  ? -25.878 25.905  23.230  1.00 16.48  ?  705  GLY C CA    1 
ATOM   8736  C  C     . GLY C 2 705  ? -25.423 24.971  22.130  1.00 17.81  ?  705  GLY C C     1 
ATOM   8737  O  O     . GLY C 2 705  ? -26.082 24.819  21.096  1.00 23.54  ?  705  GLY C O     1 
ATOM   8738  N  N     . PRO C 2 706  ? -24.276 24.324  22.334  1.00 11.11  ?  706  PRO C N     1 
ATOM   8739  C  CA    . PRO C 2 706  ? -23.742 23.428  21.303  1.00 19.66  ?  706  PRO C CA    1 
ATOM   8740  C  C     . PRO C 2 706  ? -24.646 22.224  21.083  1.00 18.04  ?  706  PRO C C     1 
ATOM   8741  O  O     . PRO C 2 706  ? -25.308 21.740  22.004  1.00 16.38  ?  706  PRO C O     1 
ATOM   8742  C  CB    . PRO C 2 706  ? -22.380 23.009  21.869  1.00 20.02  ?  706  PRO C CB    1 
ATOM   8743  C  CG    . PRO C 2 706  ? -22.511 23.194  23.344  1.00 17.57  ?  706  PRO C CG    1 
ATOM   8744  C  CD    . PRO C 2 706  ? -23.405 24.386  23.520  1.00 14.35  ?  706  PRO C CD    1 
ATOM   8745  N  N     . CYS C 2 707  ? -24.670 21.751  19.836  1.00 16.98  ?  707  CYS C N     1 
ATOM   8746  C  CA    . CYS C 2 707  ? -25.469 20.588  19.443  1.00 11.76  ?  707  CYS C CA    1 
ATOM   8747  C  C     . CYS C 2 707  ? -26.936 20.763  19.824  1.00 13.23  ?  707  CYS C C     1 
ATOM   8748  O  O     . CYS C 2 707  ? -27.588 19.838  20.313  1.00 19.31  ?  707  CYS C O     1 
ATOM   8749  C  CB    . CYS C 2 707  ? -24.903 19.302  20.048  1.00 10.02  ?  707  CYS C CB    1 
ATOM   8750  S  SG    . CYS C 2 707  ? -23.301 18.802  19.386  1.00 26.79  ?  707  CYS C SG    1 
ATOM   8751  N  N     . THR C 2 708  ? -27.465 21.965  19.601  1.00 17.89  ?  708  THR C N     1 
ATOM   8752  C  CA    . THR C 2 708  ? -28.851 22.253  19.936  1.00 19.36  ?  708  THR C CA    1 
ATOM   8753  C  C     . THR C 2 708  ? -29.461 23.175  18.891  1.00 19.92  ?  708  THR C C     1 
ATOM   8754  O  O     . THR C 2 708  ? -28.826 24.137  18.450  1.00 22.78  ?  708  THR C O     1 
ATOM   8755  C  CB    . THR C 2 708  ? -28.977 22.889  21.326  1.00 20.55  ?  708  THR C CB    1 
ATOM   8756  O  OG1   . THR C 2 708  ? -27.998 22.323  22.206  1.00 25.91  ?  708  THR C OG1   1 
ATOM   8757  C  CG2   . THR C 2 708  ? -30.361 22.623  21.896  1.00 24.67  ?  708  THR C CG2   1 
ATOM   8758  N  N     . ASP C 2 709  ? -30.700 22.871  18.505  1.00 23.02  ?  709  ASP C N     1 
ATOM   8759  C  CA    . ASP C 2 709  ? -31.441 23.657  17.521  1.00 26.16  ?  709  ASP C CA    1 
ATOM   8760  C  C     . ASP C 2 709  ? -32.861 23.832  18.040  1.00 28.87  ?  709  ASP C C     1 
ATOM   8761  O  O     . ASP C 2 709  ? -33.628 22.864  18.091  1.00 32.57  ?  709  ASP C O     1 
ATOM   8762  C  CB    . ASP C 2 709  ? -31.441 22.977  16.150  1.00 31.37  ?  709  ASP C CB    1 
ATOM   8763  C  CG    . ASP C 2 709  ? -32.222 23.759  15.105  1.00 33.40  ?  709  ASP C CG    1 
ATOM   8764  O  OD1   . ASP C 2 709  ? -32.425 24.978  15.285  1.00 39.38  ?  709  ASP C OD1   1 
ATOM   8765  O  OD2   . ASP C 2 709  ? -32.638 23.146  14.099  1.00 30.36  ?  709  ASP C OD2   1 
ATOM   8766  N  N     . ASP C 2 710  ? -33.204 25.062  18.430  1.00 20.80  ?  710  ASP C N     1 
ATOM   8767  C  CA    . ASP C 2 710  ? -34.528 25.394  18.956  1.00 18.50  ?  710  ASP C CA    1 
ATOM   8768  C  C     . ASP C 2 710  ? -34.861 24.560  20.191  1.00 22.56  ?  710  ASP C C     1 
ATOM   8769  O  O     . ASP C 2 710  ? -36.030 24.316  20.500  1.00 30.86  ?  710  ASP C O     1 
ATOM   8770  C  CB    . ASP C 2 710  ? -35.608 25.238  17.879  1.00 29.60  ?  710  ASP C CB    1 
ATOM   8771  C  CG    . ASP C 2 710  ? -36.738 26.238  18.035  1.00 36.82  ?  710  ASP C CG    1 
ATOM   8772  O  OD1   . ASP C 2 710  ? -37.257 26.378  19.160  1.00 47.34  ?  710  ASP C OD1   1 
ATOM   8773  O  OD2   . ASP C 2 710  ? -37.102 26.891  17.034  1.00 41.07  ?  710  ASP C OD2   1 
ATOM   8774  N  N     . GLY C 2 711  ? -33.829 24.116  20.903  1.00 24.22  ?  711  GLY C N     1 
ATOM   8775  C  CA    . GLY C 2 711  ? -33.994 23.368  22.128  1.00 21.70  ?  711  GLY C CA    1 
ATOM   8776  C  C     . GLY C 2 711  ? -33.942 21.864  21.996  1.00 27.56  ?  711  GLY C C     1 
ATOM   8777  O  O     . GLY C 2 711  ? -34.318 21.167  22.945  1.00 37.60  ?  711  GLY C O     1 
ATOM   8778  N  N     . GLU C 2 712  ? -33.493 21.340  20.859  1.00 23.59  ?  712  GLU C N     1 
ATOM   8779  C  CA    . GLU C 2 712  ? -33.442 19.906  20.618  1.00 23.97  ?  712  GLU C CA    1 
ATOM   8780  C  C     . GLU C 2 712  ? -32.008 19.484  20.336  1.00 29.49  ?  712  GLU C C     1 
ATOM   8781  O  O     . GLU C 2 712  ? -31.245 20.227  19.713  1.00 32.61  ?  712  GLU C O     1 
ATOM   8782  C  CB    . GLU C 2 712  ? -34.343 19.514  19.444  1.00 35.30  ?  712  GLU C CB    1 
ATOM   8783  C  CG    . GLU C 2 712  ? -35.823 19.729  19.700  1.00 38.81  ?  712  GLU C CG    1 
ATOM   8784  C  CD    . GLU C 2 712  ? -36.657 19.549  18.449  1.00 45.48  ?  712  GLU C CD    1 
ATOM   8785  O  OE1   . GLU C 2 712  ? -36.304 20.143  17.409  1.00 37.59  ?  712  GLU C OE1   1 
ATOM   8786  O  OE2   . GLU C 2 712  ? -37.660 18.806  18.504  1.00 37.32  ?  712  GLU C OE2   1 
ATOM   8787  N  N     . MET C 2 713  ? -31.649 18.286  20.799  1.00 17.62  ?  713  MET C N     1 
ATOM   8788  C  CA    . MET C 2 713  ? -30.310 17.748  20.586  1.00 19.52  ?  713  MET C CA    1 
ATOM   8789  C  C     . MET C 2 713  ? -29.993 17.644  19.100  1.00 25.17  ?  713  MET C C     1 
ATOM   8790  O  O     . MET C 2 713  ? -30.537 16.784  18.401  1.00 33.09  ?  713  MET C O     1 
ATOM   8791  C  CB    . MET C 2 713  ? -30.167 16.379  21.254  1.00 16.65  ?  713  MET C CB    1 
ATOM   8792  C  CG    . MET C 2 713  ? -30.099 16.429  22.772  1.00 30.38  ?  713  MET C CG    1 
ATOM   8793  S  SD    . MET C 2 713  ? -28.688 17.381  23.368  1.00 29.31  ?  713  MET C SD    1 
ATOM   8794  C  CE    . MET C 2 713  ? -27.339 16.553  22.532  1.00 25.59  ?  713  MET C CE    1 
ATOM   8795  N  N     . ALA C 2 714  ? -29.116 18.515  18.612  1.00 18.63  ?  714  ALA C N     1 
ATOM   8796  C  CA    . ALA C 2 714  ? -28.749 18.562  17.201  1.00 18.78  ?  714  ALA C CA    1 
ATOM   8797  C  C     . ALA C 2 714  ? -27.317 18.059  17.036  1.00 21.57  ?  714  ALA C C     1 
ATOM   8798  O  O     . ALA C 2 714  ? -26.381 18.823  16.790  1.00 29.53  ?  714  ALA C O     1 
ATOM   8799  C  CB    . ALA C 2 714  ? -28.915 19.983  16.656  1.00 26.98  ?  714  ALA C CB    1 
ATOM   8800  N  N     . LEU C 2 715  ? -27.155 16.743  17.163  1.00 14.15  ?  715  LEU C N     1 
ATOM   8801  C  CA    . LEU C 2 715  ? -25.839 16.120  17.119  1.00 17.50  ?  715  LEU C CA    1 
ATOM   8802  C  C     . LEU C 2 715  ? -25.266 16.007  15.712  1.00 19.15  ?  715  LEU C C     1 
ATOM   8803  O  O     . LEU C 2 715  ? -24.122 15.563  15.569  1.00 20.09  ?  715  LEU C O     1 
ATOM   8804  C  CB    . LEU C 2 715  ? -25.900 14.732  17.758  1.00 13.69  ?  715  LEU C CB    1 
ATOM   8805  C  CG    . LEU C 2 715  ? -26.146 14.691  19.265  1.00 12.51  ?  715  LEU C CG    1 
ATOM   8806  C  CD1   . LEU C 2 715  ? -26.382 13.263  19.719  1.00 19.37  ?  715  LEU C CD1   1 
ATOM   8807  C  CD2   . LEU C 2 715  ? -24.969 15.302  20.006  1.00 10.77  ?  715  LEU C CD2   1 
ATOM   8808  N  N     . GLY C 2 716  ? -26.009 16.386  14.684  1.00 18.32  ?  716  GLY C N     1 
ATOM   8809  C  CA    . GLY C 2 716  ? -25.516 16.266  13.332  1.00 16.74  ?  716  GLY C CA    1 
ATOM   8810  C  C     . GLY C 2 716  ? -26.304 17.099  12.348  1.00 19.86  ?  716  GLY C C     1 
ATOM   8811  O  O     . GLY C 2 716  ? -26.947 18.085  12.712  1.00 23.22  ?  716  GLY C O     1 
ATOM   8812  N  N     . LYS C 2 717  ? -26.247 16.685  11.082  1.00 15.47  ?  717  LYS C N     1 
ATOM   8813  C  CA    . LYS C 2 717  ? -26.901 17.388  9.990   1.00 22.82  ?  717  LYS C CA    1 
ATOM   8814  C  C     . LYS C 2 717  ? -27.712 16.411  9.151   1.00 22.55  ?  717  LYS C C     1 
ATOM   8815  O  O     . LYS C 2 717  ? -27.396 15.220  9.076   1.00 18.10  ?  717  LYS C O     1 
ATOM   8816  C  CB    . LYS C 2 717  ? -25.885 18.104  9.091   1.00 16.95  ?  717  LYS C CB    1 
ATOM   8817  C  CG    . LYS C 2 717  ? -25.078 19.179  9.786   1.00 15.60  ?  717  LYS C CG    1 
ATOM   8818  C  CD    . LYS C 2 717  ? -25.986 20.237  10.378  1.00 19.10  ?  717  LYS C CD    1 
ATOM   8819  C  CE    . LYS C 2 717  ? -25.232 21.526  10.633  1.00 21.07  ?  717  LYS C CE    1 
ATOM   8820  N  NZ    . LYS C 2 717  ? -24.716 22.126  9.373   1.00 28.14  ?  717  LYS C NZ    1 
ATOM   8821  N  N     . ASN C 2 718  ? -28.760 16.930  8.516   1.00 20.33  ?  718  ASN C N     1 
ATOM   8822  C  CA    . ASN C 2 718  ? -29.572 16.144  7.593   1.00 9.77   ?  718  ASN C CA    1 
ATOM   8823  C  C     . ASN C 2 718  ? -28.903 16.166  6.223   1.00 12.65  ?  718  ASN C C     1 
ATOM   8824  O  O     . ASN C 2 718  ? -28.820 17.218  5.582   1.00 19.64  ?  718  ASN C O     1 
ATOM   8825  C  CB    . ASN C 2 718  ? -30.992 16.699  7.526   1.00 7.56   ?  718  ASN C CB    1 
ATOM   8826  C  CG    . ASN C 2 718  ? -31.678 16.716  8.881   1.00 14.54  ?  718  ASN C CG    1 
ATOM   8827  O  OD1   . ASN C 2 718  ? -32.401 15.785  9.235   1.00 14.57  ?  718  ASN C OD1   1 
ATOM   8828  N  ND2   . ASN C 2 718  ? -31.455 17.780  9.645   1.00 13.96  ?  718  ASN C ND2   1 
ATOM   8829  N  N     . LEU C 2 719  ? -28.420 15.011  5.775   1.00 15.57  ?  719  LEU C N     1 
ATOM   8830  C  CA    . LEU C 2 719  ? -27.660 14.899  4.538   1.00 12.30  ?  719  LEU C CA    1 
ATOM   8831  C  C     . LEU C 2 719  ? -28.428 14.078  3.512   1.00 10.10  ?  719  LEU C C     1 
ATOM   8832  O  O     . LEU C 2 719  ? -29.037 13.059  3.849   1.00 10.70  ?  719  LEU C O     1 
ATOM   8833  C  CB    . LEU C 2 719  ? -26.292 14.257  4.791   1.00 14.32  ?  719  LEU C CB    1 
ATOM   8834  C  CG    . LEU C 2 719  ? -25.093 15.182  5.007   1.00 11.82  ?  719  LEU C CG    1 
ATOM   8835  C  CD1   . LEU C 2 719  ? -25.401 16.255  6.034   1.00 8.87   ?  719  LEU C CD1   1 
ATOM   8836  C  CD2   . LEU C 2 719  ? -23.880 14.370  5.432   1.00 12.30  ?  719  LEU C CD2   1 
ATOM   8837  N  N     . LEU C 2 720  ? -28.390 14.526  2.259   1.00 14.84  ?  720  LEU C N     1 
ATOM   8838  C  CA    . LEU C 2 720  ? -29.001 13.795  1.154   1.00 18.16  ?  720  LEU C CA    1 
ATOM   8839  C  C     . LEU C 2 720  ? -28.103 12.616  0.799   1.00 19.84  ?  720  LEU C C     1 
ATOM   8840  O  O     . LEU C 2 720  ? -26.999 12.802  0.277   1.00 22.90  ?  720  LEU C O     1 
ATOM   8841  C  CB    . LEU C 2 720  ? -29.211 14.715  -0.045  1.00 16.76  ?  720  LEU C CB    1 
ATOM   8842  C  CG    . LEU C 2 720  ? -29.883 14.106  -1.277  1.00 15.34  ?  720  LEU C CG    1 
ATOM   8843  C  CD1   . LEU C 2 720  ? -31.239 13.526  -0.917  1.00 14.31  ?  720  LEU C CD1   1 
ATOM   8844  C  CD2   . LEU C 2 720  ? -30.020 15.143  -2.382  1.00 16.05  ?  720  LEU C CD2   1 
ATOM   8845  N  N     . VAL C 2 721  ? -28.572 11.403  1.077   1.00 13.11  ?  721  VAL C N     1 
ATOM   8846  C  CA    . VAL C 2 721  ? -27.761 10.197  0.974   1.00 14.42  ?  721  VAL C CA    1 
ATOM   8847  C  C     . VAL C 2 721  ? -28.255 9.350   -0.192  1.00 22.00  ?  721  VAL C C     1 
ATOM   8848  O  O     . VAL C 2 721  ? -29.461 9.278   -0.458  1.00 26.64  ?  721  VAL C O     1 
ATOM   8849  C  CB    . VAL C 2 721  ? -27.787 9.398   2.294   1.00 15.51  ?  721  VAL C CB    1 
ATOM   8850  C  CG1   . VAL C 2 721  ? -29.214 9.028   2.673   1.00 18.97  ?  721  VAL C CG1   1 
ATOM   8851  C  CG2   . VAL C 2 721  ? -26.911 8.157   2.196   1.00 14.13  ?  721  VAL C CG2   1 
ATOM   8852  N  N     . ALA C 2 722  ? -27.315 8.725   -0.897  1.00 20.71  ?  722  ALA C N     1 
ATOM   8853  C  CA    . ALA C 2 722  ? -27.610 7.743   -1.930  1.00 17.63  ?  722  ALA C CA    1 
ATOM   8854  C  C     . ALA C 2 722  ? -26.918 6.438   -1.568  1.00 18.33  ?  722  ALA C C     1 
ATOM   8855  O  O     . ALA C 2 722  ? -25.720 6.430   -1.267  1.00 18.72  ?  722  ALA C O     1 
ATOM   8856  C  CB    . ALA C 2 722  ? -27.153 8.230   -3.308  1.00 12.65  ?  722  ALA C CB    1 
ATOM   8857  N  N     . ILE C 2 723  ? -27.668 5.341   -1.594  1.00 13.97  ?  723  ILE C N     1 
ATOM   8858  C  CA    . ILE C 2 723  ? -27.161 4.035   -1.176  1.00 18.13  ?  723  ILE C CA    1 
ATOM   8859  C  C     . ILE C 2 723  ? -26.723 3.305   -2.443  1.00 19.66  ?  723  ILE C C     1 
ATOM   8860  O  O     . ILE C 2 723  ? -27.513 2.633   -3.105  1.00 21.77  ?  723  ILE C O     1 
ATOM   8861  C  CB    . ILE C 2 723  ? -28.203 3.247   -0.386  1.00 17.59  ?  723  ILE C CB    1 
ATOM   8862  C  CG1   . ILE C 2 723  ? -28.802 4.114   0.723   1.00 17.31  ?  723  ILE C CG1   1 
ATOM   8863  C  CG2   . ILE C 2 723  ? -27.583 1.990   0.202   1.00 17.20  ?  723  ILE C CG2   1 
ATOM   8864  C  CD1   . ILE C 2 723  ? -27.789 4.576   1.748   1.00 18.62  ?  723  ILE C CD1   1 
ATOM   8865  N  N     . MET C 2 724  ? -25.437 3.427   -2.780  1.00 17.34  ?  724  MET C N     1 
ATOM   8866  C  CA    . MET C 2 724  ? -24.898 2.790   -3.976  1.00 16.51  ?  724  MET C CA    1 
ATOM   8867  C  C     . MET C 2 724  ? -23.376 2.762   -3.927  1.00 17.92  ?  724  MET C C     1 
ATOM   8868  O  O     . MET C 2 724  ? -22.753 3.708   -3.426  1.00 25.91  ?  724  MET C O     1 
ATOM   8869  C  CB    . MET C 2 724  ? -25.352 3.526   -5.239  1.00 15.36  ?  724  MET C CB    1 
ATOM   8870  C  CG    . MET C 2 724  ? -25.123 5.030   -5.187  1.00 7.31   ?  724  MET C CG    1 
ATOM   8871  S  SD    . MET C 2 724  ? -25.390 5.835   -6.775  1.00 28.94  ?  724  MET C SD    1 
ATOM   8872  C  CE    . MET C 2 724  ? -24.007 5.191   -7.714  1.00 14.81  ?  724  MET C CE    1 
ATOM   8873  N  N     . PRO C 2 725  ? -22.743 1.701   -4.427  1.00 15.57  ?  725  PRO C N     1 
ATOM   8874  C  CA    . PRO C 2 725  ? -21.291 1.739   -4.618  1.00 17.20  ?  725  PRO C CA    1 
ATOM   8875  C  C     . PRO C 2 725  ? -20.932 2.760   -5.684  1.00 13.57  ?  725  PRO C C     1 
ATOM   8876  O  O     . PRO C 2 725  ? -21.670 2.965   -6.650  1.00 23.72  ?  725  PRO C O     1 
ATOM   8877  C  CB    . PRO C 2 725  ? -20.948 0.313   -5.072  1.00 19.79  ?  725  PRO C CB    1 
ATOM   8878  C  CG    . PRO C 2 725  ? -22.141 -0.520  -4.684  1.00 21.76  ?  725  PRO C CG    1 
ATOM   8879  C  CD    . PRO C 2 725  ? -23.315 0.400   -4.802  1.00 16.45  ?  725  PRO C CD    1 
ATOM   8880  N  N     . TRP C 2 726  ? -19.790 3.420   -5.496  1.00 14.77  ?  726  TRP C N     1 
ATOM   8881  C  CA    . TRP C 2 726  ? -19.380 4.501   -6.397  1.00 16.23  ?  726  TRP C CA    1 
ATOM   8882  C  C     . TRP C 2 726  ? -17.876 4.397   -6.638  1.00 18.52  ?  726  TRP C C     1 
ATOM   8883  O  O     . TRP C 2 726  ? -17.075 4.923   -5.861  1.00 21.40  ?  726  TRP C O     1 
ATOM   8884  C  CB    . TRP C 2 726  ? -19.767 5.862   -5.836  1.00 15.89  ?  726  TRP C CB    1 
ATOM   8885  C  CG    . TRP C 2 726  ? -19.817 6.927   -6.882  1.00 16.04  ?  726  TRP C CG    1 
ATOM   8886  C  CD1   . TRP C 2 726  ? -20.914 7.336   -7.580  1.00 14.27  ?  726  TRP C CD1   1 
ATOM   8887  C  CD2   . TRP C 2 726  ? -18.719 7.709   -7.367  1.00 15.26  ?  726  TRP C CD2   1 
ATOM   8888  N  NE1   . TRP C 2 726  ? -20.570 8.328   -8.465  1.00 23.11  ?  726  TRP C NE1   1 
ATOM   8889  C  CE2   . TRP C 2 726  ? -19.227 8.576   -8.353  1.00 20.57  ?  726  TRP C CE2   1 
ATOM   8890  C  CE3   . TRP C 2 726  ? -17.356 7.763   -7.059  1.00 12.63  ?  726  TRP C CE3   1 
ATOM   8891  C  CZ2   . TRP C 2 726  ? -18.423 9.485   -9.034  1.00 22.32  ?  726  TRP C CZ2   1 
ATOM   8892  C  CZ3   . TRP C 2 726  ? -16.558 8.665   -7.738  1.00 15.59  ?  726  TRP C CZ3   1 
ATOM   8893  C  CH2   . TRP C 2 726  ? -17.094 9.514   -8.714  1.00 19.62  ?  726  TRP C CH2   1 
ATOM   8894  N  N     . GLU C 2 727  ? -17.508 3.711   -7.721  1.00 20.23  ?  727  GLU C N     1 
ATOM   8895  C  CA    . GLU C 2 727  ? -16.132 3.630   -8.211  1.00 18.25  ?  727  GLU C CA    1 
ATOM   8896  C  C     . GLU C 2 727  ? -15.141 3.175   -7.144  1.00 16.36  ?  727  GLU C C     1 
ATOM   8897  O  O     . GLU C 2 727  ? -13.953 3.493   -7.227  1.00 16.86  ?  727  GLU C O     1 
ATOM   8898  C  CB    . GLU C 2 727  ? -15.682 4.971   -8.796  1.00 15.56  ?  727  GLU C CB    1 
ATOM   8899  C  CG    . GLU C 2 727  ? -16.676 5.579   -9.776  1.00 26.13  ?  727  GLU C CG    1 
ATOM   8900  C  CD    . GLU C 2 727  ? -16.564 4.997   -11.168 1.00 43.41  ?  727  GLU C CD    1 
ATOM   8901  O  OE1   . GLU C 2 727  ? -16.236 5.758   -12.099 1.00 52.63  ?  727  GLU C OE1   1 
ATOM   8902  O  OE2   . GLU C 2 727  ? -16.797 3.782   -11.333 1.00 33.40  ?  727  GLU C OE2   1 
ATOM   8903  N  N     . GLY C 2 728  ? -15.604 2.445   -6.132  1.00 18.82  ?  728  GLY C N     1 
ATOM   8904  C  CA    . GLY C 2 728  ? -14.718 1.921   -5.117  1.00 15.65  ?  728  GLY C CA    1 
ATOM   8905  C  C     . GLY C 2 728  ? -14.284 2.900   -4.050  1.00 21.10  ?  728  GLY C C     1 
ATOM   8906  O  O     . GLY C 2 728  ? -13.622 2.485   -3.092  1.00 20.57  ?  728  GLY C O     1 
ATOM   8907  N  N     . HIS C 2 729  ? -14.623 4.185   -4.177  1.00 19.68  ?  729  HIS C N     1 
ATOM   8908  C  CA    . HIS C 2 729  ? -14.222 5.157   -3.165  1.00 18.07  ?  729  HIS C CA    1 
ATOM   8909  C  C     . HIS C 2 729  ? -14.951 4.970   -1.841  1.00 17.25  ?  729  HIS C C     1 
ATOM   8910  O  O     . HIS C 2 729  ? -14.511 5.526   -0.829  1.00 20.01  ?  729  HIS C O     1 
ATOM   8911  C  CB    . HIS C 2 729  ? -14.433 6.583   -3.681  1.00 14.62  ?  729  HIS C CB    1 
ATOM   8912  C  CG    . HIS C 2 729  ? -13.365 7.048   -4.620  1.00 21.10  ?  729  HIS C CG    1 
ATOM   8913  N  ND1   . HIS C 2 729  ? -13.558 7.148   -5.981  1.00 24.76  ?  729  HIS C ND1   1 
ATOM   8914  C  CD2   . HIS C 2 729  ? -12.087 7.434   -4.393  1.00 23.87  ?  729  HIS C CD2   1 
ATOM   8915  C  CE1   . HIS C 2 729  ? -12.447 7.580   -6.551  1.00 27.13  ?  729  HIS C CE1   1 
ATOM   8916  N  NE2   . HIS C 2 729  ? -11.539 7.761   -5.609  1.00 33.56  ?  729  HIS C NE2   1 
ATOM   8917  N  N     . ASN C 2 730  ? -16.045 4.209   -1.821  1.00 20.35  ?  730  ASN C N     1 
ATOM   8918  C  CA    . ASN C 2 730  ? -16.692 3.835   -0.569  1.00 17.33  ?  730  ASN C CA    1 
ATOM   8919  C  C     . ASN C 2 730  ? -16.595 2.328   -0.367  1.00 22.34  ?  730  ASN C C     1 
ATOM   8920  O  O     . ASN C 2 730  ? -17.613 1.641   -0.237  1.00 32.64  ?  730  ASN C O     1 
ATOM   8921  C  CB    . ASN C 2 730  ? -18.152 4.299   -0.546  1.00 19.79  ?  730  ASN C CB    1 
ATOM   8922  C  CG    . ASN C 2 730  ? -18.917 3.896   -1.792  1.00 22.56  ?  730  ASN C CG    1 
ATOM   8923  O  OD1   . ASN C 2 730  ? -18.431 3.117   -2.611  1.00 26.58  ?  730  ASN C OD1   1 
ATOM   8924  N  ND2   . ASN C 2 730  ? -20.126 4.426   -1.937  1.00 19.30  ?  730  ASN C ND2   1 
ATOM   8925  N  N     . TYR C 2 731  ? -15.370 1.809   -0.340  1.00 19.09  ?  731  TYR C N     1 
ATOM   8926  C  CA    . TYR C 2 731  ? -15.124 0.374   -0.264  1.00 27.84  ?  731  TYR C CA    1 
ATOM   8927  C  C     . TYR C 2 731  ? -15.075 -0.061  1.198   1.00 24.90  ?  731  TYR C C     1 
ATOM   8928  O  O     . TYR C 2 731  ? -14.232 0.419   1.963   1.00 23.34  ?  731  TYR C O     1 
ATOM   8929  C  CB    . TYR C 2 731  ? -13.824 0.028   -0.988  1.00 21.02  ?  731  TYR C CB    1 
ATOM   8930  C  CG    . TYR C 2 731  ? -13.407 -1.418  -0.886  1.00 30.65  ?  731  TYR C CG    1 
ATOM   8931  C  CD1   . TYR C 2 731  ? -14.223 -2.434  -1.362  1.00 28.16  ?  731  TYR C CD1   1 
ATOM   8932  C  CD2   . TYR C 2 731  ? -12.182 -1.766  -0.334  1.00 32.58  ?  731  TYR C CD2   1 
ATOM   8933  C  CE1   . TYR C 2 731  ? -13.836 -3.757  -1.276  1.00 30.76  ?  731  TYR C CE1   1 
ATOM   8934  C  CE2   . TYR C 2 731  ? -11.787 -3.084  -0.244  1.00 26.96  ?  731  TYR C CE2   1 
ATOM   8935  C  CZ    . TYR C 2 731  ? -12.618 -4.076  -0.716  1.00 31.02  ?  731  TYR C CZ    1 
ATOM   8936  O  OH    . TYR C 2 731  ? -12.227 -5.392  -0.628  1.00 41.79  ?  731  TYR C OH    1 
ATOM   8937  N  N     . GLU C 2 732  ? -15.960 -0.996  1.561   1.00 28.92  ?  732  GLU C N     1 
ATOM   8938  C  CA    . GLU C 2 732  ? -16.248 -1.423  2.931   1.00 39.45  ?  732  GLU C CA    1 
ATOM   8939  C  C     . GLU C 2 732  ? -16.118 -0.304  3.960   1.00 29.70  ?  732  GLU C C     1 
ATOM   8940  O  O     . GLU C 2 732  ? -15.027 -0.032  4.473   1.00 28.48  ?  732  GLU C O     1 
ATOM   8941  C  CB    . GLU C 2 732  ? -15.379 -2.623  3.340   1.00 35.80  ?  732  GLU C CB    1 
ATOM   8942  C  CG    . GLU C 2 732  ? -13.878 -2.516  3.121   1.00 24.86  ?  732  GLU C CG    1 
ATOM   8943  C  CD    . GLU C 2 732  ? -13.130 -3.676  3.755   1.00 44.81  ?  732  GLU C CD    1 
ATOM   8944  O  OE1   . GLU C 2 732  ? -13.785 -4.523  4.400   1.00 49.27  ?  732  GLU C OE1   1 
ATOM   8945  O  OE2   . GLU C 2 732  ? -11.892 -3.741  3.611   1.00 55.20  ?  732  GLU C OE2   1 
ATOM   8946  N  N     . ASP C 2 733  ? -17.243 0.343   4.263   1.00 26.84  ?  733  ASP C N     1 
ATOM   8947  C  CA    . ASP C 2 733  ? -17.416 1.340   5.316   1.00 23.36  ?  733  ASP C CA    1 
ATOM   8948  C  C     . ASP C 2 733  ? -16.759 2.678   5.001   1.00 18.54  ?  733  ASP C C     1 
ATOM   8949  O  O     . ASP C 2 733  ? -16.798 3.577   5.846   1.00 19.24  ?  733  ASP C O     1 
ATOM   8950  C  CB    . ASP C 2 733  ? -16.907 0.846   6.678   1.00 23.48  ?  733  ASP C CB    1 
ATOM   8951  C  CG    . ASP C 2 733  ? -17.504 -0.490  7.069   1.00 35.14  ?  733  ASP C CG    1 
ATOM   8952  O  OD1   . ASP C 2 733  ? -18.630 -0.792  6.619   1.00 31.90  ?  733  ASP C OD1   1 
ATOM   8953  O  OD2   . ASP C 2 733  ? -16.849 -1.240  7.824   1.00 36.99  ?  733  ASP C OD2   1 
ATOM   8954  N  N     . ALA C 2 734  ? -16.158 2.847   3.828   1.00 25.37  ?  734  ALA C N     1 
ATOM   8955  C  CA    . ALA C 2 734  ? -15.676 4.166   3.454   1.00 13.68  ?  734  ALA C CA    1 
ATOM   8956  C  C     . ALA C 2 734  ? -16.849 5.045   3.028   1.00 16.83  ?  734  ALA C C     1 
ATOM   8957  O  O     . ALA C 2 734  ? -17.919 4.559   2.655   1.00 25.59  ?  734  ALA C O     1 
ATOM   8958  C  CB    . ALA C 2 734  ? -14.640 4.068   2.336   1.00 14.23  ?  734  ALA C CB    1 
ATOM   8959  N  N     . ILE C 2 735  ? -16.641 6.359   3.096   1.00 8.93   ?  735  ILE C N     1 
ATOM   8960  C  CA    . ILE C 2 735  ? -17.703 7.331   2.867   1.00 12.03  ?  735  ILE C CA    1 
ATOM   8961  C  C     . ILE C 2 735  ? -17.238 8.367   1.854   1.00 14.59  ?  735  ILE C C     1 
ATOM   8962  O  O     . ILE C 2 735  ? -16.116 8.877   1.940   1.00 15.73  ?  735  ILE C O     1 
ATOM   8963  C  CB    . ILE C 2 735  ? -18.135 8.012   4.183   1.00 10.18  ?  735  ILE C CB    1 
ATOM   8964  C  CG1   . ILE C 2 735  ? -18.760 6.985   5.129   1.00 16.36  ?  735  ILE C CG1   1 
ATOM   8965  C  CG2   . ILE C 2 735  ? -19.100 9.151   3.906   1.00 10.67  ?  735  ILE C CG2   1 
ATOM   8966  C  CD1   . ILE C 2 735  ? -19.303 7.579   6.407   1.00 19.43  ?  735  ILE C CD1   1 
ATOM   8967  N  N     . ILE C 2 736  ? -18.109 8.678   0.896   1.00 13.07  ?  736  ILE C N     1 
ATOM   8968  C  CA    . ILE C 2 736  ? -17.870 9.709   -0.107  1.00 13.51  ?  736  ILE C CA    1 
ATOM   8969  C  C     . ILE C 2 736  ? -18.742 10.909  0.226   1.00 14.78  ?  736  ILE C C     1 
ATOM   8970  O  O     . ILE C 2 736  ? -19.926 10.755  0.548   1.00 11.15  ?  736  ILE C O     1 
ATOM   8971  C  CB    . ILE C 2 736  ? -18.174 9.191   -1.526  1.00 17.37  ?  736  ILE C CB    1 
ATOM   8972  C  CG1   . ILE C 2 736  ? -17.450 7.868   -1.779  1.00 17.32  ?  736  ILE C CG1   1 
ATOM   8973  C  CG2   . ILE C 2 736  ? -17.779 10.225  -2.563  1.00 16.48  ?  736  ILE C CG2   1 
ATOM   8974  C  CD1   . ILE C 2 736  ? -17.892 7.170   -3.040  1.00 15.68  ?  736  ILE C CD1   1 
ATOM   8975  N  N     . LEU C 2 737  ? -18.162 12.105  0.143   1.00 16.38  ?  737  LEU C N     1 
ATOM   8976  C  CA    . LEU C 2 737  ? -18.861 13.337  0.483   1.00 15.25  ?  737  LEU C CA    1 
ATOM   8977  C  C     . LEU C 2 737  ? -18.872 14.296  -0.697  1.00 11.27  ?  737  LEU C C     1 
ATOM   8978  O  O     . LEU C 2 737  ? -17.900 14.381  -1.455  1.00 11.86  ?  737  LEU C O     1 
ATOM   8979  C  CB    . LEU C 2 737  ? -18.218 14.034  1.685   1.00 12.48  ?  737  LEU C CB    1 
ATOM   8980  C  CG    . LEU C 2 737  ? -18.474 13.443  3.069   1.00 9.27   ?  737  LEU C CG    1 
ATOM   8981  C  CD1   . LEU C 2 737  ? -18.100 14.453  4.140   1.00 10.52  ?  737  LEU C CD1   1 
ATOM   8982  C  CD2   . LEU C 2 737  ? -19.924 13.007  3.217   1.00 20.55  ?  737  LEU C CD2   1 
ATOM   8983  N  N     . SER C 2 738  ? -19.980 15.016  -0.843  1.00 7.24   ?  738  SER C N     1 
ATOM   8984  C  CA    . SER C 2 738  ? -20.023 16.146  -1.759  1.00 11.22  ?  738  SER C CA    1 
ATOM   8985  C  C     . SER C 2 738  ? -19.272 17.327  -1.155  1.00 16.89  ?  738  SER C C     1 
ATOM   8986  O  O     . SER C 2 738  ? -19.320 17.561  0.055   1.00 18.79  ?  738  SER C O     1 
ATOM   8987  C  CB    . SER C 2 738  ? -21.469 16.537  -2.062  1.00 15.69  ?  738  SER C CB    1 
ATOM   8988  O  OG    . SER C 2 738  ? -21.534 17.800  -2.703  1.00 17.92  ?  738  SER C OG    1 
ATOM   8989  N  N     . ASN C 2 739  ? -18.576 18.081  -2.010  1.00 12.82  ?  739  ASN C N     1 
ATOM   8990  C  CA    . ASN C 2 739  ? -17.731 19.176  -1.547  1.00 10.29  ?  739  ASN C CA    1 
ATOM   8991  C  C     . ASN C 2 739  ? -18.606 20.324  -1.055  1.00 13.01  ?  739  ASN C C     1 
ATOM   8992  O  O     . ASN C 2 739  ? -18.102 21.325  -0.530  1.00 14.23  ?  739  ASN C O     1 
ATOM   8993  C  CB    . ASN C 2 739  ? -16.787 19.643  -2.655  1.00 16.62  ?  739  ASN C CB    1 
ATOM   8994  C  CG    . ASN C 2 739  ? -15.620 20.447  -2.121  1.00 19.59  ?  739  ASN C CG    1 
ATOM   8995  O  OD1   . ASN C 2 739  ? -15.680 21.673  -2.048  1.00 21.68  ?  739  ASN C OD1   1 
ATOM   8996  N  ND2   . ASN C 2 739  ? -14.556 19.755  -1.726  1.00 23.30  ?  739  ASN C ND2   1 
ATOM   8997  N  N     . ARG C 2 740  ? -19.926 20.182  -1.224  1.00 15.24  ?  740  ARG C N     1 
ATOM   8998  C  CA    . ARG C 2 740  ? -20.853 21.165  -0.679  1.00 16.57  ?  740  ARG C CA    1 
ATOM   8999  C  C     . ARG C 2 740  ? -20.729 21.261  0.836   1.00 23.39  ?  740  ARG C C     1 
ATOM   9000  O  O     . ARG C 2 740  ? -20.835 22.353  1.405   1.00 28.98  ?  740  ARG C O     1 
ATOM   9001  C  CB    . ARG C 2 740  ? -22.281 20.806  -1.071  1.00 17.54  ?  740  ARG C CB    1 
ATOM   9002  C  CG    . ARG C 2 740  ? -23.287 21.874  -0.677  1.00 14.56  ?  740  ARG C CG    1 
ATOM   9003  C  CD    . ARG C 2 740  ? -24.709 21.346  -0.700  1.00 22.83  ?  740  ARG C CD    1 
ATOM   9004  N  NE    . ARG C 2 740  ? -24.976 20.421  0.399   1.00 20.18  ?  740  ARG C NE    1 
ATOM   9005  C  CZ    . ARG C 2 740  ? -25.463 20.782  1.583   1.00 24.04  ?  740  ARG C CZ    1 
ATOM   9006  N  NH1   . ARG C 2 740  ? -25.735 22.056  1.835   1.00 33.12  ?  740  ARG C NH1   1 
ATOM   9007  N  NH2   . ARG C 2 740  ? -25.678 19.868  2.519   1.00 20.65  ?  740  ARG C NH2   1 
ATOM   9008  N  N     . LEU C 2 741  ? -20.520 20.125  1.507   1.00 11.85  ?  741  LEU C N     1 
ATOM   9009  C  CA    . LEU C 2 741  ? -20.350 20.136  2.955   1.00 9.27   ?  741  LEU C CA    1 
ATOM   9010  C  C     . LEU C 2 741  ? -19.106 20.906  3.373   1.00 16.17  ?  741  LEU C C     1 
ATOM   9011  O  O     . LEU C 2 741  ? -19.040 21.395  4.506   1.00 20.37  ?  741  LEU C O     1 
ATOM   9012  C  CB    . LEU C 2 741  ? -20.286 18.703  3.486   1.00 15.97  ?  741  LEU C CB    1 
ATOM   9013  C  CG    . LEU C 2 741  ? -21.424 17.776  3.054   1.00 15.76  ?  741  LEU C CG    1 
ATOM   9014  C  CD1   . LEU C 2 741  ? -21.270 16.405  3.690   1.00 14.15  ?  741  LEU C CD1   1 
ATOM   9015  C  CD2   . LEU C 2 741  ? -22.775 18.384  3.397   1.00 18.38  ?  741  LEU C CD2   1 
ATOM   9016  N  N     . VAL C 2 742  ? -18.119 21.022  2.484   1.00 20.51  ?  742  VAL C N     1 
ATOM   9017  C  CA    . VAL C 2 742  ? -16.943 21.837  2.770   1.00 13.97  ?  742  VAL C CA    1 
ATOM   9018  C  C     . VAL C 2 742  ? -17.216 23.299  2.446   1.00 17.39  ?  742  VAL C C     1 
ATOM   9019  O  O     . VAL C 2 742  ? -16.906 24.195  3.240   1.00 19.08  ?  742  VAL C O     1 
ATOM   9020  C  CB    . VAL C 2 742  ? -15.720 21.312  1.993   1.00 9.02   ?  742  VAL C CB    1 
ATOM   9021  C  CG1   . VAL C 2 742  ? -14.527 22.244  2.178   1.00 8.61   ?  742  VAL C CG1   1 
ATOM   9022  C  CG2   . VAL C 2 742  ? -15.371 19.901  2.434   1.00 11.04  ?  742  VAL C CG2   1 
ATOM   9023  N  N     . GLU C 2 743  ? -17.810 23.559  1.279   1.00 17.59  ?  743  GLU C N     1 
ATOM   9024  C  CA    . GLU C 2 743  ? -18.025 24.935  0.842   1.00 19.91  ?  743  GLU C CA    1 
ATOM   9025  C  C     . GLU C 2 743  ? -19.026 25.666  1.726   1.00 20.07  ?  743  GLU C C     1 
ATOM   9026  O  O     . GLU C 2 743  ? -18.941 26.891  1.871   1.00 28.86  ?  743  GLU C O     1 
ATOM   9027  C  CB    . GLU C 2 743  ? -18.501 24.960  -0.612  1.00 25.81  ?  743  GLU C CB    1 
ATOM   9028  C  CG    . GLU C 2 743  ? -17.534 24.340  -1.607  1.00 27.70  ?  743  GLU C CG    1 
ATOM   9029  C  CD    . GLU C 2 743  ? -18.064 24.371  -3.028  1.00 40.15  ?  743  GLU C CD    1 
ATOM   9030  O  OE1   . GLU C 2 743  ? -19.100 25.027  -3.263  1.00 43.64  ?  743  GLU C OE1   1 
ATOM   9031  O  OE2   . GLU C 2 743  ? -17.446 23.738  -3.910  1.00 26.47  ?  743  GLU C OE2   1 
ATOM   9032  N  N     . GLU C 2 744  ? -19.973 24.944  2.323   1.00 10.03  ?  744  GLU C N     1 
ATOM   9033  C  CA    . GLU C 2 744  ? -21.050 25.561  3.085   1.00 20.39  ?  744  GLU C CA    1 
ATOM   9034  C  C     . GLU C 2 744  ? -20.932 25.316  4.584   1.00 24.00  ?  744  GLU C C     1 
ATOM   9035  O  O     . GLU C 2 744  ? -21.887 25.587  5.320   1.00 24.63  ?  744  GLU C O     1 
ATOM   9036  C  CB    . GLU C 2 744  ? -22.403 25.070  2.567   1.00 25.29  ?  744  GLU C CB    1 
ATOM   9037  C  CG    . GLU C 2 744  ? -22.664 25.436  1.110   1.00 36.88  ?  744  GLU C CG    1 
ATOM   9038  C  CD    . GLU C 2 744  ? -24.024 24.979  0.620   1.00 40.32  ?  744  GLU C CD    1 
ATOM   9039  O  OE1   . GLU C 2 744  ? -24.684 24.195  1.334   1.00 37.58  ?  744  GLU C OE1   1 
ATOM   9040  O  OE2   . GLU C 2 744  ? -24.434 25.404  -0.481  1.00 38.67  ?  744  GLU C OE2   1 
ATOM   9041  N  N     . ASP C 2 745  ? -19.785 24.815  5.051   1.00 16.20  ?  745  ASP C N     1 
ATOM   9042  C  CA    . ASP C 2 745  ? -19.511 24.652  6.481   1.00 14.61  ?  745  ASP C CA    1 
ATOM   9043  C  C     . ASP C 2 745  ? -20.591 23.823  7.172   1.00 14.00  ?  745  ASP C C     1 
ATOM   9044  O  O     . ASP C 2 745  ? -20.984 24.097  8.308   1.00 25.62  ?  745  ASP C O     1 
ATOM   9045  C  CB    . ASP C 2 745  ? -19.347 26.010  7.166   1.00 22.68  ?  745  ASP C CB    1 
ATOM   9046  C  CG    . ASP C 2 745  ? -18.055 26.705  6.784   1.00 39.44  ?  745  ASP C CG    1 
ATOM   9047  O  OD1   . ASP C 2 745  ? -17.055 26.003  6.528   1.00 33.43  ?  745  ASP C OD1   1 
ATOM   9048  O  OD2   . ASP C 2 745  ? -18.039 27.954  6.742   1.00 52.62  ?  745  ASP C OD2   1 
ATOM   9049  N  N     . VAL C 2 746  ? -21.078 22.795  6.476   1.00 18.34  ?  746  VAL C N     1 
ATOM   9050  C  CA    . VAL C 2 746  ? -22.115 21.942  7.047   1.00 19.62  ?  746  VAL C CA    1 
ATOM   9051  C  C     . VAL C 2 746  ? -21.531 21.063  8.146   1.00 21.53  ?  746  VAL C C     1 
ATOM   9052  O  O     . VAL C 2 746  ? -22.101 20.940  9.236   1.00 21.12  ?  746  VAL C O     1 
ATOM   9053  C  CB    . VAL C 2 746  ? -22.786 21.101  5.947   1.00 21.25  ?  746  VAL C CB    1 
ATOM   9054  C  CG1   . VAL C 2 746  ? -24.014 20.396  6.496   1.00 21.07  ?  746  VAL C CG1   1 
ATOM   9055  C  CG2   . VAL C 2 746  ? -23.151 21.977  4.760   1.00 22.88  ?  746  VAL C CG2   1 
ATOM   9056  N  N     . LEU C 2 747  ? -20.383 20.442  7.877   1.00 17.09  ?  747  LEU C N     1 
ATOM   9057  C  CA    . LEU C 2 747  ? -19.690 19.611  8.853   1.00 16.94  ?  747  LEU C CA    1 
ATOM   9058  C  C     . LEU C 2 747  ? -18.443 20.300  9.400   1.00 26.12  ?  747  LEU C C     1 
ATOM   9059  O  O     . LEU C 2 747  ? -17.488 19.635  9.809   1.00 33.33  ?  747  LEU C O     1 
ATOM   9060  C  CB    . LEU C 2 747  ? -19.328 18.257  8.246   1.00 27.26  ?  747  LEU C CB    1 
ATOM   9061  C  CG    . LEU C 2 747  ? -20.509 17.411  7.766   1.00 18.69  ?  747  LEU C CG    1 
ATOM   9062  C  CD1   . LEU C 2 747  ? -20.031 16.042  7.322   1.00 8.67   ?  747  LEU C CD1   1 
ATOM   9063  C  CD2   . LEU C 2 747  ? -21.568 17.289  8.851   1.00 6.98   ?  747  LEU C CD2   1 
ATOM   9064  N  N     . THR C 2 748  ? -18.439 21.629  9.409   1.00 25.93  ?  748  THR C N     1 
ATOM   9065  C  CA    . THR C 2 748  ? -17.336 22.402  9.962   1.00 24.16  ?  748  THR C CA    1 
ATOM   9066  C  C     . THR C 2 748  ? -17.569 22.623  11.451  1.00 17.55  ?  748  THR C C     1 
ATOM   9067  O  O     . THR C 2 748  ? -18.681 22.965  11.867  1.00 17.71  ?  748  THR C O     1 
ATOM   9068  C  CB    . THR C 2 748  ? -17.201 23.743  9.238   1.00 21.26  ?  748  THR C CB    1 
ATOM   9069  O  OG1   . THR C 2 748  ? -16.846 23.512  7.869   1.00 28.93  ?  748  THR C OG1   1 
ATOM   9070  C  CG2   . THR C 2 748  ? -16.134 24.605  9.894   1.00 19.64  ?  748  THR C CG2   1 
ATOM   9071  N  N     . SER C 2 749  ? -16.524 22.419  12.248  1.00 19.86  ?  749  SER C N     1 
ATOM   9072  C  CA    . SER C 2 749  ? -16.613 22.549  13.693  1.00 22.44  ?  749  SER C CA    1 
ATOM   9073  C  C     . SER C 2 749  ? -15.440 23.365  14.214  1.00 21.08  ?  749  SER C C     1 
ATOM   9074  O  O     . SER C 2 749  ? -14.357 23.376  13.624  1.00 19.72  ?  749  SER C O     1 
ATOM   9075  C  CB    . SER C 2 749  ? -16.635 21.177  14.375  1.00 17.14  ?  749  SER C CB    1 
ATOM   9076  O  OG    . SER C 2 749  ? -15.453 20.448  14.093  1.00 8.80   ?  749  SER C OG    1 
ATOM   9077  N  N     . ILE C 2 750  ? -15.670 24.047  15.328  1.00 17.96  ?  750  ILE C N     1 
ATOM   9078  C  CA    . ILE C 2 750  ? -14.645 24.849  15.985  1.00 12.22  ?  750  ILE C CA    1 
ATOM   9079  C  C     . ILE C 2 750  ? -13.993 24.013  17.076  1.00 13.03  ?  750  ILE C C     1 
ATOM   9080  O  O     . ILE C 2 750  ? -14.666 23.251  17.781  1.00 16.29  ?  750  ILE C O     1 
ATOM   9081  C  CB    . ILE C 2 750  ? -15.249 26.144  16.559  1.00 11.36  ?  750  ILE C CB    1 
ATOM   9082  C  CG1   . ILE C 2 750  ? -16.062 26.875  15.489  1.00 18.72  ?  750  ILE C CG1   1 
ATOM   9083  C  CG2   . ILE C 2 750  ? -14.154 27.049  17.106  1.00 17.35  ?  750  ILE C CG2   1 
ATOM   9084  C  CD1   . ILE C 2 750  ? -16.717 28.143  15.985  1.00 22.78  ?  750  ILE C CD1   1 
ATOM   9085  N  N     . HIS C 2 751  ? -12.676 24.150  17.214  1.00 15.56  ?  751  HIS C N     1 
ATOM   9086  C  CA    . HIS C 2 751  ? -11.921 23.429  18.228  1.00 19.96  ?  751  HIS C CA    1 
ATOM   9087  C  C     . HIS C 2 751  ? -10.928 24.377  18.882  1.00 20.59  ?  751  HIS C C     1 
ATOM   9088  O  O     . HIS C 2 751  ? -10.257 25.153  18.197  1.00 27.82  ?  751  HIS C O     1 
ATOM   9089  C  CB    . HIS C 2 751  ? -11.194 22.223  17.626  1.00 21.86  ?  751  HIS C CB    1 
ATOM   9090  C  CG    . HIS C 2 751  ? -12.113 21.207  17.024  1.00 17.02  ?  751  HIS C CG    1 
ATOM   9091  N  ND1   . HIS C 2 751  ? -12.448 20.034  17.666  1.00 24.57  ?  751  HIS C ND1   1 
ATOM   9092  C  CD2   . HIS C 2 751  ? -12.775 21.192  15.844  1.00 16.02  ?  751  HIS C CD2   1 
ATOM   9093  C  CE1   . HIS C 2 751  ? -13.273 19.339  16.904  1.00 22.49  ?  751  HIS C CE1   1 
ATOM   9094  N  NE2   . HIS C 2 751  ? -13.487 20.019  15.793  1.00 18.08  ?  751  HIS C NE2   1 
ATOM   9095  N  N     . ILE C 2 752  ? -10.840 24.309  20.208  1.00 16.72  ?  752  ILE C N     1 
ATOM   9096  C  CA    . ILE C 2 752  ? -10.022 25.227  20.991  1.00 20.15  ?  752  ILE C CA    1 
ATOM   9097  C  C     . ILE C 2 752  ? -9.052  24.417  21.839  1.00 21.97  ?  752  ILE C C     1 
ATOM   9098  O  O     . ILE C 2 752  ? -9.468  23.525  22.587  1.00 26.89  ?  752  ILE C O     1 
ATOM   9099  C  CB    . ILE C 2 752  ? -10.882 26.140  21.886  1.00 14.41  ?  752  ILE C CB    1 
ATOM   9100  C  CG1   . ILE C 2 752  ? -11.904 26.904  21.041  1.00 10.95  ?  752  ILE C CG1   1 
ATOM   9101  C  CG2   . ILE C 2 752  ? -10.002 27.106  22.663  1.00 15.45  ?  752  ILE C CG2   1 
ATOM   9102  C  CD1   . ILE C 2 752  ? -12.846 27.765  21.851  1.00 18.37  ?  752  ILE C CD1   1 
ATOM   9103  N  N     . GLU C 2 753  ? -7.765  24.732  21.724  1.00 24.69  ?  753  GLU C N     1 
ATOM   9104  C  CA    . GLU C 2 753  ? -6.724  24.121  22.534  1.00 33.01  ?  753  GLU C CA    1 
ATOM   9105  C  C     . GLU C 2 753  ? -6.211  25.123  23.561  1.00 33.53  ?  753  GLU C C     1 
ATOM   9106  O  O     . GLU C 2 753  ? -6.258  26.338  23.345  1.00 34.81  ?  753  GLU C O     1 
ATOM   9107  C  CB    . GLU C 2 753  ? -5.563  23.627  21.663  1.00 46.01  ?  753  GLU C CB    1 
ATOM   9108  C  CG    . GLU C 2 753  ? -5.958  22.607  20.604  1.00 64.47  ?  753  GLU C CG    1 
ATOM   9109  C  CD    . GLU C 2 753  ? -6.406  21.282  21.196  1.00 77.45  ?  753  GLU C CD    1 
ATOM   9110  O  OE1   . GLU C 2 753  ? -6.010  20.972  22.340  1.00 74.94  ?  753  GLU C OE1   1 
ATOM   9111  O  OE2   . GLU C 2 753  ? -7.155  20.549  20.515  1.00 85.29  ?  753  GLU C OE2   1 
ATOM   9112  N  N     . GLU C 2 754  ? -5.722  24.605  24.683  1.00 39.79  ?  754  GLU C N     1 
ATOM   9113  C  CA    . GLU C 2 754  ? -5.176  25.424  25.758  1.00 33.19  ?  754  GLU C CA    1 
ATOM   9114  C  C     . GLU C 2 754  ? -3.680  25.167  25.866  1.00 27.49  ?  754  GLU C C     1 
ATOM   9115  O  O     . GLU C 2 754  ? -3.256  24.026  26.079  1.00 36.08  ?  754  GLU C O     1 
ATOM   9116  C  CB    . GLU C 2 754  ? -5.866  25.126  27.090  1.00 43.12  ?  754  GLU C CB    1 
ATOM   9117  C  CG    . GLU C 2 754  ? -5.379  25.999  28.235  1.00 46.12  ?  754  GLU C CG    1 
ATOM   9118  C  CD    . GLU C 2 754  ? -6.065  25.682  29.547  1.00 57.29  ?  754  GLU C CD    1 
ATOM   9119  O  OE1   . GLU C 2 754  ? -5.665  24.701  30.208  1.00 61.84  ?  754  GLU C OE1   1 
ATOM   9120  O  OE2   . GLU C 2 754  ? -7.011  26.411  29.914  1.00 58.29  ?  754  GLU C OE2   1 
ATOM   9121  N  N     . HIS C 2 755  ? -2.887  26.224  25.720  1.00 22.50  ?  755  HIS C N     1 
ATOM   9122  C  CA    . HIS C 2 755  ? -1.443  26.150  25.863  1.00 26.94  ?  755  HIS C CA    1 
ATOM   9123  C  C     . HIS C 2 755  ? -1.008  27.015  27.038  1.00 36.40  ?  755  HIS C C     1 
ATOM   9124  O  O     . HIS C 2 755  ? -1.612  28.054  27.322  1.00 35.00  ?  755  HIS C O     1 
ATOM   9125  C  CB    . HIS C 2 755  ? -0.735  26.585  24.576  1.00 23.95  ?  755  HIS C CB    1 
ATOM   9126  C  CG    . HIS C 2 755  ? -1.055  25.720  23.396  1.00 30.94  ?  755  HIS C CG    1 
ATOM   9127  N  ND1   . HIS C 2 755  ? -2.000  26.065  22.455  1.00 28.40  ?  755  HIS C ND1   1 
ATOM   9128  C  CD2   . HIS C 2 755  ? -0.568  24.516  23.015  1.00 35.12  ?  755  HIS C CD2   1 
ATOM   9129  C  CE1   . HIS C 2 755  ? -2.074  25.116  21.539  1.00 38.07  ?  755  HIS C CE1   1 
ATOM   9130  N  NE2   . HIS C 2 755  ? -1.216  24.164  21.856  1.00 43.58  ?  755  HIS C NE2   1 
ATOM   9131  N  N     . GLU C 2 756  ? 0.046   26.577  27.721  1.00 28.30  ?  756  GLU C N     1 
ATOM   9132  C  CA    . GLU C 2 756  ? 0.395   27.135  29.019  1.00 26.04  ?  756  GLU C CA    1 
ATOM   9133  C  C     . GLU C 2 756  ? 1.898   27.036  29.235  1.00 29.25  ?  756  GLU C C     1 
ATOM   9134  O  O     . GLU C 2 756  ? 2.518   26.031  28.873  1.00 25.02  ?  756  GLU C O     1 
ATOM   9135  C  CB    . GLU C 2 756  ? -0.355  26.393  30.133  1.00 36.97  ?  756  GLU C CB    1 
ATOM   9136  C  CG    . GLU C 2 756  ? -0.122  26.915  31.538  1.00 39.27  ?  756  GLU C CG    1 
ATOM   9137  C  CD    . GLU C 2 756  ? -0.775  26.033  32.587  1.00 52.01  ?  756  GLU C CD    1 
ATOM   9138  O  OE1   . GLU C 2 756  ? -0.982  24.833  32.308  1.00 60.38  ?  756  GLU C OE1   1 
ATOM   9139  O  OE2   . GLU C 2 756  ? -1.087  26.539  33.685  1.00 59.22  ?  756  GLU C OE2   1 
ATOM   9140  N  N     . ILE C 2 757  ? 2.475   28.083  29.825  1.00 24.91  ?  757  ILE C N     1 
ATOM   9141  C  CA    . ILE C 2 757  ? 3.884   28.076  30.197  1.00 27.20  ?  757  ILE C CA    1 
ATOM   9142  C  C     . ILE C 2 757  ? 4.060   29.053  31.348  1.00 32.43  ?  757  ILE C C     1 
ATOM   9143  O  O     . ILE C 2 757  ? 3.291   30.006  31.494  1.00 28.18  ?  757  ILE C O     1 
ATOM   9144  C  CB    . ILE C 2 757  ? 4.790   28.425  28.988  1.00 24.26  ?  757  ILE C CB    1 
ATOM   9145  C  CG1   . ILE C 2 757  ? 6.248   28.062  29.282  1.00 28.80  ?  757  ILE C CG1   1 
ATOM   9146  C  CG2   . ILE C 2 757  ? 4.659   29.895  28.619  1.00 23.10  ?  757  ILE C CG2   1 
ATOM   9147  C  CD1   . ILE C 2 757  ? 7.192   28.347  28.137  1.00 39.61  ?  757  ILE C CD1   1 
ATOM   9148  N  N     . ASP C 2 758  ? 5.070   28.805  32.179  1.00 35.95  ?  758  ASP C N     1 
ATOM   9149  C  CA    . ASP C 2 758  ? 5.334   29.623  33.352  1.00 32.32  ?  758  ASP C CA    1 
ATOM   9150  C  C     . ASP C 2 758  ? 6.809   29.993  33.410  1.00 39.59  ?  758  ASP C C     1 
ATOM   9151  O  O     . ASP C 2 758  ? 7.666   29.323  32.829  1.00 41.14  ?  758  ASP C O     1 
ATOM   9152  C  CB    . ASP C 2 758  ? 4.924   28.902  34.643  1.00 33.67  ?  758  ASP C CB    1 
ATOM   9153  C  CG    . ASP C 2 758  ? 5.410   27.468  34.690  1.00 49.53  ?  758  ASP C CG    1 
ATOM   9154  O  OD1   . ASP C 2 758  ? 6.639   27.253  34.744  1.00 54.49  ?  758  ASP C OD1   1 
ATOM   9155  O  OD2   . ASP C 2 758  ? 4.559   26.553  34.672  1.00 51.38  ?  758  ASP C OD2   1 
ATOM   9156  N  N     . ALA C 2 759  ? 7.091   31.076  34.128  1.00 41.37  ?  759  ALA C N     1 
ATOM   9157  C  CA    . ALA C 2 759  ? 8.448   31.559  34.348  1.00 47.60  ?  759  ALA C CA    1 
ATOM   9158  C  C     . ALA C 2 759  ? 8.797   31.367  35.818  1.00 55.74  ?  759  ALA C C     1 
ATOM   9159  O  O     . ALA C 2 759  ? 8.175   31.980  36.692  1.00 59.71  ?  759  ALA C O     1 
ATOM   9160  C  CB    . ALA C 2 759  ? 8.578   33.027  33.944  1.00 49.09  ?  759  ALA C CB    1 
ATOM   9161  N  N     . ARG C 2 760  ? 9.790   30.526  36.086  1.00 50.37  ?  760  ARG C N     1 
ATOM   9162  C  CA    . ARG C 2 760  ? 10.140  30.124  37.439  1.00 53.61  ?  760  ARG C CA    1 
ATOM   9163  C  C     . ARG C 2 760  ? 11.435  30.789  37.892  1.00 63.29  ?  760  ARG C C     1 
ATOM   9164  O  O     . ARG C 2 760  ? 12.089  31.528  37.151  1.00 67.02  ?  760  ARG C O     1 
ATOM   9165  C  CB    . ARG C 2 760  ? 10.270  28.603  37.535  1.00 54.15  ?  760  ARG C CB    1 
ATOM   9166  C  CG    . ARG C 2 760  ? 8.959   27.852  37.455  1.00 55.11  ?  760  ARG C CG    1 
ATOM   9167  C  CD    . ARG C 2 760  ? 9.141   26.413  37.901  1.00 60.13  ?  760  ARG C CD    1 
ATOM   9168  N  NE    . ARG C 2 760  ? 7.919   25.637  37.729  1.00 66.41  ?  760  ARG C NE    1 
ATOM   9169  C  CZ    . ARG C 2 760  ? 7.625   24.951  36.631  1.00 81.96  ?  760  ARG C CZ    1 
ATOM   9170  N  NH1   . ARG C 2 760  ? 8.466   24.943  35.606  1.00 81.49  ?  760  ARG C NH1   1 
ATOM   9171  N  NH2   . ARG C 2 760  ? 6.489   24.274  36.556  1.00 83.29  ?  760  ARG C NH2   1 
ATOM   9172  N  N     . ASP C 2 761  ? 11.796  30.511  39.143  1.00 63.41  ?  761  ASP C N     1 
ATOM   9173  C  CA    . ASP C 2 761  ? 13.084  30.888  39.708  1.00 59.50  ?  761  ASP C CA    1 
ATOM   9174  C  C     . ASP C 2 761  ? 14.025  29.697  39.584  1.00 60.30  ?  761  ASP C C     1 
ATOM   9175  O  O     . ASP C 2 761  ? 13.718  28.607  40.078  1.00 60.92  ?  761  ASP C O     1 
ATOM   9176  C  CB    . ASP C 2 761  ? 12.942  31.306  41.171  1.00 65.61  ?  761  ASP C CB    1 
ATOM   9177  C  CG    . ASP C 2 761  ? 11.930  32.417  41.366  1.00 73.28  ?  761  ASP C CG    1 
ATOM   9178  O  OD1   . ASP C 2 761  ? 10.756  32.230  40.982  1.00 72.04  ?  761  ASP C OD1   1 
ATOM   9179  O  OD2   . ASP C 2 761  ? 12.306  33.475  41.915  1.00 75.38  ?  761  ASP C OD2   1 
ATOM   9180  N  N     . THR C 2 762  ? 15.159  29.901  38.927  1.00 56.38  ?  762  THR C N     1 
ATOM   9181  C  CA    . THR C 2 762  ? 16.137  28.846  38.712  1.00 61.50  ?  762  THR C CA    1 
ATOM   9182  C  C     . THR C 2 762  ? 17.365  29.089  39.583  1.00 61.31  ?  762  THR C C     1 
ATOM   9183  O  O     . THR C 2 762  ? 17.457  30.078  40.316  1.00 49.07  ?  762  THR C O     1 
ATOM   9184  C  CB    . THR C 2 762  ? 16.519  28.755  37.234  1.00 57.20  ?  762  THR C CB    1 
ATOM   9185  O  OG1   . THR C 2 762  ? 17.511  27.736  37.057  1.00 52.29  ?  762  THR C OG1   1 
ATOM   9186  C  CG2   . THR C 2 762  ? 17.071  30.080  36.750  1.00 47.83  ?  762  THR C CG2   1 
ATOM   9187  N  N     . LYS C 2 763  ? 18.323  28.164  39.491  1.00 67.12  ?  763  LYS C N     1 
ATOM   9188  C  CA    . LYS C 2 763  ? 19.508  28.234  40.338  1.00 58.08  ?  763  LYS C CA    1 
ATOM   9189  C  C     . LYS C 2 763  ? 20.405  29.409  39.969  1.00 51.61  ?  763  LYS C C     1 
ATOM   9190  O  O     . LYS C 2 763  ? 21.068  29.978  40.845  1.00 54.92  ?  763  LYS C O     1 
ATOM   9191  C  CB    . LYS C 2 763  ? 20.289  26.923  40.248  1.00 62.25  ?  763  LYS C CB    1 
ATOM   9192  C  CG    . LYS C 2 763  ? 19.525  25.715  40.765  1.00 71.18  ?  763  LYS C CG    1 
ATOM   9193  C  CD    . LYS C 2 763  ? 19.414  25.744  42.281  1.00 77.98  ?  763  LYS C CD    1 
ATOM   9194  C  CE    . LYS C 2 763  ? 18.325  24.808  42.774  1.00 73.29  ?  763  LYS C CE    1 
ATOM   9195  N  NZ    . LYS C 2 763  ? 16.969  25.298  42.399  1.00 70.99  ?  763  LYS C NZ    1 
ATOM   9196  N  N     . LEU C 2 764  ? 20.438  29.789  38.694  1.00 51.93  ?  764  LEU C N     1 
ATOM   9197  C  CA    . LEU C 2 764  ? 21.330  30.832  38.212  1.00 52.59  ?  764  LEU C CA    1 
ATOM   9198  C  C     . LEU C 2 764  ? 20.613  32.151  37.954  1.00 50.88  ?  764  LEU C C     1 
ATOM   9199  O  O     . LEU C 2 764  ? 21.229  33.091  37.444  1.00 51.39  ?  764  LEU C O     1 
ATOM   9200  C  CB    . LEU C 2 764  ? 22.040  30.366  36.940  1.00 47.50  ?  764  LEU C CB    1 
ATOM   9201  C  CG    . LEU C 2 764  ? 22.629  28.954  36.997  1.00 57.55  ?  764  LEU C CG    1 
ATOM   9202  C  CD1   . LEU C 2 764  ? 21.763  27.967  36.222  1.00 59.99  ?  764  LEU C CD1   1 
ATOM   9203  C  CD2   . LEU C 2 764  ? 24.058  28.945  36.485  1.00 61.73  ?  764  LEU C CD2   1 
ATOM   9204  N  N     . GLY C 2 765  ? 19.331  32.242  38.294  1.00 62.79  ?  765  GLY C N     1 
ATOM   9205  C  CA    . GLY C 2 765  ? 18.584  33.465  38.086  1.00 56.80  ?  765  GLY C CA    1 
ATOM   9206  C  C     . GLY C 2 765  ? 17.086  33.250  38.113  1.00 57.60  ?  765  GLY C C     1 
ATOM   9207  O  O     . GLY C 2 765  ? 16.565  32.569  39.001  1.00 65.41  ?  765  GLY C O     1 
ATOM   9208  N  N     . ALA C 2 766  ? 16.383  33.824  37.140  1.00 58.98  ?  766  ALA C N     1 
ATOM   9209  C  CA    . ALA C 2 766  ? 14.936  33.694  37.067  1.00 62.64  ?  766  ALA C CA    1 
ATOM   9210  C  C     . ALA C 2 766  ? 14.508  33.706  35.609  1.00 63.02  ?  766  ALA C C     1 
ATOM   9211  O  O     . ALA C 2 766  ? 14.920  34.586  34.848  1.00 58.50  ?  766  ALA C O     1 
ATOM   9212  C  CB    . ALA C 2 766  ? 14.238  34.821  37.836  1.00 57.09  ?  766  ALA C CB    1 
ATOM   9213  N  N     . GLU C 2 767  ? 13.697  32.723  35.227  1.00 64.63  ?  767  GLU C N     1 
ATOM   9214  C  CA    . GLU C 2 767  ? 13.099  32.725  33.900  1.00 58.60  ?  767  GLU C CA    1 
ATOM   9215  C  C     . GLU C 2 767  ? 12.238  33.969  33.732  1.00 59.99  ?  767  GLU C C     1 
ATOM   9216  O  O     . GLU C 2 767  ? 11.416  34.289  34.595  1.00 63.40  ?  767  GLU C O     1 
ATOM   9217  C  CB    . GLU C 2 767  ? 12.257  31.466  33.691  1.00 60.33  ?  767  GLU C CB    1 
ATOM   9218  C  CG    . GLU C 2 767  ? 12.998  30.160  33.929  1.00 61.06  ?  767  GLU C CG    1 
ATOM   9219  C  CD    . GLU C 2 767  ? 12.154  28.944  33.593  1.00 63.40  ?  767  GLU C CD    1 
ATOM   9220  O  OE1   . GLU C 2 767  ? 10.924  29.096  33.438  1.00 61.55  ?  767  GLU C OE1   1 
ATOM   9221  O  OE2   . GLU C 2 767  ? 12.719  27.836  33.479  1.00 59.86  ?  767  GLU C OE2   1 
ATOM   9222  N  N     . GLU C 2 768  ? 12.439  34.682  32.628  1.00 53.66  ?  768  GLU C N     1 
ATOM   9223  C  CA    . GLU C 2 768  ? 11.682  35.890  32.340  1.00 58.37  ?  768  GLU C CA    1 
ATOM   9224  C  C     . GLU C 2 768  ? 11.005  35.768  30.983  1.00 56.43  ?  768  GLU C C     1 
ATOM   9225  O  O     . GLU C 2 768  ? 11.612  35.307  30.010  1.00 52.61  ?  768  GLU C O     1 
ATOM   9226  C  CB    . GLU C 2 768  ? 12.576  37.138  32.374  1.00 59.32  ?  768  GLU C CB    1 
ATOM   9227  C  CG    . GLU C 2 768  ? 13.776  37.092  31.443  1.00 69.01  ?  768  GLU C CG    1 
ATOM   9228  C  CD    . GLU C 2 768  ? 14.397  38.459  31.236  1.00 80.24  ?  768  GLU C CD    1 
ATOM   9229  O  OE1   . GLU C 2 768  ? 13.734  39.468  31.557  1.00 83.60  ?  768  GLU C OE1   1 
ATOM   9230  O  OE2   . GLU C 2 768  ? 15.547  38.526  30.753  1.00 79.96  ?  768  GLU C OE2   1 
ATOM   9231  N  N     . ILE C 2 769  ? 9.741   36.172  30.932  1.00 48.73  ?  769  ILE C N     1 
ATOM   9232  C  CA    . ILE C 2 769  ? 8.973   36.196  29.694  1.00 43.35  ?  769  ILE C CA    1 
ATOM   9233  C  C     . ILE C 2 769  ? 9.236   37.537  29.021  1.00 40.96  ?  769  ILE C C     1 
ATOM   9234  O  O     . ILE C 2 769  ? 8.815   38.585  29.518  1.00 44.59  ?  769  ILE C O     1 
ATOM   9235  C  CB    . ILE C 2 769  ? 7.479   35.983  29.957  1.00 43.04  ?  769  ILE C CB    1 
ATOM   9236  C  CG1   . ILE C 2 769  ? 7.231   34.566  30.478  1.00 33.21  ?  769  ILE C CG1   1 
ATOM   9237  C  CG2   . ILE C 2 769  ? 6.674   36.255  28.700  1.00 44.00  ?  769  ILE C CG2   1 
ATOM   9238  C  CD1   . ILE C 2 769  ? 5.802   34.310  30.887  1.00 28.04  ?  769  ILE C CD1   1 
ATOM   9239  N  N     . THR C 2 770  ? 9.938   37.509  27.890  1.00 39.55  ?  770  THR C N     1 
ATOM   9240  C  CA    . THR C 2 770  ? 10.357  38.732  27.226  1.00 47.30  ?  770  THR C CA    1 
ATOM   9241  C  C     . THR C 2 770  ? 10.309  38.552  25.717  1.00 41.24  ?  770  THR C C     1 
ATOM   9242  O  O     . THR C 2 770  ? 10.457  37.443  25.198  1.00 40.26  ?  770  THR C O     1 
ATOM   9243  C  CB    . THR C 2 770  ? 11.772  39.147  27.650  1.00 56.14  ?  770  THR C CB    1 
ATOM   9244  O  OG1   . THR C 2 770  ? 12.207  40.255  26.853  1.00 57.05  ?  770  THR C OG1   1 
ATOM   9245  C  CG2   . THR C 2 770  ? 12.742  37.987  27.477  1.00 49.10  ?  770  THR C CG2   1 
ATOM   9246  N  N     . ARG C 2 771  ? 10.096  39.669  25.018  1.00 48.52  ?  771  ARG C N     1 
ATOM   9247  C  CA    . ARG C 2 771  ? 10.150  39.660  23.561  1.00 49.81  ?  771  ARG C CA    1 
ATOM   9248  C  C     . ARG C 2 771  ? 11.576  39.462  23.061  1.00 53.21  ?  771  ARG C C     1 
ATOM   9249  O  O     . ARG C 2 771  ? 11.780  38.974  21.944  1.00 43.53  ?  771  ARG C O     1 
ATOM   9250  C  CB    . ARG C 2 771  ? 9.562   40.963  23.017  1.00 41.85  ?  771  ARG C CB    1 
ATOM   9251  C  CG    . ARG C 2 771  ? 9.318   40.984  21.519  1.00 49.17  ?  771  ARG C CG    1 
ATOM   9252  C  CD    . ARG C 2 771  ? 8.812   42.348  21.075  1.00 50.93  ?  771  ARG C CD    1 
ATOM   9253  N  NE    . ARG C 2 771  ? 8.421   42.359  19.669  1.00 51.01  ?  771  ARG C NE    1 
ATOM   9254  C  CZ    . ARG C 2 771  ? 9.259   42.583  18.663  1.00 59.81  ?  771  ARG C CZ    1 
ATOM   9255  N  NH1   . ARG C 2 771  ? 10.543  42.814  18.905  1.00 55.66  ?  771  ARG C NH1   1 
ATOM   9256  N  NH2   . ARG C 2 771  ? 8.815   42.575  17.414  1.00 64.93  ?  771  ARG C NH2   1 
ATOM   9257  N  N     . ASP C 2 772  ? 12.566  39.824  23.875  1.00 54.17  ?  772  ASP C N     1 
ATOM   9258  C  CA    . ASP C 2 772  ? 13.972  39.695  23.508  1.00 50.72  ?  772  ASP C CA    1 
ATOM   9259  C  C     . ASP C 2 772  ? 14.386  38.234  23.643  1.00 55.58  ?  772  ASP C C     1 
ATOM   9260  O  O     . ASP C 2 772  ? 14.558  37.728  24.757  1.00 58.41  ?  772  ASP C O     1 
ATOM   9261  C  CB    . ASP C 2 772  ? 14.828  40.603  24.389  1.00 57.47  ?  772  ASP C CB    1 
ATOM   9262  C  CG    . ASP C 2 772  ? 16.279  40.669  23.939  1.00 77.97  ?  772  ASP C CG    1 
ATOM   9263  O  OD1   . ASP C 2 772  ? 16.953  39.618  23.906  1.00 75.18  ?  772  ASP C OD1   1 
ATOM   9264  O  OD2   . ASP C 2 772  ? 16.748  41.782  23.618  1.00 85.21  ?  772  ASP C OD2   1 
ATOM   9265  N  N     . ILE C 2 773  ? 14.544  37.556  22.511  1.00 54.75  ?  773  ILE C N     1 
ATOM   9266  C  CA    . ILE C 2 773  ? 14.957  36.159  22.463  1.00 51.25  ?  773  ILE C CA    1 
ATOM   9267  C  C     . ILE C 2 773  ? 16.258  36.090  21.683  1.00 59.54  ?  773  ILE C C     1 
ATOM   9268  O  O     . ILE C 2 773  ? 16.356  36.687  20.608  1.00 61.75  ?  773  ILE C O     1 
ATOM   9269  C  CB    . ILE C 2 773  ? 13.892  35.255  21.814  1.00 48.87  ?  773  ILE C CB    1 
ATOM   9270  C  CG1   . ILE C 2 773  ? 12.533  35.481  22.479  1.00 45.34  ?  773  ILE C CG1   1 
ATOM   9271  C  CG2   . ILE C 2 773  ? 14.291  33.791  21.919  1.00 52.10  ?  773  ILE C CG2   1 
ATOM   9272  C  CD1   . ILE C 2 773  ? 11.432  34.609  21.929  1.00 46.67  ?  773  ILE C CD1   1 
ATOM   9273  N  N     . PRO C 2 774  ? 17.283  35.393  22.178  1.00 60.05  ?  774  PRO C N     1 
ATOM   9274  C  CA    . PRO C 2 774  ? 18.587  35.406  21.500  1.00 60.57  ?  774  PRO C CA    1 
ATOM   9275  C  C     . PRO C 2 774  ? 18.526  34.743  20.129  1.00 66.65  ?  774  PRO C C     1 
ATOM   9276  O  O     . PRO C 2 774  ? 17.939  33.671  19.966  1.00 62.45  ?  774  PRO C O     1 
ATOM   9277  C  CB    . PRO C 2 774  ? 19.494  34.624  22.459  1.00 63.03  ?  774  PRO C CB    1 
ATOM   9278  C  CG    . PRO C 2 774  ? 18.808  34.703  23.786  1.00 65.15  ?  774  PRO C CG    1 
ATOM   9279  C  CD    . PRO C 2 774  ? 17.343  34.707  23.480  1.00 57.23  ?  774  PRO C CD    1 
ATOM   9280  N  N     . ASN C 2 775  ? 19.137  35.406  19.143  1.00 84.25  ?  775  ASN C N     1 
ATOM   9281  C  CA    . ASN C 2 775  ? 19.348  34.847  17.804  1.00 82.14  ?  775  ASN C CA    1 
ATOM   9282  C  C     . ASN C 2 775  ? 18.030  34.518  17.106  1.00 80.33  ?  775  ASN C C     1 
ATOM   9283  O  O     . ASN C 2 775  ? 17.901  33.491  16.436  1.00 81.06  ?  775  ASN C O     1 
ATOM   9284  C  CB    . ASN C 2 775  ? 20.255  33.615  17.859  1.00 82.42  ?  775  ASN C CB    1 
ATOM   9285  C  CG    . ASN C 2 775  ? 21.646  33.939  18.367  1.00 91.25  ?  775  ASN C CG    1 
ATOM   9286  O  OD1   . ASN C 2 775  ? 22.184  35.014  18.098  1.00 93.70  ?  775  ASN C OD1   1 
ATOM   9287  N  ND2   . ASN C 2 775  ? 22.234  33.010  19.110  1.00 95.21  ?  775  ASN C ND2   1 
ATOM   9288  N  N     . ILE C 2 776  ? 17.045  35.401  17.253  1.00 78.60  ?  776  ILE C N     1 
ATOM   9289  C  CA    . ILE C 2 776  ? 15.764  35.281  16.567  1.00 72.20  ?  776  ILE C CA    1 
ATOM   9290  C  C     . ILE C 2 776  ? 15.508  36.575  15.809  1.00 75.65  ?  776  ILE C C     1 
ATOM   9291  O  O     . ILE C 2 776  ? 15.698  37.668  16.355  1.00 76.24  ?  776  ILE C O     1 
ATOM   9292  C  CB    . ILE C 2 776  ? 14.610  34.983  17.543  1.00 70.90  ?  776  ILE C CB    1 
ATOM   9293  C  CG1   . ILE C 2 776  ? 14.914  33.730  18.365  1.00 71.46  ?  776  ILE C CG1   1 
ATOM   9294  C  CG2   . ILE C 2 776  ? 13.304  34.803  16.783  1.00 67.09  ?  776  ILE C CG2   1 
ATOM   9295  C  CD1   . ILE C 2 776  ? 15.027  32.468  17.543  1.00 72.17  ?  776  ILE C CD1   1 
ATOM   9296  N  N     . SER C 2 777  ? 15.082  36.451  14.556  1.00 73.19  ?  777  SER C N     1 
ATOM   9297  C  CA    . SER C 2 777  ? 14.841  37.620  13.725  1.00 74.41  ?  777  SER C CA    1 
ATOM   9298  C  C     . SER C 2 777  ? 13.628  38.402  14.225  1.00 72.76  ?  777  SER C C     1 
ATOM   9299  O  O     . SER C 2 777  ? 12.804  37.904  14.998  1.00 74.70  ?  777  SER C O     1 
ATOM   9300  C  CB    . SER C 2 777  ? 14.629  37.205  12.269  1.00 72.97  ?  777  SER C CB    1 
ATOM   9301  O  OG    . SER C 2 777  ? 13.554  36.288  12.151  1.00 72.51  ?  777  SER C OG    1 
ATOM   9302  N  N     . ASP C 2 778  ? 13.528  39.651  13.768  1.00 62.63  ?  778  ASP C N     1 
ATOM   9303  C  CA    . ASP C 2 778  ? 12.360  40.469  14.066  1.00 67.43  ?  778  ASP C CA    1 
ATOM   9304  C  C     . ASP C 2 778  ? 11.112  39.989  13.338  1.00 59.50  ?  778  ASP C C     1 
ATOM   9305  O  O     . ASP C 2 778  ? 10.025  40.515  13.597  1.00 55.47  ?  778  ASP C O     1 
ATOM   9306  C  CB    . ASP C 2 778  ? 12.631  41.931  13.704  1.00 72.42  ?  778  ASP C CB    1 
ATOM   9307  C  CG    . ASP C 2 778  ? 13.808  42.511  14.461  1.00 74.81  ?  778  ASP C CG    1 
ATOM   9308  O  OD1   . ASP C 2 778  ? 14.467  41.756  15.208  1.00 74.80  ?  778  ASP C OD1   1 
ATOM   9309  O  OD2   . ASP C 2 778  ? 14.075  43.722  14.313  1.00 78.26  ?  778  ASP C OD2   1 
ATOM   9310  N  N     . GLU C 2 779  ? 11.242  39.012  12.438  1.00 58.70  ?  779  GLU C N     1 
ATOM   9311  C  CA    . GLU C 2 779  ? 10.096  38.537  11.672  1.00 58.30  ?  779  GLU C CA    1 
ATOM   9312  C  C     . GLU C 2 779  ? 9.322   37.462  12.427  1.00 47.97  ?  779  GLU C C     1 
ATOM   9313  O  O     . GLU C 2 779  ? 8.088   37.432  12.375  1.00 50.92  ?  779  GLU C O     1 
ATOM   9314  C  CB    . GLU C 2 779  ? 10.568  38.009  10.319  1.00 73.62  ?  779  GLU C CB    1 
ATOM   9315  C  CG    . GLU C 2 779  ? 11.580  38.917  9.636   1.00 86.46  ?  779  GLU C CG    1 
ATOM   9316  C  CD    . GLU C 2 779  ? 12.377  38.204  8.563   1.00 113.61 ?  779  GLU C CD    1 
ATOM   9317  O  OE1   . GLU C 2 779  ? 11.864  37.218  7.995   1.00 120.21 ?  779  GLU C OE1   1 
ATOM   9318  O  OE2   . GLU C 2 779  ? 13.521  38.625  8.292   1.00 108.32 ?  779  GLU C OE2   1 
ATOM   9319  N  N     . VAL C 2 780  ? 10.025  36.574  13.131  1.00 42.22  ?  780  VAL C N     1 
ATOM   9320  C  CA    . VAL C 2 780  ? 9.346   35.560  13.931  1.00 46.23  ?  780  VAL C CA    1 
ATOM   9321  C  C     . VAL C 2 780  ? 8.640   36.207  15.115  1.00 45.01  ?  780  VAL C C     1 
ATOM   9322  O  O     . VAL C 2 780  ? 7.506   35.847  15.454  1.00 47.13  ?  780  VAL C O     1 
ATOM   9323  C  CB    . VAL C 2 780  ? 10.347  34.483  14.385  1.00 43.22  ?  780  VAL C CB    1 
ATOM   9324  C  CG1   . VAL C 2 780  ? 9.612   33.314  15.021  1.00 49.58  ?  780  VAL C CG1   1 
ATOM   9325  C  CG2   . VAL C 2 780  ? 11.197  34.020  13.212  1.00 32.53  ?  780  VAL C CG2   1 
ATOM   9326  N  N     . LEU C 2 781  ? 9.293   37.173  15.757  1.00 41.67  ?  781  LEU C N     1 
ATOM   9327  C  CA    . LEU C 2 781  ? 8.728   37.897  16.888  1.00 46.40  ?  781  LEU C CA    1 
ATOM   9328  C  C     . LEU C 2 781  ? 7.744   38.980  16.465  1.00 46.99  ?  781  LEU C C     1 
ATOM   9329  O  O     . LEU C 2 781  ? 7.277   39.738  17.322  1.00 47.60  ?  781  LEU C O     1 
ATOM   9330  C  CB    . LEU C 2 781  ? 9.853   38.523  17.718  1.00 47.34  ?  781  LEU C CB    1 
ATOM   9331  C  CG    . LEU C 2 781  ? 11.075  37.645  17.995  1.00 47.27  ?  781  LEU C CG    1 
ATOM   9332  C  CD1   . LEU C 2 781  ? 12.158  38.440  18.710  1.00 63.08  ?  781  LEU C CD1   1 
ATOM   9333  C  CD2   . LEU C 2 781  ? 10.690  36.417  18.802  1.00 53.30  ?  781  LEU C CD2   1 
ATOM   9334  N  N     . ALA C 2 782  ? 7.420   39.070  15.172  1.00 44.63  ?  782  ALA C N     1 
ATOM   9335  C  CA    . ALA C 2 782  ? 6.563   40.149  14.694  1.00 47.77  ?  782  ALA C CA    1 
ATOM   9336  C  C     . ALA C 2 782  ? 5.131   40.003  15.192  1.00 45.35  ?  782  ALA C C     1 
ATOM   9337  O  O     . ALA C 2 782  ? 4.420   41.006  15.327  1.00 41.21  ?  782  ALA C O     1 
ATOM   9338  C  CB    . ALA C 2 782  ? 6.591   40.205  13.167  1.00 59.00  ?  782  ALA C CB    1 
ATOM   9339  N  N     . ASP C 2 783  ? 4.688   38.779  15.468  1.00 40.30  ?  783  ASP C N     1 
ATOM   9340  C  CA    . ASP C 2 783  ? 3.344   38.540  15.973  1.00 37.66  ?  783  ASP C CA    1 
ATOM   9341  C  C     . ASP C 2 783  ? 3.258   38.624  17.492  1.00 31.03  ?  783  ASP C C     1 
ATOM   9342  O  O     . ASP C 2 783  ? 2.220   38.274  18.062  1.00 29.56  ?  783  ASP C O     1 
ATOM   9343  C  CB    . ASP C 2 783  ? 2.832   37.177  15.498  1.00 44.63  ?  783  ASP C CB    1 
ATOM   9344  C  CG    . ASP C 2 783  ? 2.592   37.133  14.001  1.00 63.10  ?  783  ASP C CG    1 
ATOM   9345  O  OD1   . ASP C 2 783  ? 3.363   36.455  13.289  1.00 72.49  ?  783  ASP C OD1   1 
ATOM   9346  O  OD2   . ASP C 2 783  ? 1.637   37.789  13.534  1.00 53.51  ?  783  ASP C OD2   1 
ATOM   9347  N  N     . LEU C 2 784  ? 4.314   39.081  18.157  1.00 35.21  ?  784  LEU C N     1 
ATOM   9348  C  CA    . LEU C 2 784  ? 4.329   39.220  19.605  1.00 33.44  ?  784  LEU C CA    1 
ATOM   9349  C  C     . LEU C 2 784  ? 4.153   40.682  19.999  1.00 39.33  ?  784  LEU C C     1 
ATOM   9350  O  O     . LEU C 2 784  ? 4.545   41.593  19.266  1.00 46.25  ?  784  LEU C O     1 
ATOM   9351  C  CB    . LEU C 2 784  ? 5.636   38.685  20.194  1.00 32.56  ?  784  LEU C CB    1 
ATOM   9352  C  CG    . LEU C 2 784  ? 6.045   37.254  19.840  1.00 27.36  ?  784  LEU C CG    1 
ATOM   9353  C  CD1   . LEU C 2 784  ? 7.423   36.948  20.400  1.00 27.39  ?  784  LEU C CD1   1 
ATOM   9354  C  CD2   . LEU C 2 784  ? 5.026   36.254  20.356  1.00 30.37  ?  784  LEU C CD2   1 
ATOM   9355  N  N     . ASP C 2 785  ? 3.556   40.898  21.169  1.00 31.94  ?  785  ASP C N     1 
ATOM   9356  C  CA    . ASP C 2 785  ? 3.460   42.238  21.730  1.00 33.48  ?  785  ASP C CA    1 
ATOM   9357  C  C     . ASP C 2 785  ? 4.777   42.576  22.428  1.00 42.05  ?  785  ASP C C     1 
ATOM   9358  O  O     . ASP C 2 785  ? 5.775   41.859  22.306  1.00 44.49  ?  785  ASP C O     1 
ATOM   9359  C  CB    . ASP C 2 785  ? 2.254   42.349  22.663  1.00 37.53  ?  785  ASP C CB    1 
ATOM   9360  C  CG    . ASP C 2 785  ? 2.222   41.260  23.720  1.00 40.62  ?  785  ASP C CG    1 
ATOM   9361  O  OD1   . ASP C 2 785  ? 3.203   41.127  24.480  1.00 43.15  ?  785  ASP C OD1   1 
ATOM   9362  O  OD2   . ASP C 2 785  ? 1.201   40.544  23.801  1.00 34.28  ?  785  ASP C OD2   1 
ATOM   9363  N  N     . GLU C 2 786  ? 4.797   43.678  23.180  1.00 45.80  ?  786  GLU C N     1 
ATOM   9364  C  CA    . GLU C 2 786  ? 6.035   44.105  23.820  1.00 46.29  ?  786  GLU C CA    1 
ATOM   9365  C  C     . GLU C 2 786  ? 6.437   43.196  24.974  1.00 40.67  ?  786  GLU C C     1 
ATOM   9366  O  O     . GLU C 2 786  ? 7.594   43.241  25.406  1.00 47.86  ?  786  GLU C O     1 
ATOM   9367  C  CB    . GLU C 2 786  ? 5.907   45.549  24.313  1.00 49.68  ?  786  GLU C CB    1 
ATOM   9368  C  CG    . GLU C 2 786  ? 5.323   45.698  25.712  1.00 48.04  ?  786  GLU C CG    1 
ATOM   9369  C  CD    . GLU C 2 786  ? 3.821   45.493  25.759  1.00 48.07  ?  786  GLU C CD    1 
ATOM   9370  O  OE1   . GLU C 2 786  ? 3.211   45.244  24.698  1.00 44.51  ?  786  GLU C OE1   1 
ATOM   9371  O  OE2   . GLU C 2 786  ? 3.246   45.589  26.864  1.00 54.25  ?  786  GLU C OE2   1 
ATOM   9372  N  N     . ARG C 2 787  ? 5.519   42.372  25.477  1.00 35.93  ?  787  ARG C N     1 
ATOM   9373  C  CA    . ARG C 2 787  ? 5.812   41.467  26.580  1.00 38.41  ?  787  ARG C CA    1 
ATOM   9374  C  C     . ARG C 2 787  ? 6.403   40.140  26.126  1.00 44.71  ?  787  ARG C C     1 
ATOM   9375  O  O     . ARG C 2 787  ? 6.865   39.365  26.970  1.00 46.50  ?  787  ARG C O     1 
ATOM   9376  C  CB    . ARG C 2 787  ? 4.540   41.187  27.388  1.00 38.34  ?  787  ARG C CB    1 
ATOM   9377  C  CG    . ARG C 2 787  ? 3.646   42.394  27.595  1.00 41.16  ?  787  ARG C CG    1 
ATOM   9378  C  CD    . ARG C 2 787  ? 2.347   41.994  28.275  1.00 36.93  ?  787  ARG C CD    1 
ATOM   9379  N  NE    . ARG C 2 787  ? 1.624   40.978  27.514  1.00 37.72  ?  787  ARG C NE    1 
ATOM   9380  C  CZ    . ARG C 2 787  ? 0.430   40.500  27.851  1.00 44.99  ?  787  ARG C CZ    1 
ATOM   9381  N  NH1   . ARG C 2 787  ? -0.183  40.946  28.939  1.00 40.01  ?  787  ARG C NH1   1 
ATOM   9382  N  NH2   . ARG C 2 787  ? -0.152  39.576  27.098  1.00 52.47  ?  787  ARG C NH2   1 
ATOM   9383  N  N     . GLY C 2 788  ? 6.403   39.861  24.826  1.00 41.45  ?  788  GLY C N     1 
ATOM   9384  C  CA    . GLY C 2 788  ? 6.776   38.557  24.327  1.00 41.48  ?  788  GLY C CA    1 
ATOM   9385  C  C     . GLY C 2 788  ? 5.624   37.596  24.153  1.00 37.16  ?  788  GLY C C     1 
ATOM   9386  O  O     . GLY C 2 788  ? 5.861   36.408  23.905  1.00 29.73  ?  788  GLY C O     1 
ATOM   9387  N  N     . ILE C 2 789  ? 4.388   38.071  24.278  1.00 32.65  ?  789  ILE C N     1 
ATOM   9388  C  CA    . ILE C 2 789  ? 3.194   37.246  24.137  1.00 28.20  ?  789  ILE C CA    1 
ATOM   9389  C  C     . ILE C 2 789  ? 2.611   37.469  22.751  1.00 33.40  ?  789  ILE C C     1 
ATOM   9390  O  O     . ILE C 2 789  ? 2.608   38.597  22.241  1.00 37.79  ?  789  ILE C O     1 
ATOM   9391  C  CB    . ILE C 2 789  ? 2.159   37.582  25.229  1.00 28.52  ?  789  ILE C CB    1 
ATOM   9392  C  CG1   . ILE C 2 789  ? 2.827   37.645  26.603  1.00 27.12  ?  789  ILE C CG1   1 
ATOM   9393  C  CG2   . ILE C 2 789  ? 1.029   36.562  25.231  1.00 32.24  ?  789  ILE C CG2   1 
ATOM   9394  C  CD1   . ILE C 2 789  ? 3.403   36.329  27.061  1.00 32.78  ?  789  ILE C CD1   1 
ATOM   9395  N  N     . VAL C 2 790  ? 2.120   36.391  22.133  1.00 26.72  ?  790  VAL C N     1 
ATOM   9396  C  CA    . VAL C 2 790  ? 1.418   36.529  20.864  1.00 20.81  ?  790  VAL C CA    1 
ATOM   9397  C  C     . VAL C 2 790  ? 0.167   37.371  21.078  1.00 22.52  ?  790  VAL C C     1 
ATOM   9398  O  O     . VAL C 2 790  ? -0.476  37.310  22.134  1.00 23.04  ?  790  VAL C O     1 
ATOM   9399  C  CB    . VAL C 2 790  ? 1.085   35.145  20.281  1.00 19.48  ?  790  VAL C CB    1 
ATOM   9400  C  CG1   . VAL C 2 790  ? 0.163   34.372  21.214  1.00 22.63  ?  790  VAL C CG1   1 
ATOM   9401  C  CG2   . VAL C 2 790  ? 0.475   35.272  18.891  1.00 21.63  ?  790  VAL C CG2   1 
ATOM   9402  N  N     . ARG C 2 791  ? -0.172  38.185  20.084  1.00 22.84  ?  791  ARG C N     1 
ATOM   9403  C  CA    . ARG C 2 791  ? -1.288  39.110  20.206  1.00 20.60  ?  791  ARG C CA    1 
ATOM   9404  C  C     . ARG C 2 791  ? -2.589  38.445  19.774  1.00 18.91  ?  791  ARG C C     1 
ATOM   9405  O  O     . ARG C 2 791  ? -2.595  37.498  18.982  1.00 26.69  ?  791  ARG C O     1 
ATOM   9406  C  CB    . ARG C 2 791  ? -1.033  40.369  19.376  1.00 20.78  ?  791  ARG C CB    1 
ATOM   9407  C  CG    . ARG C 2 791  ? 0.326   41.003  19.645  1.00 23.53  ?  791  ARG C CG    1 
ATOM   9408  C  CD    . ARG C 2 791  ? 0.419   42.415  19.090  1.00 32.09  ?  791  ARG C CD    1 
ATOM   9409  N  NE    . ARG C 2 791  ? 0.315   42.453  17.634  1.00 36.48  ?  791  ARG C NE    1 
ATOM   9410  C  CZ    . ARG C 2 791  ? 1.356   42.455  16.808  1.00 36.81  ?  791  ARG C CZ    1 
ATOM   9411  N  NH1   . ARG C 2 791  ? 2.591   42.419  17.292  1.00 35.37  ?  791  ARG C NH1   1 
ATOM   9412  N  NH2   . ARG C 2 791  ? 1.164   42.494  15.497  1.00 44.19  ?  791  ARG C NH2   1 
ATOM   9413  N  N     . ILE C 2 792  ? -3.701  38.951  20.315  1.00 16.93  ?  792  ILE C N     1 
ATOM   9414  C  CA    . ILE C 2 792  ? -5.008  38.384  20.008  1.00 19.21  ?  792  ILE C CA    1 
ATOM   9415  C  C     . ILE C 2 792  ? -5.319  38.568  18.530  1.00 22.39  ?  792  ILE C C     1 
ATOM   9416  O  O     . ILE C 2 792  ? -5.104  39.644  17.957  1.00 34.19  ?  792  ILE C O     1 
ATOM   9417  C  CB    . ILE C 2 792  ? -6.092  39.027  20.889  1.00 19.00  ?  792  ILE C CB    1 
ATOM   9418  C  CG1   . ILE C 2 792  ? -5.856  38.690  22.361  1.00 24.15  ?  792  ILE C CG1   1 
ATOM   9419  C  CG2   . ILE C 2 792  ? -7.478  38.569  20.462  1.00 18.33  ?  792  ILE C CG2   1 
ATOM   9420  C  CD1   . ILE C 2 792  ? -6.926  39.222  23.286  1.00 37.05  ?  792  ILE C CD1   1 
ATOM   9421  N  N     . GLY C 2 793  ? -5.827  37.507  17.903  1.00 19.55  ?  793  GLY C N     1 
ATOM   9422  C  CA    . GLY C 2 793  ? -6.197  37.539  16.507  1.00 24.97  ?  793  GLY C CA    1 
ATOM   9423  C  C     . GLY C 2 793  ? -5.117  37.097  15.545  1.00 25.96  ?  793  GLY C C     1 
ATOM   9424  O  O     . GLY C 2 793  ? -5.409  36.907  14.357  1.00 38.44  ?  793  GLY C O     1 
ATOM   9425  N  N     . ALA C 2 794  ? -3.885  36.924  16.014  1.00 20.42  ?  794  ALA C N     1 
ATOM   9426  C  CA    . ALA C 2 794  ? -2.800  36.510  15.137  1.00 35.76  ?  794  ALA C CA    1 
ATOM   9427  C  C     . ALA C 2 794  ? -2.918  35.026  14.812  1.00 28.29  ?  794  ALA C C     1 
ATOM   9428  O  O     . ALA C 2 794  ? -3.063  34.192  15.710  1.00 24.16  ?  794  ALA C O     1 
ATOM   9429  C  CB    . ALA C 2 794  ? -1.450  36.804  15.788  1.00 37.60  ?  794  ALA C CB    1 
ATOM   9430  N  N     . GLU C 2 795  ? -2.861  34.699  13.524  1.00 39.57  ?  795  GLU C N     1 
ATOM   9431  C  CA    . GLU C 2 795  ? -2.877  33.309  13.094  1.00 39.49  ?  795  GLU C CA    1 
ATOM   9432  C  C     . GLU C 2 795  ? -1.494  32.702  13.286  1.00 36.27  ?  795  GLU C C     1 
ATOM   9433  O  O     . GLU C 2 795  ? -0.485  33.304  12.907  1.00 47.63  ?  795  GLU C O     1 
ATOM   9434  C  CB    . GLU C 2 795  ? -3.311  33.204  11.633  1.00 57.27  ?  795  GLU C CB    1 
ATOM   9435  C  CG    . GLU C 2 795  ? -4.658  33.845  11.339  1.00 73.81  ?  795  GLU C CG    1 
ATOM   9436  C  CD    . GLU C 2 795  ? -5.147  33.559  9.933   1.00 85.48  ?  795  GLU C CD    1 
ATOM   9437  O  OE1   . GLU C 2 795  ? -6.250  34.029  9.580   1.00 83.33  ?  795  GLU C OE1   1 
ATOM   9438  O  OE2   . GLU C 2 795  ? -4.431  32.864  9.182   1.00 82.62  ?  795  GLU C OE2   1 
ATOM   9439  N  N     . VAL C 2 796  ? -1.446  31.512  13.880  1.00 38.62  ?  796  VAL C N     1 
ATOM   9440  C  CA    . VAL C 2 796  ? -0.188  30.861  14.223  1.00 41.49  ?  796  VAL C CA    1 
ATOM   9441  C  C     . VAL C 2 796  ? -0.192  29.444  13.667  1.00 41.33  ?  796  VAL C C     1 
ATOM   9442  O  O     . VAL C 2 796  ? -1.142  28.685  13.886  1.00 36.24  ?  796  VAL C O     1 
ATOM   9443  C  CB    . VAL C 2 796  ? 0.052   30.849  15.746  1.00 34.05  ?  796  VAL C CB    1 
ATOM   9444  C  CG1   . VAL C 2 796  ? 0.466   32.232  16.223  1.00 39.94  ?  796  VAL C CG1   1 
ATOM   9445  C  CG2   . VAL C 2 796  ? -1.195  30.387  16.488  1.00 22.04  ?  796  VAL C CG2   1 
ATOM   9446  N  N     . ARG C 2 797  ? 0.865   29.097  12.938  1.00 42.04  ?  797  ARG C N     1 
ATOM   9447  C  CA    . ARG C 2 797  ? 1.089   27.733  12.493  1.00 43.06  ?  797  ARG C CA    1 
ATOM   9448  C  C     . ARG C 2 797  ? 1.875   26.973  13.558  1.00 45.70  ?  797  ARG C C     1 
ATOM   9449  O  O     . ARG C 2 797  ? 2.157   27.486  14.644  1.00 44.59  ?  797  ARG C O     1 
ATOM   9450  C  CB    . ARG C 2 797  ? 1.825   27.715  11.154  1.00 51.08  ?  797  ARG C CB    1 
ATOM   9451  C  CG    . ARG C 2 797  ? 0.977   28.090  9.950   1.00 69.25  ?  797  ARG C CG    1 
ATOM   9452  C  CD    . ARG C 2 797  ? 1.808   28.119  8.668   1.00 90.12  ?  797  ARG C CD    1 
ATOM   9453  N  NE    . ARG C 2 797  ? 2.557   26.881  8.458   1.00 93.47  ?  797  ARG C NE    1 
ATOM   9454  C  CZ    . ARG C 2 797  ? 3.859   26.744  8.693   1.00 82.35  ?  797  ARG C CZ    1 
ATOM   9455  N  NH1   . ARG C 2 797  ? 4.564   27.771  9.147   1.00 79.60  ?  797  ARG C NH1   1 
ATOM   9456  N  NH2   . ARG C 2 797  ? 4.455   25.579  8.476   1.00 67.44  ?  797  ARG C NH2   1 
ATOM   9457  N  N     . ASP C 2 798  ? 2.242   25.734  13.245  1.00 48.40  ?  798  ASP C N     1 
ATOM   9458  C  CA    . ASP C 2 798  ? 3.064   24.953  14.158  1.00 45.85  ?  798  ASP C CA    1 
ATOM   9459  C  C     . ASP C 2 798  ? 4.501   25.459  14.135  1.00 45.24  ?  798  ASP C C     1 
ATOM   9460  O  O     . ASP C 2 798  ? 5.053   25.767  13.075  1.00 47.34  ?  798  ASP C O     1 
ATOM   9461  C  CB    . ASP C 2 798  ? 3.014   23.470  13.791  1.00 41.77  ?  798  ASP C CB    1 
ATOM   9462  C  CG    . ASP C 2 798  ? 3.512   23.197  12.386  1.00 63.83  ?  798  ASP C CG    1 
ATOM   9463  O  OD1   . ASP C 2 798  ? 3.307   24.054  11.501  1.00 79.69  ?  798  ASP C OD1   1 
ATOM   9464  O  OD2   . ASP C 2 798  ? 4.111   22.122  12.168  1.00 70.02  ?  798  ASP C OD2   1 
ATOM   9465  N  N     . GLY C 2 799  ? 5.105   25.552  15.317  1.00 44.59  ?  799  GLY C N     1 
ATOM   9466  C  CA    . GLY C 2 799  ? 6.438   26.092  15.455  1.00 39.87  ?  799  GLY C CA    1 
ATOM   9467  C  C     . GLY C 2 799  ? 6.501   27.576  15.743  1.00 36.02  ?  799  GLY C C     1 
ATOM   9468  O  O     . GLY C 2 799  ? 7.568   28.069  16.133  1.00 32.53  ?  799  GLY C O     1 
ATOM   9469  N  N     . ASP C 2 800  ? 5.403   28.305  15.564  1.00 43.56  ?  800  ASP C N     1 
ATOM   9470  C  CA    . ASP C 2 800  ? 5.391   29.727  15.870  1.00 44.39  ?  800  ASP C CA    1 
ATOM   9471  C  C     . ASP C 2 800  ? 5.535   29.954  17.371  1.00 36.54  ?  800  ASP C C     1 
ATOM   9472  O  O     . ASP C 2 800  ? 5.167   29.107  18.191  1.00 35.67  ?  800  ASP C O     1 
ATOM   9473  C  CB    . ASP C 2 800  ? 4.102   30.376  15.367  1.00 47.95  ?  800  ASP C CB    1 
ATOM   9474  C  CG    . ASP C 2 800  ? 4.008   30.391  13.854  1.00 58.95  ?  800  ASP C CG    1 
ATOM   9475  O  OD1   . ASP C 2 800  ? 4.026   29.301  13.246  1.00 64.86  ?  800  ASP C OD1   1 
ATOM   9476  O  OD2   . ASP C 2 800  ? 3.910   31.493  13.273  1.00 69.62  ?  800  ASP C OD2   1 
ATOM   9477  N  N     . ILE C 2 801  ? 6.078   31.114  17.726  1.00 39.13  ?  801  ILE C N     1 
ATOM   9478  C  CA    . ILE C 2 801  ? 6.289   31.465  19.125  1.00 32.98  ?  801  ILE C CA    1 
ATOM   9479  C  C     . ILE C 2 801  ? 4.998   32.026  19.705  1.00 25.60  ?  801  ILE C C     1 
ATOM   9480  O  O     . ILE C 2 801  ? 4.426   32.983  19.171  1.00 30.42  ?  801  ILE C O     1 
ATOM   9481  C  CB    . ILE C 2 801  ? 7.441   32.472  19.266  1.00 31.50  ?  801  ILE C CB    1 
ATOM   9482  C  CG1   . ILE C 2 801  ? 8.772   31.820  18.881  1.00 42.78  ?  801  ILE C CG1   1 
ATOM   9483  C  CG2   . ILE C 2 801  ? 7.493   33.032  20.682  1.00 30.92  ?  801  ILE C CG2   1 
ATOM   9484  C  CD1   . ILE C 2 801  ? 9.969   32.735  19.032  1.00 43.68  ?  801  ILE C CD1   1 
ATOM   9485  N  N     . LEU C 2 802  ? 4.535   31.429  20.802  1.00 30.49  ?  802  LEU C N     1 
AT