data_6DWY
# 
_entry.id   6DWY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6DWY         
WWPDB D_1000234365 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6DWY 
_pdbx_database_status.recvd_initial_deposition_date   2018-06-28 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Dyda, F.'      1 ? 
'Hickman, A.B.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            46 
_citation.language                  ? 
_citation.page_first                10286 
_citation.page_last                 10301 
_citation.title                     
'Structural insights into the mechanism of double strand break formation by Hermes, a hAT family eukaryotic DNA transposase.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gky838 
_citation.pdbx_database_id_PubMed   30239795 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hickman, A.B.' 1 ? 
primary 'Voth, A.R.'    2 ? 
primary 'Ewis, H.'      3 ? 
primary 'Li, X.'        4 ? 
primary 'Craig, N.L.'   5 ? 
primary 'Dyda, F.'      6 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6DWY 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     121.380 
_cell.length_a_esd                 ? 
_cell.length_b                     135.350 
_cell.length_b_esd                 ? 
_cell.length_c                     103.210 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6DWY 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Hermes transposase'                                             59033.633 1 ? C519S ? ? 
2 polymer     syn 
;DNA (5'-D(*AP*GP*AP*GP*AP*AP*CP*AP*AP*CP*AP*AP*CP*AP*AP*G)-3')
;
4942.273  1 ? ?     ? ? 
3 polymer     syn 'DNA (26-MER)'                                                   7983.107  1 ? ?     ? ? 
4 polymer     syn 
;DNA (5'-D(*C*GP*CP*GP*TP*GP*AP*C)-3')
;
2427.605  1 ? ?     ? ? 
5 non-polymer syn 'CALCIUM ION'                                                    40.078    1 ? ?     ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GSHMSRELKTVSADCKKEAIEKCAQWVVRDCRPFSAVSGSGFIDMIKFFIKVGAEYGEHVNVEELLPSPITLSRKVTSDA
KEKKALISREIKSAVEKDGASATIDLWTDNYIKRNFLGVTLHYHENNELRDLILGLKSLDFERSTAENIYKKLKAIFSQF
NVEDLSSIKFVTDRGANVVKSLANNIRINCSSHLLSNVLENSFEETPELNMPILACKNIVKYFKKANLQHRLRSSLKSEC
PTRWNSTYTMLRSILDNWESVIQILSEAGETQRIVHINKSIIQTMVNILDGFERIFKELQTCSSPSLCFVVPSILKVKEI
CSPDVGDVADIAKLKVNIIKNVRIIWEENLSIWHYTAFFFYPPALHMQQEKVAQIKEFCLSKMEDLELINRMSSFNELSA
TQLNQSDSNSHNSIDLTSHSKPVSPSDEFEFYRKEIVILSEDFKVMEWWNLNSKKYPKLSKLALSLLSIPASSAASERTF
SLAGNIITEKRNRIGQQTVDSLLFLNSFYKNFCKLDI
;
;GSHMSRELKTVSADCKKEAIEKCAQWVVRDCRPFSAVSGSGFIDMIKFFIKVGAEYGEHVNVEELLPSPITLSRKVTSDA
KEKKALISREIKSAVEKDGASATIDLWTDNYIKRNFLGVTLHYHENNELRDLILGLKSLDFERSTAENIYKKLKAIFSQF
NVEDLSSIKFVTDRGANVVKSLANNIRINCSSHLLSNVLENSFEETPELNMPILACKNIVKYFKKANLQHRLRSSLKSEC
PTRWNSTYTMLRSILDNWESVIQILSEAGETQRIVHINKSIIQTMVNILDGFERIFKELQTCSSPSLCFVVPSILKVKEI
CSPDVGDVADIAKLKVNIIKNVRIIWEENLSIWHYTAFFFYPPALHMQQEKVAQIKEFCLSKMEDLELINRMSSFNELSA
TQLNQSDSNSHNSIDLTSHSKPVSPSDEFEFYRKEIVILSEDFKVMEWWNLNSKKYPKLSKLALSLLSIPASSAASERTF
SLAGNIITEKRNRIGQQTVDSLLFLNSFYKNFCKLDI
;
A ? 
2 polydeoxyribonucleotide no no '(DA)(DG)(DA)(DG)(DA)(DA)(DC)(DA)(DA)(DC)(DA)(DA)(DC)(DA)(DA)(DG)' AGAGAACAACAACAAG B ? 
3 polydeoxyribonucleotide no no 
;(DC)(DT)(DT)(DG)(DT)(DT)(DG)(DT)(DT)(DG)(DT)(DT)(DC)(DT)(DC)(DT)(DG)(DG)(DG)(DT)
(DC)(DA)(DC)(DG)(DC)(DG)
;
CTTGTTGTTGTTCTCTGGGTCACGCG C ? 
4 polydeoxyribonucleotide no no '(DC)(DG)(DC)(DG)(DT)(DG)(DA)(DC)' CGCGTGAC D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   SER n 
1 6   ARG n 
1 7   GLU n 
1 8   LEU n 
1 9   LYS n 
1 10  THR n 
1 11  VAL n 
1 12  SER n 
1 13  ALA n 
1 14  ASP n 
1 15  CYS n 
1 16  LYS n 
1 17  LYS n 
1 18  GLU n 
1 19  ALA n 
1 20  ILE n 
1 21  GLU n 
1 22  LYS n 
1 23  CYS n 
1 24  ALA n 
1 25  GLN n 
1 26  TRP n 
1 27  VAL n 
1 28  VAL n 
1 29  ARG n 
1 30  ASP n 
1 31  CYS n 
1 32  ARG n 
1 33  PRO n 
1 34  PHE n 
1 35  SER n 
1 36  ALA n 
1 37  VAL n 
1 38  SER n 
1 39  GLY n 
1 40  SER n 
1 41  GLY n 
1 42  PHE n 
1 43  ILE n 
1 44  ASP n 
1 45  MET n 
1 46  ILE n 
1 47  LYS n 
1 48  PHE n 
1 49  PHE n 
1 50  ILE n 
1 51  LYS n 
1 52  VAL n 
1 53  GLY n 
1 54  ALA n 
1 55  GLU n 
1 56  TYR n 
1 57  GLY n 
1 58  GLU n 
1 59  HIS n 
1 60  VAL n 
1 61  ASN n 
1 62  VAL n 
1 63  GLU n 
1 64  GLU n 
1 65  LEU n 
1 66  LEU n 
1 67  PRO n 
1 68  SER n 
1 69  PRO n 
1 70  ILE n 
1 71  THR n 
1 72  LEU n 
1 73  SER n 
1 74  ARG n 
1 75  LYS n 
1 76  VAL n 
1 77  THR n 
1 78  SER n 
1 79  ASP n 
1 80  ALA n 
1 81  LYS n 
1 82  GLU n 
1 83  LYS n 
1 84  LYS n 
1 85  ALA n 
1 86  LEU n 
1 87  ILE n 
1 88  SER n 
1 89  ARG n 
1 90  GLU n 
1 91  ILE n 
1 92  LYS n 
1 93  SER n 
1 94  ALA n 
1 95  VAL n 
1 96  GLU n 
1 97  LYS n 
1 98  ASP n 
1 99  GLY n 
1 100 ALA n 
1 101 SER n 
1 102 ALA n 
1 103 THR n 
1 104 ILE n 
1 105 ASP n 
1 106 LEU n 
1 107 TRP n 
1 108 THR n 
1 109 ASP n 
1 110 ASN n 
1 111 TYR n 
1 112 ILE n 
1 113 LYS n 
1 114 ARG n 
1 115 ASN n 
1 116 PHE n 
1 117 LEU n 
1 118 GLY n 
1 119 VAL n 
1 120 THR n 
1 121 LEU n 
1 122 HIS n 
1 123 TYR n 
1 124 HIS n 
1 125 GLU n 
1 126 ASN n 
1 127 ASN n 
1 128 GLU n 
1 129 LEU n 
1 130 ARG n 
1 131 ASP n 
1 132 LEU n 
1 133 ILE n 
1 134 LEU n 
1 135 GLY n 
1 136 LEU n 
1 137 LYS n 
1 138 SER n 
1 139 LEU n 
1 140 ASP n 
1 141 PHE n 
1 142 GLU n 
1 143 ARG n 
1 144 SER n 
1 145 THR n 
1 146 ALA n 
1 147 GLU n 
1 148 ASN n 
1 149 ILE n 
1 150 TYR n 
1 151 LYS n 
1 152 LYS n 
1 153 LEU n 
1 154 LYS n 
1 155 ALA n 
1 156 ILE n 
1 157 PHE n 
1 158 SER n 
1 159 GLN n 
1 160 PHE n 
1 161 ASN n 
1 162 VAL n 
1 163 GLU n 
1 164 ASP n 
1 165 LEU n 
1 166 SER n 
1 167 SER n 
1 168 ILE n 
1 169 LYS n 
1 170 PHE n 
1 171 VAL n 
1 172 THR n 
1 173 ASP n 
1 174 ARG n 
1 175 GLY n 
1 176 ALA n 
1 177 ASN n 
1 178 VAL n 
1 179 VAL n 
1 180 LYS n 
1 181 SER n 
1 182 LEU n 
1 183 ALA n 
1 184 ASN n 
1 185 ASN n 
1 186 ILE n 
1 187 ARG n 
1 188 ILE n 
1 189 ASN n 
1 190 CYS n 
1 191 SER n 
1 192 SER n 
1 193 HIS n 
1 194 LEU n 
1 195 LEU n 
1 196 SER n 
1 197 ASN n 
1 198 VAL n 
1 199 LEU n 
1 200 GLU n 
1 201 ASN n 
1 202 SER n 
1 203 PHE n 
1 204 GLU n 
1 205 GLU n 
1 206 THR n 
1 207 PRO n 
1 208 GLU n 
1 209 LEU n 
1 210 ASN n 
1 211 MET n 
1 212 PRO n 
1 213 ILE n 
1 214 LEU n 
1 215 ALA n 
1 216 CYS n 
1 217 LYS n 
1 218 ASN n 
1 219 ILE n 
1 220 VAL n 
1 221 LYS n 
1 222 TYR n 
1 223 PHE n 
1 224 LYS n 
1 225 LYS n 
1 226 ALA n 
1 227 ASN n 
1 228 LEU n 
1 229 GLN n 
1 230 HIS n 
1 231 ARG n 
1 232 LEU n 
1 233 ARG n 
1 234 SER n 
1 235 SER n 
1 236 LEU n 
1 237 LYS n 
1 238 SER n 
1 239 GLU n 
1 240 CYS n 
1 241 PRO n 
1 242 THR n 
1 243 ARG n 
1 244 TRP n 
1 245 ASN n 
1 246 SER n 
1 247 THR n 
1 248 TYR n 
1 249 THR n 
1 250 MET n 
1 251 LEU n 
1 252 ARG n 
1 253 SER n 
1 254 ILE n 
1 255 LEU n 
1 256 ASP n 
1 257 ASN n 
1 258 TRP n 
1 259 GLU n 
1 260 SER n 
1 261 VAL n 
1 262 ILE n 
1 263 GLN n 
1 264 ILE n 
1 265 LEU n 
1 266 SER n 
1 267 GLU n 
1 268 ALA n 
1 269 GLY n 
1 270 GLU n 
1 271 THR n 
1 272 GLN n 
1 273 ARG n 
1 274 ILE n 
1 275 VAL n 
1 276 HIS n 
1 277 ILE n 
1 278 ASN n 
1 279 LYS n 
1 280 SER n 
1 281 ILE n 
1 282 ILE n 
1 283 GLN n 
1 284 THR n 
1 285 MET n 
1 286 VAL n 
1 287 ASN n 
1 288 ILE n 
1 289 LEU n 
1 290 ASP n 
1 291 GLY n 
1 292 PHE n 
1 293 GLU n 
1 294 ARG n 
1 295 ILE n 
1 296 PHE n 
1 297 LYS n 
1 298 GLU n 
1 299 LEU n 
1 300 GLN n 
1 301 THR n 
1 302 CYS n 
1 303 SER n 
1 304 SER n 
1 305 PRO n 
1 306 SER n 
1 307 LEU n 
1 308 CYS n 
1 309 PHE n 
1 310 VAL n 
1 311 VAL n 
1 312 PRO n 
1 313 SER n 
1 314 ILE n 
1 315 LEU n 
1 316 LYS n 
1 317 VAL n 
1 318 LYS n 
1 319 GLU n 
1 320 ILE n 
1 321 CYS n 
1 322 SER n 
1 323 PRO n 
1 324 ASP n 
1 325 VAL n 
1 326 GLY n 
1 327 ASP n 
1 328 VAL n 
1 329 ALA n 
1 330 ASP n 
1 331 ILE n 
1 332 ALA n 
1 333 LYS n 
1 334 LEU n 
1 335 LYS n 
1 336 VAL n 
1 337 ASN n 
1 338 ILE n 
1 339 ILE n 
1 340 LYS n 
1 341 ASN n 
1 342 VAL n 
1 343 ARG n 
1 344 ILE n 
1 345 ILE n 
1 346 TRP n 
1 347 GLU n 
1 348 GLU n 
1 349 ASN n 
1 350 LEU n 
1 351 SER n 
1 352 ILE n 
1 353 TRP n 
1 354 HIS n 
1 355 TYR n 
1 356 THR n 
1 357 ALA n 
1 358 PHE n 
1 359 PHE n 
1 360 PHE n 
1 361 TYR n 
1 362 PRO n 
1 363 PRO n 
1 364 ALA n 
1 365 LEU n 
1 366 HIS n 
1 367 MET n 
1 368 GLN n 
1 369 GLN n 
1 370 GLU n 
1 371 LYS n 
1 372 VAL n 
1 373 ALA n 
1 374 GLN n 
1 375 ILE n 
1 376 LYS n 
1 377 GLU n 
1 378 PHE n 
1 379 CYS n 
1 380 LEU n 
1 381 SER n 
1 382 LYS n 
1 383 MET n 
1 384 GLU n 
1 385 ASP n 
1 386 LEU n 
1 387 GLU n 
1 388 LEU n 
1 389 ILE n 
1 390 ASN n 
1 391 ARG n 
1 392 MET n 
1 393 SER n 
1 394 SER n 
1 395 PHE n 
1 396 ASN n 
1 397 GLU n 
1 398 LEU n 
1 399 SER n 
1 400 ALA n 
1 401 THR n 
1 402 GLN n 
1 403 LEU n 
1 404 ASN n 
1 405 GLN n 
1 406 SER n 
1 407 ASP n 
1 408 SER n 
1 409 ASN n 
1 410 SER n 
1 411 HIS n 
1 412 ASN n 
1 413 SER n 
1 414 ILE n 
1 415 ASP n 
1 416 LEU n 
1 417 THR n 
1 418 SER n 
1 419 HIS n 
1 420 SER n 
1 421 LYS n 
1 422 PRO n 
1 423 VAL n 
1 424 SER n 
1 425 PRO n 
1 426 SER n 
1 427 ASP n 
1 428 GLU n 
1 429 PHE n 
1 430 GLU n 
1 431 PHE n 
1 432 TYR n 
1 433 ARG n 
1 434 LYS n 
1 435 GLU n 
1 436 ILE n 
1 437 VAL n 
1 438 ILE n 
1 439 LEU n 
1 440 SER n 
1 441 GLU n 
1 442 ASP n 
1 443 PHE n 
1 444 LYS n 
1 445 VAL n 
1 446 MET n 
1 447 GLU n 
1 448 TRP n 
1 449 TRP n 
1 450 ASN n 
1 451 LEU n 
1 452 ASN n 
1 453 SER n 
1 454 LYS n 
1 455 LYS n 
1 456 TYR n 
1 457 PRO n 
1 458 LYS n 
1 459 LEU n 
1 460 SER n 
1 461 LYS n 
1 462 LEU n 
1 463 ALA n 
1 464 LEU n 
1 465 SER n 
1 466 LEU n 
1 467 LEU n 
1 468 SER n 
1 469 ILE n 
1 470 PRO n 
1 471 ALA n 
1 472 SER n 
1 473 SER n 
1 474 ALA n 
1 475 ALA n 
1 476 SER n 
1 477 GLU n 
1 478 ARG n 
1 479 THR n 
1 480 PHE n 
1 481 SER n 
1 482 LEU n 
1 483 ALA n 
1 484 GLY n 
1 485 ASN n 
1 486 ILE n 
1 487 ILE n 
1 488 THR n 
1 489 GLU n 
1 490 LYS n 
1 491 ARG n 
1 492 ASN n 
1 493 ARG n 
1 494 ILE n 
1 495 GLY n 
1 496 GLN n 
1 497 GLN n 
1 498 THR n 
1 499 VAL n 
1 500 ASP n 
1 501 SER n 
1 502 LEU n 
1 503 LEU n 
1 504 PHE n 
1 505 LEU n 
1 506 ASN n 
1 507 SER n 
1 508 PHE n 
1 509 TYR n 
1 510 LYS n 
1 511 ASN n 
1 512 PHE n 
1 513 CYS n 
1 514 LYS n 
1 515 LEU n 
1 516 ASP n 
1 517 ILE n 
2 1   DA  n 
2 2   DG  n 
2 3   DA  n 
2 4   DG  n 
2 5   DA  n 
2 6   DA  n 
2 7   DC  n 
2 8   DA  n 
2 9   DA  n 
2 10  DC  n 
2 11  DA  n 
2 12  DA  n 
2 13  DC  n 
2 14  DA  n 
2 15  DA  n 
2 16  DG  n 
3 1   DC  n 
3 2   DT  n 
3 3   DT  n 
3 4   DG  n 
3 5   DT  n 
3 6   DT  n 
3 7   DG  n 
3 8   DT  n 
3 9   DT  n 
3 10  DG  n 
3 11  DT  n 
3 12  DT  n 
3 13  DC  n 
3 14  DT  n 
3 15  DC  n 
3 16  DT  n 
3 17  DG  n 
3 18  DG  n 
3 19  DG  n 
3 20  DT  n 
3 21  DC  n 
3 22  DA  n 
3 23  DC  n 
3 24  DG  n 
3 25  DC  n 
3 26  DG  n 
4 1   DC  n 
4 2   DG  n 
4 3   DC  n 
4 4   DG  n 
4 5   DT  n 
4 6   DG  n 
4 7   DA  n 
4 8   DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   517 
_entity_src_gen.gene_src_common_name               'House fly' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Musca domestica' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7370 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 16 'Musca domestica' ? 7370 ? 
3 1 sample 1 26 'Musca domestica' ? 7370 ? 
4 1 sample 1 8  'Musca domestica' ? 7370 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP Q25438_MUSDO Q25438 ? 1 
;SRELKTVSADCKKEAIEKCAQWVVRDCRPFSAVSGSGFIDMIKFFIKVKAEYGEHVNVEELLPSPITLSRKVTSDAKEKK
ALISREIKSAVEKDGASATIDLWTDNYIKRNFLGVTLHYHENNELRDLILGLKSLDFERSTAENIYKKLKAIFSQFNVED
LSSIKFVTDRGANVVKSLANNIRINCSSHLLSNVLENSFEETPELNMPILACKNIVKYFKKANLQHRLRSSLKSECPTRW
NSTYTMLRSILDNWESVIQILSEAGETQRIVHINKSIIQTMVNILDGFERIFKELQTCSSPSLCFVVPSILKVKEICSPD
VGDVADIAKLKVNIIKNVRIIWEENLSIWHYTAFFFYPPALHMQQEKVAQIKEFCLSKMEDLELINRMSSFNELSATQLN
QSDSNSHNSIDLTSHSKDISTTSFFFPQLTQNNSREPPVCPSDEFEFYRKEIVILSEDFKVMEWWNLNSKKYPKLSKLAL
SLLSIPASSAASERTFSLAGNIITEKRNRIGQQTVDSLLFLNSFYKNFCKLDI
;
80 
2 PDB 6DWY         6DWY   ? 2 ? 1  
3 PDB 6DWY         6DWY   ? 3 ? 1  
4 PDB 6DWY         6DWY   ? 4 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6DWY A 5 ? 517 ? Q25438 80 ? 612 ? 80 612 
2 2 6DWY B 1 ? 16  ? 6DWY   1  ? 16  ? 1  16  
3 3 6DWY C 1 ? 26  ? 6DWY   1  ? 26  ? 1  26  
4 4 6DWY D 1 ? 8   ? 6DWY   0  ? 7   ? 0  7   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6DWY GLY A 1   ? UNP Q25438 ?   ?   'expression tag'      76  1  
1 6DWY SER A 2   ? UNP Q25438 ?   ?   'expression tag'      77  2  
1 6DWY HIS A 3   ? UNP Q25438 ?   ?   'expression tag'      78  3  
1 6DWY MET A 4   ? UNP Q25438 ?   ?   'expression tag'      79  4  
1 6DWY GLY A 53  ? UNP Q25438 LYS 128 conflict              128 5  
1 6DWY ?   A ?   ? UNP Q25438 ASP 497 deletion              ?   6  
1 6DWY ?   A ?   ? UNP Q25438 ILE 498 deletion              ?   7  
1 6DWY ?   A ?   ? UNP Q25438 SER 499 deletion              ?   8  
1 6DWY ?   A ?   ? UNP Q25438 THR 500 deletion              ?   9  
1 6DWY ?   A ?   ? UNP Q25438 THR 501 deletion              ?   10 
1 6DWY ?   A ?   ? UNP Q25438 SER 502 deletion              ?   11 
1 6DWY ?   A ?   ? UNP Q25438 PHE 503 deletion              ?   12 
1 6DWY ?   A ?   ? UNP Q25438 PHE 504 deletion              ?   13 
1 6DWY ?   A ?   ? UNP Q25438 PHE 505 deletion              ?   14 
1 6DWY ?   A ?   ? UNP Q25438 PRO 506 deletion              ?   15 
1 6DWY ?   A ?   ? UNP Q25438 GLN 507 deletion              ?   16 
1 6DWY ?   A ?   ? UNP Q25438 LEU 508 deletion              ?   17 
1 6DWY ?   A ?   ? UNP Q25438 THR 509 deletion              ?   18 
1 6DWY ?   A ?   ? UNP Q25438 GLN 510 deletion              ?   19 
1 6DWY ?   A ?   ? UNP Q25438 ASN 511 deletion              ?   20 
1 6DWY ?   A ?   ? UNP Q25438 ASN 512 deletion              ?   21 
1 6DWY ?   A ?   ? UNP Q25438 SER 513 deletion              ?   22 
1 6DWY ?   A ?   ? UNP Q25438 ARG 514 deletion              ?   23 
1 6DWY ?   A ?   ? UNP Q25438 GLU 515 deletion              ?   24 
1 6DWY ?   A ?   ? UNP Q25438 PRO 516 deletion              ?   25 
1 6DWY SER A 424 ? UNP Q25438 CYS 519 'engineered mutation' 519 26 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'            40.078  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6DWY 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.85 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.79 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '50 mM MES pH 5.8-6.5, 50 mM sodium acetate, 15% PEG MME 2000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           95 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX-300' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-04-13 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54980 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.54980 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6DWY 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.1 
_reflns.d_resolution_low                 30.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       15708 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.24 
_reflns.pdbx_Rmerge_I_obs                0.108 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13.61 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.1 
_reflns_shell.d_res_low                   3.18 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1152 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.675 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6DWY 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.200 
_refine.ls_d_res_low                             29.554 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     14296 
_refine.ls_number_reflns_R_free                  858 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.65 
_refine.ls_percent_reflns_R_free                 6.00 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2614 
_refine.ls_R_factor_R_free                       0.2951 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2591 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.99 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4D1Q 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.30 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             1.10 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 37.07 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.43 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3888 
_refine_hist.pdbx_number_atoms_nucleic_acid   978 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               4867 
_refine_hist.d_res_high                       3.200 
_refine_hist.d_res_low                        29.554 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.005  ? 5058 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.747  ? 7030 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 18.581 ? 2898 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.042  ? 798  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 719  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.2001 3.4003  . . 139 2179 99.00  . . . 0.3644 . 0.3299 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4003 3.6624  . . 141 2216 100.00 . . . 0.3464 . 0.3208 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6624 4.0302  . . 142 2214 100.00 . . . 0.3752 . 0.3019 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0302 4.6114  . . 142 2234 99.00  . . . 0.3326 . 0.2852 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.6114 5.8027  . . 144 2252 100.00 . . . 0.3209 . 0.2624 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.8027 29.5555 . . 150 2343 100.00 . . . 0.2190 . 0.2044 . . . . . . . . . . 
# 
_struct.entry_id                     6DWY 
_struct.title                        'Hermes transposase deletion dimer complex with (C/G) DNA and Ca2+' 
_struct.pdbx_descriptor              'Hermes transposase/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6DWY 
_struct_keywords.text            'transposase, DNA BINDING PROTEIN, dna binding protein-dna complex' 
_struct_keywords.pdbx_keywords   'dna binding protein/dna' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 12  ? CYS A 31  ? SER A 87  CYS A 106 1 ? 20 
HELX_P HELX_P2  AA2 PRO A 33  ? VAL A 37  ? PRO A 108 VAL A 112 5 ? 5  
HELX_P HELX_P3  AA3 GLY A 39  ? GLY A 57  ? GLY A 114 GLY A 132 1 ? 19 
HELX_P HELX_P4  AA4 ASN A 61  ? LEU A 66  ? ASN A 136 LEU A 141 1 ? 6  
HELX_P HELX_P5  AA5 SER A 68  ? LYS A 97  ? SER A 143 LYS A 172 1 ? 30 
HELX_P HELX_P6  AA6 THR A 145 ? SER A 158 ? THR A 220 SER A 233 1 ? 14 
HELX_P HELX_P7  AA7 GLY A 175 ? LEU A 182 ? GLY A 250 LEU A 257 1 ? 8  
HELX_P HELX_P8  AA8 CYS A 190 ? GLU A 205 ? CYS A 265 GLU A 280 1 ? 16 
HELX_P HELX_P9  AA9 THR A 206 ? GLU A 208 ? THR A 281 GLU A 283 5 ? 3  
HELX_P HELX_P10 AB1 LEU A 209 ? ALA A 226 ? LEU A 284 ALA A 301 1 ? 18 
HELX_P HELX_P11 AB2 ASN A 245 ? ASN A 257 ? ASN A 320 ASN A 332 1 ? 13 
HELX_P HELX_P12 AB3 ASN A 257 ? ALA A 268 ? ASN A 332 ALA A 343 1 ? 12 
HELX_P HELX_P13 AB4 THR A 271 ? HIS A 276 ? THR A 346 HIS A 351 1 ? 6  
HELX_P HELX_P14 AB5 ASN A 278 ? LEU A 299 ? ASN A 353 LEU A 374 1 ? 22 
HELX_P HELX_P15 AB6 SER A 306 ? CYS A 308 ? SER A 381 CYS A 383 5 ? 3  
HELX_P HELX_P16 AB7 PHE A 309 ? CYS A 321 ? PHE A 384 CYS A 396 1 ? 13 
HELX_P HELX_P17 AB8 ILE A 331 ? ILE A 345 ? ILE A 406 ILE A 420 1 ? 15 
HELX_P HELX_P18 AB9 TRP A 346 ? LEU A 350 ? TRP A 421 LEU A 425 5 ? 5  
HELX_P HELX_P19 AC1 SER A 351 ? PHE A 360 ? SER A 426 PHE A 435 1 ? 10 
HELX_P HELX_P20 AC2 GLU A 370 ? MET A 392 ? GLU A 445 MET A 467 1 ? 23 
HELX_P HELX_P21 AC3 SER A 424 ? LYS A 434 ? SER A 519 LYS A 529 1 ? 11 
HELX_P HELX_P22 AC4 LYS A 444 ? TRP A 449 ? LYS A 539 TRP A 544 1 ? 6  
HELX_P HELX_P23 AC5 TYR A 456 ? LEU A 467 ? TYR A 551 LEU A 562 1 ? 12 
HELX_P HELX_P24 AC6 SER A 473 ? ILE A 487 ? SER A 568 ILE A 582 1 ? 15 
HELX_P HELX_P25 AC7 GLY A 495 ? PHE A 512 ? GLY A 590 PHE A 607 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 105 OD1   ? ? ? 1_555 E CA .  CA ? ? A ASP 180 A CA 701 1_555 ? ? ? ? ? ? ?               3.060 ? 
metalc2  metalc ? ? A ASP 173 OD2   ? ? ? 1_555 E CA .  CA ? ? A ASP 248 A CA 701 1_555 ? ? ? ? ? ? ?               3.168 ? 
metalc3  metalc ? ? C DG  18  OP2   ? ? ? 1_555 E CA .  CA ? ? C DG  18  A CA 701 1_555 ? ? ? ? ? ? ?               2.954 ? 
metalc4  metalc ? ? D DC  8   "O3'" ? ? ? 1_555 E CA .  CA ? ? D DC  7   A CA 701 1_555 ? ? ? ? ? ? ?               2.876 ? 
hydrog1  hydrog ? ? B DA  1   N1    ? ? ? 1_555 C DT 16 N3 ? ? B DA  1   C DT 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2  hydrog ? ? B DA  1   N6    ? ? ? 1_555 C DT 16 O4 ? ? B DA  1   C DT 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3  hydrog ? ? B DG  2   N1    ? ? ? 1_555 C DC 15 N3 ? ? B DG  2   C DC 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4  hydrog ? ? B DG  2   N2    ? ? ? 1_555 C DC 15 O2 ? ? B DG  2   C DC 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5  hydrog ? ? B DG  2   O6    ? ? ? 1_555 C DC 15 N4 ? ? B DG  2   C DC 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6  hydrog ? ? B DA  3   N1    ? ? ? 1_555 C DT 14 N3 ? ? B DA  3   C DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7  hydrog ? ? B DA  3   N6    ? ? ? 1_555 C DT 14 O4 ? ? B DA  3   C DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8  hydrog ? ? B DG  4   N1    ? ? ? 1_555 C DC 13 N3 ? ? B DG  4   C DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9  hydrog ? ? B DG  4   N2    ? ? ? 1_555 C DC 13 O2 ? ? B DG  4   C DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10 hydrog ? ? B DG  4   O6    ? ? ? 1_555 C DC 13 N4 ? ? B DG  4   C DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11 hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT 12 N3 ? ? B DA  5   C DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12 hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT 12 O4 ? ? B DA  5   C DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13 hydrog ? ? B DA  6   N1    ? ? ? 1_555 C DT 11 N3 ? ? B DA  6   C DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14 hydrog ? ? B DA  6   N6    ? ? ? 1_555 C DT 11 O4 ? ? B DA  6   C DT 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15 hydrog ? ? B DC  7   N3    ? ? ? 1_555 C DG 10 N1 ? ? B DC  7   C DG 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16 hydrog ? ? B DC  7   N4    ? ? ? 1_555 C DG 10 O6 ? ? B DC  7   C DG 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17 hydrog ? ? B DC  7   O2    ? ? ? 1_555 C DG 10 N2 ? ? B DC  7   C DG 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18 hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT 9  N3 ? ? B DA  8   C DT 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19 hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT 9  O4 ? ? B DA  8   C DT 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20 hydrog ? ? B DA  9   N1    ? ? ? 1_555 C DT 8  N3 ? ? B DA  9   C DT 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21 hydrog ? ? B DA  9   N6    ? ? ? 1_555 C DT 8  O4 ? ? B DA  9   C DT 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22 hydrog ? ? B DC  10  N3    ? ? ? 1_555 C DG 7  N1 ? ? B DC  10  C DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23 hydrog ? ? B DC  10  N4    ? ? ? 1_555 C DG 7  O6 ? ? B DC  10  C DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24 hydrog ? ? B DC  10  O2    ? ? ? 1_555 C DG 7  N2 ? ? B DC  10  C DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25 hydrog ? ? B DA  11  N1    ? ? ? 1_555 C DT 6  N3 ? ? B DA  11  C DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26 hydrog ? ? B DA  11  N6    ? ? ? 1_555 C DT 6  O4 ? ? B DA  11  C DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27 hydrog ? ? B DA  12  N1    ? ? ? 1_555 C DT 5  N3 ? ? B DA  12  C DT 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28 hydrog ? ? B DA  12  N6    ? ? ? 1_555 C DT 5  O4 ? ? B DA  12  C DT 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29 hydrog ? ? B DC  13  N3    ? ? ? 1_555 C DG 4  N1 ? ? B DC  13  C DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30 hydrog ? ? B DC  13  N4    ? ? ? 1_555 C DG 4  O6 ? ? B DC  13  C DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31 hydrog ? ? B DC  13  O2    ? ? ? 1_555 C DG 4  N2 ? ? B DC  13  C DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32 hydrog ? ? B DA  14  N1    ? ? ? 1_555 C DT 3  N3 ? ? B DA  14  C DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33 hydrog ? ? B DA  14  N6    ? ? ? 1_555 C DT 3  O4 ? ? B DA  14  C DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34 hydrog ? ? B DA  15  N1    ? ? ? 1_555 C DT 2  N3 ? ? B DA  15  C DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35 hydrog ? ? B DA  15  N6    ? ? ? 1_555 C DT 2  O4 ? ? B DA  15  C DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36 hydrog ? ? B DG  16  N2    ? ? ? 1_555 C DC 1  N3 ? ? B DG  16  C DC 1   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog37 hydrog ? ? C DT  20  N3    ? ? ? 1_555 D DG 6  O6 ? ? C DT  20  D DG 5   1_555 ? ? ? ? ? ? 'DT-DG MISPAIR' ?     ? 
hydrog38 hydrog ? ? C DT  20  N3    ? ? ? 1_555 D DA 7  N1 ? ? C DT  20  D DA 6   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog39 hydrog ? ? C DC  21  N3    ? ? ? 1_555 D DG 6  N1 ? ? C DC  21  D DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40 hydrog ? ? C DC  21  N4    ? ? ? 1_555 D DG 6  O6 ? ? C DC  21  D DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41 hydrog ? ? C DC  21  O2    ? ? ? 1_555 D DG 6  N2 ? ? C DC  21  D DG 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42 hydrog ? ? C DA  22  N1    ? ? ? 1_555 D DT 5  N3 ? ? C DA  22  D DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43 hydrog ? ? C DA  22  N6    ? ? ? 1_555 D DT 5  O4 ? ? C DA  22  D DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44 hydrog ? ? C DC  23  N3    ? ? ? 1_555 D DG 4  N1 ? ? C DC  23  D DG 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45 hydrog ? ? C DC  23  N4    ? ? ? 1_555 D DG 4  O6 ? ? C DC  23  D DG 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46 hydrog ? ? C DC  23  O2    ? ? ? 1_555 D DG 4  N2 ? ? C DC  23  D DG 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47 hydrog ? ? C DG  24  N1    ? ? ? 1_555 D DC 3  N3 ? ? C DG  24  D DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48 hydrog ? ? C DG  24  N2    ? ? ? 1_555 D DC 3  O2 ? ? C DG  24  D DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49 hydrog ? ? C DG  24  O6    ? ? ? 1_555 D DC 3  N4 ? ? C DG  24  D DC 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50 hydrog ? ? C DC  25  O2    ? ? ? 1_555 D DG 2  N1 ? ? C DC  25  D DG 1   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 129 ? SER A 138 ? LEU A 204 SER A 213 
AA1 2 ASN A 115 ? HIS A 124 ? ASN A 190 HIS A 199 
AA1 3 ALA A 100 ? THR A 108 ? ALA A 175 THR A 183 
AA1 4 LYS A 169 ? THR A 172 ? LYS A 244 THR A 247 
AA1 5 ILE A 186 ? ASN A 189 ? ILE A 261 ASN A 264 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ARG A 130 ? O ARG A 205 N TYR A 123 ? N TYR A 198 
AA1 2 3 O HIS A 122 ? O HIS A 197 N SER A 101 ? N SER A 176 
AA1 3 4 N ALA A 102 ? N ALA A 177 O LYS A 169 ? O LYS A 244 
AA1 4 5 N THR A 172 ? N THR A 247 O ILE A 188 ? O ILE A 263 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    CA 
_struct_site.pdbx_auth_seq_id     701 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'binding site for residue CA A 701' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 ASP A 105 ? ASP A 180 . ? 1_555 ? 
2 AC1 4 ASP A 173 ? ASP A 248 . ? 1_555 ? 
3 AC1 4 DG  C 18  ? DG  C 18  . ? 1_555 ? 
4 AC1 4 DC  D 8   ? DC  D 7   . ? 1_555 ? 
# 
_atom_sites.entry_id                    6DWY 
_atom_sites.fract_transf_matrix[1][1]   0.008239 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007388 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009689 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ARG A 1 6   ? -11.546 66.420  35.381 1.00 118.19 ? 81  ARG A N     1 
ATOM   2    C  CA    . ARG A 1 6   ? -10.542 66.800  34.394 1.00 114.79 ? 81  ARG A CA    1 
ATOM   3    C  C     . ARG A 1 6   ? -10.058 68.230  34.593 1.00 115.33 ? 81  ARG A C     1 
ATOM   4    O  O     . ARG A 1 6   ? -8.855  68.479  34.673 1.00 118.42 ? 81  ARG A O     1 
ATOM   5    C  CB    . ARG A 1 6   ? -11.092 66.638  32.978 1.00 117.15 ? 81  ARG A CB    1 
ATOM   6    C  CG    . ARG A 1 6   ? -10.271 67.366  31.928 1.00 112.30 ? 81  ARG A CG    1 
ATOM   7    C  CD    . ARG A 1 6   ? -10.318 66.640  30.602 1.00 115.10 ? 81  ARG A CD    1 
ATOM   8    N  NE    . ARG A 1 6   ? -10.098 65.207  30.777 1.00 121.72 ? 81  ARG A NE    1 
ATOM   9    C  CZ    . ARG A 1 6   ? -8.909  64.652  30.995 1.00 130.76 ? 81  ARG A CZ    1 
ATOM   10   N  NH1   . ARG A 1 6   ? -7.820  65.409  31.069 1.00 123.67 ? 81  ARG A NH1   1 
ATOM   11   N  NH2   . ARG A 1 6   ? -8.806  63.338  31.144 1.00 132.07 ? 81  ARG A NH2   1 
ATOM   12   N  N     . GLU A 1 7   ? -10.993 69.172  34.672 1.00 119.12 ? 82  GLU A N     1 
ATOM   13   C  CA    . GLU A 1 7   ? -10.620 70.570  34.841 1.00 123.51 ? 82  GLU A CA    1 
ATOM   14   C  C     . GLU A 1 7   ? -10.143 70.784  36.272 1.00 122.09 ? 82  GLU A C     1 
ATOM   15   O  O     . GLU A 1 7   ? -10.895 70.553  37.225 1.00 123.07 ? 82  GLU A O     1 
ATOM   16   C  CB    . GLU A 1 7   ? -11.806 71.475  34.515 1.00 120.87 ? 82  GLU A CB    1 
ATOM   17   C  CG    . GLU A 1 7   ? -11.445 72.760  33.780 1.00 125.71 ? 82  GLU A CG    1 
ATOM   18   C  CD    . GLU A 1 7   ? -10.575 73.691  34.604 1.00 130.11 ? 82  GLU A CD    1 
ATOM   19   O  OE1   . GLU A 1 7   ? -9.331  73.611  34.486 1.00 127.96 ? 82  GLU A OE1   1 
ATOM   20   O  OE2   . GLU A 1 7   ? -11.136 74.502  35.373 1.00 128.11 ? 82  GLU A OE2   1 
ATOM   21   N  N     . LEU A 1 8   ? -8.900  71.232  36.422 1.00 119.06 ? 83  LEU A N     1 
ATOM   22   C  CA    . LEU A 1 8   ? -8.243  71.298  37.720 1.00 114.75 ? 83  LEU A CA    1 
ATOM   23   C  C     . LEU A 1 8   ? -8.350  72.697  38.311 1.00 113.83 ? 83  LEU A C     1 
ATOM   24   O  O     . LEU A 1 8   ? -8.129  73.699  37.622 1.00 111.58 ? 83  LEU A O     1 
ATOM   25   C  CB    . LEU A 1 8   ? -6.779  70.876  37.599 1.00 111.43 ? 83  LEU A CB    1 
ATOM   26   C  CG    . LEU A 1 8   ? -6.630  69.390  37.266 1.00 112.24 ? 83  LEU A CG    1 
ATOM   27   C  CD1   . LEU A 1 8   ? -5.178  69.014  37.015 1.00 113.34 ? 83  LEU A CD1   1 
ATOM   28   C  CD2   . LEU A 1 8   ? -7.219  68.547  38.386 1.00 106.07 ? 83  LEU A CD2   1 
ATOM   29   N  N     . LYS A 1 9   ? -8.676  72.751  39.598 1.00 108.45 ? 84  LYS A N     1 
ATOM   30   C  CA    . LYS A 1 9   ? -9.063  73.993  40.247 1.00 106.92 ? 84  LYS A CA    1 
ATOM   31   C  C     . LYS A 1 9   ? -7.856  74.847  40.613 1.00 101.58 ? 84  LYS A C     1 
ATOM   32   O  O     . LYS A 1 9   ? -6.759  74.347  40.876 1.00 107.67 ? 84  LYS A O     1 
ATOM   33   C  CB    . LYS A 1 9   ? -9.882  73.696  41.502 1.00 106.86 ? 84  LYS A CB    1 
ATOM   34   C  CG    . LYS A 1 9   ? -11.019 72.729  41.250 1.00 108.56 ? 84  LYS A CG    1 
ATOM   35   C  CD    . LYS A 1 9   ? -11.843 72.485  42.495 1.00 110.16 ? 84  LYS A CD    1 
ATOM   36   C  CE    . LYS A 1 9   ? -12.814 71.348  42.258 1.00 110.40 ? 84  LYS A CE    1 
ATOM   37   N  NZ    . LYS A 1 9   ? -13.454 71.455  40.915 1.00 110.49 ? 84  LYS A NZ    1 
ATOM   38   N  N     . THR A 1 10  ? -8.081  76.152  40.632 1.00 97.26  ? 85  THR A N     1 
ATOM   39   C  CA    . THR A 1 10  ? -7.132  77.134  41.124 1.00 101.31 ? 85  THR A CA    1 
ATOM   40   C  C     . THR A 1 10  ? -7.565  77.576  42.518 1.00 99.84  ? 85  THR A C     1 
ATOM   41   O  O     . THR A 1 10  ? -8.756  77.603  42.834 1.00 104.39 ? 85  THR A O     1 
ATOM   42   C  CB    . THR A 1 10  ? -7.056  78.329  40.164 1.00 103.65 ? 85  THR A CB    1 
ATOM   43   O  OG1   . THR A 1 10  ? -6.540  77.890  38.899 1.00 100.71 ? 85  THR A OG1   1 
ATOM   44   C  CG2   . THR A 1 10  ? -6.172  79.444  40.715 1.00 100.10 ? 85  THR A CG2   1 
ATOM   45   N  N     . VAL A 1 11  ? -6.590  77.889  43.363 1.00 99.71  ? 86  VAL A N     1 
ATOM   46   C  CA    . VAL A 1 11  ? -6.856  78.301  44.735 1.00 98.74  ? 86  VAL A CA    1 
ATOM   47   C  C     . VAL A 1 11  ? -6.792  79.817  44.811 1.00 98.16  ? 86  VAL A C     1 
ATOM   48   O  O     . VAL A 1 11  ? -6.057  80.472  44.060 1.00 95.74  ? 86  VAL A O     1 
ATOM   49   C  CB    . VAL A 1 11  ? -5.875  77.658  45.736 1.00 100.80 ? 86  VAL A CB    1 
ATOM   50   C  CG1   . VAL A 1 11  ? -5.940  76.140  45.643 1.00 98.73  ? 86  VAL A CG1   1 
ATOM   51   C  CG2   . VAL A 1 11  ? -4.463  78.169  45.500 1.00 93.65  ? 86  VAL A CG2   1 
ATOM   52   N  N     . SER A 1 12  ? -7.596  80.378  45.710 1.00 97.11  ? 87  SER A N     1 
ATOM   53   C  CA    . SER A 1 12  ? -7.655  81.822  45.883 1.00 102.87 ? 87  SER A CA    1 
ATOM   54   C  C     . SER A 1 12  ? -6.268  82.390  46.164 1.00 96.99  ? 87  SER A C     1 
ATOM   55   O  O     . SER A 1 12  ? -5.425  81.749  46.795 1.00 95.25  ? 87  SER A O     1 
ATOM   56   C  CB    . SER A 1 12  ? -8.610  82.174  47.024 1.00 101.80 ? 87  SER A CB    1 
ATOM   57   O  OG    . SER A 1 12  ? -8.323  81.397  48.175 1.00 99.32  ? 87  SER A OG    1 
ATOM   58   N  N     . ALA A 1 13  ? -6.030  83.606  45.669 1.00 96.65  ? 88  ALA A N     1 
ATOM   59   C  CA    . ALA A 1 13  ? -4.749  84.262  45.901 1.00 105.89 ? 88  ALA A CA    1 
ATOM   60   C  C     . ALA A 1 13  ? -4.451  84.433  47.384 1.00 103.16 ? 88  ALA A C     1 
ATOM   61   O  O     . ALA A 1 13  ? -3.282  84.578  47.757 1.00 105.54 ? 88  ALA A O     1 
ATOM   62   C  CB    . ALA A 1 13  ? -4.715  85.621  45.199 1.00 117.02 ? 88  ALA A CB    1 
ATOM   63   N  N     . ASP A 1 14  ? -5.477  84.431  48.235 1.00 100.20 ? 89  ASP A N     1 
ATOM   64   C  CA    . ASP A 1 14  ? -5.247  84.377  49.670 1.00 103.90 ? 89  ASP A CA    1 
ATOM   65   C  C     . ASP A 1 14  ? -4.895  82.974  50.139 1.00 104.04 ? 89  ASP A C     1 
ATOM   66   O  O     . ASP A 1 14  ? -4.369  82.819  51.246 1.00 107.46 ? 89  ASP A O     1 
ATOM   67   C  CB    . ASP A 1 14  ? -6.474  84.886  50.430 1.00 105.85 ? 89  ASP A CB    1 
ATOM   68   C  CG    . ASP A 1 14  ? -6.704  86.373  50.237 1.00 111.40 ? 89  ASP A CG    1 
ATOM   69   O  OD1   . ASP A 1 14  ? -6.533  86.859  49.099 1.00 112.43 ? 89  ASP A OD1   1 
ATOM   70   O  OD2   . ASP A 1 14  ? -7.052  87.055  51.224 1.00 112.93 ? 89  ASP A OD2   1 
ATOM   71   N  N     . CYS A 1 15  ? -5.188  81.951  49.332 1.00 98.18  ? 90  CYS A N     1 
ATOM   72   C  CA    . CYS A 1 15  ? -4.778  80.595  49.680 1.00 98.42  ? 90  CYS A CA    1 
ATOM   73   C  C     . CYS A 1 15  ? -3.319  80.332  49.310 1.00 103.49 ? 90  CYS A C     1 
ATOM   74   O  O     . CYS A 1 15  ? -2.589  79.704  50.084 1.00 105.18 ? 90  CYS A O     1 
ATOM   75   C  CB    . CYS A 1 15  ? -5.696  79.574  49.009 1.00 99.71  ? 90  CYS A CB    1 
ATOM   76   S  SG    . CYS A 1 15  ? -5.189  77.864  49.276 1.00 98.62  ? 90  CYS A SG    1 
ATOM   77   N  N     . LYS A 1 16  ? -2.871  80.799  48.138 1.00 101.91 ? 91  LYS A N     1 
ATOM   78   C  CA    . LYS A 1 16  ? -1.478  80.574  47.755 1.00 95.22  ? 91  LYS A CA    1 
ATOM   79   C  C     . LYS A 1 16  ? -0.524  81.410  48.601 1.00 94.38  ? 91  LYS A C     1 
ATOM   80   O  O     . LYS A 1 16  ? 0.607   80.984  48.857 1.00 98.42  ? 91  LYS A O     1 
ATOM   81   C  CB    . LYS A 1 16  ? -1.276  80.869  46.266 1.00 94.71  ? 91  LYS A CB    1 
ATOM   82   C  CG    . LYS A 1 16  ? -0.909  82.310  45.952 1.00 95.61  ? 91  LYS A CG    1 
ATOM   83   C  CD    . LYS A 1 16  ? -0.717  82.515  44.463 1.00 99.59  ? 91  LYS A CD    1 
ATOM   84   C  CE    . LYS A 1 16  ? -0.502  83.982  44.134 1.00 103.88 ? 91  LYS A CE    1 
ATOM   85   N  NZ    . LYS A 1 16  ? -0.543  84.223  42.663 1.00 103.79 ? 91  LYS A NZ    1 
ATOM   86   N  N     . LYS A 1 17  ? -0.960  82.591  49.049 1.00 96.54  ? 92  LYS A N     1 
ATOM   87   C  CA    . LYS A 1 17  ? -0.151  83.388  49.965 1.00 94.66  ? 92  LYS A CA    1 
ATOM   88   C  C     . LYS A 1 17  ? 0.152   82.618  51.244 1.00 96.46  ? 92  LYS A C     1 
ATOM   89   O  O     . LYS A 1 17  ? 1.172   82.869  51.897 1.00 90.83  ? 92  LYS A O     1 
ATOM   90   C  CB    . LYS A 1 17  ? -0.870  84.706  50.269 1.00 99.51  ? 92  LYS A CB    1 
ATOM   91   C  CG    . LYS A 1 17  ? -0.270  85.549  51.391 1.00 101.97 ? 92  LYS A CG    1 
ATOM   92   C  CD    . LYS A 1 17  ? 1.150   85.998  51.073 1.00 108.79 ? 92  LYS A CD    1 
ATOM   93   C  CE    . LYS A 1 17  ? 1.699   86.936  52.146 1.00 109.27 ? 92  LYS A CE    1 
ATOM   94   N  NZ    . LYS A 1 17  ? 0.929   88.211  52.234 1.00 106.16 ? 92  LYS A NZ    1 
ATOM   95   N  N     . GLU A 1 18  ? -0.716  81.673  51.612 1.00 98.16  ? 93  GLU A N     1 
ATOM   96   C  CA    . GLU A 1 18  ? -0.430  80.805  52.749 1.00 96.98  ? 93  GLU A CA    1 
ATOM   97   C  C     . GLU A 1 18  ? 0.619   79.765  52.384 1.00 100.55 ? 93  GLU A C     1 
ATOM   98   O  O     . GLU A 1 18  ? 1.596   79.571  53.116 1.00 108.04 ? 93  GLU A O     1 
ATOM   99   C  CB    . GLU A 1 18  ? -1.710  80.124  53.226 1.00 100.20 ? 93  GLU A CB    1 
ATOM   100  C  CG    . GLU A 1 18  ? -1.581  79.396  54.553 1.00 99.97  ? 93  GLU A CG    1 
ATOM   101  C  CD    . GLU A 1 18  ? -1.818  80.308  55.739 1.00 114.15 ? 93  GLU A CD    1 
ATOM   102  O  OE1   . GLU A 1 18  ? -0.826  80.765  56.346 1.00 113.08 ? 93  GLU A OE1   1 
ATOM   103  O  OE2   . GLU A 1 18  ? -2.999  80.575  56.056 1.00 124.10 ? 93  GLU A OE2   1 
ATOM   104  N  N     . ALA A 1 19  ? 0.434   79.091  51.245 1.00 96.90  ? 94  ALA A N     1 
ATOM   105  C  CA    . ALA A 1 19  ? 1.395   78.079  50.817 1.00 97.07  ? 94  ALA A CA    1 
ATOM   106  C  C     . ALA A 1 19  ? 2.795   78.666  50.678 1.00 94.67  ? 94  ALA A C     1 
ATOM   107  O  O     . ALA A 1 19  ? 3.784   78.030  51.059 1.00 94.86  ? 94  ALA A O     1 
ATOM   108  C  CB    . ALA A 1 19  ? 0.940   77.450  49.499 1.00 90.96  ? 94  ALA A CB    1 
ATOM   109  N  N     . ILE A 1 20  ? 2.897   79.891  50.156 1.00 97.33  ? 95  ILE A N     1 
ATOM   110  C  CA    . ILE A 1 20  ? 4.206   80.496  49.937 1.00 93.96  ? 95  ILE A CA    1 
ATOM   111  C  C     . ILE A 1 20  ? 4.898   80.796  51.264 1.00 94.89  ? 95  ILE A C     1 
ATOM   112  O  O     . ILE A 1 20  ? 6.131   80.754  51.347 1.00 88.05  ? 95  ILE A O     1 
ATOM   113  C  CB    . ILE A 1 20  ? 4.068   81.755  49.055 1.00 88.44  ? 95  ILE A CB    1 
ATOM   114  C  CG1   . ILE A 1 20  ? 5.405   82.132  48.428 1.00 101.34 ? 95  ILE A CG1   1 
ATOM   115  C  CG2   . ILE A 1 20  ? 3.554   82.940  49.848 1.00 96.56  ? 95  ILE A CG2   1 
ATOM   116  C  CD1   . ILE A 1 20  ? 5.351   83.445  47.664 1.00 110.66 ? 95  ILE A CD1   1 
ATOM   117  N  N     . GLU A 1 21  ? 4.138   81.109  52.316 1.00 100.19 ? 96  GLU A N     1 
ATOM   118  C  CA    . GLU A 1 21  ? 4.735   81.312  53.630 1.00 101.66 ? 96  GLU A CA    1 
ATOM   119  C  C     . GLU A 1 21  ? 4.715   80.063  54.500 1.00 99.88  ? 96  GLU A C     1 
ATOM   120  O  O     . GLU A 1 21  ? 5.375   80.051  55.546 1.00 101.50 ? 96  GLU A O     1 
ATOM   121  C  CB    . GLU A 1 21  ? 4.037   82.463  54.367 1.00 108.34 ? 96  GLU A CB    1 
ATOM   122  C  CG    . GLU A 1 21  ? 2.572   82.218  54.677 1.00 106.52 ? 96  GLU A CG    1 
ATOM   123  C  CD    . GLU A 1 21  ? 1.893   83.427  55.296 1.00 109.27 ? 96  GLU A CD    1 
ATOM   124  O  OE1   . GLU A 1 21  ? 2.603   84.311  55.826 1.00 109.97 ? 96  GLU A OE1   1 
ATOM   125  O  OE2   . GLU A 1 21  ? 0.646   83.493  55.247 1.00 111.08 ? 96  GLU A OE2   1 
ATOM   126  N  N     . LYS A 1 22  ? 3.975   79.021  54.107 1.00 94.35  ? 97  LYS A N     1 
ATOM   127  C  CA    . LYS A 1 22  ? 4.086   77.738  54.797 1.00 96.64  ? 97  LYS A CA    1 
ATOM   128  C  C     . LYS A 1 22  ? 5.273   76.934  54.283 1.00 93.38  ? 97  LYS A C     1 
ATOM   129  O  O     . LYS A 1 22  ? 5.998   76.317  55.073 1.00 92.24  ? 97  LYS A O     1 
ATOM   130  C  CB    . LYS A 1 22  ? 2.791   76.934  54.650 1.00 96.81  ? 97  LYS A CB    1 
ATOM   131  C  CG    . LYS A 1 22  ? 1.626   77.435  55.507 1.00 105.65 ? 97  LYS A CG    1 
ATOM   132  C  CD    . LYS A 1 22  ? 1.800   77.103  56.992 1.00 108.53 ? 97  LYS A CD    1 
ATOM   133  C  CE    . LYS A 1 22  ? 2.294   78.300  57.807 1.00 109.25 ? 97  LYS A CE    1 
ATOM   134  N  NZ    . LYS A 1 22  ? 1.355   79.459  57.771 1.00 110.10 ? 97  LYS A NZ    1 
ATOM   135  N  N     . CYS A 1 23  ? 5.483   76.929  52.964 1.00 90.52  ? 98  CYS A N     1 
ATOM   136  C  CA    . CYS A 1 23  ? 6.651   76.260  52.403 1.00 84.87  ? 98  CYS A CA    1 
ATOM   137  C  C     . CYS A 1 23  ? 7.939   76.885  52.919 1.00 85.22  ? 98  CYS A C     1 
ATOM   138  O  O     . CYS A 1 23  ? 8.926   76.183  53.165 1.00 85.02  ? 98  CYS A O     1 
ATOM   139  C  CB    . CYS A 1 23  ? 6.603   76.314  50.877 1.00 81.32  ? 98  CYS A CB    1 
ATOM   140  S  SG    . CYS A 1 23  ? 5.207   75.432  50.141 1.00 94.08  ? 98  CYS A SG    1 
ATOM   141  N  N     . ALA A 1 24  ? 7.947   78.207  53.096 1.00 87.15  ? 99  ALA A N     1 
ATOM   142  C  CA    . ALA A 1 24  ? 9.125   78.865  53.645 1.00 84.48  ? 99  ALA A CA    1 
ATOM   143  C  C     . ALA A 1 24  ? 9.413   78.398  55.063 1.00 83.35  ? 99  ALA A C     1 
ATOM   144  O  O     . ALA A 1 24  ? 10.576  78.339  55.471 1.00 84.07  ? 99  ALA A O     1 
ATOM   145  C  CB    . ALA A 1 24  ? 8.948   80.383  53.609 1.00 87.16  ? 99  ALA A CB    1 
ATOM   146  N  N     . GLN A 1 25  ? 8.376   78.059  55.828 1.00 89.46  ? 100 GLN A N     1 
ATOM   147  C  CA    . GLN A 1 25  ? 8.605   77.531  57.168 1.00 91.43  ? 100 GLN A CA    1 
ATOM   148  C  C     . GLN A 1 25  ? 9.303   76.180  57.112 1.00 86.39  ? 100 GLN A C     1 
ATOM   149  O  O     . GLN A 1 25  ? 10.162  75.882  57.953 1.00 83.94  ? 100 GLN A O     1 
ATOM   150  C  CB    . GLN A 1 25  ? 7.282   77.427  57.926 1.00 97.33  ? 100 GLN A CB    1 
ATOM   151  C  CG    . GLN A 1 25  ? 6.739   78.765  58.399 1.00 98.55  ? 100 GLN A CG    1 
ATOM   152  C  CD    . GLN A 1 25  ? 6.100   78.671  59.767 1.00 109.95 ? 100 GLN A CD    1 
ATOM   153  O  OE1   . GLN A 1 25  ? 6.126   77.615  60.404 1.00 105.06 ? 100 GLN A OE1   1 
ATOM   154  N  NE2   . GLN A 1 25  ? 5.521   79.775  60.229 1.00 113.96 ? 100 GLN A NE2   1 
ATOM   155  N  N     . TRP A 1 26  ? 8.941   75.351  56.131 1.00 84.81  ? 101 TRP A N     1 
ATOM   156  C  CA    . TRP A 1 26  ? 9.612   74.071  55.933 1.00 78.59  ? 101 TRP A CA    1 
ATOM   157  C  C     . TRP A 1 26  ? 11.110  74.265  55.770 1.00 78.55  ? 101 TRP A C     1 
ATOM   158  O  O     . TRP A 1 26  ? 11.907  73.752  56.563 1.00 84.49  ? 101 TRP A O     1 
ATOM   159  C  CB    . TRP A 1 26  ? 9.041   73.361  54.710 1.00 77.94  ? 101 TRP A CB    1 
ATOM   160  C  CG    . TRP A 1 26  ? 9.650   72.026  54.463 1.00 65.63  ? 101 TRP A CG    1 
ATOM   161  C  CD1   . TRP A 1 26  ? 10.086  71.139  55.398 1.00 68.61  ? 101 TRP A CD1   1 
ATOM   162  C  CD2   . TRP A 1 26  ? 9.893   71.421  53.191 1.00 58.54  ? 101 TRP A CD2   1 
ATOM   163  N  NE1   . TRP A 1 26  ? 10.581  70.011  54.788 1.00 69.04  ? 101 TRP A NE1   1 
ATOM   164  C  CE2   . TRP A 1 26  ? 10.472  70.162  53.431 1.00 61.49  ? 101 TRP A CE2   1 
ATOM   165  C  CE3   . TRP A 1 26  ? 9.672   71.821  51.871 1.00 59.60  ? 101 TRP A CE3   1 
ATOM   166  C  CZ2   . TRP A 1 26  ? 10.838  69.302  52.400 1.00 60.01  ? 101 TRP A CZ2   1 
ATOM   167  C  CZ3   . TRP A 1 26  ? 10.032  70.966  50.850 1.00 58.70  ? 101 TRP A CZ3   1 
ATOM   168  C  CH2   . TRP A 1 26  ? 10.607  69.721  51.119 1.00 59.31  ? 101 TRP A CH2   1 
ATOM   169  N  N     . VAL A 1 27  ? 11.500  75.008  54.730 1.00 78.03  ? 102 VAL A N     1 
ATOM   170  C  CA    . VAL A 1 27  ? 12.906  75.139  54.348 1.00 77.21  ? 102 VAL A CA    1 
ATOM   171  C  C     . VAL A 1 27  ? 13.771  75.525  55.543 1.00 75.41  ? 102 VAL A C     1 
ATOM   172  O  O     . VAL A 1 27  ? 14.796  74.890  55.814 1.00 77.49  ? 102 VAL A O     1 
ATOM   173  C  CB    . VAL A 1 27  ? 13.047  76.148  53.193 1.00 74.25  ? 102 VAL A CB    1 
ATOM   174  C  CG1   . VAL A 1 27  ? 14.358  76.909  53.292 1.00 75.25  ? 102 VAL A CG1   1 
ATOM   175  C  CG2   . VAL A 1 27  ? 12.958  75.428  51.856 1.00 70.40  ? 102 VAL A CG2   1 
ATOM   176  N  N     . VAL A 1 28  ? 13.364  76.554  56.290 1.00 69.95  ? 103 VAL A N     1 
ATOM   177  C  CA    . VAL A 1 28  ? 14.257  77.091  57.313 1.00 74.58  ? 103 VAL A CA    1 
ATOM   178  C  C     . VAL A 1 28  ? 14.366  76.134  58.495 1.00 77.46  ? 103 VAL A C     1 
ATOM   179  O  O     . VAL A 1 28  ? 15.449  75.958  59.064 1.00 83.26  ? 103 VAL A O     1 
ATOM   180  C  CB    . VAL A 1 28  ? 13.810  78.504  57.747 1.00 72.40  ? 103 VAL A CB    1 
ATOM   181  C  CG1   . VAL A 1 28  ? 13.366  79.310  56.544 1.00 74.40  ? 103 VAL A CG1   1 
ATOM   182  C  CG2   . VAL A 1 28  ? 12.715  78.465  58.801 1.00 80.41  ? 103 VAL A CG2   1 
ATOM   183  N  N     . ARG A 1 29  ? 13.270  75.472  58.859 1.00 71.83  ? 104 ARG A N     1 
ATOM   184  C  CA    . ARG A 1 29  ? 13.286  74.677  60.080 1.00 79.33  ? 104 ARG A CA    1 
ATOM   185  C  C     . ARG A 1 29  ? 13.987  73.341  59.873 1.00 82.94  ? 104 ARG A C     1 
ATOM   186  O  O     . ARG A 1 29  ? 14.730  72.888  60.752 1.00 82.61  ? 104 ARG A O     1 
ATOM   187  C  CB    . ARG A 1 29  ? 11.857  74.482  60.589 1.00 88.05  ? 104 ARG A CB    1 
ATOM   188  C  CG    . ARG A 1 29  ? 11.313  75.704  61.325 1.00 87.94  ? 104 ARG A CG    1 
ATOM   189  C  CD    . ARG A 1 29  ? 9.803   75.665  61.511 1.00 88.66  ? 104 ARG A CD    1 
ATOM   190  N  NE    . ARG A 1 29  ? 9.349   74.589  62.392 1.00 95.00  ? 104 ARG A NE    1 
ATOM   191  C  CZ    . ARG A 1 29  ? 9.294   74.674  63.720 1.00 94.50  ? 104 ARG A CZ    1 
ATOM   192  N  NH1   . ARG A 1 29  ? 9.680   75.784  64.337 1.00 89.41  ? 104 ARG A NH1   1 
ATOM   193  N  NH2   . ARG A 1 29  ? 8.860   73.643  64.433 1.00 90.45  ? 104 ARG A NH2   1 
ATOM   194  N  N     . ASP A 1 30  ? 13.773  72.705  58.721 1.00 81.39  ? 105 ASP A N     1 
ATOM   195  C  CA    . ASP A 1 30  ? 14.396  71.428  58.397 1.00 82.23  ? 105 ASP A CA    1 
ATOM   196  C  C     . ASP A 1 30  ? 15.657  71.567  57.551 1.00 83.39  ? 105 ASP A C     1 
ATOM   197  O  O     . ASP A 1 30  ? 16.288  70.551  57.238 1.00 82.01  ? 105 ASP A O     1 
ATOM   198  C  CB    . ASP A 1 30  ? 13.390  70.520  57.687 1.00 75.02  ? 105 ASP A CB    1 
ATOM   199  C  CG    . ASP A 1 30  ? 12.285  70.054  58.610 1.00 80.49  ? 105 ASP A CG    1 
ATOM   200  O  OD1   . ASP A 1 30  ? 12.149  70.638  59.708 1.00 76.40  ? 105 ASP A OD1   1 
ATOM   201  O  OD2   . ASP A 1 30  ? 11.555  69.109  58.239 1.00 81.34  ? 105 ASP A OD2   1 
ATOM   202  N  N     . CYS A 1 31  ? 16.033  72.790  57.171 1.00 79.49  ? 106 CYS A N     1 
ATOM   203  C  CA    . CYS A 1 31  ? 17.276  73.046  56.441 1.00 79.25  ? 106 CYS A CA    1 
ATOM   204  C  C     . CYS A 1 31  ? 17.300  72.308  55.102 1.00 74.21  ? 106 CYS A C     1 
ATOM   205  O  O     . CYS A 1 31  ? 18.300  71.691  54.729 1.00 78.40  ? 106 CYS A O     1 
ATOM   206  C  CB    . CYS A 1 31  ? 18.497  72.682  57.291 1.00 79.45  ? 106 CYS A CB    1 
ATOM   207  S  SG    . CYS A 1 31  ? 19.956  73.706  56.981 1.00 77.57  ? 106 CYS A SG    1 
ATOM   208  N  N     . ARG A 1 32  ? 16.182  72.350  54.382 1.00 65.45  ? 107 ARG A N     1 
ATOM   209  C  CA    . ARG A 1 32  ? 16.079  71.745  53.064 1.00 63.55  ? 107 ARG A CA    1 
ATOM   210  C  C     . ARG A 1 32  ? 16.412  72.753  51.971 1.00 64.37  ? 107 ARG A C     1 
ATOM   211  O  O     . ARG A 1 32  ? 16.382  73.966  52.198 1.00 66.86  ? 107 ARG A O     1 
ATOM   212  C  CB    . ARG A 1 32  ? 14.679  71.187  52.861 1.00 65.28  ? 107 ARG A CB    1 
ATOM   213  C  CG    . ARG A 1 32  ? 14.199  70.359  54.033 1.00 68.07  ? 107 ARG A CG    1 
ATOM   214  C  CD    . ARG A 1 32  ? 14.789  68.964  54.037 1.00 65.99  ? 107 ARG A CD    1 
ATOM   215  N  NE    . ARG A 1 32  ? 14.388  68.248  55.242 1.00 75.05  ? 107 ARG A NE    1 
ATOM   216  C  CZ    . ARG A 1 32  ? 15.233  67.745  56.134 1.00 78.94  ? 107 ARG A CZ    1 
ATOM   217  N  NH1   . ARG A 1 32  ? 16.541  67.855  55.946 1.00 75.37  ? 107 ARG A NH1   1 
ATOM   218  N  NH2   . ARG A 1 32  ? 14.770  67.118  57.208 1.00 79.95  ? 107 ARG A NH2   1 
ATOM   219  N  N     . PRO A 1 33  ? 16.757  72.285  50.773 1.00 59.40  ? 108 PRO A N     1 
ATOM   220  C  CA    . PRO A 1 33  ? 17.003  73.214  49.664 1.00 62.72  ? 108 PRO A CA    1 
ATOM   221  C  C     . PRO A 1 33  ? 15.719  73.870  49.178 1.00 70.78  ? 108 PRO A C     1 
ATOM   222  O  O     . PRO A 1 33  ? 14.606  73.413  49.444 1.00 73.77  ? 108 PRO A O     1 
ATOM   223  C  CB    . PRO A 1 33  ? 17.606  72.323  48.571 1.00 65.09  ? 108 PRO A CB    1 
ATOM   224  C  CG    . PRO A 1 33  ? 18.040  71.076  49.270 1.00 69.10  ? 108 PRO A CG    1 
ATOM   225  C  CD    . PRO A 1 33  ? 17.080  70.899  50.401 1.00 68.92  ? 108 PRO A CD    1 
ATOM   226  N  N     . PHE A 1 34  ? 15.898  74.967  48.439 1.00 74.24  ? 109 PHE A N     1 
ATOM   227  C  CA    . PHE A 1 34  ? 14.757  75.643  47.830 1.00 73.74  ? 109 PHE A CA    1 
ATOM   228  C  C     . PHE A 1 34  ? 14.138  74.811  46.715 1.00 75.13  ? 109 PHE A C     1 
ATOM   229  O  O     . PHE A 1 34  ? 12.925  74.882  46.494 1.00 81.92  ? 109 PHE A O     1 
ATOM   230  C  CB    . PHE A 1 34  ? 15.175  77.009  47.284 1.00 74.03  ? 109 PHE A CB    1 
ATOM   231  C  CG    . PHE A 1 34  ? 15.568  77.997  48.344 1.00 78.41  ? 109 PHE A CG    1 
ATOM   232  C  CD1   . PHE A 1 34  ? 16.613  78.884  48.129 1.00 78.56  ? 109 PHE A CD1   1 
ATOM   233  C  CD2   . PHE A 1 34  ? 14.889  78.051  49.549 1.00 74.87  ? 109 PHE A CD2   1 
ATOM   234  C  CE1   . PHE A 1 34  ? 16.979  79.806  49.101 1.00 74.35  ? 109 PHE A CE1   1 
ATOM   235  C  CE2   . PHE A 1 34  ? 15.251  78.970  50.526 1.00 76.06  ? 109 PHE A CE2   1 
ATOM   236  C  CZ    . PHE A 1 34  ? 16.299  79.847  50.301 1.00 72.03  ? 109 PHE A CZ    1 
ATOM   237  N  N     . SER A 1 35  ? 14.935  74.008  46.017 1.00 71.93  ? 110 SER A N     1 
ATOM   238  C  CA    . SER A 1 35  ? 14.434  73.284  44.856 1.00 72.73  ? 110 SER A CA    1 
ATOM   239  C  C     . SER A 1 35  ? 13.692  72.015  45.239 1.00 74.04  ? 110 SER A C     1 
ATOM   240  O  O     . SER A 1 35  ? 13.280  71.262  44.350 1.00 78.10  ? 110 SER A O     1 
ATOM   241  C  CB    . SER A 1 35  ? 15.583  72.947  43.901 1.00 72.33  ? 110 SER A CB    1 
ATOM   242  O  OG    . SER A 1 35  ? 16.527  72.088  44.519 1.00 71.81  ? 110 SER A OG    1 
ATOM   243  N  N     . ALA A 1 36  ? 13.531  71.753  46.537 1.00 69.61  ? 111 ALA A N     1 
ATOM   244  C  CA    . ALA A 1 36  ? 12.723  70.618  46.964 1.00 72.64  ? 111 ALA A CA    1 
ATOM   245  C  C     . ALA A 1 36  ? 11.291  70.736  46.457 1.00 74.45  ? 111 ALA A C     1 
ATOM   246  O  O     . ALA A 1 36  ? 10.677  69.730  46.082 1.00 75.36  ? 111 ALA A O     1 
ATOM   247  C  CB    . ALA A 1 36  ? 12.746  70.508  48.486 1.00 73.33  ? 111 ALA A CB    1 
ATOM   248  N  N     . VAL A 1 37  ? 10.749  71.958  46.422 1.00 74.28  ? 112 VAL A N     1 
ATOM   249  C  CA    . VAL A 1 37  ? 9.355   72.145  46.025 1.00 76.69  ? 112 VAL A CA    1 
ATOM   250  C  C     . VAL A 1 37  ? 9.154   71.782  44.562 1.00 79.42  ? 112 VAL A C     1 
ATOM   251  O  O     . VAL A 1 37  ? 8.143   71.172  44.196 1.00 87.03  ? 112 VAL A O     1 
ATOM   252  C  CB    . VAL A 1 37  ? 8.891   73.586  46.310 1.00 73.38  ? 112 VAL A CB    1 
ATOM   253  C  CG1   . VAL A 1 37  ? 8.748   73.802  47.801 1.00 78.66  ? 112 VAL A CG1   1 
ATOM   254  C  CG2   . VAL A 1 37  ? 9.849   74.597  45.704 1.00 70.51  ? 112 VAL A CG2   1 
ATOM   255  N  N     . SER A 1 38  ? 10.101  72.141  43.706 1.00 75.18  ? 113 SER A N     1 
ATOM   256  C  CA    . SER A 1 38  ? 9.943   71.887  42.283 1.00 75.52  ? 113 SER A CA    1 
ATOM   257  C  C     . SER A 1 38  ? 10.381  70.489  41.880 1.00 74.45  ? 113 SER A C     1 
ATOM   258  O  O     . SER A 1 38  ? 10.342  70.171  40.687 1.00 77.60  ? 113 SER A O     1 
ATOM   259  C  CB    . SER A 1 38  ? 10.711  72.933  41.477 1.00 77.80  ? 113 SER A CB    1 
ATOM   260  O  OG    . SER A 1 38  ? 11.896  73.315  42.150 1.00 89.01  ? 113 SER A OG    1 
ATOM   261  N  N     . GLY A 1 39  ? 10.799  69.657  42.830 1.00 75.89  ? 114 GLY A N     1 
ATOM   262  C  CA    . GLY A 1 39  ? 11.174  68.293  42.497 1.00 84.62  ? 114 GLY A CA    1 
ATOM   263  C  C     . GLY A 1 39  ? 9.961   67.465  42.106 1.00 84.03  ? 114 GLY A C     1 
ATOM   264  O  O     . GLY A 1 39  ? 8.902   67.540  42.733 1.00 83.27  ? 114 GLY A O     1 
ATOM   265  N  N     . SER A 1 40  ? 10.128  66.659  41.052 1.00 80.12  ? 115 SER A N     1 
ATOM   266  C  CA    . SER A 1 40  ? 8.997   65.914  40.505 1.00 78.83  ? 115 SER A CA    1 
ATOM   267  C  C     . SER A 1 40  ? 8.424   64.944  41.530 1.00 78.11  ? 115 SER A C     1 
ATOM   268  O  O     . SER A 1 40  ? 7.202   64.840  41.682 1.00 80.67  ? 115 SER A O     1 
ATOM   269  C  CB    . SER A 1 40  ? 9.417   65.175  39.232 1.00 76.35  ? 115 SER A CB    1 
ATOM   270  O  OG    . SER A 1 40  ? 10.345  64.146  39.518 1.00 93.10  ? 115 SER A OG    1 
ATOM   271  N  N     . GLY A 1 41  ? 9.289   64.234  42.252 1.00 81.04  ? 116 GLY A N     1 
ATOM   272  C  CA    . GLY A 1 41  ? 8.801   63.317  43.267 1.00 81.98  ? 116 GLY A CA    1 
ATOM   273  C  C     . GLY A 1 41  ? 8.031   64.025  44.364 1.00 81.28  ? 116 GLY A C     1 
ATOM   274  O  O     . GLY A 1 41  ? 7.002   63.534  44.833 1.00 81.76  ? 116 GLY A O     1 
ATOM   275  N  N     . PHE A 1 42  ? 8.513   65.197  44.781 1.00 77.36  ? 117 PHE A N     1 
ATOM   276  C  CA    . PHE A 1 42  ? 7.820   65.941  45.823 1.00 75.33  ? 117 PHE A CA    1 
ATOM   277  C  C     . PHE A 1 42  ? 6.485   66.481  45.338 1.00 83.52  ? 117 PHE A C     1 
ATOM   278  O  O     . PHE A 1 42  ? 5.553   66.618  46.138 1.00 89.30  ? 117 PHE A O     1 
ATOM   279  C  CB    . PHE A 1 42  ? 8.685   67.090  46.324 1.00 77.32  ? 117 PHE A CB    1 
ATOM   280  C  CG    . PHE A 1 42  ? 7.971   68.014  47.267 1.00 70.69  ? 117 PHE A CG    1 
ATOM   281  C  CD1   . PHE A 1 42  ? 7.721   67.632  48.573 1.00 66.80  ? 117 PHE A CD1   1 
ATOM   282  C  CD2   . PHE A 1 42  ? 7.551   69.264  46.848 1.00 69.00  ? 117 PHE A CD2   1 
ATOM   283  C  CE1   . PHE A 1 42  ? 7.072   68.478  49.447 1.00 60.84  ? 117 PHE A CE1   1 
ATOM   284  C  CE2   . PHE A 1 42  ? 6.902   70.118  47.717 1.00 70.48  ? 117 PHE A CE2   1 
ATOM   285  C  CZ    . PHE A 1 42  ? 6.661   69.724  49.019 1.00 68.58  ? 117 PHE A CZ    1 
ATOM   286  N  N     . ILE A 1 43  ? 6.371   66.797  44.044 1.00 87.64  ? 118 ILE A N     1 
ATOM   287  C  CA    . ILE A 1 43  ? 5.120   67.351  43.522 1.00 88.20  ? 118 ILE A CA    1 
ATOM   288  C  C     . ILE A 1 43  ? 4.001   66.320  43.625 1.00 81.53  ? 118 ILE A C     1 
ATOM   289  O  O     . ILE A 1 43  ? 2.887   66.632  44.062 1.00 80.07  ? 118 ILE A O     1 
ATOM   290  C  CB    . ILE A 1 43  ? 5.310   67.855  42.076 1.00 86.76  ? 118 ILE A CB    1 
ATOM   291  C  CG1   . ILE A 1 43  ? 5.400   69.386  42.046 1.00 79.86  ? 118 ILE A CG1   1 
ATOM   292  C  CG2   . ILE A 1 43  ? 4.182   67.386  41.167 1.00 88.04  ? 118 ILE A CG2   1 
ATOM   293  C  CD1   . ILE A 1 43  ? 5.401   69.973  40.643 1.00 70.46  ? 118 ILE A CD1   1 
ATOM   294  N  N     . ASP A 1 44  ? 4.289   65.070  43.246 1.00 85.27  ? 119 ASP A N     1 
ATOM   295  C  CA    . ASP A 1 44  ? 3.275   64.023  43.305 1.00 80.04  ? 119 ASP A CA    1 
ATOM   296  C  C     . ASP A 1 44  ? 2.870   63.715  44.739 1.00 81.60  ? 119 ASP A C     1 
ATOM   297  O  O     . ASP A 1 44  ? 1.707   63.384  44.996 1.00 85.73  ? 119 ASP A O     1 
ATOM   298  C  CB    . ASP A 1 44  ? 3.786   62.755  42.617 1.00 82.11  ? 119 ASP A CB    1 
ATOM   299  C  CG    . ASP A 1 44  ? 4.395   63.034  41.245 1.00 87.95  ? 119 ASP A CG    1 
ATOM   300  O  OD1   . ASP A 1 44  ? 3.995   64.026  40.598 1.00 84.71  ? 119 ASP A OD1   1 
ATOM   301  O  OD2   . ASP A 1 44  ? 5.276   62.257  40.814 1.00 93.09  ? 119 ASP A OD2   1 
ATOM   302  N  N     . MET A 1 45  ? 3.805   63.822  45.686 1.00 85.85  ? 120 MET A N     1 
ATOM   303  C  CA    . MET A 1 45  ? 3.476   63.498  47.070 1.00 85.76  ? 120 MET A CA    1 
ATOM   304  C  C     . MET A 1 45  ? 2.472   64.483  47.651 1.00 83.67  ? 120 MET A C     1 
ATOM   305  O  O     . MET A 1 45  ? 1.666   64.108  48.511 1.00 88.82  ? 120 MET A O     1 
ATOM   306  C  CB    . MET A 1 45  ? 4.740   63.461  47.931 1.00 84.53  ? 120 MET A CB    1 
ATOM   307  C  CG    . MET A 1 45  ? 4.515   62.828  49.299 1.00 86.52  ? 120 MET A CG    1 
ATOM   308  S  SD    . MET A 1 45  ? 5.867   63.066  50.467 1.00 80.81  ? 120 MET A SD    1 
ATOM   309  C  CE    . MET A 1 45  ? 5.827   64.846  50.674 1.00 71.40  ? 120 MET A CE    1 
ATOM   310  N  N     . ILE A 1 46  ? 2.490   65.734  47.190 1.00 83.41  ? 121 ILE A N     1 
ATOM   311  C  CA    . ILE A 1 46  ? 1.549   66.725  47.705 1.00 88.28  ? 121 ILE A CA    1 
ATOM   312  C  C     . ILE A 1 46  ? 0.144   66.464  47.172 1.00 85.59  ? 121 ILE A C     1 
ATOM   313  O  O     . ILE A 1 46  ? -0.846  66.609  47.900 1.00 83.98  ? 121 ILE A O     1 
ATOM   314  C  CB    . ILE A 1 46  ? 2.041   68.145  47.372 1.00 83.28  ? 121 ILE A CB    1 
ATOM   315  C  CG1   . ILE A 1 46  ? 3.354   68.409  48.101 1.00 79.12  ? 121 ILE A CG1   1 
ATOM   316  C  CG2   . ILE A 1 46  ? 1.011   69.186  47.769 1.00 84.88  ? 121 ILE A CG2   1 
ATOM   317  C  CD1   . ILE A 1 46  ? 3.337   67.944  49.545 1.00 79.52  ? 121 ILE A CD1   1 
ATOM   318  N  N     . LYS A 1 47  ? 0.034   66.061  45.901 1.00 83.01  ? 122 LYS A N     1 
ATOM   319  C  CA    . LYS A 1 47  ? -1.258  65.695  45.328 1.00 82.63  ? 122 LYS A CA    1 
ATOM   320  C  C     . LYS A 1 47  ? -1.981  64.655  46.173 1.00 88.03  ? 122 LYS A C     1 
ATOM   321  O  O     . LYS A 1 47  ? -3.215  64.656  46.243 1.00 87.74  ? 122 LYS A O     1 
ATOM   322  C  CB    . LYS A 1 47  ? -1.068  65.163  43.906 1.00 78.49  ? 122 LYS A CB    1 
ATOM   323  C  CG    . LYS A 1 47  ? -0.526  66.170  42.917 1.00 74.41  ? 122 LYS A CG    1 
ATOM   324  C  CD    . LYS A 1 47  ? -0.465  65.560  41.530 1.00 80.69  ? 122 LYS A CD    1 
ATOM   325  C  CE    . LYS A 1 47  ? 0.063   66.551  40.512 1.00 90.61  ? 122 LYS A CE    1 
ATOM   326  N  NZ    . LYS A 1 47  ? 0.182   65.940  39.160 1.00 99.32  ? 122 LYS A NZ    1 
ATOM   327  N  N     . PHE A 1 48  ? -1.231  63.756  46.812 1.00 88.52  ? 123 PHE A N     1 
ATOM   328  C  CA    . PHE A 1 48  ? -1.836  62.728  47.649 1.00 87.48  ? 123 PHE A CA    1 
ATOM   329  C  C     . PHE A 1 48  ? -2.312  63.278  48.987 1.00 89.61  ? 123 PHE A C     1 
ATOM   330  O  O     . PHE A 1 48  ? -3.280  62.762  49.556 1.00 92.31  ? 123 PHE A O     1 
ATOM   331  C  CB    . PHE A 1 48  ? -0.842  61.589  47.876 1.00 82.29  ? 123 PHE A CB    1 
ATOM   332  C  CG    . PHE A 1 48  ? -1.197  60.701  49.032 1.00 87.14  ? 123 PHE A CG    1 
ATOM   333  C  CD1   . PHE A 1 48  ? -2.232  59.789  48.926 1.00 89.53  ? 123 PHE A CD1   1 
ATOM   334  C  CD2   . PHE A 1 48  ? -0.499  60.778  50.228 1.00 89.52  ? 123 PHE A CD2   1 
ATOM   335  C  CE1   . PHE A 1 48  ? -2.565  58.971  49.989 1.00 91.24  ? 123 PHE A CE1   1 
ATOM   336  C  CE2   . PHE A 1 48  ? -0.827  59.959  51.296 1.00 88.97  ? 123 PHE A CE2   1 
ATOM   337  C  CZ    . PHE A 1 48  ? -1.859  59.054  51.174 1.00 91.80  ? 123 PHE A CZ    1 
ATOM   338  N  N     . PHE A 1 49  ? -1.652  64.309  49.512 1.00 88.91  ? 124 PHE A N     1 
ATOM   339  C  CA    . PHE A 1 49  ? -2.043  64.823  50.818 1.00 89.05  ? 124 PHE A CA    1 
ATOM   340  C  C     . PHE A 1 49  ? -3.270  65.719  50.740 1.00 94.84  ? 124 PHE A C     1 
ATOM   341  O  O     . PHE A 1 49  ? -4.061  65.756  51.688 1.00 99.70  ? 124 PHE A O     1 
ATOM   342  C  CB    . PHE A 1 49  ? -0.874  65.560  51.465 1.00 91.06  ? 124 PHE A CB    1 
ATOM   343  C  CG    . PHE A 1 49  ? 0.142   64.640  52.073 1.00 94.37  ? 124 PHE A CG    1 
ATOM   344  C  CD1   . PHE A 1 49  ? 1.485   64.964  52.070 1.00 91.94  ? 124 PHE A CD1   1 
ATOM   345  C  CD2   . PHE A 1 49  ? -0.252  63.438  52.643 1.00 94.13  ? 124 PHE A CD2   1 
ATOM   346  C  CE1   . PHE A 1 49  ? 2.416   64.109  52.631 1.00 93.62  ? 124 PHE A CE1   1 
ATOM   347  C  CE2   . PHE A 1 49  ? 0.672   62.580  53.203 1.00 84.13  ? 124 PHE A CE2   1 
ATOM   348  C  CZ    . PHE A 1 49  ? 2.008   62.915  53.197 1.00 88.22  ? 124 PHE A CZ    1 
ATOM   349  N  N     . ILE A 1 50  ? -3.449  66.445  49.636 1.00 94.25  ? 125 ILE A N     1 
ATOM   350  C  CA    . ILE A 1 50  ? -4.730  67.105  49.420 1.00 90.02  ? 125 ILE A CA    1 
ATOM   351  C  C     . ILE A 1 50  ? -5.811  66.062  49.162 1.00 91.71  ? 125 ILE A C     1 
ATOM   352  O  O     . ILE A 1 50  ? -6.978  66.258  49.524 1.00 93.55  ? 125 ILE A O     1 
ATOM   353  C  CB    . ILE A 1 50  ? -4.619  68.121  48.269 1.00 89.41  ? 125 ILE A CB    1 
ATOM   354  C  CG1   . ILE A 1 50  ? -4.408  67.399  46.937 1.00 88.55  ? 125 ILE A CG1   1 
ATOM   355  C  CG2   . ILE A 1 50  ? -3.471  69.093  48.518 1.00 87.20  ? 125 ILE A CG2   1 
ATOM   356  C  CD1   . ILE A 1 50  ? -4.079  68.311  45.781 1.00 92.77  ? 125 ILE A CD1   1 
ATOM   357  N  N     . LYS A 1 51  ? -5.436  64.928  48.564 1.00 91.09  ? 126 LYS A N     1 
ATOM   358  C  CA    . LYS A 1 51  ? -6.392  63.862  48.285 1.00 90.43  ? 126 LYS A CA    1 
ATOM   359  C  C     . LYS A 1 51  ? -6.911  63.237  49.573 1.00 88.35  ? 126 LYS A C     1 
ATOM   360  O  O     . LYS A 1 51  ? -8.083  62.858  49.656 1.00 97.32  ? 126 LYS A O     1 
ATOM   361  C  CB    . LYS A 1 51  ? -5.728  62.812  47.391 1.00 97.47  ? 126 LYS A CB    1 
ATOM   362  C  CG    . LYS A 1 51  ? -6.562  61.593  47.026 1.00 96.61  ? 126 LYS A CG    1 
ATOM   363  C  CD    . LYS A 1 51  ? -5.818  60.768  45.973 1.00 94.89  ? 126 LYS A CD    1 
ATOM   364  C  CE    . LYS A 1 51  ? -6.554  59.490  45.595 1.00 96.57  ? 126 LYS A CE    1 
ATOM   365  N  NZ    . LYS A 1 51  ? -6.518  58.474  46.682 1.00 94.49  ? 126 LYS A NZ    1 
ATOM   366  N  N     . VAL A 1 52  ? -6.056  63.125  50.589 1.00 89.45  ? 127 VAL A N     1 
ATOM   367  C  CA    . VAL A 1 52  ? -6.500  62.602  51.876 1.00 90.65  ? 127 VAL A CA    1 
ATOM   368  C  C     . VAL A 1 52  ? -7.289  63.658  52.637 1.00 91.70  ? 127 VAL A C     1 
ATOM   369  O  O     . VAL A 1 52  ? -8.269  63.345  53.322 1.00 95.19  ? 127 VAL A O     1 
ATOM   370  C  CB    . VAL A 1 52  ? -5.295  62.088  52.689 1.00 89.60  ? 127 VAL A CB    1 
ATOM   371  C  CG1   . VAL A 1 52  ? -5.708  61.725  54.109 1.00 84.96  ? 127 VAL A CG1   1 
ATOM   372  C  CG2   . VAL A 1 52  ? -4.680  60.885  52.007 1.00 88.87  ? 127 VAL A CG2   1 
ATOM   373  N  N     . GLY A 1 53  ? -6.888  64.925  52.520 1.00 87.43  ? 128 GLY A N     1 
ATOM   374  C  CA    . GLY A 1 53  ? -7.629  65.986  53.177 1.00 94.20  ? 128 GLY A CA    1 
ATOM   375  C  C     . GLY A 1 53  ? -9.045  66.134  52.658 1.00 97.51  ? 128 GLY A C     1 
ATOM   376  O  O     . GLY A 1 53  ? -9.944  66.537  53.398 1.00 94.47  ? 128 GLY A O     1 
ATOM   377  N  N     . ALA A 1 54  ? -9.268  65.807  51.385 1.00 98.83  ? 129 ALA A N     1 
ATOM   378  C  CA    . ALA A 1 54  ? -10.613 65.868  50.826 1.00 90.48  ? 129 ALA A CA    1 
ATOM   379  C  C     . ALA A 1 54  ? -11.521 64.826  51.467 1.00 93.87  ? 129 ALA A C     1 
ATOM   380  O  O     . ALA A 1 54  ? -12.576 65.160  52.018 1.00 103.84 ? 129 ALA A O     1 
ATOM   381  C  CB    . ALA A 1 54  ? -10.560 65.681  49.309 1.00 88.54  ? 129 ALA A CB    1 
ATOM   382  N  N     . GLU A 1 55  ? -11.118 63.553  51.417 1.00 94.60  ? 130 GLU A N     1 
ATOM   383  C  CA    . GLU A 1 55  ? -11.979 62.470  51.890 1.00 101.85 ? 130 GLU A CA    1 
ATOM   384  C  C     . GLU A 1 55  ? -12.146 62.487  53.404 1.00 101.76 ? 130 GLU A C     1 
ATOM   385  O  O     . GLU A 1 55  ? -13.183 62.052  53.916 1.00 96.76  ? 130 GLU A O     1 
ATOM   386  C  CB    . GLU A 1 55  ? -11.418 61.118  51.447 1.00 101.61 ? 130 GLU A CB    1 
ATOM   387  C  CG    . GLU A 1 55  ? -11.797 60.700  50.032 1.00 107.48 ? 130 GLU A CG    1 
ATOM   388  C  CD    . GLU A 1 55  ? -11.319 61.679  48.973 1.00 110.55 ? 130 GLU A CD    1 
ATOM   389  O  OE1   . GLU A 1 55  ? -12.038 62.663  48.695 1.00 113.42 ? 130 GLU A OE1   1 
ATOM   390  O  OE2   . GLU A 1 55  ? -10.219 61.468  48.420 1.00 111.02 ? 130 GLU A OE2   1 
ATOM   391  N  N     . TYR A 1 56  ? -11.146 62.984  54.128 1.00 99.58  ? 131 TYR A N     1 
ATOM   392  C  CA    . TYR A 1 56  ? -11.100 62.941  55.586 1.00 98.20  ? 131 TYR A CA    1 
ATOM   393  C  C     . TYR A 1 56  ? -11.392 64.296  56.221 1.00 97.10  ? 131 TYR A C     1 
ATOM   394  O  O     . TYR A 1 56  ? -12.263 64.392  57.088 1.00 103.97 ? 131 TYR A O     1 
ATOM   395  C  CB    . TYR A 1 56  ? -9.757  62.378  56.052 1.00 95.40  ? 131 TYR A CB    1 
ATOM   396  C  CG    . TYR A 1 56  ? -9.620  60.895  55.766 1.00 95.14  ? 131 TYR A CG    1 
ATOM   397  C  CD1   . TYR A 1 56  ? -9.449  60.428  54.466 1.00 95.26  ? 131 TYR A CD1   1 
ATOM   398  C  CD2   . TYR A 1 56  ? -9.665  59.961  56.793 1.00 100.73 ? 131 TYR A CD2   1 
ATOM   399  C  CE1   . TYR A 1 56  ? -9.322  59.071  54.198 1.00 100.20 ? 131 TYR A CE1   1 
ATOM   400  C  CE2   . TYR A 1 56  ? -9.537  58.600  56.535 1.00 101.96 ? 131 TYR A CE2   1 
ATOM   401  C  CZ    . TYR A 1 56  ? -9.366  58.161  55.236 1.00 100.50 ? 131 TYR A CZ    1 
ATOM   402  O  OH    . TYR A 1 56  ? -9.236  56.813  54.976 1.00 92.78  ? 131 TYR A OH    1 
ATOM   403  N  N     . GLY A 1 57  ? -10.664 65.336  55.840 1.00 92.73  ? 132 GLY A N     1 
ATOM   404  C  CA    . GLY A 1 57  ? -10.961 66.678  56.297 1.00 96.51  ? 132 GLY A CA    1 
ATOM   405  C  C     . GLY A 1 57  ? -9.869  67.262  57.176 1.00 100.50 ? 132 GLY A C     1 
ATOM   406  O  O     . GLY A 1 57  ? -8.916  66.597  57.580 1.00 105.37 ? 132 GLY A O     1 
ATOM   407  N  N     . GLU A 1 58  ? -10.042 68.559  57.452 1.00 101.78 ? 133 GLU A N     1 
ATOM   408  C  CA    . GLU A 1 58  ? -9.015  69.395  58.068 1.00 103.73 ? 133 GLU A CA    1 
ATOM   409  C  C     . GLU A 1 58  ? -8.467  68.819  59.368 1.00 103.70 ? 133 GLU A C     1 
ATOM   410  O  O     . GLU A 1 58  ? -7.375  69.212  59.795 1.00 101.38 ? 133 GLU A O     1 
ATOM   411  C  CB    . GLU A 1 58  ? -9.600  70.793  58.316 1.00 110.86 ? 133 GLU A CB    1 
ATOM   412  C  CG    . GLU A 1 58  ? -8.635  71.830  58.880 1.00 110.76 ? 133 GLU A CG    1 
ATOM   413  C  CD    . GLU A 1 58  ? -9.332  73.130  59.245 1.00 110.09 ? 133 GLU A CD    1 
ATOM   414  O  OE1   . GLU A 1 58  ? -10.549 73.247  58.979 1.00 107.00 ? 133 GLU A OE1   1 
ATOM   415  O  OE2   . GLU A 1 58  ? -8.665  74.030  59.801 1.00 106.17 ? 133 GLU A OE2   1 
ATOM   416  N  N     . HIS A 1 59  ? -9.184  67.899  60.009 1.00 108.13 ? 134 HIS A N     1 
ATOM   417  C  CA    . HIS A 1 59  ? -8.741  67.307  61.266 1.00 107.46 ? 134 HIS A CA    1 
ATOM   418  C  C     . HIS A 1 59  ? -8.365  65.852  61.016 1.00 102.89 ? 134 HIS A C     1 
ATOM   419  O  O     . HIS A 1 59  ? -9.239  64.996  60.845 1.00 107.75 ? 134 HIS A O     1 
ATOM   420  C  CB    . HIS A 1 59  ? -9.829  67.429  62.330 1.00 111.95 ? 134 HIS A CB    1 
ATOM   421  C  CG    . HIS A 1 59  ? -10.411 68.806  62.438 1.00 113.00 ? 134 HIS A CG    1 
ATOM   422  N  ND1   . HIS A 1 59  ? -9.633  69.930  62.619 1.00 108.63 ? 134 HIS A ND1   1 
ATOM   423  C  CD2   . HIS A 1 59  ? -11.692 69.240  62.383 1.00 113.41 ? 134 HIS A CD2   1 
ATOM   424  C  CE1   . HIS A 1 59  ? -10.410 70.996  62.672 1.00 110.16 ? 134 HIS A CE1   1 
ATOM   425  N  NE2   . HIS A 1 59  ? -11.664 70.606  62.532 1.00 113.60 ? 134 HIS A NE2   1 
ATOM   426  N  N     . VAL A 1 60  ? -7.062  65.582  61.006 1.00 102.16 ? 135 VAL A N     1 
ATOM   427  C  CA    . VAL A 1 60  ? -6.505  64.239  60.910 1.00 101.76 ? 135 VAL A CA    1 
ATOM   428  C  C     . VAL A 1 60  ? -5.263  64.223  61.789 1.00 103.68 ? 135 VAL A C     1 
ATOM   429  O  O     . VAL A 1 60  ? -4.629  65.260  62.009 1.00 101.12 ? 135 VAL A O     1 
ATOM   430  C  CB    . VAL A 1 60  ? -6.135  63.831  59.458 1.00 95.58  ? 135 VAL A CB    1 
ATOM   431  C  CG1   . VAL A 1 60  ? -5.819  62.343  59.377 1.00 95.98  ? 135 VAL A CG1   1 
ATOM   432  C  CG2   . VAL A 1 60  ? -7.230  64.189  58.475 1.00 94.01  ? 135 VAL A CG2   1 
ATOM   433  N  N     . ASN A 1 61  ? -4.899  63.042  62.279 1.00 102.50 ? 136 ASN A N     1 
ATOM   434  C  CA    . ASN A 1 61  ? -3.683  62.904  63.071 1.00 99.33  ? 136 ASN A CA    1 
ATOM   435  C  C     . ASN A 1 61  ? -2.552  62.568  62.108 1.00 98.23  ? 136 ASN A C     1 
ATOM   436  O  O     . ASN A 1 61  ? -2.481  61.452  61.582 1.00 101.96 ? 136 ASN A O     1 
ATOM   437  C  CB    . ASN A 1 61  ? -3.840  61.830  64.144 1.00 98.67  ? 136 ASN A CB    1 
ATOM   438  C  CG    . ASN A 1 61  ? -2.875  62.019  65.300 1.00 101.63 ? 136 ASN A CG    1 
ATOM   439  O  OD1   . ASN A 1 61  ? -1.915  62.786  65.204 1.00 100.22 ? 136 ASN A OD1   1 
ATOM   440  N  ND2   . ASN A 1 61  ? -3.125  61.320  66.402 1.00 100.90 ? 136 ASN A ND2   1 
ATOM   441  N  N     . VAL A 1 62  ? -1.665  63.537  61.888 1.00 99.54  ? 137 VAL A N     1 
ATOM   442  C  CA    . VAL A 1 62  ? -0.639  63.396  60.862 1.00 95.17  ? 137 VAL A CA    1 
ATOM   443  C  C     . VAL A 1 62  ? 0.539   62.589  61.381 1.00 99.03  ? 137 VAL A C     1 
ATOM   444  O  O     . VAL A 1 62  ? 1.089   61.750  60.660 1.00 102.71 ? 137 VAL A O     1 
ATOM   445  C  CB    . VAL A 1 62  ? -0.196  64.782  60.360 1.00 94.24  ? 137 VAL A CB    1 
ATOM   446  C  CG1   . VAL A 1 62  ? 0.373   64.682  58.948 1.00 90.84  ? 137 VAL A CG1   1 
ATOM   447  C  CG2   . VAL A 1 62  ? -1.357  65.761  60.418 1.00 98.85  ? 137 VAL A CG2   1 
ATOM   448  N  N     . GLU A 1 63  ? 0.951   62.839  62.628 1.00 98.18  ? 138 GLU A N     1 
ATOM   449  C  CA    . GLU A 1 63  ? 2.083   62.116  63.201 1.00 95.24  ? 138 GLU A CA    1 
ATOM   450  C  C     . GLU A 1 63  ? 1.882   60.613  63.089 1.00 96.46  ? 138 GLU A C     1 
ATOM   451  O  O     . GLU A 1 63  ? 2.817   59.869  62.774 1.00 95.48  ? 138 GLU A O     1 
ATOM   452  C  CB    . GLU A 1 63  ? 2.282   62.522  64.663 1.00 91.59  ? 138 GLU A CB    1 
ATOM   453  C  CG    . GLU A 1 63  ? 2.793   63.945  64.863 1.00 95.06  ? 138 GLU A CG    1 
ATOM   454  C  CD    . GLU A 1 63  ? 1.720   65.000  64.646 1.00 103.86 ? 138 GLU A CD    1 
ATOM   455  O  OE1   . GLU A 1 63  ? 0.545   64.624  64.434 1.00 104.91 ? 138 GLU A OE1   1 
ATOM   456  O  OE2   . GLU A 1 63  ? 2.050   66.206  64.688 1.00 98.16  ? 138 GLU A OE2   1 
ATOM   457  N  N     . GLU A 1 64  ? 0.660   60.154  63.332 1.00 89.97  ? 139 GLU A N     1 
ATOM   458  C  CA    . GLU A 1 64  ? 0.326   58.755  63.129 1.00 99.15  ? 139 GLU A CA    1 
ATOM   459  C  C     . GLU A 1 64  ? 0.209   58.409  61.650 1.00 100.27 ? 139 GLU A C     1 
ATOM   460  O  O     . GLU A 1 64  ? 0.532   57.280  61.255 1.00 100.94 ? 139 GLU A O     1 
ATOM   461  C  CB    . GLU A 1 64  ? -0.977  58.431  63.856 1.00 96.18  ? 139 GLU A CB    1 
ATOM   462  C  CG    . GLU A 1 64  ? -1.161  56.970  64.123 1.00 99.77  ? 139 GLU A CG    1 
ATOM   463  C  CD    . GLU A 1 64  ? -2.602  56.563  64.008 1.00 103.21 ? 139 GLU A CD    1 
ATOM   464  O  OE1   . GLU A 1 64  ? -3.264  57.004  63.043 1.00 97.12  ? 139 GLU A OE1   1 
ATOM   465  O  OE2   . GLU A 1 64  ? -3.073  55.812  64.886 1.00 110.25 ? 139 GLU A OE2   1 
ATOM   466  N  N     . LEU A 1 65  ? -0.250  59.357  60.828 1.00 92.93  ? 140 LEU A N     1 
ATOM   467  C  CA    . LEU A 1 65  ? -0.329  59.120  59.390 1.00 93.91  ? 140 LEU A CA    1 
ATOM   468  C  C     . LEU A 1 65  ? 1.052   59.164  58.749 1.00 92.02  ? 140 LEU A C     1 
ATOM   469  O  O     . LEU A 1 65  ? 1.376   58.327  57.897 1.00 93.06  ? 140 LEU A O     1 
ATOM   470  C  CB    . LEU A 1 65  ? -1.258  60.152  58.745 1.00 95.80  ? 140 LEU A CB    1 
ATOM   471  C  CG    . LEU A 1 65  ? -1.516  60.171  57.224 1.00 96.32  ? 140 LEU A CG    1 
ATOM   472  C  CD1   . LEU A 1 65  ? -0.551  61.096  56.486 1.00 91.69  ? 140 LEU A CD1   1 
ATOM   473  C  CD2   . LEU A 1 65  ? -1.492  58.772  56.611 1.00 96.88  ? 140 LEU A CD2   1 
ATOM   474  N  N     . LEU A 1 66  ? 1.869   60.130  59.140 1.00 87.96  ? 141 LEU A N     1 
ATOM   475  C  CA    . LEU A 1 66  ? 3.206   60.265  58.583 1.00 84.91  ? 141 LEU A CA    1 
ATOM   476  C  C     . LEU A 1 66  ? 4.094   59.144  59.098 1.00 90.04  ? 141 LEU A C     1 
ATOM   477  O  O     . LEU A 1 66  ? 4.222   58.978  60.319 1.00 91.63  ? 141 LEU A O     1 
ATOM   478  C  CB    . LEU A 1 66  ? 3.801   61.623  58.940 1.00 83.72  ? 141 LEU A CB    1 
ATOM   479  C  CG    . LEU A 1 66  ? 3.265   62.796  58.115 1.00 82.40  ? 141 LEU A CG    1 
ATOM   480  C  CD1   . LEU A 1 66  ? 4.051   64.073  58.382 1.00 82.47  ? 141 LEU A CD1   1 
ATOM   481  C  CD2   . LEU A 1 66  ? 3.279   62.437  56.636 1.00 81.38  ? 141 LEU A CD2   1 
ATOM   482  N  N     . PRO A 1 67  ? 4.706   58.350  58.223 1.00 84.71  ? 142 PRO A N     1 
ATOM   483  C  CA    . PRO A 1 67  ? 5.563   57.263  58.693 1.00 79.21  ? 142 PRO A CA    1 
ATOM   484  C  C     . PRO A 1 67  ? 6.817   57.818  59.339 1.00 80.90  ? 142 PRO A C     1 
ATOM   485  O  O     . PRO A 1 67  ? 7.194   58.974  59.138 1.00 83.68  ? 142 PRO A O     1 
ATOM   486  C  CB    . PRO A 1 67  ? 5.894   56.493  57.411 1.00 79.47  ? 142 PRO A CB    1 
ATOM   487  C  CG    . PRO A 1 67  ? 5.812   57.525  56.340 1.00 77.39  ? 142 PRO A CG    1 
ATOM   488  C  CD    . PRO A 1 67  ? 4.710   58.461  56.754 1.00 84.51  ? 142 PRO A CD    1 
ATOM   489  N  N     . SER A 1 68  ? 7.448   56.983  60.146 1.00 83.01  ? 143 SER A N     1 
ATOM   490  C  CA    . SER A 1 68  ? 8.768   57.334  60.633 1.00 77.17  ? 143 SER A CA    1 
ATOM   491  C  C     . SER A 1 68  ? 9.807   56.992  59.568 1.00 80.43  ? 143 SER A C     1 
ATOM   492  O  O     . SER A 1 68  ? 9.593   56.088  58.755 1.00 81.53  ? 143 SER A O     1 
ATOM   493  C  CB    . SER A 1 68  ? 9.080   56.590  61.928 1.00 74.48  ? 143 SER A CB    1 
ATOM   494  O  OG    . SER A 1 68  ? 9.075   55.189  61.722 1.00 75.74  ? 143 SER A OG    1 
ATOM   495  N  N     . PRO A 1 69  ? 10.927  57.718  59.537 1.00 78.86  ? 144 PRO A N     1 
ATOM   496  C  CA    . PRO A 1 69  ? 11.955  57.445  58.519 1.00 77.12  ? 144 PRO A CA    1 
ATOM   497  C  C     . PRO A 1 69  ? 12.385  55.989  58.434 1.00 76.68  ? 144 PRO A C     1 
ATOM   498  O  O     . PRO A 1 69  ? 12.700  55.512  57.335 1.00 76.45  ? 144 PRO A O     1 
ATOM   499  C  CB    . PRO A 1 69  ? 13.120  58.346  58.955 1.00 83.33  ? 144 PRO A CB    1 
ATOM   500  C  CG    . PRO A 1 69  ? 12.763  58.840  60.344 1.00 81.15  ? 144 PRO A CG    1 
ATOM   501  C  CD    . PRO A 1 69  ? 11.281  58.871  60.377 1.00 77.06  ? 144 PRO A CD    1 
ATOM   502  N  N     . ILE A 1 70  ? 12.409  55.261  59.550 1.00 70.47  ? 145 ILE A N     1 
ATOM   503  C  CA    . ILE A 1 70  ? 12.880  53.882  59.501 1.00 72.24  ? 145 ILE A CA    1 
ATOM   504  C  C     . ILE A 1 70  ? 11.971  53.044  58.609 1.00 72.56  ? 145 ILE A C     1 
ATOM   505  O  O     . ILE A 1 70  ? 12.441  52.344  57.706 1.00 75.08  ? 145 ILE A O     1 
ATOM   506  C  CB    . ILE A 1 70  ? 13.010  53.301  60.922 1.00 69.68  ? 145 ILE A CB    1 
ATOM   507  C  CG1   . ILE A 1 70  ? 13.057  51.772  60.881 1.00 70.67  ? 145 ILE A CG1   1 
ATOM   508  C  CG2   . ILE A 1 70  ? 11.916  53.818  61.829 1.00 71.62  ? 145 ILE A CG2   1 
ATOM   509  C  CD1   . ILE A 1 70  ? 13.505  51.140  62.190 1.00 70.98  ? 145 ILE A CD1   1 
ATOM   510  N  N     . THR A 1 71  ? 10.652  53.131  58.817 1.00 77.97  ? 146 THR A N     1 
ATOM   511  C  CA    . THR A 1 71  ? 9.720   52.430  57.932 1.00 83.73  ? 146 THR A CA    1 
ATOM   512  C  C     . THR A 1 71  ? 9.855   52.889  56.490 1.00 84.64  ? 146 THR A C     1 
ATOM   513  O  O     . THR A 1 71  ? 9.464   52.158  55.573 1.00 80.15  ? 146 THR A O     1 
ATOM   514  C  CB    . THR A 1 71  ? 8.271   52.618  58.392 1.00 79.74  ? 146 THR A CB    1 
ATOM   515  O  OG1   . THR A 1 71  ? 8.187   53.744  59.276 1.00 77.97  ? 146 THR A OG1   1 
ATOM   516  C  CG2   . THR A 1 71  ? 7.767   51.360  59.091 1.00 86.56  ? 146 THR A CG2   1 
ATOM   517  N  N     . LEU A 1 72  ? 10.387  54.092  56.277 1.00 83.61  ? 147 LEU A N     1 
ATOM   518  C  CA    . LEU A 1 72  ? 10.717  54.534  54.930 1.00 79.92  ? 147 LEU A CA    1 
ATOM   519  C  C     . LEU A 1 72  ? 11.994  53.872  54.443 1.00 78.07  ? 147 LEU A C     1 
ATOM   520  O  O     . LEU A 1 72  ? 12.072  53.428  53.291 1.00 78.74  ? 147 LEU A O     1 
ATOM   521  C  CB    . LEU A 1 72  ? 10.857  56.052  54.897 1.00 74.91  ? 147 LEU A CB    1 
ATOM   522  C  CG    . LEU A 1 72  ? 9.584   56.851  54.651 1.00 71.28  ? 147 LEU A CG    1 
ATOM   523  C  CD1   . LEU A 1 72  ? 9.867   58.319  54.850 1.00 71.22  ? 147 LEU A CD1   1 
ATOM   524  C  CD2   . LEU A 1 72  ? 9.098   56.591  53.243 1.00 77.21  ? 147 LEU A CD2   1 
ATOM   525  N  N     . SER A 1 73  ? 13.002  53.795  55.311 1.00 77.19  ? 148 SER A N     1 
ATOM   526  C  CA    . SER A 1 73  ? 14.190  53.024  54.978 1.00 81.24  ? 148 SER A CA    1 
ATOM   527  C  C     . SER A 1 73  ? 13.823  51.588  54.640 1.00 81.69  ? 148 SER A C     1 
ATOM   528  O  O     . SER A 1 73  ? 14.387  50.991  53.715 1.00 80.78  ? 148 SER A O     1 
ATOM   529  C  CB    . SER A 1 73  ? 15.187  53.058  56.135 1.00 78.23  ? 148 SER A CB    1 
ATOM   530  O  OG    . SER A 1 73  ? 15.993  51.888  56.132 1.00 74.55  ? 148 SER A OG    1 
ATOM   531  N  N     . ARG A 1 74  ? 12.854  51.027  55.366 1.00 80.07  ? 149 ARG A N     1 
ATOM   532  C  CA    . ARG A 1 74  ? 12.523  49.619  55.197 1.00 82.84  ? 149 ARG A CA    1 
ATOM   533  C  C     . ARG A 1 74  ? 11.689  49.388  53.945 1.00 84.12  ? 149 ARG A C     1 
ATOM   534  O  O     . ARG A 1 74  ? 11.867  48.374  53.261 1.00 87.48  ? 149 ARG A O     1 
ATOM   535  C  CB    . ARG A 1 74  ? 11.813  49.099  56.449 1.00 72.05  ? 149 ARG A CB    1 
ATOM   536  C  CG    . ARG A 1 74  ? 12.662  49.270  57.706 1.00 71.57  ? 149 ARG A CG    1 
ATOM   537  C  CD    . ARG A 1 74  ? 12.377  48.249  58.794 1.00 59.79  ? 149 ARG A CD    1 
ATOM   538  N  NE    . ARG A 1 74  ? 11.519  48.785  59.848 1.00 66.27  ? 149 ARG A NE    1 
ATOM   539  C  CZ    . ARG A 1 74  ? 11.621  48.452  61.133 1.00 66.72  ? 149 ARG A CZ    1 
ATOM   540  N  NH1   . ARG A 1 74  ? 12.562  47.598  61.525 1.00 63.95  ? 149 ARG A NH1   1 
ATOM   541  N  NH2   . ARG A 1 74  ? 10.795  48.985  62.027 1.00 56.85  ? 149 ARG A NH2   1 
ATOM   542  N  N     . LYS A 1 75  ? 10.791  50.317  53.612 1.00 85.37  ? 150 LYS A N     1 
ATOM   543  C  CA    . LYS A 1 75  ? 10.018  50.155  52.385 1.00 89.51  ? 150 LYS A CA    1 
ATOM   544  C  C     . LYS A 1 75  ? 10.901  50.319  51.155 1.00 89.15  ? 150 LYS A C     1 
ATOM   545  O  O     . LYS A 1 75  ? 10.797  49.534  50.204 1.00 88.45  ? 150 LYS A O     1 
ATOM   546  C  CB    . LYS A 1 75  ? 8.853   51.142  52.348 1.00 84.12  ? 150 LYS A CB    1 
ATOM   547  C  CG    . LYS A 1 75  ? 8.064   51.078  51.046 1.00 95.28  ? 150 LYS A CG    1 
ATOM   548  C  CD    . LYS A 1 75  ? 6.606   51.488  51.234 1.00 101.49 ? 150 LYS A CD    1 
ATOM   549  C  CE    . LYS A 1 75  ? 5.687   50.280  51.351 1.00 99.67  ? 150 LYS A CE    1 
ATOM   550  N  NZ    . LYS A 1 75  ? 5.620   49.501  50.082 1.00 102.94 ? 150 LYS A NZ    1 
ATOM   551  N  N     . VAL A 1 76  ? 11.780  51.327  51.161 1.00 89.97  ? 151 VAL A N     1 
ATOM   552  C  CA    . VAL A 1 76  ? 12.700  51.524  50.042 1.00 83.75  ? 151 VAL A CA    1 
ATOM   553  C  C     . VAL A 1 76  ? 13.515  50.264  49.803 1.00 85.11  ? 151 VAL A C     1 
ATOM   554  O  O     . VAL A 1 76  ? 13.806  49.897  48.658 1.00 80.48  ? 151 VAL A O     1 
ATOM   555  C  CB    . VAL A 1 76  ? 13.606  52.741  50.296 1.00 72.60  ? 151 VAL A CB    1 
ATOM   556  C  CG1   . VAL A 1 76  ? 14.663  52.838  49.218 1.00 80.20  ? 151 VAL A CG1   1 
ATOM   557  C  CG2   . VAL A 1 76  ? 12.786  54.007  50.327 1.00 75.24  ? 151 VAL A CG2   1 
ATOM   558  N  N     . THR A 1 77  ? 13.882  49.575  50.884 1.00 88.71  ? 152 THR A N     1 
ATOM   559  C  CA    . THR A 1 77  ? 14.545  48.283  50.758 1.00 88.85  ? 152 THR A CA    1 
ATOM   560  C  C     . THR A 1 77  ? 13.608  47.245  50.154 1.00 94.67  ? 152 THR A C     1 
ATOM   561  O  O     . THR A 1 77  ? 13.963  46.564  49.183 1.00 93.19  ? 152 THR A O     1 
ATOM   562  C  CB    . THR A 1 77  ? 15.043  47.817  52.125 1.00 82.35  ? 152 THR A CB    1 
ATOM   563  O  OG1   . THR A 1 77  ? 16.058  48.712  52.600 1.00 83.20  ? 152 THR A OG1   1 
ATOM   564  C  CG2   . THR A 1 77  ? 15.608  46.413  52.025 1.00 84.19  ? 152 THR A CG2   1 
ATOM   565  N  N     . SER A 1 78  ? 12.401  47.113  50.717 1.00 95.36  ? 153 SER A N     1 
ATOM   566  C  CA    . SER A 1 78  ? 11.481  46.055  50.313 1.00 90.40  ? 153 SER A CA    1 
ATOM   567  C  C     . SER A 1 78  ? 10.712  46.386  49.046 1.00 88.62  ? 153 SER A C     1 
ATOM   568  O  O     . SER A 1 78  ? 10.221  45.467  48.381 1.00 89.99  ? 153 SER A O     1 
ATOM   569  C  CB    . SER A 1 78  ? 10.498  45.747  51.443 1.00 83.79  ? 153 SER A CB    1 
ATOM   570  O  OG    . SER A 1 78  ? 11.148  45.045  52.489 1.00 88.26  ? 153 SER A OG    1 
ATOM   571  N  N     . ASP A 1 79  ? 10.587  47.665  48.695 1.00 88.89  ? 154 ASP A N     1 
ATOM   572  C  CA    . ASP A 1 79  ? 10.001  47.991  47.404 1.00 93.47  ? 154 ASP A CA    1 
ATOM   573  C  C     . ASP A 1 79  ? 11.008  47.839  46.274 1.00 90.73  ? 154 ASP A C     1 
ATOM   574  O  O     . ASP A 1 79  ? 10.605  47.671  45.120 1.00 87.10  ? 154 ASP A O     1 
ATOM   575  C  CB    . ASP A 1 79  ? 9.427   49.411  47.413 1.00 92.71  ? 154 ASP A CB    1 
ATOM   576  C  CG    . ASP A 1 79  ? 8.254   49.574  46.454 1.00 103.63 ? 154 ASP A CG    1 
ATOM   577  O  OD1   . ASP A 1 79  ? 7.120   49.193  46.824 1.00 103.51 ? 154 ASP A OD1   1 
ATOM   578  O  OD2   . ASP A 1 79  ? 8.464   50.079  45.330 1.00 102.32 ? 154 ASP A OD2   1 
ATOM   579  N  N     . ALA A 1 80  ? 12.305  47.867  46.585 1.00 90.50  ? 155 ALA A N     1 
ATOM   580  C  CA    . ALA A 1 80  ? 13.320  47.687  45.556 1.00 92.64  ? 155 ALA A CA    1 
ATOM   581  C  C     . ALA A 1 80  ? 13.446  46.231  45.130 1.00 93.97  ? 155 ALA A C     1 
ATOM   582  O  O     . ALA A 1 80  ? 13.739  45.958  43.960 1.00 93.67  ? 155 ALA A O     1 
ATOM   583  C  CB    . ALA A 1 80  ? 14.669  48.211  46.051 1.00 92.07  ? 155 ALA A CB    1 
ATOM   584  N  N     . LYS A 1 81  ? 13.229  45.291  46.054 1.00 94.96  ? 156 LYS A N     1 
ATOM   585  C  CA    . LYS A 1 81  ? 13.304  43.878  45.696 1.00 93.05  ? 156 LYS A CA    1 
ATOM   586  C  C     . LYS A 1 81  ? 12.222  43.514  44.688 1.00 93.56  ? 156 LYS A C     1 
ATOM   587  O  O     . LYS A 1 81  ? 12.495  42.865  43.672 1.00 90.61  ? 156 LYS A O     1 
ATOM   588  C  CB    . LYS A 1 81  ? 13.192  43.013  46.951 1.00 81.66  ? 156 LYS A CB    1 
ATOM   589  C  CG    . LYS A 1 81  ? 14.477  42.946  47.759 1.00 91.64  ? 156 LYS A CG    1 
ATOM   590  C  CD    . LYS A 1 81  ? 14.336  42.043  48.970 1.00 89.91  ? 156 LYS A CD    1 
ATOM   591  C  CE    . LYS A 1 81  ? 15.697  41.717  49.571 1.00 88.96  ? 156 LYS A CE    1 
ATOM   592  N  NZ    . LYS A 1 81  ? 16.504  42.938  49.872 1.00 83.61  ? 156 LYS A NZ    1 
ATOM   593  N  N     . GLU A 1 82  ? 10.986  43.949  44.945 1.00 96.78  ? 157 GLU A N     1 
ATOM   594  C  CA    . GLU A 1 82  ? 9.881   43.606  44.057 1.00 100.89 ? 157 GLU A CA    1 
ATOM   595  C  C     . GLU A 1 82  ? 10.053  44.242  42.684 1.00 102.66 ? 157 GLU A C     1 
ATOM   596  O  O     . GLU A 1 82  ? 9.668   43.640  41.673 1.00 104.52 ? 157 GLU A O     1 
ATOM   597  C  CB    . GLU A 1 82  ? 8.544   44.020  44.691 1.00 101.33 ? 157 GLU A CB    1 
ATOM   598  C  CG    . GLU A 1 82  ? 8.313   45.526  44.780 1.00 102.25 ? 157 GLU A CG    1 
ATOM   599  C  CD    . GLU A 1 82  ? 7.038   45.892  45.526 1.00 104.22 ? 157 GLU A CD    1 
ATOM   600  O  OE1   . GLU A 1 82  ? 6.837   45.381  46.650 1.00 106.61 ? 157 GLU A OE1   1 
ATOM   601  O  OE2   . GLU A 1 82  ? 6.238   46.693  44.991 1.00 96.93  ? 157 GLU A OE2   1 
ATOM   602  N  N     . LYS A 1 83  ? 10.635  45.444  42.622 1.00 100.63 ? 158 LYS A N     1 
ATOM   603  C  CA    . LYS A 1 83  ? 10.833  46.084  41.327 1.00 95.88  ? 158 LYS A CA    1 
ATOM   604  C  C     . LYS A 1 83  ? 11.827  45.303  40.480 1.00 96.21  ? 158 LYS A C     1 
ATOM   605  O  O     . LYS A 1 83  ? 11.612  45.119  39.277 1.00 95.57  ? 158 LYS A O     1 
ATOM   606  C  CB    . LYS A 1 83  ? 11.304  47.525  41.506 1.00 92.76  ? 158 LYS A CB    1 
ATOM   607  C  CG    . LYS A 1 83  ? 10.302  48.447  42.182 1.00 96.57  ? 158 LYS A CG    1 
ATOM   608  C  CD    . LYS A 1 83  ? 9.037   48.640  41.365 1.00 96.84  ? 158 LYS A CD    1 
ATOM   609  C  CE    . LYS A 1 83  ? 8.094   49.621  42.054 1.00 99.09  ? 158 LYS A CE    1 
ATOM   610  N  NZ    . LYS A 1 83  ? 6.832   49.840  41.290 1.00 109.96 ? 158 LYS A NZ    1 
ATOM   611  N  N     . LYS A 1 84  ? 12.912  44.824  41.090 1.00 97.70  ? 159 LYS A N     1 
ATOM   612  C  CA    . LYS A 1 84  ? 13.887  44.044  40.337 1.00 98.97  ? 159 LYS A CA    1 
ATOM   613  C  C     . LYS A 1 84  ? 13.281  42.747  39.823 1.00 100.65 ? 159 LYS A C     1 
ATOM   614  O  O     . LYS A 1 84  ? 13.721  42.221  38.794 1.00 102.79 ? 159 LYS A O     1 
ATOM   615  C  CB    . LYS A 1 84  ? 15.117  43.758  41.198 1.00 97.96  ? 159 LYS A CB    1 
ATOM   616  C  CG    . LYS A 1 84  ? 15.909  44.998  41.569 1.00 92.15  ? 159 LYS A CG    1 
ATOM   617  C  CD    . LYS A 1 84  ? 17.279  44.638  42.125 1.00 102.03 ? 159 LYS A CD    1 
ATOM   618  C  CE    . LYS A 1 84  ? 17.174  43.870  43.436 1.00 107.29 ? 159 LYS A CE    1 
ATOM   619  N  NZ    . LYS A 1 84  ? 16.559  44.683  44.525 1.00 100.99 ? 159 LYS A NZ    1 
ATOM   620  N  N     . ALA A 1 85  ? 12.275  42.219  40.518 1.00 101.46 ? 160 ALA A N     1 
ATOM   621  C  CA    . ALA A 1 85  ? 11.564  41.051  40.009 1.00 107.05 ? 160 ALA A CA    1 
ATOM   622  C  C     . ALA A 1 85  ? 10.661  41.426  38.839 1.00 106.23 ? 160 ALA A C     1 
ATOM   623  O  O     . ALA A 1 85  ? 10.710  40.791  37.779 1.00 105.09 ? 160 ALA A O     1 
ATOM   624  C  CB    . ALA A 1 85  ? 10.757  40.400  41.132 1.00 105.62 ? 160 ALA A CB    1 
ATOM   625  N  N     . LEU A 1 86  ? 9.835   42.467  39.016 1.00 103.16 ? 161 LEU A N     1 
ATOM   626  C  CA    . LEU A 1 86  ? 8.900   42.888  37.973 1.00 96.72  ? 161 LEU A CA    1 
ATOM   627  C  C     . LEU A 1 86  ? 9.613   43.177  36.657 1.00 103.76 ? 161 LEU A C     1 
ATOM   628  O  O     . LEU A 1 86  ? 9.081   42.888  35.577 1.00 102.61 ? 161 LEU A O     1 
ATOM   629  C  CB    . LEU A 1 86  ? 8.124   44.121  38.438 1.00 92.75  ? 161 LEU A CB    1 
ATOM   630  C  CG    . LEU A 1 86  ? 7.365   44.905  37.364 1.00 97.07  ? 161 LEU A CG    1 
ATOM   631  C  CD1   . LEU A 1 86  ? 6.261   44.055  36.751 1.00 112.61 ? 161 LEU A CD1   1 
ATOM   632  C  CD2   . LEU A 1 86  ? 6.799   46.203  37.924 1.00 95.39  ? 161 LEU A CD2   1 
ATOM   633  N  N     . ILE A 1 87  ? 10.816  43.755  36.724 1.00 106.99 ? 162 ILE A N     1 
ATOM   634  C  CA    . ILE A 1 87  ? 11.611  43.986  35.519 1.00 102.76 ? 162 ILE A CA    1 
ATOM   635  C  C     . ILE A 1 87  ? 12.397  42.753  35.111 1.00 101.19 ? 162 ILE A C     1 
ATOM   636  O  O     . ILE A 1 87  ? 13.025  42.755  34.044 1.00 102.24 ? 162 ILE A O     1 
ATOM   637  C  CB    . ILE A 1 87  ? 12.569  45.175  35.717 1.00 102.53 ? 162 ILE A CB    1 
ATOM   638  C  CG1   . ILE A 1 87  ? 11.887  46.279  36.519 1.00 101.44 ? 162 ILE A CG1   1 
ATOM   639  C  CG2   . ILE A 1 87  ? 12.989  45.762  34.382 1.00 106.13 ? 162 ILE A CG2   1 
ATOM   640  C  CD1   . ILE A 1 87  ? 12.808  47.414  36.894 1.00 100.58 ? 162 ILE A CD1   1 
ATOM   641  N  N     . SER A 1 88  ? 12.373  41.697  35.929 1.00 97.37  ? 163 SER A N     1 
ATOM   642  C  CA    . SER A 1 88  ? 13.099  40.486  35.586 1.00 101.76 ? 163 SER A CA    1 
ATOM   643  C  C     . SER A 1 88  ? 12.773  39.979  34.197 1.00 105.93 ? 163 SER A C     1 
ATOM   644  O  O     . SER A 1 88  ? 13.654  39.506  33.474 1.00 106.96 ? 163 SER A O     1 
ATOM   645  N  N     . ARG A 1 89  ? 11.505  40.090  33.795 1.00 103.38 ? 164 ARG A N     1 
ATOM   646  C  CA    . ARG A 1 89  ? 11.123  39.664  32.455 1.00 109.01 ? 164 ARG A CA    1 
ATOM   647  C  C     . ARG A 1 89  ? 11.548  40.681  31.401 1.00 107.19 ? 164 ARG A C     1 
ATOM   648  O  O     . ARG A 1 89  ? 12.069  40.297  30.347 1.00 107.41 ? 164 ARG A O     1 
ATOM   649  C  CB    . ARG A 1 89  ? 9.616   39.416  32.378 1.00 115.18 ? 164 ARG A CB    1 
ATOM   650  C  CG    . ARG A 1 89  ? 9.147   38.960  30.999 1.00 120.70 ? 164 ARG A CG    1 
ATOM   651  C  CD    . ARG A 1 89  ? 7.645   38.717  30.960 1.00 132.20 ? 164 ARG A CD    1 
ATOM   652  N  NE    . ARG A 1 89  ? 7.186   38.267  29.647 1.00 145.89 ? 164 ARG A NE    1 
ATOM   653  C  CZ    . ARG A 1 89  ? 5.927   37.941  29.367 1.00 149.45 ? 164 ARG A CZ    1 
ATOM   654  N  NH1   . ARG A 1 89  ? 4.999   38.014  30.311 1.00 147.44 ? 164 ARG A NH1   1 
ATOM   655  N  NH2   . ARG A 1 89  ? 5.595   37.541  28.146 1.00 151.42 ? 164 ARG A NH2   1 
ATOM   656  N  N     . GLU A 1 90  ? 11.345  41.977  31.666 1.00 106.67 ? 165 GLU A N     1 
ATOM   657  C  CA    . GLU A 1 90  ? 11.651  42.995  30.659 1.00 110.44 ? 165 GLU A CA    1 
ATOM   658  C  C     . GLU A 1 90  ? 13.151  43.073  30.387 1.00 107.51 ? 165 GLU A C     1 
ATOM   659  O  O     . GLU A 1 90  ? 13.569  43.333  29.252 1.00 104.17 ? 165 GLU A O     1 
ATOM   660  C  CB    . GLU A 1 90  ? 11.105  44.361  31.093 1.00 111.00 ? 165 GLU A CB    1 
ATOM   661  C  CG    . GLU A 1 90  ? 11.361  45.528  30.100 1.00 117.54 ? 165 GLU A CG    1 
ATOM   662  C  CD    . GLU A 1 90  ? 10.659  46.837  30.500 1.00 133.76 ? 165 GLU A CD    1 
ATOM   663  O  OE1   . GLU A 1 90  ? 10.403  47.028  31.706 1.00 141.00 ? 165 GLU A OE1   1 
ATOM   664  O  OE2   . GLU A 1 90  ? 10.359  47.670  29.611 1.00 136.38 ? 165 GLU A OE2   1 
ATOM   665  N  N     . ILE A 1 91  ? 13.978  42.836  31.405 1.00 104.11 ? 166 ILE A N     1 
ATOM   666  C  CA    . ILE A 1 91  ? 15.424  42.802  31.191 1.00 103.62 ? 166 ILE A CA    1 
ATOM   667  C  C     . ILE A 1 91  ? 15.821  41.546  30.427 1.00 101.56 ? 166 ILE A C     1 
ATOM   668  O  O     . ILE A 1 91  ? 16.514  41.615  29.406 1.00 97.42  ? 166 ILE A O     1 
ATOM   669  C  CB    . ILE A 1 91  ? 16.172  42.910  32.532 1.00 103.84 ? 166 ILE A CB    1 
ATOM   670  C  CG1   . ILE A 1 91  ? 15.984  44.305  33.134 1.00 104.59 ? 166 ILE A CG1   1 
ATOM   671  C  CG2   . ILE A 1 91  ? 17.653  42.609  32.362 1.00 94.00  ? 166 ILE A CG2   1 
ATOM   672  C  CD1   . ILE A 1 91  ? 16.234  45.435  32.150 1.00 102.72 ? 166 ILE A CD1   1 
ATOM   673  N  N     . LYS A 1 92  ? 15.364  40.381  30.897 1.00 101.20 ? 167 LYS A N     1 
ATOM   674  C  CA    . LYS A 1 92  ? 15.750  39.113  30.287 1.00 104.93 ? 167 LYS A CA    1 
ATOM   675  C  C     . LYS A 1 92  ? 15.355  39.027  28.816 1.00 106.59 ? 167 LYS A C     1 
ATOM   676  O  O     . LYS A 1 92  ? 15.983  38.276  28.058 1.00 105.57 ? 167 LYS A O     1 
ATOM   677  C  CB    . LYS A 1 92  ? 15.132  37.949  31.070 1.00 108.32 ? 167 LYS A CB    1 
ATOM   678  C  CG    . LYS A 1 92  ? 15.739  36.594  30.760 1.00 113.16 ? 167 LYS A CG    1 
ATOM   679  C  CD    . LYS A 1 92  ? 17.229  36.597  31.055 1.00 115.24 ? 167 LYS A CD    1 
ATOM   680  C  CE    . LYS A 1 92  ? 17.932  35.360  30.510 1.00 121.16 ? 167 LYS A CE    1 
ATOM   681  N  NZ    . LYS A 1 92  ? 17.390  34.092  31.075 1.00 127.29 ? 167 LYS A NZ    1 
ATOM   682  N  N     . SER A 1 93  ? 14.336  39.778  28.393 1.00 105.17 ? 168 SER A N     1 
ATOM   683  C  CA    . SER A 1 93  ? 13.927  39.729  26.992 1.00 105.47 ? 168 SER A CA    1 
ATOM   684  C  C     . SER A 1 93  ? 14.994  40.331  26.086 1.00 105.93 ? 168 SER A C     1 
ATOM   685  O  O     . SER A 1 93  ? 15.445  39.690  25.129 1.00 109.40 ? 168 SER A O     1 
ATOM   686  C  CB    . SER A 1 93  ? 12.598  40.462  26.800 1.00 111.31 ? 168 SER A CB    1 
ATOM   687  O  OG    . SER A 1 93  ? 11.543  39.815  27.488 1.00 119.16 ? 168 SER A OG    1 
ATOM   688  N  N     . ALA A 1 94  ? 15.421  41.557  26.386 1.00 107.65 ? 169 ALA A N     1 
ATOM   689  C  CA    . ALA A 1 94  ? 16.364  42.245  25.514 1.00 105.60 ? 169 ALA A CA    1 
ATOM   690  C  C     . ALA A 1 94  ? 17.733  41.573  25.524 1.00 103.22 ? 169 ALA A C     1 
ATOM   691  O  O     . ALA A 1 94  ? 18.401  41.508  24.485 1.00 100.21 ? 169 ALA A O     1 
ATOM   692  C  CB    . ALA A 1 94  ? 16.477  43.712  25.925 1.00 100.68 ? 169 ALA A CB    1 
ATOM   693  N  N     . VAL A 1 95  ? 18.166  41.059  26.680 1.00 99.40  ? 170 VAL A N     1 
ATOM   694  C  CA    . VAL A 1 95  ? 19.512  40.496  26.772 1.00 102.79 ? 170 VAL A CA    1 
ATOM   695  C  C     . VAL A 1 95  ? 19.651  39.287  25.857 1.00 107.66 ? 170 VAL A C     1 
ATOM   696  O  O     . VAL A 1 95  ? 20.676  39.114  25.187 1.00 108.82 ? 170 VAL A O     1 
ATOM   697  C  CB    . VAL A 1 95  ? 19.872  40.154  28.235 1.00 98.15  ? 170 VAL A CB    1 
ATOM   698  C  CG1   . VAL A 1 95  ? 19.721  41.376  29.121 1.00 103.50 ? 170 VAL A CG1   1 
ATOM   699  C  CG2   . VAL A 1 95  ? 19.035  39.005  28.771 1.00 108.58 ? 170 VAL A CG2   1 
ATOM   700  N  N     . GLU A 1 96  ? 18.617  38.449  25.787 1.00 113.23 ? 171 GLU A N     1 
ATOM   701  C  CA    . GLU A 1 96  ? 18.689  37.259  24.953 1.00 115.12 ? 171 GLU A CA    1 
ATOM   702  C  C     . GLU A 1 96  ? 18.511  37.576  23.479 1.00 115.66 ? 171 GLU A C     1 
ATOM   703  O  O     . GLU A 1 96  ? 18.868  36.749  22.636 1.00 118.49 ? 171 GLU A O     1 
ATOM   704  C  CB    . GLU A 1 96  ? 17.642  36.237  25.394 1.00 116.60 ? 171 GLU A CB    1 
ATOM   705  C  CG    . GLU A 1 96  ? 17.831  35.755  26.822 1.00 119.52 ? 171 GLU A CG    1 
ATOM   706  C  CD    . GLU A 1 96  ? 17.033  34.503  27.125 1.00 130.48 ? 171 GLU A CD    1 
ATOM   707  O  OE1   . GLU A 1 96  ? 17.569  33.611  27.818 1.00 134.63 ? 171 GLU A OE1   1 
ATOM   708  O  OE2   . GLU A 1 96  ? 15.875  34.407  26.664 1.00 131.22 ? 171 GLU A OE2   1 
ATOM   709  N  N     . LYS A 1 97  ? 17.979  38.748  23.153 1.00 114.72 ? 172 LYS A N     1 
ATOM   710  C  CA    . LYS A 1 97  ? 17.830  39.178  21.772 1.00 120.50 ? 172 LYS A CA    1 
ATOM   711  C  C     . LYS A 1 97  ? 19.082  39.866  21.239 1.00 122.12 ? 172 LYS A C     1 
ATOM   712  O  O     . LYS A 1 97  ? 19.055  40.388  20.120 1.00 125.76 ? 172 LYS A O     1 
ATOM   713  C  CB    . LYS A 1 97  ? 16.608  40.090  21.632 1.00 117.69 ? 172 LYS A CB    1 
ATOM   714  C  CG    . LYS A 1 97  ? 15.299  39.421  22.048 1.00 116.96 ? 172 LYS A CG    1 
ATOM   715  C  CD    . LYS A 1 97  ? 15.232  37.992  21.528 1.00 123.27 ? 172 LYS A CD    1 
ATOM   716  C  CE    . LYS A 1 97  ? 14.210  37.148  22.279 1.00 112.95 ? 172 LYS A CE    1 
ATOM   717  N  NZ    . LYS A 1 97  ? 12.833  37.308  21.747 1.00 98.90  ? 172 LYS A NZ    1 
ATOM   718  N  N     . ASP A 1 98  ? 20.159  39.897  22.028 1.00 118.77 ? 173 ASP A N     1 
ATOM   719  C  CA    . ASP A 1 98  ? 21.477  40.449  21.734 1.00 121.60 ? 173 ASP A CA    1 
ATOM   720  C  C     . ASP A 1 98  ? 21.508  41.968  21.910 1.00 123.98 ? 173 ASP A C     1 
ATOM   721  O  O     . ASP A 1 98  ? 22.585  42.555  21.839 1.00 124.82 ? 173 ASP A O     1 
ATOM   722  C  CB    . ASP A 1 98  ? 21.989  40.091  20.321 1.00 120.53 ? 173 ASP A CB    1 
ATOM   723  C  CG    . ASP A 1 98  ? 23.474  40.361  20.144 1.00 126.95 ? 173 ASP A CG    1 
ATOM   724  O  OD1   . ASP A 1 98  ? 23.853  40.972  19.120 1.00 125.63 ? 173 ASP A OD1   1 
ATOM   725  O  OD2   . ASP A 1 98  ? 24.261  39.956  21.025 1.00 129.83 ? 173 ASP A OD2   1 
ATOM   726  N  N     . GLY A 1 99  ? 20.380  42.622  22.174 1.00 118.14 ? 174 GLY A N     1 
ATOM   727  C  CA    . GLY A 1 99  ? 20.333  44.072  22.174 1.00 114.80 ? 174 GLY A CA    1 
ATOM   728  C  C     . GLY A 1 99  ? 20.659  44.732  23.499 1.00 110.92 ? 174 GLY A C     1 
ATOM   729  O  O     . GLY A 1 99  ? 20.246  45.869  23.750 1.00 112.87 ? 174 GLY A O     1 
ATOM   730  N  N     . ALA A 1 100 ? 21.392  44.031  24.358 1.00 104.93 ? 175 ALA A N     1 
ATOM   731  C  CA    . ALA A 1 100 ? 21.730  44.528  25.684 1.00 106.05 ? 175 ALA A CA    1 
ATOM   732  C  C     . ALA A 1 100 ? 23.153  45.069  25.702 1.00 105.71 ? 175 ALA A C     1 
ATOM   733  O  O     . ALA A 1 100 ? 24.085  44.394  25.252 1.00 112.90 ? 175 ALA A O     1 
ATOM   734  C  CB    . ALA A 1 100 ? 21.580  43.423  26.729 1.00 101.90 ? 175 ALA A CB    1 
ATOM   735  N  N     . SER A 1 101 ? 23.316  46.280  26.231 1.00 101.23 ? 176 SER A N     1 
ATOM   736  C  CA    . SER A 1 101 ? 24.624  46.874  26.462 1.00 100.10 ? 176 SER A CA    1 
ATOM   737  C  C     . SER A 1 101 ? 24.763  47.204  27.940 1.00 96.89  ? 176 SER A C     1 
ATOM   738  O  O     . SER A 1 101 ? 23.833  47.735  28.555 1.00 99.08  ? 176 SER A O     1 
ATOM   739  C  CB    . SER A 1 101 ? 24.820  48.135  25.618 1.00 103.50 ? 176 SER A CB    1 
ATOM   740  O  OG    . SER A 1 101 ? 24.408  47.915  24.280 1.00 109.46 ? 176 SER A OG    1 
ATOM   741  N  N     . ALA A 1 102 ? 25.923  46.890  28.511 1.00 92.34  ? 177 ALA A N     1 
ATOM   742  C  CA    . ALA A 1 102 ? 26.173  47.114  29.926 1.00 88.29  ? 177 ALA A CA    1 
ATOM   743  C  C     . ALA A 1 102 ? 27.444  47.931  30.105 1.00 90.27  ? 177 ALA A C     1 
ATOM   744  O  O     . ALA A 1 102 ? 28.346  47.899  29.266 1.00 93.19  ? 177 ALA A O     1 
ATOM   745  C  CB    . ALA A 1 102 ? 26.292  45.795  30.696 1.00 87.76  ? 177 ALA A CB    1 
ATOM   746  N  N     . THR A 1 103 ? 27.508  48.661  31.217 1.00 85.31  ? 178 THR A N     1 
ATOM   747  C  CA    . THR A 1 103 ? 28.649  49.509  31.541 1.00 83.84  ? 178 THR A CA    1 
ATOM   748  C  C     . THR A 1 103 ? 29.014  49.315  33.005 1.00 85.04  ? 178 THR A C     1 
ATOM   749  O  O     . THR A 1 103 ? 28.196  49.585  33.892 1.00 84.40  ? 178 THR A O     1 
ATOM   750  C  CB    . THR A 1 103 ? 28.333  50.978  31.264 1.00 80.58  ? 178 THR A CB    1 
ATOM   751  O  OG1   . THR A 1 103 ? 27.851  51.111  29.923 1.00 86.80  ? 178 THR A OG1   1 
ATOM   752  C  CG2   . THR A 1 103 ? 29.573  51.824  31.438 1.00 79.76  ? 178 THR A CG2   1 
ATOM   753  N  N     . ILE A 1 104 ? 30.243  48.860  33.258 1.00 80.34  ? 179 ILE A N     1 
ATOM   754  C  CA    . ILE A 1 104 ? 30.691  48.548  34.608 1.00 78.03  ? 179 ILE A CA    1 
ATOM   755  C  C     . ILE A 1 104 ? 31.990  49.289  34.898 1.00 79.86  ? 179 ILE A C     1 
ATOM   756  O  O     . ILE A 1 104 ? 32.810  49.524  34.004 1.00 79.39  ? 179 ILE A O     1 
ATOM   757  C  CB    . ILE A 1 104 ? 30.869  47.026  34.808 1.00 79.30  ? 179 ILE A CB    1 
ATOM   758  C  CG1   . ILE A 1 104 ? 32.125  46.527  34.093 1.00 73.18  ? 179 ILE A CG1   1 
ATOM   759  C  CG2   . ILE A 1 104 ? 29.657  46.280  34.278 1.00 82.24  ? 179 ILE A CG2   1 
ATOM   760  C  CD1   . ILE A 1 104 ? 32.419  45.071  34.343 1.00 70.97  ? 179 ILE A CD1   1 
ATOM   761  N  N     . ASP A 1 105 ? 32.156  49.688  36.159 1.00 78.11  ? 180 ASP A N     1 
ATOM   762  C  CA    . ASP A 1 105 ? 33.369  50.354  36.621 1.00 75.16  ? 180 ASP A CA    1 
ATOM   763  C  C     . ASP A 1 105 ? 33.474  50.189  38.130 1.00 76.76  ? 180 ASP A C     1 
ATOM   764  O  O     . ASP A 1 105 ? 32.539  49.733  38.791 1.00 78.45  ? 180 ASP A O     1 
ATOM   765  C  CB    . ASP A 1 105 ? 33.407  51.832  36.235 1.00 77.08  ? 180 ASP A CB    1 
ATOM   766  C  CG    . ASP A 1 105 ? 34.792  52.273  35.840 1.00 82.90  ? 180 ASP A CG    1 
ATOM   767  O  OD1   . ASP A 1 105 ? 35.477  51.440  35.215 1.00 85.39  ? 180 ASP A OD1   1 
ATOM   768  O  OD2   . ASP A 1 105 ? 35.203  53.414  36.158 1.00 83.80  ? 180 ASP A OD2   1 
ATOM   769  N  N     . LEU A 1 106 ? 34.640  50.536  38.664 1.00 71.42  ? 181 LEU A N     1 
ATOM   770  C  CA    . LEU A 1 106 ? 34.897  50.441  40.092 1.00 75.91  ? 181 LEU A CA    1 
ATOM   771  C  C     . LEU A 1 106 ? 34.998  51.826  40.717 1.00 77.80  ? 181 LEU A C     1 
ATOM   772  O  O     . LEU A 1 106 ? 35.531  52.758  40.106 1.00 80.80  ? 181 LEU A O     1 
ATOM   773  C  CB    . LEU A 1 106 ? 36.177  49.654  40.357 1.00 80.20  ? 181 LEU A CB    1 
ATOM   774  C  CG    . LEU A 1 106 ? 36.061  48.195  39.931 1.00 72.23  ? 181 LEU A CG    1 
ATOM   775  C  CD1   . LEU A 1 106 ? 37.430  47.568  39.817 1.00 83.90  ? 181 LEU A CD1   1 
ATOM   776  C  CD2   . LEU A 1 106 ? 35.205  47.438  40.926 1.00 78.44  ? 181 LEU A CD2   1 
ATOM   777  N  N     . TRP A 1 107 ? 34.504  51.936  41.950 1.00 74.37  ? 182 TRP A N     1 
ATOM   778  C  CA    . TRP A 1 107 ? 34.436  53.189  42.688 1.00 77.75  ? 182 TRP A CA    1 
ATOM   779  C  C     . TRP A 1 107 ? 34.659  52.895  44.165 1.00 84.86  ? 182 TRP A C     1 
ATOM   780  O  O     . TRP A 1 107 ? 34.496  51.760  44.619 1.00 88.89  ? 182 TRP A O     1 
ATOM   781  C  CB    . TRP A 1 107 ? 33.076  53.872  42.466 1.00 79.37  ? 182 TRP A CB    1 
ATOM   782  C  CG    . TRP A 1 107 ? 32.911  55.251  43.060 1.00 83.95  ? 182 TRP A CG    1 
ATOM   783  C  CD1   . TRP A 1 107 ? 33.578  56.385  42.698 1.00 90.50  ? 182 TRP A CD1   1 
ATOM   784  C  CD2   . TRP A 1 107 ? 31.986  55.643  44.086 1.00 76.76  ? 182 TRP A CD2   1 
ATOM   785  N  NE1   . TRP A 1 107 ? 33.143  57.453  43.450 1.00 85.47  ? 182 TRP A NE1   1 
ATOM   786  C  CE2   . TRP A 1 107 ? 32.166  57.022  44.308 1.00 77.36  ? 182 TRP A CE2   1 
ATOM   787  C  CE3   . TRP A 1 107 ? 31.036  54.959  44.848 1.00 78.04  ? 182 TRP A CE3   1 
ATOM   788  C  CZ2   . TRP A 1 107 ? 31.433  57.728  45.257 1.00 77.23  ? 182 TRP A CZ2   1 
ATOM   789  C  CZ3   . TRP A 1 107 ? 30.308  55.663  45.791 1.00 72.67  ? 182 TRP A CZ3   1 
ATOM   790  C  CH2   . TRP A 1 107 ? 30.510  57.032  45.986 1.00 75.13  ? 182 TRP A CH2   1 
ATOM   791  N  N     . THR A 1 108 ? 35.058  53.923  44.916 1.00 86.37  ? 183 THR A N     1 
ATOM   792  C  CA    . THR A 1 108 ? 35.085  53.839  46.371 1.00 87.59  ? 183 THR A CA    1 
ATOM   793  C  C     . THR A 1 108 ? 34.553  55.149  46.935 1.00 81.67  ? 183 THR A C     1 
ATOM   794  O  O     . THR A 1 108 ? 34.865  56.228  46.424 1.00 82.10  ? 183 THR A O     1 
ATOM   795  C  CB    . THR A 1 108 ? 36.497  53.515  46.920 1.00 82.10  ? 183 THR A CB    1 
ATOM   796  O  OG1   . THR A 1 108 ? 36.382  52.791  48.150 1.00 83.57  ? 183 THR A OG1   1 
ATOM   797  C  CG2   . THR A 1 108 ? 37.318  54.769  47.171 1.00 82.91  ? 183 THR A CG2   1 
ATOM   798  N  N     . ASP A 1 109 ? 33.711  55.045  47.960 1.00 82.33  ? 184 ASP A N     1 
ATOM   799  C  CA    . ASP A 1 109 ? 33.027  56.219  48.483 1.00 84.58  ? 184 ASP A CA    1 
ATOM   800  C  C     . ASP A 1 109 ? 33.961  57.033  49.366 1.00 82.64  ? 184 ASP A C     1 
ATOM   801  O  O     . ASP A 1 109 ? 34.902  56.510  49.969 1.00 77.65  ? 184 ASP A O     1 
ATOM   802  C  CB    . ASP A 1 109 ? 31.759  55.830  49.255 1.00 79.95  ? 184 ASP A CB    1 
ATOM   803  C  CG    . ASP A 1 109 ? 32.051  55.198  50.607 1.00 81.64  ? 184 ASP A CG    1 
ATOM   804  O  OD1   . ASP A 1 109 ? 32.308  55.942  51.578 1.00 84.09  ? 184 ASP A OD1   1 
ATOM   805  O  OD2   . ASP A 1 109 ? 31.995  53.954  50.711 1.00 78.88  ? 184 ASP A OD2   1 
ATOM   806  N  N     . ASN A 1 110 ? 33.680  58.330  49.440 1.00 89.66  ? 185 ASN A N     1 
ATOM   807  C  CA    . ASN A 1 110 ? 34.585  59.291  50.050 1.00 87.48  ? 185 ASN A CA    1 
ATOM   808  C  C     . ASN A 1 110 ? 34.592  59.237  51.573 1.00 90.16  ? 185 ASN A C     1 
ATOM   809  O  O     . ASN A 1 110 ? 35.414  59.922  52.190 1.00 97.08  ? 185 ASN A O     1 
ATOM   810  C  CB    . ASN A 1 110 ? 34.219  60.701  49.580 1.00 84.26  ? 185 ASN A CB    1 
ATOM   811  C  CG    . ASN A 1 110 ? 35.393  61.653  49.627 1.00 100.91 ? 185 ASN A CG    1 
ATOM   812  O  OD1   . ASN A 1 110 ? 36.518  61.253  49.925 1.00 111.78 ? 185 ASN A OD1   1 
ATOM   813  N  ND2   . ASN A 1 110 ? 35.140  62.921  49.319 1.00 108.85 ? 185 ASN A ND2   1 
ATOM   814  N  N     . TYR A 1 111 ? 33.714  58.450  52.197 1.00 86.89  ? 186 TYR A N     1 
ATOM   815  C  CA    . TYR A 1 111 ? 33.609  58.432  53.654 1.00 86.05  ? 186 TYR A CA    1 
ATOM   816  C  C     . TYR A 1 111 ? 33.961  57.075  54.247 1.00 87.69  ? 186 TYR A C     1 
ATOM   817  O  O     . TYR A 1 111 ? 34.953  56.972  54.976 1.00 96.55  ? 186 TYR A O     1 
ATOM   818  C  CB    . TYR A 1 111 ? 32.204  58.880  54.081 1.00 86.90  ? 186 TYR A CB    1 
ATOM   819  C  CG    . TYR A 1 111 ? 31.974  60.361  53.866 1.00 81.18  ? 186 TYR A CG    1 
ATOM   820  C  CD1   . TYR A 1 111 ? 32.351  61.290  54.830 1.00 77.55  ? 186 TYR A CD1   1 
ATOM   821  C  CD2   . TYR A 1 111 ? 31.399  60.831  52.694 1.00 80.24  ? 186 TYR A CD2   1 
ATOM   822  C  CE1   . TYR A 1 111 ? 32.156  62.644  54.634 1.00 78.23  ? 186 TYR A CE1   1 
ATOM   823  C  CE2   . TYR A 1 111 ? 31.199  62.185  52.489 1.00 81.81  ? 186 TYR A CE2   1 
ATOM   824  C  CZ    . TYR A 1 111 ? 31.578  63.085  53.460 1.00 79.01  ? 186 TYR A CZ    1 
ATOM   825  O  OH    . TYR A 1 111 ? 31.381  64.430  53.250 1.00 77.14  ? 186 TYR A OH    1 
ATOM   826  N  N     . ILE A 1 112 ? 33.183  56.025  53.966 1.00 83.85  ? 187 ILE A N     1 
ATOM   827  C  CA    . ILE A 1 112 ? 33.490  54.705  54.518 1.00 83.88  ? 187 ILE A CA    1 
ATOM   828  C  C     . ILE A 1 112 ? 34.609  54.001  53.766 1.00 87.81  ? 187 ILE A C     1 
ATOM   829  O  O     . ILE A 1 112 ? 35.189  53.040  54.292 1.00 88.57  ? 187 ILE A O     1 
ATOM   830  C  CB    . ILE A 1 112 ? 32.209  53.849  54.542 1.00 80.23  ? 187 ILE A CB    1 
ATOM   831  C  CG1   . ILE A 1 112 ? 31.061  54.641  55.170 1.00 86.38  ? 187 ILE A CG1   1 
ATOM   832  C  CG2   . ILE A 1 112 ? 32.410  52.576  55.349 1.00 79.27  ? 187 ILE A CG2   1 
ATOM   833  C  CD1   . ILE A 1 112 ? 31.196  54.829  56.671 1.00 83.05  ? 187 ILE A CD1   1 
ATOM   834  N  N     . LYS A 1 113 ? 34.951  54.471  52.562 1.00 89.39  ? 188 LYS A N     1 
ATOM   835  C  CA    . LYS A 1 113 ? 35.993  53.867  51.724 1.00 83.43  ? 188 LYS A CA    1 
ATOM   836  C  C     . LYS A 1 113 ? 35.656  52.426  51.361 1.00 84.93  ? 188 LYS A C     1 
ATOM   837  O  O     . LYS A 1 113 ? 36.547  51.595  51.169 1.00 91.34  ? 188 LYS A O     1 
ATOM   838  C  CB    . LYS A 1 113 ? 37.371  53.947  52.389 1.00 81.89  ? 188 LYS A CB    1 
ATOM   839  C  CG    . LYS A 1 113 ? 37.967  55.347  52.395 1.00 86.07  ? 188 LYS A CG    1 
ATOM   840  C  CD    . LYS A 1 113 ? 38.160  55.863  50.974 1.00 85.66  ? 188 LYS A CD    1 
ATOM   841  C  CE    . LYS A 1 113 ? 38.786  57.248  50.959 1.00 85.41  ? 188 LYS A CE    1 
ATOM   842  N  NZ    . LYS A 1 113 ? 38.002  58.219  51.773 1.00 89.42  ? 188 LYS A NZ    1 
ATOM   843  N  N     . ARG A 1 114 ? 34.364  52.125  51.273 1.00 82.39  ? 189 ARG A N     1 
ATOM   844  C  CA    . ARG A 1 114 ? 33.919  50.819  50.811 1.00 80.59  ? 189 ARG A CA    1 
ATOM   845  C  C     . ARG A 1 114 ? 34.240  50.666  49.330 1.00 78.79  ? 189 ARG A C     1 
ATOM   846  O  O     . ARG A 1 114 ? 33.944  51.555  48.528 1.00 77.25  ? 189 ARG A O     1 
ATOM   847  C  CB    . ARG A 1 114 ? 32.415  50.666  51.048 1.00 79.92  ? 189 ARG A CB    1 
ATOM   848  C  CG    . ARG A 1 114 ? 32.009  49.407  51.798 1.00 80.99  ? 189 ARG A CG    1 
ATOM   849  C  CD    . ARG A 1 114 ? 30.505  49.335  52.033 1.00 73.32  ? 189 ARG A CD    1 
ATOM   850  N  NE    . ARG A 1 114 ? 30.045  50.139  53.166 1.00 80.20  ? 189 ARG A NE    1 
ATOM   851  C  CZ    . ARG A 1 114 ? 29.382  51.291  53.058 1.00 80.98  ? 189 ARG A CZ    1 
ATOM   852  N  NH1   . ARG A 1 114 ? 29.101  51.796  51.863 1.00 72.23  ? 189 ARG A NH1   1 
ATOM   853  N  NH2   . ARG A 1 114 ? 28.995  51.942  54.149 1.00 75.15  ? 189 ARG A NH2   1 
ATOM   854  N  N     . ASN A 1 115 ? 34.867  49.553  48.964 1.00 79.45  ? 190 ASN A N     1 
ATOM   855  C  CA    . ASN A 1 115 ? 35.056  49.257  47.551 1.00 78.84  ? 190 ASN A CA    1 
ATOM   856  C  C     . ASN A 1 115 ? 33.701  48.950  46.921 1.00 83.15  ? 190 ASN A C     1 
ATOM   857  O  O     . ASN A 1 115 ? 32.894  48.210  47.492 1.00 89.95  ? 190 ASN A O     1 
ATOM   858  C  CB    . ASN A 1 115 ? 36.027  48.087  47.372 1.00 86.73  ? 190 ASN A CB    1 
ATOM   859  C  CG    . ASN A 1 115 ? 37.483  48.472  47.674 1.00 99.55  ? 190 ASN A CG    1 
ATOM   860  O  OD1   . ASN A 1 115 ? 37.760  49.231  48.605 1.00 97.15  ? 190 ASN A OD1   1 
ATOM   861  N  ND2   . ASN A 1 115 ? 38.414  47.954  46.874 1.00 86.38  ? 190 ASN A ND2   1 
ATOM   862  N  N     . PHE A 1 116 ? 33.429  49.547  45.761 1.00 80.07  ? 191 PHE A N     1 
ATOM   863  C  CA    . PHE A 1 116 ? 32.130  49.428  45.113 1.00 74.64  ? 191 PHE A CA    1 
ATOM   864  C  C     . PHE A 1 116 ? 32.294  49.024  43.656 1.00 79.78  ? 191 PHE A C     1 
ATOM   865  O  O     . PHE A 1 116 ? 33.330  49.280  43.034 1.00 82.01  ? 191 PHE A O     1 
ATOM   866  C  CB    . PHE A 1 116 ? 31.332  50.739  45.183 1.00 72.09  ? 191 PHE A CB    1 
ATOM   867  C  CG    . PHE A 1 116 ? 30.447  50.853  46.395 1.00 72.78  ? 191 PHE A CG    1 
ATOM   868  C  CD1   . PHE A 1 116 ? 30.832  51.615  47.482 1.00 75.21  ? 191 PHE A CD1   1 
ATOM   869  C  CD2   . PHE A 1 116 ? 29.226  50.204  46.442 1.00 77.08  ? 191 PHE A CD2   1 
ATOM   870  C  CE1   . PHE A 1 116 ? 30.022  51.727  48.594 1.00 70.71  ? 191 PHE A CE1   1 
ATOM   871  C  CE2   . PHE A 1 116 ? 28.408  50.314  47.551 1.00 77.31  ? 191 PHE A CE2   1 
ATOM   872  C  CZ    . PHE A 1 116 ? 28.809  51.076  48.629 1.00 73.89  ? 191 PHE A CZ    1 
ATOM   873  N  N     . LEU A 1 117 ? 31.251  48.390  43.118 1.00 79.50  ? 192 LEU A N     1 
ATOM   874  C  CA    . LEU A 1 117 ? 31.191  48.013  41.709 1.00 78.74  ? 192 LEU A CA    1 
ATOM   875  C  C     . LEU A 1 117 ? 29.850  48.456  41.144 1.00 75.22  ? 192 LEU A C     1 
ATOM   876  O  O     . LEU A 1 117 ? 28.806  47.926  41.534 1.00 78.12  ? 192 LEU A O     1 
ATOM   877  C  CB    . LEU A 1 117 ? 31.373  46.507  41.530 1.00 74.48  ? 192 LEU A CB    1 
ATOM   878  C  CG    . LEU A 1 117 ? 30.889  45.968  40.182 1.00 80.10  ? 192 LEU A CG    1 
ATOM   879  C  CD1   . LEU A 1 117 ? 31.746  46.494  39.035 1.00 76.55  ? 192 LEU A CD1   1 
ATOM   880  C  CD2   . LEU A 1 117 ? 30.855  44.447  40.189 1.00 87.55  ? 192 LEU A CD2   1 
ATOM   881  N  N     . GLY A 1 118 ? 29.878  49.415  40.226 1.00 76.00  ? 193 GLY A N     1 
ATOM   882  C  CA    . GLY A 1 118 ? 28.676  49.830  39.537 1.00 77.35  ? 193 GLY A CA    1 
ATOM   883  C  C     . GLY A 1 118 ? 28.477  49.091  38.225 1.00 85.05  ? 193 GLY A C     1 
ATOM   884  O  O     . GLY A 1 118 ? 29.432  48.690  37.562 1.00 84.13  ? 193 GLY A O     1 
ATOM   885  N  N     . VAL A 1 119 ? 27.209  48.915  37.858 1.00 82.29  ? 194 VAL A N     1 
ATOM   886  C  CA    . VAL A 1 119 ? 26.818  48.346  36.572 1.00 82.60  ? 194 VAL A CA    1 
ATOM   887  C  C     . VAL A 1 119 ? 25.598  49.106  36.082 1.00 86.31  ? 194 VAL A C     1 
ATOM   888  O  O     . VAL A 1 119 ? 24.603  49.212  36.806 1.00 93.62  ? 194 VAL A O     1 
ATOM   889  C  CB    . VAL A 1 119 ? 26.488  46.840  36.662 1.00 92.65  ? 194 VAL A CB    1 
ATOM   890  C  CG1   . VAL A 1 119 ? 26.045  46.313  35.301 1.00 92.65  ? 194 VAL A CG1   1 
ATOM   891  C  CG2   . VAL A 1 119 ? 27.670  46.032  37.195 1.00 84.22  ? 194 VAL A CG2   1 
ATOM   892  N  N     . THR A 1 120 ? 25.660  49.626  34.861 1.00 87.64  ? 195 THR A N     1 
ATOM   893  C  CA    . THR A 1 120 ? 24.490  50.201  34.213 1.00 88.82  ? 195 THR A CA    1 
ATOM   894  C  C     . THR A 1 120 ? 24.181  49.407  32.954 1.00 91.61  ? 195 THR A C     1 
ATOM   895  O  O     . THR A 1 120 ? 25.070  48.791  32.356 1.00 91.50  ? 195 THR A O     1 
ATOM   896  C  CB    . THR A 1 120 ? 24.680  51.685  33.854 1.00 81.41  ? 195 THR A CB    1 
ATOM   897  O  OG1   . THR A 1 120 ? 25.601  51.807  32.763 1.00 79.47  ? 195 THR A OG1   1 
ATOM   898  C  CG2   . THR A 1 120 ? 25.194  52.468  35.051 1.00 77.15  ? 195 THR A CG2   1 
ATOM   899  N  N     . LEU A 1 121 ? 22.914  49.418  32.559 1.00 85.13  ? 196 LEU A N     1 
ATOM   900  C  CA    . LEU A 1 121 ? 22.456  48.659  31.408 1.00 90.35  ? 196 LEU A CA    1 
ATOM   901  C  C     . LEU A 1 121 ? 21.826  49.596  30.388 1.00 94.56  ? 196 LEU A C     1 
ATOM   902  O  O     . LEU A 1 121 ? 21.089  50.520  30.748 1.00 95.25  ? 196 LEU A O     1 
ATOM   903  C  CB    . LEU A 1 121 ? 21.458  47.577  31.828 1.00 92.13  ? 196 LEU A CB    1 
ATOM   904  C  CG    . LEU A 1 121 ? 21.297  46.378  30.892 1.00 90.52  ? 196 LEU A CG    1 
ATOM   905  C  CD1   . LEU A 1 121 ? 22.626  45.689  30.654 1.00 94.51  ? 196 LEU A CD1   1 
ATOM   906  C  CD2   . LEU A 1 121 ? 20.301  45.400  31.474 1.00 92.41  ? 196 LEU A CD2   1 
ATOM   907  N  N     . HIS A 1 122 ? 22.124  49.351  29.115 1.00 96.33  ? 197 HIS A N     1 
ATOM   908  C  CA    . HIS A 1 122 ? 21.619  50.161  28.015 1.00 99.49  ? 197 HIS A CA    1 
ATOM   909  C  C     . HIS A 1 122 ? 21.017  49.246  26.966 1.00 106.22 ? 197 HIS A C     1 
ATOM   910  O  O     . HIS A 1 122 ? 21.729  48.434  26.367 1.00 105.78 ? 197 HIS A O     1 
ATOM   911  C  CB    . HIS A 1 122 ? 22.731  51.010  27.402 1.00 98.65  ? 197 HIS A CB    1 
ATOM   912  C  CG    . HIS A 1 122 ? 23.331  51.983  28.362 1.00 99.65  ? 197 HIS A CG    1 
ATOM   913  N  ND1   . HIS A 1 122 ? 24.186  51.598  29.372 1.00 89.76  ? 197 HIS A ND1   1 
ATOM   914  C  CD2   . HIS A 1 122 ? 23.181  53.323  28.484 1.00 101.08 ? 197 HIS A CD2   1 
ATOM   915  C  CE1   . HIS A 1 122 ? 24.546  52.661  30.068 1.00 89.16  ? 197 HIS A CE1   1 
ATOM   916  N  NE2   . HIS A 1 122 ? 23.950  53.720  29.550 1.00 97.57  ? 197 HIS A NE2   1 
ATOM   917  N  N     . TYR A 1 123 ? 19.714  49.386  26.737 1.00 108.15 ? 198 TYR A N     1 
ATOM   918  C  CA    . TYR A 1 123 ? 19.040  48.611  25.710 1.00 112.26 ? 198 TYR A CA    1 
ATOM   919  C  C     . TYR A 1 123 ? 17.995  49.480  25.029 1.00 114.80 ? 198 TYR A C     1 
ATOM   920  O  O     . TYR A 1 123 ? 17.596  50.534  25.532 1.00 113.70 ? 198 TYR A O     1 
ATOM   921  C  CB    . TYR A 1 123 ? 18.396  47.338  26.281 1.00 109.59 ? 198 TYR A CB    1 
ATOM   922  C  CG    . TYR A 1 123 ? 17.135  47.576  27.083 1.00 114.72 ? 198 TYR A CG    1 
ATOM   923  C  CD1   . TYR A 1 123 ? 17.173  48.263  28.288 1.00 116.31 ? 198 TYR A CD1   1 
ATOM   924  C  CD2   . TYR A 1 123 ? 15.909  47.095  26.643 1.00 120.71 ? 198 TYR A CD2   1 
ATOM   925  C  CE1   . TYR A 1 123 ? 16.023  48.478  29.026 1.00 116.32 ? 198 TYR A CE1   1 
ATOM   926  C  CE2   . TYR A 1 123 ? 14.754  47.301  27.376 1.00 123.43 ? 198 TYR A CE2   1 
ATOM   927  C  CZ    . TYR A 1 123 ? 14.818  47.994  28.566 1.00 119.04 ? 198 TYR A CZ    1 
ATOM   928  O  OH    . TYR A 1 123 ? 13.675  48.205  29.301 1.00 117.40 ? 198 TYR A OH    1 
ATOM   929  N  N     . HIS A 1 124 ? 17.567  49.013  23.864 1.00 120.16 ? 199 HIS A N     1 
ATOM   930  C  CA    . HIS A 1 124 ? 16.589  49.689  23.025 1.00 122.72 ? 199 HIS A CA    1 
ATOM   931  C  C     . HIS A 1 124 ? 15.266  48.947  23.106 1.00 123.40 ? 199 HIS A C     1 
ATOM   932  O  O     . HIS A 1 124 ? 15.224  47.728  22.909 1.00 121.67 ? 199 HIS A O     1 
ATOM   933  C  CB    . HIS A 1 124 ? 17.064  49.736  21.571 1.00 125.79 ? 199 HIS A CB    1 
ATOM   934  C  CG    . HIS A 1 124 ? 17.403  48.389  20.998 1.00 131.82 ? 199 HIS A CG    1 
ATOM   935  N  ND1   . HIS A 1 124 ? 17.816  47.322  21.770 1.00 131.34 ? 199 HIS A ND1   1 
ATOM   936  C  CD2   . HIS A 1 124 ? 17.385  47.939  19.722 1.00 134.61 ? 199 HIS A CD2   1 
ATOM   937  C  CE1   . HIS A 1 124 ? 18.040  46.276  20.994 1.00 131.07 ? 199 HIS A CE1   1 
ATOM   938  N  NE2   . HIS A 1 124 ? 17.789  46.625  19.746 1.00 134.09 ? 199 HIS A NE2   1 
ATOM   939  N  N     . GLU A 1 125 ? 14.185  49.670  23.390 1.00 130.56 ? 200 GLU A N     1 
ATOM   940  C  CA    . GLU A 1 125 ? 12.894  48.998  23.343 1.00 136.98 ? 200 GLU A CA    1 
ATOM   941  C  C     . GLU A 1 125 ? 12.355  49.045  21.921 1.00 141.82 ? 200 GLU A C     1 
ATOM   942  O  O     . GLU A 1 125 ? 12.377  48.034  21.212 1.00 144.78 ? 200 GLU A O     1 
ATOM   943  C  CB    . GLU A 1 125 ? 11.898  49.625  24.321 1.00 128.67 ? 200 GLU A CB    1 
ATOM   944  C  CG    . GLU A 1 125 ? 10.557  48.899  24.378 1.00 129.65 ? 200 GLU A CG    1 
ATOM   945  C  CD    . GLU A 1 125 ? 10.703  47.391  24.518 1.00 132.00 ? 200 GLU A CD    1 
ATOM   946  O  OE1   . GLU A 1 125 ? 11.535  46.934  25.332 1.00 130.46 ? 200 GLU A OE1   1 
ATOM   947  O  OE2   . GLU A 1 125 ? 9.983   46.664  23.802 1.00 132.05 ? 200 GLU A OE2   1 
ATOM   948  N  N     . ASN A 1 126 ? 11.844  50.201  21.502 1.00 137.79 ? 201 ASN A N     1 
ATOM   949  C  CA    . ASN A 1 126 ? 11.525  50.415  20.095 1.00 141.19 ? 201 ASN A CA    1 
ATOM   950  C  C     . ASN A 1 126 ? 11.991  51.795  19.647 1.00 141.07 ? 201 ASN A C     1 
ATOM   951  O  O     . ASN A 1 126 ? 12.924  51.924  18.847 1.00 145.40 ? 201 ASN A O     1 
ATOM   952  C  CB    . ASN A 1 126 ? 10.020  50.239  19.853 1.00 149.78 ? 201 ASN A CB    1 
ATOM   953  C  CG    . ASN A 1 126 ? 9.701   49.650  18.476 1.00 155.18 ? 201 ASN A CG    1 
ATOM   954  O  OD1   . ASN A 1 126 ? 10.541  49.000  17.849 1.00 155.59 ? 201 ASN A OD1   1 
ATOM   955  N  ND2   . ASN A 1 126 ? 8.472   49.870  18.011 1.00 149.21 ? 201 ASN A ND2   1 
ATOM   956  N  N     . ASN A 1 127 ? 11.340  52.830  20.175 1.00 138.42 ? 202 ASN A N     1 
ATOM   957  C  CA    . ASN A 1 127 ? 11.561  54.209  19.767 1.00 136.20 ? 202 ASN A CA    1 
ATOM   958  C  C     . ASN A 1 127 ? 12.562  54.945  20.649 1.00 138.55 ? 202 ASN A C     1 
ATOM   959  O  O     . ASN A 1 127 ? 12.849  56.117  20.385 1.00 140.59 ? 202 ASN A O     1 
ATOM   960  C  CB    . ASN A 1 127 ? 10.227  54.968  19.765 1.00 134.14 ? 202 ASN A CB    1 
ATOM   961  C  CG    . ASN A 1 127 ? 10.255  56.206  18.890 1.00 133.89 ? 202 ASN A CG    1 
ATOM   962  O  OD1   . ASN A 1 127 ? 11.176  56.399  18.097 1.00 130.75 ? 202 ASN A OD1   1 
ATOM   963  N  ND2   . ASN A 1 127 ? 9.237   57.049  19.023 1.00 135.62 ? 202 ASN A ND2   1 
ATOM   964  N  N     . GLU A 1 128 ? 13.107  54.301  21.681 1.00 134.81 ? 203 GLU A N     1 
ATOM   965  C  CA    . GLU A 1 128 ? 13.924  55.011  22.658 1.00 129.71 ? 203 GLU A CA    1 
ATOM   966  C  C     . GLU A 1 128 ? 15.004  54.086  23.209 1.00 125.43 ? 203 GLU A C     1 
ATOM   967  O  O     . GLU A 1 128 ? 15.104  52.914  22.834 1.00 126.74 ? 203 GLU A O     1 
ATOM   968  C  CB    . GLU A 1 128 ? 13.048  55.570  23.785 1.00 133.02 ? 203 GLU A CB    1 
ATOM   969  C  CG    . GLU A 1 128 ? 12.347  54.490  24.595 1.00 132.84 ? 203 GLU A CG    1 
ATOM   970  C  CD    . GLU A 1 128 ? 11.412  55.050  25.650 1.00 135.38 ? 203 GLU A CD    1 
ATOM   971  O  OE1   . GLU A 1 128 ? 10.307  55.507  25.288 1.00 135.23 ? 203 GLU A OE1   1 
ATOM   972  O  OE2   . GLU A 1 128 ? 11.782  55.033  26.843 1.00 137.64 ? 203 GLU A OE2   1 
ATOM   973  N  N     . LEU A 1 129 ? 15.821  54.636  24.111 1.00 122.22 ? 204 LEU A N     1 
ATOM   974  C  CA    . LEU A 1 129 ? 16.866  53.900  24.810 1.00 117.61 ? 204 LEU A CA    1 
ATOM   975  C  C     . LEU A 1 129 ? 16.698  54.093  26.309 1.00 110.81 ? 204 LEU A C     1 
ATOM   976  O  O     . LEU A 1 129 ? 16.231  55.138  26.769 1.00 108.50 ? 204 LEU A O     1 
ATOM   977  C  CB    . LEU A 1 129 ? 18.272  54.360  24.399 1.00 112.27 ? 204 LEU A CB    1 
ATOM   978  C  CG    . LEU A 1 129 ? 18.676  54.193  22.935 1.00 108.91 ? 204 LEU A CG    1 
ATOM   979  C  CD1   . LEU A 1 129 ? 19.997  54.892  22.673 1.00 106.48 ? 204 LEU A CD1   1 
ATOM   980  C  CD2   . LEU A 1 129 ? 18.767  52.724  22.576 1.00 109.37 ? 204 LEU A CD2   1 
ATOM   981  N  N     . ARG A 1 130 ? 17.095  53.081  27.072 1.00 102.11 ? 205 ARG A N     1 
ATOM   982  C  CA    . ARG A 1 130 ? 16.982  53.108  28.523 1.00 102.05 ? 205 ARG A CA    1 
ATOM   983  C  C     . ARG A 1 130 ? 18.360  52.928  29.139 1.00 102.45 ? 205 ARG A C     1 
ATOM   984  O  O     . ARG A 1 130 ? 19.037  51.928  28.878 1.00 104.05 ? 205 ARG A O     1 
ATOM   985  C  CB    . ARG A 1 130 ? 16.023  52.025  29.024 1.00 111.36 ? 205 ARG A CB    1 
ATOM   986  C  CG    . ARG A 1 130 ? 14.612  52.527  29.329 1.00 116.41 ? 205 ARG A CG    1 
ATOM   987  C  CD    . ARG A 1 130 ? 13.772  52.719  28.070 1.00 119.63 ? 205 ARG A CD    1 
ATOM   988  N  NE    . ARG A 1 130 ? 13.055  51.504  27.683 1.00 124.58 ? 205 ARG A NE    1 
ATOM   989  C  CZ    . ARG A 1 130 ? 11.791  51.242  28.010 1.00 119.02 ? 205 ARG A CZ    1 
ATOM   990  N  NH1   . ARG A 1 130 ? 11.098  52.113  28.732 1.00 115.52 ? 205 ARG A NH1   1 
ATOM   991  N  NH2   . ARG A 1 130 ? 11.219  50.111  27.614 1.00 109.13 ? 205 ARG A NH2   1 
ATOM   992  N  N     . ASP A 1 131 ? 18.772  53.900  29.945 1.00 99.85  ? 206 ASP A N     1 
ATOM   993  C  CA    . ASP A 1 131 ? 19.976  53.813  30.759 1.00 94.97  ? 206 ASP A CA    1 
ATOM   994  C  C     . ASP A 1 131 ? 19.545  53.744  32.217 1.00 96.63  ? 206 ASP A C     1 
ATOM   995  O  O     . ASP A 1 131 ? 18.947  54.695  32.736 1.00 94.21  ? 206 ASP A O     1 
ATOM   996  C  CB    . ASP A 1 131 ? 20.894  55.011  30.518 1.00 95.30  ? 206 ASP A CB    1 
ATOM   997  C  CG    . ASP A 1 131 ? 21.578  55.485  31.788 1.00 100.89 ? 206 ASP A CG    1 
ATOM   998  O  OD1   . ASP A 1 131 ? 21.162  56.532  32.336 1.00 97.17  ? 206 ASP A OD1   1 
ATOM   999  O  OD2   . ASP A 1 131 ? 22.515  54.800  32.251 1.00 96.09  ? 206 ASP A OD2   1 
ATOM   1000 N  N     . LEU A 1 132 ? 19.826  52.620  32.872 1.00 92.12  ? 207 LEU A N     1 
ATOM   1001 C  CA    . LEU A 1 132 ? 19.364  52.431  34.238 1.00 93.84  ? 207 LEU A CA    1 
ATOM   1002 C  C     . LEU A 1 132 ? 20.449  51.780  35.081 1.00 86.01  ? 207 LEU A C     1 
ATOM   1003 O  O     . LEU A 1 132 ? 21.403  51.190  34.568 1.00 84.89  ? 207 LEU A O     1 
ATOM   1004 C  CB    . LEU A 1 132 ? 18.063  51.608  34.287 1.00 98.31  ? 207 LEU A CB    1 
ATOM   1005 C  CG    . LEU A 1 132 ? 17.835  50.424  33.347 1.00 97.48  ? 207 LEU A CG    1 
ATOM   1006 C  CD1   . LEU A 1 132 ? 18.473  49.168  33.900 1.00 97.18  ? 207 LEU A CD1   1 
ATOM   1007 C  CD2   . LEU A 1 132 ? 16.344  50.217  33.119 1.00 95.89  ? 207 LEU A CD2   1 
ATOM   1008 N  N     . ILE A 1 133 ? 20.274  51.893  36.395 1.00 86.23  ? 208 ILE A N     1 
ATOM   1009 C  CA    . ILE A 1 133 ? 21.238  51.408  37.375 1.00 83.03  ? 208 ILE A CA    1 
ATOM   1010 C  C     . ILE A 1 133 ? 20.831  49.992  37.764 1.00 87.64  ? 208 ILE A C     1 
ATOM   1011 O  O     . ILE A 1 133 ? 19.834  49.797  38.464 1.00 93.44  ? 208 ILE A O     1 
ATOM   1012 C  CB    . ILE A 1 133 ? 21.279  52.323  38.606 1.00 75.11  ? 208 ILE A CB    1 
ATOM   1013 C  CG1   . ILE A 1 133 ? 21.384  53.790  38.187 1.00 74.50  ? 208 ILE A CG1   1 
ATOM   1014 C  CG2   . ILE A 1 133 ? 22.407  51.934  39.539 1.00 81.35  ? 208 ILE A CG2   1 
ATOM   1015 C  CD1   . ILE A 1 133 ? 22.525  54.086  37.244 1.00 76.47  ? 208 ILE A CD1   1 
ATOM   1016 N  N     . LEU A 1 134 ? 21.614  48.999  37.335 1.00 87.31  ? 209 LEU A N     1 
ATOM   1017 C  CA    . LEU A 1 134 ? 21.320  47.624  37.727 1.00 88.99  ? 209 LEU A CA    1 
ATOM   1018 C  C     . LEU A 1 134 ? 21.701  47.369  39.177 1.00 90.44  ? 209 LEU A C     1 
ATOM   1019 O  O     . LEU A 1 134 ? 21.047  46.575  39.863 1.00 95.02  ? 209 LEU A O     1 
ATOM   1020 C  CB    . LEU A 1 134 ? 22.043  46.637  36.808 1.00 95.70  ? 209 LEU A CB    1 
ATOM   1021 C  CG    . LEU A 1 134 ? 21.463  46.460  35.402 1.00 97.37  ? 209 LEU A CG    1 
ATOM   1022 C  CD1   . LEU A 1 134 ? 22.115  45.288  34.680 1.00 96.83  ? 209 LEU A CD1   1 
ATOM   1023 C  CD2   . LEU A 1 134 ? 19.956  46.279  35.465 1.00 92.70  ? 209 LEU A CD2   1 
ATOM   1024 N  N     . GLY A 1 135 ? 22.759  48.014  39.653 1.00 93.07  ? 210 GLY A N     1 
ATOM   1025 C  CA    . GLY A 1 135 ? 23.094  47.972  41.057 1.00 87.14  ? 210 GLY A CA    1 
ATOM   1026 C  C     . GLY A 1 135 ? 24.459  48.546  41.363 1.00 81.78  ? 210 GLY A C     1 
ATOM   1027 O  O     . GLY A 1 135 ? 25.318  48.683  40.484 1.00 73.35  ? 210 GLY A O     1 
ATOM   1028 N  N     . LEU A 1 136 ? 24.659  48.887  42.629 1.00 79.76  ? 211 LEU A N     1 
ATOM   1029 C  CA    . LEU A 1 136 ? 25.953  49.296  43.148 1.00 72.06  ? 211 LEU A CA    1 
ATOM   1030 C  C     . LEU A 1 136 ? 26.192  48.449  44.386 1.00 75.70  ? 211 LEU A C     1 
ATOM   1031 O  O     . LEU A 1 136 ? 25.519  48.633  45.406 1.00 79.29  ? 211 LEU A O     1 
ATOM   1032 C  CB    . LEU A 1 136 ? 25.958  50.785  43.473 1.00 70.83  ? 211 LEU A CB    1 
ATOM   1033 C  CG    . LEU A 1 136 ? 27.264  51.418  43.930 1.00 74.72  ? 211 LEU A CG    1 
ATOM   1034 C  CD1   . LEU A 1 136 ? 28.325  51.345  42.837 1.00 78.16  ? 211 LEU A CD1   1 
ATOM   1035 C  CD2   . LEU A 1 136 ? 27.002  52.852  44.347 1.00 67.61  ? 211 LEU A CD2   1 
ATOM   1036 N  N     . LYS A 1 137 ? 27.144  47.530  44.304 1.00 76.28  ? 212 LYS A N     1 
ATOM   1037 C  CA    . LYS A 1 137 ? 27.353  46.537  45.343 1.00 80.30  ? 212 LYS A CA    1 
ATOM   1038 C  C     . LYS A 1 137 ? 28.729  46.712  45.960 1.00 80.35  ? 212 LYS A C     1 
ATOM   1039 O  O     . LYS A 1 137 ? 29.717  46.938  45.253 1.00 82.31  ? 212 LYS A O     1 
ATOM   1040 C  CB    . LYS A 1 137 ? 27.200  45.111  44.796 1.00 87.98  ? 212 LYS A CB    1 
ATOM   1041 C  CG    . LYS A 1 137 ? 25.759  44.688  44.553 1.00 98.90  ? 212 LYS A CG    1 
ATOM   1042 C  CD    . LYS A 1 137 ? 25.638  43.172  44.455 1.00 110.62 ? 212 LYS A CD    1 
ATOM   1043 C  CE    . LYS A 1 137 ? 24.179  42.725  44.500 1.00 114.77 ? 212 LYS A CE    1 
ATOM   1044 N  NZ    . LYS A 1 137 ? 24.032  41.241  44.469 1.00 120.28 ? 212 LYS A NZ    1 
ATOM   1045 N  N     . SER A 1 138 ? 28.782  46.607  47.281 1.00 81.78  ? 213 SER A N     1 
ATOM   1046 C  CA    . SER A 1 138 ? 30.039  46.702  48.005 1.00 80.26  ? 213 SER A CA    1 
ATOM   1047 C  C     . SER A 1 138 ? 30.783  45.379  47.951 1.00 82.53  ? 213 SER A C     1 
ATOM   1048 O  O     . SER A 1 138 ? 30.183  44.308  48.079 1.00 94.31  ? 213 SER A O     1 
ATOM   1049 C  CB    . SER A 1 138 ? 29.781  47.085  49.459 1.00 86.53  ? 213 SER A CB    1 
ATOM   1050 O  OG    . SER A 1 138 ? 28.784  46.247  50.020 1.00 90.11  ? 213 SER A OG    1 
ATOM   1051 N  N     . LEU A 1 139 ? 32.094  45.457  47.761 1.00 80.74  ? 214 LEU A N     1 
ATOM   1052 C  CA    . LEU A 1 139 ? 32.951  44.284  47.850 1.00 79.84  ? 214 LEU A CA    1 
ATOM   1053 C  C     . LEU A 1 139 ? 33.449  44.046  49.268 1.00 85.74  ? 214 LEU A C     1 
ATOM   1054 O  O     . LEU A 1 139 ? 34.199  43.093  49.491 1.00 85.11  ? 214 LEU A O     1 
ATOM   1055 C  CB    . LEU A 1 139 ? 34.137  44.411  46.887 1.00 75.68  ? 214 LEU A CB    1 
ATOM   1056 C  CG    . LEU A 1 139 ? 33.876  43.988  45.436 1.00 76.00  ? 214 LEU A CG    1 
ATOM   1057 C  CD1   . LEU A 1 139 ? 32.798  44.843  44.779 1.00 78.20  ? 214 LEU A CD1   1 
ATOM   1058 C  CD2   . LEU A 1 139 ? 35.159  44.021  44.615 1.00 75.05  ? 214 LEU A CD2   1 
ATOM   1059 N  N     . ASP A 1 140 ? 33.038  44.887  50.218 1.00 85.83  ? 215 ASP A N     1 
ATOM   1060 C  CA    . ASP A 1 140 ? 33.301  44.716  51.648 1.00 88.64  ? 215 ASP A CA    1 
ATOM   1061 C  C     . ASP A 1 140 ? 34.756  44.339  51.918 1.00 90.70  ? 215 ASP A C     1 
ATOM   1062 O  O     . ASP A 1 140 ? 35.062  43.267  52.443 1.00 87.60  ? 215 ASP A O     1 
ATOM   1063 C  CB    . ASP A 1 140 ? 32.365  43.671  52.251 1.00 90.69  ? 215 ASP A CB    1 
ATOM   1064 C  CG    . ASP A 1 140 ? 30.930  43.877  51.845 1.00 91.36  ? 215 ASP A CG    1 
ATOM   1065 O  OD1   . ASP A 1 140 ? 30.233  44.662  52.521 1.00 101.00 ? 215 ASP A OD1   1 
ATOM   1066 O  OD2   . ASP A 1 140 ? 30.502  43.251  50.851 1.00 88.80  ? 215 ASP A OD2   1 
ATOM   1067 N  N     . PHE A 1 141 ? 35.653  45.254  51.558 1.00 90.77  ? 216 PHE A N     1 
ATOM   1068 C  CA    . PHE A 1 141 ? 37.075  45.099  51.849 1.00 93.94  ? 216 PHE A CA    1 
ATOM   1069 C  C     . PHE A 1 141 ? 37.595  43.762  51.330 1.00 93.80  ? 216 PHE A C     1 
ATOM   1070 O  O     . PHE A 1 141 ? 38.176  42.958  52.063 1.00 91.85  ? 216 PHE A O     1 
ATOM   1071 C  CB    . PHE A 1 141 ? 37.335  45.251  53.344 1.00 99.15  ? 216 PHE A CB    1 
ATOM   1072 C  CG    . PHE A 1 141 ? 36.814  46.530  53.908 1.00 97.69  ? 216 PHE A CG    1 
ATOM   1073 C  CD1   . PHE A 1 141 ? 37.638  47.635  54.022 1.00 100.86 ? 216 PHE A CD1   1 
ATOM   1074 C  CD2   . PHE A 1 141 ? 35.491  46.635  54.305 1.00 93.04  ? 216 PHE A CD2   1 
ATOM   1075 C  CE1   . PHE A 1 141 ? 37.155  48.820  54.536 1.00 107.36 ? 216 PHE A CE1   1 
ATOM   1076 C  CE2   . PHE A 1 141 ? 35.000  47.813  54.817 1.00 94.16  ? 216 PHE A CE2   1 
ATOM   1077 C  CZ    . PHE A 1 141 ? 35.830  48.909  54.934 1.00 106.11 ? 216 PHE A CZ    1 
ATOM   1078 N  N     . GLU A 1 142 ? 37.375  43.532  50.043 1.00 91.97  ? 217 GLU A N     1 
ATOM   1079 C  CA    . GLU A 1 142 ? 37.828  42.332  49.365 1.00 94.52  ? 217 GLU A CA    1 
ATOM   1080 C  C     . GLU A 1 142 ? 38.888  42.720  48.348 1.00 90.33  ? 217 GLU A C     1 
ATOM   1081 O  O     . GLU A 1 142 ? 39.009  43.885  47.958 1.00 83.28  ? 217 GLU A O     1 
ATOM   1082 C  CB    . GLU A 1 142 ? 36.673  41.589  48.679 1.00 94.50  ? 217 GLU A CB    1 
ATOM   1083 C  CG    . GLU A 1 142 ? 36.333  40.235  49.312 1.00 102.25 ? 217 GLU A CG    1 
ATOM   1084 C  CD    . GLU A 1 142 ? 35.143  39.547  48.647 1.00 116.85 ? 217 GLU A CD    1 
ATOM   1085 O  OE1   . GLU A 1 142 ? 34.104  39.342  49.317 1.00 110.89 ? 217 GLU A OE1   1 
ATOM   1086 O  OE2   . GLU A 1 142 ? 35.247  39.218  47.446 1.00 121.59 ? 217 GLU A OE2   1 
ATOM   1087 N  N     . ARG A 1 143 ? 39.664  41.717  47.937 1.00 97.63  ? 218 ARG A N     1 
ATOM   1088 C  CA    . ARG A 1 143 ? 40.867  41.940  47.146 1.00 97.32  ? 218 ARG A CA    1 
ATOM   1089 C  C     . ARG A 1 143 ? 40.641  42.858  45.953 1.00 94.18  ? 218 ARG A C     1 
ATOM   1090 O  O     . ARG A 1 143 ? 41.593  43.491  45.490 1.00 108.74 ? 218 ARG A O     1 
ATOM   1091 C  CB    . ARG A 1 143 ? 41.416  40.593  46.661 1.00 104.84 ? 218 ARG A CB    1 
ATOM   1092 C  CG    . ARG A 1 143 ? 42.027  39.721  47.752 1.00 116.38 ? 218 ARG A CG    1 
ATOM   1093 C  CD    . ARG A 1 143 ? 43.536  39.898  47.783 1.00 117.72 ? 218 ARG A CD    1 
ATOM   1094 N  NE    . ARG A 1 143 ? 43.907  41.308  47.838 1.00 114.01 ? 218 ARG A NE    1 
ATOM   1095 C  CZ    . ARG A 1 143 ? 45.079  41.790  47.443 1.00 125.37 ? 218 ARG A CZ    1 
ATOM   1096 N  NH1   . ARG A 1 143 ? 46.004  40.974  46.955 1.00 127.74 ? 218 ARG A NH1   1 
ATOM   1097 N  NH2   . ARG A 1 143 ? 45.324  43.091  47.529 1.00 130.54 ? 218 ARG A NH2   1 
ATOM   1098 N  N     . SER A 1 144 ? 39.412  42.948  45.448 1.00 81.18  ? 219 SER A N     1 
ATOM   1099 C  CA    . SER A 1 144 ? 39.087  43.679  44.223 1.00 85.05  ? 219 SER A CA    1 
ATOM   1100 C  C     . SER A 1 144 ? 39.756  43.063  43.001 1.00 80.98  ? 219 SER A C     1 
ATOM   1101 O  O     . SER A 1 144 ? 39.982  43.747  41.997 1.00 78.33  ? 219 SER A O     1 
ATOM   1102 C  CB    . SER A 1 144 ? 39.436  45.173  44.331 1.00 92.21  ? 219 SER A CB    1 
ATOM   1103 O  OG    . SER A 1 144 ? 38.401  45.908  44.966 1.00 95.15  ? 219 SER A OG    1 
ATOM   1104 N  N     . THR A 1 145 ? 40.068  41.773  43.070 1.00 85.62  ? 220 THR A N     1 
ATOM   1105 C  CA    . THR A 1 145 ? 40.587  41.061  41.915 1.00 87.24  ? 220 THR A CA    1 
ATOM   1106 C  C     . THR A 1 145 ? 39.496  40.875  40.864 1.00 87.28  ? 220 THR A C     1 
ATOM   1107 O  O     . THR A 1 145 ? 38.297  40.961  41.147 1.00 84.04  ? 220 THR A O     1 
ATOM   1108 C  CB    . THR A 1 145 ? 41.142  39.698  42.322 1.00 85.64  ? 220 THR A CB    1 
ATOM   1109 O  OG1   . THR A 1 145 ? 41.537  38.981  41.148 1.00 88.04  ? 220 THR A OG1   1 
ATOM   1110 C  CG2   . THR A 1 145 ? 40.090  38.886  43.069 1.00 82.68  ? 220 THR A CG2   1 
ATOM   1111 N  N     . ALA A 1 146 ? 39.933  40.618  39.628 1.00 85.38  ? 221 ALA A N     1 
ATOM   1112 C  CA    . ALA A 1 146 ? 38.996  40.332  38.548 1.00 84.66  ? 221 ALA A CA    1 
ATOM   1113 C  C     . ALA A 1 146 ? 38.041  39.205  38.917 1.00 84.14  ? 221 ALA A C     1 
ATOM   1114 O  O     . ALA A 1 146 ? 36.878  39.214  38.506 1.00 83.22  ? 221 ALA A O     1 
ATOM   1115 C  CB    . ALA A 1 146 ? 39.762  39.979  37.272 1.00 83.33  ? 221 ALA A CB    1 
ATOM   1116 N  N     . GLU A 1 147 ? 38.510  38.239  39.710 1.00 89.21  ? 222 GLU A N     1 
ATOM   1117 C  CA    . GLU A 1 147 ? 37.673  37.103  40.076 1.00 90.51  ? 222 GLU A CA    1 
ATOM   1118 C  C     . GLU A 1 147 ? 36.489  37.535  40.934 1.00 91.11  ? 222 GLU A C     1 
ATOM   1119 O  O     . GLU A 1 147 ? 35.372  37.038  40.755 1.00 91.67  ? 222 GLU A O     1 
ATOM   1120 C  CB    . GLU A 1 147 ? 38.521  36.058  40.800 1.00 91.34  ? 222 GLU A CB    1 
ATOM   1121 C  CG    . GLU A 1 147 ? 39.730  35.596  39.993 1.00 98.01  ? 222 GLU A CG    1 
ATOM   1122 C  CD    . GLU A 1 147 ? 40.875  35.112  40.865 1.00 100.42 ? 222 GLU A CD    1 
ATOM   1123 O  OE1   . GLU A 1 147 ? 40.939  35.519  42.046 1.00 103.22 ? 222 GLU A OE1   1 
ATOM   1124 O  OE2   . GLU A 1 147 ? 41.710  34.325  40.370 1.00 94.96  ? 222 GLU A OE2   1 
ATOM   1125 N  N     . ASN A 1 148 ? 36.711  38.465  41.864 1.00 88.93  ? 223 ASN A N     1 
ATOM   1126 C  CA    . ASN A 1 148 ? 35.632  38.907  42.738 1.00 87.69  ? 223 ASN A CA    1 
ATOM   1127 C  C     . ASN A 1 148 ? 34.652  39.820  42.017 1.00 86.80  ? 223 ASN A C     1 
ATOM   1128 O  O     . ASN A 1 148 ? 33.488  39.916  42.424 1.00 85.07  ? 223 ASN A O     1 
ATOM   1129 C  CB    . ASN A 1 148 ? 36.203  39.621  43.967 1.00 90.76  ? 223 ASN A CB    1 
ATOM   1130 C  CG    . ASN A 1 148 ? 36.929  38.678  44.906 1.00 96.65  ? 223 ASN A CG    1 
ATOM   1131 O  OD1   . ASN A 1 148 ? 37.966  39.027  45.474 1.00 92.01  ? 223 ASN A OD1   1 
ATOM   1132 N  ND2   . ASN A 1 148 ? 36.387  37.475  45.074 1.00 98.93  ? 223 ASN A ND2   1 
ATOM   1133 N  N     . ILE A 1 149 ? 35.100  40.504  40.965 1.00 88.05  ? 224 ILE A N     1 
ATOM   1134 C  CA    . ILE A 1 149 ? 34.216  41.406  40.236 1.00 86.24  ? 224 ILE A CA    1 
ATOM   1135 C  C     . ILE A 1 149 ? 33.238  40.614  39.376 1.00 83.95  ? 224 ILE A C     1 
ATOM   1136 O  O     . ILE A 1 149 ? 32.024  40.845  39.417 1.00 79.81  ? 224 ILE A O     1 
ATOM   1137 C  CB    . ILE A 1 149 ? 35.046  42.394  39.401 1.00 83.87  ? 224 ILE A CB    1 
ATOM   1138 C  CG1   . ILE A 1 149 ? 35.706  43.419  40.321 1.00 78.80  ? 224 ILE A CG1   1 
ATOM   1139 C  CG2   . ILE A 1 149 ? 34.181  43.066  38.347 1.00 87.03  ? 224 ILE A CG2   1 
ATOM   1140 C  CD1   . ILE A 1 149 ? 36.983  43.984  39.768 1.00 85.84  ? 224 ILE A CD1   1 
ATOM   1141 N  N     . TYR A 1 150 ? 33.756  39.672  38.581 1.00 84.68  ? 225 TYR A N     1 
ATOM   1142 C  CA    . TYR A 1 150 ? 32.896  38.739  37.863 1.00 82.56  ? 225 TYR A CA    1 
ATOM   1143 C  C     . TYR A 1 150 ? 31.956  38.027  38.823 1.00 86.94  ? 225 TYR A C     1 
ATOM   1144 O  O     . TYR A 1 150 ? 30.818  37.705  38.465 1.00 86.68  ? 225 TYR A O     1 
ATOM   1145 C  CB    . TYR A 1 150 ? 33.761  37.730  37.101 1.00 82.55  ? 225 TYR A CB    1 
ATOM   1146 C  CG    . TYR A 1 150 ? 33.067  36.962  35.992 1.00 92.09  ? 225 TYR A CG    1 
ATOM   1147 C  CD1   . TYR A 1 150 ? 33.753  35.993  35.266 1.00 102.91 ? 225 TYR A CD1   1 
ATOM   1148 C  CD2   . TYR A 1 150 ? 31.741  37.206  35.661 1.00 91.23  ? 225 TYR A CD2   1 
ATOM   1149 C  CE1   . TYR A 1 150 ? 33.135  35.282  34.249 1.00 103.35 ? 225 TYR A CE1   1 
ATOM   1150 C  CE2   . TYR A 1 150 ? 31.114  36.501  34.647 1.00 93.23  ? 225 TYR A CE2   1 
ATOM   1151 C  CZ    . TYR A 1 150 ? 31.815  35.541  33.943 1.00 102.11 ? 225 TYR A CZ    1 
ATOM   1152 O  OH    . TYR A 1 150 ? 31.195  34.838  32.932 1.00 106.00 ? 225 TYR A OH    1 
ATOM   1153 N  N     . LYS A 1 151 ? 32.415  37.785  40.050 1.00 87.38  ? 226 LYS A N     1 
ATOM   1154 C  CA    . LYS A 1 151 ? 31.555  37.223  41.083 1.00 82.97  ? 226 LYS A CA    1 
ATOM   1155 C  C     . LYS A 1 151 ? 30.394  38.162  41.393 1.00 85.97  ? 226 LYS A C     1 
ATOM   1156 O  O     . LYS A 1 151 ? 29.223  37.780  41.286 1.00 93.46  ? 226 LYS A O     1 
ATOM   1157 C  CB    . LYS A 1 151 ? 32.386  36.939  42.334 1.00 87.61  ? 226 LYS A CB    1 
ATOM   1158 C  CG    . LYS A 1 151 ? 31.711  36.102  43.401 1.00 88.53  ? 226 LYS A CG    1 
ATOM   1159 C  CD    . LYS A 1 151 ? 32.725  35.736  44.480 1.00 91.41  ? 226 LYS A CD    1 
ATOM   1160 C  CE    . LYS A 1 151 ? 32.124  34.857  45.561 1.00 99.33  ? 226 LYS A CE    1 
ATOM   1161 N  NZ    . LYS A 1 151 ? 33.148  34.473  46.572 1.00 91.78  ? 226 LYS A NZ    1 
ATOM   1162 N  N     . LYS A 1 152 ? 30.703  39.409  41.762 1.00 85.39  ? 227 LYS A N     1 
ATOM   1163 C  CA    . LYS A 1 152 ? 29.644  40.353  42.109 1.00 85.83  ? 227 LYS A CA    1 
ATOM   1164 C  C     . LYS A 1 152 ? 28.776  40.678  40.901 1.00 85.00  ? 227 LYS A C     1 
ATOM   1165 O  O     . LYS A 1 152 ? 27.568  40.897  41.041 1.00 88.11  ? 227 LYS A O     1 
ATOM   1166 C  CB    . LYS A 1 152 ? 30.237  41.634  42.698 1.00 82.95  ? 227 LYS A CB    1 
ATOM   1167 C  CG    . LYS A 1 152 ? 31.207  41.407  43.850 1.00 89.13  ? 227 LYS A CG    1 
ATOM   1168 C  CD    . LYS A 1 152 ? 30.654  40.430  44.879 1.00 94.22  ? 227 LYS A CD    1 
ATOM   1169 C  CE    . LYS A 1 152 ? 29.566  41.067  45.730 1.00 96.95  ? 227 LYS A CE    1 
ATOM   1170 N  NZ    . LYS A 1 152 ? 30.135  41.978  46.759 1.00 85.50  ? 227 LYS A NZ    1 
ATOM   1171 N  N     . LEU A 1 153 ? 29.374  40.715  39.709 1.00 83.96  ? 228 LEU A N     1 
ATOM   1172 C  CA    . LEU A 1 153 ? 28.603  41.013  38.507 1.00 81.08  ? 228 LEU A CA    1 
ATOM   1173 C  C     . LEU A 1 153 ? 27.507  39.980  38.286 1.00 87.13  ? 228 LEU A C     1 
ATOM   1174 O  O     . LEU A 1 153 ? 26.394  40.324  37.871 1.00 93.80  ? 228 LEU A O     1 
ATOM   1175 C  CB    . LEU A 1 153 ? 29.534  41.085  37.300 1.00 80.53  ? 228 LEU A CB    1 
ATOM   1176 C  CG    . LEU A 1 153 ? 28.893  41.281  35.928 1.00 79.10  ? 228 LEU A CG    1 
ATOM   1177 C  CD1   . LEU A 1 153 ? 29.675  42.300  35.121 1.00 80.23  ? 228 LEU A CD1   1 
ATOM   1178 C  CD2   . LEU A 1 153 ? 28.842  39.961  35.192 1.00 88.68  ? 228 LEU A CD2   1 
ATOM   1179 N  N     . LYS A 1 154 ? 27.801  38.709  38.560 1.00 87.99  ? 229 LYS A N     1 
ATOM   1180 C  CA    . LYS A 1 154 ? 26.771  37.680  38.485 1.00 84.50  ? 229 LYS A CA    1 
ATOM   1181 C  C     . LYS A 1 154 ? 25.701  37.904  39.544 1.00 88.81  ? 229 LYS A C     1 
ATOM   1182 O  O     . LYS A 1 154 ? 24.502  37.804  39.260 1.00 95.40  ? 229 LYS A O     1 
ATOM   1183 C  CB    . LYS A 1 154 ? 27.395  36.295  38.646 1.00 89.63  ? 229 LYS A CB    1 
ATOM   1184 C  CG    . LYS A 1 154 ? 28.197  35.809  37.452 1.00 95.38  ? 229 LYS A CG    1 
ATOM   1185 C  CD    . LYS A 1 154 ? 28.858  34.470  37.767 1.00 102.14 ? 229 LYS A CD    1 
ATOM   1186 C  CE    . LYS A 1 154 ? 29.666  33.937  36.591 1.00 100.21 ? 229 LYS A CE    1 
ATOM   1187 N  NZ    . LYS A 1 154 ? 30.414  32.696  36.949 1.00 89.02  ? 229 LYS A NZ    1 
ATOM   1188 N  N     . ALA A 1 155 ? 26.120  38.213  40.775 1.00 87.09  ? 230 ALA A N     1 
ATOM   1189 C  CA    . ALA A 1 155 ? 25.162  38.400  41.861 1.00 93.26  ? 230 ALA A CA    1 
ATOM   1190 C  C     . ALA A 1 155 ? 24.159  39.502  41.546 1.00 96.17  ? 230 ALA A C     1 
ATOM   1191 O  O     . ALA A 1 155 ? 23.006  39.433  41.985 1.00 100.39 ? 230 ALA A O     1 
ATOM   1192 C  CB    . ALA A 1 155 ? 25.898  38.709  43.164 1.00 94.43  ? 230 ALA A CB    1 
ATOM   1193 N  N     . ILE A 1 156 ? 24.571  40.519  40.790 1.00 95.41  ? 231 ILE A N     1 
ATOM   1194 C  CA    . ILE A 1 156 ? 23.623  41.522  40.319 1.00 94.38  ? 231 ILE A CA    1 
ATOM   1195 C  C     . ILE A 1 156 ? 22.654  40.900  39.325 1.00 93.84  ? 231 ILE A C     1 
ATOM   1196 O  O     . ILE A 1 156 ? 21.432  41.035  39.454 1.00 95.21  ? 231 ILE A O     1 
ATOM   1197 C  CB    . ILE A 1 156 ? 24.367  42.716  39.699 1.00 94.80  ? 231 ILE A CB    1 
ATOM   1198 C  CG1   . ILE A 1 156 ? 25.394  43.277  40.682 1.00 92.67  ? 231 ILE A CG1   1 
ATOM   1199 C  CG2   . ILE A 1 156 ? 23.377  43.793  39.281 1.00 99.70  ? 231 ILE A CG2   1 
ATOM   1200 C  CD1   . ILE A 1 156 ? 26.175  44.446  40.134 1.00 87.50  ? 231 ILE A CD1   1 
ATOM   1201 N  N     . PHE A 1 157 ? 23.189  40.206  38.319 1.00 90.80  ? 232 PHE A N     1 
ATOM   1202 C  CA    . PHE A 1 157 ? 22.345  39.535  37.336 1.00 95.36  ? 232 PHE A CA    1 
ATOM   1203 C  C     . PHE A 1 157 ? 21.502  38.435  37.966 1.00 99.44  ? 232 PHE A C     1 
ATOM   1204 O  O     . PHE A 1 157 ? 20.404  38.141  37.480 1.00 100.09 ? 232 PHE A O     1 
ATOM   1205 C  CB    . PHE A 1 157 ? 23.211  38.959  36.219 1.00 96.05  ? 232 PHE A CB    1 
ATOM   1206 C  CG    . PHE A 1 157 ? 23.853  39.998  35.354 1.00 95.35  ? 232 PHE A CG    1 
ATOM   1207 C  CD1   . PHE A 1 157 ? 25.042  39.730  34.693 1.00 98.34  ? 232 PHE A CD1   1 
ATOM   1208 C  CD2   . PHE A 1 157 ? 23.267  41.240  35.194 1.00 93.44  ? 232 PHE A CD2   1 
ATOM   1209 C  CE1   . PHE A 1 157 ? 25.634  40.685  33.889 1.00 93.94  ? 232 PHE A CE1   1 
ATOM   1210 C  CE2   . PHE A 1 157 ? 23.854  42.200  34.391 1.00 96.51  ? 232 PHE A CE2   1 
ATOM   1211 C  CZ    . PHE A 1 157 ? 25.038  41.923  33.739 1.00 95.12  ? 232 PHE A CZ    1 
ATOM   1212 N  N     . SER A 1 158 ? 21.994  37.814  39.041 1.00 98.42  ? 233 SER A N     1 
ATOM   1213 C  CA    . SER A 1 158 ? 21.216  36.788  39.725 1.00 99.14  ? 233 SER A CA    1 
ATOM   1214 C  C     . SER A 1 158 ? 19.961  37.354  40.377 1.00 99.27  ? 233 SER A C     1 
ATOM   1215 O  O     . SER A 1 158 ? 19.061  36.586  40.732 1.00 104.12 ? 233 SER A O     1 
ATOM   1216 C  CB    . SER A 1 158 ? 22.081  36.084  40.774 1.00 105.05 ? 233 SER A CB    1 
ATOM   1217 O  OG    . SER A 1 158 ? 23.165  35.395  40.169 1.00 103.75 ? 233 SER A OG    1 
ATOM   1218 N  N     . GLN A 1 159 ? 19.882  38.676  40.546 1.00 99.92  ? 234 GLN A N     1 
ATOM   1219 C  CA    . GLN A 1 159 ? 18.679  39.304  41.083 1.00 100.95 ? 234 GLN A CA    1 
ATOM   1220 C  C     . GLN A 1 159 ? 17.590  39.451  40.028 1.00 99.21  ? 234 GLN A C     1 
ATOM   1221 O  O     . GLN A 1 159 ? 16.401  39.408  40.359 1.00 105.29 ? 234 GLN A O     1 
ATOM   1222 C  CB    . GLN A 1 159 ? 19.024  40.671  41.672 1.00 105.39 ? 234 GLN A CB    1 
ATOM   1223 C  CG    . GLN A 1 159 ? 20.061  40.616  42.782 1.00 109.48 ? 234 GLN A CG    1 
ATOM   1224 C  CD    . GLN A 1 159 ? 20.390  41.985  43.345 1.00 119.31 ? 234 GLN A CD    1 
ATOM   1225 O  OE1   . GLN A 1 159 ? 21.070  42.789  42.702 1.00 118.99 ? 234 GLN A OE1   1 
ATOM   1226 N  NE2   . GLN A 1 159 ? 19.907  42.260  44.553 1.00 121.92 ? 234 GLN A NE2   1 
ATOM   1227 N  N     . PHE A 1 160 ? 17.972  39.647  38.770 1.00 97.11  ? 235 PHE A N     1 
ATOM   1228 C  CA    . PHE A 1 160 ? 17.030  39.686  37.662 1.00 99.11  ? 235 PHE A CA    1 
ATOM   1229 C  C     . PHE A 1 160 ? 16.911  38.346  36.958 1.00 101.29 ? 235 PHE A C     1 
ATOM   1230 O  O     . PHE A 1 160 ? 16.223  38.258  35.933 1.00 99.18  ? 235 PHE A O     1 
ATOM   1231 C  CB    . PHE A 1 160 ? 17.436  40.772  36.670 1.00 98.19  ? 235 PHE A CB    1 
ATOM   1232 C  CG    . PHE A 1 160 ? 17.560  42.122  37.295 1.00 96.12  ? 235 PHE A CG    1 
ATOM   1233 C  CD1   . PHE A 1 160 ? 16.447  42.925  37.451 1.00 99.01  ? 235 PHE A CD1   1 
ATOM   1234 C  CD2   . PHE A 1 160 ? 18.782  42.581  37.751 1.00 97.52  ? 235 PHE A CD2   1 
ATOM   1235 C  CE1   . PHE A 1 160 ? 16.550  44.167  38.036 1.00 97.99  ? 235 PHE A CE1   1 
ATOM   1236 C  CE2   . PHE A 1 160 ? 18.893  43.823  38.338 1.00 97.92  ? 235 PHE A CE2   1 
ATOM   1237 C  CZ    . PHE A 1 160 ? 17.774  44.617  38.482 1.00 98.60  ? 235 PHE A CZ    1 
ATOM   1238 N  N     . ASN A 1 161 ? 17.586  37.317  37.475 1.00 104.40 ? 236 ASN A N     1 
ATOM   1239 C  CA    . ASN A 1 161 ? 17.534  35.914  37.062 1.00 106.27 ? 236 ASN A CA    1 
ATOM   1240 C  C     . ASN A 1 161 ? 18.382  35.651  35.825 1.00 108.13 ? 236 ASN A C     1 
ATOM   1241 O  O     . ASN A 1 161 ? 18.424  34.502  35.355 1.00 113.62 ? 236 ASN A O     1 
ATOM   1242 C  CB    . ASN A 1 161 ? 16.097  35.422  36.828 1.00 101.67 ? 236 ASN A CB    1 
ATOM   1243 C  CG    . ASN A 1 161 ? 15.189  35.750  37.994 1.00 105.73 ? 236 ASN A CG    1 
ATOM   1244 O  OD1   . ASN A 1 161 ? 15.294  35.142  39.059 1.00 107.18 ? 236 ASN A OD1   1 
ATOM   1245 N  ND2   . ASN A 1 161 ? 14.306  36.726  37.809 1.00 104.89 ? 236 ASN A ND2   1 
ATOM   1246 N  N     . VAL A 1 162 ? 19.033  36.667  35.265 1.00 102.52 ? 237 VAL A N     1 
ATOM   1247 C  CA    . VAL A 1 162 ? 19.832  36.469  34.065 1.00 104.40 ? 237 VAL A CA    1 
ATOM   1248 C  C     . VAL A 1 162 ? 21.128  35.778  34.446 1.00 111.59 ? 237 VAL A C     1 
ATOM   1249 O  O     . VAL A 1 162 ? 21.910  36.291  35.255 1.00 109.63 ? 237 VAL A O     1 
ATOM   1250 C  CB    . VAL A 1 162 ? 20.123  37.803  33.378 1.00 104.99 ? 237 VAL A CB    1 
ATOM   1251 C  CG1   . VAL A 1 162 ? 20.620  37.571  31.950 1.00 112.59 ? 237 VAL A CG1   1 
ATOM   1252 C  CG2   . VAL A 1 162 ? 18.906  38.694  33.407 1.00 106.73 ? 237 VAL A CG2   1 
ATOM   1253 N  N     . GLU A 1 163 ? 21.364  34.604  33.880 1.00 115.04 ? 238 GLU A N     1 
ATOM   1254 C  CA    . GLU A 1 163 ? 22.672  33.974  33.999 1.00 110.64 ? 238 GLU A CA    1 
ATOM   1255 C  C     . GLU A 1 163 ? 23.042  33.418  32.632 1.00 114.07 ? 238 GLU A C     1 
ATOM   1256 O  O     . GLU A 1 163 ? 22.369  32.511  32.129 1.00 125.10 ? 238 GLU A O     1 
ATOM   1257 C  CB    . GLU A 1 163 ? 22.650  32.884  35.071 1.00 111.33 ? 238 GLU A CB    1 
ATOM   1258 C  CG    . GLU A 1 163 ? 23.882  32.856  35.978 1.00 112.34 ? 238 GLU A CG    1 
ATOM   1259 C  CD    . GLU A 1 163 ? 23.897  33.955  37.035 1.00 112.53 ? 238 GLU A CD    1 
ATOM   1260 O  OE1   . GLU A 1 163 ? 22.900  34.102  37.776 1.00 113.14 ? 238 GLU A OE1   1 
ATOM   1261 O  OE2   . GLU A 1 163 ? 24.921  34.664  37.132 1.00 109.20 ? 238 GLU A OE2   1 
ATOM   1262 N  N     . ASP A 1 164 ? 24.058  33.993  31.994 1.00 112.97 ? 239 ASP A N     1 
ATOM   1263 C  CA    . ASP A 1 164 ? 24.533  33.384  30.758 1.00 118.74 ? 239 ASP A CA    1 
ATOM   1264 C  C     . ASP A 1 164 ? 26.057  33.424  30.610 1.00 121.54 ? 239 ASP A C     1 
ATOM   1265 O  O     . ASP A 1 164 ? 26.719  32.380  30.631 1.00 119.51 ? 239 ASP A O     1 
ATOM   1266 C  CB    . ASP A 1 164 ? 23.849  34.040  29.566 1.00 114.61 ? 239 ASP A CB    1 
ATOM   1267 C  CG    . ASP A 1 164 ? 23.850  33.142  28.343 1.00 118.46 ? 239 ASP A CG    1 
ATOM   1268 O  OD1   . ASP A 1 164 ? 23.087  33.414  27.399 1.00 121.96 ? 239 ASP A OD1   1 
ATOM   1269 O  OD2   . ASP A 1 164 ? 24.616  32.155  28.349 1.00 120.29 ? 239 ASP A OD2   1 
ATOM   1270 N  N     . LEU A 1 165 ? 26.598  34.648  30.493 1.00 119.29 ? 240 LEU A N     1 
ATOM   1271 C  CA    . LEU A 1 165 ? 27.952  35.042  30.092 1.00 119.89 ? 240 LEU A CA    1 
ATOM   1272 C  C     . LEU A 1 165 ? 28.113  35.217  28.589 1.00 120.22 ? 240 LEU A C     1 
ATOM   1273 O  O     . LEU A 1 165 ? 29.104  35.817  28.173 1.00 122.11 ? 240 LEU A O     1 
ATOM   1274 C  CB    . LEU A 1 165 ? 29.025  34.040  30.567 1.00 114.69 ? 240 LEU A CB    1 
ATOM   1275 C  CG    . LEU A 1 165 ? 29.577  33.009  29.545 1.00 112.91 ? 240 LEU A CG    1 
ATOM   1276 C  CD1   . LEU A 1 165 ? 30.922  33.443  28.978 1.00 114.14 ? 240 LEU A CD1   1 
ATOM   1277 C  CD2   . LEU A 1 165 ? 29.679  31.599  30.135 1.00 110.66 ? 240 LEU A CD2   1 
ATOM   1278 N  N     . SER A 1 166 ? 27.194  34.752  27.744 1.00 117.26 ? 241 SER A N     1 
ATOM   1279 C  CA    . SER A 1 166 ? 27.280  35.192  26.354 1.00 112.24 ? 241 SER A CA    1 
ATOM   1280 C  C     . SER A 1 166 ? 25.889  35.581  25.894 1.00 117.02 ? 241 SER A C     1 
ATOM   1281 O  O     . SER A 1 166 ? 25.081  34.754  25.462 1.00 123.16 ? 241 SER A O     1 
ATOM   1282 C  CB    . SER A 1 166 ? 27.893  34.116  25.469 1.00 117.64 ? 241 SER A CB    1 
ATOM   1283 O  OG    . SER A 1 166 ? 26.973  33.068  25.219 1.00 125.36 ? 241 SER A OG    1 
ATOM   1284 N  N     . SER A 1 167 ? 25.609  36.864  26.021 1.00 116.87 ? 242 SER A N     1 
ATOM   1285 C  CA    . SER A 1 167 ? 24.716  37.628  25.171 1.00 114.04 ? 242 SER A CA    1 
ATOM   1286 C  C     . SER A 1 167 ? 25.255  39.044  25.168 1.00 113.18 ? 242 SER A C     1 
ATOM   1287 O  O     . SER A 1 167 ? 25.605  39.608  24.124 1.00 119.14 ? 242 SER A O     1 
ATOM   1288 C  CB    . SER A 1 167 ? 23.274  37.551  25.662 1.00 111.32 ? 242 SER A CB    1 
ATOM   1289 O  OG    . SER A 1 167 ? 22.660  36.369  25.213 1.00 103.73 ? 242 SER A OG    1 
ATOM   1290 N  N     . ILE A 1 168 ? 25.301  39.596  26.383 1.00 108.00 ? 243 ILE A N     1 
ATOM   1291 C  CA    . ILE A 1 168 ? 25.562  40.996  26.698 1.00 106.40 ? 243 ILE A CA    1 
ATOM   1292 C  C     . ILE A 1 168 ? 26.854  41.530  26.092 1.00 103.99 ? 243 ILE A C     1 
ATOM   1293 O  O     . ILE A 1 168 ? 27.828  40.795  25.904 1.00 105.02 ? 243 ILE A O     1 
ATOM   1294 C  CB    . ILE A 1 168 ? 25.589  41.159  28.227 1.00 99.86  ? 243 ILE A CB    1 
ATOM   1295 C  CG1   . ILE A 1 168 ? 24.701  40.075  28.860 1.00 95.98  ? 243 ILE A CG1   1 
ATOM   1296 C  CG2   . ILE A 1 168 ? 25.124  42.545  28.647 1.00 96.31  ? 243 ILE A CG2   1 
ATOM   1297 C  CD1   . ILE A 1 168 ? 24.918  39.843  30.338 1.00 93.06  ? 243 ILE A CD1   1 
ATOM   1298 N  N     . LYS A 1 169 ? 26.855  42.823  25.782 1.00 100.13 ? 244 LYS A N     1 
ATOM   1299 C  CA    . LYS A 1 169 ? 28.017  43.548  25.282 1.00 102.02 ? 244 LYS A CA    1 
ATOM   1300 C  C     . LYS A 1 169 ? 28.454  44.556  26.340 1.00 96.87  ? 244 LYS A C     1 
ATOM   1301 O  O     . LYS A 1 169 ? 27.696  45.472  26.684 1.00 91.28  ? 244 LYS A O     1 
ATOM   1302 C  CB    . LYS A 1 169 ? 27.689  44.256  23.967 1.00 101.80 ? 244 LYS A CB    1 
ATOM   1303 C  CG    . LYS A 1 169 ? 26.952  43.377  22.977 1.00 109.27 ? 244 LYS A CG    1 
ATOM   1304 C  CD    . LYS A 1 169 ? 26.113  44.211  22.030 1.00 112.71 ? 244 LYS A CD    1 
ATOM   1305 C  CE    . LYS A 1 169 ? 25.381  43.310  21.056 1.00 116.84 ? 244 LYS A CE    1 
ATOM   1306 N  NZ    . LYS A 1 169 ? 24.442  44.043  20.161 1.00 119.26 ? 244 LYS A NZ    1 
ATOM   1307 N  N     . PHE A 1 170 ? 29.668  44.386  26.854 1.00 97.02  ? 245 PHE A N     1 
ATOM   1308 C  CA    . PHE A 1 170 ? 30.180  45.190  27.957 1.00 90.56  ? 245 PHE A CA    1 
ATOM   1309 C  C     . PHE A 1 170 ? 31.153  46.237  27.441 1.00 89.09  ? 245 PHE A C     1 
ATOM   1310 O  O     . PHE A 1 170 ? 32.035  45.930  26.632 1.00 87.91  ? 245 PHE A O     1 
ATOM   1311 C  CB    . PHE A 1 170 ? 30.868  44.307  28.997 1.00 86.27  ? 245 PHE A CB    1 
ATOM   1312 C  CG    . PHE A 1 170 ? 29.923  43.438  29.753 1.00 88.76  ? 245 PHE A CG    1 
ATOM   1313 C  CD1   . PHE A 1 170 ? 29.357  43.884  30.932 1.00 87.66  ? 245 PHE A CD1   1 
ATOM   1314 C  CD2   . PHE A 1 170 ? 29.582  42.183  29.279 1.00 87.99  ? 245 PHE A CD2   1 
ATOM   1315 C  CE1   . PHE A 1 170 ? 28.479  43.093  31.635 1.00 85.19  ? 245 PHE A CE1   1 
ATOM   1316 C  CE2   . PHE A 1 170 ? 28.700  41.384  29.976 1.00 82.03  ? 245 PHE A CE2   1 
ATOM   1317 C  CZ    . PHE A 1 170 ? 28.149  41.840  31.157 1.00 80.56  ? 245 PHE A CZ    1 
ATOM   1318 N  N     . VAL A 1 171 ? 30.997  47.467  27.918 1.00 82.89  ? 246 VAL A N     1 
ATOM   1319 C  CA    . VAL A 1 171 ? 31.914  48.555  27.613 1.00 79.10  ? 246 VAL A CA    1 
ATOM   1320 C  C     . VAL A 1 171 ? 32.571  48.998  28.914 1.00 78.09  ? 246 VAL A C     1 
ATOM   1321 O  O     . VAL A 1 171 ? 31.889  49.201  29.926 1.00 73.72  ? 246 VAL A O     1 
ATOM   1322 C  CB    . VAL A 1 171 ? 31.198  49.724  26.911 1.00 82.14  ? 246 VAL A CB    1 
ATOM   1323 C  CG1   . VAL A 1 171 ? 29.955  50.146  27.678 1.00 86.72  ? 246 VAL A CG1   1 
ATOM   1324 C  CG2   . VAL A 1 171 ? 32.147  50.896  26.735 1.00 81.80  ? 246 VAL A CG2   1 
ATOM   1325 N  N     . THR A 1 172 ? 33.898  49.111  28.895 1.00 81.85  ? 247 THR A N     1 
ATOM   1326 C  CA    . THR A 1 172 ? 34.637  49.476  30.095 1.00 80.33  ? 247 THR A CA    1 
ATOM   1327 C  C     . THR A 1 172 ? 36.003  50.027  29.717 1.00 76.73  ? 247 THR A C     1 
ATOM   1328 O  O     . THR A 1 172 ? 36.484  49.830  28.597 1.00 73.60  ? 247 THR A O     1 
ATOM   1329 C  CB    . THR A 1 172 ? 34.809  48.285  31.031 1.00 82.03  ? 247 THR A CB    1 
ATOM   1330 O  OG1   . THR A 1 172 ? 35.321  48.754  32.283 1.00 83.29  ? 247 THR A OG1   1 
ATOM   1331 C  CG2   . THR A 1 172 ? 35.785  47.277  30.422 1.00 77.65  ? 247 THR A CG2   1 
ATOM   1332 N  N     . ASP A 1 173 ? 36.631  50.705  30.680 1.00 75.86  ? 248 ASP A N     1 
ATOM   1333 C  CA    . ASP A 1 173 ? 37.994  51.180  30.500 1.00 75.27  ? 248 ASP A CA    1 
ATOM   1334 C  C     . ASP A 1 173 ? 38.969  50.005  30.569 1.00 73.82  ? 248 ASP A C     1 
ATOM   1335 O  O     . ASP A 1 173 ? 38.582  48.841  30.693 1.00 82.67  ? 248 ASP A O     1 
ATOM   1336 C  CB    . ASP A 1 173 ? 38.340  52.264  31.526 1.00 78.71  ? 248 ASP A CB    1 
ATOM   1337 C  CG    . ASP A 1 173 ? 38.144  51.820  32.972 1.00 75.67  ? 248 ASP A CG    1 
ATOM   1338 O  OD1   . ASP A 1 173 ? 38.819  50.870  33.421 1.00 71.40  ? 248 ASP A OD1   1 
ATOM   1339 O  OD2   . ASP A 1 173 ? 37.346  52.468  33.677 1.00 69.08  ? 248 ASP A OD2   1 
ATOM   1340 N  N     . ARG A 1 174 ? 40.255  50.316  30.468 1.00 73.89  ? 249 ARG A N     1 
ATOM   1341 C  CA    . ARG A 1 174 ? 41.293  49.301  30.331 1.00 79.63  ? 249 ARG A CA    1 
ATOM   1342 C  C     . ARG A 1 174 ? 41.934  48.895  31.655 1.00 73.13  ? 249 ARG A C     1 
ATOM   1343 O  O     . ARG A 1 174 ? 42.969  48.222  31.637 1.00 73.58  ? 249 ARG A O     1 
ATOM   1344 C  CB    . ARG A 1 174 ? 42.358  49.767  29.337 1.00 71.92  ? 249 ARG A CB    1 
ATOM   1345 C  CG    . ARG A 1 174 ? 41.846  49.765  27.906 1.00 73.49  ? 249 ARG A CG    1 
ATOM   1346 C  CD    . ARG A 1 174 ? 42.965  50.025  26.938 1.00 68.43  ? 249 ARG A CD    1 
ATOM   1347 N  NE    . ARG A 1 174 ? 43.697  51.224  27.316 1.00 70.91  ? 249 ARG A NE    1 
ATOM   1348 C  CZ    . ARG A 1 174 ? 44.828  51.614  26.746 1.00 72.02  ? 249 ARG A CZ    1 
ATOM   1349 N  NH1   . ARG A 1 174 ? 45.359  50.894  25.767 1.00 76.78  ? 249 ARG A NH1   1 
ATOM   1350 N  NH2   . ARG A 1 174 ? 45.428  52.720  27.158 1.00 75.47  ? 249 ARG A NH2   1 
ATOM   1351 N  N     . GLY A 1 175 ? 41.383  49.329  32.790 1.00 70.83  ? 250 GLY A N     1 
ATOM   1352 C  CA    . GLY A 1 175 ? 41.882  48.894  34.083 1.00 70.65  ? 250 GLY A CA    1 
ATOM   1353 C  C     . GLY A 1 175 ? 42.044  47.389  34.168 1.00 76.28  ? 250 GLY A C     1 
ATOM   1354 O  O     . GLY A 1 175 ? 41.190  46.645  33.677 1.00 76.05  ? 250 GLY A O     1 
ATOM   1355 N  N     . ALA A 1 176 ? 43.143  46.932  34.780 1.00 80.40  ? 251 ALA A N     1 
ATOM   1356 C  CA    . ALA A 1 176 ? 43.515  45.522  34.697 1.00 72.43  ? 251 ALA A CA    1 
ATOM   1357 C  C     . ALA A 1 176 ? 42.489  44.621  35.375 1.00 73.38  ? 251 ALA A C     1 
ATOM   1358 O  O     . ALA A 1 176 ? 42.164  43.550  34.850 1.00 74.51  ? 251 ALA A O     1 
ATOM   1359 C  CB    . ALA A 1 176 ? 44.901  45.311  35.306 1.00 72.85  ? 251 ALA A CB    1 
ATOM   1360 N  N     . ASN A 1 177 ? 41.986  45.021  36.547 1.00 74.15  ? 252 ASN A N     1 
ATOM   1361 C  CA    . ASN A 1 177 ? 40.934  44.257  37.213 1.00 75.04  ? 252 ASN A CA    1 
ATOM   1362 C  C     . ASN A 1 177 ? 39.774  44.012  36.264 1.00 76.09  ? 252 ASN A C     1 
ATOM   1363 O  O     . ASN A 1 177 ? 39.465  42.871  35.909 1.00 75.44  ? 252 ASN A O     1 
ATOM   1364 C  CB    . ASN A 1 177 ? 40.426  45.001  38.451 1.00 74.68  ? 252 ASN A CB    1 
ATOM   1365 C  CG    . ASN A 1 177 ? 41.493  45.817  39.112 1.00 90.29  ? 252 ASN A CG    1 
ATOM   1366 O  OD1   . ASN A 1 177 ? 41.953  46.819  38.564 1.00 93.37  ? 252 ASN A OD1   1 
ATOM   1367 N  ND2   . ASN A 1 177 ? 41.893  45.406  40.306 1.00 97.22  ? 252 ASN A ND2   1 
ATOM   1368 N  N     . VAL A 1 178 ? 39.129  45.097  35.837 1.00 77.49  ? 253 VAL A N     1 
ATOM   1369 C  CA    . VAL A 1 178 ? 37.948  44.991  34.990 1.00 72.98  ? 253 VAL A CA    1 
ATOM   1370 C  C     . VAL A 1 178 ? 38.268  44.241  33.700 1.00 77.30  ? 253 VAL A C     1 
ATOM   1371 O  O     . VAL A 1 178 ? 37.505  43.368  33.277 1.00 79.99  ? 253 VAL A O     1 
ATOM   1372 C  CB    . VAL A 1 178 ? 37.371  46.388  34.706 1.00 61.99  ? 253 VAL A CB    1 
ATOM   1373 C  CG1   . VAL A 1 178 ? 36.127  46.263  33.874 1.00 67.60  ? 253 VAL A CG1   1 
ATOM   1374 C  CG2   . VAL A 1 178 ? 37.070  47.110  36.013 1.00 66.46  ? 253 VAL A CG2   1 
ATOM   1375 N  N     . VAL A 1 179 ? 39.397  44.553  33.056 1.00 80.26  ? 254 VAL A N     1 
ATOM   1376 C  CA    . VAL A 1 179 ? 39.607  44.025  31.707 1.00 83.72  ? 254 VAL A CA    1 
ATOM   1377 C  C     . VAL A 1 179 ? 39.703  42.505  31.724 1.00 88.59  ? 254 VAL A C     1 
ATOM   1378 O  O     . VAL A 1 179 ? 39.227  41.828  30.803 1.00 91.01  ? 254 VAL A O     1 
ATOM   1379 C  CB    . VAL A 1 179 ? 40.845  44.647  31.039 1.00 83.14  ? 254 VAL A CB    1 
ATOM   1380 C  CG1   . VAL A 1 179 ? 42.158  44.063  31.610 1.00 82.48  ? 254 VAL A CG1   1 
ATOM   1381 C  CG2   . VAL A 1 179 ? 40.742  44.424  29.536 1.00 88.30  ? 254 VAL A CG2   1 
ATOM   1382 N  N     . LYS A 1 180 ? 40.330  41.944  32.760 1.00 88.25  ? 255 LYS A N     1 
ATOM   1383 C  CA    . LYS A 1 180 ? 40.450  40.498  32.864 1.00 88.93  ? 255 LYS A CA    1 
ATOM   1384 C  C     . LYS A 1 180 ? 39.152  39.863  33.333 1.00 90.72  ? 255 LYS A C     1 
ATOM   1385 O  O     . LYS A 1 180 ? 38.827  38.744  32.923 1.00 93.72  ? 255 LYS A O     1 
ATOM   1386 C  CB    . LYS A 1 180 ? 41.583  40.131  33.822 1.00 86.51  ? 255 LYS A CB    1 
ATOM   1387 C  CG    . LYS A 1 180 ? 41.809  38.637  33.964 1.00 93.17  ? 255 LYS A CG    1 
ATOM   1388 C  CD    . LYS A 1 180 ? 42.735  38.312  35.127 1.00 100.01 ? 255 LYS A CD    1 
ATOM   1389 C  CE    . LYS A 1 180 ? 42.976  36.808  35.213 1.00 109.40 ? 255 LYS A CE    1 
ATOM   1390 N  NZ    . LYS A 1 180 ? 43.955  36.409  36.268 1.00 114.57 ? 255 LYS A NZ    1 
ATOM   1391 N  N     . SER A 1 181 ? 38.402  40.556  34.190 1.00 87.12  ? 256 SER A N     1 
ATOM   1392 C  CA    . SER A 1 181 ? 37.156  39.988  34.686 1.00 85.15  ? 256 SER A CA    1 
ATOM   1393 C  C     . SER A 1 181 ? 36.181  39.709  33.549 1.00 88.53  ? 256 SER A C     1 
ATOM   1394 O  O     . SER A 1 181 ? 35.391  38.760  33.626 1.00 90.68  ? 256 SER A O     1 
ATOM   1395 C  CB    . SER A 1 181 ? 36.528  40.925  35.714 1.00 87.32  ? 256 SER A CB    1 
ATOM   1396 O  OG    . SER A 1 181 ? 35.467  40.285  36.394 1.00 96.12  ? 256 SER A OG    1 
ATOM   1397 N  N     . LEU A 1 182 ? 36.238  40.504  32.483 1.00 90.56  ? 257 LEU A N     1 
ATOM   1398 C  CA    . LEU A 1 182 ? 35.373  40.353  31.319 1.00 93.67  ? 257 LEU A CA    1 
ATOM   1399 C  C     . LEU A 1 182 ? 36.000  39.511  30.214 1.00 95.24  ? 257 LEU A C     1 
ATOM   1400 O  O     . LEU A 1 182 ? 35.429  39.427  29.121 1.00 95.50  ? 257 LEU A O     1 
ATOM   1401 C  CB    . LEU A 1 182 ? 34.993  41.727  30.759 1.00 94.13  ? 257 LEU A CB    1 
ATOM   1402 C  CG    . LEU A 1 182 ? 34.293  42.699  31.707 1.00 87.15  ? 257 LEU A CG    1 
ATOM   1403 C  CD1   . LEU A 1 182 ? 34.037  44.018  30.996 1.00 86.97  ? 257 LEU A CD1   1 
ATOM   1404 C  CD2   . LEU A 1 182 ? 32.999  42.103  32.228 1.00 87.91  ? 257 LEU A CD2   1 
ATOM   1405 N  N     . ALA A 1 183 ? 37.163  38.900  30.467 1.00 94.25  ? 258 ALA A N     1 
ATOM   1406 C  CA    . ALA A 1 183 ? 37.912  38.217  29.415 1.00 95.19  ? 258 ALA A CA    1 
ATOM   1407 C  C     . ALA A 1 183 ? 37.104  37.139  28.706 1.00 98.62  ? 258 ALA A C     1 
ATOM   1408 O  O     . ALA A 1 183 ? 37.489  36.718  27.610 1.00 98.52  ? 258 ALA A O     1 
ATOM   1409 C  CB    . ALA A 1 183 ? 39.184  37.593  29.990 1.00 92.80  ? 258 ALA A CB    1 
ATOM   1410 N  N     . ASN A 1 184 ? 36.002  36.684  29.296 1.00 98.17  ? 259 ASN A N     1 
ATOM   1411 C  CA    . ASN A 1 184 ? 35.242  35.569  28.751 1.00 99.00  ? 259 ASN A CA    1 
ATOM   1412 C  C     . ASN A 1 184 ? 34.111  35.990  27.820 1.00 96.20  ? 259 ASN A C     1 
ATOM   1413 O  O     . ASN A 1 184 ? 33.383  35.120  27.334 1.00 99.75  ? 259 ASN A O     1 
ATOM   1414 C  CB    . ASN A 1 184 ? 34.671  34.720  29.890 1.00 99.19  ? 259 ASN A CB    1 
ATOM   1415 C  CG    . ASN A 1 184 ? 35.752  34.030  30.696 1.00 98.96  ? 259 ASN A CG    1 
ATOM   1416 O  OD1   . ASN A 1 184 ? 36.763  33.584  30.150 1.00 86.03  ? 259 ASN A OD1   1 
ATOM   1417 N  ND2   . ASN A 1 184 ? 35.547  33.942  32.005 1.00 104.82 ? 259 ASN A ND2   1 
ATOM   1418 N  N     . ASN A 1 185 ? 33.929  37.280  27.555 1.00 93.64  ? 260 ASN A N     1 
ATOM   1419 C  CA    . ASN A 1 185 ? 32.820  37.696  26.700 1.00 96.60  ? 260 ASN A CA    1 
ATOM   1420 C  C     . ASN A 1 185 ? 33.112  39.078  26.122 1.00 97.25  ? 260 ASN A C     1 
ATOM   1421 O  O     . ASN A 1 185 ? 34.237  39.581  26.206 1.00 94.96  ? 260 ASN A O     1 
ATOM   1422 C  CB    . ASN A 1 185 ? 31.495  37.651  27.468 1.00 94.03  ? 260 ASN A CB    1 
ATOM   1423 C  CG    . ASN A 1 185 ? 31.532  38.455  28.744 1.00 91.93  ? 260 ASN A CG    1 
ATOM   1424 O  OD1   . ASN A 1 185 ? 31.153  39.622  28.756 1.00 92.99  ? 260 ASN A OD1   1 
ATOM   1425 N  ND2   . ASN A 1 185 ? 31.976  37.832  29.832 1.00 95.14  ? 260 ASN A ND2   1 
ATOM   1426 N  N     . ILE A 1 186 ? 32.078  39.686  25.529 1.00 94.74  ? 261 ILE A N     1 
ATOM   1427 C  CA    . ILE A 1 186 ? 32.240  40.900  24.732 1.00 100.19 ? 261 ILE A CA    1 
ATOM   1428 C  C     . ILE A 1 186 ? 32.719  42.062  25.589 1.00 98.41  ? 261 ILE A C     1 
ATOM   1429 O  O     . ILE A 1 186 ? 32.172  42.333  26.667 1.00 96.14  ? 261 ILE A O     1 
ATOM   1430 C  CB    . ILE A 1 186 ? 30.920  41.237  24.021 1.00 106.11 ? 261 ILE A CB    1 
ATOM   1431 C  CG1   . ILE A 1 186 ? 30.608  40.204  22.941 1.00 106.79 ? 261 ILE A CG1   1 
ATOM   1432 C  CG2   . ILE A 1 186 ? 30.965  42.637  23.430 1.00 105.75 ? 261 ILE A CG2   1 
ATOM   1433 C  CD1   . ILE A 1 186 ? 31.661  40.104  21.834 1.00 106.50 ? 261 ILE A CD1   1 
ATOM   1434 N  N     . ARG A 1 187 ? 33.728  42.781  25.088 1.00 98.90  ? 262 ARG A N     1 
ATOM   1435 C  CA    . ARG A 1 187 ? 34.317  43.883  25.833 1.00 94.67  ? 262 ARG A CA    1 
ATOM   1436 C  C     . ARG A 1 187 ? 34.684  45.005  24.880 1.00 92.52  ? 262 ARG A C     1 
ATOM   1437 O  O     . ARG A 1 187 ? 35.356  44.769  23.871 1.00 87.46  ? 262 ARG A O     1 
ATOM   1438 C  CB    . ARG A 1 187 ? 35.542  43.381  26.613 1.00 93.06  ? 262 ARG A CB    1 
ATOM   1439 C  CG    . ARG A 1 187 ? 36.207  44.338  27.600 1.00 87.85  ? 262 ARG A CG    1 
ATOM   1440 C  CD    . ARG A 1 187 ? 37.441  43.633  28.182 1.00 100.61 ? 262 ARG A CD    1 
ATOM   1441 N  NE    . ARG A 1 187 ? 37.615  42.351  27.487 1.00 105.23 ? 262 ARG A NE    1 
ATOM   1442 C  CZ    . ARG A 1 187 ? 38.565  41.451  27.725 1.00 105.12 ? 262 ARG A CZ    1 
ATOM   1443 N  NH1   . ARG A 1 187 ? 39.483  41.658  28.661 1.00 106.30 ? 262 ARG A NH1   1 
ATOM   1444 N  NH2   . ARG A 1 187 ? 38.589  40.335  27.009 1.00 99.83  ? 262 ARG A NH2   1 
ATOM   1445 N  N     . ILE A 1 188 ? 34.255  46.218  25.211 1.00 91.85  ? 263 ILE A N     1 
ATOM   1446 C  CA    . ILE A 1 188 ? 34.492  47.387  24.380 1.00 84.87  ? 263 ILE A CA    1 
ATOM   1447 C  C     . ILE A 1 188 ? 35.237  48.409  25.231 1.00 83.41  ? 263 ILE A C     1 
ATOM   1448 O  O     . ILE A 1 188 ? 34.735  48.840  26.277 1.00 80.90  ? 263 ILE A O     1 
ATOM   1449 C  CB    . ILE A 1 188 ? 33.182  47.968  23.827 1.00 84.68  ? 263 ILE A CB    1 
ATOM   1450 C  CG1   . ILE A 1 188 ? 32.406  46.906  23.058 1.00 89.41  ? 263 ILE A CG1   1 
ATOM   1451 C  CG2   . ILE A 1 188 ? 33.462  49.158  22.926 1.00 84.40  ? 263 ILE A CG2   1 
ATOM   1452 C  CD1   . ILE A 1 188 ? 31.039  47.364  22.576 1.00 92.15  ? 263 ILE A CD1   1 
ATOM   1453 N  N     . ASN A 1 189 ? 36.437  48.782  24.800 1.00 86.55  ? 264 ASN A N     1 
ATOM   1454 C  CA    . ASN A 1 189 ? 37.215  49.765  25.542 1.00 79.35  ? 264 ASN A CA    1 
ATOM   1455 C  C     . ASN A 1 189 ? 36.574  51.144  25.427 1.00 75.20  ? 264 ASN A C     1 
ATOM   1456 O  O     . ASN A 1 189 ? 36.316  51.634  24.323 1.00 77.11  ? 264 ASN A O     1 
ATOM   1457 C  CB    . ASN A 1 189 ? 38.652  49.787  25.034 1.00 74.85  ? 264 ASN A CB    1 
ATOM   1458 C  CG    . ASN A 1 189 ? 39.370  48.472  25.270 1.00 75.76  ? 264 ASN A CG    1 
ATOM   1459 O  OD1   . ASN A 1 189 ? 39.225  47.844  26.323 1.00 75.24  ? 264 ASN A OD1   1 
ATOM   1460 N  ND2   . ASN A 1 189 ? 40.147  48.043  24.285 1.00 76.49  ? 264 ASN A ND2   1 
ATOM   1461 N  N     . CYS A 1 190 ? 36.326  51.766  26.579 1.00 74.98  ? 265 CYS A N     1 
ATOM   1462 C  CA    . CYS A 1 190 ? 35.620  53.042  26.629 1.00 77.76  ? 265 CYS A CA    1 
ATOM   1463 C  C     . CYS A 1 190 ? 36.387  54.132  25.886 1.00 76.99  ? 265 CYS A C     1 
ATOM   1464 O  O     . CYS A 1 190 ? 37.570  54.368  26.153 1.00 75.46  ? 265 CYS A O     1 
ATOM   1465 C  CB    . CYS A 1 190 ? 35.401  53.456  28.083 1.00 76.92  ? 265 CYS A CB    1 
ATOM   1466 S  SG    . CYS A 1 190 ? 35.192  55.230  28.299 1.00 82.37  ? 265 CYS A SG    1 
ATOM   1467 N  N     . SER A 1 191 ? 35.702  54.807  24.958 1.00 70.86  ? 266 SER A N     1 
ATOM   1468 C  CA    . SER A 1 191 ? 36.337  55.834  24.140 1.00 68.47  ? 266 SER A CA    1 
ATOM   1469 C  C     . SER A 1 191 ? 36.592  57.130  24.895 1.00 69.14  ? 266 SER A C     1 
ATOM   1470 O  O     . SER A 1 191 ? 37.320  57.991  24.390 1.00 69.85  ? 266 SER A O     1 
ATOM   1471 C  CB    . SER A 1 191 ? 35.485  56.129  22.906 1.00 73.35  ? 266 SER A CB    1 
ATOM   1472 O  OG    . SER A 1 191 ? 35.354  54.979  22.091 1.00 85.49  ? 266 SER A OG    1 
ATOM   1473 N  N     . SER A 1 192 ? 36.011  57.300  26.079 1.00 67.62  ? 267 SER A N     1 
ATOM   1474 C  CA    . SER A 1 192 ? 36.323  58.486  26.863 1.00 65.92  ? 267 SER A CA    1 
ATOM   1475 C  C     . SER A 1 192 ? 37.673  58.344  27.550 1.00 67.53  ? 267 SER A C     1 
ATOM   1476 O  O     . SER A 1 192 ? 38.473  59.283  27.546 1.00 73.39  ? 267 SER A O     1 
ATOM   1477 C  CB    . SER A 1 192 ? 35.216  58.751  27.884 1.00 75.69  ? 267 SER A CB    1 
ATOM   1478 O  OG    . SER A 1 192 ? 35.133  60.129  28.197 1.00 65.51  ? 267 SER A OG    1 
ATOM   1479 N  N     . HIS A 1 193 ? 37.947  57.176  28.142 1.00 74.14  ? 268 HIS A N     1 
ATOM   1480 C  CA    . HIS A 1 193 ? 39.264  56.940  28.730 1.00 72.91  ? 268 HIS A CA    1 
ATOM   1481 C  C     . HIS A 1 193 ? 40.345  56.919  27.661 1.00 68.28  ? 268 HIS A C     1 
ATOM   1482 O  O     . HIS A 1 193 ? 41.436  57.466  27.864 1.00 69.72  ? 268 HIS A O     1 
ATOM   1483 C  CB    . HIS A 1 193 ? 39.277  55.631  29.521 1.00 67.43  ? 268 HIS A CB    1 
ATOM   1484 C  CG    . HIS A 1 193 ? 38.628  55.731  30.866 1.00 75.12  ? 268 HIS A CG    1 
ATOM   1485 N  ND1   . HIS A 1 193 ? 37.280  55.516  31.061 1.00 84.81  ? 268 HIS A ND1   1 
ATOM   1486 C  CD2   . HIS A 1 193 ? 39.140  56.033  32.083 1.00 75.12  ? 268 HIS A CD2   1 
ATOM   1487 C  CE1   . HIS A 1 193 ? 36.991  55.675  32.341 1.00 85.52  ? 268 HIS A CE1   1 
ATOM   1488 N  NE2   . HIS A 1 193 ? 38.102  55.991  32.982 1.00 83.67  ? 268 HIS A NE2   1 
ATOM   1489 N  N     . LEU A 1 194 ? 40.059  56.303  26.513 1.00 67.40  ? 269 LEU A N     1 
ATOM   1490 C  CA    . LEU A 1 194 ? 41.032  56.276  25.428 1.00 67.54  ? 269 LEU A CA    1 
ATOM   1491 C  C     . LEU A 1 194 ? 41.389  57.685  24.977 1.00 70.79  ? 269 LEU A C     1 
ATOM   1492 O  O     . LEU A 1 194 ? 42.568  58.003  24.785 1.00 73.85  ? 269 LEU A O     1 
ATOM   1493 C  CB    . LEU A 1 194 ? 40.494  55.454  24.261 1.00 71.58  ? 269 LEU A CB    1 
ATOM   1494 C  CG    . LEU A 1 194 ? 40.344  53.973  24.595 1.00 74.62  ? 269 LEU A CG    1 
ATOM   1495 C  CD1   . LEU A 1 194 ? 39.858  53.195  23.385 1.00 77.84  ? 269 LEU A CD1   1 
ATOM   1496 C  CD2   . LEU A 1 194 ? 41.664  53.422  25.115 1.00 73.52  ? 269 LEU A CD2   1 
ATOM   1497 N  N     . LEU A 1 195 ? 40.383  58.549  24.811 1.00 71.91  ? 270 LEU A N     1 
ATOM   1498 C  CA    . LEU A 1 195 ? 40.659  59.935  24.438 1.00 69.30  ? 270 LEU A CA    1 
ATOM   1499 C  C     . LEU A 1 195 ? 41.501  60.627  25.498 1.00 65.39  ? 270 LEU A C     1 
ATOM   1500 O  O     . LEU A 1 195 ? 42.499  61.284  25.182 1.00 70.33  ? 270 LEU A O     1 
ATOM   1501 C  CB    . LEU A 1 195 ? 39.362  60.710  24.218 1.00 72.44  ? 270 LEU A CB    1 
ATOM   1502 C  CG    . LEU A 1 195 ? 39.626  62.194  23.934 1.00 67.72  ? 270 LEU A CG    1 
ATOM   1503 C  CD1   . LEU A 1 195 ? 40.023  62.395  22.478 1.00 69.36  ? 270 LEU A CD1   1 
ATOM   1504 C  CD2   . LEU A 1 195 ? 38.442  63.073  24.301 1.00 63.43  ? 270 LEU A CD2   1 
ATOM   1505 N  N     . SER A 1 196 ? 41.110  60.495  26.768 1.00 63.10  ? 271 SER A N     1 
ATOM   1506 C  CA    . SER A 1 196 ? 41.885  61.114  27.833 1.00 61.07  ? 271 SER A CA    1 
ATOM   1507 C  C     . SER A 1 196 ? 43.290  60.543  27.894 1.00 70.93  ? 271 SER A C     1 
ATOM   1508 O  O     . SER A 1 196 ? 44.223  61.238  28.309 1.00 74.53  ? 271 SER A O     1 
ATOM   1509 C  CB    . SER A 1 196 ? 41.189  60.935  29.177 1.00 61.84  ? 271 SER A CB    1 
ATOM   1510 O  OG    . SER A 1 196 ? 41.958  61.529  30.208 1.00 60.72  ? 271 SER A OG    1 
ATOM   1511 N  N     . ASN A 1 197 ? 43.462  59.284  27.491 1.00 72.62  ? 272 ASN A N     1 
ATOM   1512 C  CA    . ASN A 1 197 ? 44.806  58.739  27.359 1.00 65.97  ? 272 ASN A CA    1 
ATOM   1513 C  C     . ASN A 1 197 ? 45.572  59.451  26.254 1.00 65.76  ? 272 ASN A C     1 
ATOM   1514 O  O     . ASN A 1 197 ? 46.665  59.972  26.489 1.00 71.71  ? 272 ASN A O     1 
ATOM   1515 C  CB    . ASN A 1 197 ? 44.745  57.235  27.103 1.00 64.15  ? 272 ASN A CB    1 
ATOM   1516 C  CG    . ASN A 1 197 ? 44.425  56.451  28.352 1.00 68.34  ? 272 ASN A CG    1 
ATOM   1517 O  OD1   . ASN A 1 197 ? 44.828  56.828  29.449 1.00 69.81  ? 272 ASN A OD1   1 
ATOM   1518 N  ND2   . ASN A 1 197 ? 43.688  55.353  28.195 1.00 74.58  ? 272 ASN A ND2   1 
ATOM   1519 N  N     . VAL A 1 198 ? 45.001  59.503  25.046 1.00 63.08  ? 273 VAL A N     1 
ATOM   1520 C  CA    . VAL A 1 198 ? 45.690  60.121  23.914 1.00 65.15  ? 273 VAL A CA    1 
ATOM   1521 C  C     . VAL A 1 198 ? 46.083  61.553  24.250 1.00 71.69  ? 273 VAL A C     1 
ATOM   1522 O  O     . VAL A 1 198 ? 47.226  61.973  24.029 1.00 74.82  ? 273 VAL A O     1 
ATOM   1523 C  CB    . VAL A 1 198 ? 44.812  60.067  22.652 1.00 67.62  ? 273 VAL A CB    1 
ATOM   1524 C  CG1   . VAL A 1 198 ? 45.514  60.763  21.500 1.00 70.25  ? 273 VAL A CG1   1 
ATOM   1525 C  CG2   . VAL A 1 198 ? 44.489  58.638  22.286 1.00 75.60  ? 273 VAL A CG2   1 
ATOM   1526 N  N     . LEU A 1 199 ? 45.129  62.322  24.778 1.00 70.74  ? 274 LEU A N     1 
ATOM   1527 C  CA    . LEU A 1 199 ? 45.389  63.703  25.174 1.00 69.35  ? 274 LEU A CA    1 
ATOM   1528 C  C     . LEU A 1 199 ? 46.508  63.777  26.206 1.00 71.52  ? 274 LEU A C     1 
ATOM   1529 O  O     . LEU A 1 199 ? 47.574  64.346  25.946 1.00 78.90  ? 274 LEU A O     1 
ATOM   1530 C  CB    . LEU A 1 199 ? 44.109  64.339  25.720 1.00 67.82  ? 274 LEU A CB    1 
ATOM   1531 C  CG    . LEU A 1 199 ? 43.961  65.852  25.538 1.00 69.66  ? 274 LEU A CG    1 
ATOM   1532 C  CD1   . LEU A 1 199 ? 43.908  66.202  24.057 1.00 71.08  ? 274 LEU A CD1   1 
ATOM   1533 C  CD2   . LEU A 1 199 ? 42.718  66.344  26.253 1.00 74.70  ? 274 LEU A CD2   1 
ATOM   1534 N  N     . GLU A 1 200 ? 46.277  63.198  27.387 1.00 67.66  ? 275 GLU A N     1 
ATOM   1535 C  CA    . GLU A 1 200 ? 47.227  63.312  28.490 1.00 67.48  ? 275 GLU A CA    1 
ATOM   1536 C  C     . GLU A 1 200 ? 48.601  62.769  28.112 1.00 77.33  ? 275 GLU A C     1 
ATOM   1537 O  O     . GLU A 1 200 ? 49.630  63.339  28.496 1.00 81.89  ? 275 GLU A O     1 
ATOM   1538 C  CB    . GLU A 1 200 ? 46.674  62.581  29.710 1.00 70.50  ? 275 GLU A CB    1 
ATOM   1539 C  CG    . GLU A 1 200 ? 47.701  62.179  30.741 1.00 82.10  ? 275 GLU A CG    1 
ATOM   1540 C  CD    . GLU A 1 200 ? 47.243  60.989  31.561 1.00 94.35  ? 275 GLU A CD    1 
ATOM   1541 O  OE1   . GLU A 1 200 ? 47.147  59.876  30.995 1.00 91.22  ? 275 GLU A OE1   1 
ATOM   1542 O  OE2   . GLU A 1 200 ? 46.958  61.172  32.763 1.00 100.20 ? 275 GLU A OE2   1 
ATOM   1543 N  N     . ASN A 1 201 ? 48.641  61.672  27.355 1.00 73.91  ? 276 ASN A N     1 
ATOM   1544 C  CA    . ASN A 1 201 ? 49.924  61.118  26.938 1.00 73.75  ? 276 ASN A CA    1 
ATOM   1545 C  C     . ASN A 1 201 ? 50.702  62.091  26.064 1.00 77.92  ? 276 ASN A C     1 
ATOM   1546 O  O     . ASN A 1 201 ? 51.937  62.099  26.094 1.00 82.67  ? 276 ASN A O     1 
ATOM   1547 C  CB    . ASN A 1 201 ? 49.712  59.803  26.192 1.00 72.70  ? 276 ASN A CB    1 
ATOM   1548 C  CG    . ASN A 1 201 ? 50.401  58.643  26.858 1.00 70.93  ? 276 ASN A CG    1 
ATOM   1549 O  OD1   . ASN A 1 201 ? 49.879  58.050  27.804 1.00 63.51  ? 276 ASN A OD1   1 
ATOM   1550 N  ND2   . ASN A 1 201 ? 51.585  58.305  26.366 1.00 80.75  ? 276 ASN A ND2   1 
ATOM   1551 N  N     . SER A 1 202 ? 50.006  62.922  25.288 1.00 74.42  ? 277 SER A N     1 
ATOM   1552 C  CA    . SER A 1 202 ? 50.693  63.780  24.331 1.00 75.25  ? 277 SER A CA    1 
ATOM   1553 C  C     . SER A 1 202 ? 51.367  64.966  25.009 1.00 75.26  ? 277 SER A C     1 
ATOM   1554 O  O     . SER A 1 202 ? 52.481  65.343  24.633 1.00 76.36  ? 277 SER A O     1 
ATOM   1555 C  CB    . SER A 1 202 ? 49.717  64.265  23.263 1.00 75.04  ? 277 SER A CB    1 
ATOM   1556 O  OG    . SER A 1 202 ? 49.165  63.174  22.548 1.00 75.79  ? 277 SER A OG    1 
ATOM   1557 N  N     . PHE A 1 203 ? 50.710  65.577  25.995 1.00 77.07  ? 278 PHE A N     1 
ATOM   1558 C  CA    . PHE A 1 203 ? 51.338  66.690  26.702 1.00 79.18  ? 278 PHE A CA    1 
ATOM   1559 C  C     . PHE A 1 203 ? 52.559  66.220  27.474 1.00 77.69  ? 278 PHE A C     1 
ATOM   1560 O  O     . PHE A 1 203 ? 53.556  66.944  27.576 1.00 75.57  ? 278 PHE A O     1 
ATOM   1561 C  CB    . PHE A 1 203 ? 50.337  67.359  27.641 1.00 75.01  ? 278 PHE A CB    1 
ATOM   1562 C  CG    . PHE A 1 203 ? 49.306  68.178  26.933 1.00 75.23  ? 278 PHE A CG    1 
ATOM   1563 C  CD1   . PHE A 1 203 ? 48.327  67.569  26.165 1.00 77.14  ? 278 PHE A CD1   1 
ATOM   1564 C  CD2   . PHE A 1 203 ? 49.314  69.557  27.030 1.00 75.76  ? 278 PHE A CD2   1 
ATOM   1565 C  CE1   . PHE A 1 203 ? 47.375  68.320  25.507 1.00 79.12  ? 278 PHE A CE1   1 
ATOM   1566 C  CE2   . PHE A 1 203 ? 48.364  70.313  26.377 1.00 77.70  ? 278 PHE A CE2   1 
ATOM   1567 C  CZ    . PHE A 1 203 ? 47.393  69.695  25.614 1.00 81.12  ? 278 PHE A CZ    1 
ATOM   1568 N  N     . GLU A 1 204 ? 52.491  65.011  28.031 1.00 81.99  ? 279 GLU A N     1 
ATOM   1569 C  CA    . GLU A 1 204 ? 53.668  64.399  28.635 1.00 84.56  ? 279 GLU A CA    1 
ATOM   1570 C  C     . GLU A 1 204 ? 54.807  64.298  27.627 1.00 76.65  ? 279 GLU A C     1 
ATOM   1571 O  O     . GLU A 1 204 ? 55.978  64.488  27.978 1.00 73.36  ? 279 GLU A O     1 
ATOM   1572 C  CB    . GLU A 1 204 ? 53.287  63.023  29.184 1.00 84.91  ? 279 GLU A CB    1 
ATOM   1573 C  CG    . GLU A 1 204 ? 54.416  62.202  29.757 1.00 80.54  ? 279 GLU A CG    1 
ATOM   1574 C  CD    . GLU A 1 204 ? 53.904  60.943  30.426 1.00 93.18  ? 279 GLU A CD    1 
ATOM   1575 O  OE1   . GLU A 1 204 ? 53.383  61.040  31.558 1.00 96.52  ? 279 GLU A OE1   1 
ATOM   1576 O  OE2   . GLU A 1 204 ? 53.997  59.860  29.810 1.00 99.04  ? 279 GLU A OE2   1 
ATOM   1577 N  N     . GLU A 1 205 ? 54.477  64.031  26.364 1.00 78.09  ? 280 GLU A N     1 
ATOM   1578 C  CA    . GLU A 1 205 ? 55.454  63.887  25.293 1.00 75.79  ? 280 GLU A CA    1 
ATOM   1579 C  C     . GLU A 1 205 ? 55.757  65.199  24.579 1.00 77.43  ? 280 GLU A C     1 
ATOM   1580 O  O     . GLU A 1 205 ? 56.505  65.193  23.595 1.00 76.42  ? 280 GLU A O     1 
ATOM   1581 C  CB    . GLU A 1 205 ? 54.969  62.839  24.287 1.00 75.02  ? 280 GLU A CB    1 
ATOM   1582 C  CG    . GLU A 1 205 ? 54.820  61.452  24.903 1.00 84.90  ? 280 GLU A CG    1 
ATOM   1583 C  CD    . GLU A 1 205 ? 54.345  60.406  23.913 1.00 94.70  ? 280 GLU A CD    1 
ATOM   1584 O  OE1   . GLU A 1 205 ? 54.528  60.608  22.692 1.00 95.52  ? 280 GLU A OE1   1 
ATOM   1585 O  OE2   . GLU A 1 205 ? 53.786  59.379  24.360 1.00 95.02  ? 280 GLU A OE2   1 
ATOM   1586 N  N     . THR A 1 206 ? 55.190  66.316  25.036 1.00 85.50  ? 281 THR A N     1 
ATOM   1587 C  CA    . THR A 1 206 ? 55.555  67.651  24.553 1.00 80.30  ? 281 THR A CA    1 
ATOM   1588 C  C     . THR A 1 206 ? 55.892  68.544  25.745 1.00 73.73  ? 281 THR A C     1 
ATOM   1589 O  O     . THR A 1 206 ? 55.227  69.554  25.992 1.00 70.11  ? 281 THR A O     1 
ATOM   1590 C  CB    . THR A 1 206 ? 54.435  68.266  23.713 1.00 73.84  ? 281 THR A CB    1 
ATOM   1591 O  OG1   . THR A 1 206 ? 53.841  67.265  22.874 1.00 77.30  ? 281 THR A OG1   1 
ATOM   1592 C  CG2   . THR A 1 206 ? 54.985  69.388  22.837 1.00 70.08  ? 281 THR A CG2   1 
ATOM   1593 N  N     . PRO A 1 207 ? 56.936  68.199  26.507 1.00 72.54  ? 282 PRO A N     1 
ATOM   1594 C  CA    . PRO A 1 207 ? 57.270  68.992  27.703 1.00 72.67  ? 282 PRO A CA    1 
ATOM   1595 C  C     . PRO A 1 207 ? 57.665  70.422  27.390 1.00 67.94  ? 282 PRO A C     1 
ATOM   1596 O  O     . PRO A 1 207 ? 57.756  71.241  28.313 1.00 66.75  ? 282 PRO A O     1 
ATOM   1597 C  CB    . PRO A 1 207 ? 58.434  68.213  28.328 1.00 76.62  ? 282 PRO A CB    1 
ATOM   1598 C  CG    . PRO A 1 207 ? 59.072  67.528  27.173 1.00 75.33  ? 282 PRO A CG    1 
ATOM   1599 C  CD    . PRO A 1 207 ? 57.949  67.163  26.238 1.00 71.03  ? 282 PRO A CD    1 
ATOM   1600 N  N     . GLU A 1 208 ? 57.935  70.734  26.124 1.00 62.62  ? 283 GLU A N     1 
ATOM   1601 C  CA    . GLU A 1 208 ? 58.265  72.098  25.739 1.00 66.08  ? 283 GLU A CA    1 
ATOM   1602 C  C     . GLU A 1 208 ? 57.163  73.076  26.131 1.00 71.13  ? 283 GLU A C     1 
ATOM   1603 O  O     . GLU A 1 208 ? 57.431  74.264  26.353 1.00 70.12  ? 283 GLU A O     1 
ATOM   1604 C  CB    . GLU A 1 208 ? 58.531  72.125  24.238 1.00 66.39  ? 283 GLU A CB    1 
ATOM   1605 C  CG    . GLU A 1 208 ? 58.956  70.754  23.724 1.00 71.60  ? 283 GLU A CG    1 
ATOM   1606 C  CD    . GLU A 1 208 ? 59.380  70.755  22.270 1.00 84.92  ? 283 GLU A CD    1 
ATOM   1607 O  OE1   . GLU A 1 208 ? 59.577  71.852  21.704 1.00 83.26  ? 283 GLU A OE1   1 
ATOM   1608 O  OE2   . GLU A 1 208 ? 59.519  69.649  21.696 1.00 84.41  ? 283 GLU A OE2   1 
ATOM   1609 N  N     . LEU A 1 209 ? 55.927  72.596  26.240 1.00 74.61  ? 284 LEU A N     1 
ATOM   1610 C  CA    . LEU A 1 209 ? 54.790  73.409  26.646 1.00 71.47  ? 284 LEU A CA    1 
ATOM   1611 C  C     . LEU A 1 209 ? 54.553  73.389  28.151 1.00 71.99  ? 284 LEU A C     1 
ATOM   1612 O  O     . LEU A 1 209 ? 53.622  74.046  28.625 1.00 73.03  ? 284 LEU A O     1 
ATOM   1613 C  CB    . LEU A 1 209 ? 53.526  72.935  25.921 1.00 66.67  ? 284 LEU A CB    1 
ATOM   1614 C  CG    . LEU A 1 209 ? 53.638  72.790  24.401 1.00 64.90  ? 284 LEU A CG    1 
ATOM   1615 C  CD1   . LEU A 1 209 ? 52.518  71.925  23.867 1.00 65.42  ? 284 LEU A CD1   1 
ATOM   1616 C  CD2   . LEU A 1 209 ? 53.628  74.145  23.722 1.00 66.56  ? 284 LEU A CD2   1 
ATOM   1617 N  N     . ASN A 1 210 ? 55.369  72.663  28.915 1.00 74.23  ? 285 ASN A N     1 
ATOM   1618 C  CA    . ASN A 1 210 ? 55.117  72.571  30.347 1.00 74.57  ? 285 ASN A CA    1 
ATOM   1619 C  C     . ASN A 1 210 ? 55.333  73.902  31.052 1.00 78.06  ? 285 ASN A C     1 
ATOM   1620 O  O     . ASN A 1 210 ? 54.643  74.188  32.038 1.00 77.98  ? 285 ASN A O     1 
ATOM   1621 C  CB    . ASN A 1 210 ? 55.992  71.482  30.973 1.00 75.63  ? 285 ASN A CB    1 
ATOM   1622 C  CG    . ASN A 1 210 ? 55.438  70.086  30.738 1.00 86.36  ? 285 ASN A CG    1 
ATOM   1623 O  OD1   . ASN A 1 210 ? 54.255  69.921  30.425 1.00 79.93  ? 285 ASN A OD1   1 
ATOM   1624 N  ND2   . ASN A 1 210 ? 56.291  69.071  30.896 1.00 71.03  ? 285 ASN A ND2   1 
ATOM   1625 N  N     . MET A 1 211 ? 56.264  74.734  30.563 1.00 83.36  ? 286 MET A N     1 
ATOM   1626 C  CA    . MET A 1 211 ? 56.505  76.011  31.223 1.00 83.24  ? 286 MET A CA    1 
ATOM   1627 C  C     . MET A 1 211 ? 55.292  76.946  31.149 1.00 78.66  ? 286 MET A C     1 
ATOM   1628 O  O     . MET A 1 211 ? 54.964  77.557  32.170 1.00 76.60  ? 286 MET A O     1 
ATOM   1629 C  CB    . MET A 1 211 ? 57.774  76.658  30.669 1.00 87.63  ? 286 MET A CB    1 
ATOM   1630 C  CG    . MET A 1 211 ? 58.247  77.878  31.469 1.00 96.69  ? 286 MET A CG    1 
ATOM   1631 S  SD    . MET A 1 211 ? 57.428  79.391  30.931 1.00 114.26 ? 286 MET A SD    1 
ATOM   1632 C  CE    . MET A 1 211 ? 58.366  79.771  29.452 1.00 111.33 ? 286 MET A CE    1 
ATOM   1633 N  N     . PRO A 1 212 ? 54.608  77.090  29.999 1.00 77.08  ? 287 PRO A N     1 
ATOM   1634 C  CA    . PRO A 1 212 ? 53.356  77.876  30.043 1.00 75.46  ? 287 PRO A CA    1 
ATOM   1635 C  C     . PRO A 1 212 ? 52.278  77.264  30.921 1.00 81.60  ? 287 PRO A C     1 
ATOM   1636 O  O     . PRO A 1 212 ? 51.595  78.006  31.638 1.00 86.27  ? 287 PRO A O     1 
ATOM   1637 C  CB    . PRO A 1 212 ? 52.927  77.930  28.571 1.00 70.50  ? 287 PRO A CB    1 
ATOM   1638 C  CG    . PRO A 1 212 ? 54.162  77.753  27.811 1.00 71.69  ? 287 PRO A CG    1 
ATOM   1639 C  CD    . PRO A 1 212 ? 55.014  76.811  28.611 1.00 76.94  ? 287 PRO A CD    1 
ATOM   1640 N  N     . ILE A 1 213 ? 52.097  75.940  30.888 1.00 77.75  ? 288 ILE A N     1 
ATOM   1641 C  CA    . ILE A 1 213 ? 51.050  75.313  31.694 1.00 73.79  ? 288 ILE A CA    1 
ATOM   1642 C  C     . ILE A 1 213 ? 51.339  75.499  33.179 1.00 76.11  ? 288 ILE A C     1 
ATOM   1643 O  O     . ILE A 1 213 ? 50.468  75.918  33.952 1.00 74.50  ? 288 ILE A O     1 
ATOM   1644 C  CB    . ILE A 1 213 ? 50.909  73.822  31.337 1.00 70.35  ? 288 ILE A CB    1 
ATOM   1645 C  CG1   . ILE A 1 213 ? 50.673  73.633  29.838 1.00 67.74  ? 288 ILE A CG1   1 
ATOM   1646 C  CG2   . ILE A 1 213 ? 49.792  73.177  32.139 1.00 60.36  ? 288 ILE A CG2   1 
ATOM   1647 C  CD1   . ILE A 1 213 ? 49.585  74.495  29.277 1.00 72.69  ? 288 ILE A CD1   1 
ATOM   1648 N  N     . LEU A 1 214 ? 52.572  75.197  33.599 1.00 78.59  ? 289 LEU A N     1 
ATOM   1649 C  CA    . LEU A 1 214 ? 52.889  75.211  35.025 1.00 81.05  ? 289 LEU A CA    1 
ATOM   1650 C  C     . LEU A 1 214 ? 52.726  76.602  35.623 1.00 83.73  ? 289 LEU A C     1 
ATOM   1651 O  O     . LEU A 1 214 ? 52.225  76.744  36.744 1.00 88.75  ? 289 LEU A O     1 
ATOM   1652 C  CB    . LEU A 1 214 ? 54.308  74.704  35.270 1.00 70.17  ? 289 LEU A CB    1 
ATOM   1653 C  CG    . LEU A 1 214 ? 54.562  74.525  36.771 1.00 68.90  ? 289 LEU A CG    1 
ATOM   1654 C  CD1   . LEU A 1 214 ? 53.951  73.213  37.265 1.00 85.01  ? 289 LEU A CD1   1 
ATOM   1655 C  CD2   . LEU A 1 214 ? 56.034  74.612  37.123 1.00 72.59  ? 289 LEU A CD2   1 
ATOM   1656 N  N     . ALA A 1 215 ? 53.158  77.639  34.902 1.00 79.28  ? 290 ALA A N     1 
ATOM   1657 C  CA    . ALA A 1 215 ? 52.975  78.995  35.405 1.00 79.96  ? 290 ALA A CA    1 
ATOM   1658 C  C     . ALA A 1 215 ? 51.498  79.295  35.629 1.00 86.89  ? 290 ALA A C     1 
ATOM   1659 O  O     . ALA A 1 215 ? 51.125  79.888  36.649 1.00 86.58  ? 290 ALA A O     1 
ATOM   1660 C  CB    . ALA A 1 215 ? 53.598  80.003  34.442 1.00 76.92  ? 290 ALA A CB    1 
ATOM   1661 N  N     . CYS A 1 216 ? 50.640  78.874  34.693 1.00 82.29  ? 291 CYS A N     1 
ATOM   1662 C  CA    . CYS A 1 216 ? 49.201  79.015  34.887 1.00 75.46  ? 291 CYS A CA    1 
ATOM   1663 C  C     . CYS A 1 216 ? 48.759  78.320  36.166 1.00 78.36  ? 291 CYS A C     1 
ATOM   1664 O  O     . CYS A 1 216 ? 48.084  78.921  37.009 1.00 80.25  ? 291 CYS A O     1 
ATOM   1665 C  CB    . CYS A 1 216 ? 48.444  78.456  33.681 1.00 74.00  ? 291 CYS A CB    1 
ATOM   1666 S  SG    . CYS A 1 216 ? 48.522  79.465  32.184 1.00 60.77  ? 291 CYS A SG    1 
ATOM   1667 N  N     . LYS A 1 217 ? 49.142  77.050  36.332 1.00 76.88  ? 292 LYS A N     1 
ATOM   1668 C  CA    . LYS A 1 217 ? 48.820  76.337  37.563 1.00 75.74  ? 292 LYS A CA    1 
ATOM   1669 C  C     . LYS A 1 217 ? 49.338  77.091  38.778 1.00 78.28  ? 292 LYS A C     1 
ATOM   1670 O  O     . LYS A 1 217 ? 48.682  77.126  39.823 1.00 79.63  ? 292 LYS A O     1 
ATOM   1671 C  CB    . LYS A 1 217 ? 49.390  74.918  37.524 1.00 75.88  ? 292 LYS A CB    1 
ATOM   1672 C  CG    . LYS A 1 217 ? 48.477  73.904  36.845 1.00 81.29  ? 292 LYS A CG    1 
ATOM   1673 C  CD    . LYS A 1 217 ? 49.143  72.540  36.672 1.00 82.02  ? 292 LYS A CD    1 
ATOM   1674 C  CE    . LYS A 1 217 ? 49.385  71.854  38.007 1.00 79.08  ? 292 LYS A CE    1 
ATOM   1675 N  NZ    . LYS A 1 217 ? 49.646  70.400  37.831 1.00 67.24  ? 292 LYS A NZ    1 
ATOM   1676 N  N     . ASN A 1 218 ? 50.504  77.728  38.651 1.00 82.61  ? 293 ASN A N     1 
ATOM   1677 C  CA    . ASN A 1 218 ? 51.031  78.509  39.764 1.00 81.80  ? 293 ASN A CA    1 
ATOM   1678 C  C     . ASN A 1 218 ? 50.251  79.798  39.960 1.00 80.80  ? 293 ASN A C     1 
ATOM   1679 O  O     . ASN A 1 218 ? 50.189  80.314  41.081 1.00 82.86  ? 293 ASN A O     1 
ATOM   1680 C  CB    . ASN A 1 218 ? 52.516  78.806  39.552 1.00 81.66  ? 293 ASN A CB    1 
ATOM   1681 C  CG    . ASN A 1 218 ? 53.407  77.655  39.989 1.00 77.35  ? 293 ASN A CG    1 
ATOM   1682 O  OD1   . ASN A 1 218 ? 53.759  76.789  39.186 1.00 75.64  ? 293 ASN A OD1   1 
ATOM   1683 N  ND2   . ASN A 1 218 ? 53.769  77.636  41.271 1.00 65.38  ? 293 ASN A ND2   1 
ATOM   1684 N  N     . ILE A 1 219 ? 49.650  80.329  38.891 1.00 81.43  ? 294 ILE A N     1 
ATOM   1685 C  CA    . ILE A 1 219 ? 48.747  81.467  39.038 1.00 77.23  ? 294 ILE A CA    1 
ATOM   1686 C  C     . ILE A 1 219 ? 47.482  81.043  39.773 1.00 80.43  ? 294 ILE A C     1 
ATOM   1687 O  O     . ILE A 1 219 ? 47.037  81.712  40.713 1.00 78.74  ? 294 ILE A O     1 
ATOM   1688 C  CB    . ILE A 1 219 ? 48.423  82.082  37.664 1.00 72.04  ? 294 ILE A CB    1 
ATOM   1689 C  CG1   . ILE A 1 219 ? 49.656  82.763  37.079 1.00 81.49  ? 294 ILE A CG1   1 
ATOM   1690 C  CG2   . ILE A 1 219 ? 47.282  83.075  37.775 1.00 72.14  ? 294 ILE A CG2   1 
ATOM   1691 C  CD1   . ILE A 1 219 ? 49.405  83.408  35.739 1.00 85.85  ? 294 ILE A CD1   1 
ATOM   1692 N  N     . VAL A 1 220 ? 46.893  79.915  39.359 1.00 76.74  ? 295 VAL A N     1 
ATOM   1693 C  CA    . VAL A 1 220 ? 45.675  79.417  39.993 1.00 69.98  ? 295 VAL A CA    1 
ATOM   1694 C  C     . VAL A 1 220 ? 45.912  79.161  41.474 1.00 75.59  ? 295 VAL A C     1 
ATOM   1695 O  O     . VAL A 1 220 ? 45.085  79.511  42.324 1.00 80.26  ? 295 VAL A O     1 
ATOM   1696 C  CB    . VAL A 1 220 ? 45.188  78.140  39.290 1.00 74.94  ? 295 VAL A CB    1 
ATOM   1697 C  CG1   . VAL A 1 220 ? 43.849  77.707  39.862 1.00 76.24  ? 295 VAL A CG1   1 
ATOM   1698 C  CG2   . VAL A 1 220 ? 45.106  78.346  37.793 1.00 75.86  ? 295 VAL A CG2   1 
ATOM   1699 N  N     . LYS A 1 221 ? 47.040  78.525  41.800 1.00 81.47  ? 296 LYS A N     1 
ATOM   1700 C  CA    . LYS A 1 221 ? 47.354  78.222  43.192 1.00 85.87  ? 296 LYS A CA    1 
ATOM   1701 C  C     . LYS A 1 221 ? 47.430  79.487  44.037 1.00 83.04  ? 296 LYS A C     1 
ATOM   1702 O  O     . LYS A 1 221 ? 47.074  79.464  45.220 1.00 81.24  ? 296 LYS A O     1 
ATOM   1703 C  CB    . LYS A 1 221 ? 48.670  77.440  43.278 1.00 83.72  ? 296 LYS A CB    1 
ATOM   1704 C  CG    . LYS A 1 221 ? 48.604  76.042  42.670 1.00 88.42  ? 296 LYS A CG    1 
ATOM   1705 C  CD    . LYS A 1 221 ? 49.974  75.379  42.604 1.00 85.03  ? 296 LYS A CD    1 
ATOM   1706 C  CE    . LYS A 1 221 ? 49.994  74.241  41.583 1.00 93.25  ? 296 LYS A CE    1 
ATOM   1707 N  NZ    . LYS A 1 221 ? 48.852  73.289  41.749 1.00 89.14  ? 296 LYS A NZ    1 
ATOM   1708 N  N     . TYR A 1 222 ? 47.871  80.599  43.446 1.00 82.83  ? 297 TYR A N     1 
ATOM   1709 C  CA    . TYR A 1 222 ? 48.036  81.828  44.215 1.00 88.61  ? 297 TYR A CA    1 
ATOM   1710 C  C     . TYR A 1 222 ? 46.689  82.439  44.577 1.00 88.18  ? 297 TYR A C     1 
ATOM   1711 O  O     . TYR A 1 222 ? 46.448  82.792  45.738 1.00 88.95  ? 297 TYR A O     1 
ATOM   1712 C  CB    . TYR A 1 222 ? 48.888  82.828  43.435 1.00 90.03  ? 297 TYR A CB    1 
ATOM   1713 C  CG    . TYR A 1 222 ? 49.168  84.101  44.200 1.00 86.68  ? 297 TYR A CG    1 
ATOM   1714 C  CD1   . TYR A 1 222 ? 49.830  84.066  45.421 1.00 86.03  ? 297 TYR A CD1   1 
ATOM   1715 C  CD2   . TYR A 1 222 ? 48.776  85.338  43.701 1.00 84.18  ? 297 TYR A CD2   1 
ATOM   1716 C  CE1   . TYR A 1 222 ? 50.092  85.223  46.128 1.00 89.29  ? 297 TYR A CE1   1 
ATOM   1717 C  CE2   . TYR A 1 222 ? 49.035  86.503  44.400 1.00 87.58  ? 297 TYR A CE2   1 
ATOM   1718 C  CZ    . TYR A 1 222 ? 49.694  86.440  45.614 1.00 95.05  ? 297 TYR A CZ    1 
ATOM   1719 O  OH    . TYR A 1 222 ? 49.959  87.593  46.321 1.00 103.99 ? 297 TYR A OH    1 
ATOM   1720 N  N     . PHE A 1 223 ? 45.801  82.584  43.590 1.00 87.07  ? 298 PHE A N     1 
ATOM   1721 C  CA    . PHE A 1 223 ? 44.486  83.152  43.861 1.00 86.47  ? 298 PHE A CA    1 
ATOM   1722 C  C     . PHE A 1 223 ? 43.736  82.350  44.914 1.00 89.06  ? 298 PHE A C     1 
ATOM   1723 O  O     . PHE A 1 223 ? 42.987  82.923  45.713 1.00 94.44  ? 298 PHE A O     1 
ATOM   1724 C  CB    . PHE A 1 223 ? 43.669  83.232  42.572 1.00 86.64  ? 298 PHE A CB    1 
ATOM   1725 C  CG    . PHE A 1 223 ? 43.952  84.454  41.749 1.00 85.93  ? 298 PHE A CG    1 
ATOM   1726 C  CD1   . PHE A 1 223 ? 43.263  84.689  40.575 1.00 88.90  ? 298 PHE A CD1   1 
ATOM   1727 C  CD2   . PHE A 1 223 ? 44.903  85.373  42.152 1.00 91.19  ? 298 PHE A CD2   1 
ATOM   1728 C  CE1   . PHE A 1 223 ? 43.519  85.814  39.818 1.00 92.12  ? 298 PHE A CE1   1 
ATOM   1729 C  CE2   . PHE A 1 223 ? 45.162  86.502  41.398 1.00 89.17  ? 298 PHE A CE2   1 
ATOM   1730 C  CZ    . PHE A 1 223 ? 44.471  86.722  40.231 1.00 87.26  ? 298 PHE A CZ    1 
ATOM   1731 N  N     . LYS A 1 224 ? 43.936  81.032  44.946 1.00 83.42  ? 299 LYS A N     1 
ATOM   1732 C  CA    . LYS A 1 224 ? 43.274  80.220  45.960 1.00 84.73  ? 299 LYS A CA    1 
ATOM   1733 C  C     . LYS A 1 224 ? 43.921  80.402  47.331 1.00 93.02  ? 299 LYS A C     1 
ATOM   1734 O  O     . LYS A 1 224 ? 43.224  80.414  48.352 1.00 96.40  ? 299 LYS A O     1 
ATOM   1735 C  CB    . LYS A 1 224 ? 43.286  78.746  45.552 1.00 76.87  ? 299 LYS A CB    1 
ATOM   1736 C  CG    . LYS A 1 224 ? 42.469  78.427  44.310 1.00 68.73  ? 299 LYS A CG    1 
ATOM   1737 C  CD    . LYS A 1 224 ? 42.060  76.956  44.280 1.00 65.69  ? 299 LYS A CD    1 
ATOM   1738 C  CE    . LYS A 1 224 ? 40.938  76.711  43.276 1.00 72.66  ? 299 LYS A CE    1 
ATOM   1739 N  NZ    . LYS A 1 224 ? 40.228  75.418  43.509 1.00 66.77  ? 299 LYS A NZ    1 
ATOM   1740 N  N     . LYS A 1 225 ? 45.248  80.543  47.379 1.00 92.94  ? 300 LYS A N     1 
ATOM   1741 C  CA    . LYS A 1 225 ? 45.927  80.684  48.664 1.00 99.35  ? 300 LYS A CA    1 
ATOM   1742 C  C     . LYS A 1 225 ? 45.802  82.092  49.229 1.00 100.44 ? 300 LYS A C     1 
ATOM   1743 O  O     . LYS A 1 225 ? 45.857  82.273  50.450 1.00 110.05 ? 300 LYS A O     1 
ATOM   1744 C  CB    . LYS A 1 225 ? 47.407  80.311  48.535 1.00 102.38 ? 300 LYS A CB    1 
ATOM   1745 C  CG    . LYS A 1 225 ? 48.169  80.300  49.863 1.00 109.13 ? 300 LYS A CG    1 
ATOM   1746 C  CD    . LYS A 1 225 ? 49.666  80.100  49.657 1.00 117.17 ? 300 LYS A CD    1 
ATOM   1747 C  CE    . LYS A 1 225 ? 50.416  80.053  50.984 1.00 113.64 ? 300 LYS A CE    1 
ATOM   1748 N  NZ    . LYS A 1 225 ? 50.023  78.883  51.820 1.00 124.13 ? 300 LYS A NZ    1 
ATOM   1749 N  N     . ALA A 1 226 ? 45.633  83.092  48.372 1.00 93.40  ? 301 ALA A N     1 
ATOM   1750 C  CA    . ALA A 1 226 ? 45.599  84.482  48.805 1.00 93.42  ? 301 ALA A CA    1 
ATOM   1751 C  C     . ALA A 1 226 ? 44.217  84.934  49.252 1.00 99.32  ? 301 ALA A C     1 
ATOM   1752 O  O     . ALA A 1 226 ? 44.044  86.118  49.559 1.00 98.49  ? 301 ALA A O     1 
ATOM   1753 C  CB    . ALA A 1 226 ? 46.094  85.397  47.681 1.00 87.82  ? 301 ALA A CB    1 
ATOM   1754 N  N     . ASN A 1 227 ? 43.237  84.027  49.278 1.00 101.69 ? 302 ASN A N     1 
ATOM   1755 C  CA    . ASN A 1 227 ? 41.819  84.352  49.439 1.00 98.53  ? 302 ASN A CA    1 
ATOM   1756 C  C     . ASN A 1 227 ? 41.335  85.282  48.332 1.00 97.94  ? 302 ASN A C     1 
ATOM   1757 O  O     . ASN A 1 227 ? 40.342  85.999  48.497 1.00 104.54 ? 302 ASN A O     1 
ATOM   1758 C  CB    . ASN A 1 227 ? 41.521  84.953  50.822 1.00 101.91 ? 302 ASN A CB    1 
ATOM   1759 C  CG    . ASN A 1 227 ? 40.049  84.856  51.197 1.00 101.93 ? 302 ASN A CG    1 
ATOM   1760 O  OD1   . ASN A 1 227 ? 39.289  84.108  50.580 1.00 95.48  ? 302 ASN A OD1   1 
ATOM   1761 N  ND2   . ASN A 1 227 ? 39.642  85.615  52.212 1.00 106.14 ? 302 ASN A ND2   1 
ATOM   1762 N  N     . LEU A 1 228 ? 42.030  85.259  47.197 1.00 92.27  ? 303 LEU A N     1 
ATOM   1763 C  CA    . LEU A 1 228 ? 41.665  86.023  46.013 1.00 90.00  ? 303 LEU A CA    1 
ATOM   1764 C  C     . LEU A 1 228 ? 40.593  85.257  45.255 1.00 91.81  ? 303 LEU A C     1 
ATOM   1765 O  O     . LEU A 1 228 ? 39.968  84.353  45.820 1.00 93.55  ? 303 LEU A O     1 
ATOM   1766 C  CB    . LEU A 1 228 ? 42.891  86.300  45.142 1.00 92.79  ? 303 LEU A CB    1 
ATOM   1767 C  CG    . LEU A 1 228 ? 43.589  87.643  45.397 1.00 93.10  ? 303 LEU A CG    1 
ATOM   1768 C  CD1   . LEU A 1 228 ? 43.682  87.965  46.885 1.00 90.89  ? 303 LEU A CD1   1 
ATOM   1769 C  CD2   . LEU A 1 228 ? 44.971  87.660  44.768 1.00 82.74  ? 303 LEU A CD2   1 
ATOM   1770 N  N     . GLN A 1 229 ? 40.352  85.627  43.996 1.00 88.68  ? 304 GLN A N     1 
ATOM   1771 C  CA    . GLN A 1 229 ? 39.182  85.207  43.228 1.00 88.40  ? 304 GLN A CA    1 
ATOM   1772 C  C     . GLN A 1 229 ? 37.897  85.786  43.801 1.00 94.80  ? 304 GLN A C     1 
ATOM   1773 O  O     . GLN A 1 229 ? 36.814  85.245  43.570 1.00 97.92  ? 304 GLN A O     1 
ATOM   1774 C  CB    . GLN A 1 229 ? 39.064  83.676  43.134 1.00 83.38  ? 304 GLN A CB    1 
ATOM   1775 C  CG    . GLN A 1 229 ? 39.600  83.039  41.851 1.00 89.37  ? 304 GLN A CG    1 
ATOM   1776 C  CD    . GLN A 1 229 ? 39.543  81.511  41.890 1.00 89.00  ? 304 GLN A CD    1 
ATOM   1777 O  OE1   . GLN A 1 229 ? 39.522  80.844  40.852 1.00 81.59  ? 304 GLN A OE1   1 
ATOM   1778 N  NE2   . GLN A 1 229 ? 39.518  80.955  43.096 1.00 83.74  ? 304 GLN A NE2   1 
ATOM   1779 N  N     . HIS A 1 230 ? 38.001  86.896  44.537 1.00 100.41 ? 305 HIS A N     1 
ATOM   1780 C  CA    . HIS A 1 230 ? 36.829  87.615  45.019 1.00 84.46  ? 305 HIS A CA    1 
ATOM   1781 C  C     . HIS A 1 230 ? 35.988  88.163  43.883 1.00 86.02  ? 305 HIS A C     1 
ATOM   1782 O  O     . HIS A 1 230 ? 34.838  88.556  44.112 1.00 97.59  ? 305 HIS A O     1 
ATOM   1783 C  CB    . HIS A 1 230 ? 37.262  88.767  45.930 1.00 84.89  ? 305 HIS A CB    1 
ATOM   1784 C  CG    . HIS A 1 230 ? 38.347  89.626  45.352 1.00 95.09  ? 305 HIS A CG    1 
ATOM   1785 N  ND1   . HIS A 1 230 ? 38.266  90.191  44.097 1.00 89.49  ? 305 HIS A ND1   1 
ATOM   1786 C  CD2   . HIS A 1 230 ? 39.539  90.021  45.862 1.00 90.24  ? 305 HIS A CD2   1 
ATOM   1787 C  CE1   . HIS A 1 230 ? 39.359  90.893  43.857 1.00 86.42  ? 305 HIS A CE1   1 
ATOM   1788 N  NE2   . HIS A 1 230 ? 40.147  90.808  44.913 1.00 85.51  ? 305 HIS A NE2   1 
ATOM   1789 N  N     . ARG A 1 231 ? 36.531  88.191  42.673 1.00 89.42  ? 306 ARG A N     1 
ATOM   1790 C  CA    . ARG A 1 231 ? 35.943  88.897  41.544 1.00 100.03 ? 306 ARG A CA    1 
ATOM   1791 C  C     . ARG A 1 231 ? 36.318  88.142  40.273 1.00 100.67 ? 306 ARG A C     1 
ATOM   1792 O  O     . ARG A 1 231 ? 36.580  86.936  40.318 1.00 104.88 ? 306 ARG A O     1 
ATOM   1793 C  CB    . ARG A 1 231 ? 36.359  90.381  41.552 1.00 106.66 ? 306 ARG A CB    1 
ATOM   1794 C  CG    . ARG A 1 231 ? 37.720  90.733  40.977 1.00 95.76  ? 306 ARG A CG    1 
ATOM   1795 C  CD    . ARG A 1 231 ? 37.764  92.238  40.774 1.00 111.85 ? 306 ARG A CD    1 
ATOM   1796 N  NE    . ARG A 1 231 ? 38.570  92.649  39.629 1.00 123.80 ? 306 ARG A NE    1 
ATOM   1797 C  CZ    . ARG A 1 231 ? 38.433  93.819  39.013 1.00 127.93 ? 306 ARG A CZ    1 
ATOM   1798 N  NH1   . ARG A 1 231 ? 37.512  94.680  39.430 1.00 128.41 ? 306 ARG A NH1   1 
ATOM   1799 N  NH2   . ARG A 1 231 ? 39.206  94.129  37.978 1.00 119.05 ? 306 ARG A NH2   1 
ATOM   1800 N  N     . LEU A 1 232 ? 36.250  88.843  39.133 1.00 101.55 ? 307 LEU A N     1 
ATOM   1801 C  CA    . LEU A 1 232 ? 36.459  88.385  37.760 1.00 100.74 ? 307 LEU A CA    1 
ATOM   1802 C  C     . LEU A 1 232 ? 35.163  87.810  37.216 1.00 98.65  ? 307 LEU A C     1 
ATOM   1803 O  O     . LEU A 1 232 ? 34.999  87.676  35.999 1.00 100.41 ? 307 LEU A O     1 
ATOM   1804 C  CB    . LEU A 1 232 ? 37.570  87.320  37.654 1.00 98.72  ? 307 LEU A CB    1 
ATOM   1805 C  CG    . LEU A 1 232 ? 38.944  87.388  38.345 1.00 99.55  ? 307 LEU A CG    1 
ATOM   1806 C  CD1   . LEU A 1 232 ? 39.254  86.059  39.019 1.00 90.07  ? 307 LEU A CD1   1 
ATOM   1807 C  CD2   . LEU A 1 232 ? 40.033  87.723  37.357 1.00 100.00 ? 307 LEU A CD2   1 
ATOM   1808 N  N     . ARG A 1 233 ? 34.239  87.487  38.118 1.00 97.06  ? 308 ARG A N     1 
ATOM   1809 C  CA    . ARG A 1 233 ? 32.942  86.908  37.774 1.00 108.94 ? 308 ARG A CA    1 
ATOM   1810 C  C     . ARG A 1 233 ? 33.109  85.644  36.923 1.00 109.44 ? 308 ARG A C     1 
ATOM   1811 O  O     . ARG A 1 233 ? 32.156  85.149  36.309 1.00 116.73 ? 308 ARG A O     1 
ATOM   1812 C  CB    . ARG A 1 233 ? 32.052  87.953  37.082 1.00 126.83 ? 308 ARG A CB    1 
ATOM   1813 C  CG    . ARG A 1 233 ? 30.571  87.592  36.937 1.00 142.22 ? 308 ARG A CG    1 
ATOM   1814 C  CD    . ARG A 1 233 ? 30.054  86.732  38.080 1.00 147.06 ? 308 ARG A CD    1 
ATOM   1815 N  NE    . ARG A 1 233 ? 28.794  86.085  37.720 1.00 157.56 ? 308 ARG A NE    1 
ATOM   1816 C  CZ    . ARG A 1 233 ? 28.323  84.984  38.298 1.00 178.83 ? 308 ARG A CZ    1 
ATOM   1817 N  NH1   . ARG A 1 233 ? 29.013  84.395  39.266 1.00 186.97 ? 308 ARG A NH1   1 
ATOM   1818 N  NH2   . ARG A 1 233 ? 27.167  84.467  37.901 1.00 186.22 ? 308 ARG A NH2   1 
ATOM   1819 N  N     . SER A 1 234 ? 34.324  85.103  36.896 1.00 101.62 ? 309 SER A N     1 
ATOM   1820 C  CA    . SER A 1 234 ? 34.583  83.746  36.445 1.00 93.16  ? 309 SER A CA    1 
ATOM   1821 C  C     . SER A 1 234 ? 35.762  83.248  37.261 1.00 95.78  ? 309 SER A C     1 
ATOM   1822 O  O     . SER A 1 234 ? 36.775  83.945  37.363 1.00 102.01 ? 309 SER A O     1 
ATOM   1823 C  CB    . SER A 1 234 ? 34.882  83.701  34.944 1.00 94.15  ? 309 SER A CB    1 
ATOM   1824 O  OG    . SER A 1 234 ? 34.366  82.526  34.334 1.00 100.81 ? 309 SER A OG    1 
ATOM   1825 N  N     . SER A 1 235 ? 35.630  82.067  37.848 1.00 98.74  ? 310 SER A N     1 
ATOM   1826 C  CA    . SER A 1 235 ? 36.703  81.533  38.670 1.00 86.67  ? 310 SER A CA    1 
ATOM   1827 C  C     . SER A 1 235 ? 37.824  80.971  37.799 1.00 82.64  ? 310 SER A C     1 
ATOM   1828 O  O     . SER A 1 235 ? 37.644  80.680  36.612 1.00 82.98  ? 310 SER A O     1 
ATOM   1829 C  CB    . SER A 1 235 ? 36.173  80.453  39.614 1.00 95.64  ? 310 SER A CB    1 
ATOM   1830 O  OG    . SER A 1 235 ? 35.030  80.901  40.328 1.00 110.31 ? 310 SER A OG    1 
ATOM   1831 N  N     . LEU A 1 236 ? 39.000  80.838  38.405 1.00 84.23  ? 311 LEU A N     1 
ATOM   1832 C  CA    . LEU A 1 236 ? 40.111  80.120  37.792 1.00 78.79  ? 311 LEU A CA    1 
ATOM   1833 C  C     . LEU A 1 236 ? 40.067  78.673  38.260 1.00 76.95  ? 311 LEU A C     1 
ATOM   1834 O  O     . LEU A 1 236 ? 40.132  78.407  39.465 1.00 79.36  ? 311 LEU A O     1 
ATOM   1835 C  CB    . LEU A 1 236 ? 41.452  80.755  38.155 1.00 81.77  ? 311 LEU A CB    1 
ATOM   1836 C  CG    . LEU A 1 236 ? 41.727  82.185  37.692 1.00 81.25  ? 311 LEU A CG    1 
ATOM   1837 C  CD1   . LEU A 1 236 ? 43.179  82.552  37.947 1.00 80.57  ? 311 LEU A CD1   1 
ATOM   1838 C  CD2   . LEU A 1 236 ? 41.382  82.346  36.225 1.00 80.21  ? 311 LEU A CD2   1 
ATOM   1839 N  N     . LYS A 1 237 ? 39.944  77.748  37.313 1.00 76.62  ? 312 LYS A N     1 
ATOM   1840 C  CA    . LYS A 1 237 ? 39.875  76.324  37.606 1.00 82.72  ? 312 LYS A CA    1 
ATOM   1841 C  C     . LYS A 1 237 ? 41.271  75.744  37.857 1.00 85.36  ? 312 LYS A C     1 
ATOM   1842 O  O     . LYS A 1 237 ? 42.287  76.299  37.433 1.00 87.13  ? 312 LYS A O     1 
ATOM   1843 C  CB    . LYS A 1 237 ? 39.179  75.589  36.461 1.00 84.47  ? 312 LYS A CB    1 
ATOM   1844 C  CG    . LYS A 1 237 ? 38.008  76.369  35.862 1.00 77.04  ? 312 LYS A CG    1 
ATOM   1845 C  CD    . LYS A 1 237 ? 36.954  76.732  36.901 1.00 73.87  ? 312 LYS A CD    1 
ATOM   1846 C  CE    . LYS A 1 237 ? 35.896  77.650  36.303 1.00 77.90  ? 312 LYS A CE    1 
ATOM   1847 N  NZ    . LYS A 1 237 ? 35.105  78.347  37.351 1.00 68.25  ? 312 LYS A NZ    1 
ATOM   1848 N  N     . SER A 1 238 ? 41.309  74.610  38.560 1.00 87.75  ? 313 SER A N     1 
ATOM   1849 C  CA    . SER A 1 238 ? 42.552  73.965  38.970 1.00 85.31  ? 313 SER A CA    1 
ATOM   1850 C  C     . SER A 1 238 ? 42.779  72.687  38.176 1.00 88.48  ? 313 SER A C     1 
ATOM   1851 O  O     . SER A 1 238 ? 41.830  72.057  37.698 1.00 90.97  ? 313 SER A O     1 
ATOM   1852 C  CB    . SER A 1 238 ? 42.550  73.629  40.466 1.00 81.85  ? 313 SER A CB    1 
ATOM   1853 O  OG    . SER A 1 238 ? 42.726  74.787  41.263 1.00 89.75  ? 313 SER A OG    1 
ATOM   1854 N  N     . GLU A 1 239 ? 44.055  72.311  38.045 1.00 93.70  ? 314 GLU A N     1 
ATOM   1855 C  CA    . GLU A 1 239 ? 44.465  71.195  37.197 1.00 93.96  ? 314 GLU A CA    1 
ATOM   1856 C  C     . GLU A 1 239 ? 43.723  69.903  37.519 1.00 98.02  ? 314 GLU A C     1 
ATOM   1857 O  O     . GLU A 1 239 ? 42.835  69.503  36.761 1.00 95.25  ? 314 GLU A O     1 
ATOM   1858 C  CB    . GLU A 1 239 ? 45.973  70.962  37.318 1.00 89.57  ? 314 GLU A CB    1 
ATOM   1859 C  CG    . GLU A 1 239 ? 46.487  69.717  36.587 1.00 92.03  ? 314 GLU A CG    1 
ATOM   1860 C  CD    . GLU A 1 239 ? 46.075  69.666  35.121 1.00 91.07  ? 314 GLU A CD    1 
ATOM   1861 O  OE1   . GLU A 1 239 ? 44.945  69.220  34.826 1.00 87.88  ? 314 GLU A OE1   1 
ATOM   1862 O  OE2   . GLU A 1 239 ? 46.882  70.076  34.259 1.00 94.85  ? 314 GLU A OE2   1 
ATOM   1863 N  N     . CYS A 1 240 ? 44.054  69.261  38.652 1.00 96.80  ? 315 CYS A N     1 
ATOM   1864 C  CA    . CYS A 1 240 ? 43.438  68.001  39.066 1.00 98.47  ? 315 CYS A CA    1 
ATOM   1865 C  C     . CYS A 1 240 ? 43.394  67.011  37.904 1.00 96.06  ? 315 CYS A C     1 
ATOM   1866 O  O     . CYS A 1 240 ? 42.322  66.780  37.328 1.00 96.07  ? 315 CYS A O     1 
ATOM   1867 C  CB    . CYS A 1 240 ? 42.030  68.246  39.616 1.00 104.38 ? 315 CYS A CB    1 
ATOM   1868 S  SG    . CYS A 1 240 ? 41.603  67.228  41.059 1.00 137.94 ? 315 CYS A SG    1 
ATOM   1869 N  N     . PRO A 1 241 ? 44.530  66.414  37.530 1.00 93.38  ? 316 PRO A N     1 
ATOM   1870 C  CA    . PRO A 1 241 ? 44.597  65.670  36.258 1.00 93.31  ? 316 PRO A CA    1 
ATOM   1871 C  C     . PRO A 1 241 ? 43.659  64.475  36.167 1.00 96.54  ? 316 PRO A C     1 
ATOM   1872 O  O     . PRO A 1 241 ? 43.441  63.968  35.058 1.00 98.44  ? 316 PRO A O     1 
ATOM   1873 C  CB    . PRO A 1 241 ? 46.065  65.227  36.190 1.00 97.78  ? 316 PRO A CB    1 
ATOM   1874 C  CG    . PRO A 1 241 ? 46.507  65.179  37.620 1.00 100.16 ? 316 PRO A CG    1 
ATOM   1875 C  CD    . PRO A 1 241 ? 45.776  66.302  38.308 1.00 96.28  ? 316 PRO A CD    1 
ATOM   1876 N  N     . THR A 1 242 ? 43.111  63.994  37.286 1.00 92.54  ? 317 THR A N     1 
ATOM   1877 C  CA    . THR A 1 242 ? 42.185  62.869  37.220 1.00 83.91  ? 317 THR A CA    1 
ATOM   1878 C  C     . THR A 1 242 ? 40.953  63.215  36.394 1.00 92.02  ? 317 THR A C     1 
ATOM   1879 O  O     . THR A 1 242 ? 40.384  62.342  35.733 1.00 97.21  ? 317 THR A O     1 
ATOM   1880 C  CB    . THR A 1 242 ? 41.774  62.443  38.629 1.00 85.56  ? 317 THR A CB    1 
ATOM   1881 O  OG1   . THR A 1 242 ? 42.874  62.635  39.526 1.00 85.97  ? 317 THR A OG1   1 
ATOM   1882 C  CG2   . THR A 1 242 ? 41.367  60.973  38.641 1.00 76.64  ? 317 THR A CG2   1 
ATOM   1883 N  N     . ARG A 1 243 ? 40.543  64.480  36.400 1.00 88.07  ? 318 ARG A N     1 
ATOM   1884 C  CA    . ARG A 1 243 ? 39.351  64.913  35.682 1.00 78.13  ? 318 ARG A CA    1 
ATOM   1885 C  C     . ARG A 1 243 ? 39.608  65.005  34.183 1.00 80.87  ? 318 ARG A C     1 
ATOM   1886 O  O     . ARG A 1 243 ? 40.669  65.461  33.745 1.00 86.47  ? 318 ARG A O     1 
ATOM   1887 C  CB    . ARG A 1 243 ? 38.878  66.266  36.212 1.00 81.44  ? 318 ARG A CB    1 
ATOM   1888 C  CG    . ARG A 1 243 ? 38.550  66.254  37.696 1.00 94.65  ? 318 ARG A CG    1 
ATOM   1889 C  CD    . ARG A 1 243 ? 37.858  67.542  38.122 1.00 92.33  ? 318 ARG A CD    1 
ATOM   1890 N  NE    . ARG A 1 243 ? 36.578  67.290  38.780 1.00 76.33  ? 318 ARG A NE    1 
ATOM   1891 C  CZ    . ARG A 1 243 ? 35.742  68.249  39.167 1.00 82.83  ? 318 ARG A CZ    1 
ATOM   1892 N  NH1   . ARG A 1 243 ? 36.051  69.520  38.960 1.00 81.90  ? 318 ARG A NH1   1 
ATOM   1893 N  NH2   . ARG A 1 243 ? 34.596  67.942  39.756 1.00 90.12  ? 318 ARG A NH2   1 
ATOM   1894 N  N     . TRP A 1 244 ? 38.618  64.581  33.397 1.00 77.41  ? 319 TRP A N     1 
ATOM   1895 C  CA    . TRP A 1 244 ? 38.764  64.536  31.947 1.00 76.88  ? 319 TRP A CA    1 
ATOM   1896 C  C     . TRP A 1 244 ? 38.889  65.939  31.366 1.00 75.27  ? 319 TRP A C     1 
ATOM   1897 O  O     . TRP A 1 244 ? 38.109  66.835  31.702 1.00 78.69  ? 319 TRP A O     1 
ATOM   1898 C  CB    . TRP A 1 244 ? 37.569  63.828  31.312 1.00 84.93  ? 319 TRP A CB    1 
ATOM   1899 C  CG    . TRP A 1 244 ? 37.485  62.360  31.591 1.00 81.80  ? 319 TRP A CG    1 
ATOM   1900 C  CD1   . TRP A 1 244 ? 38.480  61.554  32.056 1.00 84.71  ? 319 TRP A CD1   1 
ATOM   1901 C  CD2   . TRP A 1 244 ? 36.333  61.522  31.427 1.00 81.23  ? 319 TRP A CD2   1 
ATOM   1902 N  NE1   . TRP A 1 244 ? 38.022  60.264  32.187 1.00 87.37  ? 319 TRP A NE1   1 
ATOM   1903 C  CE2   . TRP A 1 244 ? 36.705  60.219  31.809 1.00 85.12  ? 319 TRP A CE2   1 
ATOM   1904 C  CE3   . TRP A 1 244 ? 35.023  61.747  30.992 1.00 82.32  ? 319 TRP A CE3   1 
ATOM   1905 C  CZ2   . TRP A 1 244 ? 35.814  59.145  31.770 1.00 90.51  ? 319 TRP A CZ2   1 
ATOM   1906 C  CZ3   . TRP A 1 244 ? 34.139  60.678  30.956 1.00 81.19  ? 319 TRP A CZ3   1 
ATOM   1907 C  CH2   . TRP A 1 244 ? 34.538  59.396  31.341 1.00 81.82  ? 319 TRP A CH2   1 
ATOM   1908 N  N     . ASN A 1 245 ? 39.864  66.113  30.473 1.00 68.53  ? 320 ASN A N     1 
ATOM   1909 C  CA    . ASN A 1 245 ? 40.145  67.393  29.823 1.00 72.61  ? 320 ASN A CA    1 
ATOM   1910 C  C     . ASN A 1 245 ? 40.145  68.540  30.824 1.00 74.46  ? 320 ASN A C     1 
ATOM   1911 O  O     . ASN A 1 245 ? 39.645  69.632  30.545 1.00 72.83  ? 320 ASN A O     1 
ATOM   1912 C  CB    . ASN A 1 245 ? 39.159  67.677  28.697 1.00 72.06  ? 320 ASN A CB    1 
ATOM   1913 C  CG    . ASN A 1 245 ? 39.789  68.471  27.574 1.00 76.65  ? 320 ASN A CG    1 
ATOM   1914 O  OD1   . ASN A 1 245 ? 40.837  69.092  27.755 1.00 80.92  ? 320 ASN A OD1   1 
ATOM   1915 N  ND2   . ASN A 1 245 ? 39.167  68.445  26.402 1.00 76.10  ? 320 ASN A ND2   1 
ATOM   1916 N  N     . SER A 1 246 ? 40.701  68.282  32.008 1.00 79.85  ? 321 SER A N     1 
ATOM   1917 C  CA    . SER A 1 246 ? 40.785  69.291  33.054 1.00 81.07  ? 321 SER A CA    1 
ATOM   1918 C  C     . SER A 1 246 ? 41.847  70.334  32.766 1.00 76.54  ? 321 SER A C     1 
ATOM   1919 O  O     . SER A 1 246 ? 41.903  71.348  33.469 1.00 77.17  ? 321 SER A O     1 
ATOM   1920 C  CB    . SER A 1 246 ? 41.076  68.624  34.397 1.00 90.39  ? 321 SER A CB    1 
ATOM   1921 O  OG    . SER A 1 246 ? 42.352  67.999  34.385 1.00 90.65  ? 321 SER A OG    1 
ATOM   1922 N  N     . THR A 1 247 ? 42.700  70.100  31.771 1.00 76.18  ? 322 THR A N     1 
ATOM   1923 C  CA    . THR A 1 247 ? 43.683  71.103  31.395 1.00 84.60  ? 322 THR A CA    1 
ATOM   1924 C  C     . THR A 1 247 ? 43.072  72.187  30.512 1.00 77.88  ? 322 THR A C     1 
ATOM   1925 O  O     . THR A 1 247 ? 43.534  73.333  30.537 1.00 79.23  ? 322 THR A O     1 
ATOM   1926 C  CB    . THR A 1 247 ? 44.875  70.434  30.702 1.00 81.27  ? 322 THR A CB    1 
ATOM   1927 O  OG1   . THR A 1 247 ? 45.878  71.415  30.415 1.00 66.62  ? 322 THR A OG1   1 
ATOM   1928 C  CG2   . THR A 1 247 ? 44.441  69.749  29.411 1.00 83.44  ? 322 THR A CG2   1 
ATOM   1929 N  N     . TYR A 1 248 ? 42.033  71.852  29.744 1.00 76.94  ? 323 TYR A N     1 
ATOM   1930 C  CA    . TYR A 1 248 ? 41.358  72.860  28.931 1.00 82.07  ? 323 TYR A CA    1 
ATOM   1931 C  C     . TYR A 1 248 ? 40.488  73.769  29.789 1.00 78.19  ? 323 TYR A C     1 
ATOM   1932 O  O     . TYR A 1 248 ? 40.423  74.980  29.553 1.00 77.32  ? 323 TYR A O     1 
ATOM   1933 C  CB    . TYR A 1 248 ? 40.517  72.183  27.851 1.00 83.40  ? 323 TYR A CB    1 
ATOM   1934 C  CG    . TYR A 1 248 ? 39.503  73.091  27.204 1.00 81.11  ? 323 TYR A CG    1 
ATOM   1935 C  CD1   . TYR A 1 248 ? 39.854  73.901  26.139 1.00 83.93  ? 323 TYR A CD1   1 
ATOM   1936 C  CD2   . TYR A 1 248 ? 38.190  73.132  27.653 1.00 86.11  ? 323 TYR A CD2   1 
ATOM   1937 C  CE1   . TYR A 1 248 ? 38.933  74.734  25.539 1.00 88.23  ? 323 TYR A CE1   1 
ATOM   1938 C  CE2   . TYR A 1 248 ? 37.258  73.964  27.059 1.00 94.90  ? 323 TYR A CE2   1 
ATOM   1939 C  CZ    . TYR A 1 248 ? 37.636  74.763  26.000 1.00 92.60  ? 323 TYR A CZ    1 
ATOM   1940 O  OH    . TYR A 1 248 ? 36.717  75.596  25.401 1.00 99.56  ? 323 TYR A OH    1 
ATOM   1941 N  N     . THR A 1 249 ? 39.793  73.199  30.771 1.00 77.85  ? 324 THR A N     1 
ATOM   1942 C  CA    . THR A 1 249 ? 38.995  74.017  31.674 1.00 75.64  ? 324 THR A CA    1 
ATOM   1943 C  C     . THR A 1 249 ? 39.873  74.997  32.441 1.00 76.75  ? 324 THR A C     1 
ATOM   1944 O  O     . THR A 1 249 ? 39.484  76.148  32.665 1.00 82.49  ? 324 THR A O     1 
ATOM   1945 C  CB    . THR A 1 249 ? 38.218  73.122  32.638 1.00 75.77  ? 324 THR A CB    1 
ATOM   1946 O  OG1   . THR A 1 249 ? 37.532  72.104  31.897 1.00 83.38  ? 324 THR A OG1   1 
ATOM   1947 C  CG2   . THR A 1 249 ? 37.205  73.938  33.415 1.00 81.21  ? 324 THR A CG2   1 
ATOM   1948 N  N     . MET A 1 250 ? 41.071  74.563  32.835 1.00 74.89  ? 325 MET A N     1 
ATOM   1949 C  CA    . MET A 1 250 ? 41.961  75.438  33.586 1.00 74.48  ? 325 MET A CA    1 
ATOM   1950 C  C     . MET A 1 250 ? 42.483  76.574  32.715 1.00 78.55  ? 325 MET A C     1 
ATOM   1951 O  O     . MET A 1 250 ? 42.571  77.720  33.169 1.00 76.91  ? 325 MET A O     1 
ATOM   1952 C  CB    . MET A 1 250 ? 43.119  74.626  34.172 1.00 80.35  ? 325 MET A CB    1 
ATOM   1953 C  CG    . MET A 1 250 ? 44.053  75.421  35.078 1.00 87.11  ? 325 MET A CG    1 
ATOM   1954 S  SD    . MET A 1 250 ? 45.582  75.970  34.292 1.00 81.64  ? 325 MET A SD    1 
ATOM   1955 C  CE    . MET A 1 250 ? 46.372  74.387  34.015 1.00 80.24  ? 325 MET A CE    1 
ATOM   1956 N  N     . LEU A 1 251 ? 42.821  76.282  31.457 1.00 78.27  ? 326 LEU A N     1 
ATOM   1957 C  CA    . LEU A 1 251 ? 43.420  77.303  30.602 1.00 74.02  ? 326 LEU A CA    1 
ATOM   1958 C  C     . LEU A 1 251 ? 42.392  78.338  30.167 1.00 76.08  ? 326 LEU A C     1 
ATOM   1959 O  O     . LEU A 1 251 ? 42.670  79.543  30.191 1.00 76.72  ? 326 LEU A O     1 
ATOM   1960 C  CB    . LEU A 1 251 ? 44.074  76.651  29.386 1.00 71.47  ? 326 LEU A CB    1 
ATOM   1961 C  CG    . LEU A 1 251 ? 45.588  76.433  29.441 1.00 70.64  ? 326 LEU A CG    1 
ATOM   1962 C  CD1   . LEU A 1 251 ? 46.000  75.809  30.756 1.00 67.11  ? 326 LEU A CD1   1 
ATOM   1963 C  CD2   . LEU A 1 251 ? 46.027  75.561  28.277 1.00 66.32  ? 326 LEU A CD2   1 
ATOM   1964 N  N     . ARG A 1 252 ? 41.201  77.887  29.766 1.00 81.21  ? 327 ARG A N     1 
ATOM   1965 C  CA    . ARG A 1 252 ? 40.162  78.825  29.358 1.00 78.92  ? 327 ARG A CA    1 
ATOM   1966 C  C     . ARG A 1 252 ? 39.759  79.743  30.503 1.00 77.45  ? 327 ARG A C     1 
ATOM   1967 O  O     . ARG A 1 252 ? 39.419  80.910  30.273 1.00 82.72  ? 327 ARG A O     1 
ATOM   1968 C  CB    . ARG A 1 252 ? 38.941  78.069  28.834 1.00 83.16  ? 327 ARG A CB    1 
ATOM   1969 C  CG    . ARG A 1 252 ? 38.247  78.748  27.663 1.00 91.91  ? 327 ARG A CG    1 
ATOM   1970 C  CD    . ARG A 1 252 ? 36.781  78.352  27.561 1.00 97.75  ? 327 ARG A CD    1 
ATOM   1971 N  NE    . ARG A 1 252 ? 35.962  79.079  28.529 1.00 110.11 ? 327 ARG A NE    1 
ATOM   1972 C  CZ    . ARG A 1 252 ? 35.627  78.618  29.731 1.00 108.51 ? 327 ARG A CZ    1 
ATOM   1973 N  NH1   . ARG A 1 252 ? 36.031  77.417  30.124 1.00 105.94 ? 327 ARG A NH1   1 
ATOM   1974 N  NH2   . ARG A 1 252 ? 34.883  79.362  30.540 1.00 103.99 ? 327 ARG A NH2   1 
ATOM   1975 N  N     . SER A 1 253 ? 39.795  79.245  31.740 1.00 70.49  ? 328 SER A N     1 
ATOM   1976 C  CA    . SER A 1 253 ? 39.474  80.111  32.867 1.00 74.29  ? 328 SER A CA    1 
ATOM   1977 C  C     . SER A 1 253 ? 40.516  81.210  33.016 1.00 74.73  ? 328 SER A C     1 
ATOM   1978 O  O     . SER A 1 253 ? 40.170  82.376  33.241 1.00 73.61  ? 328 SER A O     1 
ATOM   1979 C  CB    . SER A 1 253 ? 39.353  79.292  34.151 1.00 73.88  ? 328 SER A CB    1 
ATOM   1980 O  OG    . SER A 1 253 ? 40.624  78.991  34.691 1.00 77.69  ? 328 SER A OG    1 
ATOM   1981 N  N     . ILE A 1 254 ? 41.796  80.857  32.875 1.00 80.17  ? 329 ILE A N     1 
ATOM   1982 C  CA    . ILE A 1 254 ? 42.856  81.861  32.886 1.00 78.23  ? 329 ILE A CA    1 
ATOM   1983 C  C     . ILE A 1 254 ? 42.636  82.868  31.768 1.00 77.59  ? 329 ILE A C     1 
ATOM   1984 O  O     . ILE A 1 254 ? 42.768  84.082  31.965 1.00 79.65  ? 329 ILE A O     1 
ATOM   1985 C  CB    . ILE A 1 254 ? 44.235  81.186  32.760 1.00 70.95  ? 329 ILE A CB    1 
ATOM   1986 C  CG1   . ILE A 1 254 ? 44.425  80.146  33.856 1.00 77.28  ? 329 ILE A CG1   1 
ATOM   1987 C  CG2   . ILE A 1 254 ? 45.347  82.214  32.836 1.00 64.20  ? 329 ILE A CG2   1 
ATOM   1988 C  CD1   . ILE A 1 254 ? 44.479  80.740  35.225 1.00 77.23  ? 329 ILE A CD1   1 
ATOM   1989 N  N     . LEU A 1 255 ? 42.262  82.378  30.588 1.00 74.74  ? 330 LEU A N     1 
ATOM   1990 C  CA    . LEU A 1 255 ? 42.279  83.211  29.394 1.00 78.05  ? 330 LEU A CA    1 
ATOM   1991 C  C     . LEU A 1 255 ? 41.155  84.238  29.408 1.00 84.75  ? 330 LEU A C     1 
ATOM   1992 O  O     . LEU A 1 255 ? 41.377  85.418  29.111 1.00 87.57  ? 330 LEU A O     1 
ATOM   1993 C  CB    . LEU A 1 255 ? 42.188  82.324  28.157 1.00 77.14  ? 330 LEU A CB    1 
ATOM   1994 C  CG    . LEU A 1 255 ? 42.419  83.017  26.821 1.00 82.57  ? 330 LEU A CG    1 
ATOM   1995 C  CD1   . LEU A 1 255 ? 43.300  82.141  25.967 1.00 85.40  ? 330 LEU A CD1   1 
ATOM   1996 C  CD2   . LEU A 1 255 ? 41.089  83.280  26.138 1.00 89.20  ? 330 LEU A CD2   1 
ATOM   1997 N  N     . ASP A 1 256 ? 39.936  83.809  29.736 1.00 82.46  ? 331 ASP A N     1 
ATOM   1998 C  CA    . ASP A 1 256 ? 38.807  84.731  29.701 1.00 81.60  ? 331 ASP A CA    1 
ATOM   1999 C  C     . ASP A 1 256 ? 38.990  85.878  30.686 1.00 83.95  ? 331 ASP A C     1 
ATOM   2000 O  O     . ASP A 1 256 ? 38.541  86.999  30.425 1.00 93.97  ? 331 ASP A O     1 
ATOM   2001 C  CB    . ASP A 1 256 ? 37.509  83.975  29.982 1.00 77.76  ? 331 ASP A CB    1 
ATOM   2002 C  CG    . ASP A 1 256 ? 37.258  82.859  28.981 1.00 84.99  ? 331 ASP A CG    1 
ATOM   2003 O  OD1   . ASP A 1 256 ? 36.581  81.869  29.336 1.00 83.94  ? 331 ASP A OD1   1 
ATOM   2004 O  OD2   . ASP A 1 256 ? 37.747  82.972  27.839 1.00 84.94  ? 331 ASP A OD2   1 
ATOM   2005 N  N     . ASN A 1 257 ? 39.651  85.620  31.809 1.00 77.24  ? 332 ASN A N     1 
ATOM   2006 C  CA    . ASN A 1 257 ? 39.898  86.609  32.846 1.00 81.94  ? 332 ASN A CA    1 
ATOM   2007 C  C     . ASN A 1 257 ? 41.266  87.275  32.726 1.00 92.72  ? 332 ASN A C     1 
ATOM   2008 O  O     . ASN A 1 257 ? 41.690  87.963  33.661 1.00 94.26  ? 332 ASN A O     1 
ATOM   2009 C  CB    . ASN A 1 257 ? 39.715  85.970  34.216 1.00 85.31  ? 332 ASN A CB    1 
ATOM   2010 C  CG    . ASN A 1 257 ? 38.287  85.536  34.450 1.00 88.13  ? 332 ASN A CG    1 
ATOM   2011 O  OD1   . ASN A 1 257 ? 37.986  84.344  34.495 1.00 92.37  ? 332 ASN A OD1   1 
ATOM   2012 N  ND2   . ASN A 1 257 ? 37.391  86.504  34.566 1.00 92.10  ? 332 ASN A ND2   1 
ATOM   2013 N  N     . TRP A 1 258 ? 41.976  87.045  31.614 1.00 94.95  ? 333 TRP A N     1 
ATOM   2014 C  CA    . TRP A 1 258 ? 43.326  87.579  31.422 1.00 91.87  ? 333 TRP A CA    1 
ATOM   2015 C  C     . TRP A 1 258 ? 43.426  89.057  31.787 1.00 91.92  ? 333 TRP A C     1 
ATOM   2016 O  O     . TRP A 1 258 ? 44.422  89.494  32.375 1.00 89.72  ? 333 TRP A O     1 
ATOM   2017 C  CB    . TRP A 1 258 ? 43.754  87.369  29.968 1.00 90.49  ? 333 TRP A CB    1 
ATOM   2018 C  CG    . TRP A 1 258 ? 45.202  87.648  29.695 1.00 94.20  ? 333 TRP A CG    1 
ATOM   2019 C  CD1   . TRP A 1 258 ? 45.745  88.822  29.256 1.00 89.50  ? 333 TRP A CD1   1 
ATOM   2020 C  CD2   . TRP A 1 258 ? 46.292  86.726  29.826 1.00 94.85  ? 333 TRP A CD2   1 
ATOM   2021 N  NE1   . TRP A 1 258 ? 47.106  88.687  29.113 1.00 92.28  ? 333 TRP A NE1   1 
ATOM   2022 C  CE2   . TRP A 1 258 ? 47.465  87.410  29.457 1.00 90.58  ? 333 TRP A CE2   1 
ATOM   2023 C  CE3   . TRP A 1 258 ? 46.388  85.388  30.224 1.00 92.99  ? 333 TRP A CE3   1 
ATOM   2024 C  CZ2   . TRP A 1 258 ? 48.718  86.802  29.475 1.00 92.11  ? 333 TRP A CZ2   1 
ATOM   2025 C  CZ3   . TRP A 1 258 ? 47.633  84.788  30.240 1.00 80.28  ? 333 TRP A CZ3   1 
ATOM   2026 C  CH2   . TRP A 1 258 ? 48.780  85.494  29.869 1.00 85.90  ? 333 TRP A CH2   1 
ATOM   2027 N  N     . GLU A 1 259 ? 42.401  89.839  31.448 1.00 95.38  ? 334 GLU A N     1 
ATOM   2028 C  CA    . GLU A 1 259 ? 42.446  91.278  31.691 1.00 99.18  ? 334 GLU A CA    1 
ATOM   2029 C  C     . GLU A 1 259 ? 42.530  91.589  33.183 1.00 100.03 ? 334 GLU A C     1 
ATOM   2030 O  O     . GLU A 1 259 ? 43.360  92.398  33.614 1.00 98.21  ? 334 GLU A O     1 
ATOM   2031 C  CB    . GLU A 1 259 ? 41.217  91.939  31.068 1.00 106.82 ? 334 GLU A CB    1 
ATOM   2032 C  CG    . GLU A 1 259 ? 40.898  91.436  29.665 1.00 106.04 ? 334 GLU A CG    1 
ATOM   2033 C  CD    . GLU A 1 259 ? 39.404  91.338  29.405 1.00 111.65 ? 334 GLU A CD    1 
ATOM   2034 O  OE1   . GLU A 1 259 ? 38.678  92.322  29.676 1.00 102.30 ? 334 GLU A OE1   1 
ATOM   2035 O  OE2   . GLU A 1 259 ? 38.954  90.269  28.941 1.00 116.18 ? 334 GLU A OE2   1 
ATOM   2036 N  N     . SER A 1 260 ? 41.671  90.960  33.989 1.00 99.21  ? 335 SER A N     1 
ATOM   2037 C  CA    . SER A 1 260 ? 41.617  91.277  35.412 1.00 99.34  ? 335 SER A CA    1 
ATOM   2038 C  C     . SER A 1 260 ? 42.715  90.588  36.214 1.00 99.81  ? 335 SER A C     1 
ATOM   2039 O  O     . SER A 1 260 ? 43.140  91.119  37.247 1.00 98.48  ? 335 SER A O     1 
ATOM   2040 C  CB    . SER A 1 260 ? 40.248  90.909  35.986 1.00 94.69  ? 335 SER A CB    1 
ATOM   2041 O  OG    . SER A 1 260 ? 39.248  91.817  35.565 1.00 103.77 ? 335 SER A OG    1 
ATOM   2042 N  N     . VAL A 1 261 ? 43.185  89.418  35.773 1.00 101.12 ? 336 VAL A N     1 
ATOM   2043 C  CA    . VAL A 1 261 ? 44.141  88.666  36.583 1.00 99.21  ? 336 VAL A CA    1 
ATOM   2044 C  C     . VAL A 1 261 ? 45.469  89.403  36.674 1.00 98.08  ? 336 VAL A C     1 
ATOM   2045 O  O     . VAL A 1 261 ? 46.104  89.429  37.734 1.00 101.17 ? 336 VAL A O     1 
ATOM   2046 C  CB    . VAL A 1 261 ? 44.323  87.237  36.038 1.00 99.38  ? 336 VAL A CB    1 
ATOM   2047 C  CG1   . VAL A 1 261 ? 44.775  87.263  34.598 1.00 100.21 ? 336 VAL A CG1   1 
ATOM   2048 C  CG2   . VAL A 1 261 ? 45.334  86.480  36.881 1.00 93.66  ? 336 VAL A CG2   1 
ATOM   2049 N  N     . ILE A 1 262 ? 45.909  90.021  35.574 1.00 101.34 ? 337 ILE A N     1 
ATOM   2050 C  CA    . ILE A 1 262 ? 47.175  90.746  35.596 1.00 101.09 ? 337 ILE A CA    1 
ATOM   2051 C  C     . ILE A 1 262 ? 47.055  91.994  36.456 1.00 98.95  ? 337 ILE A C     1 
ATOM   2052 O  O     . ILE A 1 262 ? 48.028  92.417  37.094 1.00 92.70  ? 337 ILE A O     1 
ATOM   2053 C  CB    . ILE A 1 262 ? 47.630  91.082  34.163 1.00 102.65 ? 337 ILE A CB    1 
ATOM   2054 C  CG1   . ILE A 1 262 ? 46.538  91.838  33.406 1.00 102.90 ? 337 ILE A CG1   1 
ATOM   2055 C  CG2   . ILE A 1 262 ? 48.006  89.814  33.408 1.00 104.48 ? 337 ILE A CG2   1 
ATOM   2056 C  CD1   . ILE A 1 262 ? 46.859  92.062  31.942 1.00 101.73 ? 337 ILE A CD1   1 
ATOM   2057 N  N     . GLN A 1 263 ? 45.866  92.597  36.500 1.00 103.82 ? 338 GLN A N     1 
ATOM   2058 C  CA    . GLN A 1 263 ? 45.650  93.743  37.372 1.00 105.40 ? 338 GLN A CA    1 
ATOM   2059 C  C     . GLN A 1 263 ? 45.831  93.350  38.831 1.00 105.67 ? 338 GLN A C     1 
ATOM   2060 O  O     . GLN A 1 263 ? 46.514  94.042  39.594 1.00 111.57 ? 338 GLN A O     1 
ATOM   2061 C  CB    . GLN A 1 263 ? 44.257  94.325  37.136 1.00 101.42 ? 338 GLN A CB    1 
ATOM   2062 C  CG    . GLN A 1 263 ? 44.017  95.652  37.831 1.00 110.87 ? 338 GLN A CG    1 
ATOM   2063 C  CD    . GLN A 1 263 ? 42.660  96.238  37.498 1.00 120.40 ? 338 GLN A CD    1 
ATOM   2064 O  OE1   . GLN A 1 263 ? 41.923  95.694  36.675 1.00 122.10 ? 338 GLN A OE1   1 
ATOM   2065 N  NE2   . GLN A 1 263 ? 42.321  97.352  38.138 1.00 120.64 ? 338 GLN A NE2   1 
ATOM   2066 N  N     . ILE A 1 264 ? 45.235  92.226  39.232 1.00 100.91 ? 339 ILE A N     1 
ATOM   2067 C  CA    . ILE A 1 264 ? 45.394  91.758  40.604 1.00 102.55 ? 339 ILE A CA    1 
ATOM   2068 C  C     . ILE A 1 264 ? 46.830  91.307  40.850 1.00 102.16 ? 339 ILE A C     1 
ATOM   2069 O  O     . ILE A 1 264 ? 47.389  91.533  41.930 1.00 101.65 ? 339 ILE A O     1 
ATOM   2070 C  CB    . ILE A 1 264 ? 44.385  90.635  40.904 1.00 100.64 ? 339 ILE A CB    1 
ATOM   2071 C  CG1   . ILE A 1 264 ? 42.998  91.001  40.376 1.00 94.25  ? 339 ILE A CG1   1 
ATOM   2072 C  CG2   . ILE A 1 264 ? 44.312  90.378  42.398 1.00 102.56 ? 339 ILE A CG2   1 
ATOM   2073 C  CD1   . ILE A 1 264 ? 42.382  92.203  41.057 1.00 108.78 ? 339 ILE A CD1   1 
ATOM   2074 N  N     . LEU A 1 265 ? 47.452  90.672  39.853 1.00 98.09  ? 340 LEU A N     1 
ATOM   2075 C  CA    . LEU A 1 265 ? 48.846  90.258  39.970 1.00 98.96  ? 340 LEU A CA    1 
ATOM   2076 C  C     . LEU A 1 265 ? 49.797  91.439  40.114 1.00 104.58 ? 340 LEU A C     1 
ATOM   2077 O  O     . LEU A 1 265 ? 50.960  91.237  40.484 1.00 104.64 ? 340 LEU A O     1 
ATOM   2078 C  CB    . LEU A 1 265 ? 49.247  89.417  38.752 1.00 95.85  ? 340 LEU A CB    1 
ATOM   2079 C  CG    . LEU A 1 265 ? 49.291  87.891  38.881 1.00 87.05  ? 340 LEU A CG    1 
ATOM   2080 C  CD1   . LEU A 1 265 ? 50.382  87.466  39.844 1.00 98.97  ? 340 LEU A CD1   1 
ATOM   2081 C  CD2   . LEU A 1 265 ? 47.957  87.336  39.325 1.00 90.44  ? 340 LEU A CD2   1 
ATOM   2082 N  N     . SER A 1 266 ? 49.332  92.658  39.832 1.00 102.88 ? 341 SER A N     1 
ATOM   2083 C  CA    . SER A 1 266 ? 50.187  93.838  39.919 1.00 107.00 ? 341 SER A CA    1 
ATOM   2084 C  C     . SER A 1 266 ? 50.314  94.329  41.356 1.00 108.68 ? 341 SER A C     1 
ATOM   2085 O  O     . SER A 1 266 ? 51.411  94.334  41.927 1.00 107.90 ? 341 SER A O     1 
ATOM   2086 C  CB    . SER A 1 266 ? 49.638  94.948  39.021 1.00 105.82 ? 341 SER A CB    1 
ATOM   2087 O  OG    . SER A 1 266 ? 50.418  96.122  39.143 1.00 106.03 ? 341 SER A OG    1 
ATOM   2088 N  N     . GLU A 1 267 ? 49.191  94.754  41.947 1.00 107.16 ? 342 GLU A N     1 
ATOM   2089 C  CA    . GLU A 1 267 ? 49.192  95.301  43.302 1.00 110.15 ? 342 GLU A CA    1 
ATOM   2090 C  C     . GLU A 1 267 ? 49.896  94.386  44.294 1.00 112.23 ? 342 GLU A C     1 
ATOM   2091 O  O     . GLU A 1 267 ? 50.506  94.864  45.258 1.00 114.10 ? 342 GLU A O     1 
ATOM   2092 C  CB    . GLU A 1 267 ? 47.755  95.562  43.754 1.00 112.41 ? 342 GLU A CB    1 
ATOM   2093 C  CG    . GLU A 1 267 ? 46.763  94.504  43.291 1.00 115.74 ? 342 GLU A CG    1 
ATOM   2094 C  CD    . GLU A 1 267 ? 45.317  94.914  43.515 1.00 124.65 ? 342 GLU A CD    1 
ATOM   2095 O  OE1   . GLU A 1 267 ? 44.513  94.063  43.958 1.00 127.88 ? 342 GLU A OE1   1 
ATOM   2096 O  OE2   . GLU A 1 267 ? 44.983  96.088  43.249 1.00 125.81 ? 342 GLU A OE2   1 
ATOM   2097 N  N     . ALA A 1 268 ? 49.826  93.073  44.080 1.00 109.33 ? 343 ALA A N     1 
ATOM   2098 C  CA    . ALA A 1 268 ? 50.534  92.144  44.946 1.00 103.45 ? 343 ALA A CA    1 
ATOM   2099 C  C     . ALA A 1 268 ? 52.043  92.214  44.776 1.00 106.67 ? 343 ALA A C     1 
ATOM   2100 O  O     . ALA A 1 268 ? 52.764  91.656  45.608 1.00 116.82 ? 343 ALA A O     1 
ATOM   2101 C  CB    . ALA A 1 268 ? 50.057  90.714  44.686 1.00 101.38 ? 343 ALA A CB    1 
ATOM   2102 N  N     . GLY A 1 269 ? 52.539  92.877  43.731 1.00 102.92 ? 344 GLY A N     1 
ATOM   2103 C  CA    . GLY A 1 269 ? 53.952  92.823  43.418 1.00 109.65 ? 344 GLY A CA    1 
ATOM   2104 C  C     . GLY A 1 269 ? 54.432  91.474  42.937 1.00 107.59 ? 344 GLY A C     1 
ATOM   2105 O  O     . GLY A 1 269 ? 55.630  91.318  42.667 1.00 103.10 ? 344 GLY A O     1 
ATOM   2106 N  N     . GLU A 1 270 ? 53.528  90.505  42.821 1.00 101.61 ? 345 GLU A N     1 
ATOM   2107 C  CA    . GLU A 1 270 ? 53.801  89.128  42.446 1.00 99.25  ? 345 GLU A CA    1 
ATOM   2108 C  C     . GLU A 1 270 ? 53.714  88.906  40.942 1.00 101.03 ? 345 GLU A C     1 
ATOM   2109 O  O     . GLU A 1 270 ? 53.646  87.758  40.499 1.00 105.63 ? 345 GLU A O     1 
ATOM   2110 C  CB    . GLU A 1 270 ? 52.861  88.179  43.194 1.00 100.68 ? 345 GLU A CB    1 
ATOM   2111 C  CG    . GLU A 1 270 ? 53.116  88.148  44.697 1.00 98.78  ? 345 GLU A CG    1 
ATOM   2112 C  CD    . GLU A 1 270 ? 54.598  88.104  45.035 1.00 107.94 ? 345 GLU A CD    1 
ATOM   2113 O  OE1   . GLU A 1 270 ? 55.319  87.248  44.478 1.00 114.83 ? 345 GLU A OE1   1 
ATOM   2114 O  OE2   . GLU A 1 270 ? 55.045  88.934  45.857 1.00 104.31 ? 345 GLU A OE2   1 
ATOM   2115 N  N     . THR A 1 271 ? 53.675  89.981  40.157 1.00 97.03  ? 346 THR A N     1 
ATOM   2116 C  CA    . THR A 1 271 ? 53.542  89.959  38.703 1.00 97.14  ? 346 THR A CA    1 
ATOM   2117 C  C     . THR A 1 271 ? 54.643  89.143  38.028 1.00 97.78  ? 346 THR A C     1 
ATOM   2118 O  O     . THR A 1 271 ? 54.617  88.939  36.812 1.00 99.87  ? 346 THR A O     1 
ATOM   2119 C  CB    . THR A 1 271 ? 53.536  91.391  38.158 1.00 94.64  ? 346 THR A CB    1 
ATOM   2120 O  OG1   . THR A 1 271 ? 53.745  91.371  36.738 1.00 86.27  ? 346 THR A OG1   1 
ATOM   2121 C  CG2   . THR A 1 271 ? 54.620  92.222  38.832 1.00 87.30  ? 346 THR A CG2   1 
ATOM   2122 N  N     . GLN A 1 272 ? 55.642  88.715  38.798 1.00 92.15  ? 347 GLN A N     1 
ATOM   2123 C  CA    . GLN A 1 272 ? 56.568  87.694  38.320 1.00 93.34  ? 347 GLN A CA    1 
ATOM   2124 C  C     . GLN A 1 272 ? 55.829  86.464  37.797 1.00 94.92  ? 347 GLN A C     1 
ATOM   2125 O  O     . GLN A 1 272 ? 56.200  85.903  36.760 1.00 98.36  ? 347 GLN A O     1 
ATOM   2126 C  CB    . GLN A 1 272 ? 57.530  87.302  39.445 1.00 103.47 ? 347 GLN A CB    1 
ATOM   2127 C  CG    . GLN A 1 272 ? 58.507  86.211  39.045 1.00 118.65 ? 347 GLN A CG    1 
ATOM   2128 C  CD    . GLN A 1 272 ? 59.616  85.986  40.058 1.00 127.84 ? 347 GLN A CD    1 
ATOM   2129 O  OE1   . GLN A 1 272 ? 59.783  86.753  41.008 1.00 129.84 ? 347 GLN A OE1   1 
ATOM   2130 N  NE2   . GLN A 1 272 ? 60.388  84.924  39.853 1.00 123.23 ? 347 GLN A NE2   1 
ATOM   2131 N  N     . ARG A 1 273 ? 54.767  86.041  38.492 1.00 95.61  ? 348 ARG A N     1 
ATOM   2132 C  CA    . ARG A 1 273 ? 54.073  84.791  38.190 1.00 96.15  ? 348 ARG A CA    1 
ATOM   2133 C  C     . ARG A 1 273 ? 53.365  84.786  36.838 1.00 92.72  ? 348 ARG A C     1 
ATOM   2134 O  O     . ARG A 1 273 ? 52.935  83.715  36.396 1.00 90.18  ? 348 ARG A O     1 
ATOM   2135 C  CB    . ARG A 1 273 ? 53.048  84.482  39.289 1.00 98.16  ? 348 ARG A CB    1 
ATOM   2136 C  CG    . ARG A 1 273 ? 53.648  84.141  40.646 1.00 104.80 ? 348 ARG A CG    1 
ATOM   2137 C  CD    . ARG A 1 273 ? 52.564  84.019  41.709 1.00 100.42 ? 348 ARG A CD    1 
ATOM   2138 N  NE    . ARG A 1 273 ? 53.110  83.717  43.032 1.00 99.71  ? 348 ARG A NE    1 
ATOM   2139 C  CZ    . ARG A 1 273 ? 53.090  82.511  43.594 1.00 97.47  ? 348 ARG A CZ    1 
ATOM   2140 N  NH1   . ARG A 1 273 ? 52.547  81.483  42.953 1.00 91.69  ? 348 ARG A NH1   1 
ATOM   2141 N  NH2   . ARG A 1 273 ? 53.609  82.335  44.803 1.00 93.24  ? 348 ARG A NH2   1 
ATOM   2142 N  N     . ILE A 1 274 ? 53.228  85.933  36.179 1.00 90.93  ? 349 ILE A N     1 
ATOM   2143 C  CA    . ILE A 1 274 ? 52.428  86.066  34.962 1.00 94.78  ? 349 ILE A CA    1 
ATOM   2144 C  C     . ILE A 1 274 ? 53.307  86.371  33.744 1.00 96.19  ? 349 ILE A C     1 
ATOM   2145 O  O     . ILE A 1 274 ? 53.254  85.662  32.741 1.00 98.14  ? 349 ILE A O     1 
ATOM   2146 C  CB    . ILE A 1 274 ? 51.301  87.108  35.134 1.00 93.38  ? 349 ILE A CB    1 
ATOM   2147 C  CG1   . ILE A 1 274 ? 50.626  87.398  33.792 1.00 90.82  ? 349 ILE A CG1   1 
ATOM   2148 C  CG2   . ILE A 1 274 ? 51.794  88.383  35.814 1.00 92.34  ? 349 ILE A CG2   1 
ATOM   2149 C  CD1   . ILE A 1 274 ? 49.865  86.218  33.220 1.00 88.01  ? 349 ILE A CD1   1 
ATOM   2150 N  N     . VAL A 1 275 ? 54.104  87.444  33.818 1.00 97.23  ? 350 VAL A N     1 
ATOM   2151 C  CA    . VAL A 1 275 ? 54.793  88.031  32.664 1.00 100.48 ? 350 VAL A CA    1 
ATOM   2152 C  C     . VAL A 1 275 ? 55.528  87.001  31.815 1.00 97.72  ? 350 VAL A C     1 
ATOM   2153 O  O     . VAL A 1 275 ? 55.742  87.222  30.618 1.00 94.29  ? 350 VAL A O     1 
ATOM   2154 C  CB    . VAL A 1 275 ? 55.763  89.131  33.147 1.00 98.21  ? 350 VAL A CB    1 
ATOM   2155 C  CG1   . VAL A 1 275 ? 55.002  90.264  33.810 1.00 97.75  ? 350 VAL A CG1   1 
ATOM   2156 C  CG2   . VAL A 1 275 ? 56.799  88.548  34.103 1.00 97.50  ? 350 VAL A CG2   1 
ATOM   2157 N  N     . HIS A 1 276 ? 55.927  85.875  32.401 1.00 96.75  ? 351 HIS A N     1 
ATOM   2158 C  CA    . HIS A 1 276 ? 56.658  84.857  31.657 1.00 97.12  ? 351 HIS A CA    1 
ATOM   2159 C  C     . HIS A 1 276 ? 55.757  83.974  30.801 1.00 100.74 ? 351 HIS A C     1 
ATOM   2160 O  O     . HIS A 1 276 ? 56.270  83.084  30.112 1.00 107.26 ? 351 HIS A O     1 
ATOM   2161 C  CB    . HIS A 1 276 ? 57.460  83.974  32.617 1.00 108.62 ? 351 HIS A CB    1 
ATOM   2162 C  CG    . HIS A 1 276 ? 58.783  84.552  33.015 1.00 115.14 ? 351 HIS A CG    1 
ATOM   2163 N  ND1   . HIS A 1 276 ? 59.732  84.940  32.095 1.00 115.79 ? 351 HIS A ND1   1 
ATOM   2164 C  CD2   . HIS A 1 276 ? 59.321  84.794  34.235 1.00 112.26 ? 351 HIS A CD2   1 
ATOM   2165 C  CE1   . HIS A 1 276 ? 60.794  85.405  32.729 1.00 112.45 ? 351 HIS A CE1   1 
ATOM   2166 N  NE2   . HIS A 1 276 ? 60.570  85.326  34.029 1.00 111.31 ? 351 HIS A NE2   1 
ATOM   2167 N  N     . ILE A 1 277 ? 54.444  84.184  30.823 1.00 96.49  ? 352 ILE A N     1 
ATOM   2168 C  CA    . ILE A 1 277 ? 53.513  83.352  30.070 1.00 87.92  ? 352 ILE A CA    1 
ATOM   2169 C  C     . ILE A 1 277 ? 53.268  83.970  28.704 1.00 85.53  ? 352 ILE A C     1 
ATOM   2170 O  O     . ILE A 1 277 ? 52.876  85.138  28.602 1.00 93.51  ? 352 ILE A O     1 
ATOM   2171 C  CB    . ILE A 1 277 ? 52.188  83.182  30.826 1.00 82.34  ? 352 ILE A CB    1 
ATOM   2172 C  CG1   . ILE A 1 277 ? 52.412  82.463  32.154 1.00 87.83  ? 352 ILE A CG1   1 
ATOM   2173 C  CG2   . ILE A 1 277 ? 51.194  82.413  29.973 1.00 80.32  ? 352 ILE A CG2   1 
ATOM   2174 C  CD1   . ILE A 1 277 ? 51.127  82.018  32.819 1.00 88.37  ? 352 ILE A CD1   1 
ATOM   2175 N  N     . ASN A 1 278 ? 53.469  83.180  27.653 1.00 83.31  ? 353 ASN A N     1 
ATOM   2176 C  CA    . ASN A 1 278 ? 53.107  83.615  26.312 1.00 82.94  ? 353 ASN A CA    1 
ATOM   2177 C  C     . ASN A 1 278 ? 51.606  83.435  26.133 1.00 83.18  ? 353 ASN A C     1 
ATOM   2178 O  O     . ASN A 1 278 ? 51.104  82.307  26.136 1.00 82.53  ? 353 ASN A O     1 
ATOM   2179 C  CB    . ASN A 1 278 ? 53.880  82.814  25.266 1.00 83.84  ? 353 ASN A CB    1 
ATOM   2180 C  CG    . ASN A 1 278 ? 53.679  83.339  23.852 1.00 89.34  ? 353 ASN A CG    1 
ATOM   2181 O  OD1   . ASN A 1 278 ? 52.697  84.020  23.560 1.00 87.71  ? 353 ASN A OD1   1 
ATOM   2182 N  ND2   . ASN A 1 278 ? 54.615  83.014  22.964 1.00 90.45  ? 353 ASN A ND2   1 
ATOM   2183 N  N     . LYS A 1 279 ? 50.896  84.543  25.938 1.00 81.51  ? 354 LYS A N     1 
ATOM   2184 C  CA    . LYS A 1 279 ? 49.457  84.476  25.731 1.00 78.46  ? 354 LYS A CA    1 
ATOM   2185 C  C     . LYS A 1 279 ? 49.118  83.963  24.342 1.00 79.68  ? 354 LYS A C     1 
ATOM   2186 O  O     . LYS A 1 279 ? 48.087  83.304  24.165 1.00 83.68  ? 354 LYS A O     1 
ATOM   2187 C  CB    . LYS A 1 279 ? 48.828  85.853  25.962 1.00 84.63  ? 354 LYS A CB    1 
ATOM   2188 C  CG    . LYS A 1 279 ? 47.325  85.909  25.765 1.00 82.05  ? 354 LYS A CG    1 
ATOM   2189 C  CD    . LYS A 1 279 ? 46.802  87.304  26.057 1.00 81.98  ? 354 LYS A CD    1 
ATOM   2190 C  CE    . LYS A 1 279 ? 45.339  87.446  25.673 1.00 88.67  ? 354 LYS A CE    1 
ATOM   2191 N  NZ    . LYS A 1 279 ? 44.803  88.781  26.062 1.00 85.85  ? 354 LYS A NZ    1 
ATOM   2192 N  N     . SER A 1 280 ? 49.968  84.253  23.356 1.00 83.15  ? 355 SER A N     1 
ATOM   2193 C  CA    . SER A 1 280 ? 49.738  83.741  22.012 1.00 86.48  ? 355 SER A CA    1 
ATOM   2194 C  C     . SER A 1 280 ? 49.591  82.224  22.021 1.00 84.56  ? 355 SER A C     1 
ATOM   2195 O  O     . SER A 1 280 ? 48.726  81.669  21.332 1.00 83.41  ? 355 SER A O     1 
ATOM   2196 C  CB    . SER A 1 280 ? 50.883  84.170  21.093 1.00 89.27  ? 355 SER A CB    1 
ATOM   2197 O  OG    . SER A 1 280 ? 50.784  83.555  19.820 1.00 96.28  ? 355 SER A OG    1 
ATOM   2198 N  N     . ILE A 1 281 ? 50.408  81.541  22.821 1.00 80.45  ? 356 ILE A N     1 
ATOM   2199 C  CA    . ILE A 1 281 ? 50.367  80.083  22.866 1.00 80.81  ? 356 ILE A CA    1 
ATOM   2200 C  C     . ILE A 1 281 ? 49.154  79.599  23.648 1.00 79.28  ? 356 ILE A C     1 
ATOM   2201 O  O     . ILE A 1 281 ? 48.425  78.709  23.195 1.00 78.50  ? 356 ILE A O     1 
ATOM   2202 C  CB    . ILE A 1 281 ? 51.674  79.533  23.459 1.00 83.61  ? 356 ILE A CB    1 
ATOM   2203 C  CG1   . ILE A 1 281 ? 52.871  80.197  22.784 1.00 90.71  ? 356 ILE A CG1   1 
ATOM   2204 C  CG2   . ILE A 1 281 ? 51.747  78.026  23.281 1.00 75.93  ? 356 ILE A CG2   1 
ATOM   2205 C  CD1   . ILE A 1 281 ? 52.859  80.074  21.274 1.00 95.36  ? 356 ILE A CD1   1 
ATOM   2206 N  N     . ILE A 1 282 ? 48.928  80.173  24.834 1.00 75.96  ? 357 ILE A N     1 
ATOM   2207 C  CA    . ILE A 1 282 ? 47.784  79.782  25.653 1.00 72.04  ? 357 ILE A CA    1 
ATOM   2208 C  C     . ILE A 1 282 ? 46.501  79.857  24.840 1.00 77.95  ? 357 ILE A C     1 
ATOM   2209 O  O     . ILE A 1 282 ? 45.636  78.977  24.927 1.00 79.53  ? 357 ILE A O     1 
ATOM   2210 C  CB    . ILE A 1 282 ? 47.702  80.669  26.907 1.00 71.63  ? 357 ILE A CB    1 
ATOM   2211 C  CG1   . ILE A 1 282 ? 48.985  80.564  27.731 1.00 71.26  ? 357 ILE A CG1   1 
ATOM   2212 C  CG2   . ILE A 1 282 ? 46.486  80.297  27.740 1.00 68.68  ? 357 ILE A CG2   1 
ATOM   2213 C  CD1   . ILE A 1 282 ? 49.013  79.408  28.690 1.00 69.43  ? 357 ILE A CD1   1 
ATOM   2214 N  N     . GLN A 1 283 ? 46.368  80.902  24.022 1.00 79.29  ? 358 GLN A N     1 
ATOM   2215 C  CA    . GLN A 1 283 ? 45.211  81.010  23.141 1.00 82.43  ? 358 GLN A CA    1 
ATOM   2216 C  C     . GLN A 1 283 ? 45.148  79.837  22.175 1.00 82.82  ? 358 GLN A C     1 
ATOM   2217 O  O     . GLN A 1 283 ? 44.109  79.181  22.044 1.00 82.96  ? 358 GLN A O     1 
ATOM   2218 C  CB    . GLN A 1 283 ? 45.255  82.329  22.368 1.00 84.46  ? 358 GLN A CB    1 
ATOM   2219 C  CG    . GLN A 1 283 ? 44.304  83.404  22.873 1.00 87.69  ? 358 GLN A CG    1 
ATOM   2220 C  CD    . GLN A 1 283 ? 42.837  83.092  22.606 1.00 88.59  ? 358 GLN A CD    1 
ATOM   2221 O  OE1   . GLN A 1 283 ? 41.951  83.781  23.110 1.00 95.73  ? 358 GLN A OE1   1 
ATOM   2222 N  NE2   . GLN A 1 283 ? 42.574  82.063  21.805 1.00 84.16  ? 358 GLN A NE2   1 
ATOM   2223 N  N     . THR A 1 284 ? 46.257  79.560  21.486 1.00 77.59  ? 359 THR A N     1 
ATOM   2224 C  CA    . THR A 1 284 ? 46.239  78.532  20.453 1.00 78.12  ? 359 THR A CA    1 
ATOM   2225 C  C     . THR A 1 284 ? 45.910  77.167  21.035 1.00 80.60  ? 359 THR A C     1 
ATOM   2226 O  O     . THR A 1 284 ? 45.307  76.328  20.355 1.00 79.60  ? 359 THR A O     1 
ATOM   2227 C  CB    . THR A 1 284 ? 47.581  78.503  19.730 1.00 79.18  ? 359 THR A CB    1 
ATOM   2228 O  OG1   . THR A 1 284 ? 47.951  79.841  19.377 1.00 79.65  ? 359 THR A OG1   1 
ATOM   2229 C  CG2   . THR A 1 284 ? 47.489  77.662  18.464 1.00 85.57  ? 359 THR A CG2   1 
ATOM   2230 N  N     . MET A 1 285 ? 46.265  76.939  22.299 1.00 79.39  ? 360 MET A N     1 
ATOM   2231 C  CA    . MET A 1 285 ? 45.954  75.663  22.928 1.00 81.72  ? 360 MET A CA    1 
ATOM   2232 C  C     . MET A 1 285 ? 44.455  75.503  23.146 1.00 81.54  ? 360 MET A C     1 
ATOM   2233 O  O     . MET A 1 285 ? 43.871  74.484  22.761 1.00 82.98  ? 360 MET A O     1 
ATOM   2234 C  CB    . MET A 1 285 ? 46.711  75.534  24.247 1.00 81.92  ? 360 MET A CB    1 
ATOM   2235 C  CG    . MET A 1 285 ? 48.218  75.513  24.087 1.00 77.08  ? 360 MET A CG    1 
ATOM   2236 S  SD    . MET A 1 285 ? 49.034  75.279  25.671 1.00 85.23  ? 360 MET A SD    1 
ATOM   2237 C  CE    . MET A 1 285 ? 49.346  73.520  25.632 1.00 79.97  ? 360 MET A CE    1 
ATOM   2238 N  N     . VAL A 1 286 ? 43.811  76.505  23.754 1.00 82.87  ? 361 VAL A N     1 
ATOM   2239 C  CA    . VAL A 1 286 ? 42.392  76.374  24.083 1.00 83.76  ? 361 VAL A CA    1 
ATOM   2240 C  C     . VAL A 1 286 ? 41.544  76.297  22.818 1.00 79.73  ? 361 VAL A C     1 
ATOM   2241 O  O     . VAL A 1 286 ? 40.500  75.636  22.805 1.00 86.16  ? 361 VAL A O     1 
ATOM   2242 C  CB    . VAL A 1 286 ? 41.933  77.518  25.012 1.00 84.30  ? 361 VAL A CB    1 
ATOM   2243 C  CG1   . VAL A 1 286 ? 42.872  77.647  26.208 1.00 81.83  ? 361 VAL A CG1   1 
ATOM   2244 C  CG2   . VAL A 1 286 ? 41.835  78.833  24.258 1.00 86.82  ? 361 VAL A CG2   1 
ATOM   2245 N  N     . ASN A 1 287 ? 41.974  76.946  21.733 1.00 81.11  ? 362 ASN A N     1 
ATOM   2246 C  CA    . ASN A 1 287 ? 41.249  76.808  20.476 1.00 81.64  ? 362 ASN A CA    1 
ATOM   2247 C  C     . ASN A 1 287 ? 41.327  75.377  19.961 1.00 86.38  ? 362 ASN A C     1 
ATOM   2248 O  O     . ASN A 1 287 ? 40.318  74.805  19.531 1.00 86.90  ? 362 ASN A O     1 
ATOM   2249 C  CB    . ASN A 1 287 ? 41.794  77.783  19.433 1.00 82.18  ? 362 ASN A CB    1 
ATOM   2250 C  CG    . ASN A 1 287 ? 41.471  79.223  19.753 1.00 79.03  ? 362 ASN A CG    1 
ATOM   2251 O  OD1   . ASN A 1 287 ? 42.362  80.021  20.033 1.00 80.42  ? 362 ASN A OD1   1 
ATOM   2252 N  ND2   . ASN A 1 287 ? 40.192  79.567  19.701 1.00 85.80  ? 362 ASN A ND2   1 
ATOM   2253 N  N     . ILE A 1 288 ? 42.519  74.776  20.008 1.00 88.09  ? 363 ILE A N     1 
ATOM   2254 C  CA    . ILE A 1 288 ? 42.666  73.403  19.541 1.00 87.92  ? 363 ILE A CA    1 
ATOM   2255 C  C     . ILE A 1 288 ? 42.028  72.426  20.522 1.00 85.16  ? 363 ILE A C     1 
ATOM   2256 O  O     . ILE A 1 288 ? 41.545  71.360  20.121 1.00 85.93  ? 363 ILE A O     1 
ATOM   2257 C  CB    . ILE A 1 288 ? 44.152  73.084  19.298 1.00 84.35  ? 363 ILE A CB    1 
ATOM   2258 C  CG1   . ILE A 1 288 ? 44.733  74.033  18.250 1.00 82.94  ? 363 ILE A CG1   1 
ATOM   2259 C  CG2   . ILE A 1 288 ? 44.322  71.646  18.844 1.00 91.98  ? 363 ILE A CG2   1 
ATOM   2260 C  CD1   . ILE A 1 288 ? 44.035  73.965  16.907 1.00 83.32  ? 363 ILE A CD1   1 
ATOM   2261 N  N     . LEU A 1 289 ? 42.005  72.763  21.810 1.00 83.89  ? 364 LEU A N     1 
ATOM   2262 C  CA    . LEU A 1 289 ? 41.406  71.899  22.818 1.00 81.16  ? 364 LEU A CA    1 
ATOM   2263 C  C     . LEU A 1 289 ? 39.907  72.106  22.979 1.00 86.17  ? 364 LEU A C     1 
ATOM   2264 O  O     . LEU A 1 289 ? 39.248  71.265  23.601 1.00 89.29  ? 364 LEU A O     1 
ATOM   2265 C  CB    . LEU A 1 289 ? 42.089  72.106  24.170 1.00 82.73  ? 364 LEU A CB    1 
ATOM   2266 C  CG    . LEU A 1 289 ? 43.503  71.542  24.266 1.00 78.91  ? 364 LEU A CG    1 
ATOM   2267 C  CD1   . LEU A 1 289 ? 44.042  71.698  25.678 1.00 75.63  ? 364 LEU A CD1   1 
ATOM   2268 C  CD2   . LEU A 1 289 ? 43.499  70.085  23.838 1.00 76.99  ? 364 LEU A CD2   1 
ATOM   2269 N  N     . ASP A 1 290 ? 39.355  73.200  22.449 1.00 89.19  ? 365 ASP A N     1 
ATOM   2270 C  CA    . ASP A 1 290 ? 37.907  73.372  22.479 1.00 88.08  ? 365 ASP A CA    1 
ATOM   2271 C  C     . ASP A 1 290 ? 37.212  72.356  21.585 1.00 90.46  ? 365 ASP A C     1 
ATOM   2272 O  O     . ASP A 1 290 ? 36.104  71.908  21.900 1.00 91.08  ? 365 ASP A O     1 
ATOM   2273 C  CB    . ASP A 1 290 ? 37.529  74.794  22.066 1.00 82.61  ? 365 ASP A CB    1 
ATOM   2274 C  CG    . ASP A 1 290 ? 36.040  74.961  21.849 1.00 96.90  ? 365 ASP A CG    1 
ATOM   2275 O  OD1   . ASP A 1 290 ? 35.299  75.078  22.848 1.00 104.31 ? 365 ASP A OD1   1 
ATOM   2276 O  OD2   . ASP A 1 290 ? 35.608  74.976  20.676 1.00 104.75 ? 365 ASP A OD2   1 
ATOM   2277 N  N     . GLY A 1 291 ? 37.846  71.978  20.475 1.00 94.06  ? 366 GLY A N     1 
ATOM   2278 C  CA    . GLY A 1 291 ? 37.283  70.932  19.639 1.00 93.46  ? 366 GLY A CA    1 
ATOM   2279 C  C     . GLY A 1 291 ? 37.196  69.601  20.360 1.00 90.77  ? 366 GLY A C     1 
ATOM   2280 O  O     . GLY A 1 291 ? 36.245  68.839  20.165 1.00 93.25  ? 366 GLY A O     1 
ATOM   2281 N  N     . PHE A 1 292 ? 38.188  69.301  21.203 1.00 84.12  ? 367 PHE A N     1 
ATOM   2282 C  CA    . PHE A 1 292 ? 38.138  68.071  21.985 1.00 84.71  ? 367 PHE A CA    1 
ATOM   2283 C  C     . PHE A 1 292 ? 36.982  68.098  22.974 1.00 91.03  ? 367 PHE A C     1 
ATOM   2284 O  O     . PHE A 1 292 ? 36.304  67.082  23.179 1.00 87.44  ? 367 PHE A O     1 
ATOM   2285 C  CB    . PHE A 1 292 ? 39.461  67.854  22.717 1.00 79.28  ? 367 PHE A CB    1 
ATOM   2286 C  CG    . PHE A 1 292 ? 40.570  67.394  21.825 1.00 82.08  ? 367 PHE A CG    1 
ATOM   2287 C  CD1   . PHE A 1 292 ? 40.733  66.049  21.544 1.00 79.75  ? 367 PHE A CD1   1 
ATOM   2288 C  CD2   . PHE A 1 292 ? 41.447  68.304  21.260 1.00 84.45  ? 367 PHE A CD2   1 
ATOM   2289 C  CE1   . PHE A 1 292 ? 41.749  65.620  20.718 1.00 77.89  ? 367 PHE A CE1   1 
ATOM   2290 C  CE2   . PHE A 1 292 ? 42.466  67.881  20.434 1.00 81.59  ? 367 PHE A CE2   1 
ATOM   2291 C  CZ    . PHE A 1 292 ? 42.618  66.536  20.163 1.00 80.21  ? 367 PHE A CZ    1 
ATOM   2292 N  N     . GLU A 1 293 ? 36.734  69.257  23.589 1.00 86.91  ? 368 GLU A N     1 
ATOM   2293 C  CA    . GLU A 1 293 ? 35.681  69.352  24.592 1.00 79.48  ? 368 GLU A CA    1 
ATOM   2294 C  C     . GLU A 1 293 ? 34.322  69.007  24.001 1.00 83.44  ? 368 GLU A C     1 
ATOM   2295 O  O     . GLU A 1 293 ? 33.477  68.410  24.678 1.00 89.28  ? 368 GLU A O     1 
ATOM   2296 C  CB    . GLU A 1 293 ? 35.665  70.752  25.196 1.00 83.09  ? 368 GLU A CB    1 
ATOM   2297 C  CG    . GLU A 1 293 ? 34.730  70.909  26.375 1.00 82.26  ? 368 GLU A CG    1 
ATOM   2298 C  CD    . GLU A 1 293 ? 35.307  70.351  27.659 1.00 84.95  ? 368 GLU A CD    1 
ATOM   2299 O  OE1   . GLU A 1 293 ? 36.294  69.588  27.596 1.00 84.25  ? 368 GLU A OE1   1 
ATOM   2300 O  OE2   . GLU A 1 293 ? 34.776  70.688  28.738 1.00 88.58  ? 368 GLU A OE2   1 
ATOM   2301 N  N     . ARG A 1 294 ? 34.089  69.375  22.741 1.00 84.84  ? 369 ARG A N     1 
ATOM   2302 C  CA    . ARG A 1 294 ? 32.842  68.979  22.096 1.00 88.65  ? 369 ARG A CA    1 
ATOM   2303 C  C     . ARG A 1 294 ? 32.812  67.477  21.855 1.00 86.07  ? 369 ARG A C     1 
ATOM   2304 O  O     . ARG A 1 294 ? 31.762  66.842  22.001 1.00 84.83  ? 369 ARG A O     1 
ATOM   2305 C  CB    . ARG A 1 294 ? 32.652  69.748  20.786 1.00 93.98  ? 369 ARG A CB    1 
ATOM   2306 C  CG    . ARG A 1 294 ? 32.350  71.232  20.982 1.00 95.84  ? 369 ARG A CG    1 
ATOM   2307 C  CD    . ARG A 1 294 ? 32.122  71.952  19.660 1.00 98.28  ? 369 ARG A CD    1 
ATOM   2308 N  NE    . ARG A 1 294 ? 31.939  73.388  19.853 1.00 101.69 ? 369 ARG A NE    1 
ATOM   2309 C  CZ    . ARG A 1 294 ? 31.817  74.269  18.864 1.00 102.85 ? 369 ARG A CZ    1 
ATOM   2310 N  NH1   . ARG A 1 294 ? 31.857  73.865  17.602 1.00 97.35  ? 369 ARG A NH1   1 
ATOM   2311 N  NH2   . ARG A 1 294 ? 31.658  75.557  19.138 1.00 105.57 ? 369 ARG A NH2   1 
ATOM   2312 N  N     . ILE A 1 295 ? 33.959  66.891  21.507 1.00 83.84  ? 370 ILE A N     1 
ATOM   2313 C  CA    . ILE A 1 295 ? 34.029  65.446  21.321 1.00 83.53  ? 370 ILE A CA    1 
ATOM   2314 C  C     . ILE A 1 295 ? 33.869  64.732  22.656 1.00 81.82  ? 370 ILE A C     1 
ATOM   2315 O  O     . ILE A 1 295 ? 33.213  63.687  22.742 1.00 81.29  ? 370 ILE A O     1 
ATOM   2316 C  CB    . ILE A 1 295 ? 35.346  65.060  20.624 1.00 81.32  ? 370 ILE A CB    1 
ATOM   2317 C  CG1   . ILE A 1 295 ? 35.428  65.717  19.248 1.00 87.31  ? 370 ILE A CG1   1 
ATOM   2318 C  CG2   . ILE A 1 295 ? 35.461  63.553  20.494 1.00 75.97  ? 370 ILE A CG2   1 
ATOM   2319 C  CD1   . ILE A 1 295 ? 36.617  65.277  18.437 1.00 83.05  ? 370 ILE A CD1   1 
ATOM   2320 N  N     . PHE A 1 296 ? 34.459  65.286  23.718 1.00 82.28  ? 371 PHE A N     1 
ATOM   2321 C  CA    . PHE A 1 296 ? 34.338  64.674  25.038 1.00 82.47  ? 371 PHE A CA    1 
ATOM   2322 C  C     . PHE A 1 296 ? 32.882  64.601  25.482 1.00 83.38  ? 371 PHE A C     1 
ATOM   2323 O  O     . PHE A 1 296 ? 32.445  63.587  26.039 1.00 80.37  ? 371 PHE A O     1 
ATOM   2324 C  CB    . PHE A 1 296 ? 35.180  65.451  26.054 1.00 80.38  ? 371 PHE A CB    1 
ATOM   2325 C  CG    . PHE A 1 296 ? 36.285  64.637  26.684 1.00 80.55  ? 371 PHE A CG    1 
ATOM   2326 C  CD1   . PHE A 1 296 ? 37.510  65.211  26.967 1.00 78.31  ? 371 PHE A CD1   1 
ATOM   2327 C  CD2   . PHE A 1 296 ? 36.095  63.301  27.002 1.00 83.34  ? 371 PHE A CD2   1 
ATOM   2328 C  CE1   . PHE A 1 296 ? 38.524  64.468  27.548 1.00 76.79  ? 371 PHE A CE1   1 
ATOM   2329 C  CE2   . PHE A 1 296 ? 37.110  62.554  27.585 1.00 72.91  ? 371 PHE A CE2   1 
ATOM   2330 C  CZ    . PHE A 1 296 ? 38.322  63.139  27.855 1.00 70.09  ? 371 PHE A CZ    1 
ATOM   2331 N  N     . LYS A 1 297 ? 32.112  65.666  25.241 1.00 86.96  ? 372 LYS A N     1 
ATOM   2332 C  CA    . LYS A 1 297 ? 30.683  65.621  25.534 1.00 86.78  ? 372 LYS A CA    1 
ATOM   2333 C  C     . LYS A 1 297 ? 29.948  64.745  24.528 1.00 86.38  ? 372 LYS A C     1 
ATOM   2334 O  O     . LYS A 1 297 ? 29.010  64.023  24.886 1.00 82.15  ? 372 LYS A O     1 
ATOM   2335 C  CB    . LYS A 1 297 ? 30.107  67.034  25.534 1.00 82.82  ? 372 LYS A CB    1 
ATOM   2336 C  CG    . LYS A 1 297 ? 30.691  67.936  26.600 1.00 78.55  ? 372 LYS A CG    1 
ATOM   2337 C  CD    . LYS A 1 297 ? 30.393  67.401  27.986 1.00 77.40  ? 372 LYS A CD    1 
ATOM   2338 C  CE    . LYS A 1 297 ? 30.951  68.324  29.049 1.00 83.87  ? 372 LYS A CE    1 
ATOM   2339 N  NZ    . LYS A 1 297 ? 30.797  67.736  30.403 1.00 89.05  ? 372 LYS A NZ    1 
ATOM   2340 N  N     . GLU A 1 298 ? 30.378  64.795  23.266 1.00 85.69  ? 373 GLU A N     1 
ATOM   2341 C  CA    . GLU A 1 298 ? 29.752  64.016  22.204 1.00 84.80  ? 373 GLU A CA    1 
ATOM   2342 C  C     . GLU A 1 298 ? 29.709  62.530  22.541 1.00 87.88  ? 373 GLU A C     1 
ATOM   2343 O  O     . GLU A 1 298 ? 28.723  61.847  22.244 1.00 91.44  ? 373 GLU A O     1 
ATOM   2344 C  CB    . GLU A 1 298 ? 30.520  64.251  20.904 1.00 88.17  ? 373 GLU A CB    1 
ATOM   2345 C  CG    . GLU A 1 298 ? 29.887  63.717  19.645 1.00 92.65  ? 373 GLU A CG    1 
ATOM   2346 C  CD    . GLU A 1 298 ? 30.770  63.968  18.440 1.00 92.66  ? 373 GLU A CD    1 
ATOM   2347 O  OE1   . GLU A 1 298 ? 31.290  62.989  17.864 1.00 88.29  ? 373 GLU A OE1   1 
ATOM   2348 O  OE2   . GLU A 1 298 ? 30.970  65.151  18.088 1.00 96.15  ? 373 GLU A OE2   1 
ATOM   2349 N  N     . LEU A 1 299 ? 30.768  62.013  23.163 1.00 87.02  ? 374 LEU A N     1 
ATOM   2350 C  CA    . LEU A 1 299 ? 30.906  60.587  23.427 1.00 83.02  ? 374 LEU A CA    1 
ATOM   2351 C  C     . LEU A 1 299 ? 30.437  60.177  24.812 1.00 82.90  ? 374 LEU A C     1 
ATOM   2352 O  O     . LEU A 1 299 ? 30.529  58.996  25.154 1.00 89.06  ? 374 LEU A O     1 
ATOM   2353 C  CB    . LEU A 1 299 ? 32.361  60.154  23.235 1.00 85.02  ? 374 LEU A CB    1 
ATOM   2354 C  CG    . LEU A 1 299 ? 32.833  60.222  21.785 1.00 88.34  ? 374 LEU A CG    1 
ATOM   2355 C  CD1   . LEU A 1 299 ? 34.204  59.598  21.646 1.00 80.36  ? 374 LEU A CD1   1 
ATOM   2356 C  CD2   . LEU A 1 299 ? 31.824  59.540  20.869 1.00 94.93  ? 374 LEU A CD2   1 
ATOM   2357 N  N     . GLN A 1 300 ? 29.947  61.109  25.618 1.00 82.64  ? 375 GLN A N     1 
ATOM   2358 C  CA    . GLN A 1 300 ? 29.360  60.766  26.905 1.00 85.96  ? 375 GLN A CA    1 
ATOM   2359 C  C     . GLN A 1 300 ? 27.859  60.518  26.823 1.00 97.02  ? 375 GLN A C     1 
ATOM   2360 O  O     . GLN A 1 300 ? 27.226  60.294  27.860 1.00 94.98  ? 375 GLN A O     1 
ATOM   2361 C  CB    . GLN A 1 300 ? 29.635  61.872  27.924 1.00 83.20  ? 375 GLN A CB    1 
ATOM   2362 C  CG    . GLN A 1 300 ? 31.061  61.918  28.428 1.00 84.26  ? 375 GLN A CG    1 
ATOM   2363 C  CD    . GLN A 1 300 ? 31.264  63.003  29.467 1.00 83.77  ? 375 GLN A CD    1 
ATOM   2364 O  OE1   . GLN A 1 300 ? 31.891  62.780  30.501 1.00 75.61  ? 375 GLN A OE1   1 
ATOM   2365 N  NE2   . GLN A 1 300 ? 30.726  64.187  29.196 1.00 92.36  ? 375 GLN A NE2   1 
ATOM   2366 N  N     . THR A 1 301 ? 27.276  60.552  25.627 1.00 100.32 ? 376 THR A N     1 
ATOM   2367 C  CA    . THR A 1 301 ? 25.825  60.534  25.489 1.00 98.90  ? 376 THR A CA    1 
ATOM   2368 C  C     . THR A 1 301 ? 25.296  59.109  25.605 1.00 105.09 ? 376 THR A C     1 
ATOM   2369 O  O     . THR A 1 301 ? 25.627  58.245  24.784 1.00 101.63 ? 376 THR A O     1 
ATOM   2370 C  CB    . THR A 1 301 ? 25.417  61.144  24.149 1.00 99.75  ? 376 THR A CB    1 
ATOM   2371 O  OG1   . THR A 1 301 ? 26.047  62.421  23.994 1.00 100.82 ? 376 THR A OG1   1 
ATOM   2372 C  CG2   . THR A 1 301 ? 23.908  61.325  24.083 1.00 100.79 ? 376 THR A CG2   1 
ATOM   2373 N  N     . CYS A 1 302 ? 24.494  58.863  26.642 1.00 106.14 ? 377 CYS A N     1 
ATOM   2374 C  CA    . CYS A 1 302 ? 23.662  57.673  26.752 1.00 101.68 ? 377 CYS A CA    1 
ATOM   2375 C  C     . CYS A 1 302 ? 22.195  57.927  26.417 1.00 109.82 ? 377 CYS A C     1 
ATOM   2376 O  O     . CYS A 1 302 ? 21.400  56.982  26.435 1.00 118.68 ? 377 CYS A O     1 
ATOM   2377 C  CB    . CYS A 1 302 ? 23.782  57.084  28.157 1.00 97.21  ? 377 CYS A CB    1 
ATOM   2378 S  SG    . CYS A 1 302 ? 25.491  56.744  28.623 1.00 117.92 ? 377 CYS A SG    1 
ATOM   2379 N  N     . SER A 1 303 ? 21.816  59.173  26.125 1.00 104.23 ? 378 SER A N     1 
ATOM   2380 C  CA    . SER A 1 303 ? 20.451  59.520  25.747 1.00 110.12 ? 378 SER A CA    1 
ATOM   2381 C  C     . SER A 1 303 ? 20.240  59.496  24.236 1.00 107.79 ? 378 SER A C     1 
ATOM   2382 O  O     . SER A 1 303 ? 19.187  59.936  23.761 1.00 102.22 ? 378 SER A O     1 
ATOM   2383 C  CB    . SER A 1 303 ? 20.063  60.892  26.311 1.00 106.11 ? 378 SER A CB    1 
ATOM   2384 O  OG    . SER A 1 303 ? 20.736  61.946  25.651 1.00 109.20 ? 378 SER A OG    1 
ATOM   2385 N  N     . SER A 1 304 ? 21.224  59.000  23.478 1.00 103.29 ? 379 SER A N     1 
ATOM   2386 C  CA    . SER A 1 304 ? 21.273  59.026  22.022 1.00 100.05 ? 379 SER A CA    1 
ATOM   2387 C  C     . SER A 1 304 ? 22.492  58.231  21.571 1.00 101.36 ? 379 SER A C     1 
ATOM   2388 O  O     . SER A 1 304 ? 23.442  58.070  22.352 1.00 104.59 ? 379 SER A O     1 
ATOM   2389 C  CB    . SER A 1 304 ? 21.345  60.469  21.511 1.00 100.36 ? 379 SER A CB    1 
ATOM   2390 O  OG    . SER A 1 304 ? 21.983  60.544  20.241 1.00 104.98 ? 379 SER A OG    1 
ATOM   2391 N  N     . PRO A 1 305 ? 22.495  57.690  20.351 1.00 97.65  ? 380 PRO A N     1 
ATOM   2392 C  CA    . PRO A 1 305 ? 23.634  56.872  19.919 1.00 102.52 ? 380 PRO A CA    1 
ATOM   2393 C  C     . PRO A 1 305 ? 24.948  57.638  19.977 1.00 103.61 ? 380 PRO A C     1 
ATOM   2394 O  O     . PRO A 1 305 ? 25.028  58.813  19.612 1.00 103.03 ? 380 PRO A O     1 
ATOM   2395 C  CB    . PRO A 1 305 ? 23.265  56.486  18.483 1.00 101.86 ? 380 PRO A CB    1 
ATOM   2396 C  CG    . PRO A 1 305 ? 21.797  56.454  18.493 1.00 99.29  ? 380 PRO A CG    1 
ATOM   2397 C  CD    . PRO A 1 305 ? 21.376  57.595  19.397 1.00 102.92 ? 380 PRO A CD    1 
ATOM   2398 N  N     . SER A 1 306 ? 25.983  56.944  20.448 1.00 99.77  ? 381 SER A N     1 
ATOM   2399 C  CA    . SER A 1 306 ? 27.313  57.504  20.650 1.00 95.47  ? 381 SER A CA    1 
ATOM   2400 C  C     . SER A 1 306 ? 28.340  56.664  19.900 1.00 90.78  ? 381 SER A C     1 
ATOM   2401 O  O     . SER A 1 306 ? 29.096  57.192  19.080 1.00 93.70  ? 381 SER A O     1 
ATOM   2402 C  CB    . SER A 1 306 ? 27.651  57.599  22.137 1.00 97.08  ? 381 SER A CB    1 
ATOM   2403 O  OG    . SER A 1 306 ? 27.321  56.406  22.816 1.00 99.25  ? 381 SER A OG    1 
ATOM   2404 N  N     . LEU A 1 307 ? 28.380  55.359  20.197 1.00 90.28  ? 382 LEU A N     1 
ATOM   2405 C  CA    . LEU A 1 307 ? 29.362  54.443  19.616 1.00 93.94  ? 382 LEU A CA    1 
ATOM   2406 C  C     . LEU A 1 307 ? 29.528  54.628  18.114 1.00 99.14  ? 382 LEU A C     1 
ATOM   2407 O  O     . LEU A 1 307 ? 30.631  54.444  17.582 1.00 99.70  ? 382 LEU A O     1 
ATOM   2408 C  CB    . LEU A 1 307 ? 28.950  52.998  19.917 1.00 91.99  ? 382 LEU A CB    1 
ATOM   2409 C  CG    . LEU A 1 307 ? 29.722  51.887  19.207 1.00 91.95  ? 382 LEU A CG    1 
ATOM   2410 C  CD1   . LEU A 1 307 ? 31.107  51.749  19.800 1.00 100.03 ? 382 LEU A CD1   1 
ATOM   2411 C  CD2   . LEU A 1 307 ? 28.978  50.566  19.266 1.00 94.38  ? 382 LEU A CD2   1 
ATOM   2412 N  N     . CYS A 1 308 ? 28.454  54.997  17.414 1.00 96.42  ? 383 CYS A N     1 
ATOM   2413 C  CA    . CYS A 1 308 ? 28.565  55.300  15.993 1.00 97.87  ? 383 CYS A CA    1 
ATOM   2414 C  C     . CYS A 1 308 ? 29.462  56.502  15.716 1.00 95.09  ? 383 CYS A C     1 
ATOM   2415 O  O     . CYS A 1 308 ? 29.964  56.638  14.594 1.00 95.70  ? 383 CYS A O     1 
ATOM   2416 C  CB    . CYS A 1 308 ? 27.175  55.543  15.404 1.00 105.33 ? 383 CYS A CB    1 
ATOM   2417 S  SG    . CYS A 1 308 ? 26.195  56.788  16.285 1.00 106.03 ? 383 CYS A SG    1 
ATOM   2418 N  N     . PHE A 1 309 ? 29.682  57.369  16.702 1.00 91.07  ? 384 PHE A N     1 
ATOM   2419 C  CA    . PHE A 1 309 ? 30.444  58.597  16.502 1.00 96.54  ? 384 PHE A CA    1 
ATOM   2420 C  C     . PHE A 1 309 ? 31.927  58.459  16.836 1.00 100.07 ? 384 PHE A C     1 
ATOM   2421 O  O     . PHE A 1 309 ? 32.658  59.453  16.748 1.00 94.62  ? 384 PHE A O     1 
ATOM   2422 C  CB    . PHE A 1 309 ? 29.842  59.734  17.336 1.00 97.11  ? 384 PHE A CB    1 
ATOM   2423 C  CG    . PHE A 1 309 ? 28.556  60.284  16.784 1.00 98.64  ? 384 PHE A CG    1 
ATOM   2424 C  CD1   . PHE A 1 309 ? 27.814  61.206  17.508 1.00 100.89 ? 384 PHE A CD1   1 
ATOM   2425 C  CD2   . PHE A 1 309 ? 28.089  59.885  15.541 1.00 100.06 ? 384 PHE A CD2   1 
ATOM   2426 C  CE1   . PHE A 1 309 ? 26.632  61.721  17.004 1.00 98.69  ? 384 PHE A CE1   1 
ATOM   2427 C  CE2   . PHE A 1 309 ? 26.904  60.394  15.032 1.00 103.38 ? 384 PHE A CE2   1 
ATOM   2428 C  CZ    . PHE A 1 309 ? 26.176  61.313  15.765 1.00 99.03  ? 384 PHE A CZ    1 
ATOM   2429 N  N     . VAL A 1 310 ? 32.389  57.270  17.226 1.00 99.39  ? 385 VAL A N     1 
ATOM   2430 C  CA    . VAL A 1 310 ? 33.798  57.056  17.548 1.00 91.15  ? 385 VAL A CA    1 
ATOM   2431 C  C     . VAL A 1 310 ? 34.672  57.371  16.340 1.00 88.36  ? 385 VAL A C     1 
ATOM   2432 O  O     . VAL A 1 310 ? 35.459  58.322  16.366 1.00 90.71  ? 385 VAL A O     1 
ATOM   2433 C  CB    . VAL A 1 310 ? 34.050  55.622  18.046 1.00 93.42  ? 385 VAL A CB    1 
ATOM   2434 C  CG1   . VAL A 1 310 ? 35.544  55.373  18.210 1.00 87.31  ? 385 VAL A CG1   1 
ATOM   2435 C  CG2   . VAL A 1 310 ? 33.323  55.390  19.358 1.00 96.10  ? 385 VAL A CG2   1 
ATOM   2436 N  N     . VAL A 1 311 ? 34.537  56.564  15.281 1.00 84.26  ? 386 VAL A N     1 
ATOM   2437 C  CA    . VAL A 1 311 ? 35.348  56.787  14.069 1.00 80.57  ? 386 VAL A CA    1 
ATOM   2438 C  C     . VAL A 1 311 ? 35.181  58.159  13.500 1.00 85.91  ? 386 VAL A C     1 
ATOM   2439 O  O     . VAL A 1 311 ? 36.171  58.741  13.005 1.00 90.94  ? 386 VAL A O     1 
ATOM   2440 C  CB    . VAL A 1 311 ? 35.067  55.672  13.052 1.00 80.34  ? 386 VAL A CB    1 
ATOM   2441 C  CG1   . VAL A 1 311 ? 35.655  56.023  11.690 1.00 77.99  ? 386 VAL A CG1   1 
ATOM   2442 C  CG2   . VAL A 1 311 ? 35.622  54.343  13.541 1.00 82.78  ? 386 VAL A CG2   1 
ATOM   2443 N  N     . PRO A 1 312 ? 33.995  58.796  13.471 1.00 91.82  ? 387 PRO A N     1 
ATOM   2444 C  CA    . PRO A 1 312 ? 33.914  60.177  12.977 1.00 91.38  ? 387 PRO A CA    1 
ATOM   2445 C  C     . PRO A 1 312 ? 34.824  61.152  13.714 1.00 88.63  ? 387 PRO A C     1 
ATOM   2446 O  O     . PRO A 1 312 ? 35.515  61.960  13.078 1.00 84.83  ? 387 PRO A O     1 
ATOM   2447 C  CB    . PRO A 1 312 ? 32.434  60.525  13.165 1.00 99.88  ? 387 PRO A CB    1 
ATOM   2448 C  CG    . PRO A 1 312 ? 31.729  59.217  13.025 1.00 128.79 ? 387 PRO A CG    1 
ATOM   2449 C  CD    . PRO A 1 312 ? 32.652  58.173  13.580 1.00 99.48  ? 387 PRO A CD    1 
ATOM   2450 N  N     . SER A 1 313 ? 34.847  61.090  15.047 1.00 88.90  ? 388 SER A N     1 
ATOM   2451 C  CA    . SER A 1 313 ? 35.579  62.085  15.824 1.00 89.10  ? 388 SER A CA    1 
ATOM   2452 C  C     . SER A 1 313 ? 37.085  61.956  15.639 1.00 96.27  ? 388 SER A C     1 
ATOM   2453 O  O     . SER A 1 313 ? 37.795  62.970  15.647 1.00 101.42 ? 388 SER A O     1 
ATOM   2454 C  CB    . SER A 1 313 ? 35.208  61.967  17.303 1.00 89.12  ? 388 SER A CB    1 
ATOM   2455 O  OG    . SER A 1 313 ? 33.808  62.084  17.490 1.00 96.73  ? 388 SER A OG    1 
ATOM   2456 N  N     . ILE A 1 314 ? 37.589  60.728  15.476 1.00 89.72  ? 389 ILE A N     1 
ATOM   2457 C  CA    . ILE A 1 314 ? 39.019  60.530  15.250 1.00 84.95  ? 389 ILE A CA    1 
ATOM   2458 C  C     . ILE A 1 314 ? 39.478  61.359  14.059 1.00 86.65  ? 389 ILE A C     1 
ATOM   2459 O  O     . ILE A 1 314 ? 40.439  62.132  14.145 1.00 79.67  ? 389 ILE A O     1 
ATOM   2460 C  CB    . ILE A 1 314 ? 39.331  59.036  15.057 1.00 82.53  ? 389 ILE A CB    1 
ATOM   2461 C  CG1   . ILE A 1 314 ? 39.240  58.300  16.395 1.00 84.18  ? 389 ILE A CG1   1 
ATOM   2462 C  CG2   . ILE A 1 314 ? 40.698  58.852  14.409 1.00 80.05  ? 389 ILE A CG2   1 
ATOM   2463 C  CD1   . ILE A 1 314 ? 39.482  56.812  16.297 1.00 79.23  ? 389 ILE A CD1   1 
ATOM   2464 N  N     . LEU A 1 315 ? 38.765  61.234  12.936 1.00 92.74  ? 390 LEU A N     1 
ATOM   2465 C  CA    . LEU A 1 315 ? 39.024  62.079  11.775 1.00 92.54  ? 390 LEU A CA    1 
ATOM   2466 C  C     . LEU A 1 315 ? 39.031  63.551  12.167 1.00 94.81  ? 390 LEU A C     1 
ATOM   2467 O  O     . LEU A 1 315 ? 39.974  64.286  11.851 1.00 93.39  ? 390 LEU A O     1 
ATOM   2468 C  CB    . LEU A 1 315 ? 37.968  61.812  10.700 1.00 90.24  ? 390 LEU A CB    1 
ATOM   2469 C  CG    . LEU A 1 315 ? 37.572  60.344  10.505 1.00 91.35  ? 390 LEU A CG    1 
ATOM   2470 C  CD1   . LEU A 1 315 ? 36.352  60.202  9.603  1.00 91.28  ? 390 LEU A CD1   1 
ATOM   2471 C  CD2   . LEU A 1 315 ? 38.741  59.545  9.953  1.00 98.81  ? 390 LEU A CD2   1 
ATOM   2472 N  N     . LYS A 1 316 ? 37.983  63.990  12.877 1.00 92.65  ? 391 LYS A N     1 
ATOM   2473 C  CA    . LYS A 1 316 ? 37.903  65.368  13.355 1.00 91.20  ? 391 LYS A CA    1 
ATOM   2474 C  C     . LYS A 1 316 ? 39.110  65.739  14.204 1.00 93.35  ? 391 LYS A C     1 
ATOM   2475 O  O     . LYS A 1 316 ? 39.553  66.893  14.187 1.00 95.04  ? 391 LYS A O     1 
ATOM   2476 C  CB    . LYS A 1 316 ? 36.610  65.564  14.151 1.00 94.68  ? 391 LYS A CB    1 
ATOM   2477 C  CG    . LYS A 1 316 ? 36.263  67.012  14.485 1.00 94.07  ? 391 LYS A CG    1 
ATOM   2478 C  CD    . LYS A 1 316 ? 34.866  67.100  15.101 1.00 101.91 ? 391 LYS A CD    1 
ATOM   2479 C  CE    . LYS A 1 316 ? 34.402  68.542  15.260 1.00 114.36 ? 391 LYS A CE    1 
ATOM   2480 N  NZ    . LYS A 1 316 ? 32.957  68.714  14.899 1.00 103.48 ? 391 LYS A NZ    1 
ATOM   2481 N  N     . VAL A 1 317 ? 39.660  64.778  14.945 1.00 89.98  ? 392 VAL A N     1 
ATOM   2482 C  CA    . VAL A 1 317 ? 40.891  65.040  15.680 1.00 90.69  ? 392 VAL A CA    1 
ATOM   2483 C  C     . VAL A 1 317 ? 42.067  65.167  14.718 1.00 89.99  ? 392 VAL A C     1 
ATOM   2484 O  O     . VAL A 1 317 ? 42.948  66.013  14.903 1.00 89.91  ? 392 VAL A O     1 
ATOM   2485 C  CB    . VAL A 1 317 ? 41.127  63.943  16.733 1.00 89.57  ? 392 VAL A CB    1 
ATOM   2486 C  CG1   . VAL A 1 317 ? 42.467  64.145  17.418 1.00 87.66  ? 392 VAL A CG1   1 
ATOM   2487 C  CG2   . VAL A 1 317 ? 40.003  63.942  17.753 1.00 83.80  ? 392 VAL A CG2   1 
ATOM   2488 N  N     . LYS A 1 318 ? 42.099  64.339  13.671 1.00 88.73  ? 393 LYS A N     1 
ATOM   2489 C  CA    . LYS A 1 318 ? 43.202  64.422  12.721 1.00 88.61  ? 393 LYS A CA    1 
ATOM   2490 C  C     . LYS A 1 318 ? 43.168  65.723  11.930 1.00 91.44  ? 393 LYS A C     1 
ATOM   2491 O  O     . LYS A 1 318 ? 44.223  66.239  11.542 1.00 90.66  ? 393 LYS A O     1 
ATOM   2492 C  CB    . LYS A 1 318 ? 43.178  63.223  11.770 1.00 93.66  ? 393 LYS A CB    1 
ATOM   2493 C  CG    . LYS A 1 318 ? 43.566  61.894  12.407 1.00 87.31  ? 393 LYS A CG    1 
ATOM   2494 C  CD    . LYS A 1 318 ? 43.614  60.784  11.363 1.00 81.17  ? 393 LYS A CD    1 
ATOM   2495 C  CE    . LYS A 1 318 ? 43.920  59.434  11.991 1.00 85.17  ? 393 LYS A CE    1 
ATOM   2496 N  NZ    . LYS A 1 318 ? 44.172  58.382  10.963 1.00 86.53  ? 393 LYS A NZ    1 
ATOM   2497 N  N     . GLU A 1 319 ? 41.976  66.267  11.681 1.00 93.38  ? 394 GLU A N     1 
ATOM   2498 C  CA    . GLU A 1 319 ? 41.878  67.476  10.871 1.00 99.05  ? 394 GLU A CA    1 
ATOM   2499 C  C     . GLU A 1 319 ? 42.174  68.735  11.678 1.00 99.35  ? 394 GLU A C     1 
ATOM   2500 O  O     . GLU A 1 319 ? 42.753  69.689  11.147 1.00 99.13  ? 394 GLU A O     1 
ATOM   2501 C  CB    . GLU A 1 319 ? 40.497  67.572  10.232 1.00 105.90 ? 394 GLU A CB    1 
ATOM   2502 C  CG    . GLU A 1 319 ? 40.295  68.834  9.411  1.00 113.39 ? 394 GLU A CG    1 
ATOM   2503 C  CD    . GLU A 1 319 ? 38.994  68.818  8.643  1.00 123.09 ? 394 GLU A CD    1 
ATOM   2504 O  OE1   . GLU A 1 319 ? 38.795  67.880  7.843  1.00 133.17 ? 394 GLU A OE1   1 
ATOM   2505 O  OE2   . GLU A 1 319 ? 38.167  69.730  8.853  1.00 118.96 ? 394 GLU A OE2   1 
ATOM   2506 N  N     . ILE A 1 320 ? 41.777  68.771  12.953 1.00 95.78  ? 395 ILE A N     1 
ATOM   2507 C  CA    . ILE A 1 320 ? 42.099  69.930  13.776 1.00 93.29  ? 395 ILE A CA    1 
ATOM   2508 C  C     . ILE A 1 320 ? 43.601  70.049  13.973 1.00 91.01  ? 395 ILE A C     1 
ATOM   2509 O  O     . ILE A 1 320 ? 44.105  71.143  14.250 1.00 94.05  ? 395 ILE A O     1 
ATOM   2510 C  CB    . ILE A 1 320 ? 41.358  69.864  15.131 1.00 92.78  ? 395 ILE A CB    1 
ATOM   2511 C  CG1   . ILE A 1 320 ? 41.456  71.206  15.857 1.00 94.25  ? 395 ILE A CG1   1 
ATOM   2512 C  CG2   . ILE A 1 320 ? 41.920  68.761  16.005 1.00 90.01  ? 395 ILE A CG2   1 
ATOM   2513 C  CD1   . ILE A 1 320 ? 40.617  71.278  17.104 1.00 97.78  ? 395 ILE A CD1   1 
ATOM   2514 N  N     . CYS A 1 321 ? 44.331  68.943  13.826 1.00 93.28  ? 396 CYS A N     1 
ATOM   2515 C  CA    . CYS A 1 321 ? 45.783  68.904  13.929 1.00 91.49  ? 396 CYS A CA    1 
ATOM   2516 C  C     . CYS A 1 321 ? 46.486  68.977  12.579 1.00 96.67  ? 396 CYS A C     1 
ATOM   2517 O  O     . CYS A 1 321 ? 47.709  68.802  12.527 1.00 92.72  ? 396 CYS A O     1 
ATOM   2518 C  CB    . CYS A 1 321 ? 46.221  67.649  14.676 1.00 84.16  ? 396 CYS A CB    1 
ATOM   2519 S  SG    . CYS A 1 321 ? 45.775  67.691  16.411 1.00 82.98  ? 396 CYS A SG    1 
ATOM   2520 N  N     . SER A 1 322 ? 45.746  69.189  11.491 1.00 99.29  ? 397 SER A N     1 
ATOM   2521 C  CA    . SER A 1 322 ? 46.349  69.326  10.175 1.00 100.36 ? 397 SER A CA    1 
ATOM   2522 C  C     . SER A 1 322 ? 47.453  70.379  10.227 1.00 107.86 ? 397 SER A C     1 
ATOM   2523 O  O     . SER A 1 322 ? 47.187  71.528  10.617 1.00 108.38 ? 397 SER A O     1 
ATOM   2524 C  CB    . SER A 1 322 ? 45.304  69.718  9.133  1.00 101.29 ? 397 SER A CB    1 
ATOM   2525 O  OG    . SER A 1 322 ? 44.375  68.670  8.920  1.00 110.59 ? 397 SER A OG    1 
ATOM   2526 N  N     . PRO A 1 323 ? 48.688  70.031  9.868  1.00 103.52 ? 398 PRO A N     1 
ATOM   2527 C  CA    . PRO A 1 323 ? 49.809  70.956  10.075 1.00 100.68 ? 398 PRO A CA    1 
ATOM   2528 C  C     . PRO A 1 323 ? 49.640  72.242  9.278  1.00 106.21 ? 398 PRO A C     1 
ATOM   2529 O  O     . PRO A 1 323 ? 49.383  72.221  8.072  1.00 107.57 ? 398 PRO A O     1 
ATOM   2530 C  CB    . PRO A 1 323 ? 51.022  70.149  9.601  1.00 94.88  ? 398 PRO A CB    1 
ATOM   2531 C  CG    . PRO A 1 323 ? 50.588  68.717  9.707  1.00 96.51  ? 398 PRO A CG    1 
ATOM   2532 C  CD    . PRO A 1 323 ? 49.133  68.718  9.374  1.00 92.61  ? 398 PRO A CD    1 
ATOM   2533 N  N     . ASP A 1 324 ? 49.782  73.368  9.971  1.00 104.45 ? 399 ASP A N     1 
ATOM   2534 C  CA    . ASP A 1 324 ? 49.792  74.689  9.361  1.00 105.80 ? 399 ASP A CA    1 
ATOM   2535 C  C     . ASP A 1 324 ? 51.213  75.230  9.396  1.00 102.67 ? 399 ASP A C     1 
ATOM   2536 O  O     . ASP A 1 324 ? 51.901  75.119  10.415 1.00 101.80 ? 399 ASP A O     1 
ATOM   2537 C  CB    . ASP A 1 324 ? 48.853  75.656  10.097 1.00 106.84 ? 399 ASP A CB    1 
ATOM   2538 C  CG    . ASP A 1 324 ? 47.383  75.398  9.802  1.00 113.37 ? 399 ASP A CG    1 
ATOM   2539 O  OD1   . ASP A 1 324 ? 46.762  76.228  9.101  1.00 112.85 ? 399 ASP A OD1   1 
ATOM   2540 O  OD2   . ASP A 1 324 ? 46.845  74.376  10.280 1.00 113.43 ? 399 ASP A OD2   1 
ATOM   2541 N  N     . VAL A 1 325 ? 51.657  75.808  8.276  1.00 101.44 ? 400 VAL A N     1 
ATOM   2542 C  CA    . VAL A 1 325 ? 52.964  76.459  8.269  1.00 99.29  ? 400 VAL A CA    1 
ATOM   2543 C  C     . VAL A 1 325 ? 52.978  77.624  9.246  1.00 98.14  ? 400 VAL A C     1 
ATOM   2544 O  O     . VAL A 1 325 ? 54.018  77.938  9.838  1.00 97.71  ? 400 VAL A O     1 
ATOM   2545 C  CB    . VAL A 1 325 ? 53.342  76.911  6.844  1.00 96.52  ? 400 VAL A CB    1 
ATOM   2546 C  CG1   . VAL A 1 325 ? 53.542  75.705  5.941  1.00 96.24  ? 400 VAL A CG1   1 
ATOM   2547 C  CG2   . VAL A 1 325 ? 52.280  77.843  6.275  1.00 94.95  ? 400 VAL A CG2   1 
ATOM   2548 N  N     . GLY A 1 326 ? 51.831  78.272  9.442  1.00 98.87  ? 401 GLY A N     1 
ATOM   2549 C  CA    . GLY A 1 326 ? 51.687  79.345  10.399 1.00 102.22 ? 401 GLY A CA    1 
ATOM   2550 C  C     . GLY A 1 326 ? 51.617  78.916  11.844 1.00 101.09 ? 401 GLY A C     1 
ATOM   2551 O  O     . GLY A 1 326 ? 51.408  79.759  12.721 1.00 98.06  ? 401 GLY A O     1 
ATOM   2552 N  N     . ASP A 1 327 ? 51.788  77.626  12.126 1.00 98.89  ? 402 ASP A N     1 
ATOM   2553 C  CA    . ASP A 1 327 ? 51.741  77.135  13.496 1.00 98.14  ? 402 ASP A CA    1 
ATOM   2554 C  C     . ASP A 1 327 ? 53.111  77.302  14.135 1.00 92.03  ? 402 ASP A C     1 
ATOM   2555 O  O     . ASP A 1 327 ? 54.100  76.733  13.661 1.00 93.69  ? 402 ASP A O     1 
ATOM   2556 C  CB    . ASP A 1 327 ? 51.299  75.673  13.536 1.00 97.79  ? 402 ASP A CB    1 
ATOM   2557 C  CG    . ASP A 1 327 ? 49.786  75.520  13.562 1.00 108.09 ? 402 ASP A CG    1 
ATOM   2558 O  OD1   . ASP A 1 327 ? 49.093  76.452  14.032 1.00 103.25 ? 402 ASP A OD1   1 
ATOM   2559 O  OD2   . ASP A 1 327 ? 49.291  74.460  13.117 1.00 108.80 ? 402 ASP A OD2   1 
ATOM   2560 N  N     . VAL A 1 328 ? 53.164  78.106  15.200 1.00 89.60  ? 403 VAL A N     1 
ATOM   2561 C  CA    . VAL A 1 328 ? 54.395  78.286  15.955 1.00 85.49  ? 403 VAL A CA    1 
ATOM   2562 C  C     . VAL A 1 328 ? 54.901  76.926  16.403 1.00 84.80  ? 403 VAL A C     1 
ATOM   2563 O  O     . VAL A 1 328 ? 54.115  76.036  16.737 1.00 87.56  ? 403 VAL A O     1 
ATOM   2564 C  CB    . VAL A 1 328 ? 54.134  79.231  17.144 1.00 83.47  ? 403 VAL A CB    1 
ATOM   2565 C  CG1   . VAL A 1 328 ? 52.764  78.956  17.750 1.00 95.97  ? 403 VAL A CG1   1 
ATOM   2566 C  CG2   . VAL A 1 328 ? 55.207  79.103  18.213 1.00 84.92  ? 403 VAL A CG2   1 
ATOM   2567 N  N     . ALA A 1 329 ? 56.219  76.745  16.384 1.00 90.01  ? 404 ALA A N     1 
ATOM   2568 C  CA    . ALA A 1 329 ? 56.774  75.496  16.878 1.00 90.19  ? 404 ALA A CA    1 
ATOM   2569 C  C     . ALA A 1 329 ? 56.449  75.339  18.361 1.00 90.22  ? 404 ALA A C     1 
ATOM   2570 O  O     . ALA A 1 329 ? 56.141  76.306  19.062 1.00 92.11  ? 404 ALA A O     1 
ATOM   2571 C  CB    . ALA A 1 329 ? 58.283  75.438  16.645 1.00 85.60  ? 404 ALA A CB    1 
ATOM   2572 N  N     . ASP A 1 330 ? 56.519  74.087  18.822 1.00 86.35  ? 405 ASP A N     1 
ATOM   2573 C  CA    . ASP A 1 330 ? 55.991  73.579  20.090 1.00 86.60  ? 405 ASP A CA    1 
ATOM   2574 C  C     . ASP A 1 330 ? 54.483  73.364  20.001 1.00 82.67  ? 405 ASP A C     1 
ATOM   2575 O  O     . ASP A 1 330 ? 53.916  72.601  20.791 1.00 79.79  ? 405 ASP A O     1 
ATOM   2576 C  CB    . ASP A 1 330 ? 56.290  74.512  21.278 1.00 82.42  ? 405 ASP A CB    1 
ATOM   2577 C  CG    . ASP A 1 330 ? 57.767  74.851  21.425 1.00 90.05  ? 405 ASP A CG    1 
ATOM   2578 O  OD1   . ASP A 1 330 ? 58.469  75.005  20.403 1.00 97.24  ? 405 ASP A OD1   1 
ATOM   2579 O  OD2   . ASP A 1 330 ? 58.220  74.986  22.583 1.00 86.18  ? 405 ASP A OD2   1 
ATOM   2580 N  N     . ILE A 1 331 ? 53.818  74.015  19.052 1.00 82.45  ? 406 ILE A N     1 
ATOM   2581 C  CA    . ILE A 1 331 ? 52.449  73.633  18.719 1.00 82.54  ? 406 ILE A CA    1 
ATOM   2582 C  C     . ILE A 1 331 ? 52.426  72.515  17.689 1.00 82.91  ? 406 ILE A C     1 
ATOM   2583 O  O     . ILE A 1 331 ? 51.663  71.556  17.822 1.00 83.68  ? 406 ILE A O     1 
ATOM   2584 C  CB    . ILE A 1 331 ? 51.642  74.857  18.248 1.00 84.03  ? 406 ILE A CB    1 
ATOM   2585 C  CG1   . ILE A 1 331 ? 51.417  75.819  19.416 1.00 85.77  ? 406 ILE A CG1   1 
ATOM   2586 C  CG2   . ILE A 1 331 ? 50.317  74.424  17.645 1.00 84.80  ? 406 ILE A CG2   1 
ATOM   2587 C  CD1   . ILE A 1 331 ? 50.784  75.171  20.629 1.00 77.64  ? 406 ILE A CD1   1 
ATOM   2588 N  N     . ALA A 1 332 ? 53.266  72.618  16.657 1.00 84.56  ? 407 ALA A N     1 
ATOM   2589 C  CA    . ALA A 1 332 ? 53.332  71.560  15.657 1.00 82.39  ? 407 ALA A CA    1 
ATOM   2590 C  C     . ALA A 1 332 ? 53.801  70.255  16.282 1.00 83.95  ? 407 ALA A C     1 
ATOM   2591 O  O     . ALA A 1 332 ? 53.333  69.176  15.905 1.00 85.65  ? 407 ALA A O     1 
ATOM   2592 C  CB    . ALA A 1 332 ? 54.250  71.974  14.509 1.00 85.86  ? 407 ALA A CB    1 
ATOM   2593 N  N     . LYS A 1 333 ? 54.720  70.336  17.249 1.00 82.37  ? 408 LYS A N     1 
ATOM   2594 C  CA    . LYS A 1 333 ? 55.105  69.145  17.997 1.00 84.71  ? 408 LYS A CA    1 
ATOM   2595 C  C     . LYS A 1 333 ? 53.914  68.563  18.742 1.00 85.72  ? 408 LYS A C     1 
ATOM   2596 O  O     . LYS A 1 333 ? 53.789  67.339  18.873 1.00 85.92  ? 408 LYS A O     1 
ATOM   2597 C  CB    . LYS A 1 333 ? 56.236  69.474  18.970 1.00 84.52  ? 408 LYS A CB    1 
ATOM   2598 C  CG    . LYS A 1 333 ? 57.597  68.989  18.505 1.00 90.82  ? 408 LYS A CG    1 
ATOM   2599 C  CD    . LYS A 1 333 ? 57.635  67.472  18.404 1.00 91.32  ? 408 LYS A CD    1 
ATOM   2600 C  CE    . LYS A 1 333 ? 57.600  66.826  19.781 1.00 92.54  ? 408 LYS A CE    1 
ATOM   2601 N  NZ    . LYS A 1 333 ? 58.752  67.251  20.629 1.00 88.95  ? 408 LYS A NZ    1 
ATOM   2602 N  N     . LEU A 1 334 ? 53.027  69.428  19.238 1.00 84.06  ? 409 LEU A N     1 
ATOM   2603 C  CA    . LEU A 1 334 ? 51.795  68.956  19.856 1.00 74.95  ? 409 LEU A CA    1 
ATOM   2604 C  C     . LEU A 1 334 ? 50.908  68.276  18.823 1.00 75.40  ? 409 LEU A C     1 
ATOM   2605 O  O     . LEU A 1 334 ? 50.491  67.128  19.010 1.00 76.94  ? 409 LEU A O     1 
ATOM   2606 C  CB    . LEU A 1 334 ? 51.071  70.124  20.528 1.00 70.90  ? 409 LEU A CB    1 
ATOM   2607 C  CG    . LEU A 1 334 ? 50.252  69.850  21.789 1.00 70.67  ? 409 LEU A CG    1 
ATOM   2608 C  CD1   . LEU A 1 334 ? 48.794  69.602  21.444 1.00 85.43  ? 409 LEU A CD1   1 
ATOM   2609 C  CD2   . LEU A 1 334 ? 50.832  68.677  22.555 1.00 72.51  ? 409 LEU A CD2   1 
ATOM   2610 N  N     . LYS A 1 335 ? 50.643  68.961  17.705 1.00 77.81  ? 410 LYS A N     1 
ATOM   2611 C  CA    . LYS A 1 335 ? 49.856  68.371  16.625 1.00 79.86  ? 410 LYS A CA    1 
ATOM   2612 C  C     . LYS A 1 335 ? 50.409  67.014  16.215 1.00 78.57  ? 410 LYS A C     1 
ATOM   2613 O  O     . LYS A 1 335 ? 49.652  66.060  16.000 1.00 79.67  ? 410 LYS A O     1 
ATOM   2614 C  CB    . LYS A 1 335 ? 49.830  69.316  15.422 1.00 86.49  ? 410 LYS A CB    1 
ATOM   2615 C  CG    . LYS A 1 335 ? 49.420  70.754  15.738 1.00 89.80  ? 410 LYS A CG    1 
ATOM   2616 C  CD    . LYS A 1 335 ? 47.925  70.892  15.992 1.00 85.31  ? 410 LYS A CD    1 
ATOM   2617 C  CE    . LYS A 1 335 ? 47.471  72.343  15.856 1.00 86.65  ? 410 LYS A CE    1 
ATOM   2618 N  NZ    . LYS A 1 335 ? 47.672  72.867  14.473 1.00 86.15  ? 410 LYS A NZ    1 
ATOM   2619 N  N     . VAL A 1 336 ? 51.735  66.920  16.099 1.00 83.98  ? 411 VAL A N     1 
ATOM   2620 C  CA    . VAL A 1 336 ? 52.400  65.655  15.786 1.00 82.86  ? 411 VAL A CA    1 
ATOM   2621 C  C     . VAL A 1 336 ? 52.020  64.595  16.804 1.00 84.81  ? 411 VAL A C     1 
ATOM   2622 O  O     . VAL A 1 336 ? 51.417  63.568  16.469 1.00 84.06  ? 411 VAL A O     1 
ATOM   2623 C  CB    . VAL A 1 336 ? 53.927  65.838  15.739 1.00 75.88  ? 411 VAL A CB    1 
ATOM   2624 C  CG1   . VAL A 1 336 ? 54.623  64.487  15.831 1.00 85.74  ? 411 VAL A CG1   1 
ATOM   2625 C  CG2   . VAL A 1 336 ? 54.341  66.556  14.469 1.00 79.60  ? 411 VAL A CG2   1 
ATOM   2626 N  N     . ASN A 1 337 ? 52.389  64.828  18.066 1.00 81.64  ? 412 ASN A N     1 
ATOM   2627 C  CA    . ASN A 1 337 ? 52.185  63.821  19.098 1.00 81.99  ? 412 ASN A CA    1 
ATOM   2628 C  C     . ASN A 1 337 ? 50.715  63.470  19.261 1.00 82.55  ? 412 ASN A C     1 
ATOM   2629 O  O     . ASN A 1 337 ? 50.388  62.338  19.634 1.00 84.39  ? 412 ASN A O     1 
ATOM   2630 C  CB    . ASN A 1 337 ? 52.781  64.305  20.417 1.00 82.67  ? 412 ASN A CB    1 
ATOM   2631 C  CG    . ASN A 1 337 ? 54.298  64.405  20.366 1.00 87.40  ? 412 ASN A CG    1 
ATOM   2632 O  OD1   . ASN A 1 337 ? 54.875  65.449  20.673 1.00 83.15  ? 412 ASN A OD1   1 
ATOM   2633 N  ND2   . ASN A 1 337 ? 54.950  63.316  19.972 1.00 86.14  ? 412 ASN A ND2   1 
ATOM   2634 N  N     . ILE A 1 338 ? 49.814  64.409  18.974 1.00 82.11  ? 413 ILE A N     1 
ATOM   2635 C  CA    . ILE A 1 338 ? 48.387  64.103  19.037 1.00 81.28  ? 413 ILE A CA    1 
ATOM   2636 C  C     . ILE A 1 338 ? 48.040  63.010  18.035 1.00 81.81  ? 413 ILE A C     1 
ATOM   2637 O  O     . ILE A 1 338 ? 47.529  61.946  18.401 1.00 84.00  ? 413 ILE A O     1 
ATOM   2638 C  CB    . ILE A 1 338 ? 47.546  65.368  18.794 1.00 83.60  ? 413 ILE A CB    1 
ATOM   2639 C  CG1   . ILE A 1 338 ? 47.714  66.368  19.940 1.00 78.57  ? 413 ILE A CG1   1 
ATOM   2640 C  CG2   . ILE A 1 338 ? 46.086  65.000  18.639 1.00 84.68  ? 413 ILE A CG2   1 
ATOM   2641 C  CD1   . ILE A 1 338 ? 47.279  65.846  21.278 1.00 81.32  ? 413 ILE A CD1   1 
ATOM   2642 N  N     . ILE A 1 339 ? 48.331  63.253  16.754 1.00 81.49  ? 414 ILE A N     1 
ATOM   2643 C  CA    . ILE A 1 339 ? 47.958  62.288  15.724 1.00 83.72  ? 414 ILE A CA    1 
ATOM   2644 C  C     . ILE A 1 339 ? 48.751  60.999  15.884 1.00 88.25  ? 414 ILE A C     1 
ATOM   2645 O  O     . ILE A 1 339 ? 48.276  59.919  15.509 1.00 83.05  ? 414 ILE A O     1 
ATOM   2646 C  CB    . ILE A 1 339 ? 48.140  62.894  14.318 1.00 79.38  ? 414 ILE A CB    1 
ATOM   2647 C  CG1   . ILE A 1 339 ? 49.620  62.997  13.955 1.00 91.66  ? 414 ILE A CG1   1 
ATOM   2648 C  CG2   . ILE A 1 339 ? 47.504  64.268  14.241 1.00 77.87  ? 414 ILE A CG2   1 
ATOM   2649 C  CD1   . ILE A 1 339 ? 49.874  63.647  12.612 1.00 99.43  ? 414 ILE A CD1   1 
ATOM   2650 N  N     . LYS A 1 340 ? 49.959  61.079  16.450 1.00 90.10  ? 415 LYS A N     1 
ATOM   2651 C  CA    . LYS A 1 340 ? 50.749  59.871  16.653 1.00 90.67  ? 415 LYS A CA    1 
ATOM   2652 C  C     . LYS A 1 340 ? 50.079  58.945  17.657 1.00 91.15  ? 415 LYS A C     1 
ATOM   2653 O  O     . LYS A 1 340 ? 50.034  57.726  17.453 1.00 94.06  ? 415 LYS A O     1 
ATOM   2654 C  CB    . LYS A 1 340 ? 52.160  60.231  17.116 1.00 86.32  ? 415 LYS A CB    1 
ATOM   2655 C  CG    . LYS A 1 340 ? 53.093  59.030  17.203 1.00 94.27  ? 415 LYS A CG    1 
ATOM   2656 C  CD    . LYS A 1 340 ? 54.163  59.211  18.274 1.00 100.50 ? 415 LYS A CD    1 
ATOM   2657 C  CE    . LYS A 1 340 ? 55.094  60.370  17.961 1.00 95.10  ? 415 LYS A CE    1 
ATOM   2658 N  NZ    . LYS A 1 340 ? 56.074  60.574  19.059 1.00 94.33  ? 415 LYS A NZ    1 
ATOM   2659 N  N     . ASN A 1 341 ? 49.536  59.506  18.738 1.00 86.84  ? 416 ASN A N     1 
ATOM   2660 C  CA    . ASN A 1 341 ? 48.929  58.679  19.771 1.00 84.47  ? 416 ASN A CA    1 
ATOM   2661 C  C     . ASN A 1 341 ? 47.554  58.171  19.362 1.00 86.96  ? 416 ASN A C     1 
ATOM   2662 O  O     . ASN A 1 341 ? 47.164  57.073  19.770 1.00 87.43  ? 416 ASN A O     1 
ATOM   2663 C  CB    . ASN A 1 341 ? 48.841  59.457  21.084 1.00 82.47  ? 416 ASN A CB    1 
ATOM   2664 C  CG    . ASN A 1 341 ? 50.210  59.762  21.673 1.00 89.16  ? 416 ASN A CG    1 
ATOM   2665 O  OD1   . ASN A 1 341 ? 50.631  59.141  22.651 1.00 93.17  ? 416 ASN A OD1   1 
ATOM   2666 N  ND2   . ASN A 1 341 ? 50.913  60.716  21.075 1.00 84.32  ? 416 ASN A ND2   1 
ATOM   2667 N  N     . VAL A 1 342 ? 46.816  58.941  18.554 1.00 85.03  ? 417 VAL A N     1 
ATOM   2668 C  CA    . VAL A 1 342 ? 45.495  58.503  18.104 1.00 85.72  ? 417 VAL A CA    1 
ATOM   2669 C  C     . VAL A 1 342 ? 45.582  57.148  17.419 1.00 88.91  ? 417 VAL A C     1 
ATOM   2670 O  O     . VAL A 1 342 ? 44.675  56.316  17.550 1.00 87.28  ? 417 VAL A O     1 
ATOM   2671 C  CB    . VAL A 1 342 ? 44.863  59.562  17.177 1.00 91.50  ? 417 VAL A CB    1 
ATOM   2672 C  CG1   . VAL A 1 342 ? 43.573  59.037  16.568 1.00 88.30  ? 417 VAL A CG1   1 
ATOM   2673 C  CG2   . VAL A 1 342 ? 44.594  60.846  17.941 1.00 88.71  ? 417 VAL A CG2   1 
ATOM   2674 N  N     . ARG A 1 343 ? 46.681  56.889  16.712 1.00 89.09  ? 418 ARG A N     1 
ATOM   2675 C  CA    . ARG A 1 343 ? 46.899  55.600  16.073 1.00 84.69  ? 418 ARG A CA    1 
ATOM   2676 C  C     . ARG A 1 343 ? 47.221  54.537  17.112 1.00 86.38  ? 418 ARG A C     1 
ATOM   2677 O  O     . ARG A 1 343 ? 46.456  53.586  17.300 1.00 92.90  ? 418 ARG A O     1 
ATOM   2678 C  CB    . ARG A 1 343 ? 48.038  55.690  15.059 1.00 87.94  ? 418 ARG A CB    1 
ATOM   2679 C  CG    . ARG A 1 343 ? 47.609  55.714  13.608 1.00 87.17  ? 418 ARG A CG    1 
ATOM   2680 C  CD    . ARG A 1 343 ? 48.827  55.817  12.694 1.00 93.97  ? 418 ARG A CD    1 
ATOM   2681 N  NE    . ARG A 1 343 ? 49.807  54.756  12.935 1.00 96.66  ? 418 ARG A NE    1 
ATOM   2682 C  CZ    . ARG A 1 343 ? 50.986  54.934  13.528 1.00 88.98  ? 418 ARG A CZ    1 
ATOM   2683 N  NH1   . ARG A 1 343 ? 51.350  56.139  13.947 1.00 89.08  ? 418 ARG A NH1   1 
ATOM   2684 N  NH2   . ARG A 1 343 ? 51.806  53.905  13.699 1.00 83.95  ? 418 ARG A NH2   1 
ATOM   2685 N  N     . ILE A 1 344 ? 48.358  54.690  17.794 1.00 86.00  ? 419 ILE A N     1 
ATOM   2686 C  CA    . ILE A 1 344 ? 48.852  53.642  18.679 1.00 89.11  ? 419 ILE A CA    1 
ATOM   2687 C  C     . ILE A 1 344 ? 48.024  53.478  19.944 1.00 88.13  ? 419 ILE A C     1 
ATOM   2688 O  O     . ILE A 1 344 ? 48.193  52.479  20.652 1.00 85.37  ? 419 ILE A O     1 
ATOM   2689 C  CB    . ILE A 1 344 ? 50.324  53.912  19.047 1.00 87.12  ? 419 ILE A CB    1 
ATOM   2690 C  CG1   . ILE A 1 344 ? 50.468  55.296  19.684 1.00 88.43  ? 419 ILE A CG1   1 
ATOM   2691 C  CG2   . ILE A 1 344 ? 51.203  53.799  17.812 1.00 94.07  ? 419 ILE A CG2   1 
ATOM   2692 C  CD1   . ILE A 1 344 ? 51.906  55.742  19.879 1.00 87.46  ? 419 ILE A CD1   1 
ATOM   2693 N  N     . ILE A 1 345 ? 47.137  54.422  20.254 1.00 85.41  ? 420 ILE A N     1 
ATOM   2694 C  CA    . ILE A 1 345 ? 46.317  54.299  21.454 1.00 85.10  ? 420 ILE A CA    1 
ATOM   2695 C  C     . ILE A 1 345 ? 44.864  54.088  21.058 1.00 88.47  ? 420 ILE A C     1 
ATOM   2696 O  O     . ILE A 1 345 ? 44.315  52.995  21.236 1.00 90.43  ? 420 ILE A O     1 
ATOM   2697 C  CB    . ILE A 1 345 ? 46.466  55.521  22.378 1.00 80.87  ? 420 ILE A CB    1 
ATOM   2698 C  CG1   . ILE A 1 345 ? 47.905  55.635  22.876 1.00 90.21  ? 420 ILE A CG1   1 
ATOM   2699 C  CG2   . ILE A 1 345 ? 45.537  55.401  23.570 1.00 72.64  ? 420 ILE A CG2   1 
ATOM   2700 C  CD1   . ILE A 1 345 ? 48.339  54.465  23.748 1.00 91.14  ? 420 ILE A CD1   1 
ATOM   2701 N  N     . TRP A 1 346 ? 44.230  55.127  20.515 1.00 89.23  ? 421 TRP A N     1 
ATOM   2702 C  CA    . TRP A 1 346 ? 42.797  55.042  20.265 1.00 85.02  ? 421 TRP A CA    1 
ATOM   2703 C  C     . TRP A 1 346 ? 42.493  54.070  19.134 1.00 84.99  ? 421 TRP A C     1 
ATOM   2704 O  O     . TRP A 1 346 ? 41.685  53.150  19.300 1.00 91.16  ? 421 TRP A O     1 
ATOM   2705 C  CB    . TRP A 1 346 ? 42.226  56.423  19.959 1.00 87.13  ? 421 TRP A CB    1 
ATOM   2706 C  CG    . TRP A 1 346 ? 40.758  56.501  20.211 1.00 84.69  ? 421 TRP A CG    1 
ATOM   2707 C  CD1   . TRP A 1 346 ? 39.937  55.481  20.597 1.00 86.54  ? 421 TRP A CD1   1 
ATOM   2708 C  CD2   . TRP A 1 346 ? 39.932  57.663  20.102 1.00 82.38  ? 421 TRP A CD2   1 
ATOM   2709 N  NE1   . TRP A 1 346 ? 38.648  55.938  20.733 1.00 86.09  ? 421 TRP A NE1   1 
ATOM   2710 C  CE2   . TRP A 1 346 ? 38.620  57.275  20.435 1.00 80.87  ? 421 TRP A CE2   1 
ATOM   2711 C  CE3   . TRP A 1 346 ? 40.175  58.994  19.756 1.00 80.91  ? 421 TRP A CE3   1 
ATOM   2712 C  CZ2   . TRP A 1 346 ? 37.557  58.168  20.433 1.00 75.75  ? 421 TRP A CZ2   1 
ATOM   2713 C  CZ3   . TRP A 1 346 ? 39.117  59.879  19.752 1.00 80.27  ? 421 TRP A CZ3   1 
ATOM   2714 C  CH2   . TRP A 1 346 ? 37.825  59.463  20.088 1.00 77.26  ? 421 TRP A CH2   1 
ATOM   2715 N  N     . GLU A 1 347 ? 43.135  54.252  17.978 1.00 81.74  ? 422 GLU A N     1 
ATOM   2716 C  CA    . GLU A 1 347 ? 42.872  53.363  16.851 1.00 87.35  ? 422 GLU A CA    1 
ATOM   2717 C  C     . GLU A 1 347 ? 43.284  51.931  17.167 1.00 90.45  ? 422 GLU A C     1 
ATOM   2718 O  O     . GLU A 1 347 ? 42.612  50.980  16.751 1.00 95.15  ? 422 GLU A O     1 
ATOM   2719 C  CB    . GLU A 1 347 ? 43.588  53.865  15.597 1.00 86.27  ? 422 GLU A CB    1 
ATOM   2720 C  CG    . GLU A 1 347 ? 42.777  54.861  14.780 1.00 88.89  ? 422 GLU A CG    1 
ATOM   2721 C  CD    . GLU A 1 347 ? 43.441  55.217  13.462 1.00 96.59  ? 422 GLU A CD    1 
ATOM   2722 O  OE1   . GLU A 1 347 ? 44.173  56.231  13.416 1.00 102.64 ? 422 GLU A OE1   1 
ATOM   2723 O  OE2   . GLU A 1 347 ? 43.238  54.479  12.473 1.00 98.63  ? 422 GLU A OE2   1 
ATOM   2724 N  N     . GLU A 1 348 ? 44.376  51.756  17.914 1.00 90.06  ? 423 GLU A N     1 
ATOM   2725 C  CA    . GLU A 1 348 ? 44.862  50.412  18.204 1.00 90.30  ? 423 GLU A CA    1 
ATOM   2726 C  C     . GLU A 1 348 ? 43.884  49.630  19.074 1.00 91.67  ? 423 GLU A C     1 
ATOM   2727 O  O     . GLU A 1 348 ? 43.865  48.395  19.023 1.00 97.80  ? 423 GLU A O     1 
ATOM   2728 C  CB    . GLU A 1 348 ? 46.234  50.489  18.875 1.00 88.86  ? 423 GLU A CB    1 
ATOM   2729 C  CG    . GLU A 1 348 ? 47.288  49.576  18.260 1.00 95.39  ? 423 GLU A CG    1 
ATOM   2730 C  CD    . GLU A 1 348 ? 47.310  48.190  18.883 1.00 99.96  ? 423 GLU A CD    1 
ATOM   2731 O  OE1   . GLU A 1 348 ? 46.863  48.050  20.041 1.00 91.78  ? 423 GLU A OE1   1 
ATOM   2732 O  OE2   . GLU A 1 348 ? 47.779  47.243  18.215 1.00 109.37 ? 423 GLU A OE2   1 
ATOM   2733 N  N     . ASN A 1 349 ? 43.076  50.318  19.877 1.00 88.85  ? 424 ASN A N     1 
ATOM   2734 C  CA    . ASN A 1 349 ? 42.143  49.677  20.798 1.00 91.63  ? 424 ASN A CA    1 
ATOM   2735 C  C     . ASN A 1 349 ? 40.712  49.577  20.276 1.00 89.54  ? 424 ASN A C     1 
ATOM   2736 O  O     . ASN A 1 349 ? 39.823  49.178  21.036 1.00 88.93  ? 424 ASN A O     1 
ATOM   2737 C  CB    . ASN A 1 349 ? 42.149  50.406  22.144 1.00 85.93  ? 424 ASN A CB    1 
ATOM   2738 C  CG    . ASN A 1 349 ? 43.446  50.207  22.899 1.00 80.68  ? 424 ASN A CG    1 
ATOM   2739 O  OD1   . ASN A 1 349 ? 44.019  51.152  23.433 1.00 84.12  ? 424 ASN A OD1   1 
ATOM   2740 N  ND2   . ASN A 1 349 ? 43.920  48.968  22.938 1.00 78.29  ? 424 ASN A ND2   1 
ATOM   2741 N  N     . LEU A 1 350 ? 40.454  49.959  19.027 1.00 91.62  ? 425 LEU A N     1 
ATOM   2742 C  CA    . LEU A 1 350 ? 39.100  49.926  18.481 1.00 98.78  ? 425 LEU A CA    1 
ATOM   2743 C  C     . LEU A 1 350 ? 38.805  48.582  17.827 1.00 102.95 ? 425 LEU A C     1 
ATOM   2744 O  O     . LEU A 1 350 ? 39.638  48.042  17.092 1.00 107.04 ? 425 LEU A O     1 
ATOM   2745 C  CB    . LEU A 1 350 ? 38.902  51.045  17.461 1.00 98.71  ? 425 LEU A CB    1 
ATOM   2746 C  CG    . LEU A 1 350 ? 38.930  52.468  18.010 1.00 95.74  ? 425 LEU A CG    1 
ATOM   2747 C  CD1   . LEU A 1 350 ? 38.498  53.443  16.932 1.00 96.82  ? 425 LEU A CD1   1 
ATOM   2748 C  CD2   . LEU A 1 350 ? 38.052  52.590  19.245 1.00 94.43  ? 425 LEU A CD2   1 
ATOM   2749 N  N     . SER A 1 351 ? 37.605  48.054  18.085 1.00 101.30 ? 426 SER A N     1 
ATOM   2750 C  CA    . SER A 1 351 ? 37.195  46.755  17.574 1.00 108.36 ? 426 SER A CA    1 
ATOM   2751 C  C     . SER A 1 351 ? 36.183  46.911  16.436 1.00 110.83 ? 426 SER A C     1 
ATOM   2752 O  O     . SER A 1 351 ? 35.842  48.014  16.009 1.00 109.65 ? 426 SER A O     1 
ATOM   2753 C  CB    . SER A 1 351 ? 36.631  45.894  18.707 1.00 107.11 ? 426 SER A CB    1 
ATOM   2754 O  OG    . SER A 1 351 ? 35.604  46.569  19.417 1.00 104.82 ? 426 SER A OG    1 
ATOM   2755 N  N     . ILE A 1 352 ? 35.694  45.772  15.939 1.00 111.33 ? 427 ILE A N     1 
ATOM   2756 C  CA    . ILE A 1 352 ? 34.786  45.763  14.790 1.00 110.87 ? 427 ILE A CA    1 
ATOM   2757 C  C     . ILE A 1 352 ? 33.468  46.453  15.123 1.00 105.99 ? 427 ILE A C     1 
ATOM   2758 O  O     . ILE A 1 352 ? 32.818  47.028  14.240 1.00 103.10 ? 427 ILE A O     1 
ATOM   2759 C  CB    . ILE A 1 352 ? 34.572  44.313  14.300 1.00 112.31 ? 427 ILE A CB    1 
ATOM   2760 C  CG1   . ILE A 1 352 ? 35.853  43.768  13.661 1.00 111.01 ? 427 ILE A CG1   1 
ATOM   2761 C  CG2   . ILE A 1 352 ? 33.426  44.228  13.304 1.00 111.92 ? 427 ILE A CG2   1 
ATOM   2762 C  CD1   . ILE A 1 352 ? 36.236  44.458  12.362 1.00 106.26 ? 427 ILE A CD1   1 
ATOM   2763 N  N     . TRP A 1 353 ? 33.063  46.435  16.394 1.00 104.95 ? 428 TRP A N     1 
ATOM   2764 C  CA    . TRP A 1 353 ? 31.811  47.074  16.787 1.00 100.82 ? 428 TRP A CA    1 
ATOM   2765 C  C     . TRP A 1 353 ? 31.841  48.587  16.597 1.00 103.72 ? 428 TRP A C     1 
ATOM   2766 O  O     . TRP A 1 353 ? 30.776  49.215  16.572 1.00 100.46 ? 428 TRP A O     1 
ATOM   2767 C  CB    . TRP A 1 353 ? 31.489  46.751  18.248 1.00 101.92 ? 428 TRP A CB    1 
ATOM   2768 C  CG    . TRP A 1 353 ? 31.444  45.286  18.564 1.00 105.06 ? 428 TRP A CG    1 
ATOM   2769 C  CD1   . TRP A 1 353 ? 32.508  44.443  18.695 1.00 106.11 ? 428 TRP A CD1   1 
ATOM   2770 C  CD2   . TRP A 1 353 ? 30.274  44.496  18.812 1.00 110.63 ? 428 TRP A CD2   1 
ATOM   2771 N  NE1   . TRP A 1 353 ? 32.074  43.174  18.998 1.00 108.77 ? 428 TRP A NE1   1 
ATOM   2772 C  CE2   . TRP A 1 353 ? 30.706  43.181  19.077 1.00 107.88 ? 428 TRP A CE2   1 
ATOM   2773 C  CE3   . TRP A 1 353 ? 28.905  44.772  18.832 1.00 108.08 ? 428 TRP A CE3   1 
ATOM   2774 C  CZ2   . TRP A 1 353 ? 29.817  42.146  19.358 1.00 107.79 ? 428 TRP A CZ2   1 
ATOM   2775 C  CZ3   . TRP A 1 353 ? 28.027  43.747  19.104 1.00 103.48 ? 428 TRP A CZ3   1 
ATOM   2776 C  CH2   . TRP A 1 353 ? 28.483  42.450  19.367 1.00 111.39 ? 428 TRP A CH2   1 
ATOM   2777 N  N     . HIS A 1 354 ? 33.031  49.187  16.478 1.00 107.41 ? 429 HIS A N     1 
ATOM   2778 C  CA    . HIS A 1 354 ? 33.141  50.632  16.285 1.00 102.05 ? 429 HIS A CA    1 
ATOM   2779 C  C     . HIS A 1 354 ? 32.881  51.035  14.838 1.00 100.92 ? 429 HIS A C     1 
ATOM   2780 O  O     . HIS A 1 354 ? 32.264  52.075  14.582 1.00 92.96  ? 429 HIS A O     1 
ATOM   2781 C  CB    . HIS A 1 354 ? 34.523  51.120  16.723 1.00 97.64  ? 429 HIS A CB    1 
ATOM   2782 C  CG    . HIS A 1 354 ? 34.745  51.060  18.202 1.00 96.84  ? 429 HIS A CG    1 
ATOM   2783 N  ND1   . HIS A 1 354 ? 34.538  52.143  19.029 1.00 93.43  ? 429 HIS A ND1   1 
ATOM   2784 C  CD2   . HIS A 1 354 ? 35.160  50.049  19.001 1.00 101.03 ? 429 HIS A CD2   1 
ATOM   2785 C  CE1   . HIS A 1 354 ? 34.813  51.801  20.275 1.00 93.97  ? 429 HIS A CE1   1 
ATOM   2786 N  NE2   . HIS A 1 354 ? 35.194  50.537  20.285 1.00 100.03 ? 429 HIS A NE2   1 
ATOM   2787 N  N     . TYR A 1 355 ? 33.364  50.237  13.881 1.00 105.77 ? 430 TYR A N     1 
ATOM   2788 C  CA    . TYR A 1 355 ? 33.098  50.514  12.473 1.00 107.71 ? 430 TYR A CA    1 
ATOM   2789 C  C     . TYR A 1 355 ? 31.687  50.090  12.079 1.00 114.75 ? 430 TYR A C     1 
ATOM   2790 O  O     . TYR A 1 355 ? 31.020  50.785  11.303 1.00 114.79 ? 430 TYR A O     1 
ATOM   2791 C  CB    . TYR A 1 355 ? 34.128  49.803  11.593 1.00 102.65 ? 430 TYR A CB    1 
ATOM   2792 C  CG    . TYR A 1 355 ? 35.529  49.799  12.160 1.00 112.40 ? 430 TYR A CG    1 
ATOM   2793 C  CD1   . TYR A 1 355 ? 36.042  48.672  12.791 1.00 113.09 ? 430 TYR A CD1   1 
ATOM   2794 C  CD2   . TYR A 1 355 ? 36.342  50.924  12.065 1.00 117.67 ? 430 TYR A CD2   1 
ATOM   2795 C  CE1   . TYR A 1 355 ? 37.328  48.664  13.310 1.00 115.12 ? 430 TYR A CE1   1 
ATOM   2796 C  CE2   . TYR A 1 355 ? 37.628  50.926  12.582 1.00 113.66 ? 430 TYR A CE2   1 
ATOM   2797 C  CZ    . TYR A 1 355 ? 38.115  49.794  13.203 1.00 114.63 ? 430 TYR A CZ    1 
ATOM   2798 O  OH    . TYR A 1 355 ? 39.392  49.792  13.719 1.00 112.73 ? 430 TYR A OH    1 
ATOM   2799 N  N     . THR A 1 356 ? 31.219  48.951  12.598 1.00 113.28 ? 431 THR A N     1 
ATOM   2800 C  CA    . THR A 1 356 ? 29.875  48.483  12.278 1.00 107.23 ? 431 THR A CA    1 
ATOM   2801 C  C     . THR A 1 356 ? 28.812  49.448  12.788 1.00 109.58 ? 431 THR A C     1 
ATOM   2802 O  O     . THR A 1 356 ? 27.737  49.563  12.187 1.00 118.21 ? 431 THR A O     1 
ATOM   2803 C  CB    . THR A 1 356 ? 29.657  47.084  12.857 1.00 111.13 ? 431 THR A CB    1 
ATOM   2804 O  OG1   . THR A 1 356 ? 30.759  46.241  12.495 1.00 109.56 ? 431 THR A OG1   1 
ATOM   2805 C  CG2   . THR A 1 356 ? 28.368  46.473  12.325 1.00 109.38 ? 431 THR A CG2   1 
ATOM   2806 N  N     . ALA A 1 357 ? 29.088  50.152  13.889 1.00 104.46 ? 432 ALA A N     1 
ATOM   2807 C  CA    . ALA A 1 357 ? 28.185  51.211  14.324 1.00 106.02 ? 432 ALA A CA    1 
ATOM   2808 C  C     . ALA A 1 357 ? 28.213  52.396  13.365 1.00 105.40 ? 432 ALA A C     1 
ATOM   2809 O  O     . ALA A 1 357 ? 27.209  53.100  13.222 1.00 107.60 ? 432 ALA A O     1 
ATOM   2810 C  CB    . ALA A 1 357 ? 28.540  51.660  15.742 1.00 98.57  ? 432 ALA A CB    1 
ATOM   2811 N  N     . PHE A 1 358 ? 29.349  52.633  12.707 1.00 109.41 ? 433 PHE A N     1 
ATOM   2812 C  CA    . PHE A 1 358 ? 29.438  53.698  11.714 1.00 112.01 ? 433 PHE A CA    1 
ATOM   2813 C  C     . PHE A 1 358 ? 28.866  53.267  10.370 1.00 115.89 ? 433 PHE A C     1 
ATOM   2814 O  O     . PHE A 1 358 ? 28.339  54.102  9.625  1.00 122.07 ? 433 PHE A O     1 
ATOM   2815 C  CB    . PHE A 1 358 ? 30.891  54.145  11.551 1.00 110.72 ? 433 PHE A CB    1 
ATOM   2816 C  CG    . PHE A 1 358 ? 31.044  55.485  10.893 1.00 110.14 ? 433 PHE A CG    1 
ATOM   2817 C  CD1   . PHE A 1 358 ? 30.052  56.444  11.007 1.00 114.48 ? 433 PHE A CD1   1 
ATOM   2818 C  CD2   . PHE A 1 358 ? 32.178  55.784  10.154 1.00 109.88 ? 433 PHE A CD2   1 
ATOM   2819 C  CE1   . PHE A 1 358 ? 30.187  57.678  10.399 1.00 114.59 ? 433 PHE A CE1   1 
ATOM   2820 C  CE2   . PHE A 1 358 ? 32.320  57.019  9.545  1.00 110.13 ? 433 PHE A CE2   1 
ATOM   2821 C  CZ    . PHE A 1 358 ? 31.323  57.967  9.669  1.00 113.00 ? 433 PHE A CZ    1 
ATOM   2822 N  N     . PHE A 1 359 ? 28.971  51.977  10.044 1.00 116.41 ? 434 PHE A N     1 
ATOM   2823 C  CA    . PHE A 1 359 ? 28.388  51.468  8.808  1.00 121.18 ? 434 PHE A CA    1 
ATOM   2824 C  C     . PHE A 1 359 ? 26.885  51.704  8.767  1.00 119.80 ? 434 PHE A C     1 
ATOM   2825 O  O     . PHE A 1 359 ? 26.305  51.849  7.684  1.00 122.91 ? 434 PHE A O     1 
ATOM   2826 C  CB    . PHE A 1 359 ? 28.701  49.975  8.669  1.00 122.51 ? 434 PHE A CB    1 
ATOM   2827 C  CG    . PHE A 1 359 ? 28.334  49.390  7.331  1.00 122.77 ? 434 PHE A CG    1 
ATOM   2828 C  CD1   . PHE A 1 359 ? 29.264  49.344  6.304  1.00 124.08 ? 434 PHE A CD1   1 
ATOM   2829 C  CD2   . PHE A 1 359 ? 27.069  48.864  7.108  1.00 119.75 ? 434 PHE A CD2   1 
ATOM   2830 C  CE1   . PHE A 1 359 ? 28.938  48.798  5.075  1.00 129.22 ? 434 PHE A CE1   1 
ATOM   2831 C  CE2   . PHE A 1 359 ? 26.736  48.318  5.880  1.00 120.81 ? 434 PHE A CE2   1 
ATOM   2832 C  CZ    . PHE A 1 359 ? 27.671  48.284  4.863  1.00 129.12 ? 434 PHE A CZ    1 
ATOM   2833 N  N     . PHE A 1 360 ? 26.245  51.760  9.929  1.00 116.46 ? 435 PHE A N     1 
ATOM   2834 C  CA    . PHE A 1 360 ? 24.804  51.927  10.024 1.00 120.88 ? 435 PHE A CA    1 
ATOM   2835 C  C     . PHE A 1 360 ? 24.391  53.394  10.082 1.00 121.50 ? 435 PHE A C     1 
ATOM   2836 O  O     . PHE A 1 360 ? 23.207  53.687  10.281 1.00 123.88 ? 435 PHE A O     1 
ATOM   2837 C  CB    . PHE A 1 360 ? 24.271  51.154  11.235 1.00 121.16 ? 435 PHE A CB    1 
ATOM   2838 C  CG    . PHE A 1 360 ? 24.583  49.676  11.195 1.00 118.65 ? 435 PHE A CG    1 
ATOM   2839 C  CD1   . PHE A 1 360 ? 24.622  48.926  12.359 1.00 114.55 ? 435 PHE A CD1   1 
ATOM   2840 C  CD2   . PHE A 1 360 ? 24.841  49.041  9.988  1.00 116.65 ? 435 PHE A CD2   1 
ATOM   2841 C  CE1   . PHE A 1 360 ? 24.910  47.574  12.319 1.00 117.32 ? 435 PHE A CE1   1 
ATOM   2842 C  CE2   . PHE A 1 360 ? 25.131  47.691  9.944  1.00 116.09 ? 435 PHE A CE2   1 
ATOM   2843 C  CZ    . PHE A 1 360 ? 25.163  46.956  11.109 1.00 118.23 ? 435 PHE A CZ    1 
ATOM   2844 N  N     . TYR A 1 361 ? 25.341  54.317  9.926  1.00 120.63 ? 436 TYR A N     1 
ATOM   2845 C  CA    . TYR A 1 361 ? 25.021  55.728  9.733  1.00 125.84 ? 436 TYR A CA    1 
ATOM   2846 C  C     . TYR A 1 361 ? 24.892  56.001  8.239  1.00 128.55 ? 436 TYR A C     1 
ATOM   2847 O  O     . TYR A 1 361 ? 25.852  55.759  7.496  1.00 128.46 ? 436 TYR A O     1 
ATOM   2848 C  CB    . TYR A 1 361 ? 26.098  56.611  10.344 1.00 120.11 ? 436 TYR A CB    1 
ATOM   2849 C  CG    . TYR A 1 361 ? 25.675  58.044  10.597 1.00 117.86 ? 436 TYR A CG    1 
ATOM   2850 C  CD1   . TYR A 1 361 ? 24.535  58.335  11.335 1.00 116.29 ? 436 TYR A CD1   1 
ATOM   2851 C  CD2   . TYR A 1 361 ? 26.433  59.105  10.122 1.00 116.17 ? 436 TYR A CD2   1 
ATOM   2852 C  CE1   . TYR A 1 361 ? 24.153  59.642  11.576 1.00 115.83 ? 436 TYR A CE1   1 
ATOM   2853 C  CE2   . TYR A 1 361 ? 26.061  60.413  10.360 1.00 109.71 ? 436 TYR A CE2   1 
ATOM   2854 C  CZ    . TYR A 1 361 ? 24.922  60.676  11.085 1.00 111.78 ? 436 TYR A CZ    1 
ATOM   2855 O  OH    . TYR A 1 361 ? 24.549  61.978  11.320 1.00 113.41 ? 436 TYR A OH    1 
ATOM   2856 N  N     . PRO A 1 362 ? 23.750  56.496  7.764  1.00 122.38 ? 437 PRO A N     1 
ATOM   2857 C  CA    . PRO A 1 362 ? 23.445  56.490  6.318  1.00 122.29 ? 437 PRO A CA    1 
ATOM   2858 C  C     . PRO A 1 362 ? 24.543  57.116  5.467  1.00 122.91 ? 437 PRO A C     1 
ATOM   2859 O  O     . PRO A 1 362 ? 24.907  56.550  4.425  1.00 122.97 ? 437 PRO A O     1 
ATOM   2860 C  CB    . PRO A 1 362 ? 22.139  57.290  6.238  1.00 126.25 ? 437 PRO A CB    1 
ATOM   2861 C  CG    . PRO A 1 362 ? 21.469  56.983  7.540  1.00 124.76 ? 437 PRO A CG    1 
ATOM   2862 C  CD    . PRO A 1 362 ? 22.571  56.858  8.570  1.00 119.31 ? 437 PRO A CD    1 
ATOM   2863 N  N     . PRO A 1 363 ? 25.188  58.492  5.916  1.00 122.54 ? 438 PRO A N     1 
ATOM   2864 C  CA    . PRO A 1 363 ? 26.360  58.994  5.162  1.00 126.20 ? 438 PRO A CA    1 
ATOM   2865 C  C     . PRO A 1 363 ? 27.626  58.210  5.478  1.00 122.18 ? 438 PRO A C     1 
ATOM   2866 O  O     . PRO A 1 363 ? 28.610  58.742  5.993  1.00 117.21 ? 438 PRO A O     1 
ATOM   2867 C  CB    . PRO A 1 363 ? 26.435  60.464  5.607  1.00 118.35 ? 438 PRO A CB    1 
ATOM   2868 C  CG    . PRO A 1 363 ? 25.806  60.490  6.931  1.00 120.15 ? 438 PRO A CG    1 
ATOM   2869 C  CD    . PRO A 1 363 ? 24.729  59.458  6.927  1.00 120.14 ? 438 PRO A CD    1 
ATOM   2870 N  N     . ALA A 1 364 ? 27.602  56.914  5.156  1.00 123.95 ? 439 ALA A N     1 
ATOM   2871 C  CA    . ALA A 1 364 ? 28.690  55.987  5.447  1.00 127.76 ? 439 ALA A CA    1 
ATOM   2872 C  C     . ALA A 1 364 ? 29.678  55.840  4.295  1.00 130.96 ? 439 ALA A C     1 
ATOM   2873 O  O     . ALA A 1 364 ? 30.589  55.005  4.375  1.00 132.31 ? 439 ALA A O     1 
ATOM   2874 C  CB    . ALA A 1 364 ? 28.139  54.606  5.814  1.00 128.44 ? 439 ALA A CB    1 
ATOM   2875 N  N     . LEU A 1 365 ? 29.513  56.620  3.225  1.00 128.44 ? 440 LEU A N     1 
ATOM   2876 C  CA    . LEU A 1 365 ? 30.370  56.509  2.051  1.00 125.94 ? 440 LEU A CA    1 
ATOM   2877 C  C     . LEU A 1 365 ? 31.841  56.741  2.365  1.00 132.84 ? 440 LEU A C     1 
ATOM   2878 O  O     . LEU A 1 365 ? 32.688  56.454  1.511  1.00 135.35 ? 440 LEU A O     1 
ATOM   2879 C  CB    . LEU A 1 365 ? 29.932  57.513  0.984  1.00 122.83 ? 440 LEU A CB    1 
ATOM   2880 C  CG    . LEU A 1 365 ? 30.093  58.976  1.400  1.00 121.27 ? 440 LEU A CG    1 
ATOM   2881 C  CD1   . LEU A 1 365 ? 30.529  59.821  0.217  1.00 118.16 ? 440 LEU A CD1   1 
ATOM   2882 C  CD2   . LEU A 1 365 ? 28.800  59.516  2.002  1.00 117.56 ? 440 LEU A CD2   1 
ATOM   2883 N  N     . HIS A 1 366 ? 32.159  57.249  3.556  1.00 134.00 ? 441 HIS A N     1 
ATOM   2884 C  CA    . HIS A 1 366 ? 33.512  57.656  3.916  1.00 139.18 ? 441 HIS A CA    1 
ATOM   2885 C  C     . HIS A 1 366 ? 34.538  56.557  3.679  1.00 145.93 ? 441 HIS A C     1 
ATOM   2886 O  O     . HIS A 1 366 ? 35.394  56.698  2.800  1.00 149.40 ? 441 HIS A O     1 
ATOM   2887 C  CB    . HIS A 1 366 ? 33.551  58.121  5.370  1.00 136.05 ? 441 HIS A CB    1 
ATOM   2888 C  CG    . HIS A 1 366 ? 33.325  59.591  5.529  1.00 133.37 ? 441 HIS A CG    1 
ATOM   2889 N  ND1   . HIS A 1 366 ? 32.185  60.221  5.075  1.00 133.57 ? 441 HIS A ND1   1 
ATOM   2890 C  CD2   . HIS A 1 366 ? 34.100  60.559  6.070  1.00 133.61 ? 441 HIS A CD2   1 
ATOM   2891 C  CE1   . HIS A 1 366 ? 32.264  61.513  5.341  1.00 137.63 ? 441 HIS A CE1   1 
ATOM   2892 N  NE2   . HIS A 1 366 ? 33.417  61.744  5.944  1.00 139.35 ? 441 HIS A NE2   1 
ATOM   2893 N  N     . MET A 1 367 ? 34.471  55.460  4.432  1.00 146.32 ? 442 MET A N     1 
ATOM   2894 C  CA    . MET A 1 367 ? 35.378  54.341  4.195  1.00 149.71 ? 442 MET A CA    1 
ATOM   2895 C  C     . MET A 1 367 ? 34.609  53.280  3.422  1.00 148.31 ? 442 MET A C     1 
ATOM   2896 O  O     . MET A 1 367 ? 33.807  52.531  3.988  1.00 146.41 ? 442 MET A O     1 
ATOM   2897 C  CB    . MET A 1 367 ? 35.938  53.789  5.503  1.00 145.95 ? 442 MET A CB    1 
ATOM   2898 C  CG    . MET A 1 367 ? 37.114  54.580  6.059  1.00 152.29 ? 442 MET A CG    1 
ATOM   2899 S  SD    . MET A 1 367 ? 38.453  54.772  4.863  1.00 156.74 ? 442 MET A SD    1 
ATOM   2900 C  CE    . MET A 1 367 ? 38.273  56.498  4.413  1.00 146.10 ? 442 MET A CE    1 
ATOM   2901 N  N     . GLN A 1 368 ? 34.872  53.222  2.120  1.00 149.51 ? 443 GLN A N     1 
ATOM   2902 C  CA    . GLN A 1 368 ? 34.493  52.113  1.264  1.00 147.53 ? 443 GLN A CA    1 
ATOM   2903 C  C     . GLN A 1 368 ? 35.670  51.182  1.015  1.00 143.47 ? 443 GLN A C     1 
ATOM   2904 O  O     . GLN A 1 368 ? 35.519  50.153  0.348  1.00 144.13 ? 443 GLN A O     1 
ATOM   2905 C  CB    . GLN A 1 368 ? 33.909  52.649  -0.050 1.00 148.07 ? 443 GLN A CB    1 
ATOM   2906 C  CG    . GLN A 1 368 ? 34.816  52.581  -1.259 1.00 145.58 ? 443 GLN A CG    1 
ATOM   2907 C  CD    . GLN A 1 368 ? 34.195  51.750  -2.357 1.00 147.93 ? 443 GLN A CD    1 
ATOM   2908 O  OE1   . GLN A 1 368 ? 33.012  51.409  -2.293 1.00 152.01 ? 443 GLN A OE1   1 
ATOM   2909 N  NE2   . GLN A 1 368 ? 34.986  51.410  -3.368 1.00 143.22 ? 443 GLN A NE2   1 
ATOM   2910 N  N     . GLN A 1 369 ? 36.827  51.513  1.583  1.00 141.77 ? 444 GLN A N     1 
ATOM   2911 C  CA    . GLN A 1 369 ? 38.050  50.729  1.493  1.00 142.22 ? 444 GLN A CA    1 
ATOM   2912 C  C     . GLN A 1 369 ? 37.967  49.562  2.463  1.00 140.87 ? 444 GLN A C     1 
ATOM   2913 O  O     . GLN A 1 369 ? 36.872  49.189  2.897  1.00 138.02 ? 444 GLN A O     1 
ATOM   2914 C  CB    . GLN A 1 369 ? 39.281  51.595  1.771  1.00 143.34 ? 444 GLN A CB    1 
ATOM   2915 C  CG    . GLN A 1 369 ? 39.636  52.536  0.629  1.00 144.82 ? 444 GLN A CG    1 
ATOM   2916 C  CD    . GLN A 1 369 ? 40.890  53.340  0.900  1.00 142.47 ? 444 GLN A CD    1 
ATOM   2917 O  OE1   . GLN A 1 369 ? 41.396  53.364  2.022  1.00 140.03 ? 444 GLN A OE1   1 
ATOM   2918 N  NE2   . GLN A 1 369 ? 41.401  54.005  -0.131 1.00 142.81 ? 444 GLN A NE2   1 
ATOM   2919 N  N     . GLU A 1 370 ? 39.118  48.996  2.824  1.00 140.91 ? 445 GLU A N     1 
ATOM   2920 C  CA    . GLU A 1 370 ? 39.251  47.640  3.347  1.00 142.87 ? 445 GLU A CA    1 
ATOM   2921 C  C     . GLU A 1 370 ? 38.315  47.317  4.509  1.00 141.46 ? 445 GLU A C     1 
ATOM   2922 O  O     . GLU A 1 370 ? 38.226  46.157  4.927  1.00 137.91 ? 445 GLU A O     1 
ATOM   2923 C  CB    . GLU A 1 370 ? 40.697  47.410  3.798  1.00 137.87 ? 445 GLU A CB    1 
ATOM   2924 C  CG    . GLU A 1 370 ? 41.116  48.266  4.997  1.00 142.48 ? 445 GLU A CG    1 
ATOM   2925 C  CD    . GLU A 1 370 ? 41.372  49.723  4.637  1.00 147.26 ? 445 GLU A CD    1 
ATOM   2926 O  OE1   . GLU A 1 370 ? 42.408  50.005  3.997  1.00 145.10 ? 445 GLU A OE1   1 
ATOM   2927 O  OE2   . GLU A 1 370 ? 40.533  50.584  4.985  1.00 142.76 ? 445 GLU A OE2   1 
ATOM   2928 N  N     . LYS A 1 371 ? 37.628  48.322  5.053  1.00 139.51 ? 446 LYS A N     1 
ATOM   2929 C  CA    . LYS A 1 371 ? 36.679  48.074  6.131  1.00 136.10 ? 446 LYS A CA    1 
ATOM   2930 C  C     . LYS A 1 371 ? 35.356  47.477  5.657  1.00 134.08 ? 446 LYS A C     1 
ATOM   2931 O  O     . LYS A 1 371 ? 34.617  46.933  6.484  1.00 132.96 ? 446 LYS A O     1 
ATOM   2932 C  CB    . LYS A 1 371 ? 36.413  49.366  6.905  1.00 132.47 ? 446 LYS A CB    1 
ATOM   2933 C  CG    . LYS A 1 371 ? 37.544  49.724  7.846  1.00 133.57 ? 446 LYS A CG    1 
ATOM   2934 C  CD    . LYS A 1 371 ? 37.980  48.486  8.620  1.00 133.29 ? 446 LYS A CD    1 
ATOM   2935 C  CE    . LYS A 1 371 ? 39.383  48.629  9.185  1.00 132.29 ? 446 LYS A CE    1 
ATOM   2936 N  NZ    . LYS A 1 371 ? 39.435  49.612  10.297 1.00 129.65 ? 446 LYS A NZ    1 
ATOM   2937 N  N     . VAL A 1 372 ? 35.041  47.543  4.362  1.00 134.73 ? 447 VAL A N     1 
ATOM   2938 C  CA    . VAL A 1 372 ? 33.728  47.084  3.909  1.00 133.08 ? 447 VAL A CA    1 
ATOM   2939 C  C     . VAL A 1 372 ? 33.608  45.567  4.025  1.00 127.58 ? 447 VAL A C     1 
ATOM   2940 O  O     . VAL A 1 372 ? 32.587  45.047  4.492  1.00 124.85 ? 447 VAL A O     1 
ATOM   2941 C  CB    . VAL A 1 372 ? 33.446  47.574  2.475  1.00 132.08 ? 447 VAL A CB    1 
ATOM   2942 C  CG1   . VAL A 1 372 ? 34.595  47.228  1.540  1.00 135.32 ? 447 VAL A CG1   1 
ATOM   2943 C  CG2   . VAL A 1 372 ? 32.148  46.979  1.965  1.00 129.74 ? 447 VAL A CG2   1 
ATOM   2944 N  N     . ALA A 1 373 ? 34.644  44.832  3.610  1.00 131.75 ? 448 ALA A N     1 
ATOM   2945 C  CA    . ALA A 1 373 ? 34.575  43.375  3.643  1.00 130.89 ? 448 ALA A CA    1 
ATOM   2946 C  C     . ALA A 1 373 ? 34.539  42.848  5.069  1.00 129.94 ? 448 ALA A C     1 
ATOM   2947 O  O     . ALA A 1 373 ? 33.920  41.810  5.332  1.00 129.69 ? 448 ALA A O     1 
ATOM   2948 C  CB    . ALA A 1 373 ? 35.759  42.774  2.885  1.00 135.42 ? 448 ALA A CB    1 
ATOM   2949 N  N     . GLN A 1 374 ? 35.185  43.547  6.001  1.00 129.22 ? 449 GLN A N     1 
ATOM   2950 C  CA    . GLN A 1 374 ? 35.189  43.093  7.386  1.00 127.61 ? 449 GLN A CA    1 
ATOM   2951 C  C     . GLN A 1 374 ? 33.808  43.221  8.012  1.00 124.47 ? 449 GLN A C     1 
ATOM   2952 O  O     . GLN A 1 374 ? 33.389  42.352  8.786  1.00 123.74 ? 449 GLN A O     1 
ATOM   2953 C  CB    . GLN A 1 374 ? 36.224  43.876  8.192  1.00 127.57 ? 449 GLN A CB    1 
ATOM   2954 C  CG    . GLN A 1 374 ? 37.630  43.789  7.626  1.00 131.22 ? 449 GLN A CG    1 
ATOM   2955 C  CD    . GLN A 1 374 ? 38.664  44.453  8.515  1.00 133.81 ? 449 GLN A CD    1 
ATOM   2956 O  OE1   . GLN A 1 374 ? 39.181  45.524  8.192  1.00 133.45 ? 449 GLN A OE1   1 
ATOM   2957 N  NE2   . GLN A 1 374 ? 38.976  43.815  9.638  1.00 131.94 ? 449 GLN A NE2   1 
ATOM   2958 N  N     . ILE A 1 375 ? 33.086  44.298  7.690  1.00 125.17 ? 450 ILE A N     1 
ATOM   2959 C  CA    . ILE A 1 375 ? 31.713  44.436  8.166  1.00 126.21 ? 450 ILE A CA    1 
ATOM   2960 C  C     . ILE A 1 375 ? 30.850  43.314  7.607  1.00 127.05 ? 450 ILE A C     1 
ATOM   2961 O  O     . ILE A 1 375 ? 29.977  42.776  8.299  1.00 124.90 ? 450 ILE A O     1 
ATOM   2962 C  CB    . ILE A 1 375 ? 31.146  45.819  7.792  1.00 122.50 ? 450 ILE A CB    1 
ATOM   2963 C  CG1   . ILE A 1 375 ? 32.075  46.933  8.267  1.00 118.46 ? 450 ILE A CG1   1 
ATOM   2964 C  CG2   . ILE A 1 375 ? 29.764  46.007  8.397  1.00 118.00 ? 450 ILE A CG2   1 
ATOM   2965 C  CD1   . ILE A 1 375 ? 32.236  46.995  9.761  1.00 115.04 ? 450 ILE A CD1   1 
ATOM   2966 N  N     . LYS A 1 376 ? 31.088  42.939  6.348  1.00 128.11 ? 451 LYS A N     1 
ATOM   2967 C  CA    . LYS A 1 376 ? 30.307  41.884  5.710  1.00 126.81 ? 451 LYS A CA    1 
ATOM   2968 C  C     . LYS A 1 376 ? 30.396  40.587  6.500  1.00 122.15 ? 451 LYS A C     1 
ATOM   2969 O  O     . LYS A 1 376 ? 29.377  40.016  6.900  1.00 122.73 ? 451 LYS A O     1 
ATOM   2970 C  CB    . LYS A 1 376 ? 30.790  41.676  4.274  1.00 127.74 ? 451 LYS A CB    1 
ATOM   2971 C  CG    . LYS A 1 376 ? 30.037  40.604  3.509  1.00 128.15 ? 451 LYS A CG    1 
ATOM   2972 C  CD    . LYS A 1 376 ? 30.571  40.476  2.092  1.00 126.81 ? 451 LYS A CD    1 
ATOM   2973 C  CE    . LYS A 1 376 ? 29.858  39.376  1.327  1.00 130.04 ? 451 LYS A CE    1 
ATOM   2974 N  NZ    . LYS A 1 376 ? 30.454  39.183  -0.022 1.00 123.31 ? 451 LYS A NZ    1 
ATOM   2975 N  N     . GLU A 1 377 ? 31.619  40.112  6.743  1.00 121.28 ? 452 GLU A N     1 
ATOM   2976 C  CA    . GLU A 1 377 ? 31.791  38.888  7.514  1.00 121.04 ? 452 GLU A CA    1 
ATOM   2977 C  C     . GLU A 1 377 ? 31.219  39.031  8.919  1.00 125.78 ? 452 GLU A C     1 
ATOM   2978 O  O     . GLU A 1 377 ? 30.773  38.039  9.510  1.00 130.61 ? 452 GLU A O     1 
ATOM   2979 C  CB    . GLU A 1 377 ? 33.272  38.507  7.554  1.00 116.21 ? 452 GLU A CB    1 
ATOM   2980 C  CG    . GLU A 1 377 ? 33.605  37.345  8.465  1.00 117.19 ? 452 GLU A CG    1 
ATOM   2981 C  CD    . GLU A 1 377 ? 34.293  37.799  9.733  1.00 128.03 ? 452 GLU A CD    1 
ATOM   2982 O  OE1   . GLU A 1 377 ? 35.521  37.596  9.852  1.00 129.60 ? 452 GLU A OE1   1 
ATOM   2983 O  OE2   . GLU A 1 377 ? 33.608  38.379  10.603 1.00 125.70 ? 452 GLU A OE2   1 
ATOM   2984 N  N     . PHE A 1 378 ? 31.182  40.252  9.454  1.00 123.25 ? 453 PHE A N     1 
ATOM   2985 C  CA    . PHE A 1 378 ? 30.662  40.452  10.807 1.00 122.30 ? 453 PHE A CA    1 
ATOM   2986 C  C     . PHE A 1 378 ? 29.135  40.411  10.846 1.00 126.57 ? 453 PHE A C     1 
ATOM   2987 O  O     . PHE A 1 378 ? 28.541  39.455  11.354 1.00 127.26 ? 453 PHE A O     1 
ATOM   2988 C  CB    . PHE A 1 378 ? 31.179  41.772  11.383 1.00 116.04 ? 453 PHE A CB    1 
ATOM   2989 C  CG    . PHE A 1 378 ? 30.547  42.141  12.697 1.00 114.97 ? 453 PHE A CG    1 
ATOM   2990 C  CD1   . PHE A 1 378 ? 30.927  41.514  13.876 1.00 116.12 ? 453 PHE A CD1   1 
ATOM   2991 C  CD2   . PHE A 1 378 ? 29.568  43.116  12.753 1.00 118.25 ? 453 PHE A CD2   1 
ATOM   2992 C  CE1   . PHE A 1 378 ? 30.335  41.861  15.085 1.00 114.64 ? 453 PHE A CE1   1 
ATOM   2993 C  CE2   . PHE A 1 378 ? 28.975  43.463  13.950 1.00 116.83 ? 453 PHE A CE2   1 
ATOM   2994 C  CZ    . PHE A 1 378 ? 29.359  42.838  15.118 1.00 115.65 ? 453 PHE A CZ    1 
ATOM   2995 N  N     . CYS A 1 379 ? 28.480  41.447  10.311 1.00 127.57 ? 454 CYS A N     1 
ATOM   2996 C  CA    . CYS A 1 379 ? 27.028  41.571  10.422 1.00 124.03 ? 454 CYS A CA    1 
ATOM   2997 C  C     . CYS A 1 379 ? 26.281  40.456  9.707  1.00 128.48 ? 454 CYS A C     1 
ATOM   2998 O  O     . CYS A 1 379 ? 25.065  40.338  9.888  1.00 128.96 ? 454 CYS A O     1 
ATOM   2999 C  CB    . CYS A 1 379 ? 26.561  42.928  9.882  1.00 122.29 ? 454 CYS A CB    1 
ATOM   3000 S  SG    . CYS A 1 379 ? 26.965  43.242  8.155  1.00 131.33 ? 454 CYS A SG    1 
ATOM   3001 N  N     . LEU A 1 380 ? 26.961  39.647  8.894  1.00 129.75 ? 455 LEU A N     1 
ATOM   3002 C  CA    . LEU A 1 380 ? 26.287  38.490  8.318  1.00 128.68 ? 455 LEU A CA    1 
ATOM   3003 C  C     . LEU A 1 380 ? 26.082  37.407  9.366  1.00 131.82 ? 455 LEU A C     1 
ATOM   3004 O  O     . LEU A 1 380 ? 25.040  36.741  9.385  1.00 131.45 ? 455 LEU A O     1 
ATOM   3005 C  CB    . LEU A 1 380 ? 27.081  37.941  7.137  1.00 125.74 ? 455 LEU A CB    1 
ATOM   3006 C  CG    . LEU A 1 380 ? 26.370  36.975  6.192  1.00 130.22 ? 455 LEU A CG    1 
ATOM   3007 C  CD1   . LEU A 1 380 ? 25.325  37.705  5.355  1.00 132.41 ? 455 LEU A CD1   1 
ATOM   3008 C  CD2   . LEU A 1 380 ? 27.407  36.302  5.315  1.00 126.68 ? 455 LEU A CD2   1 
ATOM   3009 N  N     . SER A 1 381 ? 27.059  37.233  10.262 1.00 129.24 ? 456 SER A N     1 
ATOM   3010 C  CA    . SER A 1 381 ? 26.978  36.163  11.252 1.00 129.72 ? 456 SER A CA    1 
ATOM   3011 C  C     . SER A 1 381 ? 26.022  36.519  12.388 1.00 131.64 ? 456 SER A C     1 
ATOM   3012 O  O     . SER A 1 381 ? 25.295  35.651  12.884 1.00 134.73 ? 456 SER A O     1 
ATOM   3013 C  CB    . SER A 1 381 ? 28.370  35.848  11.800 1.00 122.39 ? 456 SER A CB    1 
ATOM   3014 O  OG    . SER A 1 381 ? 28.317  34.805  12.752 1.00 115.64 ? 456 SER A OG    1 
ATOM   3015 N  N     . LYS A 1 382 ? 26.000  37.788  12.813 1.00 128.34 ? 457 LYS A N     1 
ATOM   3016 C  CA    . LYS A 1 382 ? 25.114  38.207  13.896 1.00 128.09 ? 457 LYS A CA    1 
ATOM   3017 C  C     . LYS A 1 382 ? 23.660  38.347  13.456 1.00 132.97 ? 457 LYS A C     1 
ATOM   3018 O  O     . LYS A 1 382 ? 22.768  38.345  14.311 1.00 134.18 ? 457 LYS A O     1 
ATOM   3019 C  CB    . LYS A 1 382 ? 25.613  39.524  14.499 1.00 128.92 ? 457 LYS A CB    1 
ATOM   3020 C  CG    . LYS A 1 382 ? 26.630  39.348  15.622 1.00 127.18 ? 457 LYS A CG    1 
ATOM   3021 C  CD    . LYS A 1 382 ? 25.971  38.786  16.872 1.00 127.34 ? 457 LYS A CD    1 
ATOM   3022 C  CE    . LYS A 1 382 ? 26.946  38.723  18.037 1.00 125.47 ? 457 LYS A CE    1 
ATOM   3023 N  NZ    . LYS A 1 382 ? 28.014  37.704  17.834 1.00 125.40 ? 457 LYS A NZ    1 
ATOM   3024 N  N     . MET A 1 383 ? 23.394  38.462  12.152 1.00 134.26 ? 458 MET A N     1 
ATOM   3025 C  CA    . MET A 1 383 ? 22.008  38.508  11.694 1.00 135.97 ? 458 MET A CA    1 
ATOM   3026 C  C     . MET A 1 383 ? 21.355  37.134  11.784 1.00 130.86 ? 458 MET A C     1 
ATOM   3027 O  O     . MET A 1 383 ? 20.180  37.018  12.151 1.00 124.08 ? 458 MET A O     1 
ATOM   3028 C  CB    . MET A 1 383 ? 21.936  39.045  10.265 1.00 136.42 ? 458 MET A CB    1 
ATOM   3029 C  CG    . MET A 1 383 ? 21.876  40.562  10.166 1.00 139.17 ? 458 MET A CG    1 
ATOM   3030 S  SD    . MET A 1 383 ? 21.847  41.144  8.458  1.00 152.84 ? 458 MET A SD    1 
ATOM   3031 C  CE    . MET A 1 383 ? 20.364  40.347  7.848  1.00 144.23 ? 458 MET A CE    1 
ATOM   3032 N  N     . GLU A 1 384 ? 22.096  36.082  11.439 1.00 132.72 ? 459 GLU A N     1 
ATOM   3033 C  CA    . GLU A 1 384 ? 21.589  34.736  11.665 1.00 131.23 ? 459 GLU A CA    1 
ATOM   3034 C  C     . GLU A 1 384 ? 21.602  34.391  13.146 1.00 131.18 ? 459 GLU A C     1 
ATOM   3035 O  O     . GLU A 1 384 ? 20.774  33.596  13.604 1.00 129.94 ? 459 GLU A O     1 
ATOM   3036 C  CB    . GLU A 1 384 ? 22.411  33.721  10.872 1.00 128.92 ? 459 GLU A CB    1 
ATOM   3037 C  CG    . GLU A 1 384 ? 22.204  33.800  9.370  1.00 130.08 ? 459 GLU A CG    1 
ATOM   3038 C  CD    . GLU A 1 384 ? 23.059  32.803  8.614  1.00 141.21 ? 459 GLU A CD    1 
ATOM   3039 O  OE1   . GLU A 1 384 ? 24.083  33.218  8.032  1.00 143.90 ? 459 GLU A OE1   1 
ATOM   3040 O  OE2   . GLU A 1 384 ? 22.713  31.602  8.608  1.00 145.37 ? 459 GLU A OE2   1 
ATOM   3041 N  N     . ASP A 1 385 ? 22.524  34.987  13.906 1.00 129.12 ? 460 ASP A N     1 
ATOM   3042 C  CA    . ASP A 1 385 ? 22.576  34.739  15.341 1.00 129.06 ? 460 ASP A CA    1 
ATOM   3043 C  C     . ASP A 1 385 ? 21.382  35.352  16.059 1.00 125.17 ? 460 ASP A C     1 
ATOM   3044 O  O     . ASP A 1 385 ? 20.913  34.794  17.056 1.00 123.10 ? 460 ASP A O     1 
ATOM   3045 C  CB    . ASP A 1 385 ? 23.883  35.276  15.920 1.00 133.81 ? 460 ASP A CB    1 
ATOM   3046 C  CG    . ASP A 1 385 ? 24.169  34.737  17.307 1.00 139.17 ? 460 ASP A CG    1 
ATOM   3047 O  OD1   . ASP A 1 385 ? 23.489  33.772  17.724 1.00 132.46 ? 460 ASP A OD1   1 
ATOM   3048 O  OD2   . ASP A 1 385 ? 25.083  35.270  17.975 1.00 143.80 ? 460 ASP A OD2   1 
ATOM   3049 N  N     . LEU A 1 386 ? 20.883  36.497  15.582 1.00 126.87 ? 461 LEU A N     1 
ATOM   3050 C  CA    . LEU A 1 386 ? 19.622  37.016  16.096 1.00 127.46 ? 461 LEU A CA    1 
ATOM   3051 C  C     . LEU A 1 386 ? 18.426  36.290  15.500 1.00 124.89 ? 461 LEU A C     1 
ATOM   3052 O  O     . LEU A 1 386 ? 17.345  36.307  16.097 1.00 121.72 ? 461 LEU A O     1 
ATOM   3053 C  CB    . LEU A 1 386 ? 19.509  38.525  15.842 1.00 128.67 ? 461 LEU A CB    1 
ATOM   3054 C  CG    . LEU A 1 386 ? 19.573  39.088  14.419 1.00 131.77 ? 461 LEU A CG    1 
ATOM   3055 C  CD1   . LEU A 1 386 ? 18.215  39.065  13.717 1.00 127.79 ? 461 LEU A CD1   1 
ATOM   3056 C  CD2   . LEU A 1 386 ? 20.145  40.498  14.437 1.00 129.74 ? 461 LEU A CD2   1 
ATOM   3057 N  N     . GLU A 1 387 ? 18.599  35.658  14.337 1.00 127.34 ? 462 GLU A N     1 
ATOM   3058 C  CA    . GLU A 1 387 ? 17.558  34.789  13.803 1.00 125.89 ? 462 GLU A CA    1 
ATOM   3059 C  C     . GLU A 1 387 ? 17.493  33.470  14.559 1.00 123.95 ? 462 GLU A C     1 
ATOM   3060 O  O     . GLU A 1 387 ? 16.420  32.863  14.650 1.00 116.63 ? 462 GLU A O     1 
ATOM   3061 C  CB    . GLU A 1 387 ? 17.792  34.537  12.315 1.00 125.37 ? 462 GLU A CB    1 
ATOM   3062 C  CG    . GLU A 1 387 ? 16.920  35.383  11.411 1.00 125.97 ? 462 GLU A CG    1 
ATOM   3063 C  CD    . GLU A 1 387 ? 15.461  35.333  11.816 1.00 127.94 ? 462 GLU A CD    1 
ATOM   3064 O  OE1   . GLU A 1 387 ? 14.993  36.276  12.489 1.00 124.12 ? 462 GLU A OE1   1 
ATOM   3065 O  OE2   . GLU A 1 387 ? 14.785  34.340  11.475 1.00 130.23 ? 462 GLU A OE2   1 
ATOM   3066 N  N     . LEU A 1 388 ? 18.627  33.010  15.098 1.00 125.07 ? 463 LEU A N     1 
ATOM   3067 C  CA    . LEU A 1 388 ? 18.616  31.838  15.966 1.00 121.52 ? 463 LEU A CA    1 
ATOM   3068 C  C     . LEU A 1 388 ? 17.714  32.048  17.174 1.00 123.21 ? 463 LEU A C     1 
ATOM   3069 O  O     . LEU A 1 388 ? 17.159  31.083  17.708 1.00 125.14 ? 463 LEU A O     1 
ATOM   3070 C  CB    . LEU A 1 388 ? 20.037  31.507  16.431 1.00 124.97 ? 463 LEU A CB    1 
ATOM   3071 C  CG    . LEU A 1 388 ? 20.771  30.309  15.821 1.00 129.43 ? 463 LEU A CG    1 
ATOM   3072 C  CD1   . LEU A 1 388 ? 21.393  30.652  14.475 1.00 126.05 ? 463 LEU A CD1   1 
ATOM   3073 C  CD2   . LEU A 1 388 ? 21.827  29.779  16.781 1.00 132.13 ? 463 LEU A CD2   1 
ATOM   3074 N  N     . ILE A 1 389 ? 17.564  33.296  17.622 1.00 124.78 ? 464 ILE A N     1 
ATOM   3075 C  CA    . ILE A 1 389 ? 16.769  33.575  18.814 1.00 122.95 ? 464 ILE A CA    1 
ATOM   3076 C  C     . ILE A 1 389 ? 15.282  33.621  18.488 1.00 122.60 ? 464 ILE A C     1 
ATOM   3077 O  O     . ILE A 1 389 ? 14.456  33.083  19.236 1.00 123.06 ? 464 ILE A O     1 
ATOM   3078 C  CB    . ILE A 1 389 ? 17.234  34.887  19.467 1.00 124.65 ? 464 ILE A CB    1 
ATOM   3079 C  CG1   . ILE A 1 389 ? 18.746  35.057  19.312 1.00 129.47 ? 464 ILE A CG1   1 
ATOM   3080 C  CG2   . ILE A 1 389 ? 16.847  34.900  20.934 1.00 122.49 ? 464 ILE A CG2   1 
ATOM   3081 C  CD1   . ILE A 1 389 ? 19.236  36.467  19.585 1.00 124.61 ? 464 ILE A CD1   1 
ATOM   3082 N  N     . ASN A 1 390 ? 14.911  34.272  17.382 1.00 124.80 ? 465 ASN A N     1 
ATOM   3083 C  CA    . ASN A 1 390 ? 13.497  34.470  17.081 1.00 126.84 ? 465 ASN A CA    1 
ATOM   3084 C  C     . ASN A 1 390 ? 12.802  33.179  16.675 1.00 121.27 ? 465 ASN A C     1 
ATOM   3085 O  O     . ASN A 1 390 ? 11.576  33.091  16.792 1.00 116.47 ? 465 ASN A O     1 
ATOM   3086 C  CB    . ASN A 1 390 ? 13.328  35.523  15.984 1.00 127.20 ? 465 ASN A CB    1 
ATOM   3087 C  CG    . ASN A 1 390 ? 13.704  36.915  16.453 1.00 129.17 ? 465 ASN A CG    1 
ATOM   3088 O  OD1   . ASN A 1 390 ? 14.384  37.660  15.746 1.00 129.99 ? 465 ASN A OD1   1 
ATOM   3089 N  ND2   . ASN A 1 390 ? 13.269  37.270  17.659 1.00 124.00 ? 465 ASN A ND2   1 
ATOM   3090 N  N     . ARG A 1 391 ? 13.553  32.182  16.202 1.00 123.65 ? 466 ARG A N     1 
ATOM   3091 C  CA    . ARG A 1 391 ? 12.956  30.877  15.939 1.00 117.11 ? 466 ARG A CA    1 
ATOM   3092 C  C     . ARG A 1 391 ? 12.638  30.150  17.238 1.00 115.71 ? 466 ARG A C     1 
ATOM   3093 O  O     . ARG A 1 391 ? 11.630  29.440  17.329 1.00 107.48 ? 466 ARG A O     1 
ATOM   3094 C  CB    . ARG A 1 391 ? 13.888  30.041  15.063 1.00 115.34 ? 466 ARG A CB    1 
ATOM   3095 C  CG    . ARG A 1 391 ? 13.982  30.544  13.641 1.00 117.49 ? 466 ARG A CG    1 
ATOM   3096 C  CD    . ARG A 1 391 ? 12.617  30.516  12.983 1.00 122.19 ? 466 ARG A CD    1 
ATOM   3097 N  NE    . ARG A 1 391 ? 12.591  31.257  11.727 1.00 132.33 ? 466 ARG A NE    1 
ATOM   3098 C  CZ    . ARG A 1 391 ? 13.043  30.781  10.572 1.00 134.46 ? 466 ARG A CZ    1 
ATOM   3099 N  NH1   . ARG A 1 391 ? 13.564  29.564  10.517 1.00 132.58 ? 466 ARG A NH1   1 
ATOM   3100 N  NH2   . ARG A 1 391 ? 12.978  31.525  9.476  1.00 140.87 ? 466 ARG A NH2   1 
ATOM   3101 N  N     . MET A 1 392 ? 13.482  30.329  18.259 1.00 117.41 ? 467 MET A N     1 
ATOM   3102 C  CA    . MET A 1 392 ? 13.229  29.788  19.590 1.00 116.83 ? 467 MET A CA    1 
ATOM   3103 C  C     . MET A 1 392 ? 12.026  30.425  20.268 1.00 120.35 ? 467 MET A C     1 
ATOM   3104 O  O     . MET A 1 392 ? 11.645  29.982  21.356 1.00 116.48 ? 467 MET A O     1 
ATOM   3105 C  CB    . MET A 1 392 ? 14.461  29.966  20.477 1.00 117.14 ? 467 MET A CB    1 
ATOM   3106 C  CG    . MET A 1 392 ? 15.678  29.249  19.954 1.00 121.02 ? 467 MET A CG    1 
ATOM   3107 S  SD    . MET A 1 392 ? 15.218  27.642  19.293 1.00 111.32 ? 467 MET A SD    1 
ATOM   3108 C  CE    . MET A 1 392 ? 16.198  27.641  17.799 1.00 112.61 ? 467 MET A CE    1 
ATOM   3109 N  N     . SER A 1 393 ? 11.434  31.450  19.662 1.00 122.01 ? 468 SER A N     1 
ATOM   3110 C  CA    . SER A 1 393 ? 10.318  32.183  20.237 1.00 115.33 ? 468 SER A CA    1 
ATOM   3111 C  C     . SER A 1 393 ? 8.967   31.562  19.896 1.00 115.39 ? 468 SER A C     1 
ATOM   3112 O  O     . SER A 1 393 ? 7.931   32.122  20.260 1.00 121.79 ? 468 SER A O     1 
ATOM   3113 C  CB    . SER A 1 393 ? 10.364  33.641  19.767 1.00 110.61 ? 468 SER A CB    1 
ATOM   3114 O  OG    . SER A 1 393 ? 9.716   34.500  20.688 1.00 113.16 ? 468 SER A OG    1 
ATOM   3115 N  N     . SER A 1 394 ? 8.949   30.419  19.220 1.00 116.15 ? 469 SER A N     1 
ATOM   3116 C  CA    . SER A 1 394 ? 7.696   29.750  18.892 1.00 110.29 ? 469 SER A CA    1 
ATOM   3117 C  C     . SER A 1 394 ? 7.142   29.071  20.138 1.00 113.77 ? 469 SER A C     1 
ATOM   3118 O  O     . SER A 1 394 ? 7.785   28.177  20.703 1.00 112.41 ? 469 SER A O     1 
ATOM   3119 C  CB    . SER A 1 394 ? 7.912   28.724  17.783 1.00 106.80 ? 469 SER A CB    1 
ATOM   3120 O  OG    . SER A 1 394 ? 8.608   27.595  18.281 1.00 109.46 ? 469 SER A OG    1 
ATOM   3121 N  N     . PHE A 1 395 ? 5.940   29.473  20.544 1.00 119.08 ? 470 PHE A N     1 
ATOM   3122 C  CA    . PHE A 1 395 ? 5.300   28.932  21.738 1.00 118.92 ? 470 PHE A CA    1 
ATOM   3123 C  C     . PHE A 1 395 ? 3.784   29.052  21.658 1.00 119.08 ? 470 PHE A C     1 
ATOM   3124 O  O     . PHE A 1 395 ? 3.072   28.048  21.702 1.00 117.07 ? 470 PHE A O     1 
ATOM   3125 C  CB    . PHE A 1 395 ? 5.819   29.638  22.994 1.00 116.84 ? 470 PHE A CB    1 
ATOM   3126 C  CG    . PHE A 1 395 ? 7.241   29.297  23.331 1.00 117.84 ? 470 PHE A CG    1 
ATOM   3127 C  CD1   . PHE A 1 395 ? 8.247   30.238  23.185 1.00 120.26 ? 470 PHE A CD1   1 
ATOM   3128 C  CD2   . PHE A 1 395 ? 7.577   28.023  23.764 1.00 116.31 ? 470 PHE A CD2   1 
ATOM   3129 C  CE1   . PHE A 1 395 ? 9.560   29.922  23.488 1.00 124.78 ? 470 PHE A CE1   1 
ATOM   3130 C  CE2   . PHE A 1 395 ? 8.889   27.699  24.064 1.00 122.39 ? 470 PHE A CE2   1 
ATOM   3131 C  CZ    . PHE A 1 395 ? 9.883   28.651  23.925 1.00 125.54 ? 470 PHE A CZ    1 
ATOM   3132 N  N     . PRO A 1 422 ? 14.008  34.753  -1.336 1.00 148.18 ? 517 PRO A N     1 
ATOM   3133 C  CA    . PRO A 1 422 ? 13.365  35.469  -0.230 1.00 149.54 ? 517 PRO A CA    1 
ATOM   3134 C  C     . PRO A 1 422 ? 14.309  36.415  0.536  1.00 150.05 ? 517 PRO A C     1 
ATOM   3135 O  O     . PRO A 1 422 ? 14.486  36.285  1.747  1.00 148.97 ? 517 PRO A O     1 
ATOM   3136 C  CB    . PRO A 1 422 ? 12.864  34.328  0.652  1.00 151.24 ? 517 PRO A CB    1 
ATOM   3137 C  CG    . PRO A 1 422 ? 12.464  33.272  -0.358 1.00 143.32 ? 517 PRO A CG    1 
ATOM   3138 C  CD    . PRO A 1 422 ? 13.455  33.395  -1.503 1.00 145.54 ? 517 PRO A CD    1 
ATOM   3139 N  N     . VAL A 1 423 ? 14.934  37.316  -0.227 1.00 155.32 ? 518 VAL A N     1 
ATOM   3140 C  CA    . VAL A 1 423 ? 15.564  38.576  0.186  1.00 153.78 ? 518 VAL A CA    1 
ATOM   3141 C  C     . VAL A 1 423 ? 16.928  38.426  0.859  1.00 150.07 ? 518 VAL A C     1 
ATOM   3142 O  O     . VAL A 1 423 ? 17.707  39.386  0.869  1.00 146.34 ? 518 VAL A O     1 
ATOM   3143 C  CB    . VAL A 1 423 ? 14.617  39.392  1.092  1.00 148.61 ? 518 VAL A CB    1 
ATOM   3144 C  CG1   . VAL A 1 423 ? 14.950  39.190  2.562  1.00 143.31 ? 518 VAL A CG1   1 
ATOM   3145 C  CG2   . VAL A 1 423 ? 14.692  40.870  0.730  1.00 142.48 ? 518 VAL A CG2   1 
ATOM   3146 N  N     . SER A 1 424 ? 17.251  37.242  1.435  1.00 150.46 ? 519 SER A N     1 
ATOM   3147 C  CA    . SER A 1 424 ? 18.605  36.790  1.740  1.00 149.85 ? 519 SER A CA    1 
ATOM   3148 C  C     . SER A 1 424 ? 19.221  37.630  2.835  1.00 149.52 ? 519 SER A C     1 
ATOM   3149 O  O     . SER A 1 424 ? 18.892  38.802  3.028  1.00 139.36 ? 519 SER A O     1 
ATOM   3150 C  CB    . SER A 1 424 ? 19.484  36.781  0.465  1.00 150.69 ? 519 SER A CB    1 
ATOM   3151 O  OG    . SER A 1 424 ? 20.838  36.394  0.725  1.00 150.13 ? 519 SER A OG    1 
ATOM   3152 N  N     . PRO A 1 425 ? 20.194  37.079  3.631  1.00 151.59 ? 520 PRO A N     1 
ATOM   3153 C  CA    . PRO A 1 425 ? 21.071  37.958  4.431  1.00 149.10 ? 520 PRO A CA    1 
ATOM   3154 C  C     . PRO A 1 425 ? 22.063  38.755  3.597  1.00 148.33 ? 520 PRO A C     1 
ATOM   3155 O  O     . PRO A 1 425 ? 22.244  39.958  3.832  1.00 146.99 ? 520 PRO A O     1 
ATOM   3156 C  CB    . PRO A 1 425 ? 21.790  36.977  5.371  1.00 147.42 ? 520 PRO A CB    1 
ATOM   3157 C  CG    . PRO A 1 425 ? 20.905  35.759  5.415  1.00 147.84 ? 520 PRO A CG    1 
ATOM   3158 C  CD    . PRO A 1 425 ? 20.321  35.667  4.032  1.00 150.68 ? 520 PRO A CD    1 
ATOM   3159 N  N     . SER A 1 426 ? 22.713  38.117  2.620  1.00 147.33 ? 521 SER A N     1 
ATOM   3160 C  CA    . SER A 1 426 ? 23.766  38.789  1.864  1.00 142.36 ? 521 SER A CA    1 
ATOM   3161 C  C     . SER A 1 426 ? 23.202  39.723  0.805  1.00 141.85 ? 521 SER A C     1 
ATOM   3162 O  O     . SER A 1 426 ? 23.846  40.717  0.457  1.00 140.38 ? 521 SER A O     1 
ATOM   3163 C  CB    . SER A 1 426 ? 24.696  37.763  1.215  1.00 139.22 ? 521 SER A CB    1 
ATOM   3164 O  OG    . SER A 1 426 ? 25.573  37.182  2.165  1.00 136.42 ? 521 SER A OG    1 
ATOM   3165 N  N     . ASP A 1 427 ? 22.019  39.415  0.272  1.00 147.16 ? 522 ASP A N     1 
ATOM   3166 C  CA    . ASP A 1 427 ? 21.347  40.350  -0.622 1.00 149.55 ? 522 ASP A CA    1 
ATOM   3167 C  C     . ASP A 1 427 ? 21.086  41.677  0.080  1.00 148.08 ? 522 ASP A C     1 
ATOM   3168 O  O     . ASP A 1 427 ? 21.139  42.742  -0.544 1.00 145.22 ? 522 ASP A O     1 
ATOM   3169 C  CB    . ASP A 1 427 ? 20.036  39.741  -1.120 1.00 151.29 ? 522 ASP A CB    1 
ATOM   3170 C  CG    . ASP A 1 427 ? 19.948  39.676  -2.629 1.00 154.40 ? 522 ASP A CG    1 
ATOM   3171 O  OD1   . ASP A 1 427 ? 20.574  38.777  -3.232 1.00 155.49 ? 522 ASP A OD1   1 
ATOM   3172 O  OD2   . ASP A 1 427 ? 19.230  40.517  -3.208 1.00 154.52 ? 522 ASP A OD2   1 
ATOM   3173 N  N     . GLU A 1 428 ? 20.812  41.629  1.384  1.00 147.60 ? 523 GLU A N     1 
ATOM   3174 C  CA    . GLU A 1 428 ? 20.551  42.829  2.165  1.00 145.99 ? 523 GLU A CA    1 
ATOM   3175 C  C     . GLU A 1 428 ? 21.813  43.632  2.449  1.00 145.39 ? 523 GLU A C     1 
ATOM   3176 O  O     . GLU A 1 428 ? 21.722  44.842  2.684  1.00 143.19 ? 523 GLU A O     1 
ATOM   3177 C  CB    . GLU A 1 428 ? 19.869  42.457  3.486  1.00 146.08 ? 523 GLU A CB    1 
ATOM   3178 C  CG    . GLU A 1 428 ? 19.251  43.639  4.194  1.00 147.23 ? 523 GLU A CG    1 
ATOM   3179 C  CD    . GLU A 1 428 ? 18.594  44.593  3.222  1.00 145.57 ? 523 GLU A CD    1 
ATOM   3180 O  OE1   . GLU A 1 428 ? 19.114  45.714  3.040  1.00 141.09 ? 523 GLU A OE1   1 
ATOM   3181 O  OE2   . GLU A 1 428 ? 17.573  44.206  2.618  1.00 150.34 ? 523 GLU A OE2   1 
ATOM   3182 N  N     . PHE A 1 429 ? 22.985  42.992  2.431  1.00 147.21 ? 524 PHE A N     1 
ATOM   3183 C  CA    . PHE A 1 429 ? 24.222  43.717  2.705  1.00 147.87 ? 524 PHE A CA    1 
ATOM   3184 C  C     . PHE A 1 429 ? 24.510  44.747  1.616  1.00 145.40 ? 524 PHE A C     1 
ATOM   3185 O  O     . PHE A 1 429 ? 24.797  45.913  1.911  1.00 141.61 ? 524 PHE A O     1 
ATOM   3186 C  CB    . PHE A 1 429 ? 25.390  42.739  2.847  1.00 146.13 ? 524 PHE A CB    1 
ATOM   3187 C  CG    . PHE A 1 429 ? 26.699  43.404  3.176  1.00 142.59 ? 524 PHE A CG    1 
ATOM   3188 C  CD1   . PHE A 1 429 ? 26.953  43.867  4.457  1.00 139.05 ? 524 PHE A CD1   1 
ATOM   3189 C  CD2   . PHE A 1 429 ? 27.676  43.564  2.206  1.00 143.05 ? 524 PHE A CD2   1 
ATOM   3190 C  CE1   . PHE A 1 429 ? 28.155  44.480  4.765  1.00 135.01 ? 524 PHE A CE1   1 
ATOM   3191 C  CE2   . PHE A 1 429 ? 28.883  44.176  2.506  1.00 137.42 ? 524 PHE A CE2   1 
ATOM   3192 C  CZ    . PHE A 1 429 ? 29.120  44.636  3.788  1.00 134.31 ? 524 PHE A CZ    1 
ATOM   3193 N  N     . GLU A 1 430 ? 24.433  44.334  0.349  1.00 145.50 ? 525 GLU A N     1 
ATOM   3194 C  CA    . GLU A 1 430 ? 24.651  45.272  -0.747 1.00 141.09 ? 525 GLU A CA    1 
ATOM   3195 C  C     . GLU A 1 430 ? 23.467  46.215  -0.929 1.00 141.10 ? 525 GLU A C     1 
ATOM   3196 O  O     . GLU A 1 430 ? 23.641  47.328  -1.440 1.00 140.17 ? 525 GLU A O     1 
ATOM   3197 C  CB    . GLU A 1 430 ? 24.923  44.515  -2.048 1.00 142.15 ? 525 GLU A CB    1 
ATOM   3198 C  CG    . GLU A 1 430 ? 26.368  44.091  -2.250 1.00 142.59 ? 525 GLU A CG    1 
ATOM   3199 C  CD    . GLU A 1 430 ? 26.816  43.013  -1.282 1.00 145.73 ? 525 GLU A CD    1 
ATOM   3200 O  OE1   . GLU A 1 430 ? 25.970  42.192  -0.870 1.00 144.73 ? 525 GLU A OE1   1 
ATOM   3201 O  OE2   . GLU A 1 430 ? 28.016  42.987  -0.933 1.00 147.35 ? 525 GLU A OE2   1 
ATOM   3202 N  N     . PHE A 1 431 ? 22.266  45.786  -0.529 1.00 143.50 ? 526 PHE A N     1 
ATOM   3203 C  CA    . PHE A 1 431 ? 21.075  46.619  -0.681 1.00 141.90 ? 526 PHE A CA    1 
ATOM   3204 C  C     . PHE A 1 431 ? 21.235  47.947  0.048  1.00 135.76 ? 526 PHE A C     1 
ATOM   3205 O  O     . PHE A 1 431 ? 21.009  49.018  -0.527 1.00 132.19 ? 526 PHE A O     1 
ATOM   3206 C  CB    . PHE A 1 431 ? 19.841  45.872  -0.163 1.00 145.08 ? 526 PHE A CB    1 
ATOM   3207 C  CG    . PHE A 1 431 ? 19.056  45.156  -1.236 1.00 148.16 ? 526 PHE A CG    1 
ATOM   3208 C  CD1   . PHE A 1 431 ? 18.117  44.191  -0.896 1.00 143.76 ? 526 PHE A CD1   1 
ATOM   3209 C  CD2   . PHE A 1 431 ? 19.247  45.452  -2.577 1.00 149.32 ? 526 PHE A CD2   1 
ATOM   3210 C  CE1   . PHE A 1 431 ? 17.389  43.532  -1.873 1.00 137.99 ? 526 PHE A CE1   1 
ATOM   3211 C  CE2   . PHE A 1 431 ? 18.520  44.795  -3.560 1.00 144.85 ? 526 PHE A CE2   1 
ATOM   3212 C  CZ    . PHE A 1 431 ? 17.590  43.835  -3.206 1.00 138.06 ? 526 PHE A CZ    1 
ATOM   3213 N  N     . TYR A 1 432 ? 21.625  47.895  1.322  1.00 134.23 ? 527 TYR A N     1 
ATOM   3214 C  CA    . TYR A 1 432 ? 21.791  49.119  2.096  1.00 132.52 ? 527 TYR A CA    1 
ATOM   3215 C  C     . TYR A 1 432 ? 22.961  49.956  1.591  1.00 130.83 ? 527 TYR A C     1 
ATOM   3216 O  O     . TYR A 1 432 ? 22.959  51.180  1.758  1.00 126.75 ? 527 TYR A O     1 
ATOM   3217 C  CB    . TYR A 1 432 ? 21.976  48.775  3.574  1.00 129.68 ? 527 TYR A CB    1 
ATOM   3218 C  CG    . TYR A 1 432 ? 22.220  49.970  4.468  1.00 130.11 ? 527 TYR A CG    1 
ATOM   3219 C  CD1   . TYR A 1 432 ? 21.173  50.797  4.857  1.00 127.36 ? 527 TYR A CD1   1 
ATOM   3220 C  CD2   . TYR A 1 432 ? 23.497  50.267  4.930  1.00 128.93 ? 527 TYR A CD2   1 
ATOM   3221 C  CE1   . TYR A 1 432 ? 21.391  51.890  5.676  1.00 124.31 ? 527 TYR A CE1   1 
ATOM   3222 C  CE2   . TYR A 1 432 ? 23.725  51.358  5.751  1.00 127.52 ? 527 TYR A CE2   1 
ATOM   3223 C  CZ    . TYR A 1 432 ? 22.668  52.166  6.121  1.00 128.87 ? 527 TYR A CZ    1 
ATOM   3224 O  OH    . TYR A 1 432 ? 22.890  53.253  6.936  1.00 125.73 ? 527 TYR A OH    1 
ATOM   3225 N  N     . ARG A 1 433 ? 23.954  49.321  0.960  1.00 135.85 ? 528 ARG A N     1 
ATOM   3226 C  CA    . ARG A 1 433 ? 25.169  50.028  0.567  1.00 134.96 ? 528 ARG A CA    1 
ATOM   3227 C  C     . ARG A 1 433 ? 24.911  51.134  -0.448 1.00 134.31 ? 528 ARG A C     1 
ATOM   3228 O  O     . ARG A 1 433 ? 25.731  52.051  -0.566 1.00 135.19 ? 528 ARG A O     1 
ATOM   3229 C  CB    . ARG A 1 433 ? 26.199  49.045  0.003  1.00 129.71 ? 528 ARG A CB    1 
ATOM   3230 C  CG    . ARG A 1 433 ? 26.885  48.200  1.061  1.00 134.32 ? 528 ARG A CG    1 
ATOM   3231 C  CD    . ARG A 1 433 ? 28.274  47.767  0.616  1.00 137.95 ? 528 ARG A CD    1 
ATOM   3232 N  NE    . ARG A 1 433 ? 28.241  46.775  -0.456 1.00 142.25 ? 528 ARG A NE    1 
ATOM   3233 C  CZ    . ARG A 1 433 ? 29.310  46.396  -1.148 1.00 139.53 ? 528 ARG A CZ    1 
ATOM   3234 N  NH1   . ARG A 1 433 ? 30.492  46.934  -0.887 1.00 137.61 ? 528 ARG A NH1   1 
ATOM   3235 N  NH2   . ARG A 1 433 ? 29.202  45.488  -2.107 1.00 136.33 ? 528 ARG A NH2   1 
ATOM   3236 N  N     . LYS A 1 434 ? 23.805  51.075  -1.184 1.00 130.43 ? 529 LYS A N     1 
ATOM   3237 C  CA    . LYS A 1 434 ? 23.528  52.081  -2.199 1.00 130.06 ? 529 LYS A CA    1 
ATOM   3238 C  C     . LYS A 1 434 ? 22.689  53.247  -1.681 1.00 131.60 ? 529 LYS A C     1 
ATOM   3239 O  O     . LYS A 1 434 ? 22.563  54.256  -2.382 1.00 133.61 ? 529 LYS A O     1 
ATOM   3240 C  CB    . LYS A 1 434 ? 22.837  51.422  -3.401 1.00 133.39 ? 529 LYS A CB    1 
ATOM   3241 C  CG    . LYS A 1 434 ? 22.770  52.284  -4.654 1.00 135.35 ? 529 LYS A CG    1 
ATOM   3242 C  CD    . LYS A 1 434 ? 24.117  52.901  -4.986 1.00 124.35 ? 529 LYS A CD    1 
ATOM   3243 C  CE    . LYS A 1 434 ? 23.976  53.935  -6.089 1.00 120.23 ? 529 LYS A CE    1 
ATOM   3244 N  NZ    . LYS A 1 434 ? 25.257  54.638  -6.353 1.00 126.97 ? 529 LYS A NZ    1 
ATOM   3245 N  N     . GLU A 1 435 ? 22.141  53.151  -0.471 1.00 131.72 ? 530 GLU A N     1 
ATOM   3246 C  CA    . GLU A 1 435 ? 21.311  54.226  0.061  1.00 130.92 ? 530 GLU A CA    1 
ATOM   3247 C  C     . GLU A 1 435 ? 22.135  55.490  0.288  1.00 130.42 ? 530 GLU A C     1 
ATOM   3248 O  O     . GLU A 1 435 ? 23.285  55.432  0.734  1.00 130.14 ? 530 GLU A O     1 
ATOM   3249 C  CB    . GLU A 1 435 ? 20.643  53.790  1.368  1.00 126.71 ? 530 GLU A CB    1 
ATOM   3250 C  CG    . GLU A 1 435 ? 19.167  53.416  1.240  1.00 125.67 ? 530 GLU A CG    1 
ATOM   3251 C  CD    . GLU A 1 435 ? 18.241  54.624  1.275  1.00 125.52 ? 530 GLU A CD    1 
ATOM   3252 O  OE1   . GLU A 1 435 ? 18.672  55.728  0.883  1.00 126.86 ? 530 GLU A OE1   1 
ATOM   3253 O  OE2   . GLU A 1 435 ? 17.077  54.467  1.705  1.00 120.94 ? 530 GLU A OE2   1 
ATOM   3254 N  N     . ILE A 1 436 ? 21.538  56.638  -0.026 1.00 127.47 ? 531 ILE A N     1 
ATOM   3255 C  CA    . ILE A 1 436 ? 22.196  57.937  0.084  1.00 126.52 ? 531 ILE A CA    1 
ATOM   3256 C  C     . ILE A 1 436 ? 21.245  58.893  0.788  1.00 126.34 ? 531 ILE A C     1 
ATOM   3257 O  O     . ILE A 1 436 ? 20.115  59.101  0.328  1.00 129.19 ? 531 ILE A O     1 
ATOM   3258 C  CB    . ILE A 1 436 ? 22.602  58.497  -1.289 1.00 123.75 ? 531 ILE A CB    1 
ATOM   3259 C  CG1   . ILE A 1 436 ? 23.679  57.616  -1.929 1.00 128.49 ? 531 ILE A CG1   1 
ATOM   3260 C  CG2   . ILE A 1 436 ? 23.080  59.936  -1.156 1.00 122.13 ? 531 ILE A CG2   1 
ATOM   3261 C  CD1   . ILE A 1 436 ? 24.088  58.056  -3.317 1.00 126.74 ? 531 ILE A CD1   1 
ATOM   3262 N  N     . VAL A 1 437 ? 21.698  59.476  1.895  1.00 125.71 ? 532 VAL A N     1 
ATOM   3263 C  CA    . VAL A 1 437 ? 20.909  60.430  2.666  1.00 123.37 ? 532 VAL A CA    1 
ATOM   3264 C  C     . VAL A 1 437 ? 21.746  61.682  2.874  1.00 125.34 ? 532 VAL A C     1 
ATOM   3265 O  O     . VAL A 1 437 ? 22.783  61.633  3.547  1.00 129.37 ? 532 VAL A O     1 
ATOM   3266 C  CB    . VAL A 1 437 ? 20.466  59.852  4.021  1.00 116.37 ? 532 VAL A CB    1 
ATOM   3267 C  CG1   . VAL A 1 437 ? 19.876  60.946  4.895  1.00 114.53 ? 532 VAL A CG1   1 
ATOM   3268 C  CG2   . VAL A 1 437 ? 19.464  58.730  3.817  1.00 125.58 ? 532 VAL A CG2   1 
ATOM   3269 N  N     . ILE A 1 438 ? 21.305  62.801  2.296  1.00 126.35 ? 533 ILE A N     1 
ATOM   3270 C  CA    . ILE A 1 438 ? 21.924  64.079  2.616  1.00 127.41 ? 533 ILE A CA    1 
ATOM   3271 C  C     . ILE A 1 438 ? 21.610  64.419  4.065  1.00 125.93 ? 533 ILE A C     1 
ATOM   3272 O  O     . ILE A 1 438 ? 20.497  64.175  4.554  1.00 122.57 ? 533 ILE A O     1 
ATOM   3273 C  CB    . ILE A 1 438 ? 21.449  65.183  1.654  1.00 125.48 ? 533 ILE A CB    1 
ATOM   3274 C  CG1   . ILE A 1 438 ? 22.219  66.479  1.917  1.00 126.14 ? 533 ILE A CG1   1 
ATOM   3275 C  CG2   . ILE A 1 438 ? 19.945  65.410  1.772  1.00 122.03 ? 533 ILE A CG2   1 
ATOM   3276 C  CD1   . ILE A 1 438 ? 23.727  66.309  1.872  1.00 122.86 ? 533 ILE A CD1   1 
ATOM   3277 N  N     . LEU A 1 439 ? 22.593  64.965  4.772  1.00 125.73 ? 534 LEU A N     1 
ATOM   3278 C  CA    . LEU A 1 439 ? 22.463  65.121  6.216  1.00 125.01 ? 534 LEU A CA    1 
ATOM   3279 C  C     . LEU A 1 439 ? 21.897  66.506  6.502  1.00 120.84 ? 534 LEU A C     1 
ATOM   3280 O  O     . LEU A 1 439 ? 22.591  67.519  6.380  1.00 123.10 ? 534 LEU A O     1 
ATOM   3281 C  CB    . LEU A 1 439 ? 23.807  64.893  6.907  1.00 123.27 ? 534 LEU A CB    1 
ATOM   3282 C  CG    . LEU A 1 439 ? 25.105  65.504  6.362  1.00 116.46 ? 534 LEU A CG    1 
ATOM   3283 C  CD1   . LEU A 1 439 ? 26.134  65.578  7.476  1.00 122.29 ? 534 LEU A CD1   1 
ATOM   3284 C  CD2   . LEU A 1 439 ? 25.672  64.713  5.186  1.00 119.43 ? 534 LEU A CD2   1 
ATOM   3285 N  N     . SER A 1 440 ? 20.621  66.539  6.872  1.00 121.65 ? 535 SER A N     1 
ATOM   3286 C  CA    . SER A 1 440 ? 19.963  67.698  7.448  1.00 126.91 ? 535 SER A CA    1 
ATOM   3287 C  C     . SER A 1 440 ? 20.206  67.746  8.955  1.00 128.18 ? 535 SER A C     1 
ATOM   3288 O  O     . SER A 1 440 ? 20.533  66.739  9.588  1.00 129.42 ? 535 SER A O     1 
ATOM   3289 C  CB    . SER A 1 440 ? 18.465  67.670  7.145  1.00 125.68 ? 535 SER A CB    1 
ATOM   3290 O  OG    . SER A 1 440 ? 18.230  67.559  5.750  1.00 125.76 ? 535 SER A OG    1 
ATOM   3291 N  N     . GLU A 1 441 ? 20.062  68.942  9.529  1.00 129.40 ? 536 GLU A N     1 
ATOM   3292 C  CA    . GLU A 1 441 ? 20.026  69.047  10.984 1.00 129.27 ? 536 GLU A CA    1 
ATOM   3293 C  C     . GLU A 1 441 ? 18.870  68.258  11.582 1.00 125.66 ? 536 GLU A C     1 
ATOM   3294 O  O     . GLU A 1 441 ? 18.926  67.889  12.760 1.00 125.43 ? 536 GLU A O     1 
ATOM   3295 C  CB    . GLU A 1 441 ? 19.924  70.507  11.413 1.00 131.22 ? 536 GLU A CB    1 
ATOM   3296 C  CG    . GLU A 1 441 ? 21.146  71.332  11.084 1.00 138.04 ? 536 GLU A CG    1 
ATOM   3297 C  CD    . GLU A 1 441 ? 21.008  72.763  11.550 1.00 147.57 ? 536 GLU A CD    1 
ATOM   3298 O  OE1   . GLU A 1 441 ? 20.046  73.054  12.292 1.00 147.60 ? 536 GLU A OE1   1 
ATOM   3299 O  OE2   . GLU A 1 441 ? 21.857  73.597  11.172 1.00 151.17 ? 536 GLU A OE2   1 
ATOM   3300 N  N     . ASP A 1 442 ? 17.821  68.003  10.799 1.00 121.37 ? 537 ASP A N     1 
ATOM   3301 C  CA    . ASP A 1 442 ? 16.736  67.138  11.239 1.00 125.19 ? 537 ASP A CA    1 
ATOM   3302 C  C     . ASP A 1 442 ? 17.123  65.668  11.227 1.00 125.54 ? 537 ASP A C     1 
ATOM   3303 O  O     . ASP A 1 442 ? 16.528  64.878  11.966 1.00 129.51 ? 537 ASP A O     1 
ATOM   3304 C  CB    . ASP A 1 442 ? 15.506  67.329  10.349 1.00 125.73 ? 537 ASP A CB    1 
ATOM   3305 C  CG    . ASP A 1 442 ? 15.041  68.766  10.298 1.00 122.55 ? 537 ASP A CG    1 
ATOM   3306 O  OD1   . ASP A 1 442 ? 15.462  69.492  9.373  1.00 124.95 ? 537 ASP A OD1   1 
ATOM   3307 O  OD2   . ASP A 1 442 ? 14.254  69.168  11.182 1.00 116.66 ? 537 ASP A OD2   1 
ATOM   3308 N  N     . PHE A 1 443 ? 18.098  65.288  10.407 1.00 123.36 ? 538 PHE A N     1 
ATOM   3309 C  CA    . PHE A 1 443 ? 18.432  63.881  10.245 1.00 125.66 ? 538 PHE A CA    1 
ATOM   3310 C  C     . PHE A 1 443 ? 19.051  63.336  11.525 1.00 120.71 ? 538 PHE A C     1 
ATOM   3311 O  O     . PHE A 1 443 ? 20.020  63.894  12.049 1.00 117.59 ? 538 PHE A O     1 
ATOM   3312 C  CB    . PHE A 1 443 ? 19.382  63.696  9.060  1.00 123.84 ? 538 PHE A CB    1 
ATOM   3313 C  CG    . PHE A 1 443 ? 20.153  62.403  9.087  1.00 123.89 ? 538 PHE A CG    1 
ATOM   3314 C  CD1   . PHE A 1 443 ? 19.502  61.183  9.223  1.00 123.62 ? 538 PHE A CD1   1 
ATOM   3315 C  CD2   . PHE A 1 443 ? 21.533  62.409  8.951  1.00 121.99 ? 538 PHE A CD2   1 
ATOM   3316 C  CE1   . PHE A 1 443 ? 20.219  59.999  9.246  1.00 119.94 ? 538 PHE A CE1   1 
ATOM   3317 C  CE2   . PHE A 1 443 ? 22.252  61.229  8.967  1.00 119.32 ? 538 PHE A CE2   1 
ATOM   3318 C  CZ    . PHE A 1 443 ? 21.593  60.026  9.116  1.00 119.39 ? 538 PHE A CZ    1 
ATOM   3319 N  N     . LYS A 1 444 ? 18.466  62.255  12.037 1.00 118.87 ? 539 LYS A N     1 
ATOM   3320 C  CA    . LYS A 1 444 ? 18.993  61.539  13.192 1.00 120.31 ? 539 LYS A CA    1 
ATOM   3321 C  C     . LYS A 1 444 ? 18.874  60.050  12.909 1.00 122.44 ? 539 LYS A C     1 
ATOM   3322 O  O     . LYS A 1 444 ? 17.774  59.558  12.641 1.00 123.87 ? 539 LYS A O     1 
ATOM   3323 C  CB    . LYS A 1 444 ? 18.236  61.923  14.469 1.00 119.01 ? 539 LYS A CB    1 
ATOM   3324 C  CG    . LYS A 1 444 ? 18.329  63.404  14.813 1.00 120.15 ? 539 LYS A CG    1 
ATOM   3325 C  CD    . LYS A 1 444 ? 16.984  63.971  15.235 1.00 118.97 ? 539 LYS A CD    1 
ATOM   3326 C  CE    . LYS A 1 444 ? 17.044  65.489  15.335 1.00 128.74 ? 539 LYS A CE    1 
ATOM   3327 N  NZ    . LYS A 1 444 ? 15.714  66.097  15.630 1.00 128.62 ? 539 LYS A NZ    1 
ATOM   3328 N  N     . VAL A 1 445 ? 20.001  59.333  12.967 1.00 122.22 ? 540 VAL A N     1 
ATOM   3329 C  CA    . VAL A 1 445 ? 20.005  57.906  12.652 1.00 120.14 ? 540 VAL A CA    1 
ATOM   3330 C  C     . VAL A 1 445 ? 19.144  57.109  13.623 1.00 121.93 ? 540 VAL A C     1 
ATOM   3331 O  O     . VAL A 1 445 ? 18.786  55.961  13.335 1.00 122.22 ? 540 VAL A O     1 
ATOM   3332 C  CB    . VAL A 1 445 ? 21.451  57.370  12.639 1.00 113.98 ? 540 VAL A CB    1 
ATOM   3333 C  CG1   . VAL A 1 445 ? 21.976  57.233  14.058 1.00 108.14 ? 540 VAL A CG1   1 
ATOM   3334 C  CG2   . VAL A 1 445 ? 21.532  56.046  11.896 1.00 113.78 ? 540 VAL A CG2   1 
ATOM   3335 N  N     . MET A 1 446 ? 18.804  57.692  14.772 1.00 122.28 ? 541 MET A N     1 
ATOM   3336 C  CA    . MET A 1 446 ? 17.974  57.041  15.778 1.00 119.75 ? 541 MET A CA    1 
ATOM   3337 C  C     . MET A 1 446 ? 16.634  56.608  15.195 1.00 125.17 ? 541 MET A C     1 
ATOM   3338 O  O     . MET A 1 446 ? 16.361  55.410  15.068 1.00 122.76 ? 541 MET A O     1 
ATOM   3339 C  CB    . MET A 1 446 ? 17.764  57.984  16.964 1.00 119.93 ? 541 MET A CB    1 
ATOM   3340 C  CG    . MET A 1 446 ? 16.885  57.433  18.073 1.00 129.62 ? 541 MET A CG    1 
ATOM   3341 S  SD    . MET A 1 446 ? 17.692  56.168  19.070 1.00 121.29 ? 541 MET A SD    1 
ATOM   3342 C  CE    . MET A 1 446 ? 16.628  56.158  20.512 1.00 122.59 ? 541 MET A CE    1 
ATOM   3343 N  N     . GLU A 1 447 ? 15.796  57.579  14.830 1.00 126.34 ? 542 GLU A N     1 
ATOM   3344 C  CA    . GLU A 1 447 ? 14.482  57.285  14.273 1.00 126.36 ? 542 GLU A CA    1 
ATOM   3345 C  C     . GLU A 1 447 ? 14.535  56.894  12.803 1.00 126.53 ? 542 GLU A C     1 
ATOM   3346 O  O     . GLU A 1 447 ? 13.542  56.370  12.285 1.00 127.30 ? 542 GLU A O     1 
ATOM   3347 C  CB    . GLU A 1 447 ? 13.548  58.491  14.447 1.00 128.08 ? 542 GLU A CB    1 
ATOM   3348 C  CG    . GLU A 1 447 ? 13.478  59.429  13.243 1.00 125.91 ? 542 GLU A CG    1 
ATOM   3349 C  CD    . GLU A 1 447 ? 14.742  60.245  13.047 1.00 127.34 ? 542 GLU A CD    1 
ATOM   3350 O  OE1   . GLU A 1 447 ? 15.354  60.646  14.058 1.00 129.96 ? 542 GLU A OE1   1 
ATOM   3351 O  OE2   . GLU A 1 447 ? 15.125  60.484  11.881 1.00 129.19 ? 542 GLU A OE2   1 
ATOM   3352 N  N     . TRP A 1 448 ? 15.661  57.132  12.123 1.00 124.90 ? 543 TRP A N     1 
ATOM   3353 C  CA    . TRP A 1 448 ? 15.741  56.831  10.698 1.00 121.66 ? 543 TRP A CA    1 
ATOM   3354 C  C     . TRP A 1 448 ? 15.494  55.355  10.420 1.00 121.20 ? 543 TRP A C     1 
ATOM   3355 O  O     . TRP A 1 448 ? 14.923  55.009  9.380  1.00 125.58 ? 543 TRP A O     1 
ATOM   3356 C  CB    . TRP A 1 448 ? 17.100  57.252  10.144 1.00 121.35 ? 543 TRP A CB    1 
ATOM   3357 C  CG    . TRP A 1 448 ? 17.196  57.140  8.649  1.00 121.17 ? 543 TRP A CG    1 
ATOM   3358 C  CD1   . TRP A 1 448 ? 16.857  58.094  7.733  1.00 123.07 ? 543 TRP A CD1   1 
ATOM   3359 C  CD2   . TRP A 1 448 ? 17.661  56.010  7.897  1.00 119.82 ? 543 TRP A CD2   1 
ATOM   3360 N  NE1   . TRP A 1 448 ? 17.083  57.629  6.459  1.00 125.27 ? 543 TRP A NE1   1 
ATOM   3361 C  CE2   . TRP A 1 448 ? 17.577  56.353  6.532  1.00 120.04 ? 543 TRP A CE2   1 
ATOM   3362 C  CE3   . TRP A 1 448 ? 18.141  54.743  8.246  1.00 120.06 ? 543 TRP A CE3   1 
ATOM   3363 C  CZ2   . TRP A 1 448 ? 17.954  55.476  5.516  1.00 116.21 ? 543 TRP A CZ2   1 
ATOM   3364 C  CZ3   . TRP A 1 448 ? 18.515  53.874  7.235  1.00 117.70 ? 543 TRP A CZ3   1 
ATOM   3365 C  CH2   . TRP A 1 448 ? 18.420  54.245  5.887  1.00 116.12 ? 543 TRP A CH2   1 
ATOM   3366 N  N     . TRP A 1 449 ? 15.923  54.472  11.323 1.00 121.18 ? 544 TRP A N     1 
ATOM   3367 C  CA    . TRP A 1 449 ? 15.626  53.053  11.183 1.00 127.77 ? 544 TRP A CA    1 
ATOM   3368 C  C     . TRP A 1 449 ? 14.225  52.699  11.660 1.00 131.22 ? 544 TRP A C     1 
ATOM   3369 O  O     . TRP A 1 449 ? 13.675  51.680  11.225 1.00 132.45 ? 544 TRP A O     1 
ATOM   3370 C  CB    . TRP A 1 449 ? 16.665  52.218  11.938 1.00 131.81 ? 544 TRP A CB    1 
ATOM   3371 C  CG    . TRP A 1 449 ? 18.042  52.322  11.361 1.00 126.20 ? 544 TRP A CG    1 
ATOM   3372 C  CD1   . TRP A 1 449 ? 18.962  53.300  11.606 1.00 119.34 ? 544 TRP A CD1   1 
ATOM   3373 C  CD2   . TRP A 1 449 ? 18.660  51.410  10.444 1.00 127.36 ? 544 TRP A CD2   1 
ATOM   3374 N  NE1   . TRP A 1 449 ? 20.113  53.055  10.897 1.00 123.43 ? 544 TRP A NE1   1 
ATOM   3375 C  CE2   . TRP A 1 449 ? 19.954  51.900  10.176 1.00 125.03 ? 544 TRP A CE2   1 
ATOM   3376 C  CE3   . TRP A 1 449 ? 18.244  50.228  9.823  1.00 129.65 ? 544 TRP A CE3   1 
ATOM   3377 C  CZ2   . TRP A 1 449 ? 20.837  51.248  9.315  1.00 122.74 ? 544 TRP A CZ2   1 
ATOM   3378 C  CZ3   . TRP A 1 449 ? 19.122  49.582  8.969  1.00 129.57 ? 544 TRP A CZ3   1 
ATOM   3379 C  CH2   . TRP A 1 449 ? 20.403  50.094  8.723  1.00 127.19 ? 544 TRP A CH2   1 
ATOM   3380 N  N     . ASN A 1 450 ? 13.638  53.513  12.542 1.00 129.23 ? 545 ASN A N     1 
ATOM   3381 C  CA    . ASN A 1 450 ? 12.246  53.295  12.917 1.00 128.60 ? 545 ASN A CA    1 
ATOM   3382 C  C     . ASN A 1 450 ? 11.317  53.516  11.730 1.00 131.14 ? 545 ASN A C     1 
ATOM   3383 O  O     . ASN A 1 450 ? 10.241  52.910  11.659 1.00 133.30 ? 545 ASN A O     1 
ATOM   3384 C  CB    . ASN A 1 450 ? 11.853  54.216  14.074 1.00 127.78 ? 545 ASN A CB    1 
ATOM   3385 C  CG    . ASN A 1 450 ? 12.794  54.105  15.261 1.00 129.18 ? 545 ASN A CG    1 
ATOM   3386 O  OD1   . ASN A 1 450 ? 13.927  53.643  15.131 1.00 129.65 ? 545 ASN A OD1   1 
ATOM   3387 N  ND2   . ASN A 1 450 ? 12.328  54.538  16.427 1.00 132.35 ? 545 ASN A ND2   1 
ATOM   3388 N  N     . LEU A 1 451 ? 11.716  54.380  10.798 1.00 131.61 ? 546 LEU A N     1 
ATOM   3389 C  CA    . LEU A 1 451 ? 10.976  54.655  9.574  1.00 133.39 ? 546 LEU A CA    1 
ATOM   3390 C  C     . LEU A 1 451 ? 11.457  53.803  8.399  1.00 130.48 ? 546 LEU A C     1 
ATOM   3391 O  O     . LEU A 1 451 ? 11.014  54.018  7.266  1.00 137.34 ? 546 LEU A O     1 
ATOM   3392 C  CB    . LEU A 1 451 ? 11.062  56.150  9.229  1.00 126.55 ? 546 LEU A CB    1 
ATOM   3393 C  CG    . LEU A 1 451 ? 10.181  57.156  9.992  1.00 123.74 ? 546 LEU A CG    1 
ATOM   3394 C  CD1   . LEU A 1 451 ? 10.517  57.248  11.480 1.00 119.43 ? 546 LEU A CD1   1 
ATOM   3395 C  CD2   . LEU A 1 451 ? 10.263  58.536  9.349  1.00 116.64 ? 546 LEU A CD2   1 
ATOM   3396 N  N     . ASN A 1 452 ? 12.363  52.858  8.648  1.00 121.31 ? 547 ASN A N     1 
ATOM   3397 C  CA    . ASN A 1 452 ? 12.942  51.964  7.650  1.00 125.98 ? 547 ASN A CA    1 
ATOM   3398 C  C     . ASN A 1 452 ? 12.523  50.515  7.852  1.00 134.28 ? 547 ASN A C     1 
ATOM   3399 O  O     . ASN A 1 452 ? 12.110  49.852  6.896  1.00 138.96 ? 547 ASN A O     1 
ATOM   3400 C  CB    . ASN A 1 452 ? 14.473  52.068  7.636  1.00 129.68 ? 547 ASN A CB    1 
ATOM   3401 C  CG    . ASN A 1 452 ? 15.083  51.511  6.353  1.00 127.09 ? 547 ASN A CG    1 
ATOM   3402 O  OD1   . ASN A 1 452 ? 15.352  50.314  6.248  1.00 129.91 ? 547 ASN A OD1   1 
ATOM   3403 N  ND2   . ASN A 1 452 ? 15.294  52.380  5.370  1.00 119.88 ? 547 ASN A ND2   1 
ATOM   3404 N  N     . SER A 1 453 ? 12.661  50.005  9.079  1.00 134.26 ? 548 SER A N     1 
ATOM   3405 C  CA    . SER A 1 453 ? 12.672  48.588  9.441  1.00 136.88 ? 548 SER A CA    1 
ATOM   3406 C  C     . SER A 1 453 ? 11.653  47.719  8.710  1.00 141.88 ? 548 SER A C     1 
ATOM   3407 O  O     . SER A 1 453 ? 11.924  46.541  8.458  1.00 143.41 ? 548 SER A O     1 
ATOM   3408 C  CB    . SER A 1 453 ? 12.441  48.453  10.950 1.00 136.31 ? 548 SER A CB    1 
ATOM   3409 O  OG    . SER A 1 453 ? 11.179  48.980  11.321 1.00 132.74 ? 548 SER A OG    1 
ATOM   3410 N  N     . LYS A 1 454 ? 10.468  48.261  8.414  1.00 145.49 ? 549 LYS A N     1 
ATOM   3411 C  CA    . LYS A 1 454 ? 9.484   47.513  7.631  1.00 145.73 ? 549 LYS A CA    1 
ATOM   3412 C  C     . LYS A 1 454 ? 10.112  46.889  6.386  1.00 143.61 ? 549 LYS A C     1 
ATOM   3413 O  O     . LYS A 1 454 ? 9.817   45.737  6.042  1.00 144.06 ? 549 LYS A O     1 
ATOM   3414 C  CB    . LYS A 1 454 ? 8.320   48.428  7.241  1.00 146.32 ? 549 LYS A CB    1 
ATOM   3415 C  CG    . LYS A 1 454 ? 7.278   48.648  8.335  1.00 150.21 ? 549 LYS A CG    1 
ATOM   3416 C  CD    . LYS A 1 454 ? 6.375   47.429  8.499  1.00 153.56 ? 549 LYS A CD    1 
ATOM   3417 C  CE    . LYS A 1 454 ? 5.226   47.707  9.462  1.00 150.03 ? 549 LYS A CE    1 
ATOM   3418 N  NZ    . LYS A 1 454 ? 4.318   46.533  9.609  1.00 144.00 ? 549 LYS A NZ    1 
ATOM   3419 N  N     . LYS A 1 455 ? 10.998  47.626  5.710  1.00 141.27 ? 550 LYS A N     1 
ATOM   3420 C  CA    . LYS A 1 455 ? 11.652  47.093  4.519  1.00 142.23 ? 550 LYS A CA    1 
ATOM   3421 C  C     . LYS A 1 455 ? 12.755  46.104  4.879  1.00 147.47 ? 550 LYS A C     1 
ATOM   3422 O  O     . LYS A 1 455 ? 12.946  45.103  4.178  1.00 148.28 ? 550 LYS A O     1 
ATOM   3423 C  CB    . LYS A 1 455 ? 12.220  48.235  3.673  1.00 133.25 ? 550 LYS A CB    1 
ATOM   3424 C  CG    . LYS A 1 455 ? 12.823  47.781  2.353  1.00 131.83 ? 550 LYS A CG    1 
ATOM   3425 C  CD    . LYS A 1 455 ? 13.278  48.960  1.513  1.00 125.28 ? 550 LYS A CD    1 
ATOM   3426 C  CE    . LYS A 1 455 ? 13.760  48.501  0.148  1.00 124.77 ? 550 LYS A CE    1 
ATOM   3427 N  NZ    . LYS A 1 455 ? 14.101  49.648  -0.736 1.00 122.67 ? 550 LYS A NZ    1 
ATOM   3428 N  N     . TYR A 1 456 ? 13.489  46.363  5.965  1.00 147.50 ? 551 TYR A N     1 
ATOM   3429 C  CA    . TYR A 1 456 ? 14.613  45.532  6.394  1.00 146.72 ? 551 TYR A CA    1 
ATOM   3430 C  C     . TYR A 1 456 ? 14.322  44.981  7.789  1.00 145.58 ? 551 TYR A C     1 
ATOM   3431 O  O     . TYR A 1 456 ? 14.873  45.473  8.785  1.00 141.25 ? 551 TYR A O     1 
ATOM   3432 C  CB    . TYR A 1 456 ? 15.923  46.322  6.402  1.00 144.79 ? 551 TYR A CB    1 
ATOM   3433 C  CG    . TYR A 1 456 ? 16.347  46.938  5.078  1.00 148.08 ? 551 TYR A CG    1 
ATOM   3434 C  CD1   . TYR A 1 456 ? 17.269  47.981  5.049  1.00 146.19 ? 551 TYR A CD1   1 
ATOM   3435 C  CD2   . TYR A 1 456 ? 15.846  46.477  3.864  1.00 147.10 ? 551 TYR A CD2   1 
ATOM   3436 C  CE1   . TYR A 1 456 ? 17.675  48.554  3.856  1.00 140.90 ? 551 TYR A CE1   1 
ATOM   3437 C  CE2   . TYR A 1 456 ? 16.247  47.047  2.659  1.00 148.23 ? 551 TYR A CE2   1 
ATOM   3438 C  CZ    . TYR A 1 456 ? 17.164  48.086  2.665  1.00 148.14 ? 551 TYR A CZ    1 
ATOM   3439 O  OH    . TYR A 1 456 ? 17.574  48.661  1.482  1.00 143.41 ? 551 TYR A OH    1 
ATOM   3440 N  N     . PRO A 1 457 ? 13.458  43.967  7.902  1.00 145.17 ? 552 PRO A N     1 
ATOM   3441 C  CA    . PRO A 1 457 ? 13.170  43.422  9.241  1.00 146.14 ? 552 PRO A CA    1 
ATOM   3442 C  C     . PRO A 1 457 ? 14.356  42.720  9.882  1.00 146.49 ? 552 PRO A C     1 
ATOM   3443 O  O     . PRO A 1 457 ? 14.567  42.857  11.094 1.00 144.34 ? 552 PRO A O     1 
ATOM   3444 C  CB    . PRO A 1 457 ? 12.006  42.451  8.981  1.00 147.80 ? 552 PRO A CB    1 
ATOM   3445 C  CG    . PRO A 1 457 ? 11.439  42.863  7.653  1.00 147.43 ? 552 PRO A CG    1 
ATOM   3446 C  CD    . PRO A 1 457 ? 12.611  43.356  6.867  1.00 146.52 ? 552 PRO A CD    1 
ATOM   3447 N  N     . LYS A 1 458 ? 15.139  41.968  9.106  1.00 147.58 ? 553 LYS A N     1 
ATOM   3448 C  CA    . LYS A 1 458 ? 16.205  41.140  9.662  1.00 147.11 ? 553 LYS A CA    1 
ATOM   3449 C  C     . LYS A 1 458 ? 17.506  41.899  9.903  1.00 150.08 ? 553 LYS A C     1 
ATOM   3450 O  O     . LYS A 1 458 ? 18.386  41.376  10.597 1.00 149.12 ? 553 LYS A O     1 
ATOM   3451 C  CB    . LYS A 1 458 ? 16.471  39.937  8.747  1.00 145.22 ? 553 LYS A CB    1 
ATOM   3452 C  CG    . LYS A 1 458 ? 16.124  40.145  7.274  1.00 146.85 ? 553 LYS A CG    1 
ATOM   3453 C  CD    . LYS A 1 458 ? 17.018  41.178  6.606  1.00 145.94 ? 553 LYS A CD    1 
ATOM   3454 C  CE    . LYS A 1 458 ? 16.865  41.138  5.098  1.00 147.76 ? 553 LYS A CE    1 
ATOM   3455 N  NZ    . LYS A 1 458 ? 17.428  39.882  4.533  1.00 147.38 ? 553 LYS A NZ    1 
ATOM   3456 N  N     . LEU A 1 459 ? 17.654  43.104  9.352  1.00 147.15 ? 554 LEU A N     1 
ATOM   3457 C  CA    . LEU A 1 459 ? 18.848  43.926  9.546  1.00 140.97 ? 554 LEU A CA    1 
ATOM   3458 C  C     . LEU A 1 459 ? 18.615  45.011  10.593 1.00 136.01 ? 554 LEU A C     1 
ATOM   3459 O  O     . LEU A 1 459 ? 19.350  45.092  11.580 1.00 131.17 ? 554 LEU A O     1 
ATOM   3460 C  CB    . LEU A 1 459 ? 19.307  44.556  8.224  1.00 141.82 ? 554 LEU A CB    1 
ATOM   3461 C  CG    . LEU A 1 459 ? 20.560  45.428  8.352  1.00 136.85 ? 554 LEU A CG    1 
ATOM   3462 C  CD1   . LEU A 1 459 ? 21.691  44.651  9.011  1.00 136.97 ? 554 LEU A CD1   1 
ATOM   3463 C  CD2   . LEU A 1 459 ? 21.002  45.970  6.998  1.00 134.45 ? 554 LEU A CD2   1 
ATOM   3464 N  N     . SER A 1 460 ? 17.612  45.865  10.367 1.00 139.93 ? 555 SER A N     1 
ATOM   3465 C  CA    . SER A 1 460 ? 17.343  47.012  11.232 1.00 136.06 ? 555 SER A CA    1 
ATOM   3466 C  C     . SER A 1 460 ? 17.300  46.650  12.711 1.00 135.26 ? 555 SER A C     1 
ATOM   3467 O  O     . SER A 1 460 ? 17.536  47.515  13.562 1.00 129.73 ? 555 SER A O     1 
ATOM   3468 C  CB    . SER A 1 460 ? 16.015  47.649  10.830 1.00 136.05 ? 555 SER A CB    1 
ATOM   3469 O  OG    . SER A 1 460 ? 14.989  46.672  10.807 1.00 133.32 ? 555 SER A OG    1 
ATOM   3470 N  N     . LYS A 1 461 ? 16.969  45.398  13.043 1.00 140.87 ? 556 LYS A N     1 
ATOM   3471 C  CA    . LYS A 1 461 ? 17.070  44.968  14.435 1.00 139.53 ? 556 LYS A CA    1 
ATOM   3472 C  C     . LYS A 1 461 ? 18.525  44.933  14.894 1.00 134.22 ? 556 LYS A C     1 
ATOM   3473 O  O     . LYS A 1 461 ? 18.833  45.325  16.026 1.00 130.38 ? 556 LYS A O     1 
ATOM   3474 C  CB    . LYS A 1 461 ? 16.410  43.599  14.620 1.00 135.41 ? 556 LYS A CB    1 
ATOM   3475 C  CG    . LYS A 1 461 ? 15.914  43.342  16.038 1.00 134.24 ? 556 LYS A CG    1 
ATOM   3476 C  CD    . LYS A 1 461 ? 15.255  41.973  16.174 1.00 141.73 ? 556 LYS A CD    1 
ATOM   3477 C  CE    . LYS A 1 461 ? 16.281  40.846  16.181 1.00 134.79 ? 556 LYS A CE    1 
ATOM   3478 N  NZ    . LYS A 1 461 ? 15.659  39.522  16.467 1.00 124.37 ? 556 LYS A NZ    1 
ATOM   3479 N  N     . LEU A 1 462 ? 19.434  44.470  14.029 1.00 129.97 ? 557 LEU A N     1 
ATOM   3480 C  CA    . LEU A 1 462 ? 20.852  44.444  14.381 1.00 127.97 ? 557 LEU A CA    1 
ATOM   3481 C  C     . LEU A 1 462 ? 21.416  45.852  14.539 1.00 121.46 ? 557 LEU A C     1 
ATOM   3482 O  O     . LEU A 1 462 ? 22.285  46.086  15.387 1.00 119.38 ? 557 LEU A O     1 
ATOM   3483 C  CB    . LEU A 1 462 ? 21.644  43.675  13.322 1.00 129.16 ? 557 LEU A CB    1 
ATOM   3484 C  CG    . LEU A 1 462 ? 23.171  43.664  13.439 1.00 113.44 ? 557 LEU A CG    1 
ATOM   3485 C  CD1   . LEU A 1 462 ? 23.616  42.782  14.594 1.00 115.13 ? 557 LEU A CD1   1 
ATOM   3486 C  CD2   . LEU A 1 462 ? 23.796  43.211  12.134 1.00 114.40 ? 557 LEU A CD2   1 
ATOM   3487 N  N     . ALA A 1 463 ? 20.939  46.796  13.721 1.00 118.51 ? 558 ALA A N     1 
ATOM   3488 C  CA    . ALA A 1 463 ? 21.392  48.184  13.795 1.00 118.17 ? 558 ALA A CA    1 
ATOM   3489 C  C     . ALA A 1 463 ? 21.150  48.778  15.177 1.00 117.22 ? 558 ALA A C     1 
ATOM   3490 O  O     . ALA A 1 463 ? 22.098  49.122  15.892 1.00 120.87 ? 558 ALA A O     1 
ATOM   3491 C  CB    . ALA A 1 463 ? 20.695  49.020  12.721 1.00 124.03 ? 558 ALA A CB    1 
ATOM   3492 N  N     . LEU A 1 464 ? 19.876  48.912  15.570 1.00 119.66 ? 559 LEU A N     1 
ATOM   3493 C  CA    . LEU A 1 464 ? 19.542  49.500  16.865 1.00 114.72 ? 559 LEU A CA    1 
ATOM   3494 C  C     . LEU A 1 464 ? 20.128  48.715  18.034 1.00 117.62 ? 559 LEU A C     1 
ATOM   3495 O  O     . LEU A 1 464 ? 20.212  49.252  19.143 1.00 119.18 ? 559 LEU A O     1 
ATOM   3496 C  CB    . LEU A 1 464 ? 18.024  49.615  17.014 1.00 123.80 ? 559 LEU A CB    1 
ATOM   3497 C  CG    . LEU A 1 464 ? 17.368  50.963  16.693 1.00 124.37 ? 559 LEU A CG    1 
ATOM   3498 C  CD1   . LEU A 1 464 ? 17.621  51.365  15.249 1.00 117.16 ? 559 LEU A CD1   1 
ATOM   3499 C  CD2   . LEU A 1 464 ? 15.871  50.928  16.993 1.00 114.32 ? 559 LEU A CD2   1 
ATOM   3500 N  N     . SER A 1 465 ? 20.525  47.457  17.817 1.00 120.26 ? 560 SER A N     1 
ATOM   3501 C  CA    . SER A 1 465 ? 21.321  46.753  18.819 1.00 119.23 ? 560 SER A CA    1 
ATOM   3502 C  C     . SER A 1 465 ? 22.705  47.377  18.953 1.00 112.16 ? 560 SER A C     1 
ATOM   3503 O  O     . SER A 1 465 ? 23.227  47.520  20.065 1.00 109.18 ? 560 SER A O     1 
ATOM   3504 C  CB    . SER A 1 465 ? 21.436  45.274  18.453 1.00 121.20 ? 560 SER A CB    1 
ATOM   3505 O  OG    . SER A 1 465 ? 22.545  44.673  19.099 1.00 113.59 ? 560 SER A OG    1 
ATOM   3506 N  N     . LEU A 1 466 ? 23.310  47.753  17.825 1.00 112.93 ? 561 LEU A N     1 
ATOM   3507 C  CA    . LEU A 1 466 ? 24.616  48.403  17.834 1.00 112.99 ? 561 LEU A CA    1 
ATOM   3508 C  C     . LEU A 1 466 ? 24.526  49.849  18.306 1.00 108.18 ? 561 LEU A C     1 
ATOM   3509 O  O     . LEU A 1 466 ? 25.389  50.312  19.062 1.00 107.66 ? 561 LEU A O     1 
ATOM   3510 C  CB    . LEU A 1 466 ? 25.236  48.347  16.437 1.00 108.81 ? 561 LEU A CB    1 
ATOM   3511 C  CG    . LEU A 1 466 ? 26.207  47.203  16.173 1.00 108.04 ? 561 LEU A CG    1 
ATOM   3512 C  CD1   . LEU A 1 466 ? 27.390  47.345  17.101 1.00 109.05 ? 561 LEU A CD1   1 
ATOM   3513 C  CD2   . LEU A 1 466 ? 25.529  45.857  16.363 1.00 115.71 ? 561 LEU A CD2   1 
ATOM   3514 N  N     . LEU A 1 467 ? 23.497  50.576  17.868 1.00 99.76  ? 562 LEU A N     1 
ATOM   3515 C  CA    . LEU A 1 467 ? 23.372  51.988  18.202 1.00 99.99  ? 562 LEU A CA    1 
ATOM   3516 C  C     . LEU A 1 467 ? 22.981  52.221  19.654 1.00 97.17  ? 562 LEU A C     1 
ATOM   3517 O  O     . LEU A 1 467 ? 22.935  53.378  20.086 1.00 96.50  ? 562 LEU A O     1 
ATOM   3518 C  CB    . LEU A 1 467 ? 22.360  52.651  17.270 1.00 104.25 ? 562 LEU A CB    1 
ATOM   3519 C  CG    . LEU A 1 467 ? 22.730  52.567  15.786 1.00 106.32 ? 562 LEU A CG    1 
ATOM   3520 C  CD1   . LEU A 1 467 ? 21.546  52.934  14.915 1.00 110.05 ? 562 LEU A CD1   1 
ATOM   3521 C  CD2   . LEU A 1 467 ? 23.919  53.466  15.482 1.00 109.62 ? 562 LEU A CD2   1 
ATOM   3522 N  N     . SER A 1 468 ? 22.696  51.163  20.409 1.00 93.36  ? 563 SER A N     1 
ATOM   3523 C  CA    . SER A 1 468 ? 22.364  51.280  21.821 1.00 97.18  ? 563 SER A CA    1 
ATOM   3524 C  C     . SER A 1 468 ? 23.583  51.218  22.731 1.00 100.86 ? 563 SER A C     1 
ATOM   3525 O  O     . SER A 1 468 ? 23.428  51.353  23.950 1.00 96.16  ? 563 SER A O     1 
ATOM   3526 C  CB    . SER A 1 468 ? 21.375  50.178  22.215 1.00 108.35 ? 563 SER A CB    1 
ATOM   3527 O  OG    . SER A 1 468 ? 21.932  48.894  21.989 1.00 110.56 ? 563 SER A OG    1 
ATOM   3528 N  N     . ILE A 1 469 ? 24.777  51.017  22.179 1.00 103.72 ? 564 ILE A N     1 
ATOM   3529 C  CA    . ILE A 1 469 ? 25.995  50.860  22.972 1.00 95.36  ? 564 ILE A CA    1 
ATOM   3530 C  C     . ILE A 1 469 ? 26.589  52.232  23.264 1.00 95.15  ? 564 ILE A C     1 
ATOM   3531 O  O     . ILE A 1 469 ? 26.824  53.013  22.331 1.00 98.29  ? 564 ILE A O     1 
ATOM   3532 C  CB    . ILE A 1 469 ? 27.009  49.968  22.249 1.00 91.97  ? 564 ILE A CB    1 
ATOM   3533 C  CG1   . ILE A 1 469 ? 26.347  48.659  21.828 1.00 96.89  ? 564 ILE A CG1   1 
ATOM   3534 C  CG2   . ILE A 1 469 ? 28.200  49.696  23.143 1.00 96.83  ? 564 ILE A CG2   1 
ATOM   3535 C  CD1   . ILE A 1 469 ? 27.269  47.708  21.114 1.00 106.07 ? 564 ILE A CD1   1 
ATOM   3536 N  N     . PRO A 1 470 ? 26.851  52.564  24.531 1.00 92.75  ? 565 PRO A N     1 
ATOM   3537 C  CA    . PRO A 1 470 ? 27.263  53.941  24.861 1.00 97.86  ? 565 PRO A CA    1 
ATOM   3538 C  C     . PRO A 1 470 ? 28.669  54.315  24.403 1.00 97.22  ? 565 PRO A C     1 
ATOM   3539 O  O     . PRO A 1 470 ? 28.928  55.504  24.174 1.00 96.65  ? 565 PRO A O     1 
ATOM   3540 C  CB    . PRO A 1 470 ? 27.140  53.981  26.393 1.00 97.45  ? 565 PRO A CB    1 
ATOM   3541 C  CG    . PRO A 1 470 ? 26.240  52.812  26.743 1.00 90.76  ? 565 PRO A CG    1 
ATOM   3542 C  CD    . PRO A 1 470 ? 26.560  51.765  25.731 1.00 89.76  ? 565 PRO A CD    1 
ATOM   3543 N  N     . ALA A 1 471 ? 29.586  53.351  24.280 1.00 92.43  ? 566 ALA A N     1 
ATOM   3544 C  CA    . ALA A 1 471 ? 30.988  53.622  23.937 1.00 95.79  ? 566 ALA A CA    1 
ATOM   3545 C  C     . ALA A 1 471 ? 31.645  54.590  24.915 1.00 87.53  ? 566 ALA A C     1 
ATOM   3546 O  O     . ALA A 1 471 ? 32.554  55.339  24.551 1.00 78.70  ? 566 ALA A O     1 
ATOM   3547 C  CB    . ALA A 1 471 ? 31.133  54.151  22.511 1.00 95.48  ? 566 ALA A CB    1 
ATOM   3548 N  N     . SER A 1 472 ? 31.179  54.590  26.158 1.00 87.12  ? 567 SER A N     1 
ATOM   3549 C  CA    . SER A 1 472 ? 31.848  55.303  27.232 1.00 80.87  ? 567 SER A CA    1 
ATOM   3550 C  C     . SER A 1 472 ? 31.417  54.675  28.545 1.00 82.03  ? 567 SER A C     1 
ATOM   3551 O  O     . SER A 1 472 ? 30.393  53.990  28.620 1.00 85.11  ? 567 SER A O     1 
ATOM   3552 C  CB    . SER A 1 472 ? 31.524  56.799  27.217 1.00 80.82  ? 567 SER A CB    1 
ATOM   3553 O  OG    . SER A 1 472 ? 30.146  57.019  27.464 1.00 92.08  ? 567 SER A OG    1 
ATOM   3554 N  N     . SER A 1 473 ? 32.215  54.912  29.578 1.00 76.27  ? 568 SER A N     1 
ATOM   3555 C  CA    . SER A 1 473 ? 31.843  54.536  30.932 1.00 72.12  ? 568 SER A CA    1 
ATOM   3556 C  C     . SER A 1 473 ? 31.062  55.634  31.636 1.00 73.06  ? 568 SER A C     1 
ATOM   3557 O  O     . SER A 1 473 ? 30.752  55.487  32.822 1.00 75.65  ? 568 SER A O     1 
ATOM   3558 C  CB    . SER A 1 473 ? 33.089  54.182  31.750 1.00 78.54  ? 568 SER A CB    1 
ATOM   3559 O  OG    . SER A 1 473 ? 33.836  53.157  31.121 1.00 80.83  ? 568 SER A OG    1 
ATOM   3560 N  N     . ALA A 1 474 ? 30.741  56.721  30.925 1.00 70.12  ? 569 ALA A N     1 
ATOM   3561 C  CA    . ALA A 1 474 ? 30.113  57.887  31.542 1.00 75.01  ? 569 ALA A CA    1 
ATOM   3562 C  C     . ALA A 1 474 ? 28.868  57.513  32.333 1.00 73.41  ? 569 ALA A C     1 
ATOM   3563 O  O     . ALA A 1 474 ? 28.642  58.036  33.431 1.00 66.97  ? 569 ALA A O     1 
ATOM   3564 C  CB    . ALA A 1 474 ? 29.766  58.917  30.467 1.00 78.70  ? 569 ALA A CB    1 
ATOM   3565 N  N     . ALA A 1 475 ? 28.048  56.610  31.788 1.00 78.30  ? 570 ALA A N     1 
ATOM   3566 C  CA    . ALA A 1 475 ? 26.847  56.169  32.490 1.00 74.50  ? 570 ALA A CA    1 
ATOM   3567 C  C     . ALA A 1 475 ? 27.195  55.585  33.849 1.00 72.37  ? 570 ALA A C     1 
ATOM   3568 O  O     . ALA A 1 475 ? 26.615  55.964  34.873 1.00 75.59  ? 570 ALA A O     1 
ATOM   3569 C  CB    . ALA A 1 475 ? 26.096  55.144  31.646 1.00 76.35  ? 570 ALA A CB    1 
ATOM   3570 N  N     . SER A 1 476 ? 28.152  54.660  33.877 1.00 73.92  ? 571 SER A N     1 
ATOM   3571 C  CA    . SER A 1 476 ? 28.599  54.110  35.148 1.00 74.10  ? 571 SER A CA    1 
ATOM   3572 C  C     . SER A 1 476 ? 29.259  55.173  36.015 1.00 75.52  ? 571 SER A C     1 
ATOM   3573 O  O     . SER A 1 476 ? 29.233  55.070  37.246 1.00 76.47  ? 571 SER A O     1 
ATOM   3574 C  CB    . SER A 1 476 ? 29.554  52.946  34.900 1.00 75.18  ? 571 SER A CB    1 
ATOM   3575 O  OG    . SER A 1 476 ? 30.039  52.421  36.120 1.00 83.98  ? 571 SER A OG    1 
ATOM   3576 N  N     . GLU A 1 477 ? 29.843  56.204  35.400 1.00 77.91  ? 572 GLU A N     1 
ATOM   3577 C  CA    . GLU A 1 477 ? 30.498  57.244  36.186 1.00 81.45  ? 572 GLU A CA    1 
ATOM   3578 C  C     . GLU A 1 477 ? 29.473  58.093  36.932 1.00 80.05  ? 572 GLU A C     1 
ATOM   3579 O  O     . GLU A 1 477 ? 29.615  58.340  38.136 1.00 77.48  ? 572 GLU A O     1 
ATOM   3580 C  CB    . GLU A 1 477 ? 31.382  58.116  35.287 1.00 81.13  ? 572 GLU A CB    1 
ATOM   3581 C  CG    . GLU A 1 477 ? 32.525  57.380  34.564 1.00 77.55  ? 572 GLU A CG    1 
ATOM   3582 C  CD    . GLU A 1 477 ? 33.653  56.937  35.493 1.00 84.63  ? 572 GLU A CD    1 
ATOM   3583 O  OE1   . GLU A 1 477 ? 34.471  56.076  35.090 1.00 82.64  ? 572 GLU A OE1   1 
ATOM   3584 O  OE2   . GLU A 1 477 ? 33.726  57.450  36.626 1.00 84.69  ? 572 GLU A OE2   1 
ATOM   3585 N  N     . ARG A 1 478 ? 28.421  58.538  36.235 1.00 75.52  ? 573 ARG A N     1 
ATOM   3586 C  CA    . ARG A 1 478 ? 27.410  59.368  36.882 1.00 76.42  ? 573 ARG A CA    1 
ATOM   3587 C  C     . ARG A 1 478 ? 26.723  58.623  38.015 1.00 78.57  ? 573 ARG A C     1 
ATOM   3588 O  O     . ARG A 1 478 ? 26.242  59.248  38.968 1.00 76.59  ? 573 ARG A O     1 
ATOM   3589 C  CB    . ARG A 1 478 ? 26.379  59.842  35.860 1.00 68.56  ? 573 ARG A CB    1 
ATOM   3590 C  CG    . ARG A 1 478 ? 26.984  60.440  34.615 1.00 68.18  ? 573 ARG A CG    1 
ATOM   3591 C  CD    . ARG A 1 478 ? 25.921  60.821  33.617 1.00 66.44  ? 573 ARG A CD    1 
ATOM   3592 N  NE    . ARG A 1 478 ? 26.452  60.900  32.262 1.00 69.84  ? 573 ARG A NE    1 
ATOM   3593 C  CZ    . ARG A 1 478 ? 26.122  60.067  31.283 1.00 73.10  ? 573 ARG A CZ    1 
ATOM   3594 N  NH1   . ARG A 1 478 ? 25.250  59.093  31.505 1.00 77.04  ? 573 ARG A NH1   1 
ATOM   3595 N  NH2   . ARG A 1 478 ? 26.653  60.213  30.078 1.00 79.54  ? 573 ARG A NH2   1 
ATOM   3596 N  N     . THR A 1 479 ? 26.668  57.291  37.926 1.00 75.91  ? 574 THR A N     1 
ATOM   3597 C  CA    . THR A 1 479 ? 26.125  56.492  39.018 1.00 78.57  ? 574 THR A CA    1 
ATOM   3598 C  C     . THR A 1 479 ? 26.871  56.771  40.314 1.00 77.12  ? 574 THR A C     1 
ATOM   3599 O  O     . THR A 1 479 ? 26.259  56.925  41.378 1.00 75.10  ? 574 THR A O     1 
ATOM   3600 C  CB    . THR A 1 479 ? 26.203  55.006  38.665 1.00 82.82  ? 574 THR A CB    1 
ATOM   3601 O  OG1   . THR A 1 479 ? 25.678  54.791  37.349 1.00 86.59  ? 574 THR A OG1   1 
ATOM   3602 C  CG2   . THR A 1 479 ? 25.409  54.177  39.657 1.00 79.34  ? 574 THR A CG2   1 
ATOM   3603 N  N     . PHE A 1 480 ? 28.199  56.861  40.240 1.00 76.92  ? 575 PHE A N     1 
ATOM   3604 C  CA    . PHE A 1 480 ? 28.980  57.177  41.429 1.00 79.33  ? 575 PHE A CA    1 
ATOM   3605 C  C     . PHE A 1 480 ? 28.707  58.602  41.896 1.00 75.78  ? 575 PHE A C     1 
ATOM   3606 O  O     . PHE A 1 480 ? 28.648  58.866  43.104 1.00 71.72  ? 575 PHE A O     1 
ATOM   3607 C  CB    . PHE A 1 480 ? 30.470  56.962  41.148 1.00 74.42  ? 575 PHE A CB    1 
ATOM   3608 C  CG    . PHE A 1 480 ? 30.777  55.652  40.467 1.00 76.21  ? 575 PHE A CG    1 
ATOM   3609 C  CD1   . PHE A 1 480 ? 31.685  55.595  39.423 1.00 78.14  ? 575 PHE A CD1   1 
ATOM   3610 C  CD2   . PHE A 1 480 ? 30.153  54.480  40.864 1.00 80.91  ? 575 PHE A CD2   1 
ATOM   3611 C  CE1   . PHE A 1 480 ? 31.965  54.397  38.788 1.00 72.86  ? 575 PHE A CE1   1 
ATOM   3612 C  CE2   . PHE A 1 480 ? 30.431  53.277  40.230 1.00 75.83  ? 575 PHE A CE2   1 
ATOM   3613 C  CZ    . PHE A 1 480 ? 31.340  53.241  39.191 1.00 71.01  ? 575 PHE A CZ    1 
ATOM   3614 N  N     . SER A 1 481 ? 28.523  59.531  40.957 1.00 75.47  ? 576 SER A N     1 
ATOM   3615 C  CA    . SER A 1 481 ? 28.169  60.892  41.341 1.00 76.10  ? 576 SER A CA    1 
ATOM   3616 C  C     . SER A 1 481 ? 26.878  60.900  42.143 1.00 71.70  ? 576 SER A C     1 
ATOM   3617 O  O     . SER A 1 481 ? 26.812  61.481  43.233 1.00 68.34  ? 576 SER A O     1 
ATOM   3618 C  CB    . SER A 1 481 ? 28.042  61.778  40.104 1.00 77.14  ? 576 SER A CB    1 
ATOM   3619 O  OG    . SER A 1 481 ? 27.928  63.139  40.483 1.00 82.00  ? 576 SER A OG    1 
ATOM   3620 N  N     . LEU A 1 482 ? 25.840  60.244  41.616 1.00 75.49  ? 577 LEU A N     1 
ATOM   3621 C  CA    . LEU A 1 482 ? 24.600  60.083  42.367 1.00 73.76  ? 577 LEU A CA    1 
ATOM   3622 C  C     . LEU A 1 482 ? 24.867  59.389  43.692 1.00 70.86  ? 577 LEU A C     1 
ATOM   3623 O  O     . LEU A 1 482 ? 24.409  59.841  44.748 1.00 67.73  ? 577 LEU A O     1 
ATOM   3624 C  CB    . LEU A 1 482 ? 23.580  59.300  41.540 1.00 66.55  ? 577 LEU A CB    1 
ATOM   3625 C  CG    . LEU A 1 482 ? 22.896  60.071  40.410 1.00 69.01  ? 577 LEU A CG    1 
ATOM   3626 C  CD1   . LEU A 1 482 ? 21.949  59.168  39.637 1.00 75.11  ? 577 LEU A CD1   1 
ATOM   3627 C  CD2   . LEU A 1 482 ? 22.155  61.283  40.964 1.00 71.19  ? 577 LEU A CD2   1 
ATOM   3628 N  N     . ALA A 1 483 ? 25.630  58.294  43.652 1.00 64.69  ? 578 ALA A N     1 
ATOM   3629 C  CA    . ALA A 1 483 ? 26.039  57.630  44.880 1.00 62.49  ? 578 ALA A CA    1 
ATOM   3630 C  C     . ALA A 1 483 ? 26.686  58.617  45.840 1.00 68.43  ? 578 ALA A C     1 
ATOM   3631 O  O     . ALA A 1 483 ? 26.421  58.586  47.045 1.00 63.92  ? 578 ALA A O     1 
ATOM   3632 C  CB    . ALA A 1 483 ? 26.992  56.482  44.558 1.00 67.17  ? 578 ALA A CB    1 
ATOM   3633 N  N     . GLY A 1 484 ? 27.517  59.521  45.316 1.00 68.75  ? 579 GLY A N     1 
ATOM   3634 C  CA    . GLY A 1 484 ? 28.113  60.536  46.164 1.00 65.03  ? 579 GLY A CA    1 
ATOM   3635 C  C     . GLY A 1 484 ? 27.093  61.474  46.777 1.00 66.32  ? 579 GLY A C     1 
ATOM   3636 O  O     . GLY A 1 484 ? 27.268  61.935  47.909 1.00 65.56  ? 579 GLY A O     1 
ATOM   3637 N  N     . ASN A 1 485 ? 26.009  61.761  46.053 1.00 64.92  ? 580 ASN A N     1 
ATOM   3638 C  CA    . ASN A 1 485 ? 25.000  62.668  46.588 1.00 69.80  ? 580 ASN A CA    1 
ATOM   3639 C  C     . ASN A 1 485 ? 24.264  62.044  47.766 1.00 69.08  ? 580 ASN A C     1 
ATOM   3640 O  O     . ASN A 1 485 ? 23.947  62.734  48.742 1.00 73.43  ? 580 ASN A O     1 
ATOM   3641 C  CB    . ASN A 1 485 ? 24.004  63.066  45.501 1.00 69.58  ? 580 ASN A CB    1 
ATOM   3642 C  CG    . ASN A 1 485 ? 24.674  63.605  44.259 1.00 69.00  ? 580 ASN A CG    1 
ATOM   3643 O  OD1   . ASN A 1 485 ? 24.302  63.254  43.142 1.00 70.02  ? 580 ASN A OD1   1 
ATOM   3644 N  ND2   . ASN A 1 485 ? 25.672  64.457  44.445 1.00 73.34  ? 580 ASN A ND2   1 
ATOM   3645 N  N     . ILE A 1 486 ? 23.983  60.743  47.699 1.00 62.06  ? 581 ILE A N     1 
ATOM   3646 C  CA    . ILE A 1 486 ? 23.166  60.122  48.735 1.00 64.75  ? 581 ILE A CA    1 
ATOM   3647 C  C     . ILE A 1 486 ? 23.981  59.855  49.998 1.00 66.22  ? 581 ILE A C     1 
ATOM   3648 O  O     . ILE A 1 486 ? 23.500  60.082  51.114 1.00 68.46  ? 581 ILE A O     1 
ATOM   3649 C  CB    . ILE A 1 486 ? 22.494  58.848  48.193 1.00 62.75  ? 581 ILE A CB    1 
ATOM   3650 C  CG1   . ILE A 1 486 ? 22.227  57.857  49.316 1.00 64.93  ? 581 ILE A CG1   1 
ATOM   3651 C  CG2   . ILE A 1 486 ? 23.332  58.205  47.124 1.00 69.66  ? 581 ILE A CG2   1 
ATOM   3652 C  CD1   . ILE A 1 486 ? 21.904  56.485  48.810 1.00 77.53  ? 581 ILE A CD1   1 
ATOM   3653 N  N     . ILE A 1 487 ? 25.221  59.394  49.871 1.00 67.26  ? 582 ILE A N     1 
ATOM   3654 C  CA    . ILE A 1 487 ? 26.068  59.214  51.047 1.00 69.34  ? 582 ILE A CA    1 
ATOM   3655 C  C     . ILE A 1 487 ? 26.895  60.486  51.227 1.00 70.45  ? 582 ILE A C     1 
ATOM   3656 O  O     . ILE A 1 487 ? 27.812  60.776  50.452 1.00 63.91  ? 582 ILE A O     1 
ATOM   3657 C  CB    . ILE A 1 487 ? 26.939  57.951  50.952 1.00 59.88  ? 582 ILE A CB    1 
ATOM   3658 C  CG1   . ILE A 1 487 ? 27.861  57.834  52.168 1.00 60.21  ? 582 ILE A CG1   1 
ATOM   3659 C  CG2   . ILE A 1 487 ? 27.717  57.875  49.653 1.00 57.00  ? 582 ILE A CG2   1 
ATOM   3660 C  CD1   . ILE A 1 487 ? 28.477  56.459  52.317 1.00 65.77  ? 582 ILE A CD1   1 
ATOM   3661 N  N     . THR A 1 488 ? 26.562  61.244  52.268 1.00 68.03  ? 583 THR A N     1 
ATOM   3662 C  CA    . THR A 1 488 ? 27.135  62.548  52.551 1.00 68.78  ? 583 THR A CA    1 
ATOM   3663 C  C     . THR A 1 488 ? 27.634  62.556  53.990 1.00 68.00  ? 583 THR A C     1 
ATOM   3664 O  O     . THR A 1 488 ? 27.563  61.544  54.691 1.00 69.22  ? 583 THR A O     1 
ATOM   3665 C  CB    . THR A 1 488 ? 26.107  63.659  52.309 1.00 76.55  ? 583 THR A CB    1 
ATOM   3666 O  OG1   . THR A 1 488 ? 24.790  63.167  52.600 1.00 66.75  ? 583 THR A OG1   1 
ATOM   3667 C  CG2   . THR A 1 488 ? 26.170  64.139  50.858 1.00 77.60  ? 583 THR A CG2   1 
ATOM   3668 N  N     . GLU A 1 489 ? 28.150  63.707  54.433 1.00 70.04  ? 584 GLU A N     1 
ATOM   3669 C  CA    . GLU A 1 489 ? 28.688  63.794  55.788 1.00 68.13  ? 584 GLU A CA    1 
ATOM   3670 C  C     . GLU A 1 489 ? 27.664  63.345  56.818 1.00 70.10  ? 584 GLU A C     1 
ATOM   3671 O  O     . GLU A 1 489 ? 27.991  62.602  57.750 1.00 70.51  ? 584 GLU A O     1 
ATOM   3672 C  CB    . GLU A 1 489 ? 29.138  65.221  56.100 1.00 69.86  ? 584 GLU A CB    1 
ATOM   3673 C  CG    . GLU A 1 489 ? 29.439  66.074  54.892 1.00 80.82  ? 584 GLU A CG    1 
ATOM   3674 C  CD    . GLU A 1 489 ? 30.285  67.282  55.244 1.00 90.70  ? 584 GLU A CD    1 
ATOM   3675 O  OE1   . GLU A 1 489 ? 30.056  67.874  56.322 1.00 88.96  ? 584 GLU A OE1   1 
ATOM   3676 O  OE2   . GLU A 1 489 ? 31.190  67.626  54.451 1.00 86.59  ? 584 GLU A OE2   1 
ATOM   3677 N  N     . LYS A 1 490 ? 26.416  63.796  56.665 1.00 71.82  ? 585 LYS A N     1 
ATOM   3678 C  CA    . LYS A 1 490 ? 25.362  63.470  57.618 1.00 62.46  ? 585 LYS A CA    1 
ATOM   3679 C  C     . LYS A 1 490 ? 24.769  62.092  57.357 1.00 68.63  ? 585 LYS A C     1 
ATOM   3680 O  O     . LYS A 1 490 ? 24.422  61.371  58.299 1.00 70.79  ? 585 LYS A O     1 
ATOM   3681 C  CB    . LYS A 1 490 ? 24.274  64.532  57.557 1.00 58.60  ? 585 LYS A CB    1 
ATOM   3682 C  CG    . LYS A 1 490 ? 24.799  65.928  57.328 1.00 58.20  ? 585 LYS A CG    1 
ATOM   3683 C  CD    . LYS A 1 490 ? 25.523  66.457  58.551 1.00 68.57  ? 585 LYS A CD    1 
ATOM   3684 C  CE    . LYS A 1 490 ? 26.262  67.738  58.207 1.00 78.37  ? 585 LYS A CE    1 
ATOM   3685 N  NZ    . LYS A 1 490 ? 25.470  68.532  57.221 1.00 82.61  ? 585 LYS A NZ    1 
ATOM   3686 N  N     . ARG A 1 491 ? 24.648  61.710  56.090 1.00 70.65  ? 586 ARG A N     1 
ATOM   3687 C  CA    . ARG A 1 491 ? 24.050  60.441  55.699 1.00 63.30  ? 586 ARG A CA    1 
ATOM   3688 C  C     . ARG A 1 491 ? 25.067  59.315  55.622 1.00 65.92  ? 586 ARG A C     1 
ATOM   3689 O  O     . ARG A 1 491 ? 24.738  58.241  55.111 1.00 73.84  ? 586 ARG A O     1 
ATOM   3690 C  CB    . ARG A 1 491 ? 23.324  60.586  54.359 1.00 69.16  ? 586 ARG A CB    1 
ATOM   3691 C  CG    . ARG A 1 491 ? 22.201  61.623  54.381 1.00 67.20  ? 586 ARG A CG    1 
ATOM   3692 C  CD    . ARG A 1 491 ? 21.372  61.580  53.114 1.00 57.57  ? 586 ARG A CD    1 
ATOM   3693 N  NE    . ARG A 1 491 ? 20.511  60.405  53.070 1.00 58.51  ? 586 ARG A NE    1 
ATOM   3694 C  CZ    . ARG A 1 491 ? 19.800  60.048  52.007 1.00 65.43  ? 586 ARG A CZ    1 
ATOM   3695 N  NH1   . ARG A 1 491 ? 19.856  60.777  50.899 1.00 64.20  ? 586 ARG A NH1   1 
ATOM   3696 N  NH2   . ARG A 1 491 ? 19.036  58.965  52.050 1.00 66.33  ? 586 ARG A NH2   1 
ATOM   3697 N  N     . ASN A 1 492 ? 26.300  59.554  56.082 1.00 72.75  ? 587 ASN A N     1 
ATOM   3698 C  CA    . ASN A 1 492 ? 27.386  58.580  55.962 1.00 69.53  ? 587 ASN A CA    1 
ATOM   3699 C  C     . ASN A 1 492 ? 27.028  57.210  56.526 1.00 66.55  ? 587 ASN A C     1 
ATOM   3700 O  O     . ASN A 1 492 ? 27.570  56.197  56.069 1.00 69.75  ? 587 ASN A O     1 
ATOM   3701 C  CB    . ASN A 1 492 ? 28.636  59.110  56.674 1.00 70.03  ? 587 ASN A CB    1 
ATOM   3702 C  CG    . ASN A 1 492 ? 28.519  59.043  58.194 1.00 66.09  ? 587 ASN A CG    1 
ATOM   3703 O  OD1   . ASN A 1 492 ? 28.811  58.012  58.800 1.00 66.98  ? 587 ASN A OD1   1 
ATOM   3704 N  ND2   . ASN A 1 492 ? 28.091  60.141  58.812 1.00 59.08  ? 587 ASN A ND2   1 
ATOM   3705 N  N     . ARG A 1 493 ? 26.133  57.155  57.521 1.00 65.32  ? 588 ARG A N     1 
ATOM   3706 C  CA    . ARG A 1 493 ? 25.818  55.889  58.179 1.00 63.49  ? 588 ARG A CA    1 
ATOM   3707 C  C     . ARG A 1 493 ? 25.159  54.888  57.243 1.00 63.62  ? 588 ARG A C     1 
ATOM   3708 O  O     . ARG A 1 493 ? 25.091  53.700  57.581 1.00 59.89  ? 588 ARG A O     1 
ATOM   3709 C  CB    . ARG A 1 493 ? 24.908  56.124  59.385 1.00 62.29  ? 588 ARG A CB    1 
ATOM   3710 C  CG    . ARG A 1 493 ? 25.598  56.742  60.580 1.00 55.26  ? 588 ARG A CG    1 
ATOM   3711 C  CD    . ARG A 1 493 ? 26.830  55.946  60.957 1.00 65.65  ? 588 ARG A CD    1 
ATOM   3712 N  NE    . ARG A 1 493 ? 26.515  54.725  61.689 1.00 75.60  ? 588 ARG A NE    1 
ATOM   3713 C  CZ    . ARG A 1 493 ? 27.422  53.824  62.057 1.00 85.67  ? 588 ARG A CZ    1 
ATOM   3714 N  NH1   . ARG A 1 493 ? 28.702  54.004  61.754 1.00 79.09  ? 588 ARG A NH1   1 
ATOM   3715 N  NH2   . ARG A 1 493 ? 27.048  52.742  62.723 1.00 97.09  ? 588 ARG A NH2   1 
ATOM   3716 N  N     . ILE A 1 494 ? 24.664  55.342  56.088 1.00 62.22  ? 589 ILE A N     1 
ATOM   3717 C  CA    . ILE A 1 494 ? 23.999  54.446  55.151 1.00 67.87  ? 589 ILE A CA    1 
ATOM   3718 C  C     . ILE A 1 494 ? 24.946  53.325  54.765 1.00 68.00  ? 589 ILE A C     1 
ATOM   3719 O  O     . ILE A 1 494 ? 26.069  53.575  54.306 1.00 79.58  ? 589 ILE A O     1 
ATOM   3720 C  CB    . ILE A 1 494 ? 23.538  55.203  53.905 1.00 65.67  ? 589 ILE A CB    1 
ATOM   3721 C  CG1   . ILE A 1 494 ? 22.436  56.190  54.246 1.00 68.15  ? 589 ILE A CG1   1 
ATOM   3722 C  CG2   . ILE A 1 494 ? 23.015  54.227  52.895 1.00 71.74  ? 589 ILE A CG2   1 
ATOM   3723 C  CD1   . ILE A 1 494 ? 21.718  56.763  53.039 1.00 69.89  ? 589 ILE A CD1   1 
ATOM   3724 N  N     . GLY A 1 495 ? 24.515  52.084  54.966 1.00 55.35  ? 590 GLY A N     1 
ATOM   3725 C  CA    . GLY A 1 495 ? 25.212  50.951  54.392 1.00 73.15  ? 590 GLY A CA    1 
ATOM   3726 C  C     . GLY A 1 495 ? 24.679  50.600  53.011 1.00 73.25  ? 590 GLY A C     1 
ATOM   3727 O  O     . GLY A 1 495 ? 23.491  50.746  52.736 1.00 72.84  ? 590 GLY A O     1 
ATOM   3728 N  N     . GLN A 1 496 ? 25.597  50.204  52.125 1.00 75.47  ? 591 GLN A N     1 
ATOM   3729 C  CA    . GLN A 1 496 ? 25.385  49.128  51.157 1.00 79.20  ? 591 GLN A CA    1 
ATOM   3730 C  C     . GLN A 1 496 ? 24.028  49.149  50.454 1.00 80.01  ? 591 GLN A C     1 
ATOM   3731 O  O     . GLN A 1 496 ? 23.729  50.069  49.685 1.00 73.85  ? 591 GLN A O     1 
ATOM   3732 C  CB    . GLN A 1 496 ? 25.617  47.788  51.855 1.00 84.58  ? 591 GLN A CB    1 
ATOM   3733 C  CG    . GLN A 1 496 ? 26.833  47.828  52.777 1.00 79.46  ? 591 GLN A CG    1 
ATOM   3734 C  CD    . GLN A 1 496 ? 27.678  46.569  52.715 1.00 82.59  ? 591 GLN A CD    1 
ATOM   3735 O  OE1   . GLN A 1 496 ? 27.287  45.566  52.114 1.00 77.02  ? 591 GLN A OE1   1 
ATOM   3736 N  NE2   . GLN A 1 496 ? 28.853  46.621  53.331 1.00 86.28  ? 591 GLN A NE2   1 
ATOM   3737 N  N     . GLN A 1 497 ? 23.228  48.099  50.693 1.00 80.74  ? 592 GLN A N     1 
ATOM   3738 C  CA    . GLN A 1 497 ? 21.979  47.871  49.965 1.00 79.31  ? 592 GLN A CA    1 
ATOM   3739 C  C     . GLN A 1 497 ? 21.060  49.084  49.969 1.00 74.71  ? 592 GLN A C     1 
ATOM   3740 O  O     . GLN A 1 497 ? 20.323  49.308  49.001 1.00 76.92  ? 592 GLN A O     1 
ATOM   3741 C  CB    . GLN A 1 497 ? 21.238  46.673  50.560 1.00 86.79  ? 592 GLN A CB    1 
ATOM   3742 C  CG    . GLN A 1 497 ? 21.999  45.371  50.498 1.00 98.48  ? 592 GLN A CG    1 
ATOM   3743 C  CD    . GLN A 1 497 ? 21.230  44.242  51.150 1.00 113.83 ? 592 GLN A CD    1 
ATOM   3744 O  OE1   . GLN A 1 497 ? 20.024  44.355  51.392 1.00 111.19 ? 592 GLN A OE1   1 
ATOM   3745 N  NE2   . GLN A 1 497 ? 21.923  43.148  51.447 1.00 115.74 ? 592 GLN A NE2   1 
ATOM   3746 N  N     . THR A 1 498 ? 21.050  49.854  51.057 1.00 66.33  ? 593 THR A N     1 
ATOM   3747 C  CA    . THR A 1 498 ? 20.238  51.066  51.068 1.00 64.07  ? 593 THR A CA    1 
ATOM   3748 C  C     . THR A 1 498 ? 20.621  51.994  49.920 1.00 73.74  ? 593 THR A C     1 
ATOM   3749 O  O     . THR A 1 498 ? 19.759  52.664  49.341 1.00 73.23  ? 593 THR A O     1 
ATOM   3750 C  CB    . THR A 1 498 ? 20.377  51.791  52.402 1.00 62.31  ? 593 THR A CB    1 
ATOM   3751 O  OG1   . THR A 1 498 ? 20.096  50.890  53.479 1.00 60.90  ? 593 THR A OG1   1 
ATOM   3752 C  CG2   . THR A 1 498 ? 19.417  52.969  52.471 1.00 63.51  ? 593 THR A CG2   1 
ATOM   3753 N  N     . VAL A 1 499 ? 21.912  52.045  49.575 1.00 77.21  ? 594 VAL A N     1 
ATOM   3754 C  CA    . VAL A 1 499 ? 22.341  52.831  48.422 1.00 70.68  ? 594 VAL A CA    1 
ATOM   3755 C  C     . VAL A 1 499 ? 21.998  52.113  47.131 1.00 73.95  ? 594 VAL A C     1 
ATOM   3756 O  O     . VAL A 1 499 ? 21.552  52.734  46.159 1.00 74.61  ? 594 VAL A O     1 
ATOM   3757 C  CB    . VAL A 1 499 ? 23.845  53.131  48.496 1.00 76.70  ? 594 VAL A CB    1 
ATOM   3758 C  CG1   . VAL A 1 499 ? 24.263  53.944  47.281 1.00 80.59  ? 594 VAL A CG1   1 
ATOM   3759 C  CG2   . VAL A 1 499 ? 24.188  53.864  49.763 1.00 75.35  ? 594 VAL A CG2   1 
ATOM   3760 N  N     . ASP A 1 500 ? 22.227  50.798  47.097 1.00 78.79  ? 595 ASP A N     1 
ATOM   3761 C  CA    . ASP A 1 500 ? 21.850  50.007  45.934 1.00 81.73  ? 595 ASP A CA    1 
ATOM   3762 C  C     . ASP A 1 500 ? 20.373  50.189  45.601 1.00 76.76  ? 595 ASP A C     1 
ATOM   3763 O  O     . ASP A 1 500 ? 20.001  50.303  44.427 1.00 75.45  ? 595 ASP A O     1 
ATOM   3764 C  CB    . ASP A 1 500 ? 22.171  48.536  46.187 1.00 79.03  ? 595 ASP A CB    1 
ATOM   3765 C  CG    . ASP A 1 500 ? 21.935  47.678  44.967 1.00 84.92  ? 595 ASP A CG    1 
ATOM   3766 O  OD1   . ASP A 1 500 ? 20.760  47.376  44.674 1.00 85.17  ? 595 ASP A OD1   1 
ATOM   3767 O  OD2   . ASP A 1 500 ? 22.926  47.306  44.304 1.00 89.69  ? 595 ASP A OD2   1 
ATOM   3768 N  N     . SER A 1 501 ? 19.518  50.229  46.626 1.00 75.40  ? 596 SER A N     1 
ATOM   3769 C  CA    . SER A 1 501 ? 18.089  50.424  46.401 1.00 76.84  ? 596 SER A CA    1 
ATOM   3770 C  C     . SER A 1 501 ? 17.796  51.844  45.934 1.00 73.57  ? 596 SER A C     1 
ATOM   3771 O  O     . SER A 1 501 ? 17.173  52.048  44.886 1.00 73.52  ? 596 SER A O     1 
ATOM   3772 C  CB    . SER A 1 501 ? 17.314  50.105  47.680 1.00 79.34  ? 596 SER A CB    1 
ATOM   3773 O  OG    . SER A 1 501 ? 17.613  48.800  48.148 1.00 82.77  ? 596 SER A OG    1 
ATOM   3774 N  N     . LEU A 1 502 ? 18.259  52.838  46.696 1.00 75.94  ? 597 LEU A N     1 
ATOM   3775 C  CA    . LEU A 1 502 ? 17.950  54.234  46.400 1.00 70.53  ? 597 LEU A CA    1 
ATOM   3776 C  C     . LEU A 1 502 ? 18.438  54.657  45.022 1.00 69.22  ? 597 LEU A C     1 
ATOM   3777 O  O     . LEU A 1 502 ? 17.851  55.555  44.409 1.00 71.92  ? 597 LEU A O     1 
ATOM   3778 C  CB    . LEU A 1 502 ? 18.559  55.133  47.472 1.00 66.50  ? 597 LEU A CB    1 
ATOM   3779 C  CG    . LEU A 1 502 ? 17.769  55.160  48.775 1.00 71.68  ? 597 LEU A CG    1 
ATOM   3780 C  CD1   . LEU A 1 502 ? 18.564  55.810  49.887 1.00 72.16  ? 597 LEU A CD1   1 
ATOM   3781 C  CD2   . LEU A 1 502 ? 16.480  55.908  48.545 1.00 77.63  ? 597 LEU A CD2   1 
ATOM   3782 N  N     . LEU A 1 503 ? 19.505  54.042  44.518 1.00 68.28  ? 598 LEU A N     1 
ATOM   3783 C  CA    . LEU A 1 503 ? 19.960  54.379  43.175 1.00 74.70  ? 598 LEU A CA    1 
ATOM   3784 C  C     . LEU A 1 503 ? 19.073  53.732  42.122 1.00 76.92  ? 598 LEU A C     1 
ATOM   3785 O  O     . LEU A 1 503 ? 18.663  54.386  41.155 1.00 74.87  ? 598 LEU A O     1 
ATOM   3786 C  CB    . LEU A 1 503 ? 21.419  53.956  42.986 1.00 78.55  ? 598 LEU A CB    1 
ATOM   3787 C  CG    . LEU A 1 503 ? 22.454  55.082  42.893 1.00 74.69  ? 598 LEU A CG    1 
ATOM   3788 C  CD1   . LEU A 1 503 ? 22.363  56.025  44.088 1.00 72.08  ? 598 LEU A CD1   1 
ATOM   3789 C  CD2   . LEU A 1 503 ? 23.843  54.497  42.793 1.00 74.36  ? 598 LEU A CD2   1 
ATOM   3790 N  N     . PHE A 1 504 ? 18.758  52.447  42.308 1.00 77.57  ? 599 PHE A N     1 
ATOM   3791 C  CA    . PHE A 1 504 ? 17.985  51.711  41.316 1.00 72.98  ? 599 PHE A CA    1 
ATOM   3792 C  C     . PHE A 1 504 ? 16.590  52.296  41.149 1.00 78.49  ? 599 PHE A C     1 
ATOM   3793 O  O     . PHE A 1 504 ? 16.103  52.445  40.022 1.00 80.97  ? 599 PHE A O     1 
ATOM   3794 C  CB    . PHE A 1 504 ? 17.910  50.242  41.720 1.00 72.90  ? 599 PHE A CB    1 
ATOM   3795 C  CG    . PHE A 1 504 ? 16.847  49.471  41.006 1.00 79.97  ? 599 PHE A CG    1 
ATOM   3796 C  CD1   . PHE A 1 504 ? 17.070  48.977  39.736 1.00 80.79  ? 599 PHE A CD1   1 
ATOM   3797 C  CD2   . PHE A 1 504 ? 15.625  49.228  41.612 1.00 84.43  ? 599 PHE A CD2   1 
ATOM   3798 C  CE1   . PHE A 1 504 ? 16.097  48.262  39.077 1.00 78.41  ? 599 PHE A CE1   1 
ATOM   3799 C  CE2   . PHE A 1 504 ? 14.646  48.517  40.958 1.00 87.04  ? 599 PHE A CE2   1 
ATOM   3800 C  CZ    . PHE A 1 504 ? 14.883  48.032  39.687 1.00 89.54  ? 599 PHE A CZ    1 
ATOM   3801 N  N     . LEU A 1 505 ? 15.937  52.643  42.261 1.00 79.38  ? 600 LEU A N     1 
ATOM   3802 C  CA    . LEU A 1 505 ? 14.563  53.135  42.202 1.00 76.94  ? 600 LEU A CA    1 
ATOM   3803 C  C     . LEU A 1 505 ? 14.493  54.506  41.542 1.00 79.80  ? 600 LEU A C     1 
ATOM   3804 O  O     . LEU A 1 505 ? 13.629  54.751  40.691 1.00 82.45  ? 600 LEU A O     1 
ATOM   3805 C  CB    . LEU A 1 505 ? 13.958  53.173  43.608 1.00 75.51  ? 600 LEU A CB    1 
ATOM   3806 C  CG    . LEU A 1 505 ? 13.800  51.812  44.296 1.00 77.99  ? 600 LEU A CG    1 
ATOM   3807 C  CD1   . LEU A 1 505 ? 13.116  51.930  45.657 1.00 69.89  ? 600 LEU A CD1   1 
ATOM   3808 C  CD2   . LEU A 1 505 ? 13.052  50.837  43.399 1.00 74.28  ? 600 LEU A CD2   1 
ATOM   3809 N  N     . ASN A 1 506 ? 15.393  55.420  41.925 1.00 80.51  ? 601 ASN A N     1 
ATOM   3810 C  CA    . ASN A 1 506 ? 15.441  56.719  41.261 1.00 78.55  ? 601 ASN A CA    1 
ATOM   3811 C  C     . ASN A 1 506 ? 15.716  56.569  39.776 1.00 81.86  ? 601 ASN A C     1 
ATOM   3812 O  O     . ASN A 1 506 ? 15.244  57.378  38.971 1.00 86.33  ? 601 ASN A O     1 
ATOM   3813 C  CB    . ASN A 1 506 ? 16.508  57.611  41.886 1.00 76.52  ? 601 ASN A CB    1 
ATOM   3814 C  CG    . ASN A 1 506 ? 16.519  59.000  41.281 1.00 82.26  ? 601 ASN A CG    1 
ATOM   3815 O  OD1   . ASN A 1 506 ? 15.462  59.573  40.998 1.00 82.72  ? 601 ASN A OD1   1 
ATOM   3816 N  ND2   . ASN A 1 506 ? 17.715  59.547  41.066 1.00 76.99  ? 601 ASN A ND2   1 
ATOM   3817 N  N     . SER A 1 507 ? 16.487  55.552  39.398 1.00 78.81  ? 602 SER A N     1 
ATOM   3818 C  CA    . SER A 1 507 ? 16.660  55.249  37.986 1.00 81.75  ? 602 SER A CA    1 
ATOM   3819 C  C     . SER A 1 507 ? 15.379  54.683  37.391 1.00 88.72  ? 602 SER A C     1 
ATOM   3820 O  O     . SER A 1 507 ? 14.935  55.113  36.320 1.00 95.13  ? 602 SER A O     1 
ATOM   3821 C  CB    . SER A 1 507 ? 17.807  54.264  37.804 1.00 84.98  ? 602 SER A CB    1 
ATOM   3822 O  OG    . SER A 1 507 ? 17.594  53.493  36.643 1.00 90.24  ? 602 SER A OG    1 
ATOM   3823 N  N     . PHE A 1 508 ? 14.775  53.710  38.079 1.00 89.44  ? 603 PHE A N     1 
ATOM   3824 C  CA    . PHE A 1 508 ? 13.551  53.084  37.589 1.00 87.87  ? 603 PHE A CA    1 
ATOM   3825 C  C     . PHE A 1 508 ? 12.449  54.115  37.376 1.00 85.68  ? 603 PHE A C     1 
ATOM   3826 O  O     . PHE A 1 508 ? 11.750  54.086  36.358 1.00 86.93  ? 603 PHE A O     1 
ATOM   3827 C  CB    . PHE A 1 508 ? 13.112  51.996  38.572 1.00 80.85  ? 603 PHE A CB    1 
ATOM   3828 C  CG    . PHE A 1 508 ? 11.757  51.419  38.288 1.00 92.47  ? 603 PHE A CG    1 
ATOM   3829 C  CD1   . PHE A 1 508 ? 11.531  50.670  37.149 1.00 94.07  ? 603 PHE A CD1   1 
ATOM   3830 C  CD2   . PHE A 1 508 ? 10.710  51.603  39.181 1.00 95.10  ? 603 PHE A CD2   1 
ATOM   3831 C  CE1   . PHE A 1 508 ? 10.279  50.130  36.891 1.00 86.73  ? 603 PHE A CE1   1 
ATOM   3832 C  CE2   . PHE A 1 508 ? 9.459   51.067  38.930 1.00 82.66  ? 603 PHE A CE2   1 
ATOM   3833 C  CZ    . PHE A 1 508 ? 9.246   50.329  37.785 1.00 81.26  ? 603 PHE A CZ    1 
ATOM   3834 N  N     . TYR A 1 509 ? 12.304  55.057  38.310 1.00 84.93  ? 604 TYR A N     1 
ATOM   3835 C  CA    . TYR A 1 509 ? 11.225  56.032  38.225 1.00 88.86  ? 604 TYR A CA    1 
ATOM   3836 C  C     . TYR A 1 509 ? 11.446  57.061  37.129 1.00 92.81  ? 604 TYR A C     1 
ATOM   3837 O  O     . TYR A 1 509 ? 10.479  57.694  36.693 1.00 95.23  ? 604 TYR A O     1 
ATOM   3838 C  CB    . TYR A 1 509 ? 11.042  56.729  39.569 1.00 90.06  ? 604 TYR A CB    1 
ATOM   3839 C  CG    . TYR A 1 509 ? 10.352  55.852  40.578 1.00 96.26  ? 604 TYR A CG    1 
ATOM   3840 C  CD1   . TYR A 1 509 ? 10.363  56.170  41.926 1.00 97.37  ? 604 TYR A CD1   1 
ATOM   3841 C  CD2   . TYR A 1 509 ? 9.685   54.699  40.179 1.00 94.89  ? 604 TYR A CD2   1 
ATOM   3842 C  CE1   . TYR A 1 509 ? 9.728   55.364  42.854 1.00 102.38 ? 604 TYR A CE1   1 
ATOM   3843 C  CE2   . TYR A 1 509 ? 9.049   53.886  41.097 1.00 98.16  ? 604 TYR A CE2   1 
ATOM   3844 C  CZ    . TYR A 1 509 ? 9.073   54.222  42.433 1.00 102.85 ? 604 TYR A CZ    1 
ATOM   3845 O  OH    . TYR A 1 509 ? 8.438   53.412  43.348 1.00 111.37 ? 604 TYR A OH    1 
ATOM   3846 N  N     . LYS A 1 510 ? 12.687  57.256  36.683 1.00 91.76  ? 605 LYS A N     1 
ATOM   3847 C  CA    . LYS A 1 510 ? 12.909  58.047  35.479 1.00 92.74  ? 605 LYS A CA    1 
ATOM   3848 C  C     . LYS A 1 510 ? 12.666  57.242  34.207 1.00 87.83  ? 605 LYS A C     1 
ATOM   3849 O  O     . LYS A 1 510 ? 12.273  57.819  33.188 1.00 86.19  ? 605 LYS A O     1 
ATOM   3850 C  CB    . LYS A 1 510 ? 14.334  58.606  35.450 1.00 96.47  ? 605 LYS A CB    1 
ATOM   3851 C  CG    . LYS A 1 510 ? 14.723  59.468  36.637 1.00 93.08  ? 605 LYS A CG    1 
ATOM   3852 C  CD    . LYS A 1 510 ? 16.233  59.714  36.643 1.00 92.45  ? 605 LYS A CD    1 
ATOM   3853 C  CE    . LYS A 1 510 ? 16.703  60.340  37.952 1.00 91.25  ? 605 LYS A CE    1 
ATOM   3854 N  NZ    . LYS A 1 510 ? 18.192  60.402  38.051 1.00 73.35  ? 605 LYS A NZ    1 
ATOM   3855 N  N     . ASN A 1 511 ? 12.897  55.927  34.246 1.00 82.84  ? 606 ASN A N     1 
ATOM   3856 C  CA    . ASN A 1 511 ? 12.881  55.106  33.033 1.00 93.93  ? 606 ASN A CA    1 
ATOM   3857 C  C     . ASN A 1 511 ? 11.464  54.741  32.599 1.00 104.69 ? 606 ASN A C     1 
ATOM   3858 O  O     . ASN A 1 511 ? 10.997  55.158  31.534 1.00 106.92 ? 606 ASN A O     1 
ATOM   3859 C  CB    . ASN A 1 511 ? 13.712  53.839  33.260 1.00 98.69  ? 606 ASN A CB    1 
ATOM   3860 C  CG    . ASN A 1 511 ? 15.200  54.086  33.120 1.00 103.13 ? 606 ASN A CG    1 
ATOM   3861 O  OD1   . ASN A 1 511 ? 15.818  53.674  32.135 1.00 104.77 ? 606 ASN A OD1   1 
ATOM   3862 N  ND2   . ASN A 1 511 ? 15.781  54.775  34.093 1.00 104.83 ? 606 ASN A ND2   1 
ATOM   3863 N  N     . PHE A 1 512 ? 10.775  53.946  33.412 1.00 104.54 ? 607 PHE A N     1 
ATOM   3864 C  CA    . PHE A 1 512 ? 9.512   53.334  33.033 1.00 98.59  ? 607 PHE A CA    1 
ATOM   3865 C  C     . PHE A 1 512 ? 8.291   54.105  33.530 1.00 95.38  ? 607 PHE A C     1 
ATOM   3866 O  O     . PHE A 1 512 ? 7.158   53.652  33.326 1.00 102.00 ? 607 PHE A O     1 
ATOM   3867 C  CB    . PHE A 1 512 ? 9.489   51.885  33.517 1.00 98.56  ? 607 PHE A CB    1 
ATOM   3868 C  CG    . PHE A 1 512 ? 10.636  51.053  32.989 1.00 100.04 ? 607 PHE A CG    1 
ATOM   3869 C  CD1   . PHE A 1 512 ? 10.746  50.745  31.641 1.00 104.55 ? 607 PHE A CD1   1 
ATOM   3870 C  CD2   . PHE A 1 512 ? 11.603  50.582  33.849 1.00 101.70 ? 607 PHE A CD2   1 
ATOM   3871 C  CE1   . PHE A 1 512 ? 11.809  49.965  31.166 1.00 112.30 ? 607 PHE A CE1   1 
ATOM   3872 C  CE2   . PHE A 1 512 ? 12.664  49.814  33.399 1.00 106.14 ? 607 PHE A CE2   1 
ATOM   3873 C  CZ    . PHE A 1 512 ? 12.764  49.511  32.058 1.00 110.40 ? 607 PHE A CZ    1 
ATOM   3874 N  N     . CYS A 1 513 ? 8.486   55.259  34.162 1.00 91.29  ? 608 CYS A N     1 
ATOM   3875 C  CA    . CYS A 1 513 ? 7.383   56.124  34.556 1.00 99.92  ? 608 CYS A CA    1 
ATOM   3876 C  C     . CYS A 1 513 ? 7.463   57.435  33.788 1.00 101.54 ? 608 CYS A C     1 
ATOM   3877 O  O     . CYS A 1 513 ? 8.542   58.024  33.674 1.00 98.52  ? 608 CYS A O     1 
ATOM   3878 C  CB    . CYS A 1 513 ? 7.397   56.377  36.066 1.00 99.53  ? 608 CYS A CB    1 
ATOM   3879 S  SG    . CYS A 1 513 ? 6.937   54.932  37.068 1.00 107.48 ? 608 CYS A SG    1 
ATOM   3880 N  N     . LYS A 1 514 ? 6.323   57.886  33.264 1.00 110.91 ? 609 LYS A N     1 
ATOM   3881 C  CA    . LYS A 1 514 ? 6.261   59.151  32.537 1.00 111.57 ? 609 LYS A CA    1 
ATOM   3882 C  C     . LYS A 1 514 ? 6.078   60.316  33.501 1.00 111.41 ? 609 LYS A C     1 
ATOM   3883 O  O     . LYS A 1 514 ? 7.036   61.013  33.837 1.00 117.55 ? 609 LYS A O     1 
ATOM   3884 C  CB    . LYS A 1 514 ? 5.125   59.147  31.503 1.00 109.65 ? 609 LYS A CB    1 
ATOM   3885 C  CG    . LYS A 1 514 ? 5.437   58.400  30.208 1.00 116.71 ? 609 LYS A CG    1 
ATOM   3886 C  CD    . LYS A 1 514 ? 5.333   56.889  30.381 1.00 117.36 ? 609 LYS A CD    1 
ATOM   3887 C  CE    . LYS A 1 514 ? 5.848   56.151  29.157 1.00 118.88 ? 609 LYS A CE    1 
ATOM   3888 N  NZ    . LYS A 1 514 ? 7.282   56.463  28.899 1.00 120.49 ? 609 LYS A NZ    1 
ATOM   3889 O  "O5'" . DA  B 2 1   ? 26.558  65.976  25.468 1.00 94.02  ? 1   DA  B "O5'" 1 
ATOM   3890 C  "C5'" . DA  B 2 1   ? 27.023  65.643  26.773 1.00 94.95  ? 1   DA  B "C5'" 1 
ATOM   3891 C  "C4'" . DA  B 2 1   ? 26.464  64.305  27.229 1.00 97.55  ? 1   DA  B "C4'" 1 
ATOM   3892 O  "O4'" . DA  B 2 1   ? 27.192  63.859  28.394 1.00 95.43  ? 1   DA  B "O4'" 1 
ATOM   3893 C  "C3'" . DA  B 2 1   ? 25.025  64.341  27.699 1.00 93.16  ? 1   DA  B "C3'" 1 
ATOM   3894 O  "O3'" . DA  B 2 1   ? 24.503  63.013  27.737 1.00 94.21  ? 1   DA  B "O3'" 1 
ATOM   3895 C  "C2'" . DA  B 2 1   ? 25.188  64.919  29.101 1.00 88.45  ? 1   DA  B "C2'" 1 
ATOM   3896 C  "C1'" . DA  B 2 1   ? 26.497  64.266  29.562 1.00 90.97  ? 1   DA  B "C1'" 1 
ATOM   3897 N  N9    . DA  B 2 1   ? 27.364  65.165  30.307 1.00 90.02  ? 1   DA  B N9    1 
ATOM   3898 C  C8    . DA  B 2 1   ? 27.699  66.447  29.974 1.00 91.82  ? 1   DA  B C8    1 
ATOM   3899 N  N7    . DA  B 2 1   ? 28.515  67.018  30.826 1.00 91.38  ? 1   DA  B N7    1 
ATOM   3900 C  C5    . DA  B 2 1   ? 28.731  66.042  31.781 1.00 88.01  ? 1   DA  B C5    1 
ATOM   3901 C  C6    . DA  B 2 1   ? 29.512  66.021  32.946 1.00 87.36  ? 1   DA  B C6    1 
ATOM   3902 N  N6    . DA  B 2 1   ? 30.226  67.069  33.367 1.00 87.44  ? 1   DA  B N6    1 
ATOM   3903 N  N1    . DA  B 2 1   ? 29.506  64.891  33.684 1.00 87.86  ? 1   DA  B N1    1 
ATOM   3904 C  C2    . DA  B 2 1   ? 28.777  63.850  33.263 1.00 82.85  ? 1   DA  B C2    1 
ATOM   3905 N  N3    . DA  B 2 1   ? 28.012  63.749  32.178 1.00 81.65  ? 1   DA  B N3    1 
ATOM   3906 C  C4    . DA  B 2 1   ? 28.034  64.890  31.474 1.00 88.01  ? 1   DA  B C4    1 
ATOM   3907 P  P     . DG  B 2 2   ? 22.986  62.739  28.197 1.00 102.69 ? 2   DG  B P     1 
ATOM   3908 O  OP1   . DG  B 2 2   ? 22.661  61.323  27.913 1.00 98.01  ? 2   DG  B OP1   1 
ATOM   3909 O  OP2   . DG  B 2 2   ? 22.139  63.824  27.654 1.00 105.63 ? 2   DG  B OP2   1 
ATOM   3910 O  "O5'" . DG  B 2 2   ? 23.034  62.863  29.784 1.00 86.75  ? 2   DG  B "O5'" 1 
ATOM   3911 C  "C5'" . DG  B 2 2   ? 21.894  62.532  30.537 1.00 91.89  ? 2   DG  B "C5'" 1 
ATOM   3912 C  "C4'" . DG  B 2 2   ? 22.237  62.456  32.004 1.00 91.12  ? 2   DG  B "C4'" 1 
ATOM   3913 O  "O4'" . DG  B 2 2   ? 23.515  63.094  32.234 1.00 80.68  ? 2   DG  B "O4'" 1 
ATOM   3914 C  "C3'" . DG  B 2 2   ? 21.235  63.153  32.930 1.00 100.26 ? 2   DG  B "C3'" 1 
ATOM   3915 O  "O3'" . DG  B 2 2   ? 20.781  62.241  33.923 1.00 101.02 ? 2   DG  B "O3'" 1 
ATOM   3916 C  "C2'" . DG  B 2 2   ? 22.038  64.309  33.539 1.00 95.73  ? 2   DG  B "C2'" 1 
ATOM   3917 C  "C1'" . DG  B 2 2   ? 23.456  63.776  33.454 1.00 82.56  ? 2   DG  B "C1'" 1 
ATOM   3918 N  N9    . DG  B 2 2   ? 24.469  64.817  33.443 1.00 80.97  ? 2   DG  B N9    1 
ATOM   3919 C  C8    . DG  B 2 2   ? 24.756  65.678  32.415 1.00 84.43  ? 2   DG  B C8    1 
ATOM   3920 N  N7    . DG  B 2 2   ? 25.721  66.509  32.690 1.00 86.52  ? 2   DG  B N7    1 
ATOM   3921 C  C5    . DG  B 2 2   ? 26.104  66.170  33.983 1.00 85.06  ? 2   DG  B C5    1 
ATOM   3922 C  C6    . DG  B 2 2   ? 27.109  66.724  34.817 1.00 86.27  ? 2   DG  B C6    1 
ATOM   3923 O  O6    . DG  B 2 2   ? 27.887  67.662  34.571 1.00 85.65  ? 2   DG  B O6    1 
ATOM   3924 N  N1    . DG  B 2 2   ? 27.159  66.089  36.056 1.00 85.05  ? 2   DG  B N1    1 
ATOM   3925 C  C2    . DG  B 2 2   ? 26.346  65.050  36.440 1.00 85.46  ? 2   DG  B C2    1 
ATOM   3926 N  N2    . DG  B 2 2   ? 26.547  64.566  37.676 1.00 84.05  ? 2   DG  B N2    1 
ATOM   3927 N  N3    . DG  B 2 2   ? 25.402  64.522  35.668 1.00 84.16  ? 2   DG  B N3    1 
ATOM   3928 C  C4    . DG  B 2 2   ? 25.340  65.130  34.459 1.00 82.73  ? 2   DG  B C4    1 
ATOM   3929 P  P     . DA  B 2 3   ? 19.326  62.420  34.580 1.00 101.62 ? 3   DA  B P     1 
ATOM   3930 O  OP1   . DA  B 2 3   ? 18.787  61.060  34.849 1.00 80.67  ? 3   DA  B OP1   1 
ATOM   3931 O  OP2   . DA  B 2 3   ? 18.580  63.376  33.727 1.00 97.92  ? 3   DA  B OP2   1 
ATOM   3932 O  "O5'" . DA  B 2 3   ? 19.636  63.133  35.979 1.00 90.51  ? 3   DA  B "O5'" 1 
ATOM   3933 C  "C5'" . DA  B 2 3   ? 20.902  62.932  36.592 1.00 91.97  ? 3   DA  B "C5'" 1 
ATOM   3934 C  "C4'" . DA  B 2 3   ? 21.048  63.768  37.848 1.00 89.55  ? 3   DA  B "C4'" 1 
ATOM   3935 O  "O4'" . DA  B 2 3   ? 22.286  64.532  37.791 1.00 90.07  ? 3   DA  B "O4'" 1 
ATOM   3936 C  "C3'" . DA  B 2 3   ? 19.932  64.777  38.104 1.00 80.61  ? 3   DA  B "C3'" 1 
ATOM   3937 O  "O3'" . DA  B 2 3   ? 19.655  64.802  39.500 1.00 82.21  ? 3   DA  B "O3'" 1 
ATOM   3938 C  "C2'" . DA  B 2 3   ? 20.550  66.089  37.623 1.00 84.11  ? 3   DA  B "C2'" 1 
ATOM   3939 C  "C1'" . DA  B 2 3   ? 22.011  65.897  38.005 1.00 81.17  ? 3   DA  B "C1'" 1 
ATOM   3940 N  N9    . DA  B 2 3   ? 22.932  66.691  37.194 1.00 78.22  ? 3   DA  B N9    1 
ATOM   3941 C  C8    . DA  B 2 3   ? 22.904  66.856  35.836 1.00 82.57  ? 3   DA  B C8    1 
ATOM   3942 N  N7    . DA  B 2 3   ? 23.857  67.635  35.376 1.00 81.28  ? 3   DA  B N7    1 
ATOM   3943 C  C5    . DA  B 2 3   ? 24.561  68.004  36.509 1.00 75.31  ? 3   DA  B C5    1 
ATOM   3944 C  C6    . DA  B 2 3   ? 25.690  68.829  36.703 1.00 72.73  ? 3   DA  B C6    1 
ATOM   3945 N  N6    . DA  B 2 3   ? 26.332  69.450  35.705 1.00 68.59  ? 3   DA  B N6    1 
ATOM   3946 N  N1    . DA  B 2 3   ? 26.135  68.989  37.968 1.00 69.22  ? 3   DA  B N1    1 
ATOM   3947 C  C2    . DA  B 2 3   ? 25.488  68.369  38.964 1.00 71.45  ? 3   DA  B C2    1 
ATOM   3948 N  N3    . DA  B 2 3   ? 24.419  67.575  38.905 1.00 73.51  ? 3   DA  B N3    1 
ATOM   3949 C  C4    . DA  B 2 3   ? 24.002  67.432  37.639 1.00 74.18  ? 3   DA  B C4    1 
ATOM   3950 P  P     . DG  B 2 4   ? 18.416  65.628  40.109 1.00 88.63  ? 4   DG  B P     1 
ATOM   3951 O  OP1   . DG  B 2 4   ? 17.491  64.626  40.691 1.00 85.87  ? 4   DG  B OP1   1 
ATOM   3952 O  OP2   . DG  B 2 4   ? 17.917  66.593  39.102 1.00 85.06  ? 4   DG  B OP2   1 
ATOM   3953 O  "O5'" . DG  B 2 4   ? 19.089  66.431  41.320 1.00 76.29  ? 4   DG  B "O5'" 1 
ATOM   3954 C  "C5'" . DG  B 2 4   ? 20.496  66.357  41.489 1.00 75.55  ? 4   DG  B "C5'" 1 
ATOM   3955 C  "C4'" . DG  B 2 4   ? 20.971  67.175  42.673 1.00 72.76  ? 4   DG  B "C4'" 1 
ATOM   3956 O  "O4'" . DG  B 2 4   ? 22.092  67.995  42.250 1.00 75.92  ? 4   DG  B "O4'" 1 
ATOM   3957 C  "C3'" . DG  B 2 4   ? 19.973  68.173  43.222 1.00 63.99  ? 4   DG  B "C3'" 1 
ATOM   3958 O  "O3'" . DG  B 2 4   ? 20.406  68.581  44.533 1.00 58.91  ? 4   DG  B "O3'" 1 
ATOM   3959 C  "C2'" . DG  B 2 4   ? 20.137  69.298  42.212 1.00 61.82  ? 4   DG  B "C2'" 1 
ATOM   3960 C  "C1'" . DG  B 2 4   ? 21.659  69.338  42.106 1.00 63.46  ? 4   DG  B "C1'" 1 
ATOM   3961 N  N9    . DG  B 2 4   ? 22.171  69.867  40.841 1.00 63.06  ? 4   DG  B N9    1 
ATOM   3962 C  C8    . DG  B 2 4   ? 21.818  69.478  39.568 1.00 63.45  ? 4   DG  B C8    1 
ATOM   3963 N  N7    . DG  B 2 4   ? 22.455  70.130  38.629 1.00 56.06  ? 4   DG  B N7    1 
ATOM   3964 C  C5    . DG  B 2 4   ? 23.287  71.002  39.324 1.00 54.28  ? 4   DG  B C5    1 
ATOM   3965 C  C6    . DG  B 2 4   ? 24.217  71.956  38.841 1.00 57.67  ? 4   DG  B C6    1 
ATOM   3966 O  O6    . DG  B 2 4   ? 24.495  72.230  37.662 1.00 58.93  ? 4   DG  B O6    1 
ATOM   3967 N  N1    . DG  B 2 4   ? 24.857  72.632  39.887 1.00 54.16  ? 4   DG  B N1    1 
ATOM   3968 C  C2    . DG  B 2 4   ? 24.625  72.407  41.228 1.00 55.49  ? 4   DG  B C2    1 
ATOM   3969 N  N2    . DG  B 2 4   ? 25.338  73.151  42.093 1.00 47.05  ? 4   DG  B N2    1 
ATOM   3970 N  N3    . DG  B 2 4   ? 23.758  71.511  41.690 1.00 56.65  ? 4   DG  B N3    1 
ATOM   3971 C  C4    . DG  B 2 4   ? 23.127  70.850  40.686 1.00 55.83  ? 4   DG  B C4    1 
ATOM   3972 P  P     . DA  B 2 5   ? 19.377  69.191  45.614 1.00 76.60  ? 5   DA  B P     1 
ATOM   3973 O  OP1   . DA  B 2 5   ? 19.820  68.740  46.952 1.00 69.76  ? 5   DA  B OP1   1 
ATOM   3974 O  OP2   . DA  B 2 5   ? 17.985  68.970  45.157 1.00 72.39  ? 5   DA  B OP2   1 
ATOM   3975 O  "O5'" . DA  B 2 5   ? 19.673  70.750  45.567 1.00 66.06  ? 5   DA  B "O5'" 1 
ATOM   3976 C  "C5'" . DA  B 2 5   ? 20.850  71.191  44.950 1.00 61.24  ? 5   DA  B "C5'" 1 
ATOM   3977 C  "C4'" . DA  B 2 5   ? 21.086  72.658  45.188 1.00 62.07  ? 5   DA  B "C4'" 1 
ATOM   3978 O  "O4'" . DA  B 2 5   ? 21.786  73.206  44.045 1.00 59.15  ? 5   DA  B "O4'" 1 
ATOM   3979 C  "C3'" . DA  B 2 5   ? 19.831  73.498  45.349 1.00 61.86  ? 5   DA  B "C3'" 1 
ATOM   3980 O  "O3'" . DA  B 2 5   ? 20.107  74.576  46.232 1.00 62.38  ? 5   DA  B "O3'" 1 
ATOM   3981 C  "C2'" . DA  B 2 5   ? 19.576  73.976  43.923 1.00 53.47  ? 5   DA  B "C2'" 1 
ATOM   3982 C  "C1'" . DA  B 2 5   ? 20.998  74.188  43.424 1.00 52.79  ? 5   DA  B "C1'" 1 
ATOM   3983 N  N9    . DA  B 2 5   ? 21.143  74.059  41.977 1.00 47.62  ? 5   DA  B N9    1 
ATOM   3984 C  C8    . DA  B 2 5   ? 20.471  73.206  41.149 1.00 49.78  ? 5   DA  B C8    1 
ATOM   3985 N  N7    . DA  B 2 5   ? 20.804  73.324  39.881 1.00 46.54  ? 5   DA  B N7    1 
ATOM   3986 C  C5    . DA  B 2 5   ? 21.756  74.328  39.880 1.00 42.15  ? 5   DA  B C5    1 
ATOM   3987 C  C6    . DA  B 2 5   ? 22.505  74.930  38.843 1.00 46.97  ? 5   DA  B C6    1 
ATOM   3988 N  N6    . DA  B 2 5   ? 22.396  74.582  37.554 1.00 43.24  ? 5   DA  B N6    1 
ATOM   3989 N  N1    . DA  B 2 5   ? 23.379  75.908  39.186 1.00 51.53  ? 5   DA  B N1    1 
ATOM   3990 C  C2    . DA  B 2 5   ? 23.488  76.253  40.480 1.00 51.21  ? 5   DA  B C2    1 
ATOM   3991 N  N3    . DA  B 2 5   ? 22.838  75.760  41.540 1.00 45.72  ? 5   DA  B N3    1 
ATOM   3992 C  C4    . DA  B 2 5   ? 21.978  74.793  41.165 1.00 43.87  ? 5   DA  B C4    1 
ATOM   3993 P  P     . DA  B 2 6   ? 18.927  75.525  46.763 1.00 73.26  ? 6   DA  B P     1 
ATOM   3994 O  OP1   . DA  B 2 6   ? 19.076  75.636  48.235 1.00 64.26  ? 6   DA  B OP1   1 
ATOM   3995 O  OP2   . DA  B 2 6   ? 17.647  75.082  46.161 1.00 73.52  ? 6   DA  B OP2   1 
ATOM   3996 O  "O5'" . DA  B 2 6   ? 19.315  76.947  46.173 1.00 57.12  ? 6   DA  B "O5'" 1 
ATOM   3997 C  "C5'" . DA  B 2 6   ? 20.355  77.660  46.773 1.00 58.77  ? 6   DA  B "C5'" 1 
ATOM   3998 C  "C4'" . DA  B 2 6   ? 20.937  78.667  45.815 1.00 57.73  ? 6   DA  B "C4'" 1 
ATOM   3999 O  "O4'" . DA  B 2 6   ? 21.022  78.075  44.516 1.00 51.84  ? 6   DA  B "O4'" 1 
ATOM   4000 C  "C3'" . DA  B 2 6   ? 20.099  79.925  45.628 1.00 62.77  ? 6   DA  B "C3'" 1 
ATOM   4001 O  "O3'" . DA  B 2 6   ? 20.705  81.020  46.304 1.00 64.48  ? 6   DA  B "O3'" 1 
ATOM   4002 C  "C2'" . DA  B 2 6   ? 20.060  80.140  44.104 1.00 57.52  ? 6   DA  B "C2'" 1 
ATOM   4003 C  "C1'" . DA  B 2 6   ? 21.043  79.100  43.576 1.00 49.35  ? 6   DA  B "C1'" 1 
ATOM   4004 N  N9    . DA  B 2 6   ? 20.669  78.521  42.293 1.00 42.70  ? 6   DA  B N9    1 
ATOM   4005 C  C8    . DA  B 2 6   ? 19.776  77.511  42.087 1.00 45.45  ? 6   DA  B C8    1 
ATOM   4006 N  N7    . DA  B 2 6   ? 19.646  77.165  40.829 1.00 44.18  ? 6   DA  B N7    1 
ATOM   4007 C  C5    . DA  B 2 6   ? 20.516  78.003  40.163 1.00 37.37  ? 6   DA  B C5    1 
ATOM   4008 C  C6    . DA  B 2 6   ? 20.838  78.136  38.801 1.00 42.66  ? 6   DA  B C6    1 
ATOM   4009 N  N6    . DA  B 2 6   ? 20.279  77.388  37.839 1.00 39.72  ? 6   DA  B N6    1 
ATOM   4010 N  N1    . DA  B 2 6   ? 21.760  79.066  38.463 1.00 47.31  ? 6   DA  B N1    1 
ATOM   4011 C  C2    . DA  B 2 6   ? 22.311  79.810  39.433 1.00 48.50  ? 6   DA  B C2    1 
ATOM   4012 N  N3    . DA  B 2 6   ? 22.080  79.778  40.750 1.00 47.34  ? 6   DA  B N3    1 
ATOM   4013 C  C4    . DA  B 2 6   ? 21.164  78.843  41.050 1.00 39.24  ? 6   DA  B C4    1 
ATOM   4014 P  P     . DC  B 2 7   ? 19.838  82.338  46.618 1.00 74.33  ? 7   DC  B P     1 
ATOM   4015 O  OP1   . DC  B 2 7   ? 20.460  83.052  47.753 1.00 64.71  ? 7   DC  B OP1   1 
ATOM   4016 O  OP2   . DC  B 2 7   ? 18.415  81.929  46.682 1.00 71.28  ? 7   DC  B OP2   1 
ATOM   4017 O  "O5'" . DC  B 2 7   ? 20.075  83.253  45.339 1.00 53.21  ? 7   DC  B "O5'" 1 
ATOM   4018 C  "C5'" . DC  B 2 7   ? 21.350  83.773  45.109 1.00 57.73  ? 7   DC  B "C5'" 1 
ATOM   4019 C  "C4'" . DC  B 2 7   ? 21.556  84.037  43.641 1.00 62.24  ? 7   DC  B "C4'" 1 
ATOM   4020 O  "O4'" . DC  B 2 7   ? 21.050  82.937  42.866 1.00 52.56  ? 7   DC  B "O4'" 1 
ATOM   4021 C  "C3'" . DC  B 2 7   ? 20.822  85.259  43.113 1.00 68.05  ? 7   DC  B "C3'" 1 
ATOM   4022 O  "O3'" . DC  B 2 7   ? 21.729  86.332  42.980 1.00 74.45  ? 7   DC  B "O3'" 1 
ATOM   4023 C  "C2'" . DC  B 2 7   ? 20.261  84.809  41.746 1.00 66.94  ? 7   DC  B "C2'" 1 
ATOM   4024 C  "C1'" . DC  B 2 7   ? 20.846  83.414  41.568 1.00 51.83  ? 7   DC  B "C1'" 1 
ATOM   4025 N  N1    . DC  B 2 7   ? 19.953  82.462  40.834 1.00 54.02  ? 7   DC  B N1    1 
ATOM   4026 C  C2    . DC  B 2 7   ? 20.106  82.293  39.448 1.00 51.17  ? 7   DC  B C2    1 
ATOM   4027 O  O2    . DC  B 2 7   ? 20.974  82.945  38.854 1.00 52.90  ? 7   DC  B O2    1 
ATOM   4028 N  N3    . DC  B 2 7   ? 19.296  81.410  38.797 1.00 44.65  ? 7   DC  B N3    1 
ATOM   4029 C  C4    . DC  B 2 7   ? 18.369  80.723  39.481 1.00 48.38  ? 7   DC  B C4    1 
ATOM   4030 N  N4    . DC  B 2 7   ? 17.588  79.873  38.803 1.00 45.07  ? 7   DC  B N4    1 
ATOM   4031 C  C5    . DC  B 2 7   ? 18.200  80.885  40.892 1.00 48.27  ? 7   DC  B C5    1 
ATOM   4032 C  C6    . DC  B 2 7   ? 19.001  81.759  41.518 1.00 54.54  ? 7   DC  B C6    1 
ATOM   4033 P  P     . DA  B 2 8   ? 21.189  87.841  42.977 1.00 90.17  ? 8   DA  B P     1 
ATOM   4034 O  OP1   . DA  B 2 8   ? 21.774  88.508  44.167 1.00 93.47  ? 8   DA  B OP1   1 
ATOM   4035 O  OP2   . DA  B 2 8   ? 19.721  87.770  42.784 1.00 64.48  ? 8   DA  B OP2   1 
ATOM   4036 O  "O5'" . DA  B 2 8   ? 21.870  88.488  41.676 1.00 82.05  ? 8   DA  B "O5'" 1 
ATOM   4037 C  "C5'" . DA  B 2 8   ? 22.494  87.641  40.720 1.00 81.90  ? 8   DA  B "C5'" 1 
ATOM   4038 C  "C4'" . DA  B 2 8   ? 22.903  88.408  39.474 1.00 86.04  ? 8   DA  B "C4'" 1 
ATOM   4039 O  "O4'" . DA  B 2 8   ? 22.463  87.682  38.306 1.00 83.89  ? 8   DA  B "O4'" 1 
ATOM   4040 C  "C3'" . DA  B 2 8   ? 22.282  89.780  39.319 1.00 81.86  ? 8   DA  B "C3'" 1 
ATOM   4041 O  "O3'" . DA  B 2 8   ? 23.083  90.580  38.444 1.00 91.22  ? 8   DA  B "O3'" 1 
ATOM   4042 C  "C2'" . DA  B 2 8   ? 20.927  89.451  38.696 1.00 80.34  ? 8   DA  B "C2'" 1 
ATOM   4043 C  "C1'" . DA  B 2 8   ? 21.215  88.185  37.877 1.00 71.57  ? 8   DA  B "C1'" 1 
ATOM   4044 N  N9    . DA  B 2 8   ? 20.209  87.142  38.062 1.00 64.05  ? 8   DA  B N9    1 
ATOM   4045 C  C8    . DA  B 2 8   ? 19.623  86.774  39.237 1.00 58.65  ? 8   DA  B C8    1 
ATOM   4046 N  N7    . DA  B 2 8   ? 18.744  85.809  39.110 1.00 61.79  ? 8   DA  B N7    1 
ATOM   4047 C  C5    . DA  B 2 8   ? 18.747  85.526  37.755 1.00 58.33  ? 8   DA  B C5    1 
ATOM   4048 C  C6    . DA  B 2 8   ? 18.027  84.592  36.976 1.00 58.41  ? 8   DA  B C6    1 
ATOM   4049 N  N6    . DA  B 2 8   ? 17.125  83.747  37.489 1.00 56.52  ? 8   DA  B N6    1 
ATOM   4050 N  N1    . DA  B 2 8   ? 18.266  84.568  35.646 1.00 53.93  ? 8   DA  B N1    1 
ATOM   4051 C  C2    . DA  B 2 8   ? 19.164  85.422  35.139 1.00 59.57  ? 8   DA  B C2    1 
ATOM   4052 N  N3    . DA  B 2 8   ? 19.903  86.340  35.770 1.00 66.44  ? 8   DA  B N3    1 
ATOM   4053 C  C4    . DA  B 2 8   ? 19.642  86.340  37.090 1.00 63.01  ? 8   DA  B C4    1 
ATOM   4054 P  P     . DA  B 2 9   ? 22.605  92.054  38.007 1.00 107.86 ? 9   DA  B P     1 
ATOM   4055 O  OP1   . DA  B 2 9   ? 23.813  92.804  37.596 1.00 103.32 ? 9   DA  B OP1   1 
ATOM   4056 O  OP2   . DA  B 2 9   ? 21.742  92.602  39.079 1.00 103.97 ? 9   DA  B OP2   1 
ATOM   4057 O  "O5'" . DA  B 2 9   ? 21.725  91.803  36.691 1.00 89.82  ? 9   DA  B "O5'" 1 
ATOM   4058 C  "C5'" . DA  B 2 9   ? 22.310  91.169  35.559 1.00 83.79  ? 9   DA  B "C5'" 1 
ATOM   4059 C  "C4'" . DA  B 2 9   ? 21.254  90.795  34.533 1.00 87.67  ? 9   DA  B "C4'" 1 
ATOM   4060 O  "O4'" . DA  B 2 9   ? 20.430  89.703  35.033 1.00 83.76  ? 9   DA  B "O4'" 1 
ATOM   4061 C  "C3'" . DA  B 2 9   ? 20.276  91.915  34.156 1.00 89.54  ? 9   DA  B "C3'" 1 
ATOM   4062 O  "O3'" . DA  B 2 9   ? 20.105  91.936  32.743 1.00 99.68  ? 9   DA  B "O3'" 1 
ATOM   4063 C  "C2'" . DA  B 2 9   ? 18.987  91.492  34.860 1.00 82.82  ? 9   DA  B "C2'" 1 
ATOM   4064 C  "C1'" . DA  B 2 9   ? 19.088  89.988  34.721 1.00 73.48  ? 9   DA  B "C1'" 1 
ATOM   4065 N  N9    . DA  B 2 9   ? 18.211  89.246  35.623 1.00 67.11  ? 9   DA  B N9    1 
ATOM   4066 C  C8    . DA  B 2 9   ? 18.079  89.411  36.973 1.00 69.95  ? 9   DA  B C8    1 
ATOM   4067 N  N7    . DA  B 2 9   ? 17.207  88.598  37.525 1.00 62.59  ? 9   DA  B N7    1 
ATOM   4068 C  C5    . DA  B 2 9   ? 16.728  87.857  36.462 1.00 60.69  ? 9   DA  B C5    1 
ATOM   4069 C  C6    . DA  B 2 9   ? 15.774  86.828  36.382 1.00 64.48  ? 9   DA  B C6    1 
ATOM   4070 N  N6    . DA  B 2 9   ? 15.117  86.352  37.444 1.00 63.51  ? 9   DA  B N6    1 
ATOM   4071 N  N1    . DA  B 2 9   ? 15.525  86.300  35.163 1.00 67.10  ? 9   DA  B N1    1 
ATOM   4072 C  C2    . DA  B 2 9   ? 16.191  86.780  34.101 1.00 65.58  ? 9   DA  B C2    1 
ATOM   4073 N  N3    . DA  B 2 9   ? 17.113  87.741  34.057 1.00 60.31  ? 9   DA  B N3    1 
ATOM   4074 C  C4    . DA  B 2 9   ? 17.336  88.243  35.281 1.00 61.56  ? 9   DA  B C4    1 
ATOM   4075 P  P     . DC  B 2 10  ? 19.427  93.202  32.018 1.00 110.80 ? 10  DC  B P     1 
ATOM   4076 O  OP1   . DC  B 2 10  ? 19.433  92.940  30.559 1.00 98.47  ? 10  DC  B OP1   1 
ATOM   4077 O  OP2   . DC  B 2 10  ? 20.067  94.418  32.574 1.00 100.15 ? 10  DC  B OP2   1 
ATOM   4078 O  "O5'" . DC  B 2 10  ? 17.900  93.156  32.492 1.00 96.23  ? 10  DC  B "O5'" 1 
ATOM   4079 C  "C5'" . DC  B 2 10  ? 16.864  93.092  31.531 1.00 90.32  ? 10  DC  B "C5'" 1 
ATOM   4080 C  "C4'" . DC  B 2 10  ? 16.231  91.719  31.531 1.00 88.40  ? 10  DC  B "C4'" 1 
ATOM   4081 O  "O4'" . DC  B 2 10  ? 16.230  91.197  32.867 1.00 81.70  ? 10  DC  B "O4'" 1 
ATOM   4082 C  "C3'" . DC  B 2 10  ? 14.770  91.692  31.125 1.00 97.65  ? 10  DC  B "C3'" 1 
ATOM   4083 O  "O3'" . DC  B 2 10  ? 14.658  91.562  29.712 1.00 108.30 ? 10  DC  B "O3'" 1 
ATOM   4084 C  "C2'" . DC  B 2 10  ? 14.218  90.456  31.855 1.00 79.85  ? 10  DC  B "C2'" 1 
ATOM   4085 C  "C1'" . DC  B 2 10  ? 15.273  90.165  32.932 1.00 76.60  ? 10  DC  B "C1'" 1 
ATOM   4086 N  N1    . DC  B 2 10  ? 14.751  90.074  34.353 1.00 72.85  ? 10  DC  B N1    1 
ATOM   4087 C  C2    . DC  B 2 10  ? 13.706  89.183  34.673 1.00 71.96  ? 10  DC  B C2    1 
ATOM   4088 O  O2    . DC  B 2 10  ? 13.195  88.496  33.784 1.00 75.45  ? 10  DC  B O2    1 
ATOM   4089 N  N3    . DC  B 2 10  ? 13.277  89.106  35.958 1.00 67.24  ? 10  DC  B N3    1 
ATOM   4090 C  C4    . DC  B 2 10  ? 13.847  89.852  36.901 1.00 68.66  ? 10  DC  B C4    1 
ATOM   4091 N  N4    . DC  B 2 10  ? 13.383  89.734  38.151 1.00 60.43  ? 10  DC  B N4    1 
ATOM   4092 C  C5    . DC  B 2 10  ? 14.919  90.755  36.604 1.00 69.53  ? 10  DC  B C5    1 
ATOM   4093 C  C6    . DC  B 2 10  ? 15.337  90.830  35.333 1.00 68.53  ? 10  DC  B C6    1 
ATOM   4094 P  P     . DA  B 2 11  ? 13.504  92.356  28.924 1.00 112.04 ? 11  DA  B P     1 
ATOM   4095 O  OP1   . DA  B 2 11  ? 13.819  92.312  27.478 1.00 108.31 ? 11  DA  B OP1   1 
ATOM   4096 O  OP2   . DA  B 2 11  ? 13.325  93.659  29.602 1.00 99.49  ? 11  DA  B OP2   1 
ATOM   4097 O  "O5'" . DA  B 2 11  ? 12.200  91.463  29.161 1.00 95.93  ? 11  DA  B "O5'" 1 
ATOM   4098 C  "C5'" . DA  B 2 11  ? 12.211  90.085  28.807 1.00 100.65 ? 11  DA  B "C5'" 1 
ATOM   4099 C  "C4'" . DA  B 2 11  ? 10.892  89.422  29.164 1.00 104.03 ? 11  DA  B "C4'" 1 
ATOM   4100 O  "O4'" . DA  B 2 11  ? 10.816  89.214  30.600 1.00 102.34 ? 11  DA  B "O4'" 1 
ATOM   4101 C  "C3'" . DA  B 2 11  ? 9.655   90.220  28.795 1.00 112.51 ? 11  DA  B "C3'" 1 
ATOM   4102 O  "O3'" . DA  B 2 11  ? 8.609   89.344  28.437 1.00 120.28 ? 11  DA  B "O3'" 1 
ATOM   4103 C  "C2'" . DA  B 2 11  ? 9.337   90.976  30.084 1.00 111.39 ? 11  DA  B "C2'" 1 
ATOM   4104 C  "C1'" . DA  B 2 11  ? 9.760   89.978  31.155 1.00 96.64  ? 11  DA  B "C1'" 1 
ATOM   4105 N  N9    . DA  B 2 11  ? 10.255  90.616  32.374 1.00 86.99  ? 11  DA  B N9    1 
ATOM   4106 C  C8    . DA  B 2 11  ? 11.205  91.595  32.460 1.00 82.96  ? 11  DA  B C8    1 
ATOM   4107 N  N7    . DA  B 2 11  ? 11.467  91.977  33.688 1.00 78.96  ? 11  DA  B N7    1 
ATOM   4108 C  C5    . DA  B 2 11  ? 10.627  91.198  34.465 1.00 82.90  ? 11  DA  B C5    1 
ATOM   4109 C  C6    . DA  B 2 11  ? 10.421  91.125  35.858 1.00 82.42  ? 11  DA  B C6    1 
ATOM   4110 N  N6    . DA  B 2 11  ? 11.085  91.884  36.739 1.00 77.64  ? 11  DA  B N6    1 
ATOM   4111 N  N1    . DA  B 2 11  ? 9.504   90.239  36.310 1.00 78.84  ? 11  DA  B N1    1 
ATOM   4112 C  C2    . DA  B 2 11  ? 8.847   89.478  35.421 1.00 76.93  ? 11  DA  B C2    1 
ATOM   4113 N  N3    . DA  B 2 11  ? 8.955   89.458  34.090 1.00 78.70  ? 11  DA  B N3    1 
ATOM   4114 C  C4    . DA  B 2 11  ? 9.871   90.350  33.672 1.00 84.71  ? 11  DA  B C4    1 
ATOM   4115 P  P     . DA  B 2 12  ? 7.396   89.875  27.531 1.00 122.48 ? 12  DA  B P     1 
ATOM   4116 O  OP1   . DA  B 2 12  ? 7.765   89.681  26.110 1.00 124.36 ? 12  DA  B OP1   1 
ATOM   4117 O  OP2   . DA  B 2 12  ? 7.029   91.224  28.019 1.00 110.18 ? 12  DA  B OP2   1 
ATOM   4118 O  "O5'" . DA  B 2 12  ? 6.207   88.870  27.874 1.00 122.32 ? 12  DA  B "O5'" 1 
ATOM   4119 C  "C5'" . DA  B 2 12  ? 4.984   89.382  28.359 1.00 126.65 ? 12  DA  B "C5'" 1 
ATOM   4120 C  "C4'" . DA  B 2 12  ? 4.713   88.912  29.775 1.00 124.39 ? 12  DA  B "C4'" 1 
ATOM   4121 O  "O4'" . DA  B 2 12  ? 5.714   89.447  30.686 1.00 115.42 ? 12  DA  B "O4'" 1 
ATOM   4122 C  "C3'" . DA  B 2 12  ? 3.359   89.357  30.333 1.00 121.85 ? 12  DA  B "C3'" 1 
ATOM   4123 O  "O3'" . DA  B 2 12  ? 2.634   88.238  30.809 1.00 127.14 ? 12  DA  B "O3'" 1 
ATOM   4124 C  "C2'" . DA  B 2 12  ? 3.727   90.314  31.467 1.00 117.45 ? 12  DA  B "C2'" 1 
ATOM   4125 C  "C1'" . DA  B 2 12  ? 5.069   89.768  31.893 1.00 109.39 ? 12  DA  B "C1'" 1 
ATOM   4126 N  N9    . DA  B 2 12  ? 5.878   90.726  32.638 1.00 100.95 ? 12  DA  B N9    1 
ATOM   4127 C  C8    . DA  B 2 12  ? 6.754   91.645  32.128 1.00 99.86  ? 12  DA  B C8    1 
ATOM   4128 N  N7    . DA  B 2 12  ? 7.349   92.378  33.045 1.00 98.04  ? 12  DA  B N7    1 
ATOM   4129 C  C5    . DA  B 2 12  ? 6.822   91.911  34.240 1.00 97.91  ? 12  DA  B C5    1 
ATOM   4130 C  C6    . DA  B 2 12  ? 7.044   92.275  35.587 1.00 89.70  ? 12  DA  B C6    1 
ATOM   4131 N  N6    . DA  B 2 12  ? 7.895   93.239  35.960 1.00 84.87  ? 12  DA  B N6    1 
ATOM   4132 N  N1    . DA  B 2 12  ? 6.352   91.606  36.538 1.00 92.09  ? 12  DA  B N1    1 
ATOM   4133 C  C2    . DA  B 2 12  ? 5.500   90.638  36.161 1.00 91.77  ? 12  DA  B C2    1 
ATOM   4134 N  N3    . DA  B 2 12  ? 5.208   90.207  34.931 1.00 91.35  ? 12  DA  B N3    1 
ATOM   4135 C  C4    . DA  B 2 12  ? 5.910   90.892  34.007 1.00 98.69  ? 12  DA  B C4    1 
ATOM   4136 P  P     . DC  B 2 13  ? 1.071   88.097  30.465 1.00 145.28 ? 13  DC  B P     1 
ATOM   4137 O  OP1   . DC  B 2 13  ? 0.747   86.655  30.377 1.00 146.06 ? 13  DC  B OP1   1 
ATOM   4138 O  OP2   . DC  B 2 13  ? 0.798   89.002  29.325 1.00 131.76 ? 13  DC  B OP2   1 
ATOM   4139 O  "O5'" . DC  B 2 13  ? 0.334   88.680  31.755 1.00 126.53 ? 13  DC  B "O5'" 1 
ATOM   4140 C  "C5'" . DC  B 2 13  ? 0.319   90.076  31.989 1.00 122.76 ? 13  DC  B "C5'" 1 
ATOM   4141 C  "C4'" . DC  B 2 13  ? 0.509   90.364  33.461 1.00 119.08 ? 13  DC  B "C4'" 1 
ATOM   4142 O  "O4'" . DC  B 2 13  ? 1.804   90.967  33.685 1.00 113.04 ? 13  DC  B "O4'" 1 
ATOM   4143 C  "C3'" . DC  B 2 13  ? -0.515  91.326  34.055 1.00 118.83 ? 13  DC  B "C3'" 1 
ATOM   4144 O  "O3'" . DC  B 2 13  ? -1.267  90.664  35.051 1.00 123.83 ? 13  DC  B "O3'" 1 
ATOM   4145 C  "C2'" . DC  B 2 13  ? 0.327   92.466  34.641 1.00 110.74 ? 13  DC  B "C2'" 1 
ATOM   4146 C  "C1'" . DC  B 2 13  ? 1.702   91.834  34.775 1.00 102.93 ? 13  DC  B "C1'" 1 
ATOM   4147 N  N1    . DC  B 2 13  ? 2.827   92.823  34.715 1.00 99.48  ? 13  DC  B N1    1 
ATOM   4148 C  C2    . DC  B 2 13  ? 3.449   93.240  35.902 1.00 96.55  ? 13  DC  B C2    1 
ATOM   4149 O  O2    . DC  B 2 13  ? 3.062   92.776  36.983 1.00 94.14  ? 13  DC  B O2    1 
ATOM   4150 N  N3    . DC  B 2 13  ? 4.463   94.139  35.831 1.00 90.10  ? 13  DC  B N3    1 
ATOM   4151 C  C4    . DC  B 2 13  ? 4.852   94.616  34.647 1.00 90.69  ? 13  DC  B C4    1 
ATOM   4152 N  N4    . DC  B 2 13  ? 5.854   95.501  34.631 1.00 92.71  ? 13  DC  B N4    1 
ATOM   4153 C  C5    . DC  B 2 13  ? 4.231   94.207  33.428 1.00 90.30  ? 13  DC  B C5    1 
ATOM   4154 C  C6    . DC  B 2 13  ? 3.233   93.318  33.508 1.00 98.20  ? 13  DC  B C6    1 
ATOM   4155 P  P     . DA  B 2 14  ? -2.819  91.017  35.256 1.00 137.08 ? 14  DA  B P     1 
ATOM   4156 O  OP1   . DA  B 2 14  ? -3.586  89.749  35.232 1.00 130.57 ? 14  DA  B OP1   1 
ATOM   4157 O  OP2   . DA  B 2 14  ? -3.151  92.095  34.294 1.00 125.59 ? 14  DA  B OP2   1 
ATOM   4158 O  "O5'" . DA  B 2 14  ? -2.869  91.607  36.742 1.00 122.18 ? 14  DA  B "O5'" 1 
ATOM   4159 C  "C5'" . DA  B 2 14  ? -2.102  90.993  37.773 1.00 114.74 ? 14  DA  B "C5'" 1 
ATOM   4160 C  "C4'" . DA  B 2 14  ? -1.586  92.034  38.747 1.00 110.98 ? 14  DA  B "C4'" 1 
ATOM   4161 O  "O4'" . DA  B 2 14  ? -0.507  92.769  38.142 1.00 106.88 ? 14  DA  B "O4'" 1 
ATOM   4162 C  "C3'" . DA  B 2 14  ? -2.614  93.082  39.160 1.00 108.96 ? 14  DA  B "C3'" 1 
ATOM   4163 O  "O3'" . DA  B 2 14  ? -3.046  92.840  40.488 1.00 110.05 ? 14  DA  B "O3'" 1 
ATOM   4164 C  "C2'" . DA  B 2 14  ? -1.879  94.432  39.035 1.00 104.27 ? 14  DA  B "C2'" 1 
ATOM   4165 C  "C1'" . DA  B 2 14  ? -0.438  94.033  38.743 1.00 95.82  ? 14  DA  B "C1'" 1 
ATOM   4166 N  N9    . DA  B 2 14  ? 0.258   94.935  37.823 1.00 89.26  ? 14  DA  B N9    1 
ATOM   4167 C  C8    . DA  B 2 14  ? 0.086   95.019  36.471 1.00 91.42  ? 14  DA  B C8    1 
ATOM   4168 N  N7    . DA  B 2 14  ? 0.864   95.898  35.885 1.00 84.32  ? 14  DA  B N7    1 
ATOM   4169 C  C5    . DA  B 2 14  ? 1.597   96.435  36.927 1.00 85.59  ? 14  DA  B C5    1 
ATOM   4170 C  C6    . DA  B 2 14  ? 2.595   97.428  36.968 1.00 84.18  ? 14  DA  B C6    1 
ATOM   4171 N  N6    . DA  B 2 14  ? 3.032   98.076  35.883 1.00 80.17  ? 14  DA  B N6    1 
ATOM   4172 N  N1    . DA  B 2 14  ? 3.127   97.730  38.173 1.00 82.90  ? 14  DA  B N1    1 
ATOM   4173 C  C2    . DA  B 2 14  ? 2.681   97.078  39.257 1.00 86.29  ? 14  DA  B C2    1 
ATOM   4174 N  N3    . DA  B 2 14  ? 1.746   96.128  39.342 1.00 86.88  ? 14  DA  B N3    1 
ATOM   4175 C  C4    . DA  B 2 14  ? 1.240   95.850  38.131 1.00 87.14  ? 14  DA  B C4    1 
ATOM   4176 P  P     . DA  B 2 15  ? -4.432  93.467  41.003 1.00 130.44 ? 15  DA  B P     1 
ATOM   4177 O  OP1   . DA  B 2 15  ? -5.062  92.488  41.920 1.00 122.72 ? 15  DA  B OP1   1 
ATOM   4178 O  OP2   . DA  B 2 15  ? -5.174  93.924  39.805 1.00 120.56 ? 15  DA  B OP2   1 
ATOM   4179 O  "O5'" . DA  B 2 15  ? -3.976  94.747  41.855 1.00 113.54 ? 15  DA  B "O5'" 1 
ATOM   4180 C  "C5'" . DA  B 2 15  ? -3.240  94.571  43.059 1.00 106.46 ? 15  DA  B "C5'" 1 
ATOM   4181 C  "C4'" . DA  B 2 15  ? -2.555  95.861  43.478 1.00 106.62 ? 15  DA  B "C4'" 1 
ATOM   4182 O  "O4'" . DA  B 2 15  ? -1.682  96.317  42.413 1.00 105.86 ? 15  DA  B "O4'" 1 
ATOM   4183 C  "C3'" . DA  B 2 15  ? -3.494  97.030  43.791 1.00 113.36 ? 15  DA  B "C3'" 1 
ATOM   4184 O  "O3'" . DA  B 2 15  ? -3.106  97.645  45.017 1.00 116.83 ? 15  DA  B "O3'" 1 
ATOM   4185 C  "C2'" . DA  B 2 15  ? -3.299  97.972  42.603 1.00 111.79 ? 15  DA  B "C2'" 1 
ATOM   4186 C  "C1'" . DA  B 2 15  ? -1.855  97.699  42.230 1.00 97.19  ? 15  DA  B "C1'" 1 
ATOM   4187 N  N9    . DA  B 2 15  ? -1.549  98.021  40.841 1.00 95.40  ? 15  DA  B N9    1 
ATOM   4188 C  C8    . DA  B 2 15  ? -2.214  97.582  39.730 1.00 94.81  ? 15  DA  B C8    1 
ATOM   4189 N  N7    . DA  B 2 15  ? -1.716  98.029  38.602 1.00 90.58  ? 15  DA  B N7    1 
ATOM   4190 C  C5    . DA  B 2 15  ? -0.655  98.824  39.000 1.00 84.61  ? 15  DA  B C5    1 
ATOM   4191 C  C6    . DA  B 2 15  ? 0.276   99.590  38.276 1.00 84.82  ? 15  DA  B C6    1 
ATOM   4192 N  N6    . DA  B 2 15  ? 0.278   99.674  36.941 1.00 81.31  ? 15  DA  B N6    1 
ATOM   4193 N  N1    . DA  B 2 15  ? 1.210   100.268 38.981 1.00 89.00  ? 15  DA  B N1    1 
ATOM   4194 C  C2    . DA  B 2 15  ? 1.202   100.179 40.318 1.00 87.01  ? 15  DA  B C2    1 
ATOM   4195 N  N3    . DA  B 2 15  ? 0.376   99.492  41.107 1.00 85.22  ? 15  DA  B N3    1 
ATOM   4196 C  C4    . DA  B 2 15  ? -0.538  98.831  40.378 1.00 87.52  ? 15  DA  B C4    1 
ATOM   4197 P  P     . DG  B 2 16  ? -3.941  98.883  45.617 1.00 127.38 ? 16  DG  B P     1 
ATOM   4198 O  OP1   . DG  B 2 16  ? -4.063  98.647  47.074 1.00 113.97 ? 16  DG  B OP1   1 
ATOM   4199 O  OP2   . DG  B 2 16  ? -5.169  99.082  44.809 1.00 116.89 ? 16  DG  B OP2   1 
ATOM   4200 O  "O5'" . DG  B 2 16  ? -2.975  100.138 45.381 1.00 107.28 ? 16  DG  B "O5'" 1 
ATOM   4201 C  "C5'" . DG  B 2 16  ? -1.573  99.935  45.189 1.00 107.77 ? 16  DG  B "C5'" 1 
ATOM   4202 C  "C4'" . DG  B 2 16  ? -0.886  101.244 44.838 1.00 110.00 ? 16  DG  B "C4'" 1 
ATOM   4203 O  "O4'" . DG  B 2 16  ? -0.427  101.199 43.463 1.00 110.33 ? 16  DG  B "O4'" 1 
ATOM   4204 C  "C3'" . DG  B 2 16  ? -1.778  102.470 44.953 1.00 106.59 ? 16  DG  B "C3'" 1 
ATOM   4205 O  "O3'" . DG  B 2 16  ? -1.597  103.077 46.232 1.00 103.79 ? 16  DG  B "O3'" 1 
ATOM   4206 C  "C2'" . DG  B 2 16  ? -1.288  103.381 43.828 1.00 98.90  ? 16  DG  B "C2'" 1 
ATOM   4207 C  "C1'" . DG  B 2 16  ? -0.760  102.397 42.786 1.00 99.98  ? 16  DG  B "C1'" 1 
ATOM   4208 N  N9    . DG  B 2 16  ? -1.708  102.075 41.716 1.00 94.71  ? 16  DG  B N9    1 
ATOM   4209 C  C8    . DG  B 2 16  ? -2.930  101.456 41.843 1.00 92.98  ? 16  DG  B C8    1 
ATOM   4210 N  N7    . DG  B 2 16  ? -3.543  101.278 40.703 1.00 93.11  ? 16  DG  B N7    1 
ATOM   4211 C  C5    . DG  B 2 16  ? -2.666  101.804 39.758 1.00 90.88  ? 16  DG  B C5    1 
ATOM   4212 C  C6    . DG  B 2 16  ? -2.786  101.895 38.346 1.00 93.02  ? 16  DG  B C6    1 
ATOM   4213 O  O6    . DG  B 2 16  ? -3.724  101.515 37.624 1.00 93.95  ? 16  DG  B O6    1 
ATOM   4214 N  N1    . DG  B 2 16  ? -1.666  102.499 37.774 1.00 88.11  ? 16  DG  B N1    1 
ATOM   4215 C  C2    . DG  B 2 16  ? -0.576  102.956 38.477 1.00 91.45  ? 16  DG  B C2    1 
ATOM   4216 N  N2    . DG  B 2 16  ? 0.407   103.509 37.758 1.00 88.03  ? 16  DG  B N2    1 
ATOM   4217 N  N3    . DG  B 2 16  ? -0.452  102.871 39.792 1.00 92.83  ? 16  DG  B N3    1 
ATOM   4218 C  C4    . DG  B 2 16  ? -1.531  102.290 40.366 1.00 90.47  ? 16  DG  B C4    1 
ATOM   4219 O  "O5'" . DC  C 3 1   ? 3.895   106.175 30.913 1.00 91.27  ? 1   DC  C "O5'" 1 
ATOM   4220 C  "C5'" . DC  C 3 1   ? 4.294   107.510 31.216 1.00 99.40  ? 1   DC  C "C5'" 1 
ATOM   4221 C  "C4'" . DC  C 3 1   ? 4.337   107.733 32.718 1.00 102.06 ? 1   DC  C "C4'" 1 
ATOM   4222 O  "O4'" . DC  C 3 1   ? 3.004   107.606 33.267 1.00 103.06 ? 1   DC  C "O4'" 1 
ATOM   4223 C  "C3'" . DC  C 3 1   ? 5.176   106.728 33.487 1.00 102.30 ? 1   DC  C "C3'" 1 
ATOM   4224 O  "O3'" . DC  C 3 1   ? 6.533   107.154 33.514 1.00 103.84 ? 1   DC  C "O3'" 1 
ATOM   4225 C  "C2'" . DC  C 3 1   ? 4.540   106.771 34.874 1.00 97.80  ? 1   DC  C "C2'" 1 
ATOM   4226 C  "C1'" . DC  C 3 1   ? 3.064   106.989 34.544 1.00 95.90  ? 1   DC  C "C1'" 1 
ATOM   4227 N  N1    . DC  C 3 1   ? 2.244   105.735 34.504 1.00 87.11  ? 1   DC  C N1    1 
ATOM   4228 C  C2    . DC  C 3 1   ? 1.850   105.116 35.698 1.00 86.19  ? 1   DC  C C2    1 
ATOM   4229 O  O2    . DC  C 3 1   ? 2.204   105.599 36.780 1.00 81.41  ? 1   DC  C O2    1 
ATOM   4230 N  N3    . DC  C 3 1   ? 1.093   103.991 35.633 1.00 88.48  ? 1   DC  C N3    1 
ATOM   4231 C  C4    . DC  C 3 1   ? 0.727   103.496 34.448 1.00 90.43  ? 1   DC  C C4    1 
ATOM   4232 N  N4    . DC  C 3 1   ? -0.022  102.386 34.435 1.00 89.46  ? 1   DC  C N4    1 
ATOM   4233 C  C5    . DC  C 3 1   ? 1.113   104.117 33.225 1.00 90.51  ? 1   DC  C C5    1 
ATOM   4234 C  C6    . DC  C 3 1   ? 1.860   105.223 33.300 1.00 88.23  ? 1   DC  C C6    1 
ATOM   4235 P  P     . DT  C 3 2   ? 7.627   106.339 34.362 1.00 111.34 ? 2   DT  C P     1 
ATOM   4236 O  OP1   . DT  C 3 2   ? 8.927   106.514 33.674 1.00 116.52 ? 2   DT  C OP1   1 
ATOM   4237 O  OP2   . DT  C 3 2   ? 7.096   104.977 34.610 1.00 88.98  ? 2   DT  C OP2   1 
ATOM   4238 O  "O5'" . DT  C 3 2   ? 7.714   107.143 35.745 1.00 109.71 ? 2   DT  C "O5'" 1 
ATOM   4239 C  "C5'" . DT  C 3 2   ? 8.431   106.599 36.843 1.00 101.85 ? 2   DT  C "C5'" 1 
ATOM   4240 C  "C4'" . DT  C 3 2   ? 7.511   106.388 38.032 1.00 106.61 ? 2   DT  C "C4'" 1 
ATOM   4241 O  "O4'" . DT  C 3 2   ? 6.262   105.843 37.580 1.00 99.73  ? 2   DT  C "O4'" 1 
ATOM   4242 C  "C3'" . DT  C 3 2   ? 8.021   105.392 39.056 1.00 110.82 ? 2   DT  C "C3'" 1 
ATOM   4243 O  "O3'" . DT  C 3 2   ? 8.799   106.069 40.037 1.00 119.89 ? 2   DT  C "O3'" 1 
ATOM   4244 C  "C2'" . DT  C 3 2   ? 6.740   104.795 39.661 1.00 100.68 ? 2   DT  C "C2'" 1 
ATOM   4245 C  "C1'" . DT  C 3 2   ? 5.652   105.135 38.636 1.00 94.55  ? 2   DT  C "C1'" 1 
ATOM   4246 N  N1    . DT  C 3 2   ? 4.959   103.953 38.051 1.00 84.57  ? 2   DT  C N1    1 
ATOM   4247 C  C2    . DT  C 3 2   ? 4.112   103.197 38.834 1.00 88.27  ? 2   DT  C C2    1 
ATOM   4248 O  O2    . DT  C 3 2   ? 3.908   103.419 40.016 1.00 89.32  ? 2   DT  C O2    1 
ATOM   4249 N  N3    . DT  C 3 2   ? 3.511   102.153 38.178 1.00 89.10  ? 2   DT  C N3    1 
ATOM   4250 C  C4    . DT  C 3 2   ? 3.662   101.804 36.845 1.00 90.96  ? 2   DT  C C4    1 
ATOM   4251 O  O4    . DT  C 3 2   ? 3.078   100.844 36.344 1.00 86.59  ? 2   DT  C O4    1 
ATOM   4252 C  C5    . DT  C 3 2   ? 4.557   102.647 36.084 1.00 86.23  ? 2   DT  C C5    1 
ATOM   4253 C  C7    . DT  C 3 2   ? 4.802   102.371 34.631 1.00 85.21  ? 2   DT  C C7    1 
ATOM   4254 C  C6    . DT  C 3 2   ? 5.149   103.668 36.716 1.00 83.60  ? 2   DT  C C6    1 
ATOM   4255 P  P     . DT  C 3 3   ? 9.801   105.240 40.979 1.00 134.25 ? 3   DT  C P     1 
ATOM   4256 O  OP1   . DT  C 3 3   ? 10.777  106.197 41.549 1.00 119.12 ? 3   DT  C OP1   1 
ATOM   4257 O  OP2   . DT  C 3 3   ? 10.273  104.075 40.193 1.00 126.75 ? 3   DT  C OP2   1 
ATOM   4258 O  "O5'" . DT  C 3 3   ? 8.858   104.720 42.167 1.00 126.94 ? 3   DT  C "O5'" 1 
ATOM   4259 C  "C5'" . DT  C 3 3   ? 9.089   103.446 42.758 1.00 119.84 ? 3   DT  C "C5'" 1 
ATOM   4260 C  "C4'" . DT  C 3 3   ? 7.788   102.679 42.912 1.00 112.70 ? 3   DT  C "C4'" 1 
ATOM   4261 O  "O4'" . DT  C 3 3   ? 7.212   102.448 41.619 1.00 104.27 ? 3   DT  C "O4'" 1 
ATOM   4262 C  "C3'" . DT  C 3 3   ? 7.935   101.293 43.520 1.00 116.92 ? 3   DT  C "C3'" 1 
ATOM   4263 O  "O3'" . DT  C 3 3   ? 7.675   101.342 44.910 1.00 128.43 ? 3   DT  C "O3'" 1 
ATOM   4264 C  "C2'" . DT  C 3 3   ? 6.889   100.435 42.785 1.00 104.08 ? 3   DT  C "C2'" 1 
ATOM   4265 C  "C1'" . DT  C 3 3   ? 6.319   101.371 41.725 1.00 100.54 ? 3   DT  C "C1'" 1 
ATOM   4266 N  N1    . DT  C 3 3   ? 6.182   100.739 40.389 1.00 92.17  ? 3   DT  C N1    1 
ATOM   4267 C  C2    . DT  C 3 3   ? 5.230   99.759  40.198 1.00 90.38  ? 3   DT  C C2    1 
ATOM   4268 O  O2    . DT  C 3 3   ? 4.482   99.367  41.079 1.00 89.88  ? 3   DT  C O2    1 
ATOM   4269 N  N3    . DT  C 3 3   ? 5.183   99.250  38.928 1.00 84.36  ? 3   DT  C N3    1 
ATOM   4270 C  C4    . DT  C 3 3   ? 5.974   99.614  37.853 1.00 85.45  ? 3   DT  C C4    1 
ATOM   4271 O  O4    . DT  C 3 3   ? 5.855   99.095  36.747 1.00 85.75  ? 3   DT  C O4    1 
ATOM   4272 C  C5    . DT  C 3 3   ? 6.949   100.646 38.122 1.00 86.44  ? 3   DT  C C5    1 
ATOM   4273 C  C7    . DT  C 3 3   ? 7.865   101.122 37.033 1.00 86.55  ? 3   DT  C C7    1 
ATOM   4274 C  C6    . DT  C 3 3   ? 7.004   101.152 39.362 1.00 89.96  ? 3   DT  C C6    1 
ATOM   4275 P  P     . DG  C 3 4   ? 8.318   100.236 45.880 1.00 141.46 ? 4   DG  C P     1 
ATOM   4276 O  OP1   . DG  C 3 4   ? 7.936   100.591 47.265 1.00 138.36 ? 4   DG  C OP1   1 
ATOM   4277 O  OP2   . DG  C 3 4   ? 9.749   100.109 45.511 1.00 125.45 ? 4   DG  C OP2   1 
ATOM   4278 O  "O5'" . DG  C 3 4   ? 7.550   98.882  45.492 1.00 120.96 ? 4   DG  C "O5'" 1 
ATOM   4279 C  "C5'" . DG  C 3 4   ? 6.147   98.757  45.736 1.00 113.75 ? 4   DG  C "C5'" 1 
ATOM   4280 C  "C4'" . DG  C 3 4   ? 5.657   97.364  45.374 1.00 111.19 ? 4   DG  C "C4'" 1 
ATOM   4281 O  "O4'" . DG  C 3 4   ? 5.454   97.266  43.937 1.00 109.51 ? 4   DG  C "O4'" 1 
ATOM   4282 C  "C3'" . DG  C 3 4   ? 6.611   96.230  45.748 1.00 113.03 ? 4   DG  C "C3'" 1 
ATOM   4283 O  "O3'" . DG  C 3 4   ? 5.874   95.132  46.269 1.00 119.95 ? 4   DG  C "O3'" 1 
ATOM   4284 C  "C2'" . DG  C 3 4   ? 7.274   95.881  44.417 1.00 105.52 ? 4   DG  C "C2'" 1 
ATOM   4285 C  "C1'" . DG  C 3 4   ? 6.141   96.137  43.436 1.00 98.91  ? 4   DG  C "C1'" 1 
ATOM   4286 N  N9    . DG  C 3 4   ? 6.604   96.437  42.081 1.00 88.56  ? 4   DG  C N9    1 
ATOM   4287 C  C8    . DG  C 3 4   ? 7.596   97.318  41.727 1.00 87.98  ? 4   DG  C C8    1 
ATOM   4288 N  N7    . DG  C 3 4   ? 7.796   97.388  40.441 1.00 83.53  ? 4   DG  C N7    1 
ATOM   4289 C  C5    . DG  C 3 4   ? 6.881   96.494  39.904 1.00 80.57  ? 4   DG  C C5    1 
ATOM   4290 C  C6    . DG  C 3 4   ? 6.636   96.143  38.553 1.00 82.42  ? 4   DG  C C6    1 
ATOM   4291 O  O6    . DG  C 3 4   ? 7.200   96.569  37.531 1.00 73.04  ? 4   DG  C O6    1 
ATOM   4292 N  N1    . DG  C 3 4   ? 5.620   95.195  38.444 1.00 83.46  ? 4   DG  C N1    1 
ATOM   4293 C  C2    . DG  C 3 4   ? 4.932   94.654  39.505 1.00 80.50  ? 4   DG  C C2    1 
ATOM   4294 N  N2    . DG  C 3 4   ? 3.987   93.752  39.199 1.00 74.56  ? 4   DG  C N2    1 
ATOM   4295 N  N3    . DG  C 3 4   ? 5.152   94.975  40.777 1.00 81.80  ? 4   DG  C N3    1 
ATOM   4296 C  C4    . DG  C 3 4   ? 6.137   95.898  40.900 1.00 82.16  ? 4   DG  C C4    1 
ATOM   4297 P  P     . DT  C 3 5   ? 6.593   94.025  47.187 1.00 130.74 ? 5   DT  C P     1 
ATOM   4298 O  OP1   . DT  C 3 5   ? 6.152   94.244  48.586 1.00 120.07 ? 5   DT  C OP1   1 
ATOM   4299 O  OP2   . DT  C 3 5   ? 8.040   94.023  46.868 1.00 115.59 ? 5   DT  C OP2   1 
ATOM   4300 O  "O5'" . DT  C 3 5   ? 5.943   92.657  46.683 1.00 107.29 ? 5   DT  C "O5'" 1 
ATOM   4301 C  "C5'" . DT  C 3 5   ? 4.537   92.554  46.584 1.00 103.00 ? 5   DT  C "C5'" 1 
ATOM   4302 C  "C4'" . DT  C 3 5   ? 4.144   91.607  45.470 1.00 105.11 ? 5   DT  C "C4'" 1 
ATOM   4303 O  "O4'" . DT  C 3 5   ? 4.612   92.117  44.196 1.00 104.44 ? 5   DT  C "O4'" 1 
ATOM   4304 C  "C3'" . DT  C 3 5   ? 4.715   90.190  45.591 1.00 101.82 ? 5   DT  C "C3'" 1 
ATOM   4305 O  "O3'" . DT  C 3 5   ? 3.666   89.251  45.493 1.00 94.37  ? 5   DT  C "O3'" 1 
ATOM   4306 C  "C2'" . DT  C 3 5   ? 5.676   90.085  44.401 1.00 99.67  ? 5   DT  C "C2'" 1 
ATOM   4307 C  "C1'" . DT  C 3 5   ? 5.011   91.022  43.417 1.00 96.57  ? 5   DT  C "C1'" 1 
ATOM   4308 N  N1    . DT  C 3 5   ? 5.902   91.496  42.306 1.00 90.32  ? 5   DT  C N1    1 
ATOM   4309 C  C2    . DT  C 3 5   ? 5.687   91.016  41.032 1.00 88.18  ? 5   DT  C C2    1 
ATOM   4310 O  O2    . DT  C 3 5   ? 4.811   90.207  40.762 1.00 88.73  ? 5   DT  C O2    1 
ATOM   4311 N  N3    . DT  C 3 5   ? 6.544   91.508  40.080 1.00 77.79  ? 5   DT  C N3    1 
ATOM   4312 C  C4    . DT  C 3 5   ? 7.568   92.418  40.267 1.00 75.64  ? 5   DT  C C4    1 
ATOM   4313 O  O4    . DT  C 3 5   ? 8.284   92.802  39.344 1.00 73.43  ? 5   DT  C O4    1 
ATOM   4314 C  C5    . DT  C 3 5   ? 7.738   92.886  41.623 1.00 76.86  ? 5   DT  C C5    1 
ATOM   4315 C  C7    . DT  C 3 5   ? 8.821   93.875  41.943 1.00 76.75  ? 5   DT  C C7    1 
ATOM   4316 C  C6    . DT  C 3 5   ? 6.906   92.410  42.568 1.00 81.19  ? 5   DT  C C6    1 
ATOM   4317 P  P     . DT  C 3 6   ? 3.988   87.679  45.467 1.00 119.38 ? 6   DT  C P     1 
ATOM   4318 O  OP1   . DT  C 3 6   ? 2.760   86.952  45.864 1.00 103.43 ? 6   DT  C OP1   1 
ATOM   4319 O  OP2   . DT  C 3 6   ? 5.247   87.474  46.222 1.00 119.62 ? 6   DT  C OP2   1 
ATOM   4320 O  "O5'" . DT  C 3 6   ? 4.255   87.379  43.921 1.00 110.21 ? 6   DT  C "O5'" 1 
ATOM   4321 C  "C5'" . DT  C 3 6   ? 4.432   86.044  43.466 1.00 104.54 ? 6   DT  C "C5'" 1 
ATOM   4322 C  "C4'" . DT  C 3 6   ? 4.450   86.015  41.952 1.00 101.66 ? 6   DT  C "C4'" 1 
ATOM   4323 O  "O4'" . DT  C 3 6   ? 5.036   87.236  41.478 1.00 99.35  ? 6   DT  C "O4'" 1 
ATOM   4324 C  "C3'" . DT  C 3 6   ? 5.294   84.913  41.341 1.00 100.33 ? 6   DT  C "C3'" 1 
ATOM   4325 O  "O3'" . DT  C 3 6   ? 4.486   83.761  41.101 1.00 109.41 ? 6   DT  C "O3'" 1 
ATOM   4326 C  "C2'" . DT  C 3 6   ? 5.805   85.525  40.028 1.00 91.75  ? 6   DT  C "C2'" 1 
ATOM   4327 C  "C1'" . DT  C 3 6   ? 5.572   87.027  40.196 1.00 90.19  ? 6   DT  C "C1'" 1 
ATOM   4328 N  N1    . DT  C 3 6   ? 6.798   87.850  40.075 1.00 77.73  ? 6   DT  C N1    1 
ATOM   4329 C  C2    . DT  C 3 6   ? 7.286   88.152  38.827 1.00 78.75  ? 6   DT  C C2    1 
ATOM   4330 O  O2    . DT  C 3 6   ? 6.774   87.756  37.797 1.00 84.90  ? 6   DT  C O2    1 
ATOM   4331 N  N3    . DT  C 3 6   ? 8.410   88.933  38.825 1.00 73.31  ? 6   DT  C N3    1 
ATOM   4332 C  C4    . DT  C 3 6   ? 9.077   89.436  39.926 1.00 74.27  ? 6   DT  C C4    1 
ATOM   4333 O  O4    . DT  C 3 6   ? 10.083  90.133  39.822 1.00 72.44  ? 6   DT  C O4    1 
ATOM   4334 C  C5    . DT  C 3 6   ? 8.507   89.084  41.208 1.00 74.01  ? 6   DT  C C5    1 
ATOM   4335 C  C7    . DT  C 3 6   ? 9.143   89.568  42.477 1.00 67.96  ? 6   DT  C C7    1 
ATOM   4336 C  C6    . DT  C 3 6   ? 7.407   88.318  41.218 1.00 77.01  ? 6   DT  C C6    1 
ATOM   4337 P  P     . DG  C 3 7   ? 5.168   82.313  40.932 1.00 121.42 ? 7   DG  C P     1 
ATOM   4338 O  OP1   . DG  C 3 7   ? 4.119   81.280  41.087 1.00 117.25 ? 7   DG  C OP1   1 
ATOM   4339 O  OP2   . DG  C 3 7   ? 6.351   82.279  41.820 1.00 111.86 ? 7   DG  C OP2   1 
ATOM   4340 O  "O5'" . DG  C 3 7   ? 5.681   82.299  39.411 1.00 113.25 ? 7   DG  C "O5'" 1 
ATOM   4341 C  "C5'" . DG  C 3 7   ? 4.790   82.638  38.345 1.00 111.32 ? 7   DG  C "C5'" 1 
ATOM   4342 C  "C4'" . DG  C 3 7   ? 5.558   82.902  37.057 1.00 109.43 ? 7   DG  C "C4'" 1 
ATOM   4343 O  "O4'" . DG  C 3 7   ? 6.392   84.085  37.212 1.00 106.00 ? 7   DG  C "O4'" 1 
ATOM   4344 C  "C3'" . DG  C 3 7   ? 6.491   81.768  36.619 1.00 110.89 ? 7   DG  C "C3'" 1 
ATOM   4345 O  "O3'" . DG  C 3 7   ? 6.304   81.482  35.232 1.00 118.13 ? 7   DG  C "O3'" 1 
ATOM   4346 C  "C2'" . DG  C 3 7   ? 7.889   82.319  36.900 1.00 96.18  ? 7   DG  C "C2'" 1 
ATOM   4347 C  "C1'" . DG  C 3 7   ? 7.685   83.815  36.714 1.00 96.80  ? 7   DG  C "C1'" 1 
ATOM   4348 N  N9    . DG  C 3 7   ? 8.656   84.626  37.452 1.00 88.08  ? 7   DG  C N9    1 
ATOM   4349 C  C8    . DG  C 3 7   ? 8.839   84.659  38.816 1.00 87.85  ? 7   DG  C C8    1 
ATOM   4350 N  N7    . DG  C 3 7   ? 9.789   85.471  39.197 1.00 79.16  ? 7   DG  C N7    1 
ATOM   4351 C  C5    . DG  C 3 7   ? 10.274  86.009  38.013 1.00 77.29  ? 7   DG  C C5    1 
ATOM   4352 C  C6    . DG  C 3 7   ? 11.310  86.950  37.799 1.00 70.72  ? 7   DG  C C6    1 
ATOM   4353 O  O6    . DG  C 3 7   ? 12.022  87.511  38.643 1.00 65.86  ? 7   DG  C O6    1 
ATOM   4354 N  N1    . DG  C 3 7   ? 11.486  87.225  36.443 1.00 70.16  ? 7   DG  C N1    1 
ATOM   4355 C  C2    . DG  C 3 7   ? 10.751  86.662  35.424 1.00 75.96  ? 7   DG  C C2    1 
ATOM   4356 N  N2    . DG  C 3 7   ? 11.066  87.053  34.180 1.00 69.07  ? 7   DG  C N2    1 
ATOM   4357 N  N3    . DG  C 3 7   ? 9.770   85.780  35.611 1.00 80.66  ? 7   DG  C N3    1 
ATOM   4358 C  C4    . DG  C 3 7   ? 9.589   85.500  36.926 1.00 82.14  ? 7   DG  C C4    1 
ATOM   4359 P  P     . DT  C 3 8   ? 6.591   80.004  34.663 1.00 121.33 ? 8   DT  C P     1 
ATOM   4360 O  OP1   . DT  C 3 8   ? 5.348   79.503  34.031 1.00 114.85 ? 8   DT  C OP1   1 
ATOM   4361 O  OP2   . DT  C 3 8   ? 7.228   79.223  35.750 1.00 106.91 ? 8   DT  C OP2   1 
ATOM   4362 O  "O5'" . DT  C 3 8   ? 7.655   80.249  33.495 1.00 104.55 ? 8   DT  C "O5'" 1 
ATOM   4363 C  "C5'" . DT  C 3 8   ? 8.869   80.921  33.780 1.00 96.74  ? 8   DT  C "C5'" 1 
ATOM   4364 C  "C4'" . DT  C 3 8   ? 9.234   81.867  32.654 1.00 98.41  ? 8   DT  C "C4'" 1 
ATOM   4365 O  "O4'" . DT  C 3 8   ? 9.542   83.169  33.202 1.00 95.65  ? 8   DT  C "O4'" 1 
ATOM   4366 C  "C3'" . DT  C 3 8   ? 10.424  81.423  31.808 1.00 90.27  ? 8   DT  C "C3'" 1 
ATOM   4367 O  "O3'" . DT  C 3 8   ? 9.985   81.156  30.481 1.00 100.15 ? 8   DT  C "O3'" 1 
ATOM   4368 C  "C2'" . DT  C 3 8   ? 11.417  82.592  31.842 1.00 84.42  ? 8   DT  C "C2'" 1 
ATOM   4369 C  "C1'" . DT  C 3 8   ? 10.848  83.570  32.863 1.00 84.65  ? 8   DT  C "C1'" 1 
ATOM   4370 N  N1    . DT  C 3 8   ? 11.660  83.706  34.121 1.00 75.21  ? 8   DT  C N1    1 
ATOM   4371 C  C2    . DT  C 3 8   ? 12.817  84.456  34.093 1.00 78.96  ? 8   DT  C C2    1 
ATOM   4372 O  O2    . DT  C 3 8   ? 13.239  85.003  33.086 1.00 80.50  ? 8   DT  C O2    1 
ATOM   4373 N  N3    . DT  C 3 8   ? 13.474  84.540  35.293 1.00 73.11  ? 8   DT  C N3    1 
ATOM   4374 C  C4    . DT  C 3 8   ? 13.095  83.967  36.493 1.00 74.27  ? 8   DT  C C4    1 
ATOM   4375 O  O4    . DT  C 3 8   ? 13.754  84.097  37.520 1.00 78.28  ? 8   DT  C O4    1 
ATOM   4376 C  C5    . DT  C 3 8   ? 11.876  83.202  36.456 1.00 68.47  ? 8   DT  C C5    1 
ATOM   4377 C  C7    . DT  C 3 8   ? 11.380  82.535  37.700 1.00 74.16  ? 8   DT  C C7    1 
ATOM   4378 C  C6    . DT  C 3 8   ? 11.222  83.108  35.286 1.00 71.22  ? 8   DT  C C6    1 
ATOM   4379 P  P     . DT  C 3 9   ? 10.909  80.314  29.473 1.00 96.78  ? 9   DT  C P     1 
ATOM   4380 O  OP1   . DT  C 3 9   ? 11.192  81.168  28.295 1.00 89.68  ? 9   DT  C OP1   1 
ATOM   4381 O  OP2   . DT  C 3 9   ? 10.258  78.997  29.286 1.00 96.02  ? 9   DT  C OP2   1 
ATOM   4382 O  "O5'" . DT  C 3 9   ? 12.269  80.103  30.288 1.00 97.36  ? 9   DT  C "O5'" 1 
ATOM   4383 C  "C5'" . DT  C 3 9   ? 13.479  79.803  29.602 1.00 97.13  ? 9   DT  C "C5'" 1 
ATOM   4384 C  "C4'" . DT  C 3 9   ? 14.183  81.074  29.157 1.00 94.65  ? 9   DT  C "C4'" 1 
ATOM   4385 O  "O4'" . DT  C 3 9   ? 14.035  82.091  30.173 1.00 89.91  ? 9   DT  C "O4'" 1 
ATOM   4386 C  "C3'" . DT  C 3 9   ? 15.671  80.907  28.894 1.00 93.50  ? 9   DT  C "C3'" 1 
ATOM   4387 O  "O3'" . DT  C 3 9   ? 15.897  80.889  27.488 1.00 100.95 ? 9   DT  C "O3'" 1 
ATOM   4388 C  "C2'" . DT  C 3 9   ? 16.338  82.122  29.550 1.00 86.07  ? 9   DT  C "C2'" 1 
ATOM   4389 C  "C1'" . DT  C 3 9   ? 15.271  82.710  30.464 1.00 86.40  ? 9   DT  C "C1'" 1 
ATOM   4390 N  N1    . DT  C 3 9   ? 15.546  82.558  31.934 1.00 77.29  ? 9   DT  C N1    1 
ATOM   4391 C  C2    . DT  C 3 9   ? 16.588  83.258  32.517 1.00 74.55  ? 9   DT  C C2    1 
ATOM   4392 O  O2    . DT  C 3 9   ? 17.348  83.987  31.893 1.00 71.82  ? 9   DT  C O2    1 
ATOM   4393 N  N3    . DT  C 3 9   ? 16.718  83.059  33.873 1.00 67.82  ? 9   DT  C N3    1 
ATOM   4394 C  C4    . DT  C 3 9   ? 15.921  82.258  34.682 1.00 64.77  ? 9   DT  C C4    1 
ATOM   4395 O  O4    . DT  C 3 9   ? 16.108  82.142  35.889 1.00 58.85  ? 9   DT  C O4    1 
ATOM   4396 C  C5    . DT  C 3 9   ? 14.853  81.569  34.005 1.00 67.93  ? 9   DT  C C5    1 
ATOM   4397 C  C7    . DT  C 3 9   ? 13.927  80.677  34.778 1.00 71.78  ? 9   DT  C C7    1 
ATOM   4398 C  C6    . DT  C 3 9   ? 14.717  81.754  32.685 1.00 73.17  ? 9   DT  C C6    1 
ATOM   4399 P  P     . DG  C 3 10  ? 17.320  80.433  26.901 1.00 110.62 ? 10  DG  C P     1 
ATOM   4400 O  OP1   . DG  C 3 10  ? 17.221  80.449  25.423 1.00 101.88 ? 10  DG  C OP1   1 
ATOM   4401 O  OP2   . DG  C 3 10  ? 17.711  79.185  27.599 1.00 99.93  ? 10  DG  C OP2   1 
ATOM   4402 O  "O5'" . DG  C 3 10  ? 18.314  81.612  27.336 1.00 99.40  ? 10  DG  C "O5'" 1 
ATOM   4403 C  "C5'" . DG  C 3 10  ? 19.695  81.340  27.509 1.00 95.37  ? 10  DG  C "C5'" 1 
ATOM   4404 C  "C4'" . DG  C 3 10  ? 20.237  81.999  28.765 1.00 84.93  ? 10  DG  C "C4'" 1 
ATOM   4405 O  "O4'" . DG  C 3 10  ? 19.356  81.757  29.865 1.00 78.89  ? 10  DG  C "O4'" 1 
ATOM   4406 C  "C3'" . DG  C 3 10  ? 21.559  81.435  29.238 1.00 89.14  ? 10  DG  C "C3'" 1 
ATOM   4407 O  "O3'" . DG  C 3 10  ? 22.624  82.126  28.634 1.00 93.17  ? 10  DG  C "O3'" 1 
ATOM   4408 C  "C2'" . DG  C 3 10  ? 21.531  81.649  30.762 1.00 82.87  ? 10  DG  C "C2'" 1 
ATOM   4409 C  "C1'" . DG  C 3 10  ? 20.073  81.989  31.049 1.00 71.58  ? 10  DG  C "C1'" 1 
ATOM   4410 N  N9    . DG  C 3 10  ? 19.475  81.204  32.119 1.00 61.15  ? 10  DG  C N9    1 
ATOM   4411 C  C8    . DG  C 3 10  ? 18.534  80.215  31.993 1.00 67.40  ? 10  DG  C C8    1 
ATOM   4412 N  N7    . DG  C 3 10  ? 18.160  79.706  33.135 1.00 66.28  ? 10  DG  C N7    1 
ATOM   4413 C  C5    . DG  C 3 10  ? 18.902  80.408  34.078 1.00 59.89  ? 10  DG  C C5    1 
ATOM   4414 C  C6    . DG  C 3 10  ? 18.925  80.297  35.491 1.00 53.28  ? 10  DG  C C6    1 
ATOM   4415 O  O6    . DG  C 3 10  ? 18.269  79.527  36.210 1.00 50.14  ? 10  DG  C O6    1 
ATOM   4416 N  N1    . DG  C 3 10  ? 19.816  81.200  36.064 1.00 44.72  ? 10  DG  C N1    1 
ATOM   4417 C  C2    . DG  C 3 10  ? 20.591  82.091  35.358 1.00 58.08  ? 10  DG  C C2    1 
ATOM   4418 N  N2    . DG  C 3 10  ? 21.401  82.883  36.079 1.00 57.30  ? 10  DG  C N2    1 
ATOM   4419 N  N3    . DG  C 3 10  ? 20.576  82.202  34.035 1.00 61.85  ? 10  DG  C N3    1 
ATOM   4420 C  C4    . DG  C 3 10  ? 19.711  81.335  33.465 1.00 57.43  ? 10  DG  C C4    1 
ATOM   4421 P  P     . DT  C 3 11  ? 24.064  81.428  28.584 1.00 93.13  ? 11  DT  C P     1 
ATOM   4422 O  OP1   . DT  C 3 11  ? 24.896  82.134  27.581 1.00 91.88  ? 11  DT  C OP1   1 
ATOM   4423 O  OP2   . DT  C 3 11  ? 23.810  79.972  28.476 1.00 87.06  ? 11  DT  C OP2   1 
ATOM   4424 O  "O5'" . DT  C 3 11  ? 24.660  81.711  30.032 1.00 80.31  ? 11  DT  C "O5'" 1 
ATOM   4425 C  "C5'" . DT  C 3 11  ? 24.653  83.027  30.554 1.00 84.70  ? 11  DT  C "C5'" 1 
ATOM   4426 C  "C4'" . DT  C 3 11  ? 25.162  82.996  31.968 1.00 84.78  ? 11  DT  C "C4'" 1 
ATOM   4427 O  "O4'" . DT  C 3 11  ? 24.146  82.421  32.820 1.00 81.48  ? 11  DT  C "O4'" 1 
ATOM   4428 C  "C3'" . DT  C 3 11  ? 26.398  82.121  32.136 1.00 81.71  ? 11  DT  C "C3'" 1 
ATOM   4429 O  "O3'" . DT  C 3 11  ? 27.489  82.889  32.574 1.00 88.83  ? 11  DT  C "O3'" 1 
ATOM   4430 C  "C2'" . DT  C 3 11  ? 25.997  81.057  33.164 1.00 79.60  ? 11  DT  C "C2'" 1 
ATOM   4431 C  "C1'" . DT  C 3 11  ? 24.766  81.656  33.818 1.00 73.08  ? 11  DT  C "C1'" 1 
ATOM   4432 N  N1    . DT  C 3 11  ? 23.792  80.632  34.293 1.00 63.16  ? 11  DT  C N1    1 
ATOM   4433 C  C2    . DT  C 3 11  ? 23.552  80.492  35.648 1.00 58.58  ? 11  DT  C C2    1 
ATOM   4434 O  O2    . DT  C 3 11  ? 24.103  81.167  36.503 1.00 57.13  ? 11  DT  C O2    1 
ATOM   4435 N  N3    . DT  C 3 11  ? 22.637  79.523  35.970 1.00 50.98  ? 11  DT  C N3    1 
ATOM   4436 C  C4    . DT  C 3 11  ? 21.948  78.700  35.094 1.00 54.77  ? 11  DT  C C4    1 
ATOM   4437 O  O4    . DT  C 3 11  ? 21.139  77.856  35.478 1.00 48.08  ? 11  DT  C O4    1 
ATOM   4438 C  C5    . DT  C 3 11  ? 22.246  78.899  33.694 1.00 62.18  ? 11  DT  C C5    1 
ATOM   4439 C  C7    . DT  C 3 11  ? 21.558  78.061  32.654 1.00 61.79  ? 11  DT  C C7    1 
ATOM   4440 C  C6    . DT  C 3 11  ? 23.145  79.843  33.365 1.00 61.41  ? 11  DT  C C6    1 
ATOM   4441 P  P     . DT  C 3 12  ? 28.951  82.229  32.604 1.00 94.73  ? 12  DT  C P     1 
ATOM   4442 O  OP1   . DT  C 3 12  ? 29.938  83.315  32.397 1.00 82.18  ? 12  DT  C OP1   1 
ATOM   4443 O  OP2   . DT  C 3 12  ? 28.921  81.059  31.692 1.00 85.06  ? 12  DT  C OP2   1 
ATOM   4444 O  "O5'" . DT  C 3 12  ? 29.090  81.711  34.109 1.00 85.60  ? 12  DT  C "O5'" 1 
ATOM   4445 C  "C5'" . DT  C 3 12  ? 28.930  82.628  35.178 1.00 91.68  ? 12  DT  C "C5'" 1 
ATOM   4446 C  "C4'" . DT  C 3 12  ? 28.689  81.897  36.482 1.00 90.02  ? 12  DT  C "C4'" 1 
ATOM   4447 O  "O4'" . DT  C 3 12  ? 27.420  81.228  36.435 1.00 84.69  ? 12  DT  C "O4'" 1 
ATOM   4448 C  "C3'" . DT  C 3 12  ? 29.677  80.791  36.781 1.00 87.02  ? 12  DT  C "C3'" 1 
ATOM   4449 O  "O3'" . DT  C 3 12  ? 30.808  81.329  37.442 1.00 100.70 ? 12  DT  C "O3'" 1 
ATOM   4450 C  "C2'" . DT  C 3 12  ? 28.881  79.853  37.700 1.00 82.00  ? 12  DT  C "C2'" 1 
ATOM   4451 C  "C1'" . DT  C 3 12  ? 27.417  80.216  37.419 1.00 74.66  ? 12  DT  C "C1'" 1 
ATOM   4452 N  N1    . DT  C 3 12  ? 26.589  79.072  36.928 1.00 59.89  ? 12  DT  C N1    1 
ATOM   4453 C  C2    . DT  C 3 12  ? 25.843  78.344  37.829 1.00 57.96  ? 12  DT  C C2    1 
ATOM   4454 O  O2    . DT  C 3 12  ? 25.823  78.573  39.029 1.00 54.79  ? 12  DT  C O2    1 
ATOM   4455 N  N3    . DT  C 3 12  ? 25.112  77.329  37.273 1.00 56.84  ? 12  DT  C N3    1 
ATOM   4456 C  C4    . DT  C 3 12  ? 25.051  76.977  35.936 1.00 59.25  ? 12  DT  C C4    1 
ATOM   4457 O  O4    . DT  C 3 12  ? 24.359  76.042  35.531 1.00 60.33  ? 12  DT  C O4    1 
ATOM   4458 C  C5    . DT  C 3 12  ? 25.853  77.781  35.049 1.00 53.00  ? 12  DT  C C5    1 
ATOM   4459 C  C7    . DT  C 3 12  ? 25.867  77.491  33.579 1.00 57.26  ? 12  DT  C C7    1 
ATOM   4460 C  C6    . DT  C 3 12  ? 26.575  78.776  35.582 1.00 56.40  ? 12  DT  C C6    1 
ATOM   4461 P  P     . DC  C 3 13  ? 31.954  80.355  38.002 1.00 95.80  ? 13  DC  C P     1 
ATOM   4462 O  OP1   . DC  C 3 13  ? 33.183  81.175  38.132 1.00 83.13  ? 13  DC  C OP1   1 
ATOM   4463 O  OP2   . DC  C 3 13  ? 31.925  79.127  37.168 1.00 79.22  ? 13  DC  C OP2   1 
ATOM   4464 O  "O5'" . DC  C 3 13  ? 31.462  79.998  39.484 1.00 87.44  ? 13  DC  C "O5'" 1 
ATOM   4465 C  "C5'" . DC  C 3 13  ? 31.994  78.873  40.160 1.00 80.37  ? 13  DC  C "C5'" 1 
ATOM   4466 C  "C4'" . DC  C 3 13  ? 30.930  78.208  41.012 1.00 73.73  ? 13  DC  C "C4'" 1 
ATOM   4467 O  "O4'" . DC  C 3 13  ? 29.740  78.024  40.230 1.00 63.19  ? 13  DC  C "O4'" 1 
ATOM   4468 C  "C3'" . DC  C 3 13  ? 31.277  76.809  41.476 1.00 79.34  ? 13  DC  C "C3'" 1 
ATOM   4469 O  "O3'" . DC  C 3 13  ? 32.046  76.855  42.679 1.00 85.93  ? 13  DC  C "O3'" 1 
ATOM   4470 C  "C2'" . DC  C 3 13  ? 29.901  76.178  41.716 1.00 68.08  ? 13  DC  C "C2'" 1 
ATOM   4471 C  "C1'" . DC  C 3 13  ? 28.980  76.974  40.792 1.00 55.88  ? 13  DC  C "C1'" 1 
ATOM   4472 N  N1    . DC  C 3 13  ? 28.369  76.174  39.689 1.00 52.04  ? 13  DC  C N1    1 
ATOM   4473 C  C2    . DC  C 3 13  ? 27.422  75.176  39.990 1.00 59.25  ? 13  DC  C C2    1 
ATOM   4474 O  O2    . DC  C 3 13  ? 27.133  74.953  41.176 1.00 55.90  ? 13  DC  C O2    1 
ATOM   4475 N  N3    . DC  C 3 13  ? 26.855  74.472  38.968 1.00 57.51  ? 13  DC  C N3    1 
ATOM   4476 C  C4    . DC  C 3 13  ? 27.196  74.743  37.700 1.00 59.40  ? 13  DC  C C4    1 
ATOM   4477 N  N4    . DC  C 3 13  ? 26.618  74.024  36.727 1.00 52.28  ? 13  DC  C N4    1 
ATOM   4478 C  C5    . DC  C 3 13  ? 28.147  75.767  37.378 1.00 55.64  ? 13  DC  C C5    1 
ATOM   4479 C  C6    . DC  C 3 13  ? 28.699  76.448  38.392 1.00 53.74  ? 13  DC  C C6    1 
ATOM   4480 P  P     . DT  C 3 14  ? 33.382  75.969  42.824 1.00 99.65  ? 14  DT  C P     1 
ATOM   4481 O  OP1   . DT  C 3 14  ? 34.110  76.449  44.026 1.00 91.23  ? 14  DT  C OP1   1 
ATOM   4482 O  OP2   . DT  C 3 14  ? 34.021  75.936  41.489 1.00 95.46  ? 14  DT  C OP2   1 
ATOM   4483 O  "O5'" . DT  C 3 14  ? 32.858  74.497  43.151 1.00 76.79  ? 14  DT  C "O5'" 1 
ATOM   4484 C  "C5'" . DT  C 3 14  ? 32.359  73.672  42.117 1.00 68.56  ? 14  DT  C "C5'" 1 
ATOM   4485 C  "C4'" . DT  C 3 14  ? 31.228  72.819  42.645 1.00 75.03  ? 14  DT  C "C4'" 1 
ATOM   4486 O  "O4'" . DT  C 3 14  ? 30.040  73.028  41.855 1.00 67.74  ? 14  DT  C "O4'" 1 
ATOM   4487 C  "C3'" . DT  C 3 14  ? 31.478  71.331  42.584 1.00 84.15  ? 14  DT  C "C3'" 1 
ATOM   4488 O  "O3'" . DT  C 3 14  ? 32.222  70.932  43.732 1.00 86.12  ? 14  DT  C "O3'" 1 
ATOM   4489 C  "C2'" . DT  C 3 14  ? 30.055  70.770  42.595 1.00 76.04  ? 14  DT  C "C2'" 1 
ATOM   4490 C  "C1'" . DT  C 3 14  ? 29.270  71.842  41.825 1.00 57.43  ? 14  DT  C "C1'" 1 
ATOM   4491 N  N1    . DT  C 3 14  ? 28.997  71.507  40.389 1.00 56.86  ? 14  DT  C N1    1 
ATOM   4492 C  C2    . DT  C 3 14  ? 28.138  70.474  40.083 1.00 68.66  ? 14  DT  C C2    1 
ATOM   4493 O  O2    . DT  C 3 14  ? 27.585  69.788  40.928 1.00 71.44  ? 14  DT  C O2    1 
ATOM   4494 N  N3    . DT  C 3 14  ? 27.951  70.264  38.737 1.00 68.79  ? 14  DT  C N3    1 
ATOM   4495 C  C4    . DT  C 3 14  ? 28.515  70.971  37.689 1.00 67.50  ? 14  DT  C C4    1 
ATOM   4496 O  O4    . DT  C 3 14  ? 28.281  70.703  36.510 1.00 66.22  ? 14  DT  C O4    1 
ATOM   4497 C  C5    . DT  C 3 14  ? 29.398  72.047  38.079 1.00 62.12  ? 14  DT  C C5    1 
ATOM   4498 C  C7    . DT  C 3 14  ? 30.073  72.883  37.031 1.00 58.06  ? 14  DT  C C7    1 
ATOM   4499 C  C6    . DT  C 3 14  ? 29.591  72.263  39.394 1.00 56.47  ? 14  DT  C C6    1 
ATOM   4500 P  P     . DC  C 3 15  ? 33.545  70.037  43.566 1.00 83.99  ? 15  DC  C P     1 
ATOM   4501 O  OP1   . DC  C 3 15  ? 34.490  70.340  44.669 1.00 70.74  ? 15  DC  C OP1   1 
ATOM   4502 O  OP2   . DC  C 3 15  ? 33.968  70.127  42.147 1.00 69.53  ? 15  DC  C OP2   1 
ATOM   4503 O  "O5'" . DC  C 3 15  ? 33.007  68.567  43.801 1.00 84.29  ? 15  DC  C "O5'" 1 
ATOM   4504 C  "C5'" . DC  C 3 15  ? 32.793  67.746  42.698 1.00 80.92  ? 15  DC  C "C5'" 1 
ATOM   4505 C  "C4'" . DC  C 3 15  ? 31.791  66.672  43.023 1.00 77.45  ? 15  DC  C "C4'" 1 
ATOM   4506 O  "O4'" . DC  C 3 15  ? 30.495  67.076  42.518 1.00 89.27  ? 15  DC  C "O4'" 1 
ATOM   4507 C  "C3'" . DC  C 3 15  ? 32.108  65.324  42.396 1.00 77.27  ? 15  DC  C "C3'" 1 
ATOM   4508 O  "O3'" . DC  C 3 15  ? 32.690  64.456  43.389 1.00 82.63  ? 15  DC  C "O3'" 1 
ATOM   4509 C  "C2'" . DC  C 3 15  ? 30.744  64.813  41.932 1.00 80.07  ? 15  DC  C "C2'" 1 
ATOM   4510 C  "C1'" . DC  C 3 15  ? 29.987  66.100  41.637 1.00 88.00  ? 15  DC  C "C1'" 1 
ATOM   4511 N  N1    . DC  C 3 15  ? 30.117  66.613  40.217 1.00 88.50  ? 15  DC  C N1    1 
ATOM   4512 C  C2    . DC  C 3 15  ? 29.651  65.840  39.139 1.00 91.89  ? 15  DC  C C2    1 
ATOM   4513 O  O2    . DC  C 3 15  ? 29.157  64.723  39.355 1.00 87.63  ? 15  DC  C O2    1 
ATOM   4514 N  N3    . DC  C 3 15  ? 29.764  66.339  37.877 1.00 93.24  ? 15  DC  C N3    1 
ATOM   4515 C  C4    . DC  C 3 15  ? 30.298  67.550  37.677 1.00 86.54  ? 15  DC  C C4    1 
ATOM   4516 N  N4    . DC  C 3 15  ? 30.386  67.999  36.418 1.00 83.34  ? 15  DC  C N4    1 
ATOM   4517 C  C5    . DC  C 3 15  ? 30.763  68.352  38.760 1.00 80.71  ? 15  DC  C C5    1 
ATOM   4518 C  C6    . DC  C 3 15  ? 30.648  67.854  39.996 1.00 81.67  ? 15  DC  C C6    1 
ATOM   4519 P  P     . DT  C 3 16  ? 34.050  63.637  43.102 1.00 75.79  ? 16  DT  C P     1 
ATOM   4520 O  OP1   . DT  C 3 16  ? 34.659  63.342  44.421 1.00 70.15  ? 16  DT  C OP1   1 
ATOM   4521 O  OP2   . DT  C 3 16  ? 34.846  64.357  42.080 1.00 76.65  ? 16  DT  C OP2   1 
ATOM   4522 O  "O5'" . DT  C 3 16  ? 33.542  62.258  42.462 1.00 75.29  ? 16  DT  C "O5'" 1 
ATOM   4523 C  "C5'" . DT  C 3 16  ? 32.919  62.266  41.187 1.00 71.46  ? 16  DT  C "C5'" 1 
ATOM   4524 C  "C4'" . DT  C 3 16  ? 32.626  60.867  40.702 1.00 76.19  ? 16  DT  C "C4'" 1 
ATOM   4525 O  "O4'" . DT  C 3 16  ? 31.472  60.904  39.831 1.00 79.42  ? 16  DT  C "O4'" 1 
ATOM   4526 C  "C3'" . DT  C 3 16  ? 33.766  60.225  39.914 1.00 84.65  ? 16  DT  C "C3'" 1 
ATOM   4527 O  "O3'" . DT  C 3 16  ? 34.218  59.034  40.578 1.00 77.60  ? 16  DT  C "O3'" 1 
ATOM   4528 C  "C2'" . DT  C 3 16  ? 33.182  59.932  38.517 1.00 82.96  ? 16  DT  C "C2'" 1 
ATOM   4529 C  "C1'" . DT  C 3 16  ? 31.855  60.692  38.494 1.00 80.53  ? 16  DT  C "C1'" 1 
ATOM   4530 N  N1    . DT  C 3 16  ? 31.880  62.028  37.752 1.00 83.70  ? 16  DT  C N1    1 
ATOM   4531 C  C2    . DT  C 3 16  ? 30.789  62.387  36.983 1.00 88.84  ? 16  DT  C C2    1 
ATOM   4532 O  O2    . DT  C 3 16  ? 29.797  61.689  36.863 1.00 91.27  ? 16  DT  C O2    1 
ATOM   4533 N  N3    . DT  C 3 16  ? 30.900  63.604  36.357 1.00 90.11  ? 16  DT  C N3    1 
ATOM   4534 C  C4    . DT  C 3 16  ? 31.967  64.483  36.415 1.00 88.96  ? 16  DT  C C4    1 
ATOM   4535 O  O4    . DT  C 3 16  ? 31.969  65.555  35.815 1.00 86.67  ? 16  DT  C O4    1 
ATOM   4536 C  C5    . DT  C 3 16  ? 33.078  64.050  37.233 1.00 88.95  ? 16  DT  C C5    1 
ATOM   4537 C  C7    . DT  C 3 16  ? 34.294  64.920  37.372 1.00 92.35  ? 16  DT  C C7    1 
ATOM   4538 C  C6    . DT  C 3 16  ? 32.982  62.860  37.853 1.00 83.18  ? 16  DT  C C6    1 
ATOM   4539 P  P     . DG  C 3 17  ? 35.707  58.953  41.183 1.00 91.57  ? 17  DG  C P     1 
ATOM   4540 O  OP1   . DG  C 3 17  ? 36.226  57.610  40.834 1.00 91.07  ? 17  DG  C OP1   1 
ATOM   4541 O  OP2   . DG  C 3 17  ? 35.654  59.368  42.608 1.00 88.35  ? 17  DG  C OP2   1 
ATOM   4542 O  "O5'" . DG  C 3 17  ? 36.530  60.051  40.345 1.00 72.88  ? 17  DG  C "O5'" 1 
ATOM   4543 C  "C5'" . DG  C 3 17  ? 37.484  59.645  39.370 1.00 81.75  ? 17  DG  C "C5'" 1 
ATOM   4544 C  "C4'" . DG  C 3 17  ? 36.811  59.252  38.065 1.00 82.95  ? 17  DG  C "C4'" 1 
ATOM   4545 O  "O4'" . DG  C 3 17  ? 36.229  60.416  37.443 1.00 77.24  ? 17  DG  C "O4'" 1 
ATOM   4546 C  "C3'" . DG  C 3 17  ? 37.749  58.652  37.014 1.00 87.10  ? 17  DG  C "C3'" 1 
ATOM   4547 O  "O3'" . DG  C 3 17  ? 37.555  57.249  36.951 1.00 86.94  ? 17  DG  C "O3'" 1 
ATOM   4548 C  "C2'" . DG  C 3 17  ? 37.348  59.345  35.689 1.00 90.74  ? 17  DG  C "C2'" 1 
ATOM   4549 C  "C1'" . DG  C 3 17  ? 36.111  60.166  36.066 1.00 82.22  ? 17  DG  C "C1'" 1 
ATOM   4550 N  N9    . DG  C 3 17  ? 36.011  61.451  35.362 1.00 85.53  ? 17  DG  C N9    1 
ATOM   4551 C  C8    . DG  C 3 17  ? 36.990  62.409  35.256 1.00 88.17  ? 17  DG  C C8    1 
ATOM   4552 N  N7    . DG  C 3 17  ? 36.621  63.462  34.574 1.00 95.25  ? 17  DG  C N7    1 
ATOM   4553 C  C5    . DG  C 3 17  ? 35.308  63.190  34.202 1.00 88.45  ? 17  DG  C C5    1 
ATOM   4554 C  C6    . DG  C 3 17  ? 34.392  63.969  33.444 1.00 82.07  ? 17  DG  C C6    1 
ATOM   4555 O  O6    . DG  C 3 17  ? 34.568  65.087  32.938 1.00 84.89  ? 17  DG  C O6    1 
ATOM   4556 N  N1    . DG  C 3 17  ? 33.167  63.326  33.295 1.00 83.62  ? 17  DG  C N1    1 
ATOM   4557 C  C2    . DG  C 3 17  ? 32.860  62.089  33.809 1.00 87.06  ? 17  DG  C C2    1 
ATOM   4558 N  N2    . DG  C 3 17  ? 31.621  61.633  33.558 1.00 79.03  ? 17  DG  C N2    1 
ATOM   4559 N  N3    . DG  C 3 17  ? 33.709  61.345  34.520 1.00 92.08  ? 17  DG  C N3    1 
ATOM   4560 C  C4    . DG  C 3 17  ? 34.912  61.957  34.677 1.00 89.28  ? 17  DG  C C4    1 
ATOM   4561 P  P     . DG  C 3 18  ? 38.801  56.239  36.832 1.00 90.15  ? 18  DG  C P     1 
ATOM   4562 O  OP1   . DG  C 3 18  ? 39.843  56.840  35.975 1.00 85.57  ? 18  DG  C OP1   1 
ATOM   4563 O  OP2   . DG  C 3 18  ? 38.176  54.976  36.387 1.00 89.19  ? 18  DG  C OP2   1 
ATOM   4564 O  "O5'" . DG  C 3 18  ? 39.358  56.087  38.343 1.00 84.73  ? 18  DG  C "O5'" 1 
ATOM   4565 C  "C5'" . DG  C 3 18  ? 40.463  56.897  38.817 1.00 88.69  ? 18  DG  C "C5'" 1 
ATOM   4566 C  "C4'" . DG  C 3 18  ? 40.199  57.414  40.230 1.00 95.91  ? 18  DG  C "C4'" 1 
ATOM   4567 O  "O4'" . DG  C 3 18  ? 39.288  56.506  40.910 1.00 103.95 ? 18  DG  C "O4'" 1 
ATOM   4568 C  "C3'" . DG  C 3 18  ? 41.437  57.527  41.152 1.00 102.85 ? 18  DG  C "C3'" 1 
ATOM   4569 O  "O3'" . DG  C 3 18  ? 41.465  58.844  41.863 1.00 105.18 ? 18  DG  C "O3'" 1 
ATOM   4570 C  "C2'" . DG  C 3 18  ? 41.260  56.332  42.075 1.00 106.03 ? 18  DG  C "C2'" 1 
ATOM   4571 C  "C1'" . DG  C 3 18  ? 39.759  56.331  42.219 1.00 104.70 ? 18  DG  C "C1'" 1 
ATOM   4572 N  N9    . DG  C 3 18  ? 39.202  55.118  42.807 1.00 105.99 ? 18  DG  C N9    1 
ATOM   4573 C  C8    . DG  C 3 18  ? 38.303  55.056  43.843 1.00 105.56 ? 18  DG  C C8    1 
ATOM   4574 N  N7    . DG  C 3 18  ? 37.976  53.842  44.171 1.00 98.76  ? 18  DG  C N7    1 
ATOM   4575 C  C5    . DG  C 3 18  ? 38.709  53.046  43.309 1.00 97.38  ? 18  DG  C C5    1 
ATOM   4576 C  C6    . DG  C 3 18  ? 38.759  51.642  43.200 1.00 101.85 ? 18  DG  C C6    1 
ATOM   4577 O  O6    . DG  C 3 18  ? 38.146  50.798  43.872 1.00 104.59 ? 18  DG  C O6    1 
ATOM   4578 N  N1    . DG  C 3 18  ? 39.627  51.237  42.191 1.00 100.59 ? 18  DG  C N1    1 
ATOM   4579 C  C2    . DG  C 3 18  ? 40.352  52.086  41.389 1.00 101.92 ? 18  DG  C C2    1 
ATOM   4580 N  N2    . DG  C 3 18  ? 41.136  51.510  40.468 1.00 100.83 ? 18  DG  C N2    1 
ATOM   4581 N  N3    . DG  C 3 18  ? 40.311  53.405  41.481 1.00 102.46 ? 18  DG  C N3    1 
ATOM   4582 C  C4    . DG  C 3 18  ? 39.472  53.814  42.461 1.00 100.58 ? 18  DG  C C4    1 
ATOM   4583 P  P     . DG  C 3 19  ? 41.374  59.040  43.477 1.00 117.34 ? 19  DG  C P     1 
ATOM   4584 O  OP1   . DG  C 3 19  ? 40.000  58.781  43.951 1.00 114.74 ? 19  DG  C OP1   1 
ATOM   4585 O  OP2   . DG  C 3 19  ? 41.959  60.375  43.733 1.00 120.75 ? 19  DG  C OP2   1 
ATOM   4586 O  "O5'" . DG  C 3 19  ? 42.374  57.967  44.136 1.00 129.03 ? 19  DG  C "O5'" 1 
ATOM   4587 C  "C5'" . DG  C 3 19  ? 41.976  57.189  45.304 1.00 122.52 ? 19  DG  C "C5'" 1 
ATOM   4588 C  "C4'" . DG  C 3 19  ? 42.500  55.758  45.183 1.00 130.00 ? 19  DG  C "C4'" 1 
ATOM   4589 O  "O4'" . DG  C 3 19  ? 43.939  55.778  45.012 1.00 133.33 ? 19  DG  C "O4'" 1 
ATOM   4590 C  "C3'" . DG  C 3 19  ? 42.233  54.822  46.356 1.00 128.61 ? 19  DG  C "C3'" 1 
ATOM   4591 O  "O3'" . DG  C 3 19  ? 42.058  53.468  45.853 1.00 124.93 ? 19  DG  C "O3'" 1 
ATOM   4592 C  "C2'" . DG  C 3 19  ? 43.492  54.988  47.213 1.00 134.64 ? 19  DG  C "C2'" 1 
ATOM   4593 C  "C1'" . DG  C 3 19  ? 44.581  55.318  46.187 1.00 136.49 ? 19  DG  C "C1'" 1 
ATOM   4594 N  N9    . DG  C 3 19  ? 45.515  56.353  46.642 1.00 138.47 ? 19  DG  C N9    1 
ATOM   4595 C  C8    . DG  C 3 19  ? 45.325  57.716  46.603 1.00 140.40 ? 19  DG  C C8    1 
ATOM   4596 N  N7    . DG  C 3 19  ? 46.332  58.397  47.080 1.00 143.77 ? 19  DG  C N7    1 
ATOM   4597 C  C5    . DG  C 3 19  ? 47.251  57.425  47.463 1.00 144.47 ? 19  DG  C C5    1 
ATOM   4598 C  C6    . DG  C 3 19  ? 48.536  57.563  48.049 1.00 141.87 ? 19  DG  C C6    1 
ATOM   4599 O  O6    . DG  C 3 19  ? 49.134  58.605  48.354 1.00 136.12 ? 19  DG  C O6    1 
ATOM   4600 N  N1    . DG  C 3 19  ? 49.134  56.323  48.278 1.00 143.07 ? 19  DG  C N1    1 
ATOM   4601 C  C2    . DG  C 3 19  ? 48.563  55.106  47.980 1.00 141.43 ? 19  DG  C C2    1 
ATOM   4602 N  N2    . DG  C 3 19  ? 49.293  54.019  48.273 1.00 139.31 ? 19  DG  C N2    1 
ATOM   4603 N  N3    . DG  C 3 19  ? 47.361  54.963  47.432 1.00 142.20 ? 19  DG  C N3    1 
ATOM   4604 C  C4    . DG  C 3 19  ? 46.764  56.161  47.202 1.00 144.37 ? 19  DG  C C4    1 
ATOM   4605 P  P     . DT  C 3 20  ? 42.309  52.149  46.751 1.00 136.97 ? 20  DT  C P     1 
ATOM   4606 O  OP1   . DT  C 3 20  ? 41.273  51.189  46.304 1.00 121.83 ? 20  DT  C OP1   1 
ATOM   4607 O  OP2   . DT  C 3 20  ? 42.380  52.462  48.197 1.00 126.12 ? 20  DT  C OP2   1 
ATOM   4608 O  "O5'" . DT  C 3 20  ? 43.739  51.613  46.243 1.00 115.35 ? 20  DT  C "O5'" 1 
ATOM   4609 C  "C5'" . DT  C 3 20  ? 44.165  50.274  46.529 1.00 106.34 ? 20  DT  C "C5'" 1 
ATOM   4610 C  "C4'" . DT  C 3 20  ? 44.478  49.508  45.244 1.00 112.35 ? 20  DT  C "C4'" 1 
ATOM   4611 O  "O4'" . DT  C 3 20  ? 45.345  50.297  44.382 1.00 115.39 ? 20  DT  C "O4'" 1 
ATOM   4612 C  "C3'" . DT  C 3 20  ? 45.194  48.155  45.441 1.00 115.57 ? 20  DT  C "C3'" 1 
ATOM   4613 O  "O3'" . DT  C 3 20  ? 44.412  47.079  44.884 1.00 119.72 ? 20  DT  C "O3'" 1 
ATOM   4614 C  "C2'" . DT  C 3 20  ? 46.528  48.326  44.699 1.00 108.27 ? 20  DT  C "C2'" 1 
ATOM   4615 C  "C1'" . DT  C 3 20  ? 46.196  49.412  43.691 1.00 114.79 ? 20  DT  C "C1'" 1 
ATOM   4616 N  N1    . DT  C 3 20  ? 47.409  50.154  43.185 1.00 114.61 ? 20  DT  C N1    1 
ATOM   4617 C  C2    . DT  C 3 20  ? 47.773  50.031  41.859 1.00 103.76 ? 20  DT  C C2    1 
ATOM   4618 O  O2    . DT  C 3 20  ? 47.151  49.364  41.054 1.00 99.71  ? 20  DT  C O2    1 
ATOM   4619 N  N3    . DT  C 3 20  ? 48.895  50.732  41.504 1.00 94.55  ? 20  DT  C N3    1 
ATOM   4620 C  C4    . DT  C 3 20  ? 49.679  51.519  42.322 1.00 100.79 ? 20  DT  C C4    1 
ATOM   4621 O  O4    . DT  C 3 20  ? 50.672  52.110  41.908 1.00 101.69 ? 20  DT  C O4    1 
ATOM   4622 C  C5    . DT  C 3 20  ? 49.251  51.599  43.700 1.00 109.16 ? 20  DT  C C5    1 
ATOM   4623 C  C7    . DT  C 3 20  ? 50.024  52.426  44.683 1.00 114.55 ? 20  DT  C C7    1 
ATOM   4624 C  C6    . DT  C 3 20  ? 48.153  50.917  44.061 1.00 113.88 ? 20  DT  C C6    1 
ATOM   4625 P  P     . DC  C 3 21  ? 44.773  45.543  45.222 1.00 111.74 ? 21  DC  C P     1 
ATOM   4626 O  OP1   . DC  C 3 21  ? 44.447  45.304  46.645 1.00 112.19 ? 21  DC  C OP1   1 
ATOM   4627 O  OP2   . DC  C 3 21  ? 46.124  45.249  44.697 1.00 109.29 ? 21  DC  C OP2   1 
ATOM   4628 O  "O5'" . DC  C 3 21  ? 43.734  44.694  44.358 1.00 98.68  ? 21  DC  C "O5'" 1 
ATOM   4629 C  "C5'" . DC  C 3 21  ? 44.196  43.627  43.540 1.00 94.69  ? 21  DC  C "C5'" 1 
ATOM   4630 C  "C4'" . DC  C 3 21  ? 44.232  44.055  42.086 1.00 95.99  ? 21  DC  C "C4'" 1 
ATOM   4631 O  "O4'" . DC  C 3 21  ? 45.071  45.214  41.958 1.00 100.88 ? 21  DC  C "O4'" 1 
ATOM   4632 C  "C3'" . DC  C 3 21  ? 44.820  43.031  41.123 1.00 96.39  ? 21  DC  C "C3'" 1 
ATOM   4633 O  "O3'" . DC  C 3 21  ? 43.776  42.268  40.519 1.00 88.67  ? 21  DC  C "O3'" 1 
ATOM   4634 C  "C2'" . DC  C 3 21  ? 45.572  43.877  40.079 1.00 96.84  ? 21  DC  C "C2'" 1 
ATOM   4635 C  "C1'" . DC  C 3 21  ? 45.507  45.306  40.628 1.00 95.70  ? 21  DC  C "C1'" 1 
ATOM   4636 N  N1    . DC  C 3 21  ? 46.815  46.009  40.616 1.00 93.40  ? 21  DC  C N1    1 
ATOM   4637 C  C2    . DC  C 3 21  ? 47.305  46.539  39.418 1.00 90.75  ? 21  DC  C C2    1 
ATOM   4638 O  O2    . DC  C 3 21  ? 46.638  46.403  38.384 1.00 86.88  ? 21  DC  C O2    1 
ATOM   4639 N  N3    . DC  C 3 21  ? 48.499  47.185  39.425 1.00 89.81  ? 21  DC  C N3    1 
ATOM   4640 C  C4    . DC  C 3 21  ? 49.188  47.302  40.563 1.00 96.24  ? 21  DC  C C4    1 
ATOM   4641 N  N4    . DC  C 3 21  ? 50.362  47.946  40.523 1.00 96.14  ? 21  DC  C N4    1 
ATOM   4642 C  C5    . DC  C 3 21  ? 48.701  46.770  41.794 1.00 102.66 ? 21  DC  C C5    1 
ATOM   4643 C  C6    . DC  C 3 21  ? 47.522  46.139  41.774 1.00 97.60  ? 21  DC  C C6    1 
ATOM   4644 P  P     . DA  C 3 22  ? 44.088  40.803  39.937 1.00 89.53  ? 22  DA  C P     1 
ATOM   4645 O  OP1   . DA  C 3 22  ? 42.798  40.173  39.567 1.00 84.23  ? 22  DA  C OP1   1 
ATOM   4646 O  OP2   . DA  C 3 22  ? 44.971  40.139  40.921 1.00 90.90  ? 22  DA  C OP2   1 
ATOM   4647 O  "O5'" . DA  C 3 22  ? 44.907  41.081  38.585 1.00 73.11  ? 22  DA  C "O5'" 1 
ATOM   4648 C  "C5'" . DA  C 3 22  ? 44.206  41.267  37.367 1.00 76.36  ? 22  DA  C "C5'" 1 
ATOM   4649 C  "C4'" . DA  C 3 22  ? 45.161  41.455  36.209 1.00 76.99  ? 22  DA  C "C4'" 1 
ATOM   4650 O  "O4'" . DA  C 3 22  ? 46.041  42.571  36.490 1.00 83.97  ? 22  DA  C "O4'" 1 
ATOM   4651 C  "C3'" . DA  C 3 22  ? 46.072  40.260  35.919 1.00 89.55  ? 22  DA  C "C3'" 1 
ATOM   4652 O  "O3'" . DA  C 3 22  ? 46.168  40.052  34.513 1.00 94.80  ? 22  DA  C "O3'" 1 
ATOM   4653 C  "C2'" . DA  C 3 22  ? 47.411  40.697  36.508 1.00 90.10  ? 22  DA  C "C2'" 1 
ATOM   4654 C  "C1'" . DA  C 3 22  ? 47.370  42.189  36.234 1.00 87.43  ? 22  DA  C "C1'" 1 
ATOM   4655 N  N9    . DA  C 3 22  ? 48.252  42.967  37.098 1.00 83.33  ? 22  DA  C N9    1 
ATOM   4656 C  C8    . DA  C 3 22  ? 48.288  42.955  38.464 1.00 86.73  ? 22  DA  C C8    1 
ATOM   4657 N  N7    . DA  C 3 22  ? 49.186  43.762  38.977 1.00 86.09  ? 22  DA  C N7    1 
ATOM   4658 C  C5    . DA  C 3 22  ? 49.781  44.340  37.870 1.00 80.95  ? 22  DA  C C5    1 
ATOM   4659 C  C6    . DA  C 3 22  ? 50.811  45.288  37.738 1.00 79.31  ? 22  DA  C C6    1 
ATOM   4660 N  N6    . DA  C 3 22  ? 51.443  45.834  38.780 1.00 80.85  ? 22  DA  C N6    1 
ATOM   4661 N  N1    . DA  C 3 22  ? 51.168  45.652  36.488 1.00 76.97  ? 22  DA  C N1    1 
ATOM   4662 C  C2    . DA  C 3 22  ? 50.530  45.101  35.448 1.00 76.19  ? 22  DA  C C2    1 
ATOM   4663 N  N3    . DA  C 3 22  ? 49.545  44.203  35.449 1.00 76.30  ? 22  DA  C N3    1 
ATOM   4664 C  C4    . DA  C 3 22  ? 49.216  43.861  36.703 1.00 78.93  ? 22  DA  C C4    1 
ATOM   4665 P  P     . DC  C 3 23  ? 46.639  38.627  33.937 1.00 100.43 ? 23  DC  C P     1 
ATOM   4666 O  OP1   . DC  C 3 23  ? 45.442  37.897  33.465 1.00 89.45  ? 23  DC  C OP1   1 
ATOM   4667 O  OP2   . DC  C 3 23  ? 47.525  38.011  34.951 1.00 103.06 ? 23  DC  C OP2   1 
ATOM   4668 O  "O5'" . DC  C 3 23  ? 47.523  38.997  32.655 1.00 90.08  ? 23  DC  C "O5'" 1 
ATOM   4669 C  "C5'" . DC  C 3 23  ? 47.558  40.326  32.171 1.00 86.76  ? 23  DC  C "C5'" 1 
ATOM   4670 C  "C4'" . DC  C 3 23  ? 48.969  40.712  31.764 1.00 93.09  ? 23  DC  C "C4'" 1 
ATOM   4671 O  "O4'" . DC  C 3 23  ? 49.600  41.464  32.832 1.00 96.60  ? 23  DC  C "O4'" 1 
ATOM   4672 C  "C3'" . DC  C 3 23  ? 49.905  39.538  31.459 1.00 97.09  ? 23  DC  C "C3'" 1 
ATOM   4673 O  "O3'" . DC  C 3 23  ? 50.550  39.757  30.210 1.00 99.62  ? 23  DC  C "O3'" 1 
ATOM   4674 C  "C2'" . DC  C 3 23  ? 50.901  39.550  32.627 1.00 91.10  ? 23  DC  C "C2'" 1 
ATOM   4675 C  "C1'" . DC  C 3 23  ? 50.929  41.023  32.986 1.00 86.78  ? 23  DC  C "C1'" 1 
ATOM   4676 N  N1    . DC  C 3 23  ? 51.360  41.303  34.396 1.00 82.25  ? 23  DC  C N1    1 
ATOM   4677 C  C2    . DC  C 3 23  ? 52.400  42.209  34.637 1.00 82.21  ? 23  DC  C C2    1 
ATOM   4678 O  O2    . DC  C 3 23  ? 52.960  42.755  33.678 1.00 84.03  ? 23  DC  C O2    1 
ATOM   4679 N  N3    . DC  C 3 23  ? 52.767  42.462  35.920 1.00 80.77  ? 23  DC  C N3    1 
ATOM   4680 C  C4    . DC  C 3 23  ? 52.139  41.856  36.929 1.00 79.47  ? 23  DC  C C4    1 
ATOM   4681 N  N4    . DC  C 3 23  ? 52.536  42.139  38.175 1.00 79.18  ? 23  DC  C N4    1 
ATOM   4682 C  C5    . DC  C 3 23  ? 51.075  40.934  36.705 1.00 81.18  ? 23  DC  C C5    1 
ATOM   4683 C  C6    . DC  C 3 23  ? 50.721  40.691  35.435 1.00 86.58  ? 23  DC  C C6    1 
ATOM   4684 P  P     . DG  C 3 24  ? 51.555  38.661  29.599 1.00 115.00 ? 24  DG  C P     1 
ATOM   4685 O  OP1   . DG  C 3 24  ? 51.231  38.535  28.160 1.00 108.47 ? 24  DG  C OP1   1 
ATOM   4686 O  OP2   . DG  C 3 24  ? 51.542  37.458  30.464 1.00 105.48 ? 24  DG  C OP2   1 
ATOM   4687 O  "O5'" . DG  C 3 24  ? 52.986  39.365  29.712 1.00 102.29 ? 24  DG  C "O5'" 1 
ATOM   4688 C  "C5'" . DG  C 3 24  ? 53.153  40.702  29.242 1.00 105.55 ? 24  DG  C "C5'" 1 
ATOM   4689 C  "C4'" . DG  C 3 24  ? 54.615  41.127  29.264 1.00 107.24 ? 24  DG  C "C4'" 1 
ATOM   4690 O  "O4'" . DG  C 3 24  ? 55.026  41.431  30.620 1.00 105.72 ? 24  DG  C "O4'" 1 
ATOM   4691 C  "C3'" . DG  C 3 24  ? 55.606  40.092  28.765 1.00 108.51 ? 24  DG  C "C3'" 1 
ATOM   4692 O  "O3'" . DG  C 3 24  ? 56.740  40.750  28.231 1.00 114.49 ? 24  DG  C "O3'" 1 
ATOM   4693 C  "C2'" . DG  C 3 24  ? 55.954  39.328  30.040 1.00 103.99 ? 24  DG  C "C2'" 1 
ATOM   4694 C  "C1'" . DG  C 3 24  ? 55.896  40.424  31.107 1.00 98.08  ? 24  DG  C "C1'" 1 
ATOM   4695 N  N9    . DG  C 3 24  ? 55.371  39.965  32.393 1.00 91.12  ? 24  DG  C N9    1 
ATOM   4696 C  C8    . DG  C 3 24  ? 54.373  39.041  32.596 1.00 88.27  ? 24  DG  C C8    1 
ATOM   4697 N  N7    . DG  C 3 24  ? 54.100  38.838  33.857 1.00 86.08  ? 24  DG  C N7    1 
ATOM   4698 C  C5    . DG  C 3 24  ? 54.968  39.686  34.534 1.00 87.54  ? 24  DG  C C5    1 
ATOM   4699 C  C6    . DG  C 3 24  ? 55.128  39.905  35.926 1.00 86.91  ? 24  DG  C C6    1 
ATOM   4700 O  O6    . DG  C 3 24  ? 54.521  39.368  36.865 1.00 85.49  ? 24  DG  C O6    1 
ATOM   4701 N  N1    . DG  C 3 24  ? 56.122  40.848  36.188 1.00 81.86  ? 24  DG  C N1    1 
ATOM   4702 C  C2    . DG  C 3 24  ? 56.860  41.501  35.227 1.00 86.61  ? 24  DG  C C2    1 
ATOM   4703 N  N2    . DG  C 3 24  ? 57.772  42.379  35.673 1.00 87.23  ? 24  DG  C N2    1 
ATOM   4704 N  N3    . DG  C 3 24  ? 56.716  41.308  33.919 1.00 86.19  ? 24  DG  C N3    1 
ATOM   4705 C  C4    . DG  C 3 24  ? 55.756  40.390  33.647 1.00 87.25  ? 24  DG  C C4    1 
ATOM   4706 P  P     . DC  C 3 25  ? 57.637  40.043  27.103 1.00 119.38 ? 25  DC  C P     1 
ATOM   4707 O  OP1   . DC  C 3 25  ? 57.439  40.792  25.840 1.00 110.41 ? 25  DC  C OP1   1 
ATOM   4708 O  OP2   . DC  C 3 25  ? 57.374  38.585  27.159 1.00 100.16 ? 25  DC  C OP2   1 
ATOM   4709 O  "O5'" . DC  C 3 25  ? 59.131  40.311  27.600 1.00 114.60 ? 25  DC  C "O5'" 1 
ATOM   4710 C  "C5'" . DC  C 3 25  ? 59.444  41.515  28.296 1.00 108.96 ? 25  DC  C "C5'" 1 
ATOM   4711 C  "C4'" . DC  C 3 25  ? 60.382  41.229  29.455 1.00 108.69 ? 25  DC  C "C4'" 1 
ATOM   4712 O  "O4'" . DC  C 3 25  ? 59.614  40.924  30.633 1.00 108.77 ? 25  DC  C "O4'" 1 
ATOM   4713 C  "C3'" . DC  C 3 25  ? 61.273  40.019  29.260 1.00 103.24 ? 25  DC  C "C3'" 1 
ATOM   4714 O  "O3'" . DC  C 3 25  ? 62.471  40.404  28.594 1.00 108.30 ? 25  DC  C "O3'" 1 
ATOM   4715 C  "C2'" . DC  C 3 25  ? 61.553  39.552  30.692 1.00 96.44  ? 25  DC  C "C2'" 1 
ATOM   4716 C  "C1'" . DC  C 3 25  ? 60.404  40.151  31.511 1.00 95.48  ? 25  DC  C "C1'" 1 
ATOM   4717 N  N1    . DC  C 3 25  ? 59.534  39.128  32.148 1.00 89.60  ? 25  DC  C N1    1 
ATOM   4718 C  C2    . DC  C 3 25  ? 59.412  39.091  33.543 1.00 87.30  ? 25  DC  C C2    1 
ATOM   4719 O  O2    . DC  C 3 25  ? 60.034  39.913  34.226 1.00 85.04  ? 25  DC  C O2    1 
ATOM   4720 N  N3    . DC  C 3 25  ? 58.610  38.152  34.107 1.00 87.21  ? 25  DC  C N3    1 
ATOM   4721 C  C4    . DC  C 3 25  ? 57.953  37.282  33.334 1.00 93.50  ? 25  DC  C C4    1 
ATOM   4722 N  N4    . DC  C 3 25  ? 57.174  36.373  33.934 1.00 88.95  ? 25  DC  C N4    1 
ATOM   4723 C  C5    . DC  C 3 25  ? 58.068  37.305  31.911 1.00 93.37  ? 25  DC  C C5    1 
ATOM   4724 C  C6    . DC  C 3 25  ? 58.863  38.234  31.367 1.00 92.68  ? 25  DC  C C6    1 
ATOM   4725 O  "O5'" . DG  D 4 2   ? 58.755  38.749  44.193 1.00 108.77 ? 1   DG  D "O5'" 1 
ATOM   4726 C  "C5'" . DG  D 4 2   ? 59.498  39.627  43.361 1.00 105.24 ? 1   DG  D "C5'" 1 
ATOM   4727 C  "C4'" . DG  D 4 2   ? 60.977  39.262  43.353 1.00 107.79 ? 1   DG  D "C4'" 1 
ATOM   4728 O  "O4'" . DG  D 4 2   ? 61.173  37.976  42.718 1.00 109.60 ? 1   DG  D "O4'" 1 
ATOM   4729 C  "C3'" . DG  D 4 2   ? 61.858  40.250  42.595 1.00 106.88 ? 1   DG  D "C3'" 1 
ATOM   4730 O  "O3'" . DG  D 4 2   ? 62.828  40.806  43.476 1.00 115.03 ? 1   DG  D "O3'" 1 
ATOM   4731 C  "C2'" . DG  D 4 2   ? 62.519  39.425  41.480 1.00 104.60 ? 1   DG  D "C2'" 1 
ATOM   4732 C  "C1'" . DG  D 4 2   ? 61.652  38.175  41.415 1.00 102.54 ? 1   DG  D "C1'" 1 
ATOM   4733 N  N9    . DG  D 4 2   ? 60.495  38.265  40.513 1.00 106.68 ? 1   DG  D N9    1 
ATOM   4734 C  C8    . DG  D 4 2   ? 59.249  37.723  40.733 1.00 103.51 ? 1   DG  D C8    1 
ATOM   4735 N  N7    . DG  D 4 2   ? 58.404  37.936  39.768 1.00 98.39  ? 1   DG  D N7    1 
ATOM   4736 C  C5    . DG  D 4 2   ? 59.124  38.675  38.844 1.00 97.74  ? 1   DG  D C5    1 
ATOM   4737 C  C6    . DG  D 4 2   ? 58.721  39.194  37.598 1.00 92.99  ? 1   DG  D C6    1 
ATOM   4738 O  O6    . DG  D 4 2   ? 57.619  39.096  37.057 1.00 95.47  ? 1   DG  D O6    1 
ATOM   4739 N  N1    . DG  D 4 2   ? 59.747  39.887  36.967 1.00 92.01  ? 1   DG  D N1    1 
ATOM   4740 C  C2    . DG  D 4 2   ? 61.008  40.057  37.480 1.00 99.79  ? 1   DG  D C2    1 
ATOM   4741 N  N2    . DG  D 4 2   ? 61.865  40.756  36.724 1.00 99.24  ? 1   DG  D N2    1 
ATOM   4742 N  N3    . DG  D 4 2   ? 61.409  39.568  38.649 1.00 104.65 ? 1   DG  D N3    1 
ATOM   4743 C  C4    . DG  D 4 2   ? 60.416  38.890  39.280 1.00 103.58 ? 1   DG  D C4    1 
ATOM   4744 P  P     . DC  D 4 3   ? 62.483  42.110  44.354 1.00 117.10 ? 2   DC  D P     1 
ATOM   4745 O  OP1   . DC  D 4 3   ? 63.720  42.528  45.049 1.00 113.44 ? 2   DC  D OP1   1 
ATOM   4746 O  OP2   . DC  D 4 3   ? 61.261  41.828  45.140 1.00 114.15 ? 2   DC  D OP2   1 
ATOM   4747 O  "O5'" . DC  D 4 3   ? 62.146  43.229  43.269 1.00 111.52 ? 2   DC  D "O5'" 1 
ATOM   4748 C  "C5'" . DC  D 4 3   ? 62.978  43.394  42.130 1.00 109.72 ? 2   DC  D "C5'" 1 
ATOM   4749 C  "C4'" . DC  D 4 3   ? 62.205  44.061  41.017 1.00 110.09 ? 2   DC  D "C4'" 1 
ATOM   4750 O  "O4'" . DC  D 4 3   ? 61.187  43.158  40.502 1.00 112.60 ? 2   DC  D "O4'" 1 
ATOM   4751 C  "C3'" . DC  D 4 3   ? 61.466  45.332  41.440 1.00 103.16 ? 2   DC  D "C3'" 1 
ATOM   4752 O  "O3'" . DC  D 4 3   ? 61.753  46.354  40.529 1.00 100.34 ? 2   DC  D "O3'" 1 
ATOM   4753 C  "C2'" . DC  D 4 3   ? 59.990  44.928  41.381 1.00 100.12 ? 2   DC  D "C2'" 1 
ATOM   4754 C  "C1'" . DC  D 4 3   ? 60.019  43.907  40.265 1.00 99.62  ? 2   DC  D "C1'" 1 
ATOM   4755 N  N1    . DC  D 4 3   ? 58.842  42.999  40.251 1.00 93.73  ? 2   DC  D N1    1 
ATOM   4756 C  C2    . DC  D 4 3   ? 58.328  42.562  39.026 1.00 95.39  ? 2   DC  D C2    1 
ATOM   4757 O  O2    . DC  D 4 3   ? 58.873  42.934  37.978 1.00 91.89  ? 2   DC  D O2    1 
ATOM   4758 N  N3    . DC  D 4 3   ? 57.249  41.738  39.022 1.00 95.97  ? 2   DC  D N3    1 
ATOM   4759 C  C4    . DC  D 4 3   ? 56.693  41.360  40.174 1.00 94.32  ? 2   DC  D C4    1 
ATOM   4760 N  N4    . DC  D 4 3   ? 55.631  40.549  40.117 1.00 87.97  ? 2   DC  D N4    1 
ATOM   4761 C  C5    . DC  D 4 3   ? 57.200  41.801  41.435 1.00 95.84  ? 2   DC  D C5    1 
ATOM   4762 C  C6    . DC  D 4 3   ? 58.264  42.614  41.426 1.00 95.96  ? 2   DC  D C6    1 
ATOM   4763 P  P     . DG  D 4 4   ? 61.637  47.890  40.973 1.00 107.15 ? 3   DG  D P     1 
ATOM   4764 O  OP1   . DG  D 4 4   ? 62.945  48.308  41.527 1.00 109.73 ? 3   DG  D OP1   1 
ATOM   4765 O  OP2   . DG  D 4 4   ? 60.419  48.031  41.800 1.00 103.96 ? 3   DG  D OP2   1 
ATOM   4766 O  "O5'" . DG  D 4 4   ? 61.420  48.644  39.582 1.00 109.89 ? 3   DG  D "O5'" 1 
ATOM   4767 C  "C5'" . DG  D 4 4   ? 62.101  48.182  38.418 1.00 104.86 ? 3   DG  D "C5'" 1 
ATOM   4768 C  "C4'" . DG  D 4 4   ? 61.157  48.105  37.229 1.00 102.74 ? 3   DG  D "C4'" 1 
ATOM   4769 O  "O4'" . DG  D 4 4   ? 60.198  47.047  37.432 1.00 97.67  ? 3   DG  D "O4'" 1 
ATOM   4770 C  "C3'" . DG  D 4 4   ? 60.336  49.371  36.968 1.00 97.62  ? 3   DG  D "C3'" 1 
ATOM   4771 O  "O3'" . DG  D 4 4   ? 60.754  49.982  35.750 1.00 96.97  ? 3   DG  D "O3'" 1 
ATOM   4772 C  "C2'" . DG  D 4 4   ? 58.879  48.881  36.889 1.00 91.80  ? 3   DG  D "C2'" 1 
ATOM   4773 C  "C1'" . DG  D 4 4   ? 59.032  47.375  36.731 1.00 86.97  ? 3   DG  D "C1'" 1 
ATOM   4774 N  N9    . DG  D 4 4   ? 57.922  46.619  37.301 1.00 84.30  ? 3   DG  D N9    1 
ATOM   4775 C  C8    . DG  D 4 4   ? 57.596  46.507  38.632 1.00 87.26  ? 3   DG  D C8    1 
ATOM   4776 N  N7    . DG  D 4 4   ? 56.545  45.768  38.851 1.00 78.66  ? 3   DG  D N7    1 
ATOM   4777 C  C5    . DG  D 4 4   ? 56.147  45.361  37.584 1.00 81.58  ? 3   DG  D C5    1 
ATOM   4778 C  C6    . DG  D 4 4   ? 55.063  44.538  37.191 1.00 82.07  ? 3   DG  D C6    1 
ATOM   4779 O  O6    . DG  D 4 4   ? 54.215  43.988  37.914 1.00 75.61  ? 3   DG  D O6    1 
ATOM   4780 N  N1    . DG  D 4 4   ? 55.015  44.376  35.803 1.00 81.37  ? 3   DG  D N1    1 
ATOM   4781 C  C2    . DG  D 4 4   ? 55.905  44.940  34.911 1.00 82.94  ? 3   DG  D C2    1 
ATOM   4782 N  N2    . DG  D 4 4   ? 55.696  44.671  33.610 1.00 77.60  ? 3   DG  D N2    1 
ATOM   4783 N  N3    . DG  D 4 4   ? 56.929  45.712  35.270 1.00 80.51  ? 3   DG  D N3    1 
ATOM   4784 C  C4    . DG  D 4 4   ? 56.986  45.878  36.616 1.00 81.67  ? 3   DG  D C4    1 
ATOM   4785 P  P     . DT  D 4 5   ? 60.105  51.374  35.279 1.00 106.29 ? 4   DT  D P     1 
ATOM   4786 O  OP1   . DT  D 4 5   ? 61.041  52.017  34.329 1.00 102.57 ? 4   DT  D OP1   1 
ATOM   4787 O  OP2   . DT  D 4 5   ? 59.674  52.100  36.498 1.00 98.64  ? 4   DT  D OP2   1 
ATOM   4788 O  "O5'" . DT  D 4 5   ? 58.822  50.919  34.440 1.00 99.50  ? 4   DT  D "O5'" 1 
ATOM   4789 C  "C5'" . DT  D 4 5   ? 58.948  49.887  33.465 1.00 93.01  ? 4   DT  D "C5'" 1 
ATOM   4790 C  "C4'" . DT  D 4 5   ? 57.619  49.623  32.786 1.00 88.59  ? 4   DT  D "C4'" 1 
ATOM   4791 O  "O4'" . DT  D 4 5   ? 56.786  48.798  33.641 1.00 84.00  ? 4   DT  D "O4'" 1 
ATOM   4792 C  "C3'" . DT  D 4 5   ? 56.801  50.876  32.480 1.00 84.79  ? 4   DT  D "C3'" 1 
ATOM   4793 O  "O3'" . DT  D 4 5   ? 56.235  50.779  31.188 1.00 85.81  ? 4   DT  D "O3'" 1 
ATOM   4794 C  "C2'" . DT  D 4 5   ? 55.725  50.858  33.560 1.00 83.08  ? 4   DT  D "C2'" 1 
ATOM   4795 C  "C1'" . DT  D 4 5   ? 55.504  49.368  33.715 1.00 76.62  ? 4   DT  D "C1'" 1 
ATOM   4796 N  N1    . DT  D 4 5   ? 54.895  49.000  35.009 1.00 74.70  ? 4   DT  D N1    1 
ATOM   4797 C  C2    . DT  D 4 5   ? 53.834  48.129  35.022 1.00 74.97  ? 4   DT  D C2    1 
ATOM   4798 O  O2    . DT  D 4 5   ? 53.369  47.630  34.014 1.00 76.08  ? 4   DT  D O2    1 
ATOM   4799 N  N3    . DT  D 4 5   ? 53.336  47.853  36.266 1.00 74.73  ? 4   DT  D N3    1 
ATOM   4800 C  C4    . DT  D 4 5   ? 53.780  48.357  37.472 1.00 78.93  ? 4   DT  D C4    1 
ATOM   4801 O  O4    . DT  D 4 5   ? 53.261  48.051  38.542 1.00 79.45  ? 4   DT  D O4    1 
ATOM   4802 C  C5    . DT  D 4 5   ? 54.898  49.272  37.385 1.00 76.17  ? 4   DT  D C5    1 
ATOM   4803 C  C7    . DT  D 4 5   ? 55.470  49.886  38.627 1.00 69.61  ? 4   DT  D C7    1 
ATOM   4804 C  C6    . DT  D 4 5   ? 55.393  49.547  36.171 1.00 74.05  ? 4   DT  D C6    1 
ATOM   4805 P  P     . DG  D 4 6   ? 55.345  51.986  30.612 1.00 94.52  ? 5   DG  D P     1 
ATOM   4806 O  OP1   . DG  D 4 6   ? 55.549  52.029  29.147 1.00 87.61  ? 5   DG  D OP1   1 
ATOM   4807 O  OP2   . DG  D 4 6   ? 55.605  53.185  31.443 1.00 92.61  ? 5   DG  D OP2   1 
ATOM   4808 O  "O5'" . DG  D 4 6   ? 53.845  51.506  30.867 1.00 82.05  ? 5   DG  D "O5'" 1 
ATOM   4809 C  "C5'" . DG  D 4 6   ? 53.373  50.330  30.237 1.00 81.36  ? 5   DG  D "C5'" 1 
ATOM   4810 C  "C4'" . DG  D 4 6   ? 51.924  50.081  30.593 1.00 77.02  ? 5   DG  D "C4'" 1 
ATOM   4811 O  "O4'" . DG  D 4 6   ? 51.825  49.675  31.984 1.00 79.26  ? 5   DG  D "O4'" 1 
ATOM   4812 C  "C3'" . DG  D 4 6   ? 51.008  51.296  30.440 1.00 74.40  ? 5   DG  D "C3'" 1 
ATOM   4813 O  "O3'" . DG  D 4 6   ? 49.821  50.908  29.785 1.00 73.97  ? 5   DG  D "O3'" 1 
ATOM   4814 C  "C2'" . DG  D 4 6   ? 50.738  51.717  31.883 1.00 70.59  ? 5   DG  D "C2'" 1 
ATOM   4815 C  "C1'" . DG  D 4 6   ? 50.770  50.376  32.585 1.00 69.95  ? 5   DG  D "C1'" 1 
ATOM   4816 N  N9    . DG  D 4 6   ? 51.027  50.477  34.012 1.00 71.12  ? 5   DG  D N9    1 
ATOM   4817 C  C8    . DG  D 4 6   ? 51.962  51.270  34.631 1.00 74.31  ? 5   DG  D C8    1 
ATOM   4818 N  N7    . DG  D 4 6   ? 51.960  51.155  35.930 1.00 75.05  ? 5   DG  D N7    1 
ATOM   4819 C  C5    . DG  D 4 6   ? 50.959  50.227  36.186 1.00 74.48  ? 5   DG  D C5    1 
ATOM   4820 C  C6    . DG  D 4 6   ? 50.498  49.704  37.414 1.00 79.49  ? 5   DG  D C6    1 
ATOM   4821 O  O6    . DG  D 4 6   ? 50.900  49.968  38.557 1.00 83.33  ? 5   DG  D O6    1 
ATOM   4822 N  N1    . DG  D 4 6   ? 49.462  48.784  37.227 1.00 80.72  ? 5   DG  D N1    1 
ATOM   4823 C  C2    . DG  D 4 6   ? 48.943  48.420  36.002 1.00 75.55  ? 5   DG  D C2    1 
ATOM   4824 N  N2    . DG  D 4 6   ? 47.947  47.518  36.014 1.00 67.98  ? 5   DG  D N2    1 
ATOM   4825 N  N3    . DG  D 4 6   ? 49.371  48.907  34.844 1.00 70.92  ? 5   DG  D N3    1 
ATOM   4826 C  C4    . DG  D 4 6   ? 50.376  49.801  35.013 1.00 71.49  ? 5   DG  D C4    1 
ATOM   4827 P  P     . DA  D 4 7   ? 48.892  52.002  29.068 1.00 74.78  ? 6   DA  D P     1 
ATOM   4828 O  OP1   . DA  D 4 7   ? 47.718  51.269  28.543 1.00 72.25  ? 6   DA  D OP1   1 
ATOM   4829 O  OP2   . DA  D 4 7   ? 49.729  52.795  28.143 1.00 71.24  ? 6   DA  D OP2   1 
ATOM   4830 O  "O5'" . DA  D 4 7   ? 48.418  52.946  30.271 1.00 75.89  ? 6   DA  D "O5'" 1 
ATOM   4831 C  "C5'" . DA  D 4 7   ? 47.035  53.271  30.426 1.00 82.17  ? 6   DA  D "C5'" 1 
ATOM   4832 C  "C4'" . DA  D 4 7   ? 46.283  52.169  31.164 1.00 69.02  ? 6   DA  D "C4'" 1 
ATOM   4833 O  "O4'" . DA  D 4 7   ? 47.190  51.471  32.043 1.00 69.15  ? 6   DA  D "O4'" 1 
ATOM   4834 C  "C3'" . DA  D 4 7   ? 45.151  52.662  32.046 1.00 74.03  ? 6   DA  D "C3'" 1 
ATOM   4835 O  "O3'" . DA  D 4 7   ? 43.936  52.647  31.310 1.00 76.28  ? 6   DA  D "O3'" 1 
ATOM   4836 C  "C2'" . DA  D 4 7   ? 45.122  51.641  33.180 1.00 69.85  ? 6   DA  D "C2'" 1 
ATOM   4837 C  "C1'" . DA  D 4 7   ? 46.575  51.214  33.290 1.00 63.89  ? 6   DA  D "C1'" 1 
ATOM   4838 N  N9    . DA  D 4 7   ? 47.331  51.902  34.336 1.00 69.89  ? 6   DA  D N9    1 
ATOM   4839 C  C8    . DA  D 4 7   ? 48.245  52.907  34.168 1.00 75.90  ? 6   DA  D C8    1 
ATOM   4840 N  N7    . DA  D 4 7   ? 48.795  53.318  35.289 1.00 76.79  ? 6   DA  D N7    1 
ATOM   4841 C  C5    . DA  D 4 7   ? 48.206  52.523  36.260 1.00 75.64  ? 6   DA  D C5    1 
ATOM   4842 C  C6    . DA  D 4 7   ? 48.359  52.463  37.663 1.00 76.92  ? 6   DA  D C6    1 
ATOM   4843 N  N6    . DA  D 4 7   ? 49.186  53.255  38.349 1.00 81.13  ? 6   DA  D N6    1 
ATOM   4844 N  N1    . DA  D 4 7   ? 47.625  51.554  38.332 1.00 77.28  ? 6   DA  D N1    1 
ATOM   4845 C  C2    . DA  D 4 7   ? 46.795  50.762  37.641 1.00 77.43  ? 6   DA  D C2    1 
ATOM   4846 N  N3    . DA  D 4 7   ? 46.564  50.727  36.328 1.00 71.95  ? 6   DA  D N3    1 
ATOM   4847 C  C4    . DA  D 4 7   ? 47.306  51.641  35.689 1.00 71.27  ? 6   DA  D C4    1 
ATOM   4848 P  P     . DC  D 4 8   ? 42.765  53.688  31.654 1.00 67.65  ? 7   DC  D P     1 
ATOM   4849 O  OP1   . DC  D 4 8   ? 41.504  53.059  31.196 1.00 69.06  ? 7   DC  D OP1   1 
ATOM   4850 O  OP2   . DC  D 4 8   ? 43.197  54.996  31.109 1.00 71.71  ? 7   DC  D OP2   1 
ATOM   4851 O  "O5'" . DC  D 4 8   ? 42.733  53.747  33.261 1.00 53.16  ? 7   DC  D "O5'" 1 
ATOM   4852 C  "C5'" . DC  D 4 8   ? 41.862  52.887  33.979 1.00 57.47  ? 7   DC  D "C5'" 1 
ATOM   4853 C  "C4'" . DC  D 4 8   ? 42.230  52.823  35.453 1.00 62.12  ? 7   DC  D "C4'" 1 
ATOM   4854 O  "O4'" . DC  D 4 8   ? 43.647  52.918  35.620 1.00 70.10  ? 7   DC  D "O4'" 1 
ATOM   4855 C  "C3'" . DC  D 4 8   ? 41.718  53.958  36.303 1.00 75.27  ? 7   DC  D "C3'" 1 
ATOM   4856 O  "O3'" . DC  D 4 8   ? 40.395  53.726  36.633 1.00 84.92  ? 7   DC  D "O3'" 1 
ATOM   4857 C  "C2'" . DC  D 4 8   ? 42.609  53.848  37.539 1.00 69.75  ? 7   DC  D "C2'" 1 
ATOM   4858 C  "C1'" . DC  D 4 8   ? 43.912  53.286  36.963 1.00 69.16  ? 7   DC  D "C1'" 1 
ATOM   4859 N  N1    . DC  D 4 8   ? 45.036  54.257  36.979 1.00 71.73  ? 7   DC  D N1    1 
ATOM   4860 C  C2    . DC  D 4 8   ? 45.568  54.689  38.202 1.00 74.49  ? 7   DC  D C2    1 
ATOM   4861 O  O2    . DC  D 4 8   ? 45.091  54.255  39.257 1.00 78.03  ? 7   DC  D O2    1 
ATOM   4862 N  N3    . DC  D 4 8   ? 46.592  55.575  38.194 1.00 76.20  ? 7   DC  D N3    1 
ATOM   4863 C  C4    . DC  D 4 8   ? 47.080  56.021  37.034 1.00 77.41  ? 7   DC  D C4    1 
ATOM   4864 N  N4    . DC  D 4 8   ? 48.092  56.895  37.075 1.00 83.51  ? 7   DC  D N4    1 
ATOM   4865 C  C5    . DC  D 4 8   ? 46.553  55.593  35.779 1.00 73.63  ? 7   DC  D C5    1 
ATOM   4866 C  C6    . DC  D 4 8   ? 45.543  54.718  35.799 1.00 72.45  ? 7   DC  D C6    1 
HETATM 4867 CA CA    . CA  E 5 .   ? 38.064  52.044  36.733 1.00 68.88  ? 701 CA  A CA    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   76  ?   ?   ?   A . n 
A 1 2   SER 2   77  ?   ?   ?   A . n 
A 1 3   HIS 3   78  ?   ?   ?   A . n 
A 1 4   MET 4   79  ?   ?   ?   A . n 
A 1 5   SER 5   80  ?   ?   ?   A . n 
A 1 6   ARG 6   81  81  ARG ARG A . n 
A 1 7   GLU 7   82  82  GLU GLU A . n 
A 1 8   LEU 8   83  83  LEU LEU A . n 
A 1 9   LYS 9   84  84  LYS LYS A . n 
A 1 10  THR 10  85  85  THR THR A . n 
A 1 11  VAL 11  86  86  VAL VAL A . n 
A 1 12  SER 12  87  87  SER SER A . n 
A 1 13  ALA 13  88  88  ALA ALA A . n 
A 1 14  ASP 14  89  89  ASP ASP A . n 
A 1 15  CYS 15  90  90  CYS CYS A . n 
A 1 16  LYS 16  91  91  LYS LYS A . n 
A 1 17  LYS 17  92  92  LYS LYS A . n 
A 1 18  GLU 18  93  93  GLU GLU A . n 
A 1 19  ALA 19  94  94  ALA ALA A . n 
A 1 20  ILE 20  95  95  ILE ILE A . n 
A 1 21  GLU 21  96  96  GLU GLU A . n 
A 1 22  LYS 22  97  97  LYS LYS A . n 
A 1 23  CYS 23  98  98  CYS CYS A . n 
A 1 24  ALA 24  99  99  ALA ALA A . n 
A 1 25  GLN 25  100 100 GLN GLN A . n 
A 1 26  TRP 26  101 101 TRP TRP A . n 
A 1 27  VAL 27  102 102 VAL VAL A . n 
A 1 28  VAL 28  103 103 VAL VAL A . n 
A 1 29  ARG 29  104 104 ARG ARG A . n 
A 1 30  ASP 30  105 105 ASP ASP A . n 
A 1 31  CYS 31  106 106 CYS CYS A . n 
A 1 32  ARG 32  107 107 ARG ARG A . n 
A 1 33  PRO 33  108 108 PRO PRO A . n 
A 1 34  PHE 34  109 109 PHE PHE A . n 
A 1 35  SER 35  110 110 SER SER A . n 
A 1 36  ALA 36  111 111 ALA ALA A . n 
A 1 37  VAL 37  112 112 VAL VAL A . n 
A 1 38  SER 38  113 113 SER SER A . n 
A 1 39  GLY 39  114 114 GLY GLY A . n 
A 1 40  SER 40  115 115 SER SER A . n 
A 1 41  GLY 41  116 116 GLY GLY A . n 
A 1 42  PHE 42  117 117 PHE PHE A . n 
A 1 43  ILE 43  118 118 ILE ILE A . n 
A 1 44  ASP 44  119 119 ASP ASP A . n 
A 1 45  MET 45  120 120 MET MET A . n 
A 1 46  ILE 46  121 121 ILE ILE A . n 
A 1 47  LYS 47  122 122 LYS LYS A . n 
A 1 48  PHE 48  123 123 PHE PHE A . n 
A 1 49  PHE 49  124 124 PHE PHE A . n 
A 1 50  ILE 50  125 125 ILE ILE A . n 
A 1 51  LYS 51  126 126 LYS LYS A . n 
A 1 52  VAL 52  127 127 VAL VAL A . n 
A 1 53  GLY 53  128 128 GLY GLY A . n 
A 1 54  ALA 54  129 129 ALA ALA A . n 
A 1 55  GLU 55  130 130 GLU GLU A . n 
A 1 56  TYR 56  131 131 TYR TYR A . n 
A 1 57  GLY 57  132 132 GLY GLY A . n 
A 1 58  GLU 58  133 133 GLU GLU A . n 
A 1 59  HIS 59  134 134 HIS HIS A . n 
A 1 60  VAL 60  135 135 VAL VAL A . n 
A 1 61  ASN 61  136 136 ASN ASN A . n 
A 1 62  VAL 62  137 137 VAL VAL A . n 
A 1 63  GLU 63  138 138 GLU GLU A . n 
A 1 64  GLU 64  139 139 GLU GLU A . n 
A 1 65  LEU 65  140 140 LEU LEU A . n 
A 1 66  LEU 66  141 141 LEU LEU A . n 
A 1 67  PRO 67  142 142 PRO PRO A . n 
A 1 68  SER 68  143 143 SER SER A . n 
A 1 69  PRO 69  144 144 PRO PRO A . n 
A 1 70  ILE 70  145 145 ILE ILE A . n 
A 1 71  THR 71  146 146 THR THR A . n 
A 1 72  LEU 72  147 147 LEU LEU A . n 
A 1 73  SER 73  148 148 SER SER A . n 
A 1 74  ARG 74  149 149 ARG ARG A . n 
A 1 75  LYS 75  150 150 LYS LYS A . n 
A 1 76  VAL 76  151 151 VAL VAL A . n 
A 1 77  THR 77  152 152 THR THR A . n 
A 1 78  SER 78  153 153 SER SER A . n 
A 1 79  ASP 79  154 154 ASP ASP A . n 
A 1 80  ALA 80  155 155 ALA ALA A . n 
A 1 81  LYS 81  156 156 LYS LYS A . n 
A 1 82  GLU 82  157 157 GLU GLU A . n 
A 1 83  LYS 83  158 158 LYS LYS A . n 
A 1 84  LYS 84  159 159 LYS LYS A . n 
A 1 85  ALA 85  160 160 ALA ALA A . n 
A 1 86  LEU 86  161 161 LEU LEU A . n 
A 1 87  ILE 87  162 162 ILE ILE A . n 
A 1 88  SER 88  163 163 SER GLY A . n 
A 1 89  ARG 89  164 164 ARG ARG A . n 
A 1 90  GLU 90  165 165 GLU GLU A . n 
A 1 91  ILE 91  166 166 ILE ILE A . n 
A 1 92  LYS 92  167 167 LYS LYS A . n 
A 1 93  SER 93  168 168 SER SER A . n 
A 1 94  ALA 94  169 169 ALA ALA A . n 
A 1 95  VAL 95  170 170 VAL VAL A . n 
A 1 96  GLU 96  171 171 GLU GLU A . n 
A 1 97  LYS 97  172 172 LYS LYS A . n 
A 1 98  ASP 98  173 173 ASP ASP A . n 
A 1 99  GLY 99  174 174 GLY GLY A . n 
A 1 100 ALA 100 175 175 ALA ALA A . n 
A 1 101 SER 101 176 176 SER SER A . n 
A 1 102 ALA 102 177 177 ALA ALA A . n 
A 1 103 THR 103 178 178 THR THR A . n 
A 1 104 ILE 104 179 179 ILE ILE A . n 
A 1 105 ASP 105 180 180 ASP ASP A . n 
A 1 106 LEU 106 181 181 LEU LEU A . n 
A 1 107 TRP 107 182 182 TRP TRP A . n 
A 1 108 THR 108 183 183 THR THR A . n 
A 1 109 ASP 109 184 184 ASP ASP A . n 
A 1 110 ASN 110 185 185 ASN ASN A . n 
A 1 111 TYR 111 186 186 TYR TYR A . n 
A 1 112 ILE 112 187 187 ILE ILE A . n 
A 1 113 LYS 113 188 188 LYS LYS A . n 
A 1 114 ARG 114 189 189 ARG ARG A . n 
A 1 115 ASN 115 190 190 ASN ASN A . n 
A 1 116 PHE 116 191 191 PHE PHE A . n 
A 1 117 LEU 117 192 192 LEU LEU A . n 
A 1 118 GLY 118 193 193 GLY GLY A . n 
A 1 119 VAL 119 194 194 VAL VAL A . n 
A 1 120 THR 120 195 195 THR THR A . n 
A 1 121 LEU 121 196 196 LEU LEU A . n 
A 1 122 HIS 122 197 197 HIS HIS A . n 
A 1 123 TYR 123 198 198 TYR TYR A . n 
A 1 124 HIS 124 199 199 HIS HIS A . n 
A 1 125 GLU 125 200 200 GLU GLU A . n 
A 1 126 ASN 126 201 201 ASN ASN A . n 
A 1 127 ASN 127 202 202 ASN ASN A . n 
A 1 128 GLU 128 203 203 GLU GLU A . n 
A 1 129 LEU 129 204 204 LEU LEU A . n 
A 1 130 ARG 130 205 205 ARG ARG A . n 
A 1 131 ASP 131 206 206 ASP ASP A . n 
A 1 132 LEU 132 207 207 LEU LEU A . n 
A 1 133 ILE 133 208 208 ILE ILE A . n 
A 1 134 LEU 134 209 209 LEU LEU A . n 
A 1 135 GLY 135 210 210 GLY GLY A . n 
A 1 136 LEU 136 211 211 LEU LEU A . n 
A 1 137 LYS 137 212 212 LYS LYS A . n 
A 1 138 SER 138 213 213 SER SER A . n 
A 1 139 LEU 139 214 214 LEU LEU A . n 
A 1 140 ASP 140 215 215 ASP ASP A . n 
A 1 141 PHE 141 216 216 PHE PHE A . n 
A 1 142 GLU 142 217 217 GLU GLU A . n 
A 1 143 ARG 143 218 218 ARG ARG A . n 
A 1 144 SER 144 219 219 SER SER A . n 
A 1 145 THR 145 220 220 THR THR A . n 
A 1 146 ALA 146 221 221 ALA ALA A . n 
A 1 147 GLU 147 222 222 GLU GLU A . n 
A 1 148 ASN 148 223 223 ASN ASN A . n 
A 1 149 ILE 149 224 224 ILE ILE A . n 
A 1 150 TYR 150 225 225 TYR TYR A . n 
A 1 151 LYS 151 226 226 LYS LYS A . n 
A 1 152 LYS 152 227 227 LYS LYS A . n 
A 1 153 LEU 153 228 228 LEU LEU A . n 
A 1 154 LYS 154 229 229 LYS LYS A . n 
A 1 155 ALA 155 230 230 ALA ALA A . n 
A 1 156 ILE 156 231 231 ILE ILE A . n 
A 1 157 PHE 157 232 232 PHE PHE A . n 
A 1 158 SER 158 233 233 SER SER A . n 
A 1 159 GLN 159 234 234 GLN GLN A . n 
A 1 160 PHE 160 235 235 PHE PHE A . n 
A 1 161 ASN 161 236 236 ASN ASN A . n 
A 1 162 VAL 162 237 237 VAL VAL A . n 
A 1 163 GLU 163 238 238 GLU GLU A . n 
A 1 164 ASP 164 239 239 ASP ASP A . n 
A 1 165 LEU 165 240 240 LEU LEU A . n 
A 1 166 SER 166 241 241 SER SER A . n 
A 1 167 SER 167 242 242 SER SER A . n 
A 1 168 ILE 168 243 243 ILE ILE A . n 
A 1 169 LYS 169 244 244 LYS LYS A . n 
A 1 170 PHE 170 245 245 PHE PHE A . n 
A 1 171 VAL 171 246 246 VAL VAL A . n 
A 1 172 THR 172 247 247 THR THR A . n 
A 1 173 ASP 173 248 248 ASP ASP A . n 
A 1 174 ARG 174 249 249 ARG ARG A . n 
A 1 175 GLY 175 250 250 GLY GLY A . n 
A 1 176 ALA 176 251 251 ALA ALA A . n 
A 1 177 ASN 177 252 252 ASN ASN A . n 
A 1 178 VAL 178 253 253 VAL VAL A . n 
A 1 179 VAL 179 254 254 VAL VAL A . n 
A 1 180 LYS 180 255 255 LYS LYS A . n 
A 1 181 SER 181 256 256 SER SER A . n 
A 1 182 LEU 182 257 257 LEU LEU A . n 
A 1 183 ALA 183 258 258 ALA ALA A . n 
A 1 184 ASN 184 259 259 ASN ASN A . n 
A 1 185 ASN 185 260 260 ASN ASN A . n 
A 1 186 ILE 186 261 261 ILE ILE A . n 
A 1 187 ARG 187 262 262 ARG ARG A . n 
A 1 188 ILE 188 263 263 ILE ILE A . n 
A 1 189 ASN 189 264 264 ASN ASN A . n 
A 1 190 CYS 190 265 265 CYS CYS A . n 
A 1 191 SER 191 266 266 SER SER A . n 
A 1 192 SER 192 267 267 SER SER A . n 
A 1 193 HIS 193 268 268 HIS HIS A . n 
A 1 194 LEU 194 269 269 LEU LEU A . n 
A 1 195 LEU 195 270 270 LEU LEU A . n 
A 1 196 SER 196 271 271 SER SER A . n 
A 1 197 ASN 197 272 272 ASN ASN A . n 
A 1 198 VAL 198 273 273 VAL VAL A . n 
A 1 199 LEU 199 274 274 LEU LEU A . n 
A 1 200 GLU 200 275 275 GLU GLU A . n 
A 1 201 ASN 201 276 276 ASN ASN A . n 
A 1 202 SER 202 277 277 SER SER A . n 
A 1 203 PHE 203 278 278 PHE PHE A . n 
A 1 204 GLU 204 279 279 GLU GLU A . n 
A 1 205 GLU 205 280 280 GLU GLU A . n 
A 1 206 THR 206 281 281 THR THR A . n 
A 1 207 PRO 207 282 282 PRO PRO A . n 
A 1 208 GLU 208 283 283 GLU GLU A . n 
A 1 209 LEU 209 284 284 LEU LEU A . n 
A 1 210 ASN 210 285 285 ASN ASN A . n 
A 1 211 MET 211 286 286 MET MET A . n 
A 1 212 PRO 212 287 287 PRO PRO A . n 
A 1 213 ILE 213 288 288 ILE ILE A . n 
A 1 214 LEU 214 289 289 LEU LEU A . n 
A 1 215 ALA 215 290 290 ALA ALA A . n 
A 1 216 CYS 216 291 291 CYS CYS A . n 
A 1 217 LYS 217 292 292 LYS LYS A . n 
A 1 218 ASN 218 293 293 ASN ASN A . n 
A 1 219 ILE 219 294 294 ILE ILE A . n 
A 1 220 VAL 220 295 295 VAL VAL A . n 
A 1 221 LYS 221 296 296 LYS LYS A . n 
A 1 222 TYR 222 297 297 TYR TYR A . n 
A 1 223 PHE 223 298 298 PHE PHE A . n 
A 1 224 LYS 224 299 299 LYS LYS A . n 
A 1 225 LYS 225 300 300 LYS LYS A . n 
A 1 226 ALA 226 301 301 ALA ALA A . n 
A 1 227 ASN 227 302 302 ASN ASN A . n 
A 1 228 LEU 228 303 303 LEU LEU A . n 
A 1 229 GLN 229 304 304 GLN GLN A . n 
A 1 230 HIS 230 305 305 HIS HIS A . n 
A 1 231 ARG 231 306 306 ARG ARG A . n 
A 1 232 LEU 232 307 307 LEU LEU A . n 
A 1 233 ARG 233 308 308 ARG ARG A . n 
A 1 234 SER 234 309 309 SER SER A . n 
A 1 235 SER 235 310 310 SER SER A . n 
A 1 236 LEU 236 311 311 LEU LEU A . n 
A 1 237 LYS 237 312 312 LYS LYS A . n 
A 1 238 SER 238 313 313 SER SER A . n 
A 1 239 GLU 239 314 314 GLU GLU A . n 
A 1 240 CYS 240 315 315 CYS CYS A . n 
A 1 241 PRO 241 316 316 PRO PRO A . n 
A 1 242 THR 242 317 317 THR THR A . n 
A 1 243 ARG 243 318 318 ARG ARG A . n 
A 1 244 TRP 244 319 319 TRP TRP A . n 
A 1 245 ASN 245 320 320 ASN ASN A . n 
A 1 246 SER 246 321 321 SER SER A . n 
A 1 247 THR 247 322 322 THR THR A . n 
A 1 248 TYR 248 323 323 TYR TYR A . n 
A 1 249 THR 249 324 324 THR THR A . n 
A 1 250 MET 250 325 325 MET MET A . n 
A 1 251 LEU 251 326 326 LEU LEU A . n 
A 1 252 ARG 252 327 327 ARG ARG A . n 
A 1 253 SER 253 328 328 SER SER A . n 
A 1 254 ILE 254 329 329 ILE ILE A . n 
A 1 255 LEU 255 330 330 LEU LEU A . n 
A 1 256 ASP 256 331 331 ASP ASP A . n 
A 1 257 ASN 257 332 332 ASN ASN A . n 
A 1 258 TRP 258 333 333 TRP TRP A . n 
A 1 259 GLU 259 334 334 GLU GLU A . n 
A 1 260 SER 260 335 335 SER SER A . n 
A 1 261 VAL 261 336 336 VAL VAL A . n 
A 1 262 ILE 262 337 337 ILE ILE A . n 
A 1 263 GLN 263 338 338 GLN GLN A . n 
A 1 264 ILE 264 339 339 ILE ILE A . n 
A 1 265 LEU 265 340 340 LEU LEU A . n 
A 1 266 SER 266 341 341 SER SER A . n 
A 1 267 GLU 267 342 342 GLU GLU A . n 
A 1 268 ALA 268 343 343 ALA ALA A . n 
A 1 269 GLY 269 344 344 GLY GLY A . n 
A 1 270 GLU 270 345 345 GLU GLU A . n 
A 1 271 THR 271 346 346 THR THR A . n 
A 1 272 GLN 272 347 347 GLN GLN A . n 
A 1 273 ARG 273 348 348 ARG ARG A . n 
A 1 274 ILE 274 349 349 ILE ILE A . n 
A 1 275 VAL 275 350 350 VAL VAL A . n 
A 1 276 HIS 276 351 351 HIS HIS A . n 
A 1 277 ILE 277 352 352 ILE ILE A . n 
A 1 278 ASN 278 353 353 ASN ASN A . n 
A 1 279 LYS 279 354 354 LYS LYS A . n 
A 1 280 SER 280 355 355 SER SER A . n 
A 1 281 ILE 281 356 356 ILE ILE A . n 
A 1 282 ILE 282 357 357 ILE ILE A . n 
A 1 283 GLN 283 358 358 GLN GLN A . n 
A 1 284 THR 284 359 359 THR THR A . n 
A 1 285 MET 285 360 360 MET MET A . n 
A 1 286 VAL 286 361 361 VAL VAL A . n 
A 1 287 ASN 287 362 362 ASN ASN A . n 
A 1 288 ILE 288 363 363 ILE ILE A . n 
A 1 289 LEU 289 364 364 LEU LEU A . n 
A 1 290 ASP 290 365 365 ASP ASP A . n 
A 1 291 GLY 291 366 366 GLY GLY A . n 
A 1 292 PHE 292 367 367 PHE PHE A . n 
A 1 293 GLU 293 368 368 GLU GLU A . n 
A 1 294 ARG 294 369 369 ARG ARG A . n 
A 1 295 ILE 295 370 370 ILE ILE A . n 
A 1 296 PHE 296 371 371 PHE PHE A . n 
A 1 297 LYS 297 372 372 LYS LYS A . n 
A 1 298 GLU 298 373 373 GLU GLU A . n 
A 1 299 LEU 299 374 374 LEU LEU A . n 
A 1 300 GLN 300 375 375 GLN GLN A . n 
A 1 301 THR 301 376 376 THR THR A . n 
A 1 302 CYS 302 377 377 CYS CYS A . n 
A 1 303 SER 303 378 378 SER SER A . n 
A 1 304 SER 304 379 379 SER SER A . n 
A 1 305 PRO 305 380 380 PRO PRO A . n 
A 1 306 SER 306 381 381 SER SER A . n 
A 1 307 LEU 307 382 382 LEU LEU A . n 
A 1 308 CYS 308 383 383 CYS CYS A . n 
A 1 309 PHE 309 384 384 PHE PHE A . n 
A 1 310 VAL 310 385 385 VAL VAL A . n 
A 1 311 VAL 311 386 386 VAL VAL A . n 
A 1 312 PRO 312 387 387 PRO PRO A . n 
A 1 313 SER 313 388 388 SER SER A . n 
A 1 314 ILE 314 389 389 ILE ILE A . n 
A 1 315 LEU 315 390 390 LEU LEU A . n 
A 1 316 LYS 316 391 391 LYS LYS A . n 
A 1 317 VAL 317 392 392 VAL VAL A . n 
A 1 318 LYS 318 393 393 LYS LYS A . n 
A 1 319 GLU 319 394 394 GLU GLU A . n 
A 1 320 ILE 320 395 395 ILE ILE A . n 
A 1 321 CYS 321 396 396 CYS CYS A . n 
A 1 322 SER 322 397 397 SER SER A . n 
A 1 323 PRO 323 398 398 PRO PRO A . n 
A 1 324 ASP 324 399 399 ASP ASP A . n 
A 1 325 VAL 325 400 400 VAL VAL A . n 
A 1 326 GLY 326 401 401 GLY GLY A . n 
A 1 327 ASP 327 402 402 ASP ASP A . n 
A 1 328 VAL 328 403 403 VAL VAL A . n 
A 1 329 ALA 329 404 404 ALA ALA A . n 
A 1 330 ASP 330 405 405 ASP ASP A . n 
A 1 331 ILE 331 406 406 ILE ILE A . n 
A 1 332 ALA 332 407 407 ALA ALA A . n 
A 1 333 LYS 333 408 408 LYS LYS A . n 
A 1 334 LEU 334 409 409 LEU LEU A . n 
A 1 335 LYS 335 410 410 LYS LYS A . n 
A 1 336 VAL 336 411 411 VAL VAL A . n 
A 1 337 ASN 337 412 412 ASN ASN A . n 
A 1 338 ILE 338 413 413 ILE ILE A . n 
A 1 339 ILE 339 414 414 ILE ILE A . n 
A 1 340 LYS 340 415 415 LYS LYS A . n 
A 1 341 ASN 341 416 416 ASN ASN A . n 
A 1 342 VAL 342 417 417 VAL VAL A . n 
A 1 343 ARG 343 418 418 ARG ARG A . n 
A 1 344 ILE 344 419 419 ILE ILE A . n 
A 1 345 ILE 345 420 420 ILE ILE A . n 
A 1 346 TRP 346 421 421 TRP TRP A . n 
A 1 347 GLU 347 422 422 GLU GLU A . n 
A 1 348 GLU 348 423 423 GLU GLU A . n 
A 1 349 ASN 349 424 424 ASN ASN A . n 
A 1 350 LEU 350 425 425 LEU LEU A . n 
A 1 351 SER 351 426 426 SER SER A . n 
A 1 352 ILE 352 427 427 ILE ILE A . n 
A 1 353 TRP 353 428 428 TRP TRP A . n 
A 1 354 HIS 354 429 429 HIS HIS A . n 
A 1 355 TYR 355 430 430 TYR TYR A . n 
A 1 356 THR 356 431 431 THR THR A . n 
A 1 357 ALA 357 432 432 ALA ALA A . n 
A 1 358 PHE 358 433 433 PHE PHE A . n 
A 1 359 PHE 359 434 434 PHE PHE A . n 
A 1 360 PHE 360 435 435 PHE PHE A . n 
A 1 361 TYR 361 436 436 TYR TYR A . n 
A 1 362 PRO 362 437 437 PRO PRO A . n 
A 1 363 PRO 363 438 438 PRO PRO A . n 
A 1 364 ALA 364 439 439 ALA ALA A . n 
A 1 365 LEU 365 440 440 LEU LEU A . n 
A 1 366 HIS 366 441 441 HIS HIS A . n 
A 1 367 MET 367 442 442 MET MET A . n 
A 1 368 GLN 368 443 443 GLN GLN A . n 
A 1 369 GLN 369 444 444 GLN GLN A . n 
A 1 370 GLU 370 445 445 GLU GLU A . n 
A 1 371 LYS 371 446 446 LYS LYS A . n 
A 1 372 VAL 372 447 447 VAL VAL A . n 
A 1 373 ALA 373 448 448 ALA ALA A . n 
A 1 374 GLN 374 449 449 GLN GLN A . n 
A 1 375 ILE 375 450 450 ILE ILE A . n 
A 1 376 LYS 376 451 451 LYS LYS A . n 
A 1 377 GLU 377 452 452 GLU GLU A . n 
A 1 378 PHE 378 453 453 PHE PHE A . n 
A 1 379 CYS 379 454 454 CYS CYS A . n 
A 1 380 LEU 380 455 455 LEU LEU A . n 
A 1 381 SER 381 456 456 SER SER A . n 
A 1 382 LYS 382 457 457 LYS LYS A . n 
A 1 383 MET 383 458 458 MET MET A . n 
A 1 384 GLU 384 459 459 GLU GLU A . n 
A 1 385 ASP 385 460 460 ASP ASP A . n 
A 1 386 LEU 386 461 461 LEU LEU A . n 
A 1 387 GLU 387 462 462 GLU GLU A . n 
A 1 388 LEU 388 463 463 LEU LEU A . n 
A 1 389 ILE 389 464 464 ILE ILE A . n 
A 1 390 ASN 390 465 465 ASN ASN A . n 
A 1 391 ARG 391 466 466 ARG ARG A . n 
A 1 392 MET 392 467 467 MET MET A . n 
A 1 393 SER 393 468 468 SER SER A . n 
A 1 394 SER 394 469 469 SER SER A . n 
A 1 395 PHE 395 470 470 PHE PHE A . n 
A 1 396 ASN 396 491 ?   ?   ?   A . n 
A 1 397 GLU 397 492 ?   ?   ?   A . n 
A 1 398 LEU 398 493 ?   ?   ?   A . n 
A 1 399 SER 399 494 ?   ?   ?   A . n 
A 1 400 ALA 400 495 ?   ?   ?   A . n 
A 1 401 THR 401 496 ?   ?   ?   A . n 
A 1 402 GLN 402 497 ?   ?   ?   A . n 
A 1 403 LEU 403 498 ?   ?   ?   A . n 
A 1 404 ASN 404 499 ?   ?   ?   A . n 
A 1 405 GLN 405 500 ?   ?   ?   A . n 
A 1 406 SER 406 501 ?   ?   ?   A . n 
A 1 407 ASP 407 502 ?   ?   ?   A . n 
A 1 408 SER 408 503 ?   ?   ?   A . n 
A 1 409 ASN 409 504 ?   ?   ?   A . n 
A 1 410 SER 410 505 ?   ?   ?   A . n 
A 1 411 HIS 411 506 ?   ?   ?   A . n 
A 1 412 ASN 412 507 ?   ?   ?   A . n 
A 1 413 SER 413 508 ?   ?   ?   A . n 
A 1 414 ILE 414 509 ?   ?   ?   A . n 
A 1 415 ASP 415 510 ?   ?   ?   A . n 
A 1 416 LEU 416 511 ?   ?   ?   A . n 
A 1 417 THR 417 512 ?   ?   ?   A . n 
A 1 418 SER 418 513 ?   ?   ?   A . n 
A 1 419 HIS 419 514 ?   ?   ?   A . n 
A 1 420 SER 420 515 ?   ?   ?   A . n 
A 1 421 LYS 421 516 ?   ?   ?   A . n 
A 1 422 PRO 422 517 517 PRO PRO A . n 
A 1 423 VAL 423 518 518 VAL VAL A . n 
A 1 424 SER 424 519 519 SER SER A . n 
A 1 425 PRO 425 520 520 PRO PRO A . n 
A 1 426 SER 426 521 521 SER SER A . n 
A 1 427 ASP 427 522 522 ASP ASP A . n 
A 1 428 GLU 428 523 523 GLU GLU A . n 
A 1 429 PHE 429 524 524 PHE PHE A . n 
A 1 430 GLU 430 525 525 GLU GLU A . n 
A 1 431 PHE 431 526 526 PHE PHE A . n 
A 1 432 TYR 432 527 527 TYR TYR A . n 
A 1 433 ARG 433 528 528 ARG ARG A . n 
A 1 434 LYS 434 529 529 LYS LYS A . n 
A 1 435 GLU 435 530 530 GLU GLU A . n 
A 1 436 ILE 436 531 531 ILE ILE A . n 
A 1 437 VAL 437 532 532 VAL VAL A . n 
A 1 438 ILE 438 533 533 ILE ILE A . n 
A 1 439 LEU 439 534 534 LEU LEU A . n 
A 1 440 SER 440 535 535 SER SER A . n 
A 1 441 GLU 441 536 536 GLU GLU A . n 
A 1 442 ASP 442 537 537 ASP ASP A . n 
A 1 443 PHE 443 538 538 PHE PHE A . n 
A 1 444 LYS 444 539 539 LYS LYS A . n 
A 1 445 VAL 445 540 540 VAL VAL A . n 
A 1 446 MET 446 541 541 MET MET A . n 
A 1 447 GLU 447 542 542 GLU GLU A . n 
A 1 448 TRP 448 543 543 TRP TRP A . n 
A 1 449 TRP 449 544 544 TRP TRP A . n 
A 1 450 ASN 450 545 545 ASN ASN A . n 
A 1 451 LEU 451 546 546 LEU LEU A . n 
A 1 452 ASN 452 547 547 ASN ASN A . n 
A 1 453 SER 453 548 548 SER SER A . n 
A 1 454 LYS 454 549 549 LYS LYS A . n 
A 1 455 LYS 455 550 550 LYS LYS A . n 
A 1 456 TYR 456 551 551 TYR TYR A . n 
A 1 457 PRO 457 552 552 PRO PRO A . n 
A 1 458 LYS 458 553 553 LYS LYS A . n 
A 1 459 LEU 459 554 554 LEU LEU A . n 
A 1 460 SER 460 555 555 SER SER A . n 
A 1 461 LYS 461 556 556 LYS LYS A . n 
A 1 462 LEU 462 557 557 LEU LEU A . n 
A 1 463 ALA 463 558 558 ALA ALA A . n 
A 1 464 LEU 464 559 559 LEU LEU A . n 
A 1 465 SER 465 560 560 SER SER A . n 
A 1 466 LEU 466 561 561 LEU LEU A . n 
A 1 467 LEU 467 562 562 LEU LEU A . n 
A 1 468 SER 468 563 563 SER SER A . n 
A 1 469 ILE 469 564 564 ILE ILE A . n 
A 1 470 PRO 470 565 565 PRO PRO A . n 
A 1 471 ALA 471 566 566 ALA ALA A . n 
A 1 472 SER 472 567 567 SER SER A . n 
A 1 473 SER 473 568 568 SER SER A . n 
A 1 474 ALA 474 569 569 ALA ALA A . n 
A 1 475 ALA 475 570 570 ALA ALA A . n 
A 1 476 SER 476 571 571 SER SER A . n 
A 1 477 GLU 477 572 572 GLU GLU A . n 
A 1 478 ARG 478 573 573 ARG ARG A . n 
A 1 479 THR 479 574 574 THR THR A . n 
A 1 480 PHE 480 575 575 PHE PHE A . n 
A 1 481 SER 481 576 576 SER SER A . n 
A 1 482 LEU 482 577 577 LEU LEU A . n 
A 1 483 ALA 483 578 578 ALA ALA A . n 
A 1 484 GLY 484 579 579 GLY GLY A . n 
A 1 485 ASN 485 580 580 ASN ASN A . n 
A 1 486 ILE 486 581 581 ILE ILE A . n 
A 1 487 ILE 487 582 582 ILE ILE A . n 
A 1 488 THR 488 583 583 THR THR A . n 
A 1 489 GLU 489 584 584 GLU GLU A . n 
A 1 490 LYS 490 585 585 LYS LYS A . n 
A 1 491 ARG 491 586 586 ARG ARG A . n 
A 1 492 ASN 492 587 587 ASN ASN A . n 
A 1 493 ARG 493 588 588 ARG ARG A . n 
A 1 494 ILE 494 589 589 ILE ILE A . n 
A 1 495 GLY 495 590 590 GLY GLY A . n 
A 1 496 GLN 496 591 591 GLN GLN A . n 
A 1 497 GLN 497 592 592 GLN GLN A . n 
A 1 498 THR 498 593 593 THR THR A . n 
A 1 499 VAL 499 594 594 VAL VAL A . n 
A 1 500 ASP 500 595 595 ASP ASP A . n 
A 1 501 SER 501 596 596 SER SER A . n 
A 1 502 LEU 502 597 597 LEU LEU A . n 
A 1 503 LEU 503 598 598 LEU LEU A . n 
A 1 504 PHE 504 599 599 PHE PHE A . n 
A 1 505 LEU 505 600 600 LEU LEU A . n 
A 1 506 ASN 506 601 601 ASN ASN A . n 
A 1 507 SER 507 602 602 SER SER A . n 
A 1 508 PHE 508 603 603 PHE PHE A . n 
A 1 509 TYR 509 604 604 TYR TYR A . n 
A 1 510 LYS 510 605 605 LYS LYS A . n 
A 1 511 ASN 511 606 606 ASN ASN A . n 
A 1 512 PHE 512 607 607 PHE PHE A . n 
A 1 513 CYS 513 608 608 CYS CYS A . n 
A 1 514 LYS 514 609 609 LYS LYS A . n 
A 1 515 LEU 515 610 ?   ?   ?   A . n 
A 1 516 ASP 516 611 ?   ?   ?   A . n 
A 1 517 ILE 517 612 ?   ?   ?   A . n 
B 2 1   DA  1   1   1   DA  DA  B . n 
B 2 2   DG  2   2   2   DG  DG  B . n 
B 2 3   DA  3   3   3   DA  DA  B . n 
B 2 4   DG  4   4   4   DG  DG  B . n 
B 2 5   DA  5   5   5   DA  DA  B . n 
B 2 6   DA  6   6   6   DA  DA  B . n 
B 2 7   DC  7   7   7   DC  DC  B . n 
B 2 8   DA  8   8   8   DA  DA  B . n 
B 2 9   DA  9   9   9   DA  DA  B . n 
B 2 10  DC  10  10  10  DC  DC  B . n 
B 2 11  DA  11  11  11  DA  DA  B . n 
B 2 12  DA  12  12  12  DA  DA  B . n 
B 2 13  DC  13  13  13  DC  DC  B . n 
B 2 14  DA  14  14  14  DA  DA  B . n 
B 2 15  DA  15  15  15  DA  DA  B . n 
B 2 16  DG  16  16  16  DG  DG  B . n 
C 3 1   DC  1   1   1   DC  DC  C . n 
C 3 2   DT  2   2   2   DT  DT  C . n 
C 3 3   DT  3   3   3   DT  DT  C . n 
C 3 4   DG  4   4   4   DG  DG  C . n 
C 3 5   DT  5   5   5   DT  DT  C . n 
C 3 6   DT  6   6   6   DT  DT  C . n 
C 3 7   DG  7   7   7   DG  DG  C . n 
C 3 8   DT  8   8   8   DT  DT  C . n 
C 3 9   DT  9   9   9   DT  DT  C . n 
C 3 10  DG  10  10  10  DG  DG  C . n 
C 3 11  DT  11  11  11  DT  DT  C . n 
C 3 12  DT  12  12  12  DT  DT  C . n 
C 3 13  DC  13  13  13  DC  DC  C . n 
C 3 14  DT  14  14  14  DT  DT  C . n 
C 3 15  DC  15  15  15  DC  DC  C . n 
C 3 16  DT  16  16  16  DT  DT  C . n 
C 3 17  DG  17  17  17  DG  DG  C . n 
C 3 18  DG  18  18  18  DG  DG  C . n 
C 3 19  DG  19  19  19  DG  DG  C . n 
C 3 20  DT  20  20  20  DT  DT  C . n 
C 3 21  DC  21  21  21  DC  DC  C . n 
C 3 22  DA  22  22  22  DA  DA  C . n 
C 3 23  DC  23  23  23  DC  DC  C . n 
C 3 24  DG  24  24  24  DG  DG  C . n 
C 3 25  DC  25  25  25  DC  DC  C . n 
C 3 26  DG  26  26  ?   ?   ?   C . n 
D 4 1   DC  1   0   ?   ?   ?   D . n 
D 4 2   DG  2   1   1   DG  DG  D . n 
D 4 3   DC  3   2   2   DC  DC  D . n 
D 4 4   DG  4   3   3   DG  DG  D . n 
D 4 5   DT  5   4   4   DT  DT  D . n 
D 4 6   DG  6   5   5   DG  DG  D . n 
D 4 7   DA  7   6   6   DA  DA  D . n 
D 4 8   DC  8   7   7   DC  DC  D . n 
# 
_pdbx_nonpoly_scheme.asym_id         E 
_pdbx_nonpoly_scheme.entity_id       5 
_pdbx_nonpoly_scheme.mon_id          CA 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     701 
_pdbx_nonpoly_scheme.auth_seq_num    1 
_pdbx_nonpoly_scheme.pdb_mon_id      CA 
_pdbx_nonpoly_scheme.auth_mon_id     CA 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   octameric 
_pdbx_struct_assembly.oligomeric_count     8 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 23490 ? 
1 MORE         -168  ? 
1 'SSA (A^2)'  55190 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_566 x,-y+1,-z+1 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 135.3500000000 0.0000000000 0.0000000000 -1.0000000000 103.2100000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OD1 ? A ASP 105 ? A ASP 180 ? 1_555 CA ? E CA . ? A CA 701 ? 1_555 OD2   ? A ASP 173 ? A ASP 248 ? 1_555 49.9  ? 
2 OD1 ? A ASP 105 ? A ASP 180 ? 1_555 CA ? E CA . ? A CA 701 ? 1_555 OP2   ? C DG  18  ? C DG  18  ? 1_555 99.8  ? 
3 OD2 ? A ASP 173 ? A ASP 248 ? 1_555 CA ? E CA . ? A CA 701 ? 1_555 OP2   ? C DG  18  ? C DG  18  ? 1_555 76.3  ? 
4 OD1 ? A ASP 105 ? A ASP 180 ? 1_555 CA ? E CA . ? A CA 701 ? 1_555 "O3'" ? D DC  8   ? D DC  7   ? 1_555 141.6 ? 
5 OD2 ? A ASP 173 ? A ASP 248 ? 1_555 CA ? E CA . ? A CA 701 ? 1_555 "O3'" ? D DC  8   ? D DC  7   ? 1_555 94.1  ? 
6 OP2 ? C DG  18  ? C DG  18  ? 1_555 CA ? E CA . ? A CA 701 ? 1_555 "O3'" ? D DC  8   ? D DC  7   ? 1_555 52.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-09-19 
2 'Structure model' 1 1 2019-01-23 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'          
2 2 'Structure model' '_citation.page_first'              
3 2 'Structure model' '_citation.page_last'               
4 2 'Structure model' '_citation.pdbx_database_id_DOI'    
5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
6 2 'Structure model' '_citation.title'                   
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10_2155: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                  2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                  3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? AMoRE  ? ? ? .                  4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   VAL 
_pdbx_validate_close_contact.auth_seq_id_1    254 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   NH1 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ARG 
_pdbx_validate_close_contact.auth_seq_id_2    262 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.16 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            C 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            PRO 
_pdbx_validate_rmsd_bond.auth_seq_id_1             437 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            N 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            PRO 
_pdbx_validate_rmsd_bond.auth_seq_id_2             438 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.585 
_pdbx_validate_rmsd_bond.bond_target_value         1.338 
_pdbx_validate_rmsd_bond.bond_deviation            0.247 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.019 
_pdbx_validate_rmsd_bond.linker_flag               Y 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             "O4'" 
_pdbx_validate_rmsd_angle.auth_asym_id_1             C 
_pdbx_validate_rmsd_angle.auth_comp_id_1             DG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              18 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             "C1'" 
_pdbx_validate_rmsd_angle.auth_asym_id_2             C 
_pdbx_validate_rmsd_angle.auth_comp_id_2             DG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              18 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             N9 
_pdbx_validate_rmsd_angle.auth_asym_id_3             C 
_pdbx_validate_rmsd_angle.auth_comp_id_3             DG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              18 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                110.60 
_pdbx_validate_rmsd_angle.angle_target_value         108.30 
_pdbx_validate_rmsd_angle.angle_deviation            2.30 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 173 ? ? 80.38   -5.91   
2  1 GLU A 200 ? ? -86.74  -76.15  
3  1 ASN A 201 ? ? -136.37 -68.08  
4  1 ASN A 236 ? ? 79.84   -0.86   
5  1 ASP A 239 ? ? -141.17 -65.24  
6  1 LEU A 240 ? ? 88.21   -14.44  
7  1 SER A 242 ? ? -149.66 -59.68  
8  1 ARG A 306 ? ? -149.10 -159.15 
9  1 LEU A 307 ? ? 85.39   -17.60  
10 1 ARG A 308 ? ? 54.53   15.19   
11 1 GLU A 314 ? ? -53.93  -73.26  
12 1 CYS A 315 ? ? 47.07   74.30   
13 1 THR A 346 ? ? -56.84  -8.11   
14 1 SER A 381 ? ? -125.11 -56.35  
15 1 ASP A 405 ? ? 78.03   -20.69  
16 1 ILE A 420 ? ? -112.27 -70.18  
17 1 GLN A 444 ? ? -78.61  -159.55 
18 1 GLU A 445 ? ? -51.12  -9.50   
19 1 PHE A 453 ? ? -77.26  -71.46  
20 1 VAL A 518 ? ? 76.86   -22.32  
21 1 SER A 519 ? ? 67.77   153.33  
22 1 TYR A 551 ? ? -119.44 76.41   
23 1 GLN A 591 ? ? 43.60   -116.17 
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 SER A 241 ? ? SER A 242 ? ? 149.44 
2 1 GLY A 590 ? ? GLN A 591 ? ? 140.89 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A SER 163 ? CB  ? A SER 88 CB  
2 1 Y 1 A SER 163 ? OG  ? A SER 88 OG  
3 1 Y 1 D DG  1   ? P   ? D DG  2  P   
4 1 Y 1 D DG  1   ? OP1 ? D DG  2  OP1 
5 1 Y 1 D DG  1   ? OP2 ? D DG  2  OP2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 76  ? A GLY 1   
2  1 Y 1 A SER 77  ? A SER 2   
3  1 Y 1 A HIS 78  ? A HIS 3   
4  1 Y 1 A MET 79  ? A MET 4   
5  1 Y 1 A SER 80  ? A SER 5   
6  1 Y 1 A ASN 491 ? A ASN 396 
7  1 Y 1 A GLU 492 ? A GLU 397 
8  1 Y 1 A LEU 493 ? A LEU 398 
9  1 Y 1 A SER 494 ? A SER 399 
10 1 Y 1 A ALA 495 ? A ALA 400 
11 1 Y 1 A THR 496 ? A THR 401 
12 1 Y 1 A GLN 497 ? A GLN 402 
13 1 Y 1 A LEU 498 ? A LEU 403 
14 1 Y 1 A ASN 499 ? A ASN 404 
15 1 Y 1 A GLN 500 ? A GLN 405 
16 1 Y 1 A SER 501 ? A SER 406 
17 1 Y 1 A ASP 502 ? A ASP 407 
18 1 Y 1 A SER 503 ? A SER 408 
19 1 Y 1 A ASN 504 ? A ASN 409 
20 1 Y 1 A SER 505 ? A SER 410 
21 1 Y 1 A HIS 506 ? A HIS 411 
22 1 Y 1 A ASN 507 ? A ASN 412 
23 1 Y 1 A SER 508 ? A SER 413 
24 1 Y 1 A ILE 509 ? A ILE 414 
25 1 Y 1 A ASP 510 ? A ASP 415 
26 1 Y 1 A LEU 511 ? A LEU 416 
27 1 Y 1 A THR 512 ? A THR 417 
28 1 Y 1 A SER 513 ? A SER 418 
29 1 Y 1 A HIS 514 ? A HIS 419 
30 1 Y 1 A SER 515 ? A SER 420 
31 1 Y 1 A LYS 516 ? A LYS 421 
32 1 Y 1 A LEU 610 ? A LEU 515 
33 1 Y 1 A ASP 611 ? A ASP 516 
34 1 Y 1 A ILE 612 ? A ILE 517 
35 1 Y 1 C DG  26  ? C DG  26  
36 1 Y 1 D DC  0   ? D DC  1   
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
6DWY 'double helix'        
6DWY 'a-form double helix' 
6DWY 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DA 1  1_555 C DT 16 1_555 0.985  0.300  -0.691 -22.970 -14.713 -0.585  1  B_DA1:DT16_C B 1  ? C 16 ? 20 1 
1 B DG 2  1_555 C DC 15 1_555 0.120  -0.123 1.832  24.505  7.193   -0.038  2  B_DG2:DC15_C B 2  ? C 15 ? 19 1 
1 B DA 3  1_555 C DT 14 1_555 0.363  -0.590 0.537  14.890  -0.447  -0.787  3  B_DA3:DT14_C B 3  ? C 14 ? 20 1 
1 B DG 4  1_555 C DC 13 1_555 -0.395 -0.180 0.214  1.356   -2.611  0.945   4  B_DG4:DC13_C B 4  ? C 13 ? 19 1 
1 B DA 5  1_555 C DT 12 1_555 -0.009 0.011  0.198  3.397   -2.840  2.168   5  B_DA5:DT12_C B 5  ? C 12 ? 20 1 
1 B DA 6  1_555 C DT 11 1_555 0.403  -0.309 0.158  2.720   0.820   -6.935  6  B_DA6:DT11_C B 6  ? C 11 ? 20 1 
1 B DC 7  1_555 C DG 10 1_555 0.350  -0.316 0.259  12.168  -6.893  -3.704  7  B_DC7:DG10_C B 7  ? C 10 ? 19 1 
1 B DA 8  1_555 C DT 9  1_555 0.575  -0.192 0.424  18.128  -8.256  -13.152 8  B_DA8:DT9_C  B 8  ? C 9  ? 20 1 
1 B DA 9  1_555 C DT 8  1_555 -0.125 -0.354 0.444  18.037  -18.452 -8.914  9  B_DA9:DT8_C  B 9  ? C 8  ? 20 1 
1 B DC 10 1_555 C DG 7  1_555 0.188  -0.421 0.408  -4.506  -13.137 -2.470  10 B_DC10:DG7_C B 10 ? C 7  ? 19 1 
1 B DA 11 1_555 C DT 6  1_555 0.584  0.157  0.569  2.633   -10.558 11.275  11 B_DA11:DT6_C B 11 ? C 6  ? 20 1 
1 B DA 12 1_555 C DT 5  1_555 0.995  0.464  0.773  5.568   -8.351  -8.704  12 B_DA12:DT5_C B 12 ? C 5  ? 20 1 
1 B DC 13 1_555 C DG 4  1_555 0.074  0.146  -0.103 7.825   -3.985  7.978   13 B_DC13:DG4_C B 13 ? C 4  ? 19 1 
1 B DA 14 1_555 C DT 3  1_555 0.406  -0.286 0.662  4.572   -21.956 1.616   14 B_DA14:DT3_C B 14 ? C 3  ? 20 1 
1 B DA 15 1_555 C DT 2  1_555 0.905  0.051  0.443  6.519   -21.064 -8.220  15 B_DA15:DT2_C B 15 ? C 2  ? 20 1 
1 B DG 16 1_555 C DC 1  1_555 1.786  0.574  1.377  9.381   -28.784 25.936  16 B_DG16:DC1_C B 16 ? C 1  ? ?  1 
1 C DT 20 1_555 D DA 7  1_555 0.793  0.089  2.055  -21.400 -7.314  6.227   17 C_DT20:DA6_D C 20 ? D 6  ? ?  1 
1 C DC 21 1_555 D DG 6  1_555 -0.191 -0.186 0.636  -3.372  -15.102 -5.101  18 C_DC21:DG5_D C 21 ? D 5  ? 19 1 
1 C DA 22 1_555 D DT 5  1_555 0.048  0.040  0.346  4.165   -5.499  -9.582  19 C_DA22:DT4_D C 22 ? D 4  ? 20 1 
1 C DC 23 1_555 D DG 4  1_555 0.821  -0.439 0.116  2.234   -8.206  -12.982 20 C_DC23:DG3_D C 23 ? D 3  ? 19 1 
1 C DG 24 1_555 D DC 3  1_555 -0.096 0.311  -0.039 3.095   -5.112  11.457  21 C_DG24:DC2_D C 24 ? D 2  ? 19 1 
1 C DC 25 1_555 D DG 2  1_555 2.218  -0.716 1.313  23.420  -35.615 -0.671  22 C_DC25:DG1_D C 25 ? D 1  ? ?  1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DA 1  1_555 C DT 16 1_555 B DG 2  1_555 C DC 15 1_555 0.104  -0.564 2.037 -27.401 10.575  26.800 -1.572 -2.069 1.176 17.468  
45.260  39.560 1  BB_DA1DG2:DC15DT16_CC B 1  ? C 16 ? B 2  ? C 15 ? 
1 B DG 2  1_555 C DC 15 1_555 B DA 3  1_555 C DT 14 1_555 -0.312 -1.470 3.512 3.157   15.093  34.710 -4.169 0.880  2.635 23.893  
-4.998  37.885 2  BB_DG2DA3:DT14DC15_CC B 2  ? C 15 ? B 3  ? C 14 ? 
1 B DA 3  1_555 C DT 14 1_555 B DG 4  1_555 C DC 13 1_555 -1.062 -1.932 3.699 -3.608  4.717   25.197 -5.754 1.269  3.402 10.626  
8.127   25.877 3  BB_DA3DG4:DC13DT14_CC B 3  ? C 14 ? B 4  ? C 13 ? 
1 B DG 4  1_555 C DC 13 1_555 B DA 5  1_555 C DT 12 1_555 -0.019 -1.070 3.265 0.133   5.853   29.627 -3.206 0.063  3.002 11.307  
-0.256  30.187 4  BB_DG4DA5:DT12DC13_CC B 4  ? C 13 ? B 5  ? C 12 ? 
1 B DA 5  1_555 C DT 12 1_555 B DA 6  1_555 C DT 11 1_555 -0.721 -0.658 3.408 -0.999  -2.564  33.590 -0.696 1.073  3.466 -4.428  
1.726   33.699 5  BB_DA5DA6:DT11DT12_CC B 5  ? C 12 ? B 6  ? C 11 ? 
1 B DA 6  1_555 C DT 11 1_555 B DC 7  1_555 C DG 10 1_555 0.430  -0.977 3.172 -1.698  -2.848  32.182 -1.260 -1.066 3.218 -5.120  
3.053   32.348 6  BB_DA6DC7:DG10DT11_CC B 6  ? C 11 ? B 7  ? C 10 ? 
1 B DC 7  1_555 C DG 10 1_555 B DA 8  1_555 C DT 9  1_555 -1.709 -0.248 3.245 -4.223  0.001   40.159 -0.360 1.992  3.400 0.001   
6.129   40.371 7  BB_DC7DA8:DT9DG10_CC  B 7  ? C 10 ? B 8  ? C 9  ? 
1 B DA 8  1_555 C DT 9  1_555 B DA 9  1_555 C DT 8  1_555 0.468  -0.764 3.161 -3.199  0.183   28.213 -1.597 -1.660 3.085 0.374   
6.536   28.391 8  BB_DA8DA9:DT8DT9_CC   B 8  ? C 9  ? B 9  ? C 8  ? 
1 B DA 9  1_555 C DT 8  1_555 B DC 10 1_555 C DG 7  1_555 1.147  -1.327 3.754 1.805   -5.569  33.623 -1.211 -1.615 3.971 -9.538  
-3.091  34.114 9  BB_DA9DC10:DG7DT8_CC  B 9  ? C 8  ? B 10 ? C 7  ? 
1 B DC 10 1_555 C DG 7  1_555 B DA 11 1_555 C DT 6  1_555 0.074  -0.170 3.177 -1.097  1.398   41.731 -0.380 -0.215 3.167 1.962   
1.539   41.768 10 BB_DC10DA11:DT6DG7_CC B 10 ? C 7  ? B 11 ? C 6  ? 
1 B DA 11 1_555 C DT 6  1_555 B DA 12 1_555 C DT 5  1_555 -1.187 -0.811 3.024 -3.565  -4.268  34.980 -0.732 1.450  3.199 -7.046  
5.884   35.406 11 BB_DA11DA12:DT5DT6_CC B 11 ? C 6  ? B 12 ? C 5  ? 
1 B DA 12 1_555 C DT 5  1_555 B DC 13 1_555 C DG 4  1_555 1.644  -0.986 3.269 7.586   -1.130  26.833 -1.756 -1.465 3.626 -2.374  
-15.938 27.889 12 BB_DA12DC13:DG4DT5_CC B 12 ? C 5  ? B 13 ? C 4  ? 
1 B DC 13 1_555 C DG 4  1_555 B DA 14 1_555 C DT 3  1_555 -0.298 -0.407 3.421 -4.196  2.065   39.390 -0.853 -0.074 3.408 3.050   
6.198   39.656 13 BB_DC13DA14:DT3DG4_CC B 13 ? C 4  ? B 14 ? C 3  ? 
1 B DA 14 1_555 C DT 3  1_555 B DA 15 1_555 C DT 2  1_555 -1.050 -0.350 3.153 -0.270  2.095   37.746 -0.799 1.587  3.137 3.236   
0.416   37.803 14 BB_DA14DA15:DT2DT3_CC B 14 ? C 3  ? B 15 ? C 2  ? 
1 B DA 15 1_555 C DT 2  1_555 B DG 16 1_555 C DC 1  1_555 1.522  -0.486 3.286 -3.494  -9.198  41.115 0.273  -2.473 3.184 -12.876 
4.891   42.227 15 BB_DA15DG16:DC1DT2_CC B 15 ? C 2  ? B 16 ? C 1  ? 
1 C DT 20 1_555 D DA 7  1_555 C DC 21 1_555 D DG 6  1_555 -1.591 -0.378 2.726 6.736   -10.220 28.393 0.881  4.039  2.295 -19.718 
-12.996 30.869 16 CC_DT20DC21:DG5DA6_DD C 20 ? D 6  ? C 21 ? D 5  ? 
1 C DC 21 1_555 D DG 6  1_555 C DA 22 1_555 D DT 5  1_555 -0.749 -0.548 2.996 0.173   10.798  36.003 -2.113 1.184  2.722 17.004  
-0.273  37.536 17 CC_DC21DA22:DT4DG5_DD C 21 ? D 5  ? C 22 ? D 4  ? 
1 C DA 22 1_555 D DT 5  1_555 C DC 23 1_555 D DG 4  1_555 -0.530 -0.497 3.595 -2.482  -0.541  37.042 -0.700 0.466  3.629 -0.850  
3.902   37.126 18 CC_DA22DC23:DG3DT4_DD C 22 ? D 4  ? C 23 ? D 3  ? 
1 C DC 23 1_555 D DG 4  1_555 C DG 24 1_555 D DC 3  1_555 0.997  0.232  3.477 1.857   -0.456  34.703 0.463  -1.366 3.520 -0.764  
-3.111  34.754 19 CC_DC23DG24:DC2DG3_DD C 23 ? D 3  ? C 24 ? D 2  ? 
1 C DG 24 1_555 D DC 3  1_555 C DC 25 1_555 D DG 2  1_555 -1.000 0.455  3.169 -14.700 1.923   42.917 0.415  -0.041 3.339 2.540   
19.412  45.291 20 CC_DG24DC25:DG1DC2_DD C 24 ? D 2  ? C 25 ? D 1  ? 
# 
_pdbx_entity_nonpoly.entity_id   5 
_pdbx_entity_nonpoly.name        'CALCIUM ION' 
_pdbx_entity_nonpoly.comp_id     CA 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#