data_6DWW
# 
_entry.id   6DWW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6DWW         
WWPDB D_1000234121 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6DWW 
_pdbx_database_status.recvd_initial_deposition_date   2018-06-28 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Dyda, F.'      1 ? 
'Voth, A.R.'    2 ? 
'Hickman, A.B.' 3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            46 
_citation.language                  ? 
_citation.page_first                10286 
_citation.page_last                 10301 
_citation.title                     
'Structural insights into the mechanism of double strand break formation by Hermes, a hAT family eukaryotic DNA transposase.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gky838 
_citation.pdbx_database_id_PubMed   30239795 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hickman, A.B.' 1 ? 
primary 'Voth, A.R.'    2 ? 
primary 'Ewis, H.'      3 ? 
primary 'Li, X.'        4 ? 
primary 'Craig, N.L.'   5 ? 
primary 'Dyda, F.'      6 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6DWW 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     122.480 
_cell.length_a_esd                 ? 
_cell.length_b                     136.460 
_cell.length_b_esd                 ? 
_cell.length_c                     104.610 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6DWW 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Hermes transposase'                                             59033.633 1  ? C519S ? ? 
2 polymer     syn 
;DNA (5'-D(*AP*GP*AP*GP*AP*AP*CP*AP*AP*CP*AP*AP*CP*AP*AP*G)-3')
;
4942.273  1  ? ?     ? ? 
3 polymer     syn 'DNA (25-MER)'                                                   7628.888  1  ? ?     ? ? 
4 polymer     syn 
;DNA (5'-D(*GP*CP*GP*TP*GP*AP*A)-3')
;
2162.448  1  ? ?     ? ? 
5 non-polymer syn 'MANGANESE (II) ION'                                             54.938    3  ? ?     ? ? 
6 water       nat water                                                            18.015    74 ? ?     ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GSHMSRELKTVSADCKKEAIEKCAQWVVRDCRPFSAVSGSGFIDMIKFFIKVGAEYGEHVNVEELLPSPITLSRKVTSDA
KEKKALISREIKSAVEKDGASATIDLWTDNYIKRNFLGVTLHYHENNELRDLILGLKSLDFERSTAENIYKKLKAIFSQF
NVEDLSSIKFVTDRGANVVKSLANNIRINCSSHLLSNVLENSFEETPELNMPILACKNIVKYFKKANLQHRLRSSLKSEC
PTRWNSTYTMLRSILDNWESVIQILSEAGETQRIVHINKSIIQTMVNILDGFERIFKELQTCSSPSLCFVVPSILKVKEI
CSPDVGDVADIAKLKVNIIKNVRIIWEENLSIWHYTAFFFYPPALHMQQEKVAQIKEFCLSKMEDLELINRMSSFNELSA
TQLNQSDSNSHNSIDLTSHSKPVSPSDEFEFYRKEIVILSEDFKVMEWWNLNSKKYPKLSKLALSLLSIPASSAASERTF
SLAGNIITEKRNRIGQQTVDSLLFLNSFYKNFCKLDI
;
;GSHMSRELKTVSADCKKEAIEKCAQWVVRDCRPFSAVSGSGFIDMIKFFIKVGAEYGEHVNVEELLPSPITLSRKVTSDA
KEKKALISREIKSAVEKDGASATIDLWTDNYIKRNFLGVTLHYHENNELRDLILGLKSLDFERSTAENIYKKLKAIFSQF
NVEDLSSIKFVTDRGANVVKSLANNIRINCSSHLLSNVLENSFEETPELNMPILACKNIVKYFKKANLQHRLRSSLKSEC
PTRWNSTYTMLRSILDNWESVIQILSEAGETQRIVHINKSIIQTMVNILDGFERIFKELQTCSSPSLCFVVPSILKVKEI
CSPDVGDVADIAKLKVNIIKNVRIIWEENLSIWHYTAFFFYPPALHMQQEKVAQIKEFCLSKMEDLELINRMSSFNELSA
TQLNQSDSNSHNSIDLTSHSKPVSPSDEFEFYRKEIVILSEDFKVMEWWNLNSKKYPKLSKLALSLLSIPASSAASERTF
SLAGNIITEKRNRIGQQTVDSLLFLNSFYKNFCKLDI
;
A ? 
2 polydeoxyribonucleotide no no '(DA)(DG)(DA)(DG)(DA)(DA)(DC)(DA)(DA)(DC)(DA)(DA)(DC)(DA)(DA)(DG)' AGAGAACAACAACAAG B ? 
3 polydeoxyribonucleotide no no 
;(DC)(DT)(DT)(DG)(DT)(DT)(DG)(DT)(DT)(DG)(DT)(DT)(DC)(DT)(DC)(DT)(DG)(DG)(DT)(DT)
(DC)(DA)(DC)(DG)(DC)
;
CTTGTTGTTGTTCTCTGGTTCACGC C ? 
4 polydeoxyribonucleotide no no '(DG)(DC)(DG)(DT)(DG)(DA)(DA)' GCGTGAA D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   SER n 
1 6   ARG n 
1 7   GLU n 
1 8   LEU n 
1 9   LYS n 
1 10  THR n 
1 11  VAL n 
1 12  SER n 
1 13  ALA n 
1 14  ASP n 
1 15  CYS n 
1 16  LYS n 
1 17  LYS n 
1 18  GLU n 
1 19  ALA n 
1 20  ILE n 
1 21  GLU n 
1 22  LYS n 
1 23  CYS n 
1 24  ALA n 
1 25  GLN n 
1 26  TRP n 
1 27  VAL n 
1 28  VAL n 
1 29  ARG n 
1 30  ASP n 
1 31  CYS n 
1 32  ARG n 
1 33  PRO n 
1 34  PHE n 
1 35  SER n 
1 36  ALA n 
1 37  VAL n 
1 38  SER n 
1 39  GLY n 
1 40  SER n 
1 41  GLY n 
1 42  PHE n 
1 43  ILE n 
1 44  ASP n 
1 45  MET n 
1 46  ILE n 
1 47  LYS n 
1 48  PHE n 
1 49  PHE n 
1 50  ILE n 
1 51  LYS n 
1 52  VAL n 
1 53  GLY n 
1 54  ALA n 
1 55  GLU n 
1 56  TYR n 
1 57  GLY n 
1 58  GLU n 
1 59  HIS n 
1 60  VAL n 
1 61  ASN n 
1 62  VAL n 
1 63  GLU n 
1 64  GLU n 
1 65  LEU n 
1 66  LEU n 
1 67  PRO n 
1 68  SER n 
1 69  PRO n 
1 70  ILE n 
1 71  THR n 
1 72  LEU n 
1 73  SER n 
1 74  ARG n 
1 75  LYS n 
1 76  VAL n 
1 77  THR n 
1 78  SER n 
1 79  ASP n 
1 80  ALA n 
1 81  LYS n 
1 82  GLU n 
1 83  LYS n 
1 84  LYS n 
1 85  ALA n 
1 86  LEU n 
1 87  ILE n 
1 88  SER n 
1 89  ARG n 
1 90  GLU n 
1 91  ILE n 
1 92  LYS n 
1 93  SER n 
1 94  ALA n 
1 95  VAL n 
1 96  GLU n 
1 97  LYS n 
1 98  ASP n 
1 99  GLY n 
1 100 ALA n 
1 101 SER n 
1 102 ALA n 
1 103 THR n 
1 104 ILE n 
1 105 ASP n 
1 106 LEU n 
1 107 TRP n 
1 108 THR n 
1 109 ASP n 
1 110 ASN n 
1 111 TYR n 
1 112 ILE n 
1 113 LYS n 
1 114 ARG n 
1 115 ASN n 
1 116 PHE n 
1 117 LEU n 
1 118 GLY n 
1 119 VAL n 
1 120 THR n 
1 121 LEU n 
1 122 HIS n 
1 123 TYR n 
1 124 HIS n 
1 125 GLU n 
1 126 ASN n 
1 127 ASN n 
1 128 GLU n 
1 129 LEU n 
1 130 ARG n 
1 131 ASP n 
1 132 LEU n 
1 133 ILE n 
1 134 LEU n 
1 135 GLY n 
1 136 LEU n 
1 137 LYS n 
1 138 SER n 
1 139 LEU n 
1 140 ASP n 
1 141 PHE n 
1 142 GLU n 
1 143 ARG n 
1 144 SER n 
1 145 THR n 
1 146 ALA n 
1 147 GLU n 
1 148 ASN n 
1 149 ILE n 
1 150 TYR n 
1 151 LYS n 
1 152 LYS n 
1 153 LEU n 
1 154 LYS n 
1 155 ALA n 
1 156 ILE n 
1 157 PHE n 
1 158 SER n 
1 159 GLN n 
1 160 PHE n 
1 161 ASN n 
1 162 VAL n 
1 163 GLU n 
1 164 ASP n 
1 165 LEU n 
1 166 SER n 
1 167 SER n 
1 168 ILE n 
1 169 LYS n 
1 170 PHE n 
1 171 VAL n 
1 172 THR n 
1 173 ASP n 
1 174 ARG n 
1 175 GLY n 
1 176 ALA n 
1 177 ASN n 
1 178 VAL n 
1 179 VAL n 
1 180 LYS n 
1 181 SER n 
1 182 LEU n 
1 183 ALA n 
1 184 ASN n 
1 185 ASN n 
1 186 ILE n 
1 187 ARG n 
1 188 ILE n 
1 189 ASN n 
1 190 CYS n 
1 191 SER n 
1 192 SER n 
1 193 HIS n 
1 194 LEU n 
1 195 LEU n 
1 196 SER n 
1 197 ASN n 
1 198 VAL n 
1 199 LEU n 
1 200 GLU n 
1 201 ASN n 
1 202 SER n 
1 203 PHE n 
1 204 GLU n 
1 205 GLU n 
1 206 THR n 
1 207 PRO n 
1 208 GLU n 
1 209 LEU n 
1 210 ASN n 
1 211 MET n 
1 212 PRO n 
1 213 ILE n 
1 214 LEU n 
1 215 ALA n 
1 216 CYS n 
1 217 LYS n 
1 218 ASN n 
1 219 ILE n 
1 220 VAL n 
1 221 LYS n 
1 222 TYR n 
1 223 PHE n 
1 224 LYS n 
1 225 LYS n 
1 226 ALA n 
1 227 ASN n 
1 228 LEU n 
1 229 GLN n 
1 230 HIS n 
1 231 ARG n 
1 232 LEU n 
1 233 ARG n 
1 234 SER n 
1 235 SER n 
1 236 LEU n 
1 237 LYS n 
1 238 SER n 
1 239 GLU n 
1 240 CYS n 
1 241 PRO n 
1 242 THR n 
1 243 ARG n 
1 244 TRP n 
1 245 ASN n 
1 246 SER n 
1 247 THR n 
1 248 TYR n 
1 249 THR n 
1 250 MET n 
1 251 LEU n 
1 252 ARG n 
1 253 SER n 
1 254 ILE n 
1 255 LEU n 
1 256 ASP n 
1 257 ASN n 
1 258 TRP n 
1 259 GLU n 
1 260 SER n 
1 261 VAL n 
1 262 ILE n 
1 263 GLN n 
1 264 ILE n 
1 265 LEU n 
1 266 SER n 
1 267 GLU n 
1 268 ALA n 
1 269 GLY n 
1 270 GLU n 
1 271 THR n 
1 272 GLN n 
1 273 ARG n 
1 274 ILE n 
1 275 VAL n 
1 276 HIS n 
1 277 ILE n 
1 278 ASN n 
1 279 LYS n 
1 280 SER n 
1 281 ILE n 
1 282 ILE n 
1 283 GLN n 
1 284 THR n 
1 285 MET n 
1 286 VAL n 
1 287 ASN n 
1 288 ILE n 
1 289 LEU n 
1 290 ASP n 
1 291 GLY n 
1 292 PHE n 
1 293 GLU n 
1 294 ARG n 
1 295 ILE n 
1 296 PHE n 
1 297 LYS n 
1 298 GLU n 
1 299 LEU n 
1 300 GLN n 
1 301 THR n 
1 302 CYS n 
1 303 SER n 
1 304 SER n 
1 305 PRO n 
1 306 SER n 
1 307 LEU n 
1 308 CYS n 
1 309 PHE n 
1 310 VAL n 
1 311 VAL n 
1 312 PRO n 
1 313 SER n 
1 314 ILE n 
1 315 LEU n 
1 316 LYS n 
1 317 VAL n 
1 318 LYS n 
1 319 GLU n 
1 320 ILE n 
1 321 CYS n 
1 322 SER n 
1 323 PRO n 
1 324 ASP n 
1 325 VAL n 
1 326 GLY n 
1 327 ASP n 
1 328 VAL n 
1 329 ALA n 
1 330 ASP n 
1 331 ILE n 
1 332 ALA n 
1 333 LYS n 
1 334 LEU n 
1 335 LYS n 
1 336 VAL n 
1 337 ASN n 
1 338 ILE n 
1 339 ILE n 
1 340 LYS n 
1 341 ASN n 
1 342 VAL n 
1 343 ARG n 
1 344 ILE n 
1 345 ILE n 
1 346 TRP n 
1 347 GLU n 
1 348 GLU n 
1 349 ASN n 
1 350 LEU n 
1 351 SER n 
1 352 ILE n 
1 353 TRP n 
1 354 HIS n 
1 355 TYR n 
1 356 THR n 
1 357 ALA n 
1 358 PHE n 
1 359 PHE n 
1 360 PHE n 
1 361 TYR n 
1 362 PRO n 
1 363 PRO n 
1 364 ALA n 
1 365 LEU n 
1 366 HIS n 
1 367 MET n 
1 368 GLN n 
1 369 GLN n 
1 370 GLU n 
1 371 LYS n 
1 372 VAL n 
1 373 ALA n 
1 374 GLN n 
1 375 ILE n 
1 376 LYS n 
1 377 GLU n 
1 378 PHE n 
1 379 CYS n 
1 380 LEU n 
1 381 SER n 
1 382 LYS n 
1 383 MET n 
1 384 GLU n 
1 385 ASP n 
1 386 LEU n 
1 387 GLU n 
1 388 LEU n 
1 389 ILE n 
1 390 ASN n 
1 391 ARG n 
1 392 MET n 
1 393 SER n 
1 394 SER n 
1 395 PHE n 
1 396 ASN n 
1 397 GLU n 
1 398 LEU n 
1 399 SER n 
1 400 ALA n 
1 401 THR n 
1 402 GLN n 
1 403 LEU n 
1 404 ASN n 
1 405 GLN n 
1 406 SER n 
1 407 ASP n 
1 408 SER n 
1 409 ASN n 
1 410 SER n 
1 411 HIS n 
1 412 ASN n 
1 413 SER n 
1 414 ILE n 
1 415 ASP n 
1 416 LEU n 
1 417 THR n 
1 418 SER n 
1 419 HIS n 
1 420 SER n 
1 421 LYS n 
1 422 PRO n 
1 423 VAL n 
1 424 SER n 
1 425 PRO n 
1 426 SER n 
1 427 ASP n 
1 428 GLU n 
1 429 PHE n 
1 430 GLU n 
1 431 PHE n 
1 432 TYR n 
1 433 ARG n 
1 434 LYS n 
1 435 GLU n 
1 436 ILE n 
1 437 VAL n 
1 438 ILE n 
1 439 LEU n 
1 440 SER n 
1 441 GLU n 
1 442 ASP n 
1 443 PHE n 
1 444 LYS n 
1 445 VAL n 
1 446 MET n 
1 447 GLU n 
1 448 TRP n 
1 449 TRP n 
1 450 ASN n 
1 451 LEU n 
1 452 ASN n 
1 453 SER n 
1 454 LYS n 
1 455 LYS n 
1 456 TYR n 
1 457 PRO n 
1 458 LYS n 
1 459 LEU n 
1 460 SER n 
1 461 LYS n 
1 462 LEU n 
1 463 ALA n 
1 464 LEU n 
1 465 SER n 
1 466 LEU n 
1 467 LEU n 
1 468 SER n 
1 469 ILE n 
1 470 PRO n 
1 471 ALA n 
1 472 SER n 
1 473 SER n 
1 474 ALA n 
1 475 ALA n 
1 476 SER n 
1 477 GLU n 
1 478 ARG n 
1 479 THR n 
1 480 PHE n 
1 481 SER n 
1 482 LEU n 
1 483 ALA n 
1 484 GLY n 
1 485 ASN n 
1 486 ILE n 
1 487 ILE n 
1 488 THR n 
1 489 GLU n 
1 490 LYS n 
1 491 ARG n 
1 492 ASN n 
1 493 ARG n 
1 494 ILE n 
1 495 GLY n 
1 496 GLN n 
1 497 GLN n 
1 498 THR n 
1 499 VAL n 
1 500 ASP n 
1 501 SER n 
1 502 LEU n 
1 503 LEU n 
1 504 PHE n 
1 505 LEU n 
1 506 ASN n 
1 507 SER n 
1 508 PHE n 
1 509 TYR n 
1 510 LYS n 
1 511 ASN n 
1 512 PHE n 
1 513 CYS n 
1 514 LYS n 
1 515 LEU n 
1 516 ASP n 
1 517 ILE n 
2 1   DA  n 
2 2   DG  n 
2 3   DA  n 
2 4   DG  n 
2 5   DA  n 
2 6   DA  n 
2 7   DC  n 
2 8   DA  n 
2 9   DA  n 
2 10  DC  n 
2 11  DA  n 
2 12  DA  n 
2 13  DC  n 
2 14  DA  n 
2 15  DA  n 
2 16  DG  n 
3 1   DC  n 
3 2   DT  n 
3 3   DT  n 
3 4   DG  n 
3 5   DT  n 
3 6   DT  n 
3 7   DG  n 
3 8   DT  n 
3 9   DT  n 
3 10  DG  n 
3 11  DT  n 
3 12  DT  n 
3 13  DC  n 
3 14  DT  n 
3 15  DC  n 
3 16  DT  n 
3 17  DG  n 
3 18  DG  n 
3 19  DT  n 
3 20  DT  n 
3 21  DC  n 
3 22  DA  n 
3 23  DC  n 
3 24  DG  n 
3 25  DC  n 
4 1   DG  n 
4 2   DC  n 
4 3   DG  n 
4 4   DT  n 
4 5   DG  n 
4 6   DA  n 
4 7   DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   517 
_entity_src_gen.gene_src_common_name               'House fly' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Musca domestica' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7370 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'RosettaBlue(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PET-15b 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 16 'Musca domestica' ? 7370 ? 
3 1 sample 1 25 'Musca domestica' ? 7370 ? 
4 1 sample 1 7  'Musca domestica' ? 7370 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP Q25438_MUSDO Q25438 ? 1 
;SRELKTVSADCKKEAIEKCAQWVVRDCRPFSAVSGSGFIDMIKFFIKVKAEYGEHVNVEELLPSPITLSRKVTSDAKEKK
ALISREIKSAVEKDGASATIDLWTDNYIKRNFLGVTLHYHENNELRDLILGLKSLDFERSTAENIYKKLKAIFSQFNVED
LSSIKFVTDRGANVVKSLANNIRINCSSHLLSNVLENSFEETPELNMPILACKNIVKYFKKANLQHRLRSSLKSECPTRW
NSTYTMLRSILDNWESVIQILSEAGETQRIVHINKSIIQTMVNILDGFERIFKELQTCSSPSLCFVVPSILKVKEICSPD
VGDVADIAKLKVNIIKNVRIIWEENLSIWHYTAFFFYPPALHMQQEKVAQIKEFCLSKMEDLELINRMSSFNELSATQLN
QSDSNSHNSIDLTSHSKDISTTSFFFPQLTQNNSREPPVCPSDEFEFYRKEIVILSEDFKVMEWWNLNSKKYPKLSKLAL
SLLSIPASSAASERTFSLAGNIITEKRNRIGQQTVDSLLFLNSFYKNFCKLDI
;
80 
2 PDB 6DWW         6DWW   ? 2 ? 1  
3 PDB 6DWW         6DWW   ? 3 ? 1  
4 PDB 6DWW         6DWW   ? 4 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6DWW A 5 ? 517 ? Q25438 80 ? 612 ? 80 612 
2 2 6DWW B 1 ? 16  ? 6DWW   1  ? 16  ? 1  16  
3 3 6DWW C 1 ? 25  ? 6DWW   1  ? 25  ? 1  25  
4 4 6DWW D 1 ? 7   ? 6DWW   1  ? 7   ? 1  7   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6DWW GLY A 1   ? UNP Q25438 ?   ?   'expression tag'      76  1  
1 6DWW SER A 2   ? UNP Q25438 ?   ?   'expression tag'      77  2  
1 6DWW HIS A 3   ? UNP Q25438 ?   ?   'expression tag'      78  3  
1 6DWW MET A 4   ? UNP Q25438 ?   ?   'expression tag'      79  4  
1 6DWW GLY A 53  ? UNP Q25438 LYS 128 conflict              128 5  
1 6DWW ?   A ?   ? UNP Q25438 ASP 497 deletion              ?   6  
1 6DWW ?   A ?   ? UNP Q25438 ILE 498 deletion              ?   7  
1 6DWW ?   A ?   ? UNP Q25438 SER 499 deletion              ?   8  
1 6DWW ?   A ?   ? UNP Q25438 THR 500 deletion              ?   9  
1 6DWW ?   A ?   ? UNP Q25438 THR 501 deletion              ?   10 
1 6DWW ?   A ?   ? UNP Q25438 SER 502 deletion              ?   11 
1 6DWW ?   A ?   ? UNP Q25438 PHE 503 deletion              ?   12 
1 6DWW ?   A ?   ? UNP Q25438 PHE 504 deletion              ?   13 
1 6DWW ?   A ?   ? UNP Q25438 PHE 505 deletion              ?   14 
1 6DWW ?   A ?   ? UNP Q25438 PRO 506 deletion              ?   15 
1 6DWW ?   A ?   ? UNP Q25438 GLN 507 deletion              ?   16 
1 6DWW ?   A ?   ? UNP Q25438 LEU 508 deletion              ?   17 
1 6DWW ?   A ?   ? UNP Q25438 THR 509 deletion              ?   18 
1 6DWW ?   A ?   ? UNP Q25438 GLN 510 deletion              ?   19 
1 6DWW ?   A ?   ? UNP Q25438 ASN 511 deletion              ?   20 
1 6DWW ?   A ?   ? UNP Q25438 ASN 512 deletion              ?   21 
1 6DWW ?   A ?   ? UNP Q25438 SER 513 deletion              ?   22 
1 6DWW ?   A ?   ? UNP Q25438 ARG 514 deletion              ?   23 
1 6DWW ?   A ?   ? UNP Q25438 GLU 515 deletion              ?   24 
1 6DWW ?   A ?   ? UNP Q25438 PRO 516 deletion              ?   25 
1 6DWW SER A 424 ? UNP Q25438 CYS 519 'engineered mutation' 519 26 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6DWW 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.96 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         58.44 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '50 mM MES pH 5.8-6.5, 50 mM sodium acetate, 15% PEG MME 2000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX-300' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-07-31 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5498031 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.5498031 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6DWW 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.850 
_reflns.d_resolution_low                 30.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       20430 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.310 
_reflns.pdbx_Rmerge_I_obs                0.066 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            20.4400 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.85 
_reflns_shell.d_res_low                   2.92 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1476 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.618 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6DWW 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.851 
_refine.ls_d_res_low                             29.803 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     20430 
_refine.ls_number_reflns_R_free                  920 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.28 
_refine.ls_percent_reflns_R_free                 4.50 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2020 
_refine.ls_R_factor_R_free                       0.2640 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1992 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4D1Q 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             1.00 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 30.79 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.49 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3888 
_refine_hist.pdbx_number_atoms_nucleic_acid   978 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             74 
_refine_hist.number_atoms_total               4943 
_refine_hist.d_res_high                       2.851 
_refine_hist.d_res_low                        29.803 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.004  ? 5062 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.644  ? 7030 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 18.587 ? 2898 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.039  ? 798  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 719  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.8507 3.0008  . . 119 2463 89.00  . . . 0.4199 . 0.3467 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0008 3.1886  . . 130 2799 100.00 . . . 0.3445 . 0.2741 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1886 3.4345  . . 127 2795 100.00 . . . 0.3393 . 0.2382 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4345 3.7795  . . 137 2810 100.00 . . . 0.3170 . 0.2312 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7795 4.3250  . . 135 2832 100.00 . . . 0.3007 . 0.1899 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3250 5.4436  . . 133 2852 100.00 . . . 0.2342 . 0.1669 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.4436 29.8043 . . 139 2959 100.00 . . . 0.1767 . 0.1616 . . . . . . . . . . 
# 
_struct.entry_id                     6DWW 
_struct.title                        'Hermes transposase deletion dimer complex with (A/T) DNA and Mn2+' 
_struct.pdbx_descriptor              'Hermes transposase/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6DWW 
_struct_keywords.text            'transposase, DNA BINDING PROTEIN, dna binding protein-dna complex' 
_struct_keywords.pdbx_keywords   'dna binding protein/dna' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 6 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 12  ? CYS A 31  ? SER A 87  CYS A 106 1 ? 20 
HELX_P HELX_P2  AA2 PRO A 33  ? SER A 38  ? PRO A 108 SER A 113 5 ? 6  
HELX_P HELX_P3  AA3 GLY A 39  ? GLY A 57  ? GLY A 114 GLY A 132 1 ? 19 
HELX_P HELX_P4  AA4 ASN A 61  ? LEU A 66  ? ASN A 136 LEU A 141 1 ? 6  
HELX_P HELX_P5  AA5 SER A 68  ? ILE A 87  ? SER A 143 ILE A 162 1 ? 20 
HELX_P HELX_P6  AA6 ILE A 87  ? LYS A 97  ? ILE A 162 LYS A 172 1 ? 11 
HELX_P HELX_P7  AA7 THR A 145 ? SER A 158 ? THR A 220 SER A 233 1 ? 14 
HELX_P HELX_P8  AA8 GLN A 159 ? ASN A 161 ? GLN A 234 ASN A 236 5 ? 3  
HELX_P HELX_P9  AA9 GLY A 175 ? LEU A 182 ? GLY A 250 LEU A 257 1 ? 8  
HELX_P HELX_P10 AB1 ALA A 183 ? ASN A 185 ? ALA A 258 ASN A 260 5 ? 3  
HELX_P HELX_P11 AB2 CYS A 190 ? GLU A 205 ? CYS A 265 GLU A 280 1 ? 16 
HELX_P HELX_P12 AB3 THR A 206 ? GLU A 208 ? THR A 281 GLU A 283 5 ? 3  
HELX_P HELX_P13 AB4 LEU A 209 ? ALA A 226 ? LEU A 284 ALA A 301 1 ? 18 
HELX_P HELX_P14 AB5 LEU A 228 ? LEU A 232 ? LEU A 303 LEU A 307 5 ? 5  
HELX_P HELX_P15 AB6 ASN A 245 ? ASP A 256 ? ASN A 320 ASP A 331 1 ? 12 
HELX_P HELX_P16 AB7 ASN A 257 ? ALA A 268 ? ASN A 332 ALA A 343 1 ? 12 
HELX_P HELX_P17 AB8 GLU A 270 ? ILE A 274 ? GLU A 345 ILE A 349 5 ? 5  
HELX_P HELX_P18 AB9 ASN A 278 ? GLN A 300 ? ASN A 353 GLN A 375 1 ? 23 
HELX_P HELX_P19 AC1 SER A 306 ? CYS A 308 ? SER A 381 CYS A 383 5 ? 3  
HELX_P HELX_P20 AC2 PHE A 309 ? CYS A 321 ? PHE A 384 CYS A 396 1 ? 13 
HELX_P HELX_P21 AC3 VAL A 328 ? ILE A 345 ? VAL A 403 ILE A 420 1 ? 18 
HELX_P HELX_P22 AC4 TRP A 346 ? LEU A 350 ? TRP A 421 LEU A 425 5 ? 5  
HELX_P HELX_P23 AC5 SER A 351 ? PHE A 360 ? SER A 426 PHE A 435 1 ? 10 
HELX_P HELX_P24 AC6 LEU A 365 ? GLN A 369 ? LEU A 440 GLN A 444 5 ? 5  
HELX_P HELX_P25 AC7 LYS A 371 ? SER A 393 ? LYS A 446 SER A 468 1 ? 23 
HELX_P HELX_P26 AC8 SER A 424 ? ARG A 433 ? SER A 519 ARG A 528 1 ? 10 
HELX_P HELX_P27 AC9 LYS A 444 ? LEU A 451 ? LYS A 539 LEU A 546 1 ? 8  
HELX_P HELX_P28 AD1 LYS A 458 ? LEU A 467 ? LYS A 553 LEU A 562 1 ? 10 
HELX_P HELX_P29 AD2 SER A 473 ? ILE A 487 ? SER A 568 ILE A 582 1 ? 15 
HELX_P HELX_P30 AD3 GLY A 495 ? PHE A 512 ? GLY A 590 PHE A 607 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 105 OD1   ? ? ? 1_555 E MN  .  MN ? ? A ASP 180 A MN  701 1_555 ? ? ? ? ? ? ?            2.572 ? 
metalc2  metalc ? ? A ASP 173 OD2   ? ? ? 1_555 E MN  .  MN ? ? A ASP 248 A MN  701 1_555 ? ? ? ? ? ? ?            2.516 ? 
metalc3  metalc ? ? A GLU 477 OE1   ? ? ? 1_555 F MN  .  MN ? ? A GLU 572 A MN  702 1_555 ? ? ? ? ? ? ?            2.685 ? 
metalc4  metalc ? ? C DG  17  OP2   ? ? ? 1_555 G MN  .  MN ? ? C DG  17  C MN  101 1_555 ? ? ? ? ? ? ?            2.411 ? 
metalc5  metalc ? ? C DG  18  OP2   ? ? ? 1_555 E MN  .  MN ? ? C DG  18  A MN  701 1_555 ? ? ? ? ? ? ?            2.411 ? 
metalc6  metalc ? ? C DG  18  OP2   ? ? ? 1_555 F MN  .  MN ? ? C DG  18  A MN  702 1_555 ? ? ? ? ? ? ?            2.783 ? 
metalc7  metalc ? ? D DA  7   "O3'" ? ? ? 1_555 E MN  .  MN ? ? D DA  7   A MN  701 1_555 ? ? ? ? ? ? ?            2.642 ? 
metalc8  metalc ? ? E MN  .   MN    ? ? ? 1_555 H HOH .  O  ? ? A MN  701 A HOH 806 1_555 ? ? ? ? ? ? ?            2.181 ? 
metalc9  metalc ? ? E MN  .   MN    ? ? ? 1_555 H HOH .  O  ? ? A MN  701 A HOH 827 1_555 ? ? ? ? ? ? ?            2.181 ? 
metalc10 metalc ? ? F MN  .   MN    ? ? ? 1_555 J HOH .  O  ? ? A MN  702 C HOH 204 1_555 ? ? ? ? ? ? ?            2.183 ? 
metalc11 metalc ? ? G MN  .   MN    ? ? ? 1_555 J HOH .  O  ? ? C MN  101 C HOH 203 1_555 ? ? ? ? ? ? ?            2.176 ? 
hydrog1  hydrog ? ? B DA  1   N1    ? ? ? 1_555 C DT  16 N3 ? ? B DA  1   C DT  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DA  1   N6    ? ? ? 1_555 C DT  16 O4 ? ? B DA  1   C DT  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DG  2   N1    ? ? ? 1_555 C DC  15 N3 ? ? B DG  2   C DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  2   N2    ? ? ? 1_555 C DC  15 O2 ? ? B DG  2   C DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  2   O6    ? ? ? 1_555 C DC  15 N4 ? ? B DG  2   C DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DA  3   N1    ? ? ? 1_555 C DT  14 N3 ? ? B DA  3   C DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DA  3   N6    ? ? ? 1_555 C DT  14 O4 ? ? B DA  3   C DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  4   N1    ? ? ? 1_555 C DC  13 N3 ? ? B DG  4   C DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  4   N2    ? ? ? 1_555 C DC  13 O2 ? ? B DG  4   C DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DG  4   O6    ? ? ? 1_555 C DC  13 N4 ? ? B DG  4   C DC  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  12 N3 ? ? B DA  5   C DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  12 O4 ? ? B DA  5   C DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DA  6   N1    ? ? ? 1_555 C DT  11 N3 ? ? B DA  6   C DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DA  6   N6    ? ? ? 1_555 C DT  11 O4 ? ? B DA  6   C DT  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DC  7   N3    ? ? ? 1_555 C DG  10 N1 ? ? B DC  7   C DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  7   N4    ? ? ? 1_555 C DG  10 O6 ? ? B DC  7   C DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  7   O2    ? ? ? 1_555 C DG  10 N2 ? ? B DC  7   C DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  9  N3 ? ? B DA  8   C DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  9  O4 ? ? B DA  8   C DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DA  9   N1    ? ? ? 1_555 C DT  8  N3 ? ? B DA  9   C DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DA  9   N6    ? ? ? 1_555 C DT  8  O4 ? ? B DA  9   C DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DC  10  N3    ? ? ? 1_555 C DG  7  N1 ? ? B DC  10  C DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DC  10  N4    ? ? ? 1_555 C DG  7  O6 ? ? B DC  10  C DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DC  10  O2    ? ? ? 1_555 C DG  7  N2 ? ? B DC  10  C DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DA  11  N1    ? ? ? 1_555 C DT  6  N3 ? ? B DA  11  C DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DA  11  N6    ? ? ? 1_555 C DT  6  O4 ? ? B DA  11  C DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DA  12  N1    ? ? ? 1_555 C DT  5  N3 ? ? B DA  12  C DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DA  12  N6    ? ? ? 1_555 C DT  5  O4 ? ? B DA  12  C DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DC  13  N3    ? ? ? 1_555 C DG  4  N1 ? ? B DC  13  C DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DC  13  N4    ? ? ? 1_555 C DG  4  O6 ? ? B DC  13  C DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DC  13  O2    ? ? ? 1_555 C DG  4  N2 ? ? B DC  13  C DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DA  14  N1    ? ? ? 1_555 C DT  3  N3 ? ? B DA  14  C DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DA  14  N6    ? ? ? 1_555 C DT  3  O4 ? ? B DA  14  C DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DA  15  N1    ? ? ? 1_555 C DT  2  N3 ? ? B DA  15  C DT  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? B DA  15  N6    ? ? ? 1_555 C DT  2  O4 ? ? B DA  15  C DT  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? B DG  16  N2    ? ? ? 1_555 C DC  1  N3 ? ? B DG  16  C DC  1   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog37 hydrog ? ? C DT  20  N3    ? ? ? 1_555 D DA  6  N1 ? ? C DT  20  D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? C DT  20  O4    ? ? ? 1_555 D DA  6  N6 ? ? C DT  20  D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? C DC  21  N3    ? ? ? 1_555 D DG  5  N1 ? ? C DC  21  D DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? C DC  21  N4    ? ? ? 1_555 D DG  5  O6 ? ? C DC  21  D DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? C DC  21  O2    ? ? ? 1_555 D DG  5  N2 ? ? C DC  21  D DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? C DA  22  N1    ? ? ? 1_555 D DT  4  N3 ? ? C DA  22  D DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? C DA  22  N6    ? ? ? 1_555 D DT  4  O4 ? ? C DA  22  D DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? C DC  23  N3    ? ? ? 1_555 D DG  3  N1 ? ? C DC  23  D DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? C DC  23  N4    ? ? ? 1_555 D DG  3  O6 ? ? C DC  23  D DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? C DC  23  O2    ? ? ? 1_555 D DG  3  N2 ? ? C DC  23  D DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? C DG  24  N1    ? ? ? 1_555 D DC  2  N3 ? ? C DG  24  D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? C DG  24  N2    ? ? ? 1_555 D DC  2  O2 ? ? C DG  24  D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? C DG  24  O6    ? ? ? 1_555 D DC  2  N4 ? ? C DG  24  D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? C DC  25  N3    ? ? ? 1_555 D DG  1  N1 ? ? C DC  25  D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? C DC  25  N4    ? ? ? 1_555 D DG  1  O6 ? ? C DC  25  D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52 hydrog ? ? C DC  25  O2    ? ? ? 1_555 D DG  1  N2 ? ? C DC  25  D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 129 ? SER A 138 ? LEU A 204 SER A 213 
AA1 2 ASN A 115 ? HIS A 124 ? ASN A 190 HIS A 199 
AA1 3 ALA A 100 ? THR A 108 ? ALA A 175 THR A 183 
AA1 4 LYS A 169 ? THR A 172 ? LYS A 244 THR A 247 
AA1 5 ILE A 186 ? ASN A 189 ? ILE A 261 ASN A 264 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ARG A 130 ? O ARG A 205 N TYR A 123 ? N TYR A 198 
AA1 2 3 O PHE A 116 ? O PHE A 191 N TRP A 107 ? N TRP A 182 
AA1 3 4 N ALA A 102 ? N ALA A 177 O LYS A 169 ? O LYS A 244 
AA1 4 5 N PHE A 170 ? N PHE A 245 O ILE A 188 ? O ILE A 263 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MN 701 ? 6 'binding site for residue MN A 701' 
AC2 Software A MN 702 ? 5 'binding site for residue MN A 702' 
AC3 Software C MN 101 ? 5 'binding site for residue MN C 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 105 ? ASP A 180 . ? 1_555 ? 
2  AC1 6 ASP A 173 ? ASP A 248 . ? 1_555 ? 
3  AC1 6 HOH H .   ? HOH A 806 . ? 1_555 ? 
4  AC1 6 HOH H .   ? HOH A 827 . ? 1_555 ? 
5  AC1 6 DG  C 18  ? DG  C 18  . ? 1_555 ? 
6  AC1 6 DA  D 7   ? DA  D 7   . ? 1_555 ? 
7  AC2 5 ASP A 105 ? ASP A 180 . ? 1_555 ? 
8  AC2 5 GLU A 477 ? GLU A 572 . ? 1_555 ? 
9  AC2 5 DG  C 17  ? DG  C 17  . ? 1_555 ? 
10 AC2 5 DG  C 18  ? DG  C 18  . ? 1_555 ? 
11 AC2 5 HOH J .   ? HOH C 204 . ? 1_555 ? 
12 AC3 5 ASN A 110 ? ASN A 185 . ? 1_555 ? 
13 AC3 5 DT  C 16  ? DT  C 16  . ? 1_555 ? 
14 AC3 5 DG  C 17  ? DG  C 17  . ? 1_555 ? 
15 AC3 5 DG  C 18  ? DG  C 18  . ? 1_555 ? 
16 AC3 5 HOH J .   ? HOH C 203 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6DWW 
_atom_sites.fract_transf_matrix[1][1]   0.008165 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007328 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009559 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ARG A 1 6   ? -11.215 67.455  36.671 1.00 90.54  ? 81  ARG A N     1 
ATOM   2    C  CA    . ARG A 1 6   ? -10.509 67.972  35.501 1.00 115.31 ? 81  ARG A CA    1 
ATOM   3    C  C     . ARG A 1 6   ? -10.142 69.447  35.655 1.00 122.21 ? 81  ARG A C     1 
ATOM   4    O  O     . ARG A 1 6   ? -8.973  69.784  35.837 1.00 131.84 ? 81  ARG A O     1 
ATOM   5    C  CB    . ARG A 1 6   ? -11.349 67.777  34.239 1.00 120.31 ? 81  ARG A CB    1 
ATOM   6    C  CG    . ARG A 1 6   ? -10.748 68.413  32.995 1.00 121.79 ? 81  ARG A CG    1 
ATOM   7    C  CD    . ARG A 1 6   ? -11.398 67.873  31.737 1.00 124.57 ? 81  ARG A CD    1 
ATOM   8    N  NE    . ARG A 1 6   ? -11.343 66.416  31.701 1.00 118.42 ? 81  ARG A NE    1 
ATOM   9    C  CZ    . ARG A 1 6   ? -10.259 65.719  31.375 1.00 119.87 ? 81  ARG A CZ    1 
ATOM   10   N  NH1   . ARG A 1 6   ? -9.136  66.347  31.054 1.00 121.85 ? 81  ARG A NH1   1 
ATOM   11   N  NH2   . ARG A 1 6   ? -10.297 64.394  31.372 1.00 114.09 ? 81  ARG A NH2   1 
ATOM   12   N  N     . GLU A 1 7   ? -11.141 70.323  35.573 1.00 119.17 ? 82  GLU A N     1 
ATOM   13   C  CA    . GLU A 1 7   ? -10.920 71.763  35.701 1.00 110.45 ? 82  GLU A CA    1 
ATOM   14   C  C     . GLU A 1 7   ? -10.482 72.071  37.126 1.00 123.55 ? 82  GLU A C     1 
ATOM   15   O  O     . GLU A 1 7   ? -11.309 72.216  38.029 1.00 126.52 ? 82  GLU A O     1 
ATOM   16   C  CB    . GLU A 1 7   ? -12.184 72.528  35.329 1.00 120.15 ? 82  GLU A CB    1 
ATOM   17   C  CG    . GLU A 1 7   ? -12.573 72.358  33.878 1.00 122.05 ? 82  GLU A CG    1 
ATOM   18   C  CD    . GLU A 1 7   ? -11.416 72.650  32.948 1.00 136.43 ? 82  GLU A CD    1 
ATOM   19   O  OE1   . GLU A 1 7   ? -11.012 73.829  32.851 1.00 148.37 ? 82  GLU A OE1   1 
ATOM   20   O  OE2   . GLU A 1 7   ? -10.894 71.698  32.330 1.00 140.08 ? 82  GLU A OE2   1 
ATOM   21   N  N     . LEU A 1 8   ? -9.170  72.179  37.327 1.00 116.82 ? 83  LEU A N     1 
ATOM   22   C  CA    . LEU A 1 8   ? -8.611  72.329  38.664 1.00 111.25 ? 83  LEU A CA    1 
ATOM   23   C  C     . LEU A 1 8   ? -8.855  73.735  39.199 1.00 110.76 ? 83  LEU A C     1 
ATOM   24   O  O     . LEU A 1 8   ? -8.567  74.729  38.524 1.00 112.42 ? 83  LEU A O     1 
ATOM   25   C  CB    . LEU A 1 8   ? -7.116  72.014  38.649 1.00 115.70 ? 83  LEU A CB    1 
ATOM   26   C  CG    . LEU A 1 8   ? -6.775  70.559  38.323 1.00 103.85 ? 83  LEU A CG    1 
ATOM   27   C  CD1   . LEU A 1 8   ? -5.284  70.313  38.465 1.00 109.09 ? 83  LEU A CD1   1 
ATOM   28   C  CD2   . LEU A 1 8   ? -7.570  69.618  39.218 1.00 102.79 ? 83  LEU A CD2   1 
ATOM   29   N  N     . LYS A 1 9   ? -9.383  73.812  40.418 1.00 104.74 ? 84  LYS A N     1 
ATOM   30   C  CA    . LYS A 1 9   ? -9.735  75.087  41.020 1.00 106.85 ? 84  LYS A CA    1 
ATOM   31   C  C     . LYS A 1 9   ? -8.495  75.791  41.554 1.00 102.94 ? 84  LYS A C     1 
ATOM   32   O  O     . LYS A 1 9   ? -7.594  75.161  42.118 1.00 112.29 ? 84  LYS A O     1 
ATOM   33   C  CB    . LYS A 1 9   ? -10.742 74.882  42.152 1.00 97.21  ? 84  LYS A CB    1 
ATOM   34   C  CG    . LYS A 1 9   ? -11.508 73.571  42.072 1.00 89.21  ? 84  LYS A CG    1 
ATOM   35   C  CD    . LYS A 1 9   ? -12.329 73.321  43.327 1.00 82.46  ? 84  LYS A CD    1 
ATOM   36   C  CE    . LYS A 1 9   ? -12.858 71.892  43.367 1.00 97.64  ? 84  LYS A CE    1 
ATOM   37   N  NZ    . LYS A 1 9   ? -13.768 71.577  42.231 1.00 130.22 ? 84  LYS A NZ    1 
ATOM   38   N  N     . THR A 1 10  ? -8.452  77.106  41.361 1.00 92.97  ? 85  THR A N     1 
ATOM   39   C  CA    . THR A 1 10  ? -7.429  77.946  41.964 1.00 110.29 ? 85  THR A CA    1 
ATOM   40   C  C     . THR A 1 10  ? -7.932  78.458  43.307 1.00 110.21 ? 85  THR A C     1 
ATOM   41   O  O     . THR A 1 10  ? -9.097  78.852  43.435 1.00 122.81 ? 85  THR A O     1 
ATOM   42   C  CB    . THR A 1 10  ? -7.076  79.116  41.040 1.00 111.71 ? 85  THR A CB    1 
ATOM   43   O  OG1   . THR A 1 10  ? -6.384  78.620  39.886 1.00 117.06 ? 85  THR A OG1   1 
ATOM   44   C  CG2   . THR A 1 10  ? -6.197  80.130  41.765 1.00 113.20 ? 85  THR A CG2   1 
ATOM   45   N  N     . VAL A 1 11  ? -7.057  78.429  44.313 1.00 105.35 ? 86  VAL A N     1 
ATOM   46   C  CA    . VAL A 1 11  ? -7.459  78.853  45.644 1.00 95.00  ? 86  VAL A CA    1 
ATOM   47   C  C     . VAL A 1 11  ? -7.466  80.376  45.734 1.00 95.89  ? 86  VAL A C     1 
ATOM   48   O  O     . VAL A 1 11  ? -6.888  81.088  44.904 1.00 94.66  ? 86  VAL A O     1 
ATOM   49   C  CB    . VAL A 1 11  ? -6.546  78.238  46.714 1.00 93.66  ? 86  VAL A CB    1 
ATOM   50   C  CG1   . VAL A 1 11  ? -6.711  76.729  46.743 1.00 77.62  ? 86  VAL A CG1   1 
ATOM   51   C  CG2   . VAL A 1 11  ? -5.103  78.616  46.452 1.00 91.86  ? 86  VAL A CG2   1 
ATOM   52   N  N     . SER A 1 12  ? -8.138  80.881  46.766 1.00 82.20  ? 87  SER A N     1 
ATOM   53   C  CA    . SER A 1 12  ? -8.199  82.316  46.999 1.00 82.37  ? 87  SER A CA    1 
ATOM   54   C  C     . SER A 1 12  ? -6.825  82.854  47.374 1.00 89.29  ? 87  SER A C     1 
ATOM   55   O  O     . SER A 1 12  ? -6.016  82.172  48.009 1.00 93.00  ? 87  SER A O     1 
ATOM   56   C  CB    . SER A 1 12  ? -9.204  82.634  48.105 1.00 92.87  ? 87  SER A CB    1 
ATOM   57   O  OG    . SER A 1 12  ? -8.850  81.995  49.319 1.00 80.39  ? 87  SER A OG    1 
ATOM   58   N  N     . ALA A 1 13  ? -6.564  84.100  46.971 1.00 92.15  ? 88  ALA A N     1 
ATOM   59   C  CA    . ALA A 1 13  ? -5.280  84.722  47.279 1.00 87.19  ? 88  ALA A CA    1 
ATOM   60   C  C     . ALA A 1 13  ? -5.063  84.846  48.780 1.00 87.55  ? 88  ALA A C     1 
ATOM   61   O  O     . ALA A 1 13  ? -3.917  84.840  49.245 1.00 100.11 ? 88  ALA A O     1 
ATOM   62   C  CB    . ALA A 1 13  ? -5.185  86.096  46.616 1.00 87.98  ? 88  ALA A CB    1 
ATOM   63   N  N     . ASP A 1 14  ? -6.146  84.959  49.551 1.00 99.58  ? 89  ASP A N     1 
ATOM   64   C  CA    . ASP A 1 14  ? -6.021  84.953  51.003 1.00 107.44 ? 89  ASP A CA    1 
ATOM   65   C  C     . ASP A 1 14  ? -5.607  83.579  51.520 1.00 105.82 ? 89  ASP A C     1 
ATOM   66   O  O     . ASP A 1 14  ? -5.002  83.478  52.594 1.00 98.97  ? 89  ASP A O     1 
ATOM   67   C  CB    . ASP A 1 14  ? -7.338  85.401  51.641 1.00 117.72 ? 89  ASP A CB    1 
ATOM   68   C  CG    . ASP A 1 14  ? -7.735  86.815  51.233 1.00 126.78 ? 89  ASP A CG    1 
ATOM   69   O  OD1   . ASP A 1 14  ? -8.948  87.078  51.070 1.00 121.76 ? 89  ASP A OD1   1 
ATOM   70   O  OD2   . ASP A 1 14  ? -6.832  87.663  51.076 1.00 114.66 ? 89  ASP A OD2   1 
ATOM   71   N  N     . CYS A 1 15  ? -5.916  82.517  50.775 1.00 101.96 ? 90  CYS A N     1 
ATOM   72   C  CA    . CYS A 1 15  ? -5.472  81.172  51.116 1.00 88.14  ? 90  CYS A CA    1 
ATOM   73   C  C     . CYS A 1 15  ? -4.167  80.790  50.430 1.00 95.63  ? 90  CYS A C     1 
ATOM   74   O  O     . CYS A 1 15  ? -3.560  79.783  50.811 1.00 96.13  ? 90  CYS A O     1 
ATOM   75   C  CB    . CYS A 1 15  ? -6.555  80.143  50.757 1.00 85.93  ? 90  CYS A CB    1 
ATOM   76   S  SG    . CYS A 1 15  ? -7.092  79.066  52.125 1.00 86.49  ? 90  CYS A SG    1 
ATOM   77   N  N     . LYS A 1 16  ? -3.718  81.562  49.436 1.00 95.25  ? 91  LYS A N     1 
ATOM   78   C  CA    . LYS A 1 16  ? -2.479  81.246  48.734 1.00 73.20  ? 91  LYS A CA    1 
ATOM   79   C  C     . LYS A 1 16  ? -1.270  81.929  49.359 1.00 72.47  ? 91  LYS A C     1 
ATOM   80   O  O     . LYS A 1 16  ? -0.179  81.350  49.380 1.00 77.03  ? 91  LYS A O     1 
ATOM   81   C  CB    . LYS A 1 16  ? -2.583  81.632  47.256 1.00 83.87  ? 91  LYS A CB    1 
ATOM   82   C  CG    . LYS A 1 16  ? -1.473  81.038  46.399 1.00 86.11  ? 91  LYS A CG    1 
ATOM   83   C  CD    . LYS A 1 16  ? -1.647  81.354  44.921 1.00 99.88  ? 91  LYS A CD    1 
ATOM   84   C  CE    . LYS A 1 16  ? -0.891  82.615  44.525 1.00 102.21 ? 91  LYS A CE    1 
ATOM   85   N  NZ    . LYS A 1 16  ? -0.962  82.868  43.056 1.00 101.20 ? 91  LYS A NZ    1 
ATOM   86   N  N     . LYS A 1 17  ? -1.435  83.157  49.861 1.00 83.79  ? 92  LYS A N     1 
ATOM   87   C  CA    . LYS A 1 17  ? -0.352  83.786  50.609 1.00 73.75  ? 92  LYS A CA    1 
ATOM   88   C  C     . LYS A 1 17  ? -0.012  82.989  51.861 1.00 76.36  ? 92  LYS A C     1 
ATOM   89   O  O     . LYS A 1 17  ? 1.155   82.927  52.260 1.00 87.03  ? 92  LYS A O     1 
ATOM   90   C  CB    . LYS A 1 17  ? -0.719  85.223  50.982 1.00 69.31  ? 92  LYS A CB    1 
ATOM   91   C  CG    . LYS A 1 17  ? 0.305   85.896  51.896 1.00 94.18  ? 92  LYS A CG    1 
ATOM   92   C  CD    . LYS A 1 17  ? 1.701   85.883  51.270 1.00 107.67 ? 92  LYS A CD    1 
ATOM   93   C  CE    . LYS A 1 17  ? 2.815   85.807  52.320 1.00 100.16 ? 92  LYS A CE    1 
ATOM   94   N  NZ    . LYS A 1 17  ? 3.116   87.111  52.980 1.00 107.82 ? 92  LYS A NZ    1 
ATOM   95   N  N     . GLU A 1 18  ? -1.008  82.364  52.487 1.00 75.22  ? 93  GLU A N     1 
ATOM   96   C  CA    . GLU A 1 18  ? -0.731  81.536  53.652 1.00 80.62  ? 93  GLU A CA    1 
ATOM   97   C  C     . GLU A 1 18  ? 0.032   80.271  53.285 1.00 72.90  ? 93  GLU A C     1 
ATOM   98   O  O     . GLU A 1 18  ? 0.714   79.702  54.144 1.00 69.76  ? 93  GLU A O     1 
ATOM   99   C  CB    . GLU A 1 18  ? -2.036  81.178  54.366 1.00 94.89  ? 93  GLU A CB    1 
ATOM   100  C  CG    . GLU A 1 18  ? -1.860  80.746  55.813 1.00 101.27 ? 93  GLU A CG    1 
ATOM   101  C  CD    . GLU A 1 18  ? -3.168  80.758  56.583 1.00 126.69 ? 93  GLU A CD    1 
ATOM   102  O  OE1   . GLU A 1 18  ? -4.233  80.572  55.954 1.00 122.64 ? 93  GLU A OE1   1 
ATOM   103  O  OE2   . GLU A 1 18  ? -3.131  80.965  57.815 1.00 140.38 ? 93  GLU A OE2   1 
ATOM   104  N  N     . ALA A 1 19  ? -0.057  79.821  52.032 1.00 72.03  ? 94  ALA A N     1 
ATOM   105  C  CA    . ALA A 1 19  ? 0.697   78.645  51.617 1.00 62.55  ? 94  ALA A CA    1 
ATOM   106  C  C     . ALA A 1 19  ? 2.175   78.954  51.422 1.00 74.28  ? 94  ALA A C     1 
ATOM   107  O  O     . ALA A 1 19  ? 3.022   78.103  51.711 1.00 69.10  ? 94  ALA A O     1 
ATOM   108  C  CB    . ALA A 1 19  ? 0.112   78.063  50.332 1.00 59.79  ? 94  ALA A CB    1 
ATOM   109  N  N     . ILE A 1 20  ? 2.513   80.151  50.933 1.00 68.89  ? 95  ILE A N     1 
ATOM   110  C  CA    . ILE A 1 20  ? 3.925   80.515  50.830 1.00 68.97  ? 95  ILE A CA    1 
ATOM   111  C  C     . ILE A 1 20  ? 4.493   80.933  52.174 1.00 68.29  ? 95  ILE A C     1 
ATOM   112  O  O     . ILE A 1 20  ? 5.709   81.129  52.289 1.00 84.53  ? 95  ILE A O     1 
ATOM   113  C  CB    . ILE A 1 20  ? 4.148   81.619  49.775 1.00 69.84  ? 95  ILE A CB    1 
ATOM   114  C  CG1   . ILE A 1 20  ? 4.062   83.013  50.391 1.00 75.58  ? 95  ILE A CG1   1 
ATOM   115  C  CG2   . ILE A 1 20  ? 3.126   81.501  48.655 1.00 75.26  ? 95  ILE A CG2   1 
ATOM   116  C  CD1   . ILE A 1 20  ? 4.262   84.117  49.377 1.00 64.86  ? 95  ILE A CD1   1 
ATOM   117  N  N     . GLU A 1 21  ? 3.650   81.063  53.198 1.00 72.58  ? 96  GLU A N     1 
ATOM   118  C  CA    . GLU A 1 21  ? 4.123   81.332  54.549 1.00 70.42  ? 96  GLU A CA    1 
ATOM   119  C  C     . GLU A 1 21  ? 4.420   80.047  55.308 1.00 63.06  ? 96  GLU A C     1 
ATOM   120  O  O     . GLU A 1 21  ? 5.382   79.994  56.080 1.00 78.64  ? 96  GLU A O     1 
ATOM   121  C  CB    . GLU A 1 21  ? 3.100   82.169  55.324 1.00 77.07  ? 96  GLU A CB    1 
ATOM   122  C  CG    . GLU A 1 21  ? 3.575   83.583  55.646 1.00 99.72  ? 96  GLU A CG    1 
ATOM   123  C  CD    . GLU A 1 21  ? 2.791   84.227  56.777 1.00 107.47 ? 96  GLU A CD    1 
ATOM   124  O  OE1   . GLU A 1 21  ? 1.653   83.784  57.047 1.00 112.88 ? 96  GLU A OE1   1 
ATOM   125  O  OE2   . GLU A 1 21  ? 3.318   85.172  57.403 1.00 92.89  ? 96  GLU A OE2   1 
ATOM   126  N  N     . LYS A 1 22  ? 3.609   79.009  55.108 1.00 58.80  ? 97  LYS A N     1 
ATOM   127  C  CA    . LYS A 1 22  ? 3.888   77.718  55.725 1.00 65.00  ? 97  LYS A CA    1 
ATOM   128  C  C     . LYS A 1 22  ? 5.013   76.972  55.019 1.00 61.74  ? 97  LYS A C     1 
ATOM   129  O  O     . LYS A 1 22  ? 5.687   76.150  55.654 1.00 56.35  ? 97  LYS A O     1 
ATOM   130  C  CB    . LYS A 1 22  ? 2.619   76.855  55.754 1.00 50.77  ? 97  LYS A CB    1 
ATOM   131  C  CG    . LYS A 1 22  ? 1.393   77.536  56.373 1.00 74.36  ? 97  LYS A CG    1 
ATOM   132  C  CD    . LYS A 1 22  ? 1.124   77.091  57.814 1.00 67.32  ? 97  LYS A CD    1 
ATOM   133  C  CE    . LYS A 1 22  ? 1.395   78.205  58.825 1.00 62.05  ? 97  LYS A CE    1 
ATOM   134  N  NZ    . LYS A 1 22  ? 0.625   79.453  58.545 1.00 90.32  ? 97  LYS A NZ    1 
ATOM   135  N  N     . CYS A 1 23  ? 5.230   77.236  53.726 1.00 63.93  ? 98  CYS A N     1 
ATOM   136  C  CA    . CYS A 1 23  ? 6.363   76.636  53.027 1.00 47.18  ? 98  CYS A CA    1 
ATOM   137  C  C     . CYS A 1 23  ? 7.673   77.300  53.433 1.00 61.64  ? 98  CYS A C     1 
ATOM   138  O  O     . CYS A 1 23  ? 8.682   76.618  53.650 1.00 54.29  ? 98  CYS A O     1 
ATOM   139  C  CB    . CYS A 1 23  ? 6.163   76.727  51.515 1.00 43.69  ? 98  CYS A CB    1 
ATOM   140  S  SG    . CYS A 1 23  ? 4.942   75.566  50.837 1.00 68.59  ? 98  CYS A SG    1 
ATOM   141  N  N     . ALA A 1 24  ? 7.674   78.629  53.551 1.00 47.85  ? 99  ALA A N     1 
ATOM   142  C  CA    . ALA A 1 24  ? 8.881   79.326  53.978 1.00 49.24  ? 99  ALA A CA    1 
ATOM   143  C  C     . ALA A 1 24  ? 9.303   78.901  55.378 1.00 50.37  ? 99  ALA A C     1 
ATOM   144  O  O     . ALA A 1 24  ? 10.500  78.778  55.662 1.00 53.25  ? 99  ALA A O     1 
ATOM   145  C  CB    . ALA A 1 24  ? 8.665   80.837  53.921 1.00 54.52  ? 99  ALA A CB    1 
ATOM   146  N  N     . GLN A 1 25  ? 8.333   78.667  56.267 1.00 57.59  ? 100 GLN A N     1 
ATOM   147  C  CA    . GLN A 1 25  ? 8.658   78.254  57.629 1.00 58.64  ? 100 GLN A CA    1 
ATOM   148  C  C     . GLN A 1 25  ? 9.154   76.817  57.695 1.00 49.53  ? 100 GLN A C     1 
ATOM   149  O  O     . GLN A 1 25  ? 9.896   76.473  58.620 1.00 50.88  ? 100 GLN A O     1 
ATOM   150  C  CB    . GLN A 1 25  ? 7.445   78.438  58.543 1.00 51.38  ? 100 GLN A CB    1 
ATOM   151  C  CG    . GLN A 1 25  ? 7.112   79.896  58.818 1.00 68.80  ? 100 GLN A CG    1 
ATOM   152  C  CD    . GLN A 1 25  ? 5.854   80.072  59.650 1.00 90.95  ? 100 GLN A CD    1 
ATOM   153  O  OE1   . GLN A 1 25  ? 5.165   79.102  59.974 1.00 102.61 ? 100 GLN A OE1   1 
ATOM   154  N  NE2   . GLN A 1 25  ? 5.550   81.317  60.002 1.00 64.80  ? 100 GLN A NE2   1 
ATOM   155  N  N     . TRP A 1 26  ? 8.770   75.973  56.739 1.00 48.52  ? 101 TRP A N     1 
ATOM   156  C  CA    . TRP A 1 26  ? 9.299   74.614  56.700 1.00 45.66  ? 101 TRP A CA    1 
ATOM   157  C  C     . TRP A 1 26  ? 10.769  74.615  56.308 1.00 49.00  ? 101 TRP A C     1 
ATOM   158  O  O     . TRP A 1 26  ? 11.590  73.930  56.929 1.00 57.17  ? 101 TRP A O     1 
ATOM   159  C  CB    . TRP A 1 26  ? 8.476   73.765  55.734 1.00 49.74  ? 101 TRP A CB    1 
ATOM   160  C  CG    . TRP A 1 26  ? 9.152   72.512  55.273 1.00 53.44  ? 101 TRP A CG    1 
ATOM   161  C  CD1   . TRP A 1 26  ? 9.667   71.519  56.056 1.00 58.81  ? 101 TRP A CD1   1 
ATOM   162  C  CD2   . TRP A 1 26  ? 9.362   72.102  53.916 1.00 47.72  ? 101 TRP A CD2   1 
ATOM   163  N  NE1   . TRP A 1 26  ? 10.195  70.522  55.270 1.00 54.03  ? 101 TRP A NE1   1 
ATOM   164  C  CE2   . TRP A 1 26  ? 10.020  70.856  53.953 1.00 36.69  ? 101 TRP A CE2   1 
ATOM   165  C  CE3   . TRP A 1 26  ? 9.060   72.669  52.673 1.00 37.75  ? 101 TRP A CE3   1 
ATOM   166  C  CZ2   . TRP A 1 26  ? 10.380  70.168  52.797 1.00 36.45  ? 101 TRP A CZ2   1 
ATOM   167  C  CZ3   . TRP A 1 26  ? 9.419   71.983  51.525 1.00 41.18  ? 101 TRP A CZ3   1 
ATOM   168  C  CH2   . TRP A 1 26  ? 10.073  70.747  51.595 1.00 49.85  ? 101 TRP A CH2   1 
ATOM   169  N  N     . VAL A 1 27  ? 11.118  75.389  55.280 1.00 54.93  ? 102 VAL A N     1 
ATOM   170  C  CA    . VAL A 1 27  ? 12.503  75.475  54.827 1.00 45.65  ? 102 VAL A CA    1 
ATOM   171  C  C     . VAL A 1 27  ? 13.384  76.093  55.905 1.00 50.39  ? 102 VAL A C     1 
ATOM   172  O  O     . VAL A 1 27  ? 14.538  75.686  56.099 1.00 51.01  ? 102 VAL A O     1 
ATOM   173  C  CB    . VAL A 1 27  ? 12.565  76.266  53.505 1.00 37.13  ? 102 VAL A CB    1 
ATOM   174  C  CG1   . VAL A 1 27  ? 13.859  77.049  53.388 1.00 41.52  ? 102 VAL A CG1   1 
ATOM   175  C  CG2   . VAL A 1 27  ? 12.390  75.324  52.323 1.00 34.91  ? 102 VAL A CG2   1 
ATOM   176  N  N     . VAL A 1 28  ? 12.855  77.077  56.631 1.00 49.74  ? 103 VAL A N     1 
ATOM   177  C  CA    . VAL A 1 28  ? 13.648  77.749  57.654 1.00 46.68  ? 103 VAL A CA    1 
ATOM   178  C  C     . VAL A 1 28  ? 13.910  76.812  58.822 1.00 47.72  ? 103 VAL A C     1 
ATOM   179  O  O     . VAL A 1 28  ? 15.059  76.600  59.226 1.00 60.95  ? 103 VAL A O     1 
ATOM   180  C  CB    . VAL A 1 28  ? 12.946  79.036  58.120 1.00 46.39  ? 103 VAL A CB    1 
ATOM   181  C  CG1   . VAL A 1 28  ? 13.530  79.499  59.443 1.00 38.66  ? 103 VAL A CG1   1 
ATOM   182  C  CG2   . VAL A 1 28  ? 13.071  80.130  57.064 1.00 44.36  ? 103 VAL A CG2   1 
ATOM   183  N  N     . ARG A 1 29  ? 12.845  76.229  59.373 1.00 50.42  ? 104 ARG A N     1 
ATOM   184  C  CA    . ARG A 1 29  ? 12.959  75.472  60.614 1.00 53.99  ? 104 ARG A CA    1 
ATOM   185  C  C     . ARG A 1 29  ? 13.744  74.182  60.410 1.00 62.39  ? 104 ARG A C     1 
ATOM   186  O  O     . ARG A 1 29  ? 14.673  73.880  61.171 1.00 61.37  ? 104 ARG A O     1 
ATOM   187  C  CB    . ARG A 1 29  ? 11.561  75.190  61.171 1.00 53.98  ? 104 ARG A CB    1 
ATOM   188  C  CG    . ARG A 1 29  ? 10.964  76.371  61.934 1.00 54.41  ? 104 ARG A CG    1 
ATOM   189  C  CD    . ARG A 1 29  ? 9.464   76.490  61.737 1.00 53.46  ? 104 ARG A CD    1 
ATOM   190  N  NE    . ARG A 1 29  ? 8.731   75.331  62.237 1.00 72.11  ? 104 ARG A NE    1 
ATOM   191  C  CZ    . ARG A 1 29  ? 8.018   75.324  63.359 1.00 74.36  ? 104 ARG A CZ    1 
ATOM   192  N  NH1   . ARG A 1 29  ? 7.939   76.421  64.101 1.00 83.69  ? 104 ARG A NH1   1 
ATOM   193  N  NH2   . ARG A 1 29  ? 7.381   74.222  63.736 1.00 48.23  ? 104 ARG A NH2   1 
ATOM   194  N  N     . ASP A 1 30  ? 13.393  73.412  59.386 1.00 55.51  ? 105 ASP A N     1 
ATOM   195  C  CA    . ASP A 1 30  ? 14.029  72.127  59.133 1.00 45.99  ? 105 ASP A CA    1 
ATOM   196  C  C     . ASP A 1 30  ? 15.308  72.243  58.314 1.00 58.94  ? 105 ASP A C     1 
ATOM   197  O  O     . ASP A 1 30  ? 15.947  71.219  58.047 1.00 56.72  ? 105 ASP A O     1 
ATOM   198  C  CB    . ASP A 1 30  ? 13.043  71.188  58.432 1.00 48.76  ? 105 ASP A CB    1 
ATOM   199  C  CG    . ASP A 1 30  ? 11.781  70.961  59.243 1.00 56.23  ? 105 ASP A CG    1 
ATOM   200  O  OD1   . ASP A 1 30  ? 11.769  71.319  60.442 1.00 49.97  ? 105 ASP A OD1   1 
ATOM   201  O  OD2   . ASP A 1 30  ? 10.806  70.417  58.686 1.00 50.74  ? 105 ASP A OD2   1 
ATOM   202  N  N     . CYS A 1 31  ? 15.703  73.454  57.926 1.00 57.43  ? 106 CYS A N     1 
ATOM   203  C  CA    . CYS A 1 31  ? 16.912  73.686  57.136 1.00 55.10  ? 106 CYS A CA    1 
ATOM   204  C  C     . CYS A 1 31  ? 16.921  72.803  55.889 1.00 48.68  ? 106 CYS A C     1 
ATOM   205  O  O     . CYS A 1 31  ? 17.757  71.915  55.717 1.00 51.54  ? 106 CYS A O     1 
ATOM   206  C  CB    . CYS A 1 31  ? 18.173  73.471  57.979 1.00 58.74  ? 106 CYS A CB    1 
ATOM   207  S  SG    . CYS A 1 31  ? 19.715  73.939  57.151 1.00 51.81  ? 106 CYS A SG    1 
ATOM   208  N  N     . ARG A 1 32  ? 15.948  73.048  55.030 1.00 44.26  ? 107 ARG A N     1 
ATOM   209  C  CA    . ARG A 1 32  ? 15.875  72.424  53.725 1.00 40.38  ? 107 ARG A CA    1 
ATOM   210  C  C     . ARG A 1 32  ? 16.157  73.464  52.652 1.00 44.14  ? 107 ARG A C     1 
ATOM   211  O  O     . ARG A 1 32  ? 16.009  74.668  52.888 1.00 51.72  ? 107 ARG A O     1 
ATOM   212  C  CB    . ARG A 1 32  ? 14.496  71.781  53.496 1.00 46.28  ? 107 ARG A CB    1 
ATOM   213  C  CG    . ARG A 1 32  ? 14.238  70.504  54.311 1.00 28.19  ? 107 ARG A CG    1 
ATOM   214  C  CD    . ARG A 1 32  ? 15.402  69.535  54.174 1.00 62.76  ? 107 ARG A CD    1 
ATOM   215  N  NE    . ARG A 1 32  ? 15.221  68.316  54.954 1.00 44.73  ? 107 ARG A NE    1 
ATOM   216  C  CZ    . ARG A 1 32  ? 15.328  68.252  56.276 1.00 52.65  ? 107 ARG A CZ    1 
ATOM   217  N  NH1   . ARG A 1 32  ? 15.599  69.343  56.976 1.00 67.81  ? 107 ARG A NH1   1 
ATOM   218  N  NH2   . ARG A 1 32  ? 15.155  67.100  56.903 1.00 61.41  ? 107 ARG A NH2   1 
ATOM   219  N  N     . PRO A 1 33  ? 16.605  73.046  51.472 1.00 38.74  ? 108 PRO A N     1 
ATOM   220  C  CA    . PRO A 1 33  ? 16.854  74.018  50.403 1.00 44.34  ? 108 PRO A CA    1 
ATOM   221  C  C     . PRO A 1 33  ? 15.558  74.566  49.820 1.00 45.40  ? 108 PRO A C     1 
ATOM   222  O  O     . PRO A 1 33  ? 14.522  73.898  49.805 1.00 43.94  ? 108 PRO A O     1 
ATOM   223  C  CB    . PRO A 1 33  ? 17.632  73.206  49.362 1.00 46.01  ? 108 PRO A CB    1 
ATOM   224  C  CG    . PRO A 1 33  ? 17.244  71.793  49.626 1.00 36.38  ? 108 PRO A CG    1 
ATOM   225  C  CD    . PRO A 1 33  ? 17.055  71.694  51.106 1.00 32.20  ? 108 PRO A CD    1 
ATOM   226  N  N     . PHE A 1 34  ? 15.632  75.810  49.331 1.00 49.56  ? 109 PHE A N     1 
ATOM   227  C  CA    . PHE A 1 34  ? 14.472  76.442  48.707 1.00 37.14  ? 109 PHE A CA    1 
ATOM   228  C  C     . PHE A 1 34  ? 13.910  75.582  47.584 1.00 46.35  ? 109 PHE A C     1 
ATOM   229  O  O     . PHE A 1 34  ? 12.692  75.510  47.398 1.00 64.10  ? 109 PHE A O     1 
ATOM   230  C  CB    . PHE A 1 34  ? 14.850  77.820  48.165 1.00 41.21  ? 109 PHE A CB    1 
ATOM   231  C  CG    . PHE A 1 34  ? 15.368  78.757  49.205 1.00 39.43  ? 109 PHE A CG    1 
ATOM   232  C  CD1   . PHE A 1 34  ? 16.570  79.410  49.021 1.00 49.31  ? 109 PHE A CD1   1 
ATOM   233  C  CD2   . PHE A 1 34  ? 14.652  78.992  50.365 1.00 51.32  ? 109 PHE A CD2   1 
ATOM   234  C  CE1   . PHE A 1 34  ? 17.057  80.275  49.979 1.00 57.08  ? 109 PHE A CE1   1 
ATOM   235  C  CE2   . PHE A 1 34  ? 15.133  79.859  51.328 1.00 46.15  ? 109 PHE A CE2   1 
ATOM   236  C  CZ    . PHE A 1 34  ? 16.338  80.500  51.132 1.00 46.51  ? 109 PHE A CZ    1 
ATOM   237  N  N     . SER A 1 35  ? 14.782  74.908  46.831 1.00 50.98  ? 110 SER A N     1 
ATOM   238  C  CA    . SER A 1 35  ? 14.350  74.100  45.698 1.00 45.42  ? 110 SER A CA    1 
ATOM   239  C  C     . SER A 1 35  ? 13.569  72.856  46.112 1.00 48.60  ? 110 SER A C     1 
ATOM   240  O  O     . SER A 1 35  ? 13.054  72.153  45.235 1.00 50.18  ? 110 SER A O     1 
ATOM   241  C  CB    . SER A 1 35  ? 15.561  73.686  44.871 1.00 44.44  ? 110 SER A CB    1 
ATOM   242  O  OG    . SER A 1 35  ? 16.382  72.792  45.600 1.00 48.73  ? 110 SER A OG    1 
ATOM   243  N  N     . ALA A 1 36  ? 13.479  72.559  47.414 1.00 40.89  ? 111 ALA A N     1 
ATOM   244  C  CA    . ALA A 1 36  ? 12.695  71.417  47.869 1.00 45.95  ? 111 ALA A CA    1 
ATOM   245  C  C     . ALA A 1 36  ? 11.204  71.597  47.601 1.00 56.07  ? 111 ALA A C     1 
ATOM   246  O  O     . ALA A 1 36  ? 10.464  70.607  47.599 1.00 48.35  ? 111 ALA A O     1 
ATOM   247  C  CB    . ALA A 1 36  ? 12.904  71.192  49.364 1.00 34.55  ? 111 ALA A CB    1 
ATOM   248  N  N     . VAL A 1 37  ? 10.747  72.832  47.371 1.00 60.13  ? 112 VAL A N     1 
ATOM   249  C  CA    . VAL A 1 37  ? 9.329   73.138  47.251 1.00 64.37  ? 112 VAL A CA    1 
ATOM   250  C  C     . VAL A 1 37  ? 8.869   72.774  45.848 1.00 57.70  ? 112 VAL A C     1 
ATOM   251  O  O     . VAL A 1 37  ? 7.692   72.923  45.513 1.00 49.88  ? 112 VAL A O     1 
ATOM   252  C  CB    . VAL A 1 37  ? 9.076   74.620  47.573 1.00 57.46  ? 112 VAL A CB    1 
ATOM   253  C  CG1   . VAL A 1 37  ? 9.560   75.509  46.424 1.00 47.92  ? 112 VAL A CG1   1 
ATOM   254  C  CG2   . VAL A 1 37  ? 7.610   74.861  47.895 1.00 57.67  ? 112 VAL A CG2   1 
ATOM   255  N  N     . SER A 1 38  ? 9.791   72.268  45.026 1.00 56.20  ? 113 SER A N     1 
ATOM   256  C  CA    . SER A 1 38  ? 9.516   72.011  43.619 1.00 40.51  ? 113 SER A CA    1 
ATOM   257  C  C     . SER A 1 38  ? 9.945   70.616  43.178 1.00 34.34  ? 113 SER A C     1 
ATOM   258  O  O     . SER A 1 38  ? 9.984   70.346  41.975 1.00 46.72  ? 113 SER A O     1 
ATOM   259  C  CB    . SER A 1 38  ? 10.190  73.080  42.742 1.00 34.45  ? 113 SER A CB    1 
ATOM   260  O  OG    . SER A 1 38  ? 11.603  73.036  42.845 1.00 54.23  ? 113 SER A OG    1 
ATOM   261  N  N     . GLY A 1 39  ? 10.256  69.726  44.111 1.00 45.57  ? 114 GLY A N     1 
ATOM   262  C  CA    . GLY A 1 39  ? 10.575  68.365  43.738 1.00 56.29  ? 114 GLY A CA    1 
ATOM   263  C  C     . GLY A 1 39  ? 9.379   67.649  43.138 1.00 57.66  ? 114 GLY A C     1 
ATOM   264  O  O     . GLY A 1 39  ? 8.232   67.868  43.526 1.00 58.83  ? 114 GLY A O     1 
ATOM   265  N  N     . SER A 1 40  ? 9.659   66.777  42.162 1.00 56.33  ? 115 SER A N     1 
ATOM   266  C  CA    . SER A 1 40  ? 8.593   65.993  41.542 1.00 38.50  ? 115 SER A CA    1 
ATOM   267  C  C     . SER A 1 40  ? 7.851   65.158  42.579 1.00 46.62  ? 115 SER A C     1 
ATOM   268  O  O     . SER A 1 40  ? 6.622   65.016  42.513 1.00 58.24  ? 115 SER A O     1 
ATOM   269  C  CB    . SER A 1 40  ? 9.165   65.089  40.445 1.00 42.73  ? 115 SER A CB    1 
ATOM   270  O  OG    . SER A 1 40  ? 9.738   65.844  39.389 1.00 68.89  ? 115 SER A OG    1 
ATOM   271  N  N     . GLY A 1 41  ? 8.581   64.602  43.552 1.00 51.67  ? 116 GLY A N     1 
ATOM   272  C  CA    . GLY A 1 41  ? 7.944   63.805  44.582 1.00 42.87  ? 116 GLY A CA    1 
ATOM   273  C  C     . GLY A 1 41  ? 7.290   64.634  45.662 1.00 52.43  ? 116 GLY A C     1 
ATOM   274  O  O     . GLY A 1 41  ? 6.364   64.165  46.328 1.00 57.68  ? 116 GLY A O     1 
ATOM   275  N  N     . PHE A 1 42  ? 7.756   65.867  45.858 1.00 50.57  ? 117 PHE A N     1 
ATOM   276  C  CA    . PHE A 1 42  ? 7.108   66.749  46.820 1.00 47.99  ? 117 PHE A CA    1 
ATOM   277  C  C     . PHE A 1 42  ? 5.721   67.147  46.339 1.00 57.26  ? 117 PHE A C     1 
ATOM   278  O  O     . PHE A 1 42  ? 4.754   67.129  47.111 1.00 50.08  ? 117 PHE A O     1 
ATOM   279  C  CB    . PHE A 1 42  ? 7.965   67.986  47.057 1.00 38.07  ? 117 PHE A CB    1 
ATOM   280  C  CG    . PHE A 1 42  ? 7.384   68.939  48.058 1.00 37.31  ? 117 PHE A CG    1 
ATOM   281  C  CD1   . PHE A 1 42  ? 7.422   68.648  49.412 1.00 30.30  ? 117 PHE A CD1   1 
ATOM   282  C  CD2   . PHE A 1 42  ? 6.814   70.133  47.648 1.00 43.86  ? 117 PHE A CD2   1 
ATOM   283  C  CE1   . PHE A 1 42  ? 6.898   69.527  50.339 1.00 40.62  ? 117 PHE A CE1   1 
ATOM   284  C  CE2   . PHE A 1 42  ? 6.285   71.018  48.568 1.00 43.04  ? 117 PHE A CE2   1 
ATOM   285  C  CZ    . PHE A 1 42  ? 6.325   70.714  49.916 1.00 53.28  ? 117 PHE A CZ    1 
ATOM   286  N  N     . ILE A 1 43  ? 5.608   67.507  45.059 1.00 60.14  ? 118 ILE A N     1 
ATOM   287  C  CA    . ILE A 1 43  ? 4.318   67.892  44.492 1.00 52.73  ? 118 ILE A CA    1 
ATOM   288  C  C     . ILE A 1 43  ? 3.357   66.706  44.495 1.00 57.77  ? 118 ILE A C     1 
ATOM   289  O  O     . ILE A 1 43  ? 2.205   66.822  44.928 1.00 57.26  ? 118 ILE A O     1 
ATOM   290  C  CB    . ILE A 1 43  ? 4.511   68.469  43.079 1.00 51.92  ? 118 ILE A CB    1 
ATOM   291  C  CG1   . ILE A 1 43  ? 5.413   69.705  43.127 1.00 46.71  ? 118 ILE A CG1   1 
ATOM   292  C  CG2   . ILE A 1 43  ? 3.178   68.825  42.458 1.00 58.01  ? 118 ILE A CG2   1 
ATOM   293  C  CD1   . ILE A 1 43  ? 5.573   70.389  41.789 1.00 38.06  ? 118 ILE A CD1   1 
ATOM   294  N  N     . ASP A 1 44  ? 3.819   65.542  44.024 1.00 53.76  ? 119 ASP A N     1 
ATOM   295  C  CA    . ASP A 1 44  ? 2.968   64.354  44.039 1.00 50.69  ? 119 ASP A CA    1 
ATOM   296  C  C     . ASP A 1 44  ? 2.530   63.987  45.454 1.00 60.00  ? 119 ASP A C     1 
ATOM   297  O  O     . ASP A 1 44  ? 1.465   63.387  45.637 1.00 78.76  ? 119 ASP A O     1 
ATOM   298  C  CB    . ASP A 1 44  ? 3.689   63.170  43.388 1.00 44.05  ? 119 ASP A CB    1 
ATOM   299  C  CG    . ASP A 1 44  ? 3.715   63.257  41.872 1.00 68.75  ? 119 ASP A CG    1 
ATOM   300  O  OD1   . ASP A 1 44  ? 3.429   64.344  41.328 1.00 72.64  ? 119 ASP A OD1   1 
ATOM   301  O  OD2   . ASP A 1 44  ? 4.033   62.234  41.225 1.00 84.55  ? 119 ASP A OD2   1 
ATOM   302  N  N     . MET A 1 45  ? 3.329   64.336  46.463 1.00 61.92  ? 120 MET A N     1 
ATOM   303  C  CA    . MET A 1 45  ? 2.947   64.045  47.840 1.00 55.18  ? 120 MET A CA    1 
ATOM   304  C  C     . MET A 1 45  ? 1.923   65.047  48.362 1.00 57.33  ? 120 MET A C     1 
ATOM   305  O  O     . MET A 1 45  ? 0.984   64.665  49.068 1.00 67.88  ? 120 MET A O     1 
ATOM   306  C  CB    . MET A 1 45  ? 4.187   64.031  48.736 1.00 60.32  ? 120 MET A CB    1 
ATOM   307  C  CG    . MET A 1 45  ? 3.901   63.702  50.190 1.00 64.76  ? 120 MET A CG    1 
ATOM   308  S  SD    . MET A 1 45  ? 5.333   63.920  51.265 1.00 48.87  ? 120 MET A SD    1 
ATOM   309  C  CE    . MET A 1 45  ? 5.675   65.664  51.030 1.00 49.30  ? 120 MET A CE    1 
ATOM   310  N  N     . ILE A 1 46  ? 2.084   66.329  48.025 1.00 56.12  ? 121 ILE A N     1 
ATOM   311  C  CA    . ILE A 1 46  ? 1.137   67.344  48.481 1.00 55.71  ? 121 ILE A CA    1 
ATOM   312  C  C     . ILE A 1 46  ? -0.240  67.100  47.872 1.00 68.81  ? 121 ILE A C     1 
ATOM   313  O  O     . ILE A 1 46  ? -1.271  67.336  48.515 1.00 71.94  ? 121 ILE A O     1 
ATOM   314  C  CB    . ILE A 1 46  ? 1.666   68.755  48.154 1.00 61.25  ? 121 ILE A CB    1 
ATOM   315  C  CG1   . ILE A 1 46  ? 2.945   69.040  48.941 1.00 54.70  ? 121 ILE A CG1   1 
ATOM   316  C  CG2   . ILE A 1 46  ? 0.624   69.817  48.461 1.00 58.97  ? 121 ILE A CG2   1 
ATOM   317  C  CD1   . ILE A 1 46  ? 2.792   68.852  50.425 1.00 48.28  ? 121 ILE A CD1   1 
ATOM   318  N  N     . LYS A 1 47  ? -0.279  66.611  46.630 1.00 75.29  ? 122 LYS A N     1 
ATOM   319  C  CA    . LYS A 1 47  ? -1.558  66.307  45.996 1.00 72.60  ? 122 LYS A CA    1 
ATOM   320  C  C     . LYS A 1 47  ? -2.314  65.234  46.770 1.00 66.32  ? 122 LYS A C     1 
ATOM   321  O  O     . LYS A 1 47  ? -3.544  65.288  46.881 1.00 78.28  ? 122 LYS A O     1 
ATOM   322  C  CB    . LYS A 1 47  ? -1.335  65.878  44.543 1.00 48.42  ? 122 LYS A CB    1 
ATOM   323  C  CG    . LYS A 1 47  ? -0.892  67.019  43.635 1.00 48.52  ? 122 LYS A CG    1 
ATOM   324  C  CD    . LYS A 1 47  ? -0.650  66.574  42.202 1.00 51.71  ? 122 LYS A CD    1 
ATOM   325  C  CE    . LYS A 1 47  ? -0.232  67.759  41.334 1.00 71.67  ? 122 LYS A CE    1 
ATOM   326  N  NZ    . LYS A 1 47  ? 0.188   67.367  39.956 1.00 66.13  ? 122 LYS A NZ    1 
ATOM   327  N  N     . PHE A 1 48  ? -1.592  64.260  47.325 1.00 59.92  ? 123 PHE A N     1 
ATOM   328  C  CA    . PHE A 1 48  ? -2.235  63.220  48.120 1.00 56.21  ? 123 PHE A CA    1 
ATOM   329  C  C     . PHE A 1 48  ? -2.791  63.773  49.424 1.00 64.41  ? 123 PHE A C     1 
ATOM   330  O  O     . PHE A 1 48  ? -3.852  63.339  49.884 1.00 78.53  ? 123 PHE A O     1 
ATOM   331  C  CB    . PHE A 1 48  ? -1.248  62.092  48.405 1.00 52.68  ? 123 PHE A CB    1 
ATOM   332  C  CG    . PHE A 1 48  ? -1.652  61.207  49.551 1.00 63.08  ? 123 PHE A CG    1 
ATOM   333  C  CD1   . PHE A 1 48  ? -2.531  60.154  49.354 1.00 68.37  ? 123 PHE A CD1   1 
ATOM   334  C  CD2   . PHE A 1 48  ? -1.144  61.421  50.825 1.00 63.80  ? 123 PHE A CD2   1 
ATOM   335  C  CE1   . PHE A 1 48  ? -2.901  59.333  50.404 1.00 67.76  ? 123 PHE A CE1   1 
ATOM   336  C  CE2   . PHE A 1 48  ? -1.512  60.605  51.880 1.00 72.74  ? 123 PHE A CE2   1 
ATOM   337  C  CZ    . PHE A 1 48  ? -2.391  59.559  51.669 1.00 71.02  ? 123 PHE A CZ    1 
ATOM   338  N  N     . PHE A 1 49  ? -2.082  64.712  50.049 1.00 62.22  ? 124 PHE A N     1 
ATOM   339  C  CA    . PHE A 1 49  ? -2.520  65.193  51.354 1.00 70.47  ? 124 PHE A CA    1 
ATOM   340  C  C     . PHE A 1 49  ? -3.731  66.115  51.269 1.00 78.92  ? 124 PHE A C     1 
ATOM   341  O  O     . PHE A 1 49  ? -4.458  66.248  52.258 1.00 82.85  ? 124 PHE A O     1 
ATOM   342  C  CB    . PHE A 1 49  ? -1.365  65.889  52.077 1.00 71.75  ? 124 PHE A CB    1 
ATOM   343  C  CG    . PHE A 1 49  ? -0.424  64.934  52.769 1.00 77.80  ? 124 PHE A CG    1 
ATOM   344  C  CD1   . PHE A 1 49  ? -0.916  63.893  53.541 1.00 72.53  ? 124 PHE A CD1   1 
ATOM   345  C  CD2   . PHE A 1 49  ? 0.949   65.066  52.631 1.00 55.11  ? 124 PHE A CD2   1 
ATOM   346  C  CE1   . PHE A 1 49  ? -0.057  63.012  54.173 1.00 56.01  ? 124 PHE A CE1   1 
ATOM   347  C  CE2   . PHE A 1 49  ? 1.808   64.190  53.258 1.00 61.68  ? 124 PHE A CE2   1 
ATOM   348  C  CZ    . PHE A 1 49  ? 1.306   63.160  54.030 1.00 69.81  ? 124 PHE A CZ    1 
ATOM   349  N  N     . ILE A 1 50  ? -3.979  66.748  50.122 1.00 70.12  ? 125 ILE A N     1 
ATOM   350  C  CA    . ILE A 1 50  ? -5.232  67.481  49.987 1.00 72.85  ? 125 ILE A CA    1 
ATOM   351  C  C     . ILE A 1 50  ? -6.401  66.528  49.772 1.00 67.67  ? 125 ILE A C     1 
ATOM   352  O  O     . ILE A 1 50  ? -7.545  66.887  50.071 1.00 71.89  ? 125 ILE A O     1 
ATOM   353  C  CB    . ILE A 1 50  ? -5.175  68.526  48.858 1.00 68.86  ? 125 ILE A CB    1 
ATOM   354  C  CG1   . ILE A 1 50  ? -5.317  67.862  47.490 1.00 83.67  ? 125 ILE A CG1   1 
ATOM   355  C  CG2   . ILE A 1 50  ? -3.881  69.333  48.937 1.00 60.13  ? 125 ILE A CG2   1 
ATOM   356  C  CD1   . ILE A 1 50  ? -5.698  68.827  46.389 1.00 102.91 ? 125 ILE A CD1   1 
ATOM   357  N  N     . LYS A 1 51  ? -6.144  65.314  49.283 1.00 66.49  ? 126 LYS A N     1 
ATOM   358  C  CA    . LYS A 1 51  ? -7.207  64.318  49.201 1.00 71.14  ? 126 LYS A CA    1 
ATOM   359  C  C     . LYS A 1 51  ? -7.670  63.907  50.591 1.00 65.82  ? 126 LYS A C     1 
ATOM   360  O  O     . LYS A 1 51  ? -8.874  63.817  50.851 1.00 87.87  ? 126 LYS A O     1 
ATOM   361  C  CB    . LYS A 1 51  ? -6.736  63.098  48.408 1.00 65.18  ? 126 LYS A CB    1 
ATOM   362  C  CG    . LYS A 1 51  ? -6.682  63.307  46.903 1.00 81.94  ? 126 LYS A CG    1 
ATOM   363  C  CD    . LYS A 1 51  ? -6.054  62.112  46.200 1.00 100.20 ? 126 LYS A CD    1 
ATOM   364  C  CE    . LYS A 1 51  ? -5.847  62.382  44.716 1.00 102.67 ? 126 LYS A CE    1 
ATOM   365  N  NZ    . LYS A 1 51  ? -4.976  61.344  44.094 1.00 115.00 ? 126 LYS A NZ    1 
ATOM   366  N  N     . VAL A 1 52  ? -6.722  63.658  51.500 1.00 66.77  ? 127 VAL A N     1 
ATOM   367  C  CA    . VAL A 1 52  ? -7.068  63.250  52.859 1.00 72.80  ? 127 VAL A CA    1 
ATOM   368  C  C     . VAL A 1 52  ? -7.898  64.322  53.552 1.00 69.93  ? 127 VAL A C     1 
ATOM   369  O  O     . VAL A 1 52  ? -8.776  64.010  54.365 1.00 72.04  ? 127 VAL A O     1 
ATOM   370  C  CB    . VAL A 1 52  ? -5.789  62.913  53.652 1.00 58.60  ? 127 VAL A CB    1 
ATOM   371  C  CG1   . VAL A 1 52  ? -6.133  62.421  55.052 1.00 71.97  ? 127 VAL A CG1   1 
ATOM   372  C  CG2   . VAL A 1 52  ? -4.974  61.872  52.911 1.00 50.66  ? 127 VAL A CG2   1 
ATOM   373  N  N     . GLY A 1 53  ? -7.653  65.594  53.235 1.00 72.24  ? 128 GLY A N     1 
ATOM   374  C  CA    . GLY A 1 53  ? -8.474  66.656  53.789 1.00 68.86  ? 128 GLY A CA    1 
ATOM   375  C  C     . GLY A 1 53  ? -9.864  66.716  53.190 1.00 71.81  ? 128 GLY A C     1 
ATOM   376  O  O     . GLY A 1 53  ? -10.803 67.188  53.838 1.00 69.93  ? 128 GLY A O     1 
ATOM   377  N  N     . ALA A 1 54  ? -10.020 66.248  51.951 1.00 72.01  ? 129 ALA A N     1 
ATOM   378  C  CA    . ALA A 1 54  ? -11.342 66.210  51.337 1.00 61.30  ? 129 ALA A CA    1 
ATOM   379  C  C     . ALA A 1 54  ? -12.191 65.097  51.939 1.00 72.52  ? 129 ALA A C     1 
ATOM   380  O  O     . ALA A 1 54  ? -13.343 65.324  52.326 1.00 84.08  ? 129 ALA A O     1 
ATOM   381  C  CB    . ALA A 1 54  ? -11.213 66.039  49.824 1.00 70.17  ? 129 ALA A CB    1 
ATOM   382  N  N     . GLU A 1 55  ? -11.638 63.888  52.033 1.00 67.85  ? 130 GLU A N     1 
ATOM   383  C  CA    . GLU A 1 55  ? -12.369 62.765  52.609 1.00 73.40  ? 130 GLU A CA    1 
ATOM   384  C  C     . GLU A 1 55  ? -12.644 62.978  54.091 1.00 78.57  ? 130 GLU A C     1 
ATOM   385  O  O     . GLU A 1 55  ? -13.800 63.138  54.496 1.00 87.67  ? 130 GLU A O     1 
ATOM   386  C  CB    . GLU A 1 55  ? -11.604 61.452  52.411 1.00 85.68  ? 130 GLU A CB    1 
ATOM   387  C  CG    . GLU A 1 55  ? -11.875 60.757  51.088 1.00 104.92 ? 130 GLU A CG    1 
ATOM   388  C  CD    . GLU A 1 55  ? -10.890 61.152  50.008 1.00 108.39 ? 130 GLU A CD    1 
ATOM   389  O  OE1   . GLU A 1 55  ? -9.718  60.724  50.089 1.00 119.79 ? 130 GLU A OE1   1 
ATOM   390  O  OE2   . GLU A 1 55  ? -11.283 61.895  49.083 1.00 102.32 ? 130 GLU A OE2   1 
ATOM   391  N  N     . TYR A 1 56  ? -11.584 62.992  54.904 1.00 77.96  ? 131 TYR A N     1 
ATOM   392  C  CA    . TYR A 1 56  ? -11.714 62.949  56.355 1.00 63.36  ? 131 TYR A CA    1 
ATOM   393  C  C     . TYR A 1 56  ? -11.969 64.309  56.995 1.00 68.79  ? 131 TYR A C     1 
ATOM   394  O  O     . TYR A 1 56  ? -12.197 64.364  58.208 1.00 75.70  ? 131 TYR A O     1 
ATOM   395  C  CB    . TYR A 1 56  ? -10.454 62.335  56.974 1.00 76.53  ? 131 TYR A CB    1 
ATOM   396  C  CG    . TYR A 1 56  ? -10.191 60.896  56.578 1.00 78.93  ? 131 TYR A CG    1 
ATOM   397  C  CD1   . TYR A 1 56  ? -9.540  60.587  55.390 1.00 79.13  ? 131 TYR A CD1   1 
ATOM   398  C  CD2   . TYR A 1 56  ? -10.581 59.847  57.401 1.00 88.26  ? 131 TYR A CD2   1 
ATOM   399  C  CE1   . TYR A 1 56  ? -9.293  59.273  55.028 1.00 98.49  ? 131 TYR A CE1   1 
ATOM   400  C  CE2   . TYR A 1 56  ? -10.339 58.531  57.049 1.00 87.89  ? 131 TYR A CE2   1 
ATOM   401  C  CZ    . TYR A 1 56  ? -9.694  58.249  55.863 1.00 94.17  ? 131 TYR A CZ    1 
ATOM   402  O  OH    . TYR A 1 56  ? -9.450  56.941  55.511 1.00 90.23  ? 131 TYR A OH    1 
ATOM   403  N  N     . GLY A 1 57  ? -11.943 65.400  56.233 1.00 66.58  ? 132 GLY A N     1 
ATOM   404  C  CA    . GLY A 1 57  ? -12.108 66.715  56.817 1.00 57.38  ? 132 GLY A CA    1 
ATOM   405  C  C     . GLY A 1 57  ? -10.799 67.255  57.360 1.00 67.97  ? 132 GLY A C     1 
ATOM   406  O  O     . GLY A 1 57  ? -9.735  66.652  57.224 1.00 75.91  ? 132 GLY A O     1 
ATOM   407  N  N     . GLU A 1 58  ? -10.887 68.414  58.011 1.00 72.94  ? 133 GLU A N     1 
ATOM   408  C  CA    . GLU A 1 58  ? -9.691  69.148  58.408 1.00 80.56  ? 133 GLU A CA    1 
ATOM   409  C  C     . GLU A 1 58  ? -9.175  68.785  59.799 1.00 88.61  ? 133 GLU A C     1 
ATOM   410  O  O     . GLU A 1 58  ? -8.152  69.334  60.223 1.00 86.29  ? 133 GLU A O     1 
ATOM   411  C  CB    . GLU A 1 58  ? -9.949  70.660  58.328 1.00 66.51  ? 133 GLU A CB    1 
ATOM   412  C  CG    . GLU A 1 58  ? -10.445 71.310  59.611 1.00 75.23  ? 133 GLU A CG    1 
ATOM   413  C  CD    . GLU A 1 58  ? -10.309 72.824  59.578 1.00 89.37  ? 133 GLU A CD    1 
ATOM   414  O  OE1   . GLU A 1 58  ? -10.726 73.438  58.572 1.00 69.94  ? 133 GLU A OE1   1 
ATOM   415  O  OE2   . GLU A 1 58  ? -9.770  73.399  60.551 1.00 86.21  ? 133 GLU A OE2   1 
ATOM   416  N  N     . HIS A 1 59  ? -9.829  67.867  60.511 1.00 81.72  ? 134 HIS A N     1 
ATOM   417  C  CA    . HIS A 1 59  ? -9.385  67.526  61.859 1.00 89.16  ? 134 HIS A CA    1 
ATOM   418  C  C     . HIS A 1 59  ? -8.797  66.120  61.922 1.00 89.17  ? 134 HIS A C     1 
ATOM   419  O  O     . HIS A 1 59  ? -9.306  65.261  62.649 1.00 89.33  ? 134 HIS A O     1 
ATOM   420  C  CB    . HIS A 1 59  ? -10.541 67.660  62.855 1.00 87.95  ? 134 HIS A CB    1 
ATOM   421  C  CG    . HIS A 1 59  ? -11.008 69.070  63.055 1.00 87.23  ? 134 HIS A CG    1 
ATOM   422  N  ND1   . HIS A 1 59  ? -10.152 70.097  63.393 1.00 87.48  ? 134 HIS A ND1   1 
ATOM   423  C  CD2   . HIS A 1 59  ? -12.242 69.621  62.974 1.00 81.00  ? 134 HIS A CD2   1 
ATOM   424  C  CE1   . HIS A 1 59  ? -10.837 71.220  63.504 1.00 79.61  ? 134 HIS A CE1   1 
ATOM   425  N  NE2   . HIS A 1 59  ? -12.108 70.959  63.255 1.00 89.86  ? 134 HIS A NE2   1 
ATOM   426  N  N     . VAL A 1 60  ? -7.717  65.882  61.183 1.00 75.91  ? 135 VAL A N     1 
ATOM   427  C  CA    . VAL A 1 60  ? -7.078  64.573  61.127 1.00 85.31  ? 135 VAL A CA    1 
ATOM   428  C  C     . VAL A 1 60  ? -5.860  64.562  62.042 1.00 95.39  ? 135 VAL A C     1 
ATOM   429  O  O     . VAL A 1 60  ? -5.151  65.567  62.188 1.00 95.95  ? 135 VAL A O     1 
ATOM   430  C  CB    . VAL A 1 60  ? -6.692  64.211  59.677 1.00 79.64  ? 135 VAL A CB    1 
ATOM   431  C  CG1   . VAL A 1 60  ? -6.161  62.788  59.600 1.00 71.56  ? 135 VAL A CG1   1 
ATOM   432  C  CG2   . VAL A 1 60  ? -7.883  64.396  58.749 1.00 72.15  ? 135 VAL A CG2   1 
ATOM   433  N  N     . ASN A 1 61  ? -5.618  63.416  62.677 1.00 85.84  ? 136 ASN A N     1 
ATOM   434  C  CA    . ASN A 1 61  ? -4.422  63.212  63.493 1.00 83.71  ? 136 ASN A CA    1 
ATOM   435  C  C     . ASN A 1 61  ? -3.242  63.024  62.548 1.00 90.68  ? 136 ASN A C     1 
ATOM   436  O  O     . ASN A 1 61  ? -3.081  61.963  61.939 1.00 91.68  ? 136 ASN A O     1 
ATOM   437  C  CB    . ASN A 1 61  ? -4.600  62.009  64.413 1.00 95.15  ? 136 ASN A CB    1 
ATOM   438  C  CG    . ASN A 1 61  ? -3.506  61.903  65.460 1.00 92.63  ? 136 ASN A CG    1 
ATOM   439  O  OD1   . ASN A 1 61  ? -2.496  62.604  65.400 1.00 98.00  ? 136 ASN A OD1   1 
ATOM   440  N  ND2   . ASN A 1 61  ? -3.702  61.013  66.426 1.00 89.16  ? 136 ASN A ND2   1 
ATOM   441  N  N     . VAL A 1 62  ? -2.406  64.055  62.425 1.00 87.50  ? 137 VAL A N     1 
ATOM   442  C  CA    . VAL A 1 62  ? -1.350  64.040  61.416 1.00 75.43  ? 137 VAL A CA    1 
ATOM   443  C  C     . VAL A 1 62  ? -0.161  63.206  61.878 1.00 74.01  ? 137 VAL A C     1 
ATOM   444  O  O     . VAL A 1 62  ? 0.393   62.418  61.104 1.00 76.76  ? 137 VAL A O     1 
ATOM   445  C  CB    . VAL A 1 62  ? -0.933  65.478  61.060 1.00 65.35  ? 137 VAL A CB    1 
ATOM   446  C  CG1   . VAL A 1 62  ? 0.266   65.468  60.129 1.00 66.58  ? 137 VAL A CG1   1 
ATOM   447  C  CG2   . VAL A 1 62  ? -2.093  66.207  60.412 1.00 64.79  ? 137 VAL A CG2   1 
ATOM   448  N  N     . GLU A 1 63  ? 0.248   63.368  63.141 1.00 80.97  ? 138 GLU A N     1 
ATOM   449  C  CA    . GLU A 1 63  ? 1.382   62.605  63.659 1.00 86.28  ? 138 GLU A CA    1 
ATOM   450  C  C     . GLU A 1 63  ? 1.145   61.106  63.537 1.00 80.33  ? 138 GLU A C     1 
ATOM   451  O  O     . GLU A 1 63  ? 2.063   60.347  63.200 1.00 75.98  ? 138 GLU A O     1 
ATOM   452  C  CB    . GLU A 1 63  ? 1.653   62.980  65.118 1.00 93.67  ? 138 GLU A CB    1 
ATOM   453  C  CG    . GLU A 1 63  ? 2.309   64.339  65.316 1.00 87.27  ? 138 GLU A CG    1 
ATOM   454  C  CD    . GLU A 1 63  ? 1.310   65.479  65.355 1.00 94.47  ? 138 GLU A CD    1 
ATOM   455  O  OE1   . GLU A 1 63  ? 0.090   65.207  65.300 1.00 103.33 ? 138 GLU A OE1   1 
ATOM   456  O  OE2   . GLU A 1 63  ? 1.746   66.647  65.448 1.00 71.50  ? 138 GLU A OE2   1 
ATOM   457  N  N     . GLU A 1 64  ? -0.082  60.661  63.812 1.00 84.03  ? 139 GLU A N     1 
ATOM   458  C  CA    . GLU A 1 64  ? -0.419  59.254  63.632 1.00 91.55  ? 139 GLU A CA    1 
ATOM   459  C  C     . GLU A 1 64  ? -0.504  58.889  62.154 1.00 86.18  ? 139 GLU A C     1 
ATOM   460  O  O     . GLU A 1 64  ? -0.202  57.750  61.779 1.00 96.96  ? 139 GLU A O     1 
ATOM   461  C  CB    . GLU A 1 64  ? -1.734  58.946  64.356 1.00 87.24  ? 139 GLU A CB    1 
ATOM   462  C  CG    . GLU A 1 64  ? -2.032  57.470  64.561 1.00 75.59  ? 139 GLU A CG    1 
ATOM   463  C  CD    . GLU A 1 64  ? -2.719  56.843  63.365 1.00 110.30 ? 139 GLU A CD    1 
ATOM   464  O  OE1   . GLU A 1 64  ? -3.250  57.599  62.524 1.00 113.40 ? 139 GLU A OE1   1 
ATOM   465  O  OE2   . GLU A 1 64  ? -2.726  55.597  63.263 1.00 114.80 ? 139 GLU A OE2   1 
ATOM   466  N  N     . LEU A 1 65  ? -0.895  59.843  61.304 1.00 74.78  ? 140 LEU A N     1 
ATOM   467  C  CA    . LEU A 1 65  ? -0.972  59.584  59.868 1.00 67.94  ? 140 LEU A CA    1 
ATOM   468  C  C     . LEU A 1 65  ? 0.416   59.549  59.235 1.00 77.49  ? 140 LEU A C     1 
ATOM   469  O  O     . LEU A 1 65  ? 0.688   58.709  58.367 1.00 73.29  ? 140 LEU A O     1 
ATOM   470  C  CB    . LEU A 1 65  ? -1.845  60.653  59.206 1.00 77.57  ? 140 LEU A CB    1 
ATOM   471  C  CG    . LEU A 1 65  ? -2.390  60.563  57.771 1.00 72.43  ? 140 LEU A CG    1 
ATOM   472  C  CD1   . LEU A 1 65  ? -1.917  61.761  56.957 1.00 56.25  ? 140 LEU A CD1   1 
ATOM   473  C  CD2   . LEU A 1 65  ? -2.069  59.251  57.053 1.00 57.63  ? 140 LEU A CD2   1 
ATOM   474  N  N     . LEU A 1 66  ? 1.301   60.451  59.657 1.00 80.81  ? 141 LEU A N     1 
ATOM   475  C  CA    . LEU A 1 66  ? 2.640   60.523  59.089 1.00 60.65  ? 141 LEU A CA    1 
ATOM   476  C  C     . LEU A 1 66  ? 3.488   59.340  59.555 1.00 64.51  ? 141 LEU A C     1 
ATOM   477  O  O     . LEU A 1 66  ? 3.393   58.921  60.715 1.00 64.86  ? 141 LEU A O     1 
ATOM   478  C  CB    . LEU A 1 66  ? 3.324   61.831  59.486 1.00 52.45  ? 141 LEU A CB    1 
ATOM   479  C  CG    . LEU A 1 66  ? 2.904   63.072  58.703 1.00 61.97  ? 141 LEU A CG    1 
ATOM   480  C  CD1   . LEU A 1 66  ? 3.718   64.288  59.136 1.00 48.53  ? 141 LEU A CD1   1 
ATOM   481  C  CD2   . LEU A 1 66  ? 3.049   62.817  57.210 1.00 52.98  ? 141 LEU A CD2   1 
ATOM   482  N  N     . PRO A 1 67  ? 4.320   58.786  58.679 1.00 69.72  ? 142 PRO A N     1 
ATOM   483  C  CA    . PRO A 1 67  ? 5.203   57.684  59.070 1.00 58.54  ? 142 PRO A CA    1 
ATOM   484  C  C     . PRO A 1 67  ? 6.446   58.201  59.781 1.00 48.81  ? 142 PRO A C     1 
ATOM   485  O  O     . PRO A 1 67  ? 6.748   59.394  59.788 1.00 47.93  ? 142 PRO A O     1 
ATOM   486  C  CB    . PRO A 1 67  ? 5.567   57.039  57.731 1.00 53.70  ? 142 PRO A CB    1 
ATOM   487  C  CG    . PRO A 1 67  ? 5.514   58.177  56.762 1.00 58.71  ? 142 PRO A CG    1 
ATOM   488  C  CD    . PRO A 1 67  ? 4.424   59.100  57.244 1.00 60.08  ? 142 PRO A CD    1 
ATOM   489  N  N     . SER A 1 68  ? 7.169   57.272  60.374 1.00 59.99  ? 143 SER A N     1 
ATOM   490  C  CA    . SER A 1 68  ? 8.444   57.571  61.003 1.00 45.40  ? 143 SER A CA    1 
ATOM   491  C  C     . SER A 1 68  ? 9.570   57.446  59.988 1.00 65.56  ? 143 SER A C     1 
ATOM   492  O  O     . SER A 1 68  ? 9.431   56.756  58.971 1.00 57.93  ? 143 SER A O     1 
ATOM   493  C  CB    . SER A 1 68  ? 8.689   56.618  62.167 1.00 49.92  ? 143 SER A CB    1 
ATOM   494  O  OG    . SER A 1 68  ? 8.844   55.290  61.695 1.00 57.29  ? 143 SER A OG    1 
ATOM   495  N  N     . PRO A 1 69  ? 10.703  58.110  60.230 1.00 55.25  ? 144 PRO A N     1 
ATOM   496  C  CA    . PRO A 1 69  ? 11.844  57.946  59.318 1.00 49.92  ? 144 PRO A CA    1 
ATOM   497  C  C     . PRO A 1 69  ? 12.335  56.515  59.231 1.00 57.14  ? 144 PRO A C     1 
ATOM   498  O  O     . PRO A 1 69  ? 12.823  56.099  58.172 1.00 55.74  ? 144 PRO A O     1 
ATOM   499  C  CB    . PRO A 1 69  ? 12.907  58.875  59.922 1.00 45.19  ? 144 PRO A CB    1 
ATOM   500  C  CG    . PRO A 1 69  ? 12.129  59.879  60.699 1.00 55.20  ? 144 PRO A CG    1 
ATOM   501  C  CD    . PRO A 1 69  ? 10.965  59.126  61.262 1.00 49.49  ? 144 PRO A CD    1 
ATOM   502  N  N     . ILE A 1 70  ? 12.206  55.741  60.311 1.00 52.12  ? 145 ILE A N     1 
ATOM   503  C  CA    . ILE A 1 70  ? 12.706  54.371  60.291 1.00 55.83  ? 145 ILE A CA    1 
ATOM   504  C  C     . ILE A 1 70  ? 11.817  53.491  59.422 1.00 57.72  ? 145 ILE A C     1 
ATOM   505  O  O     . ILE A 1 70  ? 12.314  52.646  58.669 1.00 57.66  ? 145 ILE A O     1 
ATOM   506  C  CB    . ILE A 1 70  ? 12.846  53.825  61.726 1.00 59.24  ? 145 ILE A CB    1 
ATOM   507  C  CG1   . ILE A 1 70  ? 13.665  52.535  61.728 1.00 50.29  ? 145 ILE A CG1   1 
ATOM   508  C  CG2   . ILE A 1 70  ? 11.488  53.585  62.365 1.00 56.05  ? 145 ILE A CG2   1 
ATOM   509  C  CD1   . ILE A 1 70  ? 14.087  52.097  63.113 1.00 72.62  ? 145 ILE A CD1   1 
ATOM   510  N  N     . THR A 1 71  ? 10.495  53.685  59.489 1.00 58.31  ? 146 THR A N     1 
ATOM   511  C  CA    . THR A 1 71  ? 9.597   52.943  58.611 1.00 58.81  ? 146 THR A CA    1 
ATOM   512  C  C     . THR A 1 71  ? 9.674   53.439  57.174 1.00 52.48  ? 146 THR A C     1 
ATOM   513  O  O     . THR A 1 71  ? 9.301   52.701  56.256 1.00 56.79  ? 146 THR A O     1 
ATOM   514  C  CB    . THR A 1 71  ? 8.151   53.015  59.121 1.00 60.53  ? 146 THR A CB    1 
ATOM   515  O  OG1   . THR A 1 71  ? 7.774   54.381  59.339 1.00 65.40  ? 146 THR A OG1   1 
ATOM   516  C  CG2   . THR A 1 71  ? 7.999   52.226  60.422 1.00 51.62  ? 146 THR A CG2   1 
ATOM   517  N  N     . LEU A 1 72  ? 10.146  54.670  56.958 1.00 53.02  ? 147 LEU A N     1 
ATOM   518  C  CA    . LEU A 1 72  ? 10.502  55.088  55.607 1.00 57.49  ? 147 LEU A CA    1 
ATOM   519  C  C     . LEU A 1 72  ? 11.742  54.353  55.120 1.00 60.19  ? 147 LEU A C     1 
ATOM   520  O  O     . LEU A 1 72  ? 11.838  53.996  53.941 1.00 58.40  ? 147 LEU A O     1 
ATOM   521  C  CB    . LEU A 1 72  ? 10.733  56.597  55.554 1.00 53.88  ? 147 LEU A CB    1 
ATOM   522  C  CG    . LEU A 1 72  ? 9.502   57.495  55.468 1.00 53.92  ? 147 LEU A CG    1 
ATOM   523  C  CD1   . LEU A 1 72  ? 9.902   58.889  55.010 1.00 28.68  ? 147 LEU A CD1   1 
ATOM   524  C  CD2   . LEU A 1 72  ? 8.463   56.891  54.537 1.00 52.96  ? 147 LEU A CD2   1 
ATOM   525  N  N     . SER A 1 73  ? 12.702  54.114  56.014 1.00 48.02  ? 148 SER A N     1 
ATOM   526  C  CA    . SER A 1 73  ? 13.934  53.460  55.596 1.00 49.99  ? 148 SER A CA    1 
ATOM   527  C  C     . SER A 1 73  ? 13.695  52.013  55.179 1.00 55.79  ? 148 SER A C     1 
ATOM   528  O  O     . SER A 1 73  ? 14.369  51.520  54.267 1.00 60.77  ? 148 SER A O     1 
ATOM   529  C  CB    . SER A 1 73  ? 14.973  53.532  56.712 1.00 57.50  ? 148 SER A CB    1 
ATOM   530  O  OG    . SER A 1 73  ? 16.234  53.074  56.255 1.00 53.71  ? 148 SER A OG    1 
ATOM   531  N  N     . ARG A 1 74  ? 12.750  51.315  55.819 1.00 60.08  ? 149 ARG A N     1 
ATOM   532  C  CA    . ARG A 1 74  ? 12.481  49.942  55.402 1.00 65.83  ? 149 ARG A CA    1 
ATOM   533  C  C     . ARG A 1 74  ? 11.536  49.878  54.208 1.00 53.89  ? 149 ARG A C     1 
ATOM   534  O  O     . ARG A 1 74  ? 11.575  48.901  53.453 1.00 64.33  ? 149 ARG A O     1 
ATOM   535  C  CB    . ARG A 1 74  ? 11.922  49.102  56.559 1.00 49.39  ? 149 ARG A CB    1 
ATOM   536  C  CG    . ARG A 1 74  ? 11.635  49.842  57.849 1.00 39.66  ? 149 ARG A CG    1 
ATOM   537  C  CD    . ARG A 1 74  ? 12.011  48.998  59.072 1.00 42.27  ? 149 ARG A CD    1 
ATOM   538  N  NE    . ARG A 1 74  ? 11.283  49.417  60.269 1.00 52.12  ? 149 ARG A NE    1 
ATOM   539  C  CZ    . ARG A 1 74  ? 11.557  49.009  61.505 1.00 49.81  ? 149 ARG A CZ    1 
ATOM   540  N  NH1   . ARG A 1 74  ? 12.561  48.170  61.725 1.00 54.05  ? 149 ARG A NH1   1 
ATOM   541  N  NH2   . ARG A 1 74  ? 10.829  49.447  62.524 1.00 39.80  ? 149 ARG A NH2   1 
ATOM   542  N  N     . LYS A 1 75  ? 10.694  50.899  54.011 1.00 46.20  ? 150 LYS A N     1 
ATOM   543  C  CA    . LYS A 1 75  ? 9.813   50.908  52.845 1.00 54.32  ? 150 LYS A CA    1 
ATOM   544  C  C     . LYS A 1 75  ? 10.606  51.016  51.545 1.00 56.88  ? 150 LYS A C     1 
ATOM   545  O  O     . LYS A 1 75  ? 10.305  50.308  50.576 1.00 44.17  ? 150 LYS A O     1 
ATOM   546  C  CB    . LYS A 1 75  ? 8.802   52.050  52.942 1.00 56.15  ? 150 LYS A CB    1 
ATOM   547  C  CG    . LYS A 1 75  ? 7.951   52.243  51.677 1.00 71.03  ? 150 LYS A CG    1 
ATOM   548  C  CD    . LYS A 1 75  ? 6.543   51.662  51.813 1.00 69.91  ? 150 LYS A CD    1 
ATOM   549  C  CE    . LYS A 1 75  ? 6.463   50.217  51.335 1.00 83.40  ? 150 LYS A CE    1 
ATOM   550  N  NZ    . LYS A 1 75  ? 6.482   50.102  49.850 1.00 86.53  ? 150 LYS A NZ    1 
ATOM   551  N  N     . VAL A 1 76  ? 11.617  51.895  51.497 1.00 61.01  ? 151 VAL A N     1 
ATOM   552  C  CA    . VAL A 1 76  ? 12.413  51.995  50.274 1.00 57.08  ? 151 VAL A CA    1 
ATOM   553  C  C     . VAL A 1 76  ? 13.220  50.722  50.071 1.00 60.99  ? 151 VAL A C     1 
ATOM   554  O  O     . VAL A 1 76  ? 13.536  50.357  48.935 1.00 62.24  ? 151 VAL A O     1 
ATOM   555  C  CB    . VAL A 1 76  ? 13.323  53.243  50.272 1.00 46.06  ? 151 VAL A CB    1 
ATOM   556  C  CG1   . VAL A 1 76  ? 12.672  54.400  51.008 1.00 54.63  ? 151 VAL A CG1   1 
ATOM   557  C  CG2   . VAL A 1 76  ? 14.708  52.934  50.826 1.00 48.49  ? 151 VAL A CG2   1 
ATOM   558  N  N     . THR A 1 77  ? 13.559  50.019  51.155 1.00 55.70  ? 152 THR A N     1 
ATOM   559  C  CA    . THR A 1 77  ? 14.148  48.695  51.015 1.00 65.84  ? 152 THR A CA    1 
ATOM   560  C  C     . THR A 1 77  ? 13.094  47.666  50.625 1.00 67.41  ? 152 THR A C     1 
ATOM   561  O  O     . THR A 1 77  ? 13.392  46.730  49.870 1.00 68.13  ? 152 THR A O     1 
ATOM   562  C  CB    . THR A 1 77  ? 14.851  48.295  52.315 1.00 64.15  ? 152 THR A CB    1 
ATOM   563  O  OG1   . THR A 1 77  ? 15.810  49.305  52.668 1.00 56.84  ? 152 THR A OG1   1 
ATOM   564  C  CG2   . THR A 1 77  ? 15.574  46.966  52.145 1.00 55.23  ? 152 THR A CG2   1 
ATOM   565  N  N     . SER A 1 78  ? 11.863  47.831  51.118 1.00 58.34  ? 153 SER A N     1 
ATOM   566  C  CA    . SER A 1 78  ? 10.750  47.027  50.626 1.00 56.24  ? 153 SER A CA    1 
ATOM   567  C  C     . SER A 1 78  ? 10.511  47.293  49.147 1.00 60.67  ? 153 SER A C     1 
ATOM   568  O  O     . SER A 1 78  ? 10.533  46.374  48.322 1.00 67.40  ? 153 SER A O     1 
ATOM   569  C  CB    . SER A 1 78  ? 9.488   47.327  51.434 1.00 45.46  ? 153 SER A CB    1 
ATOM   570  O  OG    . SER A 1 78  ? 9.002   46.160  52.065 1.00 72.31  ? 153 SER A OG    1 
ATOM   571  N  N     . ASP A 1 79  ? 10.290  48.563  48.796 1.00 51.71  ? 154 ASP A N     1 
ATOM   572  C  CA    . ASP A 1 79  ? 9.992   48.915  47.412 1.00 52.81  ? 154 ASP A CA    1 
ATOM   573  C  C     . ASP A 1 79  ? 11.125  48.515  46.479 1.00 63.79  ? 154 ASP A C     1 
ATOM   574  O  O     . ASP A 1 79  ? 10.882  48.120  45.334 1.00 58.36  ? 154 ASP A O     1 
ATOM   575  C  CB    . ASP A 1 79  ? 9.718   50.413  47.298 1.00 54.76  ? 154 ASP A CB    1 
ATOM   576  C  CG    . ASP A 1 79  ? 8.323   50.713  46.790 1.00 88.26  ? 154 ASP A CG    1 
ATOM   577  O  OD1   . ASP A 1 79  ? 7.371   50.022  47.212 1.00 93.88  ? 154 ASP A OD1   1 
ATOM   578  O  OD2   . ASP A 1 79  ? 8.181   51.645  45.970 1.00 97.18  ? 154 ASP A OD2   1 
ATOM   579  N  N     . ALA A 1 80  ? 12.372  48.617  46.946 1.00 67.77  ? 155 ALA A N     1 
ATOM   580  C  CA    . ALA A 1 80  ? 13.506  48.249  46.105 1.00 55.55  ? 155 ALA A CA    1 
ATOM   581  C  C     . ALA A 1 80  ? 13.442  46.778  45.721 1.00 63.42  ? 155 ALA A C     1 
ATOM   582  O  O     . ALA A 1 80  ? 13.610  46.423  44.549 1.00 62.81  ? 155 ALA A O     1 
ATOM   583  C  CB    . ALA A 1 80  ? 14.818  48.565  46.819 1.00 63.57  ? 155 ALA A CB    1 
ATOM   584  N  N     . LYS A 1 81  ? 13.199  45.905  46.703 1.00 70.57  ? 156 LYS A N     1 
ATOM   585  C  CA    . LYS A 1 81  ? 12.906  44.509  46.396 1.00 74.57  ? 156 LYS A CA    1 
ATOM   586  C  C     . LYS A 1 81  ? 11.718  44.398  45.449 1.00 74.02  ? 156 LYS A C     1 
ATOM   587  O  O     . LYS A 1 81  ? 11.721  43.576  44.525 1.00 64.95  ? 156 LYS A O     1 
ATOM   588  C  CB    . LYS A 1 81  ? 12.625  43.735  47.684 1.00 60.07  ? 156 LYS A CB    1 
ATOM   589  C  CG    . LYS A 1 81  ? 13.795  43.651  48.648 1.00 76.65  ? 156 LYS A CG    1 
ATOM   590  C  CD    . LYS A 1 81  ? 13.338  43.115  49.999 1.00 96.90  ? 156 LYS A CD    1 
ATOM   591  C  CE    . LYS A 1 81  ? 14.483  42.482  50.778 1.00 91.30  ? 156 LYS A CE    1 
ATOM   592  N  NZ    . LYS A 1 81  ? 15.565  43.451  51.094 1.00 110.26 ? 156 LYS A NZ    1 
ATOM   593  N  N     . GLU A 1 82  ? 10.704  45.242  45.653 1.00 67.15  ? 157 GLU A N     1 
ATOM   594  C  CA    . GLU A 1 82  ? 9.464   45.147  44.887 1.00 73.99  ? 157 GLU A CA    1 
ATOM   595  C  C     . GLU A 1 82  ? 9.686   45.507  43.421 1.00 79.21  ? 157 GLU A C     1 
ATOM   596  O  O     . GLU A 1 82  ? 9.332   44.735  42.522 1.00 77.40  ? 157 GLU A O     1 
ATOM   597  C  CB    . GLU A 1 82  ? 8.406   46.057  45.518 1.00 82.45  ? 157 GLU A CB    1 
ATOM   598  C  CG    . GLU A 1 82  ? 6.957   45.651  45.293 1.00 92.87  ? 157 GLU A CG    1 
ATOM   599  C  CD    . GLU A 1 82  ? 5.979   46.670  45.868 1.00 98.97  ? 157 GLU A CD    1 
ATOM   600  O  OE1   . GLU A 1 82  ? 5.739   47.706  45.209 1.00 70.78  ? 157 GLU A OE1   1 
ATOM   601  O  OE2   . GLU A 1 82  ? 5.465   46.444  46.986 1.00 101.15 ? 157 GLU A OE2   1 
ATOM   602  N  N     . LYS A 1 83  ? 10.280  46.677  43.161 1.00 84.18  ? 158 LYS A N     1 
ATOM   603  C  CA    . LYS A 1 83  ? 10.460  47.141  41.788 1.00 73.12  ? 158 LYS A CA    1 
ATOM   604  C  C     . LYS A 1 83  ? 11.510  46.339  41.026 1.00 65.40  ? 158 LYS A C     1 
ATOM   605  O  O     . LYS A 1 83  ? 11.460  46.301  39.793 1.00 61.80  ? 158 LYS A O     1 
ATOM   606  C  CB    . LYS A 1 83  ? 10.837  48.623  41.773 1.00 60.90  ? 158 LYS A CB    1 
ATOM   607  C  CG    . LYS A 1 83  ? 9.956   49.499  42.643 1.00 60.39  ? 158 LYS A CG    1 
ATOM   608  C  CD    . LYS A 1 83  ? 8.578   49.704  42.055 1.00 57.55  ? 158 LYS A CD    1 
ATOM   609  C  CE    . LYS A 1 83  ? 7.693   50.448  43.042 1.00 62.90  ? 158 LYS A CE    1 
ATOM   610  N  NZ    . LYS A 1 83  ? 6.531   51.107  42.388 1.00 83.13  ? 158 LYS A NZ    1 
ATOM   611  N  N     . LYS A 1 84  ? 12.461  45.707  41.719 1.00 58.33  ? 159 LYS A N     1 
ATOM   612  C  CA    . LYS A 1 84  ? 13.413  44.846  41.025 1.00 63.59  ? 159 LYS A CA    1 
ATOM   613  C  C     . LYS A 1 84  ? 12.759  43.570  40.513 1.00 68.93  ? 159 LYS A C     1 
ATOM   614  O  O     . LYS A 1 84  ? 13.301  42.926  39.609 1.00 67.80  ? 159 LYS A O     1 
ATOM   615  C  CB    . LYS A 1 84  ? 14.595  44.514  41.939 1.00 65.42  ? 159 LYS A CB    1 
ATOM   616  C  CG    . LYS A 1 84  ? 15.571  45.672  42.098 1.00 55.04  ? 159 LYS A CG    1 
ATOM   617  C  CD    . LYS A 1 84  ? 16.777  45.314  42.950 1.00 56.89  ? 159 LYS A CD    1 
ATOM   618  C  CE    . LYS A 1 84  ? 16.404  45.117  44.411 1.00 75.50  ? 159 LYS A CE    1 
ATOM   619  N  NZ    . LYS A 1 84  ? 17.609  45.133  45.295 1.00 74.86  ? 159 LYS A NZ    1 
ATOM   620  N  N     . ALA A 1 85  ? 11.607  43.196  41.066 1.00 80.38  ? 160 ALA A N     1 
ATOM   621  C  CA    . ALA A 1 85  ? 10.808  42.103  40.527 1.00 75.57  ? 160 ALA A CA    1 
ATOM   622  C  C     . ALA A 1 85  ? 9.854   42.579  39.438 1.00 78.87  ? 160 ALA A C     1 
ATOM   623  O  O     . ALA A 1 85  ? 9.656   41.876  38.439 1.00 79.56  ? 160 ALA A O     1 
ATOM   624  C  CB    . ALA A 1 85  ? 10.026  41.420  41.652 1.00 59.70  ? 160 ALA A CB    1 
ATOM   625  N  N     . LEU A 1 86  ? 9.278   43.774  39.611 1.00 79.94  ? 161 LEU A N     1 
ATOM   626  C  CA    . LEU A 1 86  ? 8.359   44.331  38.623 1.00 75.67  ? 161 LEU A CA    1 
ATOM   627  C  C     . LEU A 1 86  ? 9.000   44.447  37.244 1.00 79.86  ? 161 LEU A C     1 
ATOM   628  O  O     . LEU A 1 86  ? 8.316   44.262  36.227 1.00 82.22  ? 161 LEU A O     1 
ATOM   629  C  CB    . LEU A 1 86  ? 7.857   45.697  39.099 1.00 79.24  ? 161 LEU A CB    1 
ATOM   630  C  CG    . LEU A 1 86  ? 6.980   46.534  38.160 1.00 88.40  ? 161 LEU A CG    1 
ATOM   631  C  CD1   . LEU A 1 86  ? 5.691   45.800  37.824 1.00 88.97  ? 161 LEU A CD1   1 
ATOM   632  C  CD2   . LEU A 1 86  ? 6.679   47.906  38.758 1.00 66.80  ? 161 LEU A CD2   1 
ATOM   633  N  N     . ILE A 1 87  ? 10.297  44.757  37.180 1.00 89.31  ? 162 ILE A N     1 
ATOM   634  C  CA    . ILE A 1 87  ? 11.017  44.820  35.914 1.00 85.76  ? 162 ILE A CA    1 
ATOM   635  C  C     . ILE A 1 87  ? 12.008  43.681  35.750 1.00 69.32  ? 162 ILE A C     1 
ATOM   636  O  O     . ILE A 1 87  ? 12.759  43.668  34.762 1.00 62.30  ? 162 ILE A O     1 
ATOM   637  C  CB    . ILE A 1 87  ? 11.738  46.168  35.738 1.00 70.57  ? 162 ILE A CB    1 
ATOM   638  C  CG1   . ILE A 1 87  ? 12.721  46.430  36.874 1.00 61.79  ? 162 ILE A CG1   1 
ATOM   639  C  CG2   . ILE A 1 87  ? 10.746  47.315  35.608 1.00 88.68  ? 162 ILE A CG2   1 
ATOM   640  C  CD1   . ILE A 1 87  ? 13.396  47.774  36.770 1.00 64.66  ? 162 ILE A CD1   1 
ATOM   641  N  N     . SER A 1 88  ? 12.024  42.706  36.660 1.00 67.28  ? 163 SER A N     1 
ATOM   642  C  CA    . SER A 1 88  ? 12.922  41.561  36.520 1.00 62.07  ? 163 SER A CA    1 
ATOM   643  C  C     . SER A 1 88  ? 12.627  40.804  35.243 1.00 79.15  ? 163 SER A C     1 
ATOM   644  O  O     . SER A 1 88  ? 13.431  39.989  34.789 1.00 71.68  ? 163 SER A O     1 
ATOM   645  N  N     . ARG A 1 89  ? 11.461  41.084  34.661 1.00 74.57  ? 164 ARG A N     1 
ATOM   646  C  CA    . ARG A 1 89  ? 11.021  40.532  33.388 1.00 69.83  ? 164 ARG A CA    1 
ATOM   647  C  C     . ARG A 1 89  ? 11.358  41.437  32.208 1.00 70.40  ? 164 ARG A C     1 
ATOM   648  O  O     . ARG A 1 89  ? 11.910  40.965  31.211 1.00 62.58  ? 164 ARG A O     1 
ATOM   649  C  CB    . ARG A 1 89  ? 9.511   40.276  33.433 1.00 90.12  ? 164 ARG A CB    1 
ATOM   650  C  CG    . ARG A 1 89  ? 8.955   39.581  32.203 1.00 100.71 ? 164 ARG A CG    1 
ATOM   651  C  CD    . ARG A 1 89  ? 7.450   39.716  32.154 1.00 103.32 ? 164 ARG A CD    1 
ATOM   652  N  NE    . ARG A 1 89  ? 6.845   38.828  31.168 1.00 126.46 ? 164 ARG A NE    1 
ATOM   653  C  CZ    . ARG A 1 89  ? 5.545   38.802  30.896 1.00 152.87 ? 164 ARG A CZ    1 
ATOM   654  N  NH1   . ARG A 1 89  ? 4.722   39.621  31.536 1.00 165.90 ? 164 ARG A NH1   1 
ATOM   655  N  NH2   . ARG A 1 89  ? 5.067   37.963  29.987 1.00 156.45 ? 164 ARG A NH2   1 
ATOM   656  N  N     . GLU A 1 90  ? 11.029  42.733  32.293 1.00 79.59  ? 165 GLU A N     1 
ATOM   657  C  CA    . GLU A 1 90  ? 11.351  43.645  31.197 1.00 75.94  ? 165 GLU A CA    1 
ATOM   658  C  C     . GLU A 1 90  ? 12.854  43.742  30.977 1.00 69.57  ? 165 GLU A C     1 
ATOM   659  O  O     . GLU A 1 90  ? 13.306  43.965  29.848 1.00 55.09  ? 165 GLU A O     1 
ATOM   660  C  CB    . GLU A 1 90  ? 10.779  45.035  31.468 1.00 70.07  ? 165 GLU A CB    1 
ATOM   661  C  CG    . GLU A 1 90  ? 9.376   45.043  32.039 1.00 78.72  ? 165 GLU A CG    1 
ATOM   662  C  CD    . GLU A 1 90  ? 8.812   46.447  32.136 1.00 104.14 ? 165 GLU A CD    1 
ATOM   663  O  OE1   . GLU A 1 90  ? 9.209   47.303  31.313 1.00 86.11  ? 165 GLU A OE1   1 
ATOM   664  O  OE2   . GLU A 1 90  ? 7.979   46.695  33.035 1.00 100.44 ? 165 GLU A OE2   1 
ATOM   665  N  N     . ILE A 1 91  ? 13.638  43.582  32.045 1.00 78.29  ? 166 ILE A N     1 
ATOM   666  C  CA    . ILE A 1 91  ? 15.092  43.601  31.925 1.00 76.10  ? 166 ILE A CA    1 
ATOM   667  C  C     . ILE A 1 91  ? 15.585  42.338  31.234 1.00 65.59  ? 166 ILE A C     1 
ATOM   668  O  O     . ILE A 1 91  ? 16.354  42.398  30.268 1.00 73.62  ? 166 ILE A O     1 
ATOM   669  C  CB    . ILE A 1 91  ? 15.743  43.767  33.312 1.00 80.78  ? 166 ILE A CB    1 
ATOM   670  C  CG1   . ILE A 1 91  ? 15.502  45.173  33.869 1.00 68.23  ? 166 ILE A CG1   1 
ATOM   671  C  CG2   . ILE A 1 91  ? 17.231  43.442  33.255 1.00 55.03  ? 166 ILE A CG2   1 
ATOM   672  C  CD1   . ILE A 1 91  ? 16.135  46.275  33.057 1.00 69.82  ? 166 ILE A CD1   1 
ATOM   673  N  N     . LYS A 1 92  ? 15.151  41.174  31.723 1.00 69.94  ? 167 LYS A N     1 
ATOM   674  C  CA    . LYS A 1 92  ? 15.651  39.908  31.202 1.00 78.05  ? 167 LYS A CA    1 
ATOM   675  C  C     . LYS A 1 92  ? 15.365  39.740  29.714 1.00 74.33  ? 167 LYS A C     1 
ATOM   676  O  O     . LYS A 1 92  ? 16.078  38.991  29.038 1.00 66.06  ? 167 LYS A O     1 
ATOM   677  C  CB    . LYS A 1 92  ? 15.052  38.750  32.005 1.00 64.40  ? 167 LYS A CB    1 
ATOM   678  C  CG    . LYS A 1 92  ? 15.791  37.436  31.846 1.00 72.68  ? 167 LYS A CG    1 
ATOM   679  C  CD    . LYS A 1 92  ? 15.271  36.390  32.816 1.00 63.33  ? 167 LYS A CD    1 
ATOM   680  C  CE    . LYS A 1 92  ? 15.993  35.067  32.621 1.00 87.79  ? 167 LYS A CE    1 
ATOM   681  N  NZ    . LYS A 1 92  ? 15.693  34.090  33.705 1.00 76.21  ? 167 LYS A NZ    1 
ATOM   682  N  N     . SER A 1 93  ? 14.358  40.437  29.186 1.00 67.56  ? 168 SER A N     1 
ATOM   683  C  CA    . SER A 1 93  ? 14.068  40.359  27.759 1.00 68.18  ? 168 SER A CA    1 
ATOM   684  C  C     . SER A 1 93  ? 15.155  41.038  26.938 1.00 73.99  ? 168 SER A C     1 
ATOM   685  O  O     . SER A 1 93  ? 15.662  40.464  25.967 1.00 78.36  ? 168 SER A O     1 
ATOM   686  C  CB    . SER A 1 93  ? 12.704  40.986  27.467 1.00 72.81  ? 168 SER A CB    1 
ATOM   687  O  OG    . SER A 1 93  ? 12.457  41.036  26.071 1.00 83.89  ? 168 SER A OG    1 
ATOM   688  N  N     . ALA A 1 94  ? 15.529  42.265  27.316 1.00 83.26  ? 169 ALA A N     1 
ATOM   689  C  CA    . ALA A 1 94  ? 16.523  43.011  26.549 1.00 72.72  ? 169 ALA A CA    1 
ATOM   690  C  C     . ALA A 1 94  ? 17.868  42.293  26.531 1.00 58.42  ? 169 ALA A C     1 
ATOM   691  O  O     . ALA A 1 94  ? 18.584  42.330  25.524 1.00 70.34  ? 169 ALA A O     1 
ATOM   692  C  CB    . ALA A 1 94  ? 16.672  44.424  27.113 1.00 57.99  ? 169 ALA A CB    1 
ATOM   693  N  N     . VAL A 1 95  ? 18.226  41.629  27.631 1.00 55.64  ? 170 VAL A N     1 
ATOM   694  C  CA    . VAL A 1 95  ? 19.464  40.854  27.660 1.00 65.18  ? 170 VAL A CA    1 
ATOM   695  C  C     . VAL A 1 95  ? 19.376  39.684  26.689 1.00 73.23  ? 170 VAL A C     1 
ATOM   696  O  O     . VAL A 1 95  ? 20.320  39.401  25.941 1.00 77.20  ? 170 VAL A O     1 
ATOM   697  C  CB    . VAL A 1 95  ? 19.770  40.378  29.091 1.00 45.17  ? 170 VAL A CB    1 
ATOM   698  C  CG1   . VAL A 1 95  ? 20.996  39.482  29.100 1.00 51.52  ? 170 VAL A CG1   1 
ATOM   699  C  CG2   . VAL A 1 95  ? 19.977  41.563  30.010 1.00 51.28  ? 170 VAL A CG2   1 
ATOM   700  N  N     . GLU A 1 96  ? 18.235  38.985  26.691 1.00 89.66  ? 171 GLU A N     1 
ATOM   701  C  CA    . GLU A 1 96  ? 18.040  37.847  25.797 1.00 80.03  ? 171 GLU A CA    1 
ATOM   702  C  C     . GLU A 1 96  ? 18.184  38.261  24.340 1.00 74.45  ? 171 GLU A C     1 
ATOM   703  O  O     . GLU A 1 96  ? 18.883  37.604  23.560 1.00 73.68  ? 171 GLU A O     1 
ATOM   704  C  CB    . GLU A 1 96  ? 16.661  37.230  26.028 1.00 88.67  ? 171 GLU A CB    1 
ATOM   705  C  CG    . GLU A 1 96  ? 16.509  36.427  27.303 1.00 102.79 ? 171 GLU A CG    1 
ATOM   706  C  CD    . GLU A 1 96  ? 15.066  36.011  27.540 1.00 114.98 ? 171 GLU A CD    1 
ATOM   707  O  OE1   . GLU A 1 96  ? 14.632  35.988  28.711 1.00 100.05 ? 171 GLU A OE1   1 
ATOM   708  O  OE2   . GLU A 1 96  ? 14.362  35.720  26.548 1.00 114.03 ? 171 GLU A OE2   1 
ATOM   709  N  N     . LYS A 1 97  ? 17.527  39.357  23.958 1.00 72.32  ? 172 LYS A N     1 
ATOM   710  C  CA    . LYS A 1 97  ? 17.475  39.849  22.588 1.00 73.04  ? 172 LYS A CA    1 
ATOM   711  C  C     . LYS A 1 97  ? 18.746  40.601  22.163 1.00 77.77  ? 172 LYS A C     1 
ATOM   712  O  O     . LYS A 1 97  ? 18.686  41.386  21.207 1.00 73.92  ? 172 LYS A O     1 
ATOM   713  C  CB    . LYS A 1 97  ? 16.246  40.749  22.413 1.00 69.02  ? 172 LYS A CB    1 
ATOM   714  C  CG    . LYS A 1 97  ? 14.937  40.149  22.937 1.00 66.25  ? 172 LYS A CG    1 
ATOM   715  C  CD    . LYS A 1 97  ? 14.278  39.224  21.918 1.00 94.71  ? 172 LYS A CD    1 
ATOM   716  C  CE    . LYS A 1 97  ? 13.906  37.872  22.525 1.00 96.34  ? 172 LYS A CE    1 
ATOM   717  N  NZ    . LYS A 1 97  ? 12.918  37.976  23.635 1.00 89.47  ? 172 LYS A NZ    1 
ATOM   718  N  N     . ASP A 1 98  ? 19.868  40.397  22.864 1.00 86.59  ? 173 ASP A N     1 
ATOM   719  C  CA    . ASP A 1 98  ? 21.181  40.938  22.506 1.00 83.42  ? 173 ASP A CA    1 
ATOM   720  C  C     . ASP A 1 98  ? 21.258  42.458  22.640 1.00 90.16  ? 173 ASP A C     1 
ATOM   721  O  O     . ASP A 1 98  ? 22.352  43.030  22.584 1.00 100.28 ? 173 ASP A O     1 
ATOM   722  C  CB    . ASP A 1 98  ? 21.561  40.514  21.078 1.00 84.70  ? 173 ASP A CB    1 
ATOM   723  C  CG    . ASP A 1 98  ? 22.985  40.900  20.707 1.00 101.46 ? 173 ASP A CG    1 
ATOM   724  O  OD1   . ASP A 1 98  ? 23.899  40.670  21.526 1.00 96.32  ? 173 ASP A OD1   1 
ATOM   725  O  OD2   . ASP A 1 98  ? 23.190  41.440  19.597 1.00 105.69 ? 173 ASP A OD2   1 
ATOM   726  N  N     . GLY A 1 99  ? 20.122  43.123  22.842 1.00 67.26  ? 174 GLY A N     1 
ATOM   727  C  CA    . GLY A 1 99  ? 20.087  44.574  22.789 1.00 74.03  ? 174 GLY A CA    1 
ATOM   728  C  C     . GLY A 1 99  ? 20.357  45.294  24.095 1.00 69.84  ? 174 GLY A C     1 
ATOM   729  O  O     . GLY A 1 99  ? 19.792  46.366  24.338 1.00 68.03  ? 174 GLY A O     1 
ATOM   730  N  N     . ALA A 1 100 ? 21.225  44.735  24.935 1.00 67.24  ? 175 ALA A N     1 
ATOM   731  C  CA    . ALA A 1 100 ? 21.533  45.307  26.237 1.00 66.18  ? 175 ALA A CA    1 
ATOM   732  C  C     . ALA A 1 100 ? 23.033  45.527  26.382 1.00 71.34  ? 175 ALA A C     1 
ATOM   733  O  O     . ALA A 1 100 ? 23.837  44.664  26.012 1.00 69.87  ? 175 ALA A O     1 
ATOM   734  C  CB    . ALA A 1 100 ? 21.034  44.402  27.366 1.00 62.23  ? 175 ALA A CB    1 
ATOM   735  N  N     . SER A 1 101 ? 23.401  46.685  26.927 1.00 66.30  ? 176 SER A N     1 
ATOM   736  C  CA    . SER A 1 101 ? 24.785  47.020  27.230 1.00 58.76  ? 176 SER A CA    1 
ATOM   737  C  C     . SER A 1 101 ? 24.874  47.558  28.655 1.00 63.52  ? 176 SER A C     1 
ATOM   738  O  O     . SER A 1 101 ? 23.871  47.948  29.257 1.00 56.62  ? 176 SER A O     1 
ATOM   739  C  CB    . SER A 1 101 ? 25.350  48.043  26.232 1.00 54.27  ? 176 SER A CB    1 
ATOM   740  O  OG    . SER A 1 101 ? 24.605  49.250  26.250 1.00 53.56  ? 176 SER A OG    1 
ATOM   741  N  N     . ALA A 1 102 ? 26.093  47.577  29.193 1.00 65.86  ? 177 ALA A N     1 
ATOM   742  C  CA    . ALA A 1 102 ? 26.303  47.958  30.583 1.00 51.90  ? 177 ALA A CA    1 
ATOM   743  C  C     . ALA A 1 102 ? 27.670  48.606  30.741 1.00 55.97  ? 177 ALA A C     1 
ATOM   744  O  O     . ALA A 1 102 ? 28.581  48.375  29.943 1.00 59.70  ? 177 ALA A O     1 
ATOM   745  C  CB    . ALA A 1 102 ? 26.187  46.743  31.511 1.00 49.65  ? 177 ALA A CB    1 
ATOM   746  N  N     . THR A 1 103 ? 27.802  49.431  31.784 1.00 54.47  ? 178 THR A N     1 
ATOM   747  C  CA    . THR A 1 103 ? 29.072  50.040  32.167 1.00 49.42  ? 178 THR A CA    1 
ATOM   748  C  C     . THR A 1 103 ? 29.323  49.793  33.648 1.00 52.45  ? 178 THR A C     1 
ATOM   749  O  O     . THR A 1 103 ? 28.422  49.969  34.473 1.00 50.85  ? 178 THR A O     1 
ATOM   750  C  CB    . THR A 1 103 ? 29.102  51.556  31.908 1.00 44.10  ? 178 THR A CB    1 
ATOM   751  O  OG1   . THR A 1 103 ? 28.345  52.227  32.922 1.00 36.96  ? 178 THR A OG1   1 
ATOM   752  C  CG2   . THR A 1 103 ? 28.519  51.893  30.548 1.00 55.42  ? 178 THR A CG2   1 
ATOM   753  N  N     . ILE A 1 104 ? 30.549  49.383  33.985 1.00 54.38  ? 179 ILE A N     1 
ATOM   754  C  CA    . ILE A 1 104 ? 30.921  49.114  35.368 1.00 49.24  ? 179 ILE A CA    1 
ATOM   755  C  C     . ILE A 1 104 ? 32.260  49.770  35.669 1.00 47.10  ? 179 ILE A C     1 
ATOM   756  O  O     . ILE A 1 104 ? 33.110  49.929  34.787 1.00 51.36  ? 179 ILE A O     1 
ATOM   757  C  CB    . ILE A 1 104 ? 30.976  47.602  35.681 1.00 47.44  ? 179 ILE A CB    1 
ATOM   758  C  CG1   . ILE A 1 104 ? 32.172  46.945  34.999 1.00 43.41  ? 179 ILE A CG1   1 
ATOM   759  C  CG2   . ILE A 1 104 ? 29.685  46.916  35.264 1.00 46.76  ? 179 ILE A CG2   1 
ATOM   760  C  CD1   . ILE A 1 104 ? 32.323  45.482  35.330 1.00 47.70  ? 179 ILE A CD1   1 
ATOM   761  N  N     . ASP A 1 105 ? 32.441  50.156  36.932 1.00 48.91  ? 180 ASP A N     1 
ATOM   762  C  CA    . ASP A 1 105 ? 33.660  50.817  37.389 1.00 46.81  ? 180 ASP A CA    1 
ATOM   763  C  C     . ASP A 1 105 ? 33.725  50.711  38.912 1.00 47.35  ? 180 ASP A C     1 
ATOM   764  O  O     . ASP A 1 105 ? 32.821  50.172  39.557 1.00 43.09  ? 180 ASP A O     1 
ATOM   765  C  CB    . ASP A 1 105 ? 33.704  52.274  36.912 1.00 40.67  ? 180 ASP A CB    1 
ATOM   766  C  CG    . ASP A 1 105 ? 35.115  52.838  36.868 1.00 52.26  ? 180 ASP A CG    1 
ATOM   767  O  OD1   . ASP A 1 105 ? 35.845  52.697  37.870 1.00 44.07  ? 180 ASP A OD1   1 
ATOM   768  O  OD2   . ASP A 1 105 ? 35.496  53.422  35.827 1.00 65.31  ? 180 ASP A OD2   1 
ATOM   769  N  N     . LEU A 1 106 ? 34.808  51.239  39.485 1.00 50.00  ? 181 LEU A N     1 
ATOM   770  C  CA    . LEU A 1 106 ? 35.070  51.177  40.918 1.00 38.17  ? 181 LEU A CA    1 
ATOM   771  C  C     . LEU A 1 106 ? 35.180  52.574  41.517 1.00 41.01  ? 181 LEU A C     1 
ATOM   772  O  O     . LEU A 1 106 ? 35.712  53.495  40.889 1.00 44.42  ? 181 LEU A O     1 
ATOM   773  C  CB    . LEU A 1 106 ? 36.355  50.404  41.203 1.00 44.06  ? 181 LEU A CB    1 
ATOM   774  C  CG    . LEU A 1 106 ? 36.324  48.898  40.978 1.00 38.29  ? 181 LEU A CG    1 
ATOM   775  C  CD1   . LEU A 1 106 ? 37.733  48.409  40.760 1.00 36.04  ? 181 LEU A CD1   1 
ATOM   776  C  CD2   . LEU A 1 106 ? 35.697  48.201  42.173 1.00 39.85  ? 181 LEU A CD2   1 
ATOM   777  N  N     . TRP A 1 107 ? 34.705  52.712  42.753 1.00 33.98  ? 182 TRP A N     1 
ATOM   778  C  CA    . TRP A 1 107 ? 34.663  53.984  43.457 1.00 31.71  ? 182 TRP A CA    1 
ATOM   779  C  C     . TRP A 1 107 ? 34.742  53.694  44.945 1.00 43.75  ? 182 TRP A C     1 
ATOM   780  O  O     . TRP A 1 107 ? 34.344  52.619  45.398 1.00 55.91  ? 182 TRP A O     1 
ATOM   781  C  CB    . TRP A 1 107 ? 33.380  54.756  43.112 1.00 49.89  ? 182 TRP A CB    1 
ATOM   782  C  CG    . TRP A 1 107 ? 33.078  55.999  43.934 1.00 53.10  ? 182 TRP A CG    1 
ATOM   783  C  CD1   . TRP A 1 107 ? 33.655  57.231  43.804 1.00 50.28  ? 182 TRP A CD1   1 
ATOM   784  C  CD2   . TRP A 1 107 ? 32.086  56.133  44.969 1.00 45.83  ? 182 TRP A CD2   1 
ATOM   785  N  NE1   . TRP A 1 107 ? 33.104  58.113  44.705 1.00 41.79  ? 182 TRP A NE1   1 
ATOM   786  C  CE2   . TRP A 1 107 ? 32.139  57.464  45.431 1.00 36.12  ? 182 TRP A CE2   1 
ATOM   787  C  CE3   . TRP A 1 107 ? 31.169  55.253  45.557 1.00 52.86  ? 182 TRP A CE3   1 
ATOM   788  C  CZ2   . TRP A 1 107 ? 31.312  57.936  46.453 1.00 40.24  ? 182 TRP A CZ2   1 
ATOM   789  C  CZ3   . TRP A 1 107 ? 30.345  55.726  46.575 1.00 40.01  ? 182 TRP A CZ3   1 
ATOM   790  C  CH2   . TRP A 1 107 ? 30.424  57.053  47.009 1.00 39.12  ? 182 TRP A CH2   1 
ATOM   791  N  N     . THR A 1 108 ? 35.274  54.647  45.704 1.00 51.09  ? 183 THR A N     1 
ATOM   792  C  CA    . THR A 1 108 ? 35.305  54.528  47.155 1.00 54.04  ? 183 THR A CA    1 
ATOM   793  C  C     . THR A 1 108 ? 34.824  55.831  47.784 1.00 47.33  ? 183 THR A C     1 
ATOM   794  O  O     . THR A 1 108 ? 35.201  56.921  47.346 1.00 43.56  ? 183 THR A O     1 
ATOM   795  C  CB    . THR A 1 108 ? 36.712  54.128  47.675 1.00 39.00  ? 183 THR A CB    1 
ATOM   796  O  OG1   . THR A 1 108 ? 37.044  54.897  48.835 1.00 57.01  ? 183 THR A OG1   1 
ATOM   797  C  CG2   . THR A 1 108 ? 37.773  54.320  46.618 1.00 33.52  ? 183 THR A CG2   1 
ATOM   798  N  N     . ASP A 1 109 ? 33.964  55.706  48.794 1.00 49.51  ? 184 ASP A N     1 
ATOM   799  C  CA    . ASP A 1 109 ? 33.311  56.852  49.406 1.00 48.22  ? 184 ASP A CA    1 
ATOM   800  C  C     . ASP A 1 109 ? 34.262  57.560  50.365 1.00 46.32  ? 184 ASP A C     1 
ATOM   801  O  O     . ASP A 1 109 ? 35.201  56.972  50.903 1.00 55.00  ? 184 ASP A O     1 
ATOM   802  C  CB    . ASP A 1 109 ? 32.034  56.427  50.138 1.00 43.06  ? 184 ASP A CB    1 
ATOM   803  C  CG    . ASP A 1 109 ? 32.316  55.726  51.451 1.00 47.22  ? 184 ASP A CG    1 
ATOM   804  O  OD1   . ASP A 1 109 ? 32.707  54.543  51.424 1.00 56.08  ? 184 ASP A OD1   1 
ATOM   805  O  OD2   . ASP A 1 109 ? 32.132  56.355  52.513 1.00 59.12  ? 184 ASP A OD2   1 
ATOM   806  N  N     . ASN A 1 110 ? 33.992  58.846  50.584 1.00 49.20  ? 185 ASN A N     1 
ATOM   807  C  CA    . ASN A 1 110 ? 34.953  59.730  51.230 1.00 54.70  ? 185 ASN A CA    1 
ATOM   808  C  C     . ASN A 1 110 ? 34.971  59.612  52.747 1.00 55.66  ? 185 ASN A C     1 
ATOM   809  O  O     . ASN A 1 110 ? 35.885  60.154  53.375 1.00 66.82  ? 185 ASN A O     1 
ATOM   810  C  CB    . ASN A 1 110 ? 34.671  61.180  50.827 1.00 44.91  ? 185 ASN A CB    1 
ATOM   811  C  CG    . ASN A 1 110 ? 34.772  61.397  49.325 1.00 64.48  ? 185 ASN A CG    1 
ATOM   812  O  OD1   . ASN A 1 110 ? 34.994  60.456  48.562 1.00 74.21  ? 185 ASN A OD1   1 
ATOM   813  N  ND2   . ASN A 1 110 ? 34.599  62.641  48.894 1.00 75.92  ? 185 ASN A ND2   1 
ATOM   814  N  N     . TYR A 1 111 ? 34.006  58.918  53.350 1.00 58.58  ? 186 TYR A N     1 
ATOM   815  C  CA    . TYR A 1 111 ? 33.922  58.807  54.803 1.00 54.04  ? 186 TYR A CA    1 
ATOM   816  C  C     . TYR A 1 111 ? 34.311  57.408  55.268 1.00 61.72  ? 186 TYR A C     1 
ATOM   817  O  O     . TYR A 1 111 ? 35.378  57.233  55.863 1.00 76.14  ? 186 TYR A O     1 
ATOM   818  C  CB    . TYR A 1 111 ? 32.520  59.185  55.295 1.00 57.54  ? 186 TYR A CB    1 
ATOM   819  C  CG    . TYR A 1 111 ? 32.150  60.626  55.009 1.00 54.49  ? 186 TYR A CG    1 
ATOM   820  C  CD1   . TYR A 1 111 ? 32.451  61.637  55.914 1.00 50.92  ? 186 TYR A CD1   1 
ATOM   821  C  CD2   . TYR A 1 111 ? 31.514  60.976  53.826 1.00 55.80  ? 186 TYR A CD2   1 
ATOM   822  C  CE1   . TYR A 1 111 ? 32.123  62.959  55.649 1.00 61.32  ? 186 TYR A CE1   1 
ATOM   823  C  CE2   . TYR A 1 111 ? 31.184  62.291  53.551 1.00 51.37  ? 186 TYR A CE2   1 
ATOM   824  C  CZ    . TYR A 1 111 ? 31.488  63.279  54.464 1.00 60.44  ? 186 TYR A CZ    1 
ATOM   825  O  OH    . TYR A 1 111 ? 31.156  64.588  54.189 1.00 61.94  ? 186 TYR A OH    1 
ATOM   826  N  N     . ILE A 1 112 ? 33.474  56.401  55.014 1.00 59.66  ? 187 ILE A N     1 
ATOM   827  C  CA    . ILE A 1 112 ? 33.772  55.054  55.488 1.00 58.39  ? 187 ILE A CA    1 
ATOM   828  C  C     . ILE A 1 112 ? 34.851  54.374  54.652 1.00 64.98  ? 187 ILE A C     1 
ATOM   829  O  O     . ILE A 1 112 ? 35.537  53.475  55.159 1.00 58.01  ? 187 ILE A O     1 
ATOM   830  C  CB    . ILE A 1 112 ? 32.483  54.218  55.525 1.00 48.57  ? 187 ILE A CB    1 
ATOM   831  C  CG1   . ILE A 1 112 ? 31.364  55.024  56.184 1.00 63.42  ? 187 ILE A CG1   1 
ATOM   832  C  CG2   . ILE A 1 112 ? 32.691  52.926  56.293 1.00 48.47  ? 187 ILE A CG2   1 
ATOM   833  C  CD1   . ILE A 1 112 ? 31.681  55.460  57.602 1.00 61.64  ? 187 ILE A CD1   1 
ATOM   834  N  N     . LYS A 1 113 ? 35.020  54.792  53.392 1.00 61.45  ? 188 LYS A N     1 
ATOM   835  C  CA    . LYS A 1 113 ? 36.092  54.334  52.503 1.00 53.15  ? 188 LYS A CA    1 
ATOM   836  C  C     . LYS A 1 113 ? 35.870  52.914  51.993 1.00 55.73  ? 188 LYS A C     1 
ATOM   837  O  O     . LYS A 1 113 ? 36.835  52.183  51.756 1.00 70.46  ? 188 LYS A O     1 
ATOM   838  C  CB    . LYS A 1 113 ? 37.471  54.440  53.167 1.00 51.41  ? 188 LYS A CB    1 
ATOM   839  C  CG    . LYS A 1 113 ? 37.937  55.857  53.451 1.00 50.58  ? 188 LYS A CG    1 
ATOM   840  C  CD    . LYS A 1 113 ? 38.383  56.565  52.181 1.00 62.11  ? 188 LYS A CD    1 
ATOM   841  C  CE    . LYS A 1 113 ? 39.205  57.801  52.504 1.00 70.66  ? 188 LYS A CE    1 
ATOM   842  N  NZ    . LYS A 1 113 ? 38.491  58.679  53.469 1.00 80.55  ? 188 LYS A NZ    1 
ATOM   843  N  N     . ARG A 1 114 ? 34.617  52.501  51.813 1.00 43.71  ? 189 ARG A N     1 
ATOM   844  C  CA    . ARG A 1 114 ? 34.361  51.224  51.163 1.00 50.22  ? 189 ARG A CA    1 
ATOM   845  C  C     . ARG A 1 114 ? 34.612  51.352  49.669 1.00 46.69  ? 189 ARG A C     1 
ATOM   846  O  O     . ARG A 1 114 ? 34.319  52.384  49.068 1.00 52.49  ? 189 ARG A O     1 
ATOM   847  C  CB    . ARG A 1 114 ? 32.922  50.755  51.390 1.00 49.55  ? 189 ARG A CB    1 
ATOM   848  C  CG    . ARG A 1 114 ? 32.166  51.407  52.530 1.00 55.57  ? 189 ARG A CG    1 
ATOM   849  C  CD    . ARG A 1 114 ? 30.668  51.213  52.328 1.00 52.51  ? 189 ARG A CD    1 
ATOM   850  N  NE    . ARG A 1 114 ? 29.875  51.570  53.504 1.00 83.51  ? 189 ARG A NE    1 
ATOM   851  C  CZ    . ARG A 1 114 ? 29.342  52.770  53.724 1.00 73.47  ? 189 ARG A CZ    1 
ATOM   852  N  NH1   . ARG A 1 114 ? 29.516  53.758  52.854 1.00 42.86  ? 189 ARG A NH1   1 
ATOM   853  N  NH2   . ARG A 1 114 ? 28.635  52.986  54.826 1.00 78.76  ? 189 ARG A NH2   1 
ATOM   854  N  N     . ASN A 1 115 ? 35.154  50.302  49.064 1.00 52.30  ? 190 ASN A N     1 
ATOM   855  C  CA    . ASN A 1 115 ? 35.238  50.250  47.613 1.00 42.73  ? 190 ASN A CA    1 
ATOM   856  C  C     . ASN A 1 115 ? 33.906  49.761  47.061 1.00 56.49  ? 190 ASN A C     1 
ATOM   857  O  O     . ASN A 1 115 ? 33.259  48.892  47.651 1.00 66.19  ? 190 ASN A O     1 
ATOM   858  C  CB    . ASN A 1 115 ? 36.376  49.331  47.175 1.00 58.16  ? 190 ASN A CB    1 
ATOM   859  C  CG    . ASN A 1 115 ? 37.451  49.199  48.238 1.00 94.14  ? 190 ASN A CG    1 
ATOM   860  O  OD1   . ASN A 1 115 ? 37.322  48.402  49.169 1.00 93.67  ? 190 ASN A OD1   1 
ATOM   861  N  ND2   . ASN A 1 115 ? 38.514  49.988  48.112 1.00 88.12  ? 190 ASN A ND2   1 
ATOM   862  N  N     . PHE A 1 116 ? 33.483  50.340  45.940 1.00 50.26  ? 191 PHE A N     1 
ATOM   863  C  CA    . PHE A 1 116 ? 32.164  50.077  45.381 1.00 43.87  ? 191 PHE A CA    1 
ATOM   864  C  C     . PHE A 1 116 ? 32.280  49.639  43.929 1.00 44.72  ? 191 PHE A C     1 
ATOM   865  O  O     . PHE A 1 116 ? 33.212  50.025  43.218 1.00 47.43  ? 191 PHE A O     1 
ATOM   866  C  CB    . PHE A 1 116 ? 31.255  51.313  45.452 1.00 56.63  ? 191 PHE A CB    1 
ATOM   867  C  CG    . PHE A 1 116 ? 30.550  51.481  46.765 1.00 47.26  ? 191 PHE A CG    1 
ATOM   868  C  CD1   . PHE A 1 116 ? 31.085  52.286  47.756 1.00 47.86  ? 191 PHE A CD1   1 
ATOM   869  C  CD2   . PHE A 1 116 ? 29.345  50.846  47.001 1.00 39.28  ? 191 PHE A CD2   1 
ATOM   870  C  CE1   . PHE A 1 116 ? 30.435  52.448  48.963 1.00 39.23  ? 191 PHE A CE1   1 
ATOM   871  C  CE2   . PHE A 1 116 ? 28.690  51.005  48.203 1.00 44.74  ? 191 PHE A CE2   1 
ATOM   872  C  CZ    . PHE A 1 116 ? 29.237  51.807  49.187 1.00 36.16  ? 191 PHE A CZ    1 
ATOM   873  N  N     . LEU A 1 117 ? 31.314  48.832  43.498 1.00 38.51  ? 192 LEU A N     1 
ATOM   874  C  CA    . LEU A 1 117 ? 31.167  48.432  42.104 1.00 42.91  ? 192 LEU A CA    1 
ATOM   875  C  C     . LEU A 1 117 ? 29.849  48.999  41.588 1.00 45.67  ? 192 LEU A C     1 
ATOM   876  O  O     . LEU A 1 117 ? 28.773  48.606  42.050 1.00 43.89  ? 192 LEU A O     1 
ATOM   877  C  CB    . LEU A 1 117 ? 31.200  46.914  41.959 1.00 35.42  ? 192 LEU A CB    1 
ATOM   878  C  CG    . LEU A 1 117 ? 30.949  46.427  40.535 1.00 50.37  ? 192 LEU A CG    1 
ATOM   879  C  CD1   . LEU A 1 117 ? 32.030  46.945  39.599 1.00 44.56  ? 192 LEU A CD1   1 
ATOM   880  C  CD2   . LEU A 1 117 ? 30.881  44.913  40.499 1.00 51.94  ? 192 LEU A CD2   1 
ATOM   881  N  N     . GLY A 1 118 ? 29.932  49.927  40.642 1.00 35.67  ? 193 GLY A N     1 
ATOM   882  C  CA    . GLY A 1 118 ? 28.755  50.500  40.018 1.00 35.78  ? 193 GLY A CA    1 
ATOM   883  C  C     . GLY A 1 118 ? 28.426  49.752  38.725 1.00 55.00  ? 193 GLY A C     1 
ATOM   884  O  O     . GLY A 1 118 ? 29.323  49.394  37.969 1.00 51.94  ? 193 GLY A O     1 
ATOM   885  N  N     . VAL A 1 119 ? 27.135  49.515  38.510 1.00 37.79  ? 194 VAL A N     1 
ATOM   886  C  CA    . VAL A 1 119 ? 26.660  48.844  37.301 1.00 43.70  ? 194 VAL A CA    1 
ATOM   887  C  C     . VAL A 1 119 ? 25.451  49.605  36.771 1.00 46.62  ? 194 VAL A C     1 
ATOM   888  O  O     . VAL A 1 119 ? 24.480  49.818  37.504 1.00 54.56  ? 194 VAL A O     1 
ATOM   889  C  CB    . VAL A 1 119 ? 26.286  47.373  37.554 1.00 50.20  ? 194 VAL A CB    1 
ATOM   890  C  CG1   . VAL A 1 119 ? 25.849  46.718  36.256 1.00 57.97  ? 194 VAL A CG1   1 
ATOM   891  C  CG2   . VAL A 1 119 ? 27.449  46.604  38.178 1.00 42.38  ? 194 VAL A CG2   1 
ATOM   892  N  N     . THR A 1 120 ? 25.505  50.013  35.503 1.00 45.31  ? 195 THR A N     1 
ATOM   893  C  CA    . THR A 1 120 ? 24.370  50.627  34.828 1.00 52.92  ? 195 THR A CA    1 
ATOM   894  C  C     . THR A 1 120 ? 23.962  49.776  33.632 1.00 56.44  ? 195 THR A C     1 
ATOM   895  O  O     . THR A 1 120 ? 24.738  48.954  33.142 1.00 53.45  ? 195 THR A O     1 
ATOM   896  C  CB    . THR A 1 120 ? 24.681  52.057  34.359 1.00 55.83  ? 195 THR A CB    1 
ATOM   897  O  OG1   . THR A 1 120 ? 25.737  52.028  33.390 1.00 56.36  ? 195 THR A OG1   1 
ATOM   898  C  CG2   . THR A 1 120 ? 25.084  52.936  35.539 1.00 43.44  ? 195 THR A CG2   1 
ATOM   899  N  N     . LEU A 1 121 ? 22.730  49.978  33.158 1.00 52.14  ? 196 LEU A N     1 
ATOM   900  C  CA    . LEU A 1 121 ? 22.209  49.221  32.027 1.00 58.32  ? 196 LEU A CA    1 
ATOM   901  C  C     . LEU A 1 121 ? 21.602  50.160  30.994 1.00 59.52  ? 196 LEU A C     1 
ATOM   902  O  O     . LEU A 1 121 ? 21.004  51.187  31.333 1.00 49.02  ? 196 LEU A O     1 
ATOM   903  C  CB    . LEU A 1 121 ? 21.162  48.189  32.466 1.00 53.33  ? 196 LEU A CB    1 
ATOM   904  C  CG    . LEU A 1 121 ? 20.862  47.096  31.437 1.00 59.45  ? 196 LEU A CG    1 
ATOM   905  C  CD1   . LEU A 1 121 ? 22.004  46.085  31.353 1.00 54.74  ? 196 LEU A CD1   1 
ATOM   906  C  CD2   . LEU A 1 121 ? 19.547  46.404  31.746 1.00 65.59  ? 196 LEU A CD2   1 
ATOM   907  N  N     . HIS A 1 122 ? 21.749  49.787  29.722 1.00 57.99  ? 197 HIS A N     1 
ATOM   908  C  CA    . HIS A 1 122 ? 21.378  50.647  28.604 1.00 59.74  ? 197 HIS A CA    1 
ATOM   909  C  C     . HIS A 1 122 ? 20.763  49.809  27.494 1.00 58.79  ? 197 HIS A C     1 
ATOM   910  O  O     . HIS A 1 122 ? 21.401  48.878  26.992 1.00 57.87  ? 197 HIS A O     1 
ATOM   911  C  CB    . HIS A 1 122 ? 22.604  51.408  28.087 1.00 59.29  ? 197 HIS A CB    1 
ATOM   912  C  CG    . HIS A 1 122 ? 23.376  52.091  29.171 1.00 54.62  ? 197 HIS A CG    1 
ATOM   913  N  ND1   . HIS A 1 122 ? 23.226  53.430  29.457 1.00 57.31  ? 197 HIS A ND1   1 
ATOM   914  C  CD2   . HIS A 1 122 ? 24.271  51.612  30.066 1.00 52.55  ? 197 HIS A CD2   1 
ATOM   915  C  CE1   . HIS A 1 122 ? 24.009  53.751  30.471 1.00 56.81  ? 197 HIS A CE1   1 
ATOM   916  N  NE2   . HIS A 1 122 ? 24.653  52.665  30.860 1.00 47.17  ? 197 HIS A NE2   1 
ATOM   917  N  N     . TYR A 1 123 ? 19.538  50.150  27.105 1.00 49.61  ? 198 TYR A N     1 
ATOM   918  C  CA    . TYR A 1 123 ? 18.888  49.498  25.977 1.00 61.43  ? 198 TYR A CA    1 
ATOM   919  C  C     . TYR A 1 123 ? 17.874  50.460  25.368 1.00 66.19  ? 198 TYR A C     1 
ATOM   920  O  O     . TYR A 1 123 ? 17.522  51.483  25.961 1.00 55.55  ? 198 TYR A O     1 
ATOM   921  C  CB    . TYR A 1 123 ? 18.236  48.175  26.397 1.00 52.27  ? 198 TYR A CB    1 
ATOM   922  C  CG    . TYR A 1 123 ? 17.204  48.284  27.504 1.00 68.49  ? 198 TYR A CG    1 
ATOM   923  C  CD1   . TYR A 1 123 ? 15.949  48.834  27.260 1.00 70.71  ? 198 TYR A CD1   1 
ATOM   924  C  CD2   . TYR A 1 123 ? 17.469  47.809  28.784 1.00 58.97  ? 198 TYR A CD2   1 
ATOM   925  C  CE1   . TYR A 1 123 ? 14.997  48.928  28.255 1.00 60.93  ? 198 TYR A CE1   1 
ATOM   926  C  CE2   . TYR A 1 123 ? 16.516  47.898  29.792 1.00 64.30  ? 198 TYR A CE2   1 
ATOM   927  C  CZ    . TYR A 1 123 ? 15.280  48.460  29.518 1.00 66.36  ? 198 TYR A CZ    1 
ATOM   928  O  OH    . TYR A 1 123 ? 14.321  48.557  30.502 1.00 57.66  ? 198 TYR A OH    1 
ATOM   929  N  N     . HIS A 1 124 ? 17.413  50.116  24.167 1.00 65.77  ? 199 HIS A N     1 
ATOM   930  C  CA    . HIS A 1 124 ? 16.411  50.882  23.438 1.00 67.04  ? 199 HIS A CA    1 
ATOM   931  C  C     . HIS A 1 124 ? 15.002  50.385  23.772 1.00 72.88  ? 199 HIS A C     1 
ATOM   932  O  O     . HIS A 1 124 ? 14.776  49.181  23.938 1.00 57.94  ? 199 HIS A O     1 
ATOM   933  C  CB    . HIS A 1 124 ? 16.655  50.773  21.929 1.00 74.98  ? 199 HIS A CB    1 
ATOM   934  C  CG    . HIS A 1 124 ? 15.608  51.446  21.100 1.00 74.24  ? 199 HIS A CG    1 
ATOM   935  N  ND1   . HIS A 1 124 ? 15.343  52.795  21.190 1.00 91.86  ? 199 HIS A ND1   1 
ATOM   936  C  CD2   . HIS A 1 124 ? 14.748  50.954  20.177 1.00 73.30  ? 199 HIS A CD2   1 
ATOM   937  C  CE1   . HIS A 1 124 ? 14.371  53.107  20.351 1.00 84.17  ? 199 HIS A CE1   1 
ATOM   938  N  NE2   . HIS A 1 124 ? 13.992  52.008  19.725 1.00 71.58  ? 199 HIS A NE2   1 
ATOM   939  N  N     . GLU A 1 125 ? 14.052  51.336  23.877 1.00 85.16  ? 200 GLU A N     1 
ATOM   940  C  CA    . GLU A 1 125 ? 12.620  51.069  24.070 1.00 84.25  ? 200 GLU A CA    1 
ATOM   941  C  C     . GLU A 1 125 ? 11.775  51.603  22.918 1.00 90.49  ? 200 GLU A C     1 
ATOM   942  O  O     . GLU A 1 125 ? 11.716  51.002  21.837 1.00 95.69  ? 200 GLU A O     1 
ATOM   943  C  CB    . GLU A 1 125 ? 12.099  51.706  25.368 1.00 90.37  ? 200 GLU A CB    1 
ATOM   944  C  CG    . GLU A 1 125 ? 10.768  51.145  25.900 1.00 89.72  ? 200 GLU A CG    1 
ATOM   945  C  CD    . GLU A 1 125 ? 10.915  49.740  26.458 1.00 94.31  ? 200 GLU A CD    1 
ATOM   946  O  OE1   . GLU A 1 125 ? 10.936  48.775  25.660 1.00 97.65  ? 200 GLU A OE1   1 
ATOM   947  O  OE2   . GLU A 1 125 ? 11.031  49.606  27.697 1.00 89.17  ? 200 GLU A OE2   1 
ATOM   948  N  N     . ASN A 1 126 ? 11.100  52.726  23.159 1.00 81.31  ? 201 ASN A N     1 
ATOM   949  C  CA    . ASN A 1 126 ? 10.156  53.314  22.215 1.00 96.79  ? 201 ASN A CA    1 
ATOM   950  C  C     . ASN A 1 126 ? 10.712  54.678  21.851 1.00 102.34 ? 201 ASN A C     1 
ATOM   951  O  O     . ASN A 1 126 ? 10.384  55.691  22.476 1.00 109.98 ? 201 ASN A O     1 
ATOM   952  C  CB    . ASN A 1 126 ? 8.759   53.414  22.787 1.00 111.50 ? 201 ASN A CB    1 
ATOM   953  C  CG    . ASN A 1 126 ? 7.770   52.608  21.999 1.00 99.28  ? 201 ASN A CG    1 
ATOM   954  O  OD1   . ASN A 1 126 ? 8.034   51.461  21.651 1.00 96.92  ? 201 ASN A OD1   1 
ATOM   955  N  ND2   . ASN A 1 126 ? 6.625   53.207  21.692 1.00 103.27 ? 201 ASN A ND2   1 
ATOM   956  N  N     . ASN A 1 127 ? 11.643  54.663  20.894 1.00 95.26  ? 202 ASN A N     1 
ATOM   957  C  CA    . ASN A 1 127 ? 12.251  55.857  20.321 1.00 105.74 ? 202 ASN A CA    1 
ATOM   958  C  C     . ASN A 1 127 ? 13.114  56.563  21.361 1.00 103.07 ? 202 ASN A C     1 
ATOM   959  O  O     . ASN A 1 127 ? 13.722  57.607  21.085 1.00 103.22 ? 202 ASN A O     1 
ATOM   960  C  CB    . ASN A 1 127 ? 11.164  56.782  19.764 1.00 113.08 ? 202 ASN A CB    1 
ATOM   961  C  CG    . ASN A 1 127 ? 11.722  57.897  18.910 1.00 118.18 ? 202 ASN A CG    1 
ATOM   962  O  OD1   . ASN A 1 127 ? 12.850  57.823  18.417 1.00 123.30 ? 202 ASN A OD1   1 
ATOM   963  N  ND2   . ASN A 1 127 ? 10.928  58.950  18.733 1.00 125.91 ? 202 ASN A ND2   1 
ATOM   964  N  N     . GLU A 1 128 ? 13.186  55.976  22.556 1.00 98.70  ? 203 GLU A N     1 
ATOM   965  C  CA    . GLU A 1 128 ? 13.914  56.546  23.670 1.00 95.46  ? 203 GLU A CA    1 
ATOM   966  C  C     . GLU A 1 128 ? 14.825  55.489  24.275 1.00 78.66  ? 203 GLU A C     1 
ATOM   967  O  O     . GLU A 1 128 ? 14.653  54.280  24.073 1.00 66.40  ? 203 GLU A O     1 
ATOM   968  C  CB    . GLU A 1 128 ? 12.959  57.097  24.735 1.00 92.06  ? 203 GLU A CB    1 
ATOM   969  C  CG    . GLU A 1 128 ? 12.070  56.053  25.383 1.00 96.68  ? 203 GLU A CG    1 
ATOM   970  C  CD    . GLU A 1 128 ? 11.069  56.668  26.337 1.00 101.94 ? 203 GLU A CD    1 
ATOM   971  O  OE1   . GLU A 1 128 ? 11.010  57.914  26.414 1.00 78.04  ? 203 GLU A OE1   1 
ATOM   972  O  OE2   . GLU A 1 128 ? 10.341  55.910  27.008 1.00 114.29 ? 203 GLU A OE2   1 
ATOM   973  N  N     . LEU A 1 129 ? 15.799  55.975  25.032 1.00 73.83  ? 204 LEU A N     1 
ATOM   974  C  CA    . LEU A 1 129 ? 16.844  55.147  25.607 1.00 72.13  ? 204 LEU A CA    1 
ATOM   975  C  C     . LEU A 1 129 ? 16.606  54.959  27.095 1.00 61.68  ? 204 LEU A C     1 
ATOM   976  O  O     . LEU A 1 129 ? 16.134  55.869  27.783 1.00 70.29  ? 204 LEU A O     1 
ATOM   977  C  CB    . LEU A 1 129 ? 18.221  55.771  25.381 1.00 68.39  ? 204 LEU A CB    1 
ATOM   978  C  CG    . LEU A 1 129 ? 18.839  55.544  24.008 1.00 58.04  ? 204 LEU A CG    1 
ATOM   979  C  CD1   . LEU A 1 129 ? 20.088  56.381  23.864 1.00 58.35  ? 204 LEU A CD1   1 
ATOM   980  C  CD2   . LEU A 1 129 ? 19.154  54.073  23.830 1.00 62.51  ? 204 LEU A CD2   1 
ATOM   981  N  N     . ARG A 1 130 ? 16.934  53.773  27.582 1.00 49.67  ? 205 ARG A N     1 
ATOM   982  C  CA    . ARG A 1 130 ? 16.883  53.470  29.001 1.00 53.81  ? 205 ARG A CA    1 
ATOM   983  C  C     . ARG A 1 130 ? 18.272  53.637  29.598 1.00 57.64  ? 205 ARG A C     1 
ATOM   984  O  O     . ARG A 1 130 ? 19.271  53.247  28.988 1.00 58.29  ? 205 ARG A O     1 
ATOM   985  C  CB    . ARG A 1 130 ? 16.379  52.047  29.240 1.00 71.53  ? 205 ARG A CB    1 
ATOM   986  C  CG    . ARG A 1 130 ? 15.066  51.967  29.981 1.00 62.54  ? 205 ARG A CG    1 
ATOM   987  C  CD    . ARG A 1 130 ? 13.996  52.767  29.276 1.00 80.06  ? 205 ARG A CD    1 
ATOM   988  N  NE    . ARG A 1 130 ? 12.669  52.208  29.503 1.00 92.49  ? 205 ARG A NE    1 
ATOM   989  C  CZ    . ARG A 1 130 ? 11.565  52.659  28.919 1.00 85.95  ? 205 ARG A CZ    1 
ATOM   990  N  NH1   . ARG A 1 130 ? 11.634  53.679  28.075 1.00 90.83  ? 205 ARG A NH1   1 
ATOM   991  N  NH2   . ARG A 1 130 ? 10.395  52.089  29.176 1.00 85.01  ? 205 ARG A NH2   1 
ATOM   992  N  N     . ASP A 1 131 ? 18.329  54.229  30.790 1.00 65.52  ? 206 ASP A N     1 
ATOM   993  C  CA    . ASP A 1 131 ? 19.587  54.493  31.494 1.00 51.05  ? 206 ASP A CA    1 
ATOM   994  C  C     . ASP A 1 131 ? 19.352  54.095  32.949 1.00 52.61  ? 206 ASP A C     1 
ATOM   995  O  O     . ASP A 1 131 ? 18.980  54.929  33.779 1.00 60.40  ? 206 ASP A O     1 
ATOM   996  C  CB    . ASP A 1 131 ? 19.999  55.954  31.358 1.00 56.02  ? 206 ASP A CB    1 
ATOM   997  C  CG    . ASP A 1 131 ? 21.407  56.224  31.861 1.00 68.57  ? 206 ASP A CG    1 
ATOM   998  O  OD1   . ASP A 1 131 ? 21.987  55.362  32.557 1.00 69.59  ? 206 ASP A OD1   1 
ATOM   999  O  OD2   . ASP A 1 131 ? 21.934  57.317  31.565 1.00 62.37  ? 206 ASP A OD2   1 
ATOM   1000 N  N     . LEU A 1 132 ? 19.572  52.820  33.250 1.00 44.17  ? 207 LEU A N     1 
ATOM   1001 C  CA    . LEU A 1 132 ? 19.221  52.249  34.544 1.00 49.53  ? 207 LEU A CA    1 
ATOM   1002 C  C     . LEU A 1 132 ? 20.454  52.118  35.424 1.00 52.12  ? 207 LEU A C     1 
ATOM   1003 O  O     . LEU A 1 132 ? 21.505  51.670  34.959 1.00 58.42  ? 207 LEU A O     1 
ATOM   1004 C  CB    . LEU A 1 132 ? 18.567  50.876  34.369 1.00 61.55  ? 207 LEU A CB    1 
ATOM   1005 C  CG    . LEU A 1 132 ? 17.058  50.732  34.583 1.00 55.00  ? 207 LEU A CG    1 
ATOM   1006 C  CD1   . LEU A 1 132 ? 16.388  52.083  34.766 1.00 59.52  ? 207 LEU A CD1   1 
ATOM   1007 C  CD2   . LEU A 1 132 ? 16.433  49.982  33.418 1.00 56.65  ? 207 LEU A CD2   1 
ATOM   1008 N  N     . ILE A 1 133 ? 20.319  52.505  36.689 1.00 47.94  ? 208 ILE A N     1 
ATOM   1009 C  CA    . ILE A 1 133 ? 21.290  52.159  37.721 1.00 48.16  ? 208 ILE A CA    1 
ATOM   1010 C  C     . ILE A 1 133 ? 20.869  50.810  38.292 1.00 48.14  ? 208 ILE A C     1 
ATOM   1011 O  O     . ILE A 1 133 ? 19.869  50.713  39.006 1.00 55.03  ? 208 ILE A O     1 
ATOM   1012 C  CB    . ILE A 1 133 ? 21.367  53.226  38.820 1.00 46.56  ? 208 ILE A CB    1 
ATOM   1013 C  CG1   . ILE A 1 133 ? 21.997  54.511  38.288 1.00 37.81  ? 208 ILE A CG1   1 
ATOM   1014 C  CG2   . ILE A 1 133 ? 22.154  52.705  40.022 1.00 36.00  ? 208 ILE A CG2   1 
ATOM   1015 C  CD1   . ILE A 1 133 ? 22.058  55.619  39.316 1.00 38.67  ? 208 ILE A CD1   1 
ATOM   1016 N  N     . LEU A 1 134 ? 21.629  49.764  37.972 1.00 44.79  ? 209 LEU A N     1 
ATOM   1017 C  CA    . LEU A 1 134 ? 21.287  48.431  38.454 1.00 48.09  ? 209 LEU A CA    1 
ATOM   1018 C  C     . LEU A 1 134 ? 21.740  48.187  39.888 1.00 52.24  ? 209 LEU A C     1 
ATOM   1019 O  O     . LEU A 1 134 ? 21.117  47.389  40.597 1.00 63.00  ? 209 LEU A O     1 
ATOM   1020 C  CB    . LEU A 1 134 ? 21.892  47.367  37.541 1.00 51.47  ? 209 LEU A CB    1 
ATOM   1021 C  CG    . LEU A 1 134 ? 21.293  47.263  36.144 1.00 50.48  ? 209 LEU A CG    1 
ATOM   1022 C  CD1   . LEU A 1 134 ? 21.911  46.086  35.419 1.00 57.19  ? 209 LEU A CD1   1 
ATOM   1023 C  CD2   . LEU A 1 134 ? 19.785  47.122  36.228 1.00 45.98  ? 209 LEU A CD2   1 
ATOM   1024 N  N     . GLY A 1 135 ? 22.814  48.834  40.333 1.00 60.35  ? 210 GLY A N     1 
ATOM   1025 C  CA    . GLY A 1 135 ? 23.294  48.581  41.678 1.00 67.66  ? 210 GLY A CA    1 
ATOM   1026 C  C     . GLY A 1 135 ? 24.665  49.134  42.008 1.00 51.55  ? 210 GLY A C     1 
ATOM   1027 O  O     . GLY A 1 135 ? 25.537  49.249  41.140 1.00 43.04  ? 210 GLY A O     1 
ATOM   1028 N  N     . LEU A 1 136 ? 24.858  49.475  43.282 1.00 47.24  ? 211 LEU A N     1 
ATOM   1029 C  CA    . LEU A 1 136 ? 26.124  49.976  43.815 1.00 48.36  ? 211 LEU A CA    1 
ATOM   1030 C  C     . LEU A 1 136 ? 26.454  49.114  45.031 1.00 51.71  ? 211 LEU A C     1 
ATOM   1031 O  O     . LEU A 1 136 ? 26.098  49.455  46.163 1.00 55.32  ? 211 LEU A O     1 
ATOM   1032 C  CB    . LEU A 1 136 ? 26.018  51.458  44.169 1.00 42.54  ? 211 LEU A CB    1 
ATOM   1033 C  CG    . LEU A 1 136 ? 27.301  52.174  44.597 1.00 49.73  ? 211 LEU A CG    1 
ATOM   1034 C  CD1   . LEU A 1 136 ? 28.250  52.365  43.424 1.00 41.99  ? 211 LEU A CD1   1 
ATOM   1035 C  CD2   . LEU A 1 136 ? 26.978  53.503  45.253 1.00 40.65  ? 211 LEU A CD2   1 
ATOM   1036 N  N     . LYS A 1 137 ? 27.122  47.989  44.796 1.00 45.13  ? 212 LYS A N     1 
ATOM   1037 C  CA    . LYS A 1 137 ? 27.416  47.021  45.843 1.00 49.34  ? 212 LYS A CA    1 
ATOM   1038 C  C     . LYS A 1 137 ? 28.839  47.214  46.344 1.00 49.14  ? 212 LYS A C     1 
ATOM   1039 O  O     . LYS A 1 137 ? 29.774  47.306  45.545 1.00 52.26  ? 212 LYS A O     1 
ATOM   1040 C  CB    . LYS A 1 137 ? 27.227  45.589  45.336 1.00 56.13  ? 212 LYS A CB    1 
ATOM   1041 C  CG    . LYS A 1 137 ? 25.775  45.156  45.183 1.00 80.29  ? 212 LYS A CG    1 
ATOM   1042 C  CD    . LYS A 1 137 ? 25.043  45.139  46.518 1.00 82.69  ? 212 LYS A CD    1 
ATOM   1043 C  CE    . LYS A 1 137 ? 23.871  44.170  46.489 1.00 78.37  ? 212 LYS A CE    1 
ATOM   1044 N  NZ    . LYS A 1 137 ? 24.345  42.764  46.324 1.00 75.43  ? 212 LYS A NZ    1 
ATOM   1045 N  N     . SER A 1 138 ? 28.998  47.268  47.661 1.00 53.81  ? 213 SER A N     1 
ATOM   1046 C  CA    . SER A 1 138 ? 30.319  47.401  48.251 1.00 56.70  ? 213 SER A CA    1 
ATOM   1047 C  C     . SER A 1 138 ? 31.057  46.072  48.212 1.00 59.91  ? 213 SER A C     1 
ATOM   1048 O  O     . SER A 1 138 ? 30.461  44.999  48.338 1.00 78.17  ? 213 SER A O     1 
ATOM   1049 C  CB    . SER A 1 138 ? 30.226  47.884  49.696 1.00 52.65  ? 213 SER A CB    1 
ATOM   1050 O  OG    . SER A 1 138 ? 29.549  46.932  50.490 1.00 76.23  ? 213 SER A OG    1 
ATOM   1051 N  N     . LEU A 1 139 ? 32.372  46.152  48.038 1.00 64.92  ? 214 LEU A N     1 
ATOM   1052 C  CA    . LEU A 1 139 ? 33.222  44.970  48.073 1.00 63.76  ? 214 LEU A CA    1 
ATOM   1053 C  C     . LEU A 1 139 ? 33.525  44.505  49.491 1.00 63.57  ? 214 LEU A C     1 
ATOM   1054 O  O     . LEU A 1 139 ? 34.267  43.531  49.652 1.00 67.72  ? 214 LEU A O     1 
ATOM   1055 C  CB    . LEU A 1 139 ? 34.536  45.232  47.329 1.00 64.87  ? 214 LEU A CB    1 
ATOM   1056 C  CG    . LEU A 1 139 ? 34.559  44.871  45.843 1.00 56.14  ? 214 LEU A CG    1 
ATOM   1057 C  CD1   . LEU A 1 139 ? 33.554  45.702  45.069 1.00 59.62  ? 214 LEU A CD1   1 
ATOM   1058 C  CD2   . LEU A 1 139 ? 35.958  45.038  45.266 1.00 58.36  ? 214 LEU A CD2   1 
ATOM   1059 N  N     . ASP A 1 140 ? 32.975  45.172  50.511 1.00 63.48  ? 215 ASP A N     1 
ATOM   1060 C  CA    . ASP A 1 140 ? 33.203  44.811  51.915 1.00 74.86  ? 215 ASP A CA    1 
ATOM   1061 C  C     . ASP A 1 140 ? 34.693  44.736  52.251 1.00 81.58  ? 215 ASP A C     1 
ATOM   1062 O  O     . ASP A 1 140 ? 35.139  43.829  52.956 1.00 88.01  ? 215 ASP A O     1 
ATOM   1063 C  CB    . ASP A 1 140 ? 32.519  43.490  52.272 1.00 72.78  ? 215 ASP A CB    1 
ATOM   1064 C  CG    . ASP A 1 140 ? 31.015  43.605  52.327 1.00 91.26  ? 215 ASP A CG    1 
ATOM   1065 O  OD1   . ASP A 1 140 ? 30.345  43.076  51.414 1.00 102.98 ? 215 ASP A OD1   1 
ATOM   1066 O  OD2   . ASP A 1 140 ? 30.501  44.217  53.290 1.00 90.50  ? 215 ASP A OD2   1 
ATOM   1067 N  N     . PHE A 1 141 ? 35.468  45.682  51.729 1.00 74.89  ? 216 PHE A N     1 
ATOM   1068 C  CA    . PHE A 1 141 ? 36.891  45.848  52.018 1.00 69.39  ? 216 PHE A CA    1 
ATOM   1069 C  C     . PHE A 1 141 ? 37.750  44.662  51.579 1.00 72.45  ? 216 PHE A C     1 
ATOM   1070 O  O     . PHE A 1 141 ? 38.928  44.589  51.946 1.00 83.91  ? 216 PHE A O     1 
ATOM   1071 C  CB    . PHE A 1 141 ? 37.123  46.150  53.502 1.00 63.04  ? 216 PHE A CB    1 
ATOM   1072 C  CG    . PHE A 1 141 ? 36.425  47.388  53.969 1.00 62.40  ? 216 PHE A CG    1 
ATOM   1073 C  CD1   . PHE A 1 141 ? 36.978  48.637  53.754 1.00 63.83  ? 216 PHE A CD1   1 
ATOM   1074 C  CD2   . PHE A 1 141 ? 35.195  47.304  54.599 1.00 67.54  ? 216 PHE A CD2   1 
ATOM   1075 C  CE1   . PHE A 1 141 ? 36.327  49.780  54.170 1.00 65.14  ? 216 PHE A CE1   1 
ATOM   1076 C  CE2   . PHE A 1 141 ? 34.537  48.441  55.017 1.00 59.31  ? 216 PHE A CE2   1 
ATOM   1077 C  CZ    . PHE A 1 141 ? 35.101  49.681  54.804 1.00 50.42  ? 216 PHE A CZ    1 
ATOM   1078 N  N     . GLU A 1 142 ? 37.210  43.732  50.795 1.00 65.99  ? 217 GLU A N     1 
ATOM   1079 C  CA    . GLU A 1 142 ? 38.073  42.762  50.136 1.00 70.49  ? 217 GLU A CA    1 
ATOM   1080 C  C     . GLU A 1 142 ? 38.929  43.468  49.084 1.00 62.74  ? 217 GLU A C     1 
ATOM   1081 O  O     . GLU A 1 142 ? 38.607  44.566  48.617 1.00 71.50  ? 217 GLU A O     1 
ATOM   1082 C  CB    . GLU A 1 142 ? 37.254  41.649  49.473 1.00 87.98  ? 217 GLU A CB    1 
ATOM   1083 C  CG    . GLU A 1 142 ? 36.252  40.948  50.381 1.00 77.57  ? 217 GLU A CG    1 
ATOM   1084 C  CD    . GLU A 1 142 ? 35.499  39.833  49.665 1.00 113.96 ? 217 GLU A CD    1 
ATOM   1085 O  OE1   . GLU A 1 142 ? 36.154  38.908  49.133 1.00 118.28 ? 217 GLU A OE1   1 
ATOM   1086 O  OE2   . GLU A 1 142 ? 34.249  39.883  49.629 1.00 109.15 ? 217 GLU A OE2   1 
ATOM   1087 N  N     . ARG A 1 143 ? 40.036  42.827  48.717 1.00 69.12  ? 218 ARG A N     1 
ATOM   1088 C  CA    . ARG A 1 143 ? 40.890  43.367  47.667 1.00 66.42  ? 218 ARG A CA    1 
ATOM   1089 C  C     . ARG A 1 143 ? 40.132  43.430  46.347 1.00 62.64  ? 218 ARG A C     1 
ATOM   1090 O  O     . ARG A 1 143 ? 39.381  42.516  45.995 1.00 57.63  ? 218 ARG A O     1 
ATOM   1091 C  CB    . ARG A 1 143 ? 42.146  42.511  47.506 1.00 69.15  ? 218 ARG A CB    1 
ATOM   1092 C  CG    . ARG A 1 143 ? 43.206  42.757  48.558 1.00 72.41  ? 218 ARG A CG    1 
ATOM   1093 C  CD    . ARG A 1 143 ? 44.192  41.604  48.611 1.00 105.75 ? 218 ARG A CD    1 
ATOM   1094 N  NE    . ARG A 1 143 ? 45.570  42.059  48.462 1.00 122.92 ? 218 ARG A NE    1 
ATOM   1095 C  CZ    . ARG A 1 143 ? 46.181  42.211  47.292 1.00 136.91 ? 218 ARG A CZ    1 
ATOM   1096 N  NH1   . ARG A 1 143 ? 45.534  41.942  46.166 1.00 116.86 ? 218 ARG A NH1   1 
ATOM   1097 N  NH2   . ARG A 1 143 ? 47.439  42.632  47.246 1.00 143.05 ? 218 ARG A NH2   1 
ATOM   1098 N  N     . SER A 1 144 ? 40.344  44.514  45.604 1.00 69.70  ? 219 SER A N     1 
ATOM   1099 C  CA    . SER A 1 144 ? 39.638  44.724  44.346 1.00 65.60  ? 219 SER A CA    1 
ATOM   1100 C  C     . SER A 1 144 ? 40.213  43.850  43.238 1.00 51.62  ? 219 SER A C     1 
ATOM   1101 O  O     . SER A 1 144 ? 40.480  44.330  42.132 1.00 47.02  ? 219 SER A O     1 
ATOM   1102 C  CB    . SER A 1 144 ? 39.688  46.201  43.949 1.00 63.48  ? 219 SER A CB    1 
ATOM   1103 O  OG    . SER A 1 144 ? 39.001  47.006  44.895 1.00 69.08  ? 219 SER A OG    1 
ATOM   1104 N  N     . THR A 1 145 ? 40.407  42.567  43.526 1.00 58.45  ? 220 THR A N     1 
ATOM   1105 C  CA    . THR A 1 145 ? 40.904  41.642  42.523 1.00 58.79  ? 220 THR A CA    1 
ATOM   1106 C  C     . THR A 1 145 ? 39.839  41.395  41.461 1.00 54.83  ? 220 THR A C     1 
ATOM   1107 O  O     . THR A 1 145 ? 38.648  41.639  41.668 1.00 55.10  ? 220 THR A O     1 
ATOM   1108 C  CB    . THR A 1 145 ? 41.320  40.319  43.166 1.00 56.17  ? 220 THR A CB    1 
ATOM   1109 O  OG1   . THR A 1 145 ? 41.740  39.407  42.145 1.00 77.70  ? 220 THR A OG1   1 
ATOM   1110 C  CG2   . THR A 1 145 ? 40.154  39.709  43.928 1.00 53.80  ? 220 THR A CG2   1 
ATOM   1111 N  N     . ALA A 1 146 ? 40.286  40.901  40.304 1.00 51.85  ? 221 ALA A N     1 
ATOM   1112 C  CA    . ALA A 1 146 ? 39.348  40.637  39.220 1.00 53.78  ? 221 ALA A CA    1 
ATOM   1113 C  C     . ALA A 1 146 ? 38.294  39.616  39.627 1.00 52.59  ? 221 ALA A C     1 
ATOM   1114 O  O     . ALA A 1 146 ? 37.138  39.717  39.203 1.00 61.84  ? 221 ALA A O     1 
ATOM   1115 C  CB    . ALA A 1 146 ? 40.099  40.171  37.975 1.00 37.42  ? 221 ALA A CB    1 
ATOM   1116 N  N     . GLU A 1 147 ? 38.658  38.650  40.470 1.00 54.44  ? 222 GLU A N     1 
ATOM   1117 C  CA    . GLU A 1 147 ? 37.719  37.598  40.842 1.00 53.30  ? 222 GLU A CA    1 
ATOM   1118 C  C     . GLU A 1 147 ? 36.591  38.145  41.707 1.00 59.99  ? 222 GLU A C     1 
ATOM   1119 O  O     . GLU A 1 147 ? 35.418  37.819  41.493 1.00 66.42  ? 222 GLU A O     1 
ATOM   1120 C  CB    . GLU A 1 147 ? 38.457  36.479  41.569 1.00 77.85  ? 222 GLU A CB    1 
ATOM   1121 C  CG    . GLU A 1 147 ? 39.965  36.565  41.438 1.00 88.47  ? 222 GLU A CG    1 
ATOM   1122 C  CD    . GLU A 1 147 ? 40.681  35.917  42.606 1.00 121.27 ? 222 GLU A CD    1 
ATOM   1123 O  OE1   . GLU A 1 147 ? 40.159  34.919  43.148 1.00 128.32 ? 222 GLU A OE1   1 
ATOM   1124 O  OE2   . GLU A 1 147 ? 41.760  36.416  42.990 1.00 119.68 ? 222 GLU A OE2   1 
ATOM   1125 N  N     . ASN A 1 148 ? 36.929  38.976  42.695 1.00 65.73  ? 223 ASN A N     1 
ATOM   1126 C  CA    . ASN A 1 148 ? 35.902  39.540  43.564 1.00 63.28  ? 223 ASN A CA    1 
ATOM   1127 C  C     . ASN A 1 148 ? 34.979  40.480  42.797 1.00 62.62  ? 223 ASN A C     1 
ATOM   1128 O  O     . ASN A 1 148 ? 33.776  40.543  43.080 1.00 52.44  ? 223 ASN A O     1 
ATOM   1129 C  CB    . ASN A 1 148 ? 36.552  40.264  44.740 1.00 52.53  ? 223 ASN A CB    1 
ATOM   1130 C  CG    . ASN A 1 148 ? 37.167  39.310  45.735 1.00 58.83  ? 223 ASN A CG    1 
ATOM   1131 O  OD1   . ASN A 1 148 ? 36.785  38.143  45.807 1.00 73.76  ? 223 ASN A OD1   1 
ATOM   1132 N  ND2   . ASN A 1 148 ? 38.121  39.802  46.515 1.00 51.96  ? 223 ASN A ND2   1 
ATOM   1133 N  N     . ILE A 1 149 ? 35.521  41.215  41.824 1.00 51.74  ? 224 ILE A N     1 
ATOM   1134 C  CA    . ILE A 1 149 ? 34.700  42.133  41.038 1.00 53.10  ? 224 ILE A CA    1 
ATOM   1135 C  C     . ILE A 1 149 ? 33.652  41.360  40.248 1.00 53.85  ? 224 ILE A C     1 
ATOM   1136 O  O     . ILE A 1 149 ? 32.456  41.670  40.300 1.00 54.34  ? 224 ILE A O     1 
ATOM   1137 C  CB    . ILE A 1 149 ? 35.584  42.991  40.117 1.00 51.08  ? 224 ILE A CB    1 
ATOM   1138 C  CG1   . ILE A 1 149 ? 36.414  43.975  40.939 1.00 50.68  ? 224 ILE A CG1   1 
ATOM   1139 C  CG2   . ILE A 1 149 ? 34.735  43.738  39.102 1.00 46.87  ? 224 ILE A CG2   1 
ATOM   1140 C  CD1   . ILE A 1 149 ? 37.414  44.740  40.117 1.00 46.51  ? 224 ILE A CD1   1 
ATOM   1141 N  N     . TYR A 1 150 ? 34.086  40.339  39.504 1.00 56.71  ? 225 TYR A N     1 
ATOM   1142 C  CA    . TYR A 1 150 ? 33.140  39.507  38.768 1.00 58.71  ? 225 TYR A CA    1 
ATOM   1143 C  C     . TYR A 1 150 ? 32.167  38.819  39.720 1.00 63.95  ? 225 TYR A C     1 
ATOM   1144 O  O     . TYR A 1 150 ? 30.984  38.649  39.401 1.00 56.71  ? 225 TYR A O     1 
ATOM   1145 C  CB    . TYR A 1 150 ? 33.903  38.486  37.926 1.00 41.76  ? 225 TYR A CB    1 
ATOM   1146 C  CG    . TYR A 1 150 ? 33.072  37.806  36.860 1.00 64.96  ? 225 TYR A CG    1 
ATOM   1147 C  CD1   . TYR A 1 150 ? 32.998  38.325  35.572 1.00 57.37  ? 225 TYR A CD1   1 
ATOM   1148 C  CD2   . TYR A 1 150 ? 32.372  36.639  37.136 1.00 67.77  ? 225 TYR A CD2   1 
ATOM   1149 C  CE1   . TYR A 1 150 ? 32.245  37.699  34.591 1.00 71.93  ? 225 TYR A CE1   1 
ATOM   1150 C  CE2   . TYR A 1 150 ? 31.616  36.008  36.164 1.00 75.27  ? 225 TYR A CE2   1 
ATOM   1151 C  CZ    . TYR A 1 150 ? 31.555  36.542  34.893 1.00 81.62  ? 225 TYR A CZ    1 
ATOM   1152 O  OH    . TYR A 1 150 ? 30.801  35.913  33.925 1.00 73.18  ? 225 TYR A OH    1 
ATOM   1153 N  N     . LYS A 1 151 ? 32.649  38.431  40.902 1.00 59.16  ? 226 LYS A N     1 
ATOM   1154 C  CA    . LYS A 1 151 ? 31.769  37.873  41.922 1.00 53.05  ? 226 LYS A CA    1 
ATOM   1155 C  C     . LYS A 1 151 ? 30.676  38.864  42.315 1.00 56.71  ? 226 LYS A C     1 
ATOM   1156 O  O     . LYS A 1 151 ? 29.503  38.492  42.434 1.00 56.12  ? 226 LYS A O     1 
ATOM   1157 C  CB    . LYS A 1 151 ? 32.606  37.460  43.132 1.00 56.68  ? 226 LYS A CB    1 
ATOM   1158 C  CG    . LYS A 1 151 ? 31.831  36.996  44.345 1.00 54.11  ? 226 LYS A CG    1 
ATOM   1159 C  CD    . LYS A 1 151 ? 32.802  36.663  45.472 1.00 77.75  ? 226 LYS A CD    1 
ATOM   1160 C  CE    . LYS A 1 151 ? 32.091  36.429  46.792 1.00 93.46  ? 226 LYS A CE    1 
ATOM   1161 N  NZ    . LYS A 1 151 ? 33.067  36.159  47.883 1.00 106.41 ? 226 LYS A NZ    1 
ATOM   1162 N  N     . LYS A 1 152 ? 31.033  40.135  42.505 1.00 59.41  ? 227 LYS A N     1 
ATOM   1163 C  CA    . LYS A 1 152 ? 30.023  41.138  42.818 1.00 60.57  ? 227 LYS A CA    1 
ATOM   1164 C  C     . LYS A 1 152 ? 29.266  41.608  41.584 1.00 57.43  ? 227 LYS A C     1 
ATOM   1165 O  O     . LYS A 1 152 ? 28.168  42.157  41.720 1.00 53.71  ? 227 LYS A O     1 
ATOM   1166 C  CB    . LYS A 1 152 ? 30.659  42.335  43.532 1.00 56.53  ? 227 LYS A CB    1 
ATOM   1167 C  CG    . LYS A 1 152 ? 30.374  42.363  45.034 1.00 62.69  ? 227 LYS A CG    1 
ATOM   1168 C  CD    . LYS A 1 152 ? 30.798  41.055  45.696 1.00 81.19  ? 227 LYS A CD    1 
ATOM   1169 C  CE    . LYS A 1 152 ? 30.060  40.801  47.008 1.00 72.23  ? 227 LYS A CE    1 
ATOM   1170 N  NZ    . LYS A 1 152 ? 30.493  41.690  48.121 1.00 61.42  ? 227 LYS A NZ    1 
ATOM   1171 N  N     . LEU A 1 153 ? 29.816  41.403  40.388 1.00 48.97  ? 228 LEU A N     1 
ATOM   1172 C  CA    . LEU A 1 153 ? 29.067  41.735  39.183 1.00 45.92  ? 228 LEU A CA    1 
ATOM   1173 C  C     . LEU A 1 153 ? 27.917  40.762  38.987 1.00 63.49  ? 228 LEU A C     1 
ATOM   1174 O  O     . LEU A 1 153 ? 26.757  41.171  38.861 1.00 57.44  ? 228 LEU A O     1 
ATOM   1175 C  CB    . LEU A 1 153 ? 29.988  41.730  37.963 1.00 48.40  ? 228 LEU A CB    1 
ATOM   1176 C  CG    . LEU A 1 153 ? 29.297  42.031  36.630 1.00 49.95  ? 228 LEU A CG    1 
ATOM   1177 C  CD1   . LEU A 1 153 ? 28.602  43.382  36.677 1.00 45.51  ? 228 LEU A CD1   1 
ATOM   1178 C  CD2   . LEU A 1 153 ? 30.294  41.981  35.486 1.00 43.54  ? 228 LEU A CD2   1 
ATOM   1179 N  N     . LYS A 1 154 ? 28.228  39.462  38.974 1.00 65.78  ? 229 LYS A N     1 
ATOM   1180 C  CA    . LYS A 1 154 ? 27.199  38.435  38.853 1.00 57.13  ? 229 LYS A CA    1 
ATOM   1181 C  C     . LYS A 1 154 ? 26.131  38.586  39.930 1.00 63.58  ? 229 LYS A C     1 
ATOM   1182 O  O     . LYS A 1 154 ? 24.944  38.355  39.673 1.00 69.93  ? 229 LYS A O     1 
ATOM   1183 C  CB    . LYS A 1 154 ? 27.843  37.049  38.926 1.00 45.24  ? 229 LYS A CB    1 
ATOM   1184 C  CG    . LYS A 1 154 ? 28.154  36.402  37.574 1.00 64.86  ? 229 LYS A CG    1 
ATOM   1185 C  CD    . LYS A 1 154 ? 26.996  35.514  37.104 1.00 80.95  ? 229 LYS A CD    1 
ATOM   1186 C  CE    . LYS A 1 154 ? 27.462  34.381  36.183 1.00 76.77  ? 229 LYS A CE    1 
ATOM   1187 N  NZ    . LYS A 1 154 ? 27.729  34.811  34.775 1.00 73.08  ? 229 LYS A NZ    1 
ATOM   1188 N  N     . ALA A 1 155 ? 26.531  38.989  41.139 1.00 53.88  ? 230 ALA A N     1 
ATOM   1189 C  CA    . ALA A 1 155 ? 25.572  39.105  42.233 1.00 52.94  ? 230 ALA A CA    1 
ATOM   1190 C  C     . ALA A 1 155 ? 24.568  40.225  41.996 1.00 66.31  ? 230 ALA A C     1 
ATOM   1191 O  O     . ALA A 1 155 ? 23.419  40.127  42.444 1.00 67.10  ? 230 ALA A O     1 
ATOM   1192 C  CB    . ALA A 1 155 ? 26.303  39.324  43.557 1.00 55.44  ? 230 ALA A CB    1 
ATOM   1193 N  N     . ILE A 1 156 ? 24.976  41.293  41.306 1.00 70.17  ? 231 ILE A N     1 
ATOM   1194 C  CA    . ILE A 1 156 ? 24.046  42.376  40.996 1.00 68.75  ? 231 ILE A CA    1 
ATOM   1195 C  C     . ILE A 1 156 ? 23.055  41.935  39.923 1.00 67.57  ? 231 ILE A C     1 
ATOM   1196 O  O     . ILE A 1 156 ? 21.866  42.274  39.976 1.00 53.03  ? 231 ILE A O     1 
ATOM   1197 C  CB    . ILE A 1 156 ? 24.823  43.643  40.585 1.00 54.86  ? 231 ILE A CB    1 
ATOM   1198 C  CG1   . ILE A 1 156 ? 25.525  44.250  41.801 1.00 71.81  ? 231 ILE A CG1   1 
ATOM   1199 C  CG2   . ILE A 1 156 ? 23.906  44.674  39.960 1.00 43.62  ? 231 ILE A CG2   1 
ATOM   1200 C  CD1   . ILE A 1 156 ? 26.309  45.509  41.501 1.00 55.37  ? 231 ILE A CD1   1 
ATOM   1201 N  N     . PHE A 1 157 ? 23.517  41.151  38.947 1.00 79.35  ? 232 PHE A N     1 
ATOM   1202 C  CA    . PHE A 1 157 ? 22.629  40.683  37.888 1.00 69.34  ? 232 PHE A CA    1 
ATOM   1203 C  C     . PHE A 1 157 ? 21.707  39.562  38.354 1.00 75.00  ? 232 PHE A C     1 
ATOM   1204 O  O     . PHE A 1 157 ? 20.624  39.385  37.784 1.00 75.53  ? 232 PHE A O     1 
ATOM   1205 C  CB    . PHE A 1 157 ? 23.447  40.233  36.677 1.00 66.80  ? 232 PHE A CB    1 
ATOM   1206 C  CG    . PHE A 1 157 ? 23.890  41.367  35.801 1.00 65.89  ? 232 PHE A CG    1 
ATOM   1207 C  CD1   . PHE A 1 157 ? 25.210  41.791  35.800 1.00 71.29  ? 232 PHE A CD1   1 
ATOM   1208 C  CD2   . PHE A 1 157 ? 22.979  42.023  34.987 1.00 57.65  ? 232 PHE A CD2   1 
ATOM   1209 C  CE1   . PHE A 1 157 ? 25.613  42.842  34.991 1.00 68.52  ? 232 PHE A CE1   1 
ATOM   1210 C  CE2   . PHE A 1 157 ? 23.372  43.076  34.180 1.00 52.78  ? 232 PHE A CE2   1 
ATOM   1211 C  CZ    . PHE A 1 157 ? 24.691  43.488  34.183 1.00 64.07  ? 232 PHE A CZ    1 
ATOM   1212 N  N     . SER A 1 158 ? 22.108  38.800  39.376 1.00 73.68  ? 233 SER A N     1 
ATOM   1213 C  CA    . SER A 1 158 ? 21.205  37.814  39.958 1.00 63.35  ? 233 SER A CA    1 
ATOM   1214 C  C     . SER A 1 158 ? 20.004  38.467  40.628 1.00 70.38  ? 233 SER A C     1 
ATOM   1215 O  O     . SER A 1 158 ? 18.981  37.801  40.825 1.00 79.08  ? 233 SER A O     1 
ATOM   1216 C  CB    . SER A 1 158 ? 21.956  36.940  40.965 1.00 71.44  ? 233 SER A CB    1 
ATOM   1217 O  OG    . SER A 1 158 ? 22.948  36.155  40.325 1.00 76.61  ? 233 SER A OG    1 
ATOM   1218 N  N     . GLN A 1 159 ? 20.104  39.756  40.975 1.00 70.98  ? 234 GLN A N     1 
ATOM   1219 C  CA    . GLN A 1 159 ? 18.975  40.460  41.577 1.00 70.56  ? 234 GLN A CA    1 
ATOM   1220 C  C     . GLN A 1 159 ? 17.774  40.507  40.643 1.00 69.37  ? 234 GLN A C     1 
ATOM   1221 O  O     . GLN A 1 159 ? 16.633  40.617  41.104 1.00 78.33  ? 234 GLN A O     1 
ATOM   1222 C  CB    . GLN A 1 159 ? 19.377  41.886  41.960 1.00 72.83  ? 234 GLN A CB    1 
ATOM   1223 C  CG    . GLN A 1 159 ? 20.467  42.001  43.012 1.00 59.79  ? 234 GLN A CG    1 
ATOM   1224 C  CD    . GLN A 1 159 ? 20.731  43.447  43.410 1.00 74.37  ? 234 GLN A CD    1 
ATOM   1225 O  OE1   . GLN A 1 159 ? 20.187  43.938  44.402 1.00 78.00  ? 234 GLN A OE1   1 
ATOM   1226 N  NE2   . GLN A 1 159 ? 21.558  44.140  42.629 1.00 77.65  ? 234 GLN A NE2   1 
ATOM   1227 N  N     . PHE A 1 160 ? 18.005  40.454  39.334 1.00 71.05  ? 235 PHE A N     1 
ATOM   1228 C  CA    . PHE A 1 160 ? 16.935  40.497  38.346 1.00 72.06  ? 235 PHE A CA    1 
ATOM   1229 C  C     . PHE A 1 160 ? 16.772  39.166  37.628 1.00 75.17  ? 235 PHE A C     1 
ATOM   1230 O  O     . PHE A 1 160 ? 16.117  39.110  36.581 1.00 63.48  ? 235 PHE A O     1 
ATOM   1231 C  CB    . PHE A 1 160 ? 17.197  41.615  37.336 1.00 78.38  ? 235 PHE A CB    1 
ATOM   1232 C  CG    . PHE A 1 160 ? 17.560  42.932  37.967 1.00 67.96  ? 235 PHE A CG    1 
ATOM   1233 C  CD1   . PHE A 1 160 ? 16.586  43.877  38.236 1.00 73.76  ? 235 PHE A CD1   1 
ATOM   1234 C  CD2   . PHE A 1 160 ? 18.875  43.225  38.290 1.00 67.53  ? 235 PHE A CD2   1 
ATOM   1235 C  CE1   . PHE A 1 160 ? 16.915  45.086  38.813 1.00 66.66  ? 235 PHE A CE1   1 
ATOM   1236 C  CE2   . PHE A 1 160 ? 19.208  44.430  38.870 1.00 66.68  ? 235 PHE A CE2   1 
ATOM   1237 C  CZ    . PHE A 1 160 ? 18.227  45.362  39.131 1.00 62.39  ? 235 PHE A CZ    1 
ATOM   1238 N  N     . ASN A 1 161 ? 17.351  38.097  38.175 1.00 83.42  ? 236 ASN A N     1 
ATOM   1239 C  CA    . ASN A 1 161 ? 17.352  36.777  37.548 1.00 80.72  ? 236 ASN A CA    1 
ATOM   1240 C  C     . ASN A 1 161 ? 17.980  36.838  36.160 1.00 67.39  ? 236 ASN A C     1 
ATOM   1241 O  O     . ASN A 1 161 ? 17.420  36.364  35.171 1.00 69.49  ? 236 ASN A O     1 
ATOM   1242 C  CB    . ASN A 1 161 ? 15.944  36.181  37.508 1.00 74.05  ? 236 ASN A CB    1 
ATOM   1243 C  CG    . ASN A 1 161 ? 15.495  35.684  38.866 1.00 89.36  ? 236 ASN A CG    1 
ATOM   1244 O  OD1   . ASN A 1 161 ? 16.256  35.023  39.576 1.00 94.64  ? 236 ASN A OD1   1 
ATOM   1245 N  ND2   . ASN A 1 161 ? 14.268  36.015  39.247 1.00 84.54  ? 236 ASN A ND2   1 
ATOM   1246 N  N     . VAL A 1 162 ? 19.155  37.454  36.098 1.00 75.12  ? 237 VAL A N     1 
ATOM   1247 C  CA    . VAL A 1 162 ? 20.024  37.411  34.930 1.00 65.81  ? 237 VAL A CA    1 
ATOM   1248 C  C     . VAL A 1 162 ? 21.277  36.655  35.339 1.00 70.47  ? 237 VAL A C     1 
ATOM   1249 O  O     . VAL A 1 162 ? 22.038  37.116  36.199 1.00 76.33  ? 237 VAL A O     1 
ATOM   1250 C  CB    . VAL A 1 162 ? 20.368  38.816  34.415 1.00 55.53  ? 237 VAL A CB    1 
ATOM   1251 C  CG1   . VAL A 1 162 ? 21.336  38.727  33.243 1.00 61.68  ? 237 VAL A CG1   1 
ATOM   1252 C  CG2   . VAL A 1 162 ? 19.105  39.552  34.010 1.00 68.32  ? 237 VAL A CG2   1 
ATOM   1253 N  N     . GLU A 1 163 ? 21.482  35.486  34.736 1.00 78.68  ? 238 GLU A N     1 
ATOM   1254 C  CA    . GLU A 1 163 ? 22.612  34.636  35.068 1.00 71.57  ? 238 GLU A CA    1 
ATOM   1255 C  C     . GLU A 1 163 ? 23.548  34.391  33.897 1.00 55.80  ? 238 GLU A C     1 
ATOM   1256 O  O     . GLU A 1 163 ? 24.552  33.693  34.068 1.00 64.09  ? 238 GLU A O     1 
ATOM   1257 C  CB    . GLU A 1 163 ? 22.115  33.292  35.617 1.00 75.12  ? 238 GLU A CB    1 
ATOM   1258 C  CG    . GLU A 1 163 ? 21.638  33.355  37.055 1.00 79.44  ? 238 GLU A CG    1 
ATOM   1259 C  CD    . GLU A 1 163 ? 22.742  33.783  38.000 1.00 102.20 ? 238 GLU A CD    1 
ATOM   1260 O  OE1   . GLU A 1 163 ? 22.872  35.000  38.257 1.00 98.80  ? 238 GLU A OE1   1 
ATOM   1261 O  OE2   . GLU A 1 163 ? 23.493  32.902  38.471 1.00 96.01  ? 238 GLU A OE2   1 
ATOM   1262 N  N     . ASP A 1 164 ? 23.257  34.948  32.720 1.00 64.83  ? 239 ASP A N     1 
ATOM   1263 C  CA    . ASP A 1 164 ? 24.034  34.653  31.510 1.00 68.65  ? 239 ASP A CA    1 
ATOM   1264 C  C     . ASP A 1 164 ? 25.209  35.620  31.371 1.00 83.73  ? 239 ASP A C     1 
ATOM   1265 O  O     . ASP A 1 164 ? 26.370  35.213  31.440 1.00 83.33  ? 239 ASP A O     1 
ATOM   1266 C  CB    . ASP A 1 164 ? 23.127  34.702  30.279 1.00 72.75  ? 239 ASP A CB    1 
ATOM   1267 C  CG    . ASP A 1 164 ? 23.705  33.947  29.096 1.00 75.30  ? 239 ASP A CG    1 
ATOM   1268 O  OD1   . ASP A 1 164 ? 22.941  33.630  28.158 1.00 77.15  ? 239 ASP A OD1   1 
ATOM   1269 O  OD2   . ASP A 1 164 ? 24.919  33.662  29.105 1.00 59.56  ? 239 ASP A OD2   1 
ATOM   1270 N  N     . LEU A 1 165 ? 24.905  36.903  31.157 1.00 77.20  ? 240 LEU A N     1 
ATOM   1271 C  CA    . LEU A 1 165 ? 25.845  38.013  30.998 1.00 72.96  ? 240 LEU A CA    1 
ATOM   1272 C  C     . LEU A 1 165 ? 26.655  37.942  29.711 1.00 67.70  ? 240 LEU A C     1 
ATOM   1273 O  O     . LEU A 1 165 ? 27.482  38.828  29.475 1.00 79.13  ? 240 LEU A O     1 
ATOM   1274 C  CB    . LEU A 1 165 ? 26.833  38.138  32.168 1.00 54.74  ? 240 LEU A CB    1 
ATOM   1275 C  CG    . LEU A 1 165 ? 26.269  38.234  33.582 1.00 62.65  ? 240 LEU A CG    1 
ATOM   1276 C  CD1   . LEU A 1 165 ? 27.330  38.758  34.537 1.00 55.99  ? 240 LEU A CD1   1 
ATOM   1277 C  CD2   . LEU A 1 165 ? 25.037  39.110  33.601 1.00 56.67  ? 240 LEU A CD2   1 
ATOM   1278 N  N     . SER A 1 166 ? 26.454  36.929  28.869 1.00 60.09  ? 241 SER A N     1 
ATOM   1279 C  CA    . SER A 1 166 ? 27.268  36.821  27.666 1.00 56.16  ? 241 SER A CA    1 
ATOM   1280 C  C     . SER A 1 166 ? 26.778  37.733  26.547 1.00 56.56  ? 241 SER A C     1 
ATOM   1281 O  O     . SER A 1 166 ? 27.573  38.115  25.683 1.00 71.12  ? 241 SER A O     1 
ATOM   1282 C  CB    . SER A 1 166 ? 27.304  35.372  27.184 1.00 63.20  ? 241 SER A CB    1 
ATOM   1283 O  OG    . SER A 1 166 ? 25.996  34.872  26.978 1.00 69.07  ? 241 SER A OG    1 
ATOM   1284 N  N     . SER A 1 167 ? 25.492  38.088  26.536 1.00 80.33  ? 242 SER A N     1 
ATOM   1285 C  CA    . SER A 1 167 ? 24.914  38.926  25.490 1.00 64.00  ? 242 SER A CA    1 
ATOM   1286 C  C     . SER A 1 167 ? 25.018  40.416  25.786 1.00 61.45  ? 242 SER A C     1 
ATOM   1287 O  O     . SER A 1 167 ? 24.573  41.227  24.968 1.00 71.68  ? 242 SER A O     1 
ATOM   1288 C  CB    . SER A 1 167 ? 23.441  38.559  25.268 1.00 62.92  ? 242 SER A CB    1 
ATOM   1289 O  OG    . SER A 1 167 ? 23.309  37.263  24.709 1.00 88.61  ? 242 SER A OG    1 
ATOM   1290 N  N     . ILE A 1 168 ? 25.592  40.795  26.925 1.00 70.36  ? 243 ILE A N     1 
ATOM   1291 C  CA    . ILE A 1 168 ? 25.667  42.188  27.354 1.00 65.52  ? 243 ILE A CA    1 
ATOM   1292 C  C     . ILE A 1 168 ? 27.032  42.744  26.980 1.00 63.24  ? 243 ILE A C     1 
ATOM   1293 O  O     . ILE A 1 168 ? 28.065  42.173  27.352 1.00 67.01  ? 243 ILE A O     1 
ATOM   1294 C  CB    . ILE A 1 168 ? 25.423  42.319  28.867 1.00 67.58  ? 243 ILE A CB    1 
ATOM   1295 C  CG1   . ILE A 1 168 ? 24.198  41.508  29.284 1.00 62.82  ? 243 ILE A CG1   1 
ATOM   1296 C  CG2   . ILE A 1 168 ? 25.252  43.781  29.252 1.00 63.49  ? 243 ILE A CG2   1 
ATOM   1297 C  CD1   . ILE A 1 168 ? 24.046  41.361  30.781 1.00 50.85  ? 243 ILE A CD1   1 
ATOM   1298 N  N     . LYS A 1 169 ? 27.042  43.863  26.257 1.00 61.15  ? 244 LYS A N     1 
ATOM   1299 C  CA    . LYS A 1 169 ? 28.282  44.533  25.882 1.00 63.25  ? 244 LYS A CA    1 
ATOM   1300 C  C     . LYS A 1 169 ? 28.710  45.461  27.014 1.00 63.98  ? 244 LYS A C     1 
ATOM   1301 O  O     . LYS A 1 169 ? 27.987  46.406  27.354 1.00 54.56  ? 244 LYS A O     1 
ATOM   1302 C  CB    . LYS A 1 169 ? 28.108  45.323  24.587 1.00 56.79  ? 244 LYS A CB    1 
ATOM   1303 C  CG    . LYS A 1 169 ? 27.436  44.557  23.459 1.00 58.62  ? 244 LYS A CG    1 
ATOM   1304 C  CD    . LYS A 1 169 ? 25.951  44.885  23.376 1.00 74.55  ? 244 LYS A CD    1 
ATOM   1305 C  CE    . LYS A 1 169 ? 25.310  44.262  22.150 1.00 81.14  ? 244 LYS A CE    1 
ATOM   1306 N  NZ    . LYS A 1 169 ? 23.895  44.695  21.998 1.00 85.14  ? 244 LYS A NZ    1 
ATOM   1307 N  N     . PHE A 1 170 ? 29.885  45.200  27.588 1.00 54.71  ? 245 PHE A N     1 
ATOM   1308 C  CA    . PHE A 1 170 ? 30.391  45.960  28.725 1.00 58.70  ? 245 PHE A CA    1 
ATOM   1309 C  C     . PHE A 1 170 ? 31.370  47.039  28.273 1.00 54.84  ? 245 PHE A C     1 
ATOM   1310 O  O     . PHE A 1 170 ? 32.216  46.808  27.405 1.00 42.37  ? 245 PHE A O     1 
ATOM   1311 C  CB    . PHE A 1 170 ? 31.070  45.038  29.740 1.00 59.27  ? 245 PHE A CB    1 
ATOM   1312 C  CG    . PHE A 1 170 ? 30.115  44.161  30.497 1.00 55.09  ? 245 PHE A CG    1 
ATOM   1313 C  CD1   . PHE A 1 170 ? 29.529  44.609  31.671 1.00 57.87  ? 245 PHE A CD1   1 
ATOM   1314 C  CD2   . PHE A 1 170 ? 29.806  42.891  30.040 1.00 48.47  ? 245 PHE A CD2   1 
ATOM   1315 C  CE1   . PHE A 1 170 ? 28.649  43.808  32.375 1.00 53.20  ? 245 PHE A CE1   1 
ATOM   1316 C  CE2   . PHE A 1 170 ? 28.926  42.084  30.738 1.00 53.61  ? 245 PHE A CE2   1 
ATOM   1317 C  CZ    . PHE A 1 170 ? 28.347  42.543  31.909 1.00 51.03  ? 245 PHE A CZ    1 
ATOM   1318 N  N     . VAL A 1 171 ? 31.249  48.218  28.875 1.00 52.82  ? 246 VAL A N     1 
ATOM   1319 C  CA    . VAL A 1 171 ? 32.093  49.366  28.571 1.00 42.80  ? 246 VAL A CA    1 
ATOM   1320 C  C     . VAL A 1 171 ? 32.754  49.801  29.867 1.00 45.71  ? 246 VAL A C     1 
ATOM   1321 O  O     . VAL A 1 171 ? 32.064  50.176  30.823 1.00 48.06  ? 246 VAL A O     1 
ATOM   1322 C  CB    . VAL A 1 171 ? 31.287  50.521  27.957 1.00 49.42  ? 246 VAL A CB    1 
ATOM   1323 C  CG1   . VAL A 1 171 ? 32.192  51.708  27.663 1.00 54.04  ? 246 VAL A CG1   1 
ATOM   1324 C  CG2   . VAL A 1 171 ? 30.563  50.059  26.700 1.00 50.88  ? 246 VAL A CG2   1 
ATOM   1325 N  N     . THR A 1 172 ? 34.082  49.731  29.911 1.00 42.33  ? 247 THR A N     1 
ATOM   1326 C  CA    . THR A 1 172 ? 34.837  50.103  31.099 1.00 55.25  ? 247 THR A CA    1 
ATOM   1327 C  C     . THR A 1 172 ? 36.092  50.851  30.685 1.00 45.05  ? 247 THR A C     1 
ATOM   1328 O  O     . THR A 1 172 ? 36.440  50.930  29.504 1.00 40.19  ? 247 THR A O     1 
ATOM   1329 C  CB    . THR A 1 172 ? 35.244  48.886  31.942 1.00 53.32  ? 247 THR A CB    1 
ATOM   1330 O  OG1   . THR A 1 172 ? 36.167  48.082  31.200 1.00 54.58  ? 247 THR A OG1   1 
ATOM   1331 C  CG2   . THR A 1 172 ? 34.046  48.047  32.301 1.00 47.66  ? 247 THR A CG2   1 
ATOM   1332 N  N     . ASP A 1 173 ? 36.775  51.395  31.683 1.00 40.71  ? 248 ASP A N     1 
ATOM   1333 C  CA    . ASP A 1 173 ? 38.116  51.913  31.494 1.00 48.33  ? 248 ASP A CA    1 
ATOM   1334 C  C     . ASP A 1 173 ? 39.102  50.748  31.449 1.00 54.55  ? 248 ASP A C     1 
ATOM   1335 O  O     . ASP A 1 173 ? 38.726  49.578  31.568 1.00 51.56  ? 248 ASP A O     1 
ATOM   1336 C  CB    . ASP A 1 173 ? 38.462  52.901  32.603 1.00 43.97  ? 248 ASP A CB    1 
ATOM   1337 C  CG    . ASP A 1 173 ? 38.275  52.310  33.977 1.00 48.46  ? 248 ASP A CG    1 
ATOM   1338 O  OD1   . ASP A 1 173 ? 37.160  51.831  34.273 1.00 70.94  ? 248 ASP A OD1   1 
ATOM   1339 O  OD2   . ASP A 1 173 ? 39.249  52.297  34.750 1.00 42.36  ? 248 ASP A OD2   1 
ATOM   1340 N  N     . ARG A 1 174 ? 40.387  51.065  31.281 1.00 48.70  ? 249 ARG A N     1 
ATOM   1341 C  CA    . ARG A 1 174 ? 41.427  50.052  31.145 1.00 43.47  ? 249 ARG A CA    1 
ATOM   1342 C  C     . ARG A 1 174 ? 42.103  49.717  32.472 1.00 44.56  ? 249 ARG A C     1 
ATOM   1343 O  O     . ARG A 1 174 ? 43.295  49.393  32.490 1.00 45.03  ? 249 ARG A O     1 
ATOM   1344 C  CB    . ARG A 1 174 ? 42.474  50.491  30.121 1.00 34.74  ? 249 ARG A CB    1 
ATOM   1345 C  CG    . ARG A 1 174 ? 41.963  50.557  28.700 1.00 41.54  ? 249 ARG A CG    1 
ATOM   1346 C  CD    . ARG A 1 174 ? 43.109  50.772  27.734 1.00 41.99  ? 249 ARG A CD    1 
ATOM   1347 N  NE    . ARG A 1 174 ? 43.776  52.053  27.943 1.00 45.86  ? 249 ARG A NE    1 
ATOM   1348 C  CZ    . ARG A 1 174 ? 45.057  52.274  27.661 1.00 55.31  ? 249 ARG A CZ    1 
ATOM   1349 N  NH1   . ARG A 1 174 ? 45.806  51.293  27.174 1.00 46.92  ? 249 ARG A NH1   1 
ATOM   1350 N  NH2   . ARG A 1 174 ? 45.595  53.468  27.874 1.00 48.22  ? 249 ARG A NH2   1 
ATOM   1351 N  N     . GLY A 1 175 ? 41.373  49.789  33.584 1.00 42.14  ? 250 GLY A N     1 
ATOM   1352 C  CA    . GLY A 1 175 ? 41.915  49.328  34.846 1.00 37.86  ? 250 GLY A CA    1 
ATOM   1353 C  C     . GLY A 1 175 ? 42.306  47.866  34.768 1.00 47.75  ? 250 GLY A C     1 
ATOM   1354 O  O     . GLY A 1 175 ? 41.505  47.038  34.324 1.00 56.24  ? 250 GLY A O     1 
ATOM   1355 N  N     . ALA A 1 176 ? 43.533  47.538  35.187 1.00 48.43  ? 251 ALA A N     1 
ATOM   1356 C  CA    . ALA A 1 176 ? 44.048  46.179  35.017 1.00 50.02  ? 251 ALA A CA    1 
ATOM   1357 C  C     . ALA A 1 176 ? 43.130  45.143  35.652 1.00 46.18  ? 251 ALA A C     1 
ATOM   1358 O  O     . ALA A 1 176 ? 42.898  44.073  35.078 1.00 52.39  ? 251 ALA A O     1 
ATOM   1359 C  CB    . ALA A 1 176 ? 45.455  46.072  35.603 1.00 43.15  ? 251 ALA A CB    1 
ATOM   1360 N  N     . ASN A 1 177 ? 42.591  45.443  36.833 1.00 36.84  ? 252 ASN A N     1 
ATOM   1361 C  CA    . ASN A 1 177 ? 41.719  44.483  37.495 1.00 42.03  ? 252 ASN A CA    1 
ATOM   1362 C  C     . ASN A 1 177 ? 40.321  44.457  36.873 1.00 51.97  ? 252 ASN A C     1 
ATOM   1363 O  O     . ASN A 1 177 ? 39.745  43.377  36.697 1.00 55.23  ? 252 ASN A O     1 
ATOM   1364 C  CB    . ASN A 1 177 ? 41.661  44.778  38.997 1.00 44.61  ? 252 ASN A CB    1 
ATOM   1365 C  CG    . ASN A 1 177 ? 40.942  46.068  39.318 1.00 44.31  ? 252 ASN A CG    1 
ATOM   1366 O  OD1   . ASN A 1 177 ? 40.905  46.996  38.512 1.00 51.60  ? 252 ASN A OD1   1 
ATOM   1367 N  ND2   . ASN A 1 177 ? 40.362  46.133  40.509 1.00 48.53  ? 252 ASN A ND2   1 
ATOM   1368 N  N     . VAL A 1 178 ? 39.761  45.619  36.515 1.00 45.00  ? 253 VAL A N     1 
ATOM   1369 C  CA    . VAL A 1 178 ? 38.449  45.629  35.866 1.00 41.42  ? 253 VAL A CA    1 
ATOM   1370 C  C     . VAL A 1 178 ? 38.525  44.947  34.508 1.00 45.46  ? 253 VAL A C     1 
ATOM   1371 O  O     . VAL A 1 178 ? 37.623  44.192  34.125 1.00 50.93  ? 253 VAL A O     1 
ATOM   1372 C  CB    . VAL A 1 178 ? 37.905  47.066  35.738 1.00 39.83  ? 253 VAL A CB    1 
ATOM   1373 C  CG1   . VAL A 1 178 ? 36.606  47.070  34.940 1.00 39.75  ? 253 VAL A CG1   1 
ATOM   1374 C  CG2   . VAL A 1 178 ? 37.668  47.681  37.102 1.00 34.92  ? 253 VAL A CG2   1 
ATOM   1375 N  N     . VAL A 1 179 ? 39.603  45.201  33.761 1.00 57.06  ? 254 VAL A N     1 
ATOM   1376 C  CA    . VAL A 1 179 ? 39.773  44.597  32.442 1.00 51.44  ? 254 VAL A CA    1 
ATOM   1377 C  C     . VAL A 1 179 ? 39.735  43.081  32.539 1.00 46.48  ? 254 VAL A C     1 
ATOM   1378 O  O     . VAL A 1 179 ? 39.082  42.407  31.732 1.00 48.47  ? 254 VAL A O     1 
ATOM   1379 C  CB    . VAL A 1 179 ? 41.087  45.085  31.799 1.00 38.06  ? 254 VAL A CB    1 
ATOM   1380 C  CG1   . VAL A 1 179 ? 41.528  44.133  30.705 1.00 33.00  ? 254 VAL A CG1   1 
ATOM   1381 C  CG2   . VAL A 1 179 ? 40.917  46.479  31.240 1.00 37.93  ? 254 VAL A CG2   1 
ATOM   1382 N  N     . LYS A 1 180 ? 40.424  42.522  33.535 1.00 51.04  ? 255 LYS A N     1 
ATOM   1383 C  CA    . LYS A 1 180 ? 40.523  41.073  33.652 1.00 52.22  ? 255 LYS A CA    1 
ATOM   1384 C  C     . LYS A 1 180 ? 39.192  40.440  34.047 1.00 54.29  ? 255 LYS A C     1 
ATOM   1385 O  O     . LYS A 1 180 ? 38.905  39.311  33.638 1.00 52.01  ? 255 LYS A O     1 
ATOM   1386 C  CB    . LYS A 1 180 ? 41.612  40.714  34.663 1.00 50.21  ? 255 LYS A CB    1 
ATOM   1387 C  CG    . LYS A 1 180 ? 42.056  39.265  34.620 1.00 58.07  ? 255 LYS A CG    1 
ATOM   1388 C  CD    . LYS A 1 180 ? 42.954  38.936  35.798 1.00 61.63  ? 255 LYS A CD    1 
ATOM   1389 C  CE    . LYS A 1 180 ? 43.408  37.487  35.772 1.00 53.88  ? 255 LYS A CE    1 
ATOM   1390 N  NZ    . LYS A 1 180 ? 44.097  37.125  37.042 1.00 63.43  ? 255 LYS A NZ    1 
ATOM   1391 N  N     . SER A 1 181 ? 38.374  41.144  34.836 1.00 48.49  ? 256 SER A N     1 
ATOM   1392 C  CA    . SER A 1 181 ? 37.073  40.613  35.235 1.00 44.38  ? 256 SER A CA    1 
ATOM   1393 C  C     . SER A 1 181 ? 36.225  40.256  34.022 1.00 57.25  ? 256 SER A C     1 
ATOM   1394 O  O     . SER A 1 181 ? 35.606  39.187  33.971 1.00 59.50  ? 256 SER A O     1 
ATOM   1395 C  CB    . SER A 1 181 ? 36.334  41.629  36.105 1.00 47.44  ? 256 SER A CB    1 
ATOM   1396 O  OG    . SER A 1 181 ? 36.672  41.468  37.467 1.00 76.40  ? 256 SER A OG    1 
ATOM   1397 N  N     . LEU A 1 182 ? 36.178  41.149  33.035 1.00 53.10  ? 257 LEU A N     1 
ATOM   1398 C  CA    . LEU A 1 182 ? 35.353  40.967  31.849 1.00 53.04  ? 257 LEU A CA    1 
ATOM   1399 C  C     . LEU A 1 182 ? 36.136  40.359  30.690 1.00 63.28  ? 257 LEU A C     1 
ATOM   1400 O  O     . LEU A 1 182 ? 35.801  40.589  29.521 1.00 56.80  ? 257 LEU A O     1 
ATOM   1401 C  CB    . LEU A 1 182 ? 34.733  42.303  31.445 1.00 51.88  ? 257 LEU A CB    1 
ATOM   1402 C  CG    . LEU A 1 182 ? 33.940  43.037  32.530 1.00 59.96  ? 257 LEU A CG    1 
ATOM   1403 C  CD1   . LEU A 1 182 ? 33.881  44.516  32.221 1.00 43.86  ? 257 LEU A CD1   1 
ATOM   1404 C  CD2   . LEU A 1 182 ? 32.529  42.471  32.674 1.00 45.38  ? 257 LEU A CD2   1 
ATOM   1405 N  N     . ALA A 1 183 ? 37.182  39.583  30.994 1.00 58.03  ? 258 ALA A N     1 
ATOM   1406 C  CA    . ALA A 1 183 ? 37.939  38.905  29.949 1.00 60.84  ? 258 ALA A CA    1 
ATOM   1407 C  C     . ALA A 1 183 ? 37.107  37.855  29.229 1.00 66.08  ? 258 ALA A C     1 
ATOM   1408 O  O     . ALA A 1 183 ? 37.444  37.480  28.101 1.00 59.35  ? 258 ALA A O     1 
ATOM   1409 C  CB    . ALA A 1 183 ? 39.192  38.252  30.539 1.00 52.05  ? 258 ALA A CB    1 
ATOM   1410 N  N     . ASN A 1 184 ? 36.029  37.382  29.850 1.00 79.29  ? 259 ASN A N     1 
ATOM   1411 C  CA    . ASN A 1 184 ? 35.211  36.309  29.307 1.00 51.16  ? 259 ASN A CA    1 
ATOM   1412 C  C     . ASN A 1 184 ? 33.963  36.811  28.599 1.00 58.99  ? 259 ASN A C     1 
ATOM   1413 O  O     . ASN A 1 184 ? 33.125  35.998  28.199 1.00 77.65  ? 259 ASN A O     1 
ATOM   1414 C  CB    . ASN A 1 184 ? 34.820  35.338  30.424 1.00 65.09  ? 259 ASN A CB    1 
ATOM   1415 C  CG    . ASN A 1 184 ? 35.977  34.465  30.867 1.00 78.41  ? 259 ASN A CG    1 
ATOM   1416 O  OD1   . ASN A 1 184 ? 36.782  34.026  30.045 1.00 62.05  ? 259 ASN A OD1   1 
ATOM   1417 N  ND2   . ASN A 1 184 ? 36.069  34.211  32.168 1.00 78.75  ? 259 ASN A ND2   1 
ATOM   1418 N  N     . ASN A 1 185 ? 33.812  38.121  28.430 1.00 55.40  ? 260 ASN A N     1 
ATOM   1419 C  CA    . ASN A 1 185 ? 32.640  38.655  27.745 1.00 69.92  ? 260 ASN A CA    1 
ATOM   1420 C  C     . ASN A 1 185 ? 33.053  39.893  26.951 1.00 62.39  ? 260 ASN A C     1 
ATOM   1421 O  O     . ASN A 1 185 ? 34.242  40.177  26.773 1.00 60.55  ? 260 ASN A O     1 
ATOM   1422 C  CB    . ASN A 1 185 ? 31.504  38.925  28.744 1.00 61.29  ? 260 ASN A CB    1 
ATOM   1423 C  CG    . ASN A 1 185 ? 31.995  39.052  30.168 1.00 62.40  ? 260 ASN A CG    1 
ATOM   1424 O  OD1   . ASN A 1 185 ? 32.343  40.141  30.611 1.00 81.82  ? 260 ASN A OD1   1 
ATOM   1425 N  ND2   . ASN A 1 185 ? 32.023  37.939  30.894 1.00 53.25  ? 260 ASN A ND2   1 
ATOM   1426 N  N     . ILE A 1 186 ? 32.054  40.625  26.464 1.00 52.67  ? 261 ILE A N     1 
ATOM   1427 C  CA    . ILE A 1 186 ? 32.268  41.747  25.555 1.00 63.87  ? 261 ILE A CA    1 
ATOM   1428 C  C     . ILE A 1 186 ? 32.697  42.971  26.358 1.00 68.83  ? 261 ILE A C     1 
ATOM   1429 O  O     . ILE A 1 186 ? 31.968  43.429  27.243 1.00 61.99  ? 261 ILE A O     1 
ATOM   1430 C  CB    . ILE A 1 186 ? 30.996  42.039  24.747 1.00 76.17  ? 261 ILE A CB    1 
ATOM   1431 C  CG1   . ILE A 1 186 ? 30.491  40.759  24.076 1.00 72.68  ? 261 ILE A CG1   1 
ATOM   1432 C  CG2   . ILE A 1 186 ? 31.248  43.134  23.720 1.00 64.80  ? 261 ILE A CG2   1 
ATOM   1433 C  CD1   . ILE A 1 186 ? 29.175  40.924  23.353 1.00 68.11  ? 261 ILE A CD1   1 
ATOM   1434 N  N     . ARG A 1 187 ? 33.877  43.509  26.041 1.00 61.56  ? 262 ARG A N     1 
ATOM   1435 C  CA    . ARG A 1 187 ? 34.421  44.676  26.727 1.00 39.68  ? 262 ARG A CA    1 
ATOM   1436 C  C     . ARG A 1 187 ? 34.836  45.714  25.700 1.00 53.75  ? 262 ARG A C     1 
ATOM   1437 O  O     . ARG A 1 187 ? 35.704  45.448  24.862 1.00 56.27  ? 262 ARG A O     1 
ATOM   1438 C  CB    . ARG A 1 187 ? 35.618  44.309  27.604 1.00 51.22  ? 262 ARG A CB    1 
ATOM   1439 C  CG    . ARG A 1 187 ? 35.467  44.754  29.040 1.00 48.24  ? 262 ARG A CG    1 
ATOM   1440 C  CD    . ARG A 1 187 ? 36.809  45.007  29.691 1.00 46.59  ? 262 ARG A CD    1 
ATOM   1441 N  NE    . ARG A 1 187 ? 37.253  46.370  29.438 1.00 50.88  ? 262 ARG A NE    1 
ATOM   1442 C  CZ    . ARG A 1 187 ? 38.160  46.704  28.530 1.00 53.82  ? 262 ARG A CZ    1 
ATOM   1443 N  NH1   . ARG A 1 187 ? 38.737  45.769  27.791 1.00 49.07  ? 262 ARG A NH1   1 
ATOM   1444 N  NH2   . ARG A 1 187 ? 38.493  47.976  28.369 1.00 63.02  ? 262 ARG A NH2   1 
ATOM   1445 N  N     . ILE A 1 188 ? 34.231  46.894  25.781 1.00 56.81  ? 263 ILE A N     1 
ATOM   1446 C  CA    . ILE A 1 188 ? 34.566  48.031  24.934 1.00 52.85  ? 263 ILE A CA    1 
ATOM   1447 C  C     . ILE A 1 188 ? 35.296  49.062  25.783 1.00 56.26  ? 263 ILE A C     1 
ATOM   1448 O  O     . ILE A 1 188 ? 34.896  49.338  26.920 1.00 62.75  ? 263 ILE A O     1 
ATOM   1449 C  CB    . ILE A 1 188 ? 33.299  48.632  24.293 1.00 55.95  ? 263 ILE A CB    1 
ATOM   1450 C  CG1   . ILE A 1 188 ? 32.592  47.586  23.427 1.00 49.65  ? 263 ILE A CG1   1 
ATOM   1451 C  CG2   . ILE A 1 188 ? 33.634  49.865  23.480 1.00 61.41  ? 263 ILE A CG2   1 
ATOM   1452 C  CD1   . ILE A 1 188 ? 31.237  48.032  22.919 1.00 56.85  ? 263 ILE A CD1   1 
ATOM   1453 N  N     . ASN A 1 189 ? 36.371  49.627  25.234 1.00 53.29  ? 264 ASN A N     1 
ATOM   1454 C  CA    . ASN A 1 189 ? 37.169  50.609  25.958 1.00 40.75  ? 264 ASN A CA    1 
ATOM   1455 C  C     . ASN A 1 189 ? 36.455  51.951  26.014 1.00 41.21  ? 264 ASN A C     1 
ATOM   1456 O  O     . ASN A 1 189 ? 36.026  52.482  24.984 1.00 52.01  ? 264 ASN A O     1 
ATOM   1457 C  CB    . ASN A 1 189 ? 38.532  50.777  25.296 1.00 52.16  ? 264 ASN A CB    1 
ATOM   1458 C  CG    . ASN A 1 189 ? 39.463  49.633  25.596 1.00 51.43  ? 264 ASN A CG    1 
ATOM   1459 O  OD1   . ASN A 1 189 ? 39.571  49.193  26.739 1.00 47.69  ? 264 ASN A OD1   1 
ATOM   1460 N  ND2   . ASN A 1 189 ? 40.138  49.135  24.567 1.00 44.94  ? 264 ASN A ND2   1 
ATOM   1461 N  N     . CYS A 1 190 ? 36.331  52.499  27.221 1.00 38.51  ? 265 CYS A N     1 
ATOM   1462 C  CA    . CYS A 1 190 ? 35.778  53.836  27.384 1.00 36.59  ? 265 CYS A CA    1 
ATOM   1463 C  C     . CYS A 1 190 ? 36.619  54.836  26.601 1.00 41.10  ? 265 CYS A C     1 
ATOM   1464 O  O     . CYS A 1 190 ? 37.850  54.849  26.708 1.00 46.18  ? 265 CYS A O     1 
ATOM   1465 C  CB    . CYS A 1 190 ? 35.729  54.204  28.869 1.00 38.14  ? 265 CYS A CB    1 
ATOM   1466 S  SG    . CYS A 1 190 ? 35.494  55.957  29.244 1.00 43.42  ? 265 CYS A SG    1 
ATOM   1467 N  N     . SER A 1 191 ? 35.953  55.654  25.787 1.00 36.44  ? 266 SER A N     1 
ATOM   1468 C  CA    . SER A 1 191 ? 36.646  56.606  24.931 1.00 46.97  ? 266 SER A CA    1 
ATOM   1469 C  C     . SER A 1 191 ? 36.948  57.923  25.628 1.00 39.24  ? 266 SER A C     1 
ATOM   1470 O  O     . SER A 1 191 ? 37.749  58.709  25.112 1.00 43.96  ? 266 SER A O     1 
ATOM   1471 C  CB    . SER A 1 191 ? 35.834  56.872  23.658 1.00 43.86  ? 266 SER A CB    1 
ATOM   1472 O  OG    . SER A 1 191 ? 35.966  55.799  22.744 1.00 44.98  ? 266 SER A OG    1 
ATOM   1473 N  N     . SER A 1 192 ? 36.334  58.184  26.780 1.00 35.36  ? 267 SER A N     1 
ATOM   1474 C  CA    . SER A 1 192 ? 36.717  59.360  27.551 1.00 42.51  ? 267 SER A CA    1 
ATOM   1475 C  C     . SER A 1 192 ? 38.054  59.142  28.246 1.00 44.00  ? 267 SER A C     1 
ATOM   1476 O  O     . SER A 1 192 ? 38.879  60.060  28.318 1.00 46.64  ? 267 SER A O     1 
ATOM   1477 C  CB    . SER A 1 192 ? 35.626  59.703  28.562 1.00 42.30  ? 267 SER A CB    1 
ATOM   1478 O  OG    . SER A 1 192 ? 34.445  60.131  27.905 1.00 53.83  ? 267 SER A OG    1 
ATOM   1479 N  N     . HIS A 1 193 ? 38.290  57.932  28.757 1.00 40.68  ? 268 HIS A N     1 
ATOM   1480 C  CA    . HIS A 1 193 ? 39.596  57.620  29.326 1.00 40.51  ? 268 HIS A CA    1 
ATOM   1481 C  C     . HIS A 1 193 ? 40.666  57.571  28.247 1.00 47.32  ? 268 HIS A C     1 
ATOM   1482 O  O     . HIS A 1 193 ? 41.794  58.027  28.466 1.00 55.14  ? 268 HIS A O     1 
ATOM   1483 C  CB    . HIS A 1 193 ? 39.546  56.299  30.088 1.00 36.08  ? 268 HIS A CB    1 
ATOM   1484 C  CG    . HIS A 1 193 ? 38.867  56.400  31.418 1.00 47.75  ? 268 HIS A CG    1 
ATOM   1485 N  ND1   . HIS A 1 193 ? 37.499  56.316  31.566 1.00 46.17  ? 268 HIS A ND1   1 
ATOM   1486 C  CD2   . HIS A 1 193 ? 39.368  56.590  32.662 1.00 41.66  ? 268 HIS A CD2   1 
ATOM   1487 C  CE1   . HIS A 1 193 ? 37.188  56.442  32.843 1.00 53.18  ? 268 HIS A CE1   1 
ATOM   1488 N  NE2   . HIS A 1 193 ? 38.304  56.612  33.530 1.00 44.95  ? 268 HIS A NE2   1 
ATOM   1489 N  N     . LEU A 1 194 ? 40.333  57.030  27.075 1.00 42.19  ? 269 LEU A N     1 
ATOM   1490 C  CA    . LEU A 1 194 ? 41.297  57.008  25.981 1.00 45.23  ? 269 LEU A CA    1 
ATOM   1491 C  C     . LEU A 1 194 ? 41.681  58.420  25.566 1.00 44.98  ? 269 LEU A C     1 
ATOM   1492 O  O     . LEU A 1 194 ? 42.868  58.755  25.486 1.00 58.69  ? 269 LEU A O     1 
ATOM   1493 C  CB    . LEU A 1 194 ? 40.737  56.225  24.795 1.00 39.27  ? 269 LEU A CB    1 
ATOM   1494 C  CG    . LEU A 1 194 ? 40.748  54.712  24.999 1.00 47.45  ? 269 LEU A CG    1 
ATOM   1495 C  CD1   . LEU A 1 194 ? 40.266  53.995  23.751 1.00 51.98  ? 269 LEU A CD1   1 
ATOM   1496 C  CD2   . LEU A 1 194 ? 42.140  54.247  25.393 1.00 39.76  ? 269 LEU A CD2   1 
ATOM   1497 N  N     . LEU A 1 195 ? 40.688  59.271  25.305 1.00 39.42  ? 270 LEU A N     1 
ATOM   1498 C  CA    . LEU A 1 195 ? 40.998  60.650  24.950 1.00 41.11  ? 270 LEU A CA    1 
ATOM   1499 C  C     . LEU A 1 195 ? 41.803  61.333  26.045 1.00 52.02  ? 270 LEU A C     1 
ATOM   1500 O  O     . LEU A 1 195 ? 42.687  62.147  25.752 1.00 55.22  ? 270 LEU A O     1 
ATOM   1501 C  CB    . LEU A 1 195 ? 39.714  61.426  24.665 1.00 41.85  ? 270 LEU A CB    1 
ATOM   1502 C  CG    . LEU A 1 195 ? 39.893  62.854  24.143 1.00 47.28  ? 270 LEU A CG    1 
ATOM   1503 C  CD1   . LEU A 1 195 ? 40.866  62.873  22.972 1.00 39.89  ? 270 LEU A CD1   1 
ATOM   1504 C  CD2   . LEU A 1 195 ? 38.553  63.457  23.740 1.00 41.64  ? 270 LEU A CD2   1 
ATOM   1505 N  N     . SER A 1 196 ? 41.537  60.996  27.307 1.00 42.10  ? 271 SER A N     1 
ATOM   1506 C  CA    . SER A 1 196 ? 42.298  61.595  28.394 1.00 42.58  ? 271 SER A CA    1 
ATOM   1507 C  C     . SER A 1 196 ? 43.736  61.089  28.400 1.00 50.15  ? 271 SER A C     1 
ATOM   1508 O  O     . SER A 1 196 ? 44.665  61.848  28.702 1.00 48.51  ? 271 SER A O     1 
ATOM   1509 C  CB    . SER A 1 196 ? 41.612  61.310  29.727 1.00 40.45  ? 271 SER A CB    1 
ATOM   1510 O  OG    . SER A 1 196 ? 42.227  62.038  30.775 1.00 43.27  ? 271 SER A OG    1 
ATOM   1511 N  N     . ASN A 1 197 ? 43.944  59.814  28.060 1.00 49.47  ? 272 ASN A N     1 
ATOM   1512 C  CA    . ASN A 1 197 ? 45.305  59.294  27.964 1.00 43.33  ? 272 ASN A CA    1 
ATOM   1513 C  C     . ASN A 1 197 ? 46.090  60.017  26.876 1.00 52.42  ? 272 ASN A C     1 
ATOM   1514 O  O     . ASN A 1 197 ? 47.276  60.322  27.055 1.00 47.42  ? 272 ASN A O     1 
ATOM   1515 C  CB    . ASN A 1 197 ? 45.288  57.788  27.688 1.00 40.53  ? 272 ASN A CB    1 
ATOM   1516 C  CG    . ASN A 1 197 ? 44.638  56.989  28.802 1.00 49.19  ? 272 ASN A CG    1 
ATOM   1517 O  OD1   . ASN A 1 197 ? 43.872  56.057  28.547 1.00 58.64  ? 272 ASN A OD1   1 
ATOM   1518 N  ND2   . ASN A 1 197 ? 44.941  57.345  30.041 1.00 47.34  ? 272 ASN A ND2   1 
ATOM   1519 N  N     . VAL A 1 198 ? 45.442  60.298  25.740 1.00 52.73  ? 273 VAL A N     1 
ATOM   1520 C  CA    . VAL A 1 198 ? 46.103  61.005  24.646 1.00 42.51  ? 273 VAL A CA    1 
ATOM   1521 C  C     . VAL A 1 198 ? 46.571  62.380  25.104 1.00 46.88  ? 273 VAL A C     1 
ATOM   1522 O  O     . VAL A 1 198 ? 47.692  62.805  24.798 1.00 50.21  ? 273 VAL A O     1 
ATOM   1523 C  CB    . VAL A 1 198 ? 45.164  61.105  23.429 1.00 40.83  ? 273 VAL A CB    1 
ATOM   1524 C  CG1   . VAL A 1 198 ? 45.822  61.904  22.311 1.00 39.71  ? 273 VAL A CG1   1 
ATOM   1525 C  CG2   . VAL A 1 198 ? 44.779  59.724  22.944 1.00 37.61  ? 273 VAL A CG2   1 
ATOM   1526 N  N     . LEU A 1 199 ? 45.726  63.095  25.849 1.00 47.84  ? 274 LEU A N     1 
ATOM   1527 C  CA    . LEU A 1 199 ? 46.114  64.411  26.344 1.00 45.99  ? 274 LEU A CA    1 
ATOM   1528 C  C     . LEU A 1 199 ? 47.244  64.309  27.362 1.00 45.27  ? 274 LEU A C     1 
ATOM   1529 O  O     . LEU A 1 199 ? 48.248  65.024  27.258 1.00 51.82  ? 274 LEU A O     1 
ATOM   1530 C  CB    . LEU A 1 199 ? 44.905  65.122  26.950 1.00 40.76  ? 274 LEU A CB    1 
ATOM   1531 C  CG    . LEU A 1 199 ? 43.844  65.584  25.952 1.00 45.30  ? 274 LEU A CG    1 
ATOM   1532 C  CD1   . LEU A 1 199 ? 42.736  66.339  26.666 1.00 44.66  ? 274 LEU A CD1   1 
ATOM   1533 C  CD2   . LEU A 1 199 ? 44.465  66.442  24.859 1.00 37.42  ? 274 LEU A CD2   1 
ATOM   1534 N  N     . GLU A 1 200 ? 47.103  63.426  28.353 1.00 45.55  ? 275 GLU A N     1 
ATOM   1535 C  CA    . GLU A 1 200 ? 48.118  63.321  29.398 1.00 42.23  ? 275 GLU A CA    1 
ATOM   1536 C  C     . GLU A 1 200 ? 49.481  63.001  28.801 1.00 48.60  ? 275 GLU A C     1 
ATOM   1537 O  O     . GLU A 1 200 ? 50.473  63.683  29.086 1.00 43.54  ? 275 GLU A O     1 
ATOM   1538 C  CB    . GLU A 1 200 ? 47.717  62.259  30.423 1.00 42.14  ? 275 GLU A CB    1 
ATOM   1539 C  CG    . GLU A 1 200 ? 48.766  61.999  31.493 1.00 52.65  ? 275 GLU A CG    1 
ATOM   1540 C  CD    . GLU A 1 200 ? 48.407  60.834  32.398 1.00 90.12  ? 275 GLU A CD    1 
ATOM   1541 O  OE1   . GLU A 1 200 ? 47.196  60.553  32.551 1.00 78.07  ? 275 GLU A OE1   1 
ATOM   1542 O  OE2   . GLU A 1 200 ? 49.335  60.196  32.949 1.00 95.64  ? 275 GLU A OE2   1 
ATOM   1543 N  N     . ASN A 1 201 ? 49.542  61.976  27.950 1.00 50.91  ? 276 ASN A N     1 
ATOM   1544 C  CA    . ASN A 1 201 ? 50.810  61.592  27.344 1.00 46.27  ? 276 ASN A CA    1 
ATOM   1545 C  C     . ASN A 1 201 ? 51.362  62.707  26.465 1.00 48.35  ? 276 ASN A C     1 
ATOM   1546 O  O     . ASN A 1 201 ? 52.539  63.067  26.572 1.00 49.77  ? 276 ASN A O     1 
ATOM   1547 C  CB    . ASN A 1 201 ? 50.641  60.305  26.538 1.00 41.23  ? 276 ASN A CB    1 
ATOM   1548 C  CG    . ASN A 1 201 ? 50.795  59.058  27.387 1.00 55.54  ? 276 ASN A CG    1 
ATOM   1549 O  OD1   . ASN A 1 201 ? 50.506  59.061  28.586 1.00 57.62  ? 276 ASN A OD1   1 
ATOM   1550 N  ND2   . ASN A 1 201 ? 51.263  57.980  26.766 1.00 47.94  ? 276 ASN A ND2   1 
ATOM   1551 N  N     . SER A 1 202 ? 50.523  63.277  25.594 1.00 33.84  ? 277 SER A N     1 
ATOM   1552 C  CA    . SER A 1 202 ? 51.021  64.272  24.651 1.00 37.61  ? 277 SER A CA    1 
ATOM   1553 C  C     . SER A 1 202 ? 51.611  65.483  25.361 1.00 43.41  ? 277 SER A C     1 
ATOM   1554 O  O     . SER A 1 202 ? 52.551  66.103  24.854 1.00 38.44  ? 277 SER A O     1 
ATOM   1555 C  CB    . SER A 1 202 ? 49.909  64.702  23.700 1.00 39.97  ? 277 SER A CB    1 
ATOM   1556 O  OG    . SER A 1 202 ? 49.595  63.659  22.800 1.00 43.89  ? 277 SER A OG    1 
ATOM   1557 N  N     . PHE A 1 203 ? 51.088  65.832  26.533 1.00 51.05  ? 278 PHE A N     1 
ATOM   1558 C  CA    . PHE A 1 203 ? 51.674  66.933  27.285 1.00 46.93  ? 278 PHE A CA    1 
ATOM   1559 C  C     . PHE A 1 203 ? 52.916  66.502  28.051 1.00 45.09  ? 278 PHE A C     1 
ATOM   1560 O  O     . PHE A 1 203 ? 53.829  67.313  28.238 1.00 47.43  ? 278 PHE A O     1 
ATOM   1561 C  CB    . PHE A 1 203 ? 50.633  67.534  28.229 1.00 43.90  ? 278 PHE A CB    1 
ATOM   1562 C  CG    . PHE A 1 203 ? 49.683  68.466  27.546 1.00 34.75  ? 278 PHE A CG    1 
ATOM   1563 C  CD1   . PHE A 1 203 ? 49.856  69.832  27.632 1.00 41.66  ? 278 PHE A CD1   1 
ATOM   1564 C  CD2   . PHE A 1 203 ? 48.638  67.975  26.788 1.00 49.37  ? 278 PHE A CD2   1 
ATOM   1565 C  CE1   . PHE A 1 203 ? 48.988  70.691  26.995 1.00 56.57  ? 278 PHE A CE1   1 
ATOM   1566 C  CE2   . PHE A 1 203 ? 47.765  68.829  26.146 1.00 67.81  ? 278 PHE A CE2   1 
ATOM   1567 C  CZ    . PHE A 1 203 ? 47.940  70.191  26.251 1.00 68.34  ? 278 PHE A CZ    1 
ATOM   1568 N  N     . GLU A 1 204 ? 52.969  65.246  28.505 1.00 53.88  ? 279 GLU A N     1 
ATOM   1569 C  CA    . GLU A 1 204 ? 54.219  64.712  29.039 1.00 43.67  ? 279 GLU A CA    1 
ATOM   1570 C  C     . GLU A 1 204 ? 55.319  64.771  27.989 1.00 47.51  ? 279 GLU A C     1 
ATOM   1571 O  O     . GLU A 1 204 ? 56.477  65.071  28.303 1.00 50.13  ? 279 GLU A O     1 
ATOM   1572 C  CB    . GLU A 1 204 ? 54.030  63.268  29.521 1.00 51.58  ? 279 GLU A CB    1 
ATOM   1573 C  CG    . GLU A 1 204 ? 53.293  63.088  30.852 1.00 72.18  ? 279 GLU A CG    1 
ATOM   1574 C  CD    . GLU A 1 204 ? 53.250  61.628  31.304 1.00 82.58  ? 279 GLU A CD    1 
ATOM   1575 O  OE1   . GLU A 1 204 ? 52.173  61.152  31.738 1.00 71.79  ? 279 GLU A OE1   1 
ATOM   1576 O  OE2   . GLU A 1 204 ? 54.299  60.953  31.218 1.00 69.52  ? 279 GLU A OE2   1 
ATOM   1577 N  N     . GLU A 1 205 ? 54.967  64.509  26.733 1.00 48.70  ? 280 GLU A N     1 
ATOM   1578 C  CA    . GLU A 1 205 ? 55.922  64.394  25.641 1.00 33.92  ? 280 GLU A CA    1 
ATOM   1579 C  C     . GLU A 1 205 ? 56.247  65.730  24.980 1.00 49.46  ? 280 GLU A C     1 
ATOM   1580 O  O     . GLU A 1 205 ? 57.058  65.759  24.048 1.00 51.88  ? 280 GLU A O     1 
ATOM   1581 C  CB    . GLU A 1 205 ? 55.388  63.402  24.600 1.00 38.67  ? 280 GLU A CB    1 
ATOM   1582 C  CG    . GLU A 1 205 ? 55.135  62.006  25.174 1.00 46.10  ? 280 GLU A CG    1 
ATOM   1583 C  CD    . GLU A 1 205 ? 54.446  61.063  24.200 1.00 55.31  ? 280 GLU A CD    1 
ATOM   1584 O  OE1   . GLU A 1 205 ? 54.326  61.410  23.005 1.00 59.75  ? 280 GLU A OE1   1 
ATOM   1585 O  OE2   . GLU A 1 205 ? 54.025  59.968  24.635 1.00 52.31  ? 280 GLU A OE2   1 
ATOM   1586 N  N     . THR A 1 206 ? 55.653  66.831  25.441 1.00 60.21  ? 281 THR A N     1 
ATOM   1587 C  CA    . THR A 1 206 ? 55.936  68.168  24.910 1.00 43.38  ? 281 THR A CA    1 
ATOM   1588 C  C     . THR A 1 206 ? 56.364  69.097  26.042 1.00 38.37  ? 281 THR A C     1 
ATOM   1589 O  O     . THR A 1 206 ? 55.730  70.126  26.293 1.00 39.98  ? 281 THR A O     1 
ATOM   1590 C  CB    . THR A 1 206 ? 54.718  68.733  24.179 1.00 32.24  ? 281 THR A CB    1 
ATOM   1591 O  OG1   . THR A 1 206 ? 54.061  67.688  23.450 1.00 50.75  ? 281 THR A OG1   1 
ATOM   1592 C  CG2   . THR A 1 206 ? 55.137  69.819  23.207 1.00 42.30  ? 281 THR A CG2   1 
ATOM   1593 N  N     . PRO A 1 207 ? 57.463  68.776  26.735 1.00 45.99  ? 282 PRO A N     1 
ATOM   1594 C  CA    . PRO A 1 207 ? 57.835  69.543  27.934 1.00 30.14  ? 282 PRO A CA    1 
ATOM   1595 C  C     . PRO A 1 207 ? 58.259  70.974  27.651 1.00 42.41  ? 282 PRO A C     1 
ATOM   1596 O  O     . PRO A 1 207 ? 58.531  71.717  28.602 1.00 51.29  ? 282 PRO A O     1 
ATOM   1597 C  CB    . PRO A 1 207 ? 58.995  68.727  28.514 1.00 31.41  ? 282 PRO A CB    1 
ATOM   1598 C  CG    . PRO A 1 207 ? 59.616  68.095  27.331 1.00 40.89  ? 282 PRO A CG    1 
ATOM   1599 C  CD    . PRO A 1 207 ? 58.494  67.783  26.382 1.00 41.95  ? 282 PRO A CD    1 
ATOM   1600 N  N     . GLU A 1 208 ? 58.338  71.382  26.381 1.00 37.19  ? 283 GLU A N     1 
ATOM   1601 C  CA    . GLU A 1 208 ? 58.542  72.792  26.068 1.00 40.73  ? 283 GLU A CA    1 
ATOM   1602 C  C     . GLU A 1 208 ? 57.430  73.652  26.650 1.00 43.39  ? 283 GLU A C     1 
ATOM   1603 O  O     . GLU A 1 208 ? 57.665  74.810  27.012 1.00 51.51  ? 283 GLU A O     1 
ATOM   1604 C  CB    . GLU A 1 208 ? 58.619  72.994  24.551 1.00 46.44  ? 283 GLU A CB    1 
ATOM   1605 C  CG    . GLU A 1 208 ? 59.837  72.389  23.870 1.00 37.20  ? 283 GLU A CG    1 
ATOM   1606 C  CD    . GLU A 1 208 ? 59.682  70.908  23.574 1.00 50.46  ? 283 GLU A CD    1 
ATOM   1607 O  OE1   . GLU A 1 208 ? 58.697  70.302  24.044 1.00 55.90  ? 283 GLU A OE1   1 
ATOM   1608 O  OE2   . GLU A 1 208 ? 60.545  70.349  22.864 1.00 48.58  ? 283 GLU A OE2   1 
ATOM   1609 N  N     . LEU A 1 209 ? 56.220  73.105  26.750 1.00 46.22  ? 284 LEU A N     1 
ATOM   1610 C  CA    . LEU A 1 209 ? 55.067  73.812  27.284 1.00 40.25  ? 284 LEU A CA    1 
ATOM   1611 C  C     . LEU A 1 209 ? 54.965  73.730  28.804 1.00 41.31  ? 284 LEU A C     1 
ATOM   1612 O  O     . LEU A 1 209 ? 53.975  74.206  29.366 1.00 51.09  ? 284 LEU A O     1 
ATOM   1613 C  CB    . LEU A 1 209 ? 53.785  73.265  26.645 1.00 39.23  ? 284 LEU A CB    1 
ATOM   1614 C  CG    . LEU A 1 209 ? 53.672  73.426  25.125 1.00 36.40  ? 284 LEU A CG    1 
ATOM   1615 C  CD1   . LEU A 1 209 ? 52.456  72.699  24.587 1.00 33.71  ? 284 LEU A CD1   1 
ATOM   1616 C  CD2   . LEU A 1 209 ? 53.604  74.891  24.757 1.00 37.51  ? 284 LEU A CD2   1 
ATOM   1617 N  N     . ASN A 1 210 ? 55.959  73.146  29.478 1.00 40.97  ? 285 ASN A N     1 
ATOM   1618 C  CA    . ASN A 1 210 ? 55.916  73.038  30.934 1.00 43.15  ? 285 ASN A CA    1 
ATOM   1619 C  C     . ASN A 1 210 ? 55.925  74.412  31.586 1.00 51.12  ? 285 ASN A C     1 
ATOM   1620 O  O     . ASN A 1 210 ? 55.142  74.687  32.504 1.00 57.47  ? 285 ASN A O     1 
ATOM   1621 C  CB    . ASN A 1 210 ? 57.106  72.222  31.438 1.00 40.36  ? 285 ASN A CB    1 
ATOM   1622 C  CG    . ASN A 1 210 ? 56.958  70.740  31.184 1.00 47.14  ? 285 ASN A CG    1 
ATOM   1623 O  OD1   . ASN A 1 210 ? 55.861  70.243  30.918 1.00 50.17  ? 285 ASN A OD1   1 
ATOM   1624 N  ND2   . ASN A 1 210 ? 58.066  70.017  31.283 1.00 48.71  ? 285 ASN A ND2   1 
ATOM   1625 N  N     . MET A 1 211 ? 56.820  75.284  31.127 1.00 48.99  ? 286 MET A N     1 
ATOM   1626 C  CA    . MET A 1 211 ? 56.972  76.589  31.761 1.00 55.37  ? 286 MET A CA    1 
ATOM   1627 C  C     . MET A 1 211 ? 55.730  77.461  31.664 1.00 55.93  ? 286 MET A C     1 
ATOM   1628 O  O     . MET A 1 211 ? 55.384  78.095  32.679 1.00 54.30  ? 286 MET A O     1 
ATOM   1629 C  CB    . MET A 1 211 ? 58.202  77.293  31.173 1.00 51.64  ? 286 MET A CB    1 
ATOM   1630 C  CG    . MET A 1 211 ? 58.481  78.653  31.778 1.00 77.65  ? 286 MET A CG    1 
ATOM   1631 S  SD    . MET A 1 211 ? 58.351  79.958  30.547 1.00 95.70  ? 286 MET A SD    1 
ATOM   1632 C  CE    . MET A 1 211 ? 59.589  79.422  29.369 1.00 59.84  ? 286 MET A CE    1 
ATOM   1633 N  N     . PRO A 1 212 ? 55.035  77.575  30.525 1.00 56.45  ? 287 PRO A N     1 
ATOM   1634 C  CA    . PRO A 1 212 ? 53.793  78.362  30.537 1.00 50.19  ? 287 PRO A CA    1 
ATOM   1635 C  C     . PRO A 1 212 ? 52.710  77.750  31.407 1.00 52.45  ? 287 PRO A C     1 
ATOM   1636 O  O     . PRO A 1 212 ? 52.039  78.475  32.153 1.00 54.08  ? 287 PRO A O     1 
ATOM   1637 C  CB    . PRO A 1 212 ? 53.378  78.399  29.059 1.00 33.51  ? 287 PRO A CB    1 
ATOM   1638 C  CG    . PRO A 1 212 ? 54.617  78.094  28.307 1.00 40.51  ? 287 PRO A CG    1 
ATOM   1639 C  CD    . PRO A 1 212 ? 55.371  77.130  29.159 1.00 48.47  ? 287 PRO A CD    1 
ATOM   1640 N  N     . ILE A 1 213 ? 52.517  76.431  31.340 1.00 39.69  ? 288 ILE A N     1 
ATOM   1641 C  CA    . ILE A 1 213 ? 51.477  75.795  32.143 1.00 42.51  ? 288 ILE A CA    1 
ATOM   1642 C  C     . ILE A 1 213 ? 51.778  75.955  33.628 1.00 43.33  ? 288 ILE A C     1 
ATOM   1643 O  O     . ILE A 1 213 ? 50.933  76.414  34.403 1.00 43.55  ? 288 ILE A O     1 
ATOM   1644 C  CB    . ILE A 1 213 ? 51.329  74.316  31.753 1.00 37.04  ? 288 ILE A CB    1 
ATOM   1645 C  CG1   . ILE A 1 213 ? 50.747  74.200  30.343 1.00 32.67  ? 288 ILE A CG1   1 
ATOM   1646 C  CG2   . ILE A 1 213 ? 50.466  73.593  32.765 1.00 39.97  ? 288 ILE A CG2   1 
ATOM   1647 C  CD1   . ILE A 1 213 ? 50.546  72.775  29.895 1.00 39.60  ? 288 ILE A CD1   1 
ATOM   1648 N  N     . LEU A 1 214 ? 52.988  75.580  34.046 1.00 50.05  ? 289 LEU A N     1 
ATOM   1649 C  CA    . LEU A 1 214 ? 53.358  75.701  35.453 1.00 46.17  ? 289 LEU A CA    1 
ATOM   1650 C  C     . LEU A 1 214 ? 53.289  77.145  35.928 1.00 53.50  ? 289 LEU A C     1 
ATOM   1651 O  O     . LEU A 1 214 ? 52.923  77.411  37.080 1.00 55.19  ? 289 LEU A O     1 
ATOM   1652 C  CB    . LEU A 1 214 ? 54.757  75.138  35.676 1.00 53.06  ? 289 LEU A CB    1 
ATOM   1653 C  CG    . LEU A 1 214 ? 55.269  75.258  37.108 1.00 44.40  ? 289 LEU A CG    1 
ATOM   1654 C  CD1   . LEU A 1 214 ? 54.501  74.323  38.040 1.00 37.88  ? 289 LEU A CD1   1 
ATOM   1655 C  CD2   . LEU A 1 214 ? 56.750  74.982  37.154 1.00 30.28  ? 289 LEU A CD2   1 
ATOM   1656 N  N     . ALA A 1 215 ? 53.637  78.093  35.056 1.00 53.35  ? 290 ALA A N     1 
ATOM   1657 C  CA    . ALA A 1 215 ? 53.482  79.500  35.405 1.00 32.26  ? 290 ALA A CA    1 
ATOM   1658 C  C     . ALA A 1 215 ? 52.025  79.829  35.691 1.00 48.01  ? 290 ALA A C     1 
ATOM   1659 O  O     . ALA A 1 215 ? 51.715  80.510  36.676 1.00 57.30  ? 290 ALA A O     1 
ATOM   1660 C  CB    . ALA A 1 215 ? 54.020  80.388  34.284 1.00 31.19  ? 290 ALA A CB    1 
ATOM   1661 N  N     . CYS A 1 216 ? 51.113  79.341  34.845 1.00 48.86  ? 291 CYS A N     1 
ATOM   1662 C  CA    . CYS A 1 216 ? 49.691  79.546  35.096 1.00 40.81  ? 291 CYS A CA    1 
ATOM   1663 C  C     . CYS A 1 216 ? 49.250  78.854  36.381 1.00 52.64  ? 291 CYS A C     1 
ATOM   1664 O  O     . CYS A 1 216 ? 48.463  79.415  37.153 1.00 53.54  ? 291 CYS A O     1 
ATOM   1665 C  CB    . CYS A 1 216 ? 48.871  79.050  33.906 1.00 43.87  ? 291 CYS A CB    1 
ATOM   1666 S  SG    . CYS A 1 216 ? 48.998  80.077  32.432 1.00 48.52  ? 291 CYS A SG    1 
ATOM   1667 N  N     . LYS A 1 217 ? 49.752  77.636  36.631 1.00 52.37  ? 292 LYS A N     1 
ATOM   1668 C  CA    . LYS A 1 217 ? 49.373  76.907  37.841 1.00 48.08  ? 292 LYS A CA    1 
ATOM   1669 C  C     . LYS A 1 217 ? 49.725  77.688  39.098 1.00 52.19  ? 292 LYS A C     1 
ATOM   1670 O  O     . LYS A 1 217 ? 48.985  77.636  40.087 1.00 54.93  ? 292 LYS A O     1 
ATOM   1671 C  CB    . LYS A 1 217 ? 50.046  75.531  37.880 1.00 47.84  ? 292 LYS A CB    1 
ATOM   1672 C  CG    . LYS A 1 217 ? 49.385  74.467  37.012 1.00 60.96  ? 292 LYS A CG    1 
ATOM   1673 C  CD    . LYS A 1 217 ? 50.095  73.119  37.113 1.00 59.53  ? 292 LYS A CD    1 
ATOM   1674 C  CE    . LYS A 1 217 ? 49.878  72.456  38.468 1.00 86.28  ? 292 LYS A CE    1 
ATOM   1675 N  NZ    . LYS A 1 217 ? 50.389  71.051  38.479 1.00 88.43  ? 292 LYS A NZ    1 
ATOM   1676 N  N     . ASN A 1 218 ? 50.838  78.421  39.075 1.00 53.60  ? 293 ASN A N     1 
ATOM   1677 C  CA    . ASN A 1 218 ? 51.278  79.179  40.236 1.00 59.38  ? 293 ASN A CA    1 
ATOM   1678 C  C     . ASN A 1 218 ? 50.562  80.516  40.380 1.00 56.75  ? 293 ASN A C     1 
ATOM   1679 O  O     . ASN A 1 218 ? 50.668  81.143  41.441 1.00 51.54  ? 293 ASN A O     1 
ATOM   1680 C  CB    . ASN A 1 218 ? 52.796  79.379  40.174 1.00 45.16  ? 293 ASN A CB    1 
ATOM   1681 C  CG    . ASN A 1 218 ? 53.557  78.087  40.428 1.00 49.68  ? 293 ASN A CG    1 
ATOM   1682 O  OD1   . ASN A 1 218 ? 53.013  77.135  40.994 1.00 57.06  ? 293 ASN A OD1   1 
ATOM   1683 N  ND2   . ASN A 1 218 ? 54.818  78.048  40.016 1.00 45.13  ? 293 ASN A ND2   1 
ATOM   1684 N  N     . ILE A 1 219 ? 49.834  80.962  39.356 1.00 45.08  ? 294 ILE A N     1 
ATOM   1685 C  CA    . ILE A 1 219 ? 48.948  82.109  39.524 1.00 46.24  ? 294 ILE A CA    1 
ATOM   1686 C  C     . ILE A 1 219 ? 47.680  81.697  40.264 1.00 44.45  ? 294 ILE A C     1 
ATOM   1687 O  O     . ILE A 1 219 ? 47.234  82.383  41.190 1.00 42.08  ? 294 ILE A O     1 
ATOM   1688 C  CB    . ILE A 1 219 ? 48.626  82.748  38.160 1.00 36.42  ? 294 ILE A CB    1 
ATOM   1689 C  CG1   . ILE A 1 219 ? 49.868  83.434  37.591 1.00 36.65  ? 294 ILE A CG1   1 
ATOM   1690 C  CG2   . ILE A 1 219 ? 47.475  83.735  38.295 1.00 38.90  ? 294 ILE A CG2   1 
ATOM   1691 C  CD1   . ILE A 1 219 ? 49.686  83.978  36.198 1.00 26.96  ? 294 ILE A CD1   1 
ATOM   1692 N  N     . VAL A 1 220 ? 47.086  80.567  39.868 1.00 38.87  ? 295 VAL A N     1 
ATOM   1693 C  CA    . VAL A 1 220 ? 45.954  80.014  40.604 1.00 35.64  ? 295 VAL A CA    1 
ATOM   1694 C  C     . VAL A 1 220 ? 46.337  79.760  42.057 1.00 50.38  ? 295 VAL A C     1 
ATOM   1695 O  O     . VAL A 1 220 ? 45.581  80.084  42.981 1.00 53.28  ? 295 VAL A O     1 
ATOM   1696 C  CB    . VAL A 1 220 ? 45.453  78.727  39.920 1.00 40.80  ? 295 VAL A CB    1 
ATOM   1697 C  CG1   . VAL A 1 220 ? 44.218  78.187  40.626 1.00 35.96  ? 295 VAL A CG1   1 
ATOM   1698 C  CG2   . VAL A 1 220 ? 45.172  78.978  38.443 1.00 38.40  ? 295 VAL A CG2   1 
ATOM   1699 N  N     . LYS A 1 221 ? 47.528  79.192  42.276 1.00 48.66  ? 296 LYS A N     1 
ATOM   1700 C  CA    . LYS A 1 221 ? 48.004  78.896  43.624 1.00 45.67  ? 296 LYS A CA    1 
ATOM   1701 C  C     . LYS A 1 221 ? 48.130  80.157  44.469 1.00 53.23  ? 296 LYS A C     1 
ATOM   1702 O  O     . LYS A 1 221 ? 47.957  80.106  45.694 1.00 52.21  ? 296 LYS A O     1 
ATOM   1703 C  CB    . LYS A 1 221 ? 49.348  78.166  43.536 1.00 43.72  ? 296 LYS A CB    1 
ATOM   1704 C  CG    . LYS A 1 221 ? 49.949  77.714  44.855 1.00 74.12  ? 296 LYS A CG    1 
ATOM   1705 C  CD    . LYS A 1 221 ? 51.252  76.971  44.603 1.00 90.41  ? 296 LYS A CD    1 
ATOM   1706 C  CE    . LYS A 1 221 ? 51.926  76.551  45.893 1.00 82.35  ? 296 LYS A CE    1 
ATOM   1707 N  NZ    . LYS A 1 221 ? 53.195  75.819  45.622 1.00 87.42  ? 296 LYS A NZ    1 
ATOM   1708 N  N     . TYR A 1 222 ? 48.421  81.295  43.835 1.00 55.67  ? 297 TYR A N     1 
ATOM   1709 C  CA    . TYR A 1 222 ? 48.567  82.552  44.563 1.00 62.93  ? 297 TYR A CA    1 
ATOM   1710 C  C     . TYR A 1 222 ? 47.220  83.220  44.814 1.00 61.23  ? 297 TYR A C     1 
ATOM   1711 O  O     . TYR A 1 222 ? 47.011  83.821  45.875 1.00 49.68  ? 297 TYR A O     1 
ATOM   1712 C  CB    . TYR A 1 222 ? 49.491  83.492  43.792 1.00 55.26  ? 297 TYR A CB    1 
ATOM   1713 C  CG    . TYR A 1 222 ? 49.679  84.852  44.426 1.00 58.14  ? 297 TYR A CG    1 
ATOM   1714 C  CD1   . TYR A 1 222 ? 50.597  85.039  45.449 1.00 60.14  ? 297 TYR A CD1   1 
ATOM   1715 C  CD2   . TYR A 1 222 ? 48.950  85.953  43.989 1.00 66.41  ? 297 TYR A CD2   1 
ATOM   1716 C  CE1   . TYR A 1 222 ? 50.781  86.286  46.028 1.00 71.38  ? 297 TYR A CE1   1 
ATOM   1717 C  CE2   . TYR A 1 222 ? 49.125  87.204  44.564 1.00 56.97  ? 297 TYR A CE2   1 
ATOM   1718 C  CZ    . TYR A 1 222 ? 50.042  87.364  45.583 1.00 68.53  ? 297 TYR A CZ    1 
ATOM   1719 O  OH    . TYR A 1 222 ? 50.223  88.603  46.158 1.00 76.00  ? 297 TYR A OH    1 
ATOM   1720 N  N     . PHE A 1 223 ? 46.300  83.142  43.848 1.00 59.73  ? 298 PHE A N     1 
ATOM   1721 C  CA    . PHE A 1 223 ? 44.977  83.722  44.052 1.00 56.68  ? 298 PHE A CA    1 
ATOM   1722 C  C     . PHE A 1 223 ? 44.211  82.996  45.143 1.00 56.05  ? 298 PHE A C     1 
ATOM   1723 O  O     . PHE A 1 223 ? 43.404  83.610  45.850 1.00 59.45  ? 298 PHE A O     1 
ATOM   1724 C  CB    . PHE A 1 223 ? 44.187  83.711  42.746 1.00 58.40  ? 298 PHE A CB    1 
ATOM   1725 C  CG    . PHE A 1 223 ? 44.361  84.959  41.934 1.00 66.48  ? 298 PHE A CG    1 
ATOM   1726 C  CD1   . PHE A 1 223 ? 43.281  85.775  41.654 1.00 55.64  ? 298 PHE A CD1   1 
ATOM   1727 C  CD2   . PHE A 1 223 ? 45.614  85.331  41.477 1.00 67.06  ? 298 PHE A CD2   1 
ATOM   1728 C  CE1   . PHE A 1 223 ? 43.447  86.929  40.916 1.00 61.17  ? 298 PHE A CE1   1 
ATOM   1729 C  CE2   . PHE A 1 223 ? 45.783  86.482  40.738 1.00 61.37  ? 298 PHE A CE2   1 
ATOM   1730 C  CZ    . PHE A 1 223 ? 44.698  87.283  40.458 1.00 63.66  ? 298 PHE A CZ    1 
ATOM   1731 N  N     . LYS A 1 224 ? 44.459  81.699  45.307 1.00 55.65  ? 299 LYS A N     1 
ATOM   1732 C  CA    . LYS A 1 224 ? 43.804  80.966  46.382 1.00 56.84  ? 299 LYS A CA    1 
ATOM   1733 C  C     . LYS A 1 224 ? 44.458  81.243  47.733 1.00 50.26  ? 299 LYS A C     1 
ATOM   1734 O  O     . LYS A 1 224 ? 43.761  81.376  48.744 1.00 48.48  ? 299 LYS A O     1 
ATOM   1735 C  CB    . LYS A 1 224 ? 43.800  79.470  46.066 1.00 42.52  ? 299 LYS A CB    1 
ATOM   1736 C  CG    . LYS A 1 224 ? 42.866  79.099  44.921 1.00 32.15  ? 299 LYS A CG    1 
ATOM   1737 C  CD    . LYS A 1 224 ? 42.699  77.597  44.792 1.00 29.88  ? 299 LYS A CD    1 
ATOM   1738 C  CE    . LYS A 1 224 ? 41.646  77.249  43.752 1.00 36.81  ? 299 LYS A CE    1 
ATOM   1739 N  NZ    . LYS A 1 224 ? 41.594  75.786  43.479 1.00 59.06  ? 299 LYS A NZ    1 
ATOM   1740 N  N     . LYS A 1 225 ? 45.789  81.347  47.773 1.00 53.40  ? 300 LYS A N     1 
ATOM   1741 C  CA    . LYS A 1 225 ? 46.459  81.609  49.045 1.00 61.04  ? 300 LYS A CA    1 
ATOM   1742 C  C     . LYS A 1 225 ? 46.222  83.036  49.524 1.00 53.22  ? 300 LYS A C     1 
ATOM   1743 O  O     . LYS A 1 225 ? 46.111  83.272  50.731 1.00 58.88  ? 300 LYS A O     1 
ATOM   1744 C  CB    . LYS A 1 225 ? 47.962  81.333  48.926 1.00 63.01  ? 300 LYS A CB    1 
ATOM   1745 C  CG    . LYS A 1 225 ? 48.749  81.613  50.208 1.00 64.50  ? 300 LYS A CG    1 
ATOM   1746 C  CD    . LYS A 1 225 ? 50.211  81.200  50.094 1.00 78.13  ? 300 LYS A CD    1 
ATOM   1747 C  CE    . LYS A 1 225 ? 50.986  81.562  51.356 1.00 67.62  ? 300 LYS A CE    1 
ATOM   1748 N  NZ    . LYS A 1 225 ? 50.365  80.983  52.580 1.00 77.25  ? 300 LYS A NZ    1 
ATOM   1749 N  N     . ALA A 1 226 ? 46.135  83.993  48.607 1.00 56.56  ? 301 ALA A N     1 
ATOM   1750 C  CA    . ALA A 1 226 ? 45.945  85.392  48.957 1.00 59.37  ? 301 ALA A CA    1 
ATOM   1751 C  C     . ALA A 1 226 ? 44.475  85.796  49.032 1.00 71.61  ? 301 ALA A C     1 
ATOM   1752 O  O     . ALA A 1 226 ? 44.185  86.982  49.232 1.00 62.90  ? 301 ALA A O     1 
ATOM   1753 C  CB    . ALA A 1 226 ? 46.683  86.285  47.958 1.00 53.14  ? 301 ALA A CB    1 
ATOM   1754 N  N     . ASN A 1 227 ? 43.551  84.844  48.880 1.00 58.35  ? 302 ASN A N     1 
ATOM   1755 C  CA    . ASN A 1 227 ? 42.115  85.100  48.987 1.00 44.89  ? 302 ASN A CA    1 
ATOM   1756 C  C     . ASN A 1 227 ? 41.701  86.251  48.073 1.00 62.05  ? 302 ASN A C     1 
ATOM   1757 O  O     . ASN A 1 227 ? 41.115  87.247  48.504 1.00 68.03  ? 302 ASN A O     1 
ATOM   1758 C  CB    . ASN A 1 227 ? 41.720  85.370  50.444 1.00 63.83  ? 302 ASN A CB    1 
ATOM   1759 C  CG    . ASN A 1 227 ? 40.212  85.345  50.662 1.00 91.80  ? 302 ASN A CG    1 
ATOM   1760 O  OD1   . ASN A 1 227 ? 39.460  84.803  49.848 1.00 69.78  ? 302 ASN A OD1   1 
ATOM   1761 N  ND2   . ASN A 1 227 ? 39.766  85.933  51.770 1.00 91.05  ? 302 ASN A ND2   1 
ATOM   1762 N  N     . LEU A 1 228 ? 42.032  86.112  46.791 1.00 58.03  ? 303 LEU A N     1 
ATOM   1763 C  CA    . LEU A 1 228 ? 41.784  87.158  45.811 1.00 53.78  ? 303 LEU A CA    1 
ATOM   1764 C  C     . LEU A 1 228 ? 40.768  86.766  44.750 1.00 53.28  ? 303 LEU A C     1 
ATOM   1765 O  O     . LEU A 1 228 ? 40.458  87.585  43.879 1.00 63.28  ? 303 LEU A O     1 
ATOM   1766 C  CB    . LEU A 1 228 ? 43.091  87.562  45.127 1.00 49.96  ? 303 LEU A CB    1 
ATOM   1767 C  CG    . LEU A 1 228 ? 44.204  88.061  46.043 1.00 54.87  ? 303 LEU A CG    1 
ATOM   1768 C  CD1   . LEU A 1 228 ? 45.480  88.282  45.248 1.00 50.31  ? 303 LEU A CD1   1 
ATOM   1769 C  CD2   . LEU A 1 228 ? 43.777  89.337  46.749 1.00 65.24  ? 303 LEU A CD2   1 
ATOM   1770 N  N     . GLN A 1 229 ? 40.244  85.541  44.788 1.00 53.73  ? 304 GLN A N     1 
ATOM   1771 C  CA    . GLN A 1 229 ? 39.294  85.120  43.766 1.00 50.55  ? 304 GLN A CA    1 
ATOM   1772 C  C     . GLN A 1 229 ? 37.968  85.854  43.863 1.00 56.27  ? 304 GLN A C     1 
ATOM   1773 O  O     . GLN A 1 229 ? 37.178  85.795  42.912 1.00 61.44  ? 304 GLN A O     1 
ATOM   1774 C  CB    . GLN A 1 229 ? 39.058  83.611  43.850 1.00 45.54  ? 304 GLN A CB    1 
ATOM   1775 C  CG    . GLN A 1 229 ? 40.312  82.778  43.647 1.00 48.50  ? 304 GLN A CG    1 
ATOM   1776 C  CD    . GLN A 1 229 ? 40.249  81.908  42.406 1.00 53.81  ? 304 GLN A CD    1 
ATOM   1777 O  OE1   . GLN A 1 229 ? 39.837  82.361  41.335 1.00 58.81  ? 304 GLN A OE1   1 
ATOM   1778 N  NE2   . GLN A 1 229 ? 40.646  80.653  42.545 1.00 50.51  ? 304 GLN A NE2   1 
ATOM   1779 N  N     . HIS A 1 230 ? 37.706  86.542  44.977 1.00 68.02  ? 305 HIS A N     1 
ATOM   1780 C  CA    . HIS A 1 230 ? 36.457  87.277  45.114 1.00 61.51  ? 305 HIS A CA    1 
ATOM   1781 C  C     . HIS A 1 230 ? 36.397  88.492  44.198 1.00 52.87  ? 305 HIS A C     1 
ATOM   1782 O  O     . HIS A 1 230 ? 35.302  89.018  43.968 1.00 77.84  ? 305 HIS A O     1 
ATOM   1783 C  CB    . HIS A 1 230 ? 36.253  87.705  46.568 1.00 59.25  ? 305 HIS A CB    1 
ATOM   1784 C  CG    . HIS A 1 230 ? 37.139  88.834  47.001 1.00 57.41  ? 305 HIS A CG    1 
ATOM   1785 N  ND1   . HIS A 1 230 ? 38.334  88.635  47.660 1.00 62.81  ? 305 HIS A ND1   1 
ATOM   1786 C  CD2   . HIS A 1 230 ? 36.998  90.175  46.879 1.00 62.44  ? 305 HIS A CD2   1 
ATOM   1787 C  CE1   . HIS A 1 230 ? 38.894  89.804  47.915 1.00 62.35  ? 305 HIS A CE1   1 
ATOM   1788 N  NE2   . HIS A 1 230 ? 38.103  90.756  47.453 1.00 65.68  ? 305 HIS A NE2   1 
ATOM   1789 N  N     . ARG A 1 231 ? 37.541  88.947  43.680 1.00 55.87  ? 306 ARG A N     1 
ATOM   1790 C  CA    . ARG A 1 231 ? 37.609  90.076  42.761 1.00 67.66  ? 306 ARG A CA    1 
ATOM   1791 C  C     . ARG A 1 231 ? 37.330  89.680  41.320 1.00 63.04  ? 306 ARG A C     1 
ATOM   1792 O  O     . ARG A 1 231 ? 37.107  90.557  40.479 1.00 63.90  ? 306 ARG A O     1 
ATOM   1793 C  CB    . ARG A 1 231 ? 38.984  90.737  42.839 1.00 41.32  ? 306 ARG A CB    1 
ATOM   1794 C  CG    . ARG A 1 231 ? 39.409  91.104  44.241 1.00 44.10  ? 306 ARG A CG    1 
ATOM   1795 C  CD    . ARG A 1 231 ? 40.443  92.197  44.188 1.00 65.24  ? 306 ARG A CD    1 
ATOM   1796 N  NE    . ARG A 1 231 ? 41.183  92.306  45.436 1.00 83.16  ? 306 ARG A NE    1 
ATOM   1797 C  CZ    . ARG A 1 231 ? 42.209  93.128  45.619 1.00 84.10  ? 306 ARG A CZ    1 
ATOM   1798 N  NH1   . ARG A 1 231 ? 42.615  93.915  44.629 1.00 74.56  ? 306 ARG A NH1   1 
ATOM   1799 N  NH2   . ARG A 1 231 ? 42.828  93.161  46.792 1.00 83.81  ? 306 ARG A NH2   1 
ATOM   1800 N  N     . LEU A 1 232 ? 37.326  88.389  41.025 1.00 56.09  ? 307 LEU A N     1 
ATOM   1801 C  CA    . LEU A 1 232 ? 37.072  87.881  39.688 1.00 62.89  ? 307 LEU A CA    1 
ATOM   1802 C  C     . LEU A 1 232 ? 35.588  87.571  39.565 1.00 70.32  ? 307 LEU A C     1 
ATOM   1803 O  O     . LEU A 1 232 ? 34.998  86.951  40.459 1.00 78.26  ? 307 LEU A O     1 
ATOM   1804 C  CB    . LEU A 1 232 ? 37.894  86.619  39.414 1.00 68.33  ? 307 LEU A CB    1 
ATOM   1805 C  CG    . LEU A 1 232 ? 39.418  86.677  39.254 1.00 55.68  ? 307 LEU A CG    1 
ATOM   1806 C  CD1   . LEU A 1 232 ? 39.804  87.607  38.123 1.00 64.08  ? 307 LEU A CD1   1 
ATOM   1807 C  CD2   . LEU A 1 232 ? 40.096  87.093  40.543 1.00 67.29  ? 307 LEU A CD2   1 
ATOM   1808 N  N     . ARG A 1 233 ? 34.986  88.003  38.462 1.00 48.07  ? 308 ARG A N     1 
ATOM   1809 C  CA    . ARG A 1 233 ? 33.602  87.639  38.206 1.00 68.73  ? 308 ARG A CA    1 
ATOM   1810 C  C     . ARG A 1 233 ? 33.477  86.179  37.808 1.00 65.55  ? 308 ARG A C     1 
ATOM   1811 O  O     . ARG A 1 233 ? 32.399  85.593  37.957 1.00 81.55  ? 308 ARG A O     1 
ATOM   1812 C  CB    . ARG A 1 233 ? 33.025  88.574  37.148 1.00 96.11  ? 308 ARG A CB    1 
ATOM   1813 C  CG    . ARG A 1 233 ? 32.963  89.995  37.679 1.00 121.03 ? 308 ARG A CG    1 
ATOM   1814 C  CD    . ARG A 1 233 ? 32.496  91.010  36.667 1.00 128.37 ? 308 ARG A CD    1 
ATOM   1815 N  NE    . ARG A 1 233 ? 32.349  92.317  37.301 1.00 148.15 ? 308 ARG A NE    1 
ATOM   1816 C  CZ    . ARG A 1 233 ? 32.121  93.449  36.645 1.00 165.53 ? 308 ARG A CZ    1 
ATOM   1817 N  NH1   . ARG A 1 233 ? 32.016  93.441  35.324 1.00 173.62 ? 308 ARG A NH1   1 
ATOM   1818 N  NH2   . ARG A 1 233 ? 32.001  94.591  37.311 1.00 162.30 ? 308 ARG A NH2   1 
ATOM   1819 N  N     . SER A 1 234 ? 34.564  85.583  37.329 1.00 72.04  ? 309 SER A N     1 
ATOM   1820 C  CA    . SER A 1 234 ? 34.681  84.145  37.145 1.00 62.79  ? 309 SER A CA    1 
ATOM   1821 C  C     . SER A 1 234 ? 35.988  83.724  37.798 1.00 52.72  ? 309 SER A C     1 
ATOM   1822 O  O     . SER A 1 234 ? 37.033  84.322  37.527 1.00 71.54  ? 309 SER A O     1 
ATOM   1823 C  CB    . SER A 1 234 ? 34.660  83.769  35.661 1.00 62.50  ? 309 SER A CB    1 
ATOM   1824 O  OG    . SER A 1 234 ? 34.226  82.439  35.472 1.00 75.87  ? 309 SER A OG    1 
ATOM   1825 N  N     . SER A 1 235 ? 35.933  82.718  38.666 1.00 56.52  ? 310 SER A N     1 
ATOM   1826 C  CA    . SER A 1 235 ? 37.113  82.341  39.431 1.00 51.03  ? 310 SER A CA    1 
ATOM   1827 C  C     . SER A 1 235 ? 38.087  81.527  38.581 1.00 50.88  ? 310 SER A C     1 
ATOM   1828 O  O     . SER A 1 235 ? 37.718  80.911  37.575 1.00 49.02  ? 310 SER A O     1 
ATOM   1829 C  CB    . SER A 1 235 ? 36.723  81.529  40.661 1.00 48.76  ? 310 SER A CB    1 
ATOM   1830 O  OG    . SER A 1 235 ? 36.449  80.188  40.299 1.00 46.02  ? 310 SER A OG    1 
ATOM   1831 N  N     . LEU A 1 236 ? 39.350  81.530  39.011 1.00 57.19  ? 311 LEU A N     1 
ATOM   1832 C  CA    . LEU A 1 236 ? 40.387  80.723  38.380 1.00 61.71  ? 311 LEU A CA    1 
ATOM   1833 C  C     . LEU A 1 236 ? 40.328  79.296  38.909 1.00 50.38  ? 311 LEU A C     1 
ATOM   1834 O  O     . LEU A 1 236 ? 40.197  79.072  40.117 1.00 48.19  ? 311 LEU A O     1 
ATOM   1835 C  CB    . LEU A 1 236 ? 41.776  81.304  38.655 1.00 53.25  ? 311 LEU A CB    1 
ATOM   1836 C  CG    . LEU A 1 236 ? 42.044  82.794  38.447 1.00 45.28  ? 311 LEU A CG    1 
ATOM   1837 C  CD1   . LEU A 1 236 ? 43.516  83.090  38.672 1.00 39.68  ? 311 LEU A CD1   1 
ATOM   1838 C  CD2   . LEU A 1 236 ? 41.614  83.238  37.065 1.00 49.96  ? 311 LEU A CD2   1 
ATOM   1839 N  N     . LYS A 1 237 ? 40.442  78.328  38.003 1.00 46.78  ? 312 LYS A N     1 
ATOM   1840 C  CA    . LYS A 1 237 ? 40.334  76.915  38.348 1.00 53.01  ? 312 LYS A CA    1 
ATOM   1841 C  C     . LYS A 1 237 ? 41.713  76.269  38.428 1.00 46.17  ? 312 LYS A C     1 
ATOM   1842 O  O     . LYS A 1 237 ? 42.564  76.489  37.564 1.00 58.16  ? 312 LYS A O     1 
ATOM   1843 C  CB    . LYS A 1 237 ? 39.478  76.163  37.324 1.00 45.61  ? 312 LYS A CB    1 
ATOM   1844 C  CG    . LYS A 1 237 ? 38.320  76.958  36.738 1.00 57.03  ? 312 LYS A CG    1 
ATOM   1845 C  CD    . LYS A 1 237 ? 37.277  77.325  37.779 1.00 54.64  ? 312 LYS A CD    1 
ATOM   1846 C  CE    . LYS A 1 237 ? 36.147  78.125  37.144 1.00 50.09  ? 312 LYS A CE    1 
ATOM   1847 N  NZ    . LYS A 1 237 ? 35.295  78.785  38.165 1.00 51.41  ? 312 LYS A NZ    1 
ATOM   1848 N  N     . SER A 1 238 ? 41.923  75.465  39.468 1.00 48.47  ? 313 SER A N     1 
ATOM   1849 C  CA    . SER A 1 238 ? 43.160  74.711  39.600 1.00 45.75  ? 313 SER A CA    1 
ATOM   1850 C  C     . SER A 1 238 ? 43.218  73.601  38.560 1.00 61.32  ? 313 SER A C     1 
ATOM   1851 O  O     . SER A 1 238 ? 42.196  73.160  38.026 1.00 54.63  ? 313 SER A O     1 
ATOM   1852 C  CB    . SER A 1 238 ? 43.282  74.097  40.996 1.00 52.06  ? 313 SER A CB    1 
ATOM   1853 O  OG    . SER A 1 238 ? 43.493  75.088  41.987 1.00 67.14  ? 313 SER A OG    1 
ATOM   1854 N  N     . GLU A 1 239 ? 44.434  73.143  38.272 1.00 68.50  ? 314 GLU A N     1 
ATOM   1855 C  CA    . GLU A 1 239 ? 44.617  71.951  37.454 1.00 77.84  ? 314 GLU A CA    1 
ATOM   1856 C  C     . GLU A 1 239 ? 44.632  70.741  38.378 1.00 72.00  ? 314 GLU A C     1 
ATOM   1857 O  O     . GLU A 1 239 ? 45.566  70.569  39.168 1.00 90.72  ? 314 GLU A O     1 
ATOM   1858 C  CB    . GLU A 1 239 ? 45.899  72.016  36.631 1.00 74.07  ? 314 GLU A CB    1 
ATOM   1859 C  CG    . GLU A 1 239 ? 46.021  70.854  35.647 1.00 59.37  ? 314 GLU A CG    1 
ATOM   1860 C  CD    . GLU A 1 239 ? 47.457  70.470  35.346 1.00 96.49  ? 314 GLU A CD    1 
ATOM   1861 O  OE1   . GLU A 1 239 ? 48.331  70.699  36.208 1.00 109.38 ? 314 GLU A OE1   1 
ATOM   1862 O  OE2   . GLU A 1 239 ? 47.710  69.936  34.245 1.00 97.98  ? 314 GLU A OE2   1 
ATOM   1863 N  N     . CYS A 1 240 ? 43.587  69.917  38.292 1.00 57.82  ? 315 CYS A N     1 
ATOM   1864 C  CA    . CYS A 1 240 ? 43.555  68.619  38.952 1.00 79.56  ? 315 CYS A CA    1 
ATOM   1865 C  C     . CYS A 1 240 ? 43.756  67.533  37.908 1.00 79.69  ? 315 CYS A C     1 
ATOM   1866 O  O     . CYS A 1 240 ? 42.903  67.381  37.022 1.00 83.22  ? 315 CYS A O     1 
ATOM   1867 C  CB    . CYS A 1 240 ? 42.234  68.404  39.685 1.00 68.80  ? 315 CYS A CB    1 
ATOM   1868 S  SG    . CYS A 1 240 ? 42.045  66.716  40.301 1.00 95.03  ? 315 CYS A SG    1 
ATOM   1869 N  N     . PRO A 1 241 ? 44.838  66.753  37.968 1.00 58.66  ? 316 PRO A N     1 
ATOM   1870 C  CA    . PRO A 1 241 ? 45.107  65.801  36.878 1.00 62.73  ? 316 PRO A CA    1 
ATOM   1871 C  C     . PRO A 1 241 ? 44.015  64.765  36.684 1.00 70.19  ? 316 PRO A C     1 
ATOM   1872 O  O     . PRO A 1 241 ? 43.829  64.283  35.559 1.00 75.54  ? 316 PRO A O     1 
ATOM   1873 C  CB    . PRO A 1 241 ? 46.433  65.152  37.302 1.00 65.64  ? 316 PRO A CB    1 
ATOM   1874 C  CG    . PRO A 1 241 ? 47.062  66.148  38.224 1.00 82.04  ? 316 PRO A CG    1 
ATOM   1875 C  CD    . PRO A 1 241 ? 45.916  66.767  38.968 1.00 68.92  ? 316 PRO A CD    1 
ATOM   1876 N  N     . THR A 1 242 ? 43.276  64.416  37.737 1.00 73.70  ? 317 THR A N     1 
ATOM   1877 C  CA    . THR A 1 242 ? 42.256  63.380  37.637 1.00 61.49  ? 317 THR A CA    1 
ATOM   1878 C  C     . THR A 1 242 ? 40.956  63.869  37.011 1.00 71.79  ? 317 THR A C     1 
ATOM   1879 O  O     . THR A 1 242 ? 40.001  63.088  36.931 1.00 73.65  ? 317 THR A O     1 
ATOM   1880 C  CB    . THR A 1 242 ? 41.966  62.784  39.018 1.00 65.14  ? 317 THR A CB    1 
ATOM   1881 O  OG1   . THR A 1 242 ? 42.169  63.784  40.026 1.00 67.60  ? 317 THR A OG1   1 
ATOM   1882 C  CG2   . THR A 1 242 ? 42.872  61.589  39.286 1.00 68.60  ? 317 THR A CG2   1 
ATOM   1883 N  N     . ARG A 1 243 ? 40.888  65.123  36.569 1.00 51.44  ? 318 ARG A N     1 
ATOM   1884 C  CA    . ARG A 1 243 ? 39.708  65.635  35.888 1.00 39.82  ? 318 ARG A CA    1 
ATOM   1885 C  C     . ARG A 1 243 ? 39.984  65.799  34.402 1.00 45.15  ? 318 ARG A C     1 
ATOM   1886 O  O     . ARG A 1 243 ? 41.065  66.237  34.000 1.00 60.01  ? 318 ARG A O     1 
ATOM   1887 C  CB    . ARG A 1 243 ? 39.249  66.962  36.490 1.00 51.13  ? 318 ARG A CB    1 
ATOM   1888 C  CG    . ARG A 1 243 ? 38.631  66.799  37.861 1.00 60.03  ? 318 ARG A CG    1 
ATOM   1889 C  CD    . ARG A 1 243 ? 37.576  67.852  38.148 1.00 45.50  ? 318 ARG A CD    1 
ATOM   1890 N  NE    . ARG A 1 243 ? 37.022  67.666  39.485 1.00 68.94  ? 318 ARG A NE    1 
ATOM   1891 C  CZ    . ARG A 1 243 ? 36.234  68.537  40.104 1.00 54.60  ? 318 ARG A CZ    1 
ATOM   1892 N  NH1   . ARG A 1 243 ? 35.896  69.672  39.510 1.00 62.86  ? 318 ARG A NH1   1 
ATOM   1893 N  NH2   . ARG A 1 243 ? 35.788  68.270  41.324 1.00 44.54  ? 318 ARG A NH2   1 
ATOM   1894 N  N     . TRP A 1 244 ? 38.994  65.442  33.592 1.00 39.56  ? 319 TRP A N     1 
ATOM   1895 C  CA    . TRP A 1 244 ? 39.172  65.424  32.149 1.00 49.51  ? 319 TRP A CA    1 
ATOM   1896 C  C     . TRP A 1 244 ? 39.268  66.844  31.610 1.00 55.04  ? 319 TRP A C     1 
ATOM   1897 O  O     . TRP A 1 244 ? 38.469  67.712  31.974 1.00 71.69  ? 319 TRP A O     1 
ATOM   1898 C  CB    . TRP A 1 244 ? 38.018  64.671  31.491 1.00 56.08  ? 319 TRP A CB    1 
ATOM   1899 C  CG    . TRP A 1 244 ? 37.953  63.229  31.894 1.00 53.39  ? 319 TRP A CG    1 
ATOM   1900 C  CD1   . TRP A 1 244 ? 38.967  62.477  32.422 1.00 52.89  ? 319 TRP A CD1   1 
ATOM   1901 C  CD2   . TRP A 1 244 ? 36.815  62.366  31.815 1.00 48.21  ? 319 TRP A CD2   1 
ATOM   1902 N  NE1   . TRP A 1 244 ? 38.530  61.197  32.669 1.00 43.06  ? 319 TRP A NE1   1 
ATOM   1903 C  CE2   . TRP A 1 244 ? 37.211  61.104  32.308 1.00 56.91  ? 319 TRP A CE2   1 
ATOM   1904 C  CE3   . TRP A 1 244 ? 35.501  62.534  31.372 1.00 52.43  ? 319 TRP A CE3   1 
ATOM   1905 C  CZ2   . TRP A 1 244 ? 36.337  60.018  32.370 1.00 53.31  ? 319 TRP A CZ2   1 
ATOM   1906 C  CZ3   . TRP A 1 244 ? 34.633  61.452  31.436 1.00 58.81  ? 319 TRP A CZ3   1 
ATOM   1907 C  CH2   . TRP A 1 244 ? 35.056  60.213  31.931 1.00 45.57  ? 319 TRP A CH2   1 
ATOM   1908 N  N     . ASN A 1 245 ? 40.255  67.074  30.742 1.00 48.57  ? 320 ASN A N     1 
ATOM   1909 C  CA    . ASN A 1 245 ? 40.496  68.387  30.145 1.00 44.76  ? 320 ASN A CA    1 
ATOM   1910 C  C     . ASN A 1 245 ? 40.742  69.443  31.218 1.00 47.14  ? 320 ASN A C     1 
ATOM   1911 O  O     . ASN A 1 245 ? 40.303  70.589  31.102 1.00 48.65  ? 320 ASN A O     1 
ATOM   1912 C  CB    . ASN A 1 245 ? 39.343  68.795  29.229 1.00 53.34  ? 320 ASN A CB    1 
ATOM   1913 C  CG    . ASN A 1 245 ? 39.823  69.263  27.878 1.00 61.70  ? 320 ASN A CG    1 
ATOM   1914 O  OD1   . ASN A 1 245 ? 41.017  69.482  27.677 1.00 59.22  ? 320 ASN A OD1   1 
ATOM   1915 N  ND2   . ASN A 1 245 ? 38.894  69.426  26.941 1.00 67.17  ? 320 ASN A ND2   1 
ATOM   1916 N  N     . SER A 1 246 ? 41.462  69.047  32.270 1.00 47.50  ? 321 SER A N     1 
ATOM   1917 C  CA    . SER A 1 246 ? 41.678  69.927  33.413 1.00 43.75  ? 321 SER A CA    1 
ATOM   1918 C  C     . SER A 1 246 ? 42.622  71.075  33.082 1.00 49.14  ? 321 SER A C     1 
ATOM   1919 O  O     . SER A 1 246 ? 42.454  72.183  33.607 1.00 63.92  ? 321 SER A O     1 
ATOM   1920 C  CB    . SER A 1 246 ? 42.215  69.114  34.589 1.00 40.64  ? 321 SER A CB    1 
ATOM   1921 O  OG    . SER A 1 246 ? 43.041  69.897  35.433 1.00 66.74  ? 321 SER A OG    1 
ATOM   1922 N  N     . THR A 1 247 ? 43.623  70.832  32.231 1.00 52.94  ? 322 THR A N     1 
ATOM   1923 C  CA    . THR A 1 247 ? 44.544  71.897  31.845 1.00 52.43  ? 322 THR A CA    1 
ATOM   1924 C  C     . THR A 1 247 ? 43.822  72.981  31.056 1.00 44.11  ? 322 THR A C     1 
ATOM   1925 O  O     . THR A 1 247 ? 44.084  74.176  31.240 1.00 51.19  ? 322 THR A O     1 
ATOM   1926 C  CB    . THR A 1 247 ? 45.711  71.313  31.038 1.00 60.96  ? 322 THR A CB    1 
ATOM   1927 O  OG1   . THR A 1 247 ? 46.577  70.570  31.907 1.00 49.76  ? 322 THR A OG1   1 
ATOM   1928 C  CG2   . THR A 1 247 ? 46.514  72.411  30.358 1.00 47.54  ? 322 THR A CG2   1 
ATOM   1929 N  N     . TYR A 1 248 ? 42.892  72.578  30.187 1.00 51.23  ? 323 TYR A N     1 
ATOM   1930 C  CA    . TYR A 1 248 ? 42.088  73.540  29.438 1.00 47.83  ? 323 TYR A CA    1 
ATOM   1931 C  C     . TYR A 1 248 ? 41.215  74.383  30.358 1.00 46.14  ? 323 TYR A C     1 
ATOM   1932 O  O     . TYR A 1 248 ? 41.018  75.578  30.114 1.00 56.91  ? 323 TYR A O     1 
ATOM   1933 C  CB    . TYR A 1 248 ? 41.221  72.804  28.420 1.00 45.60  ? 323 TYR A CB    1 
ATOM   1934 C  CG    . TYR A 1 248 ? 40.041  73.596  27.912 1.00 52.58  ? 323 TYR A CG    1 
ATOM   1935 C  CD1   . TYR A 1 248 ? 40.203  74.577  26.943 1.00 61.42  ? 323 TYR A CD1   1 
ATOM   1936 C  CD2   . TYR A 1 248 ? 38.759  73.348  28.384 1.00 60.54  ? 323 TYR A CD2   1 
ATOM   1937 C  CE1   . TYR A 1 248 ? 39.122  75.299  26.466 1.00 62.45  ? 323 TYR A CE1   1 
ATOM   1938 C  CE2   . TYR A 1 248 ? 37.671  74.064  27.913 1.00 59.79  ? 323 TYR A CE2   1 
ATOM   1939 C  CZ    . TYR A 1 248 ? 37.859  75.040  26.955 1.00 65.02  ? 323 TYR A CZ    1 
ATOM   1940 O  OH    . TYR A 1 248 ? 36.781  75.760  26.485 1.00 56.15  ? 323 TYR A OH    1 
ATOM   1941 N  N     . THR A 1 249 ? 40.666  73.775  31.409 1.00 49.34  ? 324 THR A N     1 
ATOM   1942 C  CA    . THR A 1 249 ? 39.793  74.520  32.308 1.00 45.44  ? 324 THR A CA    1 
ATOM   1943 C  C     . THR A 1 249 ? 40.562  75.607  33.048 1.00 51.98  ? 324 THR A C     1 
ATOM   1944 O  O     . THR A 1 249 ? 40.062  76.728  33.211 1.00 50.76  ? 324 THR A O     1 
ATOM   1945 C  CB    . THR A 1 249 ? 39.114  73.569  33.296 1.00 52.57  ? 324 THR A CB    1 
ATOM   1946 O  OG1   . THR A 1 249 ? 38.339  72.602  32.576 1.00 51.40  ? 324 THR A OG1   1 
ATOM   1947 C  CG2   . THR A 1 249 ? 38.197  74.338  34.231 1.00 35.46  ? 324 THR A CG2   1 
ATOM   1948 N  N     . MET A 1 250 ? 41.783  75.300  33.496 1.00 40.25  ? 325 MET A N     1 
ATOM   1949 C  CA    . MET A 1 250 ? 42.597  76.312  34.159 1.00 40.81  ? 325 MET A CA    1 
ATOM   1950 C  C     . MET A 1 250 ? 42.999  77.414  33.190 1.00 51.94  ? 325 MET A C     1 
ATOM   1951 O  O     . MET A 1 250 ? 42.841  78.604  33.486 1.00 50.15  ? 325 MET A O     1 
ATOM   1952 C  CB    . MET A 1 250 ? 43.847  75.687  34.767 1.00 48.93  ? 325 MET A CB    1 
ATOM   1953 C  CG    . MET A 1 250 ? 44.940  76.725  34.977 1.00 46.44  ? 325 MET A CG    1 
ATOM   1954 S  SD    . MET A 1 250 ? 46.510  76.062  35.515 1.00 55.35  ? 325 MET A SD    1 
ATOM   1955 C  CE    . MET A 1 250 ? 46.967  75.068  34.101 1.00 64.56  ? 325 MET A CE    1 
ATOM   1956 N  N     . LEU A 1 251 ? 43.546  77.030  32.033 1.00 43.99  ? 326 LEU A N     1 
ATOM   1957 C  CA    . LEU A 1 251 ? 44.003  78.012  31.056 1.00 36.93  ? 326 LEU A CA    1 
ATOM   1958 C  C     . LEU A 1 251 ? 42.880  78.958  30.653 1.00 46.74  ? 326 LEU A C     1 
ATOM   1959 O  O     . LEU A 1 251 ? 43.080  80.176  30.578 1.00 49.13  ? 326 LEU A O     1 
ATOM   1960 C  CB    . LEU A 1 251 ? 44.566  77.296  29.827 1.00 39.05  ? 326 LEU A CB    1 
ATOM   1961 C  CG    . LEU A 1 251 ? 46.077  77.070  29.722 1.00 40.16  ? 326 LEU A CG    1 
ATOM   1962 C  CD1   . LEU A 1 251 ? 46.746  77.016  31.083 1.00 32.67  ? 326 LEU A CD1   1 
ATOM   1963 C  CD2   . LEU A 1 251 ? 46.335  75.795  28.946 1.00 24.89  ? 326 LEU A CD2   1 
ATOM   1964 N  N     . ARG A 1 252 ? 41.689  78.418  30.394 1.00 40.90  ? 327 ARG A N     1 
ATOM   1965 C  CA    . ARG A 1 252 ? 40.576  79.276  30.014 1.00 37.80  ? 327 ARG A CA    1 
ATOM   1966 C  C     . ARG A 1 252 ? 40.178  80.192  31.161 1.00 45.63  ? 327 ARG A C     1 
ATOM   1967 O  O     . ARG A 1 252 ? 39.848  81.364  30.942 1.00 48.34  ? 327 ARG A O     1 
ATOM   1968 C  CB    . ARG A 1 252 ? 39.387  78.435  29.562 1.00 35.32  ? 327 ARG A CB    1 
ATOM   1969 C  CG    . ARG A 1 252 ? 38.246  79.278  29.053 1.00 31.86  ? 327 ARG A CG    1 
ATOM   1970 C  CD    . ARG A 1 252 ? 37.035  78.445  28.711 1.00 57.05  ? 327 ARG A CD    1 
ATOM   1971 N  NE    . ARG A 1 252 ? 35.940  79.285  28.234 1.00 95.27  ? 327 ARG A NE    1 
ATOM   1972 C  CZ    . ARG A 1 252 ? 34.708  78.848  28.000 1.00 110.42 ? 327 ARG A CZ    1 
ATOM   1973 N  NH1   . ARG A 1 252 ? 34.402  77.573  28.202 1.00 110.93 ? 327 ARG A NH1   1 
ATOM   1974 N  NH2   . ARG A 1 252 ? 33.778  79.689  27.567 1.00 122.72 ? 327 ARG A NH2   1 
ATOM   1975 N  N     . SER A 1 253 ? 40.207  79.680  32.394 1.00 38.82  ? 328 SER A N     1 
ATOM   1976 C  CA    . SER A 1 253 ? 39.854  80.519  33.532 1.00 44.76  ? 328 SER A CA    1 
ATOM   1977 C  C     . SER A 1 253 ? 40.836  81.673  33.690 1.00 48.84  ? 328 SER A C     1 
ATOM   1978 O  O     . SER A 1 253 ? 40.469  82.738  34.198 1.00 49.28  ? 328 SER A O     1 
ATOM   1979 C  CB    . SER A 1 253 ? 39.784  79.681  34.812 1.00 43.61  ? 328 SER A CB    1 
ATOM   1980 O  OG    . SER A 1 253 ? 41.069  79.297  35.265 1.00 52.92  ? 328 SER A OG    1 
ATOM   1981 N  N     . ILE A 1 254 ? 42.076  81.491  33.242 1.00 42.08  ? 329 ILE A N     1 
ATOM   1982 C  CA    . ILE A 1 254 ? 43.036  82.586  33.282 1.00 50.43  ? 329 ILE A CA    1 
ATOM   1983 C  C     . ILE A 1 254 ? 42.807  83.543  32.123 1.00 55.78  ? 329 ILE A C     1 
ATOM   1984 O  O     . ILE A 1 254 ? 42.822  84.765  32.305 1.00 54.63  ? 329 ILE A O     1 
ATOM   1985 C  CB    . ILE A 1 254 ? 44.470  82.030  33.301 1.00 47.79  ? 329 ILE A CB    1 
ATOM   1986 C  CG1   . ILE A 1 254 ? 44.922  81.816  34.744 1.00 43.48  ? 329 ILE A CG1   1 
ATOM   1987 C  CG2   . ILE A 1 254 ? 45.423  82.962  32.577 1.00 40.13  ? 329 ILE A CG2   1 
ATOM   1988 C  CD1   . ILE A 1 254 ? 46.118  80.930  34.874 1.00 52.91  ? 329 ILE A CD1   1 
ATOM   1989 N  N     . LEU A 1 255 ? 42.576  83.013  30.920 1.00 53.36  ? 330 LEU A N     1 
ATOM   1990 C  CA    . LEU A 1 255 ? 42.331  83.876  29.770 1.00 45.10  ? 330 LEU A CA    1 
ATOM   1991 C  C     . LEU A 1 255 ? 41.079  84.720  29.975 1.00 52.51  ? 330 LEU A C     1 
ATOM   1992 O  O     . LEU A 1 255 ? 41.121  85.952  29.881 1.00 50.43  ? 330 LEU A O     1 
ATOM   1993 C  CB    . LEU A 1 255 ? 42.211  83.038  28.502 1.00 33.11  ? 330 LEU A CB    1 
ATOM   1994 C  CG    . LEU A 1 255 ? 43.523  82.651  27.831 1.00 51.44  ? 330 LEU A CG    1 
ATOM   1995 C  CD1   . LEU A 1 255 ? 43.226  82.128  26.441 1.00 69.71  ? 330 LEU A CD1   1 
ATOM   1996 C  CD2   . LEU A 1 255 ? 44.478  83.834  27.772 1.00 45.76  ? 330 LEU A CD2   1 
ATOM   1997 N  N     . ASP A 1 256 ? 39.953  84.067  30.274 1.00 58.23  ? 331 ASP A N     1 
ATOM   1998 C  CA    . ASP A 1 256 ? 38.684  84.770  30.435 1.00 52.52  ? 331 ASP A CA    1 
ATOM   1999 C  C     . ASP A 1 256 ? 38.715  85.791  31.566 1.00 55.06  ? 331 ASP A C     1 
ATOM   2000 O  O     . ASP A 1 256 ? 37.757  86.558  31.715 1.00 56.16  ? 331 ASP A O     1 
ATOM   2001 C  CB    . ASP A 1 256 ? 37.561  83.752  30.659 1.00 30.03  ? 331 ASP A CB    1 
ATOM   2002 C  CG    . ASP A 1 256 ? 37.265  82.927  29.414 1.00 49.39  ? 331 ASP A CG    1 
ATOM   2003 O  OD1   . ASP A 1 256 ? 38.042  83.010  28.437 1.00 54.24  ? 331 ASP A OD1   1 
ATOM   2004 O  OD2   . ASP A 1 256 ? 36.256  82.191  29.410 1.00 51.41  ? 331 ASP A OD2   1 
ATOM   2005 N  N     . ASN A 1 257 ? 39.792  85.826  32.353 1.00 40.13  ? 332 ASN A N     1 
ATOM   2006 C  CA    . ASN A 1 257 ? 39.994  86.816  33.401 1.00 49.11  ? 332 ASN A CA    1 
ATOM   2007 C  C     . ASN A 1 257 ? 41.371  87.462  33.283 1.00 56.22  ? 332 ASN A C     1 
ATOM   2008 O  O     . ASN A 1 257 ? 41.913  87.948  34.274 1.00 57.63  ? 332 ASN A O     1 
ATOM   2009 C  CB    . ASN A 1 257 ? 39.820  86.188  34.788 1.00 47.41  ? 332 ASN A CB    1 
ATOM   2010 C  CG    . ASN A 1 257 ? 38.376  85.836  35.108 1.00 48.58  ? 332 ASN A CG    1 
ATOM   2011 O  OD1   . ASN A 1 257 ? 37.942  84.706  34.899 1.00 48.12  ? 332 ASN A OD1   1 
ATOM   2012 N  ND2   . ASN A 1 257 ? 37.634  86.800  35.641 1.00 57.25  ? 332 ASN A ND2   1 
ATOM   2013 N  N     . TRP A 1 258 ? 41.939  87.482  32.073 1.00 56.85  ? 333 TRP A N     1 
ATOM   2014 C  CA    . TRP A 1 258 ? 43.328  87.910  31.894 1.00 54.53  ? 333 TRP A CA    1 
ATOM   2015 C  C     . TRP A 1 258 ? 43.520  89.379  32.267 1.00 61.01  ? 333 TRP A C     1 
ATOM   2016 O  O     . TRP A 1 258 ? 44.470  89.735  32.976 1.00 62.29  ? 333 TRP A O     1 
ATOM   2017 C  CB    . TRP A 1 258 ? 43.774  87.662  30.448 1.00 54.89  ? 333 TRP A CB    1 
ATOM   2018 C  CG    . TRP A 1 258 ? 45.213  88.015  30.173 1.00 53.84  ? 333 TRP A CG    1 
ATOM   2019 C  CD1   . TRP A 1 258 ? 45.697  89.229  29.778 1.00 52.80  ? 333 TRP A CD1   1 
ATOM   2020 C  CD2   . TRP A 1 258 ? 46.352  87.144  30.271 1.00 60.77  ? 333 TRP A CD2   1 
ATOM   2021 N  NE1   . TRP A 1 258 ? 47.061  89.171  29.629 1.00 48.88  ? 333 TRP A NE1   1 
ATOM   2022 C  CE2   . TRP A 1 258 ? 47.488  87.903  29.925 1.00 60.16  ? 333 TRP A CE2   1 
ATOM   2023 C  CE3   . TRP A 1 258 ? 46.521  85.798  30.618 1.00 61.23  ? 333 TRP A CE3   1 
ATOM   2024 C  CZ2   . TRP A 1 258 ? 48.776  87.362  29.918 1.00 54.69  ? 333 TRP A CZ2   1 
ATOM   2025 C  CZ3   . TRP A 1 258 ? 47.802  85.264  30.608 1.00 52.88  ? 333 TRP A CZ3   1 
ATOM   2026 C  CH2   . TRP A 1 258 ? 48.910  86.045  30.262 1.00 51.70  ? 333 TRP A CH2   1 
ATOM   2027 N  N     . GLU A 1 259 ? 42.627  90.249  31.789 1.00 73.85  ? 334 GLU A N     1 
ATOM   2028 C  CA    . GLU A 1 259 ? 42.757  91.676  32.072 1.00 69.76  ? 334 GLU A CA    1 
ATOM   2029 C  C     . GLU A 1 259 ? 42.733  91.949  33.572 1.00 65.94  ? 334 GLU A C     1 
ATOM   2030 O  O     . GLU A 1 259 ? 43.608  92.641  34.101 1.00 62.50  ? 334 GLU A O     1 
ATOM   2031 C  CB    . GLU A 1 259 ? 41.646  92.454  31.366 1.00 104.54 ? 334 GLU A CB    1 
ATOM   2032 C  CG    . GLU A 1 259 ? 41.572  93.926  31.756 1.00 108.11 ? 334 GLU A CG    1 
ATOM   2033 C  CD    . GLU A 1 259 ? 42.278  94.837  30.769 1.00 124.41 ? 334 GLU A CD    1 
ATOM   2034 O  OE1   . GLU A 1 259 ? 43.033  94.322  29.917 1.00 113.82 ? 334 GLU A OE1   1 
ATOM   2035 O  OE2   . GLU A 1 259 ? 42.072  96.070  30.844 1.00 135.44 ? 334 GLU A OE2   1 
ATOM   2036 N  N     . SER A 1 260 ? 41.736  91.408  34.278 1.00 79.57  ? 335 SER A N     1 
ATOM   2037 C  CA    . SER A 1 260 ? 41.616  91.676  35.708 1.00 55.44  ? 335 SER A CA    1 
ATOM   2038 C  C     . SER A 1 260 ? 42.680  90.960  36.527 1.00 56.05  ? 335 SER A C     1 
ATOM   2039 O  O     . SER A 1 260 ? 42.878  91.309  37.695 1.00 56.13  ? 335 SER A O     1 
ATOM   2040 C  CB    . SER A 1 260 ? 40.227  91.280  36.213 1.00 37.94  ? 335 SER A CB    1 
ATOM   2041 O  OG    . SER A 1 260 ? 39.351  90.996  35.137 1.00 62.43  ? 335 SER A OG    1 
ATOM   2042 N  N     . VAL A 1 261 ? 43.365  89.974  35.948 1.00 55.13  ? 336 VAL A N     1 
ATOM   2043 C  CA    . VAL A 1 261 ? 44.412  89.273  36.683 1.00 49.47  ? 336 VAL A CA    1 
ATOM   2044 C  C     . VAL A 1 261 ? 45.707  90.075  36.677 1.00 61.07  ? 336 VAL A C     1 
ATOM   2045 O  O     . VAL A 1 261 ? 46.366  90.211  37.716 1.00 53.72  ? 336 VAL A O     1 
ATOM   2046 C  CB    . VAL A 1 261 ? 44.612  87.855  36.115 1.00 44.52  ? 336 VAL A CB    1 
ATOM   2047 C  CG1   . VAL A 1 261 ? 46.027  87.360  36.374 1.00 47.33  ? 336 VAL A CG1   1 
ATOM   2048 C  CG2   . VAL A 1 261 ? 43.606  86.895  36.736 1.00 48.05  ? 336 VAL A CG2   1 
ATOM   2049 N  N     . ILE A 1 262 ? 46.094  90.624  35.521 1.00 59.55  ? 337 ILE A N     1 
ATOM   2050 C  CA    . ILE A 1 262 ? 47.313  91.429  35.483 1.00 62.47  ? 337 ILE A CA    1 
ATOM   2051 C  C     . ILE A 1 262 ? 47.150  92.668  36.350 1.00 61.11  ? 337 ILE A C     1 
ATOM   2052 O  O     . ILE A 1 262 ? 48.115  93.139  36.965 1.00 59.60  ? 337 ILE A O     1 
ATOM   2053 C  CB    . ILE A 1 262 ? 47.708  91.790  34.031 1.00 57.79  ? 337 ILE A CB    1 
ATOM   2054 C  CG1   . ILE A 1 262 ? 46.566  92.460  33.274 1.00 82.99  ? 337 ILE A CG1   1 
ATOM   2055 C  CG2   . ILE A 1 262 ? 48.143  90.564  33.263 1.00 63.17  ? 337 ILE A CG2   1 
ATOM   2056 C  CD1   . ILE A 1 262 ? 46.841  92.583  31.784 1.00 82.89  ? 337 ILE A CD1   1 
ATOM   2057 N  N     . GLN A 1 263 ? 45.929  93.195  36.445 1.00 66.59  ? 338 GLN A N     1 
ATOM   2058 C  CA    . GLN A 1 263 ? 45.693  94.372  37.271 1.00 62.05  ? 338 GLN A CA    1 
ATOM   2059 C  C     . GLN A 1 263 ? 45.812  94.037  38.752 1.00 58.36  ? 338 GLN A C     1 
ATOM   2060 O  O     . GLN A 1 263 ? 46.490  94.746  39.504 1.00 68.70  ? 338 GLN A O     1 
ATOM   2061 C  CB    . GLN A 1 263 ? 44.323  94.962  36.952 1.00 64.89  ? 338 GLN A CB    1 
ATOM   2062 C  CG    . GLN A 1 263 ? 43.973  96.180  37.776 1.00 96.19  ? 338 GLN A CG    1 
ATOM   2063 C  CD    . GLN A 1 263 ? 42.699  96.836  37.301 1.00 123.96 ? 338 GLN A CD    1 
ATOM   2064 O  OE1   . GLN A 1 263 ? 42.203  96.533  36.214 1.00 126.43 ? 338 GLN A OE1   1 
ATOM   2065 N  NE2   . GLN A 1 263 ? 42.155  97.738  38.112 1.00 128.50 ? 338 GLN A NE2   1 
ATOM   2066 N  N     . ILE A 1 264 ? 45.161  92.955  39.191 1.00 59.71  ? 339 ILE A N     1 
ATOM   2067 C  CA    . ILE A 1 264 ? 45.258  92.542  40.590 1.00 55.69  ? 339 ILE A CA    1 
ATOM   2068 C  C     . ILE A 1 264 ? 46.703  92.229  40.953 1.00 48.28  ? 339 ILE A C     1 
ATOM   2069 O  O     . ILE A 1 264 ? 47.174  92.578  42.042 1.00 51.81  ? 339 ILE A O     1 
ATOM   2070 C  CB    . ILE A 1 264 ? 44.337  91.338  40.861 1.00 52.96  ? 339 ILE A CB    1 
ATOM   2071 C  CG1   . ILE A 1 264 ? 42.871  91.744  40.759 1.00 40.11  ? 339 ILE A CG1   1 
ATOM   2072 C  CG2   . ILE A 1 264 ? 44.606  90.756  42.235 1.00 46.91  ? 339 ILE A CG2   1 
ATOM   2073 C  CD1   . ILE A 1 264 ? 41.929  90.580  40.891 1.00 60.91  ? 339 ILE A CD1   1 
ATOM   2074 N  N     . LEU A 1 265 ? 47.430  91.580  40.041 1.00 59.53  ? 340 LEU A N     1 
ATOM   2075 C  CA    . LEU A 1 265 ? 48.829  91.247  40.291 1.00 52.09  ? 340 LEU A CA    1 
ATOM   2076 C  C     . LEU A 1 265 ? 49.691  92.500  40.370 1.00 56.81  ? 340 LEU A C     1 
ATOM   2077 O  O     . LEU A 1 265 ? 50.530  92.631  41.271 1.00 59.11  ? 340 LEU A O     1 
ATOM   2078 C  CB    . LEU A 1 265 ? 49.344  90.309  39.200 1.00 59.31  ? 340 LEU A CB    1 
ATOM   2079 C  CG    . LEU A 1 265 ? 48.936  88.845  39.340 1.00 55.23  ? 340 LEU A CG    1 
ATOM   2080 C  CD1   . LEU A 1 265 ? 49.295  88.060  38.089 1.00 45.28  ? 340 LEU A CD1   1 
ATOM   2081 C  CD2   . LEU A 1 265 ? 49.613  88.254  40.564 1.00 53.06  ? 340 LEU A CD2   1 
ATOM   2082 N  N     . SER A 1 266 ? 49.509  93.427  39.424 1.00 58.35  ? 341 SER A N     1 
ATOM   2083 C  CA    . SER A 1 266 ? 50.227  94.698  39.484 1.00 62.28  ? 341 SER A CA    1 
ATOM   2084 C  C     . SER A 1 266 ? 49.941  95.422  40.791 1.00 61.78  ? 341 SER A C     1 
ATOM   2085 O  O     . SER A 1 266 ? 50.844  96.007  41.402 1.00 52.16  ? 341 SER A O     1 
ATOM   2086 C  CB    . SER A 1 266 ? 49.841  95.573  38.291 1.00 57.29  ? 341 SER A CB    1 
ATOM   2087 O  OG    . SER A 1 266 ? 50.440  96.854  38.383 1.00 75.97  ? 341 SER A OG    1 
ATOM   2088 N  N     . GLU A 1 267 ? 48.687  95.373  41.242 1.00 64.94  ? 342 GLU A N     1 
ATOM   2089 C  CA    . GLU A 1 267 ? 48.293  96.028  42.483 1.00 72.25  ? 342 GLU A CA    1 
ATOM   2090 C  C     . GLU A 1 267 ? 49.097  95.501  43.663 1.00 67.47  ? 342 GLU A C     1 
ATOM   2091 O  O     . GLU A 1 267 ? 49.600  96.279  44.482 1.00 74.95  ? 342 GLU A O     1 
ATOM   2092 C  CB    . GLU A 1 267 ? 46.796  95.822  42.706 1.00 74.10  ? 342 GLU A CB    1 
ATOM   2093 C  CG    . GLU A 1 267 ? 46.175  96.638  43.812 1.00 64.49  ? 342 GLU A CG    1 
ATOM   2094 C  CD    . GLU A 1 267 ? 44.663  96.515  43.803 1.00 89.82  ? 342 GLU A CD    1 
ATOM   2095 O  OE1   . GLU A 1 267 ? 44.031  97.007  42.843 1.00 87.94  ? 342 GLU A OE1   1 
ATOM   2096 O  OE2   . GLU A 1 267 ? 44.109  95.909  44.745 1.00 103.69 ? 342 GLU A OE2   1 
ATOM   2097 N  N     . ALA A 1 268 ? 49.243  94.182  43.760 1.00 68.52  ? 343 ALA A N     1 
ATOM   2098 C  CA    . ALA A 1 268 ? 49.950  93.562  44.872 1.00 60.90  ? 343 ALA A CA    1 
ATOM   2099 C  C     . ALA A 1 268 ? 51.456  93.591  44.708 1.00 64.38  ? 343 ALA A C     1 
ATOM   2100 O  O     . ALA A 1 268 ? 52.150  92.891  45.458 1.00 65.04  ? 343 ALA A O     1 
ATOM   2101 C  CB    . ALA A 1 268 ? 49.513  92.107  45.045 1.00 62.48  ? 343 ALA A CB    1 
ATOM   2102 N  N     . GLY A 1 269 ? 51.973  94.361  43.748 1.00 65.99  ? 344 GLY A N     1 
ATOM   2103 C  CA    . GLY A 1 269 ? 53.389  94.329  43.426 1.00 58.31  ? 344 GLY A CA    1 
ATOM   2104 C  C     . GLY A 1 269 ? 53.930  92.971  43.032 1.00 69.08  ? 344 GLY A C     1 
ATOM   2105 O  O     . GLY A 1 269 ? 55.153  92.780  43.026 1.00 65.79  ? 344 GLY A O     1 
ATOM   2106 N  N     . GLU A 1 270 ? 53.064  92.009  42.718 1.00 74.79  ? 345 GLU A N     1 
ATOM   2107 C  CA    . GLU A 1 270 ? 53.507  90.677  42.309 1.00 67.78  ? 345 GLU A CA    1 
ATOM   2108 C  C     . GLU A 1 270 ? 53.444  90.507  40.803 1.00 62.57  ? 345 GLU A C     1 
ATOM   2109 O  O     . GLU A 1 270 ? 53.074  89.443  40.313 1.00 61.04  ? 345 GLU A O     1 
ATOM   2110 C  CB    . GLU A 1 270 ? 52.682  89.594  42.996 1.00 53.36  ? 345 GLU A CB    1 
ATOM   2111 C  CG    . GLU A 1 270 ? 52.916  89.498  44.488 1.00 52.94  ? 345 GLU A CG    1 
ATOM   2112 C  CD    . GLU A 1 270 ? 54.270  88.915  44.829 1.00 68.42  ? 345 GLU A CD    1 
ATOM   2113 O  OE1   . GLU A 1 270 ? 54.865  88.229  43.967 1.00 74.64  ? 345 GLU A OE1   1 
ATOM   2114 O  OE2   . GLU A 1 270 ? 54.737  89.143  45.964 1.00 61.38  ? 345 GLU A OE2   1 
ATOM   2115 N  N     . THR A 1 271 ? 53.809  91.538  40.045 1.00 71.31  ? 346 THR A N     1 
ATOM   2116 C  CA    . THR A 1 271 ? 53.623  91.528  38.600 1.00 66.47  ? 346 THR A CA    1 
ATOM   2117 C  C     . THR A 1 271 ? 54.590  90.607  37.866 1.00 67.44  ? 346 THR A C     1 
ATOM   2118 O  O     . THR A 1 271 ? 54.369  90.325  36.682 1.00 68.25  ? 346 THR A O     1 
ATOM   2119 C  CB    . THR A 1 271 ? 53.775  92.940  38.069 1.00 50.44  ? 346 THR A CB    1 
ATOM   2120 O  OG1   . THR A 1 271 ? 53.733  92.910  36.640 1.00 54.77  ? 346 THR A OG1   1 
ATOM   2121 C  CG2   . THR A 1 271 ? 55.102  93.515  38.538 1.00 45.33  ? 346 THR A CG2   1 
ATOM   2122 N  N     . GLN A 1 272 ? 55.652  90.142  38.522 1.00 61.00  ? 347 GLN A N     1 
ATOM   2123 C  CA    . GLN A 1 272 ? 56.619  89.273  37.866 1.00 73.74  ? 347 GLN A CA    1 
ATOM   2124 C  C     . GLN A 1 272 ? 56.103  87.849  37.686 1.00 69.37  ? 347 GLN A C     1 
ATOM   2125 O  O     . GLN A 1 272 ? 56.719  87.067  36.951 1.00 71.05  ? 347 GLN A O     1 
ATOM   2126 C  CB    . GLN A 1 272 ? 57.940  89.311  38.653 1.00 80.93  ? 347 GLN A CB    1 
ATOM   2127 C  CG    . GLN A 1 272 ? 58.504  87.979  39.117 1.00 104.25 ? 347 GLN A CG    1 
ATOM   2128 C  CD    . GLN A 1 272 ? 58.108  87.633  40.537 1.00 125.82 ? 347 GLN A CD    1 
ATOM   2129 O  OE1   . GLN A 1 272 ? 57.157  88.192  41.085 1.00 125.95 ? 347 GLN A OE1   1 
ATOM   2130 N  NE2   . GLN A 1 272 ? 58.844  86.710  41.147 1.00 152.39 ? 347 GLN A NE2   1 
ATOM   2131 N  N     . ARG A 1 273 ? 54.961  87.510  38.283 1.00 54.99  ? 348 ARG A N     1 
ATOM   2132 C  CA    . ARG A 1 273 ? 54.394  86.174  38.153 1.00 48.20  ? 348 ARG A CA    1 
ATOM   2133 C  C     . ARG A 1 273 ? 53.652  85.947  36.841 1.00 59.64  ? 348 ARG A C     1 
ATOM   2134 O  O     . ARG A 1 273 ? 53.062  84.872  36.674 1.00 52.91  ? 348 ARG A O     1 
ATOM   2135 C  CB    . ARG A 1 273 ? 53.429  85.890  39.307 1.00 45.51  ? 348 ARG A CB    1 
ATOM   2136 C  CG    . ARG A 1 273 ? 54.040  85.915  40.692 1.00 48.98  ? 348 ARG A CG    1 
ATOM   2137 C  CD    . ARG A 1 273 ? 52.973  85.658  41.747 1.00 48.55  ? 348 ARG A CD    1 
ATOM   2138 N  NE    . ARG A 1 273 ? 53.523  85.652  43.099 1.00 62.09  ? 348 ARG A NE    1 
ATOM   2139 C  CZ    . ARG A 1 273 ? 53.634  84.569  43.862 1.00 46.33  ? 348 ARG A CZ    1 
ATOM   2140 N  NH1   . ARG A 1 273 ? 53.222  83.390  43.415 1.00 44.51  ? 348 ARG A NH1   1 
ATOM   2141 N  NH2   . ARG A 1 273 ? 54.151  84.667  45.077 1.00 59.21  ? 348 ARG A NH2   1 
ATOM   2142 N  N     . ILE A 1 274 ? 53.651  86.909  35.913 1.00 63.38  ? 349 ILE A N     1 
ATOM   2143 C  CA    . ILE A 1 274 ? 52.821  86.787  34.717 1.00 61.93  ? 349 ILE A CA    1 
ATOM   2144 C  C     . ILE A 1 274 ? 53.488  87.433  33.508 1.00 66.64  ? 349 ILE A C     1 
ATOM   2145 O  O     . ILE A 1 274 ? 53.097  87.177  32.363 1.00 68.81  ? 349 ILE A O     1 
ATOM   2146 C  CB    . ILE A 1 274 ? 51.425  87.394  34.961 1.00 48.44  ? 349 ILE A CB    1 
ATOM   2147 C  CG1   . ILE A 1 274 ? 50.463  87.027  33.827 1.00 58.58  ? 349 ILE A CG1   1 
ATOM   2148 C  CG2   . ILE A 1 274 ? 51.514  88.904  35.107 1.00 59.80  ? 349 ILE A CG2   1 
ATOM   2149 C  CD1   . ILE A 1 274 ? 49.015  87.326  34.136 1.00 50.84  ? 349 ILE A CD1   1 
ATOM   2150 N  N     . VAL A 1 275 ? 54.506  88.265  33.741 1.00 64.18  ? 350 VAL A N     1 
ATOM   2151 C  CA    . VAL A 1 275 ? 55.108  88.997  32.628 1.00 71.74  ? 350 VAL A CA    1 
ATOM   2152 C  C     . VAL A 1 275 ? 55.914  88.072  31.725 1.00 58.94  ? 350 VAL A C     1 
ATOM   2153 O  O     . VAL A 1 275 ? 56.075  88.348  30.530 1.00 63.69  ? 350 VAL A O     1 
ATOM   2154 C  CB    . VAL A 1 275 ? 55.971  90.159  33.150 1.00 74.62  ? 350 VAL A CB    1 
ATOM   2155 C  CG1   . VAL A 1 275 ? 55.082  91.257  33.711 1.00 88.89  ? 350 VAL A CG1   1 
ATOM   2156 C  CG2   . VAL A 1 275 ? 56.952  89.660  34.196 1.00 69.32  ? 350 VAL A CG2   1 
ATOM   2157 N  N     . HIS A 1 276 ? 56.429  86.971  32.261 1.00 55.26  ? 351 HIS A N     1 
ATOM   2158 C  CA    . HIS A 1 276 ? 57.193  86.036  31.447 1.00 40.29  ? 351 HIS A CA    1 
ATOM   2159 C  C     . HIS A 1 276 ? 56.310  85.022  30.732 1.00 53.58  ? 351 HIS A C     1 
ATOM   2160 O  O     . HIS A 1 276 ? 56.835  84.175  30.001 1.00 73.87  ? 351 HIS A O     1 
ATOM   2161 C  CB    . HIS A 1 276 ? 58.224  85.313  32.316 1.00 67.73  ? 351 HIS A CB    1 
ATOM   2162 C  CG    . HIS A 1 276 ? 58.949  86.215  33.267 1.00 84.37  ? 351 HIS A CG    1 
ATOM   2163 N  ND1   . HIS A 1 276 ? 60.028  86.985  32.890 1.00 76.59  ? 351 HIS A ND1   1 
ATOM   2164 C  CD2   . HIS A 1 276 ? 58.744  86.474  34.581 1.00 88.61  ? 351 HIS A CD2   1 
ATOM   2165 C  CE1   . HIS A 1 276 ? 60.458  87.678  33.930 1.00 88.35  ? 351 HIS A CE1   1 
ATOM   2166 N  NE2   . HIS A 1 276 ? 59.696  87.386  34.968 1.00 95.54  ? 351 HIS A NE2   1 
ATOM   2167 N  N     . ILE A 1 277 ? 54.995  85.095  30.916 1.00 53.10  ? 352 ILE A N     1 
ATOM   2168 C  CA    . ILE A 1 277 ? 54.057  84.142  30.329 1.00 51.91  ? 352 ILE A CA    1 
ATOM   2169 C  C     . ILE A 1 277 ? 53.674  84.623  28.936 1.00 57.12  ? 352 ILE A C     1 
ATOM   2170 O  O     . ILE A 1 277 ? 53.112  85.713  28.780 1.00 56.74  ? 352 ILE A O     1 
ATOM   2171 C  CB    . ILE A 1 277 ? 52.809  83.982  31.208 1.00 53.29  ? 352 ILE A CB    1 
ATOM   2172 C  CG1   . ILE A 1 277 ? 53.189  83.457  32.589 1.00 53.86  ? 352 ILE A CG1   1 
ATOM   2173 C  CG2   . ILE A 1 277 ? 51.796  83.066  30.539 1.00 45.91  ? 352 ILE A CG2   1 
ATOM   2174 C  CD1   . ILE A 1 277 ? 52.018  83.346  33.529 1.00 69.27  ? 352 ILE A CD1   1 
ATOM   2175 N  N     . ASN A 1 278 ? 53.956  83.804  27.926 1.00 49.99  ? 353 ASN A N     1 
ATOM   2176 C  CA    . ASN A 1 278 ? 53.594  84.133  26.549 1.00 42.57  ? 353 ASN A CA    1 
ATOM   2177 C  C     . ASN A 1 278 ? 52.094  83.918  26.378 1.00 51.24  ? 353 ASN A C     1 
ATOM   2178 O  O     . ASN A 1 278 ? 51.629  82.784  26.243 1.00 71.80  ? 353 ASN A O     1 
ATOM   2179 C  CB    . ASN A 1 278 ? 54.393  83.286  25.567 1.00 34.31  ? 353 ASN A CB    1 
ATOM   2180 C  CG    . ASN A 1 278 ? 54.269  83.780  24.139 1.00 61.72  ? 353 ASN A CG    1 
ATOM   2181 O  OD1   . ASN A 1 278 ? 53.932  84.940  23.898 1.00 65.82  ? 353 ASN A OD1   1 
ATOM   2182 N  ND2   . ASN A 1 278 ? 54.548  82.904  23.183 1.00 68.60  ? 353 ASN A ND2   1 
ATOM   2183 N  N     . LYS A 1 279 ? 51.331  85.016  26.374 1.00 50.71  ? 354 LYS A N     1 
ATOM   2184 C  CA    . LYS A 1 279 ? 49.875  84.918  26.287 1.00 40.52  ? 354 LYS A CA    1 
ATOM   2185 C  C     . LYS A 1 279 ? 49.435  84.223  25.006 1.00 38.43  ? 354 LYS A C     1 
ATOM   2186 O  O     . LYS A 1 279 ? 48.459  83.466  25.008 1.00 54.95  ? 354 LYS A O     1 
ATOM   2187 C  CB    . LYS A 1 279 ? 49.253  86.312  26.381 1.00 35.93  ? 354 LYS A CB    1 
ATOM   2188 C  CG    . LYS A 1 279 ? 47.760  86.370  26.105 1.00 39.62  ? 354 LYS A CG    1 
ATOM   2189 C  CD    . LYS A 1 279 ? 47.213  87.772  26.350 1.00 47.52  ? 354 LYS A CD    1 
ATOM   2190 C  CE    . LYS A 1 279 ? 45.688  87.796  26.319 1.00 62.48  ? 354 LYS A CE    1 
ATOM   2191 N  NZ    . LYS A 1 279 ? 45.142  89.142  26.656 1.00 52.52  ? 354 LYS A NZ    1 
ATOM   2192 N  N     . SER A 1 280 ? 50.150  84.461  23.903 1.00 60.23  ? 355 SER A N     1 
ATOM   2193 C  CA    . SER A 1 280 ? 49.737  83.918  22.612 1.00 50.20  ? 355 SER A CA    1 
ATOM   2194 C  C     . SER A 1 280 ? 49.707  82.394  22.630 1.00 54.19  ? 355 SER A C     1 
ATOM   2195 O  O     . SER A 1 280 ? 48.798  81.777  22.064 1.00 51.43  ? 355 SER A O     1 
ATOM   2196 C  CB    . SER A 1 280 ? 50.672  84.421  21.515 1.00 52.07  ? 355 SER A CB    1 
ATOM   2197 O  OG    . SER A 1 280 ? 51.992  83.947  21.724 1.00 67.05  ? 355 SER A OG    1 
ATOM   2198 N  N     . ILE A 1 281 ? 50.692  81.767  23.276 1.00 52.81  ? 356 ILE A N     1 
ATOM   2199 C  CA    . ILE A 1 281 ? 50.712  80.310  23.327 1.00 57.81  ? 356 ILE A CA    1 
ATOM   2200 C  C     . ILE A 1 281 ? 49.637  79.791  24.273 1.00 59.92  ? 356 ILE A C     1 
ATOM   2201 O  O     . ILE A 1 281 ? 49.046  78.732  24.027 1.00 49.92  ? 356 ILE A O     1 
ATOM   2202 C  CB    . ILE A 1 281 ? 52.119  79.811  23.705 1.00 54.43  ? 356 ILE A CB    1 
ATOM   2203 C  CG1   . ILE A 1 281 ? 53.102  80.151  22.582 1.00 76.52  ? 356 ILE A CG1   1 
ATOM   2204 C  CG2   . ILE A 1 281 ? 52.126  78.315  23.963 1.00 49.07  ? 356 ILE A CG2   1 
ATOM   2205 C  CD1   . ILE A 1 281 ? 52.515  80.017  21.174 1.00 77.84  ? 356 ILE A CD1   1 
ATOM   2206 N  N     . ILE A 1 282 ? 49.350  80.524  25.353 1.00 46.67  ? 357 ILE A N     1 
ATOM   2207 C  CA    . ILE A 1 282 ? 48.217  80.170  26.203 1.00 40.71  ? 357 ILE A CA    1 
ATOM   2208 C  C     . ILE A 1 282 ? 46.924  80.196  25.397 1.00 51.61  ? 357 ILE A C     1 
ATOM   2209 O  O     . ILE A 1 282 ? 46.079  79.300  25.516 1.00 56.97  ? 357 ILE A O     1 
ATOM   2210 C  CB    . ILE A 1 282 ? 48.146  81.112  27.419 1.00 41.14  ? 357 ILE A CB    1 
ATOM   2211 C  CG1   . ILE A 1 282 ? 49.410  80.981  28.273 1.00 42.47  ? 357 ILE A CG1   1 
ATOM   2212 C  CG2   . ILE A 1 282 ? 46.908  80.820  28.246 1.00 49.67  ? 357 ILE A CG2   1 
ATOM   2213 C  CD1   . ILE A 1 282 ? 49.672  79.581  28.774 1.00 47.81  ? 357 ILE A CD1   1 
ATOM   2214 N  N     . GLN A 1 283 ? 46.757  81.212  24.549 1.00 50.40  ? 358 GLN A N     1 
ATOM   2215 C  CA    . GLN A 1 283 ? 45.556  81.298  23.725 1.00 52.61  ? 358 GLN A CA    1 
ATOM   2216 C  C     . GLN A 1 283 ? 45.526  80.199  22.669 1.00 52.91  ? 358 GLN A C     1 
ATOM   2217 O  O     . GLN A 1 283 ? 44.453  79.681  22.334 1.00 56.99  ? 358 GLN A O     1 
ATOM   2218 C  CB    . GLN A 1 283 ? 45.469  82.677  23.071 1.00 51.36  ? 358 GLN A CB    1 
ATOM   2219 C  CG    . GLN A 1 283 ? 44.259  82.869  22.175 1.00 42.90  ? 358 GLN A CG    1 
ATOM   2220 C  CD    . GLN A 1 283 ? 42.962  82.905  22.951 1.00 58.80  ? 358 GLN A CD    1 
ATOM   2221 O  OE1   . GLN A 1 283 ? 42.698  83.849  23.699 1.00 66.43  ? 358 GLN A OE1   1 
ATOM   2222 N  NE2   . GLN A 1 283 ? 42.143  81.875  22.781 1.00 70.16  ? 358 GLN A NE2   1 
ATOM   2223 N  N     . THR A 1 284 ? 46.690  79.826  22.132 1.00 47.95  ? 359 THR A N     1 
ATOM   2224 C  CA    . THR A 1 284 ? 46.716  78.771  21.124 1.00 43.92  ? 359 THR A CA    1 
ATOM   2225 C  C     . THR A 1 284 ? 46.300  77.433  21.723 1.00 52.81  ? 359 THR A C     1 
ATOM   2226 O  O     . THR A 1 284 ? 45.549  76.678  21.098 1.00 51.41  ? 359 THR A O     1 
ATOM   2227 C  CB    . THR A 1 284 ? 48.103  78.666  20.489 1.00 40.85  ? 359 THR A CB    1 
ATOM   2228 O  OG1   . THR A 1 284 ? 48.507  79.949  19.996 1.00 52.30  ? 359 THR A OG1   1 
ATOM   2229 C  CG2   . THR A 1 284 ? 48.076  77.694  19.329 1.00 46.38  ? 359 THR A CG2   1 
ATOM   2230 N  N     . MET A 1 285 ? 46.761  77.132  22.944 1.00 62.87  ? 360 MET A N     1 
ATOM   2231 C  CA    . MET A 1 285 ? 46.394  75.872  23.589 1.00 53.75  ? 360 MET A CA    1 
ATOM   2232 C  C     . MET A 1 285 ? 44.913  75.828  23.943 1.00 53.61  ? 360 MET A C     1 
ATOM   2233 O  O     . MET A 1 285 ? 44.309  74.749  23.947 1.00 45.99  ? 360 MET A O     1 
ATOM   2234 C  CB    . MET A 1 285 ? 47.231  75.647  24.849 1.00 40.44  ? 360 MET A CB    1 
ATOM   2235 C  CG    . MET A 1 285 ? 48.737  75.689  24.629 1.00 56.81  ? 360 MET A CG    1 
ATOM   2236 S  SD    . MET A 1 285 ? 49.689  75.698  26.168 1.00 48.15  ? 360 MET A SD    1 
ATOM   2237 C  CE    . MET A 1 285 ? 49.607  73.972  26.603 1.00 45.17  ? 360 MET A CE    1 
ATOM   2238 N  N     . VAL A 1 286 ? 44.312  76.981  24.244 1.00 47.68  ? 361 VAL A N     1 
ATOM   2239 C  CA    . VAL A 1 286 ? 42.902  76.994  24.611 1.00 49.31  ? 361 VAL A CA    1 
ATOM   2240 C  C     . VAL A 1 286 ? 42.026  76.773  23.384 1.00 53.19  ? 361 VAL A C     1 
ATOM   2241 O  O     . VAL A 1 286 ? 41.028  76.045  23.445 1.00 63.01  ? 361 VAL A O     1 
ATOM   2242 C  CB    . VAL A 1 286 ? 42.556  78.302  25.343 1.00 52.19  ? 361 VAL A CB    1 
ATOM   2243 C  CG1   . VAL A 1 286 ? 41.064  78.410  25.545 1.00 43.41  ? 361 VAL A CG1   1 
ATOM   2244 C  CG2   . VAL A 1 286 ? 43.269  78.346  26.681 1.00 48.32  ? 361 VAL A CG2   1 
ATOM   2245 N  N     . ASN A 1 287 ? 42.384  77.383  22.250 1.00 55.32  ? 362 ASN A N     1 
ATOM   2246 C  CA    . ASN A 1 287 ? 41.644  77.132  21.014 1.00 51.90  ? 362 ASN A CA    1 
ATOM   2247 C  C     . ASN A 1 287 ? 41.750  75.670  20.592 1.00 50.05  ? 362 ASN A C     1 
ATOM   2248 O  O     . ASN A 1 287 ? 40.781  75.091  20.088 1.00 53.10  ? 362 ASN A O     1 
ATOM   2249 C  CB    . ASN A 1 287 ? 42.152  78.040  19.893 1.00 53.99  ? 362 ASN A CB    1 
ATOM   2250 C  CG    . ASN A 1 287 ? 42.005  79.513  20.219 1.00 56.57  ? 362 ASN A CG    1 
ATOM   2251 O  OD1   . ASN A 1 287 ? 41.212  79.896  21.081 1.00 62.36  ? 362 ASN A OD1   1 
ATOM   2252 N  ND2   . ASN A 1 287 ? 42.764  80.350  19.522 1.00 53.49  ? 362 ASN A ND2   1 
ATOM   2253 N  N     . ILE A 1 288 ? 42.923  75.061  20.786 1.00 55.10  ? 363 ILE A N     1 
ATOM   2254 C  CA    . ILE A 1 288 ? 43.111  73.657  20.428 1.00 43.30  ? 363 ILE A CA    1 
ATOM   2255 C  C     . ILE A 1 288 ? 42.263  72.760  21.321 1.00 41.55  ? 363 ILE A C     1 
ATOM   2256 O  O     . ILE A 1 288 ? 41.515  71.904  20.838 1.00 47.85  ? 363 ILE A O     1 
ATOM   2257 C  CB    . ILE A 1 288 ? 44.601  73.270  20.505 1.00 42.72  ? 363 ILE A CB    1 
ATOM   2258 C  CG1   . ILE A 1 288 ? 45.431  74.106  19.535 1.00 43.52  ? 363 ILE A CG1   1 
ATOM   2259 C  CG2   . ILE A 1 288 ? 44.784  71.793  20.214 1.00 38.43  ? 363 ILE A CG2   1 
ATOM   2260 C  CD1   . ILE A 1 288 ? 44.771  74.323  18.182 1.00 77.22  ? 363 ILE A CD1   1 
ATOM   2261 N  N     . LEU A 1 289 ? 42.373  72.938  22.640 1.00 54.89  ? 364 LEU A N     1 
ATOM   2262 C  CA    . LEU A 1 289 ? 41.664  72.088  23.590 1.00 51.37  ? 364 LEU A CA    1 
ATOM   2263 C  C     . LEU A 1 289 ? 40.175  72.395  23.670 1.00 51.33  ? 364 LEU A C     1 
ATOM   2264 O  O     . LEU A 1 289 ? 39.443  71.637  24.312 1.00 55.23  ? 364 LEU A O     1 
ATOM   2265 C  CB    . LEU A 1 289 ? 42.293  72.222  24.979 1.00 42.97  ? 364 LEU A CB    1 
ATOM   2266 C  CG    . LEU A 1 289 ? 43.765  71.823  25.115 1.00 49.59  ? 364 LEU A CG    1 
ATOM   2267 C  CD1   . LEU A 1 289 ? 44.352  72.358  26.414 1.00 42.25  ? 364 LEU A CD1   1 
ATOM   2268 C  CD2   . LEU A 1 289 ? 43.928  70.313  25.034 1.00 41.73  ? 364 LEU A CD2   1 
ATOM   2269 N  N     . ASP A 1 290 ? 39.714  73.478  23.039 1.00 54.14  ? 365 ASP A N     1 
ATOM   2270 C  CA    . ASP A 1 290 ? 38.292  73.810  23.060 1.00 52.19  ? 365 ASP A CA    1 
ATOM   2271 C  C     . ASP A 1 290 ? 37.461  72.739  22.367 1.00 48.59  ? 365 ASP A C     1 
ATOM   2272 O  O     . ASP A 1 290 ? 36.399  72.349  22.862 1.00 56.60  ? 365 ASP A O     1 
ATOM   2273 C  CB    . ASP A 1 290 ? 38.067  75.168  22.399 1.00 63.83  ? 365 ASP A CB    1 
ATOM   2274 C  CG    . ASP A 1 290 ? 36.601  75.509  22.250 1.00 60.57  ? 365 ASP A CG    1 
ATOM   2275 O  OD1   . ASP A 1 290 ? 36.007  76.002  23.230 1.00 58.88  ? 365 ASP A OD1   1 
ATOM   2276 O  OD2   . ASP A 1 290 ? 36.043  75.283  21.155 1.00 85.87  ? 365 ASP A OD2   1 
ATOM   2277 N  N     . GLY A 1 291 ? 37.916  72.262  21.210 1.00 55.85  ? 366 GLY A N     1 
ATOM   2278 C  CA    . GLY A 1 291 ? 37.232  71.175  20.533 1.00 53.90  ? 366 GLY A CA    1 
ATOM   2279 C  C     . GLY A 1 291 ? 37.296  69.858  21.272 1.00 53.04  ? 366 GLY A C     1 
ATOM   2280 O  O     . GLY A 1 291 ? 36.419  69.006  21.082 1.00 63.21  ? 366 GLY A O     1 
ATOM   2281 N  N     . PHE A 1 292 ? 38.321  69.666  22.103 1.00 50.75  ? 367 PHE A N     1 
ATOM   2282 C  CA    . PHE A 1 292 ? 38.379  68.458  22.916 1.00 52.04  ? 367 PHE A CA    1 
ATOM   2283 C  C     . PHE A 1 292 ? 37.246  68.426  23.936 1.00 49.99  ? 367 PHE A C     1 
ATOM   2284 O  O     . PHE A 1 292 ? 36.743  67.347  24.276 1.00 47.89  ? 367 PHE A O     1 
ATOM   2285 C  CB    . PHE A 1 292 ? 39.729  68.353  23.630 1.00 50.23  ? 367 PHE A CB    1 
ATOM   2286 C  CG    . PHE A 1 292 ? 40.870  67.962  22.734 1.00 55.87  ? 367 PHE A CG    1 
ATOM   2287 C  CD1   . PHE A 1 292 ? 41.284  66.642  22.646 1.00 59.23  ? 367 PHE A CD1   1 
ATOM   2288 C  CD2   . PHE A 1 292 ? 41.532  68.915  21.981 1.00 55.19  ? 367 PHE A CD2   1 
ATOM   2289 C  CE1   . PHE A 1 292 ? 42.340  66.284  21.823 1.00 44.28  ? 367 PHE A CE1   1 
ATOM   2290 C  CE2   . PHE A 1 292 ? 42.586  68.564  21.159 1.00 45.41  ? 367 PHE A CE2   1 
ATOM   2291 C  CZ    . PHE A 1 292 ? 42.989  67.248  21.080 1.00 46.96  ? 367 PHE A CZ    1 
ATOM   2292 N  N     . GLU A 1 293 ? 36.821  69.597  24.419 1.00 42.43  ? 368 GLU A N     1 
ATOM   2293 C  CA    . GLU A 1 293 ? 35.715  69.659  25.367 1.00 46.44  ? 368 GLU A CA    1 
ATOM   2294 C  C     . GLU A 1 293 ? 34.378  69.381  24.690 1.00 55.36  ? 368 GLU A C     1 
ATOM   2295 O  O     . GLU A 1 293 ? 33.463  68.853  25.329 1.00 59.49  ? 368 GLU A O     1 
ATOM   2296 C  CB    . GLU A 1 293 ? 35.695  71.022  26.053 1.00 45.12  ? 368 GLU A CB    1 
ATOM   2297 C  CG    . GLU A 1 293 ? 34.764  71.111  27.252 1.00 58.62  ? 368 GLU A CG    1 
ATOM   2298 C  CD    . GLU A 1 293 ? 35.497  70.953  28.568 1.00 71.46  ? 368 GLU A CD    1 
ATOM   2299 O  OE1   . GLU A 1 293 ? 36.670  70.520  28.545 1.00 62.78  ? 368 GLU A OE1   1 
ATOM   2300 O  OE2   . GLU A 1 293 ? 34.903  71.268  29.622 1.00 77.33  ? 368 GLU A OE2   1 
ATOM   2301 N  N     . ARG A 1 294 ? 34.236  69.735  23.409 1.00 50.19  ? 369 ARG A N     1 
ATOM   2302 C  CA    . ARG A 1 294 ? 33.040  69.338  22.673 1.00 48.24  ? 369 ARG A CA    1 
ATOM   2303 C  C     . ARG A 1 294 ? 32.955  67.822  22.567 1.00 50.69  ? 369 ARG A C     1 
ATOM   2304 O  O     . ARG A 1 294 ? 31.876  67.238  22.722 1.00 45.79  ? 369 ARG A O     1 
ATOM   2305 C  CB    . ARG A 1 294 ? 33.034  69.972  21.281 1.00 62.66  ? 369 ARG A CB    1 
ATOM   2306 C  CG    . ARG A 1 294 ? 33.042  71.492  21.279 1.00 62.56  ? 369 ARG A CG    1 
ATOM   2307 C  CD    . ARG A 1 294 ? 32.759  72.041  19.891 1.00 98.62  ? 369 ARG A CD    1 
ATOM   2308 N  NE    . ARG A 1 294 ? 32.611  73.493  19.900 1.00 112.86 ? 369 ARG A NE    1 
ATOM   2309 C  CZ    . ARG A 1 294 ? 32.206  74.208  18.855 1.00 133.36 ? 369 ARG A CZ    1 
ATOM   2310 N  NH1   . ARG A 1 294 ? 31.905  73.606  17.711 1.00 135.34 ? 369 ARG A NH1   1 
ATOM   2311 N  NH2   . ARG A 1 294 ? 32.101  75.526  18.954 1.00 136.56 ? 369 ARG A NH2   1 
ATOM   2312 N  N     . ILE A 1 295 ? 34.093  67.169  22.321 1.00 51.02  ? 370 ILE A N     1 
ATOM   2313 C  CA    . ILE A 1 295 ? 34.121  65.716  22.193 1.00 47.21  ? 370 ILE A CA    1 
ATOM   2314 C  C     . ILE A 1 295 ? 33.875  65.052  23.543 1.00 49.00  ? 370 ILE A C     1 
ATOM   2315 O  O     . ILE A 1 295 ? 33.162  64.045  23.632 1.00 40.30  ? 370 ILE A O     1 
ATOM   2316 C  CB    . ILE A 1 295 ? 35.458  65.272  21.574 1.00 45.99  ? 370 ILE A CB    1 
ATOM   2317 C  CG1   . ILE A 1 295 ? 35.658  65.925  20.204 1.00 51.27  ? 370 ILE A CG1   1 
ATOM   2318 C  CG2   . ILE A 1 295 ? 35.519  63.763  21.461 1.00 46.62  ? 370 ILE A CG2   1 
ATOM   2319 C  CD1   . ILE A 1 295 ? 36.898  65.453  19.478 1.00 33.05  ? 370 ILE A CD1   1 
ATOM   2320 N  N     . PHE A 1 296 ? 34.459  65.601  24.613 1.00 54.42  ? 371 PHE A N     1 
ATOM   2321 C  CA    . PHE A 1 296 ? 34.287  65.023  25.944 1.00 47.80  ? 371 PHE A CA    1 
ATOM   2322 C  C     . PHE A 1 296 ? 32.826  65.051  26.379 1.00 56.23  ? 371 PHE A C     1 
ATOM   2323 O  O     . PHE A 1 296 ? 32.289  64.042  26.850 1.00 65.58  ? 371 PHE A O     1 
ATOM   2324 C  CB    . PHE A 1 296 ? 35.161  65.764  26.957 1.00 39.86  ? 371 PHE A CB    1 
ATOM   2325 C  CG    . PHE A 1 296 ? 36.519  65.154  27.154 1.00 55.55  ? 371 PHE A CG    1 
ATOM   2326 C  CD1   . PHE A 1 296 ? 37.653  65.947  27.158 1.00 58.48  ? 371 PHE A CD1   1 
ATOM   2327 C  CD2   . PHE A 1 296 ? 36.661  63.793  27.351 1.00 55.31  ? 371 PHE A CD2   1 
ATOM   2328 C  CE1   . PHE A 1 296 ? 38.902  65.389  27.341 1.00 49.49  ? 371 PHE A CE1   1 
ATOM   2329 C  CE2   . PHE A 1 296 ? 37.909  63.233  27.534 1.00 41.02  ? 371 PHE A CE2   1 
ATOM   2330 C  CZ    . PHE A 1 296 ? 39.029  64.033  27.529 1.00 42.11  ? 371 PHE A CZ    1 
ATOM   2331 N  N     . LYS A 1 297 ? 32.164  66.204  26.233 1.00 46.18  ? 372 LYS A N     1 
ATOM   2332 C  CA    . LYS A 1 297 ? 30.763  66.300  26.636 1.00 48.66  ? 372 LYS A CA    1 
ATOM   2333 C  C     . LYS A 1 297 ? 29.859  65.469  25.732 1.00 50.15  ? 372 LYS A C     1 
ATOM   2334 O  O     . LYS A 1 297 ? 28.812  64.988  26.180 1.00 53.19  ? 372 LYS A O     1 
ATOM   2335 C  CB    . LYS A 1 297 ? 30.313  67.762  26.646 1.00 42.03  ? 372 LYS A CB    1 
ATOM   2336 C  CG    . LYS A 1 297 ? 30.988  68.633  27.704 1.00 44.90  ? 372 LYS A CG    1 
ATOM   2337 C  CD    . LYS A 1 297 ? 30.526  68.270  29.106 1.00 54.91  ? 372 LYS A CD    1 
ATOM   2338 C  CE    . LYS A 1 297 ? 31.126  69.194  30.153 1.00 55.78  ? 372 LYS A CE    1 
ATOM   2339 N  NZ    . LYS A 1 297 ? 30.590  68.885  31.508 1.00 64.09  ? 372 LYS A NZ    1 
ATOM   2340 N  N     . GLU A 1 298 ? 30.240  65.292  24.465 1.00 47.38  ? 373 GLU A N     1 
ATOM   2341 C  CA    . GLU A 1 298 ? 29.507  64.381  23.591 1.00 45.65  ? 373 GLU A CA    1 
ATOM   2342 C  C     . GLU A 1 298 ? 29.600  62.948  24.097 1.00 46.48  ? 373 GLU A C     1 
ATOM   2343 O  O     . GLU A 1 298 ? 28.579  62.283  24.304 1.00 59.96  ? 373 GLU A O     1 
ATOM   2344 C  CB    . GLU A 1 298 ? 30.041  64.475  22.159 1.00 56.15  ? 373 GLU A CB    1 
ATOM   2345 C  CG    . GLU A 1 298 ? 29.445  65.590  21.312 1.00 56.95  ? 373 GLU A CG    1 
ATOM   2346 C  CD    . GLU A 1 298 ? 30.148  65.740  19.972 1.00 84.15  ? 373 GLU A CD    1 
ATOM   2347 O  OE1   . GLU A 1 298 ? 30.296  66.890  19.502 1.00 95.30  ? 373 GLU A OE1   1 
ATOM   2348 O  OE2   . GLU A 1 298 ? 30.560  64.710  19.393 1.00 70.50  ? 373 GLU A OE2   1 
ATOM   2349 N  N     . LEU A 1 299 ? 30.826  62.460  24.317 1.00 49.94  ? 374 LEU A N     1 
ATOM   2350 C  CA    . LEU A 1 299 ? 31.047  61.067  24.692 1.00 48.69  ? 374 LEU A CA    1 
ATOM   2351 C  C     . LEU A 1 299 ? 30.327  60.672  25.977 1.00 55.87  ? 374 LEU A C     1 
ATOM   2352 O  O     . LEU A 1 299 ? 30.153  59.475  26.229 1.00 51.23  ? 374 LEU A O     1 
ATOM   2353 C  CB    . LEU A 1 299 ? 32.546  60.798  24.844 1.00 52.65  ? 374 LEU A CB    1 
ATOM   2354 C  CG    . LEU A 1 299 ? 33.429  60.852  23.593 1.00 48.03  ? 374 LEU A CG    1 
ATOM   2355 C  CD1   . LEU A 1 299 ? 34.902  60.901  23.982 1.00 39.39  ? 374 LEU A CD1   1 
ATOM   2356 C  CD2   . LEU A 1 299 ? 33.161  59.663  22.687 1.00 33.45  ? 374 LEU A CD2   1 
ATOM   2357 N  N     . GLN A 1 300 ? 29.903  61.639  26.793 1.00 48.74  ? 375 GLN A N     1 
ATOM   2358 C  CA    . GLN A 1 300 ? 29.259  61.360  28.070 1.00 43.67  ? 375 GLN A CA    1 
ATOM   2359 C  C     . GLN A 1 300 ? 27.736  61.358  27.979 1.00 61.95  ? 375 GLN A C     1 
ATOM   2360 O  O     . GLN A 1 300 ? 27.063  61.553  28.996 1.00 65.79  ? 375 GLN A O     1 
ATOM   2361 C  CB    . GLN A 1 300 ? 29.713  62.373  29.119 1.00 49.49  ? 375 GLN A CB    1 
ATOM   2362 C  CG    . GLN A 1 300 ? 31.201  62.361  29.403 1.00 50.62  ? 375 GLN A CG    1 
ATOM   2363 C  CD    . GLN A 1 300 ? 31.632  63.535  30.260 1.00 49.05  ? 375 GLN A CD    1 
ATOM   2364 O  OE1   . GLN A 1 300 ? 31.347  63.584  31.458 1.00 49.13  ? 375 GLN A OE1   1 
ATOM   2365 N  NE2   . GLN A 1 300 ? 32.314  64.495  29.647 1.00 37.96  ? 375 GLN A NE2   1 
ATOM   2366 N  N     . THR A 1 301 ? 27.177  61.142  26.791 1.00 74.23  ? 376 THR A N     1 
ATOM   2367 C  CA    . THR A 1 301 ? 25.734  61.182  26.589 1.00 62.47  ? 376 THR A CA    1 
ATOM   2368 C  C     . THR A 1 301 ? 25.168  59.768  26.613 1.00 56.79  ? 376 THR A C     1 
ATOM   2369 O  O     . THR A 1 301 ? 25.657  58.886  25.897 1.00 50.90  ? 376 THR A O     1 
ATOM   2370 C  CB    . THR A 1 301 ? 25.382  61.864  25.263 1.00 60.27  ? 376 THR A CB    1 
ATOM   2371 O  OG1   . THR A 1 301 ? 25.945  63.180  25.231 1.00 60.58  ? 376 THR A OG1   1 
ATOM   2372 C  CG2   . THR A 1 301 ? 23.871  61.968  25.098 1.00 64.33  ? 376 THR A CG2   1 
ATOM   2373 N  N     . CYS A 1 302 ? 24.142  59.556  27.438 1.00 55.23  ? 377 CYS A N     1 
ATOM   2374 C  CA    . CYS A 1 302 ? 23.410  58.298  27.470 1.00 53.72  ? 377 CYS A CA    1 
ATOM   2375 C  C     . CYS A 1 302 ? 21.921  58.475  27.217 1.00 63.58  ? 377 CYS A C     1 
ATOM   2376 O  O     . CYS A 1 302 ? 21.179  57.486  27.258 1.00 62.73  ? 377 CYS A O     1 
ATOM   2377 C  CB    . CYS A 1 302 ? 23.617  57.586  28.812 1.00 49.25  ? 377 CYS A CB    1 
ATOM   2378 S  SG    . CYS A 1 302 ? 25.343  57.283  29.219 1.00 80.67  ? 377 CYS A SG    1 
ATOM   2379 N  N     . SER A 1 303 ? 21.461  59.703  26.974 1.00 55.11  ? 378 SER A N     1 
ATOM   2380 C  CA    . SER A 1 303 ? 20.087  59.957  26.568 1.00 59.61  ? 378 SER A CA    1 
ATOM   2381 C  C     . SER A 1 303 ? 19.913  59.948  25.057 1.00 70.27  ? 378 SER A C     1 
ATOM   2382 O  O     . SER A 1 303 ? 18.775  60.015  24.578 1.00 75.01  ? 378 SER A O     1 
ATOM   2383 C  CB    . SER A 1 303 ? 19.610  61.302  27.121 1.00 58.84  ? 378 SER A CB    1 
ATOM   2384 O  OG    . SER A 1 303 ? 20.460  62.353  26.697 1.00 69.10  ? 378 SER A OG    1 
ATOM   2385 N  N     . SER A 1 304 ? 21.006  59.874  24.308 1.00 64.94  ? 379 SER A N     1 
ATOM   2386 C  CA    . SER A 1 304 ? 20.990  59.832  22.856 1.00 60.44  ? 379 SER A CA    1 
ATOM   2387 C  C     . SER A 1 304 ? 22.125  58.927  22.406 1.00 60.02  ? 379 SER A C     1 
ATOM   2388 O  O     . SER A 1 304 ? 23.037  58.640  23.192 1.00 66.35  ? 379 SER A O     1 
ATOM   2389 C  CB    . SER A 1 304 ? 21.128  61.243  22.266 1.00 57.65  ? 379 SER A CB    1 
ATOM   2390 O  OG    . SER A 1 304 ? 22.024  61.261  21.168 1.00 69.77  ? 379 SER A OG    1 
ATOM   2391 N  N     . PRO A 1 305 ? 22.082  58.421  21.171 1.00 62.63  ? 380 PRO A N     1 
ATOM   2392 C  CA    . PRO A 1 305 ? 23.182  57.579  20.675 1.00 57.38  ? 380 PRO A CA    1 
ATOM   2393 C  C     . PRO A 1 305 ? 24.528  58.295  20.736 1.00 63.87  ? 380 PRO A C     1 
ATOM   2394 O  O     . PRO A 1 305 ? 24.637  59.481  20.420 1.00 57.84  ? 380 PRO A O     1 
ATOM   2395 C  CB    . PRO A 1 305 ? 22.773  57.278  19.229 1.00 53.55  ? 380 PRO A CB    1 
ATOM   2396 C  CG    . PRO A 1 305 ? 21.277  57.358  19.249 1.00 71.12  ? 380 PRO A CG    1 
ATOM   2397 C  CD    . PRO A 1 305 ? 20.929  58.423  20.252 1.00 67.29  ? 380 PRO A CD    1 
ATOM   2398 N  N     . SER A 1 306 ? 25.566  57.551  21.148 1.00 63.59  ? 381 SER A N     1 
ATOM   2399 C  CA    . SER A 1 306 ? 26.895  58.124  21.361 1.00 55.37  ? 381 SER A CA    1 
ATOM   2400 C  C     . SER A 1 306 ? 28.050  57.274  20.847 1.00 53.49  ? 381 SER A C     1 
ATOM   2401 O  O     . SER A 1 306 ? 29.067  57.847  20.446 1.00 53.59  ? 381 SER A O     1 
ATOM   2402 C  CB    . SER A 1 306 ? 27.119  58.408  22.859 1.00 56.85  ? 381 SER A CB    1 
ATOM   2403 O  OG    . SER A 1 306 ? 27.426  57.221  23.577 1.00 49.34  ? 381 SER A OG    1 
ATOM   2404 N  N     . LEU A 1 307 ? 27.947  55.945  20.839 1.00 52.16  ? 382 LEU A N     1 
ATOM   2405 C  CA    . LEU A 1 307 ? 29.060  55.121  20.377 1.00 49.48  ? 382 LEU A CA    1 
ATOM   2406 C  C     . LEU A 1 307 ? 29.397  55.395  18.921 1.00 56.06  ? 382 LEU A C     1 
ATOM   2407 O  O     . LEU A 1 307 ? 30.559  55.266  18.519 1.00 61.78  ? 382 LEU A O     1 
ATOM   2408 C  CB    . LEU A 1 307 ? 28.730  53.639  20.563 1.00 55.77  ? 382 LEU A CB    1 
ATOM   2409 C  CG    . LEU A 1 307 ? 29.859  52.641  20.292 1.00 53.75  ? 382 LEU A CG    1 
ATOM   2410 C  CD1   . LEU A 1 307 ? 30.925  52.749  21.378 1.00 46.18  ? 382 LEU A CD1   1 
ATOM   2411 C  CD2   . LEU A 1 307 ? 29.311  51.219  20.191 1.00 51.87  ? 382 LEU A CD2   1 
ATOM   2412 N  N     . CYS A 1 308 ? 28.400  55.780  18.121 1.00 50.55  ? 383 CYS A N     1 
ATOM   2413 C  CA    . CYS A 1 308 ? 28.586  56.006  16.694 1.00 60.30  ? 383 CYS A CA    1 
ATOM   2414 C  C     . CYS A 1 308 ? 29.439  57.227  16.380 1.00 54.94  ? 383 CYS A C     1 
ATOM   2415 O  O     . CYS A 1 308 ? 29.803  57.418  15.216 1.00 58.60  ? 383 CYS A O     1 
ATOM   2416 C  CB    . CYS A 1 308 ? 27.223  56.141  16.005 1.00 72.57  ? 383 CYS A CB    1 
ATOM   2417 S  SG    . CYS A 1 308 ? 26.110  57.398  16.694 1.00 68.27  ? 383 CYS A SG    1 
ATOM   2418 N  N     . PHE A 1 309 ? 29.775  58.047  17.373 1.00 57.99  ? 384 PHE A N     1 
ATOM   2419 C  CA    . PHE A 1 309 ? 30.520  59.277  17.138 1.00 59.95  ? 384 PHE A CA    1 
ATOM   2420 C  C     . PHE A 1 309 ? 31.978  59.202  17.575 1.00 52.36  ? 384 PHE A C     1 
ATOM   2421 O  O     . PHE A 1 309 ? 32.677  60.216  17.509 1.00 59.72  ? 384 PHE A O     1 
ATOM   2422 C  CB    . PHE A 1 309 ? 29.832  60.452  17.840 1.00 55.23  ? 384 PHE A CB    1 
ATOM   2423 C  CG    . PHE A 1 309 ? 28.500  60.816  17.246 1.00 57.47  ? 384 PHE A CG    1 
ATOM   2424 C  CD1   . PHE A 1 309 ? 27.434  61.170  18.060 1.00 66.34  ? 384 PHE A CD1   1 
ATOM   2425 C  CD2   . PHE A 1 309 ? 28.313  60.809  15.872 1.00 61.02  ? 384 PHE A CD2   1 
ATOM   2426 C  CE1   . PHE A 1 309 ? 26.205  61.505  17.515 1.00 66.57  ? 384 PHE A CE1   1 
ATOM   2427 C  CE2   . PHE A 1 309 ? 27.088  61.144  15.321 1.00 63.54  ? 384 PHE A CE2   1 
ATOM   2428 C  CZ    . PHE A 1 309 ? 26.032  61.492  16.143 1.00 54.33  ? 384 PHE A CZ    1 
ATOM   2429 N  N     . VAL A 1 310 ? 32.460  58.034  18.007 1.00 57.91  ? 385 VAL A N     1 
ATOM   2430 C  CA    . VAL A 1 310 ? 33.858  57.918  18.415 1.00 43.64  ? 385 VAL A CA    1 
ATOM   2431 C  C     . VAL A 1 310 ? 34.778  58.124  17.219 1.00 52.64  ? 385 VAL A C     1 
ATOM   2432 O  O     . VAL A 1 310 ? 35.745  58.892  17.284 1.00 58.63  ? 385 VAL A O     1 
ATOM   2433 C  CB    . VAL A 1 310 ? 34.112  56.563  19.100 1.00 45.21  ? 385 VAL A CB    1 
ATOM   2434 C  CG1   . VAL A 1 310 ? 35.605  56.308  19.239 1.00 48.53  ? 385 VAL A CG1   1 
ATOM   2435 C  CG2   . VAL A 1 310 ? 33.447  56.523  20.466 1.00 47.92  ? 385 VAL A CG2   1 
ATOM   2436 N  N     . VAL A 1 311 ? 34.483  57.459  16.107 1.00 54.23  ? 386 VAL A N     1 
ATOM   2437 C  CA    . VAL A 1 311 ? 35.318  57.530  14.909 1.00 57.71  ? 386 VAL A CA    1 
ATOM   2438 C  C     . VAL A 1 311 ? 35.327  58.938  14.311 1.00 56.47  ? 386 VAL A C     1 
ATOM   2439 O  O     . VAL A 1 311 ? 36.417  59.462  14.044 1.00 59.53  ? 386 VAL A O     1 
ATOM   2440 C  CB    . VAL A 1 311 ? 34.884  56.485  13.868 1.00 51.74  ? 386 VAL A CB    1 
ATOM   2441 C  CG1   . VAL A 1 311 ? 35.736  56.604  12.616 1.00 59.18  ? 386 VAL A CG1   1 
ATOM   2442 C  CG2   . VAL A 1 311 ? 34.985  55.086  14.456 1.00 47.24  ? 386 VAL A CG2   1 
ATOM   2443 N  N     . PRO A 1 312 ? 34.181  59.596  14.075 1.00 61.79  ? 387 PRO A N     1 
ATOM   2444 C  CA    . PRO A 1 312 ? 34.245  60.961  13.522 1.00 57.50  ? 387 PRO A CA    1 
ATOM   2445 C  C     . PRO A 1 312 ? 34.835  61.979  14.482 1.00 62.85  ? 387 PRO A C     1 
ATOM   2446 O  O     . PRO A 1 312 ? 35.350  63.008  14.025 1.00 70.00  ? 387 PRO A O     1 
ATOM   2447 C  CB    . PRO A 1 312 ? 32.781  61.284  13.199 1.00 53.17  ? 387 PRO A CB    1 
ATOM   2448 C  CG    . PRO A 1 312 ? 32.010  60.447  14.129 1.00 52.86  ? 387 PRO A CG    1 
ATOM   2449 C  CD    . PRO A 1 312 ? 32.781  59.164  14.249 1.00 62.29  ? 387 PRO A CD    1 
ATOM   2450 N  N     . SER A 1 313 ? 34.772  61.732  15.792 1.00 58.37  ? 388 SER A N     1 
ATOM   2451 C  CA    . SER A 1 313 ? 35.466  62.604  16.733 1.00 63.80  ? 388 SER A CA    1 
ATOM   2452 C  C     . SER A 1 313 ? 36.978  62.453  16.609 1.00 68.33  ? 388 SER A C     1 
ATOM   2453 O  O     . SER A 1 313 ? 37.715  63.443  16.706 1.00 67.22  ? 388 SER A O     1 
ATOM   2454 C  CB    . SER A 1 313 ? 35.004  62.308  18.159 1.00 45.02  ? 388 SER A CB    1 
ATOM   2455 O  OG    . SER A 1 313 ? 33.662  62.718  18.346 1.00 63.59  ? 388 SER A OG    1 
ATOM   2456 N  N     . ILE A 1 314 ? 37.457  61.223  16.393 1.00 60.49  ? 389 ILE A N     1 
ATOM   2457 C  CA    . ILE A 1 314 ? 38.883  60.994  16.167 1.00 46.77  ? 389 ILE A CA    1 
ATOM   2458 C  C     . ILE A 1 314 ? 39.357  61.752  14.934 1.00 59.90  ? 389 ILE A C     1 
ATOM   2459 O  O     . ILE A 1 314 ? 40.457  62.319  14.918 1.00 57.98  ? 389 ILE A O     1 
ATOM   2460 C  CB    . ILE A 1 314 ? 39.165  59.485  16.049 1.00 40.81  ? 389 ILE A CB    1 
ATOM   2461 C  CG1   . ILE A 1 314 ? 38.981  58.809  17.408 1.00 49.86  ? 389 ILE A CG1   1 
ATOM   2462 C  CG2   . ILE A 1 314 ? 40.558  59.233  15.494 1.00 37.42  ? 389 ILE A CG2   1 
ATOM   2463 C  CD1   . ILE A 1 314 ? 39.412  57.368  17.439 1.00 47.20  ? 389 ILE A CD1   1 
ATOM   2464 N  N     . LEU A 1 315 ? 38.536  61.777  13.883 1.00 65.76  ? 390 LEU A N     1 
ATOM   2465 C  CA    . LEU A 1 315 ? 38.883  62.558  12.701 1.00 63.01  ? 390 LEU A CA    1 
ATOM   2466 C  C     . LEU A 1 315 ? 38.972  64.039  13.036 1.00 64.51  ? 390 LEU A C     1 
ATOM   2467 O  O     . LEU A 1 315 ? 39.859  64.744  12.539 1.00 62.00  ? 390 LEU A O     1 
ATOM   2468 C  CB    . LEU A 1 315 ? 37.859  62.319  11.592 1.00 64.97  ? 390 LEU A CB    1 
ATOM   2469 C  CG    . LEU A 1 315 ? 37.661  60.864  11.162 1.00 76.29  ? 390 LEU A CG    1 
ATOM   2470 C  CD1   . LEU A 1 315 ? 36.730  60.772  9.954  1.00 57.33  ? 390 LEU A CD1   1 
ATOM   2471 C  CD2   . LEU A 1 315 ? 39.004  60.189  10.883 1.00 65.20  ? 390 LEU A CD2   1 
ATOM   2472 N  N     . LYS A 1 316 ? 38.067  64.527  13.887 1.00 64.48  ? 391 LYS A N     1 
ATOM   2473 C  CA    . LYS A 1 316 ? 38.093  65.938  14.250 1.00 65.42  ? 391 LYS A CA    1 
ATOM   2474 C  C     . LYS A 1 316 ? 39.325  66.276  15.081 1.00 61.59  ? 391 LYS A C     1 
ATOM   2475 O  O     . LYS A 1 316 ? 39.813  67.410  15.024 1.00 70.85  ? 391 LYS A O     1 
ATOM   2476 C  CB    . LYS A 1 316 ? 36.805  66.314  14.989 1.00 53.74  ? 391 LYS A CB    1 
ATOM   2477 C  CG    . LYS A 1 316 ? 36.487  67.811  14.983 1.00 59.62  ? 391 LYS A CG    1 
ATOM   2478 C  CD    . LYS A 1 316 ? 35.016  68.068  15.290 1.00 80.90  ? 391 LYS A CD    1 
ATOM   2479 C  CE    . LYS A 1 316 ? 34.770  69.514  15.701 1.00 108.11 ? 391 LYS A CE    1 
ATOM   2480 N  NZ    . LYS A 1 316 ? 35.216  70.488  14.666 1.00 93.97  ? 391 LYS A NZ    1 
ATOM   2481 N  N     . VAL A 1 317 ? 39.851  65.312  15.842 1.00 59.20  ? 392 VAL A N     1 
ATOM   2482 C  CA    . VAL A 1 317 ? 41.105  65.543  16.555 1.00 61.76  ? 392 VAL A CA    1 
ATOM   2483 C  C     . VAL A 1 317 ? 42.273  65.570  15.579 1.00 60.08  ? 392 VAL A C     1 
ATOM   2484 O  O     . VAL A 1 317 ? 43.177  66.407  15.691 1.00 57.19  ? 392 VAL A O     1 
ATOM   2485 C  CB    . VAL A 1 317 ? 41.317  64.482  17.649 1.00 46.06  ? 392 VAL A CB    1 
ATOM   2486 C  CG1   . VAL A 1 317 ? 42.710  64.606  18.220 1.00 50.28  ? 392 VAL A CG1   1 
ATOM   2487 C  CG2   . VAL A 1 317 ? 40.297  64.644  18.751 1.00 44.49  ? 392 VAL A CG2   1 
ATOM   2488 N  N     . LYS A 1 318 ? 42.276  64.654  14.609 1.00 62.33  ? 393 LYS A N     1 
ATOM   2489 C  CA    . LYS A 1 318 ? 43.283  64.704  13.558 1.00 56.56  ? 393 LYS A CA    1 
ATOM   2490 C  C     . LYS A 1 318 ? 43.217  66.016  12.787 1.00 53.34  ? 393 LYS A C     1 
ATOM   2491 O  O     . LYS A 1 318 ? 44.246  66.514  12.316 1.00 57.80  ? 393 LYS A O     1 
ATOM   2492 C  CB    . LYS A 1 318 ? 43.110  63.515  12.612 1.00 50.04  ? 393 LYS A CB    1 
ATOM   2493 C  CG    . LYS A 1 318 ? 43.558  62.185  13.197 1.00 49.50  ? 393 LYS A CG    1 
ATOM   2494 C  CD    . LYS A 1 318 ? 43.437  61.060  12.181 1.00 55.00  ? 393 LYS A CD    1 
ATOM   2495 C  CE    . LYS A 1 318 ? 44.053  59.778  12.710 1.00 56.61  ? 393 LYS A CE    1 
ATOM   2496 N  NZ    . LYS A 1 318 ? 43.912  58.640  11.762 1.00 57.90  ? 393 LYS A NZ    1 
ATOM   2497 N  N     . GLU A 1 319 ? 42.023  66.599  12.667 1.00 69.27  ? 394 GLU A N     1 
ATOM   2498 C  CA    . GLU A 1 319 ? 41.861  67.834  11.907 1.00 71.79  ? 394 GLU A CA    1 
ATOM   2499 C  C     . GLU A 1 319 ? 42.325  69.050  12.699 1.00 65.28  ? 394 GLU A C     1 
ATOM   2500 O  O     . GLU A 1 319 ? 42.915  69.976  12.130 1.00 77.27  ? 394 GLU A O     1 
ATOM   2501 C  CB    . GLU A 1 319 ? 40.400  68.002  11.487 1.00 81.85  ? 394 GLU A CB    1 
ATOM   2502 C  CG    . GLU A 1 319 ? 40.202  69.016  10.382 1.00 102.62 ? 394 GLU A CG    1 
ATOM   2503 C  CD    . GLU A 1 319 ? 40.941  68.630  9.116  1.00 126.47 ? 394 GLU A CD    1 
ATOM   2504 O  OE1   . GLU A 1 319 ? 40.781  67.475  8.665  1.00 127.95 ? 394 GLU A OE1   1 
ATOM   2505 O  OE2   . GLU A 1 319 ? 41.691  69.475  8.580  1.00 122.56 ? 394 GLU A OE2   1 
ATOM   2506 N  N     . ILE A 1 320 ? 42.062  69.068  14.007 1.00 62.19  ? 395 ILE A N     1 
ATOM   2507 C  CA    . ILE A 1 320 ? 42.488  70.188  14.843 1.00 64.49  ? 395 ILE A CA    1 
ATOM   2508 C  C     . ILE A 1 320 ? 44.008  70.291  14.852 1.00 62.84  ? 395 ILE A C     1 
ATOM   2509 O  O     . ILE A 1 320 ? 44.581  71.375  14.689 1.00 57.91  ? 395 ILE A O     1 
ATOM   2510 C  CB    . ILE A 1 320 ? 41.921  70.034  16.266 1.00 61.96  ? 395 ILE A CB    1 
ATOM   2511 C  CG1   . ILE A 1 320 ? 40.406  70.266  16.264 1.00 68.13  ? 395 ILE A CG1   1 
ATOM   2512 C  CG2   . ILE A 1 320 ? 42.623  70.977  17.231 1.00 61.89  ? 395 ILE A CG2   1 
ATOM   2513 C  CD1   . ILE A 1 320 ? 39.696  69.746  17.498 1.00 52.17  ? 395 ILE A CD1   1 
ATOM   2514 N  N     . CYS A 1 321 ? 44.682  69.153  15.023 1.00 69.87  ? 396 CYS A N     1 
ATOM   2515 C  CA    . CYS A 1 321 ? 46.135  69.093  15.093 1.00 56.93  ? 396 CYS A CA    1 
ATOM   2516 C  C     . CYS A 1 321 ? 46.776  68.839  13.740 1.00 56.52  ? 396 CYS A C     1 
ATOM   2517 O  O     . CYS A 1 321 ? 47.885  68.288  13.676 1.00 63.20  ? 396 CYS A O     1 
ATOM   2518 C  CB    . CYS A 1 321 ? 46.553  68.023  16.097 1.00 53.24  ? 396 CYS A CB    1 
ATOM   2519 S  SG    . CYS A 1 321 ? 45.740  68.241  17.687 1.00 52.90  ? 396 CYS A SG    1 
ATOM   2520 N  N     . SER A 1 322 ? 46.100  69.210  12.659 1.00 60.69  ? 397 SER A N     1 
ATOM   2521 C  CA    . SER A 1 322 ? 46.717  69.151  11.346 1.00 63.62  ? 397 SER A CA    1 
ATOM   2522 C  C     . SER A 1 322 ? 47.921  70.089  11.310 1.00 74.23  ? 397 SER A C     1 
ATOM   2523 O  O     . SER A 1 322 ? 47.854  71.205  11.843 1.00 75.71  ? 397 SER A O     1 
ATOM   2524 C  CB    . SER A 1 322 ? 45.711  69.542  10.262 1.00 59.35  ? 397 SER A CB    1 
ATOM   2525 O  OG    . SER A 1 322 ? 46.349  69.708  9.008  1.00 85.25  ? 397 SER A OG    1 
ATOM   2526 N  N     . PRO A 1 323 ? 49.038  69.667  10.721 1.00 65.53  ? 398 PRO A N     1 
ATOM   2527 C  CA    . PRO A 1 323 ? 50.208  70.550  10.652 1.00 61.99  ? 398 PRO A CA    1 
ATOM   2528 C  C     . PRO A 1 323 ? 49.879  71.849  9.930  1.00 67.77  ? 398 PRO A C     1 
ATOM   2529 O  O     . PRO A 1 323 ? 49.175  71.861  8.917  1.00 76.36  ? 398 PRO A O     1 
ATOM   2530 C  CB    . PRO A 1 323 ? 51.241  69.713  9.886  1.00 54.88  ? 398 PRO A CB    1 
ATOM   2531 C  CG    . PRO A 1 323 ? 50.465  68.600  9.250  1.00 71.00  ? 398 PRO A CG    1 
ATOM   2532 C  CD    . PRO A 1 323 ? 49.310  68.337  10.154 1.00 66.10  ? 398 PRO A CD    1 
ATOM   2533 N  N     . ASP A 1 324 ? 50.387  72.951  10.479 1.00 62.55  ? 399 ASP A N     1 
ATOM   2534 C  CA    . ASP A 1 324 ? 50.087  74.296  9.997  1.00 60.39  ? 399 ASP A CA    1 
ATOM   2535 C  C     . ASP A 1 324 ? 51.395  75.066  9.912  1.00 75.24  ? 399 ASP A C     1 
ATOM   2536 O  O     . ASP A 1 324 ? 52.132  75.136  10.900 1.00 84.09  ? 399 ASP A O     1 
ATOM   2537 C  CB    . ASP A 1 324 ? 49.098  75.000  10.935 1.00 64.46  ? 399 ASP A CB    1 
ATOM   2538 C  CG    . ASP A 1 324 ? 48.542  76.285  10.350 1.00 88.01  ? 399 ASP A CG    1 
ATOM   2539 O  OD1   . ASP A 1 324 ? 49.295  77.280  10.264 1.00 75.47  ? 399 ASP A OD1   1 
ATOM   2540 O  OD2   . ASP A 1 324 ? 47.344  76.303  9.993  1.00 104.02 ? 399 ASP A OD2   1 
ATOM   2541 N  N     . VAL A 1 325 ? 51.679  75.645  8.740  1.00 82.60  ? 400 VAL A N     1 
ATOM   2542 C  CA    . VAL A 1 325 ? 52.979  76.270  8.493  1.00 73.40  ? 400 VAL A CA    1 
ATOM   2543 C  C     . VAL A 1 325 ? 53.222  77.455  9.412  1.00 61.82  ? 400 VAL A C     1 
ATOM   2544 O  O     . VAL A 1 325 ? 54.374  77.864  9.602  1.00 61.87  ? 400 VAL A O     1 
ATOM   2545 C  CB    . VAL A 1 325 ? 53.105  76.698  7.012  1.00 68.49  ? 400 VAL A CB    1 
ATOM   2546 C  CG1   . VAL A 1 325 ? 52.150  75.894  6.139  1.00 82.27  ? 400 VAL A CG1   1 
ATOM   2547 C  CG2   . VAL A 1 325 ? 52.865  78.200  6.849  1.00 43.20  ? 400 VAL A CG2   1 
ATOM   2548 N  N     . GLY A 1 326 ? 52.165  78.017  9.992  1.00 60.65  ? 401 GLY A N     1 
ATOM   2549 C  CA    . GLY A 1 326 ? 52.259  79.155  10.876 1.00 55.23  ? 401 GLY A CA    1 
ATOM   2550 C  C     . GLY A 1 326 ? 52.376  78.834  12.346 1.00 59.94  ? 401 GLY A C     1 
ATOM   2551 O  O     . GLY A 1 326 ? 52.537  79.756  13.150 1.00 67.75  ? 401 GLY A O     1 
ATOM   2552 N  N     . ASP A 1 327 ? 52.286  77.560  12.729 1.00 62.94  ? 402 ASP A N     1 
ATOM   2553 C  CA    . ASP A 1 327 ? 52.491  77.181  14.121 1.00 62.36  ? 402 ASP A CA    1 
ATOM   2554 C  C     . ASP A 1 327 ? 53.890  77.580  14.577 1.00 55.30  ? 402 ASP A C     1 
ATOM   2555 O  O     . ASP A 1 327 ? 54.850  77.550  13.803 1.00 61.41  ? 402 ASP A O     1 
ATOM   2556 C  CB    . ASP A 1 327 ? 52.323  75.667  14.312 1.00 72.83  ? 402 ASP A CB    1 
ATOM   2557 C  CG    . ASP A 1 327 ? 50.896  75.189  14.119 1.00 60.29  ? 402 ASP A CG    1 
ATOM   2558 O  OD1   . ASP A 1 327 ? 50.726  74.052  13.628 1.00 62.82  ? 402 ASP A OD1   1 
ATOM   2559 O  OD2   . ASP A 1 327 ? 49.953  75.929  14.470 1.00 62.06  ? 402 ASP A OD2   1 
ATOM   2560 N  N     . VAL A 1 328 ? 54.006  77.944  15.854 1.00 42.98  ? 403 VAL A N     1 
ATOM   2561 C  CA    . VAL A 1 328 ? 55.315  78.108  16.476 1.00 32.61  ? 403 VAL A CA    1 
ATOM   2562 C  C     . VAL A 1 328 ? 55.900  76.722  16.720 1.00 46.70  ? 403 VAL A C     1 
ATOM   2563 O  O     . VAL A 1 328 ? 55.246  75.705  16.460 1.00 43.96  ? 403 VAL A O     1 
ATOM   2564 C  CB    . VAL A 1 328 ? 55.237  78.917  17.784 1.00 44.29  ? 403 VAL A CB    1 
ATOM   2565 C  CG1   . VAL A 1 328 ? 54.660  80.301  17.528 1.00 39.73  ? 403 VAL A CG1   1 
ATOM   2566 C  CG2   . VAL A 1 328 ? 54.422  78.173  18.817 1.00 59.05  ? 403 VAL A CG2   1 
ATOM   2567 N  N     . ALA A 1 329 ? 57.132  76.666  17.227 1.00 55.84  ? 404 ALA A N     1 
ATOM   2568 C  CA    . ALA A 1 329 ? 57.820  75.383  17.327 1.00 52.17  ? 404 ALA A CA    1 
ATOM   2569 C  C     . ALA A 1 329 ? 57.180  74.489  18.380 1.00 50.22  ? 404 ALA A C     1 
ATOM   2570 O  O     . ALA A 1 329 ? 57.007  73.285  18.157 1.00 58.35  ? 404 ALA A O     1 
ATOM   2571 C  CB    . ALA A 1 329 ? 59.300  75.599  17.637 1.00 52.80  ? 404 ALA A CB    1 
ATOM   2572 N  N     . ASP A 1 330 ? 56.814  75.059  19.529 1.00 46.26  ? 405 ASP A N     1 
ATOM   2573 C  CA    . ASP A 1 330 ? 56.303  74.242  20.624 1.00 52.08  ? 405 ASP A CA    1 
ATOM   2574 C  C     . ASP A 1 330 ? 54.886  73.748  20.354 1.00 56.04  ? 405 ASP A C     1 
ATOM   2575 O  O     . ASP A 1 330 ? 54.523  72.650  20.791 1.00 49.92  ? 405 ASP A O     1 
ATOM   2576 C  CB    . ASP A 1 330 ? 56.359  75.033  21.929 1.00 61.28  ? 405 ASP A CB    1 
ATOM   2577 C  CG    . ASP A 1 330 ? 57.772  75.465  22.287 1.00 67.18  ? 405 ASP A CG    1 
ATOM   2578 O  OD1   . ASP A 1 330 ? 57.977  75.955  23.418 1.00 63.56  ? 405 ASP A OD1   1 
ATOM   2579 O  OD2   . ASP A 1 330 ? 58.678  75.309  21.438 1.00 65.03  ? 405 ASP A OD2   1 
ATOM   2580 N  N     . ILE A 1 331 ? 54.075  74.533  19.642 1.00 54.07  ? 406 ILE A N     1 
ATOM   2581 C  CA    . ILE A 1 331 ? 52.740  74.072  19.275 1.00 39.77  ? 406 ILE A CA    1 
ATOM   2582 C  C     . ILE A 1 331 ? 52.820  73.044  18.152 1.00 54.11  ? 406 ILE A C     1 
ATOM   2583 O  O     . ILE A 1 331 ? 52.066  72.063  18.134 1.00 57.55  ? 406 ILE A O     1 
ATOM   2584 C  CB    . ILE A 1 331 ? 51.853  75.267  18.889 1.00 42.47  ? 406 ILE A CB    1 
ATOM   2585 C  CG1   . ILE A 1 331 ? 51.672  76.192  20.091 1.00 50.21  ? 406 ILE A CG1   1 
ATOM   2586 C  CG2   . ILE A 1 331 ? 50.503  74.789  18.379 1.00 44.91  ? 406 ILE A CG2   1 
ATOM   2587 C  CD1   . ILE A 1 331 ? 51.062  75.514  21.292 1.00 44.45  ? 406 ILE A CD1   1 
ATOM   2588 N  N     . ALA A 1 332 ? 53.728  73.253  17.195 1.00 56.07  ? 407 ALA A N     1 
ATOM   2589 C  CA    . ALA A 1 332 ? 53.899  72.284  16.117 1.00 42.00  ? 407 ALA A CA    1 
ATOM   2590 C  C     . ALA A 1 332 ? 54.245  70.909  16.664 1.00 42.70  ? 407 ALA A C     1 
ATOM   2591 O  O     . ALA A 1 332 ? 53.796  69.887  16.132 1.00 51.18  ? 407 ALA A O     1 
ATOM   2592 C  CB    . ALA A 1 332 ? 54.978  72.759  15.151 1.00 35.23  ? 407 ALA A CB    1 
ATOM   2593 N  N     . LYS A 1 333 ? 55.024  70.867  17.741 1.00 50.70  ? 408 LYS A N     1 
ATOM   2594 C  CA    . LYS A 1 333 ? 55.403  69.598  18.343 1.00 54.98  ? 408 LYS A CA    1 
ATOM   2595 C  C     . LYS A 1 333 ? 54.249  68.970  19.112 1.00 57.28  ? 408 LYS A C     1 
ATOM   2596 O  O     . LYS A 1 333 ? 54.118  67.741  19.123 1.00 56.17  ? 408 LYS A O     1 
ATOM   2597 C  CB    . LYS A 1 333 ? 56.614  69.806  19.257 1.00 32.61  ? 408 LYS A CB    1 
ATOM   2598 C  CG    . LYS A 1 333 ? 57.148  68.550  19.913 1.00 35.60  ? 408 LYS A CG    1 
ATOM   2599 C  CD    . LYS A 1 333 ? 58.442  68.843  20.644 1.00 43.65  ? 408 LYS A CD    1 
ATOM   2600 C  CE    . LYS A 1 333 ? 58.928  67.647  21.436 1.00 52.27  ? 408 LYS A CE    1 
ATOM   2601 N  NZ    . LYS A 1 333 ? 60.206  67.954  22.135 1.00 36.43  ? 408 LYS A NZ    1 
ATOM   2602 N  N     . LEU A 1 334 ? 53.408  69.790  19.750 1.00 57.11  ? 409 LEU A N     1 
ATOM   2603 C  CA    . LEU A 1 334 ? 52.237  69.260  20.442 1.00 41.04  ? 409 LEU A CA    1 
ATOM   2604 C  C     . LEU A 1 334 ? 51.284  68.593  19.462 1.00 51.87  ? 409 LEU A C     1 
ATOM   2605 O  O     . LEU A 1 334 ? 50.837  67.463  19.688 1.00 57.97  ? 409 LEU A O     1 
ATOM   2606 C  CB    . LEU A 1 334 ? 51.519  70.371  21.207 1.00 40.77  ? 409 LEU A CB    1 
ATOM   2607 C  CG    . LEU A 1 334 ? 50.272  69.914  21.974 1.00 44.80  ? 409 LEU A CG    1 
ATOM   2608 C  CD1   . LEU A 1 334 ? 50.640  68.999  23.139 1.00 34.93  ? 409 LEU A CD1   1 
ATOM   2609 C  CD2   . LEU A 1 334 ? 49.459  71.103  22.458 1.00 28.99  ? 409 LEU A CD2   1 
ATOM   2610 N  N     . LYS A 1 335 ? 50.963  69.276  18.359 1.00 41.60  ? 410 LYS A N     1 
ATOM   2611 C  CA    . LYS A 1 335 ? 50.088  68.670  17.363 1.00 45.17  ? 410 LYS A CA    1 
ATOM   2612 C  C     . LYS A 1 335 ? 50.687  67.384  16.809 1.00 54.35  ? 410 LYS A C     1 
ATOM   2613 O  O     . LYS A 1 335 ? 49.951  66.438  16.501 1.00 51.10  ? 410 LYS A O     1 
ATOM   2614 C  CB    . LYS A 1 335 ? 49.802  69.662  16.232 1.00 51.17  ? 410 LYS A CB    1 
ATOM   2615 C  CG    . LYS A 1 335 ? 49.154  70.967  16.683 1.00 42.04  ? 410 LYS A CG    1 
ATOM   2616 C  CD    . LYS A 1 335 ? 48.714  71.799  15.488 1.00 51.52  ? 410 LYS A CD    1 
ATOM   2617 C  CE    . LYS A 1 335 ? 48.114  73.129  15.916 1.00 46.19  ? 410 LYS A CE    1 
ATOM   2618 N  NZ    . LYS A 1 335 ? 47.561  73.884  14.756 1.00 46.77  ? 410 LYS A NZ    1 
ATOM   2619 N  N     . VAL A 1 336 ? 52.017  67.322  16.700 1.00 57.77  ? 411 VAL A N     1 
ATOM   2620 C  CA    . VAL A 1 336 ? 52.680  66.126  16.190 1.00 46.44  ? 411 VAL A CA    1 
ATOM   2621 C  C     . VAL A 1 336 ? 52.512  64.965  17.159 1.00 52.58  ? 411 VAL A C     1 
ATOM   2622 O  O     . VAL A 1 336 ? 52.239  63.829  16.750 1.00 53.74  ? 411 VAL A O     1 
ATOM   2623 C  CB    . VAL A 1 336 ? 54.163  66.427  15.915 1.00 41.23  ? 411 VAL A CB    1 
ATOM   2624 C  CG1   . VAL A 1 336 ? 54.984  65.154  15.971 1.00 37.72  ? 411 VAL A CG1   1 
ATOM   2625 C  CG2   . VAL A 1 336 ? 54.317  67.101  14.567 1.00 42.58  ? 411 VAL A CG2   1 
ATOM   2626 N  N     . ASN A 1 337 ? 52.671  65.231  18.457 1.00 46.17  ? 412 ASN A N     1 
ATOM   2627 C  CA    . ASN A 1 337 ? 52.536  64.175  19.451 1.00 47.40  ? 412 ASN A CA    1 
ATOM   2628 C  C     . ASN A 1 337 ? 51.082  63.776  19.664 1.00 55.43  ? 412 ASN A C     1 
ATOM   2629 O  O     . ASN A 1 337 ? 50.807  62.624  20.020 1.00 54.56  ? 412 ASN A O     1 
ATOM   2630 C  CB    . ASN A 1 337 ? 53.168  64.621  20.765 1.00 50.17  ? 412 ASN A CB    1 
ATOM   2631 C  CG    . ASN A 1 337 ? 54.672  64.752  20.664 1.00 59.48  ? 412 ASN A CG    1 
ATOM   2632 O  OD1   . ASN A 1 337 ? 55.304  64.117  19.821 1.00 64.44  ? 412 ASN A OD1   1 
ATOM   2633 N  ND2   . ASN A 1 337 ? 55.254  65.577  21.522 1.00 51.29  ? 412 ASN A ND2   1 
ATOM   2634 N  N     . ILE A 1 338 ? 50.142  64.698  19.449 1.00 49.81  ? 413 ILE A N     1 
ATOM   2635 C  CA    . ILE A 1 338 ? 48.734  64.372  19.648 1.00 47.32  ? 413 ILE A CA    1 
ATOM   2636 C  C     . ILE A 1 338 ? 48.245  63.431  18.555 1.00 54.39  ? 413 ILE A C     1 
ATOM   2637 O  O     . ILE A 1 338 ? 47.580  62.426  18.836 1.00 57.38  ? 413 ILE A O     1 
ATOM   2638 C  CB    . ILE A 1 338 ? 47.879  65.649  19.720 1.00 45.73  ? 413 ILE A CB    1 
ATOM   2639 C  CG1   . ILE A 1 338 ? 48.132  66.394  21.029 1.00 45.83  ? 413 ILE A CG1   1 
ATOM   2640 C  CG2   . ILE A 1 338 ? 46.414  65.301  19.632 1.00 31.28  ? 413 ILE A CG2   1 
ATOM   2641 C  CD1   . ILE A 1 338 ? 47.274  67.630  21.194 1.00 42.41  ? 413 ILE A CD1   1 
ATOM   2642 N  N     . ILE A 1 339 ? 48.563  63.734  17.292 1.00 46.30  ? 414 ILE A N     1 
ATOM   2643 C  CA    . ILE A 1 339 ? 48.159  62.829  16.221 1.00 53.85  ? 414 ILE A CA    1 
ATOM   2644 C  C     . ILE A 1 339 ? 48.858  61.486  16.353 1.00 53.43  ? 414 ILE A C     1 
ATOM   2645 O  O     . ILE A 1 339 ? 48.349  60.473  15.861 1.00 64.52  ? 414 ILE A O     1 
ATOM   2646 C  CB    . ILE A 1 339 ? 48.414  63.436  14.825 1.00 46.72  ? 414 ILE A CB    1 
ATOM   2647 C  CG1   . ILE A 1 339 ? 49.913  63.535  14.531 1.00 71.38  ? 414 ILE A CG1   1 
ATOM   2648 C  CG2   . ILE A 1 339 ? 47.733  64.796  14.690 1.00 43.91  ? 414 ILE A CG2   1 
ATOM   2649 C  CD1   . ILE A 1 339 ? 50.415  62.502  13.532 1.00 67.13  ? 414 ILE A CD1   1 
ATOM   2650 N  N     . LYS A 1 340 ? 50.012  61.449  17.019 1.00 50.53  ? 415 LYS A N     1 
ATOM   2651 C  CA    . LYS A 1 340 ? 50.690  60.184  17.264 1.00 48.29  ? 415 LYS A CA    1 
ATOM   2652 C  C     . LYS A 1 340 ? 49.930  59.357  18.293 1.00 59.91  ? 415 LYS A C     1 
ATOM   2653 O  O     . LYS A 1 340 ? 49.553  58.208  18.033 1.00 61.54  ? 415 LYS A O     1 
ATOM   2654 C  CB    . LYS A 1 340 ? 52.125  60.450  17.722 1.00 54.16  ? 415 LYS A CB    1 
ATOM   2655 C  CG    . LYS A 1 340 ? 52.947  59.205  17.987 1.00 69.19  ? 415 LYS A CG    1 
ATOM   2656 C  CD    . LYS A 1 340 ? 54.348  59.579  18.449 1.00 82.03  ? 415 LYS A CD    1 
ATOM   2657 C  CE    . LYS A 1 340 ? 55.054  60.438  17.408 1.00 85.32  ? 415 LYS A CE    1 
ATOM   2658 N  NZ    . LYS A 1 340 ? 56.404  60.869  17.863 1.00 92.20  ? 415 LYS A NZ    1 
ATOM   2659 N  N     . ASN A 1 341 ? 49.680  59.935  19.471 1.00 54.43  ? 416 ASN A N     1 
ATOM   2660 C  CA    . ASN A 1 341 ? 48.982  59.196  20.518 1.00 54.31  ? 416 ASN A CA    1 
ATOM   2661 C  C     . ASN A 1 341 ? 47.531  58.907  20.143 1.00 58.15  ? 416 ASN A C     1 
ATOM   2662 O  O     . ASN A 1 341 ? 46.963  57.915  20.609 1.00 63.39  ? 416 ASN A O     1 
ATOM   2663 C  CB    . ASN A 1 341 ? 49.057  59.958  21.839 1.00 50.21  ? 416 ASN A CB    1 
ATOM   2664 C  CG    . ASN A 1 341 ? 50.463  59.995  22.411 1.00 56.25  ? 416 ASN A CG    1 
ATOM   2665 O  OD1   . ASN A 1 341 ? 51.183  58.995  22.392 1.00 54.83  ? 416 ASN A OD1   1 
ATOM   2666 N  ND2   . ASN A 1 341 ? 50.861  61.154  22.925 1.00 50.72  ? 416 ASN A ND2   1 
ATOM   2667 N  N     . VAL A 1 342 ? 46.908  59.744  19.309 1.00 52.98  ? 417 VAL A N     1 
ATOM   2668 C  CA    . VAL A 1 342 ? 45.589  59.383  18.791 1.00 50.15  ? 417 VAL A CA    1 
ATOM   2669 C  C     . VAL A 1 342 ? 45.666  58.060  18.045 1.00 54.37  ? 417 VAL A C     1 
ATOM   2670 O  O     . VAL A 1 342 ? 44.724  57.257  18.080 1.00 54.49  ? 417 VAL A O     1 
ATOM   2671 C  CB    . VAL A 1 342 ? 45.030  60.513  17.902 1.00 55.92  ? 417 VAL A CB    1 
ATOM   2672 C  CG1   . VAL A 1 342 ? 43.984  59.985  16.931 1.00 45.53  ? 417 VAL A CG1   1 
ATOM   2673 C  CG2   . VAL A 1 342 ? 44.425  61.595  18.764 1.00 46.64  ? 417 VAL A CG2   1 
ATOM   2674 N  N     . ARG A 1 343 ? 46.802  57.790  17.401 1.00 53.54  ? 418 ARG A N     1 
ATOM   2675 C  CA    . ARG A 1 343 ? 46.973  56.557  16.645 1.00 55.01  ? 418 ARG A CA    1 
ATOM   2676 C  C     . ARG A 1 343 ? 47.310  55.377  17.553 1.00 53.26  ? 418 ARG A C     1 
ATOM   2677 O  O     . ARG A 1 343 ? 46.729  54.295  17.417 1.00 56.58  ? 418 ARG A O     1 
ATOM   2678 C  CB    . ARG A 1 343 ? 48.062  56.746  15.587 1.00 58.39  ? 418 ARG A CB    1 
ATOM   2679 C  CG    . ARG A 1 343 ? 47.937  55.806  14.404 1.00 76.18  ? 418 ARG A CG    1 
ATOM   2680 C  CD    . ARG A 1 343 ? 49.132  55.906  13.472 1.00 68.93  ? 418 ARG A CD    1 
ATOM   2681 N  NE    . ARG A 1 343 ? 50.344  55.367  14.079 1.00 48.26  ? 418 ARG A NE    1 
ATOM   2682 C  CZ    . ARG A 1 343 ? 51.341  56.112  14.542 1.00 81.06  ? 418 ARG A CZ    1 
ATOM   2683 N  NH1   . ARG A 1 343 ? 51.274  57.437  14.464 1.00 64.05  ? 418 ARG A NH1   1 
ATOM   2684 N  NH2   . ARG A 1 343 ? 52.408  55.533  15.078 1.00 82.06  ? 418 ARG A NH2   1 
ATOM   2685 N  N     . ILE A 1 344 ? 48.244  55.566  18.490 1.00 52.42  ? 419 ILE A N     1 
ATOM   2686 C  CA    . ILE A 1 344 ? 48.771  54.453  19.278 1.00 54.80  ? 419 ILE A CA    1 
ATOM   2687 C  C     . ILE A 1 344 ? 48.094  54.300  20.635 1.00 58.98  ? 419 ILE A C     1 
ATOM   2688 O  O     . ILE A 1 344 ? 48.342  53.297  21.325 1.00 54.12  ? 419 ILE A O     1 
ATOM   2689 C  CB    . ILE A 1 344 ? 50.298  54.580  19.477 1.00 57.67  ? 419 ILE A CB    1 
ATOM   2690 C  CG1   . ILE A 1 344 ? 50.620  55.618  20.551 1.00 54.67  ? 419 ILE A CG1   1 
ATOM   2691 C  CG2   . ILE A 1 344 ? 50.981  54.955  18.166 1.00 55.60  ? 419 ILE A CG2   1 
ATOM   2692 C  CD1   . ILE A 1 344 ? 52.094  55.949  20.646 1.00 50.76  ? 419 ILE A CD1   1 
ATOM   2693 N  N     . ILE A 1 345 ? 47.262  55.253  21.047 1.00 53.05  ? 420 ILE A N     1 
ATOM   2694 C  CA    . ILE A 1 345 ? 46.506  55.159  22.290 1.00 40.37  ? 420 ILE A CA    1 
ATOM   2695 C  C     . ILE A 1 345 ? 45.015  55.012  22.018 1.00 54.73  ? 420 ILE A C     1 
ATOM   2696 O  O     . ILE A 1 345 ? 44.349  54.164  22.613 1.00 62.95  ? 420 ILE A O     1 
ATOM   2697 C  CB    . ILE A 1 345 ? 46.781  56.371  23.211 1.00 53.09  ? 420 ILE A CB    1 
ATOM   2698 C  CG1   . ILE A 1 345 ? 48.253  56.439  23.627 1.00 47.43  ? 420 ILE A CG1   1 
ATOM   2699 C  CG2   . ILE A 1 345 ? 45.896  56.311  24.441 1.00 46.07  ? 420 ILE A CG2   1 
ATOM   2700 C  CD1   . ILE A 1 345 ? 48.598  55.554  24.802 1.00 58.29  ? 420 ILE A CD1   1 
ATOM   2701 N  N     . TRP A 1 346 ? 44.470  55.828  21.114 1.00 56.43  ? 421 TRP A N     1 
ATOM   2702 C  CA    . TRP A 1 346 ? 43.023  55.832  20.918 1.00 56.03  ? 421 TRP A CA    1 
ATOM   2703 C  C     . TRP A 1 346 ? 42.599  54.867  19.813 1.00 50.56  ? 421 TRP A C     1 
ATOM   2704 O  O     . TRP A 1 346 ? 41.817  53.944  20.062 1.00 52.72  ? 421 TRP A O     1 
ATOM   2705 C  CB    . TRP A 1 346 ? 42.526  57.255  20.632 1.00 55.61  ? 421 TRP A CB    1 
ATOM   2706 C  CG    . TRP A 1 346 ? 41.034  57.408  20.831 1.00 58.59  ? 421 TRP A CG    1 
ATOM   2707 C  CD1   . TRP A 1 346 ? 40.150  56.429  21.197 1.00 42.32  ? 421 TRP A CD1   1 
ATOM   2708 C  CD2   . TRP A 1 346 ? 40.261  58.605  20.676 1.00 42.91  ? 421 TRP A CD2   1 
ATOM   2709 N  NE1   . TRP A 1 346 ? 38.880  56.942  21.275 1.00 50.10  ? 421 TRP A NE1   1 
ATOM   2710 C  CE2   . TRP A 1 346 ? 38.918  58.275  20.961 1.00 52.72  ? 421 TRP A CE2   1 
ATOM   2711 C  CE3   . TRP A 1 346 ? 40.572  59.923  20.326 1.00 39.04  ? 421 TRP A CE3   1 
ATOM   2712 C  CZ2   . TRP A 1 346 ? 37.887  59.215  20.906 1.00 37.59  ? 421 TRP A CZ2   1 
ATOM   2713 C  CZ3   . TRP A 1 346 ? 39.545  60.854  20.268 1.00 52.22  ? 421 TRP A CZ3   1 
ATOM   2714 C  CH2   . TRP A 1 346 ? 38.219  60.493  20.556 1.00 38.99  ? 421 TRP A CH2   1 
ATOM   2715 N  N     . GLU A 1 347 ? 43.095  55.071  18.587 1.00 54.65  ? 422 GLU A N     1 
ATOM   2716 C  CA    . GLU A 1 347 ? 42.776  54.140  17.506 1.00 53.46  ? 422 GLU A CA    1 
ATOM   2717 C  C     . GLU A 1 347 ? 43.216  52.724  17.848 1.00 64.37  ? 422 GLU A C     1 
ATOM   2718 O  O     . GLU A 1 347 ? 42.551  51.754  17.463 1.00 65.60  ? 422 GLU A O     1 
ATOM   2719 C  CB    . GLU A 1 347 ? 43.425  54.597  16.196 1.00 43.43  ? 422 GLU A CB    1 
ATOM   2720 C  CG    . GLU A 1 347 ? 42.729  55.783  15.521 1.00 67.69  ? 422 GLU A CG    1 
ATOM   2721 C  CD    . GLU A 1 347 ? 43.567  56.418  14.417 1.00 71.09  ? 422 GLU A CD    1 
ATOM   2722 O  OE1   . GLU A 1 347 ? 43.567  55.906  13.277 1.00 83.43  ? 422 GLU A OE1   1 
ATOM   2723 O  OE2   . GLU A 1 347 ? 44.237  57.432  14.696 1.00 76.38  ? 422 GLU A OE2   1 
ATOM   2724 N  N     . GLU A 1 348 ? 44.313  52.591  18.596 1.00 62.37  ? 423 GLU A N     1 
ATOM   2725 C  CA    . GLU A 1 348 ? 44.825  51.279  18.973 1.00 50.24  ? 423 GLU A CA    1 
ATOM   2726 C  C     . GLU A 1 348 ? 43.814  50.476  19.785 1.00 54.50  ? 423 GLU A C     1 
ATOM   2727 O  O     . GLU A 1 348 ? 43.818  49.241  19.728 1.00 63.40  ? 423 GLU A O     1 
ATOM   2728 C  CB    . GLU A 1 348 ? 46.122  51.455  19.762 1.00 46.96  ? 423 GLU A CB    1 
ATOM   2729 C  CG    . GLU A 1 348 ? 46.739  50.172  20.275 1.00 58.59  ? 423 GLU A CG    1 
ATOM   2730 C  CD    . GLU A 1 348 ? 47.279  49.303  19.159 1.00 83.02  ? 423 GLU A CD    1 
ATOM   2731 O  OE1   . GLU A 1 348 ? 47.561  48.114  19.420 1.00 88.81  ? 423 GLU A OE1   1 
ATOM   2732 O  OE2   . GLU A 1 348 ? 47.422  49.808  18.023 1.00 79.05  ? 423 GLU A OE2   1 
ATOM   2733 N  N     . ASN A 1 349 ? 42.943  51.147  20.540 1.00 55.20  ? 424 ASN A N     1 
ATOM   2734 C  CA    . ASN A 1 349 ? 42.026  50.481  21.459 1.00 53.15  ? 424 ASN A CA    1 
ATOM   2735 C  C     . ASN A 1 349 ? 40.563  50.644  21.044 1.00 63.20  ? 424 ASN A C     1 
ATOM   2736 O  O     . ASN A 1 349 ? 39.680  50.754  21.899 1.00 65.49  ? 424 ASN A O     1 
ATOM   2737 C  CB    . ASN A 1 349 ? 42.225  50.994  22.885 1.00 51.24  ? 424 ASN A CB    1 
ATOM   2738 C  CG    . ASN A 1 349 ? 43.619  50.713  23.425 1.00 50.87  ? 424 ASN A CG    1 
ATOM   2739 O  OD1   . ASN A 1 349 ? 44.577  51.391  23.067 1.00 55.45  ? 424 ASN A OD1   1 
ATOM   2740 N  ND2   . ASN A 1 349 ? 43.731  49.724  24.310 1.00 53.01  ? 424 ASN A ND2   1 
ATOM   2741 N  N     . LEU A 1 350 ? 40.289  50.666  19.743 1.00 53.10  ? 425 LEU A N     1 
ATOM   2742 C  CA    . LEU A 1 350 ? 38.924  50.631  19.235 1.00 55.74  ? 425 LEU A CA    1 
ATOM   2743 C  C     . LEU A 1 350 ? 38.575  49.222  18.768 1.00 61.47  ? 425 LEU A C     1 
ATOM   2744 O  O     . LEU A 1 350 ? 39.420  48.326  18.732 1.00 66.32  ? 425 LEU A O     1 
ATOM   2745 C  CB    . LEU A 1 350 ? 38.742  51.640  18.098 1.00 45.78  ? 425 LEU A CB    1 
ATOM   2746 C  CG    . LEU A 1 350 ? 38.753  53.113  18.507 1.00 52.98  ? 425 LEU A CG    1 
ATOM   2747 C  CD1   . LEU A 1 350 ? 38.331  53.988  17.346 1.00 47.97  ? 425 LEU A CD1   1 
ATOM   2748 C  CD2   . LEU A 1 350 ? 37.848  53.338  19.703 1.00 52.38  ? 425 LEU A CD2   1 
ATOM   2749 N  N     . SER A 1 351 ? 37.306  49.033  18.406 1.00 51.69  ? 426 SER A N     1 
ATOM   2750 C  CA    . SER A 1 351 ? 36.811  47.734  17.973 1.00 50.92  ? 426 SER A CA    1 
ATOM   2751 C  C     . SER A 1 351 ? 35.820  47.917  16.828 1.00 63.83  ? 426 SER A C     1 
ATOM   2752 O  O     . SER A 1 351 ? 35.429  49.038  16.490 1.00 69.54  ? 426 SER A O     1 
ATOM   2753 C  CB    . SER A 1 351 ? 36.160  46.977  19.138 1.00 46.88  ? 426 SER A CB    1 
ATOM   2754 O  OG    . SER A 1 351 ? 35.133  47.749  19.733 1.00 60.77  ? 426 SER A OG    1 
ATOM   2755 N  N     . ILE A 1 352 ? 35.402  46.795  16.228 1.00 59.01  ? 427 ILE A N     1 
ATOM   2756 C  CA    . ILE A 1 352 ? 34.414  46.859  15.152 1.00 66.35  ? 427 ILE A CA    1 
ATOM   2757 C  C     . ILE A 1 352 ? 33.075  47.384  15.648 1.00 61.41  ? 427 ILE A C     1 
ATOM   2758 O  O     . ILE A 1 352 ? 32.230  47.772  14.837 1.00 68.49  ? 427 ILE A O     1 
ATOM   2759 C  CB    . ILE A 1 352 ? 34.227  45.492  14.455 1.00 70.96  ? 427 ILE A CB    1 
ATOM   2760 C  CG1   . ILE A 1 352 ? 34.730  44.346  15.332 1.00 56.72  ? 427 ILE A CG1   1 
ATOM   2761 C  CG2   . ILE A 1 352 ? 34.890  45.494  13.078 1.00 75.34  ? 427 ILE A CG2   1 
ATOM   2762 C  CD1   . ILE A 1 352 ? 33.814  44.010  16.483 1.00 58.90  ? 427 ILE A CD1   1 
ATOM   2763 N  N     . TRP A 1 353 ? 32.854  47.403  16.964 1.00 57.59  ? 428 TRP A N     1 
ATOM   2764 C  CA    . TRP A 1 353 ? 31.673  48.073  17.495 1.00 54.52  ? 428 TRP A CA    1 
ATOM   2765 C  C     . TRP A 1 353 ? 31.721  49.570  17.208 1.00 64.90  ? 428 TRP A C     1 
ATOM   2766 O  O     . TRP A 1 353 ? 30.683  50.191  16.951 1.00 59.40  ? 428 TRP A O     1 
ATOM   2767 C  CB    . TRP A 1 353 ? 31.552  47.817  18.998 1.00 62.54  ? 428 TRP A CB    1 
ATOM   2768 C  CG    . TRP A 1 353 ? 31.470  46.359  19.355 1.00 68.30  ? 428 TRP A CG    1 
ATOM   2769 C  CD1   . TRP A 1 353 ? 32.516  45.500  19.530 1.00 55.09  ? 428 TRP A CD1   1 
ATOM   2770 C  CD2   . TRP A 1 353 ? 30.278  45.593  19.587 1.00 70.21  ? 428 TRP A CD2   1 
ATOM   2771 N  NE1   . TRP A 1 353 ? 32.051  44.249  19.854 1.00 65.32  ? 428 TRP A NE1   1 
ATOM   2772 C  CE2   . TRP A 1 353 ? 30.681  44.278  19.895 1.00 74.53  ? 428 TRP A CE2   1 
ATOM   2773 C  CE3   . TRP A 1 353 ? 28.911  45.890  19.564 1.00 68.67  ? 428 TRP A CE3   1 
ATOM   2774 C  CZ2   . TRP A 1 353 ? 29.765  43.262  20.176 1.00 66.97  ? 428 TRP A CZ2   1 
ATOM   2775 C  CZ3   . TRP A 1 353 ? 28.004  44.879  19.843 1.00 69.65  ? 428 TRP A CZ3   1 
ATOM   2776 C  CH2   . TRP A 1 353 ? 28.436  43.582  20.145 1.00 59.00  ? 428 TRP A CH2   1 
ATOM   2777 N  N     . HIS A 1 354 ? 32.920  50.167  17.238 1.00 62.66  ? 429 HIS A N     1 
ATOM   2778 C  CA    . HIS A 1 354 ? 33.041  51.599  16.968 1.00 52.79  ? 429 HIS A CA    1 
ATOM   2779 C  C     . HIS A 1 354 ? 32.827  51.901  15.490 1.00 70.87  ? 429 HIS A C     1 
ATOM   2780 O  O     . HIS A 1 354 ? 32.253  52.940  15.139 1.00 61.85  ? 429 HIS A O     1 
ATOM   2781 C  CB    . HIS A 1 354 ? 34.409  52.115  17.417 1.00 54.02  ? 429 HIS A CB    1 
ATOM   2782 C  CG    . HIS A 1 354 ? 34.628  52.068  18.899 1.00 56.66  ? 429 HIS A CG    1 
ATOM   2783 N  ND1   . HIS A 1 354 ? 35.193  50.983  19.535 1.00 49.15  ? 429 HIS A ND1   1 
ATOM   2784 C  CD2   . HIS A 1 354 ? 34.380  52.981  19.868 1.00 56.34  ? 429 HIS A CD2   1 
ATOM   2785 C  CE1   . HIS A 1 354 ? 35.277  51.226  20.830 1.00 50.45  ? 429 HIS A CE1   1 
ATOM   2786 N  NE2   . HIS A 1 354 ? 34.789  52.432  21.059 1.00 53.70  ? 429 HIS A NE2   1 
ATOM   2787 N  N     . TYR A 1 355 ? 33.290  51.006  14.609 1.00 68.23  ? 430 TYR A N     1 
ATOM   2788 C  CA    . TYR A 1 355 ? 33.111  51.186  13.172 1.00 73.28  ? 430 TYR A CA    1 
ATOM   2789 C  C     . TYR A 1 355 ? 31.685  50.855  12.741 1.00 72.15  ? 430 TYR A C     1 
ATOM   2790 O  O     . TYR A 1 355 ? 31.093  51.579  11.930 1.00 66.03  ? 430 TYR A O     1 
ATOM   2791 C  CB    . TYR A 1 355 ? 34.107  50.314  12.404 1.00 68.87  ? 430 TYR A CB    1 
ATOM   2792 C  CG    . TYR A 1 355 ? 35.514  50.329  12.960 1.00 66.70  ? 430 TYR A CG    1 
ATOM   2793 C  CD1   . TYR A 1 355 ? 36.131  49.154  13.370 1.00 72.85  ? 430 TYR A CD1   1 
ATOM   2794 C  CD2   . TYR A 1 355 ? 36.225  51.515  13.078 1.00 74.47  ? 430 TYR A CD2   1 
ATOM   2795 C  CE1   . TYR A 1 355 ? 37.416  49.158  13.883 1.00 71.23  ? 430 TYR A CE1   1 
ATOM   2796 C  CE2   . TYR A 1 355 ? 37.512  51.531  13.587 1.00 68.62  ? 430 TYR A CE2   1 
ATOM   2797 C  CZ    . TYR A 1 355 ? 38.100  50.349  13.988 1.00 67.61  ? 430 TYR A CZ    1 
ATOM   2798 O  OH    . TYR A 1 355 ? 39.378  50.357  14.495 1.00 77.29  ? 430 TYR A OH    1 
ATOM   2799 N  N     . THR A 1 356 ? 31.123  49.762  13.270 1.00 66.76  ? 431 THR A N     1 
ATOM   2800 C  CA    . THR A 1 356 ? 29.764  49.371  12.911 1.00 52.50  ? 431 THR A CA    1 
ATOM   2801 C  C     . THR A 1 356 ? 28.744  50.382  13.417 1.00 60.61  ? 431 THR A C     1 
ATOM   2802 O  O     . THR A 1 356 ? 27.752  50.662  12.735 1.00 67.65  ? 431 THR A O     1 
ATOM   2803 C  CB    . THR A 1 356 ? 29.459  47.981  13.464 1.00 63.32  ? 431 THR A CB    1 
ATOM   2804 O  OG1   . THR A 1 356 ? 30.383  47.036  12.911 1.00 63.67  ? 431 THR A OG1   1 
ATOM   2805 C  CG2   . THR A 1 356 ? 28.030  47.561  13.125 1.00 75.60  ? 431 THR A CG2   1 
ATOM   2806 N  N     . ALA A 1 357 ? 28.967  50.938  14.611 1.00 68.05  ? 432 ALA A N     1 
ATOM   2807 C  CA    . ALA A 1 357 ? 28.083  51.991  15.100 1.00 67.00  ? 432 ALA A CA    1 
ATOM   2808 C  C     . ALA A 1 357 ? 28.114  53.197  14.173 1.00 71.53  ? 432 ALA A C     1 
ATOM   2809 O  O     . ALA A 1 357 ? 27.077  53.816  13.911 1.00 80.88  ? 432 ALA A O     1 
ATOM   2810 C  CB    . ALA A 1 357 ? 28.470  52.396  16.523 1.00 53.84  ? 432 ALA A CB    1 
ATOM   2811 N  N     . PHE A 1 358 ? 29.295  53.534  13.651 1.00 68.97  ? 433 PHE A N     1 
ATOM   2812 C  CA    . PHE A 1 358 ? 29.399  54.642  12.707 1.00 70.31  ? 433 PHE A CA    1 
ATOM   2813 C  C     . PHE A 1 358 ? 28.747  54.290  11.375 1.00 68.63  ? 433 PHE A C     1 
ATOM   2814 O  O     . PHE A 1 358 ? 28.144  55.153  10.726 1.00 70.73  ? 433 PHE A O     1 
ATOM   2815 C  CB    . PHE A 1 358 ? 30.870  55.021  12.522 1.00 83.48  ? 433 PHE A CB    1 
ATOM   2816 C  CG    . PHE A 1 358 ? 31.084  56.343  11.840 1.00 61.01  ? 433 PHE A CG    1 
ATOM   2817 C  CD1   . PHE A 1 358 ? 30.308  57.444  12.169 1.00 63.97  ? 433 PHE A CD1   1 
ATOM   2818 C  CD2   . PHE A 1 358 ? 32.078  56.490  10.887 1.00 50.79  ? 433 PHE A CD2   1 
ATOM   2819 C  CE1   . PHE A 1 358 ? 30.506  58.661  11.545 1.00 60.13  ? 433 PHE A CE1   1 
ATOM   2820 C  CE2   . PHE A 1 358 ? 32.285  57.703  10.261 1.00 58.85  ? 433 PHE A CE2   1 
ATOM   2821 C  CZ    . PHE A 1 358 ? 31.499  58.792  10.591 1.00 65.02  ? 433 PHE A CZ    1 
ATOM   2822 N  N     . PHE A 1 359 ? 28.851  53.023  10.958 1.00 70.58  ? 434 PHE A N     1 
ATOM   2823 C  CA    . PHE A 1 359 ? 28.182  52.567  9.741  1.00 69.98  ? 434 PHE A CA    1 
ATOM   2824 C  C     . PHE A 1 359 ? 26.693  52.889  9.776  1.00 70.60  ? 434 PHE A C     1 
ATOM   2825 O  O     . PHE A 1 359 ? 26.124  53.362  8.786  1.00 79.02  ? 434 PHE A O     1 
ATOM   2826 C  CB    . PHE A 1 359 ? 28.404  51.061  9.563  1.00 76.88  ? 434 PHE A CB    1 
ATOM   2827 C  CG    . PHE A 1 359 ? 27.795  50.493  8.310  1.00 81.43  ? 434 PHE A CG    1 
ATOM   2828 C  CD1   . PHE A 1 359 ? 28.573  50.278  7.185  1.00 80.07  ? 434 PHE A CD1   1 
ATOM   2829 C  CD2   . PHE A 1 359 ? 26.450  50.162  8.261  1.00 85.91  ? 434 PHE A CD2   1 
ATOM   2830 C  CE1   . PHE A 1 359 ? 28.016  49.753  6.034  1.00 91.83  ? 434 PHE A CE1   1 
ATOM   2831 C  CE2   . PHE A 1 359 ? 25.889  49.644  7.115  1.00 84.12  ? 434 PHE A CE2   1 
ATOM   2832 C  CZ    . PHE A 1 359 ? 26.673  49.436  6.000  1.00 88.70  ? 434 PHE A CZ    1 
ATOM   2833 N  N     . PHE A 1 360 ? 26.044  52.638  10.915 1.00 66.65  ? 435 PHE A N     1 
ATOM   2834 C  CA    . PHE A 1 360 ? 24.619  52.892  11.086 1.00 72.30  ? 435 PHE A CA    1 
ATOM   2835 C  C     . PHE A 1 360 ? 24.297  54.367  11.334 1.00 73.91  ? 435 PHE A C     1 
ATOM   2836 O  O     . PHE A 1 360 ? 23.222  54.677  11.866 1.00 64.50  ? 435 PHE A O     1 
ATOM   2837 C  CB    . PHE A 1 360 ? 24.066  52.022  12.219 1.00 73.69  ? 435 PHE A CB    1 
ATOM   2838 C  CG    . PHE A 1 360 ? 24.137  50.546  11.932 1.00 78.24  ? 435 PHE A CG    1 
ATOM   2839 C  CD1   . PHE A 1 360 ? 24.507  49.646  12.920 1.00 71.56  ? 435 PHE A CD1   1 
ATOM   2840 C  CD2   . PHE A 1 360 ? 23.840  50.062  10.670 1.00 76.06  ? 435 PHE A CD2   1 
ATOM   2841 C  CE1   . PHE A 1 360 ? 24.576  48.291  12.650 1.00 70.05  ? 435 PHE A CE1   1 
ATOM   2842 C  CE2   . PHE A 1 360 ? 23.907  48.711  10.396 1.00 78.91  ? 435 PHE A CE2   1 
ATOM   2843 C  CZ    . PHE A 1 360 ? 24.276  47.824  11.387 1.00 74.20  ? 435 PHE A CZ    1 
ATOM   2844 N  N     . TYR A 1 361 ? 25.208  55.277  10.980 1.00 75.71  ? 436 TYR A N     1 
ATOM   2845 C  CA    . TYR A 1 361 ? 24.884  56.691  10.863 1.00 72.53  ? 436 TYR A CA    1 
ATOM   2846 C  C     . TYR A 1 361 ? 24.623  56.968  9.391  1.00 78.97  ? 436 TYR A C     1 
ATOM   2847 O  O     . TYR A 1 361 ? 25.560  56.879  8.582  1.00 87.11  ? 436 TYR A O     1 
ATOM   2848 C  CB    . TYR A 1 361 ? 26.022  57.567  11.388 1.00 61.06  ? 436 TYR A CB    1 
ATOM   2849 C  CG    . TYR A 1 361 ? 25.642  59.021  11.587 1.00 63.38  ? 436 TYR A CG    1 
ATOM   2850 C  CD1   . TYR A 1 361 ? 24.670  59.386  12.513 1.00 48.85  ? 436 TYR A CD1   1 
ATOM   2851 C  CD2   . TYR A 1 361 ? 26.265  60.031  10.860 1.00 67.45  ? 436 TYR A CD2   1 
ATOM   2852 C  CE1   . TYR A 1 361 ? 24.323  60.713  12.700 1.00 51.29  ? 436 TYR A CE1   1 
ATOM   2853 C  CE2   . TYR A 1 361 ? 25.924  61.360  11.041 1.00 56.45  ? 436 TYR A CE2   1 
ATOM   2854 C  CZ    . TYR A 1 361 ? 24.954  61.695  11.961 1.00 59.92  ? 436 TYR A CZ    1 
ATOM   2855 O  OH    . TYR A 1 361 ? 24.615  63.016  12.140 1.00 64.23  ? 436 TYR A OH    1 
ATOM   2856 N  N     . PRO A 1 362 ? 23.394  57.298  8.997  1.00 82.00  ? 437 PRO A N     1 
ATOM   2857 C  CA    . PRO A 1 362 ? 22.981  57.159  7.589  1.00 75.32  ? 437 PRO A CA    1 
ATOM   2858 C  C     . PRO A 1 362 ? 23.858  57.933  6.615  1.00 76.29  ? 437 PRO A C     1 
ATOM   2859 O  O     . PRO A 1 362 ? 24.064  57.464  5.486  1.00 85.24  ? 437 PRO A O     1 
ATOM   2860 C  CB    . PRO A 1 362 ? 21.538  57.677  7.606  1.00 83.42  ? 437 PRO A CB    1 
ATOM   2861 C  CG    . PRO A 1 362 ? 21.062  57.294  8.969  1.00 78.55  ? 437 PRO A CG    1 
ATOM   2862 C  CD    . PRO A 1 362 ? 22.240  57.559  9.875  1.00 74.90  ? 437 PRO A CD    1 
ATOM   2863 N  N     . PRO A 1 363 ? 24.403  59.117  6.980  1.00 72.45  ? 438 PRO A N     1 
ATOM   2864 C  CA    . PRO A 1 363 ? 25.523  59.643  6.181  1.00 65.52  ? 438 PRO A CA    1 
ATOM   2865 C  C     . PRO A 1 363 ? 26.708  58.681  6.167  1.00 94.42  ? 438 PRO A C     1 
ATOM   2866 O  O     . PRO A 1 363 ? 27.742  58.916  6.804  1.00 70.00  ? 438 PRO A O     1 
ATOM   2867 C  CB    . PRO A 1 363 ? 25.852  60.969  6.872  1.00 58.38  ? 438 PRO A CB    1 
ATOM   2868 C  CG    . PRO A 1 363 ? 24.529  61.427  7.376  1.00 59.34  ? 438 PRO A CG    1 
ATOM   2869 C  CD    . PRO A 1 363 ? 23.821  60.175  7.834  1.00 66.01  ? 438 PRO A CD    1 
ATOM   2870 N  N     . ALA A 1 364 ? 26.558  57.589  5.411  1.00 109.91 ? 439 ALA A N     1 
ATOM   2871 C  CA    . ALA A 1 364 ? 27.441  56.429  5.460  1.00 100.47 ? 439 ALA A CA    1 
ATOM   2872 C  C     . ALA A 1 364 ? 28.447  56.402  4.314  1.00 104.60 ? 439 ALA A C     1 
ATOM   2873 O  O     . ALA A 1 364 ? 28.879  55.324  3.896  1.00 110.15 ? 439 ALA A O     1 
ATOM   2874 C  CB    . ALA A 1 364 ? 26.610  55.144  5.458  1.00 69.09  ? 439 ALA A CB    1 
ATOM   2875 N  N     . LEU A 1 365 ? 28.837  57.570  3.805  1.00 107.71 ? 440 LEU A N     1 
ATOM   2876 C  CA    . LEU A 1 365 ? 29.709  57.636  2.637  1.00 97.66  ? 440 LEU A CA    1 
ATOM   2877 C  C     . LEU A 1 365 ? 31.159  57.288  2.954  1.00 102.89 ? 440 LEU A C     1 
ATOM   2878 O  O     . LEU A 1 365 ? 31.909  56.931  2.039  1.00 93.75  ? 440 LEU A O     1 
ATOM   2879 C  CB    . LEU A 1 365 ? 29.647  59.039  2.026  1.00 87.05  ? 440 LEU A CB    1 
ATOM   2880 C  CG    . LEU A 1 365 ? 30.010  60.174  2.988  1.00 81.18  ? 440 LEU A CG    1 
ATOM   2881 C  CD1   . LEU A 1 365 ? 30.991  61.146  2.346  1.00 77.35  ? 440 LEU A CD1   1 
ATOM   2882 C  CD2   . LEU A 1 365 ? 28.760  60.902  3.468  1.00 72.86  ? 440 LEU A CD2   1 
ATOM   2883 N  N     . HIS A 1 366 ? 31.566  57.368  4.221  1.00 107.15 ? 441 HIS A N     1 
ATOM   2884 C  CA    . HIS A 1 366 ? 32.984  57.427  4.564  1.00 106.13 ? 441 HIS A CA    1 
ATOM   2885 C  C     . HIS A 1 366 ? 33.714  56.094  4.449  1.00 108.86 ? 441 HIS A C     1 
ATOM   2886 O  O     . HIS A 1 366 ? 34.387  55.839  3.444  1.00 127.66 ? 441 HIS A O     1 
ATOM   2887 C  CB    . HIS A 1 366 ? 33.155  57.983  5.978  1.00 93.01  ? 441 HIS A CB    1 
ATOM   2888 C  CG    . HIS A 1 366 ? 32.907  59.455  6.077  1.00 89.39  ? 441 HIS A CG    1 
ATOM   2889 N  ND1   . HIS A 1 366 ? 31.648  60.006  5.976  1.00 106.13 ? 441 HIS A ND1   1 
ATOM   2890 C  CD2   . HIS A 1 366 ? 33.759  60.492  6.254  1.00 96.13  ? 441 HIS A CD2   1 
ATOM   2891 C  CE1   . HIS A 1 366 ? 31.734  61.319  6.093  1.00 110.57 ? 441 HIS A CE1   1 
ATOM   2892 N  NE2   . HIS A 1 366 ? 33.004  61.640  6.262  1.00 108.23 ? 441 HIS A NE2   1 
ATOM   2893 N  N     . MET A 1 367 ? 33.597  55.240  5.467  1.00 93.00  ? 442 MET A N     1 
ATOM   2894 C  CA    . MET A 1 367 ? 34.458  54.067  5.601  1.00 90.31  ? 442 MET A CA    1 
ATOM   2895 C  C     . MET A 1 367 ? 34.238  53.025  4.509  1.00 115.49 ? 442 MET A C     1 
ATOM   2896 O  O     . MET A 1 367 ? 34.466  51.829  4.738  1.00 111.28 ? 442 MET A O     1 
ATOM   2897 C  CB    . MET A 1 367 ? 34.244  53.421  6.969  1.00 98.37  ? 442 MET A CB    1 
ATOM   2898 C  CG    . MET A 1 367 ? 34.032  54.418  8.091  1.00 94.69  ? 442 MET A CG    1 
ATOM   2899 S  SD    . MET A 1 367 ? 33.562  53.612  9.631  1.00 98.43  ? 442 MET A SD    1 
ATOM   2900 C  CE    . MET A 1 367 ? 35.101  52.814  10.062 1.00 94.75  ? 442 MET A CE    1 
ATOM   2901 N  N     . GLN A 1 368 ? 33.806  53.473  3.323  1.00 136.11 ? 443 GLN A N     1 
ATOM   2902 C  CA    . GLN A 1 368 ? 33.615  52.590  2.178  1.00 136.71 ? 443 GLN A CA    1 
ATOM   2903 C  C     . GLN A 1 368 ? 34.850  51.751  1.881  1.00 126.02 ? 443 GLN A C     1 
ATOM   2904 O  O     . GLN A 1 368 ? 34.734  50.677  1.280  1.00 126.72 ? 443 GLN A O     1 
ATOM   2905 C  CB    . GLN A 1 368 ? 33.232  53.437  0.952  1.00 125.91 ? 443 GLN A CB    1 
ATOM   2906 C  CG    . GLN A 1 368 ? 33.077  52.676  -0.357 1.00 134.64 ? 443 GLN A CG    1 
ATOM   2907 C  CD    . GLN A 1 368 ? 31.941  51.671  -0.326 1.00 134.19 ? 443 GLN A CD    1 
ATOM   2908 O  OE1   . GLN A 1 368 ? 32.032  50.602  -0.930 1.00 141.27 ? 443 GLN A OE1   1 
ATOM   2909 N  NE2   . GLN A 1 368 ? 30.861  52.013  0.368  1.00 127.23 ? 443 GLN A NE2   1 
ATOM   2910 N  N     . GLN A 1 369 ? 36.024  52.202  2.315  1.00 123.60 ? 444 GLN A N     1 
ATOM   2911 C  CA    . GLN A 1 369 ? 37.261  51.482  2.057  1.00 142.06 ? 444 GLN A CA    1 
ATOM   2912 C  C     . GLN A 1 369 ? 37.396  50.236  2.922  1.00 126.86 ? 444 GLN A C     1 
ATOM   2913 O  O     . GLN A 1 369 ? 36.652  49.264  2.759  1.00 122.93 ? 444 GLN A O     1 
ATOM   2914 C  CB    . GLN A 1 369 ? 38.465  52.399  2.278  1.00 148.23 ? 444 GLN A CB    1 
ATOM   2915 C  CG    . GLN A 1 369 ? 38.824  53.262  1.080  1.00 152.02 ? 444 GLN A CG    1 
ATOM   2916 C  CD    . GLN A 1 369 ? 40.312  53.540  0.989  1.00 140.73 ? 444 GLN A CD    1 
ATOM   2917 O  OE1   . GLN A 1 369 ? 41.034  53.455  1.984  1.00 138.38 ? 444 GLN A OE1   1 
ATOM   2918 N  NE2   . GLN A 1 369 ? 40.782  53.863  -0.212 1.00 118.41 ? 444 GLN A NE2   1 
ATOM   2919 N  N     . GLU A 1 370 ? 38.342  50.270  3.859  1.00 112.71 ? 445 GLU A N     1 
ATOM   2920 C  CA    . GLU A 1 370 ? 38.857  49.061  4.488  1.00 117.82 ? 445 GLU A CA    1 
ATOM   2921 C  C     . GLU A 1 370 ? 37.852  48.344  5.381  1.00 115.05 ? 445 GLU A C     1 
ATOM   2922 O  O     . GLU A 1 370 ? 38.090  47.182  5.728  1.00 116.06 ? 445 GLU A O     1 
ATOM   2923 C  CB    . GLU A 1 370 ? 40.104  49.403  5.309  1.00 124.78 ? 445 GLU A CB    1 
ATOM   2924 C  CG    . GLU A 1 370 ? 39.858  50.389  6.450  1.00 131.34 ? 445 GLU A CG    1 
ATOM   2925 C  CD    . GLU A 1 370 ? 39.852  51.842  5.998  1.00 142.19 ? 445 GLU A CD    1 
ATOM   2926 O  OE1   . GLU A 1 370 ? 40.302  52.118  4.866  1.00 150.14 ? 445 GLU A OE1   1 
ATOM   2927 O  OE2   . GLU A 1 370 ? 39.399  52.707  6.779  1.00 123.79 ? 445 GLU A OE2   1 
ATOM   2928 N  N     . LYS A 1 371 ? 36.743  48.978  5.751  1.00 102.74 ? 446 LYS A N     1 
ATOM   2929 C  CA    . LYS A 1 371 ? 35.956  48.488  6.876  1.00 105.92 ? 446 LYS A CA    1 
ATOM   2930 C  C     . LYS A 1 371 ? 34.674  47.763  6.501  1.00 101.62 ? 446 LYS A C     1 
ATOM   2931 O  O     . LYS A 1 371 ? 34.257  46.873  7.245  1.00 96.04  ? 446 LYS A O     1 
ATOM   2932 C  CB    . LYS A 1 371 ? 35.618  49.646  7.820  1.00 104.76 ? 446 LYS A CB    1 
ATOM   2933 C  CG    . LYS A 1 371 ? 36.835  50.144  8.569  1.00 100.53 ? 446 LYS A CG    1 
ATOM   2934 C  CD    . LYS A 1 371 ? 37.435  49.030  9.410  1.00 93.00  ? 446 LYS A CD    1 
ATOM   2935 C  CE    . LYS A 1 371 ? 38.852  49.363  9.842  1.00 93.00  ? 446 LYS A CE    1 
ATOM   2936 N  NZ    . LYS A 1 371 ? 38.937  50.722  10.437 1.00 75.49  ? 446 LYS A NZ    1 
ATOM   2937 N  N     . VAL A 1 372 ? 34.038  48.099  5.375  1.00 92.16  ? 447 VAL A N     1 
ATOM   2938 C  CA    . VAL A 1 372 ? 32.765  47.467  5.042  1.00 82.81  ? 447 VAL A CA    1 
ATOM   2939 C  C     . VAL A 1 372 ? 32.919  45.963  4.865  1.00 85.99  ? 447 VAL A C     1 
ATOM   2940 O  O     . VAL A 1 372 ? 31.925  45.231  4.912  1.00 74.47  ? 447 VAL A O     1 
ATOM   2941 C  CB    . VAL A 1 372 ? 32.150  48.107  3.782  1.00 88.52  ? 447 VAL A CB    1 
ATOM   2942 C  CG1   . VAL A 1 372 ? 32.719  47.466  2.525  1.00 98.12  ? 447 VAL A CG1   1 
ATOM   2943 C  CG2   . VAL A 1 372 ? 30.634  47.990  3.819  1.00 77.62  ? 447 VAL A CG2   1 
ATOM   2944 N  N     . ALA A 1 373 ? 34.150  45.483  4.669  1.00 85.96  ? 448 ALA A N     1 
ATOM   2945 C  CA    . ALA A 1 373 ? 34.394  44.046  4.602  1.00 70.26  ? 448 ALA A CA    1 
ATOM   2946 C  C     . ALA A 1 373 ? 34.130  43.390  5.951  1.00 82.70  ? 448 ALA A C     1 
ATOM   2947 O  O     . ALA A 1 373 ? 33.327  42.456  6.057  1.00 77.51  ? 448 ALA A O     1 
ATOM   2948 C  CB    . ALA A 1 373 ? 35.828  43.780  4.143  1.00 78.80  ? 448 ALA A CB    1 
ATOM   2949 N  N     . GLN A 1 374 ? 34.801  43.870  7.000  1.00 71.29  ? 449 GLN A N     1 
ATOM   2950 C  CA    . GLN A 1 374 ? 34.588  43.289  8.318  1.00 74.04  ? 449 GLN A CA    1 
ATOM   2951 C  C     . GLN A 1 374 ? 33.252  43.710  8.910  1.00 81.42  ? 449 GLN A C     1 
ATOM   2952 O  O     . GLN A 1 374 ? 32.697  42.989  9.745  1.00 80.03  ? 449 GLN A O     1 
ATOM   2953 C  CB    . GLN A 1 374 ? 35.728  43.672  9.255  1.00 65.10  ? 449 GLN A CB    1 
ATOM   2954 C  CG    . GLN A 1 374 ? 36.014  45.153  9.302  1.00 93.34  ? 449 GLN A CG    1 
ATOM   2955 C  CD    . GLN A 1 374 ? 37.462  45.463  8.994  1.00 106.49 ? 449 GLN A CD    1 
ATOM   2956 O  OE1   . GLN A 1 374 ? 37.900  45.360  7.847  1.00 106.04 ? 449 GLN A OE1   1 
ATOM   2957 N  NE2   . GLN A 1 374 ? 38.219  45.833  10.020 1.00 89.17  ? 449 GLN A NE2   1 
ATOM   2958 N  N     . ILE A 1 375 ? 32.720  44.860  8.490  1.00 78.31  ? 450 ILE A N     1 
ATOM   2959 C  CA    . ILE A 1 375 ? 31.427  45.309  8.998  1.00 75.21  ? 450 ILE A CA    1 
ATOM   2960 C  C     . ILE A 1 375 ? 30.303  44.441  8.444  1.00 81.73  ? 450 ILE A C     1 
ATOM   2961 O  O     . ILE A 1 375 ? 29.406  44.018  9.182  1.00 78.20  ? 450 ILE A O     1 
ATOM   2962 C  CB    . ILE A 1 375 ? 31.206  46.796  8.674  1.00 75.56  ? 450 ILE A CB    1 
ATOM   2963 C  CG1   . ILE A 1 375 ? 32.151  47.660  9.512  1.00 92.13  ? 450 ILE A CG1   1 
ATOM   2964 C  CG2   . ILE A 1 375 ? 29.757  47.188  8.922  1.00 69.60  ? 450 ILE A CG2   1 
ATOM   2965 C  CD1   . ILE A 1 375 ? 31.975  49.146  9.295  1.00 90.98  ? 450 ILE A CD1   1 
ATOM   2966 N  N     . LYS A 1 376 ? 30.326  44.169  7.137  1.00 88.21  ? 451 LYS A N     1 
ATOM   2967 C  CA    . LYS A 1 376 ? 29.363  43.223  6.583  1.00 82.82  ? 451 LYS A CA    1 
ATOM   2968 C  C     . LYS A 1 376 ? 29.523  41.856  7.232  1.00 73.97  ? 451 LYS A C     1 
ATOM   2969 O  O     . LYS A 1 376 ? 28.534  41.221  7.612  1.00 83.01  ? 451 LYS A O     1 
ATOM   2970 C  CB    . LYS A 1 376 ? 29.520  43.124  5.063  1.00 89.47  ? 451 LYS A CB    1 
ATOM   2971 C  CG    . LYS A 1 376 ? 28.389  42.371  4.361  1.00 97.66  ? 451 LYS A CG    1 
ATOM   2972 C  CD    . LYS A 1 376 ? 28.549  42.400  2.843  1.00 97.50  ? 451 LYS A CD    1 
ATOM   2973 C  CE    . LYS A 1 376 ? 27.293  41.909  2.131  1.00 86.24  ? 451 LYS A CE    1 
ATOM   2974 N  NZ    . LYS A 1 376 ? 27.466  40.556  1.532  1.00 92.49  ? 451 LYS A NZ    1 
ATOM   2975 N  N     . GLU A 1 377 ? 30.767  41.400  7.393  1.00 71.61  ? 452 GLU A N     1 
ATOM   2976 C  CA    . GLU A 1 377 ? 31.011  40.132  8.070  1.00 72.81  ? 452 GLU A CA    1 
ATOM   2977 C  C     . GLU A 1 377 ? 30.515  40.170  9.511  1.00 78.00  ? 452 GLU A C     1 
ATOM   2978 O  O     . GLU A 1 377 ? 30.006  39.169  10.030 1.00 73.08  ? 452 GLU A O     1 
ATOM   2979 C  CB    . GLU A 1 377 ? 32.500  39.797  8.025  1.00 67.89  ? 452 GLU A CB    1 
ATOM   2980 C  CG    . GLU A 1 377 ? 32.863  38.543  8.783  1.00 52.91  ? 452 GLU A CG    1 
ATOM   2981 C  CD    . GLU A 1 377 ? 34.113  38.721  9.603  1.00 77.40  ? 452 GLU A CD    1 
ATOM   2982 O  OE1   . GLU A 1 377 ? 35.074  37.950  9.399  1.00 75.59  ? 452 GLU A OE1   1 
ATOM   2983 O  OE2   . GLU A 1 377 ? 34.136  39.644  10.446 1.00 84.35  ? 452 GLU A OE2   1 
ATOM   2984 N  N     . PHE A 1 378 ? 30.647  41.321  10.170 1.00 83.12  ? 453 PHE A N     1 
ATOM   2985 C  CA    . PHE A 1 378 ? 30.171  41.458  11.542 1.00 80.26  ? 453 PHE A CA    1 
ATOM   2986 C  C     . PHE A 1 378 ? 28.654  41.611  11.599 1.00 80.38  ? 453 PHE A C     1 
ATOM   2987 O  O     . PHE A 1 378 ? 27.994  40.964  12.420 1.00 77.89  ? 453 PHE A O     1 
ATOM   2988 C  CB    . PHE A 1 378 ? 30.870  42.648  12.209 1.00 75.39  ? 453 PHE A CB    1 
ATOM   2989 C  CG    . PHE A 1 378 ? 30.303  43.031  13.551 1.00 84.10  ? 453 PHE A CG    1 
ATOM   2990 C  CD1   . PHE A 1 378 ? 30.765  42.428  14.711 1.00 65.47  ? 453 PHE A CD1   1 
ATOM   2991 C  CD2   . PHE A 1 378 ? 29.329  44.019  13.654 1.00 83.55  ? 453 PHE A CD2   1 
ATOM   2992 C  CE1   . PHE A 1 378 ? 30.252  42.790  15.950 1.00 61.31  ? 453 PHE A CE1   1 
ATOM   2993 C  CE2   . PHE A 1 378 ? 28.810  44.383  14.887 1.00 55.67  ? 453 PHE A CE2   1 
ATOM   2994 C  CZ    . PHE A 1 378 ? 29.272  43.767  16.037 1.00 61.02  ? 453 PHE A CZ    1 
ATOM   2995 N  N     . CYS A 1 379 ? 28.081  42.451  10.732 1.00 80.67  ? 454 CYS A N     1 
ATOM   2996 C  CA    . CYS A 1 379 ? 26.645  42.712  10.799 1.00 77.08  ? 454 CYS A CA    1 
ATOM   2997 C  C     . CYS A 1 379 ? 25.834  41.468  10.460 1.00 88.25  ? 454 CYS A C     1 
ATOM   2998 O  O     . CYS A 1 379 ? 24.787  41.222  11.069 1.00 100.55 ? 454 CYS A O     1 
ATOM   2999 C  CB    . CYS A 1 379 ? 26.271  43.864  9.866  1.00 88.75  ? 454 CYS A CB    1 
ATOM   3000 S  SG    . CYS A 1 379 ? 26.748  45.506  10.462 1.00 87.28  ? 454 CYS A SG    1 
ATOM   3001 N  N     . LEU A 1 380 ? 26.298  40.672  9.492  1.00 88.65  ? 455 LEU A N     1 
ATOM   3002 C  CA    . LEU A 1 380 ? 25.558  39.476  9.100  1.00 86.95  ? 455 LEU A CA    1 
ATOM   3003 C  C     . LEU A 1 380 ? 25.522  38.449  10.226 1.00 85.19  ? 455 LEU A C     1 
ATOM   3004 O  O     . LEU A 1 380 ? 24.503  37.777  10.428 1.00 79.73  ? 455 LEU A O     1 
ATOM   3005 C  CB    . LEU A 1 380 ? 26.172  38.862  7.840  1.00 83.71  ? 455 LEU A CB    1 
ATOM   3006 C  CG    . LEU A 1 380 ? 26.020  39.640  6.532  1.00 80.57  ? 455 LEU A CG    1 
ATOM   3007 C  CD1   . LEU A 1 380 ? 26.747  38.933  5.396  1.00 87.81  ? 455 LEU A CD1   1 
ATOM   3008 C  CD2   . LEU A 1 380 ? 24.555  39.833  6.198  1.00 85.92  ? 455 LEU A CD2   1 
ATOM   3009 N  N     . SER A 1 381 ? 26.626  38.310  10.963 1.00 77.47  ? 456 SER A N     1 
ATOM   3010 C  CA    . SER A 1 381 ? 26.669  37.356  12.066 1.00 69.25  ? 456 SER A CA    1 
ATOM   3011 C  C     . SER A 1 381 ? 25.722  37.757  13.191 1.00 88.37  ? 456 SER A C     1 
ATOM   3012 O  O     . SER A 1 381 ? 25.103  36.894  13.825 1.00 77.43  ? 456 SER A O     1 
ATOM   3013 C  CB    . SER A 1 381 ? 28.099  37.232  12.587 1.00 53.55  ? 456 SER A CB    1 
ATOM   3014 O  OG    . SER A 1 381 ? 28.154  36.408  13.737 1.00 69.19  ? 456 SER A OG    1 
ATOM   3015 N  N     . LYS A 1 382 ? 25.585  39.062  13.445 1.00 93.20  ? 457 LYS A N     1 
ATOM   3016 C  CA    . LYS A 1 382 ? 24.756  39.536  14.548 1.00 90.54  ? 457 LYS A CA    1 
ATOM   3017 C  C     . LYS A 1 382 ? 23.269  39.481  14.221 1.00 83.23  ? 457 LYS A C     1 
ATOM   3018 O  O     . LYS A 1 382 ? 22.456  39.229  15.116 1.00 78.34  ? 457 LYS A O     1 
ATOM   3019 C  CB    . LYS A 1 382 ? 25.163  40.959  14.937 1.00 90.85  ? 457 LYS A CB    1 
ATOM   3020 C  CG    . LYS A 1 382 ? 26.285  41.023  15.965 1.00 79.69  ? 457 LYS A CG    1 
ATOM   3021 C  CD    . LYS A 1 382 ? 25.751  40.833  17.376 1.00 98.00  ? 457 LYS A CD    1 
ATOM   3022 C  CE    . LYS A 1 382 ? 26.857  40.425  18.329 1.00 90.14  ? 457 LYS A CE    1 
ATOM   3023 N  NZ    . LYS A 1 382 ? 27.381  39.076  17.982 1.00 94.50  ? 457 LYS A NZ    1 
ATOM   3024 N  N     . MET A 1 383 ? 22.894  39.724  12.961 1.00 81.68  ? 458 MET A N     1 
ATOM   3025 C  CA    . MET A 1 383 ? 21.519  39.484  12.536 1.00 81.52  ? 458 MET A CA    1 
ATOM   3026 C  C     . MET A 1 383 ? 21.173  38.001  12.546 1.00 83.05  ? 458 MET A C     1 
ATOM   3027 O  O     . MET A 1 383 ? 19.989  37.648  12.597 1.00 64.15  ? 458 MET A O     1 
ATOM   3028 C  CB    . MET A 1 383 ? 21.286  40.065  11.139 1.00 58.92  ? 458 MET A CB    1 
ATOM   3029 C  CG    . MET A 1 383 ? 21.151  41.578  11.108 1.00 74.26  ? 458 MET A CG    1 
ATOM   3030 S  SD    . MET A 1 383 ? 20.980  42.242  9.441  1.00 93.64  ? 458 MET A SD    1 
ATOM   3031 C  CE    . MET A 1 383 ? 22.615  41.946  8.769  1.00 75.50  ? 458 MET A CE    1 
ATOM   3032 N  N     . GLU A 1 384 ? 22.184  37.131  12.503 1.00 85.53  ? 459 GLU A N     1 
ATOM   3033 C  CA    . GLU A 1 384 ? 21.955  35.693  12.513 1.00 69.23  ? 459 GLU A CA    1 
ATOM   3034 C  C     . GLU A 1 384 ? 21.594  35.194  13.907 1.00 79.99  ? 459 GLU A C     1 
ATOM   3035 O  O     . GLU A 1 384 ? 20.672  34.385  14.057 1.00 87.11  ? 459 GLU A O     1 
ATOM   3036 C  CB    . GLU A 1 384 ? 23.197  34.976  11.981 1.00 76.66  ? 459 GLU A CB    1 
ATOM   3037 C  CG    . GLU A 1 384 ? 22.922  33.692  11.216 1.00 88.63  ? 459 GLU A CG    1 
ATOM   3038 C  CD    . GLU A 1 384 ? 24.103  33.280  10.353 1.00 119.78 ? 459 GLU A CD    1 
ATOM   3039 O  OE1   . GLU A 1 384 ? 24.655  34.152  9.648  1.00 130.82 ? 459 GLU A OE1   1 
ATOM   3040 O  OE2   . GLU A 1 384 ? 24.486  32.091  10.385 1.00 121.95 ? 459 GLU A OE2   1 
ATOM   3041 N  N     . ASP A 1 385 ? 22.298  35.671  14.938 1.00 79.53  ? 460 ASP A N     1 
ATOM   3042 C  CA    . ASP A 1 385 ? 21.973  35.265  16.301 1.00 75.24  ? 460 ASP A CA    1 
ATOM   3043 C  C     . ASP A 1 385 ? 20.646  35.854  16.765 1.00 78.15  ? 460 ASP A C     1 
ATOM   3044 O  O     . ASP A 1 385 ? 20.012  35.306  17.674 1.00 78.44  ? 460 ASP A O     1 
ATOM   3045 C  CB    . ASP A 1 385 ? 23.092  35.675  17.255 1.00 77.83  ? 460 ASP A CB    1 
ATOM   3046 C  CG    . ASP A 1 385 ? 24.411  35.021  16.918 1.00 91.97  ? 460 ASP A CG    1 
ATOM   3047 O  OD1   . ASP A 1 385 ? 25.276  35.704  16.333 1.00 89.67  ? 460 ASP A OD1   1 
ATOM   3048 O  OD2   . ASP A 1 385 ? 24.580  33.824  17.235 1.00 107.89 ? 460 ASP A OD2   1 
ATOM   3049 N  N     . LEU A 1 386 ? 20.218  36.969  16.164 1.00 86.36  ? 461 LEU A N     1 
ATOM   3050 C  CA    . LEU A 1 386 ? 18.921  37.552  16.500 1.00 91.94  ? 461 LEU A CA    1 
ATOM   3051 C  C     . LEU A 1 386 ? 17.780  36.637  16.064 1.00 88.56  ? 461 LEU A C     1 
ATOM   3052 O  O     . LEU A 1 386 ? 16.798  36.466  16.797 1.00 73.94  ? 461 LEU A O     1 
ATOM   3053 C  CB    . LEU A 1 386 ? 18.785  38.936  15.854 1.00 105.34 ? 461 LEU A CB    1 
ATOM   3054 C  CG    . LEU A 1 386 ? 19.246  40.205  16.593 1.00 121.79 ? 461 LEU A CG    1 
ATOM   3055 C  CD1   . LEU A 1 386 ? 20.515  39.992  17.415 1.00 110.16 ? 461 LEU A CD1   1 
ATOM   3056 C  CD2   . LEU A 1 386 ? 19.441  41.359  15.603 1.00 105.33 ? 461 LEU A CD2   1 
ATOM   3057 N  N     . GLU A 1 387 ? 17.894  36.038  14.876 1.00 95.12  ? 462 GLU A N     1 
ATOM   3058 C  CA    . GLU A 1 387 ? 16.894  35.076  14.421 1.00 97.14  ? 462 GLU A CA    1 
ATOM   3059 C  C     . GLU A 1 387 ? 16.941  33.797  15.251 1.00 94.85  ? 462 GLU A C     1 
ATOM   3060 O  O     . GLU A 1 387 ? 15.897  33.269  15.653 1.00 87.85  ? 462 GLU A O     1 
ATOM   3061 C  CB    . GLU A 1 387 ? 17.110  34.763  12.941 1.00 101.65 ? 462 GLU A CB    1 
ATOM   3062 C  CG    . GLU A 1 387 ? 16.957  35.962  12.024 1.00 103.61 ? 462 GLU A CG    1 
ATOM   3063 C  CD    . GLU A 1 387 ? 15.758  35.838  11.106 1.00 112.30 ? 462 GLU A CD    1 
ATOM   3064 O  OE1   . GLU A 1 387 ? 15.149  34.748  11.063 1.00 104.79 ? 462 GLU A OE1   1 
ATOM   3065 O  OE2   . GLU A 1 387 ? 15.426  36.832  10.428 1.00 118.91 ? 462 GLU A OE2   1 
ATOM   3066 N  N     . LEU A 1 388 ? 18.148  33.279  15.503 1.00 83.87  ? 463 LEU A N     1 
ATOM   3067 C  CA    . LEU A 1 388 ? 18.310  32.088  16.334 1.00 80.01  ? 463 LEU A CA    1 
ATOM   3068 C  C     . LEU A 1 388 ? 17.567  32.229  17.657 1.00 91.81  ? 463 LEU A C     1 
ATOM   3069 O  O     . LEU A 1 388 ? 16.871  31.308  18.096 1.00 84.71  ? 463 LEU A O     1 
ATOM   3070 C  CB    . LEU A 1 388 ? 19.803  31.827  16.564 1.00 91.14  ? 463 LEU A CB    1 
ATOM   3071 C  CG    . LEU A 1 388 ? 20.330  30.789  17.561 1.00 105.79 ? 463 LEU A CG    1 
ATOM   3072 C  CD1   . LEU A 1 388 ? 21.704  30.328  17.109 1.00 109.60 ? 463 LEU A CD1   1 
ATOM   3073 C  CD2   . LEU A 1 388 ? 20.413  31.332  18.986 1.00 103.40 ? 463 LEU A CD2   1 
ATOM   3074 N  N     . ILE A 1 389 ? 17.701  33.389  18.300 1.00 96.77  ? 464 ILE A N     1 
ATOM   3075 C  CA    . ILE A 1 389 ? 17.040  33.624  19.580 1.00 90.55  ? 464 ILE A CA    1 
ATOM   3076 C  C     . ILE A 1 389 ? 15.532  33.753  19.397 1.00 86.13  ? 464 ILE A C     1 
ATOM   3077 O  O     . ILE A 1 389 ? 14.749  33.209  20.186 1.00 89.74  ? 464 ILE A O     1 
ATOM   3078 C  CB    . ILE A 1 389 ? 17.636  34.871  20.263 1.00 86.99  ? 464 ILE A CB    1 
ATOM   3079 C  CG1   . ILE A 1 389 ? 18.960  34.528  20.953 1.00 86.27  ? 464 ILE A CG1   1 
ATOM   3080 C  CG2   . ILE A 1 389 ? 16.646  35.474  21.252 1.00 75.40  ? 464 ILE A CG2   1 
ATOM   3081 C  CD1   . ILE A 1 389 ? 18.796  33.726  22.230 1.00 89.49  ? 464 ILE A CD1   1 
ATOM   3082 N  N     . ASN A 1 390 ? 15.096  34.467  18.358 1.00 73.96  ? 465 ASN A N     1 
ATOM   3083 C  CA    . ASN A 1 390 ? 13.676  34.765  18.209 1.00 91.06  ? 465 ASN A CA    1 
ATOM   3084 C  C     . ASN A 1 390 ? 12.861  33.580  17.705 1.00 97.90  ? 465 ASN A C     1 
ATOM   3085 O  O     . ASN A 1 390 ? 11.639  33.566  17.892 1.00 97.36  ? 465 ASN A O     1 
ATOM   3086 C  CB    . ASN A 1 390 ? 13.477  35.964  17.278 1.00 98.85  ? 465 ASN A CB    1 
ATOM   3087 C  CG    . ASN A 1 390 ? 13.395  37.282  18.033 1.00 96.72  ? 465 ASN A CG    1 
ATOM   3088 O  OD1   . ASN A 1 390 ? 12.931  37.331  19.175 1.00 78.55  ? 465 ASN A OD1   1 
ATOM   3089 N  ND2   . ASN A 1 390 ? 13.843  38.359  17.396 1.00 97.33  ? 465 ASN A ND2   1 
ATOM   3090 N  N     . ARG A 1 391 ? 13.494  32.591  17.070 1.00 89.61  ? 466 ARG A N     1 
ATOM   3091 C  CA    . ARG A 1 391 ? 12.753  31.388  16.708 1.00 68.79  ? 466 ARG A CA    1 
ATOM   3092 C  C     . ARG A 1 391 ? 12.445  30.545  17.936 1.00 73.61  ? 466 ARG A C     1 
ATOM   3093 O  O     . ARG A 1 391 ? 11.386  29.908  17.998 1.00 78.96  ? 466 ARG A O     1 
ATOM   3094 C  CB    . ARG A 1 391 ? 13.527  30.577  15.670 1.00 79.35  ? 466 ARG A CB    1 
ATOM   3095 C  CG    . ARG A 1 391 ? 13.730  31.316  14.359 1.00 90.72  ? 466 ARG A CG    1 
ATOM   3096 C  CD    . ARG A 1 391 ? 13.821  30.369  13.176 1.00 85.11  ? 466 ARG A CD    1 
ATOM   3097 N  NE    . ARG A 1 391 ? 14.074  31.095  11.935 1.00 94.87  ? 466 ARG A NE    1 
ATOM   3098 C  CZ    . ARG A 1 391 ? 15.282  31.276  11.411 1.00 95.49  ? 466 ARG A CZ    1 
ATOM   3099 N  NH1   . ARG A 1 391 ? 16.352  30.773  12.015 1.00 77.89  ? 466 ARG A NH1   1 
ATOM   3100 N  NH2   . ARG A 1 391 ? 15.422  31.955  10.280 1.00 95.85  ? 466 ARG A NH2   1 
ATOM   3101 N  N     . MET A 1 392 ? 13.344  30.546  18.926 1.00 77.77  ? 467 MET A N     1 
ATOM   3102 C  CA    . MET A 1 392 ? 13.058  29.910  20.206 1.00 75.61  ? 467 MET A CA    1 
ATOM   3103 C  C     . MET A 1 392 ? 11.918  30.603  20.940 1.00 76.46  ? 467 MET A C     1 
ATOM   3104 O  O     . MET A 1 392 ? 11.315  30.006  21.841 1.00 71.90  ? 467 MET A O     1 
ATOM   3105 C  CB    . MET A 1 392 ? 14.314  29.903  21.077 1.00 85.09  ? 467 MET A CB    1 
ATOM   3106 C  CG    . MET A 1 392 ? 15.564  29.395  20.368 1.00 107.96 ? 467 MET A CG    1 
ATOM   3107 S  SD    . MET A 1 392 ? 15.553  27.628  20.005 1.00 97.47  ? 467 MET A SD    1 
ATOM   3108 C  CE    . MET A 1 392 ? 16.946  27.525  18.881 1.00 95.82  ? 467 MET A CE    1 
ATOM   3109 N  N     . SER A 1 393 ? 11.624  31.856  20.586 1.00 82.13  ? 468 SER A N     1 
ATOM   3110 C  CA    . SER A 1 393 ? 10.408  32.532  21.030 1.00 82.81  ? 468 SER A CA    1 
ATOM   3111 C  C     . SER A 1 393 ? 9.260   32.041  20.150 1.00 81.25  ? 468 SER A C     1 
ATOM   3112 O  O     . SER A 1 393 ? 8.866   32.666  19.160 1.00 74.34  ? 468 SER A O     1 
ATOM   3113 C  CB    . SER A 1 393 ? 10.568  34.043  20.957 1.00 71.36  ? 468 SER A CB    1 
ATOM   3114 O  OG    . SER A 1 393 ? 11.538  34.498  21.884 1.00 70.64  ? 468 SER A OG    1 
ATOM   3115 N  N     . SER A 1 394 ? 8.733   30.873  20.518 1.00 85.58  ? 469 SER A N     1 
ATOM   3116 C  CA    . SER A 1 394 ? 7.630   30.248  19.799 1.00 79.97  ? 469 SER A CA    1 
ATOM   3117 C  C     . SER A 1 394 ? 7.011   29.163  20.668 1.00 100.29 ? 469 SER A C     1 
ATOM   3118 O  O     . SER A 1 394 ? 6.095   28.455  20.239 1.00 112.07 ? 469 SER A O     1 
ATOM   3119 C  CB    . SER A 1 394 ? 8.108   29.661  18.472 1.00 74.88  ? 469 SER A CB    1 
ATOM   3120 O  OG    . SER A 1 394 ? 9.075   28.651  18.690 1.00 74.61  ? 469 SER A OG    1 
ATOM   3121 N  N     . PHE A 1 395 ? 7.509   29.028  21.891 1.00 101.74 ? 470 PHE A N     1 
ATOM   3122 C  CA    . PHE A 1 395 ? 7.021   28.000  22.797 1.00 105.35 ? 470 PHE A CA    1 
ATOM   3123 C  C     . PHE A 1 395 ? 6.341   28.643  23.999 1.00 87.26  ? 470 PHE A C     1 
ATOM   3124 O  O     . PHE A 1 395 ? 5.729   29.705  23.873 1.00 75.41  ? 470 PHE A O     1 
ATOM   3125 C  CB    . PHE A 1 395 ? 8.169   27.090  23.241 1.00 103.77 ? 470 PHE A CB    1 
ATOM   3126 C  CG    . PHE A 1 395 ? 8.700   26.197  22.144 1.00 108.72 ? 470 PHE A CG    1 
ATOM   3127 C  CD1   . PHE A 1 395 ? 9.349   26.734  21.043 1.00 83.82  ? 470 PHE A CD1   1 
ATOM   3128 C  CD2   . PHE A 1 395 ? 8.559   24.819  22.222 1.00 116.17 ? 470 PHE A CD2   1 
ATOM   3129 C  CE1   . PHE A 1 395 ? 9.836   25.916  20.034 1.00 70.88  ? 470 PHE A CE1   1 
ATOM   3130 C  CE2   . PHE A 1 395 ? 9.051   23.994  21.216 1.00 93.34  ? 470 PHE A CE2   1 
ATOM   3131 C  CZ    . PHE A 1 395 ? 9.689   24.545  20.123 1.00 61.88  ? 470 PHE A CZ    1 
ATOM   3132 N  N     . PRO A 1 422 ? 14.223  36.298  -1.391 1.00 163.17 ? 517 PRO A N     1 
ATOM   3133 C  CA    . PRO A 1 422 ? 13.921  37.733  -1.395 1.00 155.57 ? 517 PRO A CA    1 
ATOM   3134 C  C     . PRO A 1 422 ? 14.145  38.416  -0.041 1.00 155.68 ? 517 PRO A C     1 
ATOM   3135 O  O     . PRO A 1 422 ? 13.890  37.808  1.000  1.00 156.01 ? 517 PRO A O     1 
ATOM   3136 C  CB    . PRO A 1 422 ? 12.444  37.763  -1.787 1.00 140.30 ? 517 PRO A CB    1 
ATOM   3137 C  CG    . PRO A 1 422 ? 12.296  36.587  -2.696 1.00 133.32 ? 517 PRO A CG    1 
ATOM   3138 C  CD    . PRO A 1 422 ? 13.227  35.524  -2.155 1.00 150.28 ? 517 PRO A CD    1 
ATOM   3139 N  N     . VAL A 1 423 ? 14.598  39.675  -0.089 1.00 148.37 ? 518 VAL A N     1 
ATOM   3140 C  CA    . VAL A 1 423 ? 14.934  40.524  1.058  1.00 128.30 ? 518 VAL A CA    1 
ATOM   3141 C  C     . VAL A 1 423 ? 15.569  39.713  2.189  1.00 119.86 ? 518 VAL A C     1 
ATOM   3142 O  O     . VAL A 1 423 ? 14.974  39.505  3.252  1.00 114.66 ? 518 VAL A O     1 
ATOM   3143 C  CB    . VAL A 1 423 ? 13.706  41.346  1.527  1.00 119.59 ? 518 VAL A CB    1 
ATOM   3144 C  CG1   . VAL A 1 423 ? 12.516  40.471  1.959  1.00 114.11 ? 518 VAL A CG1   1 
ATOM   3145 C  CG2   . VAL A 1 423 ? 14.095  42.359  2.611  1.00 112.80 ? 518 VAL A CG2   1 
ATOM   3146 N  N     . SER A 1 424 ? 16.773  39.263  1.960  1.00 114.51 ? 519 SER A N     1 
ATOM   3147 C  CA    . SER A 1 424 ? 17.584  38.588  2.969  1.00 113.60 ? 519 SER A CA    1 
ATOM   3148 C  C     . SER A 1 424 ? 18.503  39.564  3.666  1.00 126.50 ? 519 SER A C     1 
ATOM   3149 O  O     . SER A 1 424 ? 18.667  40.703  3.196  1.00 137.65 ? 519 SER A O     1 
ATOM   3150 C  CB    . SER A 1 424 ? 18.373  37.410  2.344  1.00 126.21 ? 519 SER A CB    1 
ATOM   3151 O  OG    . SER A 1 424 ? 19.331  37.836  1.369  1.00 131.75 ? 519 SER A OG    1 
ATOM   3152 N  N     . PRO A 1 425 ? 19.108  39.202  4.800  1.00 119.36 ? 520 PRO A N     1 
ATOM   3153 C  CA    . PRO A 1 425 ? 20.010  40.156  5.478  1.00 104.36 ? 520 PRO A CA    1 
ATOM   3154 C  C     . PRO A 1 425 ? 21.155  40.652  4.608  1.00 112.96 ? 520 PRO A C     1 
ATOM   3155 O  O     . PRO A 1 425 ? 21.421  41.861  4.578  1.00 106.36 ? 520 PRO A O     1 
ATOM   3156 C  CB    . PRO A 1 425 ? 20.511  39.351  6.684  1.00 102.94 ? 520 PRO A CB    1 
ATOM   3157 C  CG    . PRO A 1 425 ? 19.412  38.402  6.972  1.00 97.84  ? 520 PRO A CG    1 
ATOM   3158 C  CD    . PRO A 1 425 ? 18.837  38.019  5.637  1.00 105.38 ? 520 PRO A CD    1 
ATOM   3159 N  N     . SER A 1 426 ? 21.849  39.754  3.899  1.00 115.36 ? 521 SER A N     1 
ATOM   3160 C  CA    . SER A 1 426 ? 22.945  40.183  3.035  1.00 102.74 ? 521 SER A CA    1 
ATOM   3161 C  C     . SER A 1 426 ? 22.461  41.082  1.906  1.00 104.54 ? 521 SER A C     1 
ATOM   3162 O  O     . SER A 1 426 ? 23.251  41.868  1.370  1.00 100.39 ? 521 SER A O     1 
ATOM   3163 C  CB    . SER A 1 426 ? 23.680  38.967  2.469  1.00 97.35  ? 521 SER A CB    1 
ATOM   3164 O  OG    . SER A 1 426 ? 25.080  39.191  2.444  1.00 95.20  ? 521 SER A OG    1 
ATOM   3165 N  N     . ASP A 1 427 ? 21.183  40.976  1.534  1.00 119.83 ? 522 ASP A N     1 
ATOM   3166 C  CA    . ASP A 1 427 ? 20.565  41.949  0.640  1.00 129.47 ? 522 ASP A CA    1 
ATOM   3167 C  C     . ASP A 1 427 ? 20.149  43.202  1.406  1.00 121.20 ? 522 ASP A C     1 
ATOM   3168 O  O     . ASP A 1 427 ? 20.476  44.323  1.001  1.00 118.06 ? 522 ASP A O     1 
ATOM   3169 C  CB    . ASP A 1 427 ? 19.354  41.325  -0.065 1.00 131.33 ? 522 ASP A CB    1 
ATOM   3170 C  CG    . ASP A 1 427 ? 19.746  40.351  -1.169 1.00 134.51 ? 522 ASP A CG    1 
ATOM   3171 O  OD1   . ASP A 1 427 ? 18.917  40.120  -2.076 1.00 120.71 ? 522 ASP A OD1   1 
ATOM   3172 O  OD2   . ASP A 1 427 ? 20.876  39.818  -1.134 1.00 132.97 ? 522 ASP A OD2   1 
ATOM   3173 N  N     . GLU A 1 428 ? 19.433  43.023  2.523  1.00 124.04 ? 523 GLU A N     1 
ATOM   3174 C  CA    . GLU A 1 428 ? 18.999  44.156  3.337  1.00 115.14 ? 523 GLU A CA    1 
ATOM   3175 C  C     . GLU A 1 428 ? 20.180  44.990  3.819  1.00 111.34 ? 523 GLU A C     1 
ATOM   3176 O  O     . GLU A 1 428 ? 20.037  46.199  4.039  1.00 90.65  ? 523 GLU A O     1 
ATOM   3177 C  CB    . GLU A 1 428 ? 18.173  43.651  4.521  1.00 96.87  ? 523 GLU A CB    1 
ATOM   3178 C  CG    . GLU A 1 428 ? 17.693  44.728  5.474  1.00 89.99  ? 523 GLU A CG    1 
ATOM   3179 C  CD    . GLU A 1 428 ? 16.511  44.271  6.304  1.00 100.35 ? 523 GLU A CD    1 
ATOM   3180 O  OE1   . GLU A 1 428 ? 15.603  43.634  5.731  1.00 120.40 ? 523 GLU A OE1   1 
ATOM   3181 O  OE2   . GLU A 1 428 ? 16.492  44.537  7.523  1.00 90.55  ? 523 GLU A OE2   1 
ATOM   3182 N  N     . PHE A 1 429 ? 21.349  44.364  3.985  1.00 112.61 ? 524 PHE A N     1 
ATOM   3183 C  CA    . PHE A 1 429 ? 22.562  45.110  4.305  1.00 93.02  ? 524 PHE A CA    1 
ATOM   3184 C  C     . PHE A 1 429 ? 22.917  46.081  3.184  1.00 100.71 ? 524 PHE A C     1 
ATOM   3185 O  O     . PHE A 1 429 ? 23.108  47.279  3.420  1.00 103.73 ? 524 PHE A O     1 
ATOM   3186 C  CB    . PHE A 1 429 ? 23.714  44.134  4.565  1.00 105.12 ? 524 PHE A CB    1 
ATOM   3187 C  CG    . PHE A 1 429 ? 25.038  44.799  4.844  1.00 103.80 ? 524 PHE A CG    1 
ATOM   3188 C  CD1   . PHE A 1 429 ? 25.407  45.124  6.140  1.00 99.51  ? 524 PHE A CD1   1 
ATOM   3189 C  CD2   . PHE A 1 429 ? 25.924  45.076  3.812  1.00 90.60  ? 524 PHE A CD2   1 
ATOM   3190 C  CE1   . PHE A 1 429 ? 26.626  45.726  6.401  1.00 89.61  ? 524 PHE A CE1   1 
ATOM   3191 C  CE2   . PHE A 1 429 ? 27.142  45.681  4.066  1.00 87.37  ? 524 PHE A CE2   1 
ATOM   3192 C  CZ    . PHE A 1 429 ? 27.493  46.006  5.362  1.00 85.22  ? 524 PHE A CZ    1 
ATOM   3193 N  N     . GLU A 1 430 ? 23.005  45.578  1.949  1.00 104.08 ? 525 GLU A N     1 
ATOM   3194 C  CA    . GLU A 1 430 ? 23.395  46.420  0.824  1.00 92.86  ? 525 GLU A CA    1 
ATOM   3195 C  C     . GLU A 1 430 ? 22.290  47.384  0.405  1.00 91.13  ? 525 GLU A C     1 
ATOM   3196 O  O     . GLU A 1 430 ? 22.586  48.409  -0.219 1.00 72.13  ? 525 GLU A O     1 
ATOM   3197 C  CB    . GLU A 1 430 ? 23.810  45.543  -0.360 1.00 82.32  ? 525 GLU A CB    1 
ATOM   3198 C  CG    . GLU A 1 430 ? 24.938  44.557  -0.054 1.00 70.83  ? 525 GLU A CG    1 
ATOM   3199 C  CD    . GLU A 1 430 ? 26.321  45.185  -0.149 1.00 92.70  ? 525 GLU A CD    1 
ATOM   3200 O  OE1   . GLU A 1 430 ? 26.416  46.371  -0.531 1.00 82.36  ? 525 GLU A OE1   1 
ATOM   3201 O  OE2   . GLU A 1 430 ? 27.316  44.490  0.154  1.00 94.61  ? 525 GLU A OE2   1 
ATOM   3202 N  N     . PHE A 1 431 ? 21.027  47.080  0.727  1.00 106.33 ? 526 PHE A N     1 
ATOM   3203 C  CA    . PHE A 1 431 ? 19.936  48.005  0.423  1.00 107.41 ? 526 PHE A CA    1 
ATOM   3204 C  C     . PHE A 1 431 ? 20.066  49.292  1.225  1.00 98.72  ? 526 PHE A C     1 
ATOM   3205 O  O     . PHE A 1 431 ? 19.786  50.383  0.713  1.00 98.33  ? 526 PHE A O     1 
ATOM   3206 C  CB    . PHE A 1 431 ? 18.586  47.343  0.701  1.00 116.76 ? 526 PHE A CB    1 
ATOM   3207 C  CG    . PHE A 1 431 ? 18.210  46.286  -0.299 1.00 129.15 ? 526 PHE A CG    1 
ATOM   3208 C  CD1   . PHE A 1 431 ? 17.573  45.126  0.109  1.00 128.44 ? 526 PHE A CD1   1 
ATOM   3209 C  CD2   . PHE A 1 431 ? 18.483  46.458  -1.647 1.00 127.98 ? 526 PHE A CD2   1 
ATOM   3210 C  CE1   . PHE A 1 431 ? 17.225  44.150  -0.807 1.00 126.46 ? 526 PHE A CE1   1 
ATOM   3211 C  CE2   . PHE A 1 431 ? 18.136  45.488  -2.569 1.00 116.24 ? 526 PHE A CE2   1 
ATOM   3212 C  CZ    . PHE A 1 431 ? 17.506  44.332  -2.148 1.00 124.82 ? 526 PHE A CZ    1 
ATOM   3213 N  N     . TYR A 1 432 ? 20.469  49.181  2.493  1.00 101.91 ? 527 TYR A N     1 
ATOM   3214 C  CA    . TYR A 1 432 ? 20.768  50.368  3.287  1.00 104.61 ? 527 TYR A CA    1 
ATOM   3215 C  C     . TYR A 1 432 ? 22.010  51.076  2.766  1.00 97.57  ? 527 TYR A C     1 
ATOM   3216 O  O     . TYR A 1 432 ? 22.103  52.309  2.836  1.00 78.97  ? 527 TYR A O     1 
ATOM   3217 C  CB    . TYR A 1 432 ? 20.956  49.979  4.755  1.00 108.00 ? 527 TYR A CB    1 
ATOM   3218 C  CG    . TYR A 1 432 ? 21.525  51.067  5.647  1.00 102.90 ? 527 TYR A CG    1 
ATOM   3219 C  CD1   . TYR A 1 432 ? 20.707  52.062  6.167  1.00 92.21  ? 527 TYR A CD1   1 
ATOM   3220 C  CD2   . TYR A 1 432 ? 22.875  51.080  5.992  1.00 93.33  ? 527 TYR A CD2   1 
ATOM   3221 C  CE1   . TYR A 1 432 ? 21.216  53.049  6.991  1.00 89.34  ? 527 TYR A CE1   1 
ATOM   3222 C  CE2   . TYR A 1 432 ? 23.394  52.064  6.817  1.00 64.69  ? 527 TYR A CE2   1 
ATOM   3223 C  CZ    . TYR A 1 432 ? 22.558  53.043  7.313  1.00 75.78  ? 527 TYR A CZ    1 
ATOM   3224 O  OH    . TYR A 1 432 ? 23.068  54.019  8.132  1.00 76.22  ? 527 TYR A OH    1 
ATOM   3225 N  N     . ARG A 1 433 ? 22.964  50.315  2.221  1.00 85.99  ? 528 ARG A N     1 
ATOM   3226 C  CA    . ARG A 1 433 ? 24.282  50.832  1.879  1.00 74.96  ? 528 ARG A CA    1 
ATOM   3227 C  C     . ARG A 1 433 ? 24.191  51.752  0.669  1.00 77.82  ? 528 ARG A C     1 
ATOM   3228 O  O     . ARG A 1 433 ? 25.194  52.330  0.238  1.00 78.52  ? 528 ARG A O     1 
ATOM   3229 C  CB    . ARG A 1 433 ? 25.248  49.671  1.628  1.00 66.75  ? 528 ARG A CB    1 
ATOM   3230 C  CG    . ARG A 1 433 ? 26.713  50.063  1.564  1.00 66.86  ? 528 ARG A CG    1 
ATOM   3231 C  CD    . ARG A 1 433 ? 27.587  48.846  1.385  1.00 77.90  ? 528 ARG A CD    1 
ATOM   3232 N  NE    . ARG A 1 433 ? 28.905  49.190  0.867  1.00 81.08  ? 528 ARG A NE    1 
ATOM   3233 C  CZ    . ARG A 1 433 ? 29.811  48.295  0.490  1.00 102.66 ? 528 ARG A CZ    1 
ATOM   3234 N  NH1   . ARG A 1 433 ? 29.541  46.997  0.576  1.00 109.15 ? 528 ARG A NH1   1 
ATOM   3235 N  NH2   . ARG A 1 433 ? 30.985  48.697  0.026  1.00 99.22  ? 528 ARG A NH2   1 
ATOM   3236 N  N     . LYS A 1 434 ? 22.985  51.894  0.123  1.00 85.89  ? 529 LYS A N     1 
ATOM   3237 C  CA    . LYS A 1 434 ? 22.713  52.788  -0.988 1.00 91.51  ? 529 LYS A CA    1 
ATOM   3238 C  C     . LYS A 1 434 ? 21.792  53.943  -0.609 1.00 102.93 ? 529 LYS A C     1 
ATOM   3239 O  O     . LYS A 1 434 ? 21.485  54.774  -1.469 1.00 97.65  ? 529 LYS A O     1 
ATOM   3240 C  CB    . LYS A 1 434 ? 22.121  51.989  -2.155 1.00 84.35  ? 529 LYS A CB    1 
ATOM   3241 C  CG    . LYS A 1 434 ? 23.125  51.039  -2.818 1.00 96.20  ? 529 LYS A CG    1 
ATOM   3242 C  CD    . LYS A 1 434 ? 24.184  51.807  -3.612 1.00 101.67 ? 529 LYS A CD    1 
ATOM   3243 C  CE    . LYS A 1 434 ? 23.852  51.870  -5.105 1.00 93.67  ? 529 LYS A CE    1 
ATOM   3244 N  NZ    . LYS A 1 434 ? 24.777  52.767  -5.866 1.00 72.01  ? 529 LYS A NZ    1 
ATOM   3245 N  N     . GLU A 1 435 ? 21.362  54.036  0.650  1.00 98.41  ? 530 GLU A N     1 
ATOM   3246 C  CA    . GLU A 1 435 ? 20.542  55.166  1.074  1.00 86.05  ? 530 GLU A CA    1 
ATOM   3247 C  C     . GLU A 1 435 ? 21.337  56.464  0.997  1.00 88.35  ? 530 GLU A C     1 
ATOM   3248 O  O     . GLU A 1 435 ? 22.567  56.473  1.083  1.00 91.11  ? 530 GLU A O     1 
ATOM   3249 C  CB    . GLU A 1 435 ? 20.030  54.950  2.501  1.00 95.12  ? 530 GLU A CB    1 
ATOM   3250 C  CG    . GLU A 1 435 ? 18.678  54.242  2.600  1.00 104.25 ? 530 GLU A CG    1 
ATOM   3251 C  CD    . GLU A 1 435 ? 17.496  55.200  2.522  1.00 109.36 ? 530 GLU A CD    1 
ATOM   3252 O  OE1   . GLU A 1 435 ? 17.709  56.390  2.203  1.00 113.25 ? 530 GLU A OE1   1 
ATOM   3253 O  OE2   . GLU A 1 435 ? 16.355  54.761  2.786  1.00 85.94  ? 530 GLU A OE2   1 
ATOM   3254 N  N     . ILE A 1 436 ? 20.618  57.570  0.818  1.00 95.42  ? 531 ILE A N     1 
ATOM   3255 C  CA    . ILE A 1 436 ? 21.208  58.902  0.760  1.00 92.59  ? 531 ILE A CA    1 
ATOM   3256 C  C     . ILE A 1 436 ? 20.417  59.812  1.691  1.00 100.10 ? 531 ILE A C     1 
ATOM   3257 O  O     . ILE A 1 436 ? 19.197  59.947  1.542  1.00 92.47  ? 531 ILE A O     1 
ATOM   3258 C  CB    . ILE A 1 436 ? 21.209  59.475  -0.672 1.00 91.04  ? 531 ILE A CB    1 
ATOM   3259 C  CG1   . ILE A 1 436 ? 21.231  58.355  -1.717 1.00 99.13  ? 531 ILE A CG1   1 
ATOM   3260 C  CG2   . ILE A 1 436 ? 22.402  60.400  -0.869 1.00 87.51  ? 531 ILE A CG2   1 
ATOM   3261 C  CD1   . ILE A 1 436 ? 20.781  58.800  -3.098 1.00 89.84  ? 531 ILE A CD1   1 
ATOM   3262 N  N     . VAL A 1 437 ? 21.107  60.423  2.660  1.00 102.33 ? 532 VAL A N     1 
ATOM   3263 C  CA    . VAL A 1 437 ? 20.502  61.387  3.574  1.00 90.44  ? 532 VAL A CA    1 
ATOM   3264 C  C     . VAL A 1 437 ? 21.503  62.505  3.844  1.00 83.89  ? 532 VAL A C     1 
ATOM   3265 O  O     . VAL A 1 437 ? 22.720  62.292  3.848  1.00 89.47  ? 532 VAL A O     1 
ATOM   3266 C  CB    . VAL A 1 437 ? 20.026  60.736  4.901  1.00 82.52  ? 532 VAL A CB    1 
ATOM   3267 C  CG1   . VAL A 1 437 ? 20.158  59.221  4.847  1.00 75.03  ? 532 VAL A CG1   1 
ATOM   3268 C  CG2   . VAL A 1 437 ? 20.773  61.307  6.106  1.00 89.47  ? 532 VAL A CG2   1 
ATOM   3269 N  N     . ILE A 1 438 ? 20.978  63.710  4.066  1.00 90.18  ? 533 ILE A N     1 
ATOM   3270 C  CA    . ILE A 1 438 ? 21.788  64.908  4.265  1.00 96.66  ? 533 ILE A CA    1 
ATOM   3271 C  C     . ILE A 1 438 ? 21.917  65.192  5.755  1.00 98.64  ? 533 ILE A C     1 
ATOM   3272 O  O     . ILE A 1 438 ? 20.955  65.036  6.519  1.00 90.22  ? 533 ILE A O     1 
ATOM   3273 C  CB    . ILE A 1 438 ? 21.177  66.112  3.521  1.00 91.93  ? 533 ILE A CB    1 
ATOM   3274 C  CG1   . ILE A 1 438 ? 21.955  67.394  3.830  1.00 99.12  ? 533 ILE A CG1   1 
ATOM   3275 C  CG2   . ILE A 1 438 ? 19.701  66.272  3.872  1.00 95.07  ? 533 ILE A CG2   1 
ATOM   3276 C  CD1   . ILE A 1 438 ? 23.411  67.342  3.415  1.00 99.40  ? 533 ILE A CD1   1 
ATOM   3277 N  N     . LEU A 1 439 ? 23.114  65.607  6.170  1.00 90.54  ? 534 LEU A N     1 
ATOM   3278 C  CA    . LEU A 1 439 ? 23.349  66.048  7.539  1.00 99.63  ? 534 LEU A CA    1 
ATOM   3279 C  C     . LEU A 1 439 ? 22.567  67.318  7.849  1.00 105.84 ? 534 LEU A C     1 
ATOM   3280 O  O     . LEU A 1 439 ? 23.073  68.427  7.650  1.00 117.49 ? 534 LEU A O     1 
ATOM   3281 C  CB    . LEU A 1 439 ? 24.841  66.292  7.775  1.00 110.36 ? 534 LEU A CB    1 
ATOM   3282 C  CG    . LEU A 1 439 ? 25.777  65.088  7.846  1.00 108.20 ? 534 LEU A CG    1 
ATOM   3283 C  CD1   . LEU A 1 439 ? 27.218  65.541  7.692  1.00 91.30  ? 534 LEU A CD1   1 
ATOM   3284 C  CD2   . LEU A 1 439 ? 25.585  64.360  9.163  1.00 108.65 ? 534 LEU A CD2   1 
ATOM   3285 N  N     . SER A 1 440 ? 21.337  67.175  8.324  1.00 88.94  ? 535 SER A N     1 
ATOM   3286 C  CA    . SER A 1 440 ? 20.575  68.305  8.831  1.00 90.82  ? 535 SER A CA    1 
ATOM   3287 C  C     . SER A 1 440 ? 20.726  68.369  10.345 1.00 99.09  ? 535 SER A C     1 
ATOM   3288 O  O     . SER A 1 440 ? 20.944  67.349  11.003 1.00 101.71 ? 535 SER A O     1 
ATOM   3289 C  CB    . SER A 1 440 ? 19.098  68.195  8.444  1.00 90.35  ? 535 SER A CB    1 
ATOM   3290 O  OG    . SER A 1 440 ? 18.588  66.908  8.739  1.00 95.43  ? 535 SER A OG    1 
ATOM   3291 N  N     . GLU A 1 441 ? 20.625  69.583  10.895 1.00 99.47  ? 536 GLU A N     1 
ATOM   3292 C  CA    . GLU A 1 441 ? 20.857  69.762  12.326 1.00 99.22  ? 536 GLU A CA    1 
ATOM   3293 C  C     . GLU A 1 441 ? 19.791  69.083  13.176 1.00 111.59 ? 536 GLU A C     1 
ATOM   3294 O  O     . GLU A 1 441 ? 20.064  68.741  14.332 1.00 116.75 ? 536 GLU A O     1 
ATOM   3295 C  CB    . GLU A 1 441 ? 20.940  71.254  12.671 1.00 106.54 ? 536 GLU A CB    1 
ATOM   3296 C  CG    . GLU A 1 441 ? 19.638  71.890  13.156 1.00 129.65 ? 536 GLU A CG    1 
ATOM   3297 C  CD    . GLU A 1 441 ? 19.587  72.058  14.669 1.00 129.95 ? 536 GLU A CD    1 
ATOM   3298 O  OE1   . GLU A 1 441 ? 19.118  71.132  15.365 1.00 128.20 ? 536 GLU A OE1   1 
ATOM   3299 O  OE2   . GLU A 1 441 ? 20.019  73.120  15.164 1.00 133.47 ? 536 GLU A OE2   1 
ATOM   3300 N  N     . ASP A 1 442 ? 18.597  68.871  12.631 1.00 108.28 ? 537 ASP A N     1 
ATOM   3301 C  CA    . ASP A 1 442 ? 17.520  68.192  13.336 1.00 99.99  ? 537 ASP A CA    1 
ATOM   3302 C  C     . ASP A 1 442 ? 17.584  66.677  13.201 1.00 92.19  ? 537 ASP A C     1 
ATOM   3303 O  O     . ASP A 1 442 ? 16.737  65.985  13.776 1.00 95.18  ? 537 ASP A O     1 
ATOM   3304 C  CB    . ASP A 1 442 ? 16.163  68.692  12.826 1.00 125.89 ? 537 ASP A CB    1 
ATOM   3305 C  CG    . ASP A 1 442 ? 15.979  68.469  11.329 1.00 128.75 ? 537 ASP A CG    1 
ATOM   3306 O  OD1   . ASP A 1 442 ? 16.320  69.379  10.544 1.00 125.80 ? 537 ASP A OD1   1 
ATOM   3307 O  OD2   . ASP A 1 442 ? 15.493  67.385  10.937 1.00 117.42 ? 537 ASP A OD2   1 
ATOM   3308 N  N     . PHE A 1 443 ? 18.561  66.149  12.465 1.00 83.97  ? 538 PHE A N     1 
ATOM   3309 C  CA    . PHE A 1 443 ? 18.588  64.724  12.162 1.00 80.18  ? 538 PHE A CA    1 
ATOM   3310 C  C     . PHE A 1 443 ? 18.797  63.899  13.425 1.00 81.73  ? 538 PHE A C     1 
ATOM   3311 O  O     . PHE A 1 443 ? 19.762  64.106  14.167 1.00 93.11  ? 538 PHE A O     1 
ATOM   3312 C  CB    . PHE A 1 443 ? 19.688  64.419  11.145 1.00 71.64  ? 538 PHE A CB    1 
ATOM   3313 C  CG    . PHE A 1 443 ? 19.776  62.969  10.769 1.00 68.09  ? 538 PHE A CG    1 
ATOM   3314 C  CD1   . PHE A 1 443 ? 18.625  62.242  10.514 1.00 78.63  ? 538 PHE A CD1   1 
ATOM   3315 C  CD2   . PHE A 1 443 ? 21.000  62.337  10.663 1.00 73.20  ? 538 PHE A CD2   1 
ATOM   3316 C  CE1   . PHE A 1 443 ? 18.697  60.909  10.169 1.00 78.13  ? 538 PHE A CE1   1 
ATOM   3317 C  CE2   . PHE A 1 443 ? 21.077  61.005  10.315 1.00 79.32  ? 538 PHE A CE2   1 
ATOM   3318 C  CZ    . PHE A 1 443 ? 19.922  60.291  10.069 1.00 78.16  ? 538 PHE A CZ    1 
ATOM   3319 N  N     . LYS A 1 444 ? 17.891  62.958  13.661 1.00 70.57  ? 539 LYS A N     1 
ATOM   3320 C  CA    . LYS A 1 444 ? 17.932  62.083  14.829 1.00 69.97  ? 539 LYS A CA    1 
ATOM   3321 C  C     . LYS A 1 444 ? 17.973  60.643  14.329 1.00 72.38  ? 539 LYS A C     1 
ATOM   3322 O  O     . LYS A 1 444 ? 16.941  60.079  13.954 1.00 71.64  ? 539 LYS A O     1 
ATOM   3323 C  CB    . LYS A 1 444 ? 16.737  62.347  15.741 1.00 62.05  ? 539 LYS A CB    1 
ATOM   3324 C  CG    . LYS A 1 444 ? 16.911  63.599  16.588 1.00 66.10  ? 539 LYS A CG    1 
ATOM   3325 C  CD    . LYS A 1 444 ? 15.614  64.047  17.235 1.00 89.27  ? 539 LYS A CD    1 
ATOM   3326 C  CE    . LYS A 1 444 ? 14.883  65.053  16.361 1.00 111.87 ? 539 LYS A CE    1 
ATOM   3327 N  NZ    . LYS A 1 444 ? 13.729  65.676  17.069 1.00 135.49 ? 539 LYS A NZ    1 
ATOM   3328 N  N     . VAL A 1 445 ? 19.175  60.057  14.328 1.00 80.27  ? 540 VAL A N     1 
ATOM   3329 C  CA    . VAL A 1 445 ? 19.374  58.732  13.744 1.00 65.96  ? 540 VAL A CA    1 
ATOM   3330 C  C     . VAL A 1 445 ? 18.546  57.686  14.481 1.00 65.56  ? 540 VAL A C     1 
ATOM   3331 O  O     . VAL A 1 445 ? 18.002  56.761  13.868 1.00 75.74  ? 540 VAL A O     1 
ATOM   3332 C  CB    . VAL A 1 445 ? 20.875  58.376  13.732 1.00 69.83  ? 540 VAL A CB    1 
ATOM   3333 C  CG1   . VAL A 1 445 ? 21.490  58.545  15.117 1.00 51.66  ? 540 VAL A CG1   1 
ATOM   3334 C  CG2   . VAL A 1 445 ? 21.094  56.964  13.217 1.00 62.22  ? 540 VAL A CG2   1 
ATOM   3335 N  N     . MET A 1 446 ? 18.422  57.821  15.804 1.00 73.98  ? 541 MET A N     1 
ATOM   3336 C  CA    . MET A 1 446 ? 17.637  56.859  16.574 1.00 79.24  ? 541 MET A CA    1 
ATOM   3337 C  C     . MET A 1 446 ? 16.170  56.881  16.156 1.00 85.59  ? 541 MET A C     1 
ATOM   3338 O  O     . MET A 1 446 ? 15.548  55.826  15.986 1.00 89.40  ? 541 MET A O     1 
ATOM   3339 C  CB    . MET A 1 446 ? 17.786  57.145  18.068 1.00 81.87  ? 541 MET A CB    1 
ATOM   3340 C  CG    . MET A 1 446 ? 16.602  56.718  18.914 1.00 99.61  ? 541 MET A CG    1 
ATOM   3341 S  SD    . MET A 1 446 ? 17.064  56.476  20.636 1.00 88.90  ? 541 MET A SD    1 
ATOM   3342 C  CE    . MET A 1 446 ? 18.047  54.985  20.487 1.00 81.45  ? 541 MET A CE    1 
ATOM   3343 N  N     . GLU A 1 447 ? 15.602  58.077  15.988 1.00 93.02  ? 542 GLU A N     1 
ATOM   3344 C  CA    . GLU A 1 447 ? 14.262  58.196  15.422 1.00 89.18  ? 542 GLU A CA    1 
ATOM   3345 C  C     . GLU A 1 447 ? 14.217  57.687  13.989 1.00 90.72  ? 542 GLU A C     1 
ATOM   3346 O  O     . GLU A 1 447 ? 13.193  57.155  13.547 1.00 92.07  ? 542 GLU A O     1 
ATOM   3347 C  CB    . GLU A 1 447 ? 13.806  59.654  15.479 1.00 95.08  ? 542 GLU A CB    1 
ATOM   3348 C  CG    . GLU A 1 447 ? 12.389  59.907  15.001 1.00 90.01  ? 542 GLU A CG    1 
ATOM   3349 C  CD    . GLU A 1 447 ? 12.113  61.383  14.787 1.00 101.32 ? 542 GLU A CD    1 
ATOM   3350 O  OE1   . GLU A 1 447 ? 12.813  62.010  13.961 1.00 97.95  ? 542 GLU A OE1   1 
ATOM   3351 O  OE2   . GLU A 1 447 ? 11.204  61.920  15.453 1.00 117.27 ? 542 GLU A OE2   1 
ATOM   3352 N  N     . TRP A 1 448 ? 15.318  57.836  13.252 1.00 91.02  ? 543 TRP A N     1 
ATOM   3353 C  CA    . TRP A 1 448 ? 15.342  57.438  11.851 1.00 73.88  ? 543 TRP A CA    1 
ATOM   3354 C  C     . TRP A 1 448 ? 15.235  55.928  11.684 1.00 67.46  ? 543 TRP A C     1 
ATOM   3355 O  O     . TRP A 1 448 ? 14.790  55.457  10.635 1.00 75.79  ? 543 TRP A O     1 
ATOM   3356 C  CB    . TRP A 1 448 ? 16.622  57.954  11.196 1.00 73.10  ? 543 TRP A CB    1 
ATOM   3357 C  CG    . TRP A 1 448 ? 16.677  57.796  9.710  1.00 71.89  ? 543 TRP A CG    1 
ATOM   3358 C  CD1   . TRP A 1 448 ? 16.301  58.716  8.776  1.00 76.24  ? 543 TRP A CD1   1 
ATOM   3359 C  CD2   . TRP A 1 448 ? 17.147  56.655  8.982  1.00 76.39  ? 543 TRP A CD2   1 
ATOM   3360 N  NE1   . TRP A 1 448 ? 16.503  58.217  7.512  1.00 79.56  ? 543 TRP A NE1   1 
ATOM   3361 C  CE2   . TRP A 1 448 ? 17.022  56.953  7.611  1.00 78.74  ? 543 TRP A CE2   1 
ATOM   3362 C  CE3   . TRP A 1 448 ? 17.658  55.409  9.357  1.00 81.20  ? 543 TRP A CE3   1 
ATOM   3363 C  CZ2   . TRP A 1 448 ? 17.390  56.052  6.614  1.00 81.37  ? 543 TRP A CZ2   1 
ATOM   3364 C  CZ3   . TRP A 1 448 ? 18.022  54.516  8.366  1.00 78.04  ? 543 TRP A CZ3   1 
ATOM   3365 C  CH2   . TRP A 1 448 ? 17.887  54.842  7.011  1.00 76.34  ? 543 TRP A CH2   1 
ATOM   3366 N  N     . TRP A 1 449 ? 15.630  55.156  12.690 1.00 68.89  ? 544 TRP A N     1 
ATOM   3367 C  CA    . TRP A 1 449 ? 15.563  53.705  12.581 1.00 80.55  ? 544 TRP A CA    1 
ATOM   3368 C  C     . TRP A 1 449 ? 14.229  53.142  13.051 1.00 80.11  ? 544 TRP A C     1 
ATOM   3369 O  O     . TRP A 1 449 ? 13.820  52.074  12.581 1.00 83.25  ? 544 TRP A O     1 
ATOM   3370 C  CB    . TRP A 1 449 ? 16.709  53.060  13.366 1.00 83.44  ? 544 TRP A CB    1 
ATOM   3371 C  CG    . TRP A 1 449 ? 18.056  53.218  12.712 1.00 84.64  ? 544 TRP A CG    1 
ATOM   3372 C  CD1   . TRP A 1 449 ? 19.016  54.139  13.018 1.00 74.80  ? 544 TRP A CD1   1 
ATOM   3373 C  CD2   . TRP A 1 449 ? 18.592  52.422  11.647 1.00 83.35  ? 544 TRP A CD2   1 
ATOM   3374 N  NE1   . TRP A 1 449 ? 20.113  53.968  12.208 1.00 67.34  ? 544 TRP A NE1   1 
ATOM   3375 C  CE2   . TRP A 1 449 ? 19.878  52.918  11.359 1.00 78.64  ? 544 TRP A CE2   1 
ATOM   3376 C  CE3   . TRP A 1 449 ? 18.107  51.340  10.908 1.00 82.29  ? 544 TRP A CE3   1 
ATOM   3377 C  CZ2   . TRP A 1 449 ? 20.686  52.366  10.366 1.00 82.60  ? 544 TRP A CZ2   1 
ATOM   3378 C  CZ3   . TRP A 1 449 ? 18.910  50.792  9.924  1.00 80.27  ? 544 TRP A CZ3   1 
ATOM   3379 C  CH2   . TRP A 1 449 ? 20.185  51.306  9.662  1.00 72.01  ? 544 TRP A CH2   1 
ATOM   3380 N  N     . ASN A 1 450 ? 13.547  53.819  13.980 1.00 84.99  ? 545 ASN A N     1 
ATOM   3381 C  CA    . ASN A 1 450 ? 12.162  53.462  14.273 1.00 95.87  ? 545 ASN A CA    1 
ATOM   3382 C  C     . ASN A 1 450 ? 11.278  53.691  13.054 1.00 100.66 ? 545 ASN A C     1 
ATOM   3383 O  O     . ASN A 1 450 ? 10.451  52.839  12.703 1.00 85.98  ? 545 ASN A O     1 
ATOM   3384 C  CB    . ASN A 1 450 ? 11.647  54.271  15.465 1.00 86.16  ? 545 ASN A CB    1 
ATOM   3385 C  CG    . ASN A 1 450 ? 12.435  54.012  16.734 1.00 94.71  ? 545 ASN A CG    1 
ATOM   3386 O  OD1   . ASN A 1 450 ? 13.034  54.925  17.302 1.00 92.17  ? 545 ASN A OD1   1 
ATOM   3387 N  ND2   . ASN A 1 450 ? 12.433  52.764  17.190 1.00 90.88  ? 545 ASN A ND2   1 
ATOM   3388 N  N     . LEU A 1 451 ? 11.451  54.837  12.395 1.00 107.65 ? 546 LEU A N     1 
ATOM   3389 C  CA    . LEU A 1 451 ? 10.754  55.171  11.154 1.00 92.11  ? 546 LEU A CA    1 
ATOM   3390 C  C     . LEU A 1 451 ? 11.369  54.494  9.934  1.00 94.23  ? 546 LEU A C     1 
ATOM   3391 O  O     . LEU A 1 451 ? 11.449  55.090  8.860  1.00 99.24  ? 546 LEU A O     1 
ATOM   3392 C  CB    . LEU A 1 451 ? 10.734  56.691  10.985 1.00 82.13  ? 546 LEU A CB    1 
ATOM   3393 C  CG    . LEU A 1 451 ? 9.756   57.566  11.790 1.00 95.54  ? 546 LEU A CG    1 
ATOM   3394 C  CD1   . LEU A 1 451 ? 9.964   57.469  13.299 1.00 109.24 ? 546 LEU A CD1   1 
ATOM   3395 C  CD2   . LEU A 1 451 ? 9.834   59.024  11.346 1.00 66.72  ? 546 LEU A CD2   1 
ATOM   3396 N  N     . ASN A 1 452 ? 11.825  53.253  10.089 1.00 86.77  ? 547 ASN A N     1 
ATOM   3397 C  CA    . ASN A 1 452 ? 12.464  52.503  9.016  1.00 76.54  ? 547 ASN A CA    1 
ATOM   3398 C  C     . ASN A 1 452 ? 12.518  51.025  9.384  1.00 85.58  ? 547 ASN A C     1 
ATOM   3399 O  O     . ASN A 1 452 ? 13.017  50.196  8.613  1.00 72.08  ? 547 ASN A O     1 
ATOM   3400 C  CB    . ASN A 1 452 ? 13.867  53.044  8.733  1.00 88.69  ? 547 ASN A CB    1 
ATOM   3401 C  CG    . ASN A 1 452 ? 13.928  53.866  7.457  1.00 90.13  ? 547 ASN A CG    1 
ATOM   3402 O  OD1   . ASN A 1 452 ? 14.404  53.389  6.426  1.00 106.44 ? 547 ASN A OD1   1 
ATOM   3403 N  ND2   . ASN A 1 452 ? 13.445  55.101  7.517  1.00 86.37  ? 547 ASN A ND2   1 
ATOM   3404 N  N     . SER A 1 453 ? 12.000  50.691  10.570 1.00 93.87  ? 548 SER A N     1 
ATOM   3405 C  CA    . SER A 1 453 ? 11.873  49.302  10.994 1.00 98.56  ? 548 SER A CA    1 
ATOM   3406 C  C     . SER A 1 453 ? 10.975  48.492  10.069 1.00 102.77 ? 548 SER A C     1 
ATOM   3407 O  O     . SER A 1 453 ? 10.990  47.257  10.140 1.00 98.54  ? 548 SER A O     1 
ATOM   3408 C  CB    . SER A 1 453 ? 11.335  49.239  12.428 1.00 102.90 ? 548 SER A CB    1 
ATOM   3409 O  OG    . SER A 1 453 ? 10.034  49.799  12.519 1.00 96.16  ? 548 SER A OG    1 
ATOM   3410 N  N     . LYS A 1 454 ? 10.202  49.153  9.204  1.00 113.09 ? 549 LYS A N     1 
ATOM   3411 C  CA    . LYS A 1 454 ? 9.329   48.445  8.274  1.00 104.48 ? 549 LYS A CA    1 
ATOM   3412 C  C     . LYS A 1 454 ? 10.118  47.891  7.091  1.00 100.94 ? 549 LYS A C     1 
ATOM   3413 O  O     . LYS A 1 454 ? 10.152  46.675  6.870  1.00 103.88 ? 549 LYS A O     1 
ATOM   3414 C  CB    . LYS A 1 454 ? 8.206   49.375  7.803  1.00 111.00 ? 549 LYS A CB    1 
ATOM   3415 C  CG    . LYS A 1 454 ? 6.899   49.237  8.590  1.00 117.31 ? 549 LYS A CG    1 
ATOM   3416 C  CD    . LYS A 1 454 ? 7.127   49.299  10.096 1.00 111.43 ? 549 LYS A CD    1 
ATOM   3417 C  CE    . LYS A 1 454 ? 5.856   48.983  10.873 1.00 104.18 ? 549 LYS A CE    1 
ATOM   3418 N  NZ    . LYS A 1 454 ? 5.293   47.650  10.518 1.00 106.71 ? 549 LYS A NZ    1 
ATOM   3419 N  N     . LYS A 1 455 ? 10.769  48.770  6.320  1.00 97.12  ? 550 LYS A N     1 
ATOM   3420 C  CA    . LYS A 1 455 ? 11.544  48.297  5.176  1.00 104.23 ? 550 LYS A CA    1 
ATOM   3421 C  C     . LYS A 1 455 ? 12.767  47.506  5.617  1.00 116.98 ? 550 LYS A C     1 
ATOM   3422 O  O     . LYS A 1 455 ? 13.159  46.547  4.940  1.00 123.60 ? 550 LYS A O     1 
ATOM   3423 C  CB    . LYS A 1 455 ? 11.966  49.463  4.281  1.00 96.92  ? 550 LYS A CB    1 
ATOM   3424 C  CG    . LYS A 1 455 ? 12.653  49.010  2.991  1.00 116.32 ? 550 LYS A CG    1 
ATOM   3425 C  CD    . LYS A 1 455 ? 11.833  47.925  2.298  1.00 123.98 ? 550 LYS A CD    1 
ATOM   3426 C  CE    . LYS A 1 455 ? 12.658  47.108  1.312  1.00 117.78 ? 550 LYS A CE    1 
ATOM   3427 N  NZ    . LYS A 1 455 ? 13.073  47.903  0.125  1.00 136.44 ? 550 LYS A NZ    1 
ATOM   3428 N  N     . TYR A 1 456 ? 13.389  47.895  6.733  1.00 113.84 ? 551 TYR A N     1 
ATOM   3429 C  CA    . TYR A 1 456 ? 14.507  47.155  7.308  1.00 103.06 ? 551 TYR A CA    1 
ATOM   3430 C  C     . TYR A 1 456 ? 14.043  46.517  8.611  1.00 103.68 ? 551 TYR A C     1 
ATOM   3431 O  O     . TYR A 1 456 ? 14.198  47.110  9.687  1.00 98.51  ? 551 TYR A O     1 
ATOM   3432 C  CB    . TYR A 1 456 ? 15.711  48.069  7.549  1.00 92.25  ? 551 TYR A CB    1 
ATOM   3433 C  CG    . TYR A 1 456 ? 16.183  48.837  6.331  1.00 103.54 ? 551 TYR A CG    1 
ATOM   3434 C  CD1   . TYR A 1 456 ? 15.840  50.173  6.155  1.00 95.10  ? 551 TYR A CD1   1 
ATOM   3435 C  CD2   . TYR A 1 456 ? 16.978  48.231  5.362  1.00 94.84  ? 551 TYR A CD2   1 
ATOM   3436 C  CE1   . TYR A 1 456 ? 16.271  50.885  5.048  1.00 86.00  ? 551 TYR A CE1   1 
ATOM   3437 C  CE2   . TYR A 1 456 ? 17.414  48.937  4.248  1.00 89.00  ? 551 TYR A CE2   1 
ATOM   3438 C  CZ    . TYR A 1 456 ? 17.057  50.263  4.098  1.00 96.50  ? 551 TYR A CZ    1 
ATOM   3439 O  OH    . TYR A 1 456 ? 17.484  50.974  2.998  1.00 94.24  ? 551 TYR A OH    1 
ATOM   3440 N  N     . PRO A 1 457 ? 13.447  45.326  8.572  1.00 103.32 ? 552 PRO A N     1 
ATOM   3441 C  CA    . PRO A 1 457 ? 12.981  44.702  9.816  1.00 96.87  ? 552 PRO A CA    1 
ATOM   3442 C  C     . PRO A 1 457 ? 14.112  44.151  10.670 1.00 95.67  ? 552 PRO A C     1 
ATOM   3443 O  O     . PRO A 1 457 ? 14.187  44.453  11.863 1.00 97.50  ? 552 PRO A O     1 
ATOM   3444 C  CB    . PRO A 1 457 ? 12.056  43.579  9.323  1.00 108.58 ? 552 PRO A CB    1 
ATOM   3445 C  CG    . PRO A 1 457 ? 11.752  43.917  7.892  1.00 111.77 ? 552 PRO A CG    1 
ATOM   3446 C  CD    . PRO A 1 457 ? 12.986  44.585  7.389  1.00 104.59 ? 552 PRO A CD    1 
ATOM   3447 N  N     . LYS A 1 458 ? 14.999  43.347  10.080 1.00 89.93  ? 553 LYS A N     1 
ATOM   3448 C  CA    . LYS A 1 458 ? 16.009  42.638  10.858 1.00 101.54 ? 553 LYS A CA    1 
ATOM   3449 C  C     . LYS A 1 458 ? 17.322  43.401  11.006 1.00 108.51 ? 553 LYS A C     1 
ATOM   3450 O  O     . LYS A 1 458 ? 18.061  43.148  11.968 1.00 100.88 ? 553 LYS A O     1 
ATOM   3451 C  CB    . LYS A 1 458 ? 16.283  41.262  10.238 1.00 91.80  ? 553 LYS A CB    1 
ATOM   3452 C  CG    . LYS A 1 458 ? 16.173  41.229  8.726  1.00 104.32 ? 553 LYS A CG    1 
ATOM   3453 C  CD    . LYS A 1 458 ? 14.918  40.493  8.285  1.00 105.50 ? 553 LYS A CD    1 
ATOM   3454 C  CE    . LYS A 1 458 ? 14.598  40.772  6.825  1.00 109.94 ? 553 LYS A CE    1 
ATOM   3455 N  NZ    . LYS A 1 458 ? 15.759  40.501  5.935  1.00 106.29 ? 553 LYS A NZ    1 
ATOM   3456 N  N     . LEU A 1 459 ? 17.636  44.320  10.086 1.00 92.65  ? 554 LEU A N     1 
ATOM   3457 C  CA    . LEU A 1 459 ? 18.861  45.103  10.227 1.00 73.80  ? 554 LEU A CA    1 
ATOM   3458 C  C     . LEU A 1 459 ? 18.663  46.287  11.165 1.00 77.99  ? 554 LEU A C     1 
ATOM   3459 O  O     . LEU A 1 459 ? 19.561  46.616  11.947 1.00 80.00  ? 554 LEU A O     1 
ATOM   3460 C  CB    . LEU A 1 459 ? 19.350  45.594  8.864  1.00 83.27  ? 554 LEU A CB    1 
ATOM   3461 C  CG    . LEU A 1 459 ? 20.603  46.480  8.900  1.00 72.49  ? 554 LEU A CG    1 
ATOM   3462 C  CD1   . LEU A 1 459 ? 21.841  45.721  8.423  1.00 66.98  ? 554 LEU A CD1   1 
ATOM   3463 C  CD2   . LEU A 1 459 ? 20.398  47.756  8.096  1.00 65.67  ? 554 LEU A CD2   1 
ATOM   3464 N  N     . SER A 1 460 ? 17.503  46.945  11.097 1.00 83.63  ? 555 SER A N     1 
ATOM   3465 C  CA    . SER A 1 460 ? 17.237  48.051  12.009 1.00 74.05  ? 555 SER A CA    1 
ATOM   3466 C  C     . SER A 1 460 ? 17.118  47.589  13.454 1.00 79.46  ? 555 SER A C     1 
ATOM   3467 O  O     . SER A 1 460 ? 17.163  48.422  14.363 1.00 77.85  ? 555 SER A O     1 
ATOM   3468 C  CB    . SER A 1 460 ? 15.965  48.799  11.596 1.00 75.24  ? 555 SER A CB    1 
ATOM   3469 O  OG    . SER A 1 460 ? 14.810  48.000  11.767 1.00 78.36  ? 555 SER A OG    1 
ATOM   3470 N  N     . LYS A 1 461 ? 16.949  46.285  13.685 1.00 95.16  ? 556 LYS A N     1 
ATOM   3471 C  CA    . LYS A 1 461 ? 17.035  45.749  15.039 1.00 90.65  ? 556 LYS A CA    1 
ATOM   3472 C  C     . LYS A 1 461 ? 18.487  45.634  15.486 1.00 87.90  ? 556 LYS A C     1 
ATOM   3473 O  O     . LYS A 1 461 ? 18.818  45.975  16.627 1.00 82.02  ? 556 LYS A O     1 
ATOM   3474 C  CB    . LYS A 1 461 ? 16.329  44.390  15.120 1.00 91.47  ? 556 LYS A CB    1 
ATOM   3475 C  CG    . LYS A 1 461 ? 14.821  44.473  14.907 1.00 83.60  ? 556 LYS A CG    1 
ATOM   3476 C  CD    . LYS A 1 461 ? 14.136  43.119  15.047 1.00 73.99  ? 556 LYS A CD    1 
ATOM   3477 C  CE    . LYS A 1 461 ? 13.935  42.746  16.508 1.00 89.59  ? 556 LYS A CE    1 
ATOM   3478 N  NZ    . LYS A 1 461 ? 13.159  41.482  16.666 1.00 82.10  ? 556 LYS A NZ    1 
ATOM   3479 N  N     . LEU A 1 462 ? 19.368  45.172  14.594 1.00 89.77  ? 557 LEU A N     1 
ATOM   3480 C  CA    . LEU A 1 462 ? 20.795  45.164  14.896 1.00 81.99  ? 557 LEU A CA    1 
ATOM   3481 C  C     . LEU A 1 462 ? 21.325  46.579  15.092 1.00 72.67  ? 557 LEU A C     1 
ATOM   3482 O  O     . LEU A 1 462 ? 22.139  46.827  15.990 1.00 70.56  ? 557 LEU A O     1 
ATOM   3483 C  CB    . LEU A 1 462 ? 21.559  44.459  13.777 1.00 81.22  ? 557 LEU A CB    1 
ATOM   3484 C  CG    . LEU A 1 462 ? 23.057  44.752  13.710 1.00 71.10  ? 557 LEU A CG    1 
ATOM   3485 C  CD1   . LEU A 1 462 ? 23.762  44.213  14.945 1.00 67.72  ? 557 LEU A CD1   1 
ATOM   3486 C  CD2   . LEU A 1 462 ? 23.667  44.183  12.436 1.00 68.78  ? 557 LEU A CD2   1 
ATOM   3487 N  N     . ALA A 1 463 ? 20.869  47.520  14.261 1.00 73.83  ? 558 ALA A N     1 
ATOM   3488 C  CA    . ALA A 1 463 ? 21.353  48.896  14.344 1.00 67.25  ? 558 ALA A CA    1 
ATOM   3489 C  C     . ALA A 1 463 ? 20.998  49.529  15.684 1.00 73.00  ? 558 ALA A C     1 
ATOM   3490 O  O     . ALA A 1 463 ? 21.864  50.084  16.369 1.00 90.14  ? 558 ALA A O     1 
ATOM   3491 C  CB    . ALA A 1 463 ? 20.785  49.722  13.190 1.00 69.81  ? 558 ALA A CB    1 
ATOM   3492 N  N     . LEU A 1 464 ? 19.724  49.462  16.075 1.00 71.36  ? 559 LEU A N     1 
ATOM   3493 C  CA    . LEU A 1 464 ? 19.320  50.011  17.365 1.00 67.37  ? 559 LEU A CA    1 
ATOM   3494 C  C     . LEU A 1 464 ? 19.880  49.212  18.536 1.00 66.59  ? 559 LEU A C     1 
ATOM   3495 O  O     . LEU A 1 464 ? 19.896  49.718  19.662 1.00 68.10  ? 559 LEU A O     1 
ATOM   3496 C  CB    . LEU A 1 464 ? 17.795  50.083  17.455 1.00 85.61  ? 559 LEU A CB    1 
ATOM   3497 C  CG    . LEU A 1 464 ? 17.127  51.180  16.620 1.00 85.03  ? 559 LEU A CG    1 
ATOM   3498 C  CD1   . LEU A 1 464 ? 15.612  51.118  16.748 1.00 60.20  ? 559 LEU A CD1   1 
ATOM   3499 C  CD2   . LEU A 1 464 ? 17.647  52.551  17.029 1.00 84.49  ? 559 LEU A CD2   1 
ATOM   3500 N  N     . SER A 1 465 ? 20.330  47.977  18.301 1.00 71.06  ? 560 SER A N     1 
ATOM   3501 C  CA    . SER A 1 465 ? 21.096  47.268  19.321 1.00 65.59  ? 560 SER A CA    1 
ATOM   3502 C  C     . SER A 1 465 ? 22.480  47.885  19.484 1.00 76.76  ? 560 SER A C     1 
ATOM   3503 O  O     . SER A 1 465 ? 23.003  47.974  20.602 1.00 68.39  ? 560 SER A O     1 
ATOM   3504 C  CB    . SER A 1 465 ? 21.200  45.787  18.959 1.00 74.01  ? 560 SER A CB    1 
ATOM   3505 O  OG    . SER A 1 465 ? 22.119  45.110  19.801 1.00 95.88  ? 560 SER A OG    1 
ATOM   3506 N  N     . LEU A 1 466 ? 23.082  48.327  18.376 1.00 77.03  ? 561 LEU A N     1 
ATOM   3507 C  CA    . LEU A 1 466 ? 24.391  48.969  18.411 1.00 70.80  ? 561 LEU A CA    1 
ATOM   3508 C  C     . LEU A 1 466 ? 24.320  50.406  18.912 1.00 64.11  ? 561 LEU A C     1 
ATOM   3509 O  O     . LEU A 1 466 ? 25.245  50.867  19.588 1.00 77.41  ? 561 LEU A O     1 
ATOM   3510 C  CB    . LEU A 1 466 ? 25.023  48.941  17.016 1.00 58.53  ? 561 LEU A CB    1 
ATOM   3511 C  CG    . LEU A 1 466 ? 26.121  47.916  16.730 1.00 60.49  ? 561 LEU A CG    1 
ATOM   3512 C  CD1   . LEU A 1 466 ? 27.359  48.267  17.524 1.00 67.17  ? 561 LEU A CD1   1 
ATOM   3513 C  CD2   . LEU A 1 466 ? 25.663  46.504  17.051 1.00 63.81  ? 561 LEU A CD2   1 
ATOM   3514 N  N     . LEU A 1 467 ? 23.244  51.124  18.597 1.00 57.40  ? 562 LEU A N     1 
ATOM   3515 C  CA    . LEU A 1 467 ? 23.165  52.554  18.869 1.00 56.53  ? 562 LEU A CA    1 
ATOM   3516 C  C     . LEU A 1 467 ? 22.801  52.877  20.310 1.00 60.28  ? 562 LEU A C     1 
ATOM   3517 O  O     . LEU A 1 467 ? 22.725  54.061  20.655 1.00 67.15  ? 562 LEU A O     1 
ATOM   3518 C  CB    . LEU A 1 467 ? 22.153  53.218  17.927 1.00 70.58  ? 562 LEU A CB    1 
ATOM   3519 C  CG    . LEU A 1 467 ? 22.518  53.297  16.440 1.00 66.36  ? 562 LEU A CG    1 
ATOM   3520 C  CD1   . LEU A 1 467 ? 21.456  54.052  15.656 1.00 62.51  ? 562 LEU A CD1   1 
ATOM   3521 C  CD2   . LEU A 1 467 ? 23.881  53.943  16.248 1.00 67.27  ? 562 LEU A CD2   1 
ATOM   3522 N  N     . SER A 1 468 ? 22.574  51.873  21.154 1.00 67.04  ? 563 SER A N     1 
ATOM   3523 C  CA    . SER A 1 468 ? 22.265  52.093  22.561 1.00 61.93  ? 563 SER A CA    1 
ATOM   3524 C  C     . SER A 1 468 ? 23.470  51.882  23.470 1.00 60.77  ? 563 SER A C     1 
ATOM   3525 O  O     . SER A 1 468 ? 23.340  52.014  24.691 1.00 65.80  ? 563 SER A O     1 
ATOM   3526 C  CB    . SER A 1 468 ? 21.112  51.179  23.000 1.00 63.59  ? 563 SER A CB    1 
ATOM   3527 O  OG    . SER A 1 468 ? 21.454  49.809  22.876 1.00 71.20  ? 563 SER A OG    1 
ATOM   3528 N  N     . ILE A 1 469 ? 24.630  51.566  22.905 1.00 62.61  ? 564 ILE A N     1 
ATOM   3529 C  CA    . ILE A 1 469 ? 25.842  51.341  23.696 1.00 62.65  ? 564 ILE A CA    1 
ATOM   3530 C  C     . ILE A 1 469 ? 26.480  52.691  24.015 1.00 58.05  ? 564 ILE A C     1 
ATOM   3531 O  O     . ILE A 1 469 ? 26.660  53.511  23.100 1.00 54.65  ? 564 ILE A O     1 
ATOM   3532 C  CB    . ILE A 1 469 ? 26.816  50.444  22.938 1.00 53.53  ? 564 ILE A CB    1 
ATOM   3533 C  CG1   . ILE A 1 469 ? 26.165  49.105  22.591 1.00 53.29  ? 564 ILE A CG1   1 
ATOM   3534 C  CG2   . ILE A 1 469 ? 28.086  50.236  23.746 1.00 44.63  ? 564 ILE A CG2   1 
ATOM   3535 C  CD1   . ILE A 1 469 ? 27.051  48.201  21.755 1.00 61.49  ? 564 ILE A CD1   1 
ATOM   3536 N  N     . PRO A 1 470 ? 26.827  52.961  25.274 1.00 49.91  ? 565 PRO A N     1 
ATOM   3537 C  CA    . PRO A 1 470 ? 27.487  54.233  25.598 1.00 52.59  ? 565 PRO A CA    1 
ATOM   3538 C  C     . PRO A 1 470 ? 28.930  54.244  25.117 1.00 58.02  ? 565 PRO A C     1 
ATOM   3539 O  O     . PRO A 1 470 ? 29.618  53.223  25.146 1.00 52.39  ? 565 PRO A O     1 
ATOM   3540 C  CB    . PRO A 1 470 ? 27.406  54.296  27.131 1.00 50.29  ? 565 PRO A CB    1 
ATOM   3541 C  CG    . PRO A 1 470 ? 26.384  53.272  27.520 1.00 45.92  ? 565 PRO A CG    1 
ATOM   3542 C  CD    . PRO A 1 470 ? 26.475  52.201  26.483 1.00 58.98  ? 565 PRO A CD    1 
ATOM   3543 N  N     . ALA A 1 471 ? 29.388  55.416  24.671 1.00 49.35  ? 566 ALA A N     1 
ATOM   3544 C  CA    . ALA A 1 471 ? 30.762  55.513  24.191 1.00 44.82  ? 566 ALA A CA    1 
ATOM   3545 C  C     . ALA A 1 471 ? 31.779  55.538  25.322 1.00 46.03  ? 566 ALA A C     1 
ATOM   3546 O  O     . ALA A 1 471 ? 32.978  55.393  25.059 1.00 52.23  ? 566 ALA A O     1 
ATOM   3547 C  CB    . ALA A 1 471 ? 30.938  56.755  23.317 1.00 42.68  ? 566 ALA A CB    1 
ATOM   3548 N  N     . SER A 1 472 ? 31.336  55.705  26.563 1.00 45.20  ? 567 SER A N     1 
ATOM   3549 C  CA    . SER A 1 472 ? 32.240  55.788  27.696 1.00 52.54  ? 567 SER A CA    1 
ATOM   3550 C  C     . SER A 1 472 ? 31.541  55.211  28.922 1.00 44.98  ? 567 SER A C     1 
ATOM   3551 O  O     . SER A 1 472 ? 30.375  54.813  28.867 1.00 45.04  ? 567 SER A O     1 
ATOM   3552 C  CB    . SER A 1 472 ? 32.681  57.235  27.921 1.00 47.97  ? 567 SER A CB    1 
ATOM   3553 O  OG    . SER A 1 472 ? 31.575  58.048  28.248 1.00 56.66  ? 567 SER A OG    1 
ATOM   3554 N  N     . SER A 1 473 ? 32.270  55.161  30.039 1.00 44.17  ? 568 SER A N     1 
ATOM   3555 C  CA    . SER A 1 473 ? 31.719  54.715  31.314 1.00 34.84  ? 568 SER A CA    1 
ATOM   3556 C  C     . SER A 1 473 ? 31.217  55.872  32.169 1.00 43.25  ? 568 SER A C     1 
ATOM   3557 O  O     . SER A 1 473 ? 31.215  55.767  33.403 1.00 43.96  ? 568 SER A O     1 
ATOM   3558 C  CB    . SER A 1 473 ? 32.759  53.898  32.084 1.00 40.68  ? 568 SER A CB    1 
ATOM   3559 O  OG    . SER A 1 473 ? 33.915  54.668  32.373 1.00 59.18  ? 568 SER A OG    1 
ATOM   3560 N  N     . ALA A 1 474 ? 30.780  56.972  31.543 1.00 46.66  ? 569 ALA A N     1 
ATOM   3561 C  CA    . ALA A 1 474 ? 30.358  58.151  32.297 1.00 42.76  ? 569 ALA A CA    1 
ATOM   3562 C  C     . ALA A 1 474 ? 29.098  57.893  33.113 1.00 51.31  ? 569 ALA A C     1 
ATOM   3563 O  O     . ALA A 1 474 ? 28.866  58.575  34.119 1.00 49.80  ? 569 ALA A O     1 
ATOM   3564 C  CB    . ALA A 1 474 ? 30.135  59.333  31.356 1.00 43.63  ? 569 ALA A CB    1 
ATOM   3565 N  N     . ALA A 1 475 ? 28.268  56.933  32.698 1.00 44.14  ? 570 ALA A N     1 
ATOM   3566 C  CA    . ALA A 1 475 ? 27.076  56.610  33.477 1.00 38.99  ? 570 ALA A CA    1 
ATOM   3567 C  C     . ALA A 1 475 ? 27.448  56.063  34.847 1.00 51.40  ? 570 ALA A C     1 
ATOM   3568 O  O     . ALA A 1 475 ? 26.759  56.329  35.840 1.00 48.31  ? 570 ALA A O     1 
ATOM   3569 C  CB    . ALA A 1 475 ? 26.207  55.611  32.719 1.00 37.10  ? 570 ALA A CB    1 
ATOM   3570 N  N     . SER A 1 476 ? 28.535  55.294  34.919 1.00 49.32  ? 571 SER A N     1 
ATOM   3571 C  CA    . SER A 1 476 ? 29.015  54.825  36.211 1.00 39.88  ? 571 SER A CA    1 
ATOM   3572 C  C     . SER A 1 476 ? 29.609  55.970  37.013 1.00 45.89  ? 571 SER A C     1 
ATOM   3573 O  O     . SER A 1 476 ? 29.393  56.060  38.227 1.00 49.43  ? 571 SER A O     1 
ATOM   3574 C  CB    . SER A 1 476 ? 30.031  53.704  36.018 1.00 37.80  ? 571 SER A CB    1 
ATOM   3575 O  OG    . SER A 1 476 ? 29.411  52.588  35.397 1.00 42.88  ? 571 SER A OG    1 
ATOM   3576 N  N     . GLU A 1 477 ? 30.333  56.872  36.347 1.00 53.64  ? 572 GLU A N     1 
ATOM   3577 C  CA    . GLU A 1 477 ? 30.851  58.053  37.029 1.00 38.33  ? 572 GLU A CA    1 
ATOM   3578 C  C     . GLU A 1 477 ? 29.720  58.837  37.678 1.00 33.86  ? 572 GLU A C     1 
ATOM   3579 O  O     . GLU A 1 477 ? 29.793  59.192  38.860 1.00 36.94  ? 572 GLU A O     1 
ATOM   3580 C  CB    . GLU A 1 477 ? 31.629  58.939  36.048 1.00 44.53  ? 572 GLU A CB    1 
ATOM   3581 C  CG    . GLU A 1 477 ? 32.598  58.199  35.111 1.00 48.91  ? 572 GLU A CG    1 
ATOM   3582 C  CD    . GLU A 1 477 ? 33.826  57.616  35.811 1.00 49.63  ? 572 GLU A CD    1 
ATOM   3583 O  OE1   . GLU A 1 477 ? 34.035  57.897  37.010 1.00 44.58  ? 572 GLU A OE1   1 
ATOM   3584 O  OE2   . GLU A 1 477 ? 34.588  56.872  35.150 1.00 50.75  ? 572 GLU A OE2   1 
ATOM   3585 N  N     . ARG A 1 478 ? 28.646  59.088  36.923 1.00 42.60  ? 573 ARG A N     1 
ATOM   3586 C  CA    . ARG A 1 478 ? 27.521  59.855  37.451 1.00 39.25  ? 573 ARG A CA    1 
ATOM   3587 C  C     . ARG A 1 478 ? 26.855  59.138  38.614 1.00 39.21  ? 573 ARG A C     1 
ATOM   3588 O  O     . ARG A 1 478 ? 26.379  59.783  39.556 1.00 40.38  ? 573 ARG A O     1 
ATOM   3589 C  CB    . ARG A 1 478 ? 26.502  60.122  36.348 1.00 33.18  ? 573 ARG A CB    1 
ATOM   3590 C  CG    . ARG A 1 478 ? 26.846  61.299  35.488 1.00 34.55  ? 573 ARG A CG    1 
ATOM   3591 C  CD    . ARG A 1 478 ? 25.835  61.471  34.382 1.00 41.37  ? 573 ARG A CD    1 
ATOM   3592 N  NE    . ARG A 1 478 ? 26.439  61.239  33.077 1.00 46.97  ? 573 ARG A NE    1 
ATOM   3593 C  CZ    . ARG A 1 478 ? 26.049  60.293  32.233 1.00 53.16  ? 573 ARG A CZ    1 
ATOM   3594 N  NH1   . ARG A 1 478 ? 25.037  59.496  32.549 1.00 46.85  ? 573 ARG A NH1   1 
ATOM   3595 N  NH2   . ARG A 1 478 ? 26.665  60.155  31.067 1.00 54.56  ? 573 ARG A NH2   1 
ATOM   3596 N  N     . THR A 1 479 ? 26.801  57.805  38.559 1.00 42.00  ? 574 THR A N     1 
ATOM   3597 C  CA    . THR A 1 479 ? 26.261  57.039  39.678 1.00 47.36  ? 574 THR A CA    1 
ATOM   3598 C  C     . THR A 1 479 ? 27.030  57.337  40.957 1.00 44.98  ? 574 THR A C     1 
ATOM   3599 O  O     . THR A 1 479 ? 26.437  57.458  42.037 1.00 42.94  ? 574 THR A O     1 
ATOM   3600 C  CB    . THR A 1 479 ? 26.310  55.541  39.367 1.00 47.23  ? 574 THR A CB    1 
ATOM   3601 O  OG1   . THR A 1 479 ? 25.649  55.279  38.123 1.00 60.19  ? 574 THR A OG1   1 
ATOM   3602 C  CG2   . THR A 1 479 ? 25.632  54.747  40.468 1.00 35.34  ? 574 THR A CG2   1 
ATOM   3603 N  N     . PHE A 1 480 ? 28.356  57.469  40.849 1.00 44.95  ? 575 PHE A N     1 
ATOM   3604 C  CA    . PHE A 1 480 ? 29.179  57.801  42.006 1.00 34.21  ? 575 PHE A CA    1 
ATOM   3605 C  C     . PHE A 1 480 ? 28.920  59.228  42.474 1.00 37.54  ? 575 PHE A C     1 
ATOM   3606 O  O     . PHE A 1 480 ? 28.959  59.511  43.677 1.00 42.14  ? 575 PHE A O     1 
ATOM   3607 C  CB    . PHE A 1 480 ? 30.654  57.600  41.665 1.00 34.62  ? 575 PHE A CB    1 
ATOM   3608 C  CG    . PHE A 1 480 ? 30.972  56.226  41.138 1.00 41.53  ? 575 PHE A CG    1 
ATOM   3609 C  CD1   . PHE A 1 480 ? 31.940  56.050  40.164 1.00 35.11  ? 575 PHE A CD1   1 
ATOM   3610 C  CD2   . PHE A 1 480 ? 30.304  55.111  41.619 1.00 44.91  ? 575 PHE A CD2   1 
ATOM   3611 C  CE1   . PHE A 1 480 ? 32.234  54.791  39.676 1.00 34.25  ? 575 PHE A CE1   1 
ATOM   3612 C  CE2   . PHE A 1 480 ? 30.598  53.848  41.136 1.00 43.81  ? 575 PHE A CE2   1 
ATOM   3613 C  CZ    . PHE A 1 480 ? 31.564  53.689  40.163 1.00 41.91  ? 575 PHE A CZ    1 
ATOM   3614 N  N     . SER A 1 481 ? 28.648  60.140  41.540 1.00 38.54  ? 576 SER A N     1 
ATOM   3615 C  CA    . SER A 1 481 ? 28.271  61.494  41.926 1.00 34.23  ? 576 SER A CA    1 
ATOM   3616 C  C     . SER A 1 481 ? 26.955  61.483  42.688 1.00 43.63  ? 576 SER A C     1 
ATOM   3617 O  O     . SER A 1 481 ? 26.827  62.121  43.740 1.00 49.16  ? 576 SER A O     1 
ATOM   3618 C  CB    . SER A 1 481 ? 28.177  62.387  40.691 1.00 41.74  ? 576 SER A CB    1 
ATOM   3619 O  OG    . SER A 1 481 ? 28.055  63.751  41.056 1.00 49.31  ? 576 SER A OG    1 
ATOM   3620 N  N     . LEU A 1 482 ? 25.965  60.746  42.173 1.00 37.27  ? 577 LEU A N     1 
ATOM   3621 C  CA    . LEU A 1 482 ? 24.704  60.596  42.891 1.00 36.95  ? 577 LEU A CA    1 
ATOM   3622 C  C     . LEU A 1 482 ? 24.917  59.926  44.241 1.00 38.14  ? 577 LEU A C     1 
ATOM   3623 O  O     . LEU A 1 482 ? 24.366  60.370  45.256 1.00 46.31  ? 577 LEU A O     1 
ATOM   3624 C  CB    . LEU A 1 482 ? 23.710  59.799  42.049 1.00 41.92  ? 577 LEU A CB    1 
ATOM   3625 C  CG    . LEU A 1 482 ? 23.140  60.497  40.811 1.00 32.12  ? 577 LEU A CG    1 
ATOM   3626 C  CD1   . LEU A 1 482 ? 22.303  59.527  40.011 1.00 30.19  ? 577 LEU A CD1   1 
ATOM   3627 C  CD2   . LEU A 1 482 ? 22.324  61.723  41.197 1.00 30.37  ? 577 LEU A CD2   1 
ATOM   3628 N  N     . ALA A 1 483 ? 25.722  58.863  44.273 1.00 33.56  ? 578 ALA A N     1 
ATOM   3629 C  CA    . ALA A 1 483 ? 26.042  58.208  45.536 1.00 32.99  ? 578 ALA A CA    1 
ATOM   3630 C  C     . ALA A 1 483 ? 26.586  59.208  46.544 1.00 41.01  ? 578 ALA A C     1 
ATOM   3631 O  O     . ALA A 1 483 ? 26.157  59.243  47.702 1.00 41.76  ? 578 ALA A O     1 
ATOM   3632 C  CB    . ALA A 1 483 ? 27.053  57.087  45.294 1.00 42.71  ? 578 ALA A CB    1 
ATOM   3633 N  N     . GLY A 1 484 ? 27.528  60.045  46.109 1.00 40.00  ? 579 GLY A N     1 
ATOM   3634 C  CA    . GLY A 1 484 ? 28.098  61.060  46.973 1.00 32.48  ? 579 GLY A CA    1 
ATOM   3635 C  C     . GLY A 1 484 ? 27.115  62.117  47.432 1.00 41.04  ? 579 GLY A C     1 
ATOM   3636 O  O     . GLY A 1 484 ? 27.334  62.737  48.479 1.00 37.00  ? 579 GLY A O     1 
ATOM   3637 N  N     . ASN A 1 485 ? 26.046  62.352  46.665 1.00 42.13  ? 580 ASN A N     1 
ATOM   3638 C  CA    . ASN A 1 485 ? 24.995  63.245  47.142 1.00 40.71  ? 580 ASN A CA    1 
ATOM   3639 C  C     . ASN A 1 485 ? 24.201  62.639  48.297 1.00 44.71  ? 580 ASN A C     1 
ATOM   3640 O  O     . ASN A 1 485 ? 23.529  63.377  49.028 1.00 39.49  ? 580 ASN A O     1 
ATOM   3641 C  CB    . ASN A 1 485 ? 24.037  63.619  46.012 1.00 49.28  ? 580 ASN A CB    1 
ATOM   3642 C  CG    . ASN A 1 485 ? 24.656  64.560  45.000 1.00 40.45  ? 580 ASN A CG    1 
ATOM   3643 O  OD1   . ASN A 1 485 ? 25.587  65.298  45.308 1.00 41.78  ? 580 ASN A OD1   1 
ATOM   3644 N  ND2   . ASN A 1 485 ? 24.128  64.543  43.778 1.00 42.08  ? 580 ASN A ND2   1 
ATOM   3645 N  N     . ILE A 1 486 ? 24.265  61.323  48.482 1.00 35.86  ? 581 ILE A N     1 
ATOM   3646 C  CA    . ILE A 1 486 ? 23.555  60.663  49.573 1.00 37.43  ? 581 ILE A CA    1 
ATOM   3647 C  C     . ILE A 1 486 ? 24.449  60.484  50.791 1.00 38.24  ? 581 ILE A C     1 
ATOM   3648 O  O     . ILE A 1 486 ? 24.076  60.855  51.907 1.00 35.50  ? 581 ILE A O     1 
ATOM   3649 C  CB    . ILE A 1 486 ? 22.991  59.312  49.089 1.00 37.83  ? 581 ILE A CB    1 
ATOM   3650 C  CG1   . ILE A 1 486 ? 21.961  59.533  47.980 1.00 37.09  ? 581 ILE A CG1   1 
ATOM   3651 C  CG2   . ILE A 1 486 ? 22.385  58.550  50.250 1.00 29.19  ? 581 ILE A CG2   1 
ATOM   3652 C  CD1   . ILE A 1 486 ? 21.436  58.255  47.382 1.00 35.90  ? 581 ILE A CD1   1 
ATOM   3653 N  N     . ILE A 1 487 ? 25.633  59.901  50.604 1.00 38.96  ? 582 ILE A N     1 
ATOM   3654 C  CA    . ILE A 1 487 ? 26.574  59.698  51.700 1.00 35.94  ? 582 ILE A CA    1 
ATOM   3655 C  C     . ILE A 1 487 ? 27.245  61.024  52.032 1.00 36.01  ? 582 ILE A C     1 
ATOM   3656 O  O     . ILE A 1 487 ? 28.344  61.314  51.549 1.00 37.01  ? 582 ILE A O     1 
ATOM   3657 C  CB    . ILE A 1 487 ? 27.623  58.630  51.347 1.00 36.00  ? 582 ILE A CB    1 
ATOM   3658 C  CG1   . ILE A 1 487 ? 26.972  57.462  50.606 1.00 40.09  ? 582 ILE A CG1   1 
ATOM   3659 C  CG2   . ILE A 1 487 ? 28.331  58.147  52.606 1.00 44.61  ? 582 ILE A CG2   1 
ATOM   3660 C  CD1   . ILE A 1 487 ? 27.950  56.374  50.212 1.00 34.58  ? 582 ILE A CD1   1 
ATOM   3661 N  N     . THR A 1 488 ? 26.598  61.834  52.859 1.00 34.79  ? 583 THR A N     1 
ATOM   3662 C  CA    . THR A 1 488 ? 27.063  63.179  53.138 1.00 34.67  ? 583 THR A CA    1 
ATOM   3663 C  C     . THR A 1 488 ? 27.671  63.261  54.534 1.00 47.92  ? 583 THR A C     1 
ATOM   3664 O  O     . THR A 1 488 ? 27.858  62.253  55.225 1.00 46.86  ? 583 THR A O     1 
ATOM   3665 C  CB    . THR A 1 488 ? 25.919  64.184  52.975 1.00 38.38  ? 583 THR A CB    1 
ATOM   3666 O  OG1   . THR A 1 488 ? 24.934  63.973  54.000 1.00 41.97  ? 583 THR A OG1   1 
ATOM   3667 C  CG2   . THR A 1 488 ? 25.283  64.032  51.605 1.00 41.15  ? 583 THR A CG2   1 
ATOM   3668 N  N     . GLU A 1 489 ? 27.986  64.489  54.943 1.00 49.31  ? 584 GLU A N     1 
ATOM   3669 C  CA    . GLU A 1 489 ? 28.594  64.723  56.245 1.00 44.07  ? 584 GLU A CA    1 
ATOM   3670 C  C     . GLU A 1 489 ? 27.671  64.275  57.373 1.00 52.88  ? 584 GLU A C     1 
ATOM   3671 O  O     . GLU A 1 489 ? 28.106  63.609  58.319 1.00 60.99  ? 584 GLU A O     1 
ATOM   3672 C  CB    . GLU A 1 489 ? 28.938  66.204  56.369 1.00 53.81  ? 584 GLU A CB    1 
ATOM   3673 C  CG    . GLU A 1 489 ? 29.764  66.596  57.566 1.00 62.34  ? 584 GLU A CG    1 
ATOM   3674 C  CD    . GLU A 1 489 ? 29.909  68.100  57.661 1.00 61.86  ? 584 GLU A CD    1 
ATOM   3675 O  OE1   . GLU A 1 489 ? 29.058  68.741  58.319 1.00 55.73  ? 584 GLU A OE1   1 
ATOM   3676 O  OE2   . GLU A 1 489 ? 30.857  68.642  57.053 1.00 68.09  ? 584 GLU A OE2   1 
ATOM   3677 N  N     . LYS A 1 490 ? 26.386  64.623  57.286 1.00 49.69  ? 585 LYS A N     1 
ATOM   3678 C  CA    . LYS A 1 490 ? 25.450  64.295  58.353 1.00 46.35  ? 585 LYS A CA    1 
ATOM   3679 C  C     . LYS A 1 490 ? 24.690  62.996  58.107 1.00 51.73  ? 585 LYS A C     1 
ATOM   3680 O  O     . LYS A 1 490 ? 24.194  62.396  59.069 1.00 58.93  ? 585 LYS A O     1 
ATOM   3681 C  CB    . LYS A 1 490 ? 24.460  65.447  58.557 1.00 38.08  ? 585 LYS A CB    1 
ATOM   3682 C  CG    . LYS A 1 490 ? 25.102  66.825  58.478 1.00 40.90  ? 585 LYS A CG    1 
ATOM   3683 C  CD    . LYS A 1 490 ? 24.617  67.746  59.590 1.00 51.33  ? 585 LYS A CD    1 
ATOM   3684 C  CE    . LYS A 1 490 ? 25.503  67.653  60.835 1.00 66.51  ? 585 LYS A CE    1 
ATOM   3685 N  NZ    . LYS A 1 490 ? 26.867  68.259  60.670 1.00 40.09  ? 585 LYS A NZ    1 
ATOM   3686 N  N     . ARG A 1 491 ? 24.585  62.542  56.855 1.00 49.23  ? 586 ARG A N     1 
ATOM   3687 C  CA    . ARG A 1 491 ? 24.000  61.241  56.544 1.00 36.04  ? 586 ARG A CA    1 
ATOM   3688 C  C     . ARG A 1 491 ? 25.043  60.129  56.502 1.00 43.92  ? 586 ARG A C     1 
ATOM   3689 O  O     . ARG A 1 491 ? 24.828  59.105  55.841 1.00 42.37  ? 586 ARG A O     1 
ATOM   3690 C  CB    . ARG A 1 491 ? 23.245  61.302  55.214 1.00 40.75  ? 586 ARG A CB    1 
ATOM   3691 C  CG    . ARG A 1 491 ? 22.085  62.291  55.179 1.00 45.24  ? 586 ARG A CG    1 
ATOM   3692 C  CD    . ARG A 1 491 ? 21.347  62.231  53.847 1.00 33.03  ? 586 ARG A CD    1 
ATOM   3693 N  NE    . ARG A 1 491 ? 20.504  61.042  53.727 1.00 35.29  ? 586 ARG A NE    1 
ATOM   3694 C  CZ    . ARG A 1 491 ? 19.844  60.705  52.623 1.00 37.14  ? 586 ARG A CZ    1 
ATOM   3695 N  NH1   . ARG A 1 491 ? 19.934  61.461  51.541 1.00 45.26  ? 586 ARG A NH1   1 
ATOM   3696 N  NH2   . ARG A 1 491 ? 19.098  59.610  52.597 1.00 42.28  ? 586 ARG A NH2   1 
ATOM   3697 N  N     . ASN A 1 492 ? 26.166  60.301  57.206 1.00 51.36  ? 587 ASN A N     1 
ATOM   3698 C  CA    . ASN A 1 492 ? 27.312  59.411  57.048 1.00 45.56  ? 587 ASN A CA    1 
ATOM   3699 C  C     . ASN A 1 492 ? 27.055  58.009  57.585 1.00 53.30  ? 587 ASN A C     1 
ATOM   3700 O  O     . ASN A 1 492 ? 27.771  57.075  57.202 1.00 46.93  ? 587 ASN A O     1 
ATOM   3701 C  CB    . ASN A 1 492 ? 28.542  60.017  57.736 1.00 37.02  ? 587 ASN A CB    1 
ATOM   3702 C  CG    . ASN A 1 492 ? 28.484  59.902  59.253 1.00 37.69  ? 587 ASN A CG    1 
ATOM   3703 O  OD1   . ASN A 1 492 ? 28.866  58.879  59.822 1.00 57.97  ? 587 ASN A OD1   1 
ATOM   3704 N  ND2   . ASN A 1 492 ? 28.021  60.953  59.913 1.00 27.29  ? 587 ASN A ND2   1 
ATOM   3705 N  N     . ARG A 1 493 ? 26.067  57.839  58.466 1.00 49.59  ? 588 ARG A N     1 
ATOM   3706 C  CA    . ARG A 1 493 ? 25.750  56.530  59.024 1.00 45.98  ? 588 ARG A CA    1 
ATOM   3707 C  C     . ARG A 1 493 ? 24.936  55.662  58.075 1.00 43.39  ? 588 ARG A C     1 
ATOM   3708 O  O     . ARG A 1 493 ? 24.667  54.502  58.407 1.00 47.56  ? 588 ARG A O     1 
ATOM   3709 C  CB    . ARG A 1 493 ? 24.994  56.683  60.350 1.00 40.89  ? 588 ARG A CB    1 
ATOM   3710 C  CG    . ARG A 1 493 ? 25.795  57.353  61.452 1.00 46.59  ? 588 ARG A CG    1 
ATOM   3711 C  CD    . ARG A 1 493 ? 27.128  56.646  61.675 1.00 47.68  ? 588 ARG A CD    1 
ATOM   3712 N  NE    . ARG A 1 493 ? 27.030  55.548  62.630 1.00 48.34  ? 588 ARG A NE    1 
ATOM   3713 C  CZ    . ARG A 1 493 ? 27.953  54.605  62.779 1.00 58.06  ? 588 ARG A CZ    1 
ATOM   3714 N  NH1   . ARG A 1 493 ? 29.044  54.618  62.022 1.00 63.58  ? 588 ARG A NH1   1 
ATOM   3715 N  NH2   . ARG A 1 493 ? 27.781  53.645  63.679 1.00 51.51  ? 588 ARG A NH2   1 
ATOM   3716 N  N     . ILE A 1 494 ? 24.550  56.191  56.910 1.00 49.92  ? 589 ILE A N     1 
ATOM   3717 C  CA    . ILE A 1 494 ? 23.686  55.456  55.997 1.00 43.87  ? 589 ILE A CA    1 
ATOM   3718 C  C     . ILE A 1 494 ? 24.388  54.186  55.537 1.00 45.01  ? 589 ILE A C     1 
ATOM   3719 O  O     . ILE A 1 494 ? 25.611  54.157  55.343 1.00 48.79  ? 589 ILE A O     1 
ATOM   3720 C  CB    . ILE A 1 494 ? 23.280  56.361  54.819 1.00 34.38  ? 589 ILE A CB    1 
ATOM   3721 C  CG1   . ILE A 1 494 ? 21.974  55.888  54.187 1.00 42.48  ? 589 ILE A CG1   1 
ATOM   3722 C  CG2   . ILE A 1 494 ? 24.367  56.422  53.766 1.00 38.13  ? 589 ILE A CG2   1 
ATOM   3723 C  CD1   . ILE A 1 494 ? 21.250  56.991  53.443 1.00 39.49  ? 589 ILE A CD1   1 
ATOM   3724 N  N     . GLY A 1 495 ? 23.613  53.108  55.395 1.00 43.01  ? 590 GLY A N     1 
ATOM   3725 C  CA    . GLY A 1 495 ? 24.179  51.808  55.109 1.00 33.55  ? 590 GLY A CA    1 
ATOM   3726 C  C     . GLY A 1 495 ? 24.379  51.553  53.627 1.00 47.51  ? 590 GLY A C     1 
ATOM   3727 O  O     . GLY A 1 495 ? 23.883  52.279  52.769 1.00 50.32  ? 590 GLY A O     1 
ATOM   3728 N  N     . GLN A 1 496 ? 25.123  50.484  53.341 1.00 51.46  ? 591 GLN A N     1 
ATOM   3729 C  CA    . GLN A 1 496 ? 25.454  50.148  51.960 1.00 45.45  ? 591 GLN A CA    1 
ATOM   3730 C  C     . GLN A 1 496 ? 24.201  49.834  51.153 1.00 60.67  ? 591 GLN A C     1 
ATOM   3731 O  O     . GLN A 1 496 ? 24.029  50.327  50.031 1.00 54.53  ? 591 GLN A O     1 
ATOM   3732 C  CB    . GLN A 1 496 ? 26.418  48.964  51.936 1.00 56.87  ? 591 GLN A CB    1 
ATOM   3733 C  CG    . GLN A 1 496 ? 27.474  49.016  53.031 1.00 81.78  ? 591 GLN A CG    1 
ATOM   3734 C  CD    . GLN A 1 496 ? 28.327  47.763  53.076 1.00 94.62  ? 591 GLN A CD    1 
ATOM   3735 O  OE1   . GLN A 1 496 ? 27.923  46.707  52.586 1.00 74.95  ? 591 GLN A OE1   1 
ATOM   3736 N  NE2   . GLN A 1 496 ? 29.520  47.875  53.657 1.00 94.39  ? 591 GLN A NE2   1 
ATOM   3737 N  N     . GLN A 1 497 ? 23.311  49.009  51.708 1.00 65.86  ? 592 GLN A N     1 
ATOM   3738 C  CA    . GLN A 1 497 ? 22.111  48.620  50.980 1.00 50.55  ? 592 GLN A CA    1 
ATOM   3739 C  C     . GLN A 1 497 ? 21.086  49.745  50.928 1.00 48.45  ? 592 GLN A C     1 
ATOM   3740 O  O     . GLN A 1 497 ? 20.242  49.758  50.027 1.00 63.25  ? 592 GLN A O     1 
ATOM   3741 C  CB    . GLN A 1 497 ? 21.502  47.364  51.610 1.00 55.79  ? 592 GLN A CB    1 
ATOM   3742 C  CG    . GLN A 1 497 ? 20.519  46.620  50.707 1.00 72.51  ? 592 GLN A CG    1 
ATOM   3743 C  CD    . GLN A 1 497 ? 21.139  46.188  49.387 1.00 89.15  ? 592 GLN A CD    1 
ATOM   3744 O  OE1   . GLN A 1 497 ? 22.274  45.706  49.345 1.00 90.08  ? 592 GLN A OE1   1 
ATOM   3745 N  NE2   . GLN A 1 497 ? 20.395  46.365  48.298 1.00 78.65  ? 592 GLN A NE2   1 
ATOM   3746 N  N     . THR A 1 498 ? 21.147  50.694  51.862 1.00 49.22  ? 593 THR A N     1 
ATOM   3747 C  CA    . THR A 1 498 ? 20.249  51.841  51.804 1.00 50.50  ? 593 THR A CA    1 
ATOM   3748 C  C     . THR A 1 498 ? 20.621  52.789  50.669 1.00 49.63  ? 593 THR A C     1 
ATOM   3749 O  O     . THR A 1 498 ? 19.743  53.447  50.100 1.00 57.91  ? 593 THR A O     1 
ATOM   3750 C  CB    . THR A 1 498 ? 20.259  52.583  53.139 1.00 47.66  ? 593 THR A CB    1 
ATOM   3751 O  OG1   . THR A 1 498 ? 20.315  51.633  54.211 1.00 36.01  ? 593 THR A OG1   1 
ATOM   3752 C  CG2   . THR A 1 498 ? 19.000  53.435  53.284 1.00 51.41  ? 593 THR A CG2   1 
ATOM   3753 N  N     . VAL A 1 499 ? 21.909  52.884  50.333 1.00 56.61  ? 594 VAL A N     1 
ATOM   3754 C  CA    . VAL A 1 499 ? 22.312  53.681  49.180 1.00 40.82  ? 594 VAL A CA    1 
ATOM   3755 C  C     . VAL A 1 499 ? 21.987  52.946  47.890 1.00 46.36  ? 594 VAL A C     1 
ATOM   3756 O  O     . VAL A 1 499 ? 21.498  53.549  46.928 1.00 58.08  ? 594 VAL A O     1 
ATOM   3757 C  CB    . VAL A 1 499 ? 23.809  54.030  49.266 1.00 54.03  ? 594 VAL A CB    1 
ATOM   3758 C  CG1   . VAL A 1 499 ? 24.219  54.907  48.088 1.00 47.00  ? 594 VAL A CG1   1 
ATOM   3759 C  CG2   . VAL A 1 499 ? 24.124  54.713  50.587 1.00 53.34  ? 594 VAL A CG2   1 
ATOM   3760 N  N     . ASP A 1 500 ? 22.263  51.639  47.853 1.00 51.81  ? 595 ASP A N     1 
ATOM   3761 C  CA    . ASP A 1 500 ? 21.887  50.818  46.707 1.00 48.64  ? 595 ASP A CA    1 
ATOM   3762 C  C     . ASP A 1 500 ? 20.402  50.965  46.399 1.00 53.96  ? 595 ASP A C     1 
ATOM   3763 O  O     . ASP A 1 500 ? 20.012  51.109  45.235 1.00 58.44  ? 595 ASP A O     1 
ATOM   3764 C  CB    . ASP A 1 500 ? 22.244  49.353  46.987 1.00 57.58  ? 595 ASP A CB    1 
ATOM   3765 C  CG    . ASP A 1 500 ? 22.332  48.505  45.724 1.00 76.85  ? 595 ASP A CG    1 
ATOM   3766 O  OD1   . ASP A 1 500 ? 23.048  47.480  45.747 1.00 87.80  ? 595 ASP A OD1   1 
ATOM   3767 O  OD2   . ASP A 1 500 ? 21.693  48.854  44.710 1.00 65.77  ? 595 ASP A OD2   1 
ATOM   3768 N  N     . SER A 1 501 ? 19.563  50.971  47.438 1.00 50.15  ? 596 SER A N     1 
ATOM   3769 C  CA    . SER A 1 501 ? 18.120  51.042  47.236 1.00 51.45  ? 596 SER A CA    1 
ATOM   3770 C  C     . SER A 1 501 ? 17.695  52.418  46.735 1.00 50.99  ? 596 SER A C     1 
ATOM   3771 O  O     . SER A 1 501 ? 16.937  52.529  45.764 1.00 47.16  ? 596 SER A O     1 
ATOM   3772 C  CB    . SER A 1 501 ? 17.397  50.698  48.538 1.00 50.28  ? 596 SER A CB    1 
ATOM   3773 O  OG    . SER A 1 501 ? 17.963  49.551  49.146 1.00 58.03  ? 596 SER A OG    1 
ATOM   3774 N  N     . LEU A 1 502 ? 18.170  53.480  47.390 1.00 48.47  ? 597 LEU A N     1 
ATOM   3775 C  CA    . LEU A 1 502 ? 17.756  54.830  47.020 1.00 39.38  ? 597 LEU A CA    1 
ATOM   3776 C  C     . LEU A 1 502 ? 18.187  55.179  45.604 1.00 44.04  ? 597 LEU A C     1 
ATOM   3777 O  O     . LEU A 1 502 ? 17.433  55.815  44.859 1.00 44.46  ? 597 LEU A O     1 
ATOM   3778 C  CB    . LEU A 1 502 ? 18.332  55.838  48.007 1.00 42.66  ? 597 LEU A CB    1 
ATOM   3779 C  CG    . LEU A 1 502 ? 17.609  55.952  49.342 1.00 43.42  ? 597 LEU A CG    1 
ATOM   3780 C  CD1   . LEU A 1 502 ? 18.546  56.547  50.379 1.00 38.90  ? 597 LEU A CD1   1 
ATOM   3781 C  CD2   . LEU A 1 502 ? 16.358  56.807  49.178 1.00 42.17  ? 597 LEU A CD2   1 
ATOM   3782 N  N     . LEU A 1 503 ? 19.401  54.782  45.219 1.00 45.65  ? 598 LEU A N     1 
ATOM   3783 C  CA    . LEU A 1 503 ? 19.894  55.091  43.880 1.00 43.92  ? 598 LEU A CA    1 
ATOM   3784 C  C     . LEU A 1 503 ? 19.058  54.400  42.811 1.00 43.64  ? 598 LEU A C     1 
ATOM   3785 O  O     . LEU A 1 503 ? 18.672  55.019  41.813 1.00 49.13  ? 598 LEU A O     1 
ATOM   3786 C  CB    . LEU A 1 503 ? 21.363  54.688  43.755 1.00 49.22  ? 598 LEU A CB    1 
ATOM   3787 C  CG    . LEU A 1 503 ? 22.398  55.582  44.435 1.00 36.12  ? 598 LEU A CG    1 
ATOM   3788 C  CD1   . LEU A 1 503 ? 23.795  55.062  44.156 1.00 29.73  ? 598 LEU A CD1   1 
ATOM   3789 C  CD2   . LEU A 1 503 ? 22.252  57.009  43.951 1.00 38.62  ? 598 LEU A CD2   1 
ATOM   3790 N  N     . PHE A 1 504 ? 18.767  53.110  43.006 1.00 44.23  ? 599 PHE A N     1 
ATOM   3791 C  CA    . PHE A 1 504 ? 17.998  52.358  42.017 1.00 46.83  ? 599 PHE A CA    1 
ATOM   3792 C  C     . PHE A 1 504 ? 16.573  52.887  41.897 1.00 48.73  ? 599 PHE A C     1 
ATOM   3793 O  O     . PHE A 1 504 ? 16.093  53.162  40.791 1.00 48.32  ? 599 PHE A O     1 
ATOM   3794 C  CB    . PHE A 1 504 ? 17.986  50.874  42.378 1.00 36.64  ? 599 PHE A CB    1 
ATOM   3795 C  CG    . PHE A 1 504 ? 16.923  50.089  41.662 1.00 53.74  ? 599 PHE A CG    1 
ATOM   3796 C  CD1   . PHE A 1 504 ? 17.141  49.610  40.381 1.00 39.11  ? 599 PHE A CD1   1 
ATOM   3797 C  CD2   . PHE A 1 504 ? 15.699  49.835  42.269 1.00 56.69  ? 599 PHE A CD2   1 
ATOM   3798 C  CE1   . PHE A 1 504 ? 16.164  48.892  39.721 1.00 50.77  ? 599 PHE A CE1   1 
ATOM   3799 C  CE2   . PHE A 1 504 ? 14.717  49.122  41.615 1.00 49.50  ? 599 PHE A CE2   1 
ATOM   3800 C  CZ    . PHE A 1 504 ? 14.949  48.649  40.337 1.00 67.79  ? 599 PHE A CZ    1 
ATOM   3801 N  N     . LEU A 1 505 ? 15.870  53.013  43.025 1.00 44.71  ? 600 LEU A N     1 
ATOM   3802 C  CA    . LEU A 1 505 ? 14.501  53.515  42.982 1.00 49.37  ? 600 LEU A CA    1 
ATOM   3803 C  C     . LEU A 1 505 ? 14.431  54.877  42.306 1.00 50.23  ? 600 LEU A C     1 
ATOM   3804 O  O     . LEU A 1 505 ? 13.546  55.119  41.477 1.00 63.26  ? 600 LEU A O     1 
ATOM   3805 C  CB    . LEU A 1 505 ? 13.918  53.578  44.392 1.00 52.82  ? 600 LEU A CB    1 
ATOM   3806 C  CG    . LEU A 1 505 ? 13.514  52.231  44.990 1.00 46.39  ? 600 LEU A CG    1 
ATOM   3807 C  CD1   . LEU A 1 505 ? 12.789  52.422  46.313 1.00 59.14  ? 600 LEU A CD1   1 
ATOM   3808 C  CD2   . LEU A 1 505 ? 12.654  51.467  44.005 1.00 46.23  ? 600 LEU A CD2   1 
ATOM   3809 N  N     . ASN A 1 506 ? 15.363  55.775  42.634 1.00 44.73  ? 601 ASN A N     1 
ATOM   3810 C  CA    . ASN A 1 506 ? 15.393  57.072  41.966 1.00 47.35  ? 601 ASN A CA    1 
ATOM   3811 C  C     . ASN A 1 506 ? 15.583  56.907  40.461 1.00 56.17  ? 601 ASN A C     1 
ATOM   3812 O  O     . ASN A 1 506 ? 14.968  57.628  39.666 1.00 56.10  ? 601 ASN A O     1 
ATOM   3813 C  CB    . ASN A 1 506 ? 16.495  57.943  42.570 1.00 39.42  ? 601 ASN A CB    1 
ATOM   3814 C  CG    . ASN A 1 506 ? 16.649  59.267  41.855 1.00 51.25  ? 601 ASN A CG    1 
ATOM   3815 O  OD1   . ASN A 1 506 ? 17.419  59.385  40.904 1.00 56.49  ? 601 ASN A OD1   1 
ATOM   3816 N  ND2   . ASN A 1 506 ? 15.917  60.276  42.313 1.00 60.53  ? 601 ASN A ND2   1 
ATOM   3817 N  N     . SER A 1 507 ? 16.410  55.943  40.051 1.00 47.46  ? 602 SER A N     1 
ATOM   3818 C  CA    . SER A 1 507 ? 16.579  55.664  38.628 1.00 45.96  ? 602 SER A CA    1 
ATOM   3819 C  C     . SER A 1 507 ? 15.330  55.022  38.037 1.00 56.48  ? 602 SER A C     1 
ATOM   3820 O  O     . SER A 1 507 ? 14.978  55.283  36.879 1.00 57.68  ? 602 SER A O     1 
ATOM   3821 C  CB    . SER A 1 507 ? 17.794  54.762  38.415 1.00 45.52  ? 602 SER A CB    1 
ATOM   3822 O  OG    . SER A 1 507 ? 17.953  54.430  37.047 1.00 45.81  ? 602 SER A OG    1 
ATOM   3823 N  N     . PHE A 1 508 ? 14.655  54.169  38.813 1.00 53.83  ? 603 PHE A N     1 
ATOM   3824 C  CA    . PHE A 1 508 ? 13.437  53.526  38.327 1.00 59.14  ? 603 PHE A CA    1 
ATOM   3825 C  C     . PHE A 1 508 ? 12.346  54.558  38.063 1.00 61.43  ? 603 PHE A C     1 
ATOM   3826 O  O     . PHE A 1 508 ? 11.815  54.647  36.950 1.00 55.22  ? 603 PHE A O     1 
ATOM   3827 C  CB    . PHE A 1 508 ? 12.966  52.474  39.336 1.00 49.24  ? 603 PHE A CB    1 
ATOM   3828 C  CG    . PHE A 1 508 ? 11.629  51.873  39.010 1.00 59.43  ? 603 PHE A CG    1 
ATOM   3829 C  CD1   . PHE A 1 508 ? 11.528  50.809  38.132 1.00 62.20  ? 603 PHE A CD1   1 
ATOM   3830 C  CD2   . PHE A 1 508 ? 10.472  52.371  39.588 1.00 66.19  ? 603 PHE A CD2   1 
ATOM   3831 C  CE1   . PHE A 1 508 ? 10.299  50.259  37.827 1.00 48.01  ? 603 PHE A CE1   1 
ATOM   3832 C  CE2   . PHE A 1 508 ? 9.241   51.824  39.289 1.00 64.62  ? 603 PHE A CE2   1 
ATOM   3833 C  CZ    . PHE A 1 508 ? 9.155   50.766  38.408 1.00 64.08  ? 603 PHE A CZ    1 
ATOM   3834 N  N     . TYR A 1 509 ? 12.019  55.371  39.072 1.00 52.64  ? 604 TYR A N     1 
ATOM   3835 C  CA    . TYR A 1 509 ? 10.994  56.398  38.934 1.00 49.60  ? 604 TYR A CA    1 
ATOM   3836 C  C     . TYR A 1 509 ? 11.310  57.418  37.848 1.00 64.73  ? 604 TYR A C     1 
ATOM   3837 O  O     . TYR A 1 509 ? 10.442  58.235  37.522 1.00 71.03  ? 604 TYR A O     1 
ATOM   3838 C  CB    . TYR A 1 509 ? 10.799  57.107  40.275 1.00 59.70  ? 604 TYR A CB    1 
ATOM   3839 C  CG    . TYR A 1 509 ? 10.162  56.233  41.334 1.00 70.13  ? 604 TYR A CG    1 
ATOM   3840 C  CD1   . TYR A 1 509 ? 10.653  56.205  42.633 1.00 57.29  ? 604 TYR A CD1   1 
ATOM   3841 C  CD2   . TYR A 1 509 ? 9.059   55.442  41.033 1.00 72.07  ? 604 TYR A CD2   1 
ATOM   3842 C  CE1   . TYR A 1 509 ? 10.071  55.408  43.601 1.00 60.03  ? 604 TYR A CE1   1 
ATOM   3843 C  CE2   . TYR A 1 509 ? 8.468   54.644  41.994 1.00 70.81  ? 604 TYR A CE2   1 
ATOM   3844 C  CZ    . TYR A 1 509 ? 8.976   54.630  43.276 1.00 79.32  ? 604 TYR A CZ    1 
ATOM   3845 O  OH    . TYR A 1 509 ? 8.388   53.834  44.235 1.00 89.72  ? 604 TYR A OH    1 
ATOM   3846 N  N     . LYS A 1 510 ? 12.518  57.399  37.285 1.00 64.51  ? 605 LYS A N     1 
ATOM   3847 C  CA    . LYS A 1 510 ? 12.836  58.249  36.146 1.00 51.96  ? 605 LYS A CA    1 
ATOM   3848 C  C     . LYS A 1 510 ? 12.601  57.541  34.818 1.00 54.41  ? 605 LYS A C     1 
ATOM   3849 O  O     . LYS A 1 510 ? 12.150  58.172  33.856 1.00 68.88  ? 605 LYS A O     1 
ATOM   3850 C  CB    . LYS A 1 510 ? 14.290  58.729  36.219 1.00 53.59  ? 605 LYS A CB    1 
ATOM   3851 C  CG    . LYS A 1 510 ? 14.536  59.888  37.177 1.00 45.67  ? 605 LYS A CG    1 
ATOM   3852 C  CD    . LYS A 1 510 ? 15.903  60.544  36.949 1.00 39.40  ? 605 LYS A CD    1 
ATOM   3853 C  CE    . LYS A 1 510 ? 17.019  59.823  37.697 1.00 60.54  ? 605 LYS A CE    1 
ATOM   3854 N  NZ    . LYS A 1 510 ? 18.339  60.505  37.522 1.00 48.04  ? 605 LYS A NZ    1 
ATOM   3855 N  N     . ASN A 1 511 ? 12.896  56.243  34.740 1.00 57.94  ? 606 ASN A N     1 
ATOM   3856 C  CA    . ASN A 1 511 ? 12.771  55.500  33.491 1.00 60.52  ? 606 ASN A CA    1 
ATOM   3857 C  C     . ASN A 1 511 ? 11.414  54.835  33.304 1.00 67.38  ? 606 ASN A C     1 
ATOM   3858 O  O     . ASN A 1 511 ? 11.159  54.293  32.223 1.00 78.32  ? 606 ASN A O     1 
ATOM   3859 C  CB    . ASN A 1 511 ? 13.858  54.423  33.397 1.00 59.51  ? 606 ASN A CB    1 
ATOM   3860 C  CG    . ASN A 1 511 ? 15.226  54.997  33.106 1.00 68.45  ? 606 ASN A CG    1 
ATOM   3861 O  OD1   . ASN A 1 511 ? 15.605  55.180  31.946 1.00 69.01  ? 606 ASN A OD1   1 
ATOM   3862 N  ND2   . ASN A 1 511 ? 15.981  55.280  34.160 1.00 60.35  ? 606 ASN A ND2   1 
ATOM   3863 N  N     . PHE A 1 512 ? 10.542  54.848  34.317 1.00 73.18  ? 607 PHE A N     1 
ATOM   3864 C  CA    . PHE A 1 512 ? 9.256   54.165  34.217 1.00 64.51  ? 607 PHE A CA    1 
ATOM   3865 C  C     . PHE A 1 512 ? 8.134   54.964  34.878 1.00 83.51  ? 607 PHE A C     1 
ATOM   3866 O  O     . PHE A 1 512 ? 7.206   54.380  35.450 1.00 95.50  ? 607 PHE A O     1 
ATOM   3867 C  CB    . PHE A 1 512 ? 9.325   52.764  34.831 1.00 68.32  ? 607 PHE A CB    1 
ATOM   3868 C  CG    . PHE A 1 512 ? 10.368  51.876  34.210 1.00 60.28  ? 607 PHE A CG    1 
ATOM   3869 C  CD1   . PHE A 1 512 ? 10.161  51.301  32.969 1.00 60.32  ? 607 PHE A CD1   1 
ATOM   3870 C  CD2   . PHE A 1 512 ? 11.552  51.607  34.875 1.00 65.42  ? 607 PHE A CD2   1 
ATOM   3871 C  CE1   . PHE A 1 512 ? 11.118  50.481  32.398 1.00 67.05  ? 607 PHE A CE1   1 
ATOM   3872 C  CE2   . PHE A 1 512 ? 12.512  50.786  34.312 1.00 60.11  ? 607 PHE A CE2   1 
ATOM   3873 C  CZ    . PHE A 1 512 ? 12.294  50.223  33.072 1.00 63.52  ? 607 PHE A CZ    1 
ATOM   3874 N  N     . CYS A 1 513 ? 8.203   56.292  34.812 1.00 91.39  ? 608 CYS A N     1 
ATOM   3875 C  CA    . CYS A 1 513 ? 7.166   57.162  35.349 1.00 79.67  ? 608 CYS A CA    1 
ATOM   3876 C  C     . CYS A 1 513 ? 7.183   58.468  34.567 1.00 92.77  ? 608 CYS A C     1 
ATOM   3877 O  O     . CYS A 1 513 ? 8.020   58.677  33.683 1.00 84.79  ? 608 CYS A O     1 
ATOM   3878 C  CB    . CYS A 1 513 ? 7.354   57.405  36.851 1.00 81.13  ? 608 CYS A CB    1 
ATOM   3879 S  SG    . CYS A 1 513 ? 6.530   56.202  37.931 1.00 112.85 ? 608 CYS A SG    1 
ATOM   3880 N  N     . LYS A 1 514 ? 6.247   59.351  34.898 1.00 116.11 ? 609 LYS A N     1 
ATOM   3881 C  CA    . LYS A 1 514 ? 6.082   60.603  34.166 1.00 120.49 ? 609 LYS A CA    1 
ATOM   3882 C  C     . LYS A 1 514 ? 6.015   61.790  35.118 1.00 103.79 ? 609 LYS A C     1 
ATOM   3883 O  O     . LYS A 1 514 ? 5.020   62.513  35.148 1.00 118.65 ? 609 LYS A O     1 
ATOM   3884 C  CB    . LYS A 1 514 ? 4.822   60.557  33.292 1.00 119.29 ? 609 LYS A CB    1 
ATOM   3885 C  CG    . LYS A 1 514 ? 4.820   59.452  32.238 1.00 111.14 ? 609 LYS A CG    1 
ATOM   3886 C  CD    . LYS A 1 514 ? 4.211   58.161  32.772 1.00 101.68 ? 609 LYS A CD    1 
ATOM   3887 C  CE    . LYS A 1 514 ? 4.704   56.948  31.994 1.00 107.54 ? 609 LYS A CE    1 
ATOM   3888 N  NZ    . LYS A 1 514 ? 6.176   56.742  32.136 1.00 93.47  ? 609 LYS A NZ    1 
ATOM   3889 O  "O5'" . DA  B 2 1   ? 26.687  67.309  27.309 1.00 73.88  ? 1   DA  B "O5'" 1 
ATOM   3890 C  "C5'" . DA  B 2 1   ? 25.649  66.920  28.193 1.00 63.82  ? 1   DA  B "C5'" 1 
ATOM   3891 C  "C4'" . DA  B 2 1   ? 25.602  65.410  28.338 1.00 55.67  ? 1   DA  B "C4'" 1 
ATOM   3892 O  "O4'" . DA  B 2 1   ? 26.831  64.950  28.951 1.00 61.65  ? 1   DA  B "O4'" 1 
ATOM   3893 C  "C3'" . DA  B 2 1   ? 24.499  64.902  29.245 1.00 52.83  ? 1   DA  B "C3'" 1 
ATOM   3894 O  "O3'" . DA  B 2 1   ? 24.161  63.562  28.910 1.00 53.88  ? 1   DA  B "O3'" 1 
ATOM   3895 C  "C2'" . DA  B 2 1   ? 25.148  64.996  30.623 1.00 49.26  ? 1   DA  B "C2'" 1 
ATOM   3896 C  "C1'" . DA  B 2 1   ? 26.606  64.655  30.319 1.00 51.52  ? 1   DA  B "C1'" 1 
ATOM   3897 N  N9    . DA  B 2 1   ? 27.563  65.414  31.118 1.00 46.58  ? 1   DA  B N9    1 
ATOM   3898 C  C8    . DA  B 2 1   ? 28.013  66.683  30.884 1.00 54.59  ? 1   DA  B C8    1 
ATOM   3899 N  N7    . DA  B 2 1   ? 28.882  67.111  31.773 1.00 57.65  ? 1   DA  B N7    1 
ATOM   3900 C  C5    . DA  B 2 1   ? 29.009  66.045  32.651 1.00 62.27  ? 1   DA  B C5    1 
ATOM   3901 C  C6    . DA  B 2 1   ? 29.784  65.856  33.819 1.00 56.81  ? 1   DA  B C6    1 
ATOM   3902 N  N6    . DA  B 2 1   ? 30.609  66.781  34.317 1.00 53.82  ? 1   DA  B N6    1 
ATOM   3903 N  N1    . DA  B 2 1   ? 29.673  64.674  34.456 1.00 46.41  ? 1   DA  B N1    1 
ATOM   3904 C  C2    . DA  B 2 1   ? 28.846  63.748  33.956 1.00 51.36  ? 1   DA  B C2    1 
ATOM   3905 N  N3    . DA  B 2 1   ? 28.074  63.806  32.872 1.00 54.16  ? 1   DA  B N3    1 
ATOM   3906 C  C4    . DA  B 2 1   ? 28.202  64.993  32.259 1.00 56.42  ? 1   DA  B C4    1 
ATOM   3907 P  P     . DG  B 2 2   ? 22.668  63.026  29.162 1.00 58.26  ? 2   DG  B P     1 
ATOM   3908 O  OP1   . DG  B 2 2   ? 22.683  61.554  29.003 1.00 44.40  ? 2   DG  B OP1   1 
ATOM   3909 O  OP2   . DG  B 2 2   ? 21.751  63.853  28.345 1.00 53.95  ? 2   DG  B OP2   1 
ATOM   3910 O  "O5'" . DG  B 2 2   ? 22.416  63.323  30.715 1.00 54.10  ? 2   DG  B "O5'" 1 
ATOM   3911 C  "C5'" . DG  B 2 2   ? 22.761  62.335  31.681 1.00 50.45  ? 2   DG  B "C5'" 1 
ATOM   3912 C  "C4'" . DG  B 2 2   ? 22.696  62.883  33.101 1.00 45.71  ? 2   DG  B "C4'" 1 
ATOM   3913 O  "O4'" . DG  B 2 2   ? 23.872  63.684  33.389 1.00 43.69  ? 2   DG  B "O4'" 1 
ATOM   3914 C  "C3'" . DG  B 2 2   ? 21.490  63.779  33.431 1.00 45.74  ? 2   DG  B "C3'" 1 
ATOM   3915 O  "O3'" . DG  B 2 2   ? 20.959  63.387  34.691 1.00 71.74  ? 2   DG  B "O3'" 1 
ATOM   3916 C  "C2'" . DG  B 2 2   ? 22.127  65.165  33.531 1.00 47.67  ? 2   DG  B "C2'" 1 
ATOM   3917 C  "C1'" . DG  B 2 2   ? 23.451  64.778  34.152 1.00 49.86  ? 2   DG  B "C1'" 1 
ATOM   3918 N  N9    . DG  B 2 2   ? 24.476  65.819  34.143 1.00 52.17  ? 2   DG  B N9    1 
ATOM   3919 C  C8    . DG  B 2 2   ? 24.559  66.908  33.311 1.00 53.99  ? 2   DG  B C8    1 
ATOM   3920 N  N7    . DG  B 2 2   ? 25.592  67.671  33.557 1.00 58.77  ? 2   DG  B N7    1 
ATOM   3921 C  C5    . DG  B 2 2   ? 26.226  67.051  34.629 1.00 48.58  ? 2   DG  B C5    1 
ATOM   3922 C  C6    . DG  B 2 2   ? 27.397  67.418  35.338 1.00 50.10  ? 2   DG  B C6    1 
ATOM   3923 O  O6    . DG  B 2 2   ? 28.136  68.395  35.150 1.00 54.46  ? 2   DG  B O6    1 
ATOM   3924 N  N1    . DG  B 2 2   ? 27.688  66.512  36.356 1.00 54.50  ? 2   DG  B N1    1 
ATOM   3925 C  C2    . DG  B 2 2   ? 26.944  65.392  36.651 1.00 52.53  ? 2   DG  B C2    1 
ATOM   3926 N  N2    . DG  B 2 2   ? 27.381  64.634  37.669 1.00 43.90  ? 2   DG  B N2    1 
ATOM   3927 N  N3    . DG  B 2 2   ? 25.849  65.039  35.995 1.00 52.09  ? 2   DG  B N3    1 
ATOM   3928 C  C4    . DG  B 2 2   ? 25.549  65.913  35.001 1.00 52.22  ? 2   DG  B C4    1 
ATOM   3929 P  P     . DA  B 2 3   ? 19.405  63.016  34.866 1.00 73.33  ? 3   DA  B P     1 
ATOM   3930 O  OP1   . DA  B 2 3   ? 19.274  61.541  34.798 1.00 45.46  ? 3   DA  B OP1   1 
ATOM   3931 O  OP2   . DA  B 2 3   ? 18.622  63.888  33.958 1.00 60.76  ? 3   DA  B OP2   1 
ATOM   3932 O  "O5'" . DA  B 2 3   ? 19.102  63.411  36.384 1.00 50.03  ? 3   DA  B "O5'" 1 
ATOM   3933 C  "C5'" . DA  B 2 3   ? 19.476  64.690  36.876 1.00 51.12  ? 3   DA  B "C5'" 1 
ATOM   3934 C  "C4'" . DA  B 2 3   ? 20.456  64.555  38.025 1.00 54.30  ? 3   DA  B "C4'" 1 
ATOM   3935 O  "O4'" . DA  B 2 3   ? 21.806  64.682  37.523 1.00 44.48  ? 3   DA  B "O4'" 1 
ATOM   3936 C  "C3'" . DA  B 2 3   ? 20.329  65.622  39.096 1.00 56.34  ? 3   DA  B "C3'" 1 
ATOM   3937 O  "O3'" . DA  B 2 3   ? 19.375  65.213  40.063 1.00 62.97  ? 3   DA  B "O3'" 1 
ATOM   3938 C  "C2'" . DA  B 2 3   ? 21.734  65.658  39.685 1.00 57.59  ? 3   DA  B "C2'" 1 
ATOM   3939 C  "C1'" . DA  B 2 3   ? 22.605  65.377  38.460 1.00 51.72  ? 3   DA  B "C1'" 1 
ATOM   3940 N  N9    . DA  B 2 3   ? 23.136  66.580  37.821 1.00 57.81  ? 3   DA  B N9    1 
ATOM   3941 C  C8    . DA  B 2 3   ? 22.698  67.168  36.664 1.00 56.22  ? 3   DA  B C8    1 
ATOM   3942 N  N7    . DA  B 2 3   ? 23.378  68.240  36.324 1.00 53.62  ? 3   DA  B N7    1 
ATOM   3943 C  C5    . DA  B 2 3   ? 24.328  68.361  37.326 1.00 48.56  ? 3   DA  B C5    1 
ATOM   3944 C  C6    . DA  B 2 3   ? 25.357  69.295  37.551 1.00 48.31  ? 3   DA  B C6    1 
ATOM   3945 N  N6    . DA  B 2 3   ? 25.604  70.326  36.740 1.00 53.00  ? 3   DA  B N6    1 
ATOM   3946 N  N1    . DA  B 2 3   ? 26.126  69.126  38.646 1.00 55.05  ? 3   DA  B N1    1 
ATOM   3947 C  C2    . DA  B 2 3   ? 25.877  68.092  39.459 1.00 55.32  ? 3   DA  B C2    1 
ATOM   3948 N  N3    . DA  B 2 3   ? 24.941  67.153  39.354 1.00 55.65  ? 3   DA  B N3    1 
ATOM   3949 C  C4    . DA  B 2 3   ? 24.194  67.346  38.255 1.00 57.21  ? 3   DA  B C4    1 
ATOM   3950 P  P     . DG  B 2 4   ? 18.381  66.285  40.732 1.00 65.32  ? 4   DG  B P     1 
ATOM   3951 O  OP1   . DG  B 2 4   ? 17.373  65.513  41.497 1.00 73.33  ? 4   DG  B OP1   1 
ATOM   3952 O  OP2   . DG  B 2 4   ? 17.955  67.259  39.705 1.00 41.14  ? 4   DG  B OP2   1 
ATOM   3953 O  "O5'" . DG  B 2 4   ? 19.311  67.098  41.745 1.00 59.12  ? 4   DG  B "O5'" 1 
ATOM   3954 C  "C5'" . DG  B 2 4   ? 20.018  66.433  42.784 1.00 55.42  ? 4   DG  B "C5'" 1 
ATOM   3955 C  "C4'" . DG  B 2 4   ? 20.700  67.449  43.679 1.00 59.54  ? 4   DG  B "C4'" 1 
ATOM   3956 O  "O4'" . DG  B 2 4   ? 21.785  68.079  42.943 1.00 62.03  ? 4   DG  B "O4'" 1 
ATOM   3957 C  "C3'" . DG  B 2 4   ? 19.791  68.588  44.151 1.00 57.53  ? 4   DG  B "C3'" 1 
ATOM   3958 O  "O3'" . DG  B 2 4   ? 20.094  68.952  45.500 1.00 65.20  ? 4   DG  B "O3'" 1 
ATOM   3959 C  "C2'" . DG  B 2 4   ? 20.113  69.711  43.174 1.00 47.38  ? 4   DG  B "C2'" 1 
ATOM   3960 C  "C1'" . DG  B 2 4   ? 21.590  69.478  42.907 1.00 61.85  ? 4   DG  B "C1'" 1 
ATOM   3961 N  N9    . DG  B 2 4   ? 22.021  69.988  41.605 1.00 63.35  ? 4   DG  B N9    1 
ATOM   3962 C  C8    . DG  B 2 4   ? 21.546  69.618  40.368 1.00 58.53  ? 4   DG  B C8    1 
ATOM   3963 N  N7    . DG  B 2 4   ? 22.113  70.258  39.379 1.00 59.06  ? 4   DG  B N7    1 
ATOM   3964 C  C5    . DG  B 2 4   ? 23.022  71.111  40.003 1.00 48.35  ? 4   DG  B C5    1 
ATOM   3965 C  C6    . DG  B 2 4   ? 23.930  72.052  39.447 1.00 44.00  ? 4   DG  B C6    1 
ATOM   3966 O  O6    . DG  B 2 4   ? 24.119  72.331  38.252 1.00 47.88  ? 4   DG  B O6    1 
ATOM   3967 N  N1    . DG  B 2 4   ? 24.663  72.703  40.433 1.00 42.52  ? 4   DG  B N1    1 
ATOM   3968 C  C2    . DG  B 2 4   ? 24.541  72.478  41.785 1.00 51.24  ? 4   DG  B C2    1 
ATOM   3969 N  N2    . DG  B 2 4   ? 25.339  73.206  42.582 1.00 45.44  ? 4   DG  B N2    1 
ATOM   3970 N  N3    . DG  B 2 4   ? 23.698  71.601  42.321 1.00 40.85  ? 4   DG  B N3    1 
ATOM   3971 C  C4    . DG  B 2 4   ? 22.972  70.958  41.373 1.00 51.24  ? 4   DG  B C4    1 
ATOM   3972 P  P     . DA  B 2 5   ? 18.976  69.648  46.428 1.00 61.26  ? 5   DA  B P     1 
ATOM   3973 O  OP1   . DA  B 2 5   ? 18.982  69.012  47.761 1.00 59.07  ? 5   DA  B OP1   1 
ATOM   3974 O  OP2   . DA  B 2 5   ? 17.721  69.733  45.651 1.00 51.52  ? 5   DA  B OP2   1 
ATOM   3975 O  "O5'" . DA  B 2 5   ? 19.516  71.126  46.609 1.00 60.13  ? 5   DA  B "O5'" 1 
ATOM   3976 C  "C5'" . DA  B 2 5   ? 19.413  72.009  45.534 1.00 66.09  ? 5   DA  B "C5'" 1 
ATOM   3977 C  "C4'" . DA  B 2 5   ? 20.262  73.230  45.745 1.00 41.32  ? 5   DA  B "C4'" 1 
ATOM   3978 O  "O4'" . DA  B 2 5   ? 21.177  73.349  44.636 1.00 43.57  ? 5   DA  B "O4'" 1 
ATOM   3979 C  "C3'" . DA  B 2 5   ? 19.462  74.520  45.816 1.00 38.17  ? 5   DA  B "C3'" 1 
ATOM   3980 O  "O3'" . DA  B 2 5   ? 19.733  75.193  47.018 1.00 49.71  ? 5   DA  B "O3'" 1 
ATOM   3981 C  "C2'" . DA  B 2 5   ? 19.886  75.335  44.592 1.00 44.49  ? 5   DA  B "C2'" 1 
ATOM   3982 C  "C1'" . DA  B 2 5   ? 21.156  74.647  44.099 1.00 51.32  ? 5   DA  B "C1'" 1 
ATOM   3983 N  N9    . DA  B 2 5   ? 21.207  74.537  42.643 1.00 47.45  ? 5   DA  B N9    1 
ATOM   3984 C  C8    . DA  B 2 5   ? 20.414  73.753  41.850 1.00 49.86  ? 5   DA  B C8    1 
ATOM   3985 N  N7    . DA  B 2 5   ? 20.676  73.858  40.567 1.00 44.19  ? 5   DA  B N7    1 
ATOM   3986 C  C5    . DA  B 2 5   ? 21.713  74.776  40.515 1.00 39.21  ? 5   DA  B C5    1 
ATOM   3987 C  C6    . DA  B 2 5   ? 22.443  75.323  39.440 1.00 36.54  ? 5   DA  B C6    1 
ATOM   3988 N  N6    . DA  B 2 5   ? 22.225  75.001  38.160 1.00 40.11  ? 5   DA  B N6    1 
ATOM   3989 N  N1    . DA  B 2 5   ? 23.410  76.217  39.734 1.00 44.11  ? 5   DA  B N1    1 
ATOM   3990 C  C2    . DA  B 2 5   ? 23.628  76.537  41.017 1.00 43.33  ? 5   DA  B C2    1 
ATOM   3991 N  N3    . DA  B 2 5   ? 23.010  76.090  42.110 1.00 40.14  ? 5   DA  B N3    1 
ATOM   3992 C  C4    . DA  B 2 5   ? 22.052  75.206  41.787 1.00 43.80  ? 5   DA  B C4    1 
ATOM   3993 P  P     . DA  B 2 6   ? 18.787  76.401  47.483 1.00 48.01  ? 6   DA  B P     1 
ATOM   3994 O  OP1   . DA  B 2 6   ? 18.922  76.561  48.946 1.00 48.09  ? 6   DA  B OP1   1 
ATOM   3995 O  OP2   . DA  B 2 6   ? 17.461  76.188  46.858 1.00 45.44  ? 6   DA  B OP2   1 
ATOM   3996 O  "O5'" . DA  B 2 6   ? 19.476  77.674  46.832 1.00 41.84  ? 6   DA  B "O5'" 1 
ATOM   3997 C  "C5'" . DA  B 2 6   ? 20.844  77.914  47.067 1.00 46.34  ? 6   DA  B "C5'" 1 
ATOM   3998 C  "C4'" . DA  B 2 6   ? 21.291  79.158  46.335 1.00 51.23  ? 6   DA  B "C4'" 1 
ATOM   3999 O  "O4'" . DA  B 2 6   ? 21.494  78.841  44.941 1.00 45.37  ? 6   DA  B "O4'" 1 
ATOM   4000 C  "C3'" . DA  B 2 6   ? 20.294  80.315  46.384 1.00 50.42  ? 6   DA  B "C3'" 1 
ATOM   4001 O  "O3'" . DA  B 2 6   ? 20.945  81.486  46.850 1.00 48.13  ? 6   DA  B "O3'" 1 
ATOM   4002 C  "C2'" . DA  B 2 6   ? 19.803  80.458  44.939 1.00 37.09  ? 6   DA  B "C2'" 1 
ATOM   4003 C  "C1'" . DA  B 2 6   ? 20.940  79.845  44.134 1.00 40.13  ? 6   DA  B "C1'" 1 
ATOM   4004 N  N9    . DA  B 2 6   ? 20.501  79.220  42.891 1.00 31.90  ? 6   DA  B N9    1 
ATOM   4005 C  C8    . DA  B 2 6   ? 19.476  78.331  42.740 1.00 46.33  ? 6   DA  B C8    1 
ATOM   4006 N  N7    . DA  B 2 6   ? 19.308  77.919  41.504 1.00 52.59  ? 6   DA  B N7    1 
ATOM   4007 C  C5    . DA  B 2 6   ? 20.295  78.582  40.794 1.00 37.85  ? 6   DA  B C5    1 
ATOM   4008 C  C6    . DA  B 2 6   ? 20.649  78.576  39.429 1.00 32.44  ? 6   DA  B C6    1 
ATOM   4009 N  N6    . DA  B 2 6   ? 20.009  77.847  38.509 1.00 35.77  ? 6   DA  B N6    1 
ATOM   4010 N  N1    . DA  B 2 6   ? 21.686  79.350  39.046 1.00 30.83  ? 6   DA  B N1    1 
ATOM   4011 C  C2    . DA  B 2 6   ? 22.325  80.078  39.971 1.00 40.99  ? 6   DA  B C2    1 
ATOM   4012 N  N3    . DA  B 2 6   ? 22.086  80.165  41.282 1.00 47.05  ? 6   DA  B N3    1 
ATOM   4013 C  C4    . DA  B 2 6   ? 21.045  79.385  41.633 1.00 37.90  ? 6   DA  B C4    1 
ATOM   4014 P  P     . DC  B 2 7   ? 20.110  82.825  47.144 1.00 52.55  ? 7   DC  B P     1 
ATOM   4015 O  OP1   . DC  B 2 7   ? 20.758  83.541  48.263 1.00 37.97  ? 7   DC  B OP1   1 
ATOM   4016 O  OP2   . DC  B 2 7   ? 18.671  82.481  47.227 1.00 43.92  ? 7   DC  B OP2   1 
ATOM   4017 O  "O5'" . DC  B 2 7   ? 20.396  83.696  45.852 1.00 41.29  ? 7   DC  B "O5'" 1 
ATOM   4018 C  "C5'" . DC  B 2 7   ? 21.722  83.802  45.385 1.00 46.40  ? 7   DC  B "C5'" 1 
ATOM   4019 C  "C4'" . DC  B 2 7   ? 21.759  84.482  44.041 1.00 58.48  ? 7   DC  B "C4'" 1 
ATOM   4020 O  "O4'" . DC  B 2 7   ? 21.384  83.538  43.003 1.00 59.71  ? 7   DC  B "O4'" 1 
ATOM   4021 C  "C3'" . DC  B 2 7   ? 20.802  85.667  43.901 1.00 60.70  ? 7   DC  B "C3'" 1 
ATOM   4022 O  "O3'" . DC  B 2 7   ? 21.456  86.708  43.223 1.00 63.22  ? 7   DC  B "O3'" 1 
ATOM   4023 C  "C2'" . DC  B 2 7   ? 19.662  85.089  43.063 1.00 47.77  ? 7   DC  B "C2'" 1 
ATOM   4024 C  "C1'" . DC  B 2 7   ? 20.439  84.151  42.160 1.00 50.68  ? 7   DC  B "C1'" 1 
ATOM   4025 N  N1    . DC  B 2 7   ? 19.612  83.097  41.514 1.00 36.08  ? 7   DC  B N1    1 
ATOM   4026 C  C2    . DC  B 2 7   ? 19.855  82.759  40.178 1.00 40.52  ? 7   DC  B C2    1 
ATOM   4027 O  O2    . DC  B 2 7   ? 20.762  83.346  39.563 1.00 42.61  ? 7   DC  B O2    1 
ATOM   4028 N  N3    . DC  B 2 7   ? 19.095  81.796  39.595 1.00 33.36  ? 7   DC  B N3    1 
ATOM   4029 C  C4    . DC  B 2 7   ? 18.134  81.187  40.296 1.00 42.91  ? 7   DC  B C4    1 
ATOM   4030 N  N4    . DC  B 2 7   ? 17.409  80.243  39.679 1.00 38.00  ? 7   DC  B N4    1 
ATOM   4031 C  C5    . DC  B 2 7   ? 17.873  81.520  41.660 1.00 37.17  ? 7   DC  B C5    1 
ATOM   4032 C  C6    . DC  B 2 7   ? 18.627  82.473  42.223 1.00 40.45  ? 7   DC  B C6    1 
ATOM   4033 P  P     . DA  B 2 8   ? 21.373  88.209  43.775 1.00 64.04  ? 8   DA  B P     1 
ATOM   4034 O  OP1   . DA  B 2 8   ? 22.307  88.343  44.913 1.00 69.98  ? 8   DA  B OP1   1 
ATOM   4035 O  OP2   . DA  B 2 8   ? 19.936  88.517  43.944 1.00 67.01  ? 8   DA  B OP2   1 
ATOM   4036 O  "O5'" . DA  B 2 8   ? 21.968  89.073  42.573 1.00 68.42  ? 8   DA  B "O5'" 1 
ATOM   4037 C  "C5'" . DA  B 2 8   ? 23.219  88.720  42.007 1.00 69.12  ? 8   DA  B "C5'" 1 
ATOM   4038 C  "C4'" . DA  B 2 8   ? 23.230  88.978  40.510 1.00 67.50  ? 8   DA  B "C4'" 1 
ATOM   4039 O  "O4'" . DA  B 2 8   ? 22.498  87.931  39.820 1.00 82.56  ? 8   DA  B "O4'" 1 
ATOM   4040 C  "C3'" . DA  B 2 8   ? 22.606  90.296  40.076 1.00 78.06  ? 8   DA  B "C3'" 1 
ATOM   4041 O  "O3'" . DA  B 2 8   ? 23.383  90.865  39.035 1.00 94.43  ? 8   DA  B "O3'" 1 
ATOM   4042 C  "C2'" . DA  B 2 8   ? 21.203  89.893  39.600 1.00 75.79  ? 8   DA  B "C2'" 1 
ATOM   4043 C  "C1'" . DA  B 2 8   ? 21.424  88.477  39.075 1.00 65.60  ? 8   DA  B "C1'" 1 
ATOM   4044 N  N9    . DA  B 2 8   ? 20.267  87.590  39.247 1.00 52.58  ? 8   DA  B N9    1 
ATOM   4045 C  C8    . DA  B 2 8   ? 19.559  87.376  40.399 1.00 50.43  ? 8   DA  B C8    1 
ATOM   4046 N  N7    . DA  B 2 8   ? 18.583  86.506  40.269 1.00 42.05  ? 8   DA  B N7    1 
ATOM   4047 C  C5    . DA  B 2 8   ? 18.658  86.112  38.942 1.00 37.41  ? 8   DA  B C5    1 
ATOM   4048 C  C6    . DA  B 2 8   ? 17.896  85.201  38.174 1.00 45.53  ? 8   DA  B C6    1 
ATOM   4049 N  N6    . DA  B 2 8   ? 16.864  84.499  38.667 1.00 41.72  ? 8   DA  B N6    1 
ATOM   4050 N  N1    . DA  B 2 8   ? 18.235  85.040  36.877 1.00 37.94  ? 8   DA  B N1    1 
ATOM   4051 C  C2    . DA  B 2 8   ? 19.265  85.745  36.388 1.00 48.56  ? 8   DA  B C2    1 
ATOM   4052 N  N3    . DA  B 2 8   ? 20.053  86.626  37.011 1.00 45.99  ? 8   DA  B N3    1 
ATOM   4053 C  C4    . DA  B 2 8   ? 19.694  86.766  38.296 1.00 39.21  ? 8   DA  B C4    1 
ATOM   4054 P  P     . DA  B 2 9   ? 23.118  92.371  38.546 1.00 98.73  ? 9   DA  B P     1 
ATOM   4055 O  OP1   . DA  B 2 9   ? 24.426  92.940  38.150 1.00 82.76  ? 9   DA  B OP1   1 
ATOM   4056 O  OP2   . DA  B 2 9   ? 22.288  93.055  39.566 1.00 90.23  ? 9   DA  B OP2   1 
ATOM   4057 O  "O5'" . DA  B 2 9   ? 22.244  92.177  37.226 1.00 78.93  ? 9   DA  B "O5'" 1 
ATOM   4058 C  "C5'" . DA  B 2 9   ? 22.627  91.206  36.258 1.00 72.07  ? 9   DA  B "C5'" 1 
ATOM   4059 C  "C4'" . DA  B 2 9   ? 21.505  90.997  35.267 1.00 78.10  ? 9   DA  B "C4'" 1 
ATOM   4060 O  "O4'" . DA  B 2 9   ? 20.619  89.983  35.763 1.00 90.62  ? 9   DA  B "O4'" 1 
ATOM   4061 C  "C3'" . DA  B 2 9   ? 20.649  92.231  35.043 1.00 82.89  ? 9   DA  B "C3'" 1 
ATOM   4062 O  "O3'" . DA  B 2 9   ? 21.068  92.875  33.842 1.00 106.53 ? 9   DA  B "O3'" 1 
ATOM   4063 C  "C2'" . DA  B 2 9   ? 19.205  91.703  34.951 1.00 67.75  ? 9   DA  B "C2'" 1 
ATOM   4064 C  "C1'" . DA  B 2 9   ? 19.310  90.218  35.304 1.00 58.97  ? 9   DA  B "C1'" 1 
ATOM   4065 N  N9    . DA  B 2 9   ? 18.397  89.794  36.363 1.00 61.89  ? 9   DA  B N9    1 
ATOM   4066 C  C8    . DA  B 2 9   ? 18.390  90.221  37.664 1.00 56.15  ? 9   DA  B C8    1 
ATOM   4067 N  N7    . DA  B 2 9   ? 17.468  89.648  38.406 1.00 56.61  ? 9   DA  B N7    1 
ATOM   4068 C  C5    . DA  B 2 9   ? 16.835  88.774  37.535 1.00 44.53  ? 9   DA  B C5    1 
ATOM   4069 C  C6    . DA  B 2 9   ? 15.767  87.869  37.707 1.00 43.02  ? 9   DA  B C6    1 
ATOM   4070 N  N6    . DA  B 2 9   ? 15.130  87.696  38.870 1.00 49.43  ? 9   DA  B N6    1 
ATOM   4071 N  N1    . DA  B 2 9   ? 15.376  87.148  36.632 1.00 43.64  ? 9   DA  B N1    1 
ATOM   4072 C  C2    . DA  B 2 9   ? 16.016  87.327  35.469 1.00 52.25  ? 9   DA  B C2    1 
ATOM   4073 N  N3    . DA  B 2 9   ? 17.033  88.146  35.187 1.00 54.28  ? 9   DA  B N3    1 
ATOM   4074 C  C4    . DA  B 2 9   ? 17.397  88.848  36.272 1.00 51.61  ? 9   DA  B C4    1 
ATOM   4075 P  P     . DC  B 2 10  ? 20.176  94.024  33.165 1.00 103.28 ? 10  DC  B P     1 
ATOM   4076 O  OP1   . DC  B 2 10  ? 21.081  94.784  32.274 1.00 105.93 ? 10  DC  B OP1   1 
ATOM   4077 O  OP2   . DC  B 2 10  ? 19.450  94.740  34.237 1.00 97.46  ? 10  DC  B OP2   1 
ATOM   4078 O  "O5'" . DC  B 2 10  ? 19.148  93.206  32.246 1.00 78.62  ? 10  DC  B "O5'" 1 
ATOM   4079 C  "C5'" . DC  B 2 10  ? 17.808  93.642  32.112 1.00 87.23  ? 10  DC  B "C5'" 1 
ATOM   4080 C  "C4'" . DC  B 2 10  ? 16.875  92.461  31.921 1.00 83.41  ? 10  DC  B "C4'" 1 
ATOM   4081 O  "O4'" . DC  B 2 10  ? 16.683  91.786  33.183 1.00 80.27  ? 10  DC  B "O4'" 1 
ATOM   4082 C  "C3'" . DC  B 2 10  ? 15.476  92.832  31.428 1.00 91.22  ? 10  DC  B "C3'" 1 
ATOM   4083 O  "O3'" . DC  B 2 10  ? 15.259  92.303  30.144 1.00 102.76 ? 10  DC  B "O3'" 1 
ATOM   4084 C  "C2'" . DC  B 2 10  ? 14.519  92.212  32.453 1.00 88.50  ? 10  DC  B "C2'" 1 
ATOM   4085 C  "C1'" . DC  B 2 10  ? 15.401  91.223  33.195 1.00 73.91  ? 10  DC  B "C1'" 1 
ATOM   4086 N  N1    . DC  B 2 10  ? 14.974  91.010  34.615 1.00 59.96  ? 10  DC  B N1    1 
ATOM   4087 C  C2    . DC  B 2 10  ? 14.007  90.037  34.904 1.00 54.92  ? 10  DC  B C2    1 
ATOM   4088 O  O2    . DC  B 2 10  ? 13.536  89.362  33.975 1.00 53.59  ? 10  DC  B O2    1 
ATOM   4089 N  N3    . DC  B 2 10  ? 13.618  89.859  36.196 1.00 42.98  ? 10  DC  B N3    1 
ATOM   4090 C  C4    . DC  B 2 10  ? 14.156  90.607  37.167 1.00 52.24  ? 10  DC  B C4    1 
ATOM   4091 N  N4    . DC  B 2 10  ? 13.746  90.392  38.424 1.00 37.63  ? 10  DC  B N4    1 
ATOM   4092 C  C5    . DC  B 2 10  ? 15.141  91.607  36.890 1.00 37.57  ? 10  DC  B C5    1 
ATOM   4093 C  C6    . DC  B 2 10  ? 15.512  91.775  35.613 1.00 50.64  ? 10  DC  B C6    1 
ATOM   4094 P  P     . DA  B 2 11  ? 14.070  92.891  29.244 1.00 116.57 ? 11  DA  B P     1 
ATOM   4095 O  OP1   . DA  B 2 11  ? 14.325  92.477  27.846 1.00 111.51 ? 11  DA  B OP1   1 
ATOM   4096 O  OP2   . DA  B 2 11  ? 13.919  94.318  29.606 1.00 97.58  ? 11  DA  B OP2   1 
ATOM   4097 O  "O5'" . DA  B 2 11  ? 12.779  92.097  29.742 1.00 89.74  ? 11  DA  B "O5'" 1 
ATOM   4098 C  "C5'" . DA  B 2 11  ? 12.585  90.751  29.345 1.00 88.18  ? 11  DA  B "C5'" 1 
ATOM   4099 C  "C4'" . DA  B 2 11  ? 11.206  90.273  29.750 1.00 92.62  ? 11  DA  B "C4'" 1 
ATOM   4100 O  "O4'" . DA  B 2 11  ? 11.139  90.155  31.197 1.00 98.76  ? 11  DA  B "O4'" 1 
ATOM   4101 C  "C3'" . DA  B 2 11  ? 10.063  91.200  29.346 1.00 110.11 ? 11  DA  B "C3'" 1 
ATOM   4102 O  "O3'" . DA  B 2 11  ? 8.946   90.425  28.927 1.00 117.25 ? 11  DA  B "O3'" 1 
ATOM   4103 C  "C2'" . DA  B 2 11  ? 9.773   91.971  30.637 1.00 109.03 ? 11  DA  B "C2'" 1 
ATOM   4104 C  "C1'" . DA  B 2 11  ? 10.053  90.913  31.693 1.00 90.76  ? 11  DA  B "C1'" 1 
ATOM   4105 N  N9    . DA  B 2 11  ? 10.425  91.461  33.003 1.00 67.02  ? 11  DA  B N9    1 
ATOM   4106 C  C8    . DA  B 2 11  ? 11.326  92.458  33.256 1.00 65.46  ? 11  DA  B C8    1 
ATOM   4107 N  N7    . DA  B 2 11  ? 11.468  92.739  34.535 1.00 51.18  ? 11  DA  B N7    1 
ATOM   4108 C  C5    . DA  B 2 11  ? 10.596  91.866  35.168 1.00 49.62  ? 11  DA  B C5    1 
ATOM   4109 C  C6    . DA  B 2 11  ? 10.272  91.658  36.534 1.00 50.96  ? 11  DA  B C6    1 
ATOM   4110 N  N6    . DA  B 2 11  ? 10.820  92.350  37.540 1.00 43.05  ? 11  DA  B N6    1 
ATOM   4111 N  N1    . DA  B 2 11  ? 9.357   90.706  36.823 1.00 45.72  ? 11  DA  B N1    1 
ATOM   4112 C  C2    . DA  B 2 11  ? 8.807   90.013  35.813 1.00 60.27  ? 11  DA  B C2    1 
ATOM   4113 N  N3    . DA  B 2 11  ? 9.033   90.114  34.498 1.00 60.43  ? 11  DA  B N3    1 
ATOM   4114 C  C4    . DA  B 2 11  ? 9.944   91.069  34.239 1.00 60.32  ? 11  DA  B C4    1 
ATOM   4115 P  P     . DA  B 2 12  ? 7.642   91.133  28.308 1.00 127.42 ? 12  DA  B P     1 
ATOM   4116 O  OP1   . DA  B 2 12  ? 7.253   90.368  27.102 1.00 128.31 ? 12  DA  B OP1   1 
ATOM   4117 O  OP2   . DA  B 2 12  ? 7.900   92.588  28.203 1.00 92.40  ? 12  DA  B OP2   1 
ATOM   4118 O  "O5'" . DA  B 2 12  ? 6.518   90.876  29.414 1.00 107.84 ? 12  DA  B "O5'" 1 
ATOM   4119 C  "C5'" . DA  B 2 12  ? 6.190   89.542  29.787 1.00 109.33 ? 12  DA  B "C5'" 1 
ATOM   4120 C  "C4'" . DA  B 2 12  ? 5.301   89.526  31.017 1.00 104.03 ? 12  DA  B "C4'" 1 
ATOM   4121 O  "O4'" . DA  B 2 12  ? 6.030   90.052  32.154 1.00 93.84  ? 12  DA  B "O4'" 1 
ATOM   4122 C  "C3'" . DA  B 2 12  ? 4.025   90.361  30.902 1.00 121.61 ? 12  DA  B "C3'" 1 
ATOM   4123 O  "O3'" . DA  B 2 12  ? 2.908   89.589  31.311 1.00 129.59 ? 12  DA  B "O3'" 1 
ATOM   4124 C  "C2'" . DA  B 2 12  ? 4.273   91.545  31.843 1.00 103.06 ? 12  DA  B "C2'" 1 
ATOM   4125 C  "C1'" . DA  B 2 12  ? 5.198   90.925  32.876 1.00 85.40  ? 12  DA  B "C1'" 1 
ATOM   4126 N  N9    . DA  B 2 12  ? 6.043   91.895  33.572 1.00 72.76  ? 12  DA  B N9    1 
ATOM   4127 C  C8    . DA  B 2 12  ? 6.861   92.836  33.004 1.00 72.15  ? 12  DA  B C8    1 
ATOM   4128 N  N7    . DA  B 2 12  ? 7.515   93.570  33.879 1.00 65.39  ? 12  DA  B N7    1 
ATOM   4129 C  C5    . DA  B 2 12  ? 7.101   93.072  35.109 1.00 67.27  ? 12  DA  B C5    1 
ATOM   4130 C  C6    . DA  B 2 12  ? 7.429   93.422  36.441 1.00 51.00  ? 12  DA  B C6    1 
ATOM   4131 N  N6    . DA  B 2 12  ? 8.290   94.399  36.757 1.00 38.82  ? 12  DA  B N6    1 
ATOM   4132 N  N1    . DA  B 2 12  ? 6.834   92.724  37.437 1.00 49.24  ? 12  DA  B N1    1 
ATOM   4133 C  C2    . DA  B 2 12  ? 5.975   91.743  37.118 1.00 56.41  ? 12  DA  B C2    1 
ATOM   4134 N  N3    . DA  B 2 12  ? 5.589   91.323  35.910 1.00 62.31  ? 12  DA  B N3    1 
ATOM   4135 C  C4    . DA  B 2 12  ? 6.194   92.037  34.938 1.00 70.97  ? 12  DA  B C4    1 
ATOM   4136 P  P     . DC  B 2 13  ? 1.417   90.128  31.053 1.00 145.05 ? 13  DC  B P     1 
ATOM   4137 O  OP1   . DC  B 2 13  ? 0.555   88.954  30.784 1.00 132.24 ? 13  DC  B OP1   1 
ATOM   4138 O  OP2   . DC  B 2 13  ? 1.502   91.239  30.077 1.00 120.38 ? 13  DC  B OP2   1 
ATOM   4139 O  "O5'" . DC  B 2 13  ? 0.990   90.731  32.466 1.00 124.70 ? 13  DC  B "O5'" 1 
ATOM   4140 C  "C5'" . DC  B 2 13  ? 1.190   89.967  33.638 1.00 116.99 ? 13  DC  B "C5'" 1 
ATOM   4141 C  "C4'" . DC  B 2 13  ? 1.046   90.832  34.872 1.00 108.75 ? 13  DC  B "C4'" 1 
ATOM   4142 O  "O4'" . DC  B 2 13  ? 2.221   91.643  35.047 1.00 100.02 ? 13  DC  B "O4'" 1 
ATOM   4143 C  "C3'" . DC  B 2 13  ? -0.126  91.817  34.841 1.00 111.23 ? 13  DC  B "C3'" 1 
ATOM   4144 O  "O3'" . DC  B 2 13  ? -1.173  91.337  35.680 1.00 131.74 ? 13  DC  B "O3'" 1 
ATOM   4145 C  "C2'" . DC  B 2 13  ? 0.475   93.143  35.362 1.00 99.53  ? 13  DC  B "C2'" 1 
ATOM   4146 C  "C1'" . DC  B 2 13  ? 1.855   92.720  35.858 1.00 80.68  ? 13  DC  B "C1'" 1 
ATOM   4147 N  N1    . DC  B 2 13  ? 2.907   93.788  35.770 1.00 63.00  ? 13  DC  B N1    1 
ATOM   4148 C  C2    . DC  B 2 13  ? 3.525   94.231  36.943 1.00 69.44  ? 13  DC  B C2    1 
ATOM   4149 O  O2    . DC  B 2 13  ? 3.186   93.731  38.025 1.00 69.23  ? 13  DC  B O2    1 
ATOM   4150 N  N3    . DC  B 2 13  ? 4.478   95.197  36.867 1.00 54.23  ? 13  DC  B N3    1 
ATOM   4151 C  C4    . DC  B 2 13  ? 4.817   95.710  35.682 1.00 61.52  ? 13  DC  B C4    1 
ATOM   4152 N  N4    . DC  B 2 13  ? 5.766   96.659  35.660 1.00 47.02  ? 13  DC  B N4    1 
ATOM   4153 C  C5    . DC  B 2 13  ? 4.198   95.270  34.468 1.00 49.81  ? 13  DC  B C5    1 
ATOM   4154 C  C6    . DC  B 2 13  ? 3.258   94.315  34.558 1.00 63.17  ? 13  DC  B C6    1 
ATOM   4155 P  P     . DA  B 2 14  ? -2.595  92.086  35.736 1.00 138.09 ? 14  DA  B P     1 
ATOM   4156 O  OP1   . DA  B 2 14  ? -3.651  91.047  35.767 1.00 113.00 ? 14  DA  B OP1   1 
ATOM   4157 O  OP2   . DA  B 2 14  ? -2.620  93.119  34.676 1.00 115.60 ? 14  DA  B OP2   1 
ATOM   4158 O  "O5'" . DA  B 2 14  ? -2.568  92.813  37.159 1.00 112.95 ? 14  DA  B "O5'" 1 
ATOM   4159 C  "C5'" . DA  B 2 14  ? -2.038  92.131  38.292 1.00 98.05  ? 14  DA  B "C5'" 1 
ATOM   4160 C  "C4'" . DA  B 2 14  ? -1.655  93.118  39.379 1.00 100.19 ? 14  DA  B "C4'" 1 
ATOM   4161 O  "O4'" . DA  B 2 14  ? -0.449  93.822  38.990 1.00 94.65  ? 14  DA  B "O4'" 1 
ATOM   4162 C  "C3'" . DA  B 2 14  ? -2.708  94.190  39.671 1.00 119.94 ? 14  DA  B "C3'" 1 
ATOM   4163 O  "O3'" . DA  B 2 14  ? -3.033  94.196  41.057 1.00 124.36 ? 14  DA  B "O3'" 1 
ATOM   4164 C  "C2'" . DA  B 2 14  ? -2.043  95.501  39.233 1.00 106.82 ? 14  DA  B "C2'" 1 
ATOM   4165 C  "C1'" . DA  B 2 14  ? -0.563  95.174  39.351 1.00 79.18  ? 14  DA  B "C1'" 1 
ATOM   4166 N  N9    . DA  B 2 14  ? 0.281   95.959  38.453 1.00 66.74  ? 14  DA  B N9    1 
ATOM   4167 C  C8    . DA  B 2 14  ? 0.232   95.975  37.086 1.00 71.17  ? 14  DA  B C8    1 
ATOM   4168 N  N7    . DA  B 2 14  ? 1.117   96.774  36.530 1.00 73.14  ? 14  DA  B N7    1 
ATOM   4169 C  C5    . DA  B 2 14  ? 1.794   97.324  37.609 1.00 65.62  ? 14  DA  B C5    1 
ATOM   4170 C  C6    . DA  B 2 14  ? 2.858   98.254  37.694 1.00 53.28  ? 14  DA  B C6    1 
ATOM   4171 N  N6    . DA  B 2 14  ? 3.439   98.810  36.623 1.00 46.63  ? 14  DA  B N6    1 
ATOM   4172 N  N1    . DA  B 2 14  ? 3.302   98.590  38.927 1.00 43.59  ? 14  DA  B N1    1 
ATOM   4173 C  C2    . DA  B 2 14  ? 2.715   98.031  39.997 1.00 60.13  ? 14  DA  B C2    1 
ATOM   4174 N  N3    . DA  B 2 14  ? 1.711   97.147  40.042 1.00 65.43  ? 14  DA  B N3    1 
ATOM   4175 C  C4    . DA  B 2 14  ? 1.293   96.832  38.804 1.00 62.08  ? 14  DA  B C4    1 
ATOM   4176 P  P     . DA  B 2 15  ? -4.455  94.757  41.557 1.00 127.43 ? 15  DA  B P     1 
ATOM   4177 O  OP1   . DA  B 2 15  ? -5.053  93.736  42.446 1.00 109.05 ? 15  DA  B OP1   1 
ATOM   4178 O  OP2   . DA  B 2 15  ? -5.205  95.232  40.372 1.00 114.88 ? 15  DA  B OP2   1 
ATOM   4179 O  "O5'" . DA  B 2 15  ? -4.060  96.010  42.464 1.00 104.70 ? 15  DA  B "O5'" 1 
ATOM   4180 C  "C5'" . DA  B 2 15  ? -3.101  95.846  43.493 1.00 98.90  ? 15  DA  B "C5'" 1 
ATOM   4181 C  "C4'" . DA  B 2 15  ? -2.327  97.128  43.724 1.00 104.21 ? 15  DA  B "C4'" 1 
ATOM   4182 O  "O4'" . DA  B 2 15  ? -1.530  97.452  42.551 1.00 103.26 ? 15  DA  B "O4'" 1 
ATOM   4183 C  "C3'" . DA  B 2 15  ? -3.190  98.365  44.001 1.00 106.91 ? 15  DA  B "C3'" 1 
ATOM   4184 O  "O3'" . DA  B 2 15  ? -2.692  99.041  45.143 1.00 122.67 ? 15  DA  B "O3'" 1 
ATOM   4185 C  "C2'" . DA  B 2 15  ? -3.009  99.204  42.735 1.00 100.81 ? 15  DA  B "C2'" 1 
ATOM   4186 C  "C1'" . DA  B 2 15  ? -1.589  98.842  42.363 1.00 92.67  ? 15  DA  B "C1'" 1 
ATOM   4187 N  N9    . DA  B 2 15  ? -1.225  99.171  40.984 1.00 80.27  ? 15  DA  B N9    1 
ATOM   4188 C  C8    . DA  B 2 15  ? -1.821  98.723  39.835 1.00 72.51  ? 15  DA  B C8    1 
ATOM   4189 N  N7    . DA  B 2 15  ? -1.274  99.193  38.734 1.00 58.50  ? 15  DA  B N7    1 
ATOM   4190 C  C5    . DA  B 2 15  ? -0.252  100.013 39.195 1.00 53.04  ? 15  DA  B C5    1 
ATOM   4191 C  C6    . DA  B 2 15  ? 0.708   100.812 38.528 1.00 54.82  ? 15  DA  B C6    1 
ATOM   4192 N  N6    . DA  B 2 15  ? 0.786   100.911 37.196 1.00 50.30  ? 15  DA  B N6    1 
ATOM   4193 N  N1    . DA  B 2 15  ? 1.588   101.507 39.289 1.00 45.56  ? 15  DA  B N1    1 
ATOM   4194 C  C2    . DA  B 2 15  ? 1.505   101.405 40.625 1.00 60.10  ? 15  DA  B C2    1 
ATOM   4195 N  N3    . DA  B 2 15  ? 0.650   100.689 41.363 1.00 62.12  ? 15  DA  B N3    1 
ATOM   4196 C  C4    . DA  B 2 15  ? -0.210  100.011 40.579 1.00 58.00  ? 15  DA  B C4    1 
ATOM   4197 P  P     . DG  B 2 16  ? -3.593  100.135 45.902 1.00 148.29 ? 16  DG  B P     1 
ATOM   4198 O  OP1   . DG  B 2 16  ? -4.097  99.492  47.136 1.00 130.66 ? 16  DG  B OP1   1 
ATOM   4199 O  OP2   . DG  B 2 16  ? -4.558  100.710 44.936 1.00 115.04 ? 16  DG  B OP2   1 
ATOM   4200 O  "O5'" . DG  B 2 16  ? -2.537  101.263 46.330 1.00 126.57 ? 16  DG  B "O5'" 1 
ATOM   4201 C  "C5'" . DG  B 2 16  ? -1.261  101.341 45.683 1.00 111.41 ? 16  DG  B "C5'" 1 
ATOM   4202 C  "C4'" . DG  B 2 16  ? -1.076  102.694 45.014 1.00 110.38 ? 16  DG  B "C4'" 1 
ATOM   4203 O  "O4'" . DG  B 2 16  ? -0.996  102.506 43.589 1.00 107.36 ? 16  DG  B "O4'" 1 
ATOM   4204 C  "C3'" . DG  B 2 16  ? -2.213  103.679 45.261 1.00 117.80 ? 16  DG  B "C3'" 1 
ATOM   4205 O  "O3'" . DG  B 2 16  ? -1.813  104.645 46.228 1.00 108.52 ? 16  DG  B "O3'" 1 
ATOM   4206 C  "C2'" . DG  B 2 16  ? -2.493  104.332 43.898 1.00 102.44 ? 16  DG  B "C2'" 1 
ATOM   4207 C  "C1'" . DG  B 2 16  ? -1.593  103.586 42.911 1.00 86.37  ? 16  DG  B "C1'" 1 
ATOM   4208 N  N9    . DG  B 2 16  ? -2.310  103.045 41.763 1.00 77.47  ? 16  DG  B N9    1 
ATOM   4209 C  C8    . DG  B 2 16  ? -3.461  102.292 41.786 1.00 77.22  ? 16  DG  B C8    1 
ATOM   4210 N  N7    . DG  B 2 16  ? -3.870  101.927 40.601 1.00 71.48  ? 16  DG  B N7    1 
ATOM   4211 C  C5    . DG  B 2 16  ? -2.928  102.475 39.735 1.00 71.59  ? 16  DG  B C5    1 
ATOM   4212 C  C6    . DG  B 2 16  ? -2.847  102.417 38.321 1.00 72.08  ? 16  DG  B C6    1 
ATOM   4213 O  O6    . DG  B 2 16  ? -3.619  101.850 37.528 1.00 79.60  ? 16  DG  B O6    1 
ATOM   4214 N  N1    . DG  B 2 16  ? -1.731  103.106 37.840 1.00 51.45  ? 16  DG  B N1    1 
ATOM   4215 C  C2    . DG  B 2 16  ? -0.812  103.770 38.628 1.00 58.16  ? 16  DG  B C2    1 
ATOM   4216 N  N2    . DG  B 2 16  ? 0.198   104.380 37.981 1.00 39.38  ? 16  DG  B N2    1 
ATOM   4217 N  N3    . DG  B 2 16  ? -0.879  103.832 39.958 1.00 40.68  ? 16  DG  B N3    1 
ATOM   4218 C  C4    . DG  B 2 16  ? -1.958  103.164 40.438 1.00 61.61  ? 16  DG  B C4    1 
ATOM   4219 O  "O5'" . DC  C 3 1   ? 4.592   107.589 31.971 1.00 84.49  ? 1   DC  C "O5'" 1 
ATOM   4220 C  "C5'" . DC  C 3 1   ? 4.974   108.919 32.316 1.00 95.86  ? 1   DC  C "C5'" 1 
ATOM   4221 C  "C4'" . DC  C 3 1   ? 4.900   109.127 33.820 1.00 111.93 ? 1   DC  C "C4'" 1 
ATOM   4222 O  "O4'" . DC  C 3 1   ? 3.530   108.973 34.254 1.00 99.38  ? 1   DC  C "O4'" 1 
ATOM   4223 C  "C3'" . DC  C 3 1   ? 5.726   108.144 34.639 1.00 117.71 ? 1   DC  C "C3'" 1 
ATOM   4224 O  "O3'" . DC  C 3 1   ? 6.990   108.732 34.952 1.00 117.85 ? 1   DC  C "O3'" 1 
ATOM   4225 C  "C2'" . DC  C 3 1   ? 4.889   107.913 35.901 1.00 95.03  ? 1   DC  C "C2'" 1 
ATOM   4226 C  "C1'" . DC  C 3 1   ? 3.460   108.213 35.444 1.00 80.52  ? 1   DC  C "C1'" 1 
ATOM   4227 N  N1    . DC  C 3 1   ? 2.608   107.002 35.181 1.00 61.36  ? 1   DC  C N1    1 
ATOM   4228 C  C2    . DC  C 3 1   ? 2.058   106.286 36.255 1.00 55.40  ? 1   DC  C C2    1 
ATOM   4229 O  O2    . DC  C 3 1   ? 2.314   106.644 37.416 1.00 46.45  ? 1   DC  C O2    1 
ATOM   4230 N  N3    . DC  C 3 1   ? 1.265   105.210 35.991 1.00 43.97  ? 1   DC  C N3    1 
ATOM   4231 C  C4    . DC  C 3 1   ? 1.014   104.857 34.723 1.00 57.11  ? 1   DC  C C4    1 
ATOM   4232 N  N4    . DC  C 3 1   ? 0.228   103.792 34.508 1.00 49.89  ? 1   DC  C N4    1 
ATOM   4233 C  C5    . DC  C 3 1   ? 1.556   105.583 33.620 1.00 61.79  ? 1   DC  C C5    1 
ATOM   4234 C  C6    . DC  C 3 1   ? 2.333   106.639 33.892 1.00 61.40  ? 1   DC  C C6    1 
ATOM   4235 P  P     . DT  C 3 2   ? 8.139   107.864 35.663 1.00 108.98 ? 2   DT  C P     1 
ATOM   4236 O  OP1   . DT  C 3 2   ? 9.438   108.328 35.123 1.00 117.82 ? 2   DT  C OP1   1 
ATOM   4237 O  OP2   . DT  C 3 2   ? 7.756   106.437 35.550 1.00 95.46  ? 2   DT  C OP2   1 
ATOM   4238 O  "O5'" . DT  C 3 2   ? 8.061   108.314 37.197 1.00 108.41 ? 2   DT  C "O5'" 1 
ATOM   4239 C  "C5'" . DT  C 3 2   ? 8.538   107.449 38.218 1.00 111.07 ? 2   DT  C "C5'" 1 
ATOM   4240 C  "C4'" . DT  C 3 2   ? 7.417   107.065 39.170 1.00 97.97  ? 2   DT  C "C4'" 1 
ATOM   4241 O  "O4'" . DT  C 3 2   ? 6.327   106.506 38.428 1.00 80.13  ? 2   DT  C "O4'" 1 
ATOM   4242 C  "C3'" . DT  C 3 2   ? 7.788   105.996 40.183 1.00 102.33 ? 2   DT  C "C3'" 1 
ATOM   4243 O  "O3'" . DT  C 3 2   ? 8.198   106.610 41.388 1.00 119.46 ? 2   DT  C "O3'" 1 
ATOM   4244 C  "C2'" . DT  C 3 2   ? 6.497   105.178 40.375 1.00 84.00  ? 2   DT  C "C2'" 1 
ATOM   4245 C  "C1'" . DT  C 3 2   ? 5.555   105.712 39.294 1.00 71.68  ? 2   DT  C "C1'" 1 
ATOM   4246 N  N1    . DT  C 3 2   ? 4.881   104.655 38.474 1.00 60.24  ? 2   DT  C N1    1 
ATOM   4247 C  C2    . DT  C 3 2   ? 3.982   103.789 39.068 1.00 59.15  ? 2   DT  C C2    1 
ATOM   4248 O  O2    . DT  C 3 2   ? 3.712   103.811 40.261 1.00 56.08  ? 2   DT  C O2    1 
ATOM   4249 N  N3    . DT  C 3 2   ? 3.410   102.881 38.207 1.00 45.68  ? 2   DT  C N3    1 
ATOM   4250 C  C4    . DT  C 3 2   ? 3.636   102.764 36.841 1.00 51.79  ? 2   DT  C C4    1 
ATOM   4251 O  O4    . DT  C 3 2   ? 3.070   101.920 36.148 1.00 45.83  ? 2   DT  C O4    1 
ATOM   4252 C  C5    . DT  C 3 2   ? 4.583   103.707 36.287 1.00 51.31  ? 2   DT  C C5    1 
ATOM   4253 C  C7    . DT  C 3 2   ? 4.909   103.678 34.823 1.00 55.59  ? 2   DT  C C7    1 
ATOM   4254 C  C6    . DT  C 3 2   ? 5.148   104.596 37.118 1.00 56.30  ? 2   DT  C C6    1 
ATOM   4255 P  P     . DT  C 3 3   ? 9.674   106.345 41.958 1.00 125.37 ? 3   DT  C P     1 
ATOM   4256 O  OP1   . DT  C 3 3   ? 10.132  107.588 42.618 1.00 107.09 ? 3   DT  C OP1   1 
ATOM   4257 O  OP2   . DT  C 3 3   ? 10.472  105.770 40.851 1.00 114.60 ? 3   DT  C OP2   1 
ATOM   4258 O  "O5'" . DT  C 3 3   ? 9.447   105.215 43.070 1.00 116.15 ? 3   DT  C "O5'" 1 
ATOM   4259 C  "C5'" . DT  C 3 3   ? 9.052   103.907 42.675 1.00 93.80  ? 3   DT  C "C5'" 1 
ATOM   4260 C  "C4'" . DT  C 3 3   ? 7.980   103.352 43.595 1.00 107.42 ? 3   DT  C "C4'" 1 
ATOM   4261 O  "O4'" . DT  C 3 3   ? 6.784   103.070 42.815 1.00 92.73  ? 3   DT  C "O4'" 1 
ATOM   4262 C  "C3'" . DT  C 3 3   ? 8.350   102.032 44.252 1.00 121.90 ? 3   DT  C "C3'" 1 
ATOM   4263 O  "O3'" . DT  C 3 3   ? 7.660   101.862 45.483 1.00 123.33 ? 3   DT  C "O3'" 1 
ATOM   4264 C  "C2'" . DT  C 3 3   ? 7.889   101.026 43.214 1.00 110.31 ? 3   DT  C "C2'" 1 
ATOM   4265 C  "C1'" . DT  C 3 3   ? 6.611   101.667 42.691 1.00 85.31  ? 3   DT  C "C1'" 1 
ATOM   4266 N  N1    . DT  C 3 3   ? 6.359   101.333 41.261 1.00 68.98  ? 3   DT  C N1    1 
ATOM   4267 C  C2    . DT  C 3 3   ? 5.282   100.536 40.932 1.00 64.21  ? 3   DT  C C2    1 
ATOM   4268 O  O2    . DT  C 3 3   ? 4.491   100.102 41.755 1.00 58.75  ? 3   DT  C O2    1 
ATOM   4269 N  N3    . DT  C 3 3   ? 5.154   100.273 39.591 1.00 51.25  ? 3   DT  C N3    1 
ATOM   4270 C  C4    . DT  C 3 3   ? 5.986   100.710 38.569 1.00 65.00  ? 3   DT  C C4    1 
ATOM   4271 O  O4    . DT  C 3 3   ? 5.788   100.420 37.390 1.00 57.57  ? 3   DT  C O4    1 
ATOM   4272 C  C5    . DT  C 3 3   ? 7.103   101.530 38.988 1.00 58.68  ? 3   DT  C C5    1 
ATOM   4273 C  C7    . DT  C 3 3   ? 8.072   102.061 37.973 1.00 63.96  ? 3   DT  C C7    1 
ATOM   4274 C  C6    . DT  C 3 3   ? 7.236   101.792 40.297 1.00 56.90  ? 3   DT  C C6    1 
ATOM   4275 P  P     . DG  C 3 4   ? 8.063   100.659 46.472 1.00 129.15 ? 4   DG  C P     1 
ATOM   4276 O  OP1   . DG  C 3 4   ? 8.619   101.266 47.702 1.00 137.52 ? 4   DG  C OP1   1 
ATOM   4277 O  OP2   . DG  C 3 4   ? 8.870   99.667  45.727 1.00 105.26 ? 4   DG  C OP2   1 
ATOM   4278 O  "O5'" . DG  C 3 4   ? 6.664   99.973  46.818 1.00 95.46  ? 4   DG  C "O5'" 1 
ATOM   4279 C  "C5'" . DG  C 3 4   ? 5.782   99.622  45.767 1.00 96.76  ? 4   DG  C "C5'" 1 
ATOM   4280 C  "C4'" . DG  C 3 4   ? 5.231   98.226  45.968 1.00 110.83 ? 4   DG  C "C4'" 1 
ATOM   4281 O  "O4'" . DG  C 3 4   ? 4.933   97.646  44.675 1.00 111.02 ? 4   DG  C "O4'" 1 
ATOM   4282 C  "C3'" . DG  C 3 4   ? 6.189   97.242  46.617 1.00 123.08 ? 4   DG  C "C3'" 1 
ATOM   4283 O  "O3'" . DG  C 3 4   ? 5.443   96.171  47.199 1.00 126.08 ? 4   DG  C "O3'" 1 
ATOM   4284 C  "C2'" . DG  C 3 4   ? 7.007   96.777  45.418 1.00 113.35 ? 4   DG  C "C2'" 1 
ATOM   4285 C  "C1'" . DG  C 3 4   ? 5.942   96.709  44.326 1.00 99.92  ? 4   DG  C "C1'" 1 
ATOM   4286 N  N9    . DG  C 3 4   ? 6.448   97.047  42.999 1.00 81.35  ? 4   DG  C N9    1 
ATOM   4287 C  C8    . DG  C 3 4   ? 7.474   97.909  42.698 1.00 76.75  ? 4   DG  C C8    1 
ATOM   4288 N  N7    . DG  C 3 4   ? 7.706   98.020  41.418 1.00 61.00  ? 4   DG  C N7    1 
ATOM   4289 C  C5    . DG  C 3 4   ? 6.775   97.171  40.832 1.00 53.93  ? 4   DG  C C5    1 
ATOM   4290 C  C6    . DG  C 3 4   ? 6.545   96.871  39.466 1.00 57.09  ? 4   DG  C C6    1 
ATOM   4291 O  O6    . DG  C 3 4   ? 7.142   97.314  38.468 1.00 52.69  ? 4   DG  C O6    1 
ATOM   4292 N  N1    . DG  C 3 4   ? 5.499   95.955  39.309 1.00 55.34  ? 4   DG  C N1    1 
ATOM   4293 C  C2    . DG  C 3 4   ? 4.774   95.400  40.346 1.00 58.53  ? 4   DG  C C2    1 
ATOM   4294 N  N2    . DG  C 3 4   ? 3.806   94.535  40.004 1.00 42.25  ? 4   DG  C N2    1 
ATOM   4295 N  N3    . DG  C 3 4   ? 4.981   95.677  41.628 1.00 52.70  ? 4   DG  C N3    1 
ATOM   4296 C  C4    . DG  C 3 4   ? 5.992   96.565  41.795 1.00 64.80  ? 4   DG  C C4    1 
ATOM   4297 P  P     . DT  C 3 5   ? 6.172   94.933  47.925 1.00 133.84 ? 5   DT  C P     1 
ATOM   4298 O  OP1   . DT  C 3 5   ? 5.514   94.767  49.239 1.00 127.78 ? 5   DT  C OP1   1 
ATOM   4299 O  OP2   . DT  C 3 5   ? 7.643   95.094  47.860 1.00 111.36 ? 5   DT  C OP2   1 
ATOM   4300 O  "O5'" . DT  C 3 5   ? 5.725   93.681  47.043 1.00 101.05 ? 5   DT  C "O5'" 1 
ATOM   4301 C  "C5'" . DT  C 3 5   ? 4.347   93.462  46.812 1.00 83.88  ? 5   DT  C "C5'" 1 
ATOM   4302 C  "C4'" . DT  C 3 5   ? 4.128   92.564  45.612 1.00 77.87  ? 5   DT  C "C4'" 1 
ATOM   4303 O  "O4'" . DT  C 3 5   ? 4.763   93.117  44.448 1.00 90.14  ? 5   DT  C "O4'" 1 
ATOM   4304 C  "C3'" . DT  C 3 5   ? 4.681   91.148  45.749 1.00 73.90  ? 5   DT  C "C3'" 1 
ATOM   4305 O  "O3'" . DT  C 3 5   ? 3.595   90.253  45.882 1.00 82.36  ? 5   DT  C "O3'" 1 
ATOM   4306 C  "C2'" . DT  C 3 5   ? 5.481   90.913  44.445 1.00 67.76  ? 5   DT  C "C2'" 1 
ATOM   4307 C  "C1'" . DT  C 3 5   ? 5.015   92.059  43.565 1.00 70.49  ? 5   DT  C "C1'" 1 
ATOM   4308 N  N1    . DT  C 3 5   ? 6.008   92.524  42.539 1.00 57.09  ? 5   DT  C N1    1 
ATOM   4309 C  C2    . DT  C 3 5   ? 5.883   92.089  41.237 1.00 64.19  ? 5   DT  C C2    1 
ATOM   4310 O  O2    . DT  C 3 5   ? 5.018   91.304  40.873 1.00 64.48  ? 5   DT  C O2    1 
ATOM   4311 N  N3    . DT  C 3 5   ? 6.821   92.599  40.371 1.00 47.21  ? 5   DT  C N3    1 
ATOM   4312 C  C4    . DT  C 3 5   ? 7.842   93.490  40.667 1.00 50.98  ? 5   DT  C C4    1 
ATOM   4313 O  O4    . DT  C 3 5   ? 8.636   93.896  39.815 1.00 42.05  ? 5   DT  C O4    1 
ATOM   4314 C  C5    . DT  C 3 5   ? 7.909   93.913  42.048 1.00 54.89  ? 5   DT  C C5    1 
ATOM   4315 C  C7    . DT  C 3 5   ? 8.977   94.873  42.490 1.00 42.36  ? 5   DT  C C7    1 
ATOM   4316 C  C6    . DT  C 3 5   ? 6.995   93.421  42.905 1.00 54.78  ? 5   DT  C C6    1 
ATOM   4317 P  P     . DT  C 3 6   ? 3.815   88.669  45.783 1.00 100.49 ? 6   DT  C P     1 
ATOM   4318 O  OP1   . DT  C 3 6   ? 2.670   88.026  46.462 1.00 101.42 ? 6   DT  C OP1   1 
ATOM   4319 O  OP2   . DT  C 3 6   ? 5.198   88.353  46.211 1.00 110.44 ? 6   DT  C OP2   1 
ATOM   4320 O  "O5'" . DT  C 3 6   ? 3.664   88.372  44.225 1.00 85.58  ? 6   DT  C "O5'" 1 
ATOM   4321 C  "C5'" . DT  C 3 6   ? 3.799   87.055  43.753 1.00 95.03  ? 6   DT  C "C5'" 1 
ATOM   4322 C  "C4'" . DT  C 3 6   ? 4.120   87.050  42.275 1.00 86.41  ? 6   DT  C "C4'" 1 
ATOM   4323 O  "O4'" . DT  C 3 6   ? 4.982   88.161  41.967 1.00 81.02  ? 6   DT  C "O4'" 1 
ATOM   4324 C  "C3'" . DT  C 3 6   ? 4.859   85.804  41.794 1.00 81.69  ? 6   DT  C "C3'" 1 
ATOM   4325 O  "O3'" . DT  C 3 6   ? 3.981   84.991  41.035 1.00 88.58  ? 6   DT  C "O3'" 1 
ATOM   4326 C  "C2'" . DT  C 3 6   ? 6.026   86.341  40.943 1.00 75.52  ? 6   DT  C "C2'" 1 
ATOM   4327 C  "C1'" . DT  C 3 6   ? 5.724   87.829  40.829 1.00 66.14  ? 6   DT  C "C1'" 1 
ATOM   4328 N  N1    . DT  C 3 6   ? 6.932   88.683  40.792 1.00 53.42  ? 6   DT  C N1    1 
ATOM   4329 C  C2    . DT  C 3 6   ? 7.433   89.065  39.575 1.00 55.86  ? 6   DT  C C2    1 
ATOM   4330 O  O2    . DT  C 3 6   ? 6.933   88.727  38.518 1.00 57.73  ? 6   DT  C O2    1 
ATOM   4331 N  N3    . DT  C 3 6   ? 8.548   89.861  39.637 1.00 44.50  ? 6   DT  C N3    1 
ATOM   4332 C  C4    . DT  C 3 6   ? 9.199   90.300  40.777 1.00 47.53  ? 6   DT  C C4    1 
ATOM   4333 O  O4    . DT  C 3 6   ? 10.197  91.013  40.732 1.00 51.74  ? 6   DT  C O4    1 
ATOM   4334 C  C5    . DT  C 3 6   ? 8.622   89.860  42.025 1.00 48.01  ? 6   DT  C C5    1 
ATOM   4335 C  C7    . DT  C 3 6   ? 9.244   90.275  43.327 1.00 45.07  ? 6   DT  C C7    1 
ATOM   4336 C  C6    . DT  C 3 6   ? 7.525   89.083  41.975 1.00 53.05  ? 6   DT  C C6    1 
ATOM   4337 P  P     . DG  C 3 7   ? 4.335   83.447  40.774 1.00 136.22 ? 7   DG  C P     1 
ATOM   4338 O  OP1   . DG  C 3 7   ? 3.059   82.717  40.584 1.00 135.33 ? 7   DG  C OP1   1 
ATOM   4339 O  OP2   . DG  C 3 7   ? 5.270   83.014  41.841 1.00 102.91 ? 7   DG  C OP2   1 
ATOM   4340 O  "O5'" . DG  C 3 7   ? 5.096   83.483  39.366 1.00 105.39 ? 7   DG  C "O5'" 1 
ATOM   4341 C  "C5'" . DG  C 3 7   ? 4.613   84.334  38.323 1.00 95.15  ? 7   DG  C "C5'" 1 
ATOM   4342 C  "C4'" . DG  C 3 7   ? 5.526   84.276  37.115 1.00 81.30  ? 7   DG  C "C4'" 1 
ATOM   4343 O  "O4'" . DG  C 3 7   ? 6.479   85.368  37.167 1.00 83.58  ? 7   DG  C "O4'" 1 
ATOM   4344 C  "C3'" . DG  C 3 7   ? 6.332   82.985  36.994 1.00 98.23  ? 7   DG  C "C3'" 1 
ATOM   4345 O  "O3'" . DG  C 3 7   ? 6.181   82.444  35.690 1.00 108.79 ? 7   DG  C "O3'" 1 
ATOM   4346 C  "C2'" . DG  C 3 7   ? 7.777   83.411  37.286 1.00 94.96  ? 7   DG  C "C2'" 1 
ATOM   4347 C  "C1'" . DG  C 3 7   ? 7.783   84.891  36.920 1.00 85.87  ? 7   DG  C "C1'" 1 
ATOM   4348 N  N9    . DG  C 3 7   ? 8.719   85.686  37.720 1.00 66.84  ? 7   DG  C N9    1 
ATOM   4349 C  C8    . DG  C 3 7   ? 8.791   85.743  39.093 1.00 61.75  ? 7   DG  C C8    1 
ATOM   4350 N  N7    . DG  C 3 7   ? 9.722   86.545  39.534 1.00 54.91  ? 7   DG  C N7    1 
ATOM   4351 C  C5    . DG  C 3 7   ? 10.308  87.056  38.382 1.00 51.21  ? 7   DG  C C5    1 
ATOM   4352 C  C6    . DG  C 3 7   ? 11.377  87.980  38.232 1.00 49.88  ? 7   DG  C C6    1 
ATOM   4353 O  O6    . DG  C 3 7   ? 12.036  88.545  39.119 1.00 36.87  ? 7   DG  C O6    1 
ATOM   4354 N  N1    . DG  C 3 7   ? 11.659  88.228  36.887 1.00 43.61  ? 7   DG  C N1    1 
ATOM   4355 C  C2    . DG  C 3 7   ? 10.992  87.654  35.824 1.00 55.81  ? 7   DG  C C2    1 
ATOM   4356 N  N2    . DG  C 3 7   ? 11.402  88.016  34.597 1.00 45.39  ? 7   DG  C N2    1 
ATOM   4357 N  N3    . DG  C 3 7   ? 9.987   86.790  35.954 1.00 55.50  ? 7   DG  C N3    1 
ATOM   4358 C  C4    . DG  C 3 7   ? 9.701   86.538  37.255 1.00 55.75  ? 7   DG  C C4    1 
ATOM   4359 P  P     . DT  C 3 8   ? 6.677   80.952  35.356 1.00 118.67 ? 8   DT  C P     1 
ATOM   4360 O  OP1   . DT  C 3 8   ? 5.595   80.304  34.579 1.00 99.69  ? 8   DT  C OP1   1 
ATOM   4361 O  OP2   . DT  C 3 8   ? 7.167   80.311  36.598 1.00 108.42 ? 8   DT  C OP2   1 
ATOM   4362 O  "O5'" . DT  C 3 8   ? 7.897   81.207  34.361 1.00 113.60 ? 8   DT  C "O5'" 1 
ATOM   4363 C  "C5'" . DT  C 3 8   ? 7.717   82.115  33.291 1.00 99.55  ? 8   DT  C "C5'" 1 
ATOM   4364 C  "C4'" . DT  C 3 8   ? 9.021   82.767  32.880 1.00 87.17  ? 8   DT  C "C4'" 1 
ATOM   4365 O  "O4'" . DT  C 3 8   ? 9.604   83.511  33.980 1.00 83.61  ? 8   DT  C "O4'" 1 
ATOM   4366 C  "C3'" . DT  C 3 8   ? 10.114  81.808  32.392 1.00 91.25  ? 8   DT  C "C3'" 1 
ATOM   4367 O  "O3'" . DT  C 3 8   ? 10.455  82.155  31.061 1.00 101.30 ? 8   DT  C "O3'" 1 
ATOM   4368 C  "C2'" . DT  C 3 8   ? 11.282  82.064  33.365 1.00 90.94  ? 8   DT  C "C2'" 1 
ATOM   4369 C  "C1'" . DT  C 3 8   ? 10.992  83.491  33.784 1.00 86.35  ? 8   DT  C "C1'" 1 
ATOM   4370 N  N1    . DT  C 3 8   ? 11.705  83.955  35.032 1.00 67.08  ? 8   DT  C N1    1 
ATOM   4371 C  C2    . DT  C 3 8   ? 12.758  84.836  34.905 1.00 66.80  ? 8   DT  C C2    1 
ATOM   4372 O  O2    . DT  C 3 8   ? 13.154  85.252  33.828 1.00 79.62  ? 8   DT  C O2    1 
ATOM   4373 N  N3    . DT  C 3 8   ? 13.340  85.214  36.090 1.00 49.83  ? 8   DT  C N3    1 
ATOM   4374 C  C4    . DT  C 3 8   ? 12.981  84.812  37.364 1.00 58.06  ? 8   DT  C C4    1 
ATOM   4375 O  O4    . DT  C 3 8   ? 13.566  85.210  38.371 1.00 49.11  ? 8   DT  C O4    1 
ATOM   4376 C  C5    . DT  C 3 8   ? 11.870  83.892  37.428 1.00 56.18  ? 8   DT  C C5    1 
ATOM   4377 C  C7    . DT  C 3 8   ? 11.395  83.389  38.756 1.00 42.38  ? 8   DT  C C7    1 
ATOM   4378 C  C6    . DT  C 3 8   ? 11.290  83.512  36.273 1.00 67.86  ? 8   DT  C C6    1 
ATOM   4379 P  P     . DT  C 3 9   ? 11.317  81.164  30.140 1.00 108.46 ? 9   DT  C P     1 
ATOM   4380 O  OP1   . DT  C 3 9   ? 10.497  80.852  28.948 1.00 117.26 ? 9   DT  C OP1   1 
ATOM   4381 O  OP2   . DT  C 3 9   ? 11.819  80.061  30.990 1.00 117.83 ? 9   DT  C OP2   1 
ATOM   4382 O  "O5'" . DT  C 3 9   ? 12.540  82.079  29.657 1.00 95.56  ? 9   DT  C "O5'" 1 
ATOM   4383 C  "C5'" . DT  C 3 9   ? 13.127  83.017  30.558 1.00 88.07  ? 9   DT  C "C5'" 1 
ATOM   4384 C  "C4'" . DT  C 3 9   ? 14.463  83.507  30.034 1.00 97.41  ? 9   DT  C "C4'" 1 
ATOM   4385 O  "O4'" . DT  C 3 9   ? 15.197  84.140  31.113 1.00 89.33  ? 9   DT  C "O4'" 1 
ATOM   4386 C  "C3'" . DT  C 3 9   ? 15.379  82.412  29.516 1.00 103.19 ? 9   DT  C "C3'" 1 
ATOM   4387 O  "O3'" . DT  C 3 9   ? 16.273  82.940  28.534 1.00 117.80 ? 9   DT  C "O3'" 1 
ATOM   4388 C  "C2'" . DT  C 3 9   ? 16.111  81.976  30.781 1.00 94.37  ? 9   DT  C "C2'" 1 
ATOM   4389 C  "C1'" . DT  C 3 9   ? 16.246  83.290  31.551 1.00 83.74  ? 9   DT  C "C1'" 1 
ATOM   4390 N  N1    . DT  C 3 9   ? 16.140  83.119  33.040 1.00 62.59  ? 9   DT  C N1    1 
ATOM   4391 C  C2    . DT  C 3 9   ? 16.936  83.883  33.872 1.00 54.07  ? 9   DT  C C2    1 
ATOM   4392 O  O2    . DT  C 3 9   ? 17.734  84.714  33.464 1.00 52.77  ? 9   DT  C O2    1 
ATOM   4393 N  N3    . DT  C 3 9   ? 16.759  83.640  35.213 1.00 46.08  ? 9   DT  C N3    1 
ATOM   4394 C  C4    . DT  C 3 9   ? 15.888  82.727  35.793 1.00 52.61  ? 9   DT  C C4    1 
ATOM   4395 O  O4    . DT  C 3 9   ? 15.798  82.582  37.011 1.00 46.01  ? 9   DT  C O4    1 
ATOM   4396 C  C5    . DT  C 3 9   ? 15.091  81.958  34.867 1.00 51.20  ? 9   DT  C C5    1 
ATOM   4397 C  C7    . DT  C 3 9   ? 14.116  80.940  35.384 1.00 48.58  ? 9   DT  C C7    1 
ATOM   4398 C  C6    . DT  C 3 9   ? 15.253  82.186  33.551 1.00 53.91  ? 9   DT  C C6    1 
ATOM   4399 P  P     . DG  C 3 10  ? 17.426  82.017  27.896 1.00 106.59 ? 10  DG  C P     1 
ATOM   4400 O  OP1   . DG  C 3 10  ? 17.785  82.594  26.581 1.00 85.74  ? 10  DG  C OP1   1 
ATOM   4401 O  OP2   . DG  C 3 10  ? 17.020  80.597  28.010 1.00 92.41  ? 10  DG  C OP2   1 
ATOM   4402 O  "O5'" . DG  C 3 10  ? 18.673  82.281  28.847 1.00 82.77  ? 10  DG  C "O5'" 1 
ATOM   4403 C  "C5'" . DG  C 3 10  ? 19.101  83.612  29.074 1.00 94.76  ? 10  DG  C "C5'" 1 
ATOM   4404 C  "C4'" . DG  C 3 10  ? 20.283  83.635  30.015 1.00 85.67  ? 10  DG  C "C4'" 1 
ATOM   4405 O  "O4'" . DG  C 3 10  ? 19.830  83.374  31.373 1.00 84.21  ? 10  DG  C "O4'" 1 
ATOM   4406 C  "C3'" . DG  C 3 10  ? 21.353  82.588  29.714 1.00 73.98  ? 10  DG  C "C3'" 1 
ATOM   4407 O  "O3'" . DG  C 3 10  ? 22.640  83.161  29.897 1.00 97.25  ? 10  DG  C "O3'" 1 
ATOM   4408 C  "C2'" . DG  C 3 10  ? 21.061  81.497  30.744 1.00 72.68  ? 10  DG  C "C2'" 1 
ATOM   4409 C  "C1'" . DG  C 3 10  ? 20.595  82.328  31.926 1.00 72.47  ? 10  DG  C "C1'" 1 
ATOM   4410 N  N9    . DG  C 3 10  ? 19.768  81.589  32.878 1.00 55.45  ? 10  DG  C N9    1 
ATOM   4411 C  C8    . DG  C 3 10  ? 18.801  80.653  32.589 1.00 56.39  ? 10  DG  C C8    1 
ATOM   4412 N  N7    . DG  C 3 10  ? 18.225  80.154  33.652 1.00 45.88  ? 10  DG  C N7    1 
ATOM   4413 C  C5    . DG  C 3 10  ? 18.851  80.804  34.715 1.00 47.06  ? 10  DG  C C5    1 
ATOM   4414 C  C6    . DG  C 3 10  ? 18.649  80.678  36.114 1.00 42.78  ? 10  DG  C C6    1 
ATOM   4415 O  O6    . DG  C 3 10  ? 17.850  79.943  36.713 1.00 47.74  ? 10  DG  C O6    1 
ATOM   4416 N  N1    . DG  C 3 10  ? 19.494  81.519  36.835 1.00 31.32  ? 10  DG  C N1    1 
ATOM   4417 C  C2    . DG  C 3 10  ? 20.421  82.369  36.279 1.00 43.00  ? 10  DG  C C2    1 
ATOM   4418 N  N2    . DG  C 3 10  ? 21.151  83.100  37.137 1.00 43.01  ? 10  DG  C N2    1 
ATOM   4419 N  N3    . DG  C 3 10  ? 20.621  82.496  34.973 1.00 49.29  ? 10  DG  C N3    1 
ATOM   4420 C  C4    . DG  C 3 10  ? 19.804  81.687  34.254 1.00 43.42  ? 10  DG  C C4    1 
ATOM   4421 P  P     . DT  C 3 11  ? 23.963  82.371  29.441 1.00 104.16 ? 11  DT  C P     1 
ATOM   4422 O  OP1   . DT  C 3 11  ? 24.657  83.198  28.427 1.00 87.54  ? 11  DT  C OP1   1 
ATOM   4423 O  OP2   . DT  C 3 11  ? 23.583  80.975  29.122 1.00 75.68  ? 11  DT  C OP2   1 
ATOM   4424 O  "O5'" . DT  C 3 11  ? 24.879  82.410  30.749 1.00 83.58  ? 11  DT  C "O5'" 1 
ATOM   4425 C  "C5'" . DT  C 3 11  ? 25.211  83.668  31.326 1.00 89.28  ? 11  DT  C "C5'" 1 
ATOM   4426 C  "C4'" . DT  C 3 11  ? 25.591  83.516  32.788 1.00 75.36  ? 11  DT  C "C4'" 1 
ATOM   4427 O  "O4'" . DT  C 3 11  ? 24.499  82.918  33.521 1.00 75.27  ? 11  DT  C "O4'" 1 
ATOM   4428 C  "C3'" . DT  C 3 11  ? 26.814  82.636  33.049 1.00 70.71  ? 11  DT  C "C3'" 1 
ATOM   4429 O  "O3'" . DT  C 3 11  ? 27.857  83.423  33.612 1.00 88.97  ? 11  DT  C "O3'" 1 
ATOM   4430 C  "C2'" . DT  C 3 11  ? 26.314  81.559  34.028 1.00 74.09  ? 11  DT  C "C2'" 1 
ATOM   4431 C  "C1'" . DT  C 3 11  ? 25.031  82.170  34.579 1.00 64.22  ? 11  DT  C "C1'" 1 
ATOM   4432 N  N1    . DT  C 3 11  ? 24.012  81.153  35.005 1.00 52.12  ? 11  DT  C N1    1 
ATOM   4433 C  C2    . DT  C 3 11  ? 23.722  80.993  36.347 1.00 47.55  ? 11  DT  C C2    1 
ATOM   4434 O  O2    . DT  C 3 11  ? 24.252  81.642  37.236 1.00 51.55  ? 11  DT  C O2    1 
ATOM   4435 N  N3    . DT  C 3 11  ? 22.777  80.037  36.614 1.00 34.01  ? 11  DT  C N3    1 
ATOM   4436 C  C4    . DT  C 3 11  ? 22.109  79.240  35.698 1.00 36.93  ? 11  DT  C C4    1 
ATOM   4437 O  O4    . DT  C 3 11  ? 21.274  78.402  36.034 1.00 38.02  ? 11  DT  C O4    1 
ATOM   4438 C  C5    . DT  C 3 11  ? 22.458  79.459  34.320 1.00 40.12  ? 11  DT  C C5    1 
ATOM   4439 C  C7    . DT  C 3 11  ? 21.792  78.653  33.244 1.00 46.24  ? 11  DT  C C7    1 
ATOM   4440 C  C6    . DT  C 3 11  ? 23.381  80.393  34.041 1.00 44.06  ? 11  DT  C C6    1 
ATOM   4441 P  P     . DT  C 3 12  ? 29.368  82.880  33.635 1.00 82.42  ? 12  DT  C P     1 
ATOM   4442 O  OP1   . DT  C 3 12  ? 30.265  84.057  33.585 1.00 88.47  ? 12  DT  C OP1   1 
ATOM   4443 O  OP2   . DT  C 3 12  ? 29.482  81.802  32.624 1.00 80.31  ? 12  DT  C OP2   1 
ATOM   4444 O  "O5'" . DT  C 3 12  ? 29.518  82.257  35.093 1.00 66.01  ? 12  DT  C "O5'" 1 
ATOM   4445 C  "C5'" . DT  C 3 12  ? 29.307  83.081  36.227 1.00 75.62  ? 12  DT  C "C5'" 1 
ATOM   4446 C  "C4'" . DT  C 3 12  ? 29.019  82.238  37.448 1.00 67.17  ? 12  DT  C "C4'" 1 
ATOM   4447 O  "O4'" . DT  C 3 12  ? 27.768  81.551  37.275 1.00 61.25  ? 12  DT  C "O4'" 1 
ATOM   4448 C  "C3'" . DT  C 3 12  ? 30.033  81.130  37.706 1.00 55.98  ? 12  DT  C "C3'" 1 
ATOM   4449 O  "O3'" . DT  C 3 12  ? 30.967  81.541  38.687 1.00 63.09  ? 12  DT  C "O3'" 1 
ATOM   4450 C  "C2'" . DT  C 3 12  ? 29.186  79.940  38.196 1.00 61.85  ? 12  DT  C "C2'" 1 
ATOM   4451 C  "C1'" . DT  C 3 12  ? 27.758  80.483  38.176 1.00 58.08  ? 12  DT  C "C1'" 1 
ATOM   4452 N  N1    . DT  C 3 12  ? 26.739  79.476  37.748 1.00 44.40  ? 12  DT  C N1    1 
ATOM   4453 C  C2    . DT  C 3 12  ? 25.883  78.951  38.691 1.00 48.47  ? 12  DT  C C2    1 
ATOM   4454 O  O2    . DT  C 3 12  ? 25.904  79.276  39.865 1.00 54.70  ? 12  DT  C O2    1 
ATOM   4455 N  N3    . DT  C 3 12  ? 24.993  78.030  38.211 1.00 36.97  ? 12  DT  C N3    1 
ATOM   4456 C  C4    . DT  C 3 12  ? 24.872  77.585  36.911 1.00 43.97  ? 12  DT  C C4    1 
ATOM   4457 O  O4    . DT  C 3 12  ? 24.031  76.748  36.580 1.00 30.82  ? 12  DT  C O4    1 
ATOM   4458 C  C5    . DT  C 3 12  ? 25.803  78.174  35.969 1.00 39.38  ? 12  DT  C C5    1 
ATOM   4459 C  C7    . DT  C 3 12  ? 25.770  77.770  34.526 1.00 33.05  ? 12  DT  C C7    1 
ATOM   4460 C  C6    . DT  C 3 12  ? 26.684  79.078  36.430 1.00 30.46  ? 12  DT  C C6    1 
ATOM   4461 P  P     . DC  C 3 13  ? 32.325  80.706  38.887 1.00 82.82  ? 13  DC  C P     1 
ATOM   4462 O  OP1   . DC  C 3 13  ? 33.241  81.530  39.715 1.00 52.46  ? 13  DC  C OP1   1 
ATOM   4463 O  OP2   . DC  C 3 13  ? 32.725  80.191  37.556 1.00 52.82  ? 13  DC  C OP2   1 
ATOM   4464 O  "O5'" . DC  C 3 13  ? 31.884  79.460  39.781 1.00 54.43  ? 13  DC  C "O5'" 1 
ATOM   4465 C  "C5'" . DC  C 3 13  ? 31.667  79.647  41.162 1.00 71.13  ? 13  DC  C "C5'" 1 
ATOM   4466 C  "C4'" . DC  C 3 13  ? 30.877  78.497  41.751 1.00 53.06  ? 13  DC  C "C4'" 1 
ATOM   4467 O  "O4'" . DC  C 3 13  ? 29.689  78.262  40.981 1.00 55.11  ? 13  DC  C "O4'" 1 
ATOM   4468 C  "C3'" . DC  C 3 13  ? 31.558  77.152  41.706 1.00 51.47  ? 13  DC  C "C3'" 1 
ATOM   4469 O  "O3'" . DC  C 3 13  ? 32.483  77.021  42.765 1.00 62.31  ? 13  DC  C "O3'" 1 
ATOM   4470 C  "C2'" . DC  C 3 13  ? 30.377  76.193  41.883 1.00 58.65  ? 13  DC  C "C2'" 1 
ATOM   4471 C  "C1'" . DC  C 3 13  ? 29.181  77.015  41.401 1.00 48.74  ? 13  DC  C "C1'" 1 
ATOM   4472 N  N1    . DC  C 3 13  ? 28.445  76.358  40.301 1.00 38.80  ? 13  DC  C N1    1 
ATOM   4473 C  C2    . DC  C 3 13  ? 27.434  75.449  40.622 1.00 41.21  ? 13  DC  C C2    1 
ATOM   4474 O  O2    . DC  C 3 13  ? 27.174  75.241  41.815 1.00 31.61  ? 13  DC  C O2    1 
ATOM   4475 N  N3    . DC  C 3 13  ? 26.764  74.829  39.623 1.00 34.56  ? 13  DC  C N3    1 
ATOM   4476 C  C4    . DC  C 3 13  ? 27.078  75.083  38.355 1.00 38.33  ? 13  DC  C C4    1 
ATOM   4477 N  N4    . DC  C 3 13  ? 26.386  74.446  37.405 1.00 33.76  ? 13  DC  C N4    1 
ATOM   4478 C  C5    . DC  C 3 13  ? 28.116  76.005  38.004 1.00 35.65  ? 13  DC  C C5    1 
ATOM   4479 C  C6    . DC  C 3 13  ? 28.773  76.609  39.003 1.00 27.46  ? 13  DC  C C6    1 
ATOM   4480 P  P     . DT  C 3 14  ? 33.404  75.708  42.834 1.00 76.79  ? 14  DT  C P     1 
ATOM   4481 O  OP1   . DT  C 3 14  ? 34.552  75.962  43.732 1.00 72.80  ? 14  DT  C OP1   1 
ATOM   4482 O  OP2   . DT  C 3 14  ? 33.590  75.243  41.436 1.00 46.02  ? 14  DT  C OP2   1 
ATOM   4483 O  "O5'" . DT  C 3 14  ? 32.472  74.625  43.526 1.00 62.79  ? 14  DT  C "O5'" 1 
ATOM   4484 C  "C5'" . DT  C 3 14  ? 32.155  73.461  42.815 1.00 54.06  ? 14  DT  C "C5'" 1 
ATOM   4485 C  "C4'" . DT  C 3 14  ? 31.158  72.626  43.570 1.00 53.47  ? 14  DT  C "C4'" 1 
ATOM   4486 O  "O4'" . DT  C 3 14  ? 29.819  72.940  43.106 1.00 57.28  ? 14  DT  C "O4'" 1 
ATOM   4487 C  "C3'" . DT  C 3 14  ? 31.336  71.142  43.350 1.00 59.10  ? 14  DT  C "C3'" 1 
ATOM   4488 O  "O3'" . DT  C 3 14  ? 32.180  70.627  44.363 1.00 55.47  ? 14  DT  C "O3'" 1 
ATOM   4489 C  "C2'" . DT  C 3 14  ? 29.909  70.609  43.449 1.00 60.71  ? 14  DT  C "C2'" 1 
ATOM   4490 C  "C1'" . DT  C 3 14  ? 29.109  71.752  42.825 1.00 44.34  ? 14  DT  C "C1'" 1 
ATOM   4491 N  N1    . DT  C 3 14  ? 28.929  71.651  41.332 1.00 44.13  ? 14  DT  C N1    1 
ATOM   4492 C  C2    . DT  C 3 14  ? 28.012  70.760  40.816 1.00 49.67  ? 14  DT  C C2    1 
ATOM   4493 O  O2    . DT  C 3 14  ? 27.337  70.016  41.506 1.00 47.02  ? 14  DT  C O2    1 
ATOM   4494 N  N3    . DT  C 3 14  ? 27.919  70.762  39.448 1.00 48.64  ? 14  DT  C N3    1 
ATOM   4495 C  C4    . DT  C 3 14  ? 28.628  71.552  38.562 1.00 48.83  ? 14  DT  C C4    1 
ATOM   4496 O  O4    . DT  C 3 14  ? 28.469  71.478  37.344 1.00 49.92  ? 14  DT  C O4    1 
ATOM   4497 C  C5    . DT  C 3 14  ? 29.566  72.470  39.168 1.00 35.46  ? 14  DT  C C5    1 
ATOM   4498 C  C7    . DT  C 3 14  ? 30.391  73.378  38.311 1.00 32.27  ? 14  DT  C C7    1 
ATOM   4499 C  C6    . DT  C 3 14  ? 29.666  72.479  40.504 1.00 33.30  ? 14  DT  C C6    1 
ATOM   4500 P  P     . DC  C 3 15  ? 33.591  69.971  43.974 1.00 47.40  ? 15  DC  C P     1 
ATOM   4501 O  OP1   . DC  C 3 15  ? 34.471  70.051  45.162 1.00 43.19  ? 15  DC  C OP1   1 
ATOM   4502 O  OP2   . DC  C 3 15  ? 34.029  70.562  42.689 1.00 44.00  ? 15  DC  C OP2   1 
ATOM   4503 O  "O5'" . DC  C 3 15  ? 33.214  68.440  43.725 1.00 51.28  ? 15  DC  C "O5'" 1 
ATOM   4504 C  "C5'" . DC  C 3 15  ? 32.327  67.789  44.618 1.00 37.89  ? 15  DC  C "C5'" 1 
ATOM   4505 C  "C4'" . DC  C 3 15  ? 31.584  66.664  43.925 1.00 48.81  ? 15  DC  C "C4'" 1 
ATOM   4506 O  "O4'" . DC  C 3 15  ? 30.610  67.200  43.010 1.00 57.57  ? 15  DC  C "O4'" 1 
ATOM   4507 C  "C3'" . DC  C 3 15  ? 32.439  65.761  43.071 1.00 35.66  ? 15  DC  C "C3'" 1 
ATOM   4508 O  "O3'" . DC  C 3 15  ? 33.051  64.786  43.890 1.00 38.24  ? 15  DC  C "O3'" 1 
ATOM   4509 C  "C2'" . DC  C 3 15  ? 31.404  65.135  42.138 1.00 51.47  ? 15  DC  C "C2'" 1 
ATOM   4510 C  "C1'" . DC  C 3 15  ? 30.365  66.252  41.986 1.00 48.69  ? 15  DC  C "C1'" 1 
ATOM   4511 N  N1    . DC  C 3 15  ? 30.434  66.949  40.685 1.00 50.15  ? 15  DC  C N1    1 
ATOM   4512 C  C2    . DC  C 3 15  ? 29.667  66.487  39.613 1.00 48.30  ? 15  DC  C C2    1 
ATOM   4513 O  O2    . DC  C 3 15  ? 28.947  65.493  39.771 1.00 46.27  ? 15  DC  C O2    1 
ATOM   4514 N  N3    . DC  C 3 15  ? 29.737  67.142  38.428 1.00 54.63  ? 15  DC  C N3    1 
ATOM   4515 C  C4    . DC  C 3 15  ? 30.527  68.211  38.302 1.00 45.74  ? 15  DC  C C4    1 
ATOM   4516 N  N4    . DC  C 3 15  ? 30.560  68.828  37.118 1.00 41.22  ? 15  DC  C N4    1 
ATOM   4517 C  C5    . DC  C 3 15  ? 31.315  68.695  39.386 1.00 50.35  ? 15  DC  C C5    1 
ATOM   4518 C  C6    . DC  C 3 15  ? 31.239  68.040  40.548 1.00 50.77  ? 15  DC  C C6    1 
ATOM   4519 P  P     . DT  C 3 16  ? 34.421  64.090  43.435 1.00 50.53  ? 16  DT  C P     1 
ATOM   4520 O  OP1   . DT  C 3 16  ? 34.981  63.421  44.633 1.00 61.96  ? 16  DT  C OP1   1 
ATOM   4521 O  OP2   . DT  C 3 16  ? 35.218  65.075  42.664 1.00 45.70  ? 16  DT  C OP2   1 
ATOM   4522 O  "O5'" . DT  C 3 16  ? 33.957  62.971  42.397 1.00 54.65  ? 16  DT  C "O5'" 1 
ATOM   4523 C  "C5'" . DT  C 3 16  ? 33.094  61.917  42.802 1.00 38.82  ? 16  DT  C "C5'" 1 
ATOM   4524 C  "C4'" . DT  C 3 16  ? 32.720  61.068  41.601 1.00 47.46  ? 16  DT  C "C4'" 1 
ATOM   4525 O  "O4'" . DT  C 3 16  ? 31.791  61.804  40.774 1.00 39.73  ? 16  DT  C "O4'" 1 
ATOM   4526 C  "C3'" . DT  C 3 16  ? 33.883  60.730  40.681 1.00 44.05  ? 16  DT  C "C3'" 1 
ATOM   4527 O  "O3'" . DT  C 3 16  ? 34.519  59.530  41.116 1.00 55.92  ? 16  DT  C "O3'" 1 
ATOM   4528 C  "C2'" . DT  C 3 16  ? 33.197  60.538  39.327 1.00 35.48  ? 16  DT  C "C2'" 1 
ATOM   4529 C  "C1'" . DT  C 3 16  ? 31.987  61.475  39.413 1.00 33.32  ? 16  DT  C "C1'" 1 
ATOM   4530 N  N1    . DT  C 3 16  ? 32.132  62.747  38.623 1.00 43.74  ? 16  DT  C N1    1 
ATOM   4531 C  C2    . DT  C 3 16  ? 31.294  62.970  37.558 1.00 48.13  ? 16  DT  C C2    1 
ATOM   4532 O  O2    . DT  C 3 16  ? 30.433  62.182  37.214 1.00 52.32  ? 16  DT  C O2    1 
ATOM   4533 N  N3    . DT  C 3 16  ? 31.497  64.158  36.905 1.00 53.65  ? 16  DT  C N3    1 
ATOM   4534 C  C4    . DT  C 3 16  ? 32.437  65.125  37.202 1.00 47.92  ? 16  DT  C C4    1 
ATOM   4535 O  O4    . DT  C 3 16  ? 32.543  66.160  36.548 1.00 50.42  ? 16  DT  C O4    1 
ATOM   4536 C  C5    . DT  C 3 16  ? 33.288  64.829  38.333 1.00 38.65  ? 16  DT  C C5    1 
ATOM   4537 C  C7    . DT  C 3 16  ? 34.349  65.800  38.755 1.00 49.79  ? 16  DT  C C7    1 
ATOM   4538 C  C6    . DT  C 3 16  ? 33.093  63.672  38.984 1.00 38.92  ? 16  DT  C C6    1 
ATOM   4539 P  P     . DG  C 3 17  ? 35.968  59.570  41.811 1.00 47.81  ? 17  DG  C P     1 
ATOM   4540 O  OP1   . DG  C 3 17  ? 36.551  58.219  41.669 1.00 56.39  ? 17  DG  C OP1   1 
ATOM   4541 O  OP2   . DG  C 3 17  ? 35.807  60.139  43.162 1.00 48.98  ? 17  DG  C OP2   1 
ATOM   4542 O  "O5'" . DG  C 3 17  ? 36.818  60.578  40.901 1.00 38.97  ? 17  DG  C "O5'" 1 
ATOM   4543 C  "C5'" . DG  C 3 17  ? 37.652  60.076  39.869 1.00 29.55  ? 17  DG  C "C5'" 1 
ATOM   4544 C  "C4'" . DG  C 3 17  ? 36.847  59.762  38.619 1.00 45.04  ? 17  DG  C "C4'" 1 
ATOM   4545 O  "O4'" . DG  C 3 17  ? 36.307  60.975  38.063 1.00 47.16  ? 17  DG  C "O4'" 1 
ATOM   4546 C  "C3'" . DG  C 3 17  ? 37.647  59.127  37.483 1.00 39.04  ? 17  DG  C "C3'" 1 
ATOM   4547 O  "O3'" . DG  C 3 17  ? 37.450  57.717  37.483 1.00 53.00  ? 17  DG  C "O3'" 1 
ATOM   4548 C  "C2'" . DG  C 3 17  ? 37.081  59.777  36.200 1.00 44.30  ? 17  DG  C "C2'" 1 
ATOM   4549 C  "C1'" . DG  C 3 17  ? 35.999  60.728  36.714 1.00 50.11  ? 17  DG  C "C1'" 1 
ATOM   4550 N  N9    . DG  C 3 17  ? 35.947  62.002  35.993 1.00 51.01  ? 17  DG  C N9    1 
ATOM   4551 C  C8    . DG  C 3 17  ? 36.938  62.948  35.914 1.00 50.08  ? 17  DG  C C8    1 
ATOM   4552 N  N7    . DG  C 3 17  ? 36.611  63.987  35.200 1.00 55.44  ? 17  DG  C N7    1 
ATOM   4553 C  C5    . DG  C 3 17  ? 35.318  63.717  34.773 1.00 45.90  ? 17  DG  C C5    1 
ATOM   4554 C  C6    . DG  C 3 17  ? 34.443  64.486  33.962 1.00 49.72  ? 17  DG  C C6    1 
ATOM   4555 O  O6    . DG  C 3 17  ? 34.649  65.594  33.444 1.00 47.04  ? 17  DG  C O6    1 
ATOM   4556 N  N1    . DG  C 3 17  ? 33.222  63.846  33.769 1.00 52.95  ? 17  DG  C N1    1 
ATOM   4557 C  C2    . DG  C 3 17  ? 32.887  62.619  34.292 1.00 53.25  ? 17  DG  C C2    1 
ATOM   4558 N  N2    . DG  C 3 17  ? 31.663  62.163  33.995 1.00 45.90  ? 17  DG  C N2    1 
ATOM   4559 N  N3    . DG  C 3 17  ? 33.696  61.889  35.054 1.00 60.20  ? 17  DG  C N3    1 
ATOM   4560 C  C4    . DG  C 3 17  ? 34.893  62.498  35.250 1.00 49.83  ? 17  DG  C C4    1 
ATOM   4561 P  P     . DG  C 3 18  ? 38.685  56.716  37.245 1.00 46.30  ? 18  DG  C P     1 
ATOM   4562 O  OP1   . DG  C 3 18  ? 39.346  57.062  35.964 1.00 39.69  ? 18  DG  C OP1   1 
ATOM   4563 O  OP2   . DG  C 3 18  ? 38.173  55.355  37.480 1.00 46.49  ? 18  DG  C OP2   1 
ATOM   4564 O  "O5'" . DG  C 3 18  ? 39.687  57.039  38.442 1.00 53.44  ? 18  DG  C "O5'" 1 
ATOM   4565 C  "C5'" . DG  C 3 18  ? 39.450  56.498  39.732 1.00 37.30  ? 18  DG  C "C5'" 1 
ATOM   4566 C  "C4'" . DG  C 3 18  ? 40.669  56.686  40.609 1.00 49.50  ? 18  DG  C "C4'" 1 
ATOM   4567 O  "O4'" . DG  C 3 18  ? 40.922  58.098  40.786 1.00 68.34  ? 18  DG  C "O4'" 1 
ATOM   4568 C  "C3'" . DG  C 3 18  ? 40.546  56.131  42.009 1.00 64.78  ? 18  DG  C "C3'" 1 
ATOM   4569 O  "O3'" . DG  C 3 18  ? 40.895  54.752  42.005 1.00 81.71  ? 18  DG  C "O3'" 1 
ATOM   4570 C  "C2'" . DG  C 3 18  ? 41.565  56.972  42.771 1.00 63.74  ? 18  DG  C "C2'" 1 
ATOM   4571 C  "C1'" . DG  C 3 18  ? 41.465  58.330  42.069 1.00 58.67  ? 18  DG  C "C1'" 1 
ATOM   4572 N  N9    . DG  C 3 18  ? 40.608  59.282  42.760 1.00 55.29  ? 18  DG  C N9    1 
ATOM   4573 C  C8    . DG  C 3 18  ? 39.281  59.119  43.079 1.00 84.30  ? 18  DG  C C8    1 
ATOM   4574 N  N7    . DG  C 3 18  ? 38.766  60.142  43.701 1.00 85.98  ? 18  DG  C N7    1 
ATOM   4575 C  C5    . DG  C 3 18  ? 39.817  61.042  43.797 1.00 80.84  ? 18  DG  C C5    1 
ATOM   4576 C  C6    . DG  C 3 18  ? 39.857  62.329  44.373 1.00 98.12  ? 18  DG  C C6    1 
ATOM   4577 O  O6    . DG  C 3 18  ? 38.937  62.948  44.930 1.00 99.43  ? 18  DG  C O6    1 
ATOM   4578 N  N1    . DG  C 3 18  ? 41.122  62.904  44.258 1.00 113.09 ? 18  DG  C N1    1 
ATOM   4579 C  C2    . DG  C 3 18  ? 42.209  62.305  43.658 1.00 104.27 ? 18  DG  C C2    1 
ATOM   4580 N  N2    . DG  C 3 18  ? 43.349  63.014  43.644 1.00 99.83  ? 18  DG  C N2    1 
ATOM   4581 N  N3    . DG  C 3 18  ? 42.182  61.096  43.115 1.00 83.74  ? 18  DG  C N3    1 
ATOM   4582 C  C4    . DG  C 3 18  ? 40.959  60.527  43.221 1.00 62.05  ? 18  DG  C C4    1 
ATOM   4583 P  P     . DT  C 3 19  ? 40.600  53.833  43.288 1.00 99.50  ? 19  DT  C P     1 
ATOM   4584 O  OP1   . DT  C 3 19  ? 40.223  52.486  42.803 1.00 102.58 ? 19  DT  C OP1   1 
ATOM   4585 O  OP2   . DT  C 3 19  ? 39.648  54.562  44.155 1.00 75.26  ? 19  DT  C OP2   1 
ATOM   4586 O  "O5'" . DT  C 3 19  ? 42.027  53.754  44.013 1.00 94.15  ? 19  DT  C "O5'" 1 
ATOM   4587 C  "C5'" . DT  C 3 19  ? 43.230  53.812  43.229 1.00 78.66  ? 19  DT  C "C5'" 1 
ATOM   4588 C  "C4'" . DT  C 3 19  ? 44.379  54.431  44.018 1.00 90.17  ? 19  DT  C "C4'" 1 
ATOM   4589 O  "O4'" . DT  C 3 19  ? 44.270  55.869  44.006 1.00 87.26  ? 19  DT  C "O4'" 1 
ATOM   4590 C  "C3'" . DT  C 3 19  ? 44.445  54.039  45.499 1.00 101.55 ? 19  DT  C "C3'" 1 
ATOM   4591 O  "O3'" . DT  C 3 19  ? 45.468  53.065  45.707 1.00 99.72  ? 19  DT  C "O3'" 1 
ATOM   4592 C  "C2'" . DT  C 3 19  ? 44.760  55.355  46.239 1.00 104.53 ? 19  DT  C "C2'" 1 
ATOM   4593 C  "C1'" . DT  C 3 19  ? 44.978  56.361  45.112 1.00 84.12  ? 19  DT  C "C1'" 1 
ATOM   4594 N  N1    . DT  C 3 19  ? 44.514  57.765  45.438 1.00 102.94 ? 19  DT  C N1    1 
ATOM   4595 C  C2    . DT  C 3 19  ? 43.196  58.005  45.804 1.00 103.11 ? 19  DT  C C2    1 
ATOM   4596 O  O2    . DT  C 3 19  ? 42.339  57.137  45.878 1.00 90.70  ? 19  DT  C O2    1 
ATOM   4597 N  N3    . DT  C 3 19  ? 42.913  59.321  46.078 1.00 95.00  ? 19  DT  C N3    1 
ATOM   4598 C  C4    . DT  C 3 19  ? 43.787  60.395  46.030 1.00 106.10 ? 19  DT  C C4    1 
ATOM   4599 O  O4    . DT  C 3 19  ? 43.435  61.541  46.296 1.00 117.17 ? 19  DT  C O4    1 
ATOM   4600 C  C5    . DT  C 3 19  ? 45.143  60.076  45.648 1.00 106.12 ? 19  DT  C C5    1 
ATOM   4601 C  C7    . DT  C 3 19  ? 46.180  61.160  45.562 1.00 98.29  ? 19  DT  C C7    1 
ATOM   4602 C  C6    . DT  C 3 19  ? 45.436  58.794  45.376 1.00 103.21 ? 19  DT  C C6    1 
ATOM   4603 P  P     . DT  C 3 20  ? 45.667  52.382  47.151 1.00 81.83  ? 20  DT  C P     1 
ATOM   4604 O  OP1   . DT  C 3 20  ? 44.611  52.858  48.073 1.00 70.63  ? 20  DT  C OP1   1 
ATOM   4605 O  OP2   . DT  C 3 20  ? 47.097  52.525  47.505 1.00 81.22  ? 20  DT  C OP2   1 
ATOM   4606 O  "O5'" . DT  C 3 20  ? 45.366  50.840  46.885 1.00 92.03  ? 20  DT  C "O5'" 1 
ATOM   4607 C  "C5'" . DT  C 3 20  ? 44.197  50.465  46.182 1.00 75.01  ? 20  DT  C "C5'" 1 
ATOM   4608 C  "C4'" . DT  C 3 20  ? 44.534  49.491  45.074 1.00 66.29  ? 20  DT  C "C4'" 1 
ATOM   4609 O  "O4'" . DT  C 3 20  ? 45.333  50.158  44.055 1.00 76.70  ? 20  DT  C "O4'" 1 
ATOM   4610 C  "C3'" . DT  C 3 20  ? 45.353  48.272  45.514 1.00 76.50  ? 20  DT  C "C3'" 1 
ATOM   4611 O  "O3'" . DT  C 3 20  ? 44.862  47.120  44.860 1.00 77.48  ? 20  DT  C "O3'" 1 
ATOM   4612 C  "C2'" . DT  C 3 20  ? 46.759  48.618  45.027 1.00 59.82  ? 20  DT  C "C2'" 1 
ATOM   4613 C  "C1'" . DT  C 3 20  ? 46.415  49.319  43.729 1.00 66.33  ? 20  DT  C "C1'" 1 
ATOM   4614 N  N1    . DT  C 3 20  ? 47.526  50.130  43.142 1.00 63.86  ? 20  DT  C N1    1 
ATOM   4615 C  C2    . DT  C 3 20  ? 47.639  50.199  41.776 1.00 59.51  ? 20  DT  C C2    1 
ATOM   4616 O  O2    . DT  C 3 20  ? 46.870  49.638  41.019 1.00 58.18  ? 20  DT  C O2    1 
ATOM   4617 N  N3    . DT  C 3 20  ? 48.686  50.953  41.321 1.00 49.46  ? 20  DT  C N3    1 
ATOM   4618 C  C4    . DT  C 3 20  ? 49.618  51.629  42.081 1.00 57.09  ? 20  DT  C C4    1 
ATOM   4619 O  O4    . DT  C 3 20  ? 50.524  52.282  41.573 1.00 67.22  ? 20  DT  C O4    1 
ATOM   4620 C  C5    . DT  C 3 20  ? 49.449  51.511  43.515 1.00 62.06  ? 20  DT  C C5    1 
ATOM   4621 C  C7    . DT  C 3 20  ? 50.400  52.201  44.447 1.00 70.37  ? 20  DT  C C7    1 
ATOM   4622 C  C6    . DT  C 3 20  ? 48.423  50.774  43.971 1.00 66.78  ? 20  DT  C C6    1 
ATOM   4623 P  P     . DC  C 3 21  ? 44.146  45.952  45.693 1.00 86.47  ? 21  DC  C P     1 
ATOM   4624 O  OP1   . DC  C 3 21  ? 43.035  46.546  46.472 1.00 70.25  ? 21  DC  C OP1   1 
ATOM   4625 O  OP2   . DC  C 3 21  ? 45.217  45.181  46.365 1.00 71.31  ? 21  DC  C OP2   1 
ATOM   4626 O  "O5'" . DC  C 3 21  ? 43.492  45.034  44.562 1.00 90.21  ? 21  DC  C "O5'" 1 
ATOM   4627 C  "C5'" . DC  C 3 21  ? 44.299  44.106  43.856 1.00 77.60  ? 21  DC  C "C5'" 1 
ATOM   4628 C  "C4'" . DC  C 3 21  ? 44.448  44.502  42.398 1.00 62.79  ? 21  DC  C "C4'" 1 
ATOM   4629 O  "O4'" . DC  C 3 21  ? 45.340  45.623  42.291 1.00 65.70  ? 21  DC  C "O4'" 1 
ATOM   4630 C  "C3'" . DC  C 3 21  ? 45.069  43.422  41.521 1.00 73.81  ? 21  DC  C "C3'" 1 
ATOM   4631 O  "O3'" . DC  C 3 21  ? 44.056  42.698  40.857 1.00 66.75  ? 21  DC  C "O3'" 1 
ATOM   4632 C  "C2'" . DC  C 3 21  ? 45.963  44.185  40.527 1.00 65.36  ? 21  DC  C "C2'" 1 
ATOM   4633 C  "C1'" . DC  C 3 21  ? 45.880  45.638  40.993 1.00 58.60  ? 21  DC  C "C1'" 1 
ATOM   4634 N  N1    . DC  C 3 21  ? 47.198  46.330  41.024 1.00 57.08  ? 21  DC  C N1    1 
ATOM   4635 C  C2    . DC  C 3 21  ? 47.750  46.803  39.831 1.00 57.66  ? 21  DC  C C2    1 
ATOM   4636 O  O2    . DC  C 3 21  ? 47.134  46.624  38.773 1.00 54.68  ? 21  DC  C O2    1 
ATOM   4637 N  N3    . DC  C 3 21  ? 48.947  47.443  39.866 1.00 47.70  ? 21  DC  C N3    1 
ATOM   4638 C  C4    . DC  C 3 21  ? 49.579  47.611  41.029 1.00 47.57  ? 21  DC  C C4    1 
ATOM   4639 N  N4    . DC  C 3 21  ? 50.754  48.246  41.013 1.00 43.78  ? 21  DC  C N4    1 
ATOM   4640 C  C5    . DC  C 3 21  ? 49.032  47.133  42.260 1.00 48.58  ? 21  DC  C C5    1 
ATOM   4641 C  C6    . DC  C 3 21  ? 47.852  46.505  42.211 1.00 58.77  ? 21  DC  C C6    1 
ATOM   4642 P  P     . DA  C 3 22  ? 44.358  41.213  40.335 1.00 56.47  ? 22  DA  C P     1 
ATOM   4643 O  OP1   . DA  C 3 22  ? 43.063  40.589  39.969 1.00 56.59  ? 22  DA  C OP1   1 
ATOM   4644 O  OP2   . DA  C 3 22  ? 45.241  40.573  41.334 1.00 80.93  ? 22  DA  C OP2   1 
ATOM   4645 O  "O5'" . DA  C 3 22  ? 45.204  41.448  39.002 1.00 55.52  ? 22  DA  C "O5'" 1 
ATOM   4646 C  "C5'" . DA  C 3 22  ? 44.625  42.147  37.914 1.00 46.55  ? 22  DA  C "C5'" 1 
ATOM   4647 C  "C4'" . DA  C 3 22  ? 45.585  42.209  36.745 1.00 52.11  ? 22  DA  C "C4'" 1 
ATOM   4648 O  "O4'" . DA  C 3 22  ? 46.610  43.201  37.012 1.00 64.47  ? 22  DA  C "O4'" 1 
ATOM   4649 C  "C3'" . DA  C 3 22  ? 46.319  40.903  36.441 1.00 62.65  ? 22  DA  C "C3'" 1 
ATOM   4650 O  "O3'" . DA  C 3 22  ? 46.362  40.698  35.031 1.00 77.09  ? 22  DA  C "O3'" 1 
ATOM   4651 C  "C2'" . DA  C 3 22  ? 47.712  41.140  37.030 1.00 55.40  ? 22  DA  C "C2'" 1 
ATOM   4652 C  "C1'" . DA  C 3 22  ? 47.887  42.634  36.820 1.00 51.01  ? 22  DA  C "C1'" 1 
ATOM   4653 N  N9    . DA  C 3 22  ? 48.813  43.254  37.767 1.00 50.75  ? 22  DA  C N9    1 
ATOM   4654 C  C8    . DA  C 3 22  ? 48.880  43.037  39.117 1.00 49.33  ? 22  DA  C C8    1 
ATOM   4655 N  N7    . DA  C 3 22  ? 49.811  43.743  39.721 1.00 48.05  ? 22  DA  C N7    1 
ATOM   4656 C  C5    . DA  C 3 22  ? 50.394  44.473  38.696 1.00 35.22  ? 22  DA  C C5    1 
ATOM   4657 C  C6    . DA  C 3 22  ? 51.448  45.414  38.676 1.00 45.17  ? 22  DA  C C6    1 
ATOM   4658 N  N6    . DA  C 3 22  ? 52.123  45.789  39.770 1.00 42.21  ? 22  DA  C N6    1 
ATOM   4659 N  N1    . DA  C 3 22  ? 51.781  45.957  37.484 1.00 42.31  ? 22  DA  C N1    1 
ATOM   4660 C  C2    . DA  C 3 22  ? 51.105  45.582  36.392 1.00 38.81  ? 22  DA  C C2    1 
ATOM   4661 N  N3    . DA  C 3 22  ? 50.099  44.709  36.286 1.00 50.07  ? 22  DA  C N3    1 
ATOM   4662 C  C4    . DA  C 3 22  ? 49.790  44.185  37.486 1.00 41.81  ? 22  DA  C C4    1 
ATOM   4663 P  P     . DC  C 3 23  ? 46.929  39.330  34.407 1.00 74.72  ? 23  DC  C P     1 
ATOM   4664 O  OP1   . DC  C 3 23  ? 45.850  38.741  33.584 1.00 76.22  ? 23  DC  C OP1   1 
ATOM   4665 O  OP2   . DC  C 3 23  ? 47.526  38.525  35.497 1.00 81.59  ? 23  DC  C OP2   1 
ATOM   4666 O  "O5'" . DC  C 3 23  ? 48.084  39.834  33.419 1.00 66.99  ? 23  DC  C "O5'" 1 
ATOM   4667 C  "C5'" . DC  C 3 23  ? 48.483  41.204  33.451 1.00 69.73  ? 23  DC  C "C5'" 1 
ATOM   4668 C  "C4'" . DC  C 3 23  ? 49.861  41.402  32.843 1.00 69.01  ? 23  DC  C "C4'" 1 
ATOM   4669 O  "O4'" . DC  C 3 23  ? 50.700  42.150  33.768 1.00 72.30  ? 23  DC  C "O4'" 1 
ATOM   4670 C  "C3'" . DC  C 3 23  ? 50.635  40.126  32.545 1.00 79.22  ? 23  DC  C "C3'" 1 
ATOM   4671 O  "O3'" . DC  C 3 23  ? 51.501  40.358  31.453 1.00 91.66  ? 23  DC  C "O3'" 1 
ATOM   4672 C  "C2'" . DC  C 3 23  ? 51.425  39.929  33.831 1.00 66.74  ? 23  DC  C "C2'" 1 
ATOM   4673 C  "C1'" . DC  C 3 23  ? 51.821  41.366  34.126 1.00 49.57  ? 23  DC  C "C1'" 1 
ATOM   4674 N  N1    . DC  C 3 23  ? 52.151  41.625  35.559 1.00 38.86  ? 23  DC  C N1    1 
ATOM   4675 C  C2    . DC  C 3 23  ? 53.052  42.644  35.881 1.00 43.89  ? 23  DC  C C2    1 
ATOM   4676 O  O2    . DC  C 3 23  ? 53.553  43.314  34.968 1.00 51.77  ? 23  DC  C O2    1 
ATOM   4677 N  N3    . DC  C 3 23  ? 53.350  42.872  37.186 1.00 40.60  ? 23  DC  C N3    1 
ATOM   4678 C  C4    . DC  C 3 23  ? 52.787  42.127  38.140 1.00 49.20  ? 23  DC  C C4    1 
ATOM   4679 N  N4    . DC  C 3 23  ? 53.113  42.390  39.412 1.00 43.56  ? 23  DC  C N4    1 
ATOM   4680 C  C5    . DC  C 3 23  ? 51.866  41.077  37.832 1.00 31.04  ? 23  DC  C C5    1 
ATOM   4681 C  C6    . DC  C 3 23  ? 51.582  40.862  36.541 1.00 49.31  ? 23  DC  C C6    1 
ATOM   4682 P  P     . DG  C 3 24  ? 51.860  39.170  30.438 1.00 95.58  ? 24  DG  C P     1 
ATOM   4683 O  OP1   . DG  C 3 24  ? 50.914  39.252  29.303 1.00 83.54  ? 24  DG  C OP1   1 
ATOM   4684 O  OP2   . DG  C 3 24  ? 51.970  37.926  31.239 1.00 67.94  ? 24  DG  C OP2   1 
ATOM   4685 O  "O5'" . DG  C 3 24  ? 53.300  39.580  29.884 1.00 75.15  ? 24  DG  C "O5'" 1 
ATOM   4686 C  "C5'" . DG  C 3 24  ? 53.625  40.952  29.702 1.00 74.11  ? 24  DG  C "C5'" 1 
ATOM   4687 C  "C4'" . DG  C 3 24  ? 55.083  41.206  30.042 1.00 88.27  ? 24  DG  C "C4'" 1 
ATOM   4688 O  "O4'" . DG  C 3 24  ? 55.230  41.419  31.474 1.00 88.93  ? 24  DG  C "O4'" 1 
ATOM   4689 C  "C3'" . DG  C 3 24  ? 56.034  40.060  29.698 1.00 80.19  ? 24  DG  C "C3'" 1 
ATOM   4690 O  "O3'" . DG  C 3 24  ? 57.269  40.592  29.278 1.00 92.61  ? 24  DG  C "O3'" 1 
ATOM   4691 C  "C2'" . DG  C 3 24  ? 56.176  39.338  31.035 1.00 72.16  ? 24  DG  C "C2'" 1 
ATOM   4692 C  "C1'" . DG  C 3 24  ? 56.205  40.527  31.974 1.00 69.96  ? 24  DG  C "C1'" 1 
ATOM   4693 N  N9    . DG  C 3 24  ? 55.891  40.206  33.366 1.00 60.53  ? 24  DG  C N9    1 
ATOM   4694 C  C8    . DG  C 3 24  ? 54.991  39.272  33.832 1.00 59.02  ? 24  DG  C C8    1 
ATOM   4695 N  N7    . DG  C 3 24  ? 54.928  39.220  35.138 1.00 47.66  ? 24  DG  C N7    1 
ATOM   4696 C  C5    . DG  C 3 24  ? 55.844  40.183  35.561 1.00 43.60  ? 24  DG  C C5    1 
ATOM   4697 C  C6    . DG  C 3 24  ? 56.216  40.586  36.873 1.00 55.87  ? 24  DG  C C6    1 
ATOM   4698 O  O6    . DG  C 3 24  ? 55.794  40.156  37.960 1.00 50.22  ? 24  DG  C O6    1 
ATOM   4699 N  N1    . DG  C 3 24  ? 57.186  41.596  36.849 1.00 43.24  ? 24  DG  C N1    1 
ATOM   4700 C  C2    . DG  C 3 24  ? 57.722  42.147  35.703 1.00 55.62  ? 24  DG  C C2    1 
ATOM   4701 N  N2    . DG  C 3 24  ? 58.647  43.112  35.874 1.00 53.97  ? 24  DG  C N2    1 
ATOM   4702 N  N3    . DG  C 3 24  ? 57.380  41.777  34.475 1.00 54.59  ? 24  DG  C N3    1 
ATOM   4703 C  C4    . DG  C 3 24  ? 56.441  40.795  34.481 1.00 47.26  ? 24  DG  C C4    1 
ATOM   4704 P  P     . DC  C 3 25  ? 58.083  39.898  28.083 1.00 117.09 ? 25  DC  C P     1 
ATOM   4705 O  OP1   . DC  C 3 25  ? 57.242  39.994  26.866 1.00 76.15  ? 25  DC  C OP1   1 
ATOM   4706 O  OP2   . DC  C 3 25  ? 58.537  38.578  28.580 1.00 101.34 ? 25  DC  C OP2   1 
ATOM   4707 O  "O5'" . DC  C 3 25  ? 59.360  40.847  27.890 1.00 103.98 ? 25  DC  C "O5'" 1 
ATOM   4708 C  "C5'" . DC  C 3 25  ? 59.650  41.859  28.858 1.00 102.46 ? 25  DC  C "C5'" 1 
ATOM   4709 C  "C4'" . DC  C 3 25  ? 60.849  41.477  29.713 1.00 103.82 ? 25  DC  C "C4'" 1 
ATOM   4710 O  "O4'" . DC  C 3 25  ? 60.460  41.444  31.102 1.00 92.80  ? 25  DC  C "O4'" 1 
ATOM   4711 C  "C3'" . DC  C 3 25  ? 61.425  40.099  29.443 1.00 95.63  ? 25  DC  C "C3'" 1 
ATOM   4712 O  "O3'" . DC  C 3 25  ? 62.352  40.160  28.367 1.00 106.66 ? 25  DC  C "O3'" 1 
ATOM   4713 C  "C2'" . DC  C 3 25  ? 62.123  39.771  30.763 1.00 72.04  ? 25  DC  C "C2'" 1 
ATOM   4714 C  "C1'" . DC  C 3 25  ? 61.266  40.511  31.798 1.00 74.44  ? 25  DC  C "C1'" 1 
ATOM   4715 N  N1    . DC  C 3 25  ? 60.378  39.619  32.596 1.00 63.02  ? 25  DC  C N1    1 
ATOM   4716 C  C2    . DC  C 3 25  ? 60.273  39.823  33.972 1.00 56.34  ? 25  DC  C C2    1 
ATOM   4717 O  O2    . DC  C 3 25  ? 60.920  40.742  34.492 1.00 53.17  ? 25  DC  C O2    1 
ATOM   4718 N  N3    . DC  C 3 25  ? 59.464  39.006  34.701 1.00 50.32  ? 25  DC  C N3    1 
ATOM   4719 C  C4    . DC  C 3 25  ? 58.780  38.028  34.094 1.00 60.67  ? 25  DC  C C4    1 
ATOM   4720 N  N4    . DC  C 3 25  ? 57.994  37.248  34.849 1.00 47.64  ? 25  DC  C N4    1 
ATOM   4721 C  C5    . DC  C 3 25  ? 58.879  37.805  32.687 1.00 59.97  ? 25  DC  C C5    1 
ATOM   4722 C  C6    . DC  C 3 25  ? 59.681  38.616  31.984 1.00 63.86  ? 25  DC  C C6    1 
ATOM   4723 O  "O5'" . DG  D 4 1   ? 62.607  36.746  43.903 1.00 91.30  ? 1   DG  D "O5'" 1 
ATOM   4724 C  "C5'" . DG  D 4 1   ? 62.420  37.480  42.699 1.00 76.41  ? 1   DG  D "C5'" 1 
ATOM   4725 C  "C4'" . DG  D 4 1   ? 62.898  38.911  42.856 1.00 95.73  ? 1   DG  D "C4'" 1 
ATOM   4726 O  "O4'" . DG  D 4 1   ? 62.459  39.689  41.728 1.00 91.97  ? 1   DG  D "O4'" 1 
ATOM   4727 C  "C3'" . DG  D 4 1   ? 62.337  39.656  44.052 1.00 102.58 ? 1   DG  D "C3'" 1 
ATOM   4728 O  "O3'" . DG  D 4 1   ? 63.229  40.742  44.390 1.00 113.43 ? 1   DG  D "O3'" 1 
ATOM   4729 C  "C2'" . DG  D 4 1   ? 60.973  40.136  43.533 1.00 76.35  ? 1   DG  D "C2'" 1 
ATOM   4730 C  "C1'" . DG  D 4 1   ? 61.191  40.252  42.018 1.00 77.99  ? 1   DG  D "C1'" 1 
ATOM   4731 N  N9    . DG  D 4 1   ? 60.198  39.533  41.228 1.00 69.90  ? 1   DG  D N9    1 
ATOM   4732 C  C8    . DG  D 4 1   ? 59.195  38.713  41.694 1.00 70.15  ? 1   DG  D C8    1 
ATOM   4733 N  N7    . DG  D 4 1   ? 58.467  38.190  40.741 1.00 60.89  ? 1   DG  D N7    1 
ATOM   4734 C  C5    . DG  D 4 1   ? 59.029  38.690  39.570 1.00 55.03  ? 1   DG  D C5    1 
ATOM   4735 C  C6    . DG  D 4 1   ? 58.668  38.473  38.214 1.00 59.08  ? 1   DG  D C6    1 
ATOM   4736 O  O6    . DG  D 4 1   ? 57.745  37.768  37.768 1.00 56.49  ? 1   DG  D O6    1 
ATOM   4737 N  N1    . DG  D 4 1   ? 59.508  39.177  37.336 1.00 41.54  ? 1   DG  D N1    1 
ATOM   4738 C  C2    . DG  D 4 1   ? 60.558  39.986  37.728 1.00 56.61  ? 1   DG  D C2    1 
ATOM   4739 N  N2    . DG  D 4 1   ? 61.258  40.586  36.750 1.00 43.01  ? 1   DG  D N2    1 
ATOM   4740 N  N3    . DG  D 4 1   ? 60.901  40.191  38.995 1.00 56.24  ? 1   DG  D N3    1 
ATOM   4741 C  C4    . DG  D 4 1   ? 60.098  39.516  39.856 1.00 55.35  ? 1   DG  D C4    1 
ATOM   4742 P  P     . DC  D 4 2   ? 62.708  42.118  45.044 1.00 112.80 ? 2   DC  D P     1 
ATOM   4743 O  OP1   . DC  D 4 2   ? 63.890  42.749  45.678 1.00 98.83  ? 2   DC  D OP1   1 
ATOM   4744 O  OP2   . DC  D 4 2   ? 61.506  41.867  45.873 1.00 110.06 ? 2   DC  D OP2   1 
ATOM   4745 O  "O5'" . DC  D 4 2   ? 62.346  43.023  43.776 1.00 106.11 ? 2   DC  D "O5'" 1 
ATOM   4746 C  "C5'" . DC  D 4 2   ? 63.334  43.243  42.769 1.00 94.68  ? 2   DC  D "C5'" 1 
ATOM   4747 C  "C4'" . DC  D 4 2   ? 62.827  44.179  41.682 1.00 103.40 ? 2   DC  D "C4'" 1 
ATOM   4748 O  "O4'" . DC  D 4 2   ? 61.832  43.507  40.861 1.00 97.68  ? 2   DC  D "O4'" 1 
ATOM   4749 C  "C3'" . DC  D 4 2   ? 62.166  45.466  42.172 1.00 102.25 ? 2   DC  D "C3'" 1 
ATOM   4750 O  "O3'" . DC  D 4 2   ? 62.516  46.520  41.295 1.00 109.40 ? 2   DC  D "O3'" 1 
ATOM   4751 C  "C2'" . DC  D 4 2   ? 60.680  45.134  42.067 1.00 77.14  ? 2   DC  D "C2'" 1 
ATOM   4752 C  "C1'" . DC  D 4 2   ? 60.666  44.303  40.798 1.00 74.03  ? 2   DC  D "C1'" 1 
ATOM   4753 N  N1    . DC  D 4 2   ? 59.490  43.402  40.684 1.00 62.03  ? 2   DC  D N1    1 
ATOM   4754 C  C2    . DC  D 4 2   ? 59.018  43.037  39.414 1.00 58.99  ? 2   DC  D C2    1 
ATOM   4755 O  O2    . DC  D 4 2   ? 59.589  43.482  38.405 1.00 55.56  ? 2   DC  D O2    1 
ATOM   4756 N  N3    . DC  D 4 2   ? 57.947  42.204  39.327 1.00 47.01  ? 2   DC  D N3    1 
ATOM   4757 C  C4    . DC  D 4 2   ? 57.362  41.748  40.442 1.00 58.25  ? 2   DC  D C4    1 
ATOM   4758 N  N4    . DC  D 4 2   ? 56.311  40.932  40.308 1.00 46.36  ? 2   DC  D N4    1 
ATOM   4759 C  C5    . DC  D 4 2   ? 57.831  42.110  41.743 1.00 58.41  ? 2   DC  D C5    1 
ATOM   4760 C  C6    . DC  D 4 2   ? 58.886  42.931  41.815 1.00 56.72  ? 2   DC  D C6    1 
ATOM   4761 P  P     . DG  D 4 3   ? 62.295  48.055  41.709 1.00 116.14 ? 3   DG  D P     1 
ATOM   4762 O  OP1   . DG  D 4 3   ? 63.597  48.586  42.174 1.00 114.12 ? 3   DG  D OP1   1 
ATOM   4763 O  OP2   . DG  D 4 3   ? 61.115  48.144  42.597 1.00 115.26 ? 3   DG  D OP2   1 
ATOM   4764 O  "O5'" . DG  D 4 3   ? 61.958  48.750  40.309 1.00 113.64 ? 3   DG  D "O5'" 1 
ATOM   4765 C  "C5'" . DG  D 4 3   ? 62.719  48.401  39.154 1.00 107.23 ? 3   DG  D "C5'" 1 
ATOM   4766 C  "C4'" . DG  D 4 3   ? 61.860  48.430  37.902 1.00 105.55 ? 3   DG  D "C4'" 1 
ATOM   4767 O  "O4'" . DG  D 4 3   ? 60.847  47.392  37.975 1.00 88.83  ? 3   DG  D "O4'" 1 
ATOM   4768 C  "C3'" . DG  D 4 3   ? 61.117  49.741  37.657 1.00 89.08  ? 3   DG  D "C3'" 1 
ATOM   4769 O  "O3'" . DG  D 4 3   ? 61.221  50.099  36.292 1.00 84.34  ? 3   DG  D "O3'" 1 
ATOM   4770 C  "C2'" . DG  D 4 3   ? 59.677  49.414  38.050 1.00 77.55  ? 3   DG  D "C2'" 1 
ATOM   4771 C  "C1'" . DG  D 4 3   ? 59.582  47.942  37.690 1.00 67.55  ? 3   DG  D "C1'" 1 
ATOM   4772 N  N9    . DG  D 4 3   ? 58.588  47.217  38.475 1.00 75.74  ? 3   DG  D N9    1 
ATOM   4773 C  C8    . DG  D 4 3   ? 58.462  47.211  39.845 1.00 67.64  ? 3   DG  D C8    1 
ATOM   4774 N  N7    . DG  D 4 3   ? 57.482  46.463  40.273 1.00 64.10  ? 3   DG  D N7    1 
ATOM   4775 C  C5    . DG  D 4 3   ? 56.922  45.934  39.112 1.00 51.77  ? 3   DG  D C5    1 
ATOM   4776 C  C6    . DG  D 4 3   ? 55.824  45.051  38.946 1.00 57.34  ? 3   DG  D C6    1 
ATOM   4777 O  O6    . DG  D 4 3   ? 55.107  44.541  39.824 1.00 48.88  ? 3   DG  D O6    1 
ATOM   4778 N  N1    . DG  D 4 3   ? 55.587  44.768  37.599 1.00 50.70  ? 3   DG  D N1    1 
ATOM   4779 C  C2    . DG  D 4 3   ? 56.319  45.275  36.546 1.00 58.47  ? 3   DG  D C2    1 
ATOM   4780 N  N2    . DG  D 4 3   ? 55.942  44.890  35.315 1.00 47.07  ? 3   DG  D N2    1 
ATOM   4781 N  N3    . DG  D 4 3   ? 57.351  46.103  36.690 1.00 58.64  ? 3   DG  D N3    1 
ATOM   4782 C  C4    . DG  D 4 3   ? 57.593  46.389  37.996 1.00 56.85  ? 3   DG  D C4    1 
ATOM   4783 P  P     . DT  D 4 4   ? 60.688  51.527  35.790 1.00 94.15  ? 4   DT  D P     1 
ATOM   4784 O  OP1   . DT  D 4 4   ? 61.606  52.003  34.729 1.00 82.61  ? 4   DT  D OP1   1 
ATOM   4785 O  OP2   . DT  D 4 4   ? 60.421  52.354  36.990 1.00 67.41  ? 4   DT  D OP2   1 
ATOM   4786 O  "O5'" . DT  D 4 4   ? 59.301  51.178  35.088 1.00 89.23  ? 4   DT  D "O5'" 1 
ATOM   4787 C  "C5'" . DT  D 4 4   ? 59.262  50.202  34.063 1.00 72.89  ? 4   DT  D "C5'" 1 
ATOM   4788 C  "C4'" . DT  D 4 4   ? 57.833  49.934  33.641 1.00 73.43  ? 4   DT  D "C4'" 1 
ATOM   4789 O  "O4'" . DT  D 4 4   ? 57.177  49.122  34.638 1.00 76.71  ? 4   DT  D "O4'" 1 
ATOM   4790 C  "C3'" . DT  D 4 4   ? 56.970  51.188  33.476 1.00 67.79  ? 4   DT  D "C3'" 1 
ATOM   4791 O  "O3'" . DT  D 4 4   ? 56.529  51.294  32.135 1.00 57.42  ? 4   DT  D "O3'" 1 
ATOM   4792 C  "C2'" . DT  D 4 4   ? 55.798  50.985  34.450 1.00 58.68  ? 4   DT  D "C2'" 1 
ATOM   4793 C  "C1'" . DT  D 4 4   ? 55.824  49.486  34.692 1.00 56.21  ? 4   DT  D "C1'" 1 
ATOM   4794 N  N1    . DT  D 4 4   ? 55.281  49.078  36.022 1.00 54.43  ? 4   DT  D N1    1 
ATOM   4795 C  C2    . DT  D 4 4   ? 54.245  48.173  36.073 1.00 51.85  ? 4   DT  D C2    1 
ATOM   4796 O  O2    . DT  D 4 4   ? 53.734  47.686  35.077 1.00 60.59  ? 4   DT  D O2    1 
ATOM   4797 N  N3    . DT  D 4 4   ? 53.824  47.855  37.339 1.00 50.68  ? 4   DT  D N3    1 
ATOM   4798 C  C4    . DT  D 4 4   ? 54.324  48.343  38.536 1.00 59.71  ? 4   DT  D C4    1 
ATOM   4799 O  O4    . DT  D 4 4   ? 53.878  47.996  39.627 1.00 60.62  ? 4   DT  D O4    1 
ATOM   4800 C  C5    . DT  D 4 4   ? 55.410  49.287  38.412 1.00 56.76  ? 4   DT  D C5    1 
ATOM   4801 C  C7    . DT  D 4 4   ? 56.030  49.881  39.641 1.00 47.29  ? 4   DT  D C7    1 
ATOM   4802 C  C6    . DT  D 4 4   ? 55.833  49.606  37.176 1.00 55.77  ? 4   DT  D C6    1 
ATOM   4803 P  P     . DG  D 4 5   ? 55.866  52.658  31.609 1.00 86.77  ? 5   DG  D P     1 
ATOM   4804 O  OP1   . DG  D 4 5   ? 56.359  52.886  30.233 1.00 69.33  ? 5   DG  D OP1   1 
ATOM   4805 O  OP2   . DG  D 4 5   ? 56.023  53.705  32.646 1.00 84.81  ? 5   DG  D OP2   1 
ATOM   4806 O  "O5'" . DG  D 4 5   ? 54.321  52.294  31.510 1.00 79.05  ? 5   DG  D "O5'" 1 
ATOM   4807 C  "C5'" . DG  D 4 5   ? 53.926  51.117  30.836 1.00 71.72  ? 5   DG  D "C5'" 1 
ATOM   4808 C  "C4'" . DG  D 4 5   ? 52.491  50.776  31.171 1.00 56.03  ? 5   DG  D "C4'" 1 
ATOM   4809 O  "O4'" . DG  D 4 5   ? 52.417  50.286  32.526 1.00 49.43  ? 5   DG  D "O4'" 1 
ATOM   4810 C  "C3'" . DG  D 4 5   ? 51.520  51.950  31.075 1.00 54.48  ? 5   DG  D "C3'" 1 
ATOM   4811 O  "O3'" . DG  D 4 5   ? 50.513  51.654  30.095 1.00 61.58  ? 5   DG  D "O3'" 1 
ATOM   4812 C  "C2'" . DG  D 4 5   ? 50.953  52.103  32.501 1.00 45.13  ? 5   DG  D "C2'" 1 
ATOM   4813 C  "C1'" . DG  D 4 5   ? 51.246  50.751  33.134 1.00 42.85  ? 5   DG  D "C1'" 1 
ATOM   4814 N  N9    . DG  D 4 5   ? 51.499  50.804  34.572 1.00 49.64  ? 5   DG  D N9    1 
ATOM   4815 C  C8    . DG  D 4 5   ? 52.451  51.559  35.215 1.00 55.48  ? 5   DG  D C8    1 
ATOM   4816 N  N7    . DG  D 4 5   ? 52.470  51.382  36.510 1.00 55.16  ? 5   DG  D N7    1 
ATOM   4817 C  C5    . DG  D 4 5   ? 51.474  50.439  36.739 1.00 50.05  ? 5   DG  D C5    1 
ATOM   4818 C  C6    . DG  D 4 5   ? 51.031  49.852  37.954 1.00 56.93  ? 5   DG  D C6    1 
ATOM   4819 O  O6    . DG  D 4 5   ? 51.447  50.060  39.107 1.00 45.50  ? 5   DG  D O6    1 
ATOM   4820 N  N1    . DG  D 4 5   ? 49.994  48.939  37.740 1.00 50.13  ? 5   DG  D N1    1 
ATOM   4821 C  C2    . DG  D 4 5   ? 49.455  48.634  36.508 1.00 48.81  ? 5   DG  D C2    1 
ATOM   4822 N  N2    . DG  D 4 5   ? 48.463  47.730  36.499 1.00 39.27  ? 5   DG  D N2    1 
ATOM   4823 N  N3    . DG  D 4 5   ? 49.861  49.177  35.363 1.00 44.18  ? 5   DG  D N3    1 
ATOM   4824 C  C4    . DG  D 4 5   ? 50.870  50.068  35.554 1.00 48.07  ? 5   DG  D C4    1 
ATOM   4825 P  P     . DA  D 4 6   ? 49.275  52.647  29.837 1.00 60.48  ? 6   DA  D P     1 
ATOM   4826 O  OP1   . DA  D 4 6   ? 48.721  52.322  28.504 1.00 59.55  ? 6   DA  D OP1   1 
ATOM   4827 O  OP2   . DA  D 4 6   ? 49.677  54.038  30.157 1.00 39.53  ? 6   DA  D OP2   1 
ATOM   4828 O  "O5'" . DA  D 4 6   ? 48.232  52.187  30.941 1.00 59.69  ? 6   DA  D "O5'" 1 
ATOM   4829 C  "C5'" . DA  D 4 6   ? 46.897  51.944  30.612 1.00 48.50  ? 6   DA  D "C5'" 1 
ATOM   4830 C  "C4'" . DA  D 4 6   ? 46.059  52.081  31.856 1.00 50.24  ? 6   DA  D "C4'" 1 
ATOM   4831 O  "O4'" . DA  D 4 6   ? 46.905  51.860  32.999 1.00 48.82  ? 6   DA  D "O4'" 1 
ATOM   4832 C  "C3'" . DA  D 4 6   ? 45.452  53.463  32.048 1.00 50.71  ? 6   DA  D "C3'" 1 
ATOM   4833 O  "O3'" . DA  D 4 6   ? 44.070  53.420  31.656 1.00 54.22  ? 6   DA  D "O3'" 1 
ATOM   4834 C  "C2'" . DA  D 4 6   ? 45.650  53.780  33.545 1.00 49.99  ? 6   DA  D "C2'" 1 
ATOM   4835 C  "C1'" . DA  D 4 6   ? 46.400  52.566  34.097 1.00 52.50  ? 6   DA  D "C1'" 1 
ATOM   4836 N  N9    . DA  D 4 6   ? 47.517  52.917  34.974 1.00 51.34  ? 6   DA  D N9    1 
ATOM   4837 C  C8    . DA  D 4 6   ? 48.525  53.807  34.717 1.00 54.82  ? 6   DA  D C8    1 
ATOM   4838 N  N7    . DA  D 4 6   ? 49.392  53.922  35.698 1.00 52.79  ? 6   DA  D N7    1 
ATOM   4839 C  C5    . DA  D 4 6   ? 48.920  53.045  36.664 1.00 52.36  ? 6   DA  D C5    1 
ATOM   4840 C  C6    . DA  D 4 6   ? 49.389  52.696  37.952 1.00 55.94  ? 6   DA  D C6    1 
ATOM   4841 N  N6    . DA  D 4 6   ? 50.491  53.217  38.505 1.00 56.31  ? 6   DA  D N6    1 
ATOM   4842 N  N1    . DA  D 4 6   ? 48.678  51.788  38.651 1.00 47.22  ? 6   DA  D N1    1 
ATOM   4843 C  C2    . DA  D 4 6   ? 47.579  51.267  38.097 1.00 46.00  ? 6   DA  D C2    1 
ATOM   4844 N  N3    . DA  D 4 6   ? 47.042  51.515  36.903 1.00 51.15  ? 6   DA  D N3    1 
ATOM   4845 C  C4    . DA  D 4 6   ? 47.766  52.420  36.232 1.00 46.03  ? 6   DA  D C4    1 
ATOM   4846 P  P     . DA  D 4 7   ? 42.957  54.359  32.333 1.00 55.27  ? 7   DA  D P     1 
ATOM   4847 O  OP1   . DA  D 4 7   ? 41.725  54.173  31.534 1.00 46.84  ? 7   DA  D OP1   1 
ATOM   4848 O  OP2   . DA  D 4 7   ? 43.504  55.724  32.514 1.00 51.26  ? 7   DA  D OP2   1 
ATOM   4849 O  "O5'" . DA  D 4 7   ? 42.684  53.667  33.745 1.00 31.31  ? 7   DA  D "O5'" 1 
ATOM   4850 C  "C5'" . DA  D 4 7   ? 41.846  54.299  34.677 1.00 46.38  ? 7   DA  D "C5'" 1 
ATOM   4851 C  "C4'" . DA  D 4 7   ? 41.892  53.582  36.005 1.00 46.68  ? 7   DA  D "C4'" 1 
ATOM   4852 O  "O4'" . DA  D 4 7   ? 43.276  53.429  36.419 1.00 37.96  ? 7   DA  D "O4'" 1 
ATOM   4853 C  "C3'" . DA  D 4 7   ? 41.190  54.316  37.136 1.00 39.05  ? 7   DA  D "C3'" 1 
ATOM   4854 O  "O3'" . DA  D 4 7   ? 40.591  53.393  38.036 1.00 50.72  ? 7   DA  D "O3'" 1 
ATOM   4855 C  "C2'" . DA  D 4 7   ? 42.329  55.089  37.792 1.00 58.04  ? 7   DA  D "C2'" 1 
ATOM   4856 C  "C1'" . DA  D 4 7   ? 43.497  54.127  37.629 1.00 48.27  ? 7   DA  D "C1'" 1 
ATOM   4857 N  N9    . DA  D 4 7   ? 44.786  54.801  37.540 1.00 56.91  ? 7   DA  D N9    1 
ATOM   4858 C  C8    . DA  D 4 7   ? 45.243  55.567  36.504 1.00 47.69  ? 7   DA  D C8    1 
ATOM   4859 N  N7    . DA  D 4 7   ? 46.445  56.053  36.693 1.00 43.59  ? 7   DA  D N7    1 
ATOM   4860 C  C5    . DA  D 4 7   ? 46.805  55.571  37.942 1.00 57.75  ? 7   DA  D C5    1 
ATOM   4861 C  C6    . DA  D 4 7   ? 47.971  55.728  38.721 1.00 70.55  ? 7   DA  D C6    1 
ATOM   4862 N  N6    . DA  D 4 7   ? 49.029  56.448  38.326 1.00 70.70  ? 7   DA  D N6    1 
ATOM   4863 N  N1    . DA  D 4 7   ? 48.005  55.114  39.926 1.00 71.58  ? 7   DA  D N1    1 
ATOM   4864 C  C2    . DA  D 4 7   ? 46.944  54.394  40.315 1.00 66.07  ? 7   DA  D C2    1 
ATOM   4865 N  N3    . DA  D 4 7   ? 45.798  54.174  39.670 1.00 57.54  ? 7   DA  D N3    1 
ATOM   4866 C  C4    . DA  D 4 7   ? 45.792  54.798  38.479 1.00 59.21  ? 7   DA  D C4    1 
HETATM 4867 MN MN    . MN  E 5 .   ? 38.221  53.007  36.934 1.00 43.21  ? 701 MN  A MN    1 
HETATM 4868 MN MN    . MN  F 5 .   ? 35.428  55.725  37.751 1.00 75.56  ? 702 MN  A MN    1 
HETATM 4869 MN MN    . MN  G 5 .   ? 36.549  60.734  45.378 1.00 75.34  ? 101 MN  C MN    1 
HETATM 4870 O  O     . HOH H 6 .   ? 29.272  40.292  27.065 1.00 68.00  ? 801 HOH A O     1 
HETATM 4871 O  O     . HOH H 6 .   ? 14.948  73.789  63.509 1.00 52.39  ? 802 HOH A O     1 
HETATM 4872 O  O     . HOH H 6 .   ? 29.283  50.214  55.472 1.00 55.02  ? 803 HOH A O     1 
HETATM 4873 O  O     . HOH H 6 .   ? 25.093  55.449  22.426 1.00 53.68  ? 804 HOH A O     1 
HETATM 4874 O  O     . HOH H 6 .   ? 22.564  47.623  23.619 1.00 61.41  ? 805 HOH A O     1 
HETATM 4875 O  O     . HOH H 6 .   ? 38.088  52.963  39.110 1.00 39.11  ? 806 HOH A O     1 
HETATM 4876 O  O     . HOH H 6 .   ? 3.645   28.055  21.144 1.00 55.39  ? 807 HOH A O     1 
HETATM 4877 O  O     . HOH H 6 .   ? 27.823  55.522  54.669 1.00 65.94  ? 808 HOH A O     1 
HETATM 4878 O  O     . HOH H 6 .   ? 17.718  60.139  50.340 1.00 50.77  ? 809 HOH A O     1 
HETATM 4879 O  O     . HOH H 6 .   ? 21.154  54.859  27.872 1.00 40.53  ? 810 HOH A O     1 
HETATM 4880 O  O     . HOH H 6 .   ? 13.375  59.722  40.498 1.00 44.68  ? 811 HOH A O     1 
HETATM 4881 O  O     . HOH H 6 .   ? 28.125  57.831  27.147 1.00 42.73  ? 812 HOH A O     1 
HETATM 4882 O  O     . HOH H 6 .   ? 29.017  35.902  30.853 1.00 59.19  ? 813 HOH A O     1 
HETATM 4883 O  O     . HOH H 6 .   ? 32.778  64.958  16.922 1.00 47.04  ? 814 HOH A O     1 
HETATM 4884 O  O     . HOH H 6 .   ? 52.226  88.183  29.751 1.00 51.91  ? 815 HOH A O     1 
HETATM 4885 O  O     . HOH H 6 .   ? 21.582  63.765  51.028 1.00 39.20  ? 816 HOH A O     1 
HETATM 4886 O  O     . HOH H 6 .   ? 18.510  61.870  40.114 1.00 57.75  ? 817 HOH A O     1 
HETATM 4887 O  O     . HOH H 6 .   ? 41.748  53.902  28.635 1.00 49.34  ? 818 HOH A O     1 
HETATM 4888 O  O     . HOH H 6 .   ? 56.997  91.030  41.275 1.00 57.68  ? 819 HOH A O     1 
HETATM 4889 O  O     . HOH H 6 .   ? -2.439  66.314  64.590 1.00 60.50  ? 820 HOH A O     1 
HETATM 4890 O  O     . HOH H 6 .   ? 31.871  35.752  25.624 1.00 50.54  ? 821 HOH A O     1 
HETATM 4891 O  O     . HOH H 6 .   ? 37.118  56.289  44.219 1.00 44.03  ? 822 HOH A O     1 
HETATM 4892 O  O     . HOH H 6 .   ? 28.110  56.706  29.830 1.00 42.19  ? 823 HOH A O     1 
HETATM 4893 O  O     . HOH H 6 .   ? 44.765  79.368  17.673 1.00 48.60  ? 824 HOH A O     1 
HETATM 4894 O  O     . HOH H 6 .   ? 6.986   48.925  34.616 1.00 56.40  ? 825 HOH A O     1 
HETATM 4895 O  O     . HOH H 6 .   ? 30.506  44.309  1.155  1.00 60.68  ? 826 HOH A O     1 
HETATM 4896 O  O     . HOH H 6 .   ? 38.875  50.962  37.315 1.00 62.75  ? 827 HOH A O     1 
HETATM 4897 O  O     . HOH H 6 .   ? 56.031  81.371  29.897 1.00 47.29  ? 828 HOH A O     1 
HETATM 4898 O  O     . HOH H 6 .   ? 39.840  87.995  53.843 1.00 59.43  ? 829 HOH A O     1 
HETATM 4899 O  O     . HOH H 6 .   ? 42.875  64.859  30.348 1.00 46.24  ? 830 HOH A O     1 
HETATM 4900 O  O     . HOH H 6 .   ? 12.368  70.988  63.287 1.00 36.24  ? 831 HOH A O     1 
HETATM 4901 O  O     . HOH H 6 .   ? 19.685  57.646  40.156 1.00 47.16  ? 832 HOH A O     1 
HETATM 4902 O  O     . HOH H 6 .   ? 60.891  89.138  37.024 1.00 61.73  ? 833 HOH A O     1 
HETATM 4903 O  O     . HOH H 6 .   ? 46.518  76.264  16.245 1.00 53.10  ? 834 HOH A O     1 
HETATM 4904 O  O     . HOH H 6 .   ? 37.132  44.579  17.342 1.00 50.01  ? 835 HOH A O     1 
HETATM 4905 O  O     . HOH H 6 .   ? 20.312  59.418  30.086 1.00 54.78  ? 836 HOH A O     1 
HETATM 4906 O  O     . HOH H 6 .   ? 10.895  28.187  24.288 1.00 51.69  ? 837 HOH A O     1 
HETATM 4907 O  O     . HOH H 6 .   ? 49.789  69.540  31.965 1.00 49.67  ? 838 HOH A O     1 
HETATM 4908 O  O     . HOH H 6 .   ? 46.789  74.374  39.908 1.00 44.16  ? 839 HOH A O     1 
HETATM 4909 O  O     . HOH H 6 .   ? 43.526  74.269  15.263 1.00 45.29  ? 840 HOH A O     1 
HETATM 4910 O  O     . HOH H 6 .   ? 25.450  31.200  32.305 1.00 55.51  ? 841 HOH A O     1 
HETATM 4911 O  O     . HOH H 6 .   ? 17.601  76.898  57.288 1.00 48.85  ? 842 HOH A O     1 
HETATM 4912 O  O     . HOH H 6 .   ? 18.751  60.176  18.000 1.00 56.74  ? 843 HOH A O     1 
HETATM 4913 O  O     . HOH H 6 .   ? 28.416  66.430  52.381 1.00 53.42  ? 844 HOH A O     1 
HETATM 4914 O  O     . HOH H 6 .   ? 61.881  72.389  20.700 1.00 47.55  ? 845 HOH A O     1 
HETATM 4915 O  O     . HOH H 6 .   ? 37.227  41.526  26.596 1.00 66.10  ? 846 HOH A O     1 
HETATM 4916 O  O     . HOH H 6 .   ? 25.634  47.567  48.842 1.00 55.41  ? 847 HOH A O     1 
HETATM 4917 O  O     . HOH H 6 .   ? 57.068  75.570  40.492 1.00 41.77  ? 848 HOH A O     1 
HETATM 4918 O  O     . HOH H 6 .   ? 51.356  74.290  41.787 1.00 63.33  ? 849 HOH A O     1 
HETATM 4919 O  O     . HOH H 6 .   ? 21.061  63.079  44.019 1.00 52.36  ? 850 HOH A O     1 
HETATM 4920 O  O     . HOH H 6 .   ? 43.935  75.175  10.244 1.00 63.71  ? 851 HOH A O     1 
HETATM 4921 O  O     . HOH H 6 .   ? 50.636  57.563  35.080 1.00 62.97  ? 852 HOH A O     1 
HETATM 4922 O  O     . HOH H 6 .   ? 59.561  74.655  33.660 1.00 44.74  ? 853 HOH A O     1 
HETATM 4923 O  O     . HOH H 6 .   ? 41.373  38.333  47.917 1.00 60.56  ? 854 HOH A O     1 
HETATM 4924 O  O     . HOH H 6 .   ? 4.742   78.916  64.018 1.00 47.52  ? 855 HOH A O     1 
HETATM 4925 O  O     . HOH H 6 .   ? 53.205  71.313  34.169 1.00 45.23  ? 856 HOH A O     1 
HETATM 4926 O  O     . HOH H 6 .   ? 33.974  60.045  -0.021 1.00 60.03  ? 857 HOH A O     1 
HETATM 4927 O  O     . HOH H 6 .   ? 44.071  46.941  27.560 1.00 47.97  ? 858 HOH A O     1 
HETATM 4928 O  O     . HOH H 6 .   ? 58.675  73.086  14.197 1.00 49.49  ? 859 HOH A O     1 
HETATM 4929 O  O     . HOH I 6 .   ? 23.872  82.193  41.726 1.00 44.90  ? 101 HOH B O     1 
HETATM 4930 O  O     . HOH I 6 .   ? 16.584  81.632  44.956 1.00 42.06  ? 102 HOH B O     1 
HETATM 4931 O  O     . HOH I 6 .   ? 16.400  78.341  44.686 1.00 48.91  ? 103 HOH B O     1 
HETATM 4932 O  O     . HOH I 6 .   ? 22.004  71.859  35.835 1.00 55.27  ? 104 HOH B O     1 
HETATM 4933 O  O     . HOH I 6 .   ? 24.744  70.787  32.440 1.00 57.80  ? 105 HOH B O     1 
HETATM 4934 O  O     . HOH I 6 .   ? 19.422  65.238  30.552 1.00 45.81  ? 106 HOH B O     1 
HETATM 4935 O  O     . HOH J 6 .   ? 1.423   105.833 39.508 1.00 44.07  ? 201 HOH C O     1 
HETATM 4936 O  O     . HOH J 6 .   ? 33.814  66.728  31.325 1.00 46.84  ? 202 HOH C O     1 
HETATM 4937 O  O     . HOH J 6 .   ? 37.376  58.754  45.742 1.00 42.69  ? 203 HOH C O     1 
HETATM 4938 O  O     . HOH J 6 .   ? 35.472  56.226  39.875 1.00 52.14  ? 204 HOH C O     1 
HETATM 4939 O  O     . HOH J 6 .   ? 37.579  63.964  40.550 1.00 52.94  ? 205 HOH C O     1 
HETATM 4940 O  O     . HOH J 6 .   ? 45.802  57.955  41.369 1.00 43.62  ? 206 HOH C O     1 
HETATM 4941 O  O     . HOH K 6 .   ? 63.989  34.524  43.210 1.00 71.63  ? 101 HOH D O     1 
HETATM 4942 O  O     . HOH K 6 .   ? 52.494  55.238  38.462 1.00 51.33  ? 102 HOH D O     1 
HETATM 4943 O  O     . HOH K 6 .   ? 53.582  52.254  39.509 1.00 47.07  ? 103 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   76  ?   ?   ?   A . n 
A 1 2   SER 2   77  ?   ?   ?   A . n 
A 1 3   HIS 3   78  ?   ?   ?   A . n 
A 1 4   MET 4   79  ?   ?   ?   A . n 
A 1 5   SER 5   80  ?   ?   ?   A . n 
A 1 6   ARG 6   81  81  ARG ARG A . n 
A 1 7   GLU 7   82  82  GLU GLU A . n 
A 1 8   LEU 8   83  83  LEU LEU A . n 
A 1 9   LYS 9   84  84  LYS LYS A . n 
A 1 10  THR 10  85  85  THR THR A . n 
A 1 11  VAL 11  86  86  VAL VAL A . n 
A 1 12  SER 12  87  87  SER SER A . n 
A 1 13  ALA 13  88  88  ALA ALA A . n 
A 1 14  ASP 14  89  89  ASP ASP A . n 
A 1 15  CYS 15  90  90  CYS CYS A . n 
A 1 16  LYS 16  91  91  LYS LYS A . n 
A 1 17  LYS 17  92  92  LYS LYS A . n 
A 1 18  GLU 18  93  93  GLU GLU A . n 
A 1 19  ALA 19  94  94  ALA ALA A . n 
A 1 20  ILE 20  95  95  ILE ILE A . n 
A 1 21  GLU 21  96  96  GLU GLU A . n 
A 1 22  LYS 22  97  97  LYS LYS A . n 
A 1 23  CYS 23  98  98  CYS CYS A . n 
A 1 24  ALA 24  99  99  ALA ALA A . n 
A 1 25  GLN 25  100 100 GLN GLN A . n 
A 1 26  TRP 26  101 101 TRP TRP A . n 
A 1 27  VAL 27  102 102 VAL VAL A . n 
A 1 28  VAL 28  103 103 VAL VAL A . n 
A 1 29  ARG 29  104 104 ARG ARG A . n 
A 1 30  ASP 30  105 105 ASP ASP A . n 
A 1 31  CYS 31  106 106 CYS CYS A . n 
A 1 32  ARG 32  107 107 ARG ARG A . n 
A 1 33  PRO 33  108 108 PRO PRO A . n 
A 1 34  PHE 34  109 109 PHE PHE A . n 
A 1 35  SER 35  110 110 SER SER A . n 
A 1 36  ALA 36  111 111 ALA ALA A . n 
A 1 37  VAL 37  112 112 VAL VAL A . n 
A 1 38  SER 38  113 113 SER SER A . n 
A 1 39  GLY 39  114 114 GLY GLY A . n 
A 1 40  SER 40  115 115 SER SER A . n 
A 1 41  GLY 41  116 116 GLY GLY A . n 
A 1 42  PHE 42  117 117 PHE PHE A . n 
A 1 43  ILE 43  118 118 ILE ILE A . n 
A 1 44  ASP 44  119 119 ASP ASP A . n 
A 1 45  MET 45  120 120 MET MET A . n 
A 1 46  ILE 46  121 121 ILE ILE A . n 
A 1 47  LYS 47  122 122 LYS LYS A . n 
A 1 48  PHE 48  123 123 PHE PHE A . n 
A 1 49  PHE 49  124 124 PHE PHE A . n 
A 1 50  ILE 50  125 125 ILE ILE A . n 
A 1 51  LYS 51  126 126 LYS LYS A . n 
A 1 52  VAL 52  127 127 VAL VAL A . n 
A 1 53  GLY 53  128 128 GLY GLY A . n 
A 1 54  ALA 54  129 129 ALA ALA A . n 
A 1 55  GLU 55  130 130 GLU GLU A . n 
A 1 56  TYR 56  131 131 TYR TYR A . n 
A 1 57  GLY 57  132 132 GLY GLY A . n 
A 1 58  GLU 58  133 133 GLU GLU A . n 
A 1 59  HIS 59  134 134 HIS HIS A . n 
A 1 60  VAL 60  135 135 VAL VAL A . n 
A 1 61  ASN 61  136 136 ASN ASN A . n 
A 1 62  VAL 62  137 137 VAL VAL A . n 
A 1 63  GLU 63  138 138 GLU GLU A . n 
A 1 64  GLU 64  139 139 GLU GLU A . n 
A 1 65  LEU 65  140 140 LEU LEU A . n 
A 1 66  LEU 66  141 141 LEU LEU A . n 
A 1 67  PRO 67  142 142 PRO PRO A . n 
A 1 68  SER 68  143 143 SER SER A . n 
A 1 69  PRO 69  144 144 PRO PRO A . n 
A 1 70  ILE 70  145 145 ILE ILE A . n 
A 1 71  THR 71  146 146 THR THR A . n 
A 1 72  LEU 72  147 147 LEU LEU A . n 
A 1 73  SER 73  148 148 SER SER A . n 
A 1 74  ARG 74  149 149 ARG ARG A . n 
A 1 75  LYS 75  150 150 LYS LYS A . n 
A 1 76  VAL 76  151 151 VAL VAL A . n 
A 1 77  THR 77  152 152 THR THR A . n 
A 1 78  SER 78  153 153 SER SER A . n 
A 1 79  ASP 79  154 154 ASP ASP A . n 
A 1 80  ALA 80  155 155 ALA ALA A . n 
A 1 81  LYS 81  156 156 LYS LYS A . n 
A 1 82  GLU 82  157 157 GLU GLU A . n 
A 1 83  LYS 83  158 158 LYS LYS A . n 
A 1 84  LYS 84  159 159 LYS LYS A . n 
A 1 85  ALA 85  160 160 ALA ALA A . n 
A 1 86  LEU 86  161 161 LEU LEU A . n 
A 1 87  ILE 87  162 162 ILE ILE A . n 
A 1 88  SER 88  163 163 SER GLY A . n 
A 1 89  ARG 89  164 164 ARG ARG A . n 
A 1 90  GLU 90  165 165 GLU GLU A . n 
A 1 91  ILE 91  166 166 ILE ILE A . n 
A 1 92  LYS 92  167 167 LYS LYS A . n 
A 1 93  SER 93  168 168 SER SER A . n 
A 1 94  ALA 94  169 169 ALA ALA A . n 
A 1 95  VAL 95  170 170 VAL VAL A . n 
A 1 96  GLU 96  171 171 GLU GLU A . n 
A 1 97  LYS 97  172 172 LYS LYS A . n 
A 1 98  ASP 98  173 173 ASP ASP A . n 
A 1 99  GLY 99  174 174 GLY GLY A . n 
A 1 100 ALA 100 175 175 ALA ALA A . n 
A 1 101 SER 101 176 176 SER SER A . n 
A 1 102 ALA 102 177 177 ALA ALA A . n 
A 1 103 THR 103 178 178 THR THR A . n 
A 1 104 ILE 104 179 179 ILE ILE A . n 
A 1 105 ASP 105 180 180 ASP ASP A . n 
A 1 106 LEU 106 181 181 LEU LEU A . n 
A 1 107 TRP 107 182 182 TRP TRP A . n 
A 1 108 THR 108 183 183 THR THR A . n 
A 1 109 ASP 109 184 184 ASP ASP A . n 
A 1 110 ASN 110 185 185 ASN ASN A . n 
A 1 111 TYR 111 186 186 TYR TYR A . n 
A 1 112 ILE 112 187 187 ILE ILE A . n 
A 1 113 LYS 113 188 188 LYS LYS A . n 
A 1 114 ARG 114 189 189 ARG ARG A . n 
A 1 115 ASN 115 190 190 ASN ASN A . n 
A 1 116 PHE 116 191 191 PHE PHE A . n 
A 1 117 LEU 117 192 192 LEU LEU A . n 
A 1 118 GLY 118 193 193 GLY GLY A . n 
A 1 119 VAL 119 194 194 VAL VAL A . n 
A 1 120 THR 120 195 195 THR THR A . n 
A 1 121 LEU 121 196 196 LEU LEU A . n 
A 1 122 HIS 122 197 197 HIS HIS A . n 
A 1 123 TYR 123 198 198 TYR TYR A . n 
A 1 124 HIS 124 199 199 HIS HIS A . n 
A 1 125 GLU 125 200 200 GLU GLU A . n 
A 1 126 ASN 126 201 201 ASN ASN A . n 
A 1 127 ASN 127 202 202 ASN ASN A . n 
A 1 128 GLU 128 203 203 GLU GLU A . n 
A 1 129 LEU 129 204 204 LEU LEU A . n 
A 1 130 ARG 130 205 205 ARG ARG A . n 
A 1 131 ASP 131 206 206 ASP ASP A . n 
A 1 132 LEU 132 207 207 LEU LEU A . n 
A 1 133 ILE 133 208 208 ILE ILE A . n 
A 1 134 LEU 134 209 209 LEU LEU A . n 
A 1 135 GLY 135 210 210 GLY GLY A . n 
A 1 136 LEU 136 211 211 LEU LEU A . n 
A 1 137 LYS 137 212 212 LYS LYS A . n 
A 1 138 SER 138 213 213 SER SER A . n 
A 1 139 LEU 139 214 214 LEU LEU A . n 
A 1 140 ASP 140 215 215 ASP ASP A . n 
A 1 141 PHE 141 216 216 PHE PHE A . n 
A 1 142 GLU 142 217 217 GLU GLU A . n 
A 1 143 ARG 143 218 218 ARG ARG A . n 
A 1 144 SER 144 219 219 SER SER A . n 
A 1 145 THR 145 220 220 THR THR A . n 
A 1 146 ALA 146 221 221 ALA ALA A . n 
A 1 147 GLU 147 222 222 GLU GLU A . n 
A 1 148 ASN 148 223 223 ASN ASN A . n 
A 1 149 ILE 149 224 224 ILE ILE A . n 
A 1 150 TYR 150 225 225 TYR TYR A . n 
A 1 151 LYS 151 226 226 LYS LYS A . n 
A 1 152 LYS 152 227 227 LYS LYS A . n 
A 1 153 LEU 153 228 228 LEU LEU A . n 
A 1 154 LYS 154 229 229 LYS LYS A . n 
A 1 155 ALA 155 230 230 ALA ALA A . n 
A 1 156 ILE 156 231 231 ILE ILE A . n 
A 1 157 PHE 157 232 232 PHE PHE A . n 
A 1 158 SER 158 233 233 SER SER A . n 
A 1 159 GLN 159 234 234 GLN GLN A . n 
A 1 160 PHE 160 235 235 PHE PHE A . n 
A 1 161 ASN 161 236 236 ASN ASN A . n 
A 1 162 VAL 162 237 237 VAL VAL A . n 
A 1 163 GLU 163 238 238 GLU GLU A . n 
A 1 164 ASP 164 239 239 ASP ASP A . n 
A 1 165 LEU 165 240 240 LEU LEU A . n 
A 1 166 SER 166 241 241 SER SER A . n 
A 1 167 SER 167 242 242 SER SER A . n 
A 1 168 ILE 168 243 243 ILE ILE A . n 
A 1 169 LYS 169 244 244 LYS LYS A . n 
A 1 170 PHE 170 245 245 PHE PHE A . n 
A 1 171 VAL 171 246 246 VAL VAL A . n 
A 1 172 THR 172 247 247 THR THR A . n 
A 1 173 ASP 173 248 248 ASP ASP A . n 
A 1 174 ARG 174 249 249 ARG ARG A . n 
A 1 175 GLY 175 250 250 GLY GLY A . n 
A 1 176 ALA 176 251 251 ALA ALA A . n 
A 1 177 ASN 177 252 252 ASN ASN A . n 
A 1 178 VAL 178 253 253 VAL VAL A . n 
A 1 179 VAL 179 254 254 VAL VAL A . n 
A 1 180 LYS 180 255 255 LYS LYS A . n 
A 1 181 SER 181 256 256 SER SER A . n 
A 1 182 LEU 182 257 257 LEU LEU A . n 
A 1 183 ALA 183 258 258 ALA ALA A . n 
A 1 184 ASN 184 259 259 ASN ASN A . n 
A 1 185 ASN 185 260 260 ASN ASN A . n 
A 1 186 ILE 186 261 261 ILE ILE A . n 
A 1 187 ARG 187 262 262 ARG ARG A . n 
A 1 188 ILE 188 263 263 ILE ILE A . n 
A 1 189 ASN 189 264 264 ASN ASN A . n 
A 1 190 CYS 190 265 265 CYS CYS A . n 
A 1 191 SER 191 266 266 SER SER A . n 
A 1 192 SER 192 267 267 SER SER A . n 
A 1 193 HIS 193 268 268 HIS HIS A . n 
A 1 194 LEU 194 269 269 LEU LEU A . n 
A 1 195 LEU 195 270 270 LEU LEU A . n 
A 1 196 SER 196 271 271 SER SER A . n 
A 1 197 ASN 197 272 272 ASN ASN A . n 
A 1 198 VAL 198 273 273 VAL VAL A . n 
A 1 199 LEU 199 274 274 LEU LEU A . n 
A 1 200 GLU 200 275 275 GLU GLU A . n 
A 1 201 ASN 201 276 276 ASN ASN A . n 
A 1 202 SER 202 277 277 SER SER A . n 
A 1 203 PHE 203 278 278 PHE PHE A . n 
A 1 204 GLU 204 279 279 GLU GLU A . n 
A 1 205 GLU 205 280 280 GLU GLU A . n 
A 1 206 THR 206 281 281 THR THR A . n 
A 1 207 PRO 207 282 282 PRO PRO A . n 
A 1 208 GLU 208 283 283 GLU GLU A . n 
A 1 209 LEU 209 284 284 LEU LEU A . n 
A 1 210 ASN 210 285 285 ASN ASN A . n 
A 1 211 MET 211 286 286 MET MET A . n 
A 1 212 PRO 212 287 287 PRO PRO A . n 
A 1 213 ILE 213 288 288 ILE ILE A . n 
A 1 214 LEU 214 289 289 LEU LEU A . n 
A 1 215 ALA 215 290 290 ALA ALA A . n 
A 1 216 CYS 216 291 291 CYS CYS A . n 
A 1 217 LYS 217 292 292 LYS LYS A . n 
A 1 218 ASN 218 293 293 ASN ASN A . n 
A 1 219 ILE 219 294 294 ILE ILE A . n 
A 1 220 VAL 220 295 295 VAL VAL A . n 
A 1 221 LYS 221 296 296 LYS LYS A . n 
A 1 222 TYR 222 297 297 TYR TYR A . n 
A 1 223 PHE 223 298 298 PHE PHE A . n 
A 1 224 LYS 224 299 299 LYS LYS A . n 
A 1 225 LYS 225 300 300 LYS LYS A . n 
A 1 226 ALA 226 301 301 ALA ALA A . n 
A 1 227 ASN 227 302 302 ASN ASN A . n 
A 1 228 LEU 228 303 303 LEU LEU A . n 
A 1 229 GLN 229 304 304 GLN GLN A . n 
A 1 230 HIS 230 305 305 HIS HIS A . n 
A 1 231 ARG 231 306 306 ARG ARG A . n 
A 1 232 LEU 232 307 307 LEU LEU A . n 
A 1 233 ARG 233 308 308 ARG ARG A . n 
A 1 234 SER 234 309 309 SER SER A . n 
A 1 235 SER 235 310 310 SER SER A . n 
A 1 236 LEU 236 311 311 LEU LEU A . n 
A 1 237 LYS 237 312 312 LYS LYS A . n 
A 1 238 SER 238 313 313 SER SER A . n 
A 1 239 GLU 239 314 314 GLU GLU A . n 
A 1 240 CYS 240 315 315 CYS CYS A . n 
A 1 241 PRO 241 316 316 PRO PRO A . n 
A 1 242 THR 242 317 317 THR THR A . n 
A 1 243 ARG 243 318 318 ARG ARG A . n 
A 1 244 TRP 244 319 319 TRP TRP A . n 
A 1 245 ASN 245 320 320 ASN ASN A . n 
A 1 246 SER 246 321 321 SER SER A . n 
A 1 247 THR 247 322 322 THR THR A . n 
A 1 248 TYR 248 323 323 TYR TYR A . n 
A 1 249 THR 249 324 324 THR THR A . n 
A 1 250 MET 250 325 325 MET MET A . n 
A 1 251 LEU 251 326 326 LEU LEU A . n 
A 1 252 ARG 252 327 327 ARG ARG A . n 
A 1 253 SER 253 328 328 SER SER A . n 
A 1 254 ILE 254 329 329 ILE ILE A . n 
A 1 255 LEU 255 330 330 LEU LEU A . n 
A 1 256 ASP 256 331 331 ASP ASP A . n 
A 1 257 ASN 257 332 332 ASN ASN A . n 
A 1 258 TRP 258 333 333 TRP TRP A . n 
A 1 259 GLU 259 334 334 GLU GLU A . n 
A 1 260 SER 260 335 335 SER SER A . n 
A 1 261 VAL 261 336 336 VAL VAL A . n 
A 1 262 ILE 262 337 337 ILE ILE A . n 
A 1 263 GLN 263 338 338 GLN GLN A . n 
A 1 264 ILE 264 339 339 ILE ILE A . n 
A 1 265 LEU 265 340 340 LEU LEU A . n 
A 1 266 SER 266 341 341 SER SER A . n 
A 1 267 GLU 267 342 342 GLU GLU A . n 
A 1 268 ALA 268 343 343 ALA ALA A . n 
A 1 269 GLY 269 344 344 GLY GLY A . n 
A 1 270 GLU 270 345 345 GLU GLU A . n 
A 1 271 THR 271 346 346 THR THR A . n 
A 1 272 GLN 272 347 347 GLN GLN A . n 
A 1 273 ARG 273 348 348 ARG ARG A . n 
A 1 274 ILE 274 349 349 ILE ILE A . n 
A 1 275 VAL 275 350 350 VAL VAL A . n 
A 1 276 HIS 276 351 351 HIS HIS A . n 
A 1 277 ILE 277 352 352 ILE ILE A . n 
A 1 278 ASN 278 353 353 ASN ASN A . n 
A 1 279 LYS 279 354 354 LYS LYS A . n 
A 1 280 SER 280 355 355 SER SER A . n 
A 1 281 ILE 281 356 356 ILE ILE A . n 
A 1 282 ILE 282 357 357 ILE ILE A . n 
A 1 283 GLN 283 358 358 GLN GLN A . n 
A 1 284 THR 284 359 359 THR THR A . n 
A 1 285 MET 285 360 360 MET MET A . n 
A 1 286 VAL 286 361 361 VAL VAL A . n 
A 1 287 ASN 287 362 362 ASN ASN A . n 
A 1 288 ILE 288 363 363 ILE ILE A . n 
A 1 289 LEU 289 364 364 LEU LEU A . n 
A 1 290 ASP 290 365 365 ASP ASP A . n 
A 1 291 GLY 291 366 366 GLY GLY A . n 
A 1 292 PHE 292 367 367 PHE PHE A . n 
A 1 293 GLU 293 368 368 GLU GLU A . n 
A 1 294 ARG 294 369 369 ARG ARG A . n 
A 1 295 ILE 295 370 370 ILE ILE A . n 
A 1 296 PHE 296 371 371 PHE PHE A . n 
A 1 297 LYS 297 372 372 LYS LYS A . n 
A 1 298 GLU 298 373 373 GLU GLU A . n 
A 1 299 LEU 299 374 374 LEU LEU A . n 
A 1 300 GLN 300 375 375 GLN GLN A . n 
A 1 301 THR 301 376 376 THR THR A . n 
A 1 302 CYS 302 377 377 CYS CYS A . n 
A 1 303 SER 303 378 378 SER SER A . n 
A 1 304 SER 304 379 379 SER SER A . n 
A 1 305 PRO 305 380 380 PRO PRO A . n 
A 1 306 SER 306 381 381 SER SER A . n 
A 1 307 LEU 307 382 382 LEU LEU A . n 
A 1 308 CYS 308 383 383 CYS CYS A . n 
A 1 309 PHE 309 384 384 PHE PHE A . n 
A 1 310 VAL 310 385 385 VAL VAL A . n 
A 1 311 VAL 311 386 386 VAL VAL A . n 
A 1 312 PRO 312 387 387 PRO PRO A . n 
A 1 313 SER 313 388 388 SER SER A . n 
A 1 314 ILE 314 389 389 ILE ILE A . n 
A 1 315 LEU 315 390 390 LEU LEU A . n 
A 1 316 LYS 316 391 391 LYS LYS A . n 
A 1 317 VAL 317 392 392 VAL VAL A . n 
A 1 318 LYS 318 393 393 LYS LYS A . n 
A 1 319 GLU 319 394 394 GLU GLU A . n 
A 1 320 ILE 320 395 395 ILE ILE A . n 
A 1 321 CYS 321 396 396 CYS CYS A . n 
A 1 322 SER 322 397 397 SER SER A . n 
A 1 323 PRO 323 398 398 PRO PRO A . n 
A 1 324 ASP 324 399 399 ASP ASP A . n 
A 1 325 VAL 325 400 400 VAL VAL A . n 
A 1 326 GLY 326 401 401 GLY GLY A . n 
A 1 327 ASP 327 402 402 ASP ASP A . n 
A 1 328 VAL 328 403 403 VAL VAL A . n 
A 1 329 ALA 329 404 404 ALA ALA A . n 
A 1 330 ASP 330 405 405 ASP ASP A . n 
A 1 331 ILE 331 406 406 ILE ILE A . n 
A 1 332 ALA 332 407 407 ALA ALA A . n 
A 1 333 LYS 333 408 408 LYS LYS A . n 
A 1 334 LEU 334 409 409 LEU LEU A . n 
A 1 335 LYS 335 410 410 LYS LYS A . n 
A 1 336 VAL 336 411 411 VAL VAL A . n 
A 1 337 ASN 337 412 412 ASN ASN A . n 
A 1 338 ILE 338 413 413 ILE ILE A . n 
A 1 339 ILE 339 414 414 ILE ILE A . n 
A 1 340 LYS 340 415 415 LYS LYS A . n 
A 1 341 ASN 341 416 416 ASN ASN A . n 
A 1 342 VAL 342 417 417 VAL VAL A . n 
A 1 343 ARG 343 418 418 ARG ARG A . n 
A 1 344 ILE 344 419 419 ILE ILE A . n 
A 1 345 ILE 345 420 420 ILE ILE A . n 
A 1 346 TRP 346 421 421 TRP TRP A . n 
A 1 347 GLU 347 422 422 GLU GLU A . n 
A 1 348 GLU 348 423 423 GLU GLU A . n 
A 1 349 ASN 349 424 424 ASN ASN A . n 
A 1 350 LEU 350 425 425 LEU LEU A . n 
A 1 351 SER 351 426 426 SER SER A . n 
A 1 352 ILE 352 427 427 ILE ILE A . n 
A 1 353 TRP 353 428 428 TRP TRP A . n 
A 1 354 HIS 354 429 429 HIS HIS A . n 
A 1 355 TYR 355 430 430 TYR TYR A . n 
A 1 356 THR 356 431 431 THR THR A . n 
A 1 357 ALA 357 432 432 ALA ALA A . n 
A 1 358 PHE 358 433 433 PHE PHE A . n 
A 1 359 PHE 359 434 434 PHE PHE A . n 
A 1 360 PHE 360 435 435 PHE PHE A . n 
A 1 361 TYR 361 436 436 TYR TYR A . n 
A 1 362 PRO 362 437 437 PRO PRO A . n 
A 1 363 PRO 363 438 438 PRO PRO A . n 
A 1 364 ALA 364 439 439 ALA ALA A . n 
A 1 365 LEU 365 440 440 LEU LEU A . n 
A 1 366 HIS 366 441 441 HIS HIS A . n 
A 1 367 MET 367 442 442 MET MET A . n 
A 1 368 GLN 368 443 443 GLN GLN A . n 
A 1 369 GLN 369 444 444 GLN GLN A . n 
A 1 370 GLU 370 445 445 GLU GLU A . n 
A 1 371 LYS 371 446 446 LYS LYS A . n 
A 1 372 VAL 372 447 447 VAL VAL A . n 
A 1 373 ALA 373 448 448 ALA ALA A . n 
A 1 374 GLN 374 449 449 GLN GLN A . n 
A 1 375 ILE 375 450 450 ILE ILE A . n 
A 1 376 LYS 376 451 451 LYS LYS A . n 
A 1 377 GLU 377 452 452 GLU GLU A . n 
A 1 378 PHE 378 453 453 PHE PHE A . n 
A 1 379 CYS 379 454 454 CYS CYS A . n 
A 1 380 LEU 380 455 455 LEU LEU A . n 
A 1 381 SER 381 456 456 SER SER A . n 
A 1 382 LYS 382 457 457 LYS LYS A . n 
A 1 383 MET 383 458 458 MET MET A . n 
A 1 384 GLU 384 459 459 GLU GLU A . n 
A 1 385 ASP 385 460 460 ASP ASP A . n 
A 1 386 LEU 386 461 461 LEU LEU A . n 
A 1 387 GLU 387 462 462 GLU GLU A . n 
A 1 388 LEU 388 463 463 LEU LEU A . n 
A 1 389 ILE 389 464 464 ILE ILE A . n 
A 1 390 ASN 390 465 465 ASN ASN A . n 
A 1 391 ARG 391 466 466 ARG ARG A . n 
A 1 392 MET 392 467 467 MET MET A . n 
A 1 393 SER 393 468 468 SER SER A . n 
A 1 394 SER 394 469 469 SER SER A . n 
A 1 395 PHE 395 470 470 PHE PHE A . n 
A 1 396 ASN 396 491 ?   ?   ?   A . n 
A 1 397 GLU 397 492 ?   ?   ?   A . n 
A 1 398 LEU 398 493 ?   ?   ?   A . n 
A 1 399 SER 399 494 ?   ?   ?   A . n 
A 1 400 ALA 400 495 ?   ?   ?   A . n 
A 1 401 THR 401 496 ?   ?   ?   A . n 
A 1 402 GLN 402 497 ?   ?   ?   A . n 
A 1 403 LEU 403 498 ?   ?   ?   A . n 
A 1 404 ASN 404 499 ?   ?   ?   A . n 
A 1 405 GLN 405 500 ?   ?   ?   A . n 
A 1 406 SER 406 501 ?   ?   ?   A . n 
A 1 407 ASP 407 502 ?   ?   ?   A . n 
A 1 408 SER 408 503 ?   ?   ?   A . n 
A 1 409 ASN 409 504 ?   ?   ?   A . n 
A 1 410 SER 410 505 ?   ?   ?   A . n 
A 1 411 HIS 411 506 ?   ?   ?   A . n 
A 1 412 ASN 412 507 ?   ?   ?   A . n 
A 1 413 SER 413 508 ?   ?   ?   A . n 
A 1 414 ILE 414 509 ?   ?   ?   A . n 
A 1 415 ASP 415 510 ?   ?   ?   A . n 
A 1 416 LEU 416 511 ?   ?   ?   A . n 
A 1 417 THR 417 512 ?   ?   ?   A . n 
A 1 418 SER 418 513 ?   ?   ?   A . n 
A 1 419 HIS 419 514 ?   ?   ?   A . n 
A 1 420 SER 420 515 ?   ?   ?   A . n 
A 1 421 LYS 421 516 ?   ?   ?   A . n 
A 1 422 PRO 422 517 517 PRO PRO A . n 
A 1 423 VAL 423 518 518 VAL VAL A . n 
A 1 424 SER 424 519 519 SER SER A . n 
A 1 425 PRO 425 520 520 PRO PRO A . n 
A 1 426 SER 426 521 521 SER SER A . n 
A 1 427 ASP 427 522 522 ASP ASP A . n 
A 1 428 GLU 428 523 523 GLU GLU A . n 
A 1 429 PHE 429 524 524 PHE PHE A . n 
A 1 430 GLU 430 525 525 GLU GLU A . n 
A 1 431 PHE 431 526 526 PHE PHE A . n 
A 1 432 TYR 432 527 527 TYR TYR A . n 
A 1 433 ARG 433 528 528 ARG ARG A . n 
A 1 434 LYS 434 529 529 LYS LYS A . n 
A 1 435 GLU 435 530 530 GLU GLU A . n 
A 1 436 ILE 436 531 531 ILE ILE A . n 
A 1 437 VAL 437 532 532 VAL VAL A . n 
A 1 438 ILE 438 533 533 ILE ILE A . n 
A 1 439 LEU 439 534 534 LEU LEU A . n 
A 1 440 SER 440 535 535 SER SER A . n 
A 1 441 GLU 441 536 536 GLU GLU A . n 
A 1 442 ASP 442 537 537 ASP ASP A . n 
A 1 443 PHE 443 538 538 PHE PHE A . n 
A 1 444 LYS 444 539 539 LYS LYS A . n 
A 1 445 VAL 445 540 540 VAL VAL A . n 
A 1 446 MET 446 541 541 MET MET A . n 
A 1 447 GLU 447 542 542 GLU GLU A . n 
A 1 448 TRP 448 543 543 TRP TRP A . n 
A 1 449 TRP 449 544 544 TRP TRP A . n 
A 1 450 ASN 450 545 545 ASN ASN A . n 
A 1 451 LEU 451 546 546 LEU LEU A . n 
A 1 452 ASN 452 547 547 ASN ASN A . n 
A 1 453 SER 453 548 548 SER SER A . n 
A 1 454 LYS 454 549 549 LYS LYS A . n 
A 1 455 LYS 455 550 550 LYS LYS A . n 
A 1 456 TYR 456 551 551 TYR TYR A . n 
A 1 457 PRO 457 552 552 PRO PRO A . n 
A 1 458 LYS 458 553 553 LYS LYS A . n 
A 1 459 LEU 459 554 554 LEU LEU A . n 
A 1 460 SER 460 555 555 SER SER A . n 
A 1 461 LYS 461 556 556 LYS LYS A . n 
A 1 462 LEU 462 557 557 LEU LEU A . n 
A 1 463 ALA 463 558 558 ALA ALA A . n 
A 1 464 LEU 464 559 559 LEU LEU A . n 
A 1 465 SER 465 560 560 SER SER A . n 
A 1 466 LEU 466 561 561 LEU LEU A . n 
A 1 467 LEU 467 562 562 LEU LEU A . n 
A 1 468 SER 468 563 563 SER SER A . n 
A 1 469 ILE 469 564 564 ILE ILE A . n 
A 1 470 PRO 470 565 565 PRO PRO A . n 
A 1 471 ALA 471 566 566 ALA ALA A . n 
A 1 472 SER 472 567 567 SER SER A . n 
A 1 473 SER 473 568 568 SER SER A . n 
A 1 474 ALA 474 569 569 ALA ALA A . n 
A 1 475 ALA 475 570 570 ALA ALA A . n 
A 1 476 SER 476 571 571 SER SER A . n 
A 1 477 GLU 477 572 572 GLU GLU A . n 
A 1 478 ARG 478 573 573 ARG ARG A . n 
A 1 479 THR 479 574 574 THR THR A . n 
A 1 480 PHE 480 575 575 PHE PHE A . n 
A 1 481 SER 481 576 576 SER SER A . n 
A 1 482 LEU 482 577 577 LEU LEU A . n 
A 1 483 ALA 483 578 578 ALA ALA A . n 
A 1 484 GLY 484 579 579 GLY GLY A . n 
A 1 485 ASN 485 580 580 ASN ASN A . n 
A 1 486 ILE 486 581 581 ILE ILE A . n 
A 1 487 ILE 487 582 582 ILE ILE A . n 
A 1 488 THR 488 583 583 THR THR A . n 
A 1 489 GLU 489 584 584 GLU GLU A . n 
A 1 490 LYS 490 585 585 LYS LYS A . n 
A 1 491 ARG 491 586 586 ARG ARG A . n 
A 1 492 ASN 492 587 587 ASN ASN A . n 
A 1 493 ARG 493 588 588 ARG ARG A . n 
A 1 494 ILE 494 589 589 ILE ILE A . n 
A 1 495 GLY 495 590 590 GLY GLY A . n 
A 1 496 GLN 496 591 591 GLN GLN A . n 
A 1 497 GLN 497 592 592 GLN GLN A . n 
A 1 498 THR 498 593 593 THR THR A . n 
A 1 499 VAL 499 594 594 VAL VAL A . n 
A 1 500 ASP 500 595 595 ASP ASP A . n 
A 1 501 SER 501 596 596 SER SER A . n 
A 1 502 LEU 502 597 597 LEU LEU A . n 
A 1 503 LEU 503 598 598 LEU LEU A . n 
A 1 504 PHE 504 599 599 PHE PHE A . n 
A 1 505 LEU 505 600 600 LEU LEU A . n 
A 1 506 ASN 506 601 601 ASN ASN A . n 
A 1 507 SER 507 602 602 SER SER A . n 
A 1 508 PHE 508 603 603 PHE PHE A . n 
A 1 509 TYR 509 604 604 TYR TYR A . n 
A 1 510 LYS 510 605 605 LYS LYS A . n 
A 1 511 ASN 511 606 606 ASN ASN A . n 
A 1 512 PHE 512 607 607 PHE PHE A . n 
A 1 513 CYS 513 608 608 CYS CYS A . n 
A 1 514 LYS 514 609 609 LYS LYS A . n 
A 1 515 LEU 515 610 ?   ?   ?   A . n 
A 1 516 ASP 516 611 ?   ?   ?   A . n 
A 1 517 ILE 517 612 ?   ?   ?   A . n 
B 2 1   DA  1   1   1   DA  DA  B . n 
B 2 2   DG  2   2   2   DG  DG  B . n 
B 2 3   DA  3   3   3   DA  DA  B . n 
B 2 4   DG  4   4   4   DG  DG  B . n 
B 2 5   DA  5   5   5   DA  DA  B . n 
B 2 6   DA  6   6   6   DA  DA  B . n 
B 2 7   DC  7   7   7   DC  DC  B . n 
B 2 8   DA  8   8   8   DA  DA  B . n 
B 2 9   DA  9   9   9   DA  DA  B . n 
B 2 10  DC  10  10  10  DC  DC  B . n 
B 2 11  DA  11  11  11  DA  DA  B . n 
B 2 12  DA  12  12  12  DA  DA  B . n 
B 2 13  DC  13  13  13  DC  DC  B . n 
B 2 14  DA  14  14  14  DA  DA  B . n 
B 2 15  DA  15  15  15  DA  DA  B . n 
B 2 16  DG  16  16  16  DG  DG  B . n 
C 3 1   DC  1   1   1   DC  DC  C . n 
C 3 2   DT  2   2   2   DT  DT  C . n 
C 3 3   DT  3   3   3   DT  DT  C . n 
C 3 4   DG  4   4   4   DG  DG  C . n 
C 3 5   DT  5   5   5   DT  DT  C . n 
C 3 6   DT  6   6   6   DT  DT  C . n 
C 3 7   DG  7   7   7   DG  DG  C . n 
C 3 8   DT  8   8   8   DT  DT  C . n 
C 3 9   DT  9   9   9   DT  DT  C . n 
C 3 10  DG  10  10  10  DG  DG  C . n 
C 3 11  DT  11  11  11  DT  DT  C . n 
C 3 12  DT  12  12  12  DT  DT  C . n 
C 3 13  DC  13  13  13  DC  DC  C . n 
C 3 14  DT  14  14  14  DT  DT  C . n 
C 3 15  DC  15  15  15  DC  DC  C . n 
C 3 16  DT  16  16  16  DT  DT  C . n 
C 3 17  DG  17  17  17  DG  DG  C . n 
C 3 18  DG  18  18  18  DG  DG  C . n 
C 3 19  DT  19  19  19  DT  DT  C . n 
C 3 20  DT  20  20  20  DT  DT  C . n 
C 3 21  DC  21  21  21  DC  DC  C . n 
C 3 22  DA  22  22  22  DA  DA  C . n 
C 3 23  DC  23  23  23  DC  DC  C . n 
C 3 24  DG  24  24  24  DG  DG  C . n 
C 3 25  DC  25  25  25  DC  DC  C . n 
D 4 1   DG  1   1   1   DG  DG  D . n 
D 4 2   DC  2   2   2   DC  DC  D . n 
D 4 3   DG  3   3   3   DG  DG  D . n 
D 4 4   DT  4   4   4   DT  DT  D . n 
D 4 5   DG  5   5   5   DG  DG  D . n 
D 4 6   DA  6   6   6   DA  DA  D . n 
D 4 7   DA  7   7   7   DA  DA  D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 MN  1  701 1    MN  MN  A . 
F 5 MN  1  702 2    MN  MN  A . 
G 5 MN  1  101 3    MN  MN  C . 
H 6 HOH 1  801 1760 HOH WAT A . 
H 6 HOH 2  802 1302 HOH WAT A . 
H 6 HOH 3  803 1354 HOH WAT A . 
H 6 HOH 4  804 1110 HOH WAT A . 
H 6 HOH 5  805 1129 HOH WAT A . 
H 6 HOH 6  806 1010 HOH WAT A . 
H 6 HOH 7  807 1012 HOH WAT A . 
H 6 HOH 8  808 1352 HOH WAT A . 
H 6 HOH 9  809 1646 HOH WAT A . 
H 6 HOH 10 810 1125 HOH WAT A . 
H 6 HOH 11 811 1331 HOH WAT A . 
H 6 HOH 12 812 1343 HOH WAT A . 
H 6 HOH 13 813 1047 HOH WAT A . 
H 6 HOH 14 814 1546 HOH WAT A . 
H 6 HOH 15 815 1566 HOH WAT A . 
H 6 HOH 16 816 1314 HOH WAT A . 
H 6 HOH 17 817 1320 HOH WAT A . 
H 6 HOH 18 818 1735 HOH WAT A . 
H 6 HOH 19 819 1236 HOH WAT A . 
H 6 HOH 20 820 1365 HOH WAT A . 
H 6 HOH 21 821 1118 HOH WAT A . 
H 6 HOH 22 822 1741 HOH WAT A . 
H 6 HOH 23 823 1115 HOH WAT A . 
H 6 HOH 24 824 1551 HOH WAT A . 
H 6 HOH 25 825 1324 HOH WAT A . 
H 6 HOH 26 826 1718 HOH WAT A . 
H 6 HOH 27 827 1011 HOH WAT A . 
H 6 HOH 28 828 1563 HOH WAT A . 
H 6 HOH 29 829 1058 HOH WAT A . 
H 6 HOH 30 830 1752 HOH WAT A . 
H 6 HOH 31 831 1333 HOH WAT A . 
H 6 HOH 32 832 1318 HOH WAT A . 
H 6 HOH 33 833 1238 HOH WAT A . 
H 6 HOH 34 834 1550 HOH WAT A . 
H 6 HOH 35 835 1750 HOH WAT A . 
H 6 HOH 36 836 1124 HOH WAT A . 
H 6 HOH 37 837 1029 HOH WAT A . 
H 6 HOH 38 838 1239 HOH WAT A . 
H 6 HOH 39 839 1245 HOH WAT A . 
H 6 HOH 40 840 1549 HOH WAT A . 
H 6 HOH 41 841 1045 HOH WAT A . 
H 6 HOH 42 842 1645 HOH WAT A . 
H 6 HOH 43 843 1707 HOH WAT A . 
H 6 HOH 44 844 1313 HOH WAT A . 
H 6 HOH 45 845 1212 HOH WAT A . 
H 6 HOH 46 846 1106 HOH WAT A . 
H 6 HOH 47 847 1134 HOH WAT A . 
H 6 HOH 48 848 1783 HOH WAT A . 
H 6 HOH 49 849 1211 HOH WAT A . 
H 6 HOH 50 850 1120 HOH WAT A . 
H 6 HOH 51 851 1207 HOH WAT A . 
H 6 HOH 52 852 1117 HOH WAT A . 
H 6 HOH 53 853 1560 HOH WAT A . 
H 6 HOH 54 854 1053 HOH WAT A . 
H 6 HOH 55 855 1366 HOH WAT A . 
H 6 HOH 56 856 1564 HOH WAT A . 
H 6 HOH 57 857 1111 HOH WAT A . 
H 6 HOH 58 858 1777 HOH WAT A . 
H 6 HOH 59 859 1235 HOH WAT A . 
I 6 HOH 1  101 1355 HOH WAT B . 
I 6 HOH 2  102 1277 HOH WAT B . 
I 6 HOH 3  103 1276 HOH WAT B . 
I 6 HOH 4  104 1897 HOH WAT B . 
I 6 HOH 5  105 1896 HOH WAT B . 
I 6 HOH 6  106 1898 HOH WAT B . 
J 6 HOH 1  201 1190 HOH WAT C . 
J 6 HOH 2  202 1751 HOH WAT C . 
J 6 HOH 3  203 1135 HOH WAT C . 
J 6 HOH 4  204 1119 HOH WAT C . 
J 6 HOH 5  205 1744 HOH WAT C . 
J 6 HOH 6  206 1057 HOH WAT C . 
K 6 HOH 1  101 1188 HOH WAT D . 
K 6 HOH 2  102 1200 HOH WAT D . 
K 6 HOH 3  103 1199 HOH WAT D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   octameric 
_pdbx_struct_assembly.oligomeric_count     8 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 23840 ? 
1 MORE         -176  ? 
1 'SSA (A^2)'  54230 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_566 x,-y+1,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 136.4600000000 0.0000000000 0.0000000000 -1.0000000000 104.6100000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1   ? A ASP 105 ? A ASP 180 ? 1_555 MN ? E MN . ? A MN 701 ? 1_555 OD2   ? A ASP 173 ? A ASP 248 ? 1_555 131.2 ? 
2  OD1   ? A ASP 105 ? A ASP 180 ? 1_555 MN ? E MN . ? A MN 701 ? 1_555 OP2   ? C DG  18  ? C DG  18  ? 1_555 90.9  ? 
3  OD2   ? A ASP 173 ? A ASP 248 ? 1_555 MN ? E MN . ? A MN 701 ? 1_555 OP2   ? C DG  18  ? C DG  18  ? 1_555 118.7 ? 
4  OD1   ? A ASP 105 ? A ASP 180 ? 1_555 MN ? E MN . ? A MN 701 ? 1_555 "O3'" ? D DA  7   ? D DA  7   ? 1_555 134.0 ? 
5  OD2   ? A ASP 173 ? A ASP 248 ? 1_555 MN ? E MN . ? A MN 701 ? 1_555 "O3'" ? D DA  7   ? D DA  7   ? 1_555 92.1  ? 
6  OP2   ? C DG  18  ? C DG  18  ? 1_555 MN ? E MN . ? A MN 701 ? 1_555 "O3'" ? D DA  7   ? D DA  7   ? 1_555 77.4  ? 
7  OD1   ? A ASP 105 ? A ASP 180 ? 1_555 MN ? E MN . ? A MN 701 ? 1_555 O     ? H HOH .   ? A HOH 806 ? 1_555 65.0  ? 
8  OD2   ? A ASP 173 ? A ASP 248 ? 1_555 MN ? E MN . ? A MN 701 ? 1_555 O     ? H HOH .   ? A HOH 806 ? 1_555 152.3 ? 
9  OP2   ? C DG  18  ? C DG  18  ? 1_555 MN ? E MN . ? A MN 701 ? 1_555 O     ? H HOH .   ? A HOH 806 ? 1_555 78.0  ? 
10 "O3'" ? D DA  7   ? D DA  7   ? 1_555 MN ? E MN . ? A MN 701 ? 1_555 O     ? H HOH .   ? A HOH 806 ? 1_555 69.0  ? 
11 OD1   ? A ASP 105 ? A ASP 180 ? 1_555 MN ? E MN . ? A MN 701 ? 1_555 O     ? H HOH .   ? A HOH 827 ? 1_555 95.8  ? 
12 OD2   ? A ASP 173 ? A ASP 248 ? 1_555 MN ? E MN . ? A MN 701 ? 1_555 O     ? H HOH .   ? A HOH 827 ? 1_555 76.4  ? 
13 OP2   ? C DG  18  ? C DG  18  ? 1_555 MN ? E MN . ? A MN 701 ? 1_555 O     ? H HOH .   ? A HOH 827 ? 1_555 151.6 ? 
14 "O3'" ? D DA  7   ? D DA  7   ? 1_555 MN ? E MN . ? A MN 701 ? 1_555 O     ? H HOH .   ? A HOH 827 ? 1_555 78.2  ? 
15 O     ? H HOH .   ? A HOH 806 ? 1_555 MN ? E MN . ? A MN 701 ? 1_555 O     ? H HOH .   ? A HOH 827 ? 1_555 79.9  ? 
16 OE1   ? A GLU 477 ? A GLU 572 ? 1_555 MN ? F MN . ? A MN 702 ? 1_555 OP2   ? C DG  18  ? C DG  18  ? 1_555 126.3 ? 
17 OE1   ? A GLU 477 ? A GLU 572 ? 1_555 MN ? F MN . ? A MN 702 ? 1_555 O     ? J HOH .   ? C HOH 204 ? 1_555 95.4  ? 
18 OP2   ? C DG  18  ? C DG  18  ? 1_555 MN ? F MN . ? A MN 702 ? 1_555 O     ? J HOH .   ? C HOH 204 ? 1_555 96.0  ? 
19 OP2   ? C DG  17  ? C DG  17  ? 1_555 MN ? G MN . ? C MN 101 ? 1_555 O     ? J HOH .   ? C HOH 203 ? 1_555 92.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-09-19 
2 'Structure model' 1 1 2019-01-23 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'          
2 2 'Structure model' '_citation.page_first'              
3 2 'Structure model' '_citation.page_last'               
4 2 'Structure model' '_citation.pdbx_database_id_DOI'    
5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
6 2 'Structure model' '_citation.title'                   
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10_2155: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                  2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                  3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? AMoRE  ? ? ? .                  4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ASP 
_pdbx_validate_close_contact.auth_seq_id_1    105 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   NH1 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ARG 
_pdbx_validate_close_contact.auth_seq_id_2    107 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" C DT 8  ? ? "C1'" C DT 8  ? ? N1 C DT 8  ? ? 110.33 108.30 2.03 0.30 N 
2 1 "O4'" C DC 13 ? ? "C1'" C DC 13 ? ? N1 C DC 13 ? ? 110.54 108.30 2.24 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 82  ? ? -67.11  96.68   
2  1 HIS A 134 ? ? -110.48 61.63   
3  1 ASP A 173 ? ? 67.89   -10.48  
4  1 TYR A 186 ? ? -107.70 -71.09  
5  1 LYS A 188 ? ? 73.70   31.75   
6  1 GLU A 200 ? ? -118.54 -103.82 
7  1 SER A 219 ? ? -76.17  47.68   
8  1 ARG A 249 ? ? -94.29  32.13   
9  1 ILE A 349 ? ? -146.65 -15.76  
10 1 SER A 381 ? ? -137.72 -31.19  
11 1 PRO A 438 ? ? -59.46  74.02   
12 1 HIS A 441 ? ? -75.61  -81.36  
13 1 MET A 442 ? ? -66.63  28.46   
14 1 GLN A 444 ? ? -74.30  -111.11 
15 1 SER A 469 ? ? -164.09 3.28    
16 1 VAL A 518 ? ? 36.41   70.08   
17 1 LEU A 534 ? ? -65.34  89.22   
18 1 LEU A 546 ? ? -78.94  37.32   
19 1 ASN A 547 ? ? -164.46 -0.22   
20 1 PHE A 607 ? ? -141.25 34.12   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A SER 163 ? CB ? A SER 88 CB 
2 1 Y 1 A SER 163 ? OG ? A SER 88 OG 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 76  ? A GLY 1   
2  1 Y 1 A SER 77  ? A SER 2   
3  1 Y 1 A HIS 78  ? A HIS 3   
4  1 Y 1 A MET 79  ? A MET 4   
5  1 Y 1 A SER 80  ? A SER 5   
6  1 Y 1 A ASN 491 ? A ASN 396 
7  1 Y 1 A GLU 492 ? A GLU 397 
8  1 Y 1 A LEU 493 ? A LEU 398 
9  1 Y 1 A SER 494 ? A SER 399 
10 1 Y 1 A ALA 495 ? A ALA 400 
11 1 Y 1 A THR 496 ? A THR 401 
12 1 Y 1 A GLN 497 ? A GLN 402 
13 1 Y 1 A LEU 498 ? A LEU 403 
14 1 Y 1 A ASN 499 ? A ASN 404 
15 1 Y 1 A GLN 500 ? A GLN 405 
16 1 Y 1 A SER 501 ? A SER 406 
17 1 Y 1 A ASP 502 ? A ASP 407 
18 1 Y 1 A SER 503 ? A SER 408 
19 1 Y 1 A ASN 504 ? A ASN 409 
20 1 Y 1 A SER 505 ? A SER 410 
21 1 Y 1 A HIS 506 ? A HIS 411 
22 1 Y 1 A ASN 507 ? A ASN 412 
23 1 Y 1 A SER 508 ? A SER 413 
24 1 Y 1 A ILE 509 ? A ILE 414 
25 1 Y 1 A ASP 510 ? A ASP 415 
26 1 Y 1 A LEU 511 ? A LEU 416 
27 1 Y 1 A THR 512 ? A THR 417 
28 1 Y 1 A SER 513 ? A SER 418 
29 1 Y 1 A HIS 514 ? A HIS 419 
30 1 Y 1 A SER 515 ? A SER 420 
31 1 Y 1 A LYS 516 ? A LYS 421 
32 1 Y 1 A LEU 610 ? A LEU 515 
33 1 Y 1 A ASP 611 ? A ASP 516 
34 1 Y 1 A ILE 612 ? A ILE 517 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
6DWW 'double helix'        
6DWW 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DA 1  1_555 C DT 16 1_555 -0.030 0.081  0.054  -3.819  -6.680  -5.215 1  B_DA1:DT16_C B 1  ? C 16 ? 20 1 
1 B DG 2  1_555 C DC 15 1_555 -0.036 0.071  0.440  22.394  -7.721  3.400  2  B_DG2:DC15_C B 2  ? C 15 ? 19 1 
1 B DA 3  1_555 C DT 14 1_555 -0.044 -0.331 0.380  10.806  -26.985 7.077  3  B_DA3:DT14_C B 3  ? C 14 ? 20 1 
1 B DG 4  1_555 C DC 13 1_555 -0.184 0.119  -0.102 -3.392  -3.768  3.282  4  B_DG4:DC13_C B 4  ? C 13 ? 19 1 
1 B DA 5  1_555 C DT 12 1_555 0.631  -0.140 -0.517 -4.021  -5.439  0.720  5  B_DA5:DT12_C B 5  ? C 12 ? 20 1 
1 B DA 6  1_555 C DT 11 1_555 0.667  -0.206 0.099  7.475   -4.113  -1.750 6  B_DA6:DT11_C B 6  ? C 11 ? 20 1 
1 B DC 7  1_555 C DG 10 1_555 0.243  -0.136 -0.190 15.026  -2.263  5.260  7  B_DC7:DG10_C B 7  ? C 10 ? 19 1 
1 B DA 8  1_555 C DT 9  1_555 0.122  -0.327 0.092  8.256   -15.399 -1.321 8  B_DA8:DT9_C  B 8  ? C 9  ? 20 1 
1 B DA 9  1_555 C DT 8  1_555 0.805  -0.126 0.279  3.722   -17.772 -3.278 9  B_DA9:DT8_C  B 9  ? C 8  ? 20 1 
1 B DC 10 1_555 C DG 7  1_555 -0.096 -0.353 -0.102 3.123   -8.949  -1.106 10 B_DC10:DG7_C B 10 ? C 7  ? 19 1 
1 B DA 11 1_555 C DT 6  1_555 -0.205 0.144  0.329  1.714   -12.505 7.046  11 B_DA11:DT6_C B 11 ? C 6  ? 20 1 
1 B DA 12 1_555 C DT 5  1_555 0.916  -0.062 0.639  10.973  -11.934 -1.489 12 B_DA12:DT5_C B 12 ? C 5  ? 20 1 
1 B DC 13 1_555 C DG 4  1_555 0.226  -0.134 0.107  5.088   -8.622  10.540 13 B_DC13:DG4_C B 13 ? C 4  ? 19 1 
1 B DA 14 1_555 C DT 3  1_555 0.119  -0.295 -0.133 -3.871  -9.878  5.514  14 B_DA14:DT3_C B 14 ? C 3  ? 20 1 
1 B DA 15 1_555 C DT 2  1_555 0.011  -0.448 0.408  6.202   -13.924 -1.626 15 B_DA15:DT2_C B 15 ? C 2  ? 20 1 
1 B DG 16 1_555 C DC 1  1_555 1.926  0.970  0.911  13.745  -15.273 32.636 16 B_DG16:DC1_C B 16 ? C 1  ? ?  1 
1 C DT 20 1_555 D DA 6  1_555 -0.291 -0.009 0.484  -23.577 2.758   7.722  17 C_DT20:DA6_D C 20 ? D 6  ? 20 1 
1 C DC 21 1_555 D DG 5  1_555 -0.215 -0.237 0.568  -8.565  -11.058 -5.012 18 C_DC21:DG5_D C 21 ? D 5  ? 19 1 
1 C DA 22 1_555 D DT 4  1_555 0.032  -0.198 0.182  2.541   -10.223 -3.504 19 C_DA22:DT4_D C 22 ? D 4  ? 20 1 
1 C DC 23 1_555 D DG 3  1_555 0.370  -0.090 -0.210 7.848   -10.165 -0.110 20 C_DC23:DG3_D C 23 ? D 3  ? 19 1 
1 C DG 24 1_555 D DC 2  1_555 -0.260 -0.418 0.067  5.238   -6.589  -3.927 21 C_DG24:DC2_D C 24 ? D 2  ? 19 1 
1 C DC 25 1_555 D DG 1  1_555 0.022  -0.248 -0.080 10.691  -12.681 7.447  22 C_DC25:DG1_D C 25 ? D 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DA 1  1_555 C DT 16 1_555 B DG 2  1_555 C DC 15 1_555 0.603  -0.017 2.886 -4.811 10.694 26.083 -2.145 -2.172 2.534 22.316 
10.039  28.556 1  BB_DA1DG2:DC15DT16_CC B 1  ? C 16 ? B 2  ? C 15 ? 
1 B DG 2  1_555 C DC 15 1_555 B DA 3  1_555 C DT 14 1_555 0.075  -0.648 3.728 -5.445 9.407  31.579 -2.867 -1.137 3.345 16.679 
9.654   33.352 2  BB_DG2DA3:DT14DC15_CC B 2  ? C 15 ? B 3  ? C 14 ? 
1 B DA 3  1_555 C DT 14 1_555 B DG 4  1_555 C DC 13 1_555 -0.556 -1.573 3.739 0.663  16.694 32.432 -4.925 0.986  2.633 27.714 
-1.101  36.380 3  BB_DA3DG4:DC13DT14_CC B 3  ? C 14 ? B 4  ? C 13 ? 
1 B DG 4  1_555 C DC 13 1_555 B DA 5  1_555 C DT 12 1_555 -0.196 -1.039 3.565 4.687  7.458  30.354 -3.361 1.274  3.162 13.879 
-8.724  31.578 4  BB_DG4DA5:DT12DC13_CC B 4  ? C 13 ? B 5  ? C 12 ? 
1 B DA 5  1_555 C DT 12 1_555 B DA 6  1_555 C DT 11 1_555 -0.308 -0.497 3.172 -1.209 0.498  30.742 -1.031 0.350  3.173 0.938  
2.279   30.769 5  BB_DA5DA6:DT11DT12_CC B 5  ? C 12 ? B 6  ? C 11 ? 
1 B DA 6  1_555 C DT 11 1_555 B DC 7  1_555 C DG 10 1_555 0.810  -0.481 3.238 2.587  0.840  29.372 -1.124 -1.041 3.281 1.652  
-5.088  29.495 6  BB_DA6DC7:DG10DT11_CC B 6  ? C 11 ? B 7  ? C 10 ? 
1 B DC 7  1_555 C DG 10 1_555 B DA 8  1_555 C DT 9  1_555 -1.400 0.727  3.567 -3.065 0.987  37.233 0.991  1.737  3.684 1.542  
4.789   37.367 7  BB_DC7DA8:DT9DG10_CC  B 7  ? C 10 ? B 8  ? C 9  ? 
1 B DA 8  1_555 C DT 9  1_555 B DA 9  1_555 C DT 8  1_555 0.376  -0.418 3.442 -2.443 0.125  41.898 -0.598 -0.791 3.415 0.175  
3.412   41.966 8  BB_DA8DA9:DT8DT9_CC   B 8  ? C 9  ? B 9  ? C 8  ? 
1 B DA 9  1_555 C DT 8  1_555 B DC 10 1_555 C DG 7  1_555 0.597  -0.963 3.200 3.251  1.347  23.540 -2.770 -0.398 3.193 3.279  
-7.912  23.798 9  BB_DA9DC10:DG7DT8_CC  B 9  ? C 8  ? B 10 ? C 7  ? 
1 B DC 10 1_555 C DG 7  1_555 B DA 11 1_555 C DT 6  1_555 0.224  -0.551 3.361 -0.703 3.124  38.706 -1.217 -0.425 3.304 4.703  
1.059   38.833 10 BB_DC10DA11:DT6DG7_CC B 10 ? C 7  ? B 11 ? C 6  ? 
1 B DA 11 1_555 C DT 6  1_555 B DA 12 1_555 C DT 5  1_555 -0.518 -0.523 3.004 -3.470 -3.231 39.187 -0.420 0.386  3.069 -4.796 
5.150   39.462 11 BB_DA11DA12:DT5DT6_CC B 11 ? C 6  ? B 12 ? C 5  ? 
1 B DA 12 1_555 C DT 5  1_555 B DC 13 1_555 C DG 4  1_555 1.073  -1.068 3.491 6.759  -1.798 26.946 -1.739 -0.418 3.707 -3.779 
-14.204 27.822 12 BB_DA12DC13:DG4DT5_CC B 12 ? C 5  ? B 13 ? C 4  ? 
1 B DC 13 1_555 C DG 4  1_555 B DA 14 1_555 C DT 3  1_555 0.041  -0.149 3.519 1.886  5.929  36.559 -1.087 0.207  3.452 9.367  
-2.980  37.067 13 BB_DC13DA14:DT3DG4_CC B 13 ? C 4  ? B 14 ? C 3  ? 
1 B DA 14 1_555 C DT 3  1_555 B DA 15 1_555 C DT 2  1_555 -0.332 -0.212 3.014 -6.252 2.243  34.999 -0.650 -0.301 3.007 3.688  
10.282  35.604 14 BB_DA14DA15:DT2DT3_CC B 14 ? C 3  ? B 15 ? C 2  ? 
1 B DA 15 1_555 C DT 2  1_555 B DG 16 1_555 C DC 1  1_555 1.490  -0.105 3.313 -0.870 -2.468 41.154 0.119  -2.210 3.283 -3.507 
1.237   41.233 15 BB_DA15DG16:DC1DT2_CC B 15 ? C 2  ? B 16 ? C 1  ? 
1 C DT 20 1_555 D DA 6  1_555 C DC 21 1_555 D DG 5  1_555 -0.989 0.313  3.050 -4.567 1.216  33.042 0.352  0.999  3.163 2.124  
7.980   33.369 16 CC_DT20DC21:DG5DA6_DD C 20 ? D 6  ? C 21 ? D 5  ? 
1 C DC 21 1_555 D DG 5  1_555 C DA 22 1_555 D DT 4  1_555 -0.118 -0.154 3.068 3.546  6.038  36.392 -0.999 0.630  2.981 9.559  
-5.614  37.038 17 CC_DC21DA22:DT4DG5_DD C 21 ? D 5  ? C 22 ? D 4  ? 
1 C DA 22 1_555 D DT 4  1_555 C DC 23 1_555 D DG 3  1_555 0.240  -0.582 3.259 2.824  3.139  32.252 -1.584 0.061  3.199 5.620  
-5.057  32.520 18 CC_DA22DC23:DG3DT4_DD C 22 ? D 4  ? C 23 ? D 3  ? 
1 C DC 23 1_555 D DG 3  1_555 C DG 24 1_555 D DC 2  1_555 -0.088 0.746  3.568 -1.306 1.419  33.703 1.032  -0.081 3.596 2.444  
2.251   33.756 19 CC_DC23DG24:DC2DG3_DD C 23 ? D 3  ? C 24 ? D 2  ? 
1 C DG 24 1_555 D DC 2  1_555 C DC 25 1_555 D DG 1  1_555 0.018  0.966  3.230 3.644  -1.365 36.400 1.723  0.464  3.180 -2.177 
-5.814  36.600 20 CC_DG24DC25:DG1DC2_DD C 24 ? D 2  ? C 25 ? D 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'MANGANESE (II) ION' MN  
6 water                HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#