data_6DWZ
# 
_entry.id   6DWZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.303 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6DWZ         
WWPDB D_1000234366 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6DWZ 
_pdbx_database_status.recvd_initial_deposition_date   2018-06-28 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Dyda, F.'      1 ? 
'Hickman, A.B.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            46 
_citation.language                  ? 
_citation.page_first                10286 
_citation.page_last                 10301 
_citation.title                     
'Structural insights into the mechanism of double strand break formation by Hermes, a hAT family eukaryotic DNA transposase.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gky838 
_citation.pdbx_database_id_PubMed   30239795 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hickman, A.B.' 1 ? 
primary 'Voth, A.R.'    2 ? 
primary 'Ewis, H.'      3 ? 
primary 'Li, X.'        4 ? 
primary 'Craig, N.L.'   5 ? 
primary 'Dyda, F.'      6 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6DWZ 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     96.380 
_cell.length_a_esd                 ? 
_cell.length_b                     121.110 
_cell.length_b_esd                 ? 
_cell.length_c                     132.190 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6DWZ 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Hermes transposase'                                          59033.633 2 ? C519S ? ? 
2 polymer syn 
;DNA (5'-D(*GP*AP*GP*AP*AP*CP*AP*AP*CP*AP*AP*CP*AP*AP*G)-3')
;
4629.067  2 ? ?     ? ? 
3 polymer syn 'DNA (26-MER)'                                                7983.107  2 ? ?     ? ? 
4 polymer syn 
;DNA (5'-D(*GP*CP*GP*TP*GP*AP*C)-3')
;
2138.423  2 ? ?     ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GSHMSRELKTVSADCKKEAIEKCAQWVVRDCRPFSAVSGSGFIDMIKFFIKVGAEYGEHVNVEELLPSPITLSRKVTSDA
KEKKALISREIKSAVEKDGASATIDLWTDNYIKRNFLGVTLHYHENNELRDLILGLKSLDFERSTAENIYKKLKAIFSQF
NVEDLSSIKFVTDRGANVVKSLANNIRINCSSHLLSNVLENSFEETPELNMPILACKNIVKYFKKANLQHRLRSSLKSEC
PTRWNSTYTMLRSILDNWESVIQILSEAGETQRIVHINKSIIQTMVNILDGFERIFKELQTCSSPSLCFVVPSILKVKEI
CSPDVGDVADIAKLKVNIIKNVRIIWEENLSIWHYTAFFFYPPALHMQQEKVAQIKEFCLSKMEDLELINRMSSFNELSA
TQLNQSDSNSHNSIDLTSHSKPVSPSDEFEFYRKEIVILSEDFKVMEWWNLNSKKYPKLSKLALSLLSIPASSAASERTF
SLAGNIITEKRNRIGQQTVDSLLFLNSFYKNFCKLDI
;
;GSHMSRELKTVSADCKKEAIEKCAQWVVRDCRPFSAVSGSGFIDMIKFFIKVGAEYGEHVNVEELLPSPITLSRKVTSDA
KEKKALISREIKSAVEKDGASATIDLWTDNYIKRNFLGVTLHYHENNELRDLILGLKSLDFERSTAENIYKKLKAIFSQF
NVEDLSSIKFVTDRGANVVKSLANNIRINCSSHLLSNVLENSFEETPELNMPILACKNIVKYFKKANLQHRLRSSLKSEC
PTRWNSTYTMLRSILDNWESVIQILSEAGETQRIVHINKSIIQTMVNILDGFERIFKELQTCSSPSLCFVVPSILKVKEI
CSPDVGDVADIAKLKVNIIKNVRIIWEENLSIWHYTAFFFYPPALHMQQEKVAQIKEFCLSKMEDLELINRMSSFNELSA
TQLNQSDSNSHNSIDLTSHSKPVSPSDEFEFYRKEIVILSEDFKVMEWWNLNSKKYPKLSKLALSLLSIPASSAASERTF
SLAGNIITEKRNRIGQQTVDSLLFLNSFYKNFCKLDI
;
A,E ? 
2 polydeoxyribonucleotide no no '(DG)(DA)(DG)(DA)(DA)(DC)(DA)(DA)(DC)(DA)(DA)(DC)(DA)(DA)(DG)' GAGAACAACAACAAG B,F ? 
3 polydeoxyribonucleotide no no 
;(DC)(DT)(DT)(DG)(DT)(DT)(DG)(DT)(DT)(DG)(DT)(DT)(DC)(DT)(DC)(DT)(DG)(DG)(DG)(DT)
(DC)(DA)(DC)(DG)(DC)(DG)
;
CTTGTTGTTGTTCTCTGGGTCACGCG C,G ? 
4 polydeoxyribonucleotide no no '(DG)(DC)(DG)(DT)(DG)(DA)(DC)' GCGTGAC D,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   SER n 
1 6   ARG n 
1 7   GLU n 
1 8   LEU n 
1 9   LYS n 
1 10  THR n 
1 11  VAL n 
1 12  SER n 
1 13  ALA n 
1 14  ASP n 
1 15  CYS n 
1 16  LYS n 
1 17  LYS n 
1 18  GLU n 
1 19  ALA n 
1 20  ILE n 
1 21  GLU n 
1 22  LYS n 
1 23  CYS n 
1 24  ALA n 
1 25  GLN n 
1 26  TRP n 
1 27  VAL n 
1 28  VAL n 
1 29  ARG n 
1 30  ASP n 
1 31  CYS n 
1 32  ARG n 
1 33  PRO n 
1 34  PHE n 
1 35  SER n 
1 36  ALA n 
1 37  VAL n 
1 38  SER n 
1 39  GLY n 
1 40  SER n 
1 41  GLY n 
1 42  PHE n 
1 43  ILE n 
1 44  ASP n 
1 45  MET n 
1 46  ILE n 
1 47  LYS n 
1 48  PHE n 
1 49  PHE n 
1 50  ILE n 
1 51  LYS n 
1 52  VAL n 
1 53  GLY n 
1 54  ALA n 
1 55  GLU n 
1 56  TYR n 
1 57  GLY n 
1 58  GLU n 
1 59  HIS n 
1 60  VAL n 
1 61  ASN n 
1 62  VAL n 
1 63  GLU n 
1 64  GLU n 
1 65  LEU n 
1 66  LEU n 
1 67  PRO n 
1 68  SER n 
1 69  PRO n 
1 70  ILE n 
1 71  THR n 
1 72  LEU n 
1 73  SER n 
1 74  ARG n 
1 75  LYS n 
1 76  VAL n 
1 77  THR n 
1 78  SER n 
1 79  ASP n 
1 80  ALA n 
1 81  LYS n 
1 82  GLU n 
1 83  LYS n 
1 84  LYS n 
1 85  ALA n 
1 86  LEU n 
1 87  ILE n 
1 88  SER n 
1 89  ARG n 
1 90  GLU n 
1 91  ILE n 
1 92  LYS n 
1 93  SER n 
1 94  ALA n 
1 95  VAL n 
1 96  GLU n 
1 97  LYS n 
1 98  ASP n 
1 99  GLY n 
1 100 ALA n 
1 101 SER n 
1 102 ALA n 
1 103 THR n 
1 104 ILE n 
1 105 ASP n 
1 106 LEU n 
1 107 TRP n 
1 108 THR n 
1 109 ASP n 
1 110 ASN n 
1 111 TYR n 
1 112 ILE n 
1 113 LYS n 
1 114 ARG n 
1 115 ASN n 
1 116 PHE n 
1 117 LEU n 
1 118 GLY n 
1 119 VAL n 
1 120 THR n 
1 121 LEU n 
1 122 HIS n 
1 123 TYR n 
1 124 HIS n 
1 125 GLU n 
1 126 ASN n 
1 127 ASN n 
1 128 GLU n 
1 129 LEU n 
1 130 ARG n 
1 131 ASP n 
1 132 LEU n 
1 133 ILE n 
1 134 LEU n 
1 135 GLY n 
1 136 LEU n 
1 137 LYS n 
1 138 SER n 
1 139 LEU n 
1 140 ASP n 
1 141 PHE n 
1 142 GLU n 
1 143 ARG n 
1 144 SER n 
1 145 THR n 
1 146 ALA n 
1 147 GLU n 
1 148 ASN n 
1 149 ILE n 
1 150 TYR n 
1 151 LYS n 
1 152 LYS n 
1 153 LEU n 
1 154 LYS n 
1 155 ALA n 
1 156 ILE n 
1 157 PHE n 
1 158 SER n 
1 159 GLN n 
1 160 PHE n 
1 161 ASN n 
1 162 VAL n 
1 163 GLU n 
1 164 ASP n 
1 165 LEU n 
1 166 SER n 
1 167 SER n 
1 168 ILE n 
1 169 LYS n 
1 170 PHE n 
1 171 VAL n 
1 172 THR n 
1 173 ASP n 
1 174 ARG n 
1 175 GLY n 
1 176 ALA n 
1 177 ASN n 
1 178 VAL n 
1 179 VAL n 
1 180 LYS n 
1 181 SER n 
1 182 LEU n 
1 183 ALA n 
1 184 ASN n 
1 185 ASN n 
1 186 ILE n 
1 187 ARG n 
1 188 ILE n 
1 189 ASN n 
1 190 CYS n 
1 191 SER n 
1 192 SER n 
1 193 HIS n 
1 194 LEU n 
1 195 LEU n 
1 196 SER n 
1 197 ASN n 
1 198 VAL n 
1 199 LEU n 
1 200 GLU n 
1 201 ASN n 
1 202 SER n 
1 203 PHE n 
1 204 GLU n 
1 205 GLU n 
1 206 THR n 
1 207 PRO n 
1 208 GLU n 
1 209 LEU n 
1 210 ASN n 
1 211 MET n 
1 212 PRO n 
1 213 ILE n 
1 214 LEU n 
1 215 ALA n 
1 216 CYS n 
1 217 LYS n 
1 218 ASN n 
1 219 ILE n 
1 220 VAL n 
1 221 LYS n 
1 222 TYR n 
1 223 PHE n 
1 224 LYS n 
1 225 LYS n 
1 226 ALA n 
1 227 ASN n 
1 228 LEU n 
1 229 GLN n 
1 230 HIS n 
1 231 ARG n 
1 232 LEU n 
1 233 ARG n 
1 234 SER n 
1 235 SER n 
1 236 LEU n 
1 237 LYS n 
1 238 SER n 
1 239 GLU n 
1 240 CYS n 
1 241 PRO n 
1 242 THR n 
1 243 ARG n 
1 244 TRP n 
1 245 ASN n 
1 246 SER n 
1 247 THR n 
1 248 TYR n 
1 249 THR n 
1 250 MET n 
1 251 LEU n 
1 252 ARG n 
1 253 SER n 
1 254 ILE n 
1 255 LEU n 
1 256 ASP n 
1 257 ASN n 
1 258 TRP n 
1 259 GLU n 
1 260 SER n 
1 261 VAL n 
1 262 ILE n 
1 263 GLN n 
1 264 ILE n 
1 265 LEU n 
1 266 SER n 
1 267 GLU n 
1 268 ALA n 
1 269 GLY n 
1 270 GLU n 
1 271 THR n 
1 272 GLN n 
1 273 ARG n 
1 274 ILE n 
1 275 VAL n 
1 276 HIS n 
1 277 ILE n 
1 278 ASN n 
1 279 LYS n 
1 280 SER n 
1 281 ILE n 
1 282 ILE n 
1 283 GLN n 
1 284 THR n 
1 285 MET n 
1 286 VAL n 
1 287 ASN n 
1 288 ILE n 
1 289 LEU n 
1 290 ASP n 
1 291 GLY n 
1 292 PHE n 
1 293 GLU n 
1 294 ARG n 
1 295 ILE n 
1 296 PHE n 
1 297 LYS n 
1 298 GLU n 
1 299 LEU n 
1 300 GLN n 
1 301 THR n 
1 302 CYS n 
1 303 SER n 
1 304 SER n 
1 305 PRO n 
1 306 SER n 
1 307 LEU n 
1 308 CYS n 
1 309 PHE n 
1 310 VAL n 
1 311 VAL n 
1 312 PRO n 
1 313 SER n 
1 314 ILE n 
1 315 LEU n 
1 316 LYS n 
1 317 VAL n 
1 318 LYS n 
1 319 GLU n 
1 320 ILE n 
1 321 CYS n 
1 322 SER n 
1 323 PRO n 
1 324 ASP n 
1 325 VAL n 
1 326 GLY n 
1 327 ASP n 
1 328 VAL n 
1 329 ALA n 
1 330 ASP n 
1 331 ILE n 
1 332 ALA n 
1 333 LYS n 
1 334 LEU n 
1 335 LYS n 
1 336 VAL n 
1 337 ASN n 
1 338 ILE n 
1 339 ILE n 
1 340 LYS n 
1 341 ASN n 
1 342 VAL n 
1 343 ARG n 
1 344 ILE n 
1 345 ILE n 
1 346 TRP n 
1 347 GLU n 
1 348 GLU n 
1 349 ASN n 
1 350 LEU n 
1 351 SER n 
1 352 ILE n 
1 353 TRP n 
1 354 HIS n 
1 355 TYR n 
1 356 THR n 
1 357 ALA n 
1 358 PHE n 
1 359 PHE n 
1 360 PHE n 
1 361 TYR n 
1 362 PRO n 
1 363 PRO n 
1 364 ALA n 
1 365 LEU n 
1 366 HIS n 
1 367 MET n 
1 368 GLN n 
1 369 GLN n 
1 370 GLU n 
1 371 LYS n 
1 372 VAL n 
1 373 ALA n 
1 374 GLN n 
1 375 ILE n 
1 376 LYS n 
1 377 GLU n 
1 378 PHE n 
1 379 CYS n 
1 380 LEU n 
1 381 SER n 
1 382 LYS n 
1 383 MET n 
1 384 GLU n 
1 385 ASP n 
1 386 LEU n 
1 387 GLU n 
1 388 LEU n 
1 389 ILE n 
1 390 ASN n 
1 391 ARG n 
1 392 MET n 
1 393 SER n 
1 394 SER n 
1 395 PHE n 
1 396 ASN n 
1 397 GLU n 
1 398 LEU n 
1 399 SER n 
1 400 ALA n 
1 401 THR n 
1 402 GLN n 
1 403 LEU n 
1 404 ASN n 
1 405 GLN n 
1 406 SER n 
1 407 ASP n 
1 408 SER n 
1 409 ASN n 
1 410 SER n 
1 411 HIS n 
1 412 ASN n 
1 413 SER n 
1 414 ILE n 
1 415 ASP n 
1 416 LEU n 
1 417 THR n 
1 418 SER n 
1 419 HIS n 
1 420 SER n 
1 421 LYS n 
1 422 PRO n 
1 423 VAL n 
1 424 SER n 
1 425 PRO n 
1 426 SER n 
1 427 ASP n 
1 428 GLU n 
1 429 PHE n 
1 430 GLU n 
1 431 PHE n 
1 432 TYR n 
1 433 ARG n 
1 434 LYS n 
1 435 GLU n 
1 436 ILE n 
1 437 VAL n 
1 438 ILE n 
1 439 LEU n 
1 440 SER n 
1 441 GLU n 
1 442 ASP n 
1 443 PHE n 
1 444 LYS n 
1 445 VAL n 
1 446 MET n 
1 447 GLU n 
1 448 TRP n 
1 449 TRP n 
1 450 ASN n 
1 451 LEU n 
1 452 ASN n 
1 453 SER n 
1 454 LYS n 
1 455 LYS n 
1 456 TYR n 
1 457 PRO n 
1 458 LYS n 
1 459 LEU n 
1 460 SER n 
1 461 LYS n 
1 462 LEU n 
1 463 ALA n 
1 464 LEU n 
1 465 SER n 
1 466 LEU n 
1 467 LEU n 
1 468 SER n 
1 469 ILE n 
1 470 PRO n 
1 471 ALA n 
1 472 SER n 
1 473 SER n 
1 474 ALA n 
1 475 ALA n 
1 476 SER n 
1 477 GLU n 
1 478 ARG n 
1 479 THR n 
1 480 PHE n 
1 481 SER n 
1 482 LEU n 
1 483 ALA n 
1 484 GLY n 
1 485 ASN n 
1 486 ILE n 
1 487 ILE n 
1 488 THR n 
1 489 GLU n 
1 490 LYS n 
1 491 ARG n 
1 492 ASN n 
1 493 ARG n 
1 494 ILE n 
1 495 GLY n 
1 496 GLN n 
1 497 GLN n 
1 498 THR n 
1 499 VAL n 
1 500 ASP n 
1 501 SER n 
1 502 LEU n 
1 503 LEU n 
1 504 PHE n 
1 505 LEU n 
1 506 ASN n 
1 507 SER n 
1 508 PHE n 
1 509 TYR n 
1 510 LYS n 
1 511 ASN n 
1 512 PHE n 
1 513 CYS n 
1 514 LYS n 
1 515 LEU n 
1 516 ASP n 
1 517 ILE n 
2 1   DG  n 
2 2   DA  n 
2 3   DG  n 
2 4   DA  n 
2 5   DA  n 
2 6   DC  n 
2 7   DA  n 
2 8   DA  n 
2 9   DC  n 
2 10  DA  n 
2 11  DA  n 
2 12  DC  n 
2 13  DA  n 
2 14  DA  n 
2 15  DG  n 
3 1   DC  n 
3 2   DT  n 
3 3   DT  n 
3 4   DG  n 
3 5   DT  n 
3 6   DT  n 
3 7   DG  n 
3 8   DT  n 
3 9   DT  n 
3 10  DG  n 
3 11  DT  n 
3 12  DT  n 
3 13  DC  n 
3 14  DT  n 
3 15  DC  n 
3 16  DT  n 
3 17  DG  n 
3 18  DG  n 
3 19  DG  n 
3 20  DT  n 
3 21  DC  n 
3 22  DA  n 
3 23  DC  n 
3 24  DG  n 
3 25  DC  n 
3 26  DG  n 
4 1   DG  n 
4 2   DC  n 
4 3   DG  n 
4 4   DT  n 
4 5   DG  n 
4 6   DA  n 
4 7   DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   517 
_entity_src_gen.gene_src_common_name               'House fly' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Musca domestica' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7370 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 15 'Musca domestica' ? 7370 ? 
3 1 sample 1 26 'Musca domestica' ? 7370 ? 
4 1 sample 1 7  'Musca domestica' ? 7370 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP Q25438_MUSDO Q25438 ? 1 
;SRELKTVSADCKKEAIEKCAQWVVRDCRPFSAVSGSGFIDMIKFFIKVKAEYGEHVNVEELLPSPITLSRKVTSDAKEKK
ALISREIKSAVEKDGASATIDLWTDNYIKRNFLGVTLHYHENNELRDLILGLKSLDFERSTAENIYKKLKAIFSQFNVED
LSSIKFVTDRGANVVKSLANNIRINCSSHLLSNVLENSFEETPELNMPILACKNIVKYFKKANLQHRLRSSLKSECPTRW
NSTYTMLRSILDNWESVIQILSEAGETQRIVHINKSIIQTMVNILDGFERIFKELQTCSSPSLCFVVPSILKVKEICSPD
VGDVADIAKLKVNIIKNVRIIWEENLSIWHYTAFFFYPPALHMQQEKVAQIKEFCLSKMEDLELINRMSSFNELSATQLN
QSDSNSHNSIDLTSHSKDISTTSFFFPQLTQNNSREPPVCPSDEFEFYRKEIVILSEDFKVMEWWNLNSKKYPKLSKLAL
SLLSIPASSAASERTFSLAGNIITEKRNRIGQQTVDSLLFLNSFYKNFCKLDI
;
80 
2 PDB 6DWZ         6DWZ   ? 2 ? 1  
3 PDB 6DWZ         6DWZ   ? 3 ? 1  
4 PDB 6DWZ         6DWZ   ? 4 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6DWZ A 5 ? 517 ? Q25438 80 ? 612 ? 80 612 
2 2 6DWZ B 1 ? 15  ? 6DWZ   2  ? 16  ? 2  16  
3 3 6DWZ C 1 ? 26  ? 6DWZ   1  ? 26  ? 1  26  
4 4 6DWZ D 1 ? 7   ? 6DWZ   1  ? 7   ? 1  7   
5 1 6DWZ E 5 ? 517 ? Q25438 80 ? 612 ? 80 612 
6 2 6DWZ F 1 ? 15  ? 6DWZ   2  ? 16  ? 2  16  
7 3 6DWZ G 1 ? 26  ? 6DWZ   1  ? 26  ? 1  26  
8 4 6DWZ H 1 ? 7   ? 6DWZ   1  ? 7   ? 1  7   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6DWZ GLY A 1   ? UNP Q25438 ?   ?   'expression tag'      76  1  
1 6DWZ SER A 2   ? UNP Q25438 ?   ?   'expression tag'      77  2  
1 6DWZ HIS A 3   ? UNP Q25438 ?   ?   'expression tag'      78  3  
1 6DWZ MET A 4   ? UNP Q25438 ?   ?   'expression tag'      79  4  
1 6DWZ GLY A 53  ? UNP Q25438 LYS 128 conflict              128 5  
1 6DWZ ?   A ?   ? UNP Q25438 ASP 497 deletion              ?   6  
1 6DWZ ?   A ?   ? UNP Q25438 ILE 498 deletion              ?   7  
1 6DWZ ?   A ?   ? UNP Q25438 SER 499 deletion              ?   8  
1 6DWZ ?   A ?   ? UNP Q25438 THR 500 deletion              ?   9  
1 6DWZ ?   A ?   ? UNP Q25438 THR 501 deletion              ?   10 
1 6DWZ ?   A ?   ? UNP Q25438 SER 502 deletion              ?   11 
1 6DWZ ?   A ?   ? UNP Q25438 PHE 503 deletion              ?   12 
1 6DWZ ?   A ?   ? UNP Q25438 PHE 504 deletion              ?   13 
1 6DWZ ?   A ?   ? UNP Q25438 PHE 505 deletion              ?   14 
1 6DWZ ?   A ?   ? UNP Q25438 PRO 506 deletion              ?   15 
1 6DWZ ?   A ?   ? UNP Q25438 GLN 507 deletion              ?   16 
1 6DWZ ?   A ?   ? UNP Q25438 LEU 508 deletion              ?   17 
1 6DWZ ?   A ?   ? UNP Q25438 THR 509 deletion              ?   18 
1 6DWZ ?   A ?   ? UNP Q25438 GLN 510 deletion              ?   19 
1 6DWZ ?   A ?   ? UNP Q25438 ASN 511 deletion              ?   20 
1 6DWZ ?   A ?   ? UNP Q25438 ASN 512 deletion              ?   21 
1 6DWZ ?   A ?   ? UNP Q25438 SER 513 deletion              ?   22 
1 6DWZ ?   A ?   ? UNP Q25438 ARG 514 deletion              ?   23 
1 6DWZ ?   A ?   ? UNP Q25438 GLU 515 deletion              ?   24 
1 6DWZ ?   A ?   ? UNP Q25438 PRO 516 deletion              ?   25 
1 6DWZ SER A 424 ? UNP Q25438 CYS 519 'engineered mutation' 519 26 
5 6DWZ GLY E 1   ? UNP Q25438 ?   ?   'expression tag'      76  27 
5 6DWZ SER E 2   ? UNP Q25438 ?   ?   'expression tag'      77  28 
5 6DWZ HIS E 3   ? UNP Q25438 ?   ?   'expression tag'      78  29 
5 6DWZ MET E 4   ? UNP Q25438 ?   ?   'expression tag'      79  30 
5 6DWZ GLY E 53  ? UNP Q25438 LYS 128 conflict              128 31 
5 6DWZ ?   E ?   ? UNP Q25438 ASP 497 deletion              ?   32 
5 6DWZ ?   E ?   ? UNP Q25438 ILE 498 deletion              ?   33 
5 6DWZ ?   E ?   ? UNP Q25438 SER 499 deletion              ?   34 
5 6DWZ ?   E ?   ? UNP Q25438 THR 500 deletion              ?   35 
5 6DWZ ?   E ?   ? UNP Q25438 THR 501 deletion              ?   36 
5 6DWZ ?   E ?   ? UNP Q25438 SER 502 deletion              ?   37 
5 6DWZ ?   E ?   ? UNP Q25438 PHE 503 deletion              ?   38 
5 6DWZ ?   E ?   ? UNP Q25438 PHE 504 deletion              ?   39 
5 6DWZ ?   E ?   ? UNP Q25438 PHE 505 deletion              ?   40 
5 6DWZ ?   E ?   ? UNP Q25438 PRO 506 deletion              ?   41 
5 6DWZ ?   E ?   ? UNP Q25438 GLN 507 deletion              ?   42 
5 6DWZ ?   E ?   ? UNP Q25438 LEU 508 deletion              ?   43 
5 6DWZ ?   E ?   ? UNP Q25438 THR 509 deletion              ?   44 
5 6DWZ ?   E ?   ? UNP Q25438 GLN 510 deletion              ?   45 
5 6DWZ ?   E ?   ? UNP Q25438 ASN 511 deletion              ?   46 
5 6DWZ ?   E ?   ? UNP Q25438 ASN 512 deletion              ?   47 
5 6DWZ ?   E ?   ? UNP Q25438 SER 513 deletion              ?   48 
5 6DWZ ?   E ?   ? UNP Q25438 ARG 514 deletion              ?   49 
5 6DWZ ?   E ?   ? UNP Q25438 GLU 515 deletion              ?   50 
5 6DWZ ?   E ?   ? UNP Q25438 PRO 516 deletion              ?   51 
5 6DWZ SER E 424 ? UNP Q25438 CYS 519 'engineered mutation' 519 52 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6DWZ 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.78 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         55.83 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '50 mM MES, 50 mM sodium acetate, 15% PEG MME2000' 
_exptl_crystal_grow.pdbx_pH_range   5.8-6.5 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX-300' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-02-20 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6DWZ 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.90 
_reflns.d_resolution_low                 30.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       34628 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.0 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  19.27 
_reflns.pdbx_Rmerge_I_obs                0.124 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            18.63 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.90 
_reflns_shell.d_res_low                   2.98 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           2544 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.862 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6DWZ 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.200 
_refine.ls_d_res_low                             29.513 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     25884 
_refine.ls_number_reflns_R_free                  699 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.09 
_refine.ls_percent_reflns_R_free                 2.70 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2051 
_refine.ls_R_factor_R_free                       0.2982 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2025 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.99 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4D1Q 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.30 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             1.10 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 36.39 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.47 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7664 
_refine_hist.pdbx_number_atoms_nucleic_acid   1914 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               9578 
_refine_hist.d_res_high                       3.200 
_refine_hist.d_res_low                        29.513 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.017  ? 9954  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.735  ? 13836 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 23.470 ? 5708  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.087  ? 1574  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.010  ? 1416  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.2001 3.4468  . . 136 4918 98.00  . . . 0.3683 . 0.2445 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4468 3.7931  . . 138 4953 99.00  . . . 0.4017 . 0.2546 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7931 4.3404  . . 139 5009 99.00  . . . 0.3587 . 0.2209 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3404 5.4628  . . 140 5069 100.00 . . . 0.2724 . 0.2037 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.4628 29.5145 . . 146 5236 99.00  . . . 0.2315 . 0.1650 . . . . . . . . . . 
# 
_struct.entry_id                     6DWZ 
_struct.title                        'Hermes transposase deletion dimer complex with (C/G) DNA' 
_struct.pdbx_descriptor              'Hermes transposase/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6DWZ 
_struct_keywords.text            'transposase, DNA BINDING PROTEIN, dna binding protein-dna complex' 
_struct_keywords.pdbx_keywords   'dna binding protein/dna' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 12  ? ASP A 30  ? SER A 87  ASP A 105 1 ? 19 
HELX_P HELX_P2  AA2 PRO A 33  ? GLY A 39  ? PRO A 108 GLY A 114 5 ? 7  
HELX_P HELX_P3  AA3 GLY A 41  ? GLY A 57  ? GLY A 116 GLY A 132 1 ? 17 
HELX_P HELX_P4  AA4 ASN A 61  ? LEU A 66  ? ASN A 136 LEU A 141 1 ? 6  
HELX_P HELX_P5  AA5 SER A 68  ? ILE A 87  ? SER A 143 ILE A 162 1 ? 20 
HELX_P HELX_P6  AA6 ILE A 87  ? LYS A 97  ? ILE A 162 LYS A 172 1 ? 11 
HELX_P HELX_P7  AA7 THR A 145 ? SER A 158 ? THR A 220 SER A 233 1 ? 14 
HELX_P HELX_P8  AA8 GLY A 175 ? LEU A 182 ? GLY A 250 LEU A 257 1 ? 8  
HELX_P HELX_P9  AA9 CYS A 190 ? GLU A 205 ? CYS A 265 GLU A 280 1 ? 16 
HELX_P HELX_P10 AB1 THR A 206 ? ASN A 227 ? THR A 281 ASN A 302 1 ? 22 
HELX_P HELX_P11 AB2 ASN A 245 ? ASN A 257 ? ASN A 320 ASN A 332 1 ? 13 
HELX_P HELX_P12 AB3 ASN A 257 ? ALA A 268 ? ASN A 332 ALA A 343 1 ? 12 
HELX_P HELX_P13 AB4 GLY A 269 ? ILE A 274 ? GLY A 344 ILE A 349 5 ? 6  
HELX_P HELX_P14 AB5 ASN A 278 ? THR A 301 ? ASN A 353 THR A 376 1 ? 24 
HELX_P HELX_P15 AB6 SER A 306 ? CYS A 308 ? SER A 381 CYS A 383 5 ? 3  
HELX_P HELX_P16 AB7 PHE A 309 ? CYS A 321 ? PHE A 384 CYS A 396 1 ? 13 
HELX_P HELX_P17 AB8 VAL A 328 ? ILE A 345 ? VAL A 403 ILE A 420 1 ? 18 
HELX_P HELX_P18 AB9 TRP A 346 ? LEU A 350 ? TRP A 421 LEU A 425 5 ? 5  
HELX_P HELX_P19 AC1 SER A 351 ? PHE A 360 ? SER A 426 PHE A 435 1 ? 10 
HELX_P HELX_P20 AC2 LYS A 371 ? GLU A 384 ? LYS A 446 GLU A 459 1 ? 14 
HELX_P HELX_P21 AC3 SER A 426 ? LYS A 434 ? SER A 521 LYS A 529 1 ? 9  
HELX_P HELX_P22 AC4 LYS A 444 ? LEU A 451 ? LYS A 539 LEU A 546 1 ? 8  
HELX_P HELX_P23 AC5 LEU A 459 ? SER A 468 ? LEU A 554 SER A 563 1 ? 10 
HELX_P HELX_P24 AC6 SER A 473 ? ILE A 487 ? SER A 568 ILE A 582 1 ? 15 
HELX_P HELX_P25 AC7 GLY A 495 ? CYS A 513 ? GLY A 590 CYS A 608 1 ? 19 
HELX_P HELX_P26 AC8 SER E 12  ? GLU E 18  ? SER E 87  GLU E 93  1 ? 7  
HELX_P HELX_P27 AC9 GLU E 21  ? ASP E 30  ? GLU E 96  ASP E 105 1 ? 10 
HELX_P HELX_P28 AD1 PRO E 33  ? VAL E 37  ? PRO E 108 VAL E 112 5 ? 5  
HELX_P HELX_P29 AD2 GLY E 39  ? GLY E 57  ? GLY E 114 GLY E 132 1 ? 19 
HELX_P HELX_P30 AD3 ASN E 61  ? LEU E 66  ? ASN E 136 LEU E 141 1 ? 6  
HELX_P HELX_P31 AD4 SER E 68  ? LYS E 97  ? SER E 143 LYS E 172 1 ? 30 
HELX_P HELX_P32 AD5 THR E 145 ? GLN E 159 ? THR E 220 GLN E 234 1 ? 15 
HELX_P HELX_P33 AD6 GLY E 175 ? LEU E 182 ? GLY E 250 LEU E 257 1 ? 8  
HELX_P HELX_P34 AD7 CYS E 190 ? GLU E 205 ? CYS E 265 GLU E 280 1 ? 16 
HELX_P HELX_P35 AD8 THR E 206 ? ASN E 227 ? THR E 281 ASN E 302 1 ? 22 
HELX_P HELX_P36 AD9 ASN E 245 ? ASP E 256 ? ASN E 320 ASP E 331 1 ? 12 
HELX_P HELX_P37 AE1 ASN E 257 ? GLU E 267 ? ASN E 332 GLU E 342 1 ? 11 
HELX_P HELX_P38 AE2 GLU E 270 ? ILE E 274 ? GLU E 345 ILE E 349 5 ? 5  
HELX_P HELX_P39 AE3 ASN E 278 ? THR E 301 ? ASN E 353 THR E 376 1 ? 24 
HELX_P HELX_P40 AE4 SER E 306 ? CYS E 308 ? SER E 381 CYS E 383 5 ? 3  
HELX_P HELX_P41 AE5 PHE E 309 ? SER E 322 ? PHE E 384 SER E 397 1 ? 14 
HELX_P HELX_P42 AE6 VAL E 328 ? ILE E 345 ? VAL E 403 ILE E 420 1 ? 18 
HELX_P HELX_P43 AE7 TRP E 346 ? LEU E 350 ? TRP E 421 LEU E 425 5 ? 5  
HELX_P HELX_P44 AE8 SER E 351 ? PHE E 360 ? SER E 426 PHE E 435 1 ? 10 
HELX_P HELX_P45 AE9 LEU E 365 ? GLN E 369 ? LEU E 440 GLN E 444 5 ? 5  
HELX_P HELX_P46 AF1 GLU E 370 ? GLU E 384 ? GLU E 445 GLU E 459 1 ? 15 
HELX_P HELX_P47 AF2 SER E 424 ? LYS E 434 ? SER E 519 LYS E 529 1 ? 11 
HELX_P HELX_P48 AF3 LYS E 444 ? ASN E 452 ? LYS E 539 ASN E 547 1 ? 9  
HELX_P HELX_P49 AF4 TYR E 456 ? LYS E 461 ? TYR E 551 LYS E 556 1 ? 6  
HELX_P HELX_P50 AF5 LYS E 461 ? SER E 468 ? LYS E 556 SER E 563 1 ? 8  
HELX_P HELX_P51 AF6 SER E 473 ? ILE E 487 ? SER E 568 ILE E 582 1 ? 15 
HELX_P HELX_P52 AF7 GLY E 495 ? CYS E 513 ? GLY E 590 CYS E 608 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? B DG 1  N1 ? ? ? 1_555 C DC 15 N3 ? ? B DG 2  C DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog2   hydrog ? ? B DG 1  N2 ? ? ? 1_555 C DC 15 O2 ? ? B DG 2  C DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog3   hydrog ? ? B DG 1  O6 ? ? ? 1_555 C DC 15 N4 ? ? B DG 2  C DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog4   hydrog ? ? B DA 2  N1 ? ? ? 1_555 C DT 14 N3 ? ? B DA 3  C DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog5   hydrog ? ? B DA 2  N6 ? ? ? 1_555 C DT 14 O4 ? ? B DA 3  C DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog6   hydrog ? ? B DG 3  N1 ? ? ? 1_555 C DC 13 N3 ? ? B DG 4  C DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog7   hydrog ? ? B DG 3  N2 ? ? ? 1_555 C DC 13 O2 ? ? B DG 4  C DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog8   hydrog ? ? B DG 3  O6 ? ? ? 1_555 C DC 13 N4 ? ? B DG 4  C DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog9   hydrog ? ? B DA 4  N1 ? ? ? 1_555 C DT 12 N3 ? ? B DA 5  C DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog10  hydrog ? ? B DA 4  N6 ? ? ? 1_555 C DT 12 O4 ? ? B DA 5  C DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog11  hydrog ? ? B DA 5  N1 ? ? ? 1_555 C DT 11 N3 ? ? B DA 6  C DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog12  hydrog ? ? B DA 5  N6 ? ? ? 1_555 C DT 11 O4 ? ? B DA 6  C DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog13  hydrog ? ? B DC 6  N3 ? ? ? 1_555 C DG 10 N1 ? ? B DC 7  C DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog14  hydrog ? ? B DC 6  N4 ? ? ? 1_555 C DG 10 O6 ? ? B DC 7  C DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog15  hydrog ? ? B DC 6  O2 ? ? ? 1_555 C DG 10 N2 ? ? B DC 7  C DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog16  hydrog ? ? B DA 7  N1 ? ? ? 1_555 C DT 9  N3 ? ? B DA 8  C DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog17  hydrog ? ? B DA 7  N6 ? ? ? 1_555 C DT 9  O4 ? ? B DA 8  C DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog18  hydrog ? ? B DA 8  N1 ? ? ? 1_555 C DT 8  N3 ? ? B DA 9  C DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog19  hydrog ? ? B DA 8  N6 ? ? ? 1_555 C DT 8  O4 ? ? B DA 9  C DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog20  hydrog ? ? B DC 9  N3 ? ? ? 1_555 C DG 7  N1 ? ? B DC 10 C DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog21  hydrog ? ? B DC 9  N4 ? ? ? 1_555 C DG 7  O6 ? ? B DC 10 C DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog22  hydrog ? ? B DC 9  O2 ? ? ? 1_555 C DG 7  N2 ? ? B DC 10 C DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog23  hydrog ? ? B DA 10 N1 ? ? ? 1_555 C DT 6  N3 ? ? B DA 11 C DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog24  hydrog ? ? B DA 10 N6 ? ? ? 1_555 C DT 6  O4 ? ? B DA 11 C DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog25  hydrog ? ? B DA 11 N1 ? ? ? 1_555 C DT 5  N3 ? ? B DA 12 C DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog26  hydrog ? ? B DA 11 N6 ? ? ? 1_555 C DT 5  O4 ? ? B DA 12 C DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog27  hydrog ? ? B DC 12 N3 ? ? ? 1_555 C DG 4  N1 ? ? B DC 13 C DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog28  hydrog ? ? B DC 12 N4 ? ? ? 1_555 C DG 4  O6 ? ? B DC 13 C DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog29  hydrog ? ? B DC 12 O2 ? ? ? 1_555 C DG 4  N2 ? ? B DC 13 C DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog30  hydrog ? ? B DA 13 N1 ? ? ? 1_555 C DT 3  N3 ? ? B DA 14 C DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog31  hydrog ? ? B DA 13 N6 ? ? ? 1_555 C DT 3  O4 ? ? B DA 14 C DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog32  hydrog ? ? B DA 14 N1 ? ? ? 1_555 C DT 2  N3 ? ? B DA 15 C DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog33  hydrog ? ? B DA 14 N6 ? ? ? 1_555 C DT 2  O4 ? ? B DA 15 C DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog34  hydrog ? ? B DG 15 N1 ? ? ? 1_555 C DC 1  N3 ? ? B DG 16 C DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog35  hydrog ? ? B DG 15 N2 ? ? ? 1_555 C DC 1  O2 ? ? B DG 16 C DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog36  hydrog ? ? B DG 15 O6 ? ? ? 1_555 C DC 1  N4 ? ? B DG 16 C DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog37  hydrog ? ? C DG 18 N1 ? ? ? 1_555 D DC 7  O2 ? ? C DG 18 D DC 7  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog38  hydrog ? ? C DG 19 N1 ? ? ? 1_555 D DA 6  N1 ? ? C DG 19 D DA 6  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog39  hydrog ? ? C DG 19 O6 ? ? ? 1_555 D DA 6  N6 ? ? C DG 19 D DA 6  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog40  hydrog ? ? C DG 19 N1 ? ? ? 1_555 D DC 7  N3 ? ? C DG 19 D DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog41  hydrog ? ? C DG 19 N2 ? ? ? 1_555 D DC 7  O2 ? ? C DG 19 D DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog42  hydrog ? ? C DG 19 O6 ? ? ? 1_555 D DC 7  N4 ? ? C DG 19 D DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog43  hydrog ? ? C DT 20 N3 ? ? ? 1_555 D DA 6  N1 ? ? C DT 20 D DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog44  hydrog ? ? C DT 20 O4 ? ? ? 1_555 D DA 6  N6 ? ? C DT 20 D DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog45  hydrog ? ? C DC 21 N3 ? ? ? 1_555 D DG 5  N1 ? ? C DC 21 D DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog46  hydrog ? ? C DC 21 N4 ? ? ? 1_555 D DG 5  O6 ? ? C DC 21 D DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog47  hydrog ? ? C DC 21 O2 ? ? ? 1_555 D DG 5  N2 ? ? C DC 21 D DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog48  hydrog ? ? C DA 22 N1 ? ? ? 1_555 D DT 4  N3 ? ? C DA 22 D DT 4  1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog49  hydrog ? ? C DC 23 N3 ? ? ? 1_555 D DG 3  N1 ? ? C DC 23 D DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog50  hydrog ? ? C DC 23 N4 ? ? ? 1_555 D DG 3  O6 ? ? C DC 23 D DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog51  hydrog ? ? C DC 23 O2 ? ? ? 1_555 D DG 3  N2 ? ? C DC 23 D DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog52  hydrog ? ? C DG 24 N1 ? ? ? 1_555 D DC 2  O2 ? ? C DG 24 D DC 2  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog53  hydrog ? ? C DG 24 N2 ? ? ? 1_555 D DC 2  N3 ? ? C DG 24 D DC 2  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog54  hydrog ? ? C DC 25 N3 ? ? ? 1_555 D DG 1  N1 ? ? C DC 25 D DG 1  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog55  hydrog ? ? C DC 25 N4 ? ? ? 1_555 D DG 1  O6 ? ? C DC 25 D DG 1  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog56  hydrog ? ? C DC 25 O2 ? ? ? 1_555 D DG 1  N2 ? ? C DC 25 D DG 1  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog57  hydrog ? ? F DG 1  N1 ? ? ? 1_555 G DC 15 N3 ? ? F DG 2  G DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog58  hydrog ? ? F DG 1  N2 ? ? ? 1_555 G DC 15 O2 ? ? F DG 2  G DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog59  hydrog ? ? F DG 1  O6 ? ? ? 1_555 G DC 15 N4 ? ? F DG 2  G DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog60  hydrog ? ? F DA 2  N1 ? ? ? 1_555 G DT 14 N3 ? ? F DA 3  G DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog61  hydrog ? ? F DA 2  N6 ? ? ? 1_555 G DT 14 O4 ? ? F DA 3  G DT 14 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog62  hydrog ? ? F DG 3  N1 ? ? ? 1_555 G DC 13 N3 ? ? F DG 4  G DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog63  hydrog ? ? F DG 3  N2 ? ? ? 1_555 G DC 13 O2 ? ? F DG 4  G DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog64  hydrog ? ? F DG 3  O6 ? ? ? 1_555 G DC 13 N4 ? ? F DG 4  G DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog65  hydrog ? ? F DA 4  N1 ? ? ? 1_555 G DT 12 N3 ? ? F DA 5  G DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog66  hydrog ? ? F DA 4  N6 ? ? ? 1_555 G DT 12 O4 ? ? F DA 5  G DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog67  hydrog ? ? F DA 5  N1 ? ? ? 1_555 G DT 11 N3 ? ? F DA 6  G DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog68  hydrog ? ? F DA 5  N6 ? ? ? 1_555 G DT 11 O4 ? ? F DA 6  G DT 11 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog69  hydrog ? ? F DC 6  N3 ? ? ? 1_555 G DG 10 N1 ? ? F DC 7  G DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog70  hydrog ? ? F DC 6  N4 ? ? ? 1_555 G DG 10 O6 ? ? F DC 7  G DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog71  hydrog ? ? F DC 6  O2 ? ? ? 1_555 G DG 10 N2 ? ? F DC 7  G DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog72  hydrog ? ? F DA 7  N1 ? ? ? 1_555 G DT 9  N3 ? ? F DA 8  G DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog73  hydrog ? ? F DA 7  N6 ? ? ? 1_555 G DT 9  O4 ? ? F DA 8  G DT 9  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog74  hydrog ? ? F DA 8  N1 ? ? ? 1_555 G DT 8  N3 ? ? F DA 9  G DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog75  hydrog ? ? F DA 8  N6 ? ? ? 1_555 G DT 8  O4 ? ? F DA 9  G DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog76  hydrog ? ? F DC 9  N3 ? ? ? 1_555 G DG 7  N1 ? ? F DC 10 G DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog77  hydrog ? ? F DC 9  N4 ? ? ? 1_555 G DG 7  O6 ? ? F DC 10 G DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog78  hydrog ? ? F DC 9  O2 ? ? ? 1_555 G DG 7  N2 ? ? F DC 10 G DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog79  hydrog ? ? F DA 10 N1 ? ? ? 1_555 G DT 6  N3 ? ? F DA 11 G DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog80  hydrog ? ? F DA 10 N6 ? ? ? 1_555 G DT 6  O4 ? ? F DA 11 G DT 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog81  hydrog ? ? F DA 11 N1 ? ? ? 1_555 G DT 5  N3 ? ? F DA 12 G DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog82  hydrog ? ? F DA 11 N6 ? ? ? 1_555 G DT 5  O4 ? ? F DA 12 G DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog83  hydrog ? ? F DC 12 N3 ? ? ? 1_555 G DG 4  N1 ? ? F DC 13 G DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog84  hydrog ? ? F DC 12 N4 ? ? ? 1_555 G DG 4  O6 ? ? F DC 13 G DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog85  hydrog ? ? F DC 12 O2 ? ? ? 1_555 G DG 4  N2 ? ? F DC 13 G DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog86  hydrog ? ? F DA 13 N1 ? ? ? 1_555 G DT 3  N3 ? ? F DA 14 G DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog87  hydrog ? ? F DA 13 N6 ? ? ? 1_555 G DT 3  O4 ? ? F DA 14 G DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog88  hydrog ? ? F DA 14 N1 ? ? ? 1_555 G DT 2  N3 ? ? F DA 15 G DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog89  hydrog ? ? F DA 14 N6 ? ? ? 1_555 G DT 2  O4 ? ? F DA 15 G DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog90  hydrog ? ? F DG 15 N1 ? ? ? 1_555 G DC 1  N3 ? ? F DG 16 G DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog91  hydrog ? ? F DG 15 N2 ? ? ? 1_555 G DC 1  O2 ? ? F DG 16 G DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog92  hydrog ? ? F DG 15 O6 ? ? ? 1_555 G DC 1  N4 ? ? F DG 16 G DC 1  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog93  hydrog ? ? G DG 19 N1 ? ? ? 1_555 H DA 6  N1 ? ? G DG 19 H DA 6  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog94  hydrog ? ? G DG 19 O6 ? ? ? 1_555 H DA 6  N6 ? ? G DG 19 H DA 6  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog95  hydrog ? ? G DG 19 N1 ? ? ? 1_555 H DC 7  N3 ? ? G DG 19 H DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog96  hydrog ? ? G DG 19 N2 ? ? ? 1_555 H DC 7  O2 ? ? G DG 19 H DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog97  hydrog ? ? G DG 19 O6 ? ? ? 1_555 H DC 7  N4 ? ? G DG 19 H DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog98  hydrog ? ? G DT 20 N3 ? ? ? 1_555 H DA 6  N1 ? ? G DT 20 H DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog99  hydrog ? ? G DT 20 O4 ? ? ? 1_555 H DA 6  N6 ? ? G DT 20 H DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog100 hydrog ? ? G DC 21 N3 ? ? ? 1_555 H DG 5  N1 ? ? G DC 21 H DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog101 hydrog ? ? G DC 21 N4 ? ? ? 1_555 H DG 5  O6 ? ? G DC 21 H DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog102 hydrog ? ? G DC 21 O2 ? ? ? 1_555 H DG 5  N2 ? ? G DC 21 H DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog103 hydrog ? ? G DA 22 N1 ? ? ? 1_555 H DT 4  N3 ? ? G DA 22 H DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog104 hydrog ? ? G DA 22 N6 ? ? ? 1_555 H DT 4  O4 ? ? G DA 22 H DT 4  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog105 hydrog ? ? G DC 23 N3 ? ? ? 1_555 H DG 3  N1 ? ? G DC 23 H DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog106 hydrog ? ? G DC 23 N4 ? ? ? 1_555 H DG 3  O6 ? ? G DC 23 H DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog107 hydrog ? ? G DC 23 O2 ? ? ? 1_555 H DG 3  N2 ? ? G DC 23 H DG 3  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog108 hydrog ? ? G DG 24 N2 ? ? ? 1_555 H DC 2  N3 ? ? G DG 24 H DC 2  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog109 hydrog ? ? G DC 25 N3 ? ? ? 1_555 H DG 1  N1 ? ? G DC 25 H DG 1  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog110 hydrog ? ? G DC 25 N4 ? ? ? 1_555 H DG 1  O6 ? ? G DC 25 H DG 1  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog111 hydrog ? ? G DC 25 O2 ? ? ? 1_555 H DG 1  N2 ? ? G DC 25 H DG 1  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 130 ? SER A 138 ? ARG A 205 SER A 213 
AA1 2 ASN A 115 ? TYR A 123 ? ASN A 190 TYR A 198 
AA1 3 SER A 101 ? THR A 108 ? SER A 176 THR A 183 
AA1 4 LYS A 169 ? THR A 172 ? LYS A 244 THR A 247 
AA1 5 ILE A 186 ? ASN A 189 ? ILE A 261 ASN A 264 
AA2 1 ARG E 130 ? SER E 138 ? ARG E 205 SER E 213 
AA2 2 ASN E 115 ? TYR E 123 ? ASN E 190 TYR E 198 
AA2 3 SER E 101 ? THR E 108 ? SER E 176 THR E 183 
AA2 4 LYS E 169 ? THR E 172 ? LYS E 244 THR E 247 
AA2 5 ILE E 186 ? ASN E 189 ? ILE E 261 ASN E 264 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ARG A 130 ? O ARG A 205 N TYR A 123 ? N TYR A 198 
AA1 2 3 O GLY A 118 ? O GLY A 193 N ASP A 105 ? N ASP A 180 
AA1 3 4 N ALA A 102 ? N ALA A 177 O VAL A 171 ? O VAL A 246 
AA1 4 5 N PHE A 170 ? N PHE A 245 O ILE A 188 ? O ILE A 263 
AA2 1 2 O LEU E 132 ? O LEU E 207 N LEU E 121 ? N LEU E 196 
AA2 2 3 O HIS E 122 ? O HIS E 197 N SER E 101 ? N SER E 176 
AA2 3 4 N ALA E 102 ? N ALA E 177 O LYS E 169 ? O LYS E 244 
AA2 4 5 N PHE E 170 ? N PHE E 245 O ILE E 188 ? O ILE E 263 
# 
_atom_sites.entry_id                    6DWZ 
_atom_sites.fract_transf_matrix[1][1]   0.010376 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008257 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007565 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N     . ARG A 1 6   ? 65.447  101.207 63.936  1.00 161.62 ? 81  ARG A N     1 
ATOM 2    C CA    . ARG A 1 6   ? 65.951  99.924  64.424  1.00 158.45 ? 81  ARG A CA    1 
ATOM 3    C C     . ARG A 1 6   ? 65.067  99.333  65.529  1.00 148.08 ? 81  ARG A C     1 
ATOM 4    O O     . ARG A 1 6   ? 64.245  98.465  65.248  1.00 138.95 ? 81  ARG A O     1 
ATOM 5    C CB    . ARG A 1 6   ? 67.386  100.073 64.929  1.00 159.85 ? 81  ARG A CB    1 
ATOM 6    C CG    . ARG A 1 6   ? 68.394  99.167  64.234  1.00 146.42 ? 81  ARG A CG    1 
ATOM 7    C CD    . ARG A 1 6   ? 68.994  99.804  62.979  1.00 145.06 ? 81  ARG A CD    1 
ATOM 8    N NE    . ARG A 1 6   ? 68.160  99.631  61.788  1.00 153.00 ? 81  ARG A NE    1 
ATOM 9    C CZ    . ARG A 1 6   ? 68.268  98.612  60.937  1.00 153.12 ? 81  ARG A CZ    1 
ATOM 10   N NH1   . ARG A 1 6   ? 69.170  97.663  61.145  1.00 177.40 ? 81  ARG A NH1   1 
ATOM 11   N NH2   . ARG A 1 6   ? 67.477  98.535  59.877  1.00 135.82 ? 81  ARG A NH2   1 
ATOM 12   N N     . GLU A 1 7   ? 65.219  99.829  66.764  1.00 160.12 ? 82  GLU A N     1 
ATOM 13   C CA    . GLU A 1 7   ? 64.530  99.264  67.925  1.00 159.80 ? 82  GLU A CA    1 
ATOM 14   C C     . GLU A 1 7   ? 63.011  99.398  67.785  1.00 158.53 ? 82  GLU A C     1 
ATOM 15   O O     . GLU A 1 7   ? 62.494  100.239 67.042  1.00 156.74 ? 82  GLU A O     1 
ATOM 16   C CB    . GLU A 1 7   ? 64.990  99.940  69.228  1.00 142.24 ? 82  GLU A CB    1 
ATOM 17   C CG    . GLU A 1 7   ? 64.863  99.054  70.498  1.00 146.60 ? 82  GLU A CG    1 
ATOM 18   C CD    . GLU A 1 7   ? 63.742  99.474  71.470  1.00 151.17 ? 82  GLU A CD    1 
ATOM 19   O OE1   . GLU A 1 7   ? 63.456  100.683 71.581  1.00 155.16 ? 82  GLU A OE1   1 
ATOM 20   O OE2   . GLU A 1 7   ? 63.152  98.591  72.141  1.00 146.37 ? 82  GLU A OE2   1 
ATOM 21   N N     . LEU A 1 8   ? 62.292  98.536  68.506  1.00 150.87 ? 83  LEU A N     1 
ATOM 22   C CA    . LEU A 1 8   ? 60.844  98.464  68.407  1.00 128.64 ? 83  LEU A CA    1 
ATOM 23   C C     . LEU A 1 8   ? 60.227  98.472  69.800  1.00 116.56 ? 83  LEU A C     1 
ATOM 24   O O     . LEU A 1 8   ? 60.859  98.122  70.804  1.00 102.98 ? 83  LEU A O     1 
ATOM 25   C CB    . LEU A 1 8   ? 60.398  97.220  67.631  1.00 133.70 ? 83  LEU A CB    1 
ATOM 26   C CG    . LEU A 1 8   ? 61.295  96.724  66.486  1.00 143.28 ? 83  LEU A CG    1 
ATOM 27   C CD1   . LEU A 1 8   ? 61.282  95.193  66.411  1.00 143.18 ? 83  LEU A CD1   1 
ATOM 28   C CD2   . LEU A 1 8   ? 60.923  97.330  65.132  1.00 130.42 ? 83  LEU A CD2   1 
ATOM 29   N N     . LYS A 1 9   ? 58.968  98.874  69.842  1.00 112.37 ? 84  LYS A N     1 
ATOM 30   C CA    . LYS A 1 9   ? 58.362  99.214  71.116  1.00 110.27 ? 84  LYS A CA    1 
ATOM 31   C C     . LYS A 1 9   ? 58.157  97.960  71.947  1.00 86.74  ? 84  LYS A C     1 
ATOM 32   O O     . LYS A 1 9   ? 57.436  97.041  71.545  1.00 95.55  ? 84  LYS A O     1 
ATOM 33   C CB    . LYS A 1 9   ? 57.026  99.929  70.897  1.00 109.83 ? 84  LYS A CB    1 
ATOM 34   C CG    . LYS A 1 9   ? 57.021  100.996 69.796  1.00 110.13 ? 84  LYS A CG    1 
ATOM 35   C CD    . LYS A 1 9   ? 55.651  101.681 69.680  1.00 112.21 ? 84  LYS A CD    1 
ATOM 36   C CE    . LYS A 1 9   ? 55.554  102.992 70.494  1.00 123.95 ? 84  LYS A CE    1 
ATOM 37   N NZ    . LYS A 1 9   ? 55.970  102.882 71.937  1.00 110.59 ? 84  LYS A NZ    1 
ATOM 38   N N     . THR A 1 10  ? 58.765  97.931  73.113  1.00 68.92  ? 85  THR A N     1 
ATOM 39   C CA    . THR A 1 10  ? 58.159  97.168  74.180  1.00 80.25  ? 85  THR A CA    1 
ATOM 40   C C     . THR A 1 10  ? 56.771  97.723  74.445  1.00 78.80  ? 85  THR A C     1 
ATOM 41   O O     . THR A 1 10  ? 56.632  98.920  74.692  1.00 105.52 ? 85  THR A O     1 
ATOM 42   C CB    . THR A 1 10  ? 59.008  97.282  75.427  1.00 74.81  ? 85  THR A CB    1 
ATOM 43   O OG1   . THR A 1 10  ? 60.315  96.776  75.137  1.00 101.51 ? 85  THR A OG1   1 
ATOM 44   C CG2   . THR A 1 10  ? 58.351  96.523  76.572  1.00 46.07  ? 85  THR A CG2   1 
ATOM 45   N N     . VAL A 1 11  ? 55.736  96.877  74.361  1.00 83.98  ? 86  VAL A N     1 
ATOM 46   C CA    . VAL A 1 11  ? 54.380  97.225  74.831  1.00 104.41 ? 86  VAL A CA    1 
ATOM 47   C C     . VAL A 1 11  ? 54.231  97.087  76.363  1.00 102.24 ? 86  VAL A C     1 
ATOM 48   O O     . VAL A 1 11  ? 55.103  96.520  77.049  1.00 94.25  ? 86  VAL A O     1 
ATOM 49   C CB    . VAL A 1 11  ? 53.267  96.444  74.065  1.00 101.70 ? 86  VAL A CB    1 
ATOM 50   C CG1   . VAL A 1 11  ? 53.640  96.181  72.579  1.00 70.00  ? 86  VAL A CG1   1 
ATOM 51   C CG2   . VAL A 1 11  ? 52.822  95.160  74.784  1.00 94.67  ? 86  VAL A CG2   1 
ATOM 52   N N     . SER A 1 12  ? 53.149  97.658  76.913  1.00 70.58  ? 87  SER A N     1 
ATOM 53   C CA    . SER A 1 12  ? 52.946  97.762  78.361  1.00 89.46  ? 87  SER A CA    1 
ATOM 54   C C     . SER A 1 12  ? 52.693  96.422  79.067  1.00 86.25  ? 87  SER A C     1 
ATOM 55   O O     . SER A 1 12  ? 52.248  95.442  78.476  1.00 87.03  ? 87  SER A O     1 
ATOM 56   C CB    . SER A 1 12  ? 51.757  98.657  78.641  1.00 81.14  ? 87  SER A CB    1 
ATOM 57   O OG    . SER A 1 12  ? 50.756  98.384  77.686  1.00 81.24  ? 87  SER A OG    1 
ATOM 58   N N     . ALA A 1 13  ? 52.915  96.432  80.387  1.00 87.54  ? 88  ALA A N     1 
ATOM 59   C CA    . ALA A 1 13  ? 52.558  95.302  81.249  1.00 96.81  ? 88  ALA A CA    1 
ATOM 60   C C     . ALA A 1 13  ? 51.102  94.866  81.085  1.00 93.28  ? 88  ALA A C     1 
ATOM 61   O O     . ALA A 1 13  ? 50.770  93.685  81.238  1.00 86.21  ? 88  ALA A O     1 
ATOM 62   C CB    . ALA A 1 13  ? 52.816  95.668  82.711  1.00 97.79  ? 88  ALA A CB    1 
ATOM 63   N N     . ASP A 1 14  ? 50.208  95.804  80.835  1.00 100.67 ? 89  ASP A N     1 
ATOM 64   C CA    . ASP A 1 14  ? 48.822  95.405  80.673  1.00 103.41 ? 89  ASP A CA    1 
ATOM 65   C C     . ASP A 1 14  ? 48.509  94.964  79.255  1.00 92.26  ? 89  ASP A C     1 
ATOM 66   O O     . ASP A 1 14  ? 47.461  94.356  79.027  1.00 86.44  ? 89  ASP A O     1 
ATOM 67   C CB    . ASP A 1 14  ? 47.896  96.542  81.118  1.00 108.10 ? 89  ASP A CB    1 
ATOM 68   C CG    . ASP A 1 14  ? 47.860  96.681  82.635  1.00 122.11 ? 89  ASP A CG    1 
ATOM 69   O OD1   . ASP A 1 14  ? 48.887  96.342  83.275  1.00 133.49 ? 89  ASP A OD1   1 
ATOM 70   O OD2   . ASP A 1 14  ? 46.812  97.096  83.188  1.00 101.71 ? 89  ASP A OD2   1 
ATOM 71   N N     . CYS A 1 15  ? 49.353  95.304  78.290  1.00 85.47  ? 90  CYS A N     1 
ATOM 72   C CA    . CYS A 1 15  ? 49.179  94.748  76.958  1.00 84.63  ? 90  CYS A CA    1 
ATOM 73   C C     . CYS A 1 15  ? 49.863  93.401  76.808  1.00 96.13  ? 90  CYS A C     1 
ATOM 74   O O     . CYS A 1 15  ? 49.332  92.506  76.139  1.00 101.02 ? 90  CYS A O     1 
ATOM 75   C CB    . CYS A 1 15  ? 49.687  95.711  75.898  1.00 90.00  ? 90  CYS A CB    1 
ATOM 76   S SG    . CYS A 1 15  ? 49.192  95.266  74.241  1.00 82.44  ? 90  CYS A SG    1 
ATOM 77   N N     . LYS A 1 16  ? 51.049  93.242  77.395  1.00 91.81  ? 91  LYS A N     1 
ATOM 78   C CA    . LYS A 1 16  ? 51.606  91.903  77.510  1.00 87.21  ? 91  LYS A CA    1 
ATOM 79   C C     . LYS A 1 16  ? 50.563  90.990  78.122  1.00 83.49  ? 91  LYS A C     1 
ATOM 80   O O     . LYS A 1 16  ? 50.058  90.082  77.458  1.00 91.25  ? 91  LYS A O     1 
ATOM 81   C CB    . LYS A 1 16  ? 52.876  91.922  78.369  1.00 106.02 ? 91  LYS A CB    1 
ATOM 82   C CG    . LYS A 1 16  ? 53.963  90.914  77.988  1.00 116.42 ? 91  LYS A CG    1 
ATOM 83   C CD    . LYS A 1 16  ? 55.227  91.133  78.834  1.00 126.41 ? 91  LYS A CD    1 
ATOM 84   C CE    . LYS A 1 16  ? 56.411  90.303  78.329  1.00 145.50 ? 91  LYS A CE    1 
ATOM 85   N NZ    . LYS A 1 16  ? 57.708  90.686  78.975  1.00 141.47 ? 91  LYS A NZ    1 
ATOM 86   N N     . LYS A 1 17  ? 50.110  91.335  79.330  1.00 77.18  ? 92  LYS A N     1 
ATOM 87   C CA    . LYS A 1 17  ? 49.229  90.465  80.100  1.00 85.61  ? 92  LYS A CA    1 
ATOM 88   C C     . LYS A 1 17  ? 48.037  89.955  79.286  1.00 75.17  ? 92  LYS A C     1 
ATOM 89   O O     . LYS A 1 17  ? 47.475  88.902  79.600  1.00 73.27  ? 92  LYS A O     1 
ATOM 90   C CB    . LYS A 1 17  ? 48.733  91.229  81.333  1.00 92.92  ? 92  LYS A CB    1 
ATOM 91   C CG    . LYS A 1 17  ? 48.676  90.419  82.599  1.00 90.05  ? 92  LYS A CG    1 
ATOM 92   C CD    . LYS A 1 17  ? 50.069  90.204  83.173  1.00 94.05  ? 92  LYS A CD    1 
ATOM 93   C CE    . LYS A 1 17  ? 50.006  89.217  84.334  1.00 106.53 ? 92  LYS A CE    1 
ATOM 94   N NZ    . LYS A 1 17  ? 50.246  89.811  85.685  1.00 95.14  ? 92  LYS A NZ    1 
ATOM 95   N N     . GLU A 1 18  ? 47.600  90.713  78.280  1.00 72.21  ? 93  GLU A N     1 
ATOM 96   C CA    . GLU A 1 18  ? 46.469  90.298  77.457  1.00 88.11  ? 93  GLU A CA    1 
ATOM 97   C C     . GLU A 1 18  ? 46.875  89.381  76.295  1.00 91.17  ? 93  GLU A C     1 
ATOM 98   O O     . GLU A 1 18  ? 46.106  88.495  75.896  1.00 84.55  ? 93  GLU A O     1 
ATOM 99   C CB    . GLU A 1 18  ? 45.729  91.527  76.951  1.00 77.00  ? 93  GLU A CB    1 
ATOM 100  C CG    . GLU A 1 18  ? 44.215  91.375  77.027  1.00 82.61  ? 93  GLU A CG    1 
ATOM 101  C CD    . GLU A 1 18  ? 43.510  91.746  75.715  1.00 112.47 ? 93  GLU A CD    1 
ATOM 102  O OE1   . GLU A 1 18  ? 42.860  90.856  75.120  1.00 107.52 ? 93  GLU A OE1   1 
ATOM 103  O OE2   . GLU A 1 18  ? 43.602  92.924  75.274  1.00 126.65 ? 93  GLU A OE2   1 
ATOM 104  N N     . ALA A 1 19  ? 48.048  89.593  75.701  1.00 87.39  ? 94  ALA A N     1 
ATOM 105  C CA    . ALA A 1 19  ? 48.532  88.607  74.742  1.00 83.86  ? 94  ALA A CA    1 
ATOM 106  C C     . ALA A 1 19  ? 48.613  87.216  75.374  1.00 91.35  ? 94  ALA A C     1 
ATOM 107  O O     . ALA A 1 19  ? 48.426  86.207  74.683  1.00 95.13  ? 94  ALA A O     1 
ATOM 108  C CB    . ALA A 1 19  ? 49.890  89.033  74.185  1.00 72.09  ? 94  ALA A CB    1 
ATOM 109  N N     . ILE A 1 20  ? 48.908  87.135  76.673  1.00 78.15  ? 95  ILE A N     1 
ATOM 110  C CA    . ILE A 1 20  ? 48.802  85.869  77.372  1.00 66.38  ? 95  ILE A CA    1 
ATOM 111  C C     . ILE A 1 20  ? 47.365  85.380  77.201  1.00 83.83  ? 95  ILE A C     1 
ATOM 112  O O     . ILE A 1 20  ? 47.105  84.490  76.384  1.00 80.09  ? 95  ILE A O     1 
ATOM 113  C CB    . ILE A 1 20  ? 49.190  85.989  78.859  1.00 79.49  ? 95  ILE A CB    1 
ATOM 114  C CG1   . ILE A 1 20  ? 50.649  86.411  79.058  1.00 68.67  ? 95  ILE A CG1   1 
ATOM 115  C CG2   . ILE A 1 20  ? 49.091  84.666  79.521  1.00 71.17  ? 95  ILE A CG2   1 
ATOM 116  C CD1   . ILE A 1 20  ? 51.238  85.906  80.464  1.00 73.81  ? 95  ILE A CD1   1 
ATOM 117  N N     . GLU A 1 21  ? 46.404  86.024  77.884  1.00 95.10  ? 96  GLU A N     1 
ATOM 118  C CA    . GLU A 1 21  ? 45.053  85.463  77.960  1.00 93.08  ? 96  GLU A CA    1 
ATOM 119  C C     . GLU A 1 21  ? 44.356  85.397  76.613  1.00 81.01  ? 96  GLU A C     1 
ATOM 120  O O     . GLU A 1 21  ? 43.252  84.856  76.522  1.00 88.79  ? 96  GLU A O     1 
ATOM 121  C CB    . GLU A 1 21  ? 44.145  86.222  78.937  1.00 101.97 ? 96  GLU A CB    1 
ATOM 122  C CG    . GLU A 1 21  ? 42.928  85.320  79.341  1.00 123.41 ? 96  GLU A CG    1 
ATOM 123  C CD    . GLU A 1 21  ? 42.021  85.858  80.442  1.00 141.52 ? 96  GLU A CD    1 
ATOM 124  O OE1   . GLU A 1 21  ? 42.371  86.870  81.097  1.00 149.73 ? 96  GLU A OE1   1 
ATOM 125  O OE2   . GLU A 1 21  ? 40.946  85.239  80.647  1.00 128.32 ? 96  GLU A OE2   1 
ATOM 126  N N     . LYS A 1 22  ? 44.944  85.927  75.561  1.00 76.27  ? 97  LYS A N     1 
ATOM 127  C CA    . LYS A 1 22  ? 44.326  85.686  74.270  1.00 89.68  ? 97  LYS A CA    1 
ATOM 128  C C     . LYS A 1 22  ? 44.811  84.367  73.677  1.00 85.95  ? 97  LYS A C     1 
ATOM 129  O O     . LYS A 1 22  ? 44.010  83.462  73.420  1.00 93.17  ? 97  LYS A O     1 
ATOM 130  C CB    . LYS A 1 22  ? 44.596  86.859  73.330  1.00 89.16  ? 97  LYS A CB    1 
ATOM 131  C CG    . LYS A 1 22  ? 43.410  87.171  72.466  1.00 84.98  ? 97  LYS A CG    1 
ATOM 132  C CD    . LYS A 1 22  ? 42.093  87.029  73.272  1.00 115.60 ? 97  LYS A CD    1 
ATOM 133  C CE    . LYS A 1 22  ? 41.553  88.368  73.827  1.00 93.13  ? 97  LYS A CE    1 
ATOM 134  N NZ    . LYS A 1 22  ? 41.324  89.376  72.738  1.00 75.11  ? 97  LYS A NZ    1 
ATOM 135  N N     . CYS A 1 23  ? 46.117  84.265  73.427  1.00 68.92  ? 98  CYS A N     1 
ATOM 136  C CA    . CYS A 1 23  ? 46.706  83.015  72.973  1.00 72.90  ? 98  CYS A CA    1 
ATOM 137  C C     . CYS A 1 23  ? 46.327  81.845  73.875  1.00 66.48  ? 98  CYS A C     1 
ATOM 138  O O     . CYS A 1 23  ? 46.130  80.718  73.410  1.00 57.93  ? 98  CYS A O     1 
ATOM 139  C CB    . CYS A 1 23  ? 48.219  83.166  72.916  1.00 78.12  ? 98  CYS A CB    1 
ATOM 140  S SG    . CYS A 1 23  ? 48.777  84.357  71.735  1.00 69.58  ? 98  CYS A SG    1 
ATOM 141  N N     . ALA A 1 24  ? 46.234  82.086  75.172  1.00 65.97  ? 99  ALA A N     1 
ATOM 142  C CA    . ALA A 1 24  ? 45.720  81.043  76.037  1.00 66.86  ? 99  ALA A CA    1 
ATOM 143  C C     . ALA A 1 24  ? 44.364  80.565  75.545  1.00 66.34  ? 99  ALA A C     1 
ATOM 144  O O     . ALA A 1 24  ? 44.058  79.373  75.584  1.00 80.02  ? 99  ALA A O     1 
ATOM 145  C CB    . ALA A 1 24  ? 45.630  81.546  77.478  1.00 63.54  ? 99  ALA A CB    1 
ATOM 146  N N     . GLN A 1 25  ? 43.537  81.469  75.070  1.00 69.73  ? 100 GLN A N     1 
ATOM 147  C CA    . GLN A 1 25  ? 42.233  81.007  74.651  1.00 71.74  ? 100 GLN A CA    1 
ATOM 148  C C     . GLN A 1 25  ? 42.293  80.383  73.258  1.00 74.37  ? 100 GLN A C     1 
ATOM 149  O O     . GLN A 1 25  ? 41.551  79.439  72.980  1.00 77.39  ? 100 GLN A O     1 
ATOM 150  C CB    . GLN A 1 25  ? 41.236  82.158  74.774  1.00 84.44  ? 100 GLN A CB    1 
ATOM 151  C CG    . GLN A 1 25  ? 41.054  82.578  76.236  1.00 92.09  ? 100 GLN A CG    1 
ATOM 152  C CD    . GLN A 1 25  ? 40.138  83.777  76.403  1.00 106.51 ? 100 GLN A CD    1 
ATOM 153  O OE1   . GLN A 1 25  ? 39.446  84.178  75.457  1.00 102.50 ? 100 GLN A OE1   1 
ATOM 154  N NE2   . GLN A 1 25  ? 40.128  84.363  77.613  1.00 90.34  ? 100 GLN A NE2   1 
ATOM 155  N N     . TRP A 1 26  ? 43.205  80.833  72.397  1.00 61.63  ? 101 TRP A N     1 
ATOM 156  C CA    . TRP A 1 26  ? 43.465  80.124  71.147  1.00 58.53  ? 101 TRP A CA    1 
ATOM 157  C C     . TRP A 1 26  ? 43.676  78.636  71.372  1.00 69.64  ? 101 TRP A C     1 
ATOM 158  O O     . TRP A 1 26  ? 43.018  77.775  70.776  1.00 66.88  ? 101 TRP A O     1 
ATOM 159  C CB    . TRP A 1 26  ? 44.734  80.657  70.577  1.00 51.44  ? 101 TRP A CB    1 
ATOM 160  C CG    . TRP A 1 26  ? 45.085  80.115  69.354  1.00 52.01  ? 101 TRP A CG    1 
ATOM 161  C CD1   . TRP A 1 26  ? 44.255  79.725  68.374  1.00 54.07  ? 101 TRP A CD1   1 
ATOM 162  C CD2   . TRP A 1 26  ? 46.411  79.945  68.879  1.00 53.59  ? 101 TRP A CD2   1 
ATOM 163  N NE1   . TRP A 1 26  ? 44.983  79.315  67.276  1.00 61.50  ? 101 TRP A NE1   1 
ATOM 164  C CE2   . TRP A 1 26  ? 46.316  79.453  67.556  1.00 50.04  ? 101 TRP A CE2   1 
ATOM 165  C CE3   . TRP A 1 26  ? 47.677  80.167  69.441  1.00 44.33  ? 101 TRP A CE3   1 
ATOM 166  C CZ2   . TRP A 1 26  ? 47.440  79.182  66.768  1.00 33.14  ? 101 TRP A CZ2   1 
ATOM 167  C CZ3   . TRP A 1 26  ? 48.810  79.894  68.659  1.00 56.48  ? 101 TRP A CZ3   1 
ATOM 168  C CH2   . TRP A 1 26  ? 48.677  79.402  67.331  1.00 52.16  ? 101 TRP A CH2   1 
ATOM 169  N N     . VAL A 1 27  ? 44.659  78.341  72.210  1.00 71.48  ? 102 VAL A N     1 
ATOM 170  C CA    . VAL A 1 27  ? 44.989  76.989  72.624  1.00 57.66  ? 102 VAL A CA    1 
ATOM 171  C C     . VAL A 1 27  ? 43.747  76.232  73.062  1.00 68.69  ? 102 VAL A C     1 
ATOM 172  O O     . VAL A 1 27  ? 43.598  75.030  72.784  1.00 80.20  ? 102 VAL A O     1 
ATOM 173  C CB    . VAL A 1 27  ? 46.029  77.075  73.755  1.00 57.64  ? 102 VAL A CB    1 
ATOM 174  C CG1   . VAL A 1 27  ? 45.763  76.050  74.856  1.00 63.42  ? 102 VAL A CG1   1 
ATOM 175  C CG2   . VAL A 1 27  ? 47.410  76.983  73.208  1.00 39.68  ? 102 VAL A CG2   1 
ATOM 176  N N     . VAL A 1 28  ? 42.853  76.899  73.790  1.00 57.30  ? 103 VAL A N     1 
ATOM 177  C CA    . VAL A 1 28  ? 41.743  76.163  74.372  1.00 60.53  ? 103 VAL A CA    1 
ATOM 178  C C     . VAL A 1 28  ? 40.637  75.921  73.358  1.00 65.68  ? 103 VAL A C     1 
ATOM 179  O O     . VAL A 1 28  ? 40.183  74.787  73.165  1.00 81.35  ? 103 VAL A O     1 
ATOM 180  C CB    . VAL A 1 28  ? 41.218  76.896  75.600  1.00 56.64  ? 103 VAL A CB    1 
ATOM 181  C CG1   . VAL A 1 28  ? 39.908  76.243  76.033  1.00 58.13  ? 103 VAL A CG1   1 
ATOM 182  C CG2   . VAL A 1 28  ? 42.310  76.919  76.706  1.00 52.69  ? 103 VAL A CG2   1 
ATOM 183  N N     . ARG A 1 29  ? 40.213  76.968  72.675  1.00 60.31  ? 104 ARG A N     1 
ATOM 184  C CA    . ARG A 1 29  ? 39.012  76.900  71.861  1.00 66.07  ? 104 ARG A CA    1 
ATOM 185  C C     . ARG A 1 29  ? 39.282  76.332  70.498  1.00 52.75  ? 104 ARG A C     1 
ATOM 186  O O     . ARG A 1 29  ? 38.336  75.910  69.833  1.00 75.10  ? 104 ARG A O     1 
ATOM 187  C CB    . ARG A 1 29  ? 38.398  78.299  71.698  1.00 95.05  ? 104 ARG A CB    1 
ATOM 188  C CG    . ARG A 1 29  ? 38.418  79.210  72.982  1.00 83.31  ? 104 ARG A CG    1 
ATOM 189  C CD    . ARG A 1 29  ? 37.904  80.603  72.701  1.00 65.52  ? 104 ARG A CD    1 
ATOM 190  N NE    . ARG A 1 29  ? 36.596  80.505  72.087  1.00 65.91  ? 104 ARG A NE    1 
ATOM 191  C CZ    . ARG A 1 29  ? 36.178  81.235  71.066  1.00 76.24  ? 104 ARG A CZ    1 
ATOM 192  N NH1   . ARG A 1 29  ? 36.960  82.159  70.529  1.00 73.14  ? 104 ARG A NH1   1 
ATOM 193  N NH2   . ARG A 1 29  ? 34.962  81.023  70.582  1.00 93.97  ? 104 ARG A NH2   1 
ATOM 194  N N     . ASP A 1 30  ? 40.528  76.393  70.050  1.00 38.02  ? 105 ASP A N     1 
ATOM 195  C CA    . ASP A 1 30  ? 41.001  75.667  68.880  1.00 63.41  ? 105 ASP A CA    1 
ATOM 196  C C     . ASP A 1 30  ? 41.790  74.389  69.202  1.00 74.05  ? 105 ASP A C     1 
ATOM 197  O O     . ASP A 1 30  ? 42.250  73.707  68.264  1.00 64.47  ? 105 ASP A O     1 
ATOM 198  C CB    . ASP A 1 30  ? 41.871  76.572  68.015  1.00 73.62  ? 105 ASP A CB    1 
ATOM 199  C CG    . ASP A 1 30  ? 41.108  77.676  67.404  1.00 62.86  ? 105 ASP A CG    1 
ATOM 200  O OD1   . ASP A 1 30  ? 41.654  78.300  66.461  1.00 62.66  ? 105 ASP A OD1   1 
ATOM 201  O OD2   . ASP A 1 30  ? 39.978  77.904  67.887  1.00 58.26  ? 105 ASP A OD2   1 
ATOM 202  N N     . CYS A 1 31  ? 41.997  74.067  70.480  1.00 71.29  ? 106 CYS A N     1 
ATOM 203  C CA    . CYS A 1 31  ? 42.708  72.852  70.866  1.00 68.16  ? 106 CYS A CA    1 
ATOM 204  C C     . CYS A 1 31  ? 43.978  72.690  70.028  1.00 73.04  ? 106 CYS A C     1 
ATOM 205  O O     . CYS A 1 31  ? 44.051  71.887  69.101  1.00 64.26  ? 106 CYS A O     1 
ATOM 206  C CB    . CYS A 1 31  ? 41.796  71.633  70.713  1.00 84.65  ? 106 CYS A CB    1 
ATOM 207  S SG    . CYS A 1 31  ? 42.587  70.035  70.924  1.00 64.25  ? 106 CYS A SG    1 
ATOM 208  N N     . ARG A 1 32  ? 44.947  73.549  70.327  1.00 80.51  ? 107 ARG A N     1 
ATOM 209  C CA    . ARG A 1 32  ? 46.275  73.515  69.736  1.00 56.76  ? 107 ARG A CA    1 
ATOM 210  C C     . ARG A 1 32  ? 47.304  73.372  70.853  1.00 56.37  ? 107 ARG A C     1 
ATOM 211  O O     . ARG A 1 32  ? 46.961  73.457  72.045  1.00 51.64  ? 107 ARG A O     1 
ATOM 212  C CB    . ARG A 1 32  ? 46.559  74.766  68.892  1.00 50.84  ? 107 ARG A CB    1 
ATOM 213  C CG    . ARG A 1 32  ? 45.445  75.097  67.963  1.00 48.24  ? 107 ARG A CG    1 
ATOM 214  C CD    . ARG A 1 32  ? 45.877  75.229  66.547  1.00 40.92  ? 107 ARG A CD    1 
ATOM 215  N NE    . ARG A 1 32  ? 44.711  74.868  65.765  1.00 63.22  ? 107 ARG A NE    1 
ATOM 216  C CZ    . ARG A 1 32  ? 44.626  73.779  65.010  1.00 72.77  ? 107 ARG A CZ    1 
ATOM 217  N NH1   . ARG A 1 32  ? 45.682  72.962  64.869  1.00 74.58  ? 107 ARG A NH1   1 
ATOM 218  N NH2   . ARG A 1 32  ? 43.498  73.525  64.369  1.00 55.29  ? 107 ARG A NH2   1 
ATOM 219  N N     . PRO A 1 33  ? 48.536  72.990  70.506  1.00 47.16  ? 108 PRO A N     1 
ATOM 220  C CA    . PRO A 1 33  ? 49.582  72.807  71.523  1.00 42.44  ? 108 PRO A CA    1 
ATOM 221  C C     . PRO A 1 33  ? 50.235  74.112  71.916  1.00 45.48  ? 108 PRO A C     1 
ATOM 222  O O     . PRO A 1 33  ? 50.502  74.970  71.070  1.00 60.58  ? 108 PRO A O     1 
ATOM 223  C CB    . PRO A 1 33  ? 50.586  71.914  70.810  1.00 53.73  ? 108 PRO A CB    1 
ATOM 224  C CG    . PRO A 1 33  ? 50.422  72.355  69.337  1.00 49.45  ? 108 PRO A CG    1 
ATOM 225  C CD    . PRO A 1 33  ? 48.998  72.622  69.152  1.00 27.77  ? 108 PRO A CD    1 
ATOM 226  N N     . PHE A 1 34  ? 50.587  74.232  73.187  1.00 45.67  ? 109 PHE A N     1 
ATOM 227  C CA    . PHE A 1 34  ? 51.283  75.447  73.595  1.00 46.09  ? 109 PHE A CA    1 
ATOM 228  C C     . PHE A 1 34  ? 52.432  75.782  72.641  1.00 44.50  ? 109 PHE A C     1 
ATOM 229  O O     . PHE A 1 34  ? 52.564  76.916  72.189  1.00 53.16  ? 109 PHE A O     1 
ATOM 230  C CB    . PHE A 1 34  ? 51.782  75.300  75.015  1.00 34.38  ? 109 PHE A CB    1 
ATOM 231  C CG    . PHE A 1 34  ? 50.787  74.710  75.937  1.00 39.82  ? 109 PHE A CG    1 
ATOM 232  C CD1   . PHE A 1 34  ? 51.202  73.883  76.980  1.00 59.79  ? 109 PHE A CD1   1 
ATOM 233  C CD2   . PHE A 1 34  ? 49.449  74.994  75.805  1.00 45.50  ? 109 PHE A CD2   1 
ATOM 234  C CE1   . PHE A 1 34  ? 50.299  73.327  77.887  1.00 60.78  ? 109 PHE A CE1   1 
ATOM 235  C CE2   . PHE A 1 34  ? 48.527  74.454  76.707  1.00 65.94  ? 109 PHE A CE2   1 
ATOM 236  C CZ    . PHE A 1 34  ? 48.963  73.619  77.768  1.00 63.80  ? 109 PHE A CZ    1 
ATOM 237  N N     . SER A 1 35  ? 53.176  74.789  72.203  1.00 46.58  ? 110 SER A N     1 
ATOM 238  C CA    . SER A 1 35  ? 54.395  75.072  71.477  1.00 48.31  ? 110 SER A CA    1 
ATOM 239  C C     . SER A 1 35  ? 54.178  75.946  70.250  1.00 51.19  ? 110 SER A C     1 
ATOM 240  O O     . SER A 1 35  ? 55.171  76.384  69.656  1.00 60.06  ? 110 SER A O     1 
ATOM 241  C CB    . SER A 1 35  ? 55.052  73.757  71.064  1.00 61.32  ? 110 SER A CB    1 
ATOM 242  O OG    . SER A 1 35  ? 54.985  73.551  69.653  1.00 66.76  ? 110 SER A OG    1 
ATOM 243  N N     . ALA A 1 36  ? 52.938  76.210  69.841  1.00 34.21  ? 111 ALA A N     1 
ATOM 244  C CA    . ALA A 1 36  ? 52.775  76.783  68.514  1.00 52.72  ? 111 ALA A CA    1 
ATOM 245  C C     . ALA A 1 36  ? 52.897  78.303  68.476  1.00 62.46  ? 111 ALA A C     1 
ATOM 246  O O     . ALA A 1 36  ? 53.034  78.858  67.379  1.00 63.32  ? 111 ALA A O     1 
ATOM 247  C CB    . ALA A 1 36  ? 51.447  76.345  67.899  1.00 60.11  ? 111 ALA A CB    1 
ATOM 248  N N     . VAL A 1 37  ? 52.870  78.976  69.640  1.00 67.41  ? 112 VAL A N     1 
ATOM 249  C CA    . VAL A 1 37  ? 53.251  80.390  69.772  1.00 60.72  ? 112 VAL A CA    1 
ATOM 250  C C     . VAL A 1 37  ? 54.643  80.649  69.231  1.00 71.15  ? 112 VAL A C     1 
ATOM 251  O O     . VAL A 1 37  ? 54.922  81.739  68.717  1.00 79.23  ? 112 VAL A O     1 
ATOM 252  C CB    . VAL A 1 37  ? 53.203  80.827  71.242  1.00 52.80  ? 112 VAL A CB    1 
ATOM 253  C CG1   . VAL A 1 37  ? 51.838  81.251  71.617  1.00 54.18  ? 112 VAL A CG1   1 
ATOM 254  C CG2   . VAL A 1 37  ? 53.697  79.675  72.122  1.00 52.09  ? 112 VAL A CG2   1 
ATOM 255  N N     . SER A 1 38  ? 55.549  79.673  69.382  1.00 66.36  ? 113 SER A N     1 
ATOM 256  C CA    . SER A 1 38  ? 56.950  79.706  68.980  1.00 52.44  ? 113 SER A CA    1 
ATOM 257  C C     . SER A 1 38  ? 57.138  79.674  67.491  1.00 59.46  ? 113 SER A C     1 
ATOM 258  O O     . SER A 1 38  ? 58.278  79.775  67.031  1.00 53.69  ? 113 SER A O     1 
ATOM 259  C CB    . SER A 1 38  ? 57.669  78.531  69.592  1.00 48.70  ? 113 SER A CB    1 
ATOM 260  O OG    . SER A 1 38  ? 57.268  78.468  70.946  1.00 71.37  ? 113 SER A OG    1 
ATOM 261  N N     . GLY A 1 39  ? 56.062  79.542  66.727  1.00 61.57  ? 114 GLY A N     1 
ATOM 262  C CA    . GLY A 1 39  ? 56.227  79.279  65.321  1.00 69.74  ? 114 GLY A CA    1 
ATOM 263  C C     . GLY A 1 39  ? 56.973  80.341  64.543  1.00 75.74  ? 114 GLY A C     1 
ATOM 264  O O     . GLY A 1 39  ? 56.525  81.486  64.437  1.00 74.80  ? 114 GLY A O     1 
ATOM 265  N N     . SER A 1 40  ? 58.085  79.939  63.926  1.00 77.18  ? 115 SER A N     1 
ATOM 266  C CA    . SER A 1 40  ? 58.780  80.806  62.986  1.00 75.50  ? 115 SER A CA    1 
ATOM 267  C C     . SER A 1 40  ? 57.955  81.164  61.752  1.00 77.48  ? 115 SER A C     1 
ATOM 268  O O     . SER A 1 40  ? 58.470  81.896  60.893  1.00 73.60  ? 115 SER A O     1 
ATOM 269  C CB    . SER A 1 40  ? 60.051  80.152  62.482  1.00 63.24  ? 115 SER A CB    1 
ATOM 270  O OG    . SER A 1 40  ? 60.150  80.415  61.076  1.00 76.15  ? 115 SER A OG    1 
ATOM 271  N N     . GLY A 1 41  ? 56.783  80.552  61.554  1.00 71.78  ? 116 GLY A N     1 
ATOM 272  C CA    . GLY A 1 41  ? 55.846  81.040  60.557  1.00 82.40  ? 116 GLY A CA    1 
ATOM 273  C C     . GLY A 1 41  ? 54.685  81.771  61.200  1.00 82.90  ? 116 GLY A C     1 
ATOM 274  O O     . GLY A 1 41  ? 54.034  82.624  60.588  1.00 81.40  ? 116 GLY A O     1 
ATOM 275  N N     . PHE A 1 42  ? 54.470  81.455  62.476  1.00 75.22  ? 117 PHE A N     1 
ATOM 276  C CA    . PHE A 1 42  ? 53.459  82.115  63.283  1.00 60.98  ? 117 PHE A CA    1 
ATOM 277  C C     . PHE A 1 42  ? 53.891  83.507  63.579  1.00 72.37  ? 117 PHE A C     1 
ATOM 278  O O     . PHE A 1 42  ? 53.112  84.455  63.479  1.00 83.51  ? 117 PHE A O     1 
ATOM 279  C CB    . PHE A 1 42  ? 53.326  81.398  64.603  1.00 65.49  ? 117 PHE A CB    1 
ATOM 280  C CG    . PHE A 1 42  ? 52.230  81.887  65.454  1.00 59.01  ? 117 PHE A CG    1 
ATOM 281  C CD1   . PHE A 1 42  ? 50.958  82.016  64.948  1.00 52.69  ? 117 PHE A CD1   1 
ATOM 282  C CD2   . PHE A 1 42  ? 52.445  82.110  66.792  1.00 57.54  ? 117 PHE A CD2   1 
ATOM 283  C CE1   . PHE A 1 42  ? 49.923  82.385  65.752  1.00 50.01  ? 117 PHE A CE1   1 
ATOM 284  C CE2   . PHE A 1 42  ? 51.419  82.472  67.598  1.00 53.58  ? 117 PHE A CE2   1 
ATOM 285  C CZ    . PHE A 1 42  ? 50.147  82.616  67.076  1.00 47.37  ? 117 PHE A CZ    1 
ATOM 286  N N     . ILE A 1 43  ? 55.143  83.620  63.999  1.00 79.34  ? 118 ILE A N     1 
ATOM 287  C CA    . ILE A 1 43  ? 55.692  84.886  64.438  1.00 76.67  ? 118 ILE A CA    1 
ATOM 288  C C     . ILE A 1 43  ? 55.703  85.863  63.279  1.00 66.28  ? 118 ILE A C     1 
ATOM 289  O O     . ILE A 1 43  ? 55.231  86.989  63.403  1.00 72.25  ? 118 ILE A O     1 
ATOM 290  C CB    . ILE A 1 43  ? 57.081  84.643  65.054  1.00 65.87  ? 118 ILE A CB    1 
ATOM 291  C CG1   . ILE A 1 43  ? 57.046  84.979  66.547  1.00 66.95  ? 118 ILE A CG1   1 
ATOM 292  C CG2   . ILE A 1 43  ? 58.199  85.276  64.254  1.00 55.21  ? 118 ILE A CG2   1 
ATOM 293  C CD1   . ILE A 1 43  ? 57.148  83.750  67.489  1.00 41.60  ? 118 ILE A CD1   1 
ATOM 294  N N     . ASP A 1 44  ? 56.123  85.407  62.109  1.00 53.35  ? 119 ASP A N     1 
ATOM 295  C CA    . ASP A 1 44  ? 56.120  86.283  60.956  1.00 65.63  ? 119 ASP A CA    1 
ATOM 296  C C     . ASP A 1 44  ? 54.707  86.587  60.499  1.00 84.37  ? 119 ASP A C     1 
ATOM 297  O O     . ASP A 1 44  ? 54.389  87.739  60.174  1.00 92.32  ? 119 ASP A O     1 
ATOM 298  C CB    . ASP A 1 44  ? 56.929  85.654  59.834  1.00 88.42  ? 119 ASP A CB    1 
ATOM 299  C CG    . ASP A 1 44  ? 58.410  85.612  60.156  1.00 108.51 ? 119 ASP A CG    1 
ATOM 300  O OD1   . ASP A 1 44  ? 58.769  85.680  61.372  1.00 73.74  ? 119 ASP A OD1   1 
ATOM 301  O OD2   . ASP A 1 44  ? 59.201  85.521  59.183  1.00 133.76 ? 119 ASP A OD2   1 
ATOM 302  N N     . MET A 1 45  ? 53.850  85.567  60.449  1.00 89.22  ? 120 MET A N     1 
ATOM 303  C CA    . MET A 1 45  ? 52.427  85.823  60.253  1.00 85.57  ? 120 MET A CA    1 
ATOM 304  C C     . MET A 1 45  ? 51.919  86.835  61.284  1.00 89.80  ? 120 MET A C     1 
ATOM 305  O O     . MET A 1 45  ? 51.119  87.711  60.948  1.00 104.54 ? 120 MET A O     1 
ATOM 306  C CB    . MET A 1 45  ? 51.622  84.512  60.329  1.00 84.54  ? 120 MET A CB    1 
ATOM 307  C CG    . MET A 1 45  ? 50.393  84.415  59.415  1.00 63.70  ? 120 MET A CG    1 
ATOM 308  S SD    . MET A 1 45  ? 49.021  83.383  60.038  1.00 70.38  ? 120 MET A SD    1 
ATOM 309  C CE    . MET A 1 45  ? 49.083  83.493  61.841  1.00 50.00  ? 120 MET A CE    1 
ATOM 310  N N     . ILE A 1 46  ? 52.401  86.768  62.535  1.00 85.90  ? 121 ILE A N     1 
ATOM 311  C CA    . ILE A 1 46  ? 51.910  87.711  63.549  1.00 86.35  ? 121 ILE A CA    1 
ATOM 312  C C     . ILE A 1 46  ? 52.342  89.130  63.215  1.00 80.63  ? 121 ILE A C     1 
ATOM 313  O O     . ILE A 1 46  ? 51.579  90.089  63.382  1.00 82.53  ? 121 ILE A O     1 
ATOM 314  C CB    . ILE A 1 46  ? 52.355  87.303  64.968  1.00 76.22  ? 121 ILE A CB    1 
ATOM 315  C CG1   . ILE A 1 46  ? 51.446  86.189  65.481  1.00 63.55  ? 121 ILE A CG1   1 
ATOM 316  C CG2   . ILE A 1 46  ? 52.316  88.502  65.932  1.00 70.22  ? 121 ILE A CG2   1 
ATOM 317  C CD1   . ILE A 1 46  ? 50.115  86.121  64.774  1.00 56.20  ? 121 ILE A CD1   1 
ATOM 318  N N     . LYS A 1 47  ? 53.558  89.285  62.712  1.00 88.80  ? 122 LYS A N     1 
ATOM 319  C CA    . LYS A 1 47  ? 54.039  90.621  62.423  1.00 86.12  ? 122 LYS A CA    1 
ATOM 320  C C     . LYS A 1 47  ? 53.175  91.269  61.358  1.00 78.87  ? 122 LYS A C     1 
ATOM 321  O O     . LYS A 1 47  ? 52.724  92.405  61.527  1.00 85.21  ? 122 LYS A O     1 
ATOM 322  C CB    . LYS A 1 47  ? 55.519  90.559  62.045  1.00 80.91  ? 122 LYS A CB    1 
ATOM 323  C CG    . LYS A 1 47  ? 56.358  90.308  63.308  1.00 68.96  ? 122 LYS A CG    1 
ATOM 324  C CD    . LYS A 1 47  ? 57.726  90.850  63.215  1.00 63.39  ? 122 LYS A CD    1 
ATOM 325  C CE    . LYS A 1 47  ? 58.734  89.771  63.515  1.00 93.83  ? 122 LYS A CE    1 
ATOM 326  N NZ    . LYS A 1 47  ? 59.163  88.984  62.301  1.00 100.88 ? 122 LYS A NZ    1 
ATOM 327  N N     . PHE A 1 48  ? 52.844  90.521  60.304  1.00 75.05  ? 123 PHE A N     1 
ATOM 328  C CA    . PHE A 1 48  ? 51.927  91.030  59.287  1.00 85.57  ? 123 PHE A CA    1 
ATOM 329  C C     . PHE A 1 48  ? 50.565  91.439  59.865  1.00 86.49  ? 123 PHE A C     1 
ATOM 330  O O     . PHE A 1 48  ? 49.830  92.189  59.217  1.00 87.28  ? 123 PHE A O     1 
ATOM 331  C CB    . PHE A 1 48  ? 51.784  89.985  58.168  1.00 74.80  ? 123 PHE A CB    1 
ATOM 332  C CG    . PHE A 1 48  ? 50.736  90.313  57.107  1.00 97.95  ? 123 PHE A CG    1 
ATOM 333  C CD1   . PHE A 1 48  ? 51.099  90.897  55.902  1.00 106.64 ? 123 PHE A CD1   1 
ATOM 334  C CD2   . PHE A 1 48  ? 49.399  89.968  57.278  1.00 98.76  ? 123 PHE A CD2   1 
ATOM 335  C CE1   . PHE A 1 48  ? 50.133  91.170  54.911  1.00 97.01  ? 123 PHE A CE1   1 
ATOM 336  C CE2   . PHE A 1 48  ? 48.444  90.245  56.294  1.00 96.02  ? 123 PHE A CE2   1 
ATOM 337  C CZ    . PHE A 1 48  ? 48.812  90.844  55.117  1.00 89.80  ? 123 PHE A CZ    1 
ATOM 338  N N     . PHE A 1 49  ? 50.182  90.961  61.043  1.00 81.45  ? 124 PHE A N     1 
ATOM 339  C CA    . PHE A 1 49  ? 48.932  91.426  61.630  1.00 93.57  ? 124 PHE A CA    1 
ATOM 340  C C     . PHE A 1 49  ? 49.116  92.455  62.739  1.00 94.41  ? 124 PHE A C     1 
ATOM 341  O O     . PHE A 1 49  ? 48.127  92.993  63.246  1.00 91.11  ? 124 PHE A O     1 
ATOM 342  C CB    . PHE A 1 49  ? 48.106  90.229  62.109  1.00 90.06  ? 124 PHE A CB    1 
ATOM 343  C CG    . PHE A 1 49  ? 47.543  89.404  60.967  1.00 108.30 ? 124 PHE A CG    1 
ATOM 344  C CD1   . PHE A 1 49  ? 47.438  88.017  61.058  1.00 116.82 ? 124 PHE A CD1   1 
ATOM 345  C CD2   . PHE A 1 49  ? 47.134  90.016  59.781  1.00 106.81 ? 124 PHE A CD2   1 
ATOM 346  C CE1   . PHE A 1 49  ? 46.924  87.255  59.984  1.00 108.29 ? 124 PHE A CE1   1 
ATOM 347  C CE2   . PHE A 1 49  ? 46.611  89.258  58.702  1.00 101.73 ? 124 PHE A CE2   1 
ATOM 348  C CZ    . PHE A 1 49  ? 46.517  87.886  58.802  1.00 104.10 ? 124 PHE A CZ    1 
ATOM 349  N N     . ILE A 1 50  ? 50.343  92.759  63.127  1.00 84.44  ? 125 ILE A N     1 
ATOM 350  C CA    . ILE A 1 50  ? 50.518  94.014  63.828  1.00 89.21  ? 125 ILE A CA    1 
ATOM 351  C C     . ILE A 1 50  ? 50.570  95.153  62.817  1.00 96.91  ? 125 ILE A C     1 
ATOM 352  O O     . ILE A 1 50  ? 50.017  96.226  63.055  1.00 97.89  ? 125 ILE A O     1 
ATOM 353  C CB    . ILE A 1 50  ? 51.767  93.979  64.723  1.00 92.42  ? 125 ILE A CB    1 
ATOM 354  C CG1   . ILE A 1 50  ? 52.099  92.555  65.157  1.00 88.27  ? 125 ILE A CG1   1 
ATOM 355  C CG2   . ILE A 1 50  ? 51.525  94.799  65.946  1.00 95.06  ? 125 ILE A CG2   1 
ATOM 356  C CD1   . ILE A 1 50  ? 52.066  92.346  66.674  1.00 98.50  ? 125 ILE A CD1   1 
ATOM 357  N N     . LYS A 1 51  ? 51.191  94.920  61.651  1.00 96.67  ? 126 LYS A N     1 
ATOM 358  C CA    . LYS A 1 51  ? 51.338  95.970  60.640  1.00 88.22  ? 126 LYS A CA    1 
ATOM 359  C C     . LYS A 1 51  ? 50.000  96.369  60.046  1.00 80.67  ? 126 LYS A C     1 
ATOM 360  O O     . LYS A 1 51  ? 49.771  97.551  59.784  1.00 92.18  ? 126 LYS A O     1 
ATOM 361  C CB    . LYS A 1 51  ? 52.286  95.526  59.523  1.00 84.00  ? 126 LYS A CB    1 
ATOM 362  C CG    . LYS A 1 51  ? 51.773  95.788  58.098  1.00 66.60  ? 126 LYS A CG    1 
ATOM 363  C CD    . LYS A 1 51  ? 52.870  95.505  57.063  1.00 73.80  ? 126 LYS A CD    1 
ATOM 364  C CE    . LYS A 1 51  ? 52.373  95.716  55.645  1.00 73.13  ? 126 LYS A CE    1 
ATOM 365  N NZ    . LYS A 1 51  ? 50.879  95.903  55.633  1.00 65.75  ? 126 LYS A NZ    1 
ATOM 366  N N     . VAL A 1 52  ? 49.107  95.403  59.811  1.00 94.16  ? 127 VAL A N     1 
ATOM 367  C CA    . VAL A 1 52  ? 47.760  95.745  59.359  1.00 102.76 ? 127 VAL A CA    1 
ATOM 368  C C     . VAL A 1 52  ? 46.952  96.429  60.462  1.00 107.44 ? 127 VAL A C     1 
ATOM 369  O O     . VAL A 1 52  ? 45.888  96.999  60.187  1.00 97.89  ? 127 VAL A O     1 
ATOM 370  C CB    . VAL A 1 52  ? 47.062  94.489  58.787  1.00 77.20  ? 127 VAL A CB    1 
ATOM 371  C CG1   . VAL A 1 52  ? 45.682  94.814  58.258  1.00 82.66  ? 127 VAL A CG1   1 
ATOM 372  C CG2   . VAL A 1 52  ? 47.863  93.938  57.643  1.00 77.39  ? 127 VAL A CG2   1 
ATOM 373  N N     . GLY A 1 53  ? 47.439  96.418  61.706  1.00 108.62 ? 128 GLY A N     1 
ATOM 374  C CA    . GLY A 1 53  ? 46.896  97.281  62.750  1.00 105.54 ? 128 GLY A CA    1 
ATOM 375  C C     . GLY A 1 53  ? 47.380  98.726  62.741  1.00 116.91 ? 128 GLY A C     1 
ATOM 376  O O     . GLY A 1 53  ? 46.605  99.668  62.977  1.00 105.32 ? 128 GLY A O     1 
ATOM 377  N N     . ALA A 1 54  ? 48.685  98.897  62.506  1.00 114.57 ? 129 ALA A N     1 
ATOM 378  C CA    . ALA A 1 54  ? 49.246  100.226 62.337  1.00 97.79  ? 129 ALA A CA    1 
ATOM 379  C C     . ALA A 1 54  ? 48.444  100.995 61.307  1.00 112.52 ? 129 ALA A C     1 
ATOM 380  O O     . ALA A 1 54  ? 47.871  102.053 61.598  1.00 127.90 ? 129 ALA A O     1 
ATOM 381  C CB    . ALA A 1 54  ? 50.710  100.125 61.905  1.00 88.96  ? 129 ALA A CB    1 
ATOM 382  N N     . GLU A 1 55  ? 48.351  100.449 60.103  1.00 96.75  ? 130 GLU A N     1 
ATOM 383  C CA    . GLU A 1 55  ? 47.863  101.261 59.008  1.00 117.95 ? 130 GLU A CA    1 
ATOM 384  C C     . GLU A 1 55  ? 46.368  101.118 58.687  1.00 119.48 ? 130 GLU A C     1 
ATOM 385  O O     . GLU A 1 55  ? 45.869  101.899 57.866  1.00 133.24 ? 130 GLU A O     1 
ATOM 386  C CB    . GLU A 1 55  ? 48.721  101.002 57.763  1.00 111.56 ? 130 GLU A CB    1 
ATOM 387  C CG    . GLU A 1 55  ? 48.915  99.567  57.398  1.00 119.94 ? 130 GLU A CG    1 
ATOM 388  C CD    . GLU A 1 55  ? 48.192  99.223  56.108  1.00 132.82 ? 130 GLU A CD    1 
ATOM 389  O OE1   . GLU A 1 55  ? 48.372  98.087  55.602  1.00 130.72 ? 130 GLU A OE1   1 
ATOM 390  O OE2   . GLU A 1 55  ? 47.438  100.098 55.609  1.00 125.49 ? 130 GLU A OE2   1 
ATOM 391  N N     . TYR A 1 56  ? 45.629  100.147 59.230  1.00 93.40  ? 131 TYR A N     1 
ATOM 392  C CA    . TYR A 1 56  ? 44.181  100.321 59.252  1.00 79.12  ? 131 TYR A CA    1 
ATOM 393  C C     . TYR A 1 56  ? 43.572  100.520 60.638  1.00 89.80  ? 131 TYR A C     1 
ATOM 394  O O     . TYR A 1 56  ? 42.364  100.732 60.731  1.00 91.50  ? 131 TYR A O     1 
ATOM 395  C CB    . TYR A 1 56  ? 43.470  99.184  58.551  1.00 73.67  ? 131 TYR A CB    1 
ATOM 396  C CG    . TYR A 1 56  ? 43.761  98.997  57.082  1.00 87.67  ? 131 TYR A CG    1 
ATOM 397  C CD1   . TYR A 1 56  ? 44.956  98.445  56.650  1.00 105.67 ? 131 TYR A CD1   1 
ATOM 398  C CD2   . TYR A 1 56  ? 42.799  99.259  56.129  1.00 105.84 ? 131 TYR A CD2   1 
ATOM 399  C CE1   . TYR A 1 56  ? 45.204  98.204  55.294  1.00 99.80  ? 131 TYR A CE1   1 
ATOM 400  C CE2   . TYR A 1 56  ? 43.043  99.032  54.765  1.00 104.81 ? 131 TYR A CE2   1 
ATOM 401  C CZ    . TYR A 1 56  ? 44.252  98.505  54.352  1.00 92.56  ? 131 TYR A CZ    1 
ATOM 402  O OH    . TYR A 1 56  ? 44.500  98.260  53.005  1.00 71.11  ? 131 TYR A OH    1 
ATOM 403  N N     . GLY A 1 57  ? 44.337  100.446 61.715  1.00 84.96  ? 132 GLY A N     1 
ATOM 404  C CA    . GLY A 1 57  ? 43.786  100.814 63.012  1.00 103.30 ? 132 GLY A CA    1 
ATOM 405  C C     . GLY A 1 57  ? 42.706  99.862  63.520  1.00 100.44 ? 132 GLY A C     1 
ATOM 406  O O     . GLY A 1 57  ? 42.244  98.960  62.832  1.00 85.69  ? 132 GLY A O     1 
ATOM 407  N N     . GLU A 1 58  ? 42.246  100.145 64.744  1.00 103.74 ? 133 GLU A N     1 
ATOM 408  C CA    . GLU A 1 58  ? 41.580  99.153  65.586  1.00 101.10 ? 133 GLU A CA    1 
ATOM 409  C C     . GLU A 1 58  ? 40.253  98.630  65.033  1.00 114.08 ? 133 GLU A C     1 
ATOM 410  O O     . GLU A 1 58  ? 39.715  97.673  65.599  1.00 107.33 ? 133 GLU A O     1 
ATOM 411  C CB    . GLU A 1 58  ? 41.350  99.720  66.991  1.00 95.71  ? 133 GLU A CB    1 
ATOM 412  C CG    . GLU A 1 58  ? 41.117  98.660  68.068  1.00 89.56  ? 133 GLU A CG    1 
ATOM 413  C CD    . GLU A 1 58  ? 39.907  98.937  68.956  1.00 111.81 ? 133 GLU A CD    1 
ATOM 414  O OE1   . GLU A 1 58  ? 39.082  99.828  68.638  1.00 127.22 ? 133 GLU A OE1   1 
ATOM 415  O OE2   . GLU A 1 58  ? 39.785  98.258  69.994  1.00 106.17 ? 133 GLU A OE2   1 
ATOM 416  N N     . HIS A 1 59  ? 39.684  99.206  63.977  1.00 128.25 ? 134 HIS A N     1 
ATOM 417  C CA    . HIS A 1 59  ? 38.421  98.667  63.468  1.00 136.07 ? 134 HIS A CA    1 
ATOM 418  C C     . HIS A 1 59  ? 38.615  98.100  62.068  1.00 130.82 ? 134 HIS A C     1 
ATOM 419  O O     . HIS A 1 59  ? 38.498  98.825  61.077  1.00 121.65 ? 134 HIS A O     1 
ATOM 420  C CB    . HIS A 1 59  ? 37.327  99.735  63.502  1.00 138.77 ? 134 HIS A CB    1 
ATOM 421  C CG    . HIS A 1 59  ? 36.702  99.883  64.854  1.00 149.35 ? 134 HIS A CG    1 
ATOM 422  N ND1   . HIS A 1 59  ? 35.403  99.509  65.123  1.00 156.43 ? 134 HIS A ND1   1 
ATOM 423  C CD2   . HIS A 1 59  ? 37.221  100.309 66.032  1.00 151.78 ? 134 HIS A CD2   1 
ATOM 424  C CE1   . HIS A 1 59  ? 35.138  99.723  66.401  1.00 161.15 ? 134 HIS A CE1   1 
ATOM 425  N NE2   . HIS A 1 59  ? 36.225  100.207 66.975  1.00 167.51 ? 134 HIS A NE2   1 
ATOM 426  N N     . VAL A 1 60  ? 38.767  96.775  62.001  1.00 131.80 ? 135 VAL A N     1 
ATOM 427  C CA    . VAL A 1 60  ? 38.899  96.034  60.749  1.00 117.12 ? 135 VAL A CA    1 
ATOM 428  C C     . VAL A 1 60  ? 38.107  94.742  60.873  1.00 126.54 ? 135 VAL A C     1 
ATOM 429  O O     . VAL A 1 60  ? 38.118  94.078  61.922  1.00 116.25 ? 135 VAL A O     1 
ATOM 430  C CB    . VAL A 1 60  ? 40.361  95.709  60.376  1.00 106.28 ? 135 VAL A CB    1 
ATOM 431  C CG1   . VAL A 1 60  ? 40.644  96.052  58.918  1.00 110.05 ? 135 VAL A CG1   1 
ATOM 432  C CG2   . VAL A 1 60  ? 41.329  96.419  61.284  1.00 108.93 ? 135 VAL A CG2   1 
ATOM 433  N N     . ASN A 1 61  ? 37.428  94.389  59.781  1.00 136.54 ? 136 ASN A N     1 
ATOM 434  C CA    . ASN A 1 61  ? 36.661  93.153  59.683  1.00 131.62 ? 136 ASN A CA    1 
ATOM 435  C C     . ASN A 1 61  ? 37.618  92.115  59.136  1.00 119.84 ? 136 ASN A C     1 
ATOM 436  O O     . ASN A 1 61  ? 38.007  92.157  57.961  1.00 122.12 ? 136 ASN A O     1 
ATOM 437  C CB    . ASN A 1 61  ? 35.444  93.330  58.772  1.00 134.08 ? 136 ASN A CB    1 
ATOM 438  C CG    . ASN A 1 61  ? 35.217  92.140  57.827  1.00 129.31 ? 136 ASN A CG    1 
ATOM 439  O OD1   . ASN A 1 61  ? 34.372  91.278  58.089  1.00 133.23 ? 136 ASN A OD1   1 
ATOM 440  N ND2   . ASN A 1 61  ? 35.969  92.100  56.717  1.00 119.13 ? 136 ASN A ND2   1 
ATOM 441  N N     . VAL A 1 62  ? 38.024  91.189  59.985  1.00 104.54 ? 137 VAL A N     1 
ATOM 442  C CA    . VAL A 1 62  ? 39.073  90.307  59.531  1.00 99.12  ? 137 VAL A CA    1 
ATOM 443  C C     . VAL A 1 62  ? 38.485  89.010  58.990  1.00 82.26  ? 137 VAL A C     1 
ATOM 444  O O     . VAL A 1 62  ? 39.208  88.250  58.339  1.00 79.21  ? 137 VAL A O     1 
ATOM 445  C CB    . VAL A 1 62  ? 40.068  90.337  60.711  1.00 85.00  ? 137 VAL A CB    1 
ATOM 446  C CG1   . VAL A 1 62  ? 39.344  90.141  62.030  1.00 64.42  ? 137 VAL A CG1   1 
ATOM 447  C CG2   . VAL A 1 62  ? 41.240  89.421  60.507  1.00 68.86  ? 137 VAL A CG2   1 
ATOM 448  N N     . GLU A 1 63  ? 37.163  88.822  59.123  1.00 88.31  ? 138 GLU A N     1 
ATOM 449  C CA    . GLU A 1 63  ? 36.396  87.749  58.483  1.00 83.08  ? 138 GLU A CA    1 
ATOM 450  C C     . GLU A 1 63  ? 36.769  87.575  57.017  1.00 101.04 ? 138 GLU A C     1 
ATOM 451  O O     . GLU A 1 63  ? 37.157  86.482  56.573  1.00 103.54 ? 138 GLU A O     1 
ATOM 452  C CB    . GLU A 1 63  ? 34.895  88.056  58.590  1.00 93.14  ? 138 GLU A CB    1 
ATOM 453  C CG    . GLU A 1 63  ? 34.232  87.920  59.979  1.00 116.51 ? 138 GLU A CG    1 
ATOM 454  C CD    . GLU A 1 63  ? 34.925  88.685  61.131  1.00 106.91 ? 138 GLU A CD    1 
ATOM 455  O OE1   . GLU A 1 63  ? 35.687  89.664  60.896  1.00 110.92 ? 138 GLU A OE1   1 
ATOM 456  O OE2   . GLU A 1 63  ? 34.696  88.283  62.298  1.00 77.52  ? 138 GLU A OE2   1 
ATOM 457  N N     . GLU A 1 64  ? 36.569  88.631  56.232  1.00 99.29  ? 139 GLU A N     1 
ATOM 458  C CA    . GLU A 1 64  ? 36.844  88.560  54.805  1.00 101.24 ? 139 GLU A CA    1 
ATOM 459  C C     . GLU A 1 64  ? 38.319  88.731  54.494  1.00 84.03  ? 139 GLU A C     1 
ATOM 460  O O     . GLU A 1 64  ? 38.781  88.255  53.442  1.00 85.47  ? 139 GLU A O     1 
ATOM 461  C CB    . GLU A 1 64  ? 36.045  89.623  54.073  1.00 131.97 ? 139 GLU A CB    1 
ATOM 462  C CG    . GLU A 1 64  ? 34.660  89.828  54.636  1.00 136.54 ? 139 GLU A CG    1 
ATOM 463  C CD    . GLU A 1 64  ? 33.856  90.751  53.765  1.00 146.94 ? 139 GLU A CD    1 
ATOM 464  O OE1   . GLU A 1 64  ? 32.620  90.564  53.699  1.00 157.38 ? 139 GLU A OE1   1 
ATOM 465  O OE2   . GLU A 1 64  ? 34.476  91.643  53.129  1.00 123.69 ? 139 GLU A OE2   1 
ATOM 466  N N     . LEU A 1 65  ? 39.051  89.433  55.371  1.00 74.28  ? 140 LEU A N     1 
ATOM 467  C CA    . LEU A 1 65  ? 40.509  89.496  55.255  1.00 80.94  ? 140 LEU A CA    1 
ATOM 468  C C     . LEU A 1 65  ? 41.113  88.104  55.333  1.00 87.01  ? 140 LEU A C     1 
ATOM 469  O O     . LEU A 1 65  ? 41.883  87.679  54.457  1.00 78.52  ? 140 LEU A O     1 
ATOM 470  C CB    . LEU A 1 65  ? 41.093  90.370  56.367  1.00 78.37  ? 140 LEU A CB    1 
ATOM 471  C CG    . LEU A 1 65  ? 42.585  90.136  56.655  1.00 84.53  ? 140 LEU A CG    1 
ATOM 472  C CD1   . LEU A 1 65  ? 43.453  90.480  55.440  1.00 90.03  ? 140 LEU A CD1   1 
ATOM 473  C CD2   . LEU A 1 65  ? 43.056  90.916  57.889  1.00 76.67  ? 140 LEU A CD2   1 
ATOM 474  N N     . LEU A 1 66  ? 40.762  87.385  56.388  1.00 86.24  ? 141 LEU A N     1 
ATOM 475  C CA    . LEU A 1 66  ? 41.231  86.035  56.573  1.00 64.38  ? 141 LEU A CA    1 
ATOM 476  C C     . LEU A 1 66  ? 40.738  85.129  55.451  1.00 66.68  ? 141 LEU A C     1 
ATOM 477  O O     . LEU A 1 66  ? 39.579  85.244  55.002  1.00 68.23  ? 141 LEU A O     1 
ATOM 478  C CB    . LEU A 1 66  ? 40.780  85.530  57.931  1.00 45.89  ? 141 LEU A CB    1 
ATOM 479  C CG    . LEU A 1 66  ? 41.862  86.113  58.828  1.00 49.92  ? 141 LEU A CG    1 
ATOM 480  C CD1   . LEU A 1 66  ? 41.684  85.740  60.250  1.00 39.08  ? 141 LEU A CD1   1 
ATOM 481  C CD2   . LEU A 1 66  ? 43.235  85.693  58.326  1.00 46.95  ? 141 LEU A CD2   1 
ATOM 482  N N     . PRO A 1 67  ? 41.598  84.248  54.953  1.00 56.83  ? 142 PRO A N     1 
ATOM 483  C CA    . PRO A 1 67  ? 41.144  83.239  54.001  1.00 62.64  ? 142 PRO A CA    1 
ATOM 484  C C     . PRO A 1 67  ? 40.445  82.061  54.672  1.00 75.01  ? 142 PRO A C     1 
ATOM 485  O O     . PRO A 1 67  ? 40.651  81.721  55.856  1.00 51.11  ? 142 PRO A O     1 
ATOM 486  C CB    . PRO A 1 67  ? 42.434  82.795  53.298  1.00 43.60  ? 142 PRO A CB    1 
ATOM 487  C CG    . PRO A 1 67  ? 43.550  83.569  53.973  1.00 50.60  ? 142 PRO A CG    1 
ATOM 488  C CD    . PRO A 1 67  ? 43.031  84.119  55.249  1.00 40.66  ? 142 PRO A CD    1 
ATOM 489  N N     . SER A 1 68  ? 39.547  81.494  53.876  1.00 66.55  ? 143 SER A N     1 
ATOM 490  C CA    . SER A 1 68  ? 39.173  80.112  53.976  1.00 77.44  ? 143 SER A CA    1 
ATOM 491  C C     . SER A 1 68  ? 40.441  79.266  53.899  1.00 88.62  ? 143 SER A C     1 
ATOM 492  O O     . SER A 1 68  ? 41.446  79.680  53.298  1.00 79.82  ? 143 SER A O     1 
ATOM 493  C CB    . SER A 1 68  ? 38.248  79.713  52.839  1.00 81.15  ? 143 SER A CB    1 
ATOM 494  O OG    . SER A 1 68  ? 38.844  78.586  52.188  1.00 87.51  ? 143 SER A OG    1 
ATOM 495  N N     . PRO A 1 69  ? 40.443  78.088  54.516  1.00 80.63  ? 144 PRO A N     1 
ATOM 496  C CA    . PRO A 1 69  ? 41.568  77.172  54.317  1.00 75.08  ? 144 PRO A CA    1 
ATOM 497  C C     . PRO A 1 69  ? 41.598  76.533  52.942  1.00 75.78  ? 144 PRO A C     1 
ATOM 498  O O     . PRO A 1 69  ? 42.655  76.031  52.535  1.00 69.49  ? 144 PRO A O     1 
ATOM 499  C CB    . PRO A 1 69  ? 41.381  76.137  55.419  1.00 71.35  ? 144 PRO A CB    1 
ATOM 500  C CG    . PRO A 1 69  ? 40.042  76.424  56.013  1.00 71.80  ? 144 PRO A CG    1 
ATOM 501  C CD    . PRO A 1 69  ? 39.567  77.712  55.634  1.00 55.25  ? 144 PRO A CD    1 
ATOM 502  N N     . ILE A 1 70  ? 40.503  76.536  52.185  1.00 68.92  ? 145 ILE A N     1 
ATOM 503  C CA    . ILE A 1 70  ? 40.686  75.967  50.862  1.00 71.34  ? 145 ILE A CA    1 
ATOM 504  C C     . ILE A 1 70  ? 41.448  76.934  49.989  1.00 77.01  ? 145 ILE A C     1 
ATOM 505  O O     . ILE A 1 70  ? 42.114  76.503  49.045  1.00 79.01  ? 145 ILE A O     1 
ATOM 506  C CB    . ILE A 1 70  ? 39.367  75.526  50.209  1.00 70.62  ? 145 ILE A CB    1 
ATOM 507  C CG1   . ILE A 1 70  ? 39.629  74.774  48.891  1.00 49.29  ? 145 ILE A CG1   1 
ATOM 508  C CG2   . ILE A 1 70  ? 38.417  76.663  50.066  1.00 48.35  ? 145 ILE A CG2   1 
ATOM 509  C CD1   . ILE A 1 70  ? 38.338  74.105  48.297  1.00 55.54  ? 145 ILE A CD1   1 
ATOM 510  N N     . THR A 1 71  ? 41.438  78.228  50.311  1.00 75.95  ? 146 THR A N     1 
ATOM 511  C CA    . THR A 1 71  ? 42.327  79.123  49.577  1.00 77.82  ? 146 THR A CA    1 
ATOM 512  C C     . THR A 1 71  ? 43.775  78.915  50.007  1.00 59.71  ? 146 THR A C     1 
ATOM 513  O O     . THR A 1 71  ? 44.670  78.871  49.159  1.00 65.27  ? 146 THR A O     1 
ATOM 514  C CB    . THR A 1 71  ? 41.883  80.587  49.724  1.00 85.70  ? 146 THR A CB    1 
ATOM 515  O OG1   . THR A 1 71  ? 41.418  80.836  51.060  1.00 88.61  ? 146 THR A OG1   1 
ATOM 516  C CG2   . THR A 1 71  ? 40.761  80.945  48.681  1.00 70.58  ? 146 THR A CG2   1 
ATOM 517  N N     . LEU A 1 72  ? 44.019  78.722  51.307  1.00 54.50  ? 147 LEU A N     1 
ATOM 518  C CA    . LEU A 1 72  ? 45.363  78.350  51.761  1.00 64.66  ? 147 LEU A CA    1 
ATOM 519  C C     . LEU A 1 72  ? 45.822  77.040  51.155  1.00 72.49  ? 147 LEU A C     1 
ATOM 520  O O     . LEU A 1 72  ? 47.005  76.893  50.833  1.00 60.24  ? 147 LEU A O     1 
ATOM 521  C CB    . LEU A 1 72  ? 45.425  78.215  53.275  1.00 52.37  ? 147 LEU A CB    1 
ATOM 522  C CG    . LEU A 1 72  ? 45.507  79.567  53.917  1.00 60.17  ? 147 LEU A CG    1 
ATOM 523  C CD1   . LEU A 1 72  ? 45.756  79.442  55.372  1.00 48.85  ? 147 LEU A CD1   1 
ATOM 524  C CD2   . LEU A 1 72  ? 46.635  80.243  53.234  1.00 57.15  ? 147 LEU A CD2   1 
ATOM 525  N N     . SER A 1 73  ? 44.923  76.047  51.059  1.00 58.09  ? 148 SER A N     1 
ATOM 526  C CA    . SER A 1 73  ? 45.306  74.808  50.397  1.00 59.23  ? 148 SER A CA    1 
ATOM 527  C C     . SER A 1 73  ? 45.837  75.119  49.023  1.00 73.43  ? 148 SER A C     1 
ATOM 528  O O     . SER A 1 73  ? 46.905  74.642  48.626  1.00 65.98  ? 148 SER A O     1 
ATOM 529  C CB    . SER A 1 73  ? 44.130  73.834  50.271  1.00 70.70  ? 148 SER A CB    1 
ATOM 530  O OG    . SER A 1 73  ? 44.370  72.858  49.233  1.00 60.34  ? 148 SER A OG    1 
ATOM 531  N N     . ARG A 1 74  ? 45.091  75.955  48.294  1.00 87.40  ? 149 ARG A N     1 
ATOM 532  C CA    . ARG A 1 74  ? 45.330  76.211  46.882  1.00 77.65  ? 149 ARG A CA    1 
ATOM 533  C C     . ARG A 1 74  ? 46.524  77.128  46.706  1.00 92.38  ? 149 ARG A C     1 
ATOM 534  O O     . ARG A 1 74  ? 47.405  76.845  45.886  1.00 96.71  ? 149 ARG A O     1 
ATOM 535  C CB    . ARG A 1 74  ? 44.073  76.812  46.245  1.00 60.02  ? 149 ARG A CB    1 
ATOM 536  C CG    . ARG A 1 74  ? 42.910  75.835  46.199  1.00 82.59  ? 149 ARG A CG    1 
ATOM 537  C CD    . ARG A 1 74  ? 41.648  76.316  45.469  1.00 50.97  ? 149 ARG A CD    1 
ATOM 538  N NE    . ARG A 1 74  ? 40.845  77.254  46.245  1.00 44.95  ? 149 ARG A NE    1 
ATOM 539  C CZ    . ARG A 1 74  ? 39.511  77.313  46.169  1.00 62.56  ? 149 ARG A CZ    1 
ATOM 540  N NH1   . ARG A 1 74  ? 38.824  76.457  45.379  1.00 45.57  ? 149 ARG A NH1   1 
ATOM 541  N NH2   . ARG A 1 74  ? 38.857  78.219  46.898  1.00 50.40  ? 149 ARG A NH2   1 
ATOM 542  N N     . LYS A 1 75  ? 46.575  78.224  47.482  1.00 81.50  ? 150 LYS A N     1 
ATOM 543  C CA    . LYS A 1 75  ? 47.771  79.055  47.487  1.00 80.60  ? 150 LYS A CA    1 
ATOM 544  C C     . LYS A 1 75  ? 49.003  78.194  47.675  1.00 77.78  ? 150 LYS A C     1 
ATOM 545  O O     . LYS A 1 75  ? 50.015  78.369  46.985  1.00 78.29  ? 150 LYS A O     1 
ATOM 546  C CB    . LYS A 1 75  ? 47.700  80.111  48.596  1.00 78.81  ? 150 LYS A CB    1 
ATOM 547  C CG    . LYS A 1 75  ? 48.997  80.960  48.700  1.00 96.56  ? 150 LYS A CG    1 
ATOM 548  C CD    . LYS A 1 75  ? 48.998  82.287  47.840  1.00 116.01 ? 150 LYS A CD    1 
ATOM 549  C CE    . LYS A 1 75  ? 49.356  82.134  46.322  1.00 114.57 ? 150 LYS A CE    1 
ATOM 550  N NZ    . LYS A 1 75  ? 50.822  82.041  45.960  1.00 97.76  ? 150 LYS A NZ    1 
ATOM 551  N N     . VAL A 1 76  ? 48.903  77.216  48.577  1.00 89.11  ? 151 VAL A N     1 
ATOM 552  C CA    . VAL A 1 76  ? 50.013  76.329  48.904  1.00 79.63  ? 151 VAL A CA    1 
ATOM 553  C C     . VAL A 1 76  ? 50.424  75.467  47.712  1.00 73.83  ? 151 VAL A C     1 
ATOM 554  O O     . VAL A 1 76  ? 51.599  75.125  47.573  1.00 75.21  ? 151 VAL A O     1 
ATOM 555  C CB    . VAL A 1 76  ? 49.627  75.480  50.126  1.00 62.75  ? 151 VAL A CB    1 
ATOM 556  C CG1   . VAL A 1 76  ? 50.401  74.205  50.122  1.00 67.78  ? 151 VAL A CG1   1 
ATOM 557  C CG2   . VAL A 1 76  ? 49.878  76.270  51.406  1.00 59.27  ? 151 VAL A CG2   1 
ATOM 558  N N     . THR A 1 77  ? 49.482  75.111  46.829  1.00 74.96  ? 152 THR A N     1 
ATOM 559  C CA    . THR A 1 77  ? 49.836  74.355  45.631  1.00 68.06  ? 152 THR A CA    1 
ATOM 560  C C     . THR A 1 77  ? 50.421  75.254  44.554  1.00 74.08  ? 152 THR A C     1 
ATOM 561  O O     . THR A 1 77  ? 51.213  74.775  43.738  1.00 79.09  ? 152 THR A O     1 
ATOM 562  C CB    . THR A 1 77  ? 48.615  73.596  45.073  1.00 87.72  ? 152 THR A CB    1 
ATOM 563  O OG1   . THR A 1 77  ? 47.977  72.832  46.112  1.00 95.90  ? 152 THR A OG1   1 
ATOM 564  C CG2   . THR A 1 77  ? 49.016  72.631  43.934  1.00 71.31  ? 152 THR A CG2   1 
ATOM 565  N N     . SER A 1 78  ? 50.049  76.551  44.560  1.00 84.23  ? 153 SER A N     1 
ATOM 566  C CA    . SER A 1 78  ? 50.477  77.573  43.592  1.00 73.32  ? 153 SER A CA    1 
ATOM 567  C C     . SER A 1 78  ? 51.911  78.017  43.844  1.00 81.91  ? 153 SER A C     1 
ATOM 568  O O     . SER A 1 78  ? 52.784  77.846  42.981  1.00 64.38  ? 153 SER A O     1 
ATOM 569  C CB    . SER A 1 78  ? 49.565  78.806  43.675  1.00 79.30  ? 153 SER A CB    1 
ATOM 570  O OG    . SER A 1 78  ? 48.269  78.579  43.146  1.00 90.89  ? 153 SER A OG    1 
ATOM 571  N N     . ASP A 1 79  ? 52.147  78.614  45.029  1.00 76.11  ? 154 ASP A N     1 
ATOM 572  C CA    . ASP A 1 79  ? 53.461  78.943  45.567  1.00 71.94  ? 154 ASP A CA    1 
ATOM 573  C C     . ASP A 1 79  ? 54.393  77.743  45.347  1.00 90.40  ? 154 ASP A C     1 
ATOM 574  O O     . ASP A 1 79  ? 55.587  77.907  45.058  1.00 92.24  ? 154 ASP A O     1 
ATOM 575  C CB    . ASP A 1 79  ? 53.346  79.306  47.063  1.00 68.86  ? 154 ASP A CB    1 
ATOM 576  C CG    . ASP A 1 79  ? 53.981  80.674  47.418  1.00 91.69  ? 154 ASP A CG    1 
ATOM 577  O OD1   . ASP A 1 79  ? 53.869  81.599  46.587  1.00 114.76 ? 154 ASP A OD1   1 
ATOM 578  O OD2   . ASP A 1 79  ? 54.582  80.843  48.525  1.00 68.72  ? 154 ASP A OD2   1 
ATOM 579  N N     . ALA A 1 80  ? 53.852  76.524  45.462  1.00 81.32  ? 155 ALA A N     1 
ATOM 580  C CA    . ALA A 1 80  ? 54.648  75.317  45.230  1.00 76.25  ? 155 ALA A CA    1 
ATOM 581  C C     . ALA A 1 80  ? 55.045  75.162  43.770  1.00 70.79  ? 155 ALA A C     1 
ATOM 582  O O     . ALA A 1 80  ? 56.205  74.880  43.467  1.00 74.00  ? 155 ALA A O     1 
ATOM 583  C CB    . ALA A 1 80  ? 53.879  74.084  45.679  1.00 71.14  ? 155 ALA A CB    1 
ATOM 584  N N     . LYS A 1 81  ? 54.079  75.262  42.854  1.00 79.79  ? 156 LYS A N     1 
ATOM 585  C CA    . LYS A 1 81  ? 54.404  75.239  41.431  1.00 80.48  ? 156 LYS A CA    1 
ATOM 586  C C     . LYS A 1 81  ? 55.311  76.410  41.072  1.00 87.52  ? 156 LYS A C     1 
ATOM 587  O O     . LYS A 1 81  ? 56.208  76.285  40.212  1.00 69.28  ? 156 LYS A O     1 
ATOM 588  C CB    . LYS A 1 81  ? 53.124  75.294  40.588  1.00 85.38  ? 156 LYS A CB    1 
ATOM 589  C CG    . LYS A 1 81  ? 52.085  74.153  40.764  1.00 101.85 ? 156 LYS A CG    1 
ATOM 590  C CD    . LYS A 1 81  ? 51.036  74.176  39.598  1.00 130.21 ? 156 LYS A CD    1 
ATOM 591  C CE    . LYS A 1 81  ? 49.685  73.474  39.897  1.00 112.85 ? 156 LYS A CE    1 
ATOM 592  N NZ    . LYS A 1 81  ? 48.626  73.844  38.882  1.00 96.43  ? 156 LYS A NZ    1 
ATOM 593  N N     . GLU A 1 82  ? 55.077  77.562  41.726  1.00 78.60  ? 157 GLU A N     1 
ATOM 594  C CA    . GLU A 1 82  ? 55.859  78.779  41.560  1.00 69.29  ? 157 GLU A CA    1 
ATOM 595  C C     . GLU A 1 82  ? 57.322  78.446  41.754  1.00 77.68  ? 157 GLU A C     1 
ATOM 596  O O     . GLU A 1 82  ? 58.062  78.263  40.781  1.00 81.43  ? 157 GLU A O     1 
ATOM 597  C CB    . GLU A 1 82  ? 55.410  79.840  42.576  1.00 81.67  ? 157 GLU A CB    1 
ATOM 598  C CG    . GLU A 1 82  ? 55.550  81.314  42.176  1.00 88.45  ? 157 GLU A CG    1 
ATOM 599  C CD    . GLU A 1 82  ? 54.729  82.229  43.090  1.00 106.71 ? 157 GLU A CD    1 
ATOM 600  O OE1   . GLU A 1 82  ? 55.328  82.960  43.922  1.00 116.31 ? 157 GLU A OE1   1 
ATOM 601  O OE2   . GLU A 1 82  ? 53.477  82.192  42.988  1.00 96.89  ? 157 GLU A OE2   1 
ATOM 602  N N     . LYS A 1 83  ? 57.708  78.228  43.010  1.00 76.17  ? 158 LYS A N     1 
ATOM 603  C CA    . LYS A 1 83  ? 59.115  78.120  43.342  1.00 74.44  ? 158 LYS A CA    1 
ATOM 604  C C     . LYS A 1 83  ? 59.789  76.918  42.688  1.00 60.89  ? 158 LYS A C     1 
ATOM 605  O O     . LYS A 1 83  ? 61.018  76.874  42.631  1.00 65.32  ? 158 LYS A O     1 
ATOM 606  C CB    . LYS A 1 83  ? 59.195  78.130  44.852  1.00 61.60  ? 158 LYS A CB    1 
ATOM 607  C CG    . LYS A 1 83  ? 58.232  79.168  45.390  1.00 69.40  ? 158 LYS A CG    1 
ATOM 608  C CD    . LYS A 1 83  ? 58.688  79.863  46.662  1.00 73.90  ? 158 LYS A CD    1 
ATOM 609  C CE    . LYS A 1 83  ? 57.491  80.558  47.327  1.00 73.70  ? 158 LYS A CE    1 
ATOM 610  N NZ    . LYS A 1 83  ? 56.683  81.309  46.320  1.00 85.28  ? 158 LYS A NZ    1 
ATOM 611  N N     . LYS A 1 84  ? 59.015  75.992  42.131  1.00 53.90  ? 159 LYS A N     1 
ATOM 612  C CA    . LYS A 1 84  ? 59.565  74.806  41.495  1.00 68.12  ? 159 LYS A CA    1 
ATOM 613  C C     . LYS A 1 84  ? 60.124  75.132  40.131  1.00 75.73  ? 159 LYS A C     1 
ATOM 614  O O     . LYS A 1 84  ? 61.186  74.631  39.759  1.00 75.88  ? 159 LYS A O     1 
ATOM 615  C CB    . LYS A 1 84  ? 58.494  73.721  41.346  1.00 75.35  ? 159 LYS A CB    1 
ATOM 616  C CG    . LYS A 1 84  ? 58.251  72.877  42.567  1.00 75.71  ? 159 LYS A CG    1 
ATOM 617  C CD    . LYS A 1 84  ? 58.134  71.404  42.210  1.00 96.40  ? 159 LYS A CD    1 
ATOM 618  C CE    . LYS A 1 84  ? 57.352  71.179  40.910  1.00 110.22 ? 159 LYS A CE    1 
ATOM 619  N NZ    . LYS A 1 84  ? 56.625  69.851  40.883  1.00 110.51 ? 159 LYS A NZ    1 
ATOM 620  N N     . ALA A 1 85  ? 59.387  75.922  39.354  1.00 86.55  ? 160 ALA A N     1 
ATOM 621  C CA    . ALA A 1 85  ? 59.902  76.397  38.079  1.00 82.65  ? 160 ALA A CA    1 
ATOM 622  C C     . ALA A 1 85  ? 60.849  77.579  38.267  1.00 76.63  ? 160 ALA A C     1 
ATOM 623  O O     . ALA A 1 85  ? 61.810  77.715  37.502  1.00 67.55  ? 160 ALA A O     1 
ATOM 624  C CB    . ALA A 1 85  ? 58.742  76.763  37.152  1.00 73.13  ? 160 ALA A CB    1 
ATOM 625  N N     . LEU A 1 86  ? 60.607  78.425  39.278  1.00 70.76  ? 161 LEU A N     1 
ATOM 626  C CA    . LEU A 1 86  ? 61.544  79.487  39.594  1.00 62.14  ? 161 LEU A CA    1 
ATOM 627  C C     . LEU A 1 86  ? 62.945  78.901  39.627  1.00 69.33  ? 161 LEU A C     1 
ATOM 628  O O     . LEU A 1 86  ? 63.742  79.142  38.716  1.00 61.91  ? 161 LEU A O     1 
ATOM 629  C CB    . LEU A 1 86  ? 61.221  80.147  40.932  1.00 49.95  ? 161 LEU A CB    1 
ATOM 630  C CG    . LEU A 1 86  ? 62.128  81.299  41.468  1.00 78.53  ? 161 LEU A CG    1 
ATOM 631  C CD1   . LEU A 1 86  ? 62.129  81.347  42.990  1.00 82.41  ? 161 LEU A CD1   1 
ATOM 632  C CD2   . LEU A 1 86  ? 63.606  81.447  40.975  1.00 60.64  ? 161 LEU A CD2   1 
ATOM 633  N N     . ILE A 1 87  ? 63.264  78.124  40.650  1.00 65.26  ? 162 ILE A N     1 
ATOM 634  C CA    . ILE A 1 87  ? 64.664  77.760  40.802  1.00 84.36  ? 162 ILE A CA    1 
ATOM 635  C C     . ILE A 1 87  ? 64.914  76.474  40.037  1.00 80.11  ? 162 ILE A C     1 
ATOM 636  O O     . ILE A 1 87  ? 66.005  75.903  40.126  1.00 87.20  ? 162 ILE A O     1 
ATOM 637  C CB    . ILE A 1 87  ? 65.105  77.659  42.272  1.00 90.57  ? 162 ILE A CB    1 
ATOM 638  C CG1   . ILE A 1 87  ? 64.244  76.658  43.027  1.00 89.12  ? 162 ILE A CG1   1 
ATOM 639  C CG2   . ILE A 1 87  ? 65.114  79.050  42.923  1.00 86.43  ? 162 ILE A CG2   1 
ATOM 640  C CD1   . ILE A 1 87  ? 64.950  75.365  43.269  1.00 88.72  ? 162 ILE A CD1   1 
ATOM 641  N N     . SER A 1 88  ? 63.914  76.031  39.262  1.00 77.01  ? 163 SER A N     1 
ATOM 642  C CA    . SER A 1 88  ? 64.114  74.958  38.280  1.00 91.31  ? 163 SER A CA    1 
ATOM 643  C C     . SER A 1 88  ? 65.277  75.220  37.342  1.00 98.22  ? 163 SER A C     1 
ATOM 644  O O     . SER A 1 88  ? 65.779  74.280  36.713  1.00 96.55  ? 163 SER A O     1 
ATOM 645  C CB    . SER A 1 88  ? 62.887  74.756  37.393  1.00 88.40  ? 163 SER A CB    1 
ATOM 646  O OG    . SER A 1 88  ? 63.290  74.361  36.094  1.00 88.36  ? 163 SER A OG    1 
ATOM 647  N N     . ARG A 1 89  ? 65.664  76.486  37.188  1.00 112.75 ? 164 ARG A N     1 
ATOM 648  C CA    . ARG A 1 89  ? 66.833  76.853  36.398  1.00 106.40 ? 164 ARG A CA    1 
ATOM 649  C C     . ARG A 1 89  ? 68.108  76.501  37.138  1.00 101.12 ? 164 ARG A C     1 
ATOM 650  O O     . ARG A 1 89  ? 68.949  75.750  36.634  1.00 96.04  ? 164 ARG A O     1 
ATOM 651  C CB    . ARG A 1 89  ? 66.809  78.346  36.089  1.00 130.42 ? 164 ARG A CB    1 
ATOM 652  C CG    . ARG A 1 89  ? 68.178  78.919  35.719  1.00 148.37 ? 164 ARG A CG    1 
ATOM 653  C CD    . ARG A 1 89  ? 68.177  80.444  35.802  1.00 155.11 ? 164 ARG A CD    1 
ATOM 654  N NE    . ARG A 1 89  ? 69.013  81.053  34.769  1.00 163.22 ? 164 ARG A NE    1 
ATOM 655  C CZ    . ARG A 1 89  ? 68.708  82.184  34.140  1.00 152.20 ? 164 ARG A CZ    1 
ATOM 656  N NH1   . ARG A 1 89  ? 67.583  82.817  34.438  1.00 170.09 ? 164 ARG A NH1   1 
ATOM 657  N NH2   . ARG A 1 89  ? 69.517  82.676  33.209  1.00 122.30 ? 164 ARG A NH2   1 
ATOM 658  N N     . GLU A 1 90  ? 68.285  77.082  38.323  1.00 95.88  ? 165 GLU A N     1 
ATOM 659  C CA    . GLU A 1 90  ? 69.444  76.752  39.134  1.00 103.65 ? 165 GLU A CA    1 
ATOM 660  C C     . GLU A 1 90  ? 69.626  75.246  39.260  1.00 92.11  ? 165 GLU A C     1 
ATOM 661  O O     . GLU A 1 90  ? 70.753  74.740  39.281  1.00 87.96  ? 165 GLU A O     1 
ATOM 662  C CB    . GLU A 1 90  ? 69.287  77.379  40.503  1.00 95.86  ? 165 GLU A CB    1 
ATOM 663  C CG    . GLU A 1 90  ? 70.309  76.889  41.455  1.00 84.92  ? 165 GLU A CG    1 
ATOM 664  C CD    . GLU A 1 90  ? 70.230  77.639  42.729  1.00 112.50 ? 165 GLU A CD    1 
ATOM 665  O OE1   . GLU A 1 90  ? 69.567  78.706  42.715  1.00 134.79 ? 165 GLU A OE1   1 
ATOM 666  O OE2   . GLU A 1 90  ? 70.807  77.167  43.735  1.00 100.38 ? 165 GLU A OE2   1 
ATOM 667  N N     . ILE A 1 91  ? 68.525  74.514  39.327  1.00 93.57  ? 166 ILE A N     1 
ATOM 668  C CA    . ILE A 1 91  ? 68.581  73.059  39.320  1.00 111.32 ? 166 ILE A CA    1 
ATOM 669  C C     . ILE A 1 91  ? 69.307  72.591  38.064  1.00 108.71 ? 166 ILE A C     1 
ATOM 670  O O     . ILE A 1 91  ? 70.436  72.087  38.146  1.00 100.23 ? 166 ILE A O     1 
ATOM 671  C CB    . ILE A 1 91  ? 67.169  72.440  39.416  1.00 108.11 ? 166 ILE A CB    1 
ATOM 672  C CG1   . ILE A 1 91  ? 66.564  72.679  40.804  1.00 83.09  ? 166 ILE A CG1   1 
ATOM 673  C CG2   . ILE A 1 91  ? 67.196  70.936  39.076  1.00 100.35 ? 166 ILE A CG2   1 
ATOM 674  C CD1   . ILE A 1 91  ? 67.523  72.436  41.943  1.00 85.46  ? 166 ILE A CD1   1 
ATOM 675  N N     . LYS A 1 92  ? 68.680  72.799  36.894  1.00 109.80 ? 167 LYS A N     1 
ATOM 676  C CA    . LYS A 1 92  ? 69.196  72.248  35.642  1.00 103.30 ? 167 LYS A CA    1 
ATOM 677  C C     . LYS A 1 92  ? 70.678  72.570  35.465  1.00 110.46 ? 167 LYS A C     1 
ATOM 678  O O     . LYS A 1 92  ? 71.417  71.789  34.848  1.00 105.83 ? 167 LYS A O     1 
ATOM 679  C CB    . LYS A 1 92  ? 68.374  72.771  34.452  1.00 104.70 ? 167 LYS A CB    1 
ATOM 680  C CG    . LYS A 1 92  ? 67.406  71.779  33.807  1.00 99.68  ? 167 LYS A CG    1 
ATOM 681  C CD    . LYS A 1 92  ? 66.785  72.359  32.522  1.00 109.84 ? 167 LYS A CD    1 
ATOM 682  C CE    . LYS A 1 92  ? 66.790  71.333  31.378  1.00 111.92 ? 167 LYS A CE    1 
ATOM 683  N NZ    . LYS A 1 92  ? 66.307  71.866  30.060  1.00 120.50 ? 167 LYS A NZ    1 
ATOM 684  N N     . SER A 1 93  ? 71.134  73.694  36.031  1.00 103.43 ? 168 SER A N     1 
ATOM 685  C CA    . SER A 1 93  ? 72.548  74.035  36.067  1.00 92.37  ? 168 SER A CA    1 
ATOM 686  C C     . SER A 1 93  ? 73.334  72.917  36.721  1.00 105.11 ? 168 SER A C     1 
ATOM 687  O O     . SER A 1 93  ? 74.016  72.143  36.039  1.00 103.11 ? 168 SER A O     1 
ATOM 688  C CB    . SER A 1 93  ? 72.771  75.344  36.836  1.00 110.59 ? 168 SER A CB    1 
ATOM 689  O OG    . SER A 1 93  ? 73.947  75.302  37.643  1.00 112.41 ? 168 SER A OG    1 
ATOM 690  N N     . ALA A 1 94  ? 73.180  72.796  38.043  1.00 112.17 ? 169 ALA A N     1 
ATOM 691  C CA    . ALA A 1 94  ? 74.058  71.938  38.827  1.00 97.57  ? 169 ALA A CA    1 
ATOM 692  C C     . ALA A 1 94  ? 74.080  70.518  38.297  1.00 86.01  ? 169 ALA A C     1 
ATOM 693  O O     . ALA A 1 94  ? 75.097  69.831  38.430  1.00 85.55  ? 169 ALA A O     1 
ATOM 694  C CB    . ALA A 1 94  ? 73.630  71.958  40.294  1.00 85.94  ? 169 ALA A CB    1 
ATOM 695  N N     . VAL A 1 95  ? 72.981  70.068  37.679  1.00 83.55  ? 170 VAL A N     1 
ATOM 696  C CA    . VAL A 1 95  ? 72.903  68.673  37.237  1.00 110.44 ? 170 VAL A CA    1 
ATOM 697  C C     . VAL A 1 95  ? 73.780  68.456  36.030  1.00 105.77 ? 170 VAL A C     1 
ATOM 698  O O     . VAL A 1 95  ? 74.299  67.346  35.813  1.00 83.87  ? 170 VAL A O     1 
ATOM 699  C CB    . VAL A 1 95  ? 71.444  68.241  36.963  1.00 106.10 ? 170 VAL A CB    1 
ATOM 700  C CG1   . VAL A 1 95  ? 70.607  69.434  36.679  1.00 90.54  ? 170 VAL A CG1   1 
ATOM 701  C CG2   . VAL A 1 95  ? 71.323  67.154  35.823  1.00 82.11  ? 170 VAL A CG2   1 
ATOM 702  N N     . GLU A 1 96  ? 73.948  69.503  35.222  1.00 115.31 ? 171 GLU A N     1 
ATOM 703  C CA    . GLU A 1 96  ? 74.879  69.475  34.112  1.00 121.09 ? 171 GLU A CA    1 
ATOM 704  C C     . GLU A 1 96  ? 76.284  69.941  34.490  1.00 104.88 ? 171 GLU A C     1 
ATOM 705  O O     . GLU A 1 96  ? 77.222  69.630  33.751  1.00 107.47 ? 171 GLU A O     1 
ATOM 706  C CB    . GLU A 1 96  ? 74.316  70.298  32.945  1.00 118.43 ? 171 GLU A CB    1 
ATOM 707  C CG    . GLU A 1 96  ? 73.167  69.591  32.203  1.00 110.80 ? 171 GLU A CG    1 
ATOM 708  C CD    . GLU A 1 96  ? 72.869  70.208  30.834  1.00 142.37 ? 171 GLU A CD    1 
ATOM 709  O OE1   . GLU A 1 96  ? 73.227  71.384  30.622  1.00 154.86 ? 171 GLU A OE1   1 
ATOM 710  O OE2   . GLU A 1 96  ? 72.285  69.523  29.963  1.00 142.82 ? 171 GLU A OE2   1 
ATOM 711  N N     . LYS A 1 97  ? 76.468  70.619  35.640  1.00 96.40  ? 172 LYS A N     1 
ATOM 712  C CA    . LYS A 1 97  ? 77.811  70.796  36.214  1.00 110.05 ? 172 LYS A CA    1 
ATOM 713  C C     . LYS A 1 97  ? 78.364  69.505  36.831  1.00 118.76 ? 172 LYS A C     1 
ATOM 714  O O     . LYS A 1 97  ? 79.461  69.550  37.409  1.00 107.33 ? 172 LYS A O     1 
ATOM 715  C CB    . LYS A 1 97  ? 77.852  71.924  37.265  1.00 117.18 ? 172 LYS A CB    1 
ATOM 716  C CG    . LYS A 1 97  ? 79.074  72.912  37.133  1.00 136.91 ? 172 LYS A CG    1 
ATOM 717  C CD    . LYS A 1 97  ? 80.345  72.539  37.967  1.00 134.33 ? 172 LYS A CD    1 
ATOM 718  C CE    . LYS A 1 97  ? 81.659  73.181  37.407  1.00 100.09 ? 172 LYS A CE    1 
ATOM 719  N NZ    . LYS A 1 97  ? 82.519  73.825  38.456  1.00 106.90 ? 172 LYS A NZ    1 
ATOM 720  N N     . ASP A 1 98  ? 77.600  68.402  36.796  1.00 117.56 ? 173 ASP A N     1 
ATOM 721  C CA    . ASP A 1 98  ? 77.939  67.077  37.308  1.00 96.33  ? 173 ASP A CA    1 
ATOM 722  C C     . ASP A 1 98  ? 77.955  67.027  38.823  1.00 102.78 ? 173 ASP A C     1 
ATOM 723  O O     . ASP A 1 98  ? 78.198  65.958  39.389  1.00 120.50 ? 173 ASP A O     1 
ATOM 724  C CB    . ASP A 1 98  ? 79.290  66.577  36.797  1.00 90.09  ? 173 ASP A CB    1 
ATOM 725  C CG    . ASP A 1 98  ? 79.347  65.088  36.699  1.00 98.43  ? 173 ASP A CG    1 
ATOM 726  O OD1   . ASP A 1 98  ? 80.147  64.458  37.434  1.00 101.56 ? 173 ASP A OD1   1 
ATOM 727  O OD2   . ASP A 1 98  ? 78.574  64.558  35.878  1.00 102.82 ? 173 ASP A OD2   1 
ATOM 728  N N     . GLY A 1 99  ? 77.701  68.140  39.499  1.00 102.55 ? 174 GLY A N     1 
ATOM 729  C CA    . GLY A 1 99  ? 77.750  68.198  40.944  1.00 115.87 ? 174 GLY A CA    1 
ATOM 730  C C     . GLY A 1 99  ? 76.423  67.756  41.512  1.00 109.49 ? 174 GLY A C     1 
ATOM 731  O O     . GLY A 1 99  ? 76.041  68.147  42.617  1.00 107.26 ? 174 GLY A O     1 
ATOM 732  N N     . ALA A 1 100 ? 75.707  66.951  40.729  1.00 103.72 ? 175 ALA A N     1 
ATOM 733  C CA    . ALA A 1 100 ? 74.363  66.501  41.050  1.00 95.12  ? 175 ALA A CA    1 
ATOM 734  C C     . ALA A 1 100 ? 74.357  65.060  41.542  1.00 98.58  ? 175 ALA A C     1 
ATOM 735  O O     . ALA A 1 100 ? 74.669  64.132  40.783  1.00 98.58  ? 175 ALA A O     1 
ATOM 736  C CB    . ALA A 1 100 ? 73.469  66.611  39.827  1.00 97.02  ? 175 ALA A CB    1 
ATOM 737  N N     . SER A 1 101 ? 73.957  64.877  42.793  1.00 90.41  ? 176 SER A N     1 
ATOM 738  C CA    . SER A 1 101 ? 73.606  63.572  43.317  1.00 81.80  ? 176 SER A CA    1 
ATOM 739  C C     . SER A 1 101 ? 72.269  63.672  44.040  1.00 94.41  ? 176 SER A C     1 
ATOM 740  O O     . SER A 1 101 ? 71.923  64.722  44.599  1.00 101.53 ? 176 SER A O     1 
ATOM 741  C CB    . SER A 1 101 ? 74.666  63.037  44.270  1.00 77.08  ? 176 SER A CB    1 
ATOM 742  O OG    . SER A 1 101 ? 74.436  63.524  45.572  1.00 82.74  ? 176 SER A OG    1 
ATOM 743  N N     . ALA A 1 102 ? 71.526  62.562  44.032  1.00 84.88  ? 177 ALA A N     1 
ATOM 744  C CA    . ALA A 1 102 ? 70.191  62.477  44.613  1.00 74.59  ? 177 ALA A CA    1 
ATOM 745  C C     . ALA A 1 102 ? 70.092  61.270  45.535  1.00 75.87  ? 177 ALA A C     1 
ATOM 746  O O     . ALA A 1 102 ? 70.869  60.318  45.419  1.00 82.52  ? 177 ALA A O     1 
ATOM 747  C CB    . ALA A 1 102 ? 69.115  62.361  43.534  1.00 75.14  ? 177 ALA A CB    1 
ATOM 748  N N     . THR A 1 103 ? 69.122  61.310  46.456  1.00 66.90  ? 178 THR A N     1 
ATOM 749  C CA    . THR A 1 103 ? 68.771  60.156  47.273  1.00 63.43  ? 178 THR A CA    1 
ATOM 750  C C     . THR A 1 103 ? 67.316  59.794  47.021  1.00 67.19  ? 178 THR A C     1 
ATOM 751  O O     . THR A 1 103 ? 66.475  60.682  46.824  1.00 67.20  ? 178 THR A O     1 
ATOM 752  C CB    . THR A 1 103 ? 68.975  60.403  48.769  1.00 64.06  ? 178 THR A CB    1 
ATOM 753  O OG1   . THR A 1 103 ? 68.100  61.443  49.204  1.00 67.22  ? 178 THR A OG1   1 
ATOM 754  C CG2   . THR A 1 103 ? 70.399  60.771  49.077  1.00 58.94  ? 178 THR A CG2   1 
ATOM 755  N N     . ILE A 1 104 ? 67.019  58.485  46.998  1.00 61.97  ? 179 ILE A N     1 
ATOM 756  C CA    . ILE A 1 104 ? 65.646  58.029  46.804  1.00 71.77  ? 179 ILE A CA    1 
ATOM 757  C C     . ILE A 1 104 ? 65.361  56.782  47.642  1.00 60.71  ? 179 ILE A C     1 
ATOM 758  O O     . ILE A 1 104 ? 66.252  55.951  47.852  1.00 62.47  ? 179 ILE A O     1 
ATOM 759  C CB    . ILE A 1 104 ? 65.342  57.781  45.312  1.00 70.71  ? 179 ILE A CB    1 
ATOM 760  C CG1   . ILE A 1 104 ? 65.759  56.390  44.879  1.00 58.66  ? 179 ILE A CG1   1 
ATOM 761  C CG2   . ILE A 1 104 ? 65.969  58.843  44.411  1.00 46.53  ? 179 ILE A CG2   1 
ATOM 762  C CD1   . ILE A 1 104 ? 64.896  55.953  43.709  1.00 65.58  ? 179 ILE A CD1   1 
ATOM 763  N N     . ASP A 1 105 ? 64.111  56.689  48.142  1.00 48.10  ? 180 ASP A N     1 
ATOM 764  C CA    . ASP A 1 105 ? 63.554  55.575  48.920  1.00 56.96  ? 180 ASP A CA    1 
ATOM 765  C C     . ASP A 1 105 ? 62.025  55.601  48.797  1.00 63.42  ? 180 ASP A C     1 
ATOM 766  O O     . ASP A 1 105 ? 61.436  56.566  48.288  1.00 53.54  ? 180 ASP A O     1 
ATOM 767  C CB    . ASP A 1 105 ? 63.979  55.628  50.394  1.00 48.34  ? 180 ASP A CB    1 
ATOM 768  C CG    . ASP A 1 105 ? 63.815  54.298  51.103  1.00 68.15  ? 180 ASP A CG    1 
ATOM 769  O OD1   . ASP A 1 105 ? 63.143  53.377  50.567  1.00 69.38  ? 180 ASP A OD1   1 
ATOM 770  O OD2   . ASP A 1 105 ? 64.370  54.171  52.212  1.00 83.91  ? 180 ASP A OD2   1 
ATOM 771  N N     . LEU A 1 106 ? 61.378  54.515  49.256  1.00 60.42  ? 181 LEU A N     1 
ATOM 772  C CA    . LEU A 1 106 ? 59.922  54.392  49.184  1.00 45.68  ? 181 LEU A CA    1 
ATOM 773  C C     . LEU A 1 106 ? 59.254  54.273  50.553  1.00 49.23  ? 181 LEU A C     1 
ATOM 774  O O     . LEU A 1 106 ? 59.849  53.898  51.570  1.00 56.29  ? 181 LEU A O     1 
ATOM 775  C CB    . LEU A 1 106 ? 59.506  53.194  48.355  1.00 35.94  ? 181 LEU A CB    1 
ATOM 776  C CG    . LEU A 1 106 ? 60.067  53.096  46.958  1.00 43.76  ? 181 LEU A CG    1 
ATOM 777  C CD1   . LEU A 1 106 ? 59.940  51.710  46.433  1.00 34.67  ? 181 LEU A CD1   1 
ATOM 778  C CD2   . LEU A 1 106 ? 59.257  54.015  46.092  1.00 69.72  ? 181 LEU A CD2   1 
ATOM 779  N N     . TRP A 1 107 ? 57.973  54.570  50.552  1.00 46.81  ? 182 TRP A N     1 
ATOM 780  C CA    . TRP A 1 107 ? 57.276  54.776  51.800  1.00 60.05  ? 182 TRP A CA    1 
ATOM 781  C C     . TRP A 1 107 ? 55.790  54.609  51.561  1.00 68.03  ? 182 TRP A C     1 
ATOM 782  O O     . TRP A 1 107 ? 55.319  54.667  50.421  1.00 63.24  ? 182 TRP A O     1 
ATOM 783  C CB    . TRP A 1 107 ? 57.574  56.164  52.320  1.00 55.29  ? 182 TRP A CB    1 
ATOM 784  C CG    . TRP A 1 107 ? 57.030  56.514  53.599  1.00 45.93  ? 182 TRP A CG    1 
ATOM 785  C CD1   . TRP A 1 107 ? 57.463  56.090  54.795  1.00 49.39  ? 182 TRP A CD1   1 
ATOM 786  C CD2   . TRP A 1 107 ? 55.961  57.414  53.845  1.00 48.04  ? 182 TRP A CD2   1 
ATOM 787  N NE1   . TRP A 1 107 ? 56.709  56.635  55.790  1.00 49.53  ? 182 TRP A NE1   1 
ATOM 788  C CE2   . TRP A 1 107 ? 55.786  57.478  55.229  1.00 57.12  ? 182 TRP A CE2   1 
ATOM 789  C CE3   . TRP A 1 107 ? 55.118  58.170  53.027  1.00 54.95  ? 182 TRP A CE3   1 
ATOM 790  C CZ2   . TRP A 1 107 ? 54.804  58.290  55.828  1.00 52.84  ? 182 TRP A CZ2   1 
ATOM 791  C CZ3   . TRP A 1 107 ? 54.136  58.988  53.625  1.00 42.00  ? 182 TRP A CZ3   1 
ATOM 792  C CH2   . TRP A 1 107 ? 53.992  59.029  55.004  1.00 41.32  ? 182 TRP A CH2   1 
ATOM 793  N N     . THR A 1 108 ? 55.054  54.408  52.652  1.00 59.43  ? 183 THR A N     1 
ATOM 794  C CA    . THR A 1 108 ? 53.615  54.208  52.573  1.00 58.25  ? 183 THR A CA    1 
ATOM 795  C C     . THR A 1 108 ? 52.932  54.927  53.719  1.00 50.60  ? 183 THR A C     1 
ATOM 796  O O     . THR A 1 108 ? 53.252  54.646  54.872  1.00 62.98  ? 183 THR A O     1 
ATOM 797  C CB    . THR A 1 108 ? 53.283  52.721  52.617  1.00 56.90  ? 183 THR A CB    1 
ATOM 798  O OG1   . THR A 1 108 ? 53.854  52.056  51.471  1.00 68.71  ? 183 THR A OG1   1 
ATOM 799  C CG2   . THR A 1 108 ? 51.786  52.547  52.653  1.00 40.80  ? 183 THR A CG2   1 
ATOM 800  N N     . ASP A 1 109 ? 51.971  55.810  53.434  1.00 40.07  ? 184 ASP A N     1 
ATOM 801  C CA    . ASP A 1 109 ? 51.302  56.455  54.563  1.00 49.61  ? 184 ASP A CA    1 
ATOM 802  C C     . ASP A 1 109 ? 50.555  55.409  55.370  1.00 53.13  ? 184 ASP A C     1 
ATOM 803  O O     . ASP A 1 109 ? 50.321  54.295  54.911  1.00 58.97  ? 184 ASP A O     1 
ATOM 804  C CB    . ASP A 1 109 ? 50.363  57.582  54.124  1.00 42.11  ? 184 ASP A CB    1 
ATOM 805  C CG    . ASP A 1 109 ? 49.109  57.102  53.490  1.00 43.07  ? 184 ASP A CG    1 
ATOM 806  O OD1   . ASP A 1 109 ? 48.129  56.938  54.217  1.00 52.53  ? 184 ASP A OD1   1 
ATOM 807  O OD2   . ASP A 1 109 ? 49.077  56.920  52.262  1.00 46.12  ? 184 ASP A OD2   1 
ATOM 808  N N     . ASN A 1 110 ? 50.294  55.707  56.631  1.00 52.09  ? 185 ASN A N     1 
ATOM 809  C CA    . ASN A 1 110 ? 49.749  54.639  57.454  1.00 66.17  ? 185 ASN A CA    1 
ATOM 810  C C     . ASN A 1 110 ? 48.259  54.752  57.692  1.00 51.31  ? 185 ASN A C     1 
ATOM 811  O O     . ASN A 1 110 ? 47.742  54.088  58.589  1.00 64.15  ? 185 ASN A O     1 
ATOM 812  C CB    . ASN A 1 110 ? 50.537  54.460  58.753  1.00 64.76  ? 185 ASN A CB    1 
ATOM 813  C CG    . ASN A 1 110 ? 50.098  55.345  59.812  1.00 76.00  ? 185 ASN A CG    1 
ATOM 814  O OD1   . ASN A 1 110 ? 49.982  56.556  59.605  1.00 107.05 ? 185 ASN A OD1   1 
ATOM 815  N ND2   . ASN A 1 110 ? 49.868  54.778  60.995  1.00 74.21  ? 185 ASN A ND2   1 
ATOM 816  N N     . TYR A 1 111 ? 47.561  55.600  56.959  1.00 49.56  ? 186 TYR A N     1 
ATOM 817  C CA    . TYR A 1 111 ? 46.102  55.604  57.009  1.00 52.77  ? 186 TYR A CA    1 
ATOM 818  C C     . TYR A 1 111 ? 45.509  55.198  55.668  1.00 60.09  ? 186 TYR A C     1 
ATOM 819  O O     . TYR A 1 111 ? 44.716  54.265  55.626  1.00 74.04  ? 186 TYR A O     1 
ATOM 820  C CB    . TYR A 1 111 ? 45.555  56.958  57.491  1.00 34.20  ? 186 TYR A CB    1 
ATOM 821  C CG    . TYR A 1 111 ? 45.978  57.315  58.890  1.00 35.68  ? 186 TYR A CG    1 
ATOM 822  C CD1   . TYR A 1 111 ? 45.114  57.225  59.937  1.00 49.47  ? 186 TYR A CD1   1 
ATOM 823  C CD2   . TYR A 1 111 ? 47.247  57.737  59.154  1.00 54.43  ? 186 TYR A CD2   1 
ATOM 824  C CE1   . TYR A 1 111 ? 45.520  57.524  61.207  1.00 56.80  ? 186 TYR A CE1   1 
ATOM 825  C CE2   . TYR A 1 111 ? 47.655  58.056  60.415  1.00 54.81  ? 186 TYR A CE2   1 
ATOM 826  C CZ    . TYR A 1 111 ? 46.806  57.938  61.442  1.00 52.54  ? 186 TYR A CZ    1 
ATOM 827  O OH    . TYR A 1 111 ? 47.263  58.258  62.713  1.00 78.93  ? 186 TYR A OH    1 
ATOM 828  N N     . ILE A 1 112 ? 45.804  55.907  54.579  1.00 60.92  ? 187 ILE A N     1 
ATOM 829  C CA    . ILE A 1 112 ? 45.284  55.535  53.261  1.00 57.49  ? 187 ILE A CA    1 
ATOM 830  C C     . ILE A 1 112 ? 46.042  54.364  52.660  1.00 63.11  ? 187 ILE A C     1 
ATOM 831  O O     . ILE A 1 112 ? 45.511  53.642  51.797  1.00 56.67  ? 187 ILE A O     1 
ATOM 832  C CB    . ILE A 1 112 ? 45.403  56.731  52.313  1.00 58.62  ? 187 ILE A CB    1 
ATOM 833  C CG1   . ILE A 1 112 ? 44.816  57.975  52.979  1.00 62.41  ? 187 ILE A CG1   1 
ATOM 834  C CG2   . ILE A 1 112 ? 44.883  56.390  50.893  1.00 50.77  ? 187 ILE A CG2   1 
ATOM 835  C CD1   . ILE A 1 112 ? 43.486  57.741  53.631  1.00 66.17  ? 187 ILE A CD1   1 
ATOM 836  N N     . LYS A 1 113 ? 47.273  54.171  53.113  1.00 53.65  ? 188 LYS A N     1 
ATOM 837  C CA    . LYS A 1 113 ? 48.209  53.206  52.561  1.00 57.83  ? 188 LYS A CA    1 
ATOM 838  C C     . LYS A 1 113 ? 48.432  53.412  51.061  1.00 61.90  ? 188 LYS A C     1 
ATOM 839  O O     . LYS A 1 113 ? 48.290  52.483  50.252  1.00 72.81  ? 188 LYS A O     1 
ATOM 840  C CB    . LYS A 1 113 ? 47.762  51.793  52.877  1.00 54.27  ? 188 LYS A CB    1 
ATOM 841  C CG    . LYS A 1 113 ? 47.135  51.660  54.270  1.00 73.91  ? 188 LYS A CG    1 
ATOM 842  C CD    . LYS A 1 113 ? 48.034  52.105  55.422  1.00 61.54  ? 188 LYS A CD    1 
ATOM 843  C CE    . LYS A 1 113 ? 48.445  50.893  56.327  1.00 82.40  ? 188 LYS A CE    1 
ATOM 844  N NZ    . LYS A 1 113 ? 47.323  49.923  56.656  1.00 67.10  ? 188 LYS A NZ    1 
ATOM 845  N N     . ARG A 1 114 ? 48.808  54.651  50.699  1.00 47.21  ? 189 ARG A N     1 
ATOM 846  C CA    . ARG A 1 114 ? 49.400  54.933  49.397  1.00 59.43  ? 189 ARG A CA    1 
ATOM 847  C C     . ARG A 1 114 ? 50.881  54.640  49.417  1.00 59.17  ? 189 ARG A C     1 
ATOM 848  O O     . ARG A 1 114 ? 51.541  54.869  50.425  1.00 56.36  ? 189 ARG A O     1 
ATOM 849  C CB    . ARG A 1 114 ? 49.261  56.389  49.000  1.00 59.20  ? 189 ARG A CB    1 
ATOM 850  C CG    . ARG A 1 114 ? 47.947  56.844  48.557  1.00 56.46  ? 189 ARG A CG    1 
ATOM 851  C CD    . ARG A 1 114 ? 48.080  58.309  48.495  1.00 73.58  ? 189 ARG A CD    1 
ATOM 852  N NE    . ARG A 1 114 ? 46.810  58.972  48.656  1.00 87.24  ? 189 ARG A NE    1 
ATOM 853  C CZ    . ARG A 1 114 ? 45.971  59.112  47.656  1.00 70.67  ? 189 ARG A CZ    1 
ATOM 854  N NH1   . ARG A 1 114 ? 46.315  58.614  46.461  1.00 50.76  ? 189 ARG A NH1   1 
ATOM 855  N NH2   . ARG A 1 114 ? 44.816  59.726  47.871  1.00 67.45  ? 189 ARG A NH2   1 
ATOM 856  N N     . ASN A 1 115 ? 51.406  54.179  48.275  1.00 75.15  ? 190 ASN A N     1 
ATOM 857  C CA    . ASN A 1 115 ? 52.836  53.959  48.088  1.00 65.16  ? 190 ASN A CA    1 
ATOM 858  C C     . ASN A 1 115 ? 53.445  55.176  47.416  1.00 65.12  ? 190 ASN A C     1 
ATOM 859  O O     . ASN A 1 115 ? 52.850  55.760  46.509  1.00 81.50  ? 190 ASN A O     1 
ATOM 860  C CB    . ASN A 1 115 ? 53.110  52.726  47.239  1.00 71.42  ? 190 ASN A CB    1 
ATOM 861  C CG    . ASN A 1 115 ? 52.218  51.573  47.593  1.00 98.55  ? 190 ASN A CG    1 
ATOM 862  O OD1   . ASN A 1 115 ? 52.366  50.947  48.653  1.00 91.11  ? 190 ASN A OD1   1 
ATOM 863  N ND2   . ASN A 1 115 ? 51.275  51.270  46.701  1.00 119.01 ? 190 ASN A ND2   1 
ATOM 864  N N     . PHE A 1 116 ? 54.654  55.514  47.831  1.00 57.75  ? 191 PHE A N     1 
ATOM 865  C CA    . PHE A 1 116 ? 55.239  56.820  47.595  1.00 66.09  ? 191 PHE A CA    1 
ATOM 866  C C     . PHE A 1 116 ? 56.721  56.710  47.266  1.00 73.44  ? 191 PHE A C     1 
ATOM 867  O O     . PHE A 1 116 ? 57.422  55.825  47.769  1.00 76.31  ? 191 PHE A O     1 
ATOM 868  C CB    . PHE A 1 116 ? 55.097  57.696  48.837  1.00 66.78  ? 191 PHE A CB    1 
ATOM 869  C CG    . PHE A 1 116 ? 53.812  58.464  48.906  1.00 62.63  ? 191 PHE A CG    1 
ATOM 870  C CD1   . PHE A 1 116 ? 53.167  58.649  50.102  1.00 59.94  ? 191 PHE A CD1   1 
ATOM 871  C CD2   . PHE A 1 116 ? 53.270  59.031  47.791  1.00 77.39  ? 191 PHE A CD2   1 
ATOM 872  C CE1   . PHE A 1 116 ? 52.000  59.368  50.184  1.00 50.45  ? 191 PHE A CE1   1 
ATOM 873  C CE2   . PHE A 1 116 ? 52.095  59.748  47.877  1.00 80.03  ? 191 PHE A CE2   1 
ATOM 874  C CZ    . PHE A 1 116 ? 51.469  59.910  49.088  1.00 60.50  ? 191 PHE A CZ    1 
ATOM 875  N N     . LEU A 1 117 ? 57.211  57.658  46.471  1.00 71.27  ? 192 LEU A N     1 
ATOM 876  C CA    . LEU A 1 117 ? 58.631  57.740  46.168  1.00 67.81  ? 192 LEU A CA    1 
ATOM 877  C C     . LEU A 1 117 ? 59.167  59.090  46.592  1.00 59.34  ? 192 LEU A C     1 
ATOM 878  O O     . LEU A 1 117 ? 58.591  60.125  46.243  1.00 51.37  ? 192 LEU A O     1 
ATOM 879  C CB    . LEU A 1 117 ? 58.901  57.530  44.690  1.00 68.13  ? 192 LEU A CB    1 
ATOM 880  C CG    . LEU A 1 117 ? 60.364  57.748  44.304  1.00 61.86  ? 192 LEU A CG    1 
ATOM 881  C CD1   . LEU A 1 117 ? 61.302  56.596  44.714  1.00 59.40  ? 192 LEU A CD1   1 
ATOM 882  C CD2   . LEU A 1 117 ? 60.388  57.949  42.821  1.00 65.83  ? 192 LEU A CD2   1 
ATOM 883  N N     . GLY A 1 118 ? 60.229  59.065  47.387  1.00 54.97  ? 193 GLY A N     1 
ATOM 884  C CA    . GLY A 1 118 ? 60.921  60.270  47.791  1.00 58.21  ? 193 GLY A CA    1 
ATOM 885  C C     . GLY A 1 118 ? 62.139  60.557  46.941  1.00 64.74  ? 193 GLY A C     1 
ATOM 886  O O     . GLY A 1 118 ? 62.833  59.653  46.495  1.00 58.36  ? 193 GLY A O     1 
ATOM 887  N N     . VAL A 1 119 ? 62.412  61.842  46.747  1.00 71.02  ? 194 VAL A N     1 
ATOM 888  C CA    . VAL A 1 119 ? 63.621  62.281  46.065  1.00 62.55  ? 194 VAL A CA    1 
ATOM 889  C C     . VAL A 1 119 ? 64.088  63.558  46.719  1.00 63.44  ? 194 VAL A C     1 
ATOM 890  O O     . VAL A 1 119 ? 63.300  64.496  46.857  1.00 57.03  ? 194 VAL A O     1 
ATOM 891  C CB    . VAL A 1 119 ? 63.411  62.557  44.574  1.00 46.77  ? 194 VAL A CB    1 
ATOM 892  C CG1   . VAL A 1 119 ? 64.727  62.429  43.876  1.00 59.92  ? 194 VAL A CG1   1 
ATOM 893  C CG2   . VAL A 1 119 ? 62.418  61.641  43.997  1.00 51.77  ? 194 VAL A CG2   1 
ATOM 894  N N     . THR A 1 120 ? 65.371  63.611  47.077  1.00 64.55  ? 195 THR A N     1 
ATOM 895  C CA    . THR A 1 120 ? 66.038  64.845  47.452  1.00 64.01  ? 195 THR A CA    1 
ATOM 896  C C     . THR A 1 120 ? 67.268  65.023  46.585  1.00 74.59  ? 195 THR A C     1 
ATOM 897  O O     . THR A 1 120 ? 67.872  64.039  46.157  1.00 71.90  ? 195 THR A O     1 
ATOM 898  C CB    . THR A 1 120 ? 66.539  64.859  48.873  1.00 71.62  ? 195 THR A CB    1 
ATOM 899  O OG1   . THR A 1 120 ? 67.654  63.972  48.939  1.00 72.13  ? 195 THR A OG1   1 
ATOM 900  C CG2   . THR A 1 120 ? 65.474  64.442  49.860  1.00 74.72  ? 195 THR A CG2   1 
ATOM 901  N N     . LEU A 1 121 ? 67.680  66.280  46.400  1.00 82.59  ? 196 LEU A N     1 
ATOM 902  C CA    . LEU A 1 121 ? 68.838  66.621  45.586  1.00 76.14  ? 196 LEU A CA    1 
ATOM 903  C C     . LEU A 1 121 ? 69.930  67.242  46.442  1.00 81.51  ? 196 LEU A C     1 
ATOM 904  O O     . LEU A 1 121 ? 69.650  67.889  47.464  1.00 78.38  ? 196 LEU A O     1 
ATOM 905  C CB    . LEU A 1 121 ? 68.450  67.585  44.478  1.00 78.26  ? 196 LEU A CB    1 
ATOM 906  C CG    . LEU A 1 121 ? 69.325  67.664  43.246  1.00 77.43  ? 196 LEU A CG    1 
ATOM 907  C CD1   . LEU A 1 121 ? 69.934  66.308  42.928  1.00 69.90  ? 196 LEU A CD1   1 
ATOM 908  C CD2   . LEU A 1 121 ? 68.428  68.133  42.128  1.00 68.98  ? 196 LEU A CD2   1 
ATOM 909  N N     . HIS A 1 122 ? 71.178  67.032  46.010  1.00 76.22  ? 197 HIS A N     1 
ATOM 910  C CA    . HIS A 1 122 ? 72.347  67.465  46.770  1.00 85.59  ? 197 HIS A CA    1 
ATOM 911  C C     . HIS A 1 122 ? 73.417  68.064  45.870  1.00 88.61  ? 197 HIS A C     1 
ATOM 912  O O     . HIS A 1 122 ? 74.032  67.331  45.089  1.00 81.00  ? 197 HIS A O     1 
ATOM 913  C CB    . HIS A 1 122 ? 72.917  66.277  47.536  1.00 103.09 ? 197 HIS A CB    1 
ATOM 914  C CG    . HIS A 1 122 ? 71.924  65.633  48.448  1.00 92.09  ? 197 HIS A CG    1 
ATOM 915  N ND1   . HIS A 1 122 ? 71.695  66.083  49.732  1.00 94.14  ? 197 HIS A ND1   1 
ATOM 916  C CD2   . HIS A 1 122 ? 71.075  64.604  48.248  1.00 67.23  ? 197 HIS A CD2   1 
ATOM 917  C CE1   . HIS A 1 122 ? 70.750  65.350  50.285  1.00 71.43  ? 197 HIS A CE1   1 
ATOM 918  N NE2   . HIS A 1 122 ? 70.358  64.448  49.405  1.00 74.38  ? 197 HIS A NE2   1 
ATOM 919  N N     . TYR A 1 123 ? 73.684  69.369  46.049  1.00 96.83  ? 198 TYR A N     1 
ATOM 920  C CA    . TYR A 1 123 ? 74.700  70.147  45.333  1.00 96.52  ? 198 TYR A CA    1 
ATOM 921  C C     . TYR A 1 123 ? 75.034  71.404  46.149  1.00 111.08 ? 198 TYR A C     1 
ATOM 922  O O     . TYR A 1 123 ? 74.213  71.876  46.942  1.00 107.17 ? 198 TYR A O     1 
ATOM 923  C CB    . TYR A 1 123 ? 74.226  70.529  43.933  1.00 84.76  ? 198 TYR A CB    1 
ATOM 924  C CG    . TYR A 1 123 ? 73.105  71.513  44.009  1.00 100.01 ? 198 TYR A CG    1 
ATOM 925  C CD1   . TYR A 1 123 ? 73.349  72.879  44.013  1.00 105.96 ? 198 TYR A CD1   1 
ATOM 926  C CD2   . TYR A 1 123 ? 71.796  71.081  44.124  1.00 109.75 ? 198 TYR A CD2   1 
ATOM 927  C CE1   . TYR A 1 123 ? 72.319  73.776  44.114  1.00 113.57 ? 198 TYR A CE1   1 
ATOM 928  C CE2   . TYR A 1 123 ? 70.757  71.977  44.220  1.00 110.33 ? 198 TYR A CE2   1 
ATOM 929  C CZ    . TYR A 1 123 ? 71.024  73.319  44.217  1.00 108.92 ? 198 TYR A CZ    1 
ATOM 930  O OH    . TYR A 1 123 ? 69.981  74.204  44.314  1.00 112.55 ? 198 TYR A OH    1 
ATOM 931  N N     . HIS A 1 124 ? 76.237  71.975  45.892  1.00 116.94 ? 199 HIS A N     1 
ATOM 932  C CA    . HIS A 1 124 ? 77.002  72.756  46.884  1.00 115.72 ? 199 HIS A CA    1 
ATOM 933  C C     . HIS A 1 124 ? 76.622  74.242  46.984  1.00 123.84 ? 199 HIS A C     1 
ATOM 934  O O     . HIS A 1 124 ? 76.410  74.758  48.095  1.00 104.56 ? 199 HIS A O     1 
ATOM 935  C CB    . HIS A 1 124 ? 78.501  72.607  46.590  1.00 73.98  ? 199 HIS A CB    1 
ATOM 936  C CG    . HIS A 1 124 ? 78.791  72.009  45.249  1.00 122.39 ? 199 HIS A CG    1 
ATOM 937  N ND1   . HIS A 1 124 ? 78.505  70.694  44.936  1.00 142.96 ? 199 HIS A ND1   1 
ATOM 938  C CD2   . HIS A 1 124 ? 79.357  72.542  44.140  1.00 154.45 ? 199 HIS A CD2   1 
ATOM 939  C CE1   . HIS A 1 124 ? 78.871  70.446  43.689  1.00 139.30 ? 199 HIS A CE1   1 
ATOM 940  N NE2   . HIS A 1 124 ? 79.393  71.551  43.185  1.00 163.88 ? 199 HIS A NE2   1 
ATOM 941  N N     . GLU A 1 125 ? 76.608  74.960  45.850  1.00 129.74 ? 200 GLU A N     1 
ATOM 942  C CA    . GLU A 1 125 ? 76.281  76.394  45.802  1.00 138.87 ? 200 GLU A CA    1 
ATOM 943  C C     . GLU A 1 125 ? 77.125  77.306  46.711  1.00 139.79 ? 200 GLU A C     1 
ATOM 944  O O     . GLU A 1 125 ? 76.810  77.493  47.894  1.00 134.49 ? 200 GLU A O     1 
ATOM 945  C CB    . GLU A 1 125 ? 74.791  76.631  46.049  1.00 138.21 ? 200 GLU A CB    1 
ATOM 946  C CG    . GLU A 1 125 ? 74.263  77.879  45.312  1.00 140.69 ? 200 GLU A CG    1 
ATOM 947  C CD    . GLU A 1 125 ? 74.826  78.040  43.889  1.00 144.71 ? 200 GLU A CD    1 
ATOM 948  O OE1   . GLU A 1 125 ? 74.779  77.067  43.098  1.00 136.53 ? 200 GLU A OE1   1 
ATOM 949  O OE2   . GLU A 1 125 ? 75.326  79.147  43.568  1.00 145.96 ? 200 GLU A OE2   1 
ATOM 950  N N     . ASN A 1 126 ? 78.253  77.795  46.185  1.00 135.53 ? 201 ASN A N     1 
ATOM 951  C CA    . ASN A 1 126 ? 79.187  78.635  46.925  1.00 135.00 ? 201 ASN A CA    1 
ATOM 952  C C     . ASN A 1 126 ? 79.785  77.781  48.020  1.00 138.40 ? 201 ASN A C     1 
ATOM 953  O O     . ASN A 1 126 ? 80.326  76.712  47.732  1.00 144.02 ? 201 ASN A O     1 
ATOM 954  C CB    . ASN A 1 126 ? 78.505  79.880  47.502  1.00 133.73 ? 201 ASN A CB    1 
ATOM 955  C CG    . ASN A 1 126 ? 77.642  80.594  46.485  1.00 144.01 ? 201 ASN A CG    1 
ATOM 956  O OD1   . ASN A 1 126 ? 78.142  81.313  45.614  1.00 158.44 ? 201 ASN A OD1   1 
ATOM 957  N ND2   . ASN A 1 126 ? 76.333  80.407  46.594  1.00 134.88 ? 201 ASN A ND2   1 
ATOM 958  N N     . ASN A 1 127 ? 79.728  78.222  49.258  1.00 135.81 ? 202 ASN A N     1 
ATOM 959  C CA    . ASN A 1 127 ? 79.903  77.289  50.356  1.00 136.22 ? 202 ASN A CA    1 
ATOM 960  C C     . ASN A 1 127 ? 78.566  77.277  51.072  1.00 137.70 ? 202 ASN A C     1 
ATOM 961  O O     . ASN A 1 127 ? 78.286  78.151  51.894  1.00 144.25 ? 202 ASN A O     1 
ATOM 962  C CB    . ASN A 1 127 ? 81.047  77.718  51.262  1.00 140.23 ? 202 ASN A CB    1 
ATOM 963  C CG    . ASN A 1 127 ? 82.208  76.742  51.238  1.00 143.98 ? 202 ASN A CG    1 
ATOM 964  O OD1   . ASN A 1 127 ? 82.347  75.916  52.144  1.00 139.71 ? 202 ASN A OD1   1 
ATOM 965  N ND2   . ASN A 1 127 ? 83.053  76.834  50.206  1.00 123.20 ? 202 ASN A ND2   1 
ATOM 966  N N     . GLU A 1 128 ? 77.736  76.294  50.737  1.00 137.77 ? 203 GLU A N     1 
ATOM 967  C CA    . GLU A 1 128 ? 76.443  76.133  51.390  1.00 141.69 ? 203 GLU A CA    1 
ATOM 968  C C     . GLU A 1 128 ? 76.060  74.666  51.596  1.00 135.33 ? 203 GLU A C     1 
ATOM 969  O O     . GLU A 1 128 ? 75.915  74.217  52.743  1.00 120.62 ? 203 GLU A O     1 
ATOM 970  C CB    . GLU A 1 128 ? 75.374  76.911  50.628  1.00 140.81 ? 203 GLU A CB    1 
ATOM 971  C CG    . GLU A 1 128 ? 75.113  78.280  51.263  1.00 123.15 ? 203 GLU A CG    1 
ATOM 972  C CD    . GLU A 1 128 ? 74.280  79.171  50.386  1.00 138.63 ? 203 GLU A CD    1 
ATOM 973  O OE1   . GLU A 1 128 ? 74.858  79.762  49.441  1.00 146.16 ? 203 GLU A OE1   1 
ATOM 974  O OE2   . GLU A 1 128 ? 73.053  79.268  50.633  1.00 131.52 ? 203 GLU A OE2   1 
ATOM 975  N N     . LEU A 1 129 ? 75.953  73.915  50.483  1.00 127.28 ? 204 LEU A N     1 
ATOM 976  C CA    . LEU A 1 129 ? 75.387  72.559  50.402  1.00 124.38 ? 204 LEU A CA    1 
ATOM 977  C C     . LEU A 1 129 ? 73.859  72.437  50.511  1.00 117.46 ? 204 LEU A C     1 
ATOM 978  O O     . LEU A 1 129 ? 73.305  72.222  51.595  1.00 114.00 ? 204 LEU A O     1 
ATOM 979  C CB    . LEU A 1 129 ? 76.049  71.657  51.452  1.00 115.02 ? 204 LEU A CB    1 
ATOM 980  C CG    . LEU A 1 129 ? 75.998  70.159  51.175  1.00 105.72 ? 204 LEU A CG    1 
ATOM 981  C CD1   . LEU A 1 129 ? 76.461  69.856  49.746  1.00 91.06  ? 204 LEU A CD1   1 
ATOM 982  C CD2   . LEU A 1 129 ? 76.825  69.397  52.215  1.00 105.83 ? 204 LEU A CD2   1 
ATOM 983  N N     . ARG A 1 130 ? 73.177  72.643  49.380  1.00 105.52 ? 205 ARG A N     1 
ATOM 984  C CA    . ARG A 1 130 ? 71.746  72.367  49.233  1.00 108.00 ? 205 ARG A CA    1 
ATOM 985  C C     . ARG A 1 130 ? 71.378  70.886  49.470  1.00 114.68 ? 205 ARG A C     1 
ATOM 986  O O     . ARG A 1 130 ? 71.870  69.982  48.778  1.00 100.06 ? 205 ARG A O     1 
ATOM 987  C CB    . ARG A 1 130 ? 71.316  72.787  47.823  1.00 106.07 ? 205 ARG A CB    1 
ATOM 988  C CG    . ARG A 1 130 ? 70.966  74.266  47.640  1.00 119.88 ? 205 ARG A CG    1 
ATOM 989  C CD    . ARG A 1 130 ? 72.118  75.222  47.934  1.00 119.90 ? 205 ARG A CD    1 
ATOM 990  N NE    . ARG A 1 130 ? 71.722  76.341  48.795  1.00 123.94 ? 205 ARG A NE    1 
ATOM 991  C CZ    . ARG A 1 130 ? 71.180  77.473  48.352  1.00 127.67 ? 205 ARG A CZ    1 
ATOM 992  N NH1   . ARG A 1 130 ? 70.965  77.629  47.048  1.00 117.05 ? 205 ARG A NH1   1 
ATOM 993  N NH2   . ARG A 1 130 ? 70.852  78.445  49.209  1.00 120.43 ? 205 ARG A NH2   1 
ATOM 994  N N     . ASP A 1 131 ? 70.460  70.648  50.415  1.00 117.99 ? 206 ASP A N     1 
ATOM 995  C CA    . ASP A 1 131 ? 69.783  69.359  50.588  1.00 102.40 ? 206 ASP A CA    1 
ATOM 996  C C     . ASP A 1 131 ? 68.286  69.665  50.592  1.00 101.95 ? 206 ASP A C     1 
ATOM 997  O O     . ASP A 1 131 ? 67.782  70.338  51.507  1.00 92.16  ? 206 ASP A O     1 
ATOM 998  C CB    . ASP A 1 131 ? 70.257  68.642  51.872  1.00 96.98  ? 206 ASP A CB    1 
ATOM 999  C CG    . ASP A 1 131 ? 69.111  68.256  52.825  1.00 111.93 ? 206 ASP A CG    1 
ATOM 1000 O OD1   . ASP A 1 131 ? 68.526  67.159  52.663  1.00 108.11 ? 206 ASP A OD1   1 
ATOM 1001 O OD2   . ASP A 1 131 ? 68.805  69.043  53.752  1.00 113.75 ? 206 ASP A OD2   1 
ATOM 1002 N N     . LEU A 1 132 ? 67.580  69.219  49.549  1.00 79.88  ? 207 LEU A N     1 
ATOM 1003 C CA    . LEU A 1 132 ? 66.223  69.713  49.343  1.00 83.76  ? 207 LEU A CA    1 
ATOM 1004 C C     . LEU A 1 132 ? 65.378  68.639  48.683  1.00 76.29  ? 207 LEU A C     1 
ATOM 1005 O O     . LEU A 1 132 ? 65.899  67.738  48.022  1.00 69.28  ? 207 LEU A O     1 
ATOM 1006 C CB    . LEU A 1 132 ? 66.199  70.973  48.476  1.00 67.98  ? 207 LEU A CB    1 
ATOM 1007 C CG    . LEU A 1 132 ? 66.253  70.544  47.016  1.00 73.13  ? 207 LEU A CG    1 
ATOM 1008 C CD1   . LEU A 1 132 ? 65.684  71.573  46.044  1.00 56.13  ? 207 LEU A CD1   1 
ATOM 1009 C CD2   . LEU A 1 132 ? 67.666  70.133  46.643  1.00 89.20  ? 207 LEU A CD2   1 
ATOM 1010 N N     . ILE A 1 133 ? 64.060  68.772  48.830  1.00 54.10  ? 208 ILE A N     1 
ATOM 1011 C CA    . ILE A 1 133 ? 63.139  67.752  48.355  1.00 57.30  ? 208 ILE A CA    1 
ATOM 1012 C C     . ILE A 1 133 ? 62.715  68.116  46.944  1.00 63.66  ? 208 ILE A C     1 
ATOM 1013 O O     . ILE A 1 133 ? 62.001  69.103  46.745  1.00 55.54  ? 208 ILE A O     1 
ATOM 1014 C CB    . ILE A 1 133 ? 61.910  67.616  49.261  1.00 63.92  ? 208 ILE A CB    1 
ATOM 1015 C CG1   . ILE A 1 133 ? 62.225  66.766  50.497  1.00 49.82  ? 208 ILE A CG1   1 
ATOM 1016 C CG2   . ILE A 1 133 ? 60.709  67.050  48.461  1.00 50.04  ? 208 ILE A CG2   1 
ATOM 1017 C CD1   . ILE A 1 133 ? 61.906  67.453  51.832  1.00 55.17  ? 208 ILE A CD1   1 
ATOM 1018 N N     . LEU A 1 134 ? 63.145  67.308  45.965  1.00 66.57  ? 209 LEU A N     1 
ATOM 1019 C CA    . LEU A 1 134 ? 62.526  67.320  44.645  1.00 60.76  ? 209 LEU A CA    1 
ATOM 1020 C C     . LEU A 1 134 ? 61.043  67.040  44.792  1.00 66.20  ? 209 LEU A C     1 
ATOM 1021 O O     . LEU A 1 134 ? 60.207  67.914  44.563  1.00 74.39  ? 209 LEU A O     1 
ATOM 1022 C CB    . LEU A 1 134 ? 63.136  66.278  43.717  1.00 54.42  ? 209 LEU A CB    1 
ATOM 1023 C CG    . LEU A 1 134 ? 64.347  66.647  42.861  1.00 74.35  ? 209 LEU A CG    1 
ATOM 1024 C CD1   . LEU A 1 134 ? 63.931  66.884  41.407  1.00 75.02  ? 209 LEU A CD1   1 
ATOM 1025 C CD2   . LEU A 1 134 ? 65.072  67.847  43.441  1.00 74.67  ? 209 LEU A CD2   1 
ATOM 1026 N N     . GLY A 1 135 ? 60.702  65.832  45.190  1.00 62.54  ? 210 GLY A N     1 
ATOM 1027 C CA    . GLY A 1 135 ? 59.308  65.516  45.330  1.00 59.96  ? 210 GLY A CA    1 
ATOM 1028 C C     . GLY A 1 135 ? 59.097  64.251  46.119  1.00 67.91  ? 210 GLY A C     1 
ATOM 1029 O O     . GLY A 1 135 ? 59.993  63.411  46.258  1.00 64.67  ? 210 GLY A O     1 
ATOM 1030 N N     . LEU A 1 136 ? 57.896  64.151  46.660  1.00 63.03  ? 211 LEU A N     1 
ATOM 1031 C CA    . LEU A 1 136 ? 57.316  62.913  47.141  1.00 54.80  ? 211 LEU A CA    1 
ATOM 1032 C C     . LEU A 1 136 ? 56.045  62.677  46.340  1.00 62.21  ? 211 LEU A C     1 
ATOM 1033 O O     . LEU A 1 136 ? 55.044  63.376  46.550  1.00 62.59  ? 211 LEU A O     1 
ATOM 1034 C CB    . LEU A 1 136 ? 56.998  63.047  48.618  1.00 58.09  ? 211 LEU A CB    1 
ATOM 1035 C CG    . LEU A 1 136 ? 56.145  61.908  49.171  1.00 71.39  ? 211 LEU A CG    1 
ATOM 1036 C CD1   . LEU A 1 136 ? 56.999  60.645  49.515  1.00 55.43  ? 211 LEU A CD1   1 
ATOM 1037 C CD2   . LEU A 1 136 ? 55.338  62.425  50.363  1.00 43.34  ? 211 LEU A CD2   1 
ATOM 1038 N N     . LYS A 1 137 ? 56.045  61.694  45.443  1.00 62.37  ? 212 LYS A N     1 
ATOM 1039 C CA    . LYS A 1 137 ? 54.868  61.533  44.599  1.00 70.32  ? 212 LYS A CA    1 
ATOM 1040 C C     . LYS A 1 137 ? 54.332  60.110  44.609  1.00 64.65  ? 212 LYS A C     1 
ATOM 1041 O O     . LYS A 1 137 ? 55.069  59.127  44.710  1.00 57.18  ? 212 LYS A O     1 
ATOM 1042 C CB    . LYS A 1 137 ? 55.105  61.968  43.155  1.00 81.95  ? 212 LYS A CB    1 
ATOM 1043 C CG    . LYS A 1 137 ? 53.784  62.376  42.481  1.00 109.10 ? 212 LYS A CG    1 
ATOM 1044 C CD    . LYS A 1 137 ? 53.779  62.103  40.987  1.00 110.11 ? 212 LYS A CD    1 
ATOM 1045 C CE    . LYS A 1 137 ? 54.308  63.296  40.216  1.00 100.66 ? 212 LYS A CE    1 
ATOM 1046 N NZ    . LYS A 1 137 ? 55.139  62.823  39.090  1.00 79.25  ? 212 LYS A NZ    1 
ATOM 1047 N N     . SER A 1 138 ? 53.015  60.035  44.489  1.00 75.89  ? 213 SER A N     1 
ATOM 1048 C CA    . SER A 1 138 ? 52.307  58.776  44.603  1.00 77.04  ? 213 SER A CA    1 
ATOM 1049 C C     . SER A 1 138 ? 52.595  57.900  43.411  1.00 86.34  ? 213 SER A C     1 
ATOM 1050 O O     . SER A 1 138 ? 52.355  58.291  42.265  1.00 97.95  ? 213 SER A O     1 
ATOM 1051 C CB    . SER A 1 138 ? 50.816  59.037  44.692  1.00 79.86  ? 213 SER A CB    1 
ATOM 1052 O OG    . SER A 1 138 ? 50.564  60.291  44.066  1.00 101.31 ? 213 SER A OG    1 
ATOM 1053 N N     . LEU A 1 139 ? 53.050  56.693  43.695  1.00 83.10  ? 214 LEU A N     1 
ATOM 1054 C CA    . LEU A 1 139 ? 52.808  55.612  42.776  1.00 72.39  ? 214 LEU A CA    1 
ATOM 1055 C C     . LEU A 1 139 ? 51.333  55.391  42.596  1.00 93.54  ? 214 LEU A C     1 
ATOM 1056 O O     . LEU A 1 139 ? 50.948  54.484  41.850  1.00 92.35  ? 214 LEU A O     1 
ATOM 1057 C CB    . LEU A 1 139 ? 53.463  54.342  43.274  1.00 65.36  ? 214 LEU A CB    1 
ATOM 1058 C CG    . LEU A 1 139 ? 54.983  54.335  43.048  1.00 71.04  ? 214 LEU A CG    1 
ATOM 1059 C CD1   . LEU A 1 139 ? 55.738  55.173  44.039  1.00 78.47  ? 214 LEU A CD1   1 
ATOM 1060 C CD2   . LEU A 1 139 ? 55.416  52.936  43.167  1.00 78.61  ? 214 LEU A CD2   1 
ATOM 1061 N N     . ASP A 1 140 ? 50.507  56.163  43.299  1.00 87.28  ? 215 ASP A N     1 
ATOM 1062 C CA    . ASP A 1 140 ? 49.088  55.937  43.303  1.00 89.62  ? 215 ASP A CA    1 
ATOM 1063 C C     . ASP A 1 140 ? 48.995  54.516  43.830  1.00 107.13 ? 215 ASP A C     1 
ATOM 1064 O O     . ASP A 1 140 ? 49.734  54.175  44.774  1.00 103.89 ? 215 ASP A O     1 
ATOM 1065 C CB    . ASP A 1 140 ? 48.506  56.163  41.935  1.00 89.09  ? 215 ASP A CB    1 
ATOM 1066 C CG    . ASP A 1 140 ? 48.684  57.580  41.476  1.00 114.96 ? 215 ASP A CG    1 
ATOM 1067 O OD1   . ASP A 1 140 ? 48.218  58.480  42.212  1.00 117.05 ? 215 ASP A OD1   1 
ATOM 1068 O OD2   . ASP A 1 140 ? 49.271  57.786  40.381  1.00 108.07 ? 215 ASP A OD2   1 
ATOM 1069 N N     . PHE A 1 141 ? 48.178  53.666  43.242  1.00 93.86  ? 216 PHE A N     1 
ATOM 1070 C CA    . PHE A 1 141 ? 48.148  52.294  43.693  1.00 98.38  ? 216 PHE A CA    1 
ATOM 1071 C C     . PHE A 1 141 ? 48.857  51.351  42.759  1.00 93.13  ? 216 PHE A C     1 
ATOM 1072 O O     . PHE A 1 141 ? 48.804  50.138  42.957  1.00 95.61  ? 216 PHE A O     1 
ATOM 1073 C CB    . PHE A 1 141 ? 46.725  51.949  44.018  1.00 94.44  ? 216 PHE A CB    1 
ATOM 1074 C CG    . PHE A 1 141 ? 46.233  52.830  45.082  1.00 87.49  ? 216 PHE A CG    1 
ATOM 1075 C CD1   . PHE A 1 141 ? 45.501  53.957  44.778  1.00 99.99  ? 216 PHE A CD1   1 
ATOM 1076 C CD2   . PHE A 1 141 ? 46.678  52.644  46.378  1.00 80.19  ? 216 PHE A CD2   1 
ATOM 1077 C CE1   . PHE A 1 141 ? 45.112  54.825  45.778  1.00 99.87  ? 216 PHE A CE1   1 
ATOM 1078 C CE2   . PHE A 1 141 ? 46.301  53.496  47.378  1.00 78.42  ? 216 PHE A CE2   1 
ATOM 1079 C CZ    . PHE A 1 141 ? 45.511  54.592  47.086  1.00 78.37  ? 216 PHE A CZ    1 
ATOM 1080 N N     . GLU A 1 142 ? 49.563  51.896  41.781  1.00 100.20 ? 217 GLU A N     1 
ATOM 1081 C CA    . GLU A 1 142 ? 50.395  51.095  40.917  1.00 96.27  ? 217 GLU A CA    1 
ATOM 1082 C C     . GLU A 1 142 ? 51.438  50.335  41.724  1.00 89.49  ? 217 GLU A C     1 
ATOM 1083 O O     . GLU A 1 142 ? 51.732  50.615  42.885  1.00 89.34  ? 217 GLU A O     1 
ATOM 1084 C CB    . GLU A 1 142 ? 51.127  51.955  39.900  1.00 111.22 ? 217 GLU A CB    1 
ATOM 1085 C CG    . GLU A 1 142 ? 50.292  52.527  38.794  1.00 121.81 ? 217 GLU A CG    1 
ATOM 1086 C CD    . GLU A 1 142 ? 51.070  53.598  38.059  1.00 143.47 ? 217 GLU A CD    1 
ATOM 1087 O OE1   . GLU A 1 142 ? 50.909  54.805  38.393  1.00 135.76 ? 217 GLU A OE1   1 
ATOM 1088 O OE2   . GLU A 1 142 ? 51.886  53.217  37.186  1.00 138.96 ? 217 GLU A OE2   1 
ATOM 1089 N N     . ARG A 1 143 ? 52.023  49.385  41.041  1.00 84.32  ? 218 ARG A N     1 
ATOM 1090 C CA    . ARG A 1 143 ? 52.450  48.131  41.595  1.00 87.78  ? 218 ARG A CA    1 
ATOM 1091 C C     . ARG A 1 143 ? 53.840  48.145  42.198  1.00 86.79  ? 218 ARG A C     1 
ATOM 1092 O O     . ARG A 1 143 ? 54.357  47.072  42.497  1.00 84.13  ? 218 ARG A O     1 
ATOM 1093 C CB    . ARG A 1 143 ? 52.409  47.087  40.500  1.00 105.24 ? 218 ARG A CB    1 
ATOM 1094 C CG    . ARG A 1 143 ? 51.057  46.569  40.149  1.00 97.44  ? 218 ARG A CG    1 
ATOM 1095 C CD    . ARG A 1 143 ? 51.250  45.093  39.800  1.00 100.50 ? 218 ARG A CD    1 
ATOM 1096 N NE    . ARG A 1 143 ? 52.349  44.499  40.572  1.00 62.03  ? 218 ARG A NE    1 
ATOM 1097 C CZ    . ARG A 1 143 ? 53.416  43.914  40.035  1.00 81.43  ? 218 ARG A CZ    1 
ATOM 1098 N NH1   . ARG A 1 143 ? 53.539  43.814  38.710  1.00 72.41  ? 218 ARG A NH1   1 
ATOM 1099 N NH2   . ARG A 1 143 ? 54.359  43.414  40.829  1.00 80.33  ? 218 ARG A NH2   1 
ATOM 1100 N N     . SER A 1 144 ? 54.497  49.289  42.316  1.00 80.10  ? 219 SER A N     1 
ATOM 1101 C CA    . SER A 1 144 ? 55.737  49.367  43.107  1.00 99.39  ? 219 SER A CA    1 
ATOM 1102 C C     . SER A 1 144 ? 56.884  48.544  42.510  1.00 94.65  ? 219 SER A C     1 
ATOM 1103 O O     . SER A 1 144 ? 57.761  48.056  43.250  1.00 74.52  ? 219 SER A O     1 
ATOM 1104 C CB    . SER A 1 144 ? 55.511  48.938  44.571  1.00 97.12  ? 219 SER A CB    1 
ATOM 1105 O OG    . SER A 1 144 ? 55.439  50.041  45.478  1.00 88.61  ? 219 SER A OG    1 
ATOM 1106 N N     . THR A 1 145 ? 56.893  48.401  41.177  1.00 97.69  ? 220 THR A N     1 
ATOM 1107 C CA    . THR A 1 145 ? 57.994  47.787  40.449  1.00 86.99  ? 220 THR A CA    1 
ATOM 1108 C C     . THR A 1 145 ? 58.991  48.828  39.985  1.00 77.06  ? 220 THR A C     1 
ATOM 1109 O O     . THR A 1 145 ? 58.791  50.037  40.127  1.00 82.47  ? 220 THR A O     1 
ATOM 1110 C CB    . THR A 1 145 ? 57.523  47.057  39.203  1.00 82.54  ? 220 THR A CB    1 
ATOM 1111 O OG1   . THR A 1 145 ? 56.715  47.950  38.427  1.00 89.74  ? 220 THR A OG1   1 
ATOM 1112 C CG2   . THR A 1 145 ? 56.761  45.830  39.561  1.00 78.58  ? 220 THR A CG2   1 
ATOM 1113 N N     . ALA A 1 146 ? 60.031  48.328  39.323  1.00 65.76  ? 221 ALA A N     1 
ATOM 1114 C CA    . ALA A 1 146 ? 61.157  49.167  38.945  1.00 81.27  ? 221 ALA A CA    1 
ATOM 1115 C C     . ALA A 1 146 ? 60.713  50.349  38.084  1.00 79.97  ? 221 ALA A C     1 
ATOM 1116 O O     . ALA A 1 146 ? 61.094  51.502  38.337  1.00 65.66  ? 221 ALA A O     1 
ATOM 1117 C CB    . ALA A 1 146 ? 62.198  48.308  38.230  1.00 80.56  ? 221 ALA A CB    1 
ATOM 1118 N N     . GLU A 1 147 ? 59.883  50.088  37.072  1.00 83.87  ? 222 GLU A N     1 
ATOM 1119 C CA    . GLU A 1 147 ? 59.602  51.142  36.107  1.00 88.42  ? 222 GLU A CA    1 
ATOM 1120 C C     . GLU A 1 147 ? 58.664  52.179  36.686  1.00 86.83  ? 222 GLU A C     1 
ATOM 1121 O O     . GLU A 1 147 ? 58.877  53.379  36.490  1.00 89.93  ? 222 GLU A O     1 
ATOM 1122 C CB    . GLU A 1 147 ? 59.031  50.570  34.816  1.00 82.51  ? 222 GLU A CB    1 
ATOM 1123 C CG    . GLU A 1 147 ? 60.028  49.775  34.027  1.00 92.10  ? 222 GLU A CG    1 
ATOM 1124 C CD    . GLU A 1 147 ? 60.248  48.401  34.629  1.00 115.84 ? 222 GLU A CD    1 
ATOM 1125 O OE1   . GLU A 1 147 ? 61.055  47.631  34.051  1.00 137.48 ? 222 GLU A OE1   1 
ATOM 1126 O OE2   . GLU A 1 147 ? 59.610  48.096  35.677  1.00 89.99  ? 222 GLU A OE2   1 
ATOM 1127 N N     . ASN A 1 148 ? 57.626  51.747  37.402  1.00 75.36  ? 223 ASN A N     1 
ATOM 1128 C CA    . ASN A 1 148 ? 56.758  52.721  38.040  1.00 76.38  ? 223 ASN A CA    1 
ATOM 1129 C C     . ASN A 1 148 ? 57.591  53.658  38.884  1.00 83.32  ? 223 ASN A C     1 
ATOM 1130 O O     . ASN A 1 148 ? 57.327  54.864  38.939  1.00 91.80  ? 223 ASN A O     1 
ATOM 1131 C CB    . ASN A 1 148 ? 55.697  52.038  38.901  1.00 106.90 ? 223 ASN A CB    1 
ATOM 1132 C CG    . ASN A 1 148 ? 55.349  50.637  38.416  1.00 114.68 ? 223 ASN A CG    1 
ATOM 1133 O OD1   . ASN A 1 148 ? 55.198  49.700  39.218  1.00 105.71 ? 223 ASN A OD1   1 
ATOM 1134 N ND2   . ASN A 1 148 ? 55.207  50.486  37.102  1.00 111.90 ? 223 ASN A ND2   1 
ATOM 1135 N N     . ILE A 1 149 ? 58.642  53.131  39.511  1.00 77.36  ? 224 ILE A N     1 
ATOM 1136 C CA    . ILE A 1 149 ? 59.558  54.005  40.230  1.00 74.95  ? 224 ILE A CA    1 
ATOM 1137 C C     . ILE A 1 149 ? 60.210  54.979  39.262  1.00 76.08  ? 224 ILE A C     1 
ATOM 1138 O O     . ILE A 1 149 ? 60.024  56.197  39.370  1.00 79.65  ? 224 ILE A O     1 
ATOM 1139 C CB    . ILE A 1 149 ? 60.595  53.184  40.999  1.00 66.25  ? 224 ILE A CB    1 
ATOM 1140 C CG1   . ILE A 1 149 ? 59.875  52.224  41.946  1.00 78.36  ? 224 ILE A CG1   1 
ATOM 1141 C CG2   . ILE A 1 149 ? 61.475  54.098  41.787  1.00 60.72  ? 224 ILE A CG2   1 
ATOM 1142 C CD1   . ILE A 1 149 ? 60.747  51.083  42.440  1.00 76.02  ? 224 ILE A CD1   1 
ATOM 1143 N N     . TYR A 1 150 ? 60.911  54.447  38.252  1.00 76.20  ? 225 TYR A N     1 
ATOM 1144 C CA    . TYR A 1 150 ? 61.573  55.297  37.257  1.00 76.32  ? 225 TYR A CA    1 
ATOM 1145 C C     . TYR A 1 150 ? 60.576  56.203  36.551  1.00 73.04  ? 225 TYR A C     1 
ATOM 1146 O O     . TYR A 1 150 ? 60.879  57.363  36.251  1.00 83.30  ? 225 TYR A O     1 
ATOM 1147 C CB    . TYR A 1 150 ? 62.320  54.429  36.247  1.00 77.83  ? 225 TYR A CB    1 
ATOM 1148 C CG    . TYR A 1 150 ? 63.455  55.080  35.445  1.00 95.90  ? 225 TYR A CG    1 
ATOM 1149 C CD1   . TYR A 1 150 ? 63.229  55.600  34.173  1.00 89.65  ? 225 TYR A CD1   1 
ATOM 1150 C CD2   . TYR A 1 150 ? 64.772  55.101  35.927  1.00 102.88 ? 225 TYR A CD2   1 
ATOM 1151 C CE1   . TYR A 1 150 ? 64.264  56.147  33.412  1.00 91.70  ? 225 TYR A CE1   1 
ATOM 1152 C CE2   . TYR A 1 150 ? 65.819  55.658  35.168  1.00 93.70  ? 225 TYR A CE2   1 
ATOM 1153 C CZ    . TYR A 1 150 ? 65.551  56.181  33.910  1.00 96.69  ? 225 TYR A CZ    1 
ATOM 1154 O OH    . TYR A 1 150 ? 66.558  56.737  33.137  1.00 103.36 ? 225 TYR A OH    1 
ATOM 1155 N N     . LYS A 1 151 ? 59.380  55.696  36.292  1.00 69.22  ? 226 LYS A N     1 
ATOM 1156 C CA    . LYS A 1 151 ? 58.302  56.501  35.739  1.00 77.04  ? 226 LYS A CA    1 
ATOM 1157 C C     . LYS A 1 151 ? 58.126  57.745  36.582  1.00 73.46  ? 226 LYS A C     1 
ATOM 1158 O O     . LYS A 1 151 ? 58.433  58.857  36.131  1.00 68.43  ? 226 LYS A O     1 
ATOM 1159 C CB    . LYS A 1 151 ? 56.999  55.693  35.692  1.00 95.67  ? 226 LYS A CB    1 
ATOM 1160 C CG    . LYS A 1 151 ? 55.888  56.256  34.813  1.00 99.98  ? 226 LYS A CG    1 
ATOM 1161 C CD    . LYS A 1 151 ? 54.964  55.149  34.268  1.00 111.93 ? 226 LYS A CD    1 
ATOM 1162 C CE    . LYS A 1 151 ? 54.115  55.647  33.075  1.00 140.29 ? 226 LYS A CE    1 
ATOM 1163 N NZ    . LYS A 1 151 ? 53.384  54.585  32.299  1.00 132.06 ? 226 LYS A NZ    1 
ATOM 1164 N N     . LYS A 1 152 ? 57.655  57.559  37.817  1.00 67.98  ? 227 LYS A N     1 
ATOM 1165 C CA    . LYS A 1 152 ? 57.461  58.718  38.670  1.00 81.84  ? 227 LYS A CA    1 
ATOM 1166 C C     . LYS A 1 152 ? 58.768  59.455  38.867  1.00 78.28  ? 227 LYS A C     1 
ATOM 1167 O O     . LYS A 1 152 ? 58.766  60.681  38.982  1.00 66.88  ? 227 LYS A O     1 
ATOM 1168 C CB    . LYS A 1 152 ? 56.861  58.311  40.006  1.00 68.25  ? 227 LYS A CB    1 
ATOM 1169 C CG    . LYS A 1 152 ? 55.845  57.226  39.876  1.00 81.70  ? 227 LYS A CG    1 
ATOM 1170 C CD    . LYS A 1 152 ? 54.659  57.632  39.020  1.00 92.12  ? 227 LYS A CD    1 
ATOM 1171 C CE    . LYS A 1 152 ? 53.970  58.849  39.629  1.00 110.25 ? 227 LYS A CE    1 
ATOM 1172 N NZ    . LYS A 1 152 ? 52.506  58.646  39.887  1.00 114.52 ? 227 LYS A NZ    1 
ATOM 1173 N N     . LEU A 1 153 ? 59.890  58.731  38.848  1.00 70.37  ? 228 LEU A N     1 
ATOM 1174 C CA    . LEU A 1 153 ? 61.205  59.331  39.030  1.00 65.72  ? 228 LEU A CA    1 
ATOM 1175 C C     . LEU A 1 153 ? 61.445  60.404  37.999  1.00 73.85  ? 228 LEU A C     1 
ATOM 1176 O O     . LEU A 1 153 ? 61.526  61.597  38.331  1.00 77.82  ? 228 LEU A O     1 
ATOM 1177 C CB    . LEU A 1 153 ? 62.315  58.306  38.898  1.00 62.80  ? 228 LEU A CB    1 
ATOM 1178 C CG    . LEU A 1 153 ? 63.536  58.536  39.777  1.00 66.13  ? 228 LEU A CG    1 
ATOM 1179 C CD1   . LEU A 1 153 ? 64.828  58.073  39.087  1.00 57.15  ? 228 LEU A CD1   1 
ATOM 1180 C CD2   . LEU A 1 153 ? 63.607  59.993  40.304  1.00 66.82  ? 228 LEU A CD2   1 
ATOM 1181 N N     . LYS A 1 154 ? 61.579  59.965  36.748  1.00 70.99  ? 229 LYS A N     1 
ATOM 1182 C CA    . LYS A 1 154 ? 61.698  60.912  35.648  1.00 90.91  ? 229 LYS A CA    1 
ATOM 1183 C C     . LYS A 1 154 ? 60.634  62.006  35.778  1.00 83.42  ? 229 LYS A C     1 
ATOM 1184 O O     . LYS A 1 154 ? 60.941  63.212  35.765  1.00 68.36  ? 229 LYS A O     1 
ATOM 1185 C CB    . LYS A 1 154 ? 61.609  60.154  34.311  1.00 68.31  ? 229 LYS A CB    1 
ATOM 1186 C CG    . LYS A 1 154 ? 62.936  59.476  33.893  1.00 70.29  ? 229 LYS A CG    1 
ATOM 1187 C CD    . LYS A 1 154 ? 63.449  59.815  32.437  1.00 82.18  ? 229 LYS A CD    1 
ATOM 1188 C CE    . LYS A 1 154 ? 63.141  61.268  31.922  1.00 98.48  ? 229 LYS A CE    1 
ATOM 1189 N NZ    . LYS A 1 154 ? 63.990  62.440  32.363  1.00 71.71  ? 229 LYS A NZ    1 
ATOM 1190 N N     . ALA A 1 155 ? 59.394  61.584  36.033  1.00 74.00  ? 230 ALA A N     1 
ATOM 1191 C CA    . ALA A 1 155 ? 58.315  62.528  36.256  1.00 75.95  ? 230 ALA A CA    1 
ATOM 1192 C C     . ALA A 1 155 ? 58.742  63.630  37.214  1.00 77.61  ? 230 ALA A C     1 
ATOM 1193 O O     . ALA A 1 155 ? 58.435  64.807  37.000  1.00 75.81  ? 230 ALA A O     1 
ATOM 1194 C CB    . ALA A 1 155 ? 57.088  61.776  36.780  1.00 65.67  ? 230 ALA A CB    1 
ATOM 1195 N N     . ILE A 1 156 ? 59.497  63.281  38.249  1.00 74.86  ? 231 ILE A N     1 
ATOM 1196 C CA    . ILE A 1 156 ? 59.836  64.298  39.225  1.00 76.02  ? 231 ILE A CA    1 
ATOM 1197 C C     . ILE A 1 156 ? 60.815  65.273  38.630  1.00 81.50  ? 231 ILE A C     1 
ATOM 1198 O O     . ILE A 1 156 ? 60.716  66.487  38.851  1.00 75.39  ? 231 ILE A O     1 
ATOM 1199 C CB    . ILE A 1 156 ? 60.376  63.664  40.508  1.00 79.81  ? 231 ILE A CB    1 
ATOM 1200 C CG1   . ILE A 1 156 ? 59.266  62.831  41.127  1.00 84.67  ? 231 ILE A CG1   1 
ATOM 1201 C CG2   . ILE A 1 156 ? 60.825  64.759  41.487  1.00 75.42  ? 231 ILE A CG2   1 
ATOM 1202 C CD1   . ILE A 1 156 ? 59.684  61.475  41.594  1.00 69.17  ? 231 ILE A CD1   1 
ATOM 1203 N N     . PHE A 1 157 ? 61.758  64.769  37.845  1.00 75.60  ? 232 PHE A N     1 
ATOM 1204 C CA    . PHE A 1 157 ? 62.781  65.670  37.348  1.00 82.86  ? 232 PHE A CA    1 
ATOM 1205 C C     . PHE A 1 157 ? 62.245  66.548  36.226  1.00 85.69  ? 232 PHE A C     1 
ATOM 1206 O O     . PHE A 1 157 ? 62.639  67.715  36.111  1.00 81.03  ? 232 PHE A O     1 
ATOM 1207 C CB    . PHE A 1 157 ? 64.009  64.868  36.928  1.00 76.47  ? 232 PHE A CB    1 
ATOM 1208 C CG    . PHE A 1 157 ? 64.945  64.544  38.084  1.00 74.77  ? 232 PHE A CG    1 
ATOM 1209 C CD1   . PHE A 1 157 ? 65.246  63.229  38.422  1.00 68.57  ? 232 PHE A CD1   1 
ATOM 1210 C CD2   . PHE A 1 157 ? 65.517  65.559  38.842  1.00 79.15  ? 232 PHE A CD2   1 
ATOM 1211 C CE1   . PHE A 1 157 ? 66.099  62.926  39.504  1.00 52.44  ? 232 PHE A CE1   1 
ATOM 1212 C CE2   . PHE A 1 157 ? 66.384  65.257  39.921  1.00 81.29  ? 232 PHE A CE2   1 
ATOM 1213 C CZ    . PHE A 1 157 ? 66.667  63.930  40.246  1.00 60.93  ? 232 PHE A CZ    1 
ATOM 1214 N N     . SER A 1 158 ? 61.293  66.040  35.450  1.00 83.24  ? 233 SER A N     1 
ATOM 1215 C CA    . SER A 1 158 ? 60.727  66.779  34.324  1.00 88.91  ? 233 SER A CA    1 
ATOM 1216 C C     . SER A 1 158 ? 59.835  67.933  34.744  1.00 79.84  ? 233 SER A C     1 
ATOM 1217 O O     . SER A 1 158 ? 59.306  68.635  33.872  1.00 95.73  ? 233 SER A O     1 
ATOM 1218 C CB    . SER A 1 158 ? 59.952  65.825  33.419  1.00 91.77  ? 233 SER A CB    1 
ATOM 1219 O OG    . SER A 1 158 ? 60.720  64.649  33.202  1.00 100.16 ? 233 SER A OG    1 
ATOM 1220 N N     . GLN A 1 159 ? 59.603  68.111  36.036  1.00 82.13  ? 234 GLN A N     1 
ATOM 1221 C CA    . GLN A 1 159 ? 59.017  69.355  36.512  1.00 99.12  ? 234 GLN A CA    1 
ATOM 1222 C C     . GLN A 1 159 ? 60.056  70.448  36.614  1.00 86.41  ? 234 GLN A C     1 
ATOM 1223 O O     . GLN A 1 159 ? 59.714  71.629  36.705  1.00 101.48 ? 234 GLN A O     1 
ATOM 1224 C CB    . GLN A 1 159 ? 58.364  69.158  37.882  1.00 103.76 ? 234 GLN A CB    1 
ATOM 1225 C CG    . GLN A 1 159 ? 57.483  67.926  37.983  1.00 100.98 ? 234 GLN A CG    1 
ATOM 1226 C CD    . GLN A 1 159 ? 57.823  67.125  39.200  1.00 97.00  ? 234 GLN A CD    1 
ATOM 1227 O OE1   . GLN A 1 159 ? 57.455  65.957  39.318  1.00 105.22 ? 234 GLN A OE1   1 
ATOM 1228 N NE2   . GLN A 1 159 ? 58.546  67.743  40.118  1.00 92.21  ? 234 GLN A NE2   1 
ATOM 1229 N N     . PHE A 1 160 ? 61.309  70.059  36.688  1.00 88.74  ? 235 PHE A N     1 
ATOM 1230 C CA    . PHE A 1 160 ? 62.446  70.951  36.627  1.00 95.19  ? 235 PHE A CA    1 
ATOM 1231 C C     . PHE A 1 160 ? 63.075  70.945  35.255  1.00 104.28 ? 235 PHE A C     1 
ATOM 1232 O O     . PHE A 1 160 ? 64.178  71.475  35.077  1.00 105.89 ? 235 PHE A O     1 
ATOM 1233 C CB    . PHE A 1 160 ? 63.413  70.563  37.723  1.00 95.12  ? 235 PHE A CB    1 
ATOM 1234 C CG    . PHE A 1 160 ? 62.725  70.417  39.031  1.00 93.04  ? 235 PHE A CG    1 
ATOM 1235 C CD1   . PHE A 1 160 ? 62.040  69.250  39.339  1.00 92.83  ? 235 PHE A CD1   1 
ATOM 1236 C CD2   . PHE A 1 160 ? 62.674  71.474  39.914  1.00 84.25  ? 235 PHE A CD2   1 
ATOM 1237 C CE1   . PHE A 1 160 ? 61.358  69.134  40.517  1.00 88.19  ? 235 PHE A CE1   1 
ATOM 1238 C CE2   . PHE A 1 160 ? 62.005  71.356  41.107  1.00 90.20  ? 235 PHE A CE2   1 
ATOM 1239 C CZ    . PHE A 1 160 ? 61.346  70.183  41.411  1.00 75.69  ? 235 PHE A CZ    1 
ATOM 1240 N N     . ASN A 1 161 ? 62.426  70.275  34.303  1.00 107.50 ? 236 ASN A N     1 
ATOM 1241 C CA    . ASN A 1 161 ? 62.836  70.156  32.916  1.00 100.30 ? 236 ASN A CA    1 
ATOM 1242 C C     . ASN A 1 161 ? 64.091  69.331  32.789  1.00 92.66  ? 236 ASN A C     1 
ATOM 1243 O O     . ASN A 1 161 ? 64.598  69.188  31.680  1.00 104.01 ? 236 ASN A O     1 
ATOM 1244 C CB    . ASN A 1 161 ? 63.014  71.513  32.229  1.00 108.97 ? 236 ASN A CB    1 
ATOM 1245 C CG    . ASN A 1 161 ? 61.687  72.156  31.902  1.00 124.17 ? 236 ASN A CG    1 
ATOM 1246 O OD1   . ASN A 1 161 ? 60.632  71.671  32.334  1.00 119.39 ? 236 ASN A OD1   1 
ATOM 1247 N ND2   . ASN A 1 161 ? 61.719  73.245  31.138  1.00 126.86 ? 236 ASN A ND2   1 
ATOM 1248 N N     . VAL A 1 162 ? 64.632  68.806  33.887  1.00 82.41  ? 237 VAL A N     1 
ATOM 1249 C CA    . VAL A 1 162 ? 65.737  67.871  33.747  1.00 92.37  ? 237 VAL A CA    1 
ATOM 1250 C C     . VAL A 1 162 ? 65.229  66.609  33.079  1.00 83.41  ? 237 VAL A C     1 
ATOM 1251 O O     . VAL A 1 162 ? 64.427  65.857  33.642  1.00 78.67  ? 237 VAL A O     1 
ATOM 1252 C CB    . VAL A 1 162 ? 66.340  67.519  35.101  1.00 74.45  ? 237 VAL A CB    1 
ATOM 1253 C CG1   . VAL A 1 162 ? 67.583  66.659  34.884  1.00 57.66  ? 237 VAL A CG1   1 
ATOM 1254 C CG2   . VAL A 1 162 ? 66.558  68.785  35.914  1.00 84.21  ? 237 VAL A CG2   1 
ATOM 1255 N N     . GLU A 1 163 ? 65.713  66.357  31.888  1.00 84.69  ? 238 GLU A N     1 
ATOM 1256 C CA    . GLU A 1 163 ? 65.368  65.138  31.225  1.00 82.77  ? 238 GLU A CA    1 
ATOM 1257 C C     . GLU A 1 163 ? 66.494  64.129  31.235  1.00 84.20  ? 238 GLU A C     1 
ATOM 1258 O O     . GLU A 1 163 ? 66.262  62.985  30.841  1.00 85.65  ? 238 GLU A O     1 
ATOM 1259 C CB    . GLU A 1 163 ? 64.923  65.451  29.800  1.00 96.04  ? 238 GLU A CB    1 
ATOM 1260 C CG    . GLU A 1 163 ? 64.107  66.748  29.706  1.00 105.34 ? 238 GLU A CG    1 
ATOM 1261 C CD    . GLU A 1 163 ? 62.708  66.642  30.309  1.00 100.78 ? 238 GLU A CD    1 
ATOM 1262 O OE1   . GLU A 1 163 ? 62.195  67.664  30.850  1.00 90.07  ? 238 GLU A OE1   1 
ATOM 1263 O OE2   . GLU A 1 163 ? 62.119  65.538  30.212  1.00 103.42 ? 238 GLU A OE2   1 
ATOM 1264 N N     . ASP A 1 164 ? 67.685  64.489  31.715  1.00 80.17  ? 239 ASP A N     1 
ATOM 1265 C CA    . ASP A 1 164 ? 68.807  63.553  31.718  1.00 94.69  ? 239 ASP A CA    1 
ATOM 1266 C C     . ASP A 1 164 ? 69.260  63.262  33.137  1.00 96.79  ? 239 ASP A C     1 
ATOM 1267 O O     . ASP A 1 164 ? 69.609  64.182  33.884  1.00 98.22  ? 239 ASP A O     1 
ATOM 1268 C CB    . ASP A 1 164 ? 69.997  64.062  30.912  1.00 106.61 ? 239 ASP A CB    1 
ATOM 1269 C CG    . ASP A 1 164 ? 71.223  63.156  31.059  1.00 114.84 ? 239 ASP A CG    1 
ATOM 1270 O OD1   . ASP A 1 164 ? 71.899  63.210  32.122  1.00 112.03 ? 239 ASP A OD1   1 
ATOM 1271 O OD2   . ASP A 1 164 ? 71.507  62.384  30.116  1.00 108.30 ? 239 ASP A OD2   1 
ATOM 1272 N N     . LEU A 1 165 ? 69.265  61.979  33.487  1.00 93.04  ? 240 LEU A N     1 
ATOM 1273 C CA    . LEU A 1 165 ? 69.691  61.465  34.779  1.00 99.29  ? 240 LEU A CA    1 
ATOM 1274 C C     . LEU A 1 165 ? 71.097  60.880  34.752  1.00 107.00 ? 240 LEU A C     1 
ATOM 1275 O O     . LEU A 1 165 ? 71.582  60.403  35.793  1.00 95.97  ? 240 LEU A O     1 
ATOM 1276 C CB    . LEU A 1 165 ? 68.703  60.391  35.256  1.00 107.71 ? 240 LEU A CB    1 
ATOM 1277 C CG    . LEU A 1 165 ? 67.181  60.475  34.977  1.00 102.99 ? 240 LEU A CG    1 
ATOM 1278 C CD1   . LEU A 1 165 ? 66.580  61.881  35.243  1.00 80.93  ? 240 LEU A CD1   1 
ATOM 1279 C CD2   . LEU A 1 165 ? 66.800  59.925  33.580  1.00 95.23  ? 240 LEU A CD2   1 
ATOM 1280 N N     . SER A 1 166 ? 71.736  60.870  33.576  1.00 116.94 ? 241 SER A N     1 
ATOM 1281 C CA    . SER A 1 166 ? 73.017  60.206  33.357  1.00 109.80 ? 241 SER A CA    1 
ATOM 1282 C C     . SER A 1 166 ? 73.998  60.638  34.425  1.00 104.65 ? 241 SER A C     1 
ATOM 1283 O O     . SER A 1 166 ? 74.356  59.842  35.299  1.00 100.20 ? 241 SER A O     1 
ATOM 1284 C CB    . SER A 1 166 ? 73.600  60.539  31.977  1.00 112.17 ? 241 SER A CB    1 
ATOM 1285 O OG    . SER A 1 166 ? 72.673  60.340  30.923  1.00 103.02 ? 241 SER A OG    1 
ATOM 1286 N N     . SER A 1 167 ? 74.356  61.927  34.389  1.00 90.60  ? 242 SER A N     1 
ATOM 1287 C CA    . SER A 1 167 ? 75.379  62.520  35.237  1.00 86.01  ? 242 SER A CA    1 
ATOM 1288 C C     . SER A 1 167 ? 75.034  62.456  36.708  1.00 91.68  ? 242 SER A C     1 
ATOM 1289 O O     . SER A 1 167 ? 75.862  62.844  37.546  1.00 78.30  ? 242 SER A O     1 
ATOM 1290 C CB    . SER A 1 167 ? 75.553  63.976  34.865  1.00 104.09 ? 242 SER A CB    1 
ATOM 1291 O OG    . SER A 1 167 ? 74.474  64.718  35.411  1.00 111.43 ? 242 SER A OG    1 
ATOM 1292 N N     . ILE A 1 168 ? 73.822  62.022  37.032  1.00 103.39 ? 243 ILE A N     1 
ATOM 1293 C CA    . ILE A 1 168 ? 73.349  62.036  38.407  1.00 99.00  ? 243 ILE A CA    1 
ATOM 1294 C C     . ILE A 1 168 ? 73.846  60.785  39.106  1.00 90.48  ? 243 ILE A C     1 
ATOM 1295 O O     . ILE A 1 168 ? 73.473  59.664  38.732  1.00 88.85  ? 243 ILE A O     1 
ATOM 1296 C CB    . ILE A 1 168 ? 71.821  62.125  38.464  1.00 89.32  ? 243 ILE A CB    1 
ATOM 1297 C CG1   . ILE A 1 168 ? 71.373  63.481  37.914  1.00 100.14 ? 243 ILE A CG1   1 
ATOM 1298 C CG2   . ILE A 1 168 ? 71.353  61.918  39.881  1.00 83.41  ? 243 ILE A CG2   1 
ATOM 1299 C CD1   . ILE A 1 168 ? 70.127  64.057  38.564  1.00 88.32  ? 243 ILE A CD1   1 
ATOM 1300 N N     . LYS A 1 169 ? 74.695  60.982  40.115  1.00 79.88  ? 244 LYS A N     1 
ATOM 1301 C CA    . LYS A 1 169 ? 75.083  59.918  41.024  1.00 79.97  ? 244 LYS A CA    1 
ATOM 1302 C C     . LYS A 1 169 ? 73.977  59.772  42.049  1.00 76.82  ? 244 LYS A C     1 
ATOM 1303 O O     . LYS A 1 169 ? 73.699  60.705  42.794  1.00 79.83  ? 244 LYS A O     1 
ATOM 1304 C CB    . LYS A 1 169 ? 76.403  60.234  41.723  1.00 75.29  ? 244 LYS A CB    1 
ATOM 1305 C CG    . LYS A 1 169 ? 77.518  60.724  40.804  1.00 99.35  ? 244 LYS A CG    1 
ATOM 1306 C CD    . LYS A 1 169 ? 77.500  62.256  40.575  1.00 97.89  ? 244 LYS A CD    1 
ATOM 1307 C CE    . LYS A 1 169 ? 78.759  62.730  39.856  1.00 83.13  ? 244 LYS A CE    1 
ATOM 1308 N NZ    . LYS A 1 169 ? 79.243  63.980  40.468  1.00 91.96  ? 244 LYS A NZ    1 
ATOM 1309 N N     . PHE A 1 170 ? 73.345  58.617  42.092  1.00 70.60  ? 245 PHE A N     1 
ATOM 1310 C CA    . PHE A 1 170 ? 72.298  58.349  43.059  1.00 60.34  ? 245 PHE A CA    1 
ATOM 1311 C C     . PHE A 1 170 ? 72.871  57.572  44.230  1.00 70.65  ? 245 PHE A C     1 
ATOM 1312 O O     . PHE A 1 170 ? 73.692  56.665  44.035  1.00 71.35  ? 245 PHE A O     1 
ATOM 1313 C CB    . PHE A 1 170 ? 71.192  57.514  42.432  1.00 76.99  ? 245 PHE A CB    1 
ATOM 1314 C CG    . PHE A 1 170 ? 70.406  58.212  41.360  1.00 91.62  ? 245 PHE A CG    1 
ATOM 1315 C CD1   . PHE A 1 170 ? 70.609  57.900  40.025  1.00 90.08  ? 245 PHE A CD1   1 
ATOM 1316 C CD2   . PHE A 1 170 ? 69.418  59.138  41.689  1.00 82.41  ? 245 PHE A CD2   1 
ATOM 1317 C CE1   . PHE A 1 170 ? 69.862  58.522  39.050  1.00 91.92  ? 245 PHE A CE1   1 
ATOM 1318 C CE2   . PHE A 1 170 ? 68.680  59.758  40.714  1.00 64.96  ? 245 PHE A CE2   1 
ATOM 1319 C CZ    . PHE A 1 170 ? 68.896  59.451  39.403  1.00 73.25  ? 245 PHE A CZ    1 
ATOM 1320 N N     . VAL A 1 171 ? 72.406  57.887  45.443  1.00 63.29  ? 246 VAL A N     1 
ATOM 1321 C CA    . VAL A 1 171 ? 72.696  57.063  46.615  1.00 71.16  ? 246 VAL A CA    1 
ATOM 1322 C C     . VAL A 1 171 ? 71.382  56.647  47.275  1.00 67.25  ? 246 VAL A C     1 
ATOM 1323 O O     . VAL A 1 171 ? 70.509  57.487  47.520  1.00 62.49  ? 246 VAL A O     1 
ATOM 1324 C CB    . VAL A 1 171 ? 73.649  57.768  47.590  1.00 60.59  ? 246 VAL A CB    1 
ATOM 1325 C CG1   . VAL A 1 171 ? 73.880  59.183  47.127  1.00 75.34  ? 246 VAL A CG1   1 
ATOM 1326 C CG2   . VAL A 1 171 ? 73.135  57.713  49.008  1.00 67.82  ? 246 VAL A CG2   1 
ATOM 1327 N N     . THR A 1 172 ? 71.271  55.345  47.577  1.00 64.27  ? 247 THR A N     1 
ATOM 1328 C CA    . THR A 1 172 ? 70.031  54.603  47.745  1.00 51.60  ? 247 THR A CA    1 
ATOM 1329 C C     . THR A 1 172 ? 70.294  53.394  48.634  1.00 64.74  ? 247 THR A C     1 
ATOM 1330 O O     . THR A 1 172 ? 71.440  52.985  48.815  1.00 67.49  ? 247 THR A O     1 
ATOM 1331 C CB    . THR A 1 172 ? 69.525  54.122  46.400  1.00 59.52  ? 247 THR A CB    1 
ATOM 1332 O OG1   . THR A 1 172 ? 68.141  53.797  46.514  1.00 94.59  ? 247 THR A OG1   1 
ATOM 1333 C CG2   . THR A 1 172 ? 70.262  52.891  46.023  1.00 38.42  ? 247 THR A CG2   1 
ATOM 1334 N N     . ASP A 1 173 ? 69.225  52.810  49.184  1.00 72.49  ? 248 ASP A N     1 
ATOM 1335 C CA    . ASP A 1 173 ? 69.385  51.532  49.880  1.00 63.27  ? 248 ASP A CA    1 
ATOM 1336 C C     . ASP A 1 173 ? 69.461  50.414  48.843  1.00 71.89  ? 248 ASP A C     1 
ATOM 1337 O O     . ASP A 1 173 ? 69.476  50.667  47.622  1.00 52.52  ? 248 ASP A O     1 
ATOM 1338 C CB    . ASP A 1 173 ? 68.265  51.301  50.915  1.00 65.82  ? 248 ASP A CB    1 
ATOM 1339 C CG    . ASP A 1 173 ? 66.808  51.445  50.342  1.00 89.26  ? 248 ASP A CG    1 
ATOM 1340 O OD1   . ASP A 1 173 ? 66.580  51.069  49.172  1.00 96.63  ? 248 ASP A OD1   1 
ATOM 1341 O OD2   . ASP A 1 173 ? 65.875  51.897  51.084  1.00 76.85  ? 248 ASP A OD2   1 
ATOM 1342 N N     . ARG A 1 174 ? 69.518  49.155  49.300  1.00 69.15  ? 249 ARG A N     1 
ATOM 1343 C CA    . ARG A 1 174 ? 69.419  48.075  48.321  1.00 65.54  ? 249 ARG A CA    1 
ATOM 1344 C C     . ARG A 1 174 ? 68.100  47.333  48.482  1.00 61.20  ? 249 ARG A C     1 
ATOM 1345 O O     . ARG A 1 174 ? 68.067  46.144  48.795  1.00 56.31  ? 249 ARG A O     1 
ATOM 1346 C CB    . ARG A 1 174 ? 70.530  47.136  48.489  1.00 48.79  ? 249 ARG A CB    1 
ATOM 1347 C CG    . ARG A 1 174 ? 71.864  47.727  48.725  1.00 51.62  ? 249 ARG A CG    1 
ATOM 1348 C CD    . ARG A 1 174 ? 72.838  46.592  48.985  1.00 56.27  ? 249 ARG A CD    1 
ATOM 1349 N NE    . ARG A 1 174 ? 72.759  46.122  50.367  1.00 72.59  ? 249 ARG A NE    1 
ATOM 1350 C CZ    . ARG A 1 174 ? 73.159  44.926  50.790  1.00 60.93  ? 249 ARG A CZ    1 
ATOM 1351 N NH1   . ARG A 1 174 ? 73.657  44.035  49.947  1.00 49.56  ? 249 ARG A NH1   1 
ATOM 1352 N NH2   . ARG A 1 174 ? 73.045  44.626  52.073  1.00 64.53  ? 249 ARG A NH2   1 
ATOM 1353 N N     . GLY A 1 175 ? 67.049  47.955  47.972  1.00 63.10  ? 250 GLY A N     1 
ATOM 1354 C CA    . GLY A 1 175 ? 65.845  47.251  47.668  1.00 67.36  ? 250 GLY A CA    1 
ATOM 1355 C C     . GLY A 1 175 ? 65.998  46.786  46.238  1.00 62.66  ? 250 GLY A C     1 
ATOM 1356 O O     . GLY A 1 175 ? 66.506  47.518  45.383  1.00 49.35  ? 250 GLY A O     1 
ATOM 1357 N N     . ALA A 1 176 ? 65.516  45.573  45.985  1.00 68.60  ? 251 ALA A N     1 
ATOM 1358 C CA    . ALA A 1 176 ? 65.574  45.043  44.636  1.00 48.76  ? 251 ALA A CA    1 
ATOM 1359 C C     . ALA A 1 176 ? 64.952  46.032  43.656  1.00 57.79  ? 251 ALA A C     1 
ATOM 1360 O O     . ALA A 1 176 ? 65.550  46.334  42.619  1.00 49.53  ? 251 ALA A O     1 
ATOM 1361 C CB    . ALA A 1 176 ? 64.882  43.695  44.621  1.00 40.61  ? 251 ALA A CB    1 
ATOM 1362 N N     . ASN A 1 177 ? 63.808  46.638  44.042  1.00 76.01  ? 252 ASN A N     1 
ATOM 1363 C CA    . ASN A 1 177 ? 63.129  47.705  43.303  1.00 65.35  ? 252 ASN A CA    1 
ATOM 1364 C C     . ASN A 1 177 ? 64.077  48.760  42.821  1.00 64.36  ? 252 ASN A C     1 
ATOM 1365 O O     . ASN A 1 177 ? 64.559  48.728  41.682  1.00 68.27  ? 252 ASN A O     1 
ATOM 1366 C CB    . ASN A 1 177 ? 62.186  48.532  44.184  1.00 48.41  ? 252 ASN A CB    1 
ATOM 1367 C CG    . ASN A 1 177 ? 61.148  47.741  44.820  1.00 66.24  ? 252 ASN A CG    1 
ATOM 1368 O OD1   . ASN A 1 177 ? 61.405  46.635  45.317  1.00 79.39  ? 252 ASN A OD1   1 
ATOM 1369 N ND2   . ASN A 1 177 ? 59.929  48.278  44.813  1.00 53.45  ? 252 ASN A ND2   1 
ATOM 1370 N N     . VAL A 1 178 ? 64.404  49.641  43.768  1.00 57.26  ? 253 VAL A N     1 
ATOM 1371 C CA    . VAL A 1 178 ? 65.186  50.822  43.453  1.00 64.32  ? 253 VAL A CA    1 
ATOM 1372 C C     . VAL A 1 178 ? 66.511  50.410  42.851  1.00 65.02  ? 253 VAL A C     1 
ATOM 1373 O O     . VAL A 1 178 ? 67.010  51.055  41.916  1.00 66.69  ? 253 VAL A O     1 
ATOM 1374 C CB    . VAL A 1 178 ? 65.378  51.700  44.703  1.00 52.64  ? 253 VAL A CB    1 
ATOM 1375 C CG1   . VAL A 1 178 ? 64.054  52.194  45.183  1.00 54.43  ? 253 VAL A CG1   1 
ATOM 1376 C CG2   . VAL A 1 178 ? 66.113  50.948  45.805  1.00 55.50  ? 253 VAL A CG2   1 
ATOM 1377 N N     . VAL A 1 179 ? 67.081  49.312  43.349  1.00 44.95  ? 254 VAL A N     1 
ATOM 1378 C CA    . VAL A 1 179 ? 68.405  48.939  42.891  1.00 57.78  ? 254 VAL A CA    1 
ATOM 1379 C C     . VAL A 1 179 ? 68.421  48.860  41.377  1.00 62.67  ? 254 VAL A C     1 
ATOM 1380 O O     . VAL A 1 179 ? 69.312  49.413  40.713  1.00 63.02  ? 254 VAL A O     1 
ATOM 1381 C CB    . VAL A 1 179 ? 68.851  47.631  43.554  1.00 58.59  ? 254 VAL A CB    1 
ATOM 1382 C CG1   . VAL A 1 179 ? 69.743  46.824  42.638  1.00 48.40  ? 254 VAL A CG1   1 
ATOM 1383 C CG2   . VAL A 1 179 ? 69.575  47.990  44.800  1.00 56.22  ? 254 VAL A CG2   1 
ATOM 1384 N N     . LYS A 1 180 ? 67.417  48.207  40.807  1.00 50.00  ? 255 LYS A N     1 
ATOM 1385 C CA    . LYS A 1 180 ? 67.372  48.110  39.365  1.00 70.11  ? 255 LYS A CA    1 
ATOM 1386 C C     . LYS A 1 180 ? 66.495  49.172  38.729  1.00 63.66  ? 255 LYS A C     1 
ATOM 1387 O O     . LYS A 1 180 ? 66.575  49.368  37.515  1.00 71.06  ? 255 LYS A O     1 
ATOM 1388 C CB    . LYS A 1 180 ? 66.932  46.699  38.927  1.00 86.55  ? 255 LYS A CB    1 
ATOM 1389 C CG    . LYS A 1 180 ? 65.498  46.588  38.415  1.00 76.75  ? 255 LYS A CG    1 
ATOM 1390 C CD    . LYS A 1 180 ? 65.238  45.254  37.783  1.00 63.97  ? 255 LYS A CD    1 
ATOM 1391 C CE    . LYS A 1 180 ? 66.162  44.995  36.582  1.00 95.89  ? 255 LYS A CE    1 
ATOM 1392 N NZ    . LYS A 1 180 ? 65.866  43.719  35.813  1.00 75.42  ? 255 LYS A NZ    1 
ATOM 1393 N N     . SER A 1 181 ? 65.695  49.883  39.511  1.00 52.38  ? 256 SER A N     1 
ATOM 1394 C CA    . SER A 1 181 ? 65.118  51.121  39.006  1.00 67.03  ? 256 SER A CA    1 
ATOM 1395 C C     . SER A 1 181 ? 66.201  52.075  38.522  1.00 73.19  ? 256 SER A C     1 
ATOM 1396 O O     . SER A 1 181 ? 65.988  52.862  37.587  1.00 59.73  ? 256 SER A O     1 
ATOM 1397 C CB    . SER A 1 181 ? 64.301  51.798  40.096  1.00 67.49  ? 256 SER A CB    1 
ATOM 1398 O OG    . SER A 1 181 ? 63.154  52.383  39.530  1.00 84.61  ? 256 SER A OG    1 
ATOM 1399 N N     . LEU A 1 182 ? 67.338  52.071  39.199  1.00 68.29  ? 257 LEU A N     1 
ATOM 1400 C CA    . LEU A 1 182 ? 68.482  52.873  38.826  1.00 64.71  ? 257 LEU A CA    1 
ATOM 1401 C C     . LEU A 1 182 ? 69.528  52.078  38.109  1.00 67.13  ? 257 LEU A C     1 
ATOM 1402 O O     . LEU A 1 182 ? 70.665  52.549  37.996  1.00 75.27  ? 257 LEU A O     1 
ATOM 1403 C CB    . LEU A 1 182 ? 69.063  53.556  40.047  1.00 62.28  ? 257 LEU A CB    1 
ATOM 1404 C CG    . LEU A 1 182 ? 67.982  54.545  40.472  1.00 73.70  ? 257 LEU A CG    1 
ATOM 1405 C CD1   . LEU A 1 182 ? 68.573  55.511  41.409  1.00 83.22  ? 257 LEU A CD1   1 
ATOM 1406 C CD2   . LEU A 1 182 ? 67.348  55.297  39.300  1.00 74.13  ? 257 LEU A CD2   1 
ATOM 1407 N N     . ALA A 1 183 ? 69.196  50.843  37.721  1.00 69.87  ? 258 ALA A N     1 
ATOM 1408 C CA    . ALA A 1 183 ? 70.178  49.903  37.175  1.00 79.98  ? 258 ALA A CA    1 
ATOM 1409 C C     . ALA A 1 183 ? 70.999  50.506  36.044  1.00 82.58  ? 258 ALA A C     1 
ATOM 1410 O O     . ALA A 1 183 ? 72.147  50.100  35.807  1.00 73.01  ? 258 ALA A O     1 
ATOM 1411 C CB    . ALA A 1 183 ? 69.464  48.648  36.670  1.00 64.85  ? 258 ALA A CB    1 
ATOM 1412 N N     . ASN A 1 184 ? 70.417  51.452  35.316  1.00 80.76  ? 259 ASN A N     1 
ATOM 1413 C CA    . ASN A 1 184 ? 71.082  52.106  34.207  1.00 76.15  ? 259 ASN A CA    1 
ATOM 1414 C C     . ASN A 1 184 ? 71.704  53.464  34.584  1.00 93.40  ? 259 ASN A C     1 
ATOM 1415 O O     . ASN A 1 184 ? 72.069  54.229  33.682  1.00 83.27  ? 259 ASN A O     1 
ATOM 1416 C CB    . ASN A 1 184 ? 70.114  52.195  33.018  1.00 92.39  ? 259 ASN A CB    1 
ATOM 1417 C CG    . ASN A 1 184 ? 70.123  50.890  32.143  1.00 102.02 ? 259 ASN A CG    1 
ATOM 1418 O OD1   . ASN A 1 184 ? 71.171  50.230  32.014  1.00 95.24  ? 259 ASN A OD1   1 
ATOM 1419 N ND2   . ASN A 1 184 ? 68.959  50.523  31.556  1.00 67.07  ? 259 ASN A ND2   1 
ATOM 1420 N N     . ASN A 1 185 ? 71.791  53.813  35.880  1.00 89.03  ? 260 ASN A N     1 
ATOM 1421 C CA    . ASN A 1 185 ? 72.510  55.025  36.283  1.00 72.40  ? 260 ASN A CA    1 
ATOM 1422 C C     . ASN A 1 185 ? 73.670  54.734  37.239  1.00 78.49  ? 260 ASN A C     1 
ATOM 1423 O O     . ASN A 1 185 ? 73.913  53.591  37.680  1.00 52.99  ? 260 ASN A O     1 
ATOM 1424 C CB    . ASN A 1 185 ? 71.573  56.037  36.940  1.00 70.48  ? 260 ASN A CB    1 
ATOM 1425 C CG    . ASN A 1 185 ? 70.237  56.119  36.247  1.00 78.40  ? 260 ASN A CG    1 
ATOM 1426 O OD1   . ASN A 1 185 ? 69.483  55.135  36.199  1.00 74.37  ? 260 ASN A OD1   1 
ATOM 1427 N ND2   . ASN A 1 185 ? 69.926  57.296  35.704  1.00 78.57  ? 260 ASN A ND2   1 
ATOM 1428 N N     . ILE A 1 186 ? 74.374  55.836  37.540  1.00 84.92  ? 261 ILE A N     1 
ATOM 1429 C CA    . ILE A 1 186 ? 75.360  55.884  38.610  1.00 77.03  ? 261 ILE A CA    1 
ATOM 1430 C C     . ILE A 1 186 ? 74.655  55.586  39.917  1.00 78.79  ? 261 ILE A C     1 
ATOM 1431 O O     . ILE A 1 186 ? 73.685  56.268  40.286  1.00 72.60  ? 261 ILE A O     1 
ATOM 1432 C CB    . ILE A 1 186 ? 76.018  57.275  38.671  1.00 80.29  ? 261 ILE A CB    1 
ATOM 1433 C CG1   . ILE A 1 186 ? 76.127  57.924  37.299  1.00 84.42  ? 261 ILE A CG1   1 
ATOM 1434 C CG2   . ILE A 1 186 ? 77.400  57.232  39.294  1.00 77.00  ? 261 ILE A CG2   1 
ATOM 1435 C CD1   . ILE A 1 186 ? 76.780  59.309  37.359  1.00 87.37  ? 261 ILE A CD1   1 
ATOM 1436 N N     . ARG A 1 187 ? 75.149  54.588  40.643  1.00 63.74  ? 262 ARG A N     1 
ATOM 1437 C CA    . ARG A 1 187 ? 74.431  54.100  41.816  1.00 76.27  ? 262 ARG A CA    1 
ATOM 1438 C C     . ARG A 1 187 ? 75.410  53.843  42.945  1.00 78.82  ? 262 ARG A C     1 
ATOM 1439 O O     . ARG A 1 187 ? 76.340  53.046  42.785  1.00 77.28  ? 262 ARG A O     1 
ATOM 1440 C CB    . ARG A 1 187 ? 73.669  52.818  41.480  1.00 95.02  ? 262 ARG A CB    1 
ATOM 1441 C CG    . ARG A 1 187 ? 72.175  52.934  41.575  1.00 81.47  ? 262 ARG A CG    1 
ATOM 1442 C CD    . ARG A 1 187 ? 71.793  53.079  42.986  1.00 67.45  ? 262 ARG A CD    1 
ATOM 1443 N NE    . ARG A 1 187 ? 72.477  52.138  43.887  1.00 65.24  ? 262 ARG A NE    1 
ATOM 1444 C CZ    . ARG A 1 187 ? 72.155  50.854  44.018  1.00 64.12  ? 262 ARG A CZ    1 
ATOM 1445 N NH1   . ARG A 1 187 ? 71.200  50.357  43.251  1.00 65.31  ? 262 ARG A NH1   1 
ATOM 1446 N NH2   . ARG A 1 187 ? 72.783  50.067  44.898  1.00 51.32  ? 262 ARG A NH2   1 
ATOM 1447 N N     . ILE A 1 188 ? 75.180  54.478  44.092  1.00 73.19  ? 263 ILE A N     1 
ATOM 1448 C CA    . ILE A 1 188 ? 76.087  54.405  45.235  1.00 68.69  ? 263 ILE A CA    1 
ATOM 1449 C C     . ILE A 1 188 ? 75.309  53.823  46.406  1.00 67.49  ? 263 ILE A C     1 
ATOM 1450 O O     . ILE A 1 188 ? 74.166  54.224  46.636  1.00 66.51  ? 263 ILE A O     1 
ATOM 1451 C CB    . ILE A 1 188 ? 76.653  55.798  45.566  1.00 63.64  ? 263 ILE A CB    1 
ATOM 1452 C CG1   . ILE A 1 188 ? 76.895  56.589  44.265  1.00 82.29  ? 263 ILE A CG1   1 
ATOM 1453 C CG2   . ILE A 1 188 ? 77.937  55.676  46.315  1.00 60.78  ? 263 ILE A CG2   1 
ATOM 1454 C CD1   . ILE A 1 188 ? 77.420  58.045  44.427  1.00 78.76  ? 263 ILE A CD1   1 
ATOM 1455 N N     . ASN A 1 189 ? 75.899  52.867  47.134  1.00 55.51  ? 264 ASN A N     1 
ATOM 1456 C CA    . ASN A 1 189 ? 75.142  52.207  48.200  1.00 56.56  ? 264 ASN A CA    1 
ATOM 1457 C C     . ASN A 1 189 ? 75.083  53.066  49.461  1.00 65.38  ? 264 ASN A C     1 
ATOM 1458 O O     . ASN A 1 189 ? 76.107  53.575  49.930  1.00 71.96  ? 264 ASN A O     1 
ATOM 1459 C CB    . ASN A 1 189 ? 75.722  50.839  48.541  1.00 57.18  ? 264 ASN A CB    1 
ATOM 1460 C CG    . ASN A 1 189 ? 75.274  49.745  47.565  1.00 70.55  ? 264 ASN A CG    1 
ATOM 1461 O OD1   . ASN A 1 189 ? 74.244  49.852  46.870  1.00 54.85  ? 264 ASN A OD1   1 
ATOM 1462 N ND2   . ASN A 1 189 ? 76.055  48.668  47.521  1.00 81.61  ? 264 ASN A ND2   1 
ATOM 1463 N N     . CYS A 1 190 ? 73.878  53.233  50.006  1.00 55.58  ? 265 CYS A N     1 
ATOM 1464 C CA    . CYS A 1 190 ? 73.735  53.958  51.259  1.00 60.05  ? 265 CYS A CA    1 
ATOM 1465 C C     . CYS A 1 190 ? 74.566  53.284  52.340  1.00 64.72  ? 265 CYS A C     1 
ATOM 1466 O O     . CYS A 1 190 ? 74.450  52.075  52.566  1.00 56.72  ? 265 CYS A O     1 
ATOM 1467 C CB    . CYS A 1 190 ? 72.268  54.022  51.687  1.00 64.32  ? 265 CYS A CB    1 
ATOM 1468 S SG    . CYS A 1 190 ? 71.985  54.430  53.446  1.00 53.70  ? 265 CYS A SG    1 
ATOM 1469 N N     . SER A 1 191 ? 75.425  54.066  52.998  1.00 60.01  ? 266 SER A N     1 
ATOM 1470 C CA    . SER A 1 191 ? 76.334  53.458  53.951  1.00 54.02  ? 266 SER A CA    1 
ATOM 1471 C C     . SER A 1 191 ? 75.706  53.244  55.325  1.00 51.15  ? 266 SER A C     1 
ATOM 1472 O O     . SER A 1 191 ? 76.156  52.361  56.072  1.00 42.46  ? 266 SER A O     1 
ATOM 1473 C CB    . SER A 1 191 ? 77.605  54.292  54.028  1.00 66.43  ? 266 SER A CB    1 
ATOM 1474 O OG    . SER A 1 191 ? 78.749  53.530  53.662  1.00 64.75  ? 266 SER A OG    1 
ATOM 1475 N N     . SER A 1 192 ? 74.645  53.981  55.666  1.00 54.37  ? 267 SER A N     1 
ATOM 1476 C CA    . SER A 1 192 ? 74.017  53.720  56.960  1.00 47.54  ? 267 SER A CA    1 
ATOM 1477 C C     . SER A 1 192 ? 73.331  52.372  56.951  1.00 56.47  ? 267 SER A C     1 
ATOM 1478 O O     . SER A 1 192 ? 73.435  51.620  57.926  1.00 61.93  ? 267 SER A O     1 
ATOM 1479 C CB    . SER A 1 192 ? 73.042  54.830  57.366  1.00 42.49  ? 267 SER A CB    1 
ATOM 1480 O OG    . SER A 1 192 ? 72.261  55.233  56.273  1.00 72.03  ? 267 SER A OG    1 
ATOM 1481 N N     . HIS A 1 193 ? 72.675  52.017  55.843  1.00 54.92  ? 268 HIS A N     1 
ATOM 1482 C CA    . HIS A 1 193 ? 72.084  50.688  55.760  1.00 51.87  ? 268 HIS A CA    1 
ATOM 1483 C C     . HIS A 1 193 ? 73.161  49.605  55.857  1.00 54.64  ? 268 HIS A C     1 
ATOM 1484 O O     . HIS A 1 193 ? 73.129  48.763  56.771  1.00 45.06  ? 268 HIS A O     1 
ATOM 1485 C CB    . HIS A 1 193 ? 71.274  50.544  54.483  1.00 46.64  ? 268 HIS A CB    1 
ATOM 1486 C CG    . HIS A 1 193 ? 69.996  51.344  54.449  1.00 58.08  ? 268 HIS A CG    1 
ATOM 1487 N ND1   . HIS A 1 193 ? 69.859  52.510  53.721  1.00 64.63  ? 268 HIS A ND1   1 
ATOM 1488 C CD2   . HIS A 1 193 ? 68.774  51.098  54.979  1.00 52.49  ? 268 HIS A CD2   1 
ATOM 1489 C CE1   . HIS A 1 193 ? 68.621  52.960  53.827  1.00 62.26  ? 268 HIS A CE1   1 
ATOM 1490 N NE2   . HIS A 1 193 ? 67.941  52.123  54.587  1.00 58.74  ? 268 HIS A NE2   1 
ATOM 1491 N N     . LEU A 1 194 ? 74.168  49.647  54.968  1.00 40.51  ? 269 LEU A N     1 
ATOM 1492 C CA    . LEU A 1 194 ? 75.148  48.561  54.962  1.00 48.36  ? 269 LEU A CA    1 
ATOM 1493 C C     . LEU A 1 194 ? 75.610  48.261  56.368  1.00 56.95  ? 269 LEU A C     1 
ATOM 1494 O O     . LEU A 1 194 ? 75.694  47.091  56.771  1.00 49.80  ? 269 LEU A O     1 
ATOM 1495 C CB    . LEU A 1 194 ? 76.356  48.883  54.085  1.00 38.77  ? 269 LEU A CB    1 
ATOM 1496 C CG    . LEU A 1 194 ? 75.961  49.208  52.650  1.00 72.85  ? 269 LEU A CG    1 
ATOM 1497 C CD1   . LEU A 1 194 ? 77.174  49.270  51.681  1.00 64.64  ? 269 LEU A CD1   1 
ATOM 1498 C CD2   . LEU A 1 194 ? 74.843  48.231  52.173  1.00 71.25  ? 269 LEU A CD2   1 
ATOM 1499 N N     . LEU A 1 195 ? 75.839  49.319  57.151  1.00 56.27  ? 270 LEU A N     1 
ATOM 1500 C CA    . LEU A 1 195 ? 76.273  49.132  58.519  1.00 48.92  ? 270 LEU A CA    1 
ATOM 1501 C C     . LEU A 1 195 ? 75.239  48.331  59.284  1.00 57.29  ? 270 LEU A C     1 
ATOM 1502 O O     . LEU A 1 195 ? 75.577  47.378  60.000  1.00 60.47  ? 270 LEU A O     1 
ATOM 1503 C CB    . LEU A 1 195 ? 76.519  50.478  59.179  1.00 39.36  ? 270 LEU A CB    1 
ATOM 1504 C CG    . LEU A 1 195 ? 77.086  50.277  60.597  1.00 51.86  ? 270 LEU A CG    1 
ATOM 1505 C CD1   . LEU A 1 195 ? 78.543  49.894  60.592  1.00 59.87  ? 270 LEU A CD1   1 
ATOM 1506 C CD2   . LEU A 1 195 ? 76.968  51.466  61.440  1.00 45.00  ? 270 LEU A CD2   1 
ATOM 1507 N N     . SER A 1 196 ? 73.965  48.684  59.113  1.00 41.71  ? 271 SER A N     1 
ATOM 1508 C CA    . SER A 1 196 ? 72.914  48.008  59.852  1.00 41.65  ? 271 SER A CA    1 
ATOM 1509 C C     . SER A 1 196 ? 72.922  46.534  59.496  1.00 60.62  ? 271 SER A C     1 
ATOM 1510 O O     . SER A 1 196 ? 72.926  45.652  60.375  1.00 52.32  ? 271 SER A O     1 
ATOM 1511 C CB    . SER A 1 196 ? 71.578  48.670  59.513  1.00 52.32  ? 271 SER A CB    1 
ATOM 1512 O OG    . SER A 1 196 ? 70.522  48.251  60.351  1.00 66.41  ? 271 SER A OG    1 
ATOM 1513 N N     . ASN A 1 197 ? 73.010  46.268  58.188  1.00 57.97  ? 272 ASN A N     1 
ATOM 1514 C CA    . ASN A 1 197 ? 73.138  44.923  57.670  1.00 44.93  ? 272 ASN A CA    1 
ATOM 1515 C C     . ASN A 1 197 ? 74.247  44.204  58.399  1.00 49.17  ? 272 ASN A C     1 
ATOM 1516 O O     . ASN A 1 197 ? 74.005  43.249  59.136  1.00 52.92  ? 272 ASN A O     1 
ATOM 1517 C CB    . ASN A 1 197 ? 73.390  45.021  56.180  1.00 39.73  ? 272 ASN A CB    1 
ATOM 1518 C CG    . ASN A 1 197 ? 72.204  45.631  55.457  1.00 51.59  ? 272 ASN A CG    1 
ATOM 1519 O OD1   . ASN A 1 197 ? 72.235  45.924  54.253  1.00 52.72  ? 272 ASN A OD1   1 
ATOM 1520 N ND2   . ASN A 1 197 ? 71.123  45.814  56.204  1.00 56.45  ? 272 ASN A ND2   1 
ATOM 1521 N N     . VAL A 1 198 ? 75.438  44.773  58.350  1.00 48.71  ? 273 VAL A N     1 
ATOM 1522 C CA    . VAL A 1 198 ? 76.554  44.290  59.142  1.00 45.98  ? 273 VAL A CA    1 
ATOM 1523 C C     . VAL A 1 198 ? 76.151  43.991  60.569  1.00 48.39  ? 273 VAL A C     1 
ATOM 1524 O O     . VAL A 1 198 ? 76.460  42.933  61.111  1.00 53.96  ? 273 VAL A O     1 
ATOM 1525 C CB    . VAL A 1 198 ? 77.676  45.319  59.163  1.00 46.55  ? 273 VAL A CB    1 
ATOM 1526 C CG1   . VAL A 1 198 ? 78.665  44.921  60.201  1.00 53.67  ? 273 VAL A CG1   1 
ATOM 1527 C CG2   . VAL A 1 198 ? 78.303  45.397  57.817  1.00 61.47  ? 273 VAL A CG2   1 
ATOM 1528 N N     . LEU A 1 199 ? 75.484  44.915  61.204  1.00 40.93  ? 274 LEU A N     1 
ATOM 1529 C CA    . LEU A 1 199 ? 75.313  44.690  62.616  1.00 42.86  ? 274 LEU A CA    1 
ATOM 1530 C C     . LEU A 1 199 ? 74.252  43.633  62.876  1.00 64.50  ? 274 LEU A C     1 
ATOM 1531 O O     . LEU A 1 199 ? 74.381  42.817  63.804  1.00 54.50  ? 274 LEU A O     1 
ATOM 1532 C CB    . LEU A 1 199 ? 74.972  46.010  63.288  1.00 57.88  ? 274 LEU A CB    1 
ATOM 1533 C CG    . LEU A 1 199 ? 76.167  46.790  63.845  1.00 77.13  ? 274 LEU A CG    1 
ATOM 1534 C CD1   . LEU A 1 199 ? 77.242  47.115  62.785  1.00 73.09  ? 274 LEU A CD1   1 
ATOM 1535 C CD2   . LEU A 1 199 ? 75.684  48.059  64.489  1.00 65.41  ? 274 LEU A CD2   1 
ATOM 1536 N N     . GLU A 1 200 ? 73.185  43.623  62.088  1.00 64.52  ? 275 GLU A N     1 
ATOM 1537 C CA    . GLU A 1 200 ? 72.133  42.701  62.473  1.00 73.23  ? 275 GLU A CA    1 
ATOM 1538 C C     . GLU A 1 200 ? 72.421  41.290  62.011  1.00 66.51  ? 275 GLU A C     1 
ATOM 1539 O O     . GLU A 1 200 ? 71.848  40.349  62.560  1.00 70.59  ? 275 GLU A O     1 
ATOM 1540 C CB    . GLU A 1 200 ? 70.781  43.159  61.950  1.00 73.46  ? 275 GLU A CB    1 
ATOM 1541 C CG    . GLU A 1 200 ? 70.302  42.333  60.795  1.00 81.29  ? 275 GLU A CG    1 
ATOM 1542 C CD    . GLU A 1 200 ? 70.038  43.204  59.602  1.00 116.63 ? 275 GLU A CD    1 
ATOM 1543 O OE1   . GLU A 1 200 ? 69.038  42.950  58.892  1.00 146.94 ? 275 GLU A OE1   1 
ATOM 1544 O OE2   . GLU A 1 200 ? 70.822  44.165  59.395  1.00 97.42  ? 275 GLU A OE2   1 
ATOM 1545 N N     . ASN A 1 201 ? 73.293  41.120  61.027  1.00 56.60  ? 276 ASN A N     1 
ATOM 1546 C CA    . ASN A 1 201 ? 73.746  39.781  60.717  1.00 54.78  ? 276 ASN A CA    1 
ATOM 1547 C C     . ASN A 1 201 ? 74.713  39.300  61.771  1.00 65.09  ? 276 ASN A C     1 
ATOM 1548 O O     . ASN A 1 201 ? 74.556  38.207  62.316  1.00 74.24  ? 276 ASN A O     1 
ATOM 1549 C CB    . ASN A 1 201 ? 74.359  39.741  59.340  1.00 51.49  ? 276 ASN A CB    1 
ATOM 1550 C CG    . ASN A 1 201 ? 73.306  39.564  58.284  1.00 73.97  ? 276 ASN A CG    1 
ATOM 1551 O OD1   . ASN A 1 201 ? 72.319  40.301  58.237  1.00 84.57  ? 276 ASN A OD1   1 
ATOM 1552 N ND2   . ASN A 1 201 ? 73.464  38.546  57.473  1.00 79.21  ? 276 ASN A ND2   1 
ATOM 1553 N N     . SER A 1 202 ? 75.680  40.131  62.129  1.00 68.77  ? 277 SER A N     1 
ATOM 1554 C CA    . SER A 1 202 ? 76.568  39.774  63.225  1.00 60.96  ? 277 SER A CA    1 
ATOM 1555 C C     . SER A 1 202 ? 75.818  39.469  64.512  1.00 62.93  ? 277 SER A C     1 
ATOM 1556 O O     . SER A 1 202 ? 76.398  38.914  65.438  1.00 68.11  ? 277 SER A O     1 
ATOM 1557 C CB    . SER A 1 202 ? 77.559  40.893  63.455  1.00 51.24  ? 277 SER A CB    1 
ATOM 1558 O OG    . SER A 1 202 ? 78.057  41.320  62.204  1.00 59.04  ? 277 SER A OG    1 
ATOM 1559 N N     . PHE A 1 203 ? 74.585  39.898  64.651  1.00 62.07  ? 278 PHE A N     1 
ATOM 1560 C CA    . PHE A 1 203 ? 73.887  39.396  65.817  1.00 63.58  ? 278 PHE A CA    1 
ATOM 1561 C C     . PHE A 1 203 ? 73.109  38.114  65.549  1.00 77.57  ? 278 PHE A C     1 
ATOM 1562 O O     . PHE A 1 203 ? 72.972  37.295  66.462  1.00 84.56  ? 278 PHE A O     1 
ATOM 1563 C CB    . PHE A 1 203 ? 72.995  40.486  66.387  1.00 79.01  ? 278 PHE A CB    1 
ATOM 1564 C CG    . PHE A 1 203 ? 73.707  41.377  67.325  1.00 54.00  ? 278 PHE A CG    1 
ATOM 1565 C CD1   . PHE A 1 203 ? 73.543  41.236  68.683  1.00 62.90  ? 278 PHE A CD1   1 
ATOM 1566 C CD2   . PHE A 1 203 ? 74.566  42.319  66.866  1.00 45.39  ? 278 PHE A CD2   1 
ATOM 1567 C CE1   . PHE A 1 203 ? 74.215  42.041  69.577  1.00 48.59  ? 278 PHE A CE1   1 
ATOM 1568 C CE2   . PHE A 1 203 ? 75.250  43.126  67.767  1.00 60.74  ? 278 PHE A CE2   1 
ATOM 1569 C CZ    . PHE A 1 203 ? 75.066  42.978  69.131  1.00 47.16  ? 278 PHE A CZ    1 
ATOM 1570 N N     . GLU A 1 204 ? 72.538  37.954  64.342  1.00 81.52  ? 279 GLU A N     1 
ATOM 1571 C CA    . GLU A 1 204 ? 71.932  36.680  63.950  1.00 71.79  ? 279 GLU A CA    1 
ATOM 1572 C C     . GLU A 1 204 ? 72.869  35.559  64.317  1.00 82.64  ? 279 GLU A C     1 
ATOM 1573 O O     . GLU A 1 204 ? 72.479  34.565  64.938  1.00 102.94 ? 279 GLU A O     1 
ATOM 1574 C CB    . GLU A 1 204 ? 71.711  36.633  62.437  1.00 82.53  ? 279 GLU A CB    1 
ATOM 1575 C CG    . GLU A 1 204 ? 70.315  36.406  61.908  1.00 101.37 ? 279 GLU A CG    1 
ATOM 1576 C CD    . GLU A 1 204 ? 70.055  37.263  60.648  1.00 124.80 ? 279 GLU A CD    1 
ATOM 1577 O OE1   . GLU A 1 204 ? 69.664  38.446  60.815  1.00 134.70 ? 279 GLU A OE1   1 
ATOM 1578 O OE2   . GLU A 1 204 ? 70.273  36.784  59.501  1.00 104.60 ? 279 GLU A OE2   1 
ATOM 1579 N N     . GLU A 1 205 ? 74.140  35.765  64.009  1.00 76.99  ? 280 GLU A N     1 
ATOM 1580 C CA    . GLU A 1 205 ? 75.186  34.768  64.020  1.00 70.45  ? 280 GLU A CA    1 
ATOM 1581 C C     . GLU A 1 205 ? 75.893  34.626  65.371  1.00 79.73  ? 280 GLU A C     1 
ATOM 1582 O O     . GLU A 1 205 ? 76.748  33.749  65.511  1.00 91.85  ? 280 GLU A O     1 
ATOM 1583 C CB    . GLU A 1 205 ? 76.139  35.115  62.880  1.00 46.89  ? 280 GLU A CB    1 
ATOM 1584 C CG    . GLU A 1 205 ? 75.311  35.167  61.591  1.00 72.18  ? 280 GLU A CG    1 
ATOM 1585 C CD    . GLU A 1 205 ? 75.855  36.108  60.541  1.00 77.50  ? 280 GLU A CD    1 
ATOM 1586 O OE1   . GLU A 1 205 ? 75.066  36.543  59.646  1.00 64.93  ? 280 GLU A OE1   1 
ATOM 1587 O OE2   . GLU A 1 205 ? 77.075  36.388  60.623  1.00 63.57  ? 280 GLU A OE2   1 
ATOM 1588 N N     . THR A 1 206 ? 75.512  35.389  66.396  1.00 74.29  ? 281 THR A N     1 
ATOM 1589 C CA    . THR A 1 206 ? 76.084  35.246  67.740  1.00 74.46  ? 281 THR A CA    1 
ATOM 1590 C C     . THR A 1 206 ? 74.944  35.021  68.728  1.00 76.35  ? 281 THR A C     1 
ATOM 1591 O O     . THR A 1 206 ? 74.760  35.781  69.684  1.00 78.15  ? 281 THR A O     1 
ATOM 1592 C CB    . THR A 1 206 ? 76.928  36.474  68.126  1.00 75.29  ? 281 THR A CB    1 
ATOM 1593 O OG1   . THR A 1 206 ? 77.946  36.718  67.145  1.00 68.25  ? 281 THR A OG1   1 
ATOM 1594 C CG2   . THR A 1 206 ? 77.621  36.317  69.495  1.00 65.20  ? 281 THR A CG2   1 
ATOM 1595 N N     . PRO A 1 207 ? 74.152  33.969  68.536  1.00 71.66  ? 282 PRO A N     1 
ATOM 1596 C CA    . PRO A 1 207 ? 72.966  33.820  69.383  1.00 81.86  ? 282 PRO A CA    1 
ATOM 1597 C C     . PRO A 1 207 ? 73.305  33.611  70.836  1.00 76.16  ? 282 PRO A C     1 
ATOM 1598 O O     . PRO A 1 207 ? 72.437  33.793  71.696  1.00 81.25  ? 282 PRO A O     1 
ATOM 1599 C CB    . PRO A 1 207 ? 72.242  32.619  68.772  1.00 71.24  ? 282 PRO A CB    1 
ATOM 1600 C CG    . PRO A 1 207 ? 73.251  31.944  68.001  1.00 69.10  ? 282 PRO A CG    1 
ATOM 1601 C CD    . PRO A 1 207 ? 74.212  32.928  67.512  1.00 63.39  ? 282 PRO A CD    1 
ATOM 1602 N N     . GLU A 1 208 ? 74.549  33.274  71.148  1.00 69.83  ? 283 GLU A N     1 
ATOM 1603 C CA    . GLU A 1 208 ? 74.958  33.248  72.546  1.00 83.55  ? 283 GLU A CA    1 
ATOM 1604 C C     . GLU A 1 208 ? 74.561  34.543  73.244  1.00 76.74  ? 283 GLU A C     1 
ATOM 1605 O O     . GLU A 1 208 ? 73.925  34.523  74.306  1.00 69.24  ? 283 GLU A O     1 
ATOM 1606 C CB    . GLU A 1 208 ? 76.452  32.982  72.584  1.00 80.03  ? 283 GLU A CB    1 
ATOM 1607 C CG    . GLU A 1 208 ? 76.746  32.024  71.439  1.00 74.59  ? 283 GLU A CG    1 
ATOM 1608 C CD    . GLU A 1 208 ? 78.184  31.659  71.317  1.00 99.24  ? 283 GLU A CD    1 
ATOM 1609 O OE1   . GLU A 1 208 ? 78.870  32.309  70.504  1.00 82.07  ? 283 GLU A OE1   1 
ATOM 1610 O OE2   . GLU A 1 208 ? 78.631  30.726  72.027  1.00 119.56 ? 283 GLU A OE2   1 
ATOM 1611 N N     . LEU A 1 209 ? 74.889  35.678  72.618  1.00 85.89  ? 284 LEU A N     1 
ATOM 1612 C CA    . LEU A 1 209 ? 74.322  36.974  72.995  1.00 77.18  ? 284 LEU A CA    1 
ATOM 1613 C C     . LEU A 1 209 ? 72.866  37.098  72.566  1.00 72.82  ? 284 LEU A C     1 
ATOM 1614 O O     . LEU A 1 209 ? 71.970  37.246  73.400  1.00 65.26  ? 284 LEU A O     1 
ATOM 1615 C CB    . LEU A 1 209 ? 75.137  38.100  72.356  1.00 54.72  ? 284 LEU A CB    1 
ATOM 1616 C CG    . LEU A 1 209 ? 76.622  38.063  72.701  1.00 65.03  ? 284 LEU A CG    1 
ATOM 1617 C CD1   . LEU A 1 209 ? 77.403  39.042  71.883  1.00 67.92  ? 284 LEU A CD1   1 
ATOM 1618 C CD2   . LEU A 1 209 ? 76.788  38.380  74.138  1.00 57.39  ? 284 LEU A CD2   1 
ATOM 1619 N N     . ASN A 1 210 ? 72.605  36.951  71.268  1.00 66.07  ? 285 ASN A N     1 
ATOM 1620 C CA    . ASN A 1 210 ? 71.335  37.368  70.694  1.00 67.21  ? 285 ASN A CA    1 
ATOM 1621 C C     . ASN A 1 210 ? 70.123  36.706  71.343  1.00 80.51  ? 285 ASN A C     1 
ATOM 1622 O O     . ASN A 1 210 ? 68.986  37.149  71.103  1.00 74.06  ? 285 ASN A O     1 
ATOM 1623 C CB    . ASN A 1 210 ? 71.361  37.076  69.201  1.00 74.57  ? 285 ASN A CB    1 
ATOM 1624 C CG    . ASN A 1 210 ? 70.228  37.734  68.465  1.00 93.78  ? 285 ASN A CG    1 
ATOM 1625 O OD1   . ASN A 1 210 ? 70.184  38.962  68.337  1.00 93.81  ? 285 ASN A OD1   1 
ATOM 1626 N ND2   . ASN A 1 210 ? 69.300  36.923  67.967  1.00 102.48 ? 285 ASN A ND2   1 
ATOM 1627 N N     . MET A 1 211 ? 70.331  35.648  72.153  1.00 74.97  ? 286 MET A N     1 
ATOM 1628 C CA    . MET A 1 211 ? 69.204  35.069  72.878  1.00 60.75  ? 286 MET A CA    1 
ATOM 1629 C C     . MET A 1 211 ? 68.737  36.006  73.971  1.00 66.51  ? 286 MET A C     1 
ATOM 1630 O O     . MET A 1 211 ? 67.541  36.330  73.997  1.00 70.76  ? 286 MET A O     1 
ATOM 1631 C CB    . MET A 1 211 ? 69.554  33.678  73.415  1.00 85.03  ? 286 MET A CB    1 
ATOM 1632 C CG    . MET A 1 211 ? 69.726  32.583  72.358  1.00 98.11  ? 286 MET A CG    1 
ATOM 1633 S SD    . MET A 1 211 ? 70.128  30.940  73.039  1.00 106.98 ? 286 MET A SD    1 
ATOM 1634 C CE    . MET A 1 211 ? 71.216  31.355  74.425  1.00 122.35 ? 286 MET A CE    1 
ATOM 1635 N N     . PRO A 1 212 ? 69.594  36.498  74.871  1.00 70.37  ? 287 PRO A N     1 
ATOM 1636 C CA    . PRO A 1 212 ? 69.159  37.594  75.764  1.00 78.83  ? 287 PRO A CA    1 
ATOM 1637 C C     . PRO A 1 212 ? 68.591  38.859  75.094  1.00 68.54  ? 287 PRO A C     1 
ATOM 1638 O O     . PRO A 1 212 ? 67.498  39.290  75.468  1.00 62.79  ? 287 PRO A O     1 
ATOM 1639 C CB    . PRO A 1 212 ? 70.447  37.893  76.535  1.00 70.62  ? 287 PRO A CB    1 
ATOM 1640 C CG    . PRO A 1 212 ? 71.086  36.609  76.652  1.00 73.16  ? 287 PRO A CG    1 
ATOM 1641 C CD    . PRO A 1 212 ? 70.760  35.808  75.435  1.00 72.24  ? 287 PRO A CD    1 
ATOM 1642 N N     . ILE A 1 213 ? 69.271  39.444  74.105  1.00 56.62  ? 288 ILE A N     1 
ATOM 1643 C CA    . ILE A 1 213 ? 68.752  40.576  73.337  1.00 67.17  ? 288 ILE A CA    1 
ATOM 1644 C C     . ILE A 1 213 ? 67.295  40.380  72.953  1.00 72.89  ? 288 ILE A C     1 
ATOM 1645 O O     . ILE A 1 213 ? 66.434  41.216  73.250  1.00 70.15  ? 288 ILE A O     1 
ATOM 1646 C CB    . ILE A 1 213 ? 69.575  40.777  72.066  1.00 66.82  ? 288 ILE A CB    1 
ATOM 1647 C CG1   . ILE A 1 213 ? 70.982  41.147  72.464  1.00 75.03  ? 288 ILE A CG1   1 
ATOM 1648 C CG2   . ILE A 1 213 ? 68.916  41.803  71.146  1.00 42.95  ? 288 ILE A CG2   1 
ATOM 1649 C CD1   . ILE A 1 213 ? 71.984  40.491  71.617  1.00 84.71  ? 288 ILE A CD1   1 
ATOM 1650 N N     . LEU A 1 214 ? 67.035  39.320  72.199  1.00 74.03  ? 289 LEU A N     1 
ATOM 1651 C CA    . LEU A 1 214 ? 65.663  38.904  71.978  1.00 74.79  ? 289 LEU A CA    1 
ATOM 1652 C C     . LEU A 1 214 ? 64.889  38.806  73.291  1.00 62.78  ? 289 LEU A C     1 
ATOM 1653 O O     . LEU A 1 214 ? 63.719  39.182  73.358  1.00 60.76  ? 289 LEU A O     1 
ATOM 1654 C CB    . LEU A 1 214 ? 65.664  37.567  71.245  1.00 79.69  ? 289 LEU A CB    1 
ATOM 1655 C CG    . LEU A 1 214 ? 64.600  37.334  70.175  1.00 83.80  ? 289 LEU A CG    1 
ATOM 1656 C CD1   . LEU A 1 214 ? 63.461  38.367  70.287  1.00 71.01  ? 289 LEU A CD1   1 
ATOM 1657 C CD2   . LEU A 1 214 ? 65.243  37.297  68.765  1.00 79.79  ? 289 LEU A CD2   1 
ATOM 1658 N N     . ALA A 1 215 ? 65.515  38.306  74.349  1.00 51.93  ? 290 ALA A N     1 
ATOM 1659 C CA    . ALA A 1 215 ? 64.743  38.085  75.565  1.00 64.35  ? 290 ALA A CA    1 
ATOM 1660 C C     . ALA A 1 215 ? 64.352  39.399  76.188  1.00 70.20  ? 290 ALA A C     1 
ATOM 1661 O O     . ALA A 1 215 ? 63.232  39.548  76.693  1.00 73.36  ? 290 ALA A O     1 
ATOM 1662 C CB    . ALA A 1 215 ? 65.531  37.252  76.569  1.00 89.33  ? 290 ALA A CB    1 
ATOM 1663 N N     . CYS A 1 216 ? 65.294  40.348  76.179  1.00 83.88  ? 291 CYS A N     1 
ATOM 1664 C CA    . CYS A 1 216 ? 65.024  41.742  76.516  1.00 70.48  ? 291 CYS A CA    1 
ATOM 1665 C C     . CYS A 1 216 ? 63.842  42.261  75.737  1.00 66.18  ? 291 CYS A C     1 
ATOM 1666 O O     . CYS A 1 216 ? 62.866  42.733  76.324  1.00 64.10  ? 291 CYS A O     1 
ATOM 1667 C CB    . CYS A 1 216 ? 66.243  42.598  76.190  1.00 73.90  ? 291 CYS A CB    1 
ATOM 1668 S SG    . CYS A 1 216 ? 67.475  42.770  77.489  1.00 80.54  ? 291 CYS A SG    1 
ATOM 1669 N N     . LYS A 1 217 ? 63.900  42.119  74.404  1.00 63.72  ? 292 LYS A N     1 
ATOM 1670 C CA    . LYS A 1 217 ? 62.948  42.762  73.516  1.00 54.18  ? 292 LYS A CA    1 
ATOM 1671 C C     . LYS A 1 217 ? 61.532  42.534  74.000  1.00 59.89  ? 292 LYS A C     1 
ATOM 1672 O O     . LYS A 1 217 ? 60.665  43.405  73.837  1.00 71.29  ? 292 LYS A O     1 
ATOM 1673 C CB    . LYS A 1 217 ? 63.148  42.269  72.073  1.00 55.22  ? 292 LYS A CB    1 
ATOM 1674 C CG    . LYS A 1 217 ? 62.109  42.841  71.090  1.00 84.45  ? 292 LYS A CG    1 
ATOM 1675 C CD    . LYS A 1 217 ? 62.470  42.682  69.607  1.00 92.12  ? 292 LYS A CD    1 
ATOM 1676 C CE    . LYS A 1 217 ? 61.288  43.093  68.688  1.00 92.28  ? 292 LYS A CE    1 
ATOM 1677 N NZ    . LYS A 1 217 ? 61.619  43.087  67.211  1.00 83.31  ? 292 LYS A NZ    1 
ATOM 1678 N N     . ASN A 1 218 ? 61.294  41.389  74.636  1.00 72.52  ? 293 ASN A N     1 
ATOM 1679 C CA    . ASN A 1 218 ? 59.971  40.986  75.109  1.00 86.07  ? 293 ASN A CA    1 
ATOM 1680 C C     . ASN A 1 218 ? 59.611  41.506  76.496  1.00 77.32  ? 293 ASN A C     1 
ATOM 1681 O O     . ASN A 1 218 ? 58.417  41.651  76.803  1.00 75.40  ? 293 ASN A O     1 
ATOM 1682 C CB    . ASN A 1 218 ? 59.859  39.461  75.042  1.00 77.48  ? 293 ASN A CB    1 
ATOM 1683 C CG    . ASN A 1 218 ? 60.041  38.943  73.616  1.00 86.93  ? 293 ASN A CG    1 
ATOM 1684 O OD1   . ASN A 1 218 ? 59.292  39.312  72.696  1.00 77.19  ? 293 ASN A OD1   1 
ATOM 1685 N ND2   . ASN A 1 218 ? 61.072  38.124  73.416  1.00 106.36 ? 293 ASN A ND2   1 
ATOM 1686 N N     . ILE A 1 219 ? 60.604  41.740  77.355  1.00 77.64  ? 294 ILE A N     1 
ATOM 1687 C CA    . ILE A 1 219 ? 60.335  42.367  78.653  1.00 88.52  ? 294 ILE A CA    1 
ATOM 1688 C C     . ILE A 1 219 ? 59.711  43.736  78.430  1.00 82.61  ? 294 ILE A C     1 
ATOM 1689 O O     . ILE A 1 219 ? 58.731  44.124  79.086  1.00 72.34  ? 294 ILE A O     1 
ATOM 1690 C CB    . ILE A 1 219 ? 61.634  42.475  79.484  1.00 91.10  ? 294 ILE A CB    1 
ATOM 1691 C CG1   . ILE A 1 219 ? 62.501  41.197  79.354  1.00 95.04  ? 294 ILE A CG1   1 
ATOM 1692 C CG2   . ILE A 1 219 ? 61.369  42.959  80.960  1.00 59.81  ? 294 ILE A CG2   1 
ATOM 1693 C CD1   . ILE A 1 219 ? 61.770  39.828  79.436  1.00 103.76 ? 294 ILE A CD1   1 
ATOM 1694 N N     . VAL A 1 220 ? 60.300  44.494  77.500  1.00 78.95  ? 295 VAL A N     1 
ATOM 1695 C CA    . VAL A 1 220 ? 59.663  45.696  76.985  1.00 70.19  ? 295 VAL A CA    1 
ATOM 1696 C C     . VAL A 1 220 ? 58.247  45.361  76.544  1.00 75.24  ? 295 VAL A C     1 
ATOM 1697 O O     . VAL A 1 220 ? 57.270  45.828  77.142  1.00 73.03  ? 295 VAL A O     1 
ATOM 1698 C CB    . VAL A 1 220 ? 60.501  46.310  75.847  1.00 71.29  ? 295 VAL A CB    1 
ATOM 1699 C CG1   . VAL A 1 220 ? 60.414  47.804  75.909  1.00 69.62  ? 295 VAL A CG1   1 
ATOM 1700 C CG2   . VAL A 1 220 ? 61.962  45.932  75.981  1.00 66.45  ? 295 VAL A CG2   1 
ATOM 1701 N N     . LYS A 1 221 ? 58.117  44.480  75.536  1.00 87.54  ? 296 LYS A N     1 
ATOM 1702 C CA    . LYS A 1 221 ? 56.795  44.124  75.008  1.00 86.61  ? 296 LYS A CA    1 
ATOM 1703 C C     . LYS A 1 221 ? 55.818  43.716  76.115  1.00 67.59  ? 296 LYS A C     1 
ATOM 1704 O O     . LYS A 1 221 ? 54.632  44.048  76.046  1.00 65.34  ? 296 LYS A O     1 
ATOM 1705 C CB    . LYS A 1 221 ? 56.926  43.015  73.953  1.00 75.93  ? 296 LYS A CB    1 
ATOM 1706 C CG    . LYS A 1 221 ? 55.984  41.847  74.198  1.00 91.20  ? 296 LYS A CG    1 
ATOM 1707 C CD    . LYS A 1 221 ? 56.315  40.603  73.389  1.00 89.53  ? 296 LYS A CD    1 
ATOM 1708 C CE    . LYS A 1 221 ? 56.109  39.371  74.272  1.00 92.23  ? 296 LYS A CE    1 
ATOM 1709 N NZ    . LYS A 1 221 ? 55.482  38.257  73.516  1.00 118.67 ? 296 LYS A NZ    1 
ATOM 1710 N N     . TYR A 1 222 ? 56.303  43.066  77.170  1.00 68.70  ? 297 TYR A N     1 
ATOM 1711 C CA    . TYR A 1 222 ? 55.424  42.690  78.270  1.00 69.90  ? 297 TYR A CA    1 
ATOM 1712 C C     . TYR A 1 222 ? 55.059  43.883  79.137  1.00 67.27  ? 297 TYR A C     1 
ATOM 1713 O O     . TYR A 1 222 ? 53.878  44.223  79.257  1.00 67.69  ? 297 TYR A O     1 
ATOM 1714 C CB    . TYR A 1 222 ? 56.067  41.615  79.132  1.00 86.31  ? 297 TYR A CB    1 
ATOM 1715 C CG    . TYR A 1 222 ? 55.315  41.376  80.435  1.00 84.12  ? 297 TYR A CG    1 
ATOM 1716 C CD1   . TYR A 1 222 ? 54.027  40.836  80.439  1.00 85.89  ? 297 TYR A CD1   1 
ATOM 1717 C CD2   . TYR A 1 222 ? 55.900  41.674  81.660  1.00 76.25  ? 297 TYR A CD2   1 
ATOM 1718 C CE1   . TYR A 1 222 ? 53.341  40.609  81.633  1.00 77.44  ? 297 TYR A CE1   1 
ATOM 1719 C CE2   . TYR A 1 222 ? 55.234  41.447  82.851  1.00 71.69  ? 297 TYR A CE2   1 
ATOM 1720 C CZ    . TYR A 1 222 ? 53.955  40.918  82.837  1.00 74.90  ? 297 TYR A CZ    1 
ATOM 1721 O OH    . TYR A 1 222 ? 53.307  40.707  84.041  1.00 62.40  ? 297 TYR A OH    1 
ATOM 1722 N N     . PHE A 1 223 ? 56.069  44.523  79.754  1.00 70.45  ? 298 PHE A N     1 
ATOM 1723 C CA    . PHE A 1 223 ? 55.861  45.696  80.611  1.00 73.35  ? 298 PHE A CA    1 
ATOM 1724 C C     . PHE A 1 223 ? 54.844  46.628  79.983  1.00 70.35  ? 298 PHE A C     1 
ATOM 1725 O O     . PHE A 1 223 ? 53.885  47.064  80.636  1.00 62.74  ? 298 PHE A O     1 
ATOM 1726 C CB    . PHE A 1 223 ? 57.180  46.466  80.778  1.00 66.02  ? 298 PHE A CB    1 
ATOM 1727 C CG    . PHE A 1 223 ? 57.945  46.131  82.010  1.00 68.30  ? 298 PHE A CG    1 
ATOM 1728 C CD1   . PHE A 1 223 ? 58.611  44.940  82.123  1.00 61.19  ? 298 PHE A CD1   1 
ATOM 1729 C CD2   . PHE A 1 223 ? 58.036  47.039  83.048  1.00 73.83  ? 298 PHE A CD2   1 
ATOM 1730 C CE1   . PHE A 1 223 ? 59.323  44.653  83.267  1.00 69.78  ? 298 PHE A CE1   1 
ATOM 1731 C CE2   . PHE A 1 223 ? 58.753  46.748  84.197  1.00 65.37  ? 298 PHE A CE2   1 
ATOM 1732 C CZ    . PHE A 1 223 ? 59.390  45.563  84.306  1.00 62.61  ? 298 PHE A CZ    1 
ATOM 1733 N N     . LYS A 1 224 ? 55.053  46.884  78.680  1.00 67.56  ? 299 LYS A N     1 
ATOM 1734 C CA    . LYS A 1 224 ? 54.192  47.726  77.856  1.00 55.69  ? 299 LYS A CA    1 
ATOM 1735 C C     . LYS A 1 224 ? 52.755  47.205  77.805  1.00 65.84  ? 299 LYS A C     1 
ATOM 1736 O O     . LYS A 1 224 ? 51.795  47.979  77.928  1.00 58.24  ? 299 LYS A O     1 
ATOM 1737 C CB    . LYS A 1 224 ? 54.775  47.816  76.442  1.00 46.63  ? 299 LYS A CB    1 
ATOM 1738 C CG    . LYS A 1 224 ? 55.925  48.803  76.240  1.00 57.68  ? 299 LYS A CG    1 
ATOM 1739 C CD    . LYS A 1 224 ? 55.803  49.635  74.908  1.00 53.37  ? 299 LYS A CD    1 
ATOM 1740 C CE    . LYS A 1 224 ? 56.748  50.895  74.879  1.00 77.06  ? 299 LYS A CE    1 
ATOM 1741 N NZ    . LYS A 1 224 ? 56.641  51.907  76.042  1.00 66.45  ? 299 LYS A NZ    1 
ATOM 1742 N N     . LYS A 1 225 ? 52.581  45.901  77.579  1.00 76.87  ? 300 LYS A N     1 
ATOM 1743 C CA    . LYS A 1 225 ? 51.234  45.345  77.572  1.00 74.00  ? 300 LYS A CA    1 
ATOM 1744 C C     . LYS A 1 225 ? 50.703  45.132  78.992  1.00 58.34  ? 300 LYS A C     1 
ATOM 1745 O O     . LYS A 1 225 ? 49.518  45.353  79.237  1.00 55.54  ? 300 LYS A O     1 
ATOM 1746 C CB    . LYS A 1 225 ? 51.214  44.059  76.749  1.00 64.18  ? 300 LYS A CB    1 
ATOM 1747 C CG    . LYS A 1 225 ? 49.877  43.371  76.692  1.00 61.03  ? 300 LYS A CG    1 
ATOM 1748 C CD    . LYS A 1 225 ? 49.912  42.140  75.787  1.00 75.12  ? 300 LYS A CD    1 
ATOM 1749 C CE    . LYS A 1 225 ? 49.169  40.967  76.435  1.00 104.46 ? 300 LYS A CE    1 
ATOM 1750 N NZ    . LYS A 1 225 ? 48.041  41.406  77.326  1.00 93.87  ? 300 LYS A NZ    1 
ATOM 1751 N N     . ALA A 1 226 ? 51.563  44.781  79.948  1.00 56.81  ? 301 ALA A N     1 
ATOM 1752 C CA    . ALA A 1 226 ? 51.140  44.686  81.347  1.00 68.56  ? 301 ALA A CA    1 
ATOM 1753 C C     . ALA A 1 226 ? 50.795  46.036  81.940  1.00 72.77  ? 301 ALA A C     1 
ATOM 1754 O O     . ALA A 1 226 ? 50.159  46.103  83.009  1.00 61.98  ? 301 ALA A O     1 
ATOM 1755 C CB    . ALA A 1 226 ? 52.239  44.069  82.194  1.00 72.16  ? 301 ALA A CB    1 
ATOM 1756 N N     . ASN A 1 227 ? 51.223  47.096  81.259  1.00 69.16  ? 302 ASN A N     1 
ATOM 1757 C CA    . ASN A 1 227 ? 50.964  48.462  81.654  1.00 59.16  ? 302 ASN A CA    1 
ATOM 1758 C C     . ASN A 1 227 ? 51.696  48.785  82.953  1.00 57.17  ? 302 ASN A C     1 
ATOM 1759 O O     . ASN A 1 227 ? 51.140  49.358  83.884  1.00 61.18  ? 302 ASN A O     1 
ATOM 1760 C CB    . ASN A 1 227 ? 49.461  48.702  81.752  1.00 53.04  ? 302 ASN A CB    1 
ATOM 1761 C CG    . ASN A 1 227 ? 49.141  50.129  82.001  1.00 83.59  ? 302 ASN A CG    1 
ATOM 1762 O OD1   . ASN A 1 227 ? 50.010  51.009  81.899  1.00 80.26  ? 302 ASN A OD1   1 
ATOM 1763 N ND2   . ASN A 1 227 ? 47.893  50.389  82.359  1.00 103.32 ? 302 ASN A ND2   1 
ATOM 1764 N N     . LEU A 1 228 ? 52.962  48.389  83.005  1.00 68.16  ? 303 LEU A N     1 
ATOM 1765 C CA    . LEU A 1 228 ? 53.879  48.689  84.103  1.00 64.50  ? 303 LEU A CA    1 
ATOM 1766 C C     . LEU A 1 228 ? 54.624  49.972  83.749  1.00 57.70  ? 303 LEU A C     1 
ATOM 1767 O O     . LEU A 1 228 ? 54.079  50.829  83.054  1.00 76.47  ? 303 LEU A O     1 
ATOM 1768 C CB    . LEU A 1 228 ? 54.784  47.486  84.392  1.00 76.67  ? 303 LEU A CB    1 
ATOM 1769 C CG    . LEU A 1 228 ? 54.219  46.163  85.002  1.00 80.36  ? 303 LEU A CG    1 
ATOM 1770 C CD1   . LEU A 1 228 ? 52.663  45.959  85.014  1.00 45.44  ? 303 LEU A CD1   1 
ATOM 1771 C CD2   . LEU A 1 228 ? 54.878  44.984  84.303  1.00 68.19  ? 303 LEU A CD2   1 
ATOM 1772 N N     . GLN A 1 229 ? 55.786  50.197  84.326  1.00 50.83  ? 304 GLN A N     1 
ATOM 1773 C CA    . GLN A 1 229 ? 56.649  51.319  83.931  1.00 67.64  ? 304 GLN A CA    1 
ATOM 1774 C C     . GLN A 1 229 ? 56.217  52.596  84.580  1.00 64.79  ? 304 GLN A C     1 
ATOM 1775 O O     . GLN A 1 229 ? 57.029  53.521  84.721  1.00 59.25  ? 304 GLN A O     1 
ATOM 1776 C CB    . GLN A 1 229 ? 56.659  51.611  82.413  1.00 45.09  ? 304 GLN A CB    1 
ATOM 1777 C CG    . GLN A 1 229 ? 57.549  50.704  81.606  1.00 65.84  ? 304 GLN A CG    1 
ATOM 1778 C CD    . GLN A 1 229 ? 57.488  50.973  80.130  1.00 65.52  ? 304 GLN A CD    1 
ATOM 1779 O OE1   . GLN A 1 229 ? 58.518  50.950  79.430  1.00 41.58  ? 304 GLN A OE1   1 
ATOM 1780 N NE2   . GLN A 1 229 ? 56.277  51.220  79.633  1.00 54.96  ? 304 GLN A NE2   1 
ATOM 1781 N N     . HIS A 1 230 ? 54.957  52.636  85.016  1.00 73.76  ? 305 HIS A N     1 
ATOM 1782 C CA    . HIS A 1 230 ? 54.561  53.752  85.853  1.00 83.39  ? 305 HIS A CA    1 
ATOM 1783 C C     . HIS A 1 230 ? 55.313  53.696  87.161  1.00 81.28  ? 305 HIS A C     1 
ATOM 1784 O O     . HIS A 1 230 ? 55.355  54.690  87.896  1.00 98.00  ? 305 HIS A O     1 
ATOM 1785 C CB    . HIS A 1 230 ? 53.027  53.833  86.061  1.00 61.83  ? 305 HIS A CB    1 
ATOM 1786 C CG    . HIS A 1 230 ? 52.388  52.635  86.712  1.00 73.99  ? 305 HIS A CG    1 
ATOM 1787 N ND1   . HIS A 1 230 ? 51.818  51.602  85.990  1.00 90.87  ? 305 HIS A ND1   1 
ATOM 1788 C CD2   . HIS A 1 230 ? 52.148  52.348  88.012  1.00 75.06  ? 305 HIS A CD2   1 
ATOM 1789 C CE1   . HIS A 1 230 ? 51.293  50.712  86.817  1.00 68.28  ? 305 HIS A CE1   1 
ATOM 1790 N NE2   . HIS A 1 230 ? 51.477  51.143  88.050  1.00 79.02  ? 305 HIS A NE2   1 
ATOM 1791 N N     . ARG A 1 231 ? 55.967  52.584  87.435  1.00 62.79  ? 306 ARG A N     1 
ATOM 1792 C CA    . ARG A 1 231 ? 56.983  52.573  88.463  1.00 85.46  ? 306 ARG A CA    1 
ATOM 1793 C C     . ARG A 1 231 ? 58.269  52.268  87.744  1.00 73.29  ? 306 ARG A C     1 
ATOM 1794 O O     . ARG A 1 231 ? 58.572  51.091  87.569  1.00 80.29  ? 306 ARG A O     1 
ATOM 1795 C CB    . ARG A 1 231 ? 56.646  51.509  89.386  1.00 88.77  ? 306 ARG A CB    1 
ATOM 1796 C CG    . ARG A 1 231 ? 55.839  50.502  88.610  1.00 67.62  ? 306 ARG A CG    1 
ATOM 1797 C CD    . ARG A 1 231 ? 56.171  49.128  88.995  1.00 75.61  ? 306 ARG A CD    1 
ATOM 1798 N NE    . ARG A 1 231 ? 54.921  48.437  89.219  1.00 101.42 ? 306 ARG A NE    1 
ATOM 1799 C CZ    . ARG A 1 231 ? 54.549  47.910  90.375  1.00 106.28 ? 306 ARG A CZ    1 
ATOM 1800 N NH1   . ARG A 1 231 ? 55.366  47.951  91.428  1.00 92.84  ? 306 ARG A NH1   1 
ATOM 1801 N NH2   . ARG A 1 231 ? 53.363  47.318  90.459  1.00 115.27 ? 306 ARG A NH2   1 
ATOM 1802 N N     . LEU A 1 232 ? 59.026  53.281  87.346  1.00 57.15  ? 307 LEU A N     1 
ATOM 1803 C CA    . LEU A 1 232 ? 60.323  52.927  86.798  1.00 67.10  ? 307 LEU A CA    1 
ATOM 1804 C C     . LEU A 1 232 ? 61.391  53.991  87.029  1.00 69.91  ? 307 LEU A C     1 
ATOM 1805 O O     . LEU A 1 232 ? 62.467  53.687  87.548  1.00 96.37  ? 307 LEU A O     1 
ATOM 1806 C CB    . LEU A 1 232 ? 60.183  52.500  85.338  1.00 65.68  ? 307 LEU A CB    1 
ATOM 1807 C CG    . LEU A 1 232 ? 60.063  50.951  85.224  1.00 59.77  ? 307 LEU A CG    1 
ATOM 1808 C CD1   . LEU A 1 232 ? 60.097  50.399  83.832  1.00 71.10  ? 307 LEU A CD1   1 
ATOM 1809 C CD2   . LEU A 1 232 ? 61.090  50.206  86.075  1.00 78.01  ? 307 LEU A CD2   1 
ATOM 1810 N N     . ARG A 1 233 ? 61.126  55.214  86.588  1.00 56.77  ? 308 ARG A N     1 
ATOM 1811 C CA    . ARG A 1 233 ? 61.994  56.394  86.519  1.00 82.18  ? 308 ARG A CA    1 
ATOM 1812 C C     . ARG A 1 233 ? 62.732  56.432  85.198  1.00 79.42  ? 308 ARG A C     1 
ATOM 1813 O O     . ARG A 1 233 ? 63.247  57.485  84.824  1.00 92.66  ? 308 ARG A O     1 
ATOM 1814 C CB    . ARG A 1 233 ? 63.015  56.503  87.678  1.00 100.28 ? 308 ARG A CB    1 
ATOM 1815 C CG    . ARG A 1 233 ? 63.656  57.923  87.929  1.00 105.87 ? 308 ARG A CG    1 
ATOM 1816 C CD    . ARG A 1 233 ? 64.785  57.888  88.987  1.00 100.78 ? 308 ARG A CD    1 
ATOM 1817 N NE    . ARG A 1 233 ? 64.426  57.045  90.134  1.00 123.94 ? 308 ARG A NE    1 
ATOM 1818 C CZ    . ARG A 1 233 ? 64.872  55.802  90.335  1.00 116.77 ? 308 ARG A CZ    1 
ATOM 1819 N NH1   . ARG A 1 233 ? 65.713  55.265  89.466  1.00 126.93 ? 308 ARG A NH1   1 
ATOM 1820 N NH2   . ARG A 1 233 ? 64.483  55.093  91.400  1.00 99.78  ? 308 ARG A NH2   1 
ATOM 1821 N N     . SER A 1 234 ? 62.738  55.347  84.449  1.00 67.36  ? 309 SER A N     1 
ATOM 1822 C CA    . SER A 1 234 ? 62.932  55.416  83.014  1.00 67.13  ? 309 SER A CA    1 
ATOM 1823 C C     . SER A 1 234 ? 61.869  54.518  82.418  1.00 63.88  ? 309 SER A C     1 
ATOM 1824 O O     . SER A 1 234 ? 61.462  53.548  83.046  1.00 65.57  ? 309 SER A O     1 
ATOM 1825 C CB    . SER A 1 234 ? 64.339  54.981  82.596  1.00 68.12  ? 309 SER A CB    1 
ATOM 1826 O OG    . SER A 1 234 ? 64.979  56.014  81.871  1.00 80.82  ? 309 SER A OG    1 
ATOM 1827 N N     . SER A 1 235 ? 61.361  54.862  81.252  1.00 48.13  ? 310 SER A N     1 
ATOM 1828 C CA    . SER A 1 235 ? 60.463  53.935  80.585  1.00 54.41  ? 310 SER A CA    1 
ATOM 1829 C C     . SER A 1 235 ? 61.295  52.978  79.741  1.00 63.67  ? 310 SER A C     1 
ATOM 1830 O O     . SER A 1 235 ? 62.261  53.402  79.092  1.00 55.50  ? 310 SER A O     1 
ATOM 1831 C CB    . SER A 1 235 ? 59.463  54.664  79.695  1.00 46.48  ? 310 SER A CB    1 
ATOM 1832 O OG    . SER A 1 235 ? 60.037  55.008  78.447  1.00 39.50  ? 310 SER A OG    1 
ATOM 1833 N N     . LEU A 1 236 ? 60.925  51.689  79.737  1.00 42.48  ? 311 LEU A N     1 
ATOM 1834 C CA    . LEU A 1 236 ? 61.647  50.767  78.872  1.00 50.18  ? 311 LEU A CA    1 
ATOM 1835 C C     . LEU A 1 236 ? 61.419  51.113  77.409  1.00 44.37  ? 311 LEU A C     1 
ATOM 1836 O O     . LEU A 1 236 ? 60.278  51.234  76.957  1.00 54.25  ? 311 LEU A O     1 
ATOM 1837 C CB    . LEU A 1 236 ? 61.212  49.332  79.131  1.00 69.75  ? 311 LEU A CB    1 
ATOM 1838 C CG    . LEU A 1 236 ? 61.973  48.421  80.081  1.00 58.56  ? 311 LEU A CG    1 
ATOM 1839 C CD1   . LEU A 1 236 ? 62.315  49.154  81.373  1.00 63.71  ? 311 LEU A CD1   1 
ATOM 1840 C CD2   . LEU A 1 236 ? 61.087  47.237  80.344  1.00 50.99  ? 311 LEU A CD2   1 
ATOM 1841 N N     . LYS A 1 237 ? 62.504  51.256  76.666  1.00 44.22  ? 312 LYS A N     1 
ATOM 1842 C CA    . LYS A 1 237 ? 62.432  51.573  75.247  1.00 59.31  ? 312 LYS A CA    1 
ATOM 1843 C C     . LYS A 1 237 ? 62.459  50.297  74.396  1.00 50.84  ? 312 LYS A C     1 
ATOM 1844 O O     . LYS A 1 237 ? 63.450  49.568  74.390  1.00 55.49  ? 312 LYS A O     1 
ATOM 1845 C CB    . LYS A 1 237 ? 63.573  52.518  74.870  1.00 35.57  ? 312 LYS A CB    1 
ATOM 1846 C CG    . LYS A 1 237 ? 63.735  53.578  75.861  1.00 49.02  ? 312 LYS A CG    1 
ATOM 1847 C CD    . LYS A 1 237 ? 62.851  54.823  75.603  1.00 74.07  ? 312 LYS A CD    1 
ATOM 1848 C CE    . LYS A 1 237 ? 63.182  56.009  76.563  1.00 43.16  ? 312 LYS A CE    1 
ATOM 1849 N NZ    . LYS A 1 237 ? 62.741  55.598  77.904  1.00 38.77  ? 312 LYS A NZ    1 
ATOM 1850 N N     . SER A 1 238 ? 61.373  50.065  73.662  1.00 34.95  ? 313 SER A N     1 
ATOM 1851 C CA    . SER A 1 238 ? 61.281  49.048  72.624  1.00 46.44  ? 313 SER A CA    1 
ATOM 1852 C C     . SER A 1 238 ? 62.310  49.226  71.517  1.00 60.71  ? 313 SER A C     1 
ATOM 1853 O O     . SER A 1 238 ? 62.507  50.335  71.012  1.00 66.03  ? 313 SER A O     1 
ATOM 1854 C CB    . SER A 1 238 ? 59.873  49.073  72.019  1.00 48.25  ? 313 SER A CB    1 
ATOM 1855 O OG    . SER A 1 238 ? 59.786  48.339  70.803  1.00 70.15  ? 313 SER A OG    1 
ATOM 1856 N N     . GLU A 1 239 ? 62.836  48.079  71.081  1.00 72.41  ? 314 GLU A N     1 
ATOM 1857 C CA    . GLU A 1 239 ? 63.656  48.011  69.899  1.00 71.47  ? 314 GLU A CA    1 
ATOM 1858 C C     . GLU A 1 239 ? 62.688  48.106  68.733  1.00 84.21  ? 314 GLU A C     1 
ATOM 1859 O O     . GLU A 1 239 ? 61.692  47.387  68.685  1.00 89.13  ? 314 GLU A O     1 
ATOM 1860 C CB    . GLU A 1 239 ? 64.389  46.661  69.696  1.00 80.10  ? 314 GLU A CB    1 
ATOM 1861 C CG    . GLU A 1 239 ? 64.101  46.014  68.342  1.00 85.51  ? 314 GLU A CG    1 
ATOM 1862 C CD    . GLU A 1 239 ? 65.111  44.963  67.936  1.00 95.00  ? 314 GLU A CD    1 
ATOM 1863 O OE1   . GLU A 1 239 ? 65.003  43.806  68.405  1.00 96.29  ? 314 GLU A OE1   1 
ATOM 1864 O OE2   . GLU A 1 239 ? 66.000  45.299  67.137  1.00 91.95  ? 314 GLU A OE2   1 
ATOM 1865 N N     . CYS A 1 240 ? 62.973  48.951  67.817  1.00 82.40  ? 315 CYS A N     1 
ATOM 1866 C CA    . CYS A 1 240 ? 62.092  48.972  66.685  1.00 84.20  ? 315 CYS A CA    1 
ATOM 1867 C C     . CYS A 1 240 ? 62.801  48.185  65.615  1.00 89.90  ? 315 CYS A C     1 
ATOM 1868 O O     . CYS A 1 240 ? 64.018  48.341  65.455  1.00 94.58  ? 315 CYS A O     1 
ATOM 1869 C CB    . CYS A 1 240 ? 61.821  50.387  66.187  1.00 82.67  ? 315 CYS A CB    1 
ATOM 1870 S SG    . CYS A 1 240 ? 60.881  50.463  64.630  1.00 131.93 ? 315 CYS A SG    1 
ATOM 1871 N N     . PRO A 1 241 ? 62.112  47.317  64.869  1.00 93.38  ? 316 PRO A N     1 
ATOM 1872 C CA    . PRO A 1 241 ? 62.846  46.440  63.932  1.00 103.63 ? 316 PRO A CA    1 
ATOM 1873 C C     . PRO A 1 241 ? 63.642  47.185  62.875  1.00 100.81 ? 316 PRO A C     1 
ATOM 1874 O O     . PRO A 1 241 ? 64.832  46.900  62.701  1.00 108.98 ? 316 PRO A O     1 
ATOM 1875 C CB    . PRO A 1 241 ? 61.738  45.568  63.314  1.00 98.34  ? 316 PRO A CB    1 
ATOM 1876 C CG    . PRO A 1 241 ? 60.448  46.212  63.675  1.00 103.67 ? 316 PRO A CG    1 
ATOM 1877 C CD    . PRO A 1 241 ? 60.683  46.975  64.949  1.00 111.28 ? 316 PRO A CD    1 
ATOM 1878 N N     . THR A 1 242 ? 63.048  48.150  62.178  1.00 104.83 ? 317 THR A N     1 
ATOM 1879 C CA    . THR A 1 242 ? 63.814  48.949  61.222  1.00 106.33 ? 317 THR A CA    1 
ATOM 1880 C C     . THR A 1 242 ? 64.100  50.284  61.880  1.00 105.71 ? 317 THR A C     1 
ATOM 1881 O O     . THR A 1 242 ? 63.333  51.240  61.743  1.00 97.89  ? 317 THR A O     1 
ATOM 1882 C CB    . THR A 1 242 ? 63.056  49.183  59.917  1.00 113.46 ? 317 THR A CB    1 
ATOM 1883 O OG1   . THR A 1 242 ? 61.660  49.350  60.194  1.00 105.31 ? 317 THR A OG1   1 
ATOM 1884 C CG2   . THR A 1 242 ? 63.278  48.059  58.897  1.00 133.69 ? 317 THR A CG2   1 
ATOM 1885 N N     . ARG A 1 243 ? 65.261  50.354  62.501  1.00 103.61 ? 318 ARG A N     1 
ATOM 1886 C CA    . ARG A 1 243 ? 65.952  51.575  62.858  1.00 109.72 ? 318 ARG A CA    1 
ATOM 1887 C C     . ARG A 1 243 ? 67.158  51.105  63.648  1.00 110.15 ? 318 ARG A C     1 
ATOM 1888 O O     . ARG A 1 243 ? 67.091  50.042  64.275  1.00 104.73 ? 318 ARG A O     1 
ATOM 1889 C CB    . ARG A 1 243 ? 65.070  52.557  63.631  1.00 106.55 ? 318 ARG A CB    1 
ATOM 1890 C CG    . ARG A 1 243 ? 65.067  53.939  62.956  1.00 126.69 ? 318 ARG A CG    1 
ATOM 1891 C CD    . ARG A 1 243 ? 66.512  54.364  62.638  1.00 109.01 ? 318 ARG A CD    1 
ATOM 1892 N NE    . ARG A 1 243 ? 66.686  55.575  61.830  1.00 129.61 ? 318 ARG A NE    1 
ATOM 1893 C CZ    . ARG A 1 243 ? 66.668  55.598  60.498  1.00 120.83 ? 318 ARG A CZ    1 
ATOM 1894 N NH1   . ARG A 1 243 ? 66.439  54.473  59.824  1.00 119.69 ? 318 ARG A NH1   1 
ATOM 1895 N NH2   . ARG A 1 243 ? 66.865  56.743  59.840  1.00 104.67 ? 318 ARG A NH2   1 
ATOM 1896 N N     . TRP A 1 244 ? 68.212  51.924  63.711  1.00 120.81 ? 319 TRP A N     1 
ATOM 1897 C CA    . TRP A 1 244 ? 69.560  51.369  63.767  1.00 111.51 ? 319 TRP A CA    1 
ATOM 1898 C C     . TRP A 1 244 ? 69.784  50.829  65.156  1.00 100.96 ? 319 TRP A C     1 
ATOM 1899 O O     . TRP A 1 244 ? 69.980  51.600  66.113  1.00 77.72  ? 319 TRP A O     1 
ATOM 1900 C CB    . TRP A 1 244 ? 70.616  52.432  63.461  1.00 117.59 ? 319 TRP A CB    1 
ATOM 1901 C CG    . TRP A 1 244 ? 70.422  53.292  62.230  1.00 102.18 ? 319 TRP A CG    1 
ATOM 1902 C CD1   . TRP A 1 244 ? 70.668  54.635  62.124  1.00 94.02  ? 319 TRP A CD1   1 
ATOM 1903 C CD2   . TRP A 1 244 ? 69.982  52.858  60.930  1.00 107.84 ? 319 TRP A CD2   1 
ATOM 1904 N NE1   . TRP A 1 244 ? 70.400  55.064  60.845  1.00 98.88  ? 319 TRP A NE1   1 
ATOM 1905 C CE2   . TRP A 1 244 ? 69.977  53.996  60.093  1.00 99.27  ? 319 TRP A CE2   1 
ATOM 1906 C CE3   . TRP A 1 244 ? 69.581  51.616  60.395  1.00 105.06 ? 319 TRP A CE3   1 
ATOM 1907 C CZ2   . TRP A 1 244 ? 69.590  53.931  58.743  1.00 101.19 ? 319 TRP A CZ2   1 
ATOM 1908 C CZ3   . TRP A 1 244 ? 69.189  51.557  59.064  1.00 97.62  ? 319 TRP A CZ3   1 
ATOM 1909 C CH2   . TRP A 1 244 ? 69.199  52.711  58.250  1.00 82.62  ? 319 TRP A CH2   1 
ATOM 1910 N N     . ASN A 1 245 ? 69.730  49.499  65.233  1.00 101.87 ? 320 ASN A N     1 
ATOM 1911 C CA    . ASN A 1 245 ? 69.850  48.732  66.459  1.00 100.65 ? 320 ASN A CA    1 
ATOM 1912 C C     . ASN A 1 245 ? 69.439  49.694  67.594  1.00 96.35  ? 320 ASN A C     1 
ATOM 1913 O O     . ASN A 1 245 ? 70.179  49.943  68.553  1.00 98.63  ? 320 ASN A O     1 
ATOM 1914 C CB    . ASN A 1 245 ? 71.240  48.035  66.557  1.00 106.50 ? 320 ASN A CB    1 
ATOM 1915 C CG    . ASN A 1 245 ? 71.432  46.837  65.492  1.00 97.03  ? 320 ASN A CG    1 
ATOM 1916 O OD1   . ASN A 1 245 ? 71.094  45.646  65.732  1.00 71.41  ? 320 ASN A OD1   1 
ATOM 1917 N ND2   . ASN A 1 245 ? 71.984  47.186  64.334  1.00 73.49  ? 320 ASN A ND2   1 
ATOM 1918 N N     . SER A 1 246 ? 68.208  50.211  67.492  1.00 88.54  ? 321 SER A N     1 
ATOM 1919 C CA    . SER A 1 246 ? 67.495  50.759  68.625  1.00 78.02  ? 321 SER A CA    1 
ATOM 1920 C C     . SER A 1 246 ? 67.503  49.734  69.744  1.00 71.71  ? 321 SER A C     1 
ATOM 1921 O O     . SER A 1 246 ? 66.959  49.960  70.832  1.00 74.91  ? 321 SER A O     1 
ATOM 1922 C CB    . SER A 1 246 ? 66.066  51.074  68.180  1.00 87.47  ? 321 SER A CB    1 
ATOM 1923 O OG    . SER A 1 246 ? 65.334  49.900  67.834  1.00 45.64  ? 321 SER A OG    1 
ATOM 1924 N N     . THR A 1 247 ? 67.997  48.551  69.399  1.00 75.69  ? 322 THR A N     1 
ATOM 1925 C CA    . THR A 1 247 ? 68.633  47.606  70.284  1.00 71.48  ? 322 THR A CA    1 
ATOM 1926 C C     . THR A 1 247 ? 69.551  48.273  71.279  1.00 71.02  ? 322 THR A C     1 
ATOM 1927 O O     . THR A 1 247 ? 69.428  48.036  72.488  1.00 56.41  ? 322 THR A O     1 
ATOM 1928 C CB    . THR A 1 247 ? 69.428  46.696  69.390  1.00 50.86  ? 322 THR A CB    1 
ATOM 1929 O OG1   . THR A 1 247 ? 68.600  46.340  68.269  1.00 62.49  ? 322 THR A OG1   1 
ATOM 1930 C CG2   . THR A 1 247 ? 69.846  45.501  70.168  1.00 58.52  ? 322 THR A CG2   1 
ATOM 1931 N N     . TYR A 1 248 ? 70.452  49.141  70.789  1.00 63.50  ? 323 TYR A N     1 
ATOM 1932 C CA    . TYR A 1 248 ? 71.277  49.919  71.696  1.00 55.76  ? 323 TYR A CA    1 
ATOM 1933 C C     . TYR A 1 248 ? 70.397  50.744  72.623  1.00 60.85  ? 323 TYR A C     1 
ATOM 1934 O O     . TYR A 1 248 ? 70.546  50.682  73.847  1.00 59.15  ? 323 TYR A O     1 
ATOM 1935 C CB    . TYR A 1 248 ? 72.251  50.803  70.926  1.00 55.90  ? 323 TYR A CB    1 
ATOM 1936 C CG    . TYR A 1 248 ? 72.964  51.780  71.846  1.00 66.78  ? 323 TYR A CG    1 
ATOM 1937 C CD1   . TYR A 1 248 ? 73.311  51.413  73.138  1.00 81.66  ? 323 TYR A CD1   1 
ATOM 1938 C CD2   . TYR A 1 248 ? 73.274  53.056  71.443  1.00 67.10  ? 323 TYR A CD2   1 
ATOM 1939 C CE1   . TYR A 1 248 ? 73.926  52.288  74.006  1.00 78.85  ? 323 TYR A CE1   1 
ATOM 1940 C CE2   . TYR A 1 248 ? 73.897  53.933  72.297  1.00 76.11  ? 323 TYR A CE2   1 
ATOM 1941 C CZ    . TYR A 1 248 ? 74.223  53.539  73.578  1.00 84.86  ? 323 TYR A CZ    1 
ATOM 1942 O OH    . TYR A 1 248 ? 74.850  54.399  74.449  1.00 114.18 ? 323 TYR A OH    1 
ATOM 1943 N N     . THR A 1 249 ? 69.437  51.479  72.060  1.00 58.99  ? 324 THR A N     1 
ATOM 1944 C CA    . THR A 1 249 ? 68.479  52.194  72.896  1.00 52.57  ? 324 THR A CA    1 
ATOM 1945 C C     . THR A 1 249 ? 67.827  51.255  73.900  1.00 56.17  ? 324 THR A C     1 
ATOM 1946 O O     . THR A 1 249 ? 67.780  51.543  75.097  1.00 61.62  ? 324 THR A O     1 
ATOM 1947 C CB    . THR A 1 249 ? 67.391  52.860  72.049  1.00 61.64  ? 324 THR A CB    1 
ATOM 1948 O OG1   . THR A 1 249 ? 67.961  53.827  71.170  1.00 67.20  ? 324 THR A OG1   1 
ATOM 1949 C CG2   . THR A 1 249 ? 66.394  53.568  72.943  1.00 65.04  ? 324 THR A CG2   1 
ATOM 1950 N N     . MET A 1 250 ? 67.294  50.131  73.429  1.00 62.18  ? 325 MET A N     1 
ATOM 1951 C CA    . MET A 1 250 ? 66.603  49.241  74.345  1.00 57.69  ? 325 MET A CA    1 
ATOM 1952 C C     . MET A 1 250 ? 67.533  48.752  75.442  1.00 65.49  ? 325 MET A C     1 
ATOM 1953 O O     . MET A 1 250 ? 67.228  48.873  76.634  1.00 60.38  ? 325 MET A O     1 
ATOM 1954 C CB    . MET A 1 250 ? 66.035  48.054  73.606  1.00 63.79  ? 325 MET A CB    1 
ATOM 1955 C CG    . MET A 1 250 ? 65.477  47.092  74.603  1.00 58.15  ? 325 MET A CG    1 
ATOM 1956 S SD    . MET A 1 250 ? 65.243  45.552  73.806  1.00 74.61  ? 325 MET A SD    1 
ATOM 1957 C CE    . MET A 1 250 ? 66.904  45.134  73.402  1.00 65.69  ? 325 MET A CE    1 
ATOM 1958 N N     . LEU A 1 251 ? 68.676  48.187  75.056  1.00 61.55  ? 326 LEU A N     1 
ATOM 1959 C CA    . LEU A 1 251 ? 69.588  47.671  76.055  1.00 55.06  ? 326 LEU A CA    1 
ATOM 1960 C C     . LEU A 1 251 ? 69.818  48.711  77.122  1.00 55.92  ? 326 LEU A C     1 
ATOM 1961 O O     . LEU A 1 251 ? 69.498  48.492  78.286  1.00 61.41  ? 326 LEU A O     1 
ATOM 1962 C CB    . LEU A 1 251 ? 70.895  47.251  75.401  1.00 58.60  ? 326 LEU A CB    1 
ATOM 1963 C CG    . LEU A 1 251 ? 70.624  46.026  74.533  1.00 52.39  ? 326 LEU A CG    1 
ATOM 1964 C CD1   . LEU A 1 251 ? 71.860  45.424  73.946  1.00 40.15  ? 326 LEU A CD1   1 
ATOM 1965 C CD2   . LEU A 1 251 ? 69.853  45.000  75.331  1.00 52.59  ? 326 LEU A CD2   1 
ATOM 1966 N N     . ARG A 1 252 ? 70.250  49.899  76.714  1.00 57.75  ? 327 ARG A N     1 
ATOM 1967 C CA    . ARG A 1 252 ? 70.451  50.988  77.665  1.00 59.65  ? 327 ARG A CA    1 
ATOM 1968 C C     . ARG A 1 252 ? 69.255  51.214  78.563  1.00 57.14  ? 327 ARG A C     1 
ATOM 1969 O O     . ARG A 1 252 ? 69.428  51.598  79.714  1.00 62.39  ? 327 ARG A O     1 
ATOM 1970 C CB    . ARG A 1 252 ? 70.747  52.288  76.934  1.00 61.90  ? 327 ARG A CB    1 
ATOM 1971 C CG    . ARG A 1 252 ? 71.271  53.365  77.803  1.00 66.19  ? 327 ARG A CG    1 
ATOM 1972 C CD    . ARG A 1 252 ? 72.729  53.116  78.234  1.00 82.65  ? 327 ARG A CD    1 
ATOM 1973 N NE    . ARG A 1 252 ? 72.896  53.584  79.607  1.00 89.39  ? 327 ARG A NE    1 
ATOM 1974 C CZ    . ARG A 1 252 ? 72.877  54.874  79.954  1.00 109.85 ? 327 ARG A CZ    1 
ATOM 1975 N NH1   . ARG A 1 252 ? 72.731  55.816  79.025  1.00 117.24 ? 327 ARG A NH1   1 
ATOM 1976 N NH2   . ARG A 1 252 ? 73.008  55.242  81.225  1.00 95.19  ? 327 ARG A NH2   1 
ATOM 1977 N N     . SER A 1 253 ? 68.040  51.010  78.053  1.00 63.92  ? 328 SER A N     1 
ATOM 1978 C CA    . SER A 1 253 ? 66.825  51.335  78.803  1.00 63.97  ? 328 SER A CA    1 
ATOM 1979 C C     . SER A 1 253 ? 66.486  50.256  79.808  1.00 59.23  ? 328 SER A C     1 
ATOM 1980 O O     . SER A 1 253 ? 66.156  50.536  80.962  1.00 59.58  ? 328 SER A O     1 
ATOM 1981 C CB    . SER A 1 253 ? 65.660  51.517  77.849  1.00 53.14  ? 328 SER A CB    1 
ATOM 1982 O OG    . SER A 1 253 ? 65.546  50.372  77.044  1.00 55.90  ? 328 SER A OG    1 
ATOM 1983 N N     . ILE A 1 254 ? 66.517  49.010  79.361  1.00 69.80  ? 329 ILE A N     1 
ATOM 1984 C CA    . ILE A 1 254 ? 66.579  47.889  80.294  1.00 81.81  ? 329 ILE A CA    1 
ATOM 1985 C C     . ILE A 1 254 ? 67.758  48.041  81.251  1.00 84.33  ? 329 ILE A C     1 
ATOM 1986 O O     . ILE A 1 254 ? 67.695  47.619  82.420  1.00 72.52  ? 329 ILE A O     1 
ATOM 1987 C CB    . ILE A 1 254 ? 66.684  46.564  79.512  1.00 56.10  ? 329 ILE A CB    1 
ATOM 1988 C CG1   . ILE A 1 254 ? 65.318  46.118  79.014  1.00 81.80  ? 329 ILE A CG1   1 
ATOM 1989 C CG2   . ILE A 1 254 ? 67.288  45.518  80.371  1.00 53.59  ? 329 ILE A CG2   1 
ATOM 1990 C CD1   . ILE A 1 254 ? 65.320  45.595  77.570  1.00 91.76  ? 329 ILE A CD1   1 
ATOM 1991 N N     . LEU A 1 255 ? 68.863  48.610  80.766  1.00 67.80  ? 330 LEU A N     1 
ATOM 1992 C CA    . LEU A 1 255 ? 70.062  48.596  81.572  1.00 58.11  ? 330 LEU A CA    1 
ATOM 1993 C C     . LEU A 1 255 ? 69.889  49.490  82.784  1.00 64.89  ? 330 LEU A C     1 
ATOM 1994 O O     . LEU A 1 255 ? 70.504  49.250  83.824  1.00 71.77  ? 330 LEU A O     1 
ATOM 1995 C CB    . LEU A 1 255 ? 71.253  49.010  80.712  1.00 69.91  ? 330 LEU A CB    1 
ATOM 1996 C CG    . LEU A 1 255 ? 72.649  48.925  81.298  1.00 68.04  ? 330 LEU A CG    1 
ATOM 1997 C CD1   . LEU A 1 255 ? 72.775  47.632  82.063  1.00 54.44  ? 330 LEU A CD1   1 
ATOM 1998 C CD2   . LEU A 1 255 ? 73.667  49.003  80.183  1.00 64.65  ? 330 LEU A CD2   1 
ATOM 1999 N N     . ASP A 1 256 ? 69.058  50.519  82.678  1.00 65.79  ? 331 ASP A N     1 
ATOM 2000 C CA    . ASP A 1 256 ? 68.974  51.490  83.758  1.00 61.01  ? 331 ASP A CA    1 
ATOM 2001 C C     . ASP A 1 256 ? 68.002  51.085  84.861  1.00 61.02  ? 331 ASP A C     1 
ATOM 2002 O O     . ASP A 1 256 ? 68.236  51.420  86.020  1.00 80.35  ? 331 ASP A O     1 
ATOM 2003 C CB    . ASP A 1 256 ? 68.653  52.877  83.180  1.00 53.41  ? 331 ASP A CB    1 
ATOM 2004 C CG    . ASP A 1 256 ? 69.753  53.382  82.237  1.00 61.94  ? 331 ASP A CG    1 
ATOM 2005 O OD1   . ASP A 1 256 ? 69.446  54.122  81.273  1.00 65.68  ? 331 ASP A OD1   1 
ATOM 2006 O OD2   . ASP A 1 256 ? 70.932  53.014  82.447  1.00 68.79  ? 331 ASP A OD2   1 
ATOM 2007 N N     . ASN A 1 257 ? 66.918  50.384  84.546  1.00 77.91  ? 332 ASN A N     1 
ATOM 2008 C CA    . ASN A 1 257 ? 65.899  49.968  85.519  1.00 90.50  ? 332 ASN A CA    1 
ATOM 2009 C C     . ASN A 1 257 ? 66.134  48.545  86.065  1.00 86.21  ? 332 ASN A C     1 
ATOM 2010 O O     . ASN A 1 257 ? 65.214  47.948  86.640  1.00 82.32  ? 332 ASN A O     1 
ATOM 2011 C CB    . ASN A 1 257 ? 64.495  50.136  84.910  1.00 72.91  ? 332 ASN A CB    1 
ATOM 2012 C CG    . ASN A 1 257 ? 64.168  51.599  84.627  1.00 66.32  ? 332 ASN A CG    1 
ATOM 2013 O OD1   . ASN A 1 257 ? 63.472  52.243  85.393  1.00 81.66  ? 332 ASN A OD1   1 
ATOM 2014 N ND2   . ASN A 1 257 ? 64.711  52.133  83.546  1.00 61.31  ? 332 ASN A ND2   1 
ATOM 2015 N N     . TRP A 1 258 ? 67.338  48.001  85.846  1.00 84.89  ? 333 TRP A N     1 
ATOM 2016 C CA    . TRP A 1 258 ? 67.639  46.573  85.971  1.00 90.43  ? 333 TRP A CA    1 
ATOM 2017 C C     . TRP A 1 258 ? 67.162  45.971  87.287  1.00 87.15  ? 333 TRP A C     1 
ATOM 2018 O O     . TRP A 1 258 ? 66.486  44.935  87.308  1.00 81.67  ? 333 TRP A O     1 
ATOM 2019 C CB    . TRP A 1 258 ? 69.151  46.389  85.795  1.00 93.09  ? 333 TRP A CB    1 
ATOM 2020 C CG    . TRP A 1 258 ? 69.673  45.018  85.992  1.00 94.52  ? 333 TRP A CG    1 
ATOM 2021 C CD1   . TRP A 1 258 ? 70.295  44.547  87.097  1.00 110.81 ? 333 TRP A CD1   1 
ATOM 2022 C CD2   . TRP A 1 258 ? 69.647  43.934  85.053  1.00 90.99  ? 333 TRP A CD2   1 
ATOM 2023 N NE1   . TRP A 1 258 ? 70.653  43.235  86.916  1.00 115.31 ? 333 TRP A NE1   1 
ATOM 2024 C CE2   . TRP A 1 258 ? 70.260  42.836  85.668  1.00 94.90  ? 333 TRP A CE2   1 
ATOM 2025 C CE3   . TRP A 1 258 ? 69.153  43.785  83.759  1.00 83.05  ? 333 TRP A CE3   1 
ATOM 2026 C CZ2   . TRP A 1 258 ? 70.400  41.612  85.034  1.00 102.01 ? 333 TRP A CZ2   1 
ATOM 2027 C CZ3   . TRP A 1 258 ? 69.305  42.575  83.128  1.00 57.50  ? 333 TRP A CZ3   1 
ATOM 2028 C CH2   . TRP A 1 258 ? 69.916  41.506  83.763  1.00 92.34  ? 333 TRP A CH2   1 
ATOM 2029 N N     . GLU A 1 259 ? 67.515  46.592  88.401  1.00 85.82  ? 334 GLU A N     1 
ATOM 2030 C CA    . GLU A 1 259 ? 67.061  46.045  89.666  1.00 89.46  ? 334 GLU A CA    1 
ATOM 2031 C C     . GLU A 1 259 ? 65.553  46.173  89.779  1.00 91.92  ? 334 GLU A C     1 
ATOM 2032 O O     . GLU A 1 259 ? 64.864  45.208  90.126  1.00 97.59  ? 334 GLU A O     1 
ATOM 2033 C CB    . GLU A 1 259 ? 67.771  46.731  90.827  1.00 75.44  ? 334 GLU A CB    1 
ATOM 2034 C CG    . GLU A 1 259 ? 69.258  46.460  90.846  1.00 78.01  ? 334 GLU A CG    1 
ATOM 2035 C CD    . GLU A 1 259 ? 70.006  47.158  89.697  1.00 107.98 ? 334 GLU A CD    1 
ATOM 2036 O OE1   . GLU A 1 259 ? 69.424  48.058  89.026  1.00 101.39 ? 334 GLU A OE1   1 
ATOM 2037 O OE2   . GLU A 1 259 ? 71.181  46.798  89.462  1.00 107.77 ? 334 GLU A OE2   1 
ATOM 2038 N N     . SER A 1 260 ? 65.019  47.344  89.436  1.00 87.35  ? 335 SER A N     1 
ATOM 2039 C CA    . SER A 1 260 ? 63.572  47.523  89.483  1.00 99.52  ? 335 SER A CA    1 
ATOM 2040 C C     . SER A 1 260 ? 62.851  46.485  88.624  1.00 95.40  ? 335 SER A C     1 
ATOM 2041 O O     . SER A 1 260 ? 61.826  45.939  89.044  1.00 85.84  ? 335 SER A O     1 
ATOM 2042 C CB    . SER A 1 260 ? 63.205  48.948  89.060  1.00 106.06 ? 335 SER A CB    1 
ATOM 2043 O OG    . SER A 1 260 ? 63.815  49.907  89.916  1.00 102.68 ? 335 SER A OG    1 
ATOM 2044 N N     . VAL A 1 261 ? 63.384  46.174  87.435  1.00 99.67  ? 336 VAL A N     1 
ATOM 2045 C CA    . VAL A 1 261 ? 62.740  45.176  86.574  1.00 94.58  ? 336 VAL A CA    1 
ATOM 2046 C C     . VAL A 1 261 ? 62.724  43.828  87.259  1.00 89.20  ? 336 VAL A C     1 
ATOM 2047 O O     . VAL A 1 261 ? 61.658  43.260  87.523  1.00 89.35  ? 336 VAL A O     1 
ATOM 2048 C CB    . VAL A 1 261 ? 63.444  45.069  85.208  1.00 90.89  ? 336 VAL A CB    1 
ATOM 2049 C CG1   . VAL A 1 261 ? 63.164  43.704  84.563  1.00 81.27  ? 336 VAL A CG1   1 
ATOM 2050 C CG2   . VAL A 1 261 ? 62.974  46.155  84.280  1.00 82.98  ? 336 VAL A CG2   1 
ATOM 2051 N N     . ILE A 1 262 ? 63.920  43.310  87.569  1.00 106.84 ? 337 ILE A N     1 
ATOM 2052 C CA    . ILE A 1 262 ? 64.054  41.938  88.061  1.00 113.39 ? 337 ILE A CA    1 
ATOM 2053 C C     . ILE A 1 262 ? 63.109  41.713  89.226  1.00 99.82  ? 337 ILE A C     1 
ATOM 2054 O O     . ILE A 1 262 ? 62.333  40.754  89.254  1.00 84.77  ? 337 ILE A O     1 
ATOM 2055 C CB    . ILE A 1 262 ? 65.511  41.648  88.457  1.00 88.44  ? 337 ILE A CB    1 
ATOM 2056 C CG1   . ILE A 1 262 ? 66.430  41.862  87.251  1.00 96.11  ? 337 ILE A CG1   1 
ATOM 2057 C CG2   . ILE A 1 262 ? 65.602  40.246  88.979  1.00 118.45 ? 337 ILE A CG2   1 
ATOM 2058 C CD1   . ILE A 1 262 ? 67.392  40.728  86.965  1.00 99.61  ? 337 ILE A CD1   1 
ATOM 2059 N N     . GLN A 1 263 ? 63.146  42.628  90.183  1.00 99.48  ? 338 GLN A N     1 
ATOM 2060 C CA    . GLN A 1 263 ? 62.166  42.693  91.246  1.00 92.01  ? 338 GLN A CA    1 
ATOM 2061 C C     . GLN A 1 263 ? 60.746  42.611  90.702  1.00 107.96 ? 338 GLN A C     1 
ATOM 2062 O O     . GLN A 1 263 ? 60.052  41.623  90.965  1.00 113.24 ? 338 GLN A O     1 
ATOM 2063 C CB    . GLN A 1 263 ? 62.369  43.976  92.045  1.00 102.32 ? 338 GLN A CB    1 
ATOM 2064 C CG    . GLN A 1 263 ? 61.158  44.420  92.852  1.00 117.16 ? 338 GLN A CG    1 
ATOM 2065 C CD    . GLN A 1 263 ? 60.838  43.508  94.020  1.00 122.00 ? 338 GLN A CD    1 
ATOM 2066 O OE1   . GLN A 1 263 ? 60.735  42.288  93.871  1.00 136.34 ? 338 GLN A OE1   1 
ATOM 2067 N NE2   . GLN A 1 263 ? 60.674  44.101  95.199  1.00 118.95 ? 338 GLN A NE2   1 
ATOM 2068 N N     . ILE A 1 264 ? 60.310  43.624  89.933  1.00 116.64 ? 339 ILE A N     1 
ATOM 2069 C CA    . ILE A 1 264 ? 58.907  43.694  89.511  1.00 104.59 ? 339 ILE A CA    1 
ATOM 2070 C C     . ILE A 1 264 ? 58.527  42.441  88.731  1.00 107.54 ? 339 ILE A C     1 
ATOM 2071 O O     . ILE A 1 264 ? 57.430  41.892  88.899  1.00 101.13 ? 339 ILE A O     1 
ATOM 2072 C CB    . ILE A 1 264 ? 58.648  44.974  88.694  1.00 84.15  ? 339 ILE A CB    1 
ATOM 2073 C CG1   . ILE A 1 264 ? 58.959  46.221  89.506  1.00 91.95  ? 339 ILE A CG1   1 
ATOM 2074 C CG2   . ILE A 1 264 ? 57.203  45.073  88.293  1.00 91.64  ? 339 ILE A CG2   1 
ATOM 2075 C CD1   . ILE A 1 264 ? 59.095  47.461  88.636  1.00 96.81  ? 339 ILE A CD1   1 
ATOM 2076 N N     . LEU A 1 265 ? 59.447  41.948  87.900  1.00 103.35 ? 340 LEU A N     1 
ATOM 2077 C CA    . LEU A 1 265 ? 59.221  40.712  87.159  1.00 103.99 ? 340 LEU A CA    1 
ATOM 2078 C C     . LEU A 1 265 ? 59.077  39.515  88.095  1.00 117.40 ? 340 LEU A C     1 
ATOM 2079 O O     . LEU A 1 265 ? 58.149  38.703  87.960  1.00 114.76 ? 340 LEU A O     1 
ATOM 2080 C CB    . LEU A 1 265 ? 60.383  40.488  86.203  1.00 97.79  ? 340 LEU A CB    1 
ATOM 2081 C CG    . LEU A 1 265 ? 60.012  39.961  84.838  1.00 94.10  ? 340 LEU A CG    1 
ATOM 2082 C CD1   . LEU A 1 265 ? 58.663  39.282  84.870  1.00 90.91  ? 340 LEU A CD1   1 
ATOM 2083 C CD2   . LEU A 1 265 ? 60.028  41.120  83.895  1.00 75.56  ? 340 LEU A CD2   1 
ATOM 2084 N N     . SER A 1 266 ? 60.025  39.360  89.019  1.00 118.31 ? 341 SER A N     1 
ATOM 2085 C CA    . SER A 1 266 ? 59.933  38.265  89.970  1.00 106.36 ? 341 SER A CA    1 
ATOM 2086 C C     . SER A 1 266 ? 58.737  38.459  90.893  1.00 101.16 ? 341 SER A C     1 
ATOM 2087 O O     . SER A 1 266 ? 57.953  37.529  91.090  1.00 113.16 ? 341 SER A O     1 
ATOM 2088 C CB    . SER A 1 266 ? 61.252  38.129  90.751  1.00 121.42 ? 341 SER A CB    1 
ATOM 2089 O OG    . SER A 1 266 ? 62.319  37.603  89.948  1.00 113.04 ? 341 SER A OG    1 
ATOM 2090 N N     . GLU A 1 267 ? 58.536  39.677  91.407  1.00 102.86 ? 342 GLU A N     1 
ATOM 2091 C CA    . GLU A 1 267 ? 57.465  39.919  92.376  1.00 108.63 ? 342 GLU A CA    1 
ATOM 2092 C C     . GLU A 1 267 ? 56.070  39.769  91.780  1.00 117.49 ? 342 GLU A C     1 
ATOM 2093 O O     . GLU A 1 267 ? 55.101  39.623  92.532  1.00 122.91 ? 342 GLU A O     1 
ATOM 2094 C CB    . GLU A 1 267 ? 57.588  41.307  92.980  1.00 100.55 ? 342 GLU A CB    1 
ATOM 2095 C CG    . GLU A 1 267 ? 56.706  42.312  92.295  1.00 117.75 ? 342 GLU A CG    1 
ATOM 2096 C CD    . GLU A 1 267 ? 57.149  43.738  92.526  1.00 132.25 ? 342 GLU A CD    1 
ATOM 2097 O OE1   . GLU A 1 267 ? 57.957  43.963  93.458  1.00 120.96 ? 342 GLU A OE1   1 
ATOM 2098 O OE2   . GLU A 1 267 ? 56.695  44.631  91.768  1.00 132.03 ? 342 GLU A OE2   1 
ATOM 2099 N N     . ALA A 1 268 ? 55.935  39.840  90.462  1.00 121.03 ? 343 ALA A N     1 
ATOM 2100 C CA    . ALA A 1 268 ? 54.709  39.442  89.792  1.00 109.64 ? 343 ALA A CA    1 
ATOM 2101 C C     . ALA A 1 268 ? 54.764  37.991  89.366  1.00 107.50 ? 343 ALA A C     1 
ATOM 2102 O O     . ALA A 1 268 ? 53.937  37.564  88.555  1.00 120.74 ? 343 ALA A O     1 
ATOM 2103 C CB    . ALA A 1 268 ? 54.428  40.339  88.587  1.00 110.27 ? 343 ALA A CB    1 
ATOM 2104 N N     . GLY A 1 269 ? 55.786  37.260  89.813  1.00 96.01  ? 344 GLY A N     1 
ATOM 2105 C CA    . GLY A 1 269 ? 55.891  35.840  89.571  1.00 107.48 ? 344 GLY A CA    1 
ATOM 2106 C C     . GLY A 1 269 ? 56.244  35.490  88.159  1.00 100.59 ? 344 GLY A C     1 
ATOM 2107 O O     . GLY A 1 269 ? 56.546  34.329  87.862  1.00 110.27 ? 344 GLY A O     1 
ATOM 2108 N N     . GLU A 1 270 ? 56.293  36.462  87.299  1.00 110.28 ? 345 GLU A N     1 
ATOM 2109 C CA    . GLU A 1 270 ? 56.553  36.152  85.925  1.00 122.57 ? 345 GLU A CA    1 
ATOM 2110 C C     . GLU A 1 270 ? 58.021  35.907  85.694  1.00 127.24 ? 345 GLU A C     1 
ATOM 2111 O O     . GLU A 1 270 ? 58.438  35.757  84.543  1.00 134.07 ? 345 GLU A O     1 
ATOM 2112 C CB    . GLU A 1 270 ? 55.992  37.250  85.032  1.00 110.82 ? 345 GLU A CB    1 
ATOM 2113 C CG    . GLU A 1 270 ? 54.831  36.754  84.209  1.00 110.72 ? 345 GLU A CG    1 
ATOM 2114 C CD    . GLU A 1 270 ? 55.219  35.530  83.402  1.00 128.59 ? 345 GLU A CD    1 
ATOM 2115 O OE1   . GLU A 1 270 ? 55.159  34.399  83.949  1.00 142.91 ? 345 GLU A OE1   1 
ATOM 2116 O OE2   . GLU A 1 270 ? 55.609  35.706  82.227  1.00 113.78 ? 345 GLU A OE2   1 
ATOM 2117 N N     . THR A 1 271 ? 58.790  35.782  86.783  1.00 119.91 ? 346 THR A N     1 
ATOM 2118 C CA    . THR A 1 271 ? 60.246  35.721  86.764  1.00 128.80 ? 346 THR A CA    1 
ATOM 2119 C C     . THR A 1 271 ? 60.736  34.638  85.815  1.00 123.75 ? 346 THR A C     1 
ATOM 2120 O O     . THR A 1 271 ? 61.925  34.575  85.495  1.00 113.70 ? 346 THR A O     1 
ATOM 2121 C CB    . THR A 1 271 ? 60.778  35.462  88.173  1.00 127.02 ? 346 THR A CB    1 
ATOM 2122 O OG1   . THR A 1 271 ? 62.203  35.642  88.198  1.00 122.47 ? 346 THR A OG1   1 
ATOM 2123 C CG2   . THR A 1 271 ? 60.387  34.052  88.647  1.00 102.87 ? 346 THR A CG2   1 
ATOM 2124 N N     . GLN A 1 272 ? 59.817  33.800  85.339  1.00 113.74 ? 347 GLN A N     1 
ATOM 2125 C CA    . GLN A 1 272 ? 60.091  32.929  84.207  1.00 123.75 ? 347 GLN A CA    1 
ATOM 2126 C C     . GLN A 1 272 ? 60.506  33.687  82.947  1.00 121.47 ? 347 GLN A C     1 
ATOM 2127 O O     . GLN A 1 272 ? 60.865  33.045  81.949  1.00 106.07 ? 347 GLN A O     1 
ATOM 2128 C CB    . GLN A 1 272 ? 58.856  32.102  83.902  1.00 136.21 ? 347 GLN A CB    1 
ATOM 2129 C CG    . GLN A 1 272 ? 57.858  32.830  83.037  1.00 132.88 ? 347 GLN A CG    1 
ATOM 2130 C CD    . GLN A 1 272 ? 56.846  31.884  82.423  1.00 150.85 ? 347 GLN A CD    1 
ATOM 2131 O OE1   . GLN A 1 272 ? 55.812  31.588  83.034  1.00 162.77 ? 347 GLN A OE1   1 
ATOM 2132 N NE2   . GLN A 1 272 ? 57.146  31.385  81.211  1.00 115.86 ? 347 GLN A NE2   1 
ATOM 2133 N N     . ARG A 1 273 ? 60.380  35.021  82.935  1.00 132.93 ? 348 ARG A N     1 
ATOM 2134 C CA    . ARG A 1 273 ? 60.895  35.876  81.863  1.00 136.77 ? 348 ARG A CA    1 
ATOM 2135 C C     . ARG A 1 273 ? 62.280  36.469  82.138  1.00 131.61 ? 348 ARG A C     1 
ATOM 2136 O O     . ARG A 1 273 ? 62.900  36.989  81.204  1.00 125.10 ? 348 ARG A O     1 
ATOM 2137 C CB    . ARG A 1 273 ? 59.925  37.038  81.581  1.00 111.11 ? 348 ARG A CB    1 
ATOM 2138 C CG    . ARG A 1 273 ? 58.520  36.643  81.123  1.00 117.98 ? 348 ARG A CG    1 
ATOM 2139 C CD    . ARG A 1 273 ? 57.668  37.886  80.897  1.00 99.17  ? 348 ARG A CD    1 
ATOM 2140 N NE    . ARG A 1 273 ? 56.240  37.603  80.804  1.00 92.01  ? 348 ARG A NE    1 
ATOM 2141 C CZ    . ARG A 1 273 ? 55.528  37.666  79.681  1.00 100.61 ? 348 ARG A CZ    1 
ATOM 2142 N NH1   . ARG A 1 273 ? 56.102  38.006  78.519  1.00 84.97  ? 348 ARG A NH1   1 
ATOM 2143 N NH2   . ARG A 1 273 ? 54.230  37.387  79.732  1.00 103.95 ? 348 ARG A NH2   1 
ATOM 2144 N N     . ILE A 1 274 ? 62.803  36.349  83.365  1.00 132.59 ? 349 ILE A N     1 
ATOM 2145 C CA    . ILE A 1 274 ? 64.018  37.031  83.821  1.00 126.21 ? 349 ILE A CA    1 
ATOM 2146 C C     . ILE A 1 274 ? 65.205  36.168  83.398  1.00 135.06 ? 349 ILE A C     1 
ATOM 2147 O O     . ILE A 1 274 ? 66.335  36.346  83.873  1.00 143.78 ? 349 ILE A O     1 
ATOM 2148 C CB    . ILE A 1 274 ? 63.980  37.313  85.343  1.00 127.80 ? 349 ILE A CB    1 
ATOM 2149 C CG1   . ILE A 1 274 ? 64.927  38.457  85.717  1.00 119.07 ? 349 ILE A CG1   1 
ATOM 2150 C CG2   . ILE A 1 274 ? 64.367  36.091  86.155  1.00 136.68 ? 349 ILE A CG2   1 
ATOM 2151 C CD1   . ILE A 1 274 ? 64.646  39.759  85.029  1.00 94.74  ? 349 ILE A CD1   1 
ATOM 2152 N N     . VAL A 1 275 ? 64.932  35.247  82.466  1.00 136.85 ? 350 VAL A N     1 
ATOM 2153 C CA    . VAL A 1 275 ? 65.651  34.012  82.144  1.00 139.42 ? 350 VAL A CA    1 
ATOM 2154 C C     . VAL A 1 275 ? 67.181  34.109  82.148  1.00 141.15 ? 350 VAL A C     1 
ATOM 2155 O O     . VAL A 1 275 ? 67.842  33.514  83.012  1.00 128.19 ? 350 VAL A O     1 
ATOM 2156 C CB    . VAL A 1 275 ? 65.134  33.499  80.779  1.00 132.13 ? 350 VAL A CB    1 
ATOM 2157 C CG1   . VAL A 1 275 ? 63.719  32.981  80.937  1.00 125.61 ? 350 VAL A CG1   1 
ATOM 2158 C CG2   . VAL A 1 275 ? 65.128  34.607  79.697  1.00 105.04 ? 350 VAL A CG2   1 
ATOM 2159 N N     . HIS A 1 276 ? 67.760  34.829  81.185  1.00 136.64 ? 351 HIS A N     1 
ATOM 2160 C CA    . HIS A 1 276 ? 69.205  35.025  81.148  1.00 125.01 ? 351 HIS A CA    1 
ATOM 2161 C C     . HIS A 1 276 ? 69.576  36.178  82.077  1.00 126.42 ? 351 HIS A C     1 
ATOM 2162 O O     . HIS A 1 276 ? 69.131  37.314  81.885  1.00 121.76 ? 351 HIS A O     1 
ATOM 2163 C CB    . HIS A 1 276 ? 69.695  35.318  79.727  1.00 120.07 ? 351 HIS A CB    1 
ATOM 2164 C CG    . HIS A 1 276 ? 69.629  34.152  78.781  1.00 115.26 ? 351 HIS A CG    1 
ATOM 2165 N ND1   . HIS A 1 276 ? 68.565  33.942  77.928  1.00 108.47 ? 351 HIS A ND1   1 
ATOM 2166 C CD2   . HIS A 1 276 ? 70.522  33.167  78.513  1.00 133.48 ? 351 HIS A CD2   1 
ATOM 2167 C CE1   . HIS A 1 276 ? 68.794  32.866  77.196  1.00 118.57 ? 351 HIS A CE1   1 
ATOM 2168 N NE2   . HIS A 1 276 ? 69.975  32.374  77.532  1.00 131.93 ? 351 HIS A NE2   1 
ATOM 2169 N N     . ILE A 1 277 ? 70.379  35.874  83.089  1.00 141.78 ? 352 ILE A N     1 
ATOM 2170 C CA    . ILE A 1 277 ? 70.905  36.840  84.051  1.00 146.18 ? 352 ILE A CA    1 
ATOM 2171 C C     . ILE A 1 277 ? 72.165  37.492  83.478  1.00 121.26 ? 352 ILE A C     1 
ATOM 2172 O O     . ILE A 1 277 ? 72.313  37.627  82.253  1.00 88.84  ? 352 ILE A O     1 
ATOM 2173 C CB    . ILE A 1 277 ? 71.160  36.196  85.438  1.00 158.84 ? 352 ILE A CB    1 
ATOM 2174 C CG1   . ILE A 1 277 ? 72.117  34.991  85.348  1.00 134.03 ? 352 ILE A CG1   1 
ATOM 2175 C CG2   . ILE A 1 277 ? 69.814  35.827  86.130  1.00 151.85 ? 352 ILE A CG2   1 
ATOM 2176 C CD1   . ILE A 1 277 ? 72.965  34.751  86.609  1.00 112.02 ? 352 ILE A CD1   1 
ATOM 2177 N N     . ASN A 1 278 ? 73.033  37.972  84.374  1.00 120.83 ? 353 ASN A N     1 
ATOM 2178 C CA    . ASN A 1 278 ? 74.314  38.584  84.036  1.00 110.49 ? 353 ASN A CA    1 
ATOM 2179 C C     . ASN A 1 278 ? 74.127  39.881  83.280  1.00 97.72  ? 353 ASN A C     1 
ATOM 2180 O O     . ASN A 1 278 ? 74.275  39.945  82.057  1.00 97.65  ? 353 ASN A O     1 
ATOM 2181 C CB    . ASN A 1 278 ? 75.214  37.656  83.224  1.00 105.39 ? 353 ASN A CB    1 
ATOM 2182 C CG    . ASN A 1 278 ? 76.540  38.318  82.866  1.00 111.86 ? 353 ASN A CG    1 
ATOM 2183 O OD1   . ASN A 1 278 ? 76.673  38.917  81.802  1.00 109.97 ? 353 ASN A OD1   1 
ATOM 2184 N ND2   . ASN A 1 278 ? 77.516  38.239  83.768  1.00 117.59 ? 353 ASN A ND2   1 
ATOM 2185 N N     . LYS A 1 279 ? 73.756  40.911  84.024  1.00 83.46  ? 354 LYS A N     1 
ATOM 2186 C CA    . LYS A 1 279 ? 73.706  42.239  83.466  1.00 83.38  ? 354 LYS A CA    1 
ATOM 2187 C C     . LYS A 1 279 ? 75.007  42.622  82.781  1.00 92.47  ? 354 LYS A C     1 
ATOM 2188 O O     . LYS A 1 279 ? 74.992  43.486  81.902  1.00 98.16  ? 354 LYS A O     1 
ATOM 2189 C CB    . LYS A 1 279 ? 73.373  43.239  84.578  1.00 95.95  ? 354 LYS A CB    1 
ATOM 2190 C CG    . LYS A 1 279 ? 74.564  43.974  85.167  1.00 105.54 ? 354 LYS A CG    1 
ATOM 2191 C CD    . LYS A 1 279 ? 74.124  45.181  86.002  1.00 109.90 ? 354 LYS A CD    1 
ATOM 2192 C CE    . LYS A 1 279 ? 75.335  45.999  86.455  1.00 114.17 ? 354 LYS A CE    1 
ATOM 2193 N NZ    . LYS A 1 279 ? 75.979  46.748  85.323  1.00 98.20  ? 354 LYS A NZ    1 
ATOM 2194 N N     . SER A 1 280 ? 76.130  41.988  83.131  1.00 92.65  ? 355 SER A N     1 
ATOM 2195 C CA    . SER A 1 280 ? 77.423  42.544  82.736  1.00 92.53  ? 355 SER A CA    1 
ATOM 2196 C C     . SER A 1 280 ? 77.728  42.341  81.255  1.00 94.50  ? 355 SER A C     1 
ATOM 2197 O O     . SER A 1 280 ? 78.498  43.127  80.679  1.00 90.37  ? 355 SER A O     1 
ATOM 2198 C CB    . SER A 1 280 ? 78.540  41.956  83.595  1.00 96.63  ? 355 SER A CB    1 
ATOM 2199 O OG    . SER A 1 280 ? 78.788  42.774  84.727  1.00 83.69  ? 355 SER A OG    1 
ATOM 2200 N N     . ILE A 1 281 ? 77.144  41.316  80.618  1.00 84.58  ? 356 ILE A N     1 
ATOM 2201 C CA    . ILE A 1 281 ? 77.399  41.124  79.190  1.00 83.58  ? 356 ILE A CA    1 
ATOM 2202 C C     . ILE A 1 281 ? 76.583  42.100  78.368  1.00 76.23  ? 356 ILE A C     1 
ATOM 2203 O O     . ILE A 1 281 ? 77.040  42.568  77.326  1.00 74.01  ? 356 ILE A O     1 
ATOM 2204 C CB    . ILE A 1 281 ? 77.133  39.675  78.757  1.00 90.06  ? 356 ILE A CB    1 
ATOM 2205 C CG1   . ILE A 1 281 ? 78.310  38.772  79.175  1.00 109.12 ? 356 ILE A CG1   1 
ATOM 2206 C CG2   . ILE A 1 281 ? 76.907  39.614  77.271  1.00 66.22  ? 356 ILE A CG2   1 
ATOM 2207 C CD1   . ILE A 1 281 ? 79.638  39.510  79.496  1.00 99.63  ? 356 ILE A CD1   1 
ATOM 2208 N N     . ILE A 1 282 ? 75.376  42.425  78.830  1.00 79.25  ? 357 ILE A N     1 
ATOM 2209 C CA    . ILE A 1 282 ? 74.670  43.620  78.375  1.00 72.95  ? 357 ILE A CA    1 
ATOM 2210 C C     . ILE A 1 282 ? 75.593  44.831  78.378  1.00 74.36  ? 357 ILE A C     1 
ATOM 2211 O O     . ILE A 1 282 ? 75.879  45.426  77.328  1.00 68.01  ? 357 ILE A O     1 
ATOM 2212 C CB    . ILE A 1 282 ? 73.456  43.879  79.272  1.00 62.63  ? 357 ILE A CB    1 
ATOM 2213 C CG1   . ILE A 1 282 ? 72.303  43.015  78.817  1.00 75.62  ? 357 ILE A CG1   1 
ATOM 2214 C CG2   . ILE A 1 282 ? 73.069  45.353  79.244  1.00 76.03  ? 357 ILE A CG2   1 
ATOM 2215 C CD1   . ILE A 1 282 ? 70.952  43.726  78.985  1.00 95.23  ? 357 ILE A CD1   1 
ATOM 2216 N N     . GLN A 1 283 ? 76.055  45.217  79.579  1.00 69.36  ? 358 GLN A N     1 
ATOM 2217 C CA    . GLN A 1 283 ? 76.778  46.462  79.768  1.00 62.47  ? 358 GLN A CA    1 
ATOM 2218 C C     . GLN A 1 283 ? 77.905  46.585  78.794  1.00 71.91  ? 358 GLN A C     1 
ATOM 2219 O O     . GLN A 1 283 ? 78.225  47.687  78.334  1.00 63.48  ? 358 GLN A O     1 
ATOM 2220 C CB    . GLN A 1 283 ? 77.332  46.548  81.172  1.00 64.67  ? 358 GLN A CB    1 
ATOM 2221 C CG    . GLN A 1 283 ? 76.788  47.750  81.954  1.00 79.38  ? 358 GLN A CG    1 
ATOM 2222 C CD    . GLN A 1 283 ? 77.392  49.050  81.508  1.00 66.75  ? 358 GLN A CD    1 
ATOM 2223 O OE1   . GLN A 1 283 ? 78.260  49.069  80.646  1.00 64.37  ? 358 GLN A OE1   1 
ATOM 2224 N NE2   . GLN A 1 283 ? 76.948  50.148  82.103  1.00 64.32  ? 358 GLN A NE2   1 
ATOM 2225 N N     . THR A 1 284 ? 78.506  45.463  78.439  1.00 73.96  ? 359 THR A N     1 
ATOM 2226 C CA    . THR A 1 284 ? 79.533  45.540  77.422  1.00 81.34  ? 359 THR A CA    1 
ATOM 2227 C C     . THR A 1 284 ? 78.933  45.878  76.065  1.00 74.33  ? 359 THR A C     1 
ATOM 2228 O O     . THR A 1 284 ? 79.482  46.702  75.340  1.00 74.98  ? 359 THR A O     1 
ATOM 2229 C CB    . THR A 1 284 ? 80.332  44.251  77.391  1.00 69.59  ? 359 THR A CB    1 
ATOM 2230 O OG1   . THR A 1 284 ? 79.963  43.468  78.531  1.00 80.23  ? 359 THR A OG1   1 
ATOM 2231 C CG2   . THR A 1 284 ? 81.813  44.595  77.489  1.00 66.44  ? 359 THR A CG2   1 
ATOM 2232 N N     . MET A 1 285 ? 77.774  45.326  75.730  1.00 70.73  ? 360 MET A N     1 
ATOM 2233 C CA    . MET A 1 285 ? 77.232  45.578  74.399  1.00 69.03  ? 360 MET A CA    1 
ATOM 2234 C C     . MET A 1 285 ? 76.780  47.027  74.237  1.00 83.86  ? 360 MET A C     1 
ATOM 2235 O O     . MET A 1 285 ? 77.092  47.679  73.223  1.00 71.76  ? 360 MET A O     1 
ATOM 2236 C CB    . MET A 1 285 ? 76.082  44.636  74.136  1.00 65.05  ? 360 MET A CB    1 
ATOM 2237 C CG    . MET A 1 285 ? 76.386  43.227  74.523  1.00 73.41  ? 360 MET A CG    1 
ATOM 2238 S SD    . MET A 1 285 ? 74.883  42.254  74.442  1.00 81.04  ? 360 MET A SD    1 
ATOM 2239 C CE    . MET A 1 285 ? 74.853  42.048  72.663  1.00 50.93  ? 360 MET A CE    1 
ATOM 2240 N N     . VAL A 1 286 ? 76.038  47.552  75.222  1.00 72.38  ? 361 VAL A N     1 
ATOM 2241 C CA    . VAL A 1 286 ? 75.727  48.977  75.185  1.00 74.04  ? 361 VAL A CA    1 
ATOM 2242 C C     . VAL A 1 286 ? 77.018  49.798  75.101  1.00 79.12  ? 361 VAL A C     1 
ATOM 2243 O O     . VAL A 1 286 ? 77.093  50.790  74.364  1.00 88.42  ? 361 VAL A O     1 
ATOM 2244 C CB    . VAL A 1 286 ? 74.839  49.379  76.380  1.00 64.15  ? 361 VAL A CB    1 
ATOM 2245 C CG1   . VAL A 1 286 ? 74.037  48.196  76.890  1.00 67.81  ? 361 VAL A CG1   1 
ATOM 2246 C CG2   . VAL A 1 286 ? 75.631  49.983  77.460  1.00 72.87  ? 361 VAL A CG2   1 
ATOM 2247 N N     . ASN A 1 287 ? 78.080  49.356  75.783  1.00 68.58  ? 362 ASN A N     1 
ATOM 2248 C CA    . ASN A 1 287 ? 79.386  49.979  75.579  1.00 72.93  ? 362 ASN A CA    1 
ATOM 2249 C C     . ASN A 1 287 ? 79.863  49.836  74.138  1.00 74.21  ? 362 ASN A C     1 
ATOM 2250 O O     . ASN A 1 287 ? 80.550  50.720  73.609  1.00 67.32  ? 362 ASN A O     1 
ATOM 2251 C CB    . ASN A 1 287 ? 80.418  49.359  76.514  1.00 83.97  ? 362 ASN A CB    1 
ATOM 2252 C CG    . ASN A 1 287 ? 80.288  49.848  77.927  1.00 102.09 ? 362 ASN A CG    1 
ATOM 2253 O OD1   . ASN A 1 287 ? 79.297  50.507  78.290  1.00 84.18  ? 362 ASN A OD1   1 
ATOM 2254 N ND2   . ASN A 1 287 ? 81.298  49.534  78.751  1.00 112.03 ? 362 ASN A ND2   1 
ATOM 2255 N N     . ILE A 1 288 ? 79.568  48.698  73.509  1.00 79.03  ? 363 ILE A N     1 
ATOM 2256 C CA    . ILE A 1 288 ? 79.990  48.495  72.131  1.00 73.60  ? 363 ILE A CA    1 
ATOM 2257 C C     . ILE A 1 288 ? 79.095  49.267  71.210  1.00 77.17  ? 363 ILE A C     1 
ATOM 2258 O O     . ILE A 1 288 ? 79.555  49.909  70.258  1.00 62.57  ? 363 ILE A O     1 
ATOM 2259 C CB    . ILE A 1 288 ? 79.944  47.015  71.742  1.00 55.77  ? 363 ILE A CB    1 
ATOM 2260 C CG1   . ILE A 1 288 ? 80.470  46.141  72.847  1.00 48.52  ? 363 ILE A CG1   1 
ATOM 2261 C CG2   . ILE A 1 288 ? 80.718  46.826  70.460  1.00 54.71  ? 363 ILE A CG2   1 
ATOM 2262 C CD1   . ILE A 1 288 ? 81.880  46.450  73.266  1.00 79.10  ? 363 ILE A CD1   1 
ATOM 2263 N N     . LEU A 1 289 ? 77.795  49.142  71.457  1.00 63.30  ? 364 LEU A N     1 
ATOM 2264 C CA    . LEU A 1 289 ? 76.838  49.770  70.586  1.00 62.19  ? 364 LEU A CA    1 
ATOM 2265 C C     . LEU A 1 289 ? 76.920  51.269  70.691  1.00 74.01  ? 364 LEU A C     1 
ATOM 2266 O O     . LEU A 1 289 ? 76.580  51.961  69.727  1.00 81.38  ? 364 LEU A O     1 
ATOM 2267 C CB    . LEU A 1 289 ? 75.437  49.307  70.929  1.00 76.72  ? 364 LEU A CB    1 
ATOM 2268 C CG    . LEU A 1 289 ? 74.908  48.091  70.195  1.00 60.58  ? 364 LEU A CG    1 
ATOM 2269 C CD1   . LEU A 1 289 ? 75.829  47.799  69.064  1.00 48.99  ? 364 LEU A CD1   1 
ATOM 2270 C CD2   . LEU A 1 289 ? 74.796  46.963  71.182  1.00 50.06  ? 364 LEU A CD2   1 
ATOM 2271 N N     . ASP A 1 290 ? 77.371  51.796  71.835  1.00 62.10  ? 365 ASP A N     1 
ATOM 2272 C CA    . ASP A 1 290 ? 77.374  53.242  71.949  1.00 68.75  ? 365 ASP A CA    1 
ATOM 2273 C C     . ASP A 1 290 ? 78.288  53.875  70.918  1.00 77.20  ? 365 ASP A C     1 
ATOM 2274 O O     . ASP A 1 290 ? 77.986  54.949  70.388  1.00 89.19  ? 365 ASP A O     1 
ATOM 2275 C CB    . ASP A 1 290 ? 77.789  53.715  73.323  1.00 84.86  ? 365 ASP A CB    1 
ATOM 2276 C CG    . ASP A 1 290 ? 77.932  55.243  73.360  1.00 111.03 ? 365 ASP A CG    1 
ATOM 2277 O OD1   . ASP A 1 290 ? 76.888  55.956  73.276  1.00 87.53  ? 365 ASP A OD1   1 
ATOM 2278 O OD2   . ASP A 1 290 ? 79.090  55.730  73.416  1.00 116.05 ? 365 ASP A OD2   1 
ATOM 2279 N N     . GLY A 1 291 ? 79.410  53.234  70.618  1.00 66.86  ? 366 GLY A N     1 
ATOM 2280 C CA    . GLY A 1 291 ? 80.354  53.844  69.705  1.00 61.44  ? 366 GLY A CA    1 
ATOM 2281 C C     . GLY A 1 291 ? 79.909  53.863  68.264  1.00 53.17  ? 366 GLY A C     1 
ATOM 2282 O O     . GLY A 1 291 ? 80.477  54.613  67.466  1.00 68.17  ? 366 GLY A O     1 
ATOM 2283 N N     . PHE A 1 292 ? 78.944  53.024  67.897  1.00 52.25  ? 367 PHE A N     1 
ATOM 2284 C CA    . PHE A 1 292 ? 78.457  53.023  66.521  1.00 64.17  ? 367 PHE A CA    1 
ATOM 2285 C C     . PHE A 1 292 ? 77.437  54.118  66.322  1.00 63.24  ? 367 PHE A C     1 
ATOM 2286 O O     . PHE A 1 292 ? 77.241  54.606  65.198  1.00 50.03  ? 367 PHE A O     1 
ATOM 2287 C CB    . PHE A 1 292 ? 77.810  51.690  66.151  1.00 66.45  ? 367 PHE A CB    1 
ATOM 2288 C CG    . PHE A 1 292 ? 78.741  50.494  66.187  1.00 70.63  ? 367 PHE A CG    1 
ATOM 2289 C CD1   . PHE A 1 292 ? 79.034  49.798  65.020  1.00 76.18  ? 367 PHE A CD1   1 
ATOM 2290 C CD2   . PHE A 1 292 ? 79.241  50.016  67.388  1.00 65.51  ? 367 PHE A CD2   1 
ATOM 2291 C CE1   . PHE A 1 292 ? 79.840  48.683  65.045  1.00 71.42  ? 367 PHE A CE1   1 
ATOM 2292 C CE2   . PHE A 1 292 ? 80.051  48.923  67.424  1.00 64.65  ? 367 PHE A CE2   1 
ATOM 2293 C CZ    . PHE A 1 292 ? 80.359  48.252  66.246  1.00 74.28  ? 367 PHE A CZ    1 
ATOM 2294 N N     . GLU A 1 293 ? 76.776  54.476  67.422  1.00 66.80  ? 368 GLU A N     1 
ATOM 2295 C CA    . GLU A 1 293 ? 75.836  55.586  67.435  1.00 61.79  ? 368 GLU A CA    1 
ATOM 2296 C C     . GLU A 1 293 ? 76.456  56.808  66.778  1.00 57.66  ? 368 GLU A C     1 
ATOM 2297 O O     . GLU A 1 293 ? 75.877  57.400  65.860  1.00 50.27  ? 368 GLU A O     1 
ATOM 2298 C CB    . GLU A 1 293 ? 75.421  55.860  68.882  1.00 41.32  ? 368 GLU A CB    1 
ATOM 2299 C CG    . GLU A 1 293 ? 74.163  56.602  69.003  1.00 72.36  ? 368 GLU A CG    1 
ATOM 2300 C CD    . GLU A 1 293 ? 73.023  55.879  68.318  1.00 91.44  ? 368 GLU A CD    1 
ATOM 2301 O OE1   . GLU A 1 293 ? 72.760  54.727  68.734  1.00 84.44  ? 368 GLU A OE1   1 
ATOM 2302 O OE2   . GLU A 1 293 ? 72.407  56.445  67.363  1.00 88.17  ? 368 GLU A OE2   1 
ATOM 2303 N N     . ARG A 1 294 ? 77.672  57.157  67.210  1.00 59.09  ? 369 ARG A N     1 
ATOM 2304 C CA    . ARG A 1 294 ? 78.397  58.259  66.598  1.00 71.58  ? 369 ARG A CA    1 
ATOM 2305 C C     . ARG A 1 294 ? 78.576  58.035  65.114  1.00 72.42  ? 369 ARG A C     1 
ATOM 2306 O O     . ARG A 1 294 ? 78.398  58.963  64.314  1.00 60.29  ? 369 ARG A O     1 
ATOM 2307 C CB    . ARG A 1 294 ? 79.747  58.423  67.272  1.00 72.17  ? 369 ARG A CB    1 
ATOM 2308 C CG    . ARG A 1 294 ? 79.579  58.636  68.727  1.00 81.58  ? 369 ARG A CG    1 
ATOM 2309 C CD    . ARG A 1 294 ? 80.864  59.121  69.375  1.00 110.96 ? 369 ARG A CD    1 
ATOM 2310 N NE    . ARG A 1 294 ? 80.660  59.524  70.772  1.00 109.25 ? 369 ARG A NE    1 
ATOM 2311 C CZ    . ARG A 1 294 ? 80.180  58.737  71.744  1.00 121.33 ? 369 ARG A CZ    1 
ATOM 2312 N NH1   . ARG A 1 294 ? 79.820  57.477  71.505  1.00 120.89 ? 369 ARG A NH1   1 
ATOM 2313 N NH2   . ARG A 1 294 ? 80.049  59.208  72.978  1.00 107.70 ? 369 ARG A NH2   1 
ATOM 2314 N N     . ILE A 1 295 ? 78.913  56.803  64.728  1.00 64.44  ? 370 ILE A N     1 
ATOM 2315 C CA    . ILE A 1 295 ? 79.200  56.530  63.328  1.00 62.22  ? 370 ILE A CA    1 
ATOM 2316 C C     . ILE A 1 295 ? 77.953  56.744  62.483  1.00 58.05  ? 370 ILE A C     1 
ATOM 2317 O O     . ILE A 1 295 ? 77.998  57.413  61.445  1.00 51.17  ? 370 ILE A O     1 
ATOM 2318 C CB    . ILE A 1 295 ? 79.778  55.118  63.173  1.00 43.15  ? 370 ILE A CB    1 
ATOM 2319 C CG1   . ILE A 1 295 ? 80.717  54.859  64.333  1.00 62.21  ? 370 ILE A CG1   1 
ATOM 2320 C CG2   . ILE A 1 295 ? 80.616  55.032  61.941  1.00 47.62  ? 370 ILE A CG2   1 
ATOM 2321 C CD1   . ILE A 1 295 ? 81.658  53.701  64.101  1.00 61.03  ? 370 ILE A CD1   1 
ATOM 2322 N N     . PHE A 1 296 ? 76.811  56.225  62.936  1.00 56.75  ? 371 PHE A N     1 
ATOM 2323 C CA    . PHE A 1 296 ? 75.572  56.470  62.211  1.00 44.45  ? 371 PHE A CA    1 
ATOM 2324 C C     . PHE A 1 296 ? 75.308  57.952  62.089  1.00 52.72  ? 371 PHE A C     1 
ATOM 2325 O O     . PHE A 1 296 ? 75.059  58.457  60.991  1.00 48.84  ? 371 PHE A O     1 
ATOM 2326 C CB    . PHE A 1 296 ? 74.407  55.810  62.911  1.00 50.30  ? 371 PHE A CB    1 
ATOM 2327 C CG    . PHE A 1 296 ? 74.215  54.377  62.559  1.00 61.83  ? 371 PHE A CG    1 
ATOM 2328 C CD1   . PHE A 1 296 ? 74.410  53.382  63.502  1.00 65.53  ? 371 PHE A CD1   1 
ATOM 2329 C CD2   . PHE A 1 296 ? 73.809  54.012  61.298  1.00 64.40  ? 371 PHE A CD2   1 
ATOM 2330 C CE1   . PHE A 1 296 ? 74.208  52.053  63.174  1.00 61.68  ? 371 PHE A CE1   1 
ATOM 2331 C CE2   . PHE A 1 296 ? 73.624  52.676  60.976  1.00 59.89  ? 371 PHE A CE2   1 
ATOM 2332 C CZ    . PHE A 1 296 ? 73.821  51.709  61.908  1.00 48.93  ? 371 PHE A CZ    1 
ATOM 2333 N N     . LYS A 1 297 ? 75.369  58.668  63.218  1.00 61.79  ? 372 LYS A N     1 
ATOM 2334 C CA    . LYS A 1 297 ? 75.218  60.121  63.223  1.00 61.66  ? 372 LYS A CA    1 
ATOM 2335 C C     . LYS A 1 297 ? 76.159  60.783  62.212  1.00 62.06  ? 372 LYS A C     1 
ATOM 2336 O O     . LYS A 1 297 ? 75.725  61.491  61.291  1.00 45.78  ? 372 LYS A O     1 
ATOM 2337 C CB    . LYS A 1 297 ? 75.479  60.639  64.637  1.00 61.24  ? 372 LYS A CB    1 
ATOM 2338 C CG    . LYS A 1 297 ? 74.417  60.214  65.674  1.00 89.43  ? 372 LYS A CG    1 
ATOM 2339 C CD    . LYS A 1 297 ? 74.819  60.589  67.135  1.00 98.49  ? 372 LYS A CD    1 
ATOM 2340 C CE    . LYS A 1 297 ? 73.617  60.695  68.116  1.00 79.85  ? 372 LYS A CE    1 
ATOM 2341 N NZ    . LYS A 1 297 ? 73.094  62.105  68.249  1.00 81.90  ? 372 LYS A NZ    1 
ATOM 2342 N N     . GLU A 1 298 ? 77.461  60.518  62.347  1.00 64.90  ? 373 GLU A N     1 
ATOM 2343 C CA    . GLU A 1 298 ? 78.423  61.119  61.434  1.00 63.53  ? 373 GLU A CA    1 
ATOM 2344 C C     . GLU A 1 298 ? 78.148  60.719  59.992  1.00 62.09  ? 373 GLU A C     1 
ATOM 2345 O O     . GLU A 1 298 ? 78.571  61.435  59.081  1.00 75.49  ? 373 GLU A O     1 
ATOM 2346 C CB    . GLU A 1 298 ? 79.875  60.765  61.853  1.00 67.66  ? 373 GLU A CB    1 
ATOM 2347 C CG    . GLU A 1 298 ? 80.244  61.179  63.327  1.00 86.87  ? 373 GLU A CG    1 
ATOM 2348 C CD    . GLU A 1 298 ? 81.671  60.799  63.793  1.00 96.98  ? 373 GLU A CD    1 
ATOM 2349 O OE1   . GLU A 1 298 ? 82.630  61.095  63.040  1.00 93.62  ? 373 GLU A OE1   1 
ATOM 2350 O OE2   . GLU A 1 298 ? 81.826  60.237  64.922  1.00 88.26  ? 373 GLU A OE2   1 
ATOM 2351 N N     . LEU A 1 299 ? 77.447  59.601  59.766  1.00 57.00  ? 374 LEU A N     1 
ATOM 2352 C CA    . LEU A 1 299 ? 77.236  59.042  58.429  1.00 62.35  ? 374 LEU A CA    1 
ATOM 2353 C C     . LEU A 1 299 ? 76.029  59.617  57.659  1.00 61.48  ? 374 LEU A C     1 
ATOM 2354 O O     . LEU A 1 299 ? 76.053  59.705  56.419  1.00 59.93  ? 374 LEU A O     1 
ATOM 2355 C CB    . LEU A 1 299 ? 77.113  57.523  58.557  1.00 60.38  ? 374 LEU A CB    1 
ATOM 2356 C CG    . LEU A 1 299 ? 77.955  56.580  57.701  1.00 51.06  ? 374 LEU A CG    1 
ATOM 2357 C CD1   . LEU A 1 299 ? 77.841  56.995  56.252  1.00 69.12  ? 374 LEU A CD1   1 
ATOM 2358 C CD2   . LEU A 1 299 ? 79.404  56.570  58.146  1.00 71.27  ? 374 LEU A CD2   1 
ATOM 2359 N N     . GLN A 1 300 ? 74.962  59.974  58.348  1.00 66.76  ? 375 GLN A N     1 
ATOM 2360 C CA    . GLN A 1 300 ? 73.750  60.472  57.706  1.00 78.60  ? 375 GLN A CA    1 
ATOM 2361 C C     . GLN A 1 300 ? 73.713  61.995  57.581  1.00 87.24  ? 375 GLN A C     1 
ATOM 2362 O O     . GLN A 1 300 ? 72.759  62.540  56.995  1.00 71.21  ? 375 GLN A O     1 
ATOM 2363 C CB    . GLN A 1 300 ? 72.539  59.995  58.501  1.00 72.80  ? 375 GLN A CB    1 
ATOM 2364 C CG    . GLN A 1 300 ? 72.543  58.516  58.760  1.00 66.56  ? 375 GLN A CG    1 
ATOM 2365 C CD    . GLN A 1 300 ? 71.877  58.193  60.053  1.00 72.04  ? 375 GLN A CD    1 
ATOM 2366 O OE1   . GLN A 1 300 ? 72.148  57.162  60.656  1.00 91.23  ? 375 GLN A OE1   1 
ATOM 2367 N NE2   . GLN A 1 300 ? 71.007  59.082  60.506  1.00 65.19  ? 375 GLN A NE2   1 
ATOM 2368 N N     . THR A 1 301 ? 74.737  62.671  58.111  1.00 81.54  ? 376 THR A N     1 
ATOM 2369 C CA    . THR A 1 301 ? 74.802  64.118  58.154  1.00 69.47  ? 376 THR A CA    1 
ATOM 2370 C C     . THR A 1 301 ? 74.573  64.716  56.786  1.00 72.51  ? 376 THR A C     1 
ATOM 2371 O O     . THR A 1 301 ? 75.208  64.316  55.808  1.00 78.37  ? 376 THR A O     1 
ATOM 2372 C CB    . THR A 1 301 ? 76.166  64.525  58.665  1.00 64.34  ? 376 THR A CB    1 
ATOM 2373 O OG1   . THR A 1 301 ? 76.149  64.452  60.089  1.00 78.87  ? 376 THR A OG1   1 
ATOM 2374 C CG2   . THR A 1 301 ? 76.485  65.924  58.234  1.00 75.05  ? 376 THR A CG2   1 
ATOM 2375 N N     . CYS A 1 302 ? 73.600  65.616  56.703  1.00 73.26  ? 377 CYS A N     1 
ATOM 2376 C CA    . CYS A 1 302 ? 73.388  66.327  55.460  1.00 77.73  ? 377 CYS A CA    1 
ATOM 2377 C C     . CYS A 1 302 ? 73.896  67.743  55.475  1.00 78.14  ? 377 CYS A C     1 
ATOM 2378 O O     . CYS A 1 302 ? 73.881  68.392  54.432  1.00 80.86  ? 377 CYS A O     1 
ATOM 2379 C CB    . CYS A 1 302 ? 71.916  66.353  55.102  1.00 94.22  ? 377 CYS A CB    1 
ATOM 2380 S SG    . CYS A 1 302 ? 71.660  65.411  53.603  1.00 114.43 ? 377 CYS A SG    1 
ATOM 2381 N N     . SER A 1 303 ? 74.332  68.231  56.620  1.00 88.36  ? 378 SER A N     1 
ATOM 2382 C CA    . SER A 1 303 ? 74.723  69.620  56.733  1.00 69.93  ? 378 SER A CA    1 
ATOM 2383 C C     . SER A 1 303 ? 76.143  69.875  56.213  1.00 85.00  ? 378 SER A C     1 
ATOM 2384 O O     . SER A 1 303 ? 76.452  70.993  55.784  1.00 110.33 ? 378 SER A O     1 
ATOM 2385 C CB    . SER A 1 303 ? 74.581  70.031  58.191  1.00 57.87  ? 378 SER A CB    1 
ATOM 2386 O OG    . SER A 1 303 ? 75.561  69.356  58.968  1.00 78.11  ? 378 SER A OG    1 
ATOM 2387 N N     . SER A 1 304 ? 77.000  68.875  56.219  1.00 72.00  ? 379 SER A N     1 
ATOM 2388 C CA    . SER A 1 304 ? 78.376  69.007  55.763  1.00 79.28  ? 379 SER A CA    1 
ATOM 2389 C C     . SER A 1 304 ? 78.750  67.697  55.057  1.00 94.50  ? 379 SER A C     1 
ATOM 2390 O O     . SER A 1 304 ? 77.905  66.795  54.992  1.00 90.09  ? 379 SER A O     1 
ATOM 2391 C CB    . SER A 1 304 ? 79.257  69.342  56.967  1.00 80.11  ? 379 SER A CB    1 
ATOM 2392 O OG    . SER A 1 304 ? 78.659  68.886  58.166  1.00 79.47  ? 379 SER A OG    1 
ATOM 2393 N N     . PRO A 1 305 ? 79.952  67.528  54.492  1.00 91.94  ? 380 PRO A N     1 
ATOM 2394 C CA    . PRO A 1 305 ? 80.201  66.311  53.712  1.00 82.12  ? 380 PRO A CA    1 
ATOM 2395 C C     . PRO A 1 305 ? 80.180  65.102  54.617  1.00 86.43  ? 380 PRO A C     1 
ATOM 2396 O O     . PRO A 1 305 ? 80.395  65.224  55.830  1.00 78.28  ? 380 PRO A O     1 
ATOM 2397 C CB    . PRO A 1 305 ? 81.591  66.541  53.116  1.00 71.48  ? 380 PRO A CB    1 
ATOM 2398 C CG    . PRO A 1 305 ? 82.242  67.393  54.084  1.00 87.42  ? 380 PRO A CG    1 
ATOM 2399 C CD    . PRO A 1 305 ? 81.186  68.324  54.610  1.00 95.02  ? 380 PRO A CD    1 
ATOM 2400 N N     . SER A 1 306 ? 79.861  63.942  54.005  1.00 87.21  ? 381 SER A N     1 
ATOM 2401 C CA    . SER A 1 306 ? 79.622  62.650  54.662  1.00 71.05  ? 381 SER A CA    1 
ATOM 2402 C C     . SER A 1 306 ? 80.427  61.566  53.994  1.00 56.95  ? 381 SER A C     1 
ATOM 2403 O O     . SER A 1 306 ? 81.131  60.799  54.648  1.00 62.95  ? 381 SER A O     1 
ATOM 2404 C CB    . SER A 1 306 ? 78.148  62.258  54.652  1.00 64.06  ? 381 SER A CB    1 
ATOM 2405 O OG    . SER A 1 306 ? 77.432  62.996  53.675  1.00 78.69  ? 381 SER A OG    1 
ATOM 2406 N N     . LEU A 1 307 ? 80.245  61.455  52.690  1.00 66.97  ? 382 LEU A N     1 
ATOM 2407 C CA    . LEU A 1 307 ? 80.809  60.354  51.925  1.00 67.19  ? 382 LEU A CA    1 
ATOM 2408 C C     . LEU A 1 307 ? 82.250  60.064  52.276  1.00 65.03  ? 382 LEU A C     1 
ATOM 2409 O O     . LEU A 1 307 ? 82.600  58.929  52.613  1.00 76.87  ? 382 LEU A O     1 
ATOM 2410 C CB    . LEU A 1 307 ? 80.696  60.679  50.445  1.00 79.05  ? 382 LEU A CB    1 
ATOM 2411 C CG    . LEU A 1 307 ? 81.432  59.698  49.550  1.00 89.99  ? 382 LEU A CG    1 
ATOM 2412 C CD1   . LEU A 1 307 ? 80.868  58.290  49.680  1.00 79.64  ? 382 LEU A CD1   1 
ATOM 2413 C CD2   . LEU A 1 307 ? 81.345  60.153  48.115  1.00 92.61  ? 382 LEU A CD2   1 
ATOM 2414 N N     . CYS A 1 308 ? 83.094  61.090  52.256  1.00 68.87  ? 383 CYS A N     1 
ATOM 2415 C CA    . CYS A 1 308 ? 84.530  60.892  52.452  1.00 80.60  ? 383 CYS A CA    1 
ATOM 2416 C C     . CYS A 1 308 ? 84.890  60.299  53.805  1.00 78.84  ? 383 CYS A C     1 
ATOM 2417 O O     . CYS A 1 308 ? 86.024  59.835  53.977  1.00 74.12  ? 383 CYS A O     1 
ATOM 2418 C CB    . CYS A 1 308 ? 85.239  62.215  52.319  1.00 81.73  ? 383 CYS A CB    1 
ATOM 2419 S SG    . CYS A 1 308 ? 84.453  63.382  53.353  1.00 88.72  ? 383 CYS A SG    1 
ATOM 2420 N N     . PHE A 1 309 ? 83.975  60.326  54.771  1.00 68.67  ? 384 PHE A N     1 
ATOM 2421 C CA    . PHE A 1 309 ? 84.226  59.704  56.058  1.00 66.37  ? 384 PHE A CA    1 
ATOM 2422 C C     . PHE A 1 309 ? 83.715  58.300  56.155  1.00 63.74  ? 384 PHE A C     1 
ATOM 2423 O O     . PHE A 1 309 ? 83.823  57.710  57.232  1.00 64.67  ? 384 PHE A O     1 
ATOM 2424 C CB    . PHE A 1 309 ? 83.596  60.490  57.163  1.00 77.62  ? 384 PHE A CB    1 
ATOM 2425 C CG    . PHE A 1 309 ? 84.119  61.838  57.253  1.00 81.94  ? 384 PHE A CG    1 
ATOM 2426 C CD1   . PHE A 1 309 ? 83.573  62.841  56.488  1.00 72.50  ? 384 PHE A CD1   1 
ATOM 2427 C CD2   . PHE A 1 309 ? 85.189  62.098  58.070  1.00 78.10  ? 384 PHE A CD2   1 
ATOM 2428 C CE1   . PHE A 1 309 ? 84.058  64.072  56.552  1.00 68.90  ? 384 PHE A CE1   1 
ATOM 2429 C CE2   . PHE A 1 309 ? 85.684  63.316  58.150  1.00 70.14  ? 384 PHE A CE2   1 
ATOM 2430 C CZ    . PHE A 1 309 ? 85.119  64.323  57.385  1.00 95.19  ? 384 PHE A CZ    1 
ATOM 2431 N N     . VAL A 1 310 ? 83.157  57.767  55.071  1.00 61.39  ? 385 VAL A N     1 
ATOM 2432 C CA    . VAL A 1 310 ? 82.753  56.370  55.057  1.00 70.20  ? 385 VAL A CA    1 
ATOM 2433 C C     . VAL A 1 310 ? 83.935  55.474  55.402  1.00 67.56  ? 385 VAL A C     1 
ATOM 2434 O O     . VAL A 1 310 ? 83.941  54.770  56.424  1.00 53.84  ? 385 VAL A O     1 
ATOM 2435 C CB    . VAL A 1 310 ? 82.150  56.007  53.695  1.00 69.61  ? 385 VAL A CB    1 
ATOM 2436 C CG1   . VAL A 1 310 ? 81.999  54.485  53.582  1.00 73.95  ? 385 VAL A CG1   1 
ATOM 2437 C CG2   . VAL A 1 310 ? 80.807  56.699  53.532  1.00 59.98  ? 385 VAL A CG2   1 
ATOM 2438 N N     . VAL A 1 311 ? 84.953  55.493  54.553  1.00 60.48  ? 386 VAL A N     1 
ATOM 2439 C CA    . VAL A 1 311 ? 86.143  54.681  54.785  1.00 63.06  ? 386 VAL A CA    1 
ATOM 2440 C C     . VAL A 1 311 ? 86.716  54.818  56.202  1.00 80.21  ? 386 VAL A C     1 
ATOM 2441 O O     . VAL A 1 311 ? 86.812  53.794  56.902  1.00 74.60  ? 386 VAL A O     1 
ATOM 2442 C CB    . VAL A 1 311 ? 87.225  55.007  53.754  1.00 56.33  ? 386 VAL A CB    1 
ATOM 2443 C CG1   . VAL A 1 311 ? 88.445  54.190  54.058  1.00 58.31  ? 386 VAL A CG1   1 
ATOM 2444 C CG2   . VAL A 1 311 ? 86.693  54.825  52.316  1.00 52.37  ? 386 VAL A CG2   1 
ATOM 2445 N N     . PRO A 1 312 ? 87.109  56.017  56.693  1.00 79.91  ? 387 PRO A N     1 
ATOM 2446 C CA    . PRO A 1 312 ? 87.773  56.049  58.004  1.00 71.57  ? 387 PRO A CA    1 
ATOM 2447 C C     . PRO A 1 312 ? 86.898  55.467  59.076  1.00 71.12  ? 387 PRO A C     1 
ATOM 2448 O O     . PRO A 1 312 ? 87.393  54.889  60.051  1.00 67.37  ? 387 PRO A O     1 
ATOM 2449 C CB    . PRO A 1 312 ? 88.040  57.544  58.224  1.00 72.36  ? 387 PRO A CB    1 
ATOM 2450 C CG    . PRO A 1 312 ? 86.968  58.197  57.482  1.00 59.84  ? 387 PRO A CG    1 
ATOM 2451 C CD    . PRO A 1 312 ? 86.808  57.395  56.249  1.00 60.75  ? 387 PRO A CD    1 
ATOM 2452 N N     . SER A 1 313 ? 85.587  55.587  58.883  1.00 66.60  ? 388 SER A N     1 
ATOM 2453 C CA    . SER A 1 313 ? 84.642  54.983  59.800  1.00 73.34  ? 388 SER A CA    1 
ATOM 2454 C C     . SER A 1 313 ? 84.752  53.470  59.757  1.00 74.04  ? 388 SER A C     1 
ATOM 2455 O O     . SER A 1 313 ? 84.740  52.808  60.802  1.00 64.16  ? 388 SER A O     1 
ATOM 2456 C CB    . SER A 1 313 ? 83.229  55.441  59.444  1.00 77.26  ? 388 SER A CB    1 
ATOM 2457 O OG    . SER A 1 313 ? 83.213  56.828  59.134  1.00 86.36  ? 388 SER A OG    1 
ATOM 2458 N N     . ILE A 1 314 ? 84.882  52.905  58.555  1.00 72.72  ? 389 ILE A N     1 
ATOM 2459 C CA    . ILE A 1 314 ? 84.946  51.450  58.430  1.00 70.47  ? 389 ILE A CA    1 
ATOM 2460 C C     . ILE A 1 314 ? 86.079  50.901  59.278  1.00 76.16  ? 389 ILE A C     1 
ATOM 2461 O O     . ILE A 1 314 ? 85.867  50.043  60.141  1.00 79.00  ? 389 ILE A O     1 
ATOM 2462 C CB    . ILE A 1 314 ? 85.093  51.025  56.962  1.00 62.69  ? 389 ILE A CB    1 
ATOM 2463 C CG1   . ILE A 1 314 ? 83.749  51.177  56.242  1.00 66.84  ? 389 ILE A CG1   1 
ATOM 2464 C CG2   . ILE A 1 314 ? 85.570  49.618  56.898  1.00 47.28  ? 389 ILE A CG2   1 
ATOM 2465 C CD1   . ILE A 1 314 ? 83.724  50.673  54.823  1.00 61.11  ? 389 ILE A CD1   1 
ATOM 2466 N N     . LEU A 1 315 ? 87.299  51.403  59.064  1.00 70.64  ? 390 LEU A N     1 
ATOM 2467 C CA    . LEU A 1 315 ? 88.385  50.991  59.943  1.00 69.22  ? 390 LEU A CA    1 
ATOM 2468 C C     . LEU A 1 315 ? 88.127  51.440  61.367  1.00 65.12  ? 390 LEU A C     1 
ATOM 2469 O O     . LEU A 1 315 ? 88.601  50.797  62.312  1.00 58.02  ? 390 LEU A O     1 
ATOM 2470 C CB    . LEU A 1 315 ? 89.718  51.523  59.441  1.00 62.02  ? 390 LEU A CB    1 
ATOM 2471 C CG    . LEU A 1 315 ? 89.527  52.601  58.385  1.00 80.57  ? 390 LEU A CG    1 
ATOM 2472 C CD1   . LEU A 1 315 ? 90.304  53.846  58.824  1.00 91.86  ? 390 LEU A CD1   1 
ATOM 2473 C CD2   . LEU A 1 315 ? 89.928  52.125  56.960  1.00 51.83  ? 390 LEU A CD2   1 
ATOM 2474 N N     . LYS A 1 316 ? 87.356  52.519  61.547  1.00 59.71  ? 391 LYS A N     1 
ATOM 2475 C CA    . LYS A 1 316 ? 86.959  52.864  62.904  1.00 68.45  ? 391 LYS A CA    1 
ATOM 2476 C C     . LYS A 1 316 ? 86.120  51.750  63.493  1.00 72.85  ? 391 LYS A C     1 
ATOM 2477 O O     . LYS A 1 316 ? 86.274  51.419  64.673  1.00 69.13  ? 391 LYS A O     1 
ATOM 2478 C CB    . LYS A 1 316 ? 86.212  54.198  62.977  1.00 59.60  ? 391 LYS A CB    1 
ATOM 2479 C CG    . LYS A 1 316 ? 85.842  54.609  64.428  1.00 51.96  ? 391 LYS A CG    1 
ATOM 2480 C CD    . LYS A 1 316 ? 85.461  56.107  64.514  1.00 92.53  ? 391 LYS A CD    1 
ATOM 2481 C CE    . LYS A 1 316 ? 84.049  56.395  65.105  1.00 84.77  ? 391 LYS A CE    1 
ATOM 2482 N NZ    . LYS A 1 316 ? 83.986  56.479  66.599  1.00 100.65 ? 391 LYS A NZ    1 
ATOM 2483 N N     . VAL A 1 317 ? 85.277  51.109  62.670  1.00 70.97  ? 392 VAL A N     1 
ATOM 2484 C CA    . VAL A 1 317 ? 84.540  49.941  63.153  1.00 65.47  ? 392 VAL A CA    1 
ATOM 2485 C C     . VAL A 1 317 ? 85.505  48.818  63.493  1.00 63.16  ? 392 VAL A C     1 
ATOM 2486 O O     . VAL A 1 317 ? 85.468  48.267  64.597  1.00 68.09  ? 392 VAL A O     1 
ATOM 2487 C CB    . VAL A 1 317 ? 83.484  49.478  62.136  1.00 64.82  ? 392 VAL A CB    1 
ATOM 2488 C CG1   . VAL A 1 317 ? 82.386  48.744  62.848  1.00 49.21  ? 392 VAL A CG1   1 
ATOM 2489 C CG2   . VAL A 1 317 ? 82.891  50.647  61.416  1.00 74.22  ? 392 VAL A CG2   1 
ATOM 2490 N N     . LYS A 1 318 ? 86.407  48.486  62.565  1.00 60.23  ? 393 LYS A N     1 
ATOM 2491 C CA    . LYS A 1 318 ? 87.403  47.456  62.843  1.00 70.83  ? 393 LYS A CA    1 
ATOM 2492 C C     . LYS A 1 318 ? 88.172  47.741  64.134  1.00 76.89  ? 393 LYS A C     1 
ATOM 2493 O O     . LYS A 1 318 ? 88.691  46.816  64.774  1.00 74.32  ? 393 LYS A O     1 
ATOM 2494 C CB    . LYS A 1 318 ? 88.372  47.328  61.661  1.00 66.21  ? 393 LYS A CB    1 
ATOM 2495 C CG    . LYS A 1 318 ? 87.730  47.545  60.288  1.00 71.60  ? 393 LYS A CG    1 
ATOM 2496 C CD    . LYS A 1 318 ? 88.645  47.183  59.092  1.00 72.79  ? 393 LYS A CD    1 
ATOM 2497 C CE    . LYS A 1 318 ? 88.486  45.704  58.695  1.00 94.61  ? 393 LYS A CE    1 
ATOM 2498 N NZ    . LYS A 1 318 ? 89.226  45.284  57.464  1.00 104.56 ? 393 LYS A NZ    1 
ATOM 2499 N N     . GLU A 1 319 ? 88.290  49.010  64.514  1.00 65.76  ? 394 GLU A N     1 
ATOM 2500 C CA    . GLU A 1 319 ? 89.033  49.353  65.710  1.00 57.35  ? 394 GLU A CA    1 
ATOM 2501 C C     . GLU A 1 319 ? 88.239  49.319  66.991  1.00 58.08  ? 394 GLU A C     1 
ATOM 2502 O O     . GLU A 1 319 ? 88.845  49.146  68.051  1.00 60.66  ? 394 GLU A O     1 
ATOM 2503 C CB    . GLU A 1 319 ? 89.696  50.683  65.495  1.00 52.79  ? 394 GLU A CB    1 
ATOM 2504 C CG    . GLU A 1 319 ? 90.830  50.340  64.592  1.00 91.32  ? 394 GLU A CG    1 
ATOM 2505 C CD    . GLU A 1 319 ? 91.579  51.505  64.069  1.00 117.51 ? 394 GLU A CD    1 
ATOM 2506 O OE1   . GLU A 1 319 ? 91.092  52.085  63.068  1.00 127.64 ? 394 GLU A OE1   1 
ATOM 2507 O OE2   . GLU A 1 319 ? 92.657  51.820  64.646  1.00 106.50 ? 394 GLU A OE2   1 
ATOM 2508 N N     . ILE A 1 320 ? 86.918  49.518  66.932  1.00 63.48  ? 395 ILE A N     1 
ATOM 2509 C CA    . ILE A 1 320 ? 86.054  49.154  68.063  1.00 67.07  ? 395 ILE A CA    1 
ATOM 2510 C C     . ILE A 1 320 ? 86.190  47.674  68.356  1.00 77.38  ? 395 ILE A C     1 
ATOM 2511 O O     . ILE A 1 320 ? 86.249  47.245  69.519  1.00 72.06  ? 395 ILE A O     1 
ATOM 2512 C CB    . ILE A 1 320 ? 84.578  49.478  67.762  1.00 56.16  ? 395 ILE A CB    1 
ATOM 2513 C CG1   . ILE A 1 320 ? 84.445  50.434  66.590  1.00 59.89  ? 395 ILE A CG1   1 
ATOM 2514 C CG2   . ILE A 1 320 ? 83.863  49.982  68.988  1.00 51.64  ? 395 ILE A CG2   1 
ATOM 2515 C CD1   . ILE A 1 320 ? 84.417  51.902  66.968  1.00 83.14  ? 395 ILE A CD1   1 
ATOM 2516 N N     . CYS A 1 321 ? 86.209  46.879  67.286  1.00 71.34  ? 396 CYS A N     1 
ATOM 2517 C CA    . CYS A 1 321 ? 86.145  45.430  67.269  1.00 78.39  ? 396 CYS A CA    1 
ATOM 2518 C C     . CYS A 1 321 ? 87.509  44.777  67.227  1.00 84.97  ? 396 CYS A C     1 
ATOM 2519 O O     . CYS A 1 321 ? 87.591  43.564  66.984  1.00 88.78  ? 396 CYS A O     1 
ATOM 2520 C CB    . CYS A 1 321 ? 85.319  44.980  66.077  1.00 77.09  ? 396 CYS A CB    1 
ATOM 2521 S SG    . CYS A 1 321 ? 83.650  45.570  66.230  1.00 78.76  ? 396 CYS A SG    1 
ATOM 2522 N N     . SER A 1 322 ? 88.564  45.577  67.377  1.00 85.18  ? 397 SER A N     1 
ATOM 2523 C CA    . SER A 1 322 ? 89.921  45.078  67.526  1.00 90.55  ? 397 SER A CA    1 
ATOM 2524 C C     . SER A 1 322 ? 89.945  43.981  68.584  1.00 95.01  ? 397 SER A C     1 
ATOM 2525 O O     . SER A 1 322 ? 89.427  44.197  69.693  1.00 90.12  ? 397 SER A O     1 
ATOM 2526 C CB    . SER A 1 322 ? 90.848  46.232  67.939  1.00 114.63 ? 397 SER A CB    1 
ATOM 2527 O OG    . SER A 1 322 ? 90.286  47.053  68.973  1.00 107.64 ? 397 SER A OG    1 
ATOM 2528 N N     . PRO A 1 323 ? 90.509  42.797  68.285  1.00 96.95  ? 398 PRO A N     1 
ATOM 2529 C CA    . PRO A 1 323 ? 90.375  41.673  69.218  1.00 73.24  ? 398 PRO A CA    1 
ATOM 2530 C C     . PRO A 1 323 ? 90.955  42.050  70.571  1.00 79.03  ? 398 PRO A C     1 
ATOM 2531 O O     . PRO A 1 323 ? 91.731  43.003  70.702  1.00 88.04  ? 398 PRO A O     1 
ATOM 2532 C CB    . PRO A 1 323 ? 91.165  40.545  68.542  1.00 50.62  ? 398 PRO A CB    1 
ATOM 2533 C CG    . PRO A 1 323 ? 91.164  40.877  67.114  1.00 50.92  ? 398 PRO A CG    1 
ATOM 2534 C CD    . PRO A 1 323 ? 91.262  42.396  67.080  1.00 77.05  ? 398 PRO A CD    1 
ATOM 2535 N N     . ASP A 1 324 ? 90.501  41.349  71.601  1.00 69.06  ? 399 ASP A N     1 
ATOM 2536 C CA    . ASP A 1 324 ? 90.941  41.666  72.947  1.00 78.76  ? 399 ASP A CA    1 
ATOM 2537 C C     . ASP A 1 324 ? 91.000  40.379  73.731  1.00 89.39  ? 399 ASP A C     1 
ATOM 2538 O O     . ASP A 1 324 ? 90.167  39.490  73.547  1.00 99.84  ? 399 ASP A O     1 
ATOM 2539 C CB    . ASP A 1 324 ? 90.030  42.678  73.660  1.00 102.86 ? 399 ASP A CB    1 
ATOM 2540 C CG    . ASP A 1 324 ? 90.563  43.106  75.060  1.00 117.54 ? 399 ASP A CG    1 
ATOM 2541 O OD1   . ASP A 1 324 ? 91.203  42.291  75.786  1.00 95.24  ? 399 ASP A OD1   1 
ATOM 2542 O OD2   . ASP A 1 324 ? 90.315  44.279  75.441  1.00 124.75 ? 399 ASP A OD2   1 
ATOM 2543 N N     . VAL A 1 325 ? 92.004  40.305  74.605  1.00 120.69 ? 400 VAL A N     1 
ATOM 2544 C CA    . VAL A 1 325 ? 92.251  39.119  75.411  1.00 119.93 ? 400 VAL A CA    1 
ATOM 2545 C C     . VAL A 1 325 ? 91.251  39.033  76.549  1.00 114.11 ? 400 VAL A C     1 
ATOM 2546 O O     . VAL A 1 325 ? 90.855  37.927  76.950  1.00 110.39 ? 400 VAL A O     1 
ATOM 2547 C CB    . VAL A 1 325 ? 93.703  39.129  75.927  1.00 111.59 ? 400 VAL A CB    1 
ATOM 2548 C CG1   . VAL A 1 325 ? 94.488  38.029  75.254  1.00 118.29 ? 400 VAL A CG1   1 
ATOM 2549 C CG2   . VAL A 1 325 ? 94.377  40.523  75.718  1.00 74.35  ? 400 VAL A CG2   1 
ATOM 2550 N N     . GLY A 1 326 ? 90.827  40.189  77.073  1.00 102.77 ? 401 GLY A N     1 
ATOM 2551 C CA    . GLY A 1 326 ? 89.853  40.221  78.147  1.00 112.13 ? 401 GLY A CA    1 
ATOM 2552 C C     . GLY A 1 326 ? 88.463  39.798  77.726  1.00 112.48 ? 401 GLY A C     1 
ATOM 2553 O O     . GLY A 1 326 ? 87.636  39.476  78.592  1.00 108.48 ? 401 GLY A O     1 
ATOM 2554 N N     . ASP A 1 327 ? 88.202  39.764  76.417  1.00 101.47 ? 402 ASP A N     1 
ATOM 2555 C CA    . ASP A 1 327 ? 86.878  39.454  75.900  1.00 91.58  ? 402 ASP A CA    1 
ATOM 2556 C C     . ASP A 1 327 ? 86.388  38.138  76.467  1.00 87.57  ? 402 ASP A C     1 
ATOM 2557 O O     . ASP A 1 327 ? 87.052  37.115  76.315  1.00 96.96  ? 402 ASP A O     1 
ATOM 2558 C CB    . ASP A 1 327 ? 86.920  39.349  74.374  1.00 97.43  ? 402 ASP A CB    1 
ATOM 2559 C CG    . ASP A 1 327 ? 87.146  40.680  73.671  1.00 91.77  ? 402 ASP A CG    1 
ATOM 2560 O OD1   . ASP A 1 327 ? 87.087  41.767  74.313  1.00 69.79  ? 402 ASP A OD1   1 
ATOM 2561 O OD2   . ASP A 1 327 ? 87.358  40.598  72.432  1.00 92.98  ? 402 ASP A OD2   1 
ATOM 2562 N N     . VAL A 1 328 ? 85.215  38.165  77.101  1.00 82.85  ? 403 VAL A N     1 
ATOM 2563 C CA    . VAL A 1 328 ? 84.508  36.928  77.386  1.00 80.63  ? 403 VAL A CA    1 
ATOM 2564 C C     . VAL A 1 328 ? 84.186  36.240  76.043  1.00 92.30  ? 403 VAL A C     1 
ATOM 2565 O O     . VAL A 1 328 ? 84.156  36.878  74.981  1.00 91.94  ? 403 VAL A O     1 
ATOM 2566 C CB    . VAL A 1 328 ? 83.253  37.246  78.220  1.00 88.33  ? 403 VAL A CB    1 
ATOM 2567 C CG1   . VAL A 1 328 ? 82.355  38.210  77.471  1.00 93.45  ? 403 VAL A CG1   1 
ATOM 2568 C CG2   . VAL A 1 328 ? 82.482  35.988  78.600  1.00 102.31 ? 403 VAL A CG2   1 
ATOM 2569 N N     . ALA A 1 329 ? 84.014  34.920  76.070  1.00 76.26  ? 404 ALA A N     1 
ATOM 2570 C CA    . ALA A 1 329 ? 83.993  34.210  74.798  1.00 87.42  ? 404 ALA A CA    1 
ATOM 2571 C C     . ALA A 1 329 ? 82.802  34.584  73.933  1.00 85.97  ? 404 ALA A C     1 
ATOM 2572 O O     . ALA A 1 329 ? 82.880  34.463  72.706  1.00 87.05  ? 404 ALA A O     1 
ATOM 2573 C CB    . ALA A 1 329 ? 84.007  32.707  75.037  1.00 108.28 ? 404 ALA A CB    1 
ATOM 2574 N N     . ASP A 1 330 ? 81.704  35.032  74.540  1.00 87.32  ? 405 ASP A N     1 
ATOM 2575 C CA    . ASP A 1 330 ? 80.567  35.484  73.745  1.00 95.93  ? 405 ASP A CA    1 
ATOM 2576 C C     . ASP A 1 330 ? 80.864  36.822  73.075  1.00 92.12  ? 405 ASP A C     1 
ATOM 2577 O O     . ASP A 1 330 ? 80.467  37.058  71.924  1.00 88.46  ? 405 ASP A O     1 
ATOM 2578 C CB    . ASP A 1 330 ? 79.323  35.576  74.626  1.00 90.64  ? 405 ASP A CB    1 
ATOM 2579 C CG    . ASP A 1 330 ? 79.230  34.427  75.620  1.00 117.50 ? 405 ASP A CG    1 
ATOM 2580 O OD1   . ASP A 1 330 ? 78.640  33.366  75.276  1.00 114.19 ? 405 ASP A OD1   1 
ATOM 2581 O OD2   . ASP A 1 330 ? 79.757  34.592  76.748  1.00 111.63 ? 405 ASP A OD2   1 
ATOM 2582 N N     . ILE A 1 331 ? 81.569  37.710  73.773  1.00 86.00  ? 406 ILE A N     1 
ATOM 2583 C CA    . ILE A 1 331 ? 81.956  38.980  73.164  1.00 87.72  ? 406 ILE A CA    1 
ATOM 2584 C C     . ILE A 1 331 ? 82.938  38.752  72.031  1.00 75.54  ? 406 ILE A C     1 
ATOM 2585 O O     . ILE A 1 331 ? 82.732  39.205  70.897  1.00 55.34  ? 406 ILE A O     1 
ATOM 2586 C CB    . ILE A 1 331 ? 82.562  39.916  74.217  1.00 81.23  ? 406 ILE A CB    1 
ATOM 2587 C CG1   . ILE A 1 331 ? 81.464  40.657  74.969  1.00 97.13  ? 406 ILE A CG1   1 
ATOM 2588 C CG2   . ILE A 1 331 ? 83.480  40.893  73.543  1.00 68.69  ? 406 ILE A CG2   1 
ATOM 2589 C CD1   . ILE A 1 331 ? 81.989  41.407  76.141  1.00 111.52 ? 406 ILE A CD1   1 
ATOM 2590 N N     . ALA A 1 332 ? 84.024  38.046  72.337  1.00 82.16  ? 407 ALA A N     1 
ATOM 2591 C CA    . ALA A 1 332 ? 85.090  37.859  71.379  1.00 78.25  ? 407 ALA A CA    1 
ATOM 2592 C C     . ALA A 1 332 ? 84.517  37.467  70.041  1.00 83.84  ? 407 ALA A C     1 
ATOM 2593 O O     . ALA A 1 332 ? 84.966  37.964  69.001  1.00 84.61  ? 407 ALA A O     1 
ATOM 2594 C CB    . ALA A 1 332 ? 86.041  36.787  71.888  1.00 90.14  ? 407 ALA A CB    1 
ATOM 2595 N N     . LYS A 1 333 ? 83.473  36.623  70.058  1.00 79.40  ? 408 LYS A N     1 
ATOM 2596 C CA    . LYS A 1 333 ? 82.898  36.136  68.810  1.00 73.99  ? 408 LYS A CA    1 
ATOM 2597 C C     . LYS A 1 333 ? 82.298  37.269  68.009  1.00 85.89  ? 408 LYS A C     1 
ATOM 2598 O O     . LYS A 1 333 ? 82.549  37.390  66.800  1.00 78.73  ? 408 LYS A O     1 
ATOM 2599 C CB    . LYS A 1 333 ? 81.831  35.077  69.054  1.00 76.79  ? 408 LYS A CB    1 
ATOM 2600 C CG    . LYS A 1 333 ? 81.618  34.222  67.766  1.00 97.43  ? 408 LYS A CG    1 
ATOM 2601 C CD    . LYS A 1 333 ? 80.170  33.779  67.547  1.00 95.78  ? 408 LYS A CD    1 
ATOM 2602 C CE    . LYS A 1 333 ? 79.969  32.263  67.626  1.00 98.37  ? 408 LYS A CE    1 
ATOM 2603 N NZ    . LYS A 1 333 ? 78.624  31.906  68.243  1.00 92.60  ? 408 LYS A NZ    1 
ATOM 2604 N N     . LEU A 1 334 ? 81.487  38.106  68.664  1.00 89.78  ? 409 LEU A N     1 
ATOM 2605 C CA    . LEU A 1 334 ? 80.871  39.211  67.946  1.00 73.84  ? 409 LEU A CA    1 
ATOM 2606 C C     . LEU A 1 334 ? 81.929  40.014  67.200  1.00 74.31  ? 409 LEU A C     1 
ATOM 2607 O O     . LEU A 1 334 ? 81.847  40.170  65.973  1.00 67.39  ? 409 LEU A O     1 
ATOM 2608 C CB    . LEU A 1 334 ? 80.080  40.078  68.909  1.00 59.45  ? 409 LEU A CB    1 
ATOM 2609 C CG    . LEU A 1 334 ? 79.077  41.054  68.263  1.00 74.09  ? 409 LEU A CG    1 
ATOM 2610 C CD1   . LEU A 1 334 ? 78.827  40.826  66.759  1.00 62.18  ? 409 LEU A CD1   1 
ATOM 2611 C CD2   . LEU A 1 334 ? 77.741  41.048  69.020  1.00 68.50  ? 409 LEU A CD2   1 
ATOM 2612 N N     . LYS A 1 335 ? 82.987  40.435  67.913  1.00 67.00  ? 410 LYS A N     1 
ATOM 2613 C CA    . LYS A 1 335 ? 84.015  41.270  67.300  1.00 73.65  ? 410 LYS A CA    1 
ATOM 2614 C C     . LYS A 1 335 ? 84.436  40.720  65.953  1.00 76.20  ? 410 LYS A C     1 
ATOM 2615 O O     . LYS A 1 335 ? 84.606  41.472  64.987  1.00 75.26  ? 410 LYS A O     1 
ATOM 2616 C CB    . LYS A 1 335 ? 85.230  41.390  68.218  1.00 84.37  ? 410 LYS A CB    1 
ATOM 2617 C CG    . LYS A 1 335 ? 84.919  42.095  69.526  1.00 82.09  ? 410 LYS A CG    1 
ATOM 2618 C CD    . LYS A 1 335 ? 86.021  43.070  69.922  1.00 77.48  ? 410 LYS A CD    1 
ATOM 2619 C CE    . LYS A 1 335 ? 85.764  43.673  71.293  1.00 65.88  ? 410 LYS A CE    1 
ATOM 2620 N NZ    . LYS A 1 335 ? 86.897  44.569  71.696  1.00 89.29  ? 410 LYS A NZ    1 
ATOM 2621 N N     . VAL A 1 336 ? 84.576  39.405  65.856  1.00 66.06  ? 411 VAL A N     1 
ATOM 2622 C CA    . VAL A 1 336 ? 85.035  38.867  64.591  1.00 75.82  ? 411 VAL A CA    1 
ATOM 2623 C C     . VAL A 1 336 ? 83.886  38.702  63.631  1.00 74.06  ? 411 VAL A C     1 
ATOM 2624 O O     . VAL A 1 336 ? 84.047  38.853  62.404  1.00 63.46  ? 411 VAL A O     1 
ATOM 2625 C CB    . VAL A 1 336 ? 85.780  37.558  64.821  1.00 73.65  ? 411 VAL A CB    1 
ATOM 2626 C CG1   . VAL A 1 336 ? 86.625  37.279  63.618  1.00 71.56  ? 411 VAL A CG1   1 
ATOM 2627 C CG2   . VAL A 1 336 ? 86.613  37.686  66.091  1.00 86.05  ? 411 VAL A CG2   1 
ATOM 2628 N N     . ASN A 1 337 ? 82.717  38.382  64.166  1.00 68.09  ? 412 ASN A N     1 
ATOM 2629 C CA    . ASN A 1 337 ? 81.550  38.308  63.317  1.00 62.62  ? 412 ASN A CA    1 
ATOM 2630 C C     . ASN A 1 337 ? 81.269  39.645  62.689  1.00 80.22  ? 412 ASN A C     1 
ATOM 2631 O O     . ASN A 1 337 ? 80.799  39.711  61.547  1.00 80.17  ? 412 ASN A O     1 
ATOM 2632 C CB    . ASN A 1 337 ? 80.373  37.848  64.128  1.00 69.73  ? 412 ASN A CB    1 
ATOM 2633 C CG    . ASN A 1 337 ? 80.328  36.384  64.231  1.00 85.39  ? 412 ASN A CG    1 
ATOM 2634 O OD1   . ASN A 1 337 ? 81.099  35.776  64.981  1.00 91.75  ? 412 ASN A OD1   1 
ATOM 2635 N ND2   . ASN A 1 337 ? 79.444  35.773  63.446  1.00 95.70  ? 412 ASN A ND2   1 
ATOM 2636 N N     . ILE A 1 338 ? 81.588  40.718  63.408  1.00 74.14  ? 413 ILE A N     1 
ATOM 2637 C CA    . ILE A 1 338 ? 81.482  42.046  62.849  1.00 59.00  ? 413 ILE A CA    1 
ATOM 2638 C C     . ILE A 1 338 ? 82.576  42.209  61.819  1.00 70.88  ? 413 ILE A C     1 
ATOM 2639 O O     . ILE A 1 338 ? 82.281  42.315  60.624  1.00 68.94  ? 413 ILE A O     1 
ATOM 2640 C CB    . ILE A 1 338 ? 81.602  43.114  63.923  1.00 56.87  ? 413 ILE A CB    1 
ATOM 2641 C CG1   . ILE A 1 338 ? 80.279  43.278  64.622  1.00 54.47  ? 413 ILE A CG1   1 
ATOM 2642 C CG2   . ILE A 1 338 ? 81.957  44.405  63.292  1.00 70.02  ? 413 ILE A CG2   1 
ATOM 2643 C CD1   . ILE A 1 338 ? 80.383  44.241  65.738  1.00 53.60  ? 413 ILE A CD1   1 
ATOM 2644 N N     . ILE A 1 339 ? 83.840  42.203  62.265  1.00 64.49  ? 414 ILE A N     1 
ATOM 2645 C CA    . ILE A 1 339 ? 84.914  42.592  61.354  1.00 74.11  ? 414 ILE A CA    1 
ATOM 2646 C C     . ILE A 1 339 ? 84.746  41.853  60.035  1.00 75.25  ? 414 ILE A C     1 
ATOM 2647 O O     . ILE A 1 339 ? 84.693  42.469  58.962  1.00 76.25  ? 414 ILE A O     1 
ATOM 2648 C CB    . ILE A 1 339 ? 86.313  42.372  61.981  1.00 69.31  ? 414 ILE A CB    1 
ATOM 2649 C CG1   . ILE A 1 339 ? 86.606  40.907  62.303  1.00 87.09  ? 414 ILE A CG1   1 
ATOM 2650 C CG2   . ILE A 1 339 ? 86.519  43.229  63.245  1.00 77.84  ? 414 ILE A CG2   1 
ATOM 2651 C CD1   . ILE A 1 339 ? 87.740  40.713  63.341  1.00 100.82 ? 414 ILE A CD1   1 
ATOM 2652 N N     . LYS A 1 340 ? 84.526  40.541  60.109  1.00 64.23  ? 415 LYS A N     1 
ATOM 2653 C CA    . LYS A 1 340 ? 84.326  39.770  58.898  1.00 67.84  ? 415 LYS A CA    1 
ATOM 2654 C C     . LYS A 1 340 ? 83.256  40.415  58.046  1.00 65.95  ? 415 LYS A C     1 
ATOM 2655 O O     . LYS A 1 340 ? 83.440  40.677  56.849  1.00 54.48  ? 415 LYS A O     1 
ATOM 2656 C CB    . LYS A 1 340 ? 83.922  38.352  59.277  1.00 79.65  ? 415 LYS A CB    1 
ATOM 2657 C CG    . LYS A 1 340 ? 83.576  37.460  58.087  1.00 86.13  ? 415 LYS A CG    1 
ATOM 2658 C CD    . LYS A 1 340 ? 82.330  36.605  58.352  1.00 82.15  ? 415 LYS A CD    1 
ATOM 2659 C CE    . LYS A 1 340 ? 82.151  36.246  59.839  1.00 92.52  ? 415 LYS A CE    1 
ATOM 2660 N NZ    . LYS A 1 340 ? 81.154  37.132  60.545  1.00 81.72  ? 415 LYS A NZ    1 
ATOM 2661 N N     . ASN A 1 341 ? 82.140  40.722  58.690  1.00 61.96  ? 416 ASN A N     1 
ATOM 2662 C CA    . ASN A 1 341 ? 80.985  41.253  57.998  1.00 59.33  ? 416 ASN A CA    1 
ATOM 2663 C C     . ASN A 1 341 ? 81.296  42.601  57.370  1.00 69.66  ? 416 ASN A C     1 
ATOM 2664 O O     . ASN A 1 341 ? 80.910  42.879  56.225  1.00 58.79  ? 416 ASN A O     1 
ATOM 2665 C CB    . ASN A 1 341 ? 79.863  41.369  59.008  1.00 63.39  ? 416 ASN A CB    1 
ATOM 2666 C CG    . ASN A 1 341 ? 78.918  40.241  58.925  1.00 54.39  ? 416 ASN A CG    1 
ATOM 2667 O OD1   . ASN A 1 341 ? 78.850  39.601  57.907  1.00 36.94  ? 416 ASN A OD1   1 
ATOM 2668 N ND2   . ASN A 1 341 ? 78.141  40.012  59.984  1.00 64.24  ? 416 ASN A ND2   1 
ATOM 2669 N N     . VAL A 1 342 ? 81.975  43.458  58.134  1.00 74.07  ? 417 VAL A N     1 
ATOM 2670 C CA    . VAL A 1 342 ? 82.487  44.721  57.623  1.00 70.53  ? 417 VAL A CA    1 
ATOM 2671 C C     . VAL A 1 342 ? 83.210  44.504  56.313  1.00 77.65  ? 417 VAL A C     1 
ATOM 2672 O O     . VAL A 1 342 ? 83.069  45.285  55.363  1.00 73.10  ? 417 VAL A O     1 
ATOM 2673 C CB    . VAL A 1 342 ? 83.428  45.347  58.657  1.00 78.02  ? 417 VAL A CB    1 
ATOM 2674 C CG1   . VAL A 1 342 ? 84.021  46.638  58.093  1.00 79.85  ? 417 VAL A CG1   1 
ATOM 2675 C CG2   . VAL A 1 342 ? 82.704  45.524  60.001  1.00 65.93  ? 417 VAL A CG2   1 
ATOM 2676 N N     . ARG A 1 343 ? 84.018  43.449  56.252  1.00 75.65  ? 418 ARG A N     1 
ATOM 2677 C CA    . ARG A 1 343 ? 84.721  43.121  55.022  1.00 76.87  ? 418 ARG A CA    1 
ATOM 2678 C C     . ARG A 1 343 ? 83.748  42.702  53.935  1.00 72.17  ? 418 ARG A C     1 
ATOM 2679 O O     . ARG A 1 343 ? 83.729  43.275  52.839  1.00 64.60  ? 418 ARG A O     1 
ATOM 2680 C CB    . ARG A 1 343 ? 85.719  42.001  55.284  1.00 89.25  ? 418 ARG A CB    1 
ATOM 2681 C CG    . ARG A 1 343 ? 87.180  42.391  55.206  1.00 100.98 ? 418 ARG A CG    1 
ATOM 2682 C CD    . ARG A 1 343 ? 87.988  41.190  54.740  1.00 98.08  ? 418 ARG A CD    1 
ATOM 2683 N NE    . ARG A 1 343 ? 87.471  40.631  53.483  1.00 73.86  ? 418 ARG A NE    1 
ATOM 2684 C CZ    . ARG A 1 343 ? 86.895  39.442  53.358  1.00 71.28  ? 418 ARG A CZ    1 
ATOM 2685 N NH1   . ARG A 1 343 ? 86.741  38.648  54.422  1.00 66.51  ? 418 ARG A NH1   1 
ATOM 2686 N NH2   . ARG A 1 343 ? 86.485  39.046  52.159  1.00 79.07  ? 418 ARG A NH2   1 
ATOM 2687 N N     . ILE A 1 344 ? 82.930  41.687  54.219  1.00 70.23  ? 419 ILE A N     1 
ATOM 2688 C CA    . ILE A 1 344 ? 82.217  41.030  53.129  1.00 75.01  ? 419 ILE A CA    1 
ATOM 2689 C C     . ILE A 1 344 ? 80.887  41.682  52.808  1.00 72.39  ? 419 ILE A C     1 
ATOM 2690 O O     . ILE A 1 344 ? 80.323  41.392  51.740  1.00 64.73  ? 419 ILE A O     1 
ATOM 2691 C CB    . ILE A 1 344 ? 82.017  39.532  53.426  1.00 71.18  ? 419 ILE A CB    1 
ATOM 2692 C CG1   . ILE A 1 344 ? 80.911  39.332  54.441  1.00 57.83  ? 419 ILE A CG1   1 
ATOM 2693 C CG2   . ILE A 1 344 ? 83.305  38.921  53.958  1.00 75.97  ? 419 ILE A CG2   1 
ATOM 2694 C CD1   . ILE A 1 344 ? 81.298  38.414  55.590  1.00 60.78  ? 419 ILE A CD1   1 
ATOM 2695 N N     . ILE A 1 345 ? 80.374  42.567  53.684  1.00 76.92  ? 420 ILE A N     1 
ATOM 2696 C CA    . ILE A 1 345 ? 79.104  43.255  53.444  1.00 56.51  ? 420 ILE A CA    1 
ATOM 2697 C C     . ILE A 1 345 ? 79.338  44.673  53.005  1.00 55.22  ? 420 ILE A C     1 
ATOM 2698 O O     . ILE A 1 345 ? 78.824  45.082  51.957  1.00 63.31  ? 420 ILE A O     1 
ATOM 2699 C CB    . ILE A 1 345 ? 78.158  43.309  54.644  1.00 55.29  ? 420 ILE A CB    1 
ATOM 2700 C CG1   . ILE A 1 345 ? 77.998  41.930  55.304  1.00 50.27  ? 420 ILE A CG1   1 
ATOM 2701 C CG2   . ILE A 1 345 ? 76.836  43.932  54.138  1.00 51.80  ? 420 ILE A CG2   1 
ATOM 2702 C CD1   . ILE A 1 345 ? 76.887  41.815  56.324  1.00 39.50  ? 420 ILE A CD1   1 
ATOM 2703 N N     . TRP A 1 346 ? 80.024  45.447  53.870  1.00 63.64  ? 421 TRP A N     1 
ATOM 2704 C CA    . TRP A 1 346 ? 80.226  46.892  53.664  1.00 59.65  ? 421 TRP A CA    1 
ATOM 2705 C C     . TRP A 1 346 ? 81.337  47.139  52.654  1.00 61.60  ? 421 TRP A C     1 
ATOM 2706 O O     . TRP A 1 346 ? 81.050  47.458  51.498  1.00 58.66  ? 421 TRP A O     1 
ATOM 2707 C CB    . TRP A 1 346 ? 80.526  47.600  54.998  1.00 64.69  ? 421 TRP A CB    1 
ATOM 2708 C CG    . TRP A 1 346 ? 80.367  49.158  55.032  1.00 61.85  ? 421 TRP A CG    1 
ATOM 2709 C CD1   . TRP A 1 346 ? 80.085  49.990  53.990  1.00 69.80  ? 421 TRP A CD1   1 
ATOM 2710 C CD2   . TRP A 1 346 ? 80.500  50.012  56.180  1.00 47.47  ? 421 TRP A CD2   1 
ATOM 2711 N NE1   . TRP A 1 346 ? 80.036  51.306  54.419  1.00 51.99  ? 421 TRP A NE1   1 
ATOM 2712 C CE2   . TRP A 1 346 ? 80.279  51.331  55.758  1.00 35.94  ? 421 TRP A CE2   1 
ATOM 2713 C CE3   . TRP A 1 346 ? 80.754  49.777  57.526  1.00 55.75  ? 421 TRP A CE3   1 
ATOM 2714 C CZ2   . TRP A 1 346 ? 80.309  52.385  56.613  1.00 57.82  ? 421 TRP A CZ2   1 
ATOM 2715 C CZ3   . TRP A 1 346 ? 80.800  50.841  58.378  1.00 52.79  ? 421 TRP A CZ3   1 
ATOM 2716 C CH2   . TRP A 1 346 ? 80.578  52.123  57.926  1.00 64.59  ? 421 TRP A CH2   1 
ATOM 2717 N N     . GLU A 1 347 ? 82.607  46.892  53.047  1.00 70.29  ? 422 GLU A N     1 
ATOM 2718 C CA    . GLU A 1 347 ? 83.743  47.207  52.175  1.00 57.98  ? 422 GLU A CA    1 
ATOM 2719 C C     . GLU A 1 347 ? 83.525  46.692  50.765  1.00 63.25  ? 422 GLU A C     1 
ATOM 2720 O O     . GLU A 1 347 ? 84.006  47.297  49.803  1.00 88.54  ? 422 GLU A O     1 
ATOM 2721 C CB    . GLU A 1 347 ? 85.053  46.619  52.691  1.00 55.22  ? 422 GLU A CB    1 
ATOM 2722 C CG    . GLU A 1 347 ? 85.516  47.013  54.078  1.00 71.51  ? 422 GLU A CG    1 
ATOM 2723 C CD    . GLU A 1 347 ? 86.907  46.425  54.428  1.00 89.69  ? 422 GLU A CD    1 
ATOM 2724 O OE1   . GLU A 1 347 ? 87.574  46.963  55.338  1.00 99.67  ? 422 GLU A OE1   1 
ATOM 2725 O OE2   . GLU A 1 347 ? 87.349  45.429  53.801  1.00 84.88  ? 422 GLU A OE2   1 
ATOM 2726 N N     . GLU A 1 348 ? 82.810  45.582  50.623  1.00 55.51  ? 423 GLU A N     1 
ATOM 2727 C CA    . GLU A 1 348 ? 82.613  44.923  49.342  1.00 80.67  ? 423 GLU A CA    1 
ATOM 2728 C C     . GLU A 1 348 ? 81.330  45.328  48.626  1.00 79.37  ? 423 GLU A C     1 
ATOM 2729 O O     . GLU A 1 348 ? 81.160  44.988  47.449  1.00 87.57  ? 423 GLU A O     1 
ATOM 2730 C CB    . GLU A 1 348 ? 82.643  43.407  49.555  1.00 103.91 ? 423 GLU A CB    1 
ATOM 2731 C CG    . GLU A 1 348 ? 82.820  42.567  48.296  1.00 105.10 ? 423 GLU A CG    1 
ATOM 2732 C CD    . GLU A 1 348 ? 81.784  41.488  48.246  1.00 94.81  ? 423 GLU A CD    1 
ATOM 2733 O OE1   . GLU A 1 348 ? 81.003  41.447  47.264  1.00 88.65  ? 423 GLU A OE1   1 
ATOM 2734 O OE2   . GLU A 1 348 ? 81.728  40.718  49.235  1.00 98.03  ? 423 GLU A OE2   1 
ATOM 2735 N N     . ASN A 1 349 ? 80.423  46.031  49.292  1.00 83.29  ? 424 ASN A N     1 
ATOM 2736 C CA    . ASN A 1 349 ? 79.375  46.780  48.602  1.00 88.94  ? 424 ASN A CA    1 
ATOM 2737 C C     . ASN A 1 349 ? 79.767  48.240  48.363  1.00 84.84  ? 424 ASN A C     1 
ATOM 2738 O O     . ASN A 1 349 ? 78.902  49.051  48.008  1.00 75.99  ? 424 ASN A O     1 
ATOM 2739 C CB    . ASN A 1 349 ? 78.048  46.684  49.351  1.00 69.09  ? 424 ASN A CB    1 
ATOM 2740 C CG    . ASN A 1 349 ? 77.223  45.536  48.864  1.00 71.55  ? 424 ASN A CG    1 
ATOM 2741 O OD1   . ASN A 1 349 ? 76.802  45.536  47.710  1.00 60.56  ? 424 ASN A OD1   1 
ATOM 2742 N ND2   . ASN A 1 349 ? 77.012  44.531  49.717  1.00 68.06  ? 424 ASN A ND2   1 
ATOM 2743 N N     . LEU A 1 350 ? 81.035  48.589  48.617  1.00 71.58  ? 425 LEU A N     1 
ATOM 2744 C CA    . LEU A 1 350 ? 81.571  49.914  48.352  1.00 71.39  ? 425 LEU A CA    1 
ATOM 2745 C C     . LEU A 1 350 ? 81.784  50.122  46.848  1.00 87.11  ? 425 LEU A C     1 
ATOM 2746 O O     . LEU A 1 350 ? 81.531  49.233  46.017  1.00 64.21  ? 425 LEU A O     1 
ATOM 2747 C CB    . LEU A 1 350 ? 82.878  50.118  49.110  1.00 54.05  ? 425 LEU A CB    1 
ATOM 2748 C CG    . LEU A 1 350 ? 82.753  50.403  50.595  1.00 58.55  ? 425 LEU A CG    1 
ATOM 2749 C CD1   . LEU A 1 350 ? 84.132  50.547  51.183  1.00 63.00  ? 425 LEU A CD1   1 
ATOM 2750 C CD2   . LEU A 1 350 ? 81.901  51.643  50.892  1.00 62.20  ? 425 LEU A CD2   1 
ATOM 2751 N N     . SER A 1 351 ? 82.279  51.321  46.505  1.00 74.69  ? 426 SER A N     1 
ATOM 2752 C CA    . SER A 1 351 ? 82.399  51.778  45.131  1.00 63.82  ? 426 SER A CA    1 
ATOM 2753 C C     . SER A 1 351 ? 83.688  52.569  44.989  1.00 79.84  ? 426 SER A C     1 
ATOM 2754 O O     . SER A 1 351 ? 84.402  52.782  45.970  1.00 92.03  ? 426 SER A O     1 
ATOM 2755 C CB    . SER A 1 351 ? 81.189  52.628  44.742  1.00 76.83  ? 426 SER A CB    1 
ATOM 2756 O OG    . SER A 1 351 ? 81.579  53.677  43.874  1.00 98.31  ? 426 SER A OG    1 
ATOM 2757 N N     . ILE A 1 352 ? 83.974  53.043  43.765  1.00 75.80  ? 427 ILE A N     1 
ATOM 2758 C CA    . ILE A 1 352 ? 85.136  53.911  43.566  1.00 72.02  ? 427 ILE A CA    1 
ATOM 2759 C C     . ILE A 1 352 ? 84.886  55.321  44.128  1.00 81.70  ? 427 ILE A C     1 
ATOM 2760 O O     . ILE A 1 352 ? 85.764  55.901  44.784  1.00 83.39  ? 427 ILE A O     1 
ATOM 2761 C CB    . ILE A 1 352 ? 85.542  53.936  42.085  1.00 71.87  ? 427 ILE A CB    1 
ATOM 2762 C CG1   . ILE A 1 352 ? 86.185  52.580  41.694  1.00 102.06 ? 427 ILE A CG1   1 
ATOM 2763 C CG2   . ILE A 1 352 ? 86.494  55.116  41.804  1.00 52.48  ? 427 ILE A CG2   1 
ATOM 2764 C CD1   . ILE A 1 352 ? 85.245  51.493  41.050  1.00 74.75  ? 427 ILE A CD1   1 
ATOM 2765 N N     . TRP A 1 353 ? 83.680  55.876  43.949  1.00 69.95  ? 428 TRP A N     1 
ATOM 2766 C CA    . TRP A 1 353 ? 83.430  57.198  44.511  1.00 64.58  ? 428 TRP A CA    1 
ATOM 2767 C C     . TRP A 1 353 ? 83.787  57.244  45.980  1.00 69.56  ? 428 TRP A C     1 
ATOM 2768 O O     . TRP A 1 353 ? 84.066  58.319  46.513  1.00 63.60  ? 428 TRP A O     1 
ATOM 2769 C CB    . TRP A 1 353 ? 81.971  57.605  44.353  1.00 62.55  ? 428 TRP A CB    1 
ATOM 2770 C CG    . TRP A 1 353 ? 81.452  57.514  42.980  1.00 72.93  ? 428 TRP A CG    1 
ATOM 2771 C CD1   . TRP A 1 353 ? 80.903  56.407  42.377  1.00 78.30  ? 428 TRP A CD1   1 
ATOM 2772 C CD2   . TRP A 1 353 ? 81.409  58.563  42.005  1.00 82.61  ? 428 TRP A CD2   1 
ATOM 2773 N NE1   . TRP A 1 353 ? 80.526  56.705  41.080  1.00 75.06  ? 428 TRP A NE1   1 
ATOM 2774 C CE2   . TRP A 1 353 ? 80.828  58.022  40.828  1.00 92.42  ? 428 TRP A CE2   1 
ATOM 2775 C CE3   . TRP A 1 353 ? 81.819  59.898  41.998  1.00 83.64  ? 428 TRP A CE3   1 
ATOM 2776 C CZ2   . TRP A 1 353 ? 80.643  58.784  39.664  1.00 95.47  ? 428 TRP A CZ2   1 
ATOM 2777 C CZ3   . TRP A 1 353 ? 81.627  60.654  40.831  1.00 97.08  ? 428 TRP A CZ3   1 
ATOM 2778 C CH2   . TRP A 1 353 ? 81.044  60.095  39.691  1.00 93.50  ? 428 TRP A CH2   1 
ATOM 2779 N N     . HIS A 1 354 ? 83.803  56.089  46.639  1.00 64.95  ? 429 HIS A N     1 
ATOM 2780 C CA    . HIS A 1 354 ? 84.059  56.053  48.069  1.00 72.70  ? 429 HIS A CA    1 
ATOM 2781 C C     . HIS A 1 354 ? 85.504  56.324  48.370  1.00 67.74  ? 429 HIS A C     1 
ATOM 2782 O O     . HIS A 1 354 ? 85.816  57.063  49.309  1.00 55.91  ? 429 HIS A O     1 
ATOM 2783 C CB    . HIS A 1 354 ? 83.698  54.695  48.640  1.00 67.69  ? 429 HIS A CB    1 
ATOM 2784 C CG    . HIS A 1 354 ? 82.284  54.598  49.053  1.00 70.97  ? 429 HIS A CG    1 
ATOM 2785 N ND1   . HIS A 1 354 ? 81.357  53.871  48.346  1.00 82.11  ? 429 HIS A ND1   1 
ATOM 2786 C CD2   . HIS A 1 354 ? 81.618  55.177  50.076  1.00 80.02  ? 429 HIS A CD2   1 
ATOM 2787 C CE1   . HIS A 1 354 ? 80.178  53.990  48.931  1.00 92.23  ? 429 HIS A CE1   1 
ATOM 2788 N NE2   . HIS A 1 354 ? 80.308  54.783  49.980  1.00 87.02  ? 429 HIS A NE2   1 
ATOM 2789 N N     . TYR A 1 355 ? 86.392  55.636  47.641  1.00 74.28  ? 430 TYR A N     1 
ATOM 2790 C CA    . TYR A 1 355 ? 87.822  55.685  47.902  1.00 75.69  ? 430 TYR A CA    1 
ATOM 2791 C C     . TYR A 1 355 ? 88.431  56.918  47.297  1.00 76.91  ? 430 TYR A C     1 
ATOM 2792 O O     . TYR A 1 355 ? 89.449  57.405  47.800  1.00 80.62  ? 430 TYR A O     1 
ATOM 2793 C CB    . TYR A 1 355 ? 88.548  54.474  47.332  1.00 71.31  ? 430 TYR A CB    1 
ATOM 2794 C CG    . TYR A 1 355 ? 87.930  53.104  47.572  1.00 78.04  ? 430 TYR A CG    1 
ATOM 2795 C CD1   . TYR A 1 355 ? 87.286  52.423  46.544  1.00 62.52  ? 430 TYR A CD1   1 
ATOM 2796 C CD2   . TYR A 1 355 ? 88.049  52.464  48.799  1.00 89.55  ? 430 TYR A CD2   1 
ATOM 2797 C CE1   . TYR A 1 355 ? 86.756  51.168  46.732  1.00 65.06  ? 430 TYR A CE1   1 
ATOM 2798 C CE2   . TYR A 1 355 ? 87.512  51.188  49.006  1.00 76.48  ? 430 TYR A CE2   1 
ATOM 2799 C CZ    . TYR A 1 355 ? 86.859  50.548  47.968  1.00 88.69  ? 430 TYR A CZ    1 
ATOM 2800 O OH    . TYR A 1 355 ? 86.321  49.277  48.158  1.00 112.20 ? 430 TYR A OH    1 
ATOM 2801 N N     . THR A 1 356 ? 87.834  57.409  46.205  1.00 71.38  ? 431 THR A N     1 
ATOM 2802 C CA    . THR A 1 356 ? 88.170  58.742  45.724  1.00 74.55  ? 431 THR A CA    1 
ATOM 2803 C C     . THR A 1 356 ? 87.767  59.794  46.739  1.00 75.14  ? 431 THR A C     1 
ATOM 2804 O O     . THR A 1 356 ? 88.500  60.757  46.976  1.00 73.60  ? 431 THR A O     1 
ATOM 2805 C CB    . THR A 1 356 ? 87.484  59.031  44.393  1.00 76.35  ? 431 THR A CB    1 
ATOM 2806 O OG1   . THR A 1 356 ? 87.922  58.083  43.415  1.00 84.76  ? 431 THR A OG1   1 
ATOM 2807 C CG2   . THR A 1 356 ? 87.799  60.465  43.930  1.00 50.48  ? 431 THR A CG2   1 
ATOM 2808 N N     . ALA A 1 357 ? 86.601  59.632  47.352  1.00 80.31  ? 432 ALA A N     1 
ATOM 2809 C CA    . ALA A 1 357 ? 86.168  60.668  48.270  1.00 78.04  ? 432 ALA A CA    1 
ATOM 2810 C C     . ALA A 1 357 ? 87.019  60.693  49.527  1.00 83.69  ? 432 ALA A C     1 
ATOM 2811 O O     . ALA A 1 357 ? 87.196  61.763  50.106  1.00 91.72  ? 432 ALA A O     1 
ATOM 2812 C CB    . ALA A 1 357 ? 84.702  60.497  48.625  1.00 84.72  ? 432 ALA A CB    1 
ATOM 2813 N N     . PHE A 1 358 ? 87.567  59.554  49.969  1.00 81.04  ? 433 PHE A N     1 
ATOM 2814 C CA    . PHE A 1 358 ? 88.477  59.627  51.105  1.00 73.76  ? 433 PHE A CA    1 
ATOM 2815 C C     . PHE A 1 358 ? 89.865  60.101  50.717  1.00 83.59  ? 433 PHE A C     1 
ATOM 2816 O O     . PHE A 1 358 ? 90.605  60.591  51.577  1.00 86.51  ? 433 PHE A O     1 
ATOM 2817 C CB    . PHE A 1 358 ? 88.620  58.298  51.795  1.00 73.91  ? 433 PHE A CB    1 
ATOM 2818 C CG    . PHE A 1 358 ? 89.341  58.395  53.094  1.00 81.26  ? 433 PHE A CG    1 
ATOM 2819 C CD1   . PHE A 1 358 ? 89.185  59.520  53.893  1.00 84.93  ? 433 PHE A CD1   1 
ATOM 2820 C CD2   . PHE A 1 358 ? 90.181  57.376  53.522  1.00 75.02  ? 433 PHE A CD2   1 
ATOM 2821 C CE1   . PHE A 1 358 ? 89.847  59.627  55.096  1.00 83.15  ? 433 PHE A CE1   1 
ATOM 2822 C CE2   . PHE A 1 358 ? 90.838  57.475  54.722  1.00 82.39  ? 433 PHE A CE2   1 
ATOM 2823 C CZ    . PHE A 1 358 ? 90.671  58.604  55.513  1.00 87.28  ? 433 PHE A CZ    1 
ATOM 2824 N N     . PHE A 1 359 ? 90.243  59.944  49.453  1.00 83.72  ? 434 PHE A N     1 
ATOM 2825 C CA    . PHE A 1 359 ? 91.415  60.645  48.939  1.00 90.19  ? 434 PHE A CA    1 
ATOM 2826 C C     . PHE A 1 359 ? 91.335  62.135  49.267  1.00 90.33  ? 434 PHE A C     1 
ATOM 2827 O O     . PHE A 1 359 ? 92.270  62.709  49.831  1.00 107.48 ? 434 PHE A O     1 
ATOM 2828 C CB    . PHE A 1 359 ? 91.507  60.403  47.427  1.00 89.78  ? 434 PHE A CB    1 
ATOM 2829 C CG    . PHE A 1 359 ? 92.809  60.830  46.776  1.00 99.17  ? 434 PHE A CG    1 
ATOM 2830 C CD1   . PHE A 1 359 ? 93.442  59.980  45.873  1.00 112.59 ? 434 PHE A CD1   1 
ATOM 2831 C CD2   . PHE A 1 359 ? 93.368  62.082  46.988  1.00 103.37 ? 434 PHE A CD2   1 
ATOM 2832 C CE1   . PHE A 1 359 ? 94.639  60.346  45.227  1.00 103.47 ? 434 PHE A CE1   1 
ATOM 2833 C CE2   . PHE A 1 359 ? 94.559  62.446  46.347  1.00 108.87 ? 434 PHE A CE2   1 
ATOM 2834 C CZ    . PHE A 1 359 ? 95.191  61.573  45.460  1.00 90.37  ? 434 PHE A CZ    1 
ATOM 2835 N N     . PHE A 1 360 ? 90.193  62.757  49.000  1.00 74.46  ? 435 PHE A N     1 
ATOM 2836 C CA    . PHE A 1 360 ? 90.085  64.206  49.013  1.00 75.55  ? 435 PHE A CA    1 
ATOM 2837 C C     . PHE A 1 360 ? 89.956  64.771  50.405  1.00 82.10  ? 435 PHE A C     1 
ATOM 2838 O O     . PHE A 1 360 ? 89.605  65.949  50.540  1.00 92.56  ? 435 PHE A O     1 
ATOM 2839 C CB    . PHE A 1 360 ? 88.902  64.668  48.176  1.00 72.07  ? 435 PHE A CB    1 
ATOM 2840 C CG    . PHE A 1 360 ? 89.106  64.492  46.716  1.00 77.69  ? 435 PHE A CG    1 
ATOM 2841 C CD1   . PHE A 1 360 ? 88.118  64.849  45.826  1.00 82.78  ? 435 PHE A CD1   1 
ATOM 2842 C CD2   . PHE A 1 360 ? 90.277  63.961  46.224  1.00 84.63  ? 435 PHE A CD2   1 
ATOM 2843 C CE1   . PHE A 1 360 ? 88.277  64.724  44.464  1.00 81.67  ? 435 PHE A CE1   1 
ATOM 2844 C CE2   . PHE A 1 360 ? 90.449  63.802  44.857  1.00 85.72  ? 435 PHE A CE2   1 
ATOM 2845 C CZ    . PHE A 1 360 ? 89.438  64.188  43.972  1.00 90.58  ? 435 PHE A CZ    1 
ATOM 2846 N N     . TYR A 1 361 ? 90.106  63.945  51.432  1.00 71.15  ? 436 TYR A N     1 
ATOM 2847 C CA    . TYR A 1 361 ? 90.451  64.467  52.744  1.00 85.88  ? 436 TYR A CA    1 
ATOM 2848 C C     . TYR A 1 361 ? 91.950  64.678  52.722  1.00 98.62  ? 436 TYR A C     1 
ATOM 2849 O O     . TYR A 1 361 ? 92.694  63.706  52.553  1.00 111.17 ? 436 TYR A O     1 
ATOM 2850 C CB    . TYR A 1 361 ? 90.081  63.504  53.861  1.00 87.51  ? 436 TYR A CB    1 
ATOM 2851 C CG    . TYR A 1 361 ? 89.868  64.096  55.262  1.00 76.80  ? 436 TYR A CG    1 
ATOM 2852 C CD1   . TYR A 1 361 ? 88.945  65.103  55.491  1.00 61.24  ? 436 TYR A CD1   1 
ATOM 2853 C CD2   . TYR A 1 361 ? 90.540  63.563  56.374  1.00 92.99  ? 436 TYR A CD2   1 
ATOM 2854 C CE1   . TYR A 1 361 ? 88.724  65.600  56.792  1.00 86.82  ? 436 TYR A CE1   1 
ATOM 2855 C CE2   . TYR A 1 361 ? 90.322  64.041  57.688  1.00 72.98  ? 436 TYR A CE2   1 
ATOM 2856 C CZ    . TYR A 1 361 ? 89.419  65.059  57.885  1.00 91.22  ? 436 TYR A CZ    1 
ATOM 2857 O OH    . TYR A 1 361 ? 89.218  65.540  59.166  1.00 102.03 ? 436 TYR A OH    1 
ATOM 2858 N N     . PRO A 1 362 ? 92.428  65.903  52.836  1.00 96.40  ? 437 PRO A N     1 
ATOM 2859 C CA    . PRO A 1 362 ? 93.839  66.160  52.601  1.00 90.69  ? 437 PRO A CA    1 
ATOM 2860 C C     . PRO A 1 362 ? 94.741  65.399  53.564  1.00 101.23 ? 437 PRO A C     1 
ATOM 2861 O O     . PRO A 1 362 ? 95.801  64.909  53.139  1.00 114.62 ? 437 PRO A O     1 
ATOM 2862 C CB    . PRO A 1 362 ? 93.937  67.677  52.775  1.00 109.88 ? 437 PRO A CB    1 
ATOM 2863 C CG    . PRO A 1 362 ? 92.579  68.136  52.279  1.00 100.51 ? 437 PRO A CG    1 
ATOM 2864 C CD    . PRO A 1 362 ? 91.642  67.146  52.879  1.00 90.45  ? 437 PRO A CD    1 
ATOM 2865 N N     . PRO A 1 363 ? 94.370  65.215  54.872  1.00 77.56  ? 438 PRO A N     1 
ATOM 2866 C CA    . PRO A 1 363 ? 95.205  64.323  55.687  1.00 86.37  ? 438 PRO A CA    1 
ATOM 2867 C C     . PRO A 1 363 ? 94.938  62.857  55.404  1.00 96.56  ? 438 PRO A C     1 
ATOM 2868 O O     . PRO A 1 363 ? 94.892  62.039  56.321  1.00 103.86 ? 438 PRO A O     1 
ATOM 2869 C CB    . PRO A 1 363 ? 94.832  64.703  57.123  1.00 81.60  ? 438 PRO A CB    1 
ATOM 2870 C CG    . PRO A 1 363 ? 93.559  65.350  57.034  1.00 80.10  ? 438 PRO A CG    1 
ATOM 2871 C CD    . PRO A 1 363 ? 93.460  66.003  55.712  1.00 72.16  ? 438 PRO A CD    1 
ATOM 2872 N N     . ALA A 1 364 ? 94.843  62.497  54.130  1.00 107.71 ? 439 ALA A N     1 
ATOM 2873 C CA    . ALA A 1 364 ? 94.961  61.109  53.712  1.00 102.66 ? 439 ALA A CA    1 
ATOM 2874 C C     . ALA A 1 364 ? 96.357  61.021  53.126  1.00 117.80 ? 439 ALA A C     1 
ATOM 2875 O O     . ALA A 1 364 ? 96.628  61.503  52.022  1.00 116.22 ? 439 ALA A O     1 
ATOM 2876 C CB    . ALA A 1 364 ? 93.885  60.690  52.717  1.00 95.72  ? 439 ALA A CB    1 
ATOM 2877 N N     . LEU A 1 365 ? 97.234  60.445  53.926  1.00 113.43 ? 440 LEU A N     1 
ATOM 2878 C CA    . LEU A 1 365 ? 98.571  59.958  53.669  1.00 101.83 ? 440 LEU A CA    1 
ATOM 2879 C C     . LEU A 1 365 ? 98.501  58.520  53.190  1.00 121.80 ? 440 LEU A C     1 
ATOM 2880 O O     . LEU A 1 365 ? 99.080  58.158  52.160  1.00 134.06 ? 440 LEU A O     1 
ATOM 2881 C CB    . LEU A 1 365 ? 99.384  60.073  54.957  1.00 105.22 ? 440 LEU A CB    1 
ATOM 2882 C CG    . LEU A 1 365 ? 98.455  60.191  56.175  1.00 99.82  ? 440 LEU A CG    1 
ATOM 2883 C CD1   . LEU A 1 365 ? 98.892  59.330  57.338  1.00 84.73  ? 440 LEU A CD1   1 
ATOM 2884 C CD2   . LEU A 1 365 ? 98.312  61.635  56.617  1.00 95.14  ? 440 LEU A CD2   1 
ATOM 2885 N N     . HIS A 1 366 ? 97.828  57.701  53.996  1.00 145.37 ? 441 HIS A N     1 
ATOM 2886 C CA    . HIS A 1 366 ? 97.819  56.243  53.982  1.00 155.63 ? 441 HIS A CA    1 
ATOM 2887 C C     . HIS A 1 366 ? 96.899  55.593  52.951  1.00 139.83 ? 441 HIS A C     1 
ATOM 2888 O O     . HIS A 1 366 ? 97.181  54.456  52.556  1.00 137.62 ? 441 HIS A O     1 
ATOM 2889 C CB    . HIS A 1 366 ? 97.416  55.736  55.371  1.00 156.90 ? 441 HIS A CB    1 
ATOM 2890 C CG    . HIS A 1 366 ? 96.123  56.306  55.883  1.00 132.69 ? 441 HIS A CG    1 
ATOM 2891 N ND1   . HIS A 1 366 ? 95.831  57.654  55.853  1.00 130.51 ? 441 HIS A ND1   1 
ATOM 2892 C CD2   . HIS A 1 366 ? 95.057  55.707  56.465  1.00 113.02 ? 441 HIS A CD2   1 
ATOM 2893 C CE1   . HIS A 1 366 ? 94.638  57.857  56.377  1.00 124.02 ? 441 HIS A CE1   1 
ATOM 2894 N NE2   . HIS A 1 366 ? 94.148  56.693  56.760  1.00 116.62 ? 441 HIS A NE2   1 
ATOM 2895 N N     . MET A 1 367 ? 95.852  56.275  52.459  1.00 125.56 ? 442 MET A N     1 
ATOM 2896 C CA    . MET A 1 367 ? 94.805  55.617  51.660  1.00 138.53 ? 442 MET A CA    1 
ATOM 2897 C C     . MET A 1 367 ? 95.442  54.883  50.481  1.00 135.16 ? 442 MET A C     1 
ATOM 2898 O O     . MET A 1 367 ? 94.795  54.077  49.800  1.00 122.70 ? 442 MET A O     1 
ATOM 2899 C CB    . MET A 1 367 ? 93.727  56.626  51.184  1.00 146.21 ? 442 MET A CB    1 
ATOM 2900 C CG    . MET A 1 367 ? 92.838  56.197  49.933  1.00 134.39 ? 442 MET A CG    1 
ATOM 2901 S SD    . MET A 1 367 ? 91.015  55.925  49.988  1.00 125.05 ? 442 MET A SD    1 
ATOM 2902 C CE    . MET A 1 367 ? 90.845  54.454  51.011  1.00 85.96  ? 442 MET A CE    1 
ATOM 2903 N N     . GLN A 1 368 ? 96.753  55.082  50.337  1.00 139.30 ? 443 GLN A N     1 
ATOM 2904 C CA    . GLN A 1 368 ? 97.596  54.735  49.207  1.00 143.71 ? 443 GLN A CA    1 
ATOM 2905 C C     . GLN A 1 368 ? 97.252  53.386  48.586  1.00 150.49 ? 443 GLN A C     1 
ATOM 2906 O O     . GLN A 1 368 ? 96.731  53.344  47.463  1.00 146.14 ? 443 GLN A O     1 
ATOM 2907 C CB    . GLN A 1 368 ? 99.043  54.762  49.706  1.00 140.64 ? 443 GLN A CB    1 
ATOM 2908 C CG    . GLN A 1 368 ? 100.023 53.939  48.911  1.00 161.99 ? 443 GLN A CG    1 
ATOM 2909 C CD    . GLN A 1 368 ? 100.021 54.307  47.448  1.00 178.21 ? 443 GLN A CD    1 
ATOM 2910 O OE1   . GLN A 1 368 ? 100.100 55.488  47.094  1.00 184.86 ? 443 GLN A OE1   1 
ATOM 2911 N NE2   . GLN A 1 368 ? 99.916  53.298  46.584  1.00 168.34 ? 443 GLN A NE2   1 
ATOM 2912 N N     . GLN A 1 369 ? 97.521  52.290  49.303  1.00 157.96 ? 444 GLN A N     1 
ATOM 2913 C CA    . GLN A 1 369 ? 97.252  50.935  48.822  1.00 154.47 ? 444 GLN A CA    1 
ATOM 2914 C C     . GLN A 1 369 ? 97.770  50.743  47.405  1.00 154.26 ? 444 GLN A C     1 
ATOM 2915 O O     . GLN A 1 369 ? 98.832  51.252  47.038  1.00 162.87 ? 444 GLN A O     1 
ATOM 2916 C CB    . GLN A 1 369 ? 95.748  50.630  48.864  1.00 140.75 ? 444 GLN A CB    1 
ATOM 2917 C CG    . GLN A 1 369 ? 95.129  50.825  50.227  1.00 138.91 ? 444 GLN A CG    1 
ATOM 2918 C CD    . GLN A 1 369 ? 96.082  50.416  51.333  1.00 146.59 ? 444 GLN A CD    1 
ATOM 2919 O OE1   . GLN A 1 369 ? 96.783  51.252  51.908  1.00 142.57 ? 444 GLN A OE1   1 
ATOM 2920 N NE2   . GLN A 1 369 ? 96.124  49.124  51.629  1.00 160.32 ? 444 GLN A NE2   1 
ATOM 2921 N N     . GLU A 1 370 ? 97.001  50.020  46.603  1.00 150.89 ? 445 GLU A N     1 
ATOM 2922 C CA    . GLU A 1 370 ? 96.967  50.268  45.175  1.00 141.11 ? 445 GLU A CA    1 
ATOM 2923 C C     . GLU A 1 370 ? 96.151  51.506  44.873  1.00 131.52 ? 445 GLU A C     1 
ATOM 2924 O O     . GLU A 1 370 ? 96.366  52.128  43.829  1.00 116.59 ? 445 GLU A O     1 
ATOM 2925 C CB    . GLU A 1 370 ? 96.338  49.083  44.451  1.00 147.82 ? 445 GLU A CB    1 
ATOM 2926 C CG    . GLU A 1 370 ? 94.808  49.006  44.655  1.00 144.49 ? 445 GLU A CG    1 
ATOM 2927 C CD    . GLU A 1 370 ? 94.397  48.870  46.125  1.00 134.75 ? 445 GLU A CD    1 
ATOM 2928 O OE1   . GLU A 1 370 ? 94.778  47.884  46.781  1.00 154.71 ? 445 GLU A OE1   1 
ATOM 2929 O OE2   . GLU A 1 370 ? 93.708  49.756  46.641  1.00 122.59 ? 445 GLU A OE2   1 
ATOM 2930 N N     . LYS A 1 371 ? 95.313  51.921  45.837  1.00 125.84 ? 446 LYS A N     1 
ATOM 2931 C CA    . LYS A 1 371 ? 94.061  52.619  45.571  1.00 108.15 ? 446 LYS A CA    1 
ATOM 2932 C C     . LYS A 1 371 ? 94.222  53.709  44.534  1.00 107.84 ? 446 LYS A C     1 
ATOM 2933 O O     . LYS A 1 371 ? 93.476  53.761  43.553  1.00 99.94  ? 446 LYS A O     1 
ATOM 2934 C CB    . LYS A 1 371 ? 93.513  53.225  46.866  1.00 106.82 ? 446 LYS A CB    1 
ATOM 2935 C CG    . LYS A 1 371 ? 92.743  52.287  47.790  1.00 119.91 ? 446 LYS A CG    1 
ATOM 2936 C CD    . LYS A 1 371 ? 91.442  51.727  47.191  1.00 87.54  ? 446 LYS A CD    1 
ATOM 2937 C CE    . LYS A 1 371 ? 90.852  50.668  48.126  1.00 91.34  ? 446 LYS A CE    1 
ATOM 2938 N NZ    . LYS A 1 371 ? 91.849  49.669  48.653  1.00 97.15  ? 446 LYS A NZ    1 
ATOM 2939 N N     . VAL A 1 372 ? 95.222  54.573  44.725  1.00 120.53 ? 447 VAL A N     1 
ATOM 2940 C CA    . VAL A 1 372 ? 95.384  55.744  43.871  1.00 113.08 ? 447 VAL A CA    1 
ATOM 2941 C C     . VAL A 1 372 ? 95.601  55.345  42.419  1.00 105.14 ? 447 VAL A C     1 
ATOM 2942 O O     . VAL A 1 372 ? 95.301  56.131  41.509  1.00 94.11  ? 447 VAL A O     1 
ATOM 2943 C CB    . VAL A 1 372 ? 96.509  56.634  44.444  1.00 103.79 ? 447 VAL A CB    1 
ATOM 2944 C CG1   . VAL A 1 372 ? 97.312  55.857  45.479  1.00 105.60 ? 447 VAL A CG1   1 
ATOM 2945 C CG2   . VAL A 1 372 ? 97.388  57.211  43.350  1.00 108.92 ? 447 VAL A CG2   1 
ATOM 2946 N N     . ALA A 1 373 ? 96.064  54.114  42.178  1.00 102.75 ? 448 ALA A N     1 
ATOM 2947 C CA    . ALA A 1 373 ? 96.021  53.539  40.840  1.00 104.44 ? 448 ALA A CA    1 
ATOM 2948 C C     . ALA A 1 373 ? 94.618  53.704  40.255  1.00 114.97 ? 448 ALA A C     1 
ATOM 2949 O O     . ALA A 1 373 ? 94.407  54.531  39.356  1.00 104.04 ? 448 ALA A O     1 
ATOM 2950 C CB    . ALA A 1 373 ? 96.440  52.064  40.871  1.00 88.69  ? 448 ALA A CB    1 
ATOM 2951 N N     . GLN A 1 374 ? 93.646  52.958  40.802  1.00 121.71 ? 449 GLN A N     1 
ATOM 2952 C CA    . GLN A 1 374 ? 92.261  53.072  40.348  1.00 111.09 ? 449 GLN A CA    1 
ATOM 2953 C C     . GLN A 1 374 ? 91.747  54.505  40.458  1.00 106.29 ? 449 GLN A C     1 
ATOM 2954 O O     . GLN A 1 374 ? 90.906  54.913  39.649  1.00 112.84 ? 449 GLN A O     1 
ATOM 2955 C CB    . GLN A 1 374 ? 91.357  52.114  41.142  1.00 112.15 ? 449 GLN A CB    1 
ATOM 2956 C CG    . GLN A 1 374 ? 91.277  50.667  40.605  1.00 129.14 ? 449 GLN A CG    1 
ATOM 2957 C CD    . GLN A 1 374 ? 91.947  49.617  41.511  1.00 134.00 ? 449 GLN A CD    1 
ATOM 2958 O OE1   . GLN A 1 374 ? 92.699  49.946  42.433  1.00 123.54 ? 449 GLN A OE1   1 
ATOM 2959 N NE2   . GLN A 1 374 ? 91.672  48.343  41.236  1.00 128.34 ? 449 GLN A NE2   1 
ATOM 2960 N N     . ILE A 1 375 ? 92.250  55.281  41.436  1.00 99.62  ? 450 ILE A N     1 
ATOM 2961 C CA    . ILE A 1 375 ? 91.763  56.644  41.676  1.00 92.33  ? 450 ILE A CA    1 
ATOM 2962 C C     . ILE A 1 375 ? 92.196  57.565  40.556  1.00 101.65 ? 450 ILE A C     1 
ATOM 2963 O O     . ILE A 1 375 ? 91.393  58.334  40.009  1.00 96.59  ? 450 ILE A O     1 
ATOM 2964 C CB    . ILE A 1 375 ? 92.275  57.188  43.021  1.00 82.06  ? 450 ILE A CB    1 
ATOM 2965 C CG1   . ILE A 1 375 ? 91.860  56.304  44.184  1.00 77.34  ? 450 ILE A CG1   1 
ATOM 2966 C CG2   . ILE A 1 375 ? 91.775  58.591  43.224  1.00 65.43  ? 450 ILE A CG2   1 
ATOM 2967 C CD1   . ILE A 1 375 ? 92.353  56.779  45.495  1.00 70.42  ? 450 ILE A CD1   1 
ATOM 2968 N N     . LYS A 1 376 ? 93.495  57.545  40.255  1.00 108.41 ? 451 LYS A N     1 
ATOM 2969 C CA    . LYS A 1 376 ? 94.049  58.330  39.162  1.00 112.83 ? 451 LYS A CA    1 
ATOM 2970 C C     . LYS A 1 376 ? 93.299  58.040  37.872  1.00 114.09 ? 451 LYS A C     1 
ATOM 2971 O O     . LYS A 1 376 ? 92.762  58.950  37.227  1.00 106.70 ? 451 LYS A O     1 
ATOM 2972 C CB    . LYS A 1 376 ? 95.543  58.010  39.022  1.00 127.14 ? 451 LYS A CB    1 
ATOM 2973 C CG    . LYS A 1 376 ? 96.530  59.205  39.102  1.00 126.56 ? 451 LYS A CG    1 
ATOM 2974 C CD    . LYS A 1 376 ? 97.894  58.817  39.767  1.00 134.99 ? 451 LYS A CD    1 
ATOM 2975 C CE    . LYS A 1 376 ? 99.065  58.668  38.764  1.00 127.74 ? 451 LYS A CE    1 
ATOM 2976 N NZ    . LYS A 1 376 ? 100.389 58.307  39.383  1.00 112.45 ? 451 LYS A NZ    1 
ATOM 2977 N N     . GLU A 1 377 ? 93.234  56.752  37.504  1.00 114.50 ? 452 GLU A N     1 
ATOM 2978 C CA    . GLU A 1 377 ? 92.446  56.334  36.349  1.00 116.61 ? 452 GLU A CA    1 
ATOM 2979 C C     . GLU A 1 377 ? 91.043  56.924  36.406  1.00 106.89 ? 452 GLU A C     1 
ATOM 2980 O O     . GLU A 1 377 ? 90.556  57.488  35.421  1.00 96.48  ? 452 GLU A O     1 
ATOM 2981 C CB    . GLU A 1 377 ? 92.396  54.806  36.275  1.00 93.66  ? 452 GLU A CB    1 
ATOM 2982 C CG    . GLU A 1 377 ? 91.924  54.270  34.941  1.00 94.59  ? 452 GLU A CG    1 
ATOM 2983 C CD    . GLU A 1 377 ? 90.643  53.482  35.069  1.00 116.31 ? 452 GLU A CD    1 
ATOM 2984 O OE1   . GLU A 1 377 ? 90.094  53.061  34.023  1.00 106.02 ? 452 GLU A OE1   1 
ATOM 2985 O OE2   . GLU A 1 377 ? 90.192  53.287  36.223  1.00 124.91 ? 452 GLU A OE2   1 
ATOM 2986 N N     . PHE A 1 378 ? 90.395  56.840  37.567  1.00 104.16 ? 453 PHE A N     1 
ATOM 2987 C CA    . PHE A 1 378 ? 89.117  57.512  37.736  1.00 99.96  ? 453 PHE A CA    1 
ATOM 2988 C C     . PHE A 1 378 ? 89.268  59.011  37.562  1.00 103.85 ? 453 PHE A C     1 
ATOM 2989 O O     . PHE A 1 378 ? 88.655  59.610  36.671  1.00 110.46 ? 453 PHE A O     1 
ATOM 2990 C CB    . PHE A 1 378 ? 88.519  57.215  39.113  1.00 103.91 ? 453 PHE A CB    1 
ATOM 2991 C CG    . PHE A 1 378 ? 87.223  57.938  39.361  1.00 101.56 ? 453 PHE A CG    1 
ATOM 2992 C CD1   . PHE A 1 378 ? 86.020  57.369  38.984  1.00 84.20  ? 453 PHE A CD1   1 
ATOM 2993 C CD2   . PHE A 1 378 ? 87.210  59.204  39.938  1.00 97.47  ? 453 PHE A CD2   1 
ATOM 2994 C CE1   . PHE A 1 378 ? 84.837  58.046  39.185  1.00 96.15  ? 453 PHE A CE1   1 
ATOM 2995 C CE2   . PHE A 1 378 ? 86.027  59.888  40.144  1.00 95.26  ? 453 PHE A CE2   1 
ATOM 2996 C CZ    . PHE A 1 378 ? 84.841  59.312  39.771  1.00 107.72 ? 453 PHE A CZ    1 
ATOM 2997 N N     . CYS A 1 379 ? 90.086  59.635  38.411  1.00 101.71 ? 454 CYS A N     1 
ATOM 2998 C CA    . CYS A 1 379 ? 90.114  61.092  38.466  1.00 106.79 ? 454 CYS A CA    1 
ATOM 2999 C C     . CYS A 1 379 ? 90.382  61.679  37.101  1.00 108.45 ? 454 CYS A C     1 
ATOM 3000 O O     . CYS A 1 379 ? 89.655  62.560  36.631  1.00 116.01 ? 454 CYS A O     1 
ATOM 3001 C CB    . CYS A 1 379 ? 91.173  61.557  39.447  1.00 105.81 ? 454 CYS A CB    1 
ATOM 3002 S SG    . CYS A 1 379 ? 90.692  61.266  41.101  1.00 97.28  ? 454 CYS A SG    1 
ATOM 3003 N N     . LEU A 1 380 ? 91.423  61.180  36.445  1.00 108.76 ? 455 LEU A N     1 
ATOM 3004 C CA    . LEU A 1 380 ? 91.733  61.616  35.094  1.00 121.91 ? 455 LEU A CA    1 
ATOM 3005 C C     . LEU A 1 380 ? 90.548  61.404  34.165  1.00 122.99 ? 455 LEU A C     1 
ATOM 3006 O O     . LEU A 1 380 ? 90.103  62.339  33.486  1.00 127.60 ? 455 LEU A O     1 
ATOM 3007 C CB    . LEU A 1 380 ? 92.960  60.860  34.586  1.00 136.14 ? 455 LEU A CB    1 
ATOM 3008 C CG    . LEU A 1 380 ? 94.305  61.276  35.190  1.00 133.17 ? 455 LEU A CG    1 
ATOM 3009 C CD1   . LEU A 1 380 ? 95.407  60.278  34.801  1.00 90.59  ? 455 LEU A CD1   1 
ATOM 3010 C CD2   . LEU A 1 380 ? 94.661  62.720  34.775  1.00 120.50 ? 455 LEU A CD2   1 
ATOM 3011 N N     . SER A 1 381 ? 90.008  60.180  34.146  1.00 115.69 ? 456 SER A N     1 
ATOM 3012 C CA    . SER A 1 381 ? 88.961  59.832  33.192  1.00 112.50 ? 456 SER A CA    1 
ATOM 3013 C C     . SER A 1 381 ? 87.844  60.852  33.178  1.00 109.32 ? 456 SER A C     1 
ATOM 3014 O O     . SER A 1 381 ? 87.249  61.105  32.127  1.00 112.78 ? 456 SER A O     1 
ATOM 3015 C CB    . SER A 1 381 ? 88.377  58.464  33.516  1.00 124.20 ? 456 SER A CB    1 
ATOM 3016 O OG    . SER A 1 381 ? 87.239  58.218  32.710  1.00 134.52 ? 456 SER A OG    1 
ATOM 3017 N N     . LYS A 1 382 ? 87.539  61.442  34.330  1.00 113.22 ? 457 LYS A N     1 
ATOM 3018 C CA    . LYS A 1 382 ? 86.606  62.557  34.341  1.00 112.67 ? 457 LYS A CA    1 
ATOM 3019 C C     . LYS A 1 382 ? 87.273  63.802  33.786  1.00 116.44 ? 457 LYS A C     1 
ATOM 3020 O O     . LYS A 1 382 ? 86.926  64.273  32.698  1.00 127.09 ? 457 LYS A O     1 
ATOM 3021 C CB    . LYS A 1 382 ? 86.076  62.799  35.758  1.00 117.15 ? 457 LYS A CB    1 
ATOM 3022 C CG    . LYS A 1 382 ? 85.029  61.772  36.208  1.00 127.84 ? 457 LYS A CG    1 
ATOM 3023 C CD    . LYS A 1 382 ? 84.179  62.270  37.381  1.00 131.00 ? 457 LYS A CD    1 
ATOM 3024 C CE    . LYS A 1 382 ? 82.680  62.123  37.086  1.00 133.24 ? 457 LYS A CE    1 
ATOM 3025 N NZ    . LYS A 1 382 ? 82.302  60.729  36.682  1.00 142.37 ? 457 LYS A NZ    1 
ATOM 3026 N N     . MET A 1 383 ? 88.306  64.282  34.478  1.00 126.16 ? 458 MET A N     1 
ATOM 3027 C CA    . MET A 1 383 ? 88.761  65.671  34.428  1.00 143.81 ? 458 MET A CA    1 
ATOM 3028 C C     . MET A 1 383 ? 88.852  66.305  33.043  1.00 163.34 ? 458 MET A C     1 
ATOM 3029 O O     . MET A 1 383 ? 88.098  67.240  32.743  1.00 158.69 ? 458 MET A O     1 
ATOM 3030 C CB    . MET A 1 383 ? 90.124  65.782  35.106  1.00 126.43 ? 458 MET A CB    1 
ATOM 3031 C CG    . MET A 1 383 ? 90.070  65.614  36.596  1.00 116.92 ? 458 MET A CG    1 
ATOM 3032 S SD    . MET A 1 383 ? 91.693  65.205  37.254  1.00 114.14 ? 458 MET A SD    1 
ATOM 3033 C CE    . MET A 1 383 ? 92.653  66.547  36.566  1.00 130.19 ? 458 MET A CE    1 
ATOM 3034 N N     . GLU A 1 384 ? 89.774  65.828  32.203  1.00 158.29 ? 459 GLU A N     1 
ATOM 3035 C CA    . GLU A 1 384 ? 90.227  66.624  31.063  1.00 165.40 ? 459 GLU A CA    1 
ATOM 3036 C C     . GLU A 1 384 ? 89.127  67.048  30.066  1.00 178.40 ? 459 GLU A C     1 
ATOM 3037 O O     . GLU A 1 384 ? 88.727  68.220  30.048  1.00 175.74 ? 459 GLU A O     1 
ATOM 3038 C CB    . GLU A 1 384 ? 91.365  65.865  30.371  1.00 143.36 ? 459 GLU A CB    1 
ATOM 3039 C CG    . GLU A 1 384 ? 91.378  64.394  30.688  1.00 139.81 ? 459 GLU A CG    1 
ATOM 3040 C CD    . GLU A 1 384 ? 90.584  63.614  29.672  1.00 149.51 ? 459 GLU A CD    1 
ATOM 3041 O OE1   . GLU A 1 384 ? 90.556  64.060  28.510  1.00 153.74 ? 459 GLU A OE1   1 
ATOM 3042 O OE2   . GLU A 1 384 ? 89.985  62.574  30.021  1.00 147.32 ? 459 GLU A OE2   1 
ATOM 3043 N N     . ASP A 1 385 ? 88.597  66.120  29.262  1.00 169.86 ? 460 ASP A N     1 
ATOM 3044 C CA    . ASP A 1 385 ? 87.697  66.499  28.168  1.00 152.75 ? 460 ASP A CA    1 
ATOM 3045 C C     . ASP A 1 385 ? 86.420  67.172  28.661  1.00 151.59 ? 460 ASP A C     1 
ATOM 3046 O O     . ASP A 1 385 ? 85.855  68.020  27.958  1.00 134.50 ? 460 ASP A O     1 
ATOM 3047 C CB    . ASP A 1 385 ? 87.334  65.251  27.374  1.00 154.17 ? 460 ASP A CB    1 
ATOM 3048 C CG    . ASP A 1 385 ? 87.089  64.042  28.283  1.00 158.44 ? 460 ASP A CG    1 
ATOM 3049 O OD1   . ASP A 1 385 ? 86.532  64.211  29.395  1.00 141.33 ? 460 ASP A OD1   1 
ATOM 3050 O OD2   . ASP A 1 385 ? 87.474  62.919  27.897  1.00 177.04 ? 460 ASP A OD2   1 
ATOM 3051 N N     . LEU A 1 386 ? 85.980  66.818  29.872  1.00 156.46 ? 461 LEU A N     1 
ATOM 3052 C CA    . LEU A 1 386 ? 84.596  66.860  30.334  1.00 140.39 ? 461 LEU A CA    1 
ATOM 3053 C C     . LEU A 1 386 ? 84.228  68.134  31.067  1.00 136.13 ? 461 LEU A C     1 
ATOM 3054 O O     . LEU A 1 386 ? 83.193  68.156  31.737  1.00 136.11 ? 461 LEU A O     1 
ATOM 3055 C CB    . LEU A 1 386 ? 84.300  65.667  31.243  1.00 135.81 ? 461 LEU A CB    1 
ATOM 3056 C CG    . LEU A 1 386 ? 82.965  64.935  31.068  1.00 128.05 ? 461 LEU A CG    1 
ATOM 3057 C CD1   . LEU A 1 386 ? 82.420  64.479  32.418  1.00 104.66 ? 461 LEU A CD1   1 
ATOM 3058 C CD2   . LEU A 1 386 ? 81.924  65.751  30.300  1.00 131.12 ? 461 LEU A CD2   1 
ATOM 3059 N N     . GLU A 1 387 ? 85.069  69.161  31.030  1.00 144.64 ? 462 GLU A N     1 
ATOM 3060 C CA    . GLU A 1 387 ? 84.762  70.402  31.736  1.00 143.85 ? 462 GLU A CA    1 
ATOM 3061 C C     . GLU A 1 387 ? 83.527  71.126  31.219  1.00 134.45 ? 462 GLU A C     1 
ATOM 3062 O O     . GLU A 1 387 ? 83.277  72.257  31.647  1.00 111.60 ? 462 GLU A O     1 
ATOM 3063 C CB    . GLU A 1 387 ? 85.964  71.334  31.741  1.00 144.47 ? 462 GLU A CB    1 
ATOM 3064 C CG    . GLU A 1 387 ? 86.643  71.373  33.107  1.00 144.02 ? 462 GLU A CG    1 
ATOM 3065 C CD    . GLU A 1 387 ? 87.169  70.011  33.561  1.00 145.57 ? 462 GLU A CD    1 
ATOM 3066 O OE1   . GLU A 1 387 ? 86.411  69.017  33.578  1.00 132.33 ? 462 GLU A OE1   1 
ATOM 3067 O OE2   . GLU A 1 387 ? 88.364  69.933  33.911  1.00 155.73 ? 462 GLU A OE2   1 
ATOM 3068 N N     . LEU A 1 388 ? 82.849  70.546  30.219  1.00 146.97 ? 463 LEU A N     1 
ATOM 3069 C CA    . LEU A 1 388 ? 81.401  70.751  29.999  1.00 157.07 ? 463 LEU A CA    1 
ATOM 3070 C C     . LEU A 1 388 ? 80.709  71.359  31.233  1.00 143.00 ? 463 LEU A C     1 
ATOM 3071 O O     . LEU A 1 388 ? 80.744  72.571  31.477  1.00 138.25 ? 463 LEU A O     1 
ATOM 3072 C CB    . LEU A 1 388 ? 80.675  69.417  29.653  1.00 147.86 ? 463 LEU A CB    1 
ATOM 3073 C CG    . LEU A 1 388 ? 80.758  68.567  28.372  1.00 130.82 ? 463 LEU A CG    1 
ATOM 3074 C CD1   . LEU A 1 388 ? 79.655  67.503  28.361  1.00 113.21 ? 463 LEU A CD1   1 
ATOM 3075 C CD2   . LEU A 1 388 ? 80.687  69.406  27.116  1.00 123.32 ? 463 LEU A CD2   1 
ATOM 3076 N N     . PRO A 1 422 ? 101.818 75.949  33.540  1.00 83.77  ? 517 PRO A N     1 
ATOM 3077 C CA    . PRO A 1 422 ? 100.441 76.365  33.813  1.00 106.66 ? 517 PRO A CA    1 
ATOM 3078 C C     . PRO A 1 422 ? 99.454  75.214  33.890  1.00 121.41 ? 517 PRO A C     1 
ATOM 3079 O O     . PRO A 1 422 ? 98.441  75.254  33.168  1.00 94.41  ? 517 PRO A O     1 
ATOM 3080 C CB    . PRO A 1 422 ? 100.124 77.278  32.636  1.00 106.95 ? 517 PRO A CB    1 
ATOM 3081 C CG    . PRO A 1 422 ? 101.433 77.987  32.425  1.00 122.11 ? 517 PRO A CG    1 
ATOM 3082 C CD    . PRO A 1 422 ? 102.518 76.943  32.708  1.00 103.13 ? 517 PRO A CD    1 
ATOM 3083 N N     . VAL A 1 423 ? 99.780  74.242  34.767  1.00 126.38 ? 518 VAL A N     1 
ATOM 3084 C CA    . VAL A 1 423 ? 98.867  73.275  35.392  1.00 120.80 ? 518 VAL A CA    1 
ATOM 3085 C C     . VAL A 1 423 ? 98.185  72.272  34.446  1.00 125.47 ? 518 VAL A C     1 
ATOM 3086 O O     . VAL A 1 423 ? 97.033  72.467  34.041  1.00 122.92 ? 518 VAL A O     1 
ATOM 3087 C CB    . VAL A 1 423 ? 97.821  74.040  36.235  1.00 118.74 ? 518 VAL A CB    1 
ATOM 3088 C CG1   . VAL A 1 423 ? 97.104  73.115  37.170  1.00 102.31 ? 518 VAL A CG1   1 
ATOM 3089 C CG2   . VAL A 1 423 ? 98.492  75.134  37.053  1.00 118.09 ? 518 VAL A CG2   1 
ATOM 3090 N N     . SER A 1 424 ? 98.913  71.208  34.062  1.00 126.99 ? 519 SER A N     1 
ATOM 3091 C CA    . SER A 1 424 ? 98.383  70.080  33.266  1.00 128.07 ? 519 SER A CA    1 
ATOM 3092 C C     . SER A 1 424 ? 97.424  69.188  34.078  1.00 134.70 ? 519 SER A C     1 
ATOM 3093 O O     . SER A 1 424 ? 97.436  69.221  35.306  1.00 137.48 ? 519 SER A O     1 
ATOM 3094 C CB    . SER A 1 424 ? 99.551  69.239  32.727  1.00 136.38 ? 519 SER A CB    1 
ATOM 3095 O OG    . SER A 1 424 ? 99.726  68.001  33.411  1.00 117.68 ? 519 SER A OG    1 
ATOM 3096 N N     . PRO A 1 425 ? 96.576  68.372  33.415  1.00 144.49 ? 520 PRO A N     1 
ATOM 3097 C CA    . PRO A 1 425 ? 95.607  67.567  34.194  1.00 134.67 ? 520 PRO A CA    1 
ATOM 3098 C C     . PRO A 1 425 ? 96.245  66.436  34.978  1.00 124.65 ? 520 PRO A C     1 
ATOM 3099 O O     . PRO A 1 425 ? 95.831  66.156  36.109  1.00 112.56 ? 520 PRO A O     1 
ATOM 3100 C CB    . PRO A 1 425 ? 94.655  67.028  33.118  1.00 125.72 ? 520 PRO A CB    1 
ATOM 3101 C CG    . PRO A 1 425 ? 95.529  66.842  31.943  1.00 130.34 ? 520 PRO A CG    1 
ATOM 3102 C CD    . PRO A 1 425 ? 96.538  67.991  31.987  1.00 145.07 ? 520 PRO A CD    1 
ATOM 3103 N N     . SER A 1 426 ? 97.248  65.773  34.400  1.00 138.63 ? 521 SER A N     1 
ATOM 3104 C CA    . SER A 1 426 ? 97.912  64.655  35.059  1.00 131.09 ? 521 SER A CA    1 
ATOM 3105 C C     . SER A 1 426 ? 98.827  65.116  36.187  1.00 113.24 ? 521 SER A C     1 
ATOM 3106 O O     . SER A 1 426 ? 99.210  64.306  37.033  1.00 86.47  ? 521 SER A O     1 
ATOM 3107 C CB    . SER A 1 426 ? 98.702  63.853  34.019  1.00 128.09 ? 521 SER A CB    1 
ATOM 3108 O OG    . SER A 1 426 ? 98.061  63.880  32.742  1.00 128.57 ? 521 SER A OG    1 
ATOM 3109 N N     . ASP A 1 427 ? 99.174  66.401  36.212  1.00 123.98 ? 522 ASP A N     1 
ATOM 3110 C CA    . ASP A 1 427 ? 100.110 66.932  37.194  1.00 124.65 ? 522 ASP A CA    1 
ATOM 3111 C C     . ASP A 1 427 ? 99.439  67.234  38.535  1.00 122.51 ? 522 ASP A C     1 
ATOM 3112 O O     . ASP A 1 427 ? 99.990  66.889  39.589  1.00 112.24 ? 522 ASP A O     1 
ATOM 3113 C CB    . ASP A 1 427 ? 100.798 68.179  36.610  1.00 148.39 ? 522 ASP A CB    1 
ATOM 3114 C CG    . ASP A 1 427 ? 100.332 69.504  37.251  1.00 145.67 ? 522 ASP A CG    1 
ATOM 3115 O OD1   . ASP A 1 427 ? 99.170  69.910  37.051  1.00 132.51 ? 522 ASP A OD1   1 
ATOM 3116 O OD2   . ASP A 1 427 ? 101.146 70.164  37.936  1.00 162.69 ? 522 ASP A OD2   1 
ATOM 3117 N N     . GLU A 1 428 ? 98.240  67.844  38.516  1.00 115.69 ? 523 GLU A N     1 
ATOM 3118 C CA    . GLU A 1 428 ? 97.636  68.362  39.745  1.00 108.83 ? 523 GLU A CA    1 
ATOM 3119 C C     . GLU A 1 428 ? 97.517  67.281  40.810  1.00 103.84 ? 523 GLU A C     1 
ATOM 3120 O O     . GLU A 1 428 ? 97.506  67.579  42.014  1.00 83.14  ? 523 GLU A O     1 
ATOM 3121 C CB    . GLU A 1 428 ? 96.268  68.958  39.436  1.00 100.48 ? 523 GLU A CB    1 
ATOM 3122 C CG    . GLU A 1 428 ? 96.002  69.169  37.960  1.00 106.24 ? 523 GLU A CG    1 
ATOM 3123 C CD    . GLU A 1 428 ? 95.202  70.443  37.672  1.00 121.91 ? 523 GLU A CD    1 
ATOM 3124 O OE1   . GLU A 1 428 ? 95.059  70.817  36.485  1.00 113.20 ? 523 GLU A OE1   1 
ATOM 3125 O OE2   . GLU A 1 428 ? 94.726  71.083  38.633  1.00 123.31 ? 523 GLU A OE2   1 
ATOM 3126 N N     . PHE A 1 429 ? 97.447  66.023  40.368  1.00 113.31 ? 524 PHE A N     1 
ATOM 3127 C CA    . PHE A 1 429 ? 97.432  64.827  41.198  1.00 101.67 ? 524 PHE A CA    1 
ATOM 3128 C C     . PHE A 1 429 ? 98.655  64.787  42.111  1.00 114.10 ? 524 PHE A C     1 
ATOM 3129 O O     . PHE A 1 429 ? 98.538  64.974  43.328  1.00 106.93 ? 524 PHE A O     1 
ATOM 3130 C CB    . PHE A 1 429 ? 97.381  63.586  40.293  1.00 94.37  ? 524 PHE A CB    1 
ATOM 3131 C CG    . PHE A 1 429 ? 96.553  62.437  40.847  1.00 125.89 ? 524 PHE A CG    1 
ATOM 3132 C CD1   . PHE A 1 429 ? 95.245  62.229  40.415  1.00 133.00 ? 524 PHE A CD1   1 
ATOM 3133 C CD2   . PHE A 1 429 ? 97.084  61.550  41.786  1.00 135.32 ? 524 PHE A CD2   1 
ATOM 3134 C CE1   . PHE A 1 429 ? 94.472  61.169  40.921  1.00 125.51 ? 524 PHE A CE1   1 
ATOM 3135 C CE2   . PHE A 1 429 ? 96.319  60.483  42.296  1.00 124.83 ? 524 PHE A CE2   1 
ATOM 3136 C CZ    . PHE A 1 429 ? 95.016  60.295  41.860  1.00 120.95 ? 524 PHE A CZ    1 
ATOM 3137 N N     . GLU A 1 430 ? 99.839  64.555  41.534  1.00 110.42 ? 525 GLU A N     1 
ATOM 3138 C CA    . GLU A 1 430 ? 101.034 64.437  42.361  1.00 102.71 ? 525 GLU A CA    1 
ATOM 3139 C C     . GLU A 1 430 ? 101.350 65.745  43.055  1.00 96.12  ? 525 GLU A C     1 
ATOM 3140 O O     . GLU A 1 430 ? 101.836 65.751  44.195  1.00 80.60  ? 525 GLU A O     1 
ATOM 3141 C CB    . GLU A 1 430 ? 102.200 63.978  41.503  1.00 116.59 ? 525 GLU A CB    1 
ATOM 3142 C CG    . GLU A 1 430 ? 101.818 62.833  40.595  1.00 123.77 ? 525 GLU A CG    1 
ATOM 3143 C CD    . GLU A 1 430 ? 101.543 61.551  41.358  1.00 131.07 ? 525 GLU A CD    1 
ATOM 3144 O OE1   . GLU A 1 430 ? 101.893 61.490  42.560  1.00 133.73 ? 525 GLU A OE1   1 
ATOM 3145 O OE2   . GLU A 1 430 ? 100.985 60.603  40.752  1.00 125.04 ? 525 GLU A OE2   1 
ATOM 3146 N N     . PHE A 1 431 ? 101.078 66.857  42.374  1.00 95.31  ? 526 PHE A N     1 
ATOM 3147 C CA    . PHE A 1 431 ? 101.024 68.145  43.041  1.00 102.35 ? 526 PHE A CA    1 
ATOM 3148 C C     . PHE A 1 431 ? 100.154 68.057  44.291  1.00 110.65 ? 526 PHE A C     1 
ATOM 3149 O O     . PHE A 1 431 ? 100.542 68.521  45.371  1.00 107.94 ? 526 PHE A O     1 
ATOM 3150 C CB    . PHE A 1 431 ? 100.498 69.207  42.067  1.00 117.48 ? 526 PHE A CB    1 
ATOM 3151 C CG    . PHE A 1 431 ? 101.360 70.459  41.991  1.00 138.84 ? 526 PHE A CG    1 
ATOM 3152 C CD1   . PHE A 1 431 ? 101.223 71.479  42.936  1.00 138.05 ? 526 PHE A CD1   1 
ATOM 3153 C CD2   . PHE A 1 431 ? 102.305 70.617  40.975  1.00 138.28 ? 526 PHE A CD2   1 
ATOM 3154 C CE1   . PHE A 1 431 ? 102.017 72.621  42.875  1.00 139.38 ? 526 PHE A CE1   1 
ATOM 3155 C CE2   . PHE A 1 431 ? 103.099 71.758  40.906  1.00 137.34 ? 526 PHE A CE2   1 
ATOM 3156 C CZ    . PHE A 1 431 ? 102.954 72.760  41.856  1.00 142.02 ? 526 PHE A CZ    1 
ATOM 3157 N N     . TYR A 1 432 ? 98.977  67.443  44.174  1.00 106.67 ? 527 TYR A N     1 
ATOM 3158 C CA    . TYR A 1 432 ? 98.171  67.265  45.372  1.00 107.26 ? 527 TYR A CA    1 
ATOM 3159 C C     . TYR A 1 432 ? 98.919  66.413  46.383  1.00 97.27  ? 527 TYR A C     1 
ATOM 3160 O O     . TYR A 1 432 ? 99.088  66.824  47.532  1.00 108.06 ? 527 TYR A O     1 
ATOM 3161 C CB    . TYR A 1 432 ? 96.803  66.669  45.026  1.00 113.40 ? 527 TYR A CB    1 
ATOM 3162 C CG    . TYR A 1 432 ? 95.813  66.549  46.187  1.00 113.71 ? 527 TYR A CG    1 
ATOM 3163 C CD1   . TYR A 1 432 ? 94.924  67.578  46.488  1.00 115.30 ? 527 TYR A CD1   1 
ATOM 3164 C CD2   . TYR A 1 432 ? 95.753  65.388  46.964  1.00 108.37 ? 527 TYR A CD2   1 
ATOM 3165 C CE1   . TYR A 1 432 ? 94.015  67.457  47.538  1.00 125.92 ? 527 TYR A CE1   1 
ATOM 3166 C CE2   . TYR A 1 432 ? 94.845  65.254  48.013  1.00 106.12 ? 527 TYR A CE2   1 
ATOM 3167 C CZ    . TYR A 1 432 ? 93.970  66.287  48.294  1.00 124.24 ? 527 TYR A CZ    1 
ATOM 3168 O OH    . TYR A 1 432 ? 93.066  66.152  49.338  1.00 106.49 ? 527 TYR A OH    1 
ATOM 3169 N N     . ARG A 1 433 ? 99.441  65.259  45.957  1.00 64.63  ? 528 ARG A N     1 
ATOM 3170 C CA    . ARG A 1 433 ? 100.099 64.364  46.909  1.00 91.48  ? 528 ARG A CA    1 
ATOM 3171 C C     . ARG A 1 433 ? 101.083 65.108  47.818  1.00 109.31 ? 528 ARG A C     1 
ATOM 3172 O O     . ARG A 1 433 ? 101.118 64.871  49.033  1.00 91.74  ? 528 ARG A O     1 
ATOM 3173 C CB    . ARG A 1 433 ? 100.809 63.247  46.159  1.00 100.43 ? 528 ARG A CB    1 
ATOM 3174 C CG    . ARG A 1 433 ? 99.887  62.479  45.245  1.00 101.93 ? 528 ARG A CG    1 
ATOM 3175 C CD    . ARG A 1 433 ? 99.685  61.070  45.747  1.00 100.35 ? 528 ARG A CD    1 
ATOM 3176 N NE    . ARG A 1 433 ? 100.441 60.084  44.981  1.00 114.01 ? 528 ARG A NE    1 
ATOM 3177 C CZ    . ARG A 1 433 ? 100.771 58.869  45.426  1.00 136.09 ? 528 ARG A CZ    1 
ATOM 3178 N NH1   . ARG A 1 433 ? 100.425 58.475  46.652  1.00 126.28 ? 528 ARG A NH1   1 
ATOM 3179 N NH2   . ARG A 1 433 ? 101.464 58.046  44.644  1.00 135.74 ? 528 ARG A NH2   1 
ATOM 3180 N N     . LYS A 1 434 ? 101.853 66.052  47.262  1.00 112.12 ? 529 LYS A N     1 
ATOM 3181 C CA    . LYS A 1 434 ? 102.760 66.834  48.102  1.00 111.85 ? 529 LYS A CA    1 
ATOM 3182 C C     . LYS A 1 434 ? 102.025 67.742  49.081  1.00 105.53 ? 529 LYS A C     1 
ATOM 3183 O O     . LYS A 1 434 ? 102.667 68.323  49.964  1.00 104.77 ? 529 LYS A O     1 
ATOM 3184 C CB    . LYS A 1 434 ? 103.727 67.667  47.243  1.00 124.12 ? 529 LYS A CB    1 
ATOM 3185 C CG    . LYS A 1 434 ? 104.882 68.371  48.030  1.00 124.69 ? 529 LYS A CG    1 
ATOM 3186 C CD    . LYS A 1 434 ? 106.106 68.692  47.162  1.00 127.86 ? 529 LYS A CD    1 
ATOM 3187 C CE    . LYS A 1 434 ? 106.822 67.422  46.691  1.00 149.22 ? 529 LYS A CE    1 
ATOM 3188 N NZ    . LYS A 1 434 ? 107.203 67.451  45.241  1.00 157.50 ? 529 LYS A NZ    1 
ATOM 3189 N N     . GLU A 1 435 ? 100.711 67.890  48.965  1.00 104.25 ? 530 GLU A N     1 
ATOM 3190 C CA    . GLU A 1 435 ? 100.000 68.549  50.048  1.00 120.24 ? 530 GLU A CA    1 
ATOM 3191 C C     . GLU A 1 435 ? 100.220 67.751  51.326  1.00 121.51 ? 530 GLU A C     1 
ATOM 3192 O O     . GLU A 1 435 ? 100.301 66.517  51.297  1.00 101.51 ? 530 GLU A O     1 
ATOM 3193 C CB    . GLU A 1 435 ? 98.501  68.687  49.744  1.00 113.78 ? 530 GLU A CB    1 
ATOM 3194 C CG    . GLU A 1 435 ? 98.174  69.673  48.641  1.00 101.94 ? 530 GLU A CG    1 
ATOM 3195 C CD    . GLU A 1 435 ? 99.148  70.820  48.613  1.00 108.98 ? 530 GLU A CD    1 
ATOM 3196 O OE1   . GLU A 1 435 ? 99.254  71.564  49.614  1.00 108.41 ? 530 GLU A OE1   1 
ATOM 3197 O OE2   . GLU A 1 435 ? 99.840  70.953  47.588  1.00 114.29 ? 530 GLU A OE2   1 
ATOM 3198 N N     . ILE A 1 436 ? 100.415 68.475  52.432  1.00 124.34 ? 531 ILE A N     1 
ATOM 3199 C CA    . ILE A 1 436 ? 100.504 67.905  53.773  1.00 118.91 ? 531 ILE A CA    1 
ATOM 3200 C C     . ILE A 1 436 ? 99.792  68.846  54.735  1.00 123.61 ? 531 ILE A C     1 
ATOM 3201 O O     . ILE A 1 436 ? 100.132 70.033  54.801  1.00 125.44 ? 531 ILE A O     1 
ATOM 3202 C CB    . ILE A 1 436 ? 101.969 67.705  54.213  1.00 112.45 ? 531 ILE A CB    1 
ATOM 3203 C CG1   . ILE A 1 436 ? 102.710 66.734  53.282  1.00 120.19 ? 531 ILE A CG1   1 
ATOM 3204 C CG2   . ILE A 1 436 ? 102.036 67.219  55.648  1.00 104.86 ? 531 ILE A CG2   1 
ATOM 3205 C CD1   . ILE A 1 436 ? 102.234 65.293  53.341  1.00 112.54 ? 531 ILE A CD1   1 
ATOM 3206 N N     . VAL A 1 437 ? 98.815  68.323  55.490  1.00 120.63 ? 532 VAL A N     1 
ATOM 3207 C CA    . VAL A 1 437 ? 98.107  69.086  56.517  1.00 120.22 ? 532 VAL A CA    1 
ATOM 3208 C C     . VAL A 1 437 ? 98.085  68.281  57.806  1.00 131.84 ? 532 VAL A C     1 
ATOM 3209 O O     . VAL A 1 437 ? 98.254  67.060  57.805  1.00 149.58 ? 532 VAL A O     1 
ATOM 3210 C CB    . VAL A 1 437 ? 96.653  69.435  56.135  1.00 106.45 ? 532 VAL A CB    1 
ATOM 3211 C CG1   . VAL A 1 437 ? 96.129  70.563  57.017  1.00 90.77  ? 532 VAL A CG1   1 
ATOM 3212 C CG2   . VAL A 1 437 ? 96.532  69.770  54.656  1.00 120.15 ? 532 VAL A CG2   1 
ATOM 3213 N N     . ILE A 1 438 ? 97.844  68.974  58.915  1.00 115.67 ? 533 ILE A N     1 
ATOM 3214 C CA    . ILE A 1 438 ? 97.507  68.315  60.169  1.00 128.80 ? 533 ILE A CA    1 
ATOM 3215 C C     . ILE A 1 438 ? 96.014  68.486  60.409  1.00 123.33 ? 533 ILE A C     1 
ATOM 3216 O O     . ILE A 1 438 ? 95.466  69.576  60.206  1.00 107.29 ? 533 ILE A O     1 
ATOM 3217 C CB    . ILE A 1 438 ? 98.341  68.862  61.344  1.00 126.85 ? 533 ILE A CB    1 
ATOM 3218 C CG1   . ILE A 1 438 ? 97.522  68.857  62.646  1.00 118.24 ? 533 ILE A CG1   1 
ATOM 3219 C CG2   . ILE A 1 438 ? 98.946  70.226  61.001  1.00 99.64  ? 533 ILE A CG2   1 
ATOM 3220 C CD1   . ILE A 1 438 ? 98.357  68.776  63.905  1.00 122.58 ? 533 ILE A CD1   1 
ATOM 3221 N N     . LEU A 1 439 ? 95.348  67.401  60.802  1.00 127.81 ? 534 LEU A N     1 
ATOM 3222 C CA    . LEU A 1 439 ? 93.940  67.483  61.170  1.00 126.80 ? 534 LEU A CA    1 
ATOM 3223 C C     . LEU A 1 439 ? 93.792  68.351  62.418  1.00 124.33 ? 534 LEU A C     1 
ATOM 3224 O O     . LEU A 1 439 ? 94.447  68.106  63.434  1.00 140.53 ? 534 LEU A O     1 
ATOM 3225 C CB    . LEU A 1 439 ? 93.375  66.073  61.404  1.00 113.52 ? 534 LEU A CB    1 
ATOM 3226 C CG    . LEU A 1 439 ? 94.271  64.869  61.037  1.00 113.76 ? 534 LEU A CG    1 
ATOM 3227 C CD1   . LEU A 1 439 ? 94.963  64.250  62.261  1.00 114.63 ? 534 LEU A CD1   1 
ATOM 3228 C CD2   . LEU A 1 439 ? 93.504  63.803  60.280  1.00 93.85  ? 534 LEU A CD2   1 
ATOM 3229 N N     . SER A 1 440 ? 92.944  69.376  62.339  1.00 124.06 ? 535 SER A N     1 
ATOM 3230 C CA    . SER A 1 440 ? 92.782  70.341  63.421  1.00 133.64 ? 535 SER A CA    1 
ATOM 3231 C C     . SER A 1 440 ? 91.394  70.244  64.020  1.00 133.61 ? 535 SER A C     1 
ATOM 3232 O O     . SER A 1 440 ? 90.442  69.804  63.366  1.00 126.45 ? 535 SER A O     1 
ATOM 3233 C CB    . SER A 1 440 ? 92.998  71.783  62.958  1.00 118.88 ? 535 SER A CB    1 
ATOM 3234 O OG    . SER A 1 440 ? 93.436  71.816  61.621  1.00 115.99 ? 535 SER A OG    1 
ATOM 3235 N N     . GLU A 1 441 ? 91.301  70.699  65.273  1.00 141.07 ? 536 GLU A N     1 
ATOM 3236 C CA    . GLU A 1 441 ? 90.049  70.604  66.015  1.00 153.18 ? 536 GLU A CA    1 
ATOM 3237 C C     . GLU A 1 441 ? 88.885  71.078  65.163  1.00 147.04 ? 536 GLU A C     1 
ATOM 3238 O O     . GLU A 1 441 ? 87.850  70.410  65.076  1.00 144.28 ? 536 GLU A O     1 
ATOM 3239 C CB    . GLU A 1 441 ? 90.130  71.409  67.314  1.00 159.67 ? 536 GLU A CB    1 
ATOM 3240 C CG    . GLU A 1 441 ? 88.884  71.272  68.200  1.00 164.32 ? 536 GLU A CG    1 
ATOM 3241 C CD    . GLU A 1 441 ? 89.061  71.867  69.598  1.00 172.98 ? 536 GLU A CD    1 
ATOM 3242 O OE1   . GLU A 1 441 ? 88.129  71.750  70.427  1.00 157.97 ? 536 GLU A OE1   1 
ATOM 3243 O OE2   . GLU A 1 441 ? 90.132  72.453  69.871  1.00 176.93 ? 536 GLU A OE2   1 
ATOM 3244 N N     . ASP A 1 442 ? 89.051  72.207  64.491  1.00 134.58 ? 537 ASP A N     1 
ATOM 3245 C CA    . ASP A 1 442 ? 88.147  72.579  63.417  1.00 129.42 ? 537 ASP A CA    1 
ATOM 3246 C C     . ASP A 1 442 ? 88.906  72.424  62.125  1.00 115.86 ? 537 ASP A C     1 
ATOM 3247 O O     . ASP A 1 442 ? 89.784  73.230  61.819  1.00 123.43 ? 537 ASP A O     1 
ATOM 3248 C CB    . ASP A 1 442 ? 87.631  73.999  63.569  1.00 135.81 ? 537 ASP A CB    1 
ATOM 3249 C CG    . ASP A 1 442 ? 86.235  74.031  64.108  1.00 144.05 ? 537 ASP A CG    1 
ATOM 3250 O OD1   . ASP A 1 442 ? 86.020  74.702  65.132  1.00 153.18 ? 537 ASP A OD1   1 
ATOM 3251 O OD2   . ASP A 1 442 ? 85.356  73.366  63.520  1.00 145.03 ? 537 ASP A OD2   1 
ATOM 3252 N N     . PHE A 1 443 ? 88.566  71.393  61.377  1.00 98.57  ? 538 PHE A N     1 
ATOM 3253 C CA    . PHE A 1 443 ? 89.023  71.242  60.013  1.00 96.64  ? 538 PHE A CA    1 
ATOM 3254 C C     . PHE A 1 443 ? 87.768  71.196  59.172  1.00 97.13  ? 538 PHE A C     1 
ATOM 3255 O O     . PHE A 1 443 ? 86.876  70.388  59.438  1.00 128.50 ? 538 PHE A O     1 
ATOM 3256 C CB    . PHE A 1 443 ? 89.872  69.975  59.858  1.00 95.14  ? 538 PHE A CB    1 
ATOM 3257 C CG    . PHE A 1 443 ? 90.365  69.693  58.442  1.00 93.26  ? 538 PHE A CG    1 
ATOM 3258 C CD1   . PHE A 1 443 ? 89.818  70.294  57.315  1.00 92.83  ? 538 PHE A CD1   1 
ATOM 3259 C CD2   . PHE A 1 443 ? 91.378  68.776  58.247  1.00 100.99 ? 538 PHE A CD2   1 
ATOM 3260 C CE1   . PHE A 1 443 ? 90.277  69.990  56.034  1.00 99.56  ? 538 PHE A CE1   1 
ATOM 3261 C CE2   . PHE A 1 443 ? 91.849  68.477  56.966  1.00 96.13  ? 538 PHE A CE2   1 
ATOM 3262 C CZ    . PHE A 1 443 ? 91.300  69.074  55.860  1.00 83.58  ? 538 PHE A CZ    1 
ATOM 3263 N N     . LYS A 1 444 ? 87.692  72.060  58.178  1.00 80.19  ? 539 LYS A N     1 
ATOM 3264 C CA    . LYS A 1 444 ? 86.609  72.016  57.208  1.00 96.35  ? 539 LYS A CA    1 
ATOM 3265 C C     . LYS A 1 444 ? 87.187  71.659  55.847  1.00 90.94  ? 539 LYS A C     1 
ATOM 3266 O O     . LYS A 1 444 ? 87.800  72.493  55.181  1.00 96.17  ? 539 LYS A O     1 
ATOM 3267 C CB    . LYS A 1 444 ? 85.881  73.353  57.183  1.00 107.56 ? 539 LYS A CB    1 
ATOM 3268 C CG    . LYS A 1 444 ? 85.706  73.946  58.579  1.00 98.97  ? 539 LYS A CG    1 
ATOM 3269 C CD    . LYS A 1 444 ? 84.884  73.021  59.470  1.00 115.46 ? 539 LYS A CD    1 
ATOM 3270 C CE    . LYS A 1 444 ? 84.174  73.790  60.577  1.00 132.72 ? 539 LYS A CE    1 
ATOM 3271 N NZ    . LYS A 1 444 ? 83.122  72.997  61.298  1.00 129.29 ? 539 LYS A NZ    1 
ATOM 3272 N N     . VAL A 1 445 ? 86.965  70.425  55.418  1.00 101.65 ? 540 VAL A N     1 
ATOM 3273 C CA    . VAL A 1 445 ? 87.461  70.031  54.109  1.00 94.62  ? 540 VAL A CA    1 
ATOM 3274 C C     . VAL A 1 445 ? 86.597  70.658  53.041  1.00 94.92  ? 540 VAL A C     1 
ATOM 3275 O O     . VAL A 1 445 ? 87.057  70.900  51.919  1.00 86.12  ? 540 VAL A O     1 
ATOM 3276 C CB    . VAL A 1 445 ? 87.506  68.499  54.026  1.00 96.09  ? 540 VAL A CB    1 
ATOM 3277 C CG1   . VAL A 1 445 ? 86.610  67.900  55.116  1.00 89.47  ? 540 VAL A CG1   1 
ATOM 3278 C CG2   . VAL A 1 445 ? 87.120  67.997  52.644  1.00 87.03  ? 540 VAL A CG2   1 
ATOM 3279 N N     . MET A 1 446 ? 85.349  70.960  53.396  1.00 101.93 ? 541 MET A N     1 
ATOM 3280 C CA    . MET A 1 446 ? 84.507  71.834  52.590  1.00 120.06 ? 541 MET A CA    1 
ATOM 3281 C C     . MET A 1 446 ? 85.263  73.108  52.171  1.00 127.94 ? 541 MET A C     1 
ATOM 3282 O O     . MET A 1 446 ? 85.291  73.477  50.989  1.00 117.17 ? 541 MET A O     1 
ATOM 3283 C CB    . MET A 1 446 ? 83.258  72.186  53.416  1.00 123.87 ? 541 MET A CB    1 
ATOM 3284 C CG    . MET A 1 446 ? 81.881  71.952  52.790  1.00 109.95 ? 541 MET A CG    1 
ATOM 3285 S SD    . MET A 1 446 ? 80.515  72.616  53.835  1.00 145.69 ? 541 MET A SD    1 
ATOM 3286 C CE    . MET A 1 446 ? 80.955  72.059  55.494  1.00 97.40  ? 541 MET A CE    1 
ATOM 3287 N N     . GLU A 1 447 ? 85.875  73.798  53.141  1.00 109.30 ? 542 GLU A N     1 
ATOM 3288 C CA    . GLU A 1 447 ? 86.455  75.115  52.893  1.00 100.42 ? 542 GLU A CA    1 
ATOM 3289 C C     . GLU A 1 447 ? 87.865  75.048  52.319  1.00 106.57 ? 542 GLU A C     1 
ATOM 3290 O O     . GLU A 1 447 ? 88.252  75.897  51.507  1.00 100.20 ? 542 GLU A O     1 
ATOM 3291 C CB    . GLU A 1 447 ? 86.470  75.906  54.187  1.00 116.24 ? 542 GLU A CB    1 
ATOM 3292 C CG    . GLU A 1 447 ? 87.701  76.756  54.342  1.00 125.89 ? 542 GLU A CG    1 
ATOM 3293 C CD    . GLU A 1 447 ? 88.263  76.700  55.743  1.00 135.34 ? 542 GLU A CD    1 
ATOM 3294 O OE1   . GLU A 1 447 ? 88.325  75.593  56.322  1.00 112.14 ? 542 GLU A OE1   1 
ATOM 3295 O OE2   . GLU A 1 447 ? 88.631  77.775  56.269  1.00 174.19 ? 542 GLU A OE2   1 
ATOM 3296 N N     . TRP A 1 448 ? 88.664  74.085  52.774  1.00 106.09 ? 543 TRP A N     1 
ATOM 3297 C CA    . TRP A 1 448 ? 90.033  73.973  52.302  1.00 84.53  ? 543 TRP A CA    1 
ATOM 3298 C C     . TRP A 1 448 ? 90.094  74.018  50.803  1.00 84.93  ? 543 TRP A C     1 
ATOM 3299 O O     . TRP A 1 448 ? 91.044  74.552  50.249  1.00 110.60 ? 543 TRP A O     1 
ATOM 3300 C CB    . TRP A 1 448 ? 90.630  72.674  52.795  1.00 76.35  ? 543 TRP A CB    1 
ATOM 3301 C CG    . TRP A 1 448 ? 92.022  72.317  52.363  1.00 83.71  ? 543 TRP A CG    1 
ATOM 3302 C CD1   . TRP A 1 448 ? 93.134  72.342  53.149  1.00 95.67  ? 543 TRP A CD1   1 
ATOM 3303 C CD2   . TRP A 1 448 ? 92.447  71.764  51.102  1.00 92.93  ? 543 TRP A CD2   1 
ATOM 3304 N NE1   . TRP A 1 448 ? 94.229  71.874  52.460  1.00 87.90  ? 543 TRP A NE1   1 
ATOM 3305 C CE2   . TRP A 1 448 ? 93.839  71.516  51.200  1.00 91.01  ? 543 TRP A CE2   1 
ATOM 3306 C CE3   . TRP A 1 448 ? 91.796  71.461  49.905  1.00 102.78 ? 543 TRP A CE3   1 
ATOM 3307 C CZ2   . TRP A 1 448 ? 94.591  70.986  50.146  1.00 94.42  ? 543 TRP A CZ2   1 
ATOM 3308 C CZ3   . TRP A 1 448 ? 92.556  70.937  48.849  1.00 112.33 ? 543 TRP A CZ3   1 
ATOM 3309 C CH2   . TRP A 1 448 ? 93.938  70.703  48.984  1.00 100.36 ? 543 TRP A CH2   1 
ATOM 3310 N N     . TRP A 1 449 ? 89.082  73.488  50.128  1.00 100.38 ? 544 TRP A N     1 
ATOM 3311 C CA    . TRP A 1 449 ? 89.155  73.324  48.681  1.00 108.15 ? 544 TRP A CA    1 
ATOM 3312 C C     . TRP A 1 449 ? 88.896  74.619  47.907  1.00 121.68 ? 544 TRP A C     1 
ATOM 3313 O O     . TRP A 1 449 ? 89.670  74.955  47.007  1.00 133.49 ? 544 TRP A O     1 
ATOM 3314 C CB    . TRP A 1 449 ? 88.200  72.225  48.237  1.00 109.84 ? 544 TRP A CB    1 
ATOM 3315 C CG    . TRP A 1 449 ? 88.850  70.913  48.332  1.00 99.90  ? 544 TRP A CG    1 
ATOM 3316 C CD1   . TRP A 1 449 ? 88.790  70.049  49.378  1.00 100.31 ? 544 TRP A CD1   1 
ATOM 3317 C CD2   . TRP A 1 449 ? 89.709  70.315  47.359  1.00 100.82 ? 544 TRP A CD2   1 
ATOM 3318 N NE1   . TRP A 1 449 ? 89.535  68.929  49.107  1.00 107.59 ? 544 TRP A NE1   1 
ATOM 3319 C CE2   . TRP A 1 449 ? 90.116  69.071  47.873  1.00 113.15 ? 544 TRP A CE2   1 
ATOM 3320 C CE3   . TRP A 1 449 ? 90.163  70.703  46.096  1.00 104.47 ? 544 TRP A CE3   1 
ATOM 3321 C CZ2   . TRP A 1 449 ? 90.956  68.205  47.163  1.00 109.97 ? 544 TRP A CZ2   1 
ATOM 3322 C CZ3   . TRP A 1 449 ? 91.003  69.849  45.396  1.00 106.23 ? 544 TRP A CZ3   1 
ATOM 3323 C CH2   . TRP A 1 449 ? 91.392  68.616  45.932  1.00 107.61 ? 544 TRP A CH2   1 
ATOM 3324 N N     . ASN A 1 450 ? 87.822  75.366  48.208  1.00 129.76 ? 545 ASN A N     1 
ATOM 3325 C CA    . ASN A 1 450 ? 87.679  76.662  47.534  1.00 131.83 ? 545 ASN A CA    1 
ATOM 3326 C C     . ASN A 1 450 ? 88.812  77.608  47.935  1.00 126.00 ? 545 ASN A C     1 
ATOM 3327 O O     . ASN A 1 450 ? 89.158  78.526  47.181  1.00 113.97 ? 545 ASN A O     1 
ATOM 3328 C CB    . ASN A 1 450 ? 86.303  77.293  47.827  1.00 138.24 ? 545 ASN A CB    1 
ATOM 3329 C CG    . ASN A 1 450 ? 85.861  78.315  46.750  1.00 147.33 ? 545 ASN A CG    1 
ATOM 3330 O OD1   . ASN A 1 450 ? 86.020  79.530  46.926  1.00 147.55 ? 545 ASN A OD1   1 
ATOM 3331 N ND2   . ASN A 1 450 ? 85.294  77.817  45.642  1.00 138.95 ? 545 ASN A ND2   1 
ATOM 3332 N N     . LEU A 1 451 ? 89.412  77.379  49.096  1.00 121.03 ? 546 LEU A N     1 
ATOM 3333 C CA    . LEU A 1 451 ? 90.485  78.205  49.611  1.00 118.91 ? 546 LEU A CA    1 
ATOM 3334 C C     . LEU A 1 451 ? 91.877  77.596  49.401  1.00 102.99 ? 546 LEU A C     1 
ATOM 3335 O O     . LEU A 1 451 ? 92.858  78.118  49.938  1.00 100.63 ? 546 LEU A O     1 
ATOM 3336 C CB    . LEU A 1 451 ? 90.197  78.493  51.087  1.00 122.22 ? 546 LEU A CB    1 
ATOM 3337 C CG    . LEU A 1 451 ? 88.942  79.362  51.353  1.00 115.30 ? 546 LEU A CG    1 
ATOM 3338 C CD1   . LEU A 1 451 ? 87.558  78.710  51.058  1.00 91.71  ? 546 LEU A CD1   1 
ATOM 3339 C CD2   . LEU A 1 451 ? 88.976  79.912  52.781  1.00 127.84 ? 546 LEU A CD2   1 
ATOM 3340 N N     . ASN A 1 452 ? 91.961  76.425  48.779  1.00 97.39  ? 547 ASN A N     1 
ATOM 3341 C CA    . ASN A 1 452 ? 93.144  75.921  48.093  1.00 91.25  ? 547 ASN A CA    1 
ATOM 3342 C C     . ASN A 1 452 ? 92.995  75.929  46.579  1.00 120.54 ? 547 ASN A C     1 
ATOM 3343 O O     . ASN A 1 452 ? 93.828  75.330  45.882  1.00 129.78 ? 547 ASN A O     1 
ATOM 3344 C CB    . ASN A 1 452 ? 93.481  74.505  48.545  1.00 98.12  ? 547 ASN A CB    1 
ATOM 3345 C CG    . ASN A 1 452 ? 94.768  74.436  49.284  1.00 103.73 ? 547 ASN A CG    1 
ATOM 3346 O OD1   . ASN A 1 452 ? 95.707  73.744  48.866  1.00 121.68 ? 547 ASN A OD1   1 
ATOM 3347 N ND2   . ASN A 1 452 ? 94.843  75.166  50.389  1.00 101.54 ? 547 ASN A ND2   1 
ATOM 3348 N N     . SER A 1 453 ? 91.906  76.489  46.059  1.00 116.95 ? 548 SER A N     1 
ATOM 3349 C CA    . SER A 1 453 ? 91.574  76.308  44.654  1.00 112.88 ? 548 SER A CA    1 
ATOM 3350 C C     . SER A 1 453 ? 92.648  76.928  43.775  1.00 129.71 ? 548 SER A C     1 
ATOM 3351 O O     . SER A 1 453 ? 93.553  77.625  44.245  1.00 135.20 ? 548 SER A O     1 
ATOM 3352 C CB    . SER A 1 453 ? 90.219  76.928  44.333  1.00 117.62 ? 548 SER A CB    1 
ATOM 3353 O OG    . SER A 1 453 ? 90.046  78.151  45.029  1.00 127.67 ? 548 SER A OG    1 
ATOM 3354 N N     . LYS A 1 454 ? 92.608  76.569  42.497  1.00 122.38 ? 549 LYS A N     1 
ATOM 3355 C CA    . LYS A 1 454 ? 93.471  77.173  41.484  1.00 128.17 ? 549 LYS A CA    1 
ATOM 3356 C C     . LYS A 1 454 ? 94.903  76.695  41.675  1.00 116.78 ? 549 LYS A C     1 
ATOM 3357 O O     . LYS A 1 454 ? 95.686  76.704  40.723  1.00 121.38 ? 549 LYS A O     1 
ATOM 3358 C CB    . LYS A 1 454 ? 93.461  78.721  41.508  1.00 121.16 ? 549 LYS A CB    1 
ATOM 3359 C CG    . LYS A 1 454 ? 92.209  79.457  42.051  1.00 126.34 ? 549 LYS A CG    1 
ATOM 3360 C CD    . LYS A 1 454 ? 92.571  80.427  43.206  1.00 111.10 ? 549 LYS A CD    1 
ATOM 3361 C CE    . LYS A 1 454 ? 91.349  80.901  43.997  1.00 124.93 ? 549 LYS A CE    1 
ATOM 3362 N NZ    . LYS A 1 454 ? 91.696  81.736  45.187  1.00 135.64 ? 549 LYS A NZ    1 
ATOM 3363 N N     . LYS A 1 455 ? 95.251  76.234  42.882  1.00 109.38 ? 550 LYS A N     1 
ATOM 3364 C CA    . LYS A 1 455 ? 96.443  75.410  43.009  1.00 118.74 ? 550 LYS A CA    1 
ATOM 3365 C C     . LYS A 1 455 ? 96.179  74.036  42.423  1.00 130.30 ? 550 LYS A C     1 
ATOM 3366 O O     . LYS A 1 455 ? 97.124  73.292  42.133  1.00 130.25 ? 550 LYS A O     1 
ATOM 3367 C CB    . LYS A 1 455 ? 96.897  75.302  44.474  1.00 112.45 ? 550 LYS A CB    1 
ATOM 3368 C CG    . LYS A 1 455 ? 98.222  74.558  44.665  1.00 89.30  ? 550 LYS A CG    1 
ATOM 3369 C CD    . LYS A 1 455 ? 98.617  74.441  46.120  1.00 95.17  ? 550 LYS A CD    1 
ATOM 3370 C CE    . LYS A 1 455 ? 99.994  73.797  46.239  1.00 116.22 ? 550 LYS A CE    1 
ATOM 3371 N NZ    . LYS A 1 455 ? 100.722 74.117  47.513  1.00 123.71 ? 550 LYS A NZ    1 
ATOM 3372 N N     . TYR A 1 456 ? 94.904  73.683  42.255  1.00 125.65 ? 551 TYR A N     1 
ATOM 3373 C CA    . TYR A 1 456 ? 94.502  72.498  41.501  1.00 116.27 ? 551 TYR A CA    1 
ATOM 3374 C C     . TYR A 1 456 ? 93.210  72.809  40.767  1.00 114.42 ? 551 TYR A C     1 
ATOM 3375 O O     . TYR A 1 456 ? 92.172  72.194  41.021  1.00 119.27 ? 551 TYR A O     1 
ATOM 3376 C CB    . TYR A 1 456 ? 94.339  71.303  42.434  1.00 114.88 ? 551 TYR A CB    1 
ATOM 3377 C CG    . TYR A 1 456 ? 95.512  71.108  43.343  1.00 103.60 ? 551 TYR A CG    1 
ATOM 3378 C CD1   . TYR A 1 456 ? 95.583  71.766  44.573  1.00 100.06 ? 551 TYR A CD1   1 
ATOM 3379 C CD2   . TYR A 1 456 ? 96.554  70.291  42.965  1.00 88.08  ? 551 TYR A CD2   1 
ATOM 3380 C CE1   . TYR A 1 456 ? 96.656  71.601  45.397  1.00 108.99 ? 551 TYR A CE1   1 
ATOM 3381 C CE2   . TYR A 1 456 ? 97.617  70.122  43.768  1.00 101.07 ? 551 TYR A CE2   1 
ATOM 3382 C CZ    . TYR A 1 456 ? 97.675  70.769  44.990  1.00 115.49 ? 551 TYR A CZ    1 
ATOM 3383 O OH    . TYR A 1 456 ? 98.768  70.573  45.796  1.00 112.50 ? 551 TYR A OH    1 
ATOM 3384 N N     . PRO A 1 457 ? 93.251  73.738  39.807  1.00 121.70 ? 552 PRO A N     1 
ATOM 3385 C CA    . PRO A 1 457 ? 92.002  74.278  39.240  1.00 116.55 ? 552 PRO A CA    1 
ATOM 3386 C C     . PRO A 1 457 ? 91.153  73.258  38.491  1.00 113.93 ? 552 PRO A C     1 
ATOM 3387 O O     . PRO A 1 457 ? 89.974  73.531  38.233  1.00 96.00  ? 552 PRO A O     1 
ATOM 3388 C CB    . PRO A 1 457 ? 92.509  75.370  38.297  1.00 124.36 ? 552 PRO A CB    1 
ATOM 3389 C CG    . PRO A 1 457 ? 93.842  74.833  37.834  1.00 117.37 ? 552 PRO A CG    1 
ATOM 3390 C CD    . PRO A 1 457 ? 94.433  74.212  39.068  1.00 128.27 ? 552 PRO A CD    1 
ATOM 3391 N N     . LYS A 1 458 ? 91.732  72.143  38.045  1.00 121.11 ? 553 LYS A N     1 
ATOM 3392 C CA    . LYS A 1 458 ? 90.943  71.001  37.593  1.00 124.08 ? 553 LYS A CA    1 
ATOM 3393 C C     . LYS A 1 458 ? 90.569  70.024  38.708  1.00 121.59 ? 553 LYS A C     1 
ATOM 3394 O O     . LYS A 1 458 ? 89.616  69.250  38.550  1.00 109.74 ? 553 LYS A O     1 
ATOM 3395 C CB    . LYS A 1 458 ? 91.698  70.243  36.509  1.00 126.68 ? 553 LYS A CB    1 
ATOM 3396 C CG    . LYS A 1 458 ? 92.056  71.081  35.321  1.00 130.90 ? 553 LYS A CG    1 
ATOM 3397 C CD    . LYS A 1 458 ? 92.857  70.246  34.369  1.00 126.93 ? 553 LYS A CD    1 
ATOM 3398 C CE    . LYS A 1 458 ? 93.396  71.080  33.263  1.00 127.90 ? 553 LYS A CE    1 
ATOM 3399 N NZ    . LYS A 1 458 ? 94.291  70.217  32.486  1.00 129.44 ? 553 LYS A NZ    1 
ATOM 3400 N N     . LEU A 1 459 ? 91.318  70.001  39.807  1.00 116.80 ? 554 LEU A N     1 
ATOM 3401 C CA    . LEU A 1 459 ? 90.944  69.154  40.930  1.00 108.12 ? 554 LEU A CA    1 
ATOM 3402 C C     . LEU A 1 459 ? 89.927  69.832  41.839  1.00 105.81 ? 554 LEU A C     1 
ATOM 3403 O O     . LEU A 1 459 ? 89.045  69.166  42.392  1.00 103.68 ? 554 LEU A O     1 
ATOM 3404 C CB    . LEU A 1 459 ? 92.188  68.768  41.717  1.00 115.68 ? 554 LEU A CB    1 
ATOM 3405 C CG    . LEU A 1 459 ? 92.422  67.284  41.982  1.00 106.13 ? 554 LEU A CG    1 
ATOM 3406 C CD1   . LEU A 1 459 ? 92.749  66.516  40.697  1.00 75.92  ? 554 LEU A CD1   1 
ATOM 3407 C CD2   . LEU A 1 459 ? 93.519  67.126  43.031  1.00 109.72 ? 554 LEU A CD2   1 
ATOM 3408 N N     . SER A 1 460 ? 90.045  71.154  42.013  1.00 107.11 ? 555 SER A N     1 
ATOM 3409 C CA    . SER A 1 460 ? 89.091  71.891  42.837  1.00 115.88 ? 555 SER A CA    1 
ATOM 3410 C C     . SER A 1 460 ? 87.667  71.619  42.395  1.00 122.93 ? 555 SER A C     1 
ATOM 3411 O O     . SER A 1 460 ? 86.734  71.745  43.194  1.00 126.95 ? 555 SER A O     1 
ATOM 3412 C CB    . SER A 1 460 ? 89.362  73.400  42.778  1.00 124.33 ? 555 SER A CB    1 
ATOM 3413 O OG    . SER A 1 460 ? 90.697  73.730  43.145  1.00 134.01 ? 555 SER A OG    1 
ATOM 3414 N N     . LYS A 1 461 ? 87.481  71.254  41.127  1.00 118.24 ? 556 LYS A N     1 
ATOM 3415 C CA    . LYS A 1 461 ? 86.167  70.905  40.614  1.00 116.34 ? 556 LYS A CA    1 
ATOM 3416 C C     . LYS A 1 461 ? 85.781  69.446  40.899  1.00 108.87 ? 556 LYS A C     1 
ATOM 3417 O O     . LYS A 1 461 ? 84.600  69.100  40.768  1.00 103.78 ? 556 LYS A O     1 
ATOM 3418 C CB    . LYS A 1 461 ? 86.099  71.224  39.101  1.00 101.85 ? 556 LYS A CB    1 
ATOM 3419 C CG    . LYS A 1 461 ? 86.152  72.740  38.703  1.00 109.43 ? 556 LYS A CG    1 
ATOM 3420 C CD    . LYS A 1 461 ? 85.344  73.080  37.407  1.00 103.15 ? 556 LYS A CD    1 
ATOM 3421 C CE    . LYS A 1 461 ? 86.206  73.264  36.143  1.00 88.36  ? 556 LYS A CE    1 
ATOM 3422 N NZ    . LYS A 1 461 ? 85.429  73.751  34.935  1.00 71.86  ? 556 LYS A NZ    1 
ATOM 3423 N N     . LEU A 1 462 ? 86.712  68.575  41.302  1.00 100.29 ? 557 LEU A N     1 
ATOM 3424 C CA    . LEU A 1 462 ? 86.276  67.245  41.741  1.00 103.07 ? 557 LEU A CA    1 
ATOM 3425 C C     . LEU A 1 462 ? 85.786  67.313  43.183  1.00 99.91  ? 557 LEU A C     1 
ATOM 3426 O O     . LEU A 1 462 ? 84.584  67.246  43.439  1.00 103.08 ? 557 LEU A O     1 
ATOM 3427 C CB    . LEU A 1 462 ? 87.379  66.185  41.589  1.00 94.47  ? 557 LEU A CB    1 
ATOM 3428 C CG    . LEU A 1 462 ? 87.438  65.293  40.324  1.00 99.32  ? 557 LEU A CG    1 
ATOM 3429 C CD1   . LEU A 1 462 ? 88.436  64.114  40.451  1.00 87.25  ? 557 LEU A CD1   1 
ATOM 3430 C CD2   . LEU A 1 462 ? 86.078  64.795  39.835  1.00 93.90  ? 557 LEU A CD2   1 
ATOM 3431 N N     . ALA A 1 463 ? 86.695  67.491  44.136  1.00 88.34  ? 558 ALA A N     1 
ATOM 3432 C CA    . ALA A 1 463 ? 86.285  67.436  45.531  1.00 86.22  ? 558 ALA A CA    1 
ATOM 3433 C C     . ALA A 1 463 ? 85.026  68.244  45.785  1.00 85.86  ? 558 ALA A C     1 
ATOM 3434 O O     . ALA A 1 463 ? 84.158  67.813  46.542  1.00 82.08  ? 558 ALA A O     1 
ATOM 3435 C CB    . ALA A 1 463 ? 87.413  67.926  46.432  1.00 106.47 ? 558 ALA A CB    1 
ATOM 3436 N N     . LEU A 1 464 ? 84.901  69.415  45.153  1.00 103.32 ? 559 LEU A N     1 
ATOM 3437 C CA    . LEU A 1 464 ? 83.669  70.187  45.299  1.00 102.53 ? 559 LEU A CA    1 
ATOM 3438 C C     . LEU A 1 464 ? 82.477  69.325  44.888  1.00 89.50  ? 559 LEU A C     1 
ATOM 3439 O O     . LEU A 1 464 ? 81.455  69.293  45.584  1.00 80.59  ? 559 LEU A O     1 
ATOM 3440 C CB    . LEU A 1 464 ? 83.754  71.506  44.482  1.00 118.01 ? 559 LEU A CB    1 
ATOM 3441 C CG    . LEU A 1 464 ? 84.304  72.902  44.958  1.00 115.32 ? 559 LEU A CG    1 
ATOM 3442 C CD1   . LEU A 1 464 ? 85.545  72.892  45.887  1.00 93.55  ? 559 LEU A CD1   1 
ATOM 3443 C CD2   . LEU A 1 464 ? 84.571  73.892  43.778  1.00 117.62 ? 559 LEU A CD2   1 
ATOM 3444 N N     . SER A 1 465 ? 82.644  68.529  43.821  1.00 94.60  ? 560 SER A N     1 
ATOM 3445 C CA    . SER A 1 465 ? 81.560  67.711  43.269  1.00 97.37  ? 560 SER A CA    1 
ATOM 3446 C C     . SER A 1 465 ? 81.330  66.407  44.033  1.00 82.07  ? 560 SER A C     1 
ATOM 3447 O O     . SER A 1 465 ? 80.176  66.021  44.230  1.00 98.22  ? 560 SER A O     1 
ATOM 3448 C CB    . SER A 1 465 ? 81.827  67.389  41.798  1.00 93.85  ? 560 SER A CB    1 
ATOM 3449 O OG    . SER A 1 465 ? 81.102  66.235  41.398  1.00 91.62  ? 560 SER A OG    1 
ATOM 3450 N N     . LEU A 1 466 ? 82.385  65.684  44.430  1.00 72.73  ? 561 LEU A N     1 
ATOM 3451 C CA    . LEU A 1 466 ? 82.162  64.436  45.164  1.00 73.11  ? 561 LEU A CA    1 
ATOM 3452 C C     . LEU A 1 466 ? 81.754  64.695  46.598  1.00 77.54  ? 561 LEU A C     1 
ATOM 3453 O O     . LEU A 1 466 ? 81.009  63.906  47.179  1.00 95.51  ? 561 LEU A O     1 
ATOM 3454 C CB    . LEU A 1 466 ? 83.398  63.536  45.202  1.00 65.95  ? 561 LEU A CB    1 
ATOM 3455 C CG    . LEU A 1 466 ? 83.969  62.893  43.950  1.00 73.80  ? 561 LEU A CG    1 
ATOM 3456 C CD1   . LEU A 1 466 ? 84.439  61.508  44.272  1.00 67.35  ? 561 LEU A CD1   1 
ATOM 3457 C CD2   . LEU A 1 466 ? 82.994  62.914  42.780  1.00 78.69  ? 561 LEU A CD2   1 
ATOM 3458 N N     . LEU A 1 467 ? 82.254  65.755  47.208  1.00 71.36  ? 562 LEU A N     1 
ATOM 3459 C CA    . LEU A 1 467 ? 81.948  65.929  48.612  1.00 68.40  ? 562 LEU A CA    1 
ATOM 3460 C C     . LEU A 1 467 ? 80.519  66.389  48.834  1.00 79.24  ? 562 LEU A C     1 
ATOM 3461 O O     . LEU A 1 467 ? 79.958  66.123  49.900  1.00 91.60  ? 562 LEU A O     1 
ATOM 3462 C CB    . LEU A 1 467 ? 82.942  66.885  49.228  1.00 83.92  ? 562 LEU A CB    1 
ATOM 3463 C CG    . LEU A 1 467 ? 84.268  66.141  49.231  1.00 93.43  ? 562 LEU A CG    1 
ATOM 3464 C CD1   . LEU A 1 467 ? 85.456  67.085  49.491  1.00 99.51  ? 562 LEU A CD1   1 
ATOM 3465 C CD2   . LEU A 1 467 ? 84.179  65.008  50.259  1.00 88.22  ? 562 LEU A CD2   1 
ATOM 3466 N N     . SER A 1 468 ? 79.891  67.010  47.839  1.00 79.25  ? 563 SER A N     1 
ATOM 3467 C CA    . SER A 1 468 ? 78.453  67.222  47.932  1.00 82.39  ? 563 SER A CA    1 
ATOM 3468 C C     . SER A 1 468 ? 77.655  65.918  47.953  1.00 84.83  ? 563 SER A C     1 
ATOM 3469 O O     . SER A 1 468 ? 76.440  65.974  48.131  1.00 93.70  ? 563 SER A O     1 
ATOM 3470 C CB    . SER A 1 468 ? 77.966  68.093  46.775  1.00 83.15  ? 563 SER A CB    1 
ATOM 3471 O OG    . SER A 1 468 ? 77.719  67.334  45.608  1.00 81.73  ? 563 SER A OG    1 
ATOM 3472 N N     . ILE A 1 469 ? 78.279  64.761  47.765  1.00 79.52  ? 564 ILE A N     1 
ATOM 3473 C CA    . ILE A 1 469 ? 77.526  63.503  47.699  1.00 78.46  ? 564 ILE A CA    1 
ATOM 3474 C C     . ILE A 1 469 ? 77.230  63.021  49.112  1.00 90.43  ? 564 ILE A C     1 
ATOM 3475 O O     . ILE A 1 469 ? 78.152  62.980  49.957  1.00 85.13  ? 564 ILE A O     1 
ATOM 3476 C CB    . ILE A 1 469 ? 78.288  62.457  46.887  1.00 81.92  ? 564 ILE A CB    1 
ATOM 3477 C CG1   . ILE A 1 469 ? 77.917  62.581  45.400  1.00 85.43  ? 564 ILE A CG1   1 
ATOM 3478 C CG2   . ILE A 1 469 ? 77.979  61.051  47.377  1.00 80.55  ? 564 ILE A CG2   1 
ATOM 3479 C CD1   . ILE A 1 469 ? 78.904  61.948  44.408  1.00 82.61  ? 564 ILE A CD1   1 
ATOM 3480 N N     . PRO A 1 470 ? 75.957  62.672  49.408  1.00 82.43  ? 565 PRO A N     1 
ATOM 3481 C CA    . PRO A 1 470 ? 75.477  62.590  50.794  1.00 79.07  ? 565 PRO A CA    1 
ATOM 3482 C C     . PRO A 1 470 ? 75.855  61.351  51.595  1.00 78.90  ? 565 PRO A C     1 
ATOM 3483 O O     . PRO A 1 470 ? 75.729  61.414  52.829  1.00 90.99  ? 565 PRO A O     1 
ATOM 3484 C CB    . PRO A 1 470 ? 73.962  62.662  50.619  1.00 85.35  ? 565 PRO A CB    1 
ATOM 3485 C CG    . PRO A 1 470 ? 73.755  61.946  49.369  1.00 69.27  ? 565 PRO A CG    1 
ATOM 3486 C CD    . PRO A 1 470 ? 74.883  62.316  48.467  1.00 75.38  ? 565 PRO A CD    1 
ATOM 3487 N N     . ALA A 1 471 ? 76.208  60.222  50.976  1.00 44.68  ? 566 ALA A N     1 
ATOM 3488 C CA    . ALA A 1 471 ? 76.715  59.031  51.653  1.00 52.77  ? 566 ALA A CA    1 
ATOM 3489 C C     . ALA A 1 471 ? 75.652  58.139  52.287  1.00 67.44  ? 566 ALA A C     1 
ATOM 3490 O O     . ALA A 1 471 ? 76.007  57.072  52.794  1.00 74.03  ? 566 ALA A O     1 
ATOM 3491 C CB    . ALA A 1 471 ? 77.727  59.339  52.767  1.00 54.47  ? 566 ALA A CB    1 
ATOM 3492 N N     . SER A 1 472 ? 74.391  58.549  52.353  1.00 64.80  ? 567 SER A N     1 
ATOM 3493 C CA    . SER A 1 472 ? 73.355  57.726  52.958  1.00 45.94  ? 567 SER A CA    1 
ATOM 3494 C C     . SER A 1 472 ? 72.023  58.226  52.449  1.00 52.66  ? 567 SER A C     1 
ATOM 3495 O O     . SER A 1 472 ? 71.897  59.376  52.040  1.00 66.16  ? 567 SER A O     1 
ATOM 3496 C CB    . SER A 1 472 ? 73.369  57.798  54.475  1.00 49.31  ? 567 SER A CB    1 
ATOM 3497 O OG    . SER A 1 472 ? 72.570  58.884  54.866  1.00 53.99  ? 567 SER A OG    1 
ATOM 3498 N N     . SER A 1 473 ? 71.019  57.367  52.533  1.00 56.71  ? 568 SER A N     1 
ATOM 3499 C CA    . SER A 1 473 ? 69.689  57.662  52.028  1.00 45.19  ? 568 SER A CA    1 
ATOM 3500 C C     . SER A 1 473 ? 68.853  58.361  53.083  1.00 57.73  ? 568 SER A C     1 
ATOM 3501 O O     . SER A 1 473 ? 67.628  58.472  52.925  1.00 56.40  ? 568 SER A O     1 
ATOM 3502 C CB    . SER A 1 473 ? 69.017  56.386  51.490  1.00 55.29  ? 568 SER A CB    1 
ATOM 3503 O OG    . SER A 1 473 ? 68.181  55.716  52.413  1.00 73.76  ? 568 SER A OG    1 
ATOM 3504 N N     . ALA A 1 474 ? 69.508  58.805  54.166  1.00 47.99  ? 569 ALA A N     1 
ATOM 3505 C CA    . ALA A 1 474 ? 68.869  59.535  55.262  1.00 58.74  ? 569 ALA A CA    1 
ATOM 3506 C C     . ALA A 1 474 ? 67.911  60.648  54.852  1.00 55.25  ? 569 ALA A C     1 
ATOM 3507 O O     . ALA A 1 474 ? 66.830  60.789  55.428  1.00 47.73  ? 569 ALA A O     1 
ATOM 3508 C CB    . ALA A 1 474 ? 69.955  60.148  56.129  1.00 77.37  ? 569 ALA A CB    1 
ATOM 3509 N N     . ALA A 1 475 ? 68.308  61.475  53.884  1.00 56.59  ? 570 ALA A N     1 
ATOM 3510 C CA    . ALA A 1 475 ? 67.474  62.601  53.480  1.00 55.35  ? 570 ALA A CA    1 
ATOM 3511 C C     . ALA A 1 475 ? 66.039  62.174  53.260  1.00 53.81  ? 570 ALA A C     1 
ATOM 3512 O O     . ALA A 1 475 ? 65.103  62.729  53.849  1.00 40.96  ? 570 ALA A O     1 
ATOM 3513 C CB    . ALA A 1 475 ? 68.024  63.187  52.193  1.00 70.41  ? 570 ALA A CB    1 
ATOM 3514 N N     . SER A 1 476 ? 65.876  61.158  52.415  1.00 59.86  ? 571 SER A N     1 
ATOM 3515 C CA    . SER A 1 476 ? 64.584  60.549  52.146  1.00 56.18  ? 571 SER A CA    1 
ATOM 3516 C C     . SER A 1 476 ? 63.870  60.187  53.434  1.00 57.51  ? 571 SER A C     1 
ATOM 3517 O O     . SER A 1 476 ? 62.722  60.591  53.659  1.00 55.43  ? 571 SER A O     1 
ATOM 3518 C CB    . SER A 1 476 ? 64.780  59.313  51.270  1.00 56.65  ? 571 SER A CB    1 
ATOM 3519 O OG    . SER A 1 476 ? 65.290  59.655  49.990  1.00 61.04  ? 571 SER A OG    1 
ATOM 3520 N N     . GLU A 1 477 ? 64.535  59.431  54.305  1.00 60.17  ? 572 GLU A N     1 
ATOM 3521 C CA    . GLU A 1 477 ? 63.878  59.084  55.558  1.00 60.23  ? 572 GLU A CA    1 
ATOM 3522 C C     . GLU A 1 477 ? 63.460  60.348  56.292  1.00 52.83  ? 572 GLU A C     1 
ATOM 3523 O O     . GLU A 1 477 ? 62.282  60.516  56.632  1.00 52.70  ? 572 GLU A O     1 
ATOM 3524 C CB    . GLU A 1 477 ? 64.780  58.183  56.411  1.00 67.92  ? 572 GLU A CB    1 
ATOM 3525 C CG    . GLU A 1 477 ? 64.296  56.699  56.436  1.00 90.92  ? 572 GLU A CG    1 
ATOM 3526 C CD    . GLU A 1 477 ? 65.255  55.693  55.757  1.00 111.07 ? 572 GLU A CD    1 
ATOM 3527 O OE1   . GLU A 1 477 ? 66.183  55.211  56.449  1.00 103.34 ? 572 GLU A OE1   1 
ATOM 3528 O OE2   . GLU A 1 477 ? 65.076  55.366  54.549  1.00 106.79 ? 572 GLU A OE2   1 
ATOM 3529 N N     . ARG A 1 478 ? 64.394  61.296  56.437  1.00 52.57  ? 573 ARG A N     1 
ATOM 3530 C CA    . ARG A 1 478 ? 64.091  62.549  57.105  1.00 45.04  ? 573 ARG A CA    1 
ATOM 3531 C C     . ARG A 1 478 ? 62.852  63.148  56.494  1.00 47.37  ? 573 ARG A C     1 
ATOM 3532 O O     . ARG A 1 478 ? 61.917  63.531  57.207  1.00 42.82  ? 573 ARG A O     1 
ATOM 3533 C CB    . ARG A 1 478 ? 65.300  63.486  57.025  1.00 36.92  ? 573 ARG A CB    1 
ATOM 3534 C CG    . ARG A 1 478 ? 66.379  63.055  58.033  1.00 47.48  ? 573 ARG A CG    1 
ATOM 3535 C CD    . ARG A 1 478 ? 67.519  64.032  58.342  1.00 54.42  ? 573 ARG A CD    1 
ATOM 3536 N NE    . ARG A 1 478 ? 68.639  63.858  57.435  1.00 66.78  ? 573 ARG A NE    1 
ATOM 3537 C CZ    . ARG A 1 478 ? 68.741  64.495  56.262  1.00 85.24  ? 573 ARG A CZ    1 
ATOM 3538 N NH1   . ARG A 1 478 ? 67.801  65.370  55.847  1.00 61.72  ? 573 ARG A NH1   1 
ATOM 3539 N NH2   . ARG A 1 478 ? 69.792  64.257  55.493  1.00 74.21  ? 573 ARG A NH2   1 
ATOM 3540 N N     . THR A 1 479 ? 62.777  63.091  55.170  1.00 45.13  ? 574 THR A N     1 
ATOM 3541 C CA    . THR A 1 479 ? 61.615  63.581  54.441  1.00 51.12  ? 574 THR A CA    1 
ATOM 3542 C C     . THR A 1 479 ? 60.351  62.836  54.813  1.00 48.98  ? 574 THR A C     1 
ATOM 3543 O O     . THR A 1 479 ? 59.309  63.458  55.049  1.00 47.07  ? 574 THR A O     1 
ATOM 3544 C CB    . THR A 1 479 ? 61.850  63.434  52.953  1.00 55.07  ? 574 THR A CB    1 
ATOM 3545 O OG1   . THR A 1 479 ? 62.824  64.402  52.538  1.00 66.82  ? 574 THR A OG1   1 
ATOM 3546 C CG2   . THR A 1 479 ? 60.554  63.608  52.219  1.00 37.61  ? 574 THR A CG2   1 
ATOM 3547 N N     . PHE A 1 480 ? 60.416  61.495  54.814  1.00 48.32  ? 575 PHE A N     1 
ATOM 3548 C CA    . PHE A 1 480 ? 59.252  60.674  55.152  1.00 47.47  ? 575 PHE A CA    1 
ATOM 3549 C C     . PHE A 1 480 ? 58.751  60.987  56.529  1.00 49.85  ? 575 PHE A C     1 
ATOM 3550 O O     . PHE A 1 480 ? 57.534  61.058  56.760  1.00 50.16  ? 575 PHE A O     1 
ATOM 3551 C CB    . PHE A 1 480 ? 59.602  59.206  55.122  1.00 41.05  ? 575 PHE A CB    1 
ATOM 3552 C CG    . PHE A 1 480 ? 59.922  58.700  53.778  1.00 44.04  ? 575 PHE A CG    1 
ATOM 3553 C CD1   . PHE A 1 480 ? 60.990  57.868  53.584  1.00 45.06  ? 575 PHE A CD1   1 
ATOM 3554 C CD2   . PHE A 1 480 ? 59.178  59.082  52.705  1.00 54.01  ? 575 PHE A CD2   1 
ATOM 3555 C CE1   . PHE A 1 480 ? 61.302  57.421  52.355  1.00 50.29  ? 575 PHE A CE1   1 
ATOM 3556 C CE2   . PHE A 1 480 ? 59.492  58.645  51.461  1.00 53.66  ? 575 PHE A CE2   1 
ATOM 3557 C CZ    . PHE A 1 480 ? 60.545  57.793  51.288  1.00 49.50  ? 575 PHE A CZ    1 
ATOM 3558 N N     . SER A 1 481 ? 59.689  61.132  57.463  1.00 37.54  ? 576 SER A N     1 
ATOM 3559 C CA    . SER A 1 481 ? 59.344  61.523  58.812  1.00 39.77  ? 576 SER A CA    1 
ATOM 3560 C C     . SER A 1 481 ? 58.413  62.724  58.804  1.00 45.14  ? 576 SER A C     1 
ATOM 3561 O O     . SER A 1 481 ? 57.418  62.746  59.531  1.00 55.47  ? 576 SER A O     1 
ATOM 3562 C CB    . SER A 1 481 ? 60.622  61.802  59.595  1.00 55.20  ? 576 SER A CB    1 
ATOM 3563 O OG    . SER A 1 481 ? 60.349  62.578  60.753  1.00 84.62  ? 576 SER A OG    1 
ATOM 3564 N N     . LEU A 1 482 ? 58.680  63.701  57.939  1.00 42.46  ? 577 LEU A N     1 
ATOM 3565 C CA    . LEU A 1 482 ? 57.907  64.941  57.923  1.00 41.31  ? 577 LEU A CA    1 
ATOM 3566 C C     . LEU A 1 482 ? 56.570  64.770  57.224  1.00 42.64  ? 577 LEU A C     1 
ATOM 3567 O O     . LEU A 1 482 ? 55.579  65.401  57.598  1.00 35.81  ? 577 LEU A O     1 
ATOM 3568 C CB    . LEU A 1 482 ? 58.712  66.030  57.229  1.00 41.11  ? 577 LEU A CB    1 
ATOM 3569 C CG    . LEU A 1 482 ? 59.931  66.513  57.976  1.00 37.72  ? 577 LEU A CG    1 
ATOM 3570 C CD1   . LEU A 1 482 ? 60.703  67.329  57.050  1.00 40.19  ? 577 LEU A CD1   1 
ATOM 3571 C CD2   . LEU A 1 482 ? 59.523  67.337  59.181  1.00 46.64  ? 577 LEU A CD2   1 
ATOM 3572 N N     . ALA A 1 483 ? 56.541  63.950  56.178  1.00 42.33  ? 578 ALA A N     1 
ATOM 3573 C CA    . ALA A 1 483 ? 55.278  63.608  55.549  1.00 38.37  ? 578 ALA A CA    1 
ATOM 3574 C C     . ALA A 1 483 ? 54.357  62.965  56.556  1.00 47.38  ? 578 ALA A C     1 
ATOM 3575 O O     . ALA A 1 483 ? 53.137  63.188  56.543  1.00 38.41  ? 578 ALA A O     1 
ATOM 3576 C CB    . ALA A 1 483 ? 55.547  62.656  54.403  1.00 36.88  ? 578 ALA A CB    1 
ATOM 3577 N N     . GLY A 1 484 ? 54.945  62.169  57.448  1.00 39.71  ? 579 GLY A N     1 
ATOM 3578 C CA    . GLY A 1 484 ? 54.171  61.484  58.442  1.00 37.82  ? 579 GLY A CA    1 
ATOM 3579 C C     . GLY A 1 484 ? 53.431  62.410  59.367  1.00 46.43  ? 579 GLY A C     1 
ATOM 3580 O O     . GLY A 1 484 ? 52.370  62.048  59.883  1.00 53.58  ? 579 GLY A O     1 
ATOM 3581 N N     . ASN A 1 485 ? 53.966  63.604  59.617  1.00 41.19  ? 580 ASN A N     1 
ATOM 3582 C CA    . ASN A 1 485 ? 53.187  64.495  60.470  1.00 48.46  ? 580 ASN A CA    1 
ATOM 3583 C C     . ASN A 1 485 ? 52.280  65.409  59.672  1.00 49.07  ? 580 ASN A C     1 
ATOM 3584 O O     . ASN A 1 485 ? 51.455  66.112  60.266  1.00 47.09  ? 580 ASN A O     1 
ATOM 3585 C CB    . ASN A 1 485 ? 54.057  65.328  61.399  1.00 42.02  ? 580 ASN A CB    1 
ATOM 3586 C CG    . ASN A 1 485 ? 55.408  64.681  61.702  1.00 61.98  ? 580 ASN A CG    1 
ATOM 3587 O OD1   . ASN A 1 485 ? 55.591  64.079  62.765  1.00 65.47  ? 580 ASN A OD1   1 
ATOM 3588 N ND2   . ASN A 1 485 ? 56.379  64.851  60.785  1.00 50.19  ? 580 ASN A ND2   1 
ATOM 3589 N N     . ILE A 1 486 ? 52.392  65.406  58.348  1.00 52.12  ? 581 ILE A N     1 
ATOM 3590 C CA    . ILE A 1 486 ? 51.310  65.969  57.557  1.00 48.65  ? 581 ILE A CA    1 
ATOM 3591 C C     . ILE A 1 486 ? 50.163  64.999  57.497  1.00 51.95  ? 581 ILE A C     1 
ATOM 3592 O O     . ILE A 1 486 ? 49.041  65.348  57.867  1.00 65.47  ? 581 ILE A O     1 
ATOM 3593 C CB    . ILE A 1 486 ? 51.774  66.360  56.147  1.00 57.48  ? 581 ILE A CB    1 
ATOM 3594 C CG1   . ILE A 1 486 ? 52.772  67.491  56.243  1.00 49.71  ? 581 ILE A CG1   1 
ATOM 3595 C CG2   . ILE A 1 486 ? 50.607  66.855  55.336  1.00 52.59  ? 581 ILE A CG2   1 
ATOM 3596 C CD1   . ILE A 1 486 ? 52.369  68.486  57.303  1.00 50.91  ? 581 ILE A CD1   1 
ATOM 3597 N N     . ILE A 1 487 ? 50.427  63.744  57.133  1.00 47.52  ? 582 ILE A N     1 
ATOM 3598 C CA    . ILE A 1 487 ? 49.343  62.794  56.876  1.00 57.44  ? 582 ILE A CA    1 
ATOM 3599 C C     . ILE A 1 487 ? 48.999  62.094  58.192  1.00 48.38  ? 582 ILE A C     1 
ATOM 3600 O O     . ILE A 1 487 ? 49.599  61.095  58.555  1.00 64.68  ? 582 ILE A O     1 
ATOM 3601 C CB    . ILE A 1 487 ? 49.753  61.793  55.799  1.00 42.58  ? 582 ILE A CB    1 
ATOM 3602 C CG1   . ILE A 1 487 ? 50.300  62.526  54.600  1.00 43.14  ? 582 ILE A CG1   1 
ATOM 3603 C CG2   . ILE A 1 487 ? 48.626  60.888  55.397  1.00 39.30  ? 582 ILE A CG2   1 
ATOM 3604 C CD1   . ILE A 1 487 ? 51.307  61.679  53.844  1.00 49.66  ? 582 ILE A CD1   1 
ATOM 3605 N N     . THR A 1 488 ? 47.940  62.541  58.840  1.00 36.26  ? 583 THR A N     1 
ATOM 3606 C CA    . THR A 1 488 ? 47.674  62.144  60.197  1.00 44.84  ? 583 THR A CA    1 
ATOM 3607 C C     . THR A 1 488 ? 46.236  61.683  60.256  1.00 55.32  ? 583 THR A C     1 
ATOM 3608 O O     . THR A 1 488 ? 45.518  61.704  59.260  1.00 52.54  ? 583 THR A O     1 
ATOM 3609 C CB    . THR A 1 488 ? 47.955  63.280  61.192  1.00 46.12  ? 583 THR A CB    1 
ATOM 3610 O OG1   . THR A 1 488 ? 46.753  63.999  61.518  1.00 47.39  ? 583 THR A OG1   1 
ATOM 3611 C CG2   . THR A 1 488 ? 48.921  64.217  60.612  1.00 36.70  ? 583 THR A CG2   1 
ATOM 3612 N N     . GLU A 1 489 ? 45.818  61.247  61.437  1.00 59.64  ? 584 GLU A N     1 
ATOM 3613 C CA    . GLU A 1 489 ? 44.494  60.668  61.551  1.00 40.77  ? 584 GLU A CA    1 
ATOM 3614 C C     . GLU A 1 489 ? 43.441  61.663  61.130  1.00 46.95  ? 584 GLU A C     1 
ATOM 3615 O O     . GLU A 1 489 ? 42.575  61.335  60.313  1.00 43.97  ? 584 GLU A O     1 
ATOM 3616 C CB    . GLU A 1 489 ? 44.253  60.192  62.977  1.00 53.04  ? 584 GLU A CB    1 
ATOM 3617 C CG    . GLU A 1 489 ? 42.833  59.760  63.266  1.00 68.53  ? 584 GLU A CG    1 
ATOM 3618 C CD    . GLU A 1 489 ? 42.649  59.159  64.671  1.00 80.64  ? 584 GLU A CD    1 
ATOM 3619 O OE1   . GLU A 1 489 ? 41.566  59.418  65.289  1.00 80.95  ? 584 GLU A OE1   1 
ATOM 3620 O OE2   . GLU A 1 489 ? 43.585  58.434  65.132  1.00 62.35  ? 584 GLU A OE2   1 
ATOM 3621 N N     . LYS A 1 490 ? 43.508  62.906  61.661  1.00 50.33  ? 585 LYS A N     1 
ATOM 3622 C CA    . LYS A 1 490 ? 42.446  63.874  61.371  1.00 52.24  ? 585 LYS A CA    1 
ATOM 3623 C C     . LYS A 1 490 ? 42.647  64.581  60.044  1.00 46.68  ? 585 LYS A C     1 
ATOM 3624 O O     . LYS A 1 490 ? 41.676  65.037  59.436  1.00 42.14  ? 585 LYS A O     1 
ATOM 3625 C CB    . LYS A 1 490 ? 42.316  64.899  62.483  1.00 39.79  ? 585 LYS A CB    1 
ATOM 3626 C CG    . LYS A 1 490 ? 42.401  64.331  63.909  1.00 55.58  ? 585 LYS A CG    1 
ATOM 3627 C CD    . LYS A 1 490 ? 41.149  64.622  64.797  1.00 38.70  ? 585 LYS A CD    1 
ATOM 3628 C CE    . LYS A 1 490 ? 40.597  63.299  65.499  1.00 83.12  ? 585 LYS A CE    1 
ATOM 3629 N NZ    . LYS A 1 490 ? 39.963  62.123  64.676  1.00 68.03  ? 585 LYS A NZ    1 
ATOM 3630 N N     . ARG A 1 491 ? 43.865  64.591  59.545  1.00 38.32  ? 586 ARG A N     1 
ATOM 3631 C CA    . ARG A 1 491 ? 44.207  65.245  58.306  1.00 36.92  ? 586 ARG A CA    1 
ATOM 3632 C C     . ARG A 1 491 ? 44.050  64.340  57.092  1.00 42.55  ? 586 ARG A C     1 
ATOM 3633 O O     . ARG A 1 491 ? 44.710  64.571  56.072  1.00 46.76  ? 586 ARG A O     1 
ATOM 3634 C CB    . ARG A 1 491 ? 45.621  65.787  58.407  1.00 32.13  ? 586 ARG A CB    1 
ATOM 3635 C CG    . ARG A 1 491 ? 45.709  66.903  59.415  1.00 45.61  ? 586 ARG A CG    1 
ATOM 3636 C CD    . ARG A 1 491 ? 47.025  67.751  59.278  1.00 63.57  ? 586 ARG A CD    1 
ATOM 3637 N NE    . ARG A 1 491 ? 46.976  68.889  58.340  1.00 49.32  ? 586 ARG A NE    1 
ATOM 3638 C CZ    . ARG A 1 491 ? 48.045  69.447  57.778  1.00 60.78  ? 586 ARG A CZ    1 
ATOM 3639 N NH1   . ARG A 1 491 ? 49.268  68.999  58.042  1.00 62.38  ? 586 ARG A NH1   1 
ATOM 3640 N NH2   . ARG A 1 491 ? 47.893  70.456  56.942  1.00 70.28  ? 586 ARG A NH2   1 
ATOM 3641 N N     . ASN A 1 492 ? 43.310  63.242  57.213  1.00 37.37  ? 587 ASN A N     1 
ATOM 3642 C CA    . ASN A 1 492 ? 43.593  62.089  56.351  1.00 46.77  ? 587 ASN A CA    1 
ATOM 3643 C C     . ASN A 1 492 ? 43.138  62.257  54.911  1.00 49.13  ? 587 ASN A C     1 
ATOM 3644 O O     . ASN A 1 492 ? 43.641  61.516  54.045  1.00 40.49  ? 587 ASN A O     1 
ATOM 3645 C CB    . ASN A 1 492 ? 42.969  60.806  56.922  1.00 46.19  ? 587 ASN A CB    1 
ATOM 3646 C CG    . ASN A 1 492 ? 41.460  60.842  56.935  1.00 46.05  ? 587 ASN A CG    1 
ATOM 3647 O OD1   . ASN A 1 492 ? 40.814  60.444  55.962  1.00 44.45  ? 587 ASN A OD1   1 
ATOM 3648 N ND2   . ASN A 1 492 ? 40.883  61.317  58.047  1.00 33.15  ? 587 ASN A ND2   1 
ATOM 3649 N N     . ARG A 1 493 ? 42.201  63.199  54.645  1.00 45.79  ? 588 ARG A N     1 
ATOM 3650 C CA    . ARG A 1 493 ? 41.714  63.482  53.286  1.00 39.06  ? 588 ARG A CA    1 
ATOM 3651 C C     . ARG A 1 493 ? 42.758  64.141  52.384  1.00 46.04  ? 588 ARG A C     1 
ATOM 3652 O O     . ARG A 1 493 ? 42.558  64.160  51.165  1.00 39.64  ? 588 ARG A O     1 
ATOM 3653 C CB    . ARG A 1 493 ? 40.517  64.407  53.300  1.00 41.63  ? 588 ARG A CB    1 
ATOM 3654 C CG    . ARG A 1 493 ? 39.552  64.196  54.391  1.00 44.15  ? 588 ARG A CG    1 
ATOM 3655 C CD    . ARG A 1 493 ? 38.768  62.953  54.147  1.00 41.78  ? 588 ARG A CD    1 
ATOM 3656 N NE    . ARG A 1 493 ? 38.183  62.827  52.820  1.00 44.58  ? 588 ARG A NE    1 
ATOM 3657 C CZ    . ARG A 1 493 ? 38.615  61.974  51.887  1.00 61.11  ? 588 ARG A CZ    1 
ATOM 3658 N NH1   . ARG A 1 493 ? 39.669  61.164  52.119  1.00 60.86  ? 588 ARG A NH1   1 
ATOM 3659 N NH2   . ARG A 1 493 ? 37.962  61.898  50.724  1.00 41.36  ? 588 ARG A NH2   1 
ATOM 3660 N N     . ILE A 1 494 ? 43.856  64.661  52.953  1.00 45.63  ? 589 ILE A N     1 
ATOM 3661 C CA    . ILE A 1 494 ? 44.847  65.423  52.205  1.00 46.78  ? 589 ILE A CA    1 
ATOM 3662 C C     . ILE A 1 494 ? 45.274  64.673  50.957  1.00 36.75  ? 589 ILE A C     1 
ATOM 3663 O O     . ILE A 1 494 ? 45.414  63.450  50.969  1.00 65.66  ? 589 ILE A O     1 
ATOM 3664 C CB    . ILE A 1 494 ? 46.044  65.705  53.119  1.00 49.85  ? 589 ILE A CB    1 
ATOM 3665 C CG1   . ILE A 1 494 ? 46.949  66.742  52.507  1.00 43.64  ? 589 ILE A CG1   1 
ATOM 3666 C CG2   . ILE A 1 494 ? 46.800  64.451  53.379  1.00 65.55  ? 589 ILE A CG2   1 
ATOM 3667 C CD1   . ILE A 1 494 ? 46.494  68.061  52.957  1.00 56.37  ? 589 ILE A CD1   1 
ATOM 3668 N N     . GLY A 1 495 ? 45.425  65.397  49.854  1.00 45.51  ? 590 GLY A N     1 
ATOM 3669 C CA    . GLY A 1 495 ? 45.681  64.799  48.560  1.00 51.48  ? 590 GLY A CA    1 
ATOM 3670 C C     . GLY A 1 495 ? 47.167  64.803  48.264  1.00 64.31  ? 590 GLY A C     1 
ATOM 3671 O O     . GLY A 1 495 ? 47.905  65.581  48.874  1.00 61.33  ? 590 GLY A O     1 
ATOM 3672 N N     . GLN A 1 496 ? 47.590  63.924  47.324  1.00 55.74  ? 591 GLN A N     1 
ATOM 3673 C CA    . GLN A 1 496 ? 49.023  63.704  47.068  1.00 62.50  ? 591 GLN A CA    1 
ATOM 3674 C C     . GLN A 1 496 ? 49.734  65.002  46.739  1.00 74.95  ? 591 GLN A C     1 
ATOM 3675 O O     . GLN A 1 496 ? 50.928  65.170  47.047  1.00 71.23  ? 591 GLN A O     1 
ATOM 3676 C CB    . GLN A 1 496 ? 49.264  62.728  45.909  1.00 53.69  ? 591 GLN A CB    1 
ATOM 3677 C CG    . GLN A 1 496 ? 48.593  61.420  46.049  1.00 74.83  ? 591 GLN A CG    1 
ATOM 3678 C CD    . GLN A 1 496 ? 47.343  61.308  45.207  1.00 90.21  ? 591 GLN A CD    1 
ATOM 3679 O OE1   . GLN A 1 496 ? 46.237  61.636  45.669  1.00 85.75  ? 591 GLN A OE1   1 
ATOM 3680 N NE2   . GLN A 1 496 ? 47.502  60.829  43.964  1.00 93.13  ? 591 GLN A NE2   1 
ATOM 3681 N N     . GLN A 1 497 ? 49.021  65.913  46.089  1.00 66.51  ? 592 GLN A N     1 
ATOM 3682 C CA    . GLN A 1 497 ? 49.642  67.134  45.636  1.00 62.77  ? 592 GLN A CA    1 
ATOM 3683 C C     . GLN A 1 497 ? 49.803  68.118  46.779  1.00 66.85  ? 592 GLN A C     1 
ATOM 3684 O O     . GLN A 1 497 ? 50.792  68.848  46.829  1.00 74.26  ? 592 GLN A O     1 
ATOM 3685 C CB    . GLN A 1 497 ? 48.823  67.709  44.493  1.00 82.85  ? 592 GLN A CB    1 
ATOM 3686 C CG    . GLN A 1 497 ? 48.974  66.881  43.226  1.00 111.83 ? 592 GLN A CG    1 
ATOM 3687 C CD    . GLN A 1 497 ? 49.377  67.741  42.043  1.00 149.07 ? 592 GLN A CD    1 
ATOM 3688 O OE1   . GLN A 1 497 ? 48.674  68.695  41.699  1.00 153.08 ? 592 GLN A OE1   1 
ATOM 3689 N NE2   . GLN A 1 497 ? 50.520  67.423  41.426  1.00 154.16 ? 592 GLN A NE2   1 
ATOM 3690 N N     . THR A 1 498 ? 48.866  68.141  47.721  1.00 59.08  ? 593 THR A N     1 
ATOM 3691 C CA    . THR A 1 498 ? 49.017  69.056  48.841  1.00 51.84  ? 593 THR A CA    1 
ATOM 3692 C C     . THR A 1 498 ? 50.126  68.600  49.763  1.00 54.57  ? 593 THR A C     1 
ATOM 3693 O O     . THR A 1 498 ? 50.724  69.409  50.478  1.00 47.80  ? 593 THR A O     1 
ATOM 3694 C CB    . THR A 1 498 ? 47.713  69.164  49.619  1.00 56.09  ? 593 THR A CB    1 
ATOM 3695 O OG1   . THR A 1 498 ? 46.617  69.197  48.704  1.00 57.70  ? 593 THR A OG1   1 
ATOM 3696 C CG2   . THR A 1 498 ? 47.705  70.414  50.517  1.00 36.25  ? 593 THR A CG2   1 
ATOM 3697 N N     . VAL A 1 499 ? 50.404  67.310  49.796  1.00 53.28  ? 594 VAL A N     1 
ATOM 3698 C CA    . VAL A 1 499 ? 51.510  66.904  50.638  1.00 58.52  ? 594 VAL A CA    1 
ATOM 3699 C C     . VAL A 1 499 ? 52.816  67.266  49.961  1.00 59.00  ? 594 VAL A C     1 
ATOM 3700 O O     . VAL A 1 499 ? 53.669  67.944  50.542  1.00 50.09  ? 594 VAL A O     1 
ATOM 3701 C CB    . VAL A 1 499 ? 51.417  65.407  50.984  1.00 49.12  ? 594 VAL A CB    1 
ATOM 3702 C CG1   . VAL A 1 499 ? 52.423  65.073  52.035  1.00 41.18  ? 594 VAL A CG1   1 
ATOM 3703 C CG2   . VAL A 1 499 ? 50.036  65.095  51.515  1.00 66.83  ? 594 VAL A CG2   1 
ATOM 3704 N N     . ASP A 1 500 ? 52.947  66.898  48.686  1.00 67.56  ? 595 ASP A N     1 
ATOM 3705 C CA    . ASP A 1 500 ? 54.187  67.174  47.963  1.00 74.78  ? 595 ASP A CA    1 
ATOM 3706 C C     . ASP A 1 500 ? 54.494  68.664  47.938  1.00 64.81  ? 595 ASP A C     1 
ATOM 3707 O O     . ASP A 1 500 ? 55.628  69.089  48.186  1.00 54.64  ? 595 ASP A O     1 
ATOM 3708 C CB    . ASP A 1 500 ? 54.099  66.645  46.537  1.00 74.44  ? 595 ASP A CB    1 
ATOM 3709 C CG    . ASP A 1 500 ? 55.167  67.235  45.669  1.00 75.46  ? 595 ASP A CG    1 
ATOM 3710 O OD1   . ASP A 1 500 ? 56.262  66.634  45.587  1.00 69.86  ? 595 ASP A OD1   1 
ATOM 3711 O OD2   . ASP A 1 500 ? 54.927  68.328  45.111  1.00 91.43  ? 595 ASP A OD2   1 
ATOM 3712 N N     . SER A 1 501 ? 53.487  69.461  47.600  1.00 65.68  ? 596 SER A N     1 
ATOM 3713 C CA    . SER A 1 501 ? 53.578  70.907  47.667  1.00 57.09  ? 596 SER A CA    1 
ATOM 3714 C C     . SER A 1 501 ? 53.941  71.381  49.064  1.00 55.50  ? 596 SER A C     1 
ATOM 3715 O O     . SER A 1 501 ? 54.883  72.159  49.241  1.00 58.57  ? 596 SER A O     1 
ATOM 3716 C CB    . SER A 1 501 ? 52.250  71.474  47.209  1.00 64.27  ? 596 SER A CB    1 
ATOM 3717 O OG    . SER A 1 501 ? 51.972  70.913  45.929  1.00 69.78  ? 596 SER A OG    1 
ATOM 3718 N N     . LEU A 1 502 ? 53.209  70.921  50.073  1.00 53.27  ? 597 LEU A N     1 
ATOM 3719 C CA    . LEU A 1 502 ? 53.550  71.283  51.443  1.00 52.72  ? 597 LEU A CA    1 
ATOM 3720 C C     . LEU A 1 502 ? 55.001  70.941  51.757  1.00 50.46  ? 597 LEU A C     1 
ATOM 3721 O O     . LEU A 1 502 ? 55.634  71.581  52.601  1.00 43.60  ? 597 LEU A O     1 
ATOM 3722 C CB    . LEU A 1 502 ? 52.621  70.540  52.403  1.00 48.45  ? 597 LEU A CB    1 
ATOM 3723 C CG    . LEU A 1 502 ? 51.644  71.107  53.439  1.00 45.07  ? 597 LEU A CG    1 
ATOM 3724 C CD1   . LEU A 1 502 ? 52.283  72.087  54.455  1.00 46.96  ? 597 LEU A CD1   1 
ATOM 3725 C CD2   . LEU A 1 502 ? 50.415  71.658  52.776  1.00 46.39  ? 597 LEU A CD2   1 
ATOM 3726 N N     . LEU A 1 503 ? 55.519  69.884  51.135  1.00 57.39  ? 598 LEU A N     1 
ATOM 3727 C CA    . LEU A 1 503 ? 56.815  69.329  51.534  1.00 69.01  ? 598 LEU A CA    1 
ATOM 3728 C C     . LEU A 1 503 ? 57.997  70.044  50.882  1.00 70.52  ? 598 LEU A C     1 
ATOM 3729 O O     . LEU A 1 503 ? 58.981  70.385  51.555  1.00 63.10  ? 598 LEU A O     1 
ATOM 3730 C CB    . LEU A 1 503 ? 56.845  67.832  51.216  1.00 73.99  ? 598 LEU A CB    1 
ATOM 3731 C CG    . LEU A 1 503 ? 56.381  66.804  52.266  1.00 56.76  ? 598 LEU A CG    1 
ATOM 3732 C CD1   . LEU A 1 503 ? 56.381  65.427  51.637  1.00 56.36  ? 598 LEU A CD1   1 
ATOM 3733 C CD2   . LEU A 1 503 ? 57.283  66.813  53.486  1.00 39.46  ? 598 LEU A CD2   1 
ATOM 3734 N N     . PHE A 1 504 ? 57.924  70.225  49.559  1.00 76.61  ? 599 PHE A N     1 
ATOM 3735 C CA    . PHE A 1 504 ? 58.829  71.105  48.826  1.00 61.71  ? 599 PHE A CA    1 
ATOM 3736 C C     . PHE A 1 504 ? 58.940  72.443  49.528  1.00 56.56  ? 599 PHE A C     1 
ATOM 3737 O O     . PHE A 1 504 ? 60.014  72.817  50.009  1.00 60.61  ? 599 PHE A O     1 
ATOM 3738 C CB    . PHE A 1 504 ? 58.301  71.260  47.412  1.00 57.01  ? 599 PHE A CB    1 
ATOM 3739 C CG    . PHE A 1 504 ? 59.188  71.996  46.503  1.00 67.43  ? 599 PHE A CG    1 
ATOM 3740 C CD1   . PHE A 1 504 ? 59.949  71.316  45.581  1.00 78.31  ? 599 PHE A CD1   1 
ATOM 3741 C CD2   . PHE A 1 504 ? 59.207  73.369  46.499  1.00 69.61  ? 599 PHE A CD2   1 
ATOM 3742 C CE1   . PHE A 1 504 ? 60.757  72.001  44.690  1.00 83.50  ? 599 PHE A CE1   1 
ATOM 3743 C CE2   . PHE A 1 504 ? 60.010  74.049  45.627  1.00 78.80  ? 599 PHE A CE2   1 
ATOM 3744 C CZ    . PHE A 1 504 ? 60.788  73.362  44.712  1.00 74.95  ? 599 PHE A CZ    1 
ATOM 3745 N N     . LEU A 1 505 ? 57.806  73.139  49.651  1.00 49.73  ? 600 LEU A N     1 
ATOM 3746 C CA    . LEU A 1 505 ? 57.789  74.494  50.185  1.00 58.45  ? 600 LEU A CA    1 
ATOM 3747 C C     . LEU A 1 505 ? 58.593  74.610  51.468  1.00 66.39  ? 600 LEU A C     1 
ATOM 3748 O O     . LEU A 1 505 ? 59.427  75.511  51.605  1.00 67.50  ? 600 LEU A O     1 
ATOM 3749 C CB    . LEU A 1 505 ? 56.348  74.962  50.396  1.00 64.86  ? 600 LEU A CB    1 
ATOM 3750 C CG    . LEU A 1 505 ? 55.697  75.330  49.048  1.00 75.44  ? 600 LEU A CG    1 
ATOM 3751 C CD1   . LEU A 1 505 ? 54.416  76.107  49.186  1.00 71.74  ? 600 LEU A CD1   1 
ATOM 3752 C CD2   . LEU A 1 505 ? 56.645  76.102  48.160  1.00 66.76  ? 600 LEU A CD2   1 
ATOM 3753 N N     . ASN A 1 506 ? 58.402  73.693  52.413  1.00 71.26  ? 601 ASN A N     1 
ATOM 3754 C CA    . ASN A 1 506 ? 59.178  73.861  53.636  1.00 78.26  ? 601 ASN A CA    1 
ATOM 3755 C C     . ASN A 1 506 ? 60.651  73.537  53.416  1.00 74.58  ? 601 ASN A C     1 
ATOM 3756 O O     . ASN A 1 506 ? 61.507  74.114  54.094  1.00 69.88  ? 601 ASN A O     1 
ATOM 3757 C CB    . ASN A 1 506 ? 58.607  73.037  54.780  1.00 62.77  ? 601 ASN A CB    1 
ATOM 3758 C CG    . ASN A 1 506 ? 59.406  73.208  56.071  1.00 90.42  ? 601 ASN A CG    1 
ATOM 3759 O OD1   . ASN A 1 506 ? 59.878  72.212  56.664  1.00 95.76  ? 601 ASN A OD1   1 
ATOM 3760 N ND2   . ASN A 1 506 ? 59.581  74.477  56.507  1.00 73.13  ? 601 ASN A ND2   1 
ATOM 3761 N N     . SER A 1 507 ? 60.975  72.648  52.467  1.00 63.60  ? 602 SER A N     1 
ATOM 3762 C CA    . SER A 1 507 ? 62.382  72.489  52.108  1.00 70.45  ? 602 SER A CA    1 
ATOM 3763 C C     . SER A 1 507 ? 62.881  73.748  51.427  1.00 74.08  ? 602 SER A C     1 
ATOM 3764 O O     . SER A 1 507 ? 64.060  74.105  51.561  1.00 77.88  ? 602 SER A O     1 
ATOM 3765 C CB    . SER A 1 507 ? 62.597  71.256  51.199  1.00 73.24  ? 602 SER A CB    1 
ATOM 3766 O OG    . SER A 1 507 ? 63.750  70.465  51.549  1.00 62.07  ? 602 SER A OG    1 
ATOM 3767 N N     . PHE A 1 508 ? 61.977  74.459  50.745  1.00 70.64  ? 603 PHE A N     1 
ATOM 3768 C CA    . PHE A 1 508 ? 62.358  75.656  50.000  1.00 80.35  ? 603 PHE A CA    1 
ATOM 3769 C C     . PHE A 1 508 ? 62.697  76.826  50.938  1.00 84.02  ? 603 PHE A C     1 
ATOM 3770 O O     . PHE A 1 508 ? 63.754  77.452  50.798  1.00 88.88  ? 603 PHE A O     1 
ATOM 3771 C CB    . PHE A 1 508 ? 61.245  76.025  49.003  1.00 76.44  ? 603 PHE A CB    1 
ATOM 3772 C CG    . PHE A 1 508 ? 61.644  77.081  48.008  1.00 99.72  ? 603 PHE A CG    1 
ATOM 3773 C CD1   . PHE A 1 508 ? 61.918  76.737  46.683  1.00 98.98  ? 603 PHE A CD1   1 
ATOM 3774 C CD2   . PHE A 1 508 ? 61.762  78.428  48.400  1.00 97.01  ? 603 PHE A CD2   1 
ATOM 3775 C CE1   . PHE A 1 508 ? 62.316  77.716  45.758  1.00 95.86  ? 603 PHE A CE1   1 
ATOM 3776 C CE2   . PHE A 1 508 ? 62.146  79.402  47.501  1.00 81.54  ? 603 PHE A CE2   1 
ATOM 3777 C CZ    . PHE A 1 508 ? 62.424  79.046  46.169  1.00 95.42  ? 603 PHE A CZ    1 
ATOM 3778 N N     . TYR A 1 509 ? 61.833  77.146  51.908  1.00 68.25  ? 604 TYR A N     1 
ATOM 3779 C CA    . TYR A 1 509 ? 62.244  78.231  52.790  1.00 72.35  ? 604 TYR A CA    1 
ATOM 3780 C C     . TYR A 1 509 ? 63.434  77.831  53.624  1.00 72.32  ? 604 TYR A C     1 
ATOM 3781 O O     . TYR A 1 509 ? 63.979  78.664  54.345  1.00 83.62  ? 604 TYR A O     1 
ATOM 3782 C CB    . TYR A 1 509 ? 61.113  78.681  53.717  1.00 84.17  ? 604 TYR A CB    1 
ATOM 3783 C CG    . TYR A 1 509 ? 59.791  78.855  53.015  1.00 96.03  ? 604 TYR A CG    1 
ATOM 3784 C CD1   . TYR A 1 509 ? 58.596  78.616  53.685  1.00 98.32  ? 604 TYR A CD1   1 
ATOM 3785 C CD2   . TYR A 1 509 ? 59.727  79.242  51.674  1.00 79.21  ? 604 TYR A CD2   1 
ATOM 3786 C CE1   . TYR A 1 509 ? 57.367  78.758  53.039  1.00 87.75  ? 604 TYR A CE1   1 
ATOM 3787 C CE2   . TYR A 1 509 ? 58.509  79.368  51.020  1.00 72.55  ? 604 TYR A CE2   1 
ATOM 3788 C CZ    . TYR A 1 509 ? 57.330  79.126  51.708  1.00 77.04  ? 604 TYR A CZ    1 
ATOM 3789 O OH    . TYR A 1 509 ? 56.110  79.269  51.076  1.00 88.66  ? 604 TYR A OH    1 
ATOM 3790 N N     . LYS A 1 510 ? 63.798  76.560  53.581  1.00 72.81  ? 605 LYS A N     1 
ATOM 3791 C CA    . LYS A 1 510 ? 64.892  76.064  54.389  1.00 78.41  ? 605 LYS A CA    1 
ATOM 3792 C C     . LYS A 1 510 ? 66.229  76.376  53.742  1.00 69.30  ? 605 LYS A C     1 
ATOM 3793 O O     . LYS A 1 510 ? 67.122  76.934  54.384  1.00 76.28  ? 605 LYS A O     1 
ATOM 3794 C CB    . LYS A 1 510 ? 64.725  74.547  54.621  1.00 79.10  ? 605 LYS A CB    1 
ATOM 3795 C CG    . LYS A 1 510 ? 63.832  74.161  55.834  1.00 74.91  ? 605 LYS A CG    1 
ATOM 3796 C CD    . LYS A 1 510 ? 64.312  72.882  56.562  1.00 88.89  ? 605 LYS A CD    1 
ATOM 3797 C CE    . LYS A 1 510 ? 63.454  72.526  57.796  1.00 86.00  ? 605 LYS A CE    1 
ATOM 3798 N NZ    . LYS A 1 510 ? 63.549  71.079  58.220  1.00 123.68 ? 605 LYS A NZ    1 
ATOM 3799 N N     . ASN A 1 511 ? 66.382  76.033  52.470  1.00 61.31  ? 606 ASN A N     1 
ATOM 3800 C CA    . ASN A 1 511 ? 67.692  76.186  51.852  1.00 82.90  ? 606 ASN A CA    1 
ATOM 3801 C C     . ASN A 1 511 ? 67.945  77.619  51.384  1.00 93.93  ? 606 ASN A C     1 
ATOM 3802 O O     . ASN A 1 511 ? 69.104  78.054  51.343  1.00 97.30  ? 606 ASN A O     1 
ATOM 3803 C CB    . ASN A 1 511 ? 67.853  75.215  50.668  1.00 93.32  ? 606 ASN A CB    1 
ATOM 3804 C CG    . ASN A 1 511 ? 68.015  73.734  51.091  1.00 83.67  ? 606 ASN A CG    1 
ATOM 3805 O OD1   . ASN A 1 511 ? 67.681  72.833  50.327  1.00 60.26  ? 606 ASN A OD1   1 
ATOM 3806 N ND2   . ASN A 1 511 ? 68.534  73.493  52.292  1.00 89.62  ? 606 ASN A ND2   1 
ATOM 3807 N N     . PHE A 1 512 ? 66.892  78.338  50.971  1.00 90.20  ? 607 PHE A N     1 
ATOM 3808 C CA    . PHE A 1 512 ? 67.039  79.632  50.310  1.00 87.94  ? 607 PHE A CA    1 
ATOM 3809 C C     . PHE A 1 512 ? 66.727  80.874  51.164  1.00 109.57 ? 607 PHE A C     1 
ATOM 3810 O O     . PHE A 1 512 ? 66.949  81.991  50.678  1.00 125.31 ? 607 PHE A O     1 
ATOM 3811 C CB    . PHE A 1 512 ? 66.157  79.688  49.057  1.00 64.44  ? 607 PHE A CB    1 
ATOM 3812 C CG    . PHE A 1 512 ? 66.512  78.697  48.019  1.00 79.56  ? 607 PHE A CG    1 
ATOM 3813 C CD1   . PHE A 1 512 ? 67.509  77.755  48.228  1.00 91.30  ? 607 PHE A CD1   1 
ATOM 3814 C CD2   . PHE A 1 512 ? 65.849  78.702  46.805  1.00 96.30  ? 607 PHE A CD2   1 
ATOM 3815 C CE1   . PHE A 1 512 ? 67.834  76.823  47.248  1.00 97.65  ? 607 PHE A CE1   1 
ATOM 3816 C CE2   . PHE A 1 512 ? 66.171  77.776  45.809  1.00 109.92 ? 607 PHE A CE2   1 
ATOM 3817 C CZ    . PHE A 1 512 ? 67.166  76.832  46.032  1.00 102.08 ? 607 PHE A CZ    1 
ATOM 3818 N N     . CYS A 1 513 ? 66.227  80.761  52.395  1.00 88.28  ? 608 CYS A N     1 
ATOM 3819 C CA    . CYS A 1 513 ? 65.664  81.966  53.001  1.00 97.70  ? 608 CYS A CA    1 
ATOM 3820 C C     . CYS A 1 513 ? 66.069  82.128  54.460  1.00 101.10 ? 608 CYS A C     1 
ATOM 3821 O O     . CYS A 1 513 ? 65.852  81.227  55.273  1.00 112.62 ? 608 CYS A O     1 
ATOM 3822 C CB    . CYS A 1 513 ? 64.125  81.966  52.882  1.00 100.17 ? 608 CYS A CB    1 
ATOM 3823 S SG    . CYS A 1 513 ? 63.445  81.856  51.159  1.00 86.68  ? 608 CYS A SG    1 
ATOM 3824 N N     . LYS A 1 514 ? 66.635  83.282  54.797  1.00 91.91  ? 609 LYS A N     1 
ATOM 3825 C CA    . LYS A 1 514 ? 66.756  83.660  56.208  1.00 110.67 ? 609 LYS A CA    1 
ATOM 3826 C C     . LYS A 1 514 ? 65.946  84.936  56.505  1.00 133.31 ? 609 LYS A C     1 
ATOM 3827 O O     . LYS A 1 514 ? 66.158  85.998  55.901  1.00 119.89 ? 609 LYS A O     1 
ATOM 3828 C CB    . LYS A 1 514 ? 68.218  83.868  56.617  1.00 114.62 ? 609 LYS A CB    1 
ATOM 3829 C CG    . LYS A 1 514 ? 69.027  82.603  56.748  1.00 100.74 ? 609 LYS A CG    1 
ATOM 3830 C CD    . LYS A 1 514 ? 69.418  82.082  55.368  1.00 124.18 ? 609 LYS A CD    1 
ATOM 3831 C CE    . LYS A 1 514 ? 68.893  80.665  55.099  1.00 114.73 ? 609 LYS A CE    1 
ATOM 3832 N NZ    . LYS A 1 514 ? 68.707  80.380  53.641  1.00 78.23  ? 609 LYS A NZ    1 
ATOM 3833 O "O5'" . DG  B 2 1   ? 69.538  61.137  64.441  1.00 33.99  ? 2   DG  B "O5'" 1 
ATOM 3834 C "C5'" . DG  B 2 1   ? 68.152  61.128  64.879  1.00 48.07  ? 2   DG  B "C5'" 1 
ATOM 3835 C "C4'" . DG  B 2 1   ? 67.158  61.964  63.962  1.00 76.63  ? 2   DG  B "C4'" 1 
ATOM 3836 O "O4'" . DG  B 2 1   ? 65.849  61.331  63.981  1.00 76.66  ? 2   DG  B "O4'" 1 
ATOM 3837 C "C3'" . DG  B 2 1   ? 66.787  63.407  64.404  1.00 96.15  ? 2   DG  B "C3'" 1 
ATOM 3838 O "O3'" . DG  B 2 1   ? 66.071  64.186  63.304  1.00 98.02  ? 2   DG  B "O3'" 1 
ATOM 3839 C "C2'" . DG  B 2 1   ? 65.829  63.120  65.560  1.00 73.86  ? 2   DG  B "C2'" 1 
ATOM 3840 C "C1'" . DG  B 2 1   ? 65.060  61.886  65.037  1.00 67.52  ? 2   DG  B "C1'" 1 
ATOM 3841 N N9    . DG  B 2 1   ? 64.810  60.858  66.090  1.00 52.59  ? 2   DG  B N9    1 
ATOM 3842 C C8    . DG  B 2 1   ? 65.729  60.339  66.971  1.00 61.52  ? 2   DG  B C8    1 
ATOM 3843 N N7    . DG  B 2 1   ? 65.235  59.473  67.808  1.00 47.25  ? 2   DG  B N7    1 
ATOM 3844 C C5    . DG  B 2 1   ? 63.906  59.413  67.482  1.00 44.10  ? 2   DG  B C5    1 
ATOM 3845 C C6    . DG  B 2 1   ? 62.881  58.653  68.075  1.00 49.55  ? 2   DG  B C6    1 
ATOM 3846 O O6    . DG  B 2 1   ? 62.992  57.860  69.028  1.00 54.13  ? 2   DG  B O6    1 
ATOM 3847 N N1    . DG  B 2 1   ? 61.619  58.883  67.465  1.00 38.74  ? 2   DG  B N1    1 
ATOM 3848 C C2    . DG  B 2 1   ? 61.401  59.768  66.420  1.00 39.45  ? 2   DG  B C2    1 
ATOM 3849 N N2    . DG  B 2 1   ? 60.146  59.856  65.962  1.00 31.48  ? 2   DG  B N2    1 
ATOM 3850 N N3    . DG  B 2 1   ? 62.366  60.507  65.862  1.00 50.47  ? 2   DG  B N3    1 
ATOM 3851 C C4    . DG  B 2 1   ? 63.601  60.271  66.441  1.00 51.13  ? 2   DG  B C4    1 
ATOM 3852 P P     . DA  B 2 2   ? 65.924  65.820  63.331  1.00 82.51  ? 3   DA  B P     1 
ATOM 3853 O OP1   . DA  B 2 2   ? 66.339  66.346  62.024  1.00 63.00  ? 3   DA  B OP1   1 
ATOM 3854 O OP2   . DA  B 2 2   ? 66.437  66.377  64.601  1.00 54.83  ? 3   DA  B OP2   1 
ATOM 3855 O "O5'" . DA  B 2 2   ? 64.361  66.101  63.247  1.00 64.50  ? 3   DA  B "O5'" 1 
ATOM 3856 C "C5'" . DA  B 2 2   ? 63.457  65.012  63.165  1.00 89.61  ? 3   DA  B "C5'" 1 
ATOM 3857 C "C4'" . DA  B 2 2   ? 62.057  65.497  63.434  1.00 70.25  ? 3   DA  B "C4'" 1 
ATOM 3858 O "O4'" . DA  B 2 2   ? 61.396  64.624  64.413  1.00 87.52  ? 3   DA  B "O4'" 1 
ATOM 3859 C "C3'" . DA  B 2 2   ? 62.022  66.851  64.048  1.00 49.86  ? 3   DA  B "C3'" 1 
ATOM 3860 O "O3'" . DA  B 2 2   ? 60.731  67.461  63.745  1.00 72.95  ? 3   DA  B "O3'" 1 
ATOM 3861 C "C2'" . DA  B 2 2   ? 62.236  66.508  65.540  1.00 37.37  ? 3   DA  B "C2'" 1 
ATOM 3862 C "C1'" . DA  B 2 2   ? 61.406  65.237  65.694  1.00 53.68  ? 3   DA  B "C1'" 1 
ATOM 3863 N N9    . DA  B 2 2   ? 61.913  64.278  66.721  1.00 59.62  ? 3   DA  B N9    1 
ATOM 3864 C C8    . DA  B 2 2   ? 63.215  64.083  67.106  1.00 63.23  ? 3   DA  B C8    1 
ATOM 3865 N N7    . DA  B 2 2   ? 63.371  63.153  68.041  1.00 53.39  ? 3   DA  B N7    1 
ATOM 3866 C C5    . DA  B 2 2   ? 62.082  62.718  68.307  1.00 34.33  ? 3   DA  B C5    1 
ATOM 3867 C C6    . DA  B 2 2   ? 61.570  61.763  69.228  1.00 37.41  ? 3   DA  B C6    1 
ATOM 3868 N N6    . DA  B 2 2   ? 62.357  61.042  70.057  1.00 40.62  ? 3   DA  B N6    1 
ATOM 3869 N N1    . DA  B 2 2   ? 60.222  61.570  69.269  1.00 29.32  ? 3   DA  B N1    1 
ATOM 3870 C C2    . DA  B 2 2   ? 59.459  62.284  68.434  1.00 38.86  ? 3   DA  B C2    1 
ATOM 3871 N N3    . DA  B 2 2   ? 59.826  63.231  67.525  1.00 46.44  ? 3   DA  B N3    1 
ATOM 3872 C C4    . DA  B 2 2   ? 61.165  63.391  67.510  1.00 41.28  ? 3   DA  B C4    1 
ATOM 3873 P P     . DG  B 2 3   ? 60.374  68.980  64.174  1.00 94.28  ? 4   DG  B P     1 
ATOM 3874 O OP1   . DG  B 2 3   ? 60.453  69.875  62.996  1.00 68.99  ? 4   DG  B OP1   1 
ATOM 3875 O OP2   . DG  B 2 3   ? 60.911  69.254  65.564  1.00 47.39  ? 4   DG  B OP2   1 
ATOM 3876 O "O5'" . DG  B 2 3   ? 58.842  68.911  64.464  1.00 50.49  ? 4   DG  B "O5'" 1 
ATOM 3877 C "C5'" . DG  B 2 3   ? 58.518  68.825  65.752  1.00 28.89  ? 4   DG  B "C5'" 1 
ATOM 3878 C "C4'" . DG  B 2 3   ? 57.106  68.470  65.905  1.00 38.13  ? 4   DG  B "C4'" 1 
ATOM 3879 O "O4'" . DG  B 2 3   ? 57.058  67.276  66.693  1.00 61.58  ? 4   DG  B "O4'" 1 
ATOM 3880 C "C3'" . DG  B 2 3   ? 56.408  69.462  66.749  1.00 48.39  ? 4   DG  B "C3'" 1 
ATOM 3881 O "O3'" . DG  B 2 3   ? 55.045  69.311  66.623  1.00 43.36  ? 4   DG  B "O3'" 1 
ATOM 3882 C "C2'" . DG  B 2 3   ? 56.946  69.112  68.172  1.00 37.96  ? 4   DG  B "C2'" 1 
ATOM 3883 C "C1'" . DG  B 2 3   ? 57.156  67.614  68.074  1.00 41.80  ? 4   DG  B "C1'" 1 
ATOM 3884 N N9    . DG  B 2 3   ? 58.429  67.087  68.619  1.00 40.47  ? 4   DG  B N9    1 
ATOM 3885 C C8    . DG  B 2 3   ? 59.725  67.364  68.188  1.00 35.15  ? 4   DG  B C8    1 
ATOM 3886 N N7    . DG  B 2 3   ? 60.647  66.690  68.861  1.00 37.53  ? 4   DG  B N7    1 
ATOM 3887 C C5    . DG  B 2 3   ? 59.918  65.914  69.795  1.00 31.51  ? 4   DG  B C5    1 
ATOM 3888 C C6    . DG  B 2 3   ? 60.364  64.978  70.787  1.00 30.91  ? 4   DG  B C6    1 
ATOM 3889 O O6    . DG  B 2 3   ? 61.529  64.641  71.039  1.00 41.76  ? 4   DG  B O6    1 
ATOM 3890 N N1    . DG  B 2 3   ? 59.304  64.418  71.526  1.00 13.99  ? 4   DG  B N1    1 
ATOM 3891 C C2    . DG  B 2 3   ? 57.986  64.719  71.320  1.00 23.94  ? 4   DG  B C2    1 
ATOM 3892 N N2    . DG  B 2 3   ? 57.101  64.103  72.109  1.00 29.15  ? 4   DG  B N2    1 
ATOM 3893 N N3    . DG  B 2 3   ? 57.547  65.539  70.366  1.00 31.81  ? 4   DG  B N3    1 
ATOM 3894 C C4    . DG  B 2 3   ? 58.565  66.119  69.647  1.00 35.53  ? 4   DG  B C4    1 
ATOM 3895 P P     . DA  B 2 4   ? 54.108  70.384  67.336  1.00 44.84  ? 5   DA  B P     1 
ATOM 3896 O OP1   . DA  B 2 4   ? 52.680  70.177  67.108  1.00 46.75  ? 5   DA  B OP1   1 
ATOM 3897 O OP2   . DA  B 2 4   ? 54.768  71.642  66.921  1.00 60.91  ? 5   DA  B OP2   1 
ATOM 3898 O "O5'" . DA  B 2 4   ? 54.297  70.096  68.878  1.00 26.74  ? 5   DA  B "O5'" 1 
ATOM 3899 C "C5'" . DA  B 2 4   ? 53.599  69.090  69.510  1.00 31.33  ? 5   DA  B "C5'" 1 
ATOM 3900 C "C4'" . DA  B 2 4   ? 54.186  68.828  70.886  1.00 46.89  ? 5   DA  B "C4'" 1 
ATOM 3901 O "O4'" . DA  B 2 4   ? 55.596  68.633  70.789  1.00 40.09  ? 5   DA  B "O4'" 1 
ATOM 3902 C "C3'" . DA  B 2 4   ? 54.066  69.979  71.925  1.00 51.55  ? 5   DA  B "C3'" 1 
ATOM 3903 O "O3'" . DA  B 2 4   ? 52.915  69.781  72.757  1.00 42.68  ? 5   DA  B "O3'" 1 
ATOM 3904 C "C2'" . DA  B 2 4   ? 55.413  69.916  72.730  1.00 29.21  ? 5   DA  B "C2'" 1 
ATOM 3905 C "C1'" . DA  B 2 4   ? 56.041  68.675  72.111  1.00 33.55  ? 5   DA  B "C1'" 1 
ATOM 3906 N N9    . DA  B 2 4   ? 57.456  68.582  72.107  1.00 27.17  ? 5   DA  B N9    1 
ATOM 3907 C C8    . DA  B 2 4   ? 58.318  69.094  71.200  1.00 35.66  ? 5   DA  B C8    1 
ATOM 3908 N N7    . DA  B 2 4   ? 59.587  68.764  71.433  1.00 34.60  ? 5   DA  B N7    1 
ATOM 3909 C C5    . DA  B 2 4   ? 59.512  67.945  72.525  1.00 26.00  ? 5   DA  B C5    1 
ATOM 3910 C C6    . DA  B 2 4   ? 60.479  67.253  73.239  1.00 28.83  ? 5   DA  B C6    1 
ATOM 3911 N N6    . DA  B 2 4   ? 61.780  67.290  72.933  1.00 29.16  ? 5   DA  B N6    1 
ATOM 3912 N N1    . DA  B 2 4   ? 60.068  66.493  74.285  1.00 39.25  ? 5   DA  B N1    1 
ATOM 3913 C C2    . DA  B 2 4   ? 58.758  66.433  74.576  1.00 37.49  ? 5   DA  B C2    1 
ATOM 3914 N N3    . DA  B 2 4   ? 57.746  67.046  73.962  1.00 38.24  ? 5   DA  B N3    1 
ATOM 3915 C C4    . DA  B 2 4   ? 58.202  67.802  72.940  1.00 31.78  ? 5   DA  B C4    1 
ATOM 3916 P P     . DA  B 2 5   ? 52.490  70.951  73.724  1.00 56.67  ? 6   DA  B P     1 
ATOM 3917 O OP1   . DA  B 2 5   ? 51.038  71.131  73.971  1.00 40.68  ? 6   DA  B OP1   1 
ATOM 3918 O OP2   . DA  B 2 5   ? 53.281  71.994  73.040  1.00 53.90  ? 6   DA  B OP2   1 
ATOM 3919 O "O5'" . DA  B 2 5   ? 53.164  70.521  75.099  1.00 56.30  ? 6   DA  B "O5'" 1 
ATOM 3920 C "C5'" . DA  B 2 5   ? 52.481  69.614  75.937  1.00 47.05  ? 6   DA  B "C5'" 1 
ATOM 3921 C "C4'" . DA  B 2 5   ? 53.382  69.146  77.047  1.00 44.18  ? 6   DA  B "C4'" 1 
ATOM 3922 O "O4'" . DA  B 2 5   ? 54.692  69.126  76.540  1.00 43.07  ? 6   DA  B "O4'" 1 
ATOM 3923 C "C3'" . DA  B 2 5   ? 53.440  70.044  78.278  1.00 38.95  ? 6   DA  B "C3'" 1 
ATOM 3924 O "O3'" . DA  B 2 5   ? 52.910  69.378  79.343  1.00 49.83  ? 6   DA  B "O3'" 1 
ATOM 3925 C "C2'" . DA  B 2 5   ? 54.927  70.337  78.487  1.00 44.97  ? 6   DA  B "C2'" 1 
ATOM 3926 C "C1'" . DA  B 2 5   ? 55.594  69.326  77.585  1.00 43.38  ? 6   DA  B "C1'" 1 
ATOM 3927 N N9    . DA  B 2 5   ? 56.831  69.710  76.909  1.00 34.78  ? 6   DA  B N9    1 
ATOM 3928 C C8    . DA  B 2 5   ? 56.916  70.464  75.768  1.00 40.14  ? 6   DA  B C8    1 
ATOM 3929 N N7    . DA  B 2 5   ? 58.132  70.550  75.262  1.00 37.76  ? 6   DA  B N7    1 
ATOM 3930 C C5    . DA  B 2 5   ? 58.891  69.757  76.096  1.00 34.85  ? 6   DA  B C5    1 
ATOM 3931 C C6    . DA  B 2 5   ? 60.281  69.421  76.078  1.00 33.22  ? 6   DA  B C6    1 
ATOM 3932 N N6    . DA  B 2 5   ? 61.119  69.882  75.167  1.00 27.64  ? 6   DA  B N6    1 
ATOM 3933 N N1    . DA  B 2 5   ? 60.745  68.607  77.041  1.00 27.40  ? 6   DA  B N1    1 
ATOM 3934 C C2    . DA  B 2 5   ? 59.837  68.150  77.964  1.00 44.70  ? 6   DA  B C2    1 
ATOM 3935 N N3    . DA  B 2 5   ? 58.493  68.395  78.088  1.00 28.18  ? 6   DA  B N3    1 
ATOM 3936 C C4    . DA  B 2 5   ? 58.092  69.211  77.116  1.00 26.91  ? 6   DA  B C4    1 
ATOM 3937 P P     . DC  B 2 6   ? 52.573  70.187  80.669  1.00 61.25  ? 7   DC  B P     1 
ATOM 3938 O OP1   . DC  B 2 6   ? 51.835  69.448  81.735  1.00 38.83  ? 7   DC  B OP1   1 
ATOM 3939 O OP2   . DC  B 2 6   ? 51.925  71.391  80.150  1.00 44.81  ? 7   DC  B OP2   1 
ATOM 3940 O "O5'" . DC  B 2 6   ? 54.019  70.348  81.258  1.00 35.32  ? 7   DC  B "O5'" 1 
ATOM 3941 C "C5'" . DC  B 2 6   ? 54.446  69.358  82.102  1.00 35.13  ? 7   DC  B "C5'" 1 
ATOM 3942 C "C4'" . DC  B 2 6   ? 55.911  69.477  82.304  1.00 43.06  ? 7   DC  B "C4'" 1 
ATOM 3943 O "O4'" . DC  B 2 6   ? 56.546  69.878  81.083  1.00 42.11  ? 7   DC  B "O4'" 1 
ATOM 3944 C "C3'" . DC  B 2 6   ? 56.338  70.549  83.319  1.00 68.74  ? 7   DC  B "C3'" 1 
ATOM 3945 O "O3'" . DC  B 2 6   ? 57.160  69.968  84.273  1.00 59.00  ? 7   DC  B "O3'" 1 
ATOM 3946 C "C2'" . DC  B 2 6   ? 57.121  71.549  82.465  1.00 67.91  ? 7   DC  B "C2'" 1 
ATOM 3947 C "C1'" . DC  B 2 6   ? 57.677  70.568  81.502  1.00 40.98  ? 7   DC  B "C1'" 1 
ATOM 3948 N N1    . DC  B 2 6   ? 58.412  71.106  80.402  1.00 34.07  ? 7   DC  B N1    1 
ATOM 3949 C C2    . DC  B 2 6   ? 59.703  70.620  80.232  1.00 36.86  ? 7   DC  B C2    1 
ATOM 3950 O O2    . DC  B 2 6   ? 60.109  69.791  81.039  1.00 43.13  ? 7   DC  B O2    1 
ATOM 3951 N N3    . DC  B 2 6   ? 60.466  71.054  79.198  1.00 34.91  ? 7   DC  B N3    1 
ATOM 3952 C C4    . DC  B 2 6   ? 59.953  71.975  78.350  1.00 49.46  ? 7   DC  B C4    1 
ATOM 3953 N N4    . DC  B 2 6   ? 60.751  72.405  77.340  1.00 35.60  ? 7   DC  B N4    1 
ATOM 3954 C C5    . DC  B 2 6   ? 58.598  72.503  78.519  1.00 36.54  ? 7   DC  B C5    1 
ATOM 3955 C C6    . DC  B 2 6   ? 57.878  72.050  79.571  1.00 32.39  ? 7   DC  B C6    1 
ATOM 3956 P P     . DA  B 2 7   ? 56.511  69.518  85.659  1.00 73.14  ? 8   DA  B P     1 
ATOM 3957 O OP1   . DA  B 2 7   ? 55.394  68.610  85.331  1.00 50.17  ? 8   DA  B OP1   1 
ATOM 3958 O OP2   . DA  B 2 7   ? 56.199  70.820  86.273  1.00 97.67  ? 8   DA  B OP2   1 
ATOM 3959 O "O5'" . DA  B 2 7   ? 57.700  68.755  86.414  1.00 59.15  ? 8   DA  B "O5'" 1 
ATOM 3960 C "C5'" . DA  B 2 7   ? 58.643  68.061  85.601  1.00 70.23  ? 8   DA  B "C5'" 1 
ATOM 3961 C "C4'" . DA  B 2 7   ? 60.031  67.963  86.217  1.00 66.00  ? 8   DA  B "C4'" 1 
ATOM 3962 O "O4'" . DA  B 2 7   ? 61.024  68.643  85.395  1.00 76.89  ? 8   DA  B "O4'" 1 
ATOM 3963 C "C3'" . DA  B 2 7   ? 60.222  68.537  87.585  1.00 73.38  ? 8   DA  B "C3'" 1 
ATOM 3964 O "O3'" . DA  B 2 7   ? 61.303  67.811  88.156  1.00 87.00  ? 8   DA  B "O3'" 1 
ATOM 3965 C "C2'" . DA  B 2 7   ? 60.595  70.007  87.273  1.00 69.63  ? 8   DA  B "C2'" 1 
ATOM 3966 C "C1'" . DA  B 2 7   ? 61.418  69.881  85.992  1.00 57.06  ? 8   DA  B "C1'" 1 
ATOM 3967 N N9    . DA  B 2 7   ? 61.131  70.896  84.998  1.00 41.57  ? 8   DA  B N9    1 
ATOM 3968 C C8    . DA  B 2 7   ? 59.919  71.488  84.778  1.00 53.95  ? 8   DA  B C8    1 
ATOM 3969 N N7    . DA  B 2 7   ? 59.914  72.308  83.753  1.00 56.34  ? 8   DA  B N7    1 
ATOM 3970 C C5    . DA  B 2 7   ? 61.203  72.220  83.244  1.00 36.93  ? 8   DA  B C5    1 
ATOM 3971 C C6    . DA  B 2 7   ? 61.826  72.854  82.143  1.00 33.43  ? 8   DA  B C6    1 
ATOM 3972 N N6    . DA  B 2 7   ? 61.185  73.722  81.360  1.00 38.80  ? 8   DA  B N6    1 
ATOM 3973 N N1    . DA  B 2 7   ? 63.128  72.572  81.886  1.00 27.93  ? 8   DA  B N1    1 
ATOM 3974 C C2    . DA  B 2 7   ? 63.740  71.681  82.693  1.00 46.19  ? 8   DA  B C2    1 
ATOM 3975 N N3    . DA  B 2 7   ? 63.237  71.008  83.767  1.00 45.08  ? 8   DA  B N3    1 
ATOM 3976 C C4    . DA  B 2 7   ? 61.962  71.347  83.993  1.00 31.98  ? 8   DA  B C4    1 
ATOM 3977 P P     . DA  B 2 8   ? 61.931  68.205  89.571  1.00 109.90 ? 9   DA  B P     1 
ATOM 3978 O OP1   . DA  B 2 8   ? 62.719  67.030  90.056  1.00 82.12  ? 9   DA  B OP1   1 
ATOM 3979 O OP2   . DA  B 2 8   ? 60.791  68.722  90.390  1.00 112.82 ? 9   DA  B OP2   1 
ATOM 3980 O "O5'" . DA  B 2 8   ? 62.971  69.363  89.169  1.00 74.42  ? 9   DA  B "O5'" 1 
ATOM 3981 C "C5'" . DA  B 2 8   ? 64.194  69.001  88.605  1.00 79.71  ? 9   DA  B "C5'" 1 
ATOM 3982 C "C4'" . DA  B 2 8   ? 64.966  70.219  88.197  1.00 63.63  ? 9   DA  B "C4'" 1 
ATOM 3983 O "O4'" . DA  B 2 8   ? 64.158  70.998  87.315  1.00 64.61  ? 9   DA  B "O4'" 1 
ATOM 3984 C "C3'" . DA  B 2 8   ? 65.341  71.149  89.333  1.00 79.34  ? 9   DA  B "C3'" 1 
ATOM 3985 O "O3'" . DA  B 2 8   ? 66.779  70.917  89.681  1.00 96.04  ? 9   DA  B "O3'" 1 
ATOM 3986 C "C2'" . DA  B 2 8   ? 65.006  72.587  88.768  1.00 77.30  ? 9   DA  B "C2'" 1 
ATOM 3987 C "C1'" . DA  B 2 8   ? 64.656  72.307  87.290  1.00 56.39  ? 9   DA  B "C1'" 1 
ATOM 3988 N N9    . DA  B 2 8   ? 63.603  73.146  86.655  1.00 40.36  ? 9   DA  B N9    1 
ATOM 3989 C C8    . DA  B 2 8   ? 62.270  73.128  86.957  1.00 51.68  ? 9   DA  B C8    1 
ATOM 3990 N N7    . DA  B 2 8   ? 61.523  73.908  86.205  1.00 42.97  ? 9   DA  B N7    1 
ATOM 3991 C C5    . DA  B 2 8   ? 62.414  74.450  85.305  1.00 40.44  ? 9   DA  B C5    1 
ATOM 3992 C C6    . DA  B 2 8   ? 62.225  75.381  84.217  1.00 39.69  ? 9   DA  B C6    1 
ATOM 3993 N N6    . DA  B 2 8   ? 61.020  75.875  83.880  1.00 41.46  ? 9   DA  B N6    1 
ATOM 3994 N N1    . DA  B 2 8   ? 63.317  75.749  83.494  1.00 29.35  ? 9   DA  B N1    1 
ATOM 3995 C C2    . DA  B 2 8   ? 64.524  75.194  83.845  1.00 48.00  ? 9   DA  B C2    1 
ATOM 3996 N N3    . DA  B 2 8   ? 64.823  74.302  84.855  1.00 44.46  ? 9   DA  B N3    1 
ATOM 3997 C C4    . DA  B 2 8   ? 63.710  73.976  85.552  1.00 33.57  ? 9   DA  B C4    1 
ATOM 3998 P P     . DC  B 2 9   ? 67.520  71.661  90.919  1.00 104.98 ? 10  DC  B P     1 
ATOM 3999 O OP1   . DC  B 2 9   ? 68.902  71.093  91.015  1.00 89.01  ? 10  DC  B OP1   1 
ATOM 4000 O OP2   . DC  B 2 9   ? 66.713  71.472  92.150  1.00 67.55  ? 10  DC  B OP2   1 
ATOM 4001 O "O5'" . DC  B 2 9   ? 67.617  73.197  90.391  1.00 42.55  ? 10  DC  B "O5'" 1 
ATOM 4002 C "C5'" . DC  B 2 9   ? 68.530  73.440  89.372  1.00 60.77  ? 10  DC  B "C5'" 1 
ATOM 4003 C "C4'" . DC  B 2 9   ? 68.258  74.710  88.613  1.00 71.39  ? 10  DC  B "C4'" 1 
ATOM 4004 O "O4'" . DC  B 2 9   ? 66.881  74.933  88.360  1.00 72.80  ? 10  DC  B "O4'" 1 
ATOM 4005 C "C3'" . DC  B 2 9   ? 68.667  75.980  89.299  1.00 97.86  ? 10  DC  B "C3'" 1 
ATOM 4006 O "O3'" . DC  B 2 9   ? 70.025  76.210  89.020  1.00 110.41 ? 10  DC  B "O3'" 1 
ATOM 4007 C "C2'" . DC  B 2 9   ? 67.716  77.046  88.658  1.00 77.17  ? 10  DC  B "C2'" 1 
ATOM 4008 C "C1'" . DC  B 2 9   ? 66.875  76.185  87.721  1.00 52.21  ? 10  DC  B "C1'" 1 
ATOM 4009 N N1    . DC  B 2 9   ? 65.481  76.624  87.536  1.00 40.08  ? 10  DC  B N1    1 
ATOM 4010 C C2    . DC  B 2 9   ? 65.159  77.487  86.472  1.00 44.02  ? 10  DC  B C2    1 
ATOM 4011 O O2    . DC  B 2 9   ? 66.059  77.879  85.726  1.00 43.28  ? 10  DC  B O2    1 
ATOM 4012 N N3    . DC  B 2 9   ? 63.865  77.860  86.290  1.00 34.02  ? 10  DC  B N3    1 
ATOM 4013 C C4    . DC  B 2 9   ? 62.935  77.381  87.116  1.00 39.91  ? 10  DC  B C4    1 
ATOM 4014 N N4    . DC  B 2 9   ? 61.688  77.766  86.925  1.00 47.58  ? 10  DC  B N4    1 
ATOM 4015 C C5    . DC  B 2 9   ? 63.241  76.481  88.187  1.00 37.28  ? 10  DC  B C5    1 
ATOM 4016 C C6    . DC  B 2 9   ? 64.510  76.123  88.352  1.00 41.00  ? 10  DC  B C6    1 
ATOM 4017 P P     . DA  B 2 10  ? 70.814  77.308  89.860  1.00 116.52 ? 11  DA  B P     1 
ATOM 4018 O OP1   . DA  B 2 10  ? 72.265  77.110  89.604  1.00 110.26 ? 11  DA  B OP1   1 
ATOM 4019 O OP2   . DA  B 2 10  ? 70.272  77.194  91.248  1.00 91.26  ? 11  DA  B OP2   1 
ATOM 4020 O "O5'" . DA  B 2 10  ? 70.374  78.644  89.104  1.00 65.50  ? 11  DA  B "O5'" 1 
ATOM 4021 C "C5'" . DA  B 2 10  ? 70.458  78.657  87.686  1.00 64.23  ? 11  DA  B "C5'" 1 
ATOM 4022 C "C4'" . DA  B 2 10  ? 69.953  79.958  87.107  1.00 54.14  ? 11  DA  B "C4'" 1 
ATOM 4023 O "O4'" . DA  B 2 10  ? 68.516  79.932  86.876  1.00 71.01  ? 11  DA  B "O4'" 1 
ATOM 4024 C "C3'" . DA  B 2 10  ? 70.183  81.146  87.976  1.00 81.33  ? 11  DA  B "C3'" 1 
ATOM 4025 O "O3'" . DA  B 2 10  ? 70.430  82.174  87.143  1.00 101.58 ? 11  DA  B "O3'" 1 
ATOM 4026 C "C2'" . DA  B 2 10  ? 68.831  81.316  88.658  1.00 73.79  ? 11  DA  B "C2'" 1 
ATOM 4027 C "C1'" . DA  B 2 10  ? 67.925  81.039  87.491  1.00 51.71  ? 11  DA  B "C1'" 1 
ATOM 4028 N N9    . DA  B 2 10  ? 66.535  80.741  87.880  1.00 52.59  ? 11  DA  B N9    1 
ATOM 4029 C C8    . DA  B 2 10  ? 66.083  79.970  88.965  1.00 60.55  ? 11  DA  B C8    1 
ATOM 4030 N N7    . DA  B 2 10  ? 64.756  79.924  89.086  1.00 46.16  ? 11  DA  B N7    1 
ATOM 4031 C C5    . DA  B 2 10  ? 64.315  80.722  88.020  1.00 52.04  ? 11  DA  B C5    1 
ATOM 4032 C C6    . DA  B 2 10  ? 63.019  81.069  87.575  1.00 50.53  ? 11  DA  B C6    1 
ATOM 4033 N N6    . DA  B 2 10  ? 61.920  80.634  88.192  1.00 46.11  ? 11  DA  B N6    1 
ATOM 4034 N N1    . DA  B 2 10  ? 62.903  81.880  86.449  1.00 46.11  ? 11  DA  B N1    1 
ATOM 4035 C C2    . DA  B 2 10  ? 64.040  82.324  85.833  1.00 47.06  ? 11  DA  B C2    1 
ATOM 4036 N N3    . DA  B 2 10  ? 65.338  82.058  86.162  1.00 49.14  ? 11  DA  B N3    1 
ATOM 4037 C C4    . DA  B 2 10  ? 65.401  81.234  87.270  1.00 52.44  ? 11  DA  B C4    1 
ATOM 4038 P P     . DA  B 2 11  ? 71.334  83.393  87.618  1.00 130.43 ? 12  DA  B P     1 
ATOM 4039 O OP1   . DA  B 2 11  ? 72.677  82.830  87.994  1.00 74.03  ? 12  DA  B OP1   1 
ATOM 4040 O OP2   . DA  B 2 11  ? 70.585  84.061  88.730  1.00 82.73  ? 12  DA  B OP2   1 
ATOM 4041 O "O5'" . DA  B 2 11  ? 71.314  84.297  86.274  1.00 92.14  ? 12  DA  B "O5'" 1 
ATOM 4042 C "C5'" . DA  B 2 11  ? 70.989  85.636  86.378  1.00 87.72  ? 12  DA  B "C5'" 1 
ATOM 4043 C "C4'" . DA  B 2 11  ? 69.482  85.931  86.258  1.00 104.09 ? 12  DA  B "C4'" 1 
ATOM 4044 O "O4'" . DA  B 2 11  ? 68.602  84.995  86.948  1.00 80.32  ? 12  DA  B "O4'" 1 
ATOM 4045 C "C3'" . DA  B 2 11  ? 69.097  87.295  86.842  1.00 118.13 ? 12  DA  B "C3'" 1 
ATOM 4046 O "O3'" . DA  B 2 11  ? 68.712  88.118  85.836  1.00 130.30 ? 12  DA  B "O3'" 1 
ATOM 4047 C "C2'" . DA  B 2 11  ? 67.923  87.020  87.785  1.00 91.53  ? 12  DA  B "C2'" 1 
ATOM 4048 C "C1'" . DA  B 2 11  ? 67.413  85.740  87.179  1.00 66.59  ? 12  DA  B "C1'" 1 
ATOM 4049 N N9    . DA  B 2 11  ? 66.436  85.027  88.015  1.00 60.63  ? 12  DA  B N9    1 
ATOM 4050 C C8    . DA  B 2 11  ? 66.667  84.156  89.082  1.00 65.50  ? 12  DA  B C8    1 
ATOM 4051 N N7    . DA  B 2 11  ? 65.555  83.675  89.647  1.00 50.45  ? 12  DA  B N7    1 
ATOM 4052 C C5    . DA  B 2 11  ? 64.533  84.291  88.915  1.00 51.89  ? 12  DA  B C5    1 
ATOM 4053 C C6    . DA  B 2 11  ? 63.120  84.204  88.997  1.00 50.14  ? 12  DA  B C6    1 
ATOM 4054 N N6    . DA  B 2 11  ? 62.496  83.447  89.898  1.00 46.69  ? 12  DA  B N6    1 
ATOM 4055 N N1    . DA  B 2 11  ? 62.375  84.947  88.098  1.00 57.12  ? 12  DA  B N1    1 
ATOM 4056 C C2    . DA  B 2 11  ? 63.026  85.737  87.179  1.00 52.57  ? 12  DA  B C2    1 
ATOM 4057 N N3    . DA  B 2 11  ? 64.363  85.896  87.004  1.00 41.30  ? 12  DA  B N3    1 
ATOM 4058 C C4    . DA  B 2 11  ? 65.064  85.139  87.911  1.00 50.80  ? 12  DA  B C4    1 
ATOM 4059 P P     . DC  B 2 12  ? 68.834  89.676  86.105  1.00 108.28 ? 13  DC  B P     1 
ATOM 4060 O OP1   . DC  B 2 12  ? 68.790  90.351  84.780  1.00 65.16  ? 13  DC  B OP1   1 
ATOM 4061 O OP2   . DC  B 2 12  ? 69.986  89.755  87.040  1.00 113.44 ? 13  DC  B OP2   1 
ATOM 4062 O "O5'" . DC  B 2 12  ? 67.517  90.011  86.940  1.00 97.51  ? 13  DC  B "O5'" 1 
ATOM 4063 C "C5'" . DC  B 2 12  ? 66.388  90.546  86.280  1.00 78.47  ? 13  DC  B "C5'" 1 
ATOM 4064 C "C4'" . DC  B 2 12  ? 65.143  90.241  87.076  1.00 80.03  ? 13  DC  B "C4'" 1 
ATOM 4065 O "O4'" . DC  B 2 12  ? 65.345  89.114  87.938  1.00 73.62  ? 13  DC  B "O4'" 1 
ATOM 4066 C "C3'" . DC  B 2 12  ? 64.746  91.279  88.086  1.00 102.93 ? 13  DC  B "C3'" 1 
ATOM 4067 O "O3'" . DC  B 2 12  ? 64.070  92.297  87.476  1.00 117.04 ? 13  DC  B "O3'" 1 
ATOM 4068 C "C2'" . DC  B 2 12  ? 63.813  90.483  89.020  1.00 87.43  ? 13  DC  B "C2'" 1 
ATOM 4069 C "C1'" . DC  B 2 12  ? 64.149  89.042  88.668  1.00 57.09  ? 13  DC  B "C1'" 1 
ATOM 4070 N N1    . DC  B 2 12  ? 64.297  88.164  89.830  1.00 52.75  ? 13  DC  B N1    1 
ATOM 4071 C C2    . DC  B 2 12  ? 63.140  87.636  90.436  1.00 67.78  ? 13  DC  B C2    1 
ATOM 4072 O O2    . DC  B 2 12  ? 61.995  87.942  89.951  1.00 60.09  ? 13  DC  B O2    1 
ATOM 4073 N N3    . DC  B 2 12  ? 63.296  86.796  91.533  1.00 62.08  ? 13  DC  B N3    1 
ATOM 4074 C C4    . DC  B 2 12  ? 64.535  86.513  92.005  1.00 58.52  ? 13  DC  B C4    1 
ATOM 4075 N N4    . DC  B 2 12  ? 64.654  85.713  93.090  1.00 59.29  ? 13  DC  B N4    1 
ATOM 4076 C C5    . DC  B 2 12  ? 65.697  87.046  91.385  1.00 67.87  ? 13  DC  B C5    1 
ATOM 4077 C C6    . DC  B 2 12  ? 65.536  87.861  90.310  1.00 71.41  ? 13  DC  B C6    1 
ATOM 4078 P P     . DA  B 2 13  ? 63.657  93.560  88.360  1.00 128.99 ? 14  DA  B P     1 
ATOM 4079 O OP1   . DA  B 2 13  ? 63.393  94.587  87.315  1.00 93.65  ? 14  DA  B OP1   1 
ATOM 4080 O OP2   . DA  B 2 13  ? 64.731  93.680  89.403  1.00 102.27 ? 14  DA  B OP2   1 
ATOM 4081 O "O5'" . DA  B 2 13  ? 62.224  93.161  89.015  1.00 83.48  ? 14  DA  B "O5'" 1 
ATOM 4082 C "C5'" . DA  B 2 13  ? 61.069  93.177  88.185  1.00 86.28  ? 14  DA  B "C5'" 1 
ATOM 4083 C "C4'" . DA  B 2 13  ? 59.804  92.934  88.979  1.00 91.06  ? 14  DA  B "C4'" 1 
ATOM 4084 O "O4'" . DA  B 2 13  ? 59.927  91.720  89.725  1.00 103.00 ? 14  DA  B "O4'" 1 
ATOM 4085 C "C3'" . DA  B 2 13  ? 59.444  94.010  89.975  1.00 98.87  ? 14  DA  B "C3'" 1 
ATOM 4086 O "O3'" . DA  B 2 13  ? 58.084  94.311  89.852  1.00 105.07 ? 14  DA  B "O3'" 1 
ATOM 4087 C "C2'" . DA  B 2 13  ? 59.771  93.405  91.342  1.00 82.45  ? 14  DA  B "C2'" 1 
ATOM 4088 C "C1'" . DA  B 2 13  ? 59.667  91.922  91.088  1.00 73.09  ? 14  DA  B "C1'" 1 
ATOM 4089 N N9    . DA  B 2 13  ? 60.682  91.190  91.768  1.00 61.59  ? 14  DA  B N9    1 
ATOM 4090 C C8    . DA  B 2 13  ? 62.033  91.359  91.623  1.00 63.96  ? 14  DA  B C8    1 
ATOM 4091 N N7    . DA  B 2 13  ? 62.756  90.529  92.349  1.00 54.81  ? 14  DA  B N7    1 
ATOM 4092 C C5    . DA  B 2 13  ? 61.810  89.763  93.015  1.00 62.32  ? 14  DA  B C5    1 
ATOM 4093 C C6    . DA  B 2 13  ? 61.935  88.692  93.946  1.00 65.60  ? 14  DA  B C6    1 
ATOM 4094 N N6    . DA  B 2 13  ? 63.125  88.237  94.378  1.00 67.10  ? 14  DA  B N6    1 
ATOM 4095 N N1    . DA  B 2 13  ? 60.785  88.115  94.403  1.00 50.81  ? 14  DA  B N1    1 
ATOM 4096 C C2    . DA  B 2 13  ? 59.599  88.620  93.962  1.00 63.26  ? 14  DA  B C2    1 
ATOM 4097 N N3    . DA  B 2 13  ? 59.358  89.630  93.078  1.00 48.78  ? 14  DA  B N3    1 
ATOM 4098 C C4    . DA  B 2 13  ? 60.514  90.153  92.643  1.00 57.88  ? 14  DA  B C4    1 
ATOM 4099 P P     . DA  B 2 14  ? 57.497  95.575  90.635  1.00 127.22 ? 15  DA  B P     1 
ATOM 4100 O OP1   . DA  B 2 14  ? 56.207  95.935  90.012  1.00 124.95 ? 15  DA  B OP1   1 
ATOM 4101 O OP2   . DA  B 2 14  ? 58.551  96.620  90.680  1.00 128.94 ? 15  DA  B OP2   1 
ATOM 4102 O "O5'" . DA  B 2 14  ? 57.203  94.964  92.080  1.00 88.79  ? 15  DA  B "O5'" 1 
ATOM 4103 C "C5'" . DA  B 2 14  ? 56.157  94.083  92.209  1.00 80.01  ? 15  DA  B "C5'" 1 
ATOM 4104 C "C4'" . DA  B 2 14  ? 56.238  93.322  93.500  1.00 90.94  ? 15  DA  B "C4'" 1 
ATOM 4105 O "O4'" . DA  B 2 14  ? 57.554  92.746  93.656  1.00 82.02  ? 15  DA  B "O4'" 1 
ATOM 4106 C "C3'" . DA  B 2 14  ? 56.005  94.147  94.787  1.00 117.43 ? 15  DA  B "C3'" 1 
ATOM 4107 O "O3'" . DA  B 2 14  ? 54.824  93.684  95.507  1.00 123.11 ? 15  DA  B "O3'" 1 
ATOM 4108 C "C2'" . DA  B 2 14  ? 57.280  93.865  95.588  1.00 119.20 ? 15  DA  B "C2'" 1 
ATOM 4109 C "C1'" . DA  B 2 14  ? 57.636  92.522  95.017  1.00 86.18  ? 15  DA  B "C1'" 1 
ATOM 4110 N N9    . DA  B 2 14  ? 58.932  92.002  95.403  1.00 78.65  ? 15  DA  B N9    1 
ATOM 4111 C C8    . DA  B 2 14  ? 60.182  92.462  95.055  1.00 75.87  ? 15  DA  B C8    1 
ATOM 4112 N N7    . DA  B 2 14  ? 61.174  91.756  95.591  1.00 63.76  ? 15  DA  B N7    1 
ATOM 4113 C C5    . DA  B 2 14  ? 60.508  90.770  96.340  1.00 78.87  ? 15  DA  B C5    1 
ATOM 4114 C C6    . DA  B 2 14  ? 60.968  89.677  97.158  1.00 84.67  ? 15  DA  B C6    1 
ATOM 4115 N N6    . DA  B 2 14  ? 62.270  89.395  97.360  1.00 77.09  ? 15  DA  B N6    1 
ATOM 4116 N N1    . DA  B 2 14  ? 60.023  88.886  97.754  1.00 72.27  ? 15  DA  B N1    1 
ATOM 4117 C C2    . DA  B 2 14  ? 58.722  89.172  97.541  1.00 79.13  ? 15  DA  B C2    1 
ATOM 4118 N N3    . DA  B 2 14  ? 58.177  90.158  96.796  1.00 74.23  ? 15  DA  B N3    1 
ATOM 4119 C C4    . DA  B 2 14  ? 59.130  90.922  96.226  1.00 74.52  ? 15  DA  B C4    1 
ATOM 4120 P P     . DG  B 2 15  ? 54.224  94.551  96.737  1.00 155.69 ? 16  DG  B P     1 
ATOM 4121 O OP1   . DG  B 2 15  ? 53.509  95.706  96.143  1.00 164.48 ? 16  DG  B OP1   1 
ATOM 4122 O OP2   . DG  B 2 15  ? 55.286  94.809  97.728  1.00 130.70 ? 16  DG  B OP2   1 
ATOM 4123 O "O5'" . DG  B 2 15  ? 53.166  93.581  97.464  1.00 144.81 ? 16  DG  B "O5'" 1 
ATOM 4124 C "C5'" . DG  B 2 15  ? 53.441  92.176  97.618  1.00 142.96 ? 16  DG  B "C5'" 1 
ATOM 4125 C "C4'" . DG  B 2 15  ? 54.146  91.872  98.935  1.00 131.83 ? 16  DG  B "C4'" 1 
ATOM 4126 O "O4'" . DG  B 2 15  ? 55.544  91.632  98.678  1.00 128.83 ? 16  DG  B "O4'" 1 
ATOM 4127 C "C3'" . DG  B 2 15  ? 54.108  92.996  99.951  1.00 141.15 ? 16  DG  B "C3'" 1 
ATOM 4128 O "O3'" . DG  B 2 15  ? 53.001  92.818  100.829 1.00 159.29 ? 16  DG  B "O3'" 1 
ATOM 4129 C "C2'" . DG  B 2 15  ? 55.452  92.879  100.694 1.00 130.55 ? 16  DG  B "C2'" 1 
ATOM 4130 C "C1'" . DG  B 2 15  ? 56.303  91.945  99.825  1.00 112.75 ? 16  DG  B "C1'" 1 
ATOM 4131 N N9    . DG  B 2 15  ? 57.601  92.534  99.409  1.00 105.45 ? 16  DG  B N9    1 
ATOM 4132 C C8    . DG  B 2 15  ? 57.812  93.697  98.676  1.00 97.04  ? 16  DG  B C8    1 
ATOM 4133 N N7    . DG  B 2 15  ? 59.077  93.972  98.451  1.00 72.21  ? 16  DG  B N7    1 
ATOM 4134 C C5    . DG  B 2 15  ? 59.756  92.942  99.099  1.00 82.11  ? 16  DG  B C5    1 
ATOM 4135 C C6    . DG  B 2 15  ? 61.144  92.707  99.220  1.00 77.29  ? 16  DG  B C6    1 
ATOM 4136 O O6    . DG  B 2 15  ? 62.084  93.394  98.761  1.00 73.50  ? 16  DG  B O6    1 
ATOM 4137 N N1    . DG  B 2 15  ? 61.405  91.529  99.959  1.00 72.06  ? 16  DG  B N1    1 
ATOM 4138 C C2    . DG  B 2 15  ? 60.438  90.695  100.514 1.00 75.28  ? 16  DG  B C2    1 
ATOM 4139 N N2    . DG  B 2 15  ? 60.878  89.614  101.190 1.00 60.76  ? 16  DG  B N2    1 
ATOM 4140 N N3    . DG  B 2 15  ? 59.130  90.912  100.411 1.00 82.73  ? 16  DG  B N3    1 
ATOM 4141 C C4    . DG  B 2 15  ? 58.860  92.045  99.694  1.00 93.49  ? 16  DG  B C4    1 
ATOM 4142 O "O5'" . DC  C 3 1   ? 66.799  88.833  107.073 1.00 97.70  ? 1   DC  C "O5'" 1 
ATOM 4143 C "C5'" . DC  C 3 1   ? 67.135  87.490  106.599 1.00 114.06 ? 1   DC  C "C5'" 1 
ATOM 4144 C "C4'" . DC  C 3 1   ? 65.907  86.697  106.089 1.00 112.46 ? 1   DC  C "C4'" 1 
ATOM 4145 O "O4'" . DC  C 3 1   ? 65.030  87.520  105.242 1.00 96.28  ? 1   DC  C "O4'" 1 
ATOM 4146 C "C3'" . DC  C 3 1   ? 66.231  85.476  105.214 1.00 114.16 ? 1   DC  C "C3'" 1 
ATOM 4147 O "O3'" . DC  C 3 1   ? 65.214  84.470  105.411 1.00 120.94 ? 1   DC  C "O3'" 1 
ATOM 4148 C "C2'" . DC  C 3 1   ? 66.130  86.084  103.831 1.00 95.40  ? 1   DC  C "C2'" 1 
ATOM 4149 C "C1'" . DC  C 3 1   ? 64.834  86.831  104.018 1.00 77.52  ? 1   DC  C "C1'" 1 
ATOM 4150 N N1    . DC  C 3 1   ? 64.609  87.775  102.993 1.00 64.90  ? 1   DC  C N1    1 
ATOM 4151 C C2    . DC  C 3 1   ? 63.295  88.193  102.677 1.00 72.73  ? 1   DC  C C2    1 
ATOM 4152 O O2    . DC  C 3 1   ? 62.310  87.709  103.308 1.00 68.40  ? 1   DC  C O2    1 
ATOM 4153 N N3    . DC  C 3 1   ? 63.141  89.129  101.680 1.00 66.90  ? 1   DC  C N3    1 
ATOM 4154 C C4    . DC  C 3 1   ? 64.235  89.629  101.041 1.00 64.65  ? 1   DC  C C4    1 
ATOM 4155 N N4    . DC  C 3 1   ? 64.054  90.540  100.076 1.00 49.44  ? 1   DC  C N4    1 
ATOM 4156 C C5    . DC  C 3 1   ? 65.560  89.194  101.361 1.00 68.43  ? 1   DC  C C5    1 
ATOM 4157 C C6    . DC  C 3 1   ? 65.692  88.266  102.322 1.00 70.73  ? 1   DC  C C6    1 
ATOM 4158 P P     . DT  C 3 2   ? 64.773  83.429  104.250 1.00 138.10 ? 2   DT  C P     1 
ATOM 4159 O OP1   . DT  C 3 2   ? 64.500  82.211  105.048 1.00 127.84 ? 2   DT  C OP1   1 
ATOM 4160 O OP2   . DT  C 3 2   ? 65.697  83.337  103.078 1.00 116.69 ? 2   DT  C OP2   1 
ATOM 4161 O "O5'" . DT  C 3 2   ? 63.369  84.005  103.741 1.00 97.83  ? 2   DT  C "O5'" 1 
ATOM 4162 C "C5'" . DT  C 3 2   ? 62.350  84.288  104.689 1.00 100.13 ? 2   DT  C "C5'" 1 
ATOM 4163 C "C4'" . DT  C 3 2   ? 60.971  84.158  104.076 1.00 106.28 ? 2   DT  C "C4'" 1 
ATOM 4164 O "O4'" . DT  C 3 2   ? 60.816  85.162  103.047 1.00 104.36 ? 2   DT  C "O4'" 1 
ATOM 4165 C "C3'" . DT  C 3 2   ? 60.671  82.839  103.369 1.00 109.58 ? 2   DT  C "C3'" 1 
ATOM 4166 O "O3'" . DT  C 3 2   ? 59.240  82.684  103.299 1.00 125.94 ? 2   DT  C "O3'" 1 
ATOM 4167 C "C2'" . DT  C 3 2   ? 61.258  83.118  102.003 1.00 90.84  ? 2   DT  C "C2'" 1 
ATOM 4168 C "C1'" . DT  C 3 2   ? 60.746  84.523  101.793 1.00 78.27  ? 2   DT  C "C1'" 1 
ATOM 4169 N N1    . DT  C 3 2   ? 61.548  85.253  100.902 1.00 70.89  ? 2   DT  C N1    1 
ATOM 4170 C C2    . DT  C 3 2   ? 60.937  86.168  100.090 1.00 72.52  ? 2   DT  C C2    1 
ATOM 4171 O O2    . DT  C 3 2   ? 59.746  86.365  100.120 1.00 81.60  ? 2   DT  C O2    1 
ATOM 4172 N N3    . DT  C 3 2   ? 61.768  86.840  99.236  1.00 57.12  ? 2   DT  C N3    1 
ATOM 4173 C C4    . DT  C 3 2   ? 63.140  86.683  99.138  1.00 59.83  ? 2   DT  C C4    1 
ATOM 4174 O O4    . DT  C 3 2   ? 63.805  87.317  98.334  1.00 55.69  ? 2   DT  C O4    1 
ATOM 4175 C C5    . DT  C 3 2   ? 63.734  85.698  100.042 1.00 65.69  ? 2   DT  C C5    1 
ATOM 4176 C C7    . DT  C 3 2   ? 65.218  85.441  100.015 1.00 61.42  ? 2   DT  C C7    1 
ATOM 4177 C C6    . DT  C 3 2   ? 62.910  85.029  100.873 1.00 66.61  ? 2   DT  C C6    1 
ATOM 4178 P P     . DT  C 3 3   ? 58.513  81.501  102.472 1.00 142.23 ? 3   DT  C P     1 
ATOM 4179 O OP1   . DT  C 3 3   ? 58.197  80.400  103.428 1.00 122.81 ? 3   DT  C OP1   1 
ATOM 4180 O OP2   . DT  C 3 3   ? 59.236  81.215  101.213 1.00 126.50 ? 3   DT  C OP2   1 
ATOM 4181 O "O5'" . DT  C 3 3   ? 57.130  82.173  102.029 1.00 102.34 ? 3   DT  C "O5'" 1 
ATOM 4182 C "C5'" . DT  C 3 3   ? 56.577  81.861  100.788 1.00 104.03 ? 3   DT  C "C5'" 1 
ATOM 4183 C "C4'" . DT  C 3 3   ? 56.597  83.064  99.871  1.00 102.40 ? 3   DT  C "C4'" 1 
ATOM 4184 O "O4'" . DT  C 3 3   ? 57.948  83.425  99.525  1.00 90.46  ? 3   DT  C "O4'" 1 
ATOM 4185 C "C3'" . DT  C 3 3   ? 55.925  82.835  98.519  1.00 118.96 ? 3   DT  C "C3'" 1 
ATOM 4186 O "O3'" . DT  C 3 3   ? 54.548  83.157  98.581  1.00 140.96 ? 3   DT  C "O3'" 1 
ATOM 4187 C "C2'" . DT  C 3 3   ? 56.677  83.767  97.549  1.00 95.99  ? 3   DT  C "C2'" 1 
ATOM 4188 C "C1'" . DT  C 3 3   ? 57.838  84.284  98.395  1.00 98.90  ? 3   DT  C "C1'" 1 
ATOM 4189 N N1    . DT  C 3 3   ? 59.186  84.452  97.636  1.00 98.79  ? 3   DT  C N1    1 
ATOM 4190 C C2    . DT  C 3 3   ? 59.252  85.375  96.589  1.00 92.05  ? 3   DT  C C2    1 
ATOM 4191 O O2    . DT  C 3 3   ? 58.282  86.029  96.216  1.00 85.42  ? 3   DT  C O2    1 
ATOM 4192 N N3    . DT  C 3 3   ? 60.500  85.497  95.983  1.00 82.00  ? 3   DT  C N3    1 
ATOM 4193 C C4    . DT  C 3 3   ? 61.667  84.810  96.314  1.00 77.28  ? 3   DT  C C4    1 
ATOM 4194 O O4    . DT  C 3 3   ? 62.744  84.996  95.700  1.00 62.21  ? 3   DT  C O4    1 
ATOM 4195 C C5    . DT  C 3 3   ? 61.526  83.852  97.434  1.00 69.60  ? 3   DT  C C5    1 
ATOM 4196 C C7    . DT  C 3 3   ? 62.705  83.040  97.907  1.00 63.14  ? 3   DT  C C7    1 
ATOM 4197 C C6    . DT  C 3 3   ? 60.311  83.730  98.028  1.00 79.83  ? 3   DT  C C6    1 
ATOM 4198 P P     . DG  C 3 4   ? 53.524  82.398  97.604  1.00 144.82 ? 4   DG  C P     1 
ATOM 4199 O OP1   . DG  C 3 4   ? 52.170  82.570  98.193  1.00 137.18 ? 4   DG  C OP1   1 
ATOM 4200 O OP2   . DG  C 3 4   ? 54.062  81.017  97.508  1.00 102.85 ? 4   DG  C OP2   1 
ATOM 4201 O "O5'" . DG  C 3 4   ? 53.662  83.190  96.183  1.00 112.91 ? 4   DG  C "O5'" 1 
ATOM 4202 C "C5'" . DG  C 3 4   ? 53.433  84.623  96.124  1.00 119.50 ? 4   DG  C "C5'" 1 
ATOM 4203 C "C4'" . DG  C 3 4   ? 53.894  85.255  94.801  1.00 125.72 ? 4   DG  C "C4'" 1 
ATOM 4204 O "O4'" . DG  C 3 4   ? 55.354  85.429  94.775  1.00 119.56 ? 4   DG  C "O4'" 1 
ATOM 4205 C "C3'" . DG  C 3 4   ? 53.575  84.475  93.510  1.00 126.53 ? 4   DG  C "C3'" 1 
ATOM 4206 O "O3'" . DG  C 3 4   ? 53.355  85.422  92.404  1.00 125.69 ? 4   DG  C "O3'" 1 
ATOM 4207 C "C2'" . DG  C 3 4   ? 54.888  83.757  93.301  1.00 116.78 ? 4   DG  C "C2'" 1 
ATOM 4208 C "C1'" . DG  C 3 4   ? 55.778  84.963  93.513  1.00 106.95 ? 4   DG  C "C1'" 1 
ATOM 4209 N N9    . DG  C 3 4   ? 57.219  84.689  93.474  1.00 95.63  ? 4   DG  C N9    1 
ATOM 4210 C C8    . DG  C 3 4   ? 57.910  83.718  94.184  1.00 84.04  ? 4   DG  C C8    1 
ATOM 4211 N N7    . DG  C 3 4   ? 59.187  83.682  93.915  1.00 64.74  ? 4   DG  C N7    1 
ATOM 4212 C C5    . DG  C 3 4   ? 59.364  84.686  92.953  1.00 71.72  ? 4   DG  C C5    1 
ATOM 4213 C C6    . DG  C 3 4   ? 60.557  85.114  92.285  1.00 70.84  ? 4   DG  C C6    1 
ATOM 4214 O O6    . DG  C 3 4   ? 61.714  84.673  92.419  1.00 78.65  ? 4   DG  C O6    1 
ATOM 4215 N N1    . DG  C 3 4   ? 60.312  86.149  91.374  1.00 55.12  ? 4   DG  C N1    1 
ATOM 4216 C C2    . DG  C 3 4   ? 59.062  86.717  91.118  1.00 72.17  ? 4   DG  C C2    1 
ATOM 4217 N N2    . DG  C 3 4   ? 59.049  87.728  90.180  1.00 47.27  ? 4   DG  C N2    1 
ATOM 4218 N N3    . DG  C 3 4   ? 57.909  86.323  91.751  1.00 62.68  ? 4   DG  C N3    1 
ATOM 4219 C C4    . DG  C 3 4   ? 58.154  85.309  92.657  1.00 71.74  ? 4   DG  C C4    1 
ATOM 4220 P P     . DT  C 3 5   ? 53.151  84.899  90.879  1.00 160.56 ? 5   DT  C P     1 
ATOM 4221 O OP1   . DT  C 3 5   ? 51.817  84.258  90.913  1.00 149.62 ? 5   DT  C OP1   1 
ATOM 4222 O OP2   . DT  C 3 5   ? 54.295  84.063  90.418  1.00 113.61 ? 5   DT  C OP2   1 
ATOM 4223 O "O5'" . DT  C 3 5   ? 53.072  86.248  89.956  1.00 115.10 ? 5   DT  C "O5'" 1 
ATOM 4224 C "C5'" . DT  C 3 5   ? 53.094  86.158  88.464  1.00 98.05  ? 5   DT  C "C5'" 1 
ATOM 4225 C "C4'" . DT  C 3 5   ? 54.499  86.395  87.912  1.00 81.98  ? 5   DT  C "C4'" 1 
ATOM 4226 O "O4'" . DT  C 3 5   ? 55.439  85.615  88.630  1.00 76.95  ? 5   DT  C "O4'" 1 
ATOM 4227 C "C3'" . DT  C 3 5   ? 54.769  85.972  86.481  1.00 74.77  ? 5   DT  C "C3'" 1 
ATOM 4228 O "O3'" . DT  C 3 5   ? 54.351  86.959  85.637  1.00 61.73  ? 5   DT  C "O3'" 1 
ATOM 4229 C "C2'" . DT  C 3 5   ? 56.319  85.772  86.452  1.00 59.19  ? 5   DT  C "C2'" 1 
ATOM 4230 C "C1'" . DT  C 3 5   ? 56.655  85.752  87.953  1.00 68.55  ? 5   DT  C "C1'" 1 
ATOM 4231 N N1    . DT  C 3 5   ? 57.576  84.712  88.518  1.00 55.40  ? 5   DT  C N1    1 
ATOM 4232 C C2    . DT  C 3 5   ? 58.940  84.708  88.197  1.00 66.44  ? 5   DT  C C2    1 
ATOM 4233 O O2    . DT  C 3 5   ? 59.451  85.464  87.335  1.00 68.95  ? 5   DT  C O2    1 
ATOM 4234 N N3    . DT  C 3 5   ? 59.682  83.751  88.898  1.00 41.69  ? 5   DT  C N3    1 
ATOM 4235 C C4    . DT  C 3 5   ? 59.191  82.859  89.867  1.00 58.36  ? 5   DT  C C4    1 
ATOM 4236 O O4    . DT  C 3 5   ? 59.899  82.033  90.447  1.00 64.37  ? 5   DT  C O4    1 
ATOM 4237 C C5    . DT  C 3 5   ? 57.787  82.968  90.162  1.00 54.66  ? 5   DT  C C5    1 
ATOM 4238 C C7    . DT  C 3 5   ? 57.171  82.064  91.195  1.00 49.37  ? 5   DT  C C7    1 
ATOM 4239 C C6    . DT  C 3 5   ? 57.069  83.888  89.505  1.00 48.56  ? 5   DT  C C6    1 
ATOM 4240 P P     . DT  C 3 6   ? 53.500  86.556  84.347  1.00 124.18 ? 6   DT  C P     1 
ATOM 4241 O OP1   . DT  C 3 6   ? 52.210  87.276  84.345  1.00 79.57  ? 6   DT  C OP1   1 
ATOM 4242 O OP2   . DT  C 3 6   ? 53.428  85.060  84.361  1.00 121.06 ? 6   DT  C OP2   1 
ATOM 4243 O "O5'" . DT  C 3 6   ? 54.420  87.127  83.148  1.00 99.45  ? 6   DT  C "O5'" 1 
ATOM 4244 C "C5'" . DT  C 3 6   ? 55.062  86.221  82.212  1.00 94.10  ? 6   DT  C "C5'" 1 
ATOM 4245 C "C4'" . DT  C 3 6   ? 56.574  86.262  82.340  1.00 80.87  ? 6   DT  C "C4'" 1 
ATOM 4246 O "O4'" . DT  C 3 6   ? 56.985  85.669  83.590  1.00 70.13  ? 6   DT  C "O4'" 1 
ATOM 4247 C "C3'" . DT  C 3 6   ? 57.328  85.436  81.324  1.00 71.33  ? 6   DT  C "C3'" 1 
ATOM 4248 O "O3'" . DT  C 3 6   ? 57.371  86.101  80.039  1.00 86.43  ? 6   DT  C "O3'" 1 
ATOM 4249 C "C2'" . DT  C 3 6   ? 58.699  85.326  81.991  1.00 67.71  ? 6   DT  C "C2'" 1 
ATOM 4250 C "C1'" . DT  C 3 6   ? 58.365  85.471  83.483  1.00 74.16  ? 6   DT  C "C1'" 1 
ATOM 4251 N N1    . DT  C 3 6   ? 58.832  84.336  84.383  1.00 57.34  ? 6   DT  C N1    1 
ATOM 4252 C C2    . DT  C 3 6   ? 60.194  84.182  84.545  1.00 67.54  ? 6   DT  C C2    1 
ATOM 4253 O O2    . DT  C 3 6   ? 61.012  84.891  83.965  1.00 91.51  ? 6   DT  C O2    1 
ATOM 4254 N N3    . DT  C 3 6   ? 60.582  83.166  85.403  1.00 50.60  ? 6   DT  C N3    1 
ATOM 4255 C C4    . DT  C 3 6   ? 59.750  82.310  86.124  1.00 54.66  ? 6   DT  C C4    1 
ATOM 4256 O O4    . DT  C 3 6   ? 60.185  81.432  86.883  1.00 45.33  ? 6   DT  C O4    1 
ATOM 4257 C C5    . DT  C 3 6   ? 58.327  82.507  85.920  1.00 50.31  ? 6   DT  C C5    1 
ATOM 4258 C C7    . DT  C 3 6   ? 57.352  81.600  86.669  1.00 29.20  ? 6   DT  C C7    1 
ATOM 4259 C C6    . DT  C 3 6   ? 57.931  83.510  85.055  1.00 45.14  ? 6   DT  C C6    1 
ATOM 4260 P P     . DG  C 3 7   ? 57.476  85.227  78.676  1.00 106.85 ? 7   DG  C P     1 
ATOM 4261 O OP1   . DG  C 3 7   ? 57.511  86.069  77.420  1.00 77.73  ? 7   DG  C OP1   1 
ATOM 4262 O OP2   . DG  C 3 7   ? 56.376  84.211  78.748  1.00 67.22  ? 7   DG  C OP2   1 
ATOM 4263 O "O5'" . DG  C 3 7   ? 58.958  84.616  78.827  1.00 87.42  ? 7   DG  C "O5'" 1 
ATOM 4264 C "C5'" . DG  C 3 7   ? 60.050  85.542  79.116  1.00 100.80 ? 7   DG  C "C5'" 1 
ATOM 4265 C "C4'" . DG  C 3 7   ? 61.386  84.852  79.406  1.00 102.41 ? 7   DG  C "C4'" 1 
ATOM 4266 O "O4'" . DG  C 3 7   ? 61.426  84.197  80.727  1.00 88.18  ? 7   DG  C "O4'" 1 
ATOM 4267 C "C3'" . DG  C 3 7   ? 61.786  83.780  78.401  1.00 87.52  ? 7   DG  C "C3'" 1 
ATOM 4268 O "O3'" . DG  C 3 7   ? 63.148  83.815  78.234  1.00 77.70  ? 7   DG  C "O3'" 1 
ATOM 4269 C "C2'" . DG  C 3 7   ? 61.412  82.527  79.137  1.00 95.66  ? 7   DG  C "C2'" 1 
ATOM 4270 C "C1'" . DG  C 3 7   ? 61.919  82.875  80.522  1.00 82.11  ? 7   DG  C "C1'" 1 
ATOM 4271 N N9    . DG  C 3 7   ? 61.383  81.977  81.544  1.00 72.14  ? 7   DG  C N9    1 
ATOM 4272 C C8    . DG  C 3 7   ? 60.043  81.733  81.781  1.00 72.49  ? 7   DG  C C8    1 
ATOM 4273 N N7    . DG  C 3 7   ? 59.832  80.852  82.731  1.00 64.41  ? 7   DG  C N7    1 
ATOM 4274 C C5    . DG  C 3 7   ? 61.114  80.480  83.162  1.00 61.58  ? 7   DG  C C5    1 
ATOM 4275 C C6    . DG  C 3 7   ? 61.499  79.576  84.205  1.00 51.99  ? 7   DG  C C6    1 
ATOM 4276 O O6    . DG  C 3 7   ? 60.765  78.930  84.935  1.00 49.46  ? 7   DG  C O6    1 
ATOM 4277 N N1    . DG  C 3 7   ? 62.886  79.464  84.347  1.00 41.12  ? 7   DG  C N1    1 
ATOM 4278 C C2    . DG  C 3 7   ? 63.795  80.139  83.552  1.00 55.65  ? 7   DG  C C2    1 
ATOM 4279 N N2    . DG  C 3 7   ? 65.097  79.883  83.816  1.00 50.56  ? 7   DG  C N2    1 
ATOM 4280 N N3    . DG  C 3 7   ? 63.452  81.019  82.566  1.00 55.72  ? 7   DG  C N3    1 
ATOM 4281 C C4    . DG  C 3 7   ? 62.091  81.144  82.437  1.00 60.10  ? 7   DG  C C4    1 
ATOM 4282 P P     . DT  C 3 8   ? 63.818  83.187  76.929  1.00 87.50  ? 8   DT  C P     1 
ATOM 4283 O OP1   . DT  C 3 8   ? 64.200  84.288  76.002  1.00 83.35  ? 8   DT  C OP1   1 
ATOM 4284 O OP2   . DT  C 3 8   ? 62.934  82.119  76.433  1.00 104.57 ? 8   DT  C OP2   1 
ATOM 4285 O "O5'" . DT  C 3 8   ? 65.130  82.534  77.521  1.00 67.29  ? 8   DT  C "O5'" 1 
ATOM 4286 C "C5'" . DT  C 3 8   ? 65.272  82.417  78.897  1.00 61.37  ? 8   DT  C "C5'" 1 
ATOM 4287 C "C4'" . DT  C 3 8   ? 66.592  81.756  79.182  1.00 79.80  ? 8   DT  C "C4'" 1 
ATOM 4288 O "O4'" . DT  C 3 8   ? 66.400  80.763  80.207  1.00 74.09  ? 8   DT  C "O4'" 1 
ATOM 4289 C "C3'" . DT  C 3 8   ? 67.158  80.975  78.004  1.00 75.23  ? 8   DT  C "C3'" 1 
ATOM 4290 O "O3'" . DT  C 3 8   ? 68.580  80.733  78.206  1.00 80.99  ? 8   DT  C "O3'" 1 
ATOM 4291 C "C2'" . DT  C 3 8   ? 66.325  79.691  78.080  1.00 76.43  ? 8   DT  C "C2'" 1 
ATOM 4292 C "C1'" . DT  C 3 8   ? 66.231  79.495  79.598  1.00 63.20  ? 8   DT  C "C1'" 1 
ATOM 4293 N N1    . DT  C 3 8   ? 64.957  78.895  80.124  1.00 55.19  ? 8   DT  C N1    1 
ATOM 4294 C C2    . DT  C 3 8   ? 65.076  77.935  81.115  1.00 62.53  ? 8   DT  C C2    1 
ATOM 4295 O O2    . DT  C 3 8   ? 66.168  77.548  81.540  1.00 67.03  ? 8   DT  C O2    1 
ATOM 4296 N N3    . DT  C 3 8   ? 63.884  77.427  81.592  1.00 45.96  ? 8   DT  C N3    1 
ATOM 4297 C C4    . DT  C 3 8   ? 62.613  77.787  81.202  1.00 49.05  ? 8   DT  C C4    1 
ATOM 4298 O O4    . DT  C 3 8   ? 61.607  77.277  81.707  1.00 45.55  ? 8   DT  C O4    1 
ATOM 4299 C C5    . DT  C 3 8   ? 62.543  78.798  80.152  1.00 52.04  ? 8   DT  C C5    1 
ATOM 4300 C C7    . DT  C 3 8   ? 61.198  79.232  79.650  1.00 43.35  ? 8   DT  C C7    1 
ATOM 4301 C C6    . DT  C 3 8   ? 63.709  79.310  79.664  1.00 49.26  ? 8   DT  C C6    1 
ATOM 4302 P P     . DT  C 3 9   ? 69.445  79.912  77.122  1.00 101.37 ? 9   DT  C P     1 
ATOM 4303 O OP1   . DT  C 3 9   ? 70.910  80.102  77.300  1.00 92.78  ? 9   DT  C OP1   1 
ATOM 4304 O OP2   . DT  C 3 9   ? 68.864  80.331  75.808  1.00 57.66  ? 9   DT  C OP2   1 
ATOM 4305 O "O5'" . DT  C 3 9   ? 69.267  78.406  77.652  1.00 84.11  ? 9   DT  C "O5'" 1 
ATOM 4306 C "C5'" . DT  C 3 9   ? 69.348  78.212  79.078  1.00 67.23  ? 9   DT  C "C5'" 1 
ATOM 4307 C "C4'" . DT  C 3 9   ? 69.713  76.790  79.492  1.00 78.37  ? 9   DT  C "C4'" 1 
ATOM 4308 O "O4'" . DT  C 3 9   ? 68.580  76.145  80.139  1.00 75.22  ? 9   DT  C "O4'" 1 
ATOM 4309 C "C3'" . DT  C 3 9   ? 70.163  75.830  78.399  1.00 74.76  ? 9   DT  C "C3'" 1 
ATOM 4310 O "O3'" . DT  C 3 9   ? 71.120  74.914  78.991  1.00 81.10  ? 9   DT  C "O3'" 1 
ATOM 4311 C "C2'" . DT  C 3 9   ? 68.844  75.146  78.037  1.00 68.94  ? 9   DT  C "C2'" 1 
ATOM 4312 C "C1'" . DT  C 3 9   ? 68.221  74.988  79.418  1.00 56.99  ? 9   DT  C "C1'" 1 
ATOM 4313 N N1    . DT  C 3 9   ? 66.730  74.868  79.435  1.00 44.33  ? 9   DT  C N1    1 
ATOM 4314 C C2    . DT  C 3 9   ? 66.152  74.027  80.397  1.00 54.42  ? 9   DT  C C2    1 
ATOM 4315 O O2    . DT  C 3 9   ? 66.821  73.382  81.220  1.00 59.31  ? 9   DT  C O2    1 
ATOM 4316 N N3    . DT  C 3 9   ? 64.772  73.954  80.357  1.00 30.98  ? 9   DT  C N3    1 
ATOM 4317 C C4    . DT  C 3 9   ? 63.940  74.648  79.494  1.00 35.44  ? 9   DT  C C4    1 
ATOM 4318 O O4    . DT  C 3 9   ? 62.716  74.544  79.546  1.00 28.73  ? 9   DT  C O4    1 
ATOM 4319 C C5    . DT  C 3 9   ? 64.599  75.514  78.516  1.00 36.87  ? 9   DT  C C5    1 
ATOM 4320 C C7    . DT  C 3 9   ? 63.749  76.302  77.546  1.00 26.78  ? 9   DT  C C7    1 
ATOM 4321 C C6    . DT  C 3 9   ? 65.956  75.584  78.527  1.00 29.71  ? 9   DT  C C6    1 
ATOM 4322 P P     . DG  C 3 10  ? 71.762  73.694  78.168  1.00 98.37  ? 10  DG  C P     1 
ATOM 4323 O OP1   . DG  C 3 10  ? 73.015  73.266  78.837  1.00 91.79  ? 10  DG  C OP1   1 
ATOM 4324 O OP2   . DG  C 3 10  ? 71.756  74.074  76.713  1.00 51.87  ? 10  DG  C OP2   1 
ATOM 4325 O "O5'" . DG  C 3 10  ? 70.880  72.492  78.679  1.00 72.78  ? 10  DG  C "O5'" 1 
ATOM 4326 C "C5'" . DG  C 3 10  ? 70.695  72.407  80.069  1.00 73.30  ? 10  DG  C "C5'" 1 
ATOM 4327 C "C4'" . DG  C 3 10  ? 70.118  71.077  80.440  1.00 83.11  ? 10  DG  C "C4'" 1 
ATOM 4328 O "O4'" . DG  C 3 10  ? 68.655  71.114  80.363  1.00 74.77  ? 10  DG  C "O4'" 1 
ATOM 4329 C "C3'" . DG  C 3 10  ? 70.560  69.933  79.561  1.00 66.67  ? 10  DG  C "C3'" 1 
ATOM 4330 O "O3'" . DG  C 3 10  ? 70.649  68.761  80.399  1.00 66.03  ? 10  DG  C "O3'" 1 
ATOM 4331 C "C2'" . DG  C 3 10  ? 69.431  69.883  78.524  1.00 55.95  ? 10  DG  C "C2'" 1 
ATOM 4332 C "C1'" . DG  C 3 10  ? 68.193  70.236  79.364  1.00 47.54  ? 10  DG  C "C1'" 1 
ATOM 4333 N N9    . DG  C 3 10  ? 67.148  70.919  78.590  1.00 39.04  ? 10  DG  C N9    1 
ATOM 4334 C C8    . DG  C 3 10  ? 67.370  71.773  77.563  1.00 42.37  ? 10  DG  C C8    1 
ATOM 4335 N N7    . DG  C 3 10  ? 66.267  72.270  77.044  1.00 41.19  ? 10  DG  C N7    1 
ATOM 4336 C C5    . DG  C 3 10  ? 65.246  71.700  77.761  1.00 24.76  ? 10  DG  C C5    1 
ATOM 4337 C C6    . DG  C 3 10  ? 63.851  71.878  77.616  1.00 28.02  ? 10  DG  C C6    1 
ATOM 4338 O O6    . DG  C 3 10  ? 63.244  72.586  76.794  1.00 29.04  ? 10  DG  C O6    1 
ATOM 4339 N N1    . DG  C 3 10  ? 63.143  71.139  78.517  1.00 23.19  ? 10  DG  C N1    1 
ATOM 4340 C C2    . DG  C 3 10  ? 63.708  70.349  79.459  1.00 35.21  ? 10  DG  C C2    1 
ATOM 4341 N N2    . DG  C 3 10  ? 62.835  69.727  80.239  1.00 37.21  ? 10  DG  C N2    1 
ATOM 4342 N N3    . DG  C 3 10  ? 65.036  70.152  79.621  1.00 30.99  ? 10  DG  C N3    1 
ATOM 4343 C C4    . DG  C 3 10  ? 65.743  70.859  78.725  1.00 29.74  ? 10  DG  C C4    1 
ATOM 4344 P P     . DT  C 3 11  ? 70.649  67.259  79.824  1.00 101.52 ? 11  DT  C P     1 
ATOM 4345 O OP1   . DT  C 3 11  ? 71.247  66.457  80.939  1.00 62.18  ? 11  DT  C OP1   1 
ATOM 4346 O OP2   . DT  C 3 11  ? 71.151  67.288  78.406  1.00 69.41  ? 11  DT  C OP2   1 
ATOM 4347 O "O5'" . DT  C 3 11  ? 69.111  66.786  79.944  1.00 69.14  ? 11  DT  C "O5'" 1 
ATOM 4348 C "C5'" . DT  C 3 11  ? 68.496  66.813  81.262  1.00 62.55  ? 11  DT  C "C5'" 1 
ATOM 4349 C "C4'" . DT  C 3 11  ? 67.121  66.135  81.311  1.00 60.88  ? 11  DT  C "C4'" 1 
ATOM 4350 O "O4'" . DT  C 3 11  ? 66.084  66.951  80.659  1.00 60.08  ? 11  DT  C "O4'" 1 
ATOM 4351 C "C3'" . DT  C 3 11  ? 67.055  64.742  80.677  1.00 70.21  ? 11  DT  C "C3'" 1 
ATOM 4352 O "O3'" . DT  C 3 11  ? 66.379  63.822  81.588  1.00 76.08  ? 11  DT  C "O3'" 1 
ATOM 4353 C "C2'" . DT  C 3 11  ? 66.276  64.983  79.379  1.00 53.37  ? 11  DT  C "C2'" 1 
ATOM 4354 C "C1'" . DT  C 3 11  ? 65.346  66.130  79.785  1.00 55.67  ? 11  DT  C "C1'" 1 
ATOM 4355 N N1    . DT  C 3 11  ? 64.909  66.903  78.641  1.00 40.21  ? 11  DT  C N1    1 
ATOM 4356 C C2    . DT  C 3 11  ? 63.549  67.075  78.428  1.00 51.80  ? 11  DT  C C2    1 
ATOM 4357 O O2    . DT  C 3 11  ? 62.674  66.644  79.215  1.00 48.13  ? 11  DT  C O2    1 
ATOM 4358 N N3    . DT  C 3 11  ? 63.240  67.788  77.268  1.00 39.03  ? 11  DT  C N3    1 
ATOM 4359 C C4    . DT  C 3 11  ? 64.159  68.300  76.357  1.00 39.34  ? 11  DT  C C4    1 
ATOM 4360 O O4    . DT  C 3 11  ? 63.826  68.932  75.354  1.00 39.09  ? 11  DT  C O4    1 
ATOM 4361 C C5    . DT  C 3 11  ? 65.541  68.049  76.664  1.00 31.76  ? 11  DT  C C5    1 
ATOM 4362 C C7    . DT  C 3 11  ? 66.594  68.580  75.764  1.00 33.14  ? 11  DT  C C7    1 
ATOM 4363 C C6    . DT  C 3 11  ? 65.843  67.349  77.751  1.00 31.71  ? 11  DT  C C6    1 
ATOM 4364 P P     . DT  C 3 12  ? 66.536  62.233  81.425  1.00 71.71  ? 12  DT  C P     1 
ATOM 4365 O OP1   . DT  C 3 12  ? 66.291  61.500  82.697  1.00 42.40  ? 12  DT  C OP1   1 
ATOM 4366 O OP2   . DT  C 3 12  ? 67.754  62.055  80.548  1.00 39.28  ? 12  DT  C OP2   1 
ATOM 4367 O "O5'" . DT  C 3 12  ? 65.149  61.849  80.807  1.00 54.98  ? 12  DT  C "O5'" 1 
ATOM 4368 C "C5'" . DT  C 3 12  ? 64.028  61.917  81.618  1.00 41.90  ? 12  DT  C "C5'" 1 
ATOM 4369 C "C4'" . DT  C 3 12  ? 62.815  62.129  80.760  1.00 51.06  ? 12  DT  C "C4'" 1 
ATOM 4370 O "O4'" . DT  C 3 12  ? 63.083  63.124  79.759  1.00 47.26  ? 12  DT  C "O4'" 1 
ATOM 4371 C "C3'" . DT  C 3 12  ? 62.475  60.950  79.915  1.00 62.44  ? 12  DT  C "C3'" 1 
ATOM 4372 O "O3'" . DT  C 3 12  ? 61.682  60.055  80.616  1.00 65.77  ? 12  DT  C "O3'" 1 
ATOM 4373 C "C2'" . DT  C 3 12  ? 61.740  61.560  78.703  1.00 54.99  ? 12  DT  C "C2'" 1 
ATOM 4374 C "C1'" . DT  C 3 12  ? 62.015  63.056  78.856  1.00 45.95  ? 12  DT  C "C1'" 1 
ATOM 4375 N N1    . DT  C 3 12  ? 62.383  63.763  77.563  1.00 41.49  ? 12  DT  C N1    1 
ATOM 4376 C C2    . DT  C 3 12  ? 61.391  64.394  76.818  1.00 40.26  ? 12  DT  C C2    1 
ATOM 4377 O O2    . DT  C 3 12  ? 60.188  64.426  77.136  1.00 41.77  ? 12  DT  C O2    1 
ATOM 4378 N N3    . DT  C 3 12  ? 61.840  64.970  75.679  1.00 28.65  ? 12  DT  C N3    1 
ATOM 4379 C C4    . DT  C 3 12  ? 63.134  65.019  75.222  1.00 43.47  ? 12  DT  C C4    1 
ATOM 4380 O O4    . DT  C 3 12  ? 63.466  65.628  74.181  1.00 48.46  ? 12  DT  C O4    1 
ATOM 4381 C C5    . DT  C 3 12  ? 64.097  64.345  76.033  1.00 38.09  ? 12  DT  C C5    1 
ATOM 4382 C C7    . DT  C 3 12  ? 65.524  64.338  75.601  1.00 52.10  ? 12  DT  C C7    1 
ATOM 4383 C C6    . DT  C 3 12  ? 63.691  63.765  77.153  1.00 29.01  ? 12  DT  C C6    1 
ATOM 4384 P P     . DC  C 3 13  ? 61.582  58.596  79.989  1.00 75.41  ? 13  DC  C P     1 
ATOM 4385 O OP1   . DC  C 3 13  ? 61.063  57.705  81.063  1.00 56.50  ? 13  DC  C OP1   1 
ATOM 4386 O OP2   . DC  C 3 13  ? 62.883  58.417  79.273  1.00 49.29  ? 13  DC  C OP2   1 
ATOM 4387 O "O5'" . DC  C 3 13  ? 60.499  58.782  78.843  1.00 42.72  ? 13  DC  C "O5'" 1 
ATOM 4388 C "C5'" . DC  C 3 13  ? 59.163  59.022  79.210  1.00 47.45  ? 13  DC  C "C5'" 1 
ATOM 4389 C "C4'" . DC  C 3 13  ? 58.398  59.593  78.048  1.00 43.88  ? 13  DC  C "C4'" 1 
ATOM 4390 O "O4'" . DC  C 3 13  ? 59.213  60.507  77.339  1.00 42.29  ? 13  DC  C "O4'" 1 
ATOM 4391 C "C3'" . DC  C 3 13  ? 58.122  58.628  76.966  1.00 46.55  ? 13  DC  C "C3'" 1 
ATOM 4392 O "O3'" . DC  C 3 13  ? 57.080  57.804  77.312  1.00 51.28  ? 13  DC  C "O3'" 1 
ATOM 4393 C "C2'" . DC  C 3 13  ? 57.793  59.555  75.781  1.00 42.14  ? 13  DC  C "C2'" 1 
ATOM 4394 C "C1'" . DC  C 3 13  ? 58.523  60.822  76.174  1.00 33.31  ? 13  DC  C "C1'" 1 
ATOM 4395 N N1    . DC  C 3 13  ? 59.487  61.289  75.262  1.00 27.11  ? 13  DC  C N1    1 
ATOM 4396 C C2    . DC  C 3 13  ? 59.101  62.180  74.240  1.00 37.24  ? 13  DC  C C2    1 
ATOM 4397 O O2    . DC  C 3 13  ? 57.890  62.436  74.095  1.00 28.31  ? 13  DC  C O2    1 
ATOM 4398 N N3    . DC  C 3 13  ? 60.064  62.705  73.418  1.00 30.71  ? 13  DC  C N3    1 
ATOM 4399 C C4    . DC  C 3 13  ? 61.344  62.389  73.645  1.00 29.93  ? 13  DC  C C4    1 
ATOM 4400 N N4    . DC  C 3 13  ? 62.274  62.884  72.828  1.00 16.53  ? 13  DC  C N4    1 
ATOM 4401 C C5    . DC  C 3 13  ? 61.722  61.504  74.708  1.00 33.42  ? 13  DC  C C5    1 
ATOM 4402 C C6    . DC  C 3 13  ? 60.773  60.995  75.486  1.00 18.20  ? 13  DC  C C6    1 
ATOM 4403 P P     . DT  C 3 14  ? 57.114  56.349  76.684  1.00 54.87  ? 14  DT  C P     1 
ATOM 4404 O OP1   . DT  C 3 14  ? 56.381  55.466  77.619  1.00 33.72  ? 14  DT  C OP1   1 
ATOM 4405 O OP2   . DT  C 3 14  ? 58.544  56.140  76.367  1.00 37.41  ? 14  DT  C OP2   1 
ATOM 4406 O "O5'" . DT  C 3 14  ? 56.440  56.569  75.256  1.00 36.43  ? 14  DT  C "O5'" 1 
ATOM 4407 C "C5'" . DT  C 3 14  ? 55.082  56.934  75.166  1.00 37.45  ? 14  DT  C "C5'" 1 
ATOM 4408 C "C4'" . DT  C 3 14  ? 54.834  57.511  73.800  1.00 36.94  ? 14  DT  C "C4'" 1 
ATOM 4409 O "O4'" . DT  C 3 14  ? 55.817  58.512  73.565  1.00 40.37  ? 14  DT  C "O4'" 1 
ATOM 4410 C "C3'" . DT  C 3 14  ? 55.108  56.567  72.687  1.00 50.99  ? 14  DT  C "C3'" 1 
ATOM 4411 O "O3'" . DT  C 3 14  ? 54.009  55.640  72.523  1.00 65.20  ? 14  DT  C "O3'" 1 
ATOM 4412 C "C2'" . DT  C 3 14  ? 55.300  57.534  71.506  1.00 45.50  ? 14  DT  C "C2'" 1 
ATOM 4413 C "C1'" . DT  C 3 14  ? 55.992  58.707  72.180  1.00 37.08  ? 14  DT  C "C1'" 1 
ATOM 4414 N N1    . DT  C 3 14  ? 57.432  58.811  71.994  1.00 30.89  ? 14  DT  C N1    1 
ATOM 4415 C C2    . DT  C 3 14  ? 57.958  59.688  71.064  1.00 29.89  ? 14  DT  C C2    1 
ATOM 4416 O O2    . DT  C 3 14  ? 57.275  60.329  70.274  1.00 26.88  ? 14  DT  C O2    1 
ATOM 4417 N N3    . DT  C 3 14  ? 59.338  59.743  71.064  1.00 25.11  ? 14  DT  C N3    1 
ATOM 4418 C C4    . DT  C 3 14  ? 60.197  59.028  71.896  1.00 29.42  ? 14  DT  C C4    1 
ATOM 4419 O O4    . DT  C 3 14  ? 61.420  59.123  71.847  1.00 27.99  ? 14  DT  C O4    1 
ATOM 4420 C C5    . DT  C 3 14  ? 59.560  58.183  72.852  1.00 33.75  ? 14  DT  C C5    1 
ATOM 4421 C C7    . DT  C 3 14  ? 60.389  57.404  73.807  1.00 42.09  ? 14  DT  C C7    1 
ATOM 4422 C C6    . DT  C 3 14  ? 58.234  58.122  72.867  1.00 28.80  ? 14  DT  C C6    1 
ATOM 4423 P P     . DC  C 3 15  ? 54.270  54.163  71.917  1.00 56.72  ? 15  DC  C P     1 
ATOM 4424 O OP1   . DC  C 3 15  ? 53.062  53.404  72.286  1.00 27.09  ? 15  DC  C OP1   1 
ATOM 4425 O OP2   . DC  C 3 15  ? 55.539  53.592  72.365  1.00 33.81  ? 15  DC  C OP2   1 
ATOM 4426 O "O5'" . DC  C 3 15  ? 54.517  54.479  70.356  1.00 40.06  ? 15  DC  C "O5'" 1 
ATOM 4427 C "C5'" . DC  C 3 15  ? 53.553  55.210  69.627  1.00 36.88  ? 15  DC  C "C5'" 1 
ATOM 4428 C "C4'" . DC  C 3 15  ? 54.137  55.685  68.323  1.00 50.67  ? 15  DC  C "C4'" 1 
ATOM 4429 O "O4'" . DC  C 3 15  ? 55.159  56.615  68.600  1.00 60.95  ? 15  DC  C "O4'" 1 
ATOM 4430 C "C3'" . DC  C 3 15  ? 54.847  54.637  67.491  1.00 64.93  ? 15  DC  C "C3'" 1 
ATOM 4431 O "O3'" . DC  C 3 15  ? 53.909  53.954  66.670  1.00 89.91  ? 15  DC  C "O3'" 1 
ATOM 4432 C "C2'" . DC  C 3 15  ? 55.787  55.482  66.635  1.00 68.82  ? 15  DC  C "C2'" 1 
ATOM 4433 C "C1'" . DC  C 3 15  ? 56.032  56.702  67.503  1.00 56.26  ? 15  DC  C "C1'" 1 
ATOM 4434 N N1    . DC  C 3 15  ? 57.313  56.712  68.051  1.00 51.26  ? 15  DC  C N1    1 
ATOM 4435 C C2    . DC  C 3 15  ? 58.312  57.447  67.442  1.00 52.06  ? 15  DC  C C2    1 
ATOM 4436 O O2    . DC  C 3 15  ? 58.041  58.092  66.412  1.00 63.18  ? 15  DC  C O2    1 
ATOM 4437 N N3    . DC  C 3 15  ? 59.537  57.450  68.008  1.00 40.61  ? 15  DC  C N3    1 
ATOM 4438 C C4    . DC  C 3 15  ? 59.738  56.767  69.141  1.00 46.28  ? 15  DC  C C4    1 
ATOM 4439 N N4    . DC  C 3 15  ? 60.946  56.795  69.689  1.00 48.93  ? 15  DC  C N4    1 
ATOM 4440 C C5    . DC  C 3 15  ? 58.711  56.023  69.766  1.00 48.99  ? 15  DC  C C5    1 
ATOM 4441 C C6    . DC  C 3 15  ? 57.528  56.023  69.196  1.00 44.61  ? 15  DC  C C6    1 
ATOM 4442 P P     . DT  C 3 16  ? 54.055  52.382  66.447  1.00 72.33  ? 16  DT  C P     1 
ATOM 4443 O OP1   . DT  C 3 16  ? 53.436  52.061  65.136  1.00 90.50  ? 16  DT  C OP1   1 
ATOM 4444 O OP2   . DT  C 3 16  ? 53.570  51.751  67.702  1.00 51.47  ? 16  DT  C OP2   1 
ATOM 4445 O "O5'" . DT  C 3 16  ? 55.613  52.195  66.282  1.00 54.69  ? 16  DT  C "O5'" 1 
ATOM 4446 C "C5'" . DT  C 3 16  ? 56.071  51.375  65.259  1.00 91.80  ? 16  DT  C "C5'" 1 
ATOM 4447 C "C4'" . DT  C 3 16  ? 56.669  52.184  64.120  1.00 103.22 ? 16  DT  C "C4'" 1 
ATOM 4448 O "O4'" . DT  C 3 16  ? 57.048  53.501  64.603  1.00 92.09  ? 16  DT  C "O4'" 1 
ATOM 4449 C "C3'" . DT  C 3 16  ? 57.951  51.583  63.544  1.00 108.92 ? 16  DT  C "C3'" 1 
ATOM 4450 O "O3'" . DT  C 3 16  ? 57.650  50.681  62.493  1.00 112.98 ? 16  DT  C "O3'" 1 
ATOM 4451 C "C2'" . DT  C 3 16  ? 58.723  52.811  63.078  1.00 102.98 ? 16  DT  C "C2'" 1 
ATOM 4452 C "C1'" . DT  C 3 16  ? 58.380  53.807  64.192  1.00 94.58  ? 16  DT  C "C1'" 1 
ATOM 4453 N N1    . DT  C 3 16  ? 59.292  53.742  65.418  1.00 82.02  ? 16  DT  C N1    1 
ATOM 4454 C C2    . DT  C 3 16  ? 60.446  54.538  65.482  1.00 95.29  ? 16  DT  C C2    1 
ATOM 4455 O O2    . DT  C 3 16  ? 60.807  55.302  64.586  1.00 92.87  ? 16  DT  C O2    1 
ATOM 4456 N N3    . DT  C 3 16  ? 61.175  54.396  66.647  1.00 93.02  ? 16  DT  C N3    1 
ATOM 4457 C C4    . DT  C 3 16  ? 60.872  53.578  67.738  1.00 98.33  ? 16  DT  C C4    1 
ATOM 4458 O O4    . DT  C 3 16  ? 61.606  53.535  68.747  1.00 95.93  ? 16  DT  C O4    1 
ATOM 4459 C C5    . DT  C 3 16  ? 59.633  52.777  67.595  1.00 83.97  ? 16  DT  C C5    1 
ATOM 4460 C C7    . DT  C 3 16  ? 59.154  51.850  68.686  1.00 71.45  ? 16  DT  C C7    1 
ATOM 4461 C C6    . DT  C 3 16  ? 58.935  52.909  66.465  1.00 70.75  ? 16  DT  C C6    1 
ATOM 4462 P P     . DG  C 3 17  ? 57.664  49.098  62.793  1.00 140.40 ? 17  DG  C P     1 
ATOM 4463 O OP1   . DG  C 3 17  ? 56.754  48.731  63.907  1.00 126.88 ? 17  DG  C OP1   1 
ATOM 4464 O OP2   . DG  C 3 17  ? 59.099  48.760  62.878  1.00 128.87 ? 17  DG  C OP2   1 
ATOM 4465 O "O5'" . DG  C 3 17  ? 57.035  48.445  61.478  1.00 126.53 ? 17  DG  C "O5'" 1 
ATOM 4466 C "C5'" . DG  C 3 17  ? 55.955  49.081  60.791  1.00 125.51 ? 17  DG  C "C5'" 1 
ATOM 4467 C "C4'" . DG  C 3 17  ? 55.757  48.394  59.462  1.00 119.38 ? 17  DG  C "C4'" 1 
ATOM 4468 O "O4'" . DG  C 3 17  ? 56.182  49.274  58.368  1.00 127.15 ? 17  DG  C "O4'" 1 
ATOM 4469 C "C3'" . DG  C 3 17  ? 56.572  47.118  59.348  1.00 104.15 ? 17  DG  C "C3'" 1 
ATOM 4470 O "O3'" . DG  C 3 17  ? 55.680  45.937  59.197  1.00 121.75 ? 17  DG  C "O3'" 1 
ATOM 4471 C "C2'" . DG  C 3 17  ? 57.503  47.371  58.131  1.00 82.39  ? 17  DG  C "C2'" 1 
ATOM 4472 C "C1'" . DG  C 3 17  ? 56.834  48.525  57.368  1.00 99.70  ? 17  DG  C "C1'" 1 
ATOM 4473 N N9    . DG  C 3 17  ? 57.819  49.390  56.611  1.00 130.28 ? 17  DG  C N9    1 
ATOM 4474 C C8    . DG  C 3 17  ? 59.000  49.893  57.120  1.00 141.35 ? 17  DG  C C8    1 
ATOM 4475 N N7    . DG  C 3 17  ? 59.712  50.591  56.268  1.00 131.71 ? 17  DG  C N7    1 
ATOM 4476 C C5    . DG  C 3 17  ? 58.992  50.556  55.090  1.00 137.02 ? 17  DG  C C5    1 
ATOM 4477 C C6    . DG  C 3 17  ? 59.305  51.144  53.833  1.00 148.74 ? 17  DG  C C6    1 
ATOM 4478 O O6    . DG  C 3 17  ? 60.317  51.832  53.530  1.00 136.92 ? 17  DG  C O6    1 
ATOM 4479 N N1    . DG  C 3 17  ? 58.314  50.876  52.877  1.00 148.33 ? 17  DG  C N1    1 
ATOM 4480 C C2    . DG  C 3 17  ? 57.166  50.136  53.099  1.00 133.07 ? 17  DG  C C2    1 
ATOM 4481 N N2    . DG  C 3 17  ? 56.339  50.004  52.037  1.00 107.88 ? 17  DG  C N2    1 
ATOM 4482 N N3    . DG  C 3 17  ? 56.849  49.571  54.288  1.00 137.67 ? 17  DG  C N3    1 
ATOM 4483 C C4    . DG  C 3 17  ? 57.809  49.819  55.247  1.00 137.06 ? 17  DG  C C4    1 
ATOM 4484 P P     . DG  C 3 18  ? 55.311  44.940  60.433  1.00 128.96 ? 18  DG  C P     1 
ATOM 4485 O OP1   . DG  C 3 18  ? 54.442  45.672  61.378  1.00 143.31 ? 18  DG  C OP1   1 
ATOM 4486 O OP2   . DG  C 3 18  ? 56.556  44.277  60.935  1.00 85.01  ? 18  DG  C OP2   1 
ATOM 4487 O "O5'" . DG  C 3 18  ? 54.310  43.862  59.767  1.00 110.86 ? 18  DG  C "O5'" 1 
ATOM 4488 C "C5'" . DG  C 3 18  ? 53.135  44.307  59.029  1.00 107.33 ? 18  DG  C "C5'" 1 
ATOM 4489 C "C4'" . DG  C 3 18  ? 53.101  43.803  57.560  1.00 113.31 ? 18  DG  C "C4'" 1 
ATOM 4490 O "O4'" . DG  C 3 18  ? 54.118  44.473  56.735  1.00 86.22  ? 18  DG  C "O4'" 1 
ATOM 4491 C "C3'" . DG  C 3 18  ? 53.340  42.303  57.332  1.00 106.96 ? 18  DG  C "C3'" 1 
ATOM 4492 O "O3'" . DG  C 3 18  ? 52.741  41.930  56.100  1.00 95.65  ? 18  DG  C "O3'" 1 
ATOM 4493 C "C2'" . DG  C 3 18  ? 54.847  42.291  57.168  1.00 100.30 ? 18  DG  C "C2'" 1 
ATOM 4494 C "C1'" . DG  C 3 18  ? 54.986  43.474  56.211  1.00 84.46  ? 18  DG  C "C1'" 1 
ATOM 4495 N N9    . DG  C 3 18  ? 56.346  43.995  56.116  1.00 78.15  ? 18  DG  C N9    1 
ATOM 4496 C C8    . DG  C 3 18  ? 57.413  43.649  56.910  1.00 75.21  ? 18  DG  C C8    1 
ATOM 4497 N N7    . DG  C 3 18  ? 58.516  44.265  56.586  1.00 76.75  ? 18  DG  C N7    1 
ATOM 4498 C C5    . DG  C 3 18  ? 58.166  45.056  55.498  1.00 66.15  ? 18  DG  C C5    1 
ATOM 4499 C C6    . DG  C 3 18  ? 58.953  45.940  54.740  1.00 75.63  ? 18  DG  C C6    1 
ATOM 4500 O O6    . DG  C 3 18  ? 60.147  46.217  54.906  1.00 93.98  ? 18  DG  C O6    1 
ATOM 4501 N N1    . DG  C 3 18  ? 58.222  46.561  53.719  1.00 81.41  ? 18  DG  C N1    1 
ATOM 4502 C C2    . DG  C 3 18  ? 56.882  46.342  53.472  1.00 97.11  ? 18  DG  C C2    1 
ATOM 4503 N N2    . DG  C 3 18  ? 56.337  47.028  52.446  1.00 104.01 ? 18  DG  C N2    1 
ATOM 4504 N N3    . DG  C 3 18  ? 56.123  45.504  54.189  1.00 95.73  ? 18  DG  C N3    1 
ATOM 4505 C C4    . DG  C 3 18  ? 56.836  44.899  55.186  1.00 77.43  ? 18  DG  C C4    1 
ATOM 4506 P P     . DG  C 3 19  ? 51.788  40.652  55.960  1.00 119.88 ? 19  DG  C P     1 
ATOM 4507 O OP1   . DG  C 3 19  ? 50.493  41.107  56.515  1.00 128.53 ? 19  DG  C OP1   1 
ATOM 4508 O OP2   . DG  C 3 19  ? 52.401  39.393  56.466  1.00 98.03  ? 19  DG  C OP2   1 
ATOM 4509 O "O5'" . DG  C 3 19  ? 51.550  40.610  54.391  1.00 106.85 ? 19  DG  C "O5'" 1 
ATOM 4510 C "C5'" . DG  C 3 19  ? 50.591  41.515  53.835  1.00 113.20 ? 19  DG  C "C5'" 1 
ATOM 4511 C "C4'" . DG  C 3 19  ? 51.215  42.358  52.745  1.00 104.37 ? 19  DG  C "C4'" 1 
ATOM 4512 O "O4'" . DG  C 3 19  ? 52.569  42.672  53.131  1.00 98.62  ? 19  DG  C "O4'" 1 
ATOM 4513 C "C3'" . DG  C 3 19  ? 51.325  41.659  51.385  1.00 120.15 ? 19  DG  C "C3'" 1 
ATOM 4514 O "O3'" . DG  C 3 19  ? 51.176  42.616  50.320  1.00 106.24 ? 19  DG  C "O3'" 1 
ATOM 4515 C "C2'" . DG  C 3 19  ? 52.730  41.076  51.436  1.00 88.34  ? 19  DG  C "C2'" 1 
ATOM 4516 C "C1'" . DG  C 3 19  ? 53.461  42.188  52.159  1.00 81.07  ? 19  DG  C "C1'" 1 
ATOM 4517 N N9    . DG  C 3 19  ? 54.664  41.717  52.811  1.00 81.70  ? 19  DG  C N9    1 
ATOM 4518 C C8    . DG  C 3 19  ? 54.770  40.657  53.686  1.00 71.50  ? 19  DG  C C8    1 
ATOM 4519 N N7    . DG  C 3 19  ? 56.006  40.449  54.096  1.00 62.33  ? 19  DG  C N7    1 
ATOM 4520 C C5    . DG  C 3 19  ? 56.760  41.425  53.432  1.00 54.96  ? 19  DG  C C5    1 
ATOM 4521 C C6    . DG  C 3 19  ? 58.148  41.695  53.480  1.00 58.48  ? 19  DG  C C6    1 
ATOM 4522 O O6    . DG  C 3 19  ? 59.021  41.096  54.130  1.00 55.21  ? 19  DG  C O6    1 
ATOM 4523 N N1    . DG  C 3 19  ? 58.495  42.796  52.679  1.00 60.97  ? 19  DG  C N1    1 
ATOM 4524 C C2    . DG  C 3 19  ? 57.610  43.524  51.917  1.00 60.12  ? 19  DG  C C2    1 
ATOM 4525 N N2    . DG  C 3 19  ? 58.132  44.530  51.197  1.00 56.94  ? 19  DG  C N2    1 
ATOM 4526 N N3    . DG  C 3 19  ? 56.302  43.282  51.866  1.00 58.14  ? 19  DG  C N3    1 
ATOM 4527 C C4    . DG  C 3 19  ? 55.951  42.218  52.642  1.00 63.78  ? 19  DG  C C4    1 
ATOM 4528 P P     . DT  C 3 20  ? 50.973  42.143  48.790  1.00 110.66 ? 20  DT  C P     1 
ATOM 4529 O OP1   . DT  C 3 20  ? 49.563  42.454  48.446  1.00 100.08 ? 20  DT  C OP1   1 
ATOM 4530 O OP2   . DT  C 3 20  ? 51.502  40.740  48.583  1.00 82.79  ? 20  DT  C OP2   1 
ATOM 4531 O "O5'" . DT  C 3 20  ? 51.869  43.212  48.024  1.00 64.11  ? 20  DT  C "O5'" 1 
ATOM 4532 C "C5'" . DT  C 3 20  ? 52.963  43.721  48.698  1.00 62.02  ? 20  DT  C "C5'" 1 
ATOM 4533 C "C4'" . DT  C 3 20  ? 54.138  43.954  47.777  1.00 67.66  ? 20  DT  C "C4'" 1 
ATOM 4534 O "O4'" . DT  C 3 20  ? 55.367  43.640  48.483  1.00 79.31  ? 20  DT  C "O4'" 1 
ATOM 4535 C "C3'" . DT  C 3 20  ? 54.210  43.078  46.549  1.00 73.63  ? 20  DT  C "C3'" 1 
ATOM 4536 O "O3'" . DT  C 3 20  ? 55.088  43.692  45.656  1.00 82.99  ? 20  DT  C "O3'" 1 
ATOM 4537 C "C2'" . DT  C 3 20  ? 54.886  41.862  47.120  1.00 67.07  ? 20  DT  C "C2'" 1 
ATOM 4538 C "C1'" . DT  C 3 20  ? 56.002  42.595  47.792  1.00 57.15  ? 20  DT  C "C1'" 1 
ATOM 4539 N N1    . DT  C 3 20  ? 56.769  41.805  48.704  1.00 58.47  ? 20  DT  C N1    1 
ATOM 4540 C C2    . DT  C 3 20  ? 58.091  42.114  48.843  1.00 63.92  ? 20  DT  C C2    1 
ATOM 4541 O O2    . DT  C 3 20  ? 58.611  43.045  48.236  1.00 55.78  ? 20  DT  C O2    1 
ATOM 4542 N N3    . DT  C 3 20  ? 58.792  41.290  49.711  1.00 59.80  ? 20  DT  C N3    1 
ATOM 4543 C C4    . DT  C 3 20  ? 58.277  40.233  50.437  1.00 44.67  ? 20  DT  C C4    1 
ATOM 4544 O O4    . DT  C 3 20  ? 58.951  39.575  51.202  1.00 35.51  ? 20  DT  C O4    1 
ATOM 4545 C C5    . DT  C 3 20  ? 56.877  39.985  50.254  1.00 41.42  ? 20  DT  C C5    1 
ATOM 4546 C C7    . DT  C 3 20  ? 56.236  38.873  50.998  1.00 49.95  ? 20  DT  C C7    1 
ATOM 4547 C C6    . DT  C 3 20  ? 56.187  40.764  49.401  1.00 47.78  ? 20  DT  C C6    1 
ATOM 4548 P P     . DC  C 3 21  ? 54.594  44.088  44.194  1.00 94.47  ? 21  DC  C P     1 
ATOM 4549 O OP1   . DC  C 3 21  ? 54.136  45.491  44.332  1.00 55.54  ? 21  DC  C OP1   1 
ATOM 4550 O OP2   . DC  C 3 21  ? 53.684  43.012  43.708  1.00 78.28  ? 21  DC  C OP2   1 
ATOM 4551 O "O5'" . DC  C 3 21  ? 55.918  43.940  43.321  1.00 82.37  ? 21  DC  C "O5'" 1 
ATOM 4552 C "C5'" . DC  C 3 21  ? 56.709  45.055  43.038  1.00 80.67  ? 21  DC  C "C5'" 1 
ATOM 4553 C "C4'" . DC  C 3 21  ? 58.162  44.722  43.230  1.00 67.68  ? 21  DC  C "C4'" 1 
ATOM 4554 O "O4'" . DC  C 3 21  ? 58.282  43.822  44.320  1.00 73.87  ? 21  DC  C "O4'" 1 
ATOM 4555 C "C3'" . DC  C 3 21  ? 58.841  43.974  42.089  1.00 68.12  ? 21  DC  C "C3'" 1 
ATOM 4556 O "O3'" . DC  C 3 21  ? 59.492  44.893  41.229  1.00 81.81  ? 21  DC  C "O3'" 1 
ATOM 4557 C "C2'" . DC  C 3 21  ? 59.851  43.046  42.814  1.00 62.46  ? 21  DC  C "C2'" 1 
ATOM 4558 C "C1'" . DC  C 3 21  ? 59.592  43.368  44.272  1.00 63.94  ? 21  DC  C "C1'" 1 
ATOM 4559 N N1    . DC  C 3 21  ? 59.691  42.260  45.133  1.00 49.86  ? 21  DC  C N1    1 
ATOM 4560 C C2    . DC  C 3 21  ? 60.877  42.081  45.825  1.00 51.03  ? 21  DC  C C2    1 
ATOM 4561 O O2    . DC  C 3 21  ? 61.784  42.896  45.619  1.00 58.48  ? 21  DC  C O2    1 
ATOM 4562 N N3    . DC  C 3 21  ? 60.998  41.021  46.703  1.00 51.95  ? 21  DC  C N3    1 
ATOM 4563 C C4    . DC  C 3 21  ? 59.938  40.177  46.870  1.00 60.03  ? 21  DC  C C4    1 
ATOM 4564 N N4    . DC  C 3 21  ? 60.055  39.144  47.730  1.00 36.33  ? 21  DC  C N4    1 
ATOM 4565 C C5    . DC  C 3 21  ? 58.696  40.387  46.159  1.00 62.42  ? 21  DC  C C5    1 
ATOM 4566 C C6    . DC  C 3 21  ? 58.618  41.443  45.319  1.00 49.42  ? 21  DC  C C6    1 
ATOM 4567 P P     . DA  C 3 22  ? 60.517  44.388  40.082  1.00 89.79  ? 22  DA  C P     1 
ATOM 4568 O OP1   . DA  C 3 22  ? 60.585  45.437  39.020  1.00 81.73  ? 22  DA  C OP1   1 
ATOM 4569 O OP2   . DA  C 3 22  ? 60.321  42.973  39.806  1.00 51.11  ? 22  DA  C OP2   1 
ATOM 4570 O "O5'" . DA  C 3 22  ? 61.939  44.311  40.783  1.00 75.12  ? 22  DA  C "O5'" 1 
ATOM 4571 C "C5'" . DA  C 3 22  ? 63.007  43.884  40.036  1.00 56.59  ? 22  DA  C "C5'" 1 
ATOM 4572 C "C4'" . DA  C 3 22  ? 63.818  42.935  40.830  1.00 51.37  ? 22  DA  C "C4'" 1 
ATOM 4573 O "O4'" . DA  C 3 22  ? 62.972  42.153  41.643  1.00 33.48  ? 22  DA  C "O4'" 1 
ATOM 4574 C "C3'" . DA  C 3 22  ? 64.600  41.899  40.037  1.00 78.52  ? 22  DA  C "C3'" 1 
ATOM 4575 O "O3'" . DA  C 3 22  ? 65.921  42.345  39.806  1.00 84.25  ? 22  DA  C "O3'" 1 
ATOM 4576 C "C2'" . DA  C 3 22  ? 64.574  40.651  40.954  1.00 77.35  ? 22  DA  C "C2'" 1 
ATOM 4577 C "C1'" . DA  C 3 22  ? 63.836  41.185  42.166  1.00 50.88  ? 22  DA  C "C1'" 1 
ATOM 4578 N N9    . DA  C 3 22  ? 63.050  40.236  42.927  1.00 51.93  ? 22  DA  C N9    1 
ATOM 4579 C C8    . DA  C 3 22  ? 61.694  40.089  42.877  1.00 50.15  ? 22  DA  C C8    1 
ATOM 4580 N N7    . DA  C 3 22  ? 61.222  39.198  43.724  1.00 47.46  ? 22  DA  C N7    1 
ATOM 4581 C C5    . DA  C 3 22  ? 62.333  38.748  44.400  1.00 45.72  ? 22  DA  C C5    1 
ATOM 4582 C C6    . DA  C 3 22  ? 62.474  37.815  45.445  1.00 39.25  ? 22  DA  C C6    1 
ATOM 4583 N N6    . DA  C 3 22  ? 61.444  37.208  45.981  1.00 34.74  ? 22  DA  C N6    1 
ATOM 4584 N N1    . DA  C 3 22  ? 63.719  37.566  45.925  1.00 33.53  ? 22  DA  C N1    1 
ATOM 4585 C C2    . DA  C 3 22  ? 64.761  38.264  45.382  1.00 44.67  ? 22  DA  C C2    1 
ATOM 4586 N N3    . DA  C 3 22  ? 64.751  39.200  44.387  1.00 39.23  ? 22  DA  C N3    1 
ATOM 4587 C C4    . DA  C 3 22  ? 63.486  39.388  43.936  1.00 47.56  ? 22  DA  C C4    1 
ATOM 4588 P P     . DC  C 3 23  ? 66.783  41.572  38.705  1.00 106.19 ? 23  DC  C P     1 
ATOM 4589 O OP1   . DC  C 3 23  ? 68.049  42.301  38.386  1.00 95.43  ? 23  DC  C OP1   1 
ATOM 4590 O OP2   . DC  C 3 23  ? 65.735  41.341  37.672  1.00 79.40  ? 23  DC  C OP2   1 
ATOM 4591 O "O5'" . DC  C 3 23  ? 67.174  40.208  39.443  1.00 59.78  ? 23  DC  C "O5'" 1 
ATOM 4592 C "C5'" . DC  C 3 23  ? 68.001  40.283  40.520  1.00 69.87  ? 23  DC  C "C5'" 1 
ATOM 4593 C "C4'" . DC  C 3 23  ? 68.064  38.968  41.209  1.00 82.43  ? 23  DC  C "C4'" 1 
ATOM 4594 O "O4'" . DC  C 3 23  ? 66.768  38.611  41.735  1.00 89.23  ? 23  DC  C "O4'" 1 
ATOM 4595 C "C3'" . DC  C 3 23  ? 68.448  37.830  40.300  1.00 97.11  ? 23  DC  C "C3'" 1 
ATOM 4596 O "O3'" . DC  C 3 23  ? 69.524  37.165  40.887  1.00 100.72 ? 23  DC  C "O3'" 1 
ATOM 4597 C "C2'" . DC  C 3 23  ? 67.171  36.956  40.250  1.00 96.22  ? 23  DC  C "C2'" 1 
ATOM 4598 C "C1'" . DC  C 3 23  ? 66.647  37.213  41.631  1.00 60.46  ? 23  DC  C "C1'" 1 
ATOM 4599 N N1    . DC  C 3 23  ? 65.213  36.816  41.911  1.00 49.40  ? 23  DC  C N1    1 
ATOM 4600 C C2    . DC  C 3 23  ? 64.947  35.883  42.949  1.00 51.80  ? 23  DC  C C2    1 
ATOM 4601 O O2    . DC  C 3 23  ? 65.901  35.372  43.542  1.00 50.71  ? 23  DC  C O2    1 
ATOM 4602 N N3    . DC  C 3 23  ? 63.651  35.560  43.257  1.00 37.59  ? 23  DC  C N3    1 
ATOM 4603 C C4    . DC  C 3 23  ? 62.661  36.159  42.578  1.00 47.55  ? 23  DC  C C4    1 
ATOM 4604 N N4    . DC  C 3 23  ? 61.412  35.825  42.887  1.00 47.27  ? 23  DC  C N4    1 
ATOM 4605 C C5    . DC  C 3 23  ? 62.912  37.133  41.541  1.00 42.75  ? 23  DC  C C5    1 
ATOM 4606 C C6    . DC  C 3 23  ? 64.187  37.426  41.244  1.00 44.28  ? 23  DC  C C6    1 
ATOM 4607 P P     . DG  C 3 24  ? 70.892  37.065  40.071  1.00 130.92 ? 24  DG  C P     1 
ATOM 4608 O OP1   . DG  C 3 24  ? 71.980  37.169  41.084  1.00 97.77  ? 24  DG  C OP1   1 
ATOM 4609 O OP2   . DG  C 3 24  ? 70.734  38.035  38.934  1.00 95.30  ? 24  DG  C OP2   1 
ATOM 4610 O "O5'" . DG  C 3 24  ? 70.868  35.564  39.495  1.00 119.96 ? 24  DG  C "O5'" 1 
ATOM 4611 C "C5'" . DG  C 3 24  ? 69.842  34.676  39.909  1.00 90.28  ? 24  DG  C "C5'" 1 
ATOM 4612 C "C4'" . DG  C 3 24  ? 70.248  33.903  41.151  1.00 97.97  ? 24  DG  C "C4'" 1 
ATOM 4613 O "O4'" . DG  C 3 24  ? 69.093  33.713  42.003  1.00 78.99  ? 24  DG  C "O4'" 1 
ATOM 4614 C "C3'" . DG  C 3 24  ? 70.691  32.500  40.831  1.00 121.58 ? 24  DG  C "C3'" 1 
ATOM 4615 O "O3'" . DG  C 3 24  ? 71.519  31.929  41.888  1.00 138.43 ? 24  DG  C "O3'" 1 
ATOM 4616 C "C2'" . DG  C 3 24  ? 69.348  31.775  40.652  1.00 104.77 ? 24  DG  C "C2'" 1 
ATOM 4617 C "C1'" . DG  C 3 24  ? 68.402  32.540  41.587  1.00 76.85  ? 24  DG  C "C1'" 1 
ATOM 4618 N N9    . DG  C 3 24  ? 67.069  32.918  41.012  1.00 76.68  ? 24  DG  C N9    1 
ATOM 4619 C C8    . DG  C 3 24  ? 66.778  33.815  39.966  1.00 67.21  ? 24  DG  C C8    1 
ATOM 4620 N N7    . DG  C 3 24  ? 65.484  33.968  39.728  1.00 50.76  ? 24  DG  C N7    1 
ATOM 4621 C C5    . DG  C 3 24  ? 64.871  33.118  40.673  1.00 57.67  ? 24  DG  C C5    1 
ATOM 4622 C C6    . DG  C 3 24  ? 63.478  32.855  40.926  1.00 53.53  ? 24  DG  C C6    1 
ATOM 4623 O O6    . DG  C 3 24  ? 62.478  33.331  40.328  1.00 58.53  ? 24  DG  C O6    1 
ATOM 4624 N N1    . DG  C 3 24  ? 63.304  31.931  41.991  1.00 39.32  ? 24  DG  C N1    1 
ATOM 4625 C C2    . DG  C 3 24  ? 64.356  31.328  42.706  1.00 55.20  ? 24  DG  C C2    1 
ATOM 4626 N N2    . DG  C 3 24  ? 64.020  30.439  43.687  1.00 39.34  ? 24  DG  C N2    1 
ATOM 4627 N N3    . DG  C 3 24  ? 65.657  31.580  42.476  1.00 53.29  ? 24  DG  C N3    1 
ATOM 4628 C C4    . DG  C 3 24  ? 65.840  32.468  41.459  1.00 61.96  ? 24  DG  C C4    1 
ATOM 4629 P P     . DC  C 3 25  ? 72.600  30.812  41.479  1.00 131.10 ? 25  DC  C P     1 
ATOM 4630 O OP1   . DC  C 3 25  ? 74.004  31.136  41.878  1.00 94.81  ? 25  DC  C OP1   1 
ATOM 4631 O OP2   . DC  C 3 25  ? 72.155  30.608  40.087  1.00 117.24 ? 25  DC  C OP2   1 
ATOM 4632 O "O5'" . DC  C 3 25  ? 72.053  29.454  42.093  1.00 114.49 ? 25  DC  C "O5'" 1 
ATOM 4633 C "C5'" . DC  C 3 25  ? 71.358  28.559  41.209  1.00 108.79 ? 25  DC  C "C5'" 1 
ATOM 4634 C "C4'" . DC  C 3 25  ? 70.089  28.044  41.845  1.00 105.77 ? 25  DC  C "C4'" 1 
ATOM 4635 O "O4'" . DC  C 3 25  ? 68.957  28.879  41.476  1.00 105.26 ? 25  DC  C "O4'" 1 
ATOM 4636 C "C3'" . DC  C 3 25  ? 69.684  26.645  41.428  1.00 102.96 ? 25  DC  C "C3'" 1 
ATOM 4637 O "O3'" . DC  C 3 25  ? 69.050  26.030  42.531  1.00 108.40 ? 25  DC  C "O3'" 1 
ATOM 4638 C "C2'" . DC  C 3 25  ? 68.673  26.933  40.323  1.00 91.98  ? 25  DC  C "C2'" 1 
ATOM 4639 C "C1'" . DC  C 3 25  ? 67.925  28.045  40.996  1.00 71.18  ? 25  DC  C "C1'" 1 
ATOM 4640 N N1    . DC  C 3 25  ? 67.049  28.842  40.107  1.00 66.84  ? 25  DC  C N1    1 
ATOM 4641 C C2    . DC  C 3 25  ? 65.655  28.837  40.330  1.00 71.06  ? 25  DC  C C2    1 
ATOM 4642 O O2    . DC  C 3 25  ? 65.179  28.126  41.249  1.00 63.97  ? 25  DC  C O2    1 
ATOM 4643 N N3    . DC  C 3 25  ? 64.855  29.590  39.514  1.00 64.12  ? 25  DC  C N3    1 
ATOM 4644 C C4    . DC  C 3 25  ? 65.389  30.339  38.528  1.00 71.63  ? 25  DC  C C4    1 
ATOM 4645 N N4    . DC  C 3 25  ? 64.535  31.060  37.752  1.00 64.55  ? 25  DC  C N4    1 
ATOM 4646 C C5    . DC  C 3 25  ? 66.818  30.367  38.293  1.00 67.19  ? 25  DC  C C5    1 
ATOM 4647 C C6    . DC  C 3 25  ? 67.596  29.607  39.096  1.00 68.30  ? 25  DC  C C6    1 
ATOM 4648 O "O5'" . DG  D 4 1   ? 53.648  28.450  39.405  1.00 113.50 ? 1   DG  D "O5'" 1 
ATOM 4649 C "C5'" . DG  D 4 1   ? 54.176  27.149  39.134  1.00 112.14 ? 1   DG  D "C5'" 1 
ATOM 4650 C "C4'" . DG  D 4 1   ? 55.145  26.707  40.218  1.00 108.48 ? 1   DG  D "C4'" 1 
ATOM 4651 O "O4'" . DG  D 4 1   ? 56.511  27.062  39.866  1.00 104.95 ? 1   DG  D "O4'" 1 
ATOM 4652 C "C3'" . DG  D 4 1   ? 54.931  27.325  41.596  1.00 92.24  ? 1   DG  D "C3'" 1 
ATOM 4653 O "O3'" . DG  D 4 1   ? 55.333  26.377  42.567  1.00 81.46  ? 1   DG  D "O3'" 1 
ATOM 4654 C "C2'" . DG  D 4 1   ? 55.918  28.483  41.559  1.00 88.62  ? 1   DG  D "C2'" 1 
ATOM 4655 C "C1'" . DG  D 4 1   ? 57.078  27.739  40.974  1.00 78.01  ? 1   DG  D "C1'" 1 
ATOM 4656 N N9    . DG  D 4 1   ? 58.170  28.562  40.491  1.00 76.00  ? 1   DG  D N9    1 
ATOM 4657 C C8    . DG  D 4 1   ? 58.087  29.637  39.630  1.00 70.55  ? 1   DG  D C8    1 
ATOM 4658 N N7    . DG  D 4 1   ? 59.253  30.153  39.321  1.00 64.35  ? 1   DG  D N7    1 
ATOM 4659 C C5    . DG  D 4 1   ? 60.169  29.362  40.007  1.00 55.98  ? 1   DG  D C5    1 
ATOM 4660 C C6    . DG  D 4 1   ? 61.576  29.457  40.046  1.00 59.76  ? 1   DG  D C6    1 
ATOM 4661 O O6    . DG  D 4 1   ? 62.291  30.285  39.435  1.00 54.32  ? 1   DG  D O6    1 
ATOM 4662 N N1    . DG  D 4 1   ? 62.146  28.447  40.884  1.00 52.48  ? 1   DG  D N1    1 
ATOM 4663 C C2    . DG  D 4 1   ? 61.393  27.467  41.577  1.00 60.85  ? 1   DG  D C2    1 
ATOM 4664 N N2    . DG  D 4 1   ? 62.082  26.583  42.317  1.00 77.49  ? 1   DG  D N2    1 
ATOM 4665 N N3    . DG  D 4 1   ? 60.058  27.379  41.541  1.00 43.76  ? 1   DG  D N3    1 
ATOM 4666 C C4    . DG  D 4 1   ? 59.518  28.362  40.735  1.00 62.89  ? 1   DG  D C4    1 
ATOM 4667 P P     . DC  D 4 2   ? 54.653  26.342  44.028  1.00 139.10 ? 2   DC  D P     1 
ATOM 4668 O OP1   . DC  D 4 2   ? 54.269  24.922  44.245  1.00 138.81 ? 2   DC  D OP1   1 
ATOM 4669 O OP2   . DC  D 4 2   ? 53.570  27.365  44.172  1.00 93.26  ? 2   DC  D OP2   1 
ATOM 4670 O "O5'" . DC  D 4 2   ? 55.892  26.707  44.988  1.00 109.33 ? 2   DC  D "O5'" 1 
ATOM 4671 C "C5'" . DC  D 4 2   ? 57.163  27.078  44.417  1.00 97.26  ? 2   DC  D "C5'" 1 
ATOM 4672 C "C4'" . DC  D 4 2   ? 58.293  26.876  45.411  1.00 102.27 ? 2   DC  D "C4'" 1 
ATOM 4673 O "O4'" . DC  D 4 2   ? 59.526  27.453  44.885  1.00 83.19  ? 2   DC  D "O4'" 1 
ATOM 4674 C "C3'" . DC  D 4 2   ? 58.077  27.559  46.743  1.00 104.25 ? 2   DC  D "C3'" 1 
ATOM 4675 O "O3'" . DC  D 4 2   ? 58.828  26.870  47.792  1.00 105.72 ? 2   DC  D "O3'" 1 
ATOM 4676 C "C2'" . DC  D 4 2   ? 58.583  28.976  46.452  1.00 84.91  ? 2   DC  D "C2'" 1 
ATOM 4677 C "C1'" . DC  D 4 2   ? 59.723  28.730  45.446  1.00 64.97  ? 2   DC  D "C1'" 1 
ATOM 4678 N N1    . DC  D 4 2   ? 59.772  29.750  44.344  1.00 59.30  ? 2   DC  D N1    1 
ATOM 4679 C C2    . DC  D 4 2   ? 61.037  30.200  43.873  1.00 53.63  ? 2   DC  D C2    1 
ATOM 4680 O O2    . DC  D 4 2   ? 62.081  29.711  44.378  1.00 51.38  ? 2   DC  D O2    1 
ATOM 4681 N N3    . DC  D 4 2   ? 61.081  31.145  42.867  1.00 37.12  ? 2   DC  D N3    1 
ATOM 4682 C C4    . DC  D 4 2   ? 59.933  31.643  42.368  1.00 48.80  ? 2   DC  D C4    1 
ATOM 4683 N N4    . DC  D 4 2   ? 60.021  32.586  41.400  1.00 53.93  ? 2   DC  D N4    1 
ATOM 4684 C C5    . DC  D 4 2   ? 58.633  31.201  42.848  1.00 50.61  ? 2   DC  D C5    1 
ATOM 4685 C C6    . DC  D 4 2   ? 58.599  30.265  43.824  1.00 52.22  ? 2   DC  D C6    1 
ATOM 4686 P P     . DG  D 4 3   ? 58.670  27.288  49.342  1.00 101.64 ? 3   DG  D P     1 
ATOM 4687 O OP1   . DG  D 4 3   ? 58.399  26.067  50.170  1.00 86.43  ? 3   DG  D OP1   1 
ATOM 4688 O OP2   . DG  D 4 3   ? 57.771  28.473  49.418  1.00 77.18  ? 3   DG  D OP2   1 
ATOM 4689 O "O5'" . DG  D 4 3   ? 60.134  27.782  49.689  1.00 72.33  ? 3   DG  D "O5'" 1 
ATOM 4690 C "C5'" . DG  D 4 3   ? 61.207  26.943  49.408  1.00 79.41  ? 3   DG  D "C5'" 1 
ATOM 4691 C "C4'" . DG  D 4 3   ? 62.480  27.736  49.386  1.00 88.03  ? 3   DG  D "C4'" 1 
ATOM 4692 O "O4'" . DG  D 4 3   ? 62.478  28.616  48.229  1.00 89.92  ? 3   DG  D "O4'" 1 
ATOM 4693 C "C3'" . DG  D 4 3   ? 62.672  28.634  50.609  1.00 99.85  ? 3   DG  D "C3'" 1 
ATOM 4694 O "O3'" . DG  D 4 3   ? 64.046  28.542  51.086  1.00 122.83 ? 3   DG  D "O3'" 1 
ATOM 4695 C "C2'" . DG  D 4 3   ? 62.319  30.019  50.078  1.00 77.39  ? 3   DG  D "C2'" 1 
ATOM 4696 C "C1'" . DG  D 4 3   ? 62.792  29.923  48.640  1.00 69.66  ? 3   DG  D "C1'" 1 
ATOM 4697 N N9    . DG  D 4 3   ? 62.084  30.836  47.793  1.00 51.36  ? 3   DG  D N9    1 
ATOM 4698 C C8    . DG  D 4 3   ? 60.718  30.973  47.720  1.00 47.17  ? 3   DG  D C8    1 
ATOM 4699 N N7    . DG  D 4 3   ? 60.334  31.887  46.871  1.00 51.17  ? 3   DG  D N7    1 
ATOM 4700 C C5    . DG  D 4 3   ? 61.544  32.413  46.360  1.00 46.92  ? 3   DG  D C5    1 
ATOM 4701 C C6    . DG  D 4 3   ? 61.764  33.463  45.385  1.00 43.32  ? 3   DG  D C6    1 
ATOM 4702 O O6    . DG  D 4 3   ? 60.892  34.133  44.791  1.00 45.12  ? 3   DG  D O6    1 
ATOM 4703 N N1    . DG  D 4 3   ? 63.140  33.696  45.139  1.00 28.13  ? 3   DG  D N1    1 
ATOM 4704 C C2    . DG  D 4 3   ? 64.173  32.972  45.775  1.00 54.49  ? 3   DG  D C2    1 
ATOM 4705 N N2    . DG  D 4 3   ? 65.451  33.305  45.434  1.00 46.62  ? 3   DG  D N2    1 
ATOM 4706 N N3    . DG  D 4 3   ? 63.964  31.967  46.689  1.00 50.72  ? 3   DG  D N3    1 
ATOM 4707 C C4    . DG  D 4 3   ? 62.630  31.762  46.927  1.00 44.74  ? 3   DG  D C4    1 
ATOM 4708 P P     . DT  D 4 4   ? 64.582  29.474  52.292  1.00 107.00 ? 4   DT  D P     1 
ATOM 4709 O OP1   . DT  D 4 4   ? 65.910  29.013  52.795  1.00 76.42  ? 4   DT  D OP1   1 
ATOM 4710 O OP2   . DT  D 4 4   ? 63.438  29.603  53.235  1.00 95.60  ? 4   DT  D OP2   1 
ATOM 4711 O "O5'" . DT  D 4 4   ? 64.945  30.837  51.528  1.00 105.28 ? 4   DT  D "O5'" 1 
ATOM 4712 C "C5'" . DT  D 4 4   ? 65.715  30.773  50.324  1.00 85.53  ? 4   DT  D "C5'" 1 
ATOM 4713 C "C4'" . DT  D 4 4   ? 66.707  31.904  50.246  1.00 86.94  ? 4   DT  D "C4'" 1 
ATOM 4714 O "O4'" . DT  D 4 4   ? 66.304  32.814  49.187  1.00 82.21  ? 4   DT  D "O4'" 1 
ATOM 4715 C "C3'" . DT  D 4 4   ? 66.827  32.761  51.506  1.00 96.40  ? 4   DT  D "C3'" 1 
ATOM 4716 O "O3'" . DT  D 4 4   ? 68.202  33.253  51.629  1.00 119.74 ? 4   DT  D "O3'" 1 
ATOM 4717 C "C2'" . DT  D 4 4   ? 65.820  33.871  51.236  1.00 66.87  ? 4   DT  D "C2'" 1 
ATOM 4718 C "C1'" . DT  D 4 4   ? 66.005  34.083  49.738  1.00 56.54  ? 4   DT  D "C1'" 1 
ATOM 4719 N N1    . DT  D 4 4   ? 64.794  34.576  49.122  1.00 44.64  ? 4   DT  D N1    1 
ATOM 4720 C C2    . DT  D 4 4   ? 64.875  35.522  48.079  1.00 47.80  ? 4   DT  D C2    1 
ATOM 4721 O O2    . DT  D 4 4   ? 65.962  35.954  47.626  1.00 47.02  ? 4   DT  D O2    1 
ATOM 4722 N N3    . DT  D 4 4   ? 63.640  35.931  47.591  1.00 27.76  ? 4   DT  D N3    1 
ATOM 4723 C C4    . DT  D 4 4   ? 62.397  35.492  48.054  1.00 36.99  ? 4   DT  D C4    1 
ATOM 4724 O O4    . DT  D 4 4   ? 61.337  35.915  47.599  1.00 33.56  ? 4   DT  D O4    1 
ATOM 4725 C C5    . DT  D 4 4   ? 62.422  34.512  49.142  1.00 36.75  ? 4   DT  D C5    1 
ATOM 4726 C C7    . DT  D 4 4   ? 61.131  33.983  49.712  1.00 44.17  ? 4   DT  D C7    1 
ATOM 4727 C C6    . DT  D 4 4   ? 63.596  34.126  49.620  1.00 28.20  ? 4   DT  D C6    1 
ATOM 4728 P P     . DG  D 4 5   ? 68.590  34.590  52.447  1.00 95.46  ? 5   DG  D P     1 
ATOM 4729 O OP1   . DG  D 4 5   ? 69.990  34.349  52.857  1.00 50.28  ? 5   DG  D OP1   1 
ATOM 4730 O OP2   . DG  D 4 5   ? 67.568  34.908  53.493  1.00 89.72  ? 5   DG  D OP2   1 
ATOM 4731 O "O5'" . DG  D 4 5   ? 68.549  35.731  51.313  1.00 78.12  ? 5   DG  D "O5'" 1 
ATOM 4732 C "C5'" . DG  D 4 5   ? 69.755  36.269  50.782  1.00 76.22  ? 5   DG  D "C5'" 1 
ATOM 4733 C "C4'" . DG  D 4 5   ? 69.530  37.694  50.300  1.00 81.39  ? 5   DG  D "C4'" 1 
ATOM 4734 O "O4'" . DG  D 4 5   ? 68.194  37.800  49.693  1.00 73.21  ? 5   DG  D "O4'" 1 
ATOM 4735 C "C3'" . DG  D 4 5   ? 69.572  38.767  51.400  1.00 70.42  ? 5   DG  D "C3'" 1 
ATOM 4736 O "O3'" . DG  D 4 5   ? 70.090  39.981  50.865  1.00 90.00  ? 5   DG  D "O3'" 1 
ATOM 4737 C "C2'" . DG  D 4 5   ? 68.106  38.915  51.705  1.00 66.19  ? 5   DG  D "C2'" 1 
ATOM 4738 C "C1'" . DG  D 4 5   ? 67.511  38.850  50.307  1.00 50.41  ? 5   DG  D "C1'" 1 
ATOM 4739 N N9    . DG  D 4 5   ? 66.133  38.528  50.371  1.00 34.86  ? 5   DG  D N9    1 
ATOM 4740 C C8    . DG  D 4 5   ? 65.563  37.673  51.285  1.00 45.46  ? 5   DG  D C8    1 
ATOM 4741 N N7    . DG  D 4 5   ? 64.274  37.595  51.178  1.00 42.88  ? 5   DG  D N7    1 
ATOM 4742 C C5    . DG  D 4 5   ? 63.981  38.472  50.148  1.00 28.30  ? 5   DG  D C5    1 
ATOM 4743 C C6    . DG  D 4 5   ? 62.748  38.764  49.598  1.00 35.23  ? 5   DG  D C6    1 
ATOM 4744 O O6    . DG  D 4 5   ? 61.660  38.298  49.933  1.00 47.73  ? 5   DG  D O6    1 
ATOM 4745 N N1    . DG  D 4 5   ? 62.823  39.703  48.590  1.00 31.76  ? 5   DG  D N1    1 
ATOM 4746 C C2    . DG  D 4 5   ? 63.976  40.257  48.132  1.00 39.43  ? 5   DG  D C2    1 
ATOM 4747 N N2    . DG  D 4 5   ? 63.813  41.144  47.129  1.00 26.99  ? 5   DG  D N2    1 
ATOM 4748 N N3    . DG  D 4 5   ? 65.212  39.958  48.629  1.00 34.31  ? 5   DG  D N3    1 
ATOM 4749 C C4    . DG  D 4 5   ? 65.111  39.065  49.647  1.00 27.61  ? 5   DG  D C4    1 
ATOM 4750 P P     . DA  D 4 6   ? 70.897  41.045  51.761  1.00 74.56  ? 6   DA  D P     1 
ATOM 4751 O OP1   . DA  D 4 6   ? 71.261  42.088  50.757  1.00 63.62  ? 6   DA  D OP1   1 
ATOM 4752 O OP2   . DA  D 4 6   ? 72.006  40.466  52.526  1.00 72.35  ? 6   DA  D OP2   1 
ATOM 4753 O "O5'" . DA  D 4 6   ? 69.866  41.462  52.914  1.00 81.07  ? 6   DA  D "O5'" 1 
ATOM 4754 C "C5'" . DA  D 4 6   ? 68.551  41.996  52.626  1.00 67.20  ? 6   DA  D "C5'" 1 
ATOM 4755 C "C4'" . DA  D 4 6   ? 68.566  43.154  51.643  1.00 57.98  ? 6   DA  D "C4'" 1 
ATOM 4756 O "O4'" . DA  D 4 6   ? 67.768  42.796  50.527  1.00 48.68  ? 6   DA  D "O4'" 1 
ATOM 4757 C "C3'" . DA  D 4 6   ? 67.992  44.474  52.178  1.00 65.89  ? 6   DA  D "C3'" 1 
ATOM 4758 O "O3'" . DA  D 4 6   ? 68.960  45.532  52.002  1.00 72.66  ? 6   DA  D "O3'" 1 
ATOM 4759 C "C2'" . DA  D 4 6   ? 66.747  44.729  51.325  1.00 68.10  ? 6   DA  D "C2'" 1 
ATOM 4760 C "C1'" . DA  D 4 6   ? 66.523  43.441  50.599  1.00 53.74  ? 6   DA  D "C1'" 1 
ATOM 4761 N N9    . DA  D 4 6   ? 65.484  42.611  51.238  1.00 53.10  ? 6   DA  D N9    1 
ATOM 4762 C C8    . DA  D 4 6   ? 65.596  41.660  52.241  1.00 52.28  ? 6   DA  D C8    1 
ATOM 4763 N N7    . DA  D 4 6   ? 64.448  41.072  52.575  1.00 40.23  ? 6   DA  D N7    1 
ATOM 4764 C C5    . DA  D 4 6   ? 63.525  41.706  51.762  1.00 36.44  ? 6   DA  D C5    1 
ATOM 4765 C C6    . DA  D 4 6   ? 62.135  41.574  51.640  1.00 31.98  ? 6   DA  D C6    1 
ATOM 4766 N N6    . DA  D 4 6   ? 61.412  40.753  52.387  1.00 29.78  ? 6   DA  D N6    1 
ATOM 4767 N N1    . DA  D 4 6   ? 61.514  42.339  50.730  1.00 41.16  ? 6   DA  D N1    1 
ATOM 4768 C C2    . DA  D 4 6   ? 62.256  43.216  49.990  1.00 62.37  ? 6   DA  D C2    1 
ATOM 4769 N N3    . DA  D 4 6   ? 63.584  43.453  50.012  1.00 41.38  ? 6   DA  D N3    1 
ATOM 4770 C C4    . DA  D 4 6   ? 64.157  42.665  50.940  1.00 45.30  ? 6   DA  D C4    1 
ATOM 4771 P P     . DC  D 4 7   ? 68.713  47.025  52.551  1.00 64.10  ? 7   DC  D P     1 
ATOM 4772 O OP1   . DC  D 4 7   ? 69.197  47.934  51.470  1.00 56.81  ? 7   DC  D OP1   1 
ATOM 4773 O OP2   . DC  D 4 7   ? 69.332  46.975  53.901  1.00 43.47  ? 7   DC  D OP2   1 
ATOM 4774 O "O5'" . DC  D 4 7   ? 67.118  47.200  52.616  1.00 35.10  ? 7   DC  D "O5'" 1 
ATOM 4775 C "C5'" . DC  D 4 7   ? 66.532  48.441  52.686  1.00 45.55  ? 7   DC  D "C5'" 1 
ATOM 4776 C "C4'" . DC  D 4 7   ? 65.154  48.415  52.067  1.00 64.47  ? 7   DC  D "C4'" 1 
ATOM 4777 O "O4'" . DC  D 4 7   ? 64.758  47.033  51.875  1.00 54.57  ? 7   DC  D "O4'" 1 
ATOM 4778 C "C3'" . DC  D 4 7   ? 64.032  49.059  52.900  1.00 81.84  ? 7   DC  D "C3'" 1 
ATOM 4779 O "O3'" . DC  D 4 7   ? 63.891  50.573  52.630  1.00 52.55  ? 7   DC  D "O3'" 1 
ATOM 4780 C "C2'" . DC  D 4 7   ? 62.786  48.253  52.452  1.00 85.26  ? 7   DC  D "C2'" 1 
ATOM 4781 C "C1'" . DC  D 4 7   ? 63.348  46.912  51.898  1.00 45.32  ? 7   DC  D "C1'" 1 
ATOM 4782 N N1    . DC  D 4 7   ? 62.982  45.768  52.767  1.00 55.82  ? 7   DC  D N1    1 
ATOM 4783 C C2    . DC  D 4 7   ? 61.660  45.310  52.770  1.00 60.66  ? 7   DC  D C2    1 
ATOM 4784 O O2    . DC  D 4 7   ? 60.842  45.856  51.999  1.00 64.60  ? 7   DC  D O2    1 
ATOM 4785 N N3    . DC  D 4 7   ? 61.316  44.262  53.611  1.00 43.53  ? 7   DC  D N3    1 
ATOM 4786 C C4    . DC  D 4 7   ? 62.254  43.716  54.422  1.00 41.11  ? 7   DC  D C4    1 
ATOM 4787 N N4    . DC  D 4 7   ? 61.885  42.744  55.263  1.00 27.70  ? 7   DC  D N4    1 
ATOM 4788 C C5    . DC  D 4 7   ? 63.612  44.158  54.403  1.00 34.86  ? 7   DC  D C5    1 
ATOM 4789 C C6    . DC  D 4 7   ? 63.926  45.180  53.581  1.00 55.87  ? 7   DC  D C6    1 
ATOM 4790 N N     . ARG E 1 6   ? 31.438  101.205 64.801  1.00 140.50 ? 81  ARG E N     1 
ATOM 4791 C CA    . ARG E 1 6   ? 30.778  99.973  64.388  1.00 148.67 ? 81  ARG E CA    1 
ATOM 4792 C C     . ARG E 1 6   ? 31.401  99.381  63.135  1.00 158.98 ? 81  ARG E C     1 
ATOM 4793 O O     . ARG E 1 6   ? 32.143  98.403  63.201  1.00 160.01 ? 81  ARG E O     1 
ATOM 4794 C CB    . ARG E 1 6   ? 29.288  100.208 64.134  1.00 145.48 ? 81  ARG E CB    1 
ATOM 4795 C CG    . ARG E 1 6   ? 28.527  98.963  63.653  1.00 134.50 ? 81  ARG E CG    1 
ATOM 4796 C CD    . ARG E 1 6   ? 27.031  99.064  63.920  1.00 128.38 ? 81  ARG E CD    1 
ATOM 4797 N NE    . ARG E 1 6   ? 26.707  100.023 64.983  1.00 160.73 ? 81  ARG E NE    1 
ATOM 4798 C CZ    . ARG E 1 6   ? 26.936  99.839  66.286  1.00 165.87 ? 81  ARG E CZ    1 
ATOM 4799 N NH1   . ARG E 1 6   ? 27.520  98.725  66.711  1.00 168.27 ? 81  ARG E NH1   1 
ATOM 4800 N NH2   . ARG E 1 6   ? 26.603  100.784 67.164  1.00 152.48 ? 81  ARG E NH2   1 
ATOM 4801 N N     . GLU E 1 7   ? 31.076  99.981  61.993  1.00 158.64 ? 82  GLU E N     1 
ATOM 4802 C CA    . GLU E 1 7   ? 31.493  99.434  60.712  1.00 155.22 ? 82  GLU E CA    1 
ATOM 4803 C C     . GLU E 1 7   ? 33.019  99.374  60.628  1.00 153.38 ? 82  GLU E C     1 
ATOM 4804 O O     . GLU E 1 7   ? 33.731  100.235 61.157  1.00 151.75 ? 82  GLU E O     1 
ATOM 4805 C CB    . GLU E 1 7   ? 30.882  100.271 59.583  1.00 150.94 ? 82  GLU E CB    1 
ATOM 4806 C CG    . GLU E 1 7   ? 31.297  99.872  58.195  1.00 155.94 ? 82  GLU E CG    1 
ATOM 4807 C CD    . GLU E 1 7   ? 32.560  100.591 57.765  1.00 155.78 ? 82  GLU E CD    1 
ATOM 4808 O OE1   . GLU E 1 7   ? 32.671  101.807 58.032  1.00 147.20 ? 82  GLU E OE1   1 
ATOM 4809 O OE2   . GLU E 1 7   ? 33.449  99.938  57.181  1.00 156.05 ? 82  GLU E OE2   1 
ATOM 4810 N N     . LEU E 1 8   ? 33.520  98.328  59.979  1.00 141.73 ? 83  LEU E N     1 
ATOM 4811 C CA    . LEU E 1 8   ? 34.917  97.945  60.088  1.00 135.11 ? 83  LEU E CA    1 
ATOM 4812 C C     . LEU E 1 8   ? 35.626  98.036  58.743  1.00 129.38 ? 83  LEU E C     1 
ATOM 4813 O O     . LEU E 1 8   ? 35.019  97.856  57.679  1.00 116.83 ? 83  LEU E O     1 
ATOM 4814 C CB    . LEU E 1 8   ? 35.040  96.522  60.637  1.00 146.17 ? 83  LEU E CB    1 
ATOM 4815 C CG    . LEU E 1 8   ? 34.415  96.200  62.002  1.00 158.02 ? 83  LEU E CG    1 
ATOM 4816 C CD1   . LEU E 1 8   ? 34.636  94.721  62.383  1.00 148.95 ? 83  LEU E CD1   1 
ATOM 4817 C CD2   . LEU E 1 8   ? 34.957  97.125  63.086  1.00 149.55 ? 83  LEU E CD2   1 
ATOM 4818 N N     . LYS E 1 9   ? 36.935  98.264  58.813  1.00 119.35 ? 84  LYS E N     1 
ATOM 4819 C CA    . LYS E 1 9   ? 37.716  98.550  57.618  1.00 115.86 ? 84  LYS E CA    1 
ATOM 4820 C C     . LYS E 1 9   ? 37.937  97.294  56.777  1.00 105.81 ? 84  LYS E C     1 
ATOM 4821 O O     . LYS E 1 9   ? 38.054  96.184  57.299  1.00 116.33 ? 84  LYS E O     1 
ATOM 4822 C CB    . LYS E 1 9   ? 39.044  99.210  58.019  1.00 113.23 ? 84  LYS E CB    1 
ATOM 4823 C CG    . LYS E 1 9   ? 38.818  100.577 58.766  1.00 139.72 ? 84  LYS E CG    1 
ATOM 4824 C CD    . LYS E 1 9   ? 40.073  101.411 59.115  1.00 99.49  ? 84  LYS E CD    1 
ATOM 4825 C CE    . LYS E 1 9   ? 39.878  102.148 60.441  1.00 94.79  ? 84  LYS E CE    1 
ATOM 4826 N NZ    . LYS E 1 9   ? 38.439  102.475 60.728  1.00 123.42 ? 84  LYS E NZ    1 
ATOM 4827 N N     . THR E 1 10  ? 37.938  97.474  55.458  1.00 98.18  ? 85  THR E N     1 
ATOM 4828 C CA    . THR E 1 10  ? 38.122  96.402  54.477  1.00 104.14 ? 85  THR E CA    1 
ATOM 4829 C C     . THR E 1 10  ? 39.418  96.645  53.701  1.00 103.99 ? 85  THR E C     1 
ATOM 4830 O O     . THR E 1 10  ? 39.463  97.480  52.790  1.00 111.83 ? 85  THR E O     1 
ATOM 4831 C CB    . THR E 1 10  ? 36.926  96.343  53.520  1.00 104.48 ? 85  THR E CB    1 
ATOM 4832 O OG1   . THR E 1 10  ? 35.736  95.972  54.238  1.00 103.53 ? 85  THR E OG1   1 
ATOM 4833 C CG2   . THR E 1 10  ? 37.196  95.399  52.312  1.00 58.21  ? 85  THR E CG2   1 
ATOM 4834 N N     . VAL E 1 11  ? 40.447  95.859  53.996  1.00 104.75 ? 86  VAL E N     1 
ATOM 4835 C CA    . VAL E 1 11  ? 41.771  96.181  53.487  1.00 96.29  ? 86  VAL E CA    1 
ATOM 4836 C C     . VAL E 1 11  ? 41.857  95.878  51.988  1.00 87.61  ? 86  VAL E C     1 
ATOM 4837 O O     . VAL E 1 11  ? 41.027  95.165  51.414  1.00 72.48  ? 86  VAL E O     1 
ATOM 4838 C CB    . VAL E 1 11  ? 42.847  95.432  54.293  1.00 104.10 ? 86  VAL E CB    1 
ATOM 4839 C CG1   . VAL E 1 11  ? 42.605  95.561  55.859  1.00 74.02  ? 86  VAL E CG1   1 
ATOM 4840 C CG2   . VAL E 1 11  ? 42.904  93.997  53.858  1.00 104.37 ? 86  VAL E CG2   1 
ATOM 4841 N N     . SER E 1 12  ? 42.867  96.469  51.342  1.00 98.96  ? 87  SER E N     1 
ATOM 4842 C CA    . SER E 1 12  ? 43.024  96.370  49.893  1.00 91.00  ? 87  SER E CA    1 
ATOM 4843 C C     . SER E 1 12  ? 43.100  94.923  49.461  1.00 94.03  ? 87  SER E C     1 
ATOM 4844 O O     . SER E 1 12  ? 43.545  94.064  50.215  1.00 105.84 ? 87  SER E O     1 
ATOM 4845 C CB    . SER E 1 12  ? 44.296  97.066  49.440  1.00 82.18  ? 87  SER E CB    1 
ATOM 4846 O OG    . SER E 1 12  ? 45.378  96.709  50.282  1.00 94.07  ? 87  SER E OG    1 
ATOM 4847 N N     . ALA E 1 13  ? 42.660  94.651  48.232  1.00 101.05 ? 88  ALA E N     1 
ATOM 4848 C CA    . ALA E 1 13  ? 42.894  93.330  47.644  1.00 108.86 ? 88  ALA E CA    1 
ATOM 4849 C C     . ALA E 1 13  ? 44.365  93.094  47.283  1.00 111.68 ? 88  ALA E C     1 
ATOM 4850 O O     . ALA E 1 13  ? 44.687  92.035  46.726  1.00 104.90 ? 88  ALA E O     1 
ATOM 4851 C CB    . ALA E 1 13  ? 42.009  93.111  46.414  1.00 101.06 ? 88  ALA E CB    1 
ATOM 4852 N N     . ASP E 1 14  ? 45.237  94.089  47.493  1.00 105.31 ? 89  ASP E N     1 
ATOM 4853 C CA    . ASP E 1 14  ? 46.663  93.817  47.629  1.00 99.50  ? 89  ASP E CA    1 
ATOM 4854 C C     . ASP E 1 14  ? 47.005  93.371  49.044  1.00 93.06  ? 89  ASP E C     1 
ATOM 4855 O O     . ASP E 1 14  ? 47.750  92.408  49.226  1.00 95.17  ? 89  ASP E O     1 
ATOM 4856 C CB    . ASP E 1 14  ? 47.481  95.053  47.248  1.00 125.45 ? 89  ASP E CB    1 
ATOM 4857 C CG    . ASP E 1 14  ? 48.295  94.841  45.978  1.00 138.78 ? 89  ASP E CG    1 
ATOM 4858 O OD1   . ASP E 1 14  ? 47.701  94.778  44.875  1.00 131.58 ? 89  ASP E OD1   1 
ATOM 4859 O OD2   . ASP E 1 14  ? 49.534  94.733  46.085  1.00 143.36 ? 89  ASP E OD2   1 
ATOM 4860 N N     . CYS E 1 15  ? 46.462  94.043  50.060  1.00 91.72  ? 90  CYS E N     1 
ATOM 4861 C CA    . CYS E 1 15  ? 46.698  93.602  51.430  1.00 80.32  ? 90  CYS E CA    1 
ATOM 4862 C C     . CYS E 1 15  ? 46.167  92.185  51.654  1.00 101.56 ? 90  CYS E C     1 
ATOM 4863 O O     . CYS E 1 15  ? 46.782  91.397  52.385  1.00 100.91 ? 90  CYS E O     1 
ATOM 4864 C CB    . CYS E 1 15  ? 46.069  94.585  52.412  1.00 66.25  ? 90  CYS E CB    1 
ATOM 4865 S SG    . CYS E 1 15  ? 46.267  94.170  54.154  1.00 80.23  ? 90  CYS E SG    1 
ATOM 4866 N N     . LYS E 1 16  ? 45.030  91.836  51.024  1.00 111.53 ? 91  LYS E N     1 
ATOM 4867 C CA    . LYS E 1 16  ? 44.442  90.499  51.125  1.00 82.78  ? 91  LYS E CA    1 
ATOM 4868 C C     . LYS E 1 16  ? 45.494  89.489  50.710  1.00 88.25  ? 91  LYS E C     1 
ATOM 4869 O O     . LYS E 1 16  ? 46.027  88.773  51.560  1.00 97.82  ? 91  LYS E O     1 
ATOM 4870 C CB    . LYS E 1 16  ? 43.175  90.347  50.265  1.00 76.12  ? 91  LYS E CB    1 
ATOM 4871 C CG    . LYS E 1 16  ? 42.664  88.896  50.084  1.00 97.16  ? 91  LYS E CG    1 
ATOM 4872 C CD    . LYS E 1 16  ? 41.275  88.814  49.421  1.00 99.58  ? 91  LYS E CD    1 
ATOM 4873 C CE    . LYS E 1 16  ? 40.286  87.974  50.253  1.00 91.95  ? 91  LYS E CE    1 
ATOM 4874 N NZ    . LYS E 1 16  ? 38.862  88.406  50.033  1.00 69.77  ? 91  LYS E NZ    1 
ATOM 4875 N N     . LYS E 1 17  ? 45.869  89.473  49.433  1.00 87.69  ? 92  LYS E N     1 
ATOM 4876 C CA    . LYS E 1 17  ? 46.745  88.407  48.954  1.00 90.35  ? 92  LYS E CA    1 
ATOM 4877 C C     . LYS E 1 17  ? 48.135  88.428  49.589  1.00 98.98  ? 92  LYS E C     1 
ATOM 4878 O O     . LYS E 1 17  ? 48.934  87.526  49.307  1.00 91.86  ? 92  LYS E O     1 
ATOM 4879 C CB    . LYS E 1 17  ? 46.812  88.447  47.434  1.00 85.50  ? 92  LYS E CB    1 
ATOM 4880 C CG    . LYS E 1 17  ? 45.465  88.066  46.841  1.00 99.68  ? 92  LYS E CG    1 
ATOM 4881 C CD    . LYS E 1 17  ? 44.996  89.055  45.800  1.00 98.35  ? 92  LYS E CD    1 
ATOM 4882 C CE    . LYS E 1 17  ? 45.289  88.525  44.407  1.00 104.24 ? 92  LYS E CE    1 
ATOM 4883 N NZ    . LYS E 1 17  ? 46.706  88.075  44.238  1.00 84.14  ? 92  LYS E NZ    1 
ATOM 4884 N N     . GLU E 1 18  ? 48.456  89.425  50.426  1.00 99.56  ? 93  GLU E N     1 
ATOM 4885 C CA    . GLU E 1 18  ? 49.606  89.286  51.309  1.00 93.71  ? 93  GLU E CA    1 
ATOM 4886 C C     . GLU E 1 18  ? 49.240  88.764  52.689  1.00 93.57  ? 93  GLU E C     1 
ATOM 4887 O O     . GLU E 1 18  ? 50.141  88.537  53.494  1.00 111.26 ? 93  GLU E O     1 
ATOM 4888 C CB    . GLU E 1 18  ? 50.371  90.607  51.462  1.00 107.87 ? 93  GLU E CB    1 
ATOM 4889 C CG    . GLU E 1 18  ? 51.915  90.418  51.658  1.00 134.55 ? 93  GLU E CG    1 
ATOM 4890 C CD    . GLU E 1 18  ? 52.680  91.682  52.136  1.00 143.55 ? 93  GLU E CD    1 
ATOM 4891 O OE1   . GLU E 1 18  ? 52.880  91.842  53.364  1.00 126.91 ? 93  GLU E OE1   1 
ATOM 4892 O OE2   . GLU E 1 18  ? 53.111  92.500  51.286  1.00 160.16 ? 93  GLU E OE2   1 
ATOM 4893 N N     . ALA E 1 19  ? 47.960  88.591  53.009  1.00 90.57  ? 94  ALA E N     1 
ATOM 4894 C CA    . ALA E 1 19  ? 47.644  87.697  54.120  1.00 82.22  ? 94  ALA E CA    1 
ATOM 4895 C C     . ALA E 1 19  ? 47.620  86.239  53.662  1.00 88.81  ? 94  ALA E C     1 
ATOM 4896 O O     . ALA E 1 19  ? 48.176  85.363  54.343  1.00 82.33  ? 94  ALA E O     1 
ATOM 4897 C CB    . ALA E 1 19  ? 46.322  88.086  54.774  1.00 69.17  ? 94  ALA E CB    1 
ATOM 4898 N N     . ILE E 1 20  ? 47.025  85.959  52.490  1.00 93.91  ? 95  ILE E N     1 
ATOM 4899 C CA    . ILE E 1 20  ? 46.933  84.569  52.024  1.00 87.83  ? 95  ILE E CA    1 
ATOM 4900 C C     . ILE E 1 20  ? 48.263  84.047  51.469  1.00 89.36  ? 95  ILE E C     1 
ATOM 4901 O O     . ILE E 1 20  ? 48.352  82.850  51.177  1.00 106.01 ? 95  ILE E O     1 
ATOM 4902 C CB    . ILE E 1 20  ? 45.706  84.353  51.078  1.00 61.16  ? 95  ILE E CB    1 
ATOM 4903 C CG1   . ILE E 1 20  ? 46.016  84.102  49.596  1.00 67.86  ? 95  ILE E CG1   1 
ATOM 4904 C CG2   . ILE E 1 20  ? 44.631  85.460  51.200  1.00 53.94  ? 95  ILE E CG2   1 
ATOM 4905 C CD1   . ILE E 1 20  ? 44.723  83.977  48.738  1.00 46.79  ? 95  ILE E CD1   1 
ATOM 4906 N N     . GLU E 1 21  ? 49.314  84.878  51.308  1.00 96.07  ? 96  GLU E N     1 
ATOM 4907 C CA    . GLU E 1 21  ? 50.658  84.290  51.205  1.00 98.62  ? 96  GLU E CA    1 
ATOM 4908 C C     . GLU E 1 21  ? 51.370  84.119  52.548  1.00 106.09 ? 96  GLU E C     1 
ATOM 4909 O O     . GLU E 1 21  ? 52.176  83.196  52.694  1.00 110.70 ? 96  GLU E O     1 
ATOM 4910 C CB    . GLU E 1 21  ? 51.588  85.075  50.271  1.00 109.87 ? 96  GLU E CB    1 
ATOM 4911 C CG    . GLU E 1 21  ? 52.822  84.200  49.863  1.00 121.59 ? 96  GLU E CG    1 
ATOM 4912 C CD    . GLU E 1 21  ? 53.999  84.966  49.240  1.00 146.27 ? 96  GLU E CD    1 
ATOM 4913 O OE1   . GLU E 1 21  ? 54.105  86.203  49.440  1.00 130.54 ? 96  GLU E OE1   1 
ATOM 4914 O OE2   . GLU E 1 21  ? 54.827  84.311  48.553  1.00 148.14 ? 96  GLU E OE2   1 
ATOM 4915 N N     . LYS E 1 22  ? 51.180  85.030  53.507  1.00 89.56  ? 97  LYS E N     1 
ATOM 4916 C CA    . LYS E 1 22  ? 51.899  84.901  54.769  1.00 78.00  ? 97  LYS E CA    1 
ATOM 4917 C C     . LYS E 1 22  ? 51.226  83.919  55.715  1.00 95.56  ? 97  LYS E C     1 
ATOM 4918 O O     . LYS E 1 22  ? 51.895  83.331  56.579  1.00 95.48  ? 97  LYS E O     1 
ATOM 4919 C CB    . LYS E 1 22  ? 52.047  86.264  55.442  1.00 84.56  ? 97  LYS E CB    1 
ATOM 4920 C CG    . LYS E 1 22  ? 53.117  87.142  54.796  1.00 91.60  ? 97  LYS E CG    1 
ATOM 4921 C CD    . LYS E 1 22  ? 54.536  86.589  54.970  1.00 93.64  ? 97  LYS E CD    1 
ATOM 4922 C CE    . LYS E 1 22  ? 55.152  86.170  53.642  1.00 98.67  ? 97  LYS E CE    1 
ATOM 4923 N NZ    . LYS E 1 22  ? 55.086  87.231  52.587  1.00 104.12 ? 97  LYS E NZ    1 
ATOM 4924 N N     . CYS E 1 23  ? 49.910  83.739  55.580  1.00 95.36  ? 98  CYS E N     1 
ATOM 4925 C CA    . CYS E 1 23  ? 49.207  82.748  56.389  1.00 87.46  ? 98  CYS E CA    1 
ATOM 4926 C C     . CYS E 1 23  ? 49.580  81.334  55.964  1.00 87.60  ? 98  CYS E C     1 
ATOM 4927 O O     . CYS E 1 23  ? 49.882  80.473  56.802  1.00 79.58  ? 98  CYS E O     1 
ATOM 4928 C CB    . CYS E 1 23  ? 47.702  82.961  56.270  1.00 84.28  ? 98  CYS E CB    1 
ATOM 4929 S SG    . CYS E 1 23  ? 47.027  84.128  57.458  1.00 89.02  ? 98  CYS E SG    1 
ATOM 4930 N N     . ALA E 1 24  ? 49.550  81.077  54.655  1.00 80.98  ? 99  ALA E N     1 
ATOM 4931 C CA    . ALA E 1 24  ? 50.138  79.855  54.124  1.00 78.64  ? 99  ALA E CA    1 
ATOM 4932 C C     . ALA E 1 24  ? 51.544  79.626  54.687  1.00 84.91  ? 99  ALA E C     1 
ATOM 4933 O O     . ALA E 1 24  ? 51.895  78.511  55.079  1.00 73.11  ? 99  ALA E O     1 
ATOM 4934 C CB    . ALA E 1 24  ? 50.158  79.935  52.597  1.00 64.76  ? 99  ALA E CB    1 
ATOM 4935 N N     . GLN E 1 25  ? 52.354  80.687  54.754  1.00 100.17 ? 100 GLN E N     1 
ATOM 4936 C CA    . GLN E 1 25  ? 53.691  80.592  55.325  1.00 81.38  ? 100 GLN E CA    1 
ATOM 4937 C C     . GLN E 1 25  ? 53.654  79.921  56.675  1.00 68.84  ? 100 GLN E C     1 
ATOM 4938 O O     . GLN E 1 25  ? 54.571  79.191  57.039  1.00 83.14  ? 100 GLN E O     1 
ATOM 4939 C CB    . GLN E 1 25  ? 54.303  81.989  55.474  1.00 99.23  ? 100 GLN E CB    1 
ATOM 4940 C CG    . GLN E 1 25  ? 54.721  82.641  54.180  1.00 102.10 ? 100 GLN E CG    1 
ATOM 4941 C CD    . GLN E 1 25  ? 56.176  82.934  54.171  1.00 91.70  ? 100 GLN E CD    1 
ATOM 4942 O OE1   . GLN E 1 25  ? 56.760  83.268  55.207  1.00 77.71  ? 100 GLN E OE1   1 
ATOM 4943 N NE2   . GLN E 1 25  ? 56.791  82.788  53.010  1.00 91.89  ? 100 GLN E NE2   1 
ATOM 4944 N N     . TRP E 1 26  ? 52.611  80.180  57.445  1.00 65.23  ? 101 TRP E N     1 
ATOM 4945 C CA    . TRP E 1 26  ? 52.515  79.635  58.792  1.00 70.97  ? 101 TRP E CA    1 
ATOM 4946 C C     . TRP E 1 26  ? 52.402  78.124  58.768  1.00 74.73  ? 101 TRP E C     1 
ATOM 4947 O O     . TRP E 1 26  ? 53.119  77.401  59.481  1.00 70.62  ? 101 TRP E O     1 
ATOM 4948 C CB    . TRP E 1 26  ? 51.276  80.211  59.421  1.00 64.82  ? 101 TRP E CB    1 
ATOM 4949 C CG    . TRP E 1 26  ? 51.005  79.812  60.731  1.00 52.15  ? 101 TRP E CG    1 
ATOM 4950 C CD1   . TRP E 1 26  ? 51.899  79.527  61.706  1.00 50.81  ? 101 TRP E CD1   1 
ATOM 4951 C CD2   . TRP E 1 26  ? 49.709  79.684  61.294  1.00 55.90  ? 101 TRP E CD2   1 
ATOM 4952 N NE1   . TRP E 1 26  ? 51.234  79.225  62.877  1.00 60.67  ? 101 TRP E NE1   1 
ATOM 4953 C CE2   . TRP E 1 26  ? 49.883  79.325  62.654  1.00 62.63  ? 101 TRP E CE2   1 
ATOM 4954 C CE3   . TRP E 1 26  ? 48.406  79.844  60.782  1.00 43.17  ? 101 TRP E CE3   1 
ATOM 4955 C CZ2   . TRP E 1 26  ? 48.798  79.137  63.528  1.00 48.80  ? 101 TRP E CZ2   1 
ATOM 4956 C CZ3   . TRP E 1 26  ? 47.325  79.670  61.645  1.00 49.94  ? 101 TRP E CZ3   1 
ATOM 4957 C CH2   . TRP E 1 26  ? 47.530  79.322  63.007  1.00 53.92  ? 101 TRP E CH2   1 
ATOM 4958 N N     . VAL E 1 27  ? 51.458  77.651  57.958  1.00 71.56  ? 102 VAL E N     1 
ATOM 4959 C CA    . VAL E 1 27  ? 51.053  76.263  57.817  1.00 57.39  ? 102 VAL E CA    1 
ATOM 4960 C C     . VAL E 1 27  ? 52.188  75.387  57.274  1.00 64.07  ? 102 VAL E C     1 
ATOM 4961 O O     . VAL E 1 27  ? 52.245  74.175  57.539  1.00 75.16  ? 102 VAL E O     1 
ATOM 4962 C CB    . VAL E 1 27  ? 49.805  76.308  56.909  1.00 51.95  ? 102 VAL E CB    1 
ATOM 4963 C CG1   . VAL E 1 27  ? 49.734  75.154  55.935  1.00 60.46  ? 102 VAL E CG1   1 
ATOM 4964 C CG2   . VAL E 1 27  ? 48.552  76.453  57.720  1.00 49.26  ? 102 VAL E CG2   1 
ATOM 4965 N N     . VAL E 1 28  ? 53.077  75.971  56.473  1.00 61.08  ? 103 VAL E N     1 
ATOM 4966 C CA    . VAL E 1 28  ? 54.253  75.279  55.964  1.00 58.10  ? 103 VAL E CA    1 
ATOM 4967 C C     . VAL E 1 28  ? 55.427  75.318  56.963  1.00 67.11  ? 103 VAL E C     1 
ATOM 4968 O O     . VAL E 1 28  ? 56.249  74.399  56.998  1.00 86.87  ? 103 VAL E O     1 
ATOM 4969 C CB    . VAL E 1 28  ? 54.616  75.881  54.588  1.00 57.09  ? 103 VAL E CB    1 
ATOM 4970 C CG1   . VAL E 1 28  ? 55.711  75.082  53.881  1.00 50.54  ? 103 VAL E CG1   1 
ATOM 4971 C CG2   . VAL E 1 28  ? 53.356  76.030  53.707  1.00 40.72  ? 103 VAL E CG2   1 
ATOM 4972 N N     . ARG E 1 29  ? 55.576  76.385  57.742  1.00 64.53  ? 104 ARG E N     1 
ATOM 4973 C CA    . ARG E 1 29  ? 56.735  76.515  58.622  1.00 79.19  ? 104 ARG E CA    1 
ATOM 4974 C C     . ARG E 1 29  ? 56.466  76.013  60.024  1.00 67.28  ? 104 ARG E C     1 
ATOM 4975 O O     . ARG E 1 29  ? 57.405  75.861  60.815  1.00 77.46  ? 104 ARG E O     1 
ATOM 4976 C CB    . ARG E 1 29  ? 57.194  77.994  58.723  1.00 109.13 ? 104 ARG E CB    1 
ATOM 4977 C CG    . ARG E 1 29  ? 58.048  78.622  57.549  1.00 96.32  ? 104 ARG E CG    1 
ATOM 4978 C CD    . ARG E 1 29  ? 58.621  80.026  57.940  1.00 89.61  ? 104 ARG E CD    1 
ATOM 4979 N NE    . ARG E 1 29  ? 59.449  80.635  56.897  1.00 112.50 ? 104 ARG E NE    1 
ATOM 4980 C CZ    . ARG E 1 29  ? 59.743  81.934  56.838  1.00 133.97 ? 104 ARG E CZ    1 
ATOM 4981 N NH1   . ARG E 1 29  ? 59.270  82.758  57.766  1.00 114.26 ? 104 ARG E NH1   1 
ATOM 4982 N NH2   . ARG E 1 29  ? 60.500  82.416  55.850  1.00 147.88 ? 104 ARG E NH2   1 
ATOM 4983 N N     . ASP E 1 30  ? 55.209  75.885  60.396  1.00 65.43  ? 105 ASP E N     1 
ATOM 4984 C CA    . ASP E 1 30  ? 54.864  75.150  61.594  1.00 83.34  ? 105 ASP E CA    1 
ATOM 4985 C C     . ASP E 1 30  ? 54.250  73.784  61.320  1.00 80.85  ? 105 ASP E C     1 
ATOM 4986 O O     . ASP E 1 30  ? 54.020  73.020  62.273  1.00 66.59  ? 105 ASP E O     1 
ATOM 4987 C CB    . ASP E 1 30  ? 53.956  76.009  62.452  1.00 79.03  ? 105 ASP E CB    1 
ATOM 4988 C CG    . ASP E 1 30  ? 54.687  77.170  63.029  1.00 75.85  ? 105 ASP E CG    1 
ATOM 4989 O OD1   . ASP E 1 30  ? 54.013  78.060  63.579  1.00 74.03  ? 105 ASP E OD1   1 
ATOM 4990 O OD2   . ASP E 1 30  ? 55.938  77.170  62.923  1.00 76.11  ? 105 ASP E OD2   1 
ATOM 4991 N N     . CYS E 1 31  ? 54.026  73.443  60.044  1.00 82.47  ? 106 CYS E N     1 
ATOM 4992 C CA    . CYS E 1 31  ? 53.312  72.231  59.680  1.00 69.75  ? 106 CYS E CA    1 
ATOM 4993 C C     . CYS E 1 31  ? 52.030  72.194  60.500  1.00 81.63  ? 106 CYS E C     1 
ATOM 4994 O O     . CYS E 1 31  ? 51.931  71.431  61.470  1.00 84.13  ? 106 CYS E O     1 
ATOM 4995 C CB    . CYS E 1 31  ? 54.219  71.018  59.911  1.00 93.82  ? 106 CYS E CB    1 
ATOM 4996 S SG    . CYS E 1 31  ? 53.482  69.392  60.195  1.00 64.55  ? 106 CYS E SG    1 
ATOM 4997 N N     . ARG E 1 32  ? 51.084  73.077  60.180  1.00 65.46  ? 107 ARG E N     1 
ATOM 4998 C CA    . ARG E 1 32  ? 49.819  73.165  60.887  1.00 41.87  ? 107 ARG E CA    1 
ATOM 4999 C C     . ARG E 1 32  ? 48.705  72.925  59.896  1.00 44.75  ? 107 ARG E C     1 
ATOM 5000 O O     . ARG E 1 32  ? 48.959  72.886  58.690  1.00 45.74  ? 107 ARG E O     1 
ATOM 5001 C CB    . ARG E 1 32  ? 49.671  74.518  61.566  1.00 47.94  ? 107 ARG E CB    1 
ATOM 5002 C CG    . ARG E 1 32  ? 50.851  74.764  62.422  1.00 51.68  ? 107 ARG E CG    1 
ATOM 5003 C CD    . ARG E 1 32  ? 50.492  74.663  63.836  1.00 46.73  ? 107 ARG E CD    1 
ATOM 5004 N NE    . ARG E 1 32  ? 51.624  74.210  64.596  1.00 50.17  ? 107 ARG E NE    1 
ATOM 5005 C CZ    . ARG E 1 32  ? 51.517  73.385  65.623  1.00 58.64  ? 107 ARG E CZ    1 
ATOM 5006 N NH1   . ARG E 1 32  ? 50.322  72.932  65.985  1.00 69.85  ? 107 ARG E NH1   1 
ATOM 5007 N NH2   . ARG E 1 32  ? 52.591  72.999  66.279  1.00 57.63  ? 107 ARG E NH2   1 
ATOM 5008 N N     . PRO E 1 33  ? 47.491  72.621  60.358  1.00 43.66  ? 108 PRO E N     1 
ATOM 5009 C CA    . PRO E 1 33  ? 46.435  72.296  59.399  1.00 45.01  ? 108 PRO E CA    1 
ATOM 5010 C C     . PRO E 1 33  ? 45.899  73.560  58.763  1.00 53.67  ? 108 PRO E C     1 
ATOM 5011 O O     . PRO E 1 33  ? 45.892  74.644  59.362  1.00 44.64  ? 108 PRO E O     1 
ATOM 5012 C CB    . PRO E 1 33  ? 45.364  71.617  60.253  1.00 48.79  ? 108 PRO E CB    1 
ATOM 5013 C CG    . PRO E 1 33  ? 45.546  72.236  61.617  1.00 42.71  ? 108 PRO E CG    1 
ATOM 5014 C CD    . PRO E 1 33  ? 47.017  72.501  61.759  1.00 31.14  ? 108 PRO E CD    1 
ATOM 5015 N N     . PHE E 1 34  ? 45.436  73.405  57.526  1.00 49.58  ? 109 PHE E N     1 
ATOM 5016 C CA    . PHE E 1 34  ? 44.739  74.507  56.888  1.00 43.87  ? 109 PHE E CA    1 
ATOM 5017 C C     . PHE E 1 34  ? 43.652  75.057  57.811  1.00 59.61  ? 109 PHE E C     1 
ATOM 5018 O O     . PHE E 1 34  ? 43.702  76.217  58.219  1.00 64.70  ? 109 PHE E O     1 
ATOM 5019 C CB    . PHE E 1 34  ? 44.193  74.046  55.551  1.00 26.42  ? 109 PHE E CB    1 
ATOM 5020 C CG    . PHE E 1 34  ? 45.270  73.520  54.625  1.00 41.84  ? 109 PHE E CG    1 
ATOM 5021 C CD1   . PHE E 1 34  ? 44.985  72.540  53.665  1.00 44.55  ? 109 PHE E CD1   1 
ATOM 5022 C CD2   . PHE E 1 34  ? 46.566  74.010  54.703  1.00 46.58  ? 109 PHE E CD2   1 
ATOM 5023 C CE1   . PHE E 1 34  ? 45.947  72.055  52.815  1.00 40.99  ? 109 PHE E CE1   1 
ATOM 5024 C CE2   . PHE E 1 34  ? 47.545  73.539  53.855  1.00 47.00  ? 109 PHE E CE2   1 
ATOM 5025 C CZ    . PHE E 1 34  ? 47.235  72.547  52.913  1.00 51.90  ? 109 PHE E CZ    1 
ATOM 5026 N N     . SER E 1 35  ? 42.776  74.198  58.307  1.00 63.54  ? 110 SER E N     1 
ATOM 5027 C CA    . SER E 1 35  ? 41.655  74.636  59.134  1.00 55.70  ? 110 SER E CA    1 
ATOM 5028 C C     . SER E 1 35  ? 42.074  75.439  60.367  1.00 50.20  ? 110 SER E C     1 
ATOM 5029 O O     . SER E 1 35  ? 41.219  75.850  61.155  1.00 56.60  ? 110 SER E O     1 
ATOM 5030 C CB    . SER E 1 35  ? 40.846  73.410  59.576  1.00 77.28  ? 110 SER E CB    1 
ATOM 5031 O OG    . SER E 1 35  ? 41.589  72.593  60.486  1.00 75.85  ? 110 SER E OG    1 
ATOM 5032 N N     . ALA E 1 36  ? 43.373  75.591  60.612  1.00 36.44  ? 111 ALA E N     1 
ATOM 5033 C CA    . ALA E 1 36  ? 43.773  76.383  61.760  1.00 41.90  ? 111 ALA E CA    1 
ATOM 5034 C C     . ALA E 1 36  ? 43.346  77.842  61.624  1.00 58.31  ? 111 ALA E C     1 
ATOM 5035 O O     . ALA E 1 36  ? 43.015  78.451  62.654  1.00 64.01  ? 111 ALA E O     1 
ATOM 5036 C CB    . ALA E 1 36  ? 45.275  76.272  61.973  1.00 46.04  ? 111 ALA E CB    1 
ATOM 5037 N N     . VAL E 1 37  ? 43.335  78.399  60.373  1.00 53.90  ? 112 VAL E N     1 
ATOM 5038 C CA    . VAL E 1 37  ? 42.878  79.781  60.084  1.00 54.64  ? 112 VAL E CA    1 
ATOM 5039 C C     . VAL E 1 37  ? 41.470  80.017  60.608  1.00 66.17  ? 112 VAL E C     1 
ATOM 5040 O O     . VAL E 1 37  ? 41.199  81.025  61.269  1.00 82.12  ? 112 VAL E O     1 
ATOM 5041 C CB    . VAL E 1 37  ? 42.900  80.134  58.571  1.00 51.07  ? 112 VAL E CB    1 
ATOM 5042 C CG1   . VAL E 1 37  ? 44.244  80.611  58.064  1.00 48.46  ? 112 VAL E CG1   1 
ATOM 5043 C CG2   . VAL E 1 37  ? 42.326  79.044  57.680  1.00 66.55  ? 112 VAL E CG2   1 
ATOM 5044 N N     . SER E 1 38  ? 40.534  79.132  60.254  1.00 55.33  ? 113 SER E N     1 
ATOM 5045 C CA    . SER E 1 38  ? 39.130  79.279  60.609  1.00 45.12  ? 113 SER E CA    1 
ATOM 5046 C C     . SER E 1 38  ? 38.897  79.224  62.110  1.00 53.29  ? 113 SER E C     1 
ATOM 5047 O O     . SER E 1 38  ? 37.791  79.511  62.574  1.00 49.43  ? 113 SER E O     1 
ATOM 5048 C CB    . SER E 1 38  ? 38.342  78.191  59.892  1.00 56.47  ? 113 SER E CB    1 
ATOM 5049 O OG    . SER E 1 38  ? 38.831  78.041  58.560  1.00 60.71  ? 113 SER E OG    1 
ATOM 5050 N N     . GLY E 1 39  ? 39.910  78.894  62.887  1.00 59.87  ? 114 GLY E N     1 
ATOM 5051 C CA    . GLY E 1 39  ? 39.648  78.683  64.284  1.00 66.67  ? 114 GLY E CA    1 
ATOM 5052 C C     . GLY E 1 39  ? 39.159  79.914  64.985  1.00 50.56  ? 114 GLY E C     1 
ATOM 5053 O O     . GLY E 1 39  ? 39.884  80.900  65.076  1.00 67.35  ? 114 GLY E O     1 
ATOM 5054 N N     . SER E 1 40  ? 37.960  79.839  65.535  1.00 40.06  ? 115 SER E N     1 
ATOM 5055 C CA    . SER E 1 40  ? 37.397  80.970  66.259  1.00 71.25  ? 115 SER E CA    1 
ATOM 5056 C C     . SER E 1 40  ? 38.367  81.554  67.299  1.00 76.45  ? 115 SER E C     1 
ATOM 5057 O O     . SER E 1 40  ? 38.842  82.677  67.115  1.00 78.64  ? 115 SER E O     1 
ATOM 5058 C CB    . SER E 1 40  ? 36.062  80.579  66.897  1.00 66.37  ? 115 SER E CB    1 
ATOM 5059 O OG    . SER E 1 40  ? 36.247  79.609  67.906  1.00 83.66  ? 115 SER E OG    1 
ATOM 5060 N N     . GLY E 1 41  ? 38.720  80.830  68.363  1.00 71.58  ? 116 GLY E N     1 
ATOM 5061 C CA    . GLY E 1 41  ? 39.591  81.454  69.361  1.00 66.84  ? 116 GLY E CA    1 
ATOM 5062 C C     . GLY E 1 41  ? 40.884  81.976  68.793  1.00 65.63  ? 116 GLY E C     1 
ATOM 5063 O O     . GLY E 1 41  ? 41.580  82.754  69.454  1.00 70.27  ? 116 GLY E O     1 
ATOM 5064 N N     . PHE E 1 42  ? 41.211  81.556  67.585  1.00 61.73  ? 117 PHE E N     1 
ATOM 5065 C CA    . PHE E 1 42  ? 42.392  82.002  66.886  1.00 65.44  ? 117 PHE E CA    1 
ATOM 5066 C C     . PHE E 1 42  ? 42.201  83.340  66.242  1.00 72.04  ? 117 PHE E C     1 
ATOM 5067 O O     . PHE E 1 42  ? 43.202  83.980  65.930  1.00 88.31  ? 117 PHE E O     1 
ATOM 5068 C CB    . PHE E 1 42  ? 42.755  80.987  65.815  1.00 74.28  ? 117 PHE E CB    1 
ATOM 5069 C CG    . PHE E 1 42  ? 43.590  81.522  64.708  1.00 67.79  ? 117 PHE E CG    1 
ATOM 5070 C CD1   . PHE E 1 42  ? 44.961  81.650  64.860  1.00 60.71  ? 117 PHE E CD1   1 
ATOM 5071 C CD2   . PHE E 1 42  ? 43.011  81.846  63.492  1.00 58.00  ? 117 PHE E CD2   1 
ATOM 5072 C CE1   . PHE E 1 42  ? 45.742  82.112  63.831  1.00 60.04  ? 117 PHE E CE1   1 
ATOM 5073 C CE2   . PHE E 1 42  ? 43.782  82.289  62.438  1.00 49.92  ? 117 PHE E CE2   1 
ATOM 5074 C CZ    . PHE E 1 42  ? 45.153  82.428  62.613  1.00 68.08  ? 117 PHE E CZ    1 
ATOM 5075 N N     . ILE E 1 43  ? 40.955  83.742  65.954  1.00 79.52  ? 118 ILE E N     1 
ATOM 5076 C CA    . ILE E 1 43  ? 40.699  85.114  65.492  1.00 83.50  ? 118 ILE E CA    1 
ATOM 5077 C C     . ILE E 1 43  ? 40.609  86.108  66.653  1.00 76.37  ? 118 ILE E C     1 
ATOM 5078 O O     . ILE E 1 43  ? 41.357  87.088  66.693  1.00 66.61  ? 118 ILE E O     1 
ATOM 5079 C CB    . ILE E 1 43  ? 39.442  85.177  64.625  1.00 58.46  ? 118 ILE E CB    1 
ATOM 5080 C CG1   . ILE E 1 43  ? 39.146  83.793  64.083  1.00 71.85  ? 118 ILE E CG1   1 
ATOM 5081 C CG2   . ILE E 1 43  ? 39.722  86.105  63.495  1.00 53.13  ? 118 ILE E CG2   1 
ATOM 5082 C CD1   . ILE E 1 43  ? 38.338  83.799  62.814  1.00 70.20  ? 118 ILE E CD1   1 
ATOM 5083 N N     . ASP E 1 44  ? 39.763  85.846  67.654  1.00 65.89  ? 119 ASP E N     1 
ATOM 5084 C CA    . ASP E 1 44  ? 39.801  86.683  68.845  1.00 66.14  ? 119 ASP E CA    1 
ATOM 5085 C C     . ASP E 1 44  ? 41.199  86.775  69.401  1.00 90.15  ? 119 ASP E C     1 
ATOM 5086 O O     . ASP E 1 44  ? 41.489  87.704  70.164  1.00 118.97 ? 119 ASP E O     1 
ATOM 5087 C CB    . ASP E 1 44  ? 38.874  86.152  69.918  1.00 68.95  ? 119 ASP E CB    1 
ATOM 5088 C CG    . ASP E 1 44  ? 37.585  85.698  69.335  1.00 98.81  ? 119 ASP E CG    1 
ATOM 5089 O OD1   . ASP E 1 44  ? 37.568  85.621  68.078  1.00 92.71  ? 119 ASP E OD1   1 
ATOM 5090 O OD2   . ASP E 1 44  ? 36.618  85.422  70.096  1.00 111.12 ? 119 ASP E OD2   1 
ATOM 5091 N N     . MET E 1 45  ? 42.075  85.841  69.024  1.00 86.50  ? 120 MET E N     1 
ATOM 5092 C CA    . MET E 1 45  ? 43.511  86.089  69.106  1.00 93.78  ? 120 MET E CA    1 
ATOM 5093 C C     . MET E 1 45  ? 43.946  87.179  68.113  1.00 84.05  ? 120 MET E C     1 
ATOM 5094 O O     . MET E 1 45  ? 44.461  88.230  68.516  1.00 87.64  ? 120 MET E O     1 
ATOM 5095 C CB    . MET E 1 45  ? 44.270  84.777  68.869  1.00 78.68  ? 120 MET E CB    1 
ATOM 5096 C CG    . MET E 1 45  ? 45.426  84.532  69.833  1.00 64.91  ? 120 MET E CG    1 
ATOM 5097 S SD    . MET E 1 45  ? 46.870  83.991  68.898  1.00 76.53  ? 120 MET E SD    1 
ATOM 5098 C CE    . MET E 1 45  ? 46.180  83.555  67.306  1.00 67.66  ? 120 MET E CE    1 
ATOM 5099 N N     . ILE E 1 46  ? 43.676  86.978  66.817  1.00 71.57  ? 121 ILE E N     1 
ATOM 5100 C CA    . ILE E 1 46  ? 44.302  87.791  65.770  1.00 73.70  ? 121 ILE E CA    1 
ATOM 5101 C C     . ILE E 1 46  ? 43.932  89.247  65.924  1.00 84.29  ? 121 ILE E C     1 
ATOM 5102 O O     . ILE E 1 46  ? 44.788  90.133  65.828  1.00 95.24  ? 121 ILE E O     1 
ATOM 5103 C CB    . ILE E 1 46  ? 43.912  87.282  64.374  1.00 80.21  ? 121 ILE E CB    1 
ATOM 5104 C CG1   . ILE E 1 46  ? 45.025  86.391  63.836  1.00 90.49  ? 121 ILE E CG1   1 
ATOM 5105 C CG2   . ILE E 1 46  ? 43.669  88.433  63.429  1.00 69.82  ? 121 ILE E CG2   1 
ATOM 5106 C CD1   . ILE E 1 46  ? 46.426  86.889  64.188  1.00 100.11 ? 121 ILE E CD1   1 
ATOM 5107 N N     . LYS E 1 47  ? 42.642  89.510  66.157  1.00 97.46  ? 122 LYS E N     1 
ATOM 5108 C CA    . LYS E 1 47  ? 42.130  90.873  66.281  1.00 91.07  ? 122 LYS E CA    1 
ATOM 5109 C C     . LYS E 1 47  ? 42.939  91.686  67.298  1.00 82.99  ? 122 LYS E C     1 
ATOM 5110 O O     . LYS E 1 47  ? 43.378  92.801  67.002  1.00 90.06  ? 122 LYS E O     1 
ATOM 5111 C CB    . LYS E 1 47  ? 40.633  90.816  66.625  1.00 67.38  ? 122 LYS E CB    1 
ATOM 5112 C CG    . LYS E 1 47  ? 39.756  90.286  65.463  1.00 45.39  ? 122 LYS E CG    1 
ATOM 5113 C CD    . LYS E 1 47  ? 38.319  89.990  65.947  1.00 55.63  ? 122 LYS E CD    1 
ATOM 5114 C CE    . LYS E 1 47  ? 37.327  89.643  64.798  1.00 58.65  ? 122 LYS E CE    1 
ATOM 5115 N NZ    . LYS E 1 47  ? 36.944  90.753  63.829  1.00 91.95  ? 122 LYS E NZ    1 
ATOM 5116 N N     . PHE E 1 48  ? 43.212  91.121  68.473  1.00 65.38  ? 123 PHE E N     1 
ATOM 5117 C CA    . PHE E 1 48  ? 44.106  91.801  69.397  1.00 74.41  ? 123 PHE E CA    1 
ATOM 5118 C C     . PHE E 1 48  ? 45.471  92.154  68.776  1.00 76.78  ? 123 PHE E C     1 
ATOM 5119 O O     . PHE E 1 48  ? 46.170  93.032  69.286  1.00 74.13  ? 123 PHE E O     1 
ATOM 5120 C CB    . PHE E 1 48  ? 44.232  90.923  70.626  1.00 66.96  ? 123 PHE E CB    1 
ATOM 5121 C CG    . PHE E 1 48  ? 45.352  91.294  71.547  1.00 64.85  ? 123 PHE E CG    1 
ATOM 5122 C CD1   . PHE E 1 48  ? 45.088  91.908  72.754  1.00 77.02  ? 123 PHE E CD1   1 
ATOM 5123 C CD2   . PHE E 1 48  ? 46.665  90.962  71.251  1.00 64.17  ? 123 PHE E CD2   1 
ATOM 5124 C CE1   . PHE E 1 48  ? 46.117  92.215  73.643  1.00 80.80  ? 123 PHE E CE1   1 
ATOM 5125 C CE2   . PHE E 1 48  ? 47.694  91.269  72.124  1.00 76.73  ? 123 PHE E CE2   1 
ATOM 5126 C CZ    . PHE E 1 48  ? 47.417  91.892  73.330  1.00 83.22  ? 123 PHE E CZ    1 
ATOM 5127 N N     . PHE E 1 49  ? 45.895  91.487  67.711  1.00 77.53  ? 124 PHE E N     1 
ATOM 5128 C CA    . PHE E 1 49  ? 47.192  91.831  67.127  1.00 91.45  ? 124 PHE E CA    1 
ATOM 5129 C C     . PHE E 1 49  ? 47.125  93.002  66.168  1.00 92.72  ? 124 PHE E C     1 
ATOM 5130 O O     . PHE E 1 49  ? 48.097  93.767  66.049  1.00 88.60  ? 124 PHE E O     1 
ATOM 5131 C CB    . PHE E 1 49  ? 47.793  90.626  66.415  1.00 91.36  ? 124 PHE E CB    1 
ATOM 5132 C CG    . PHE E 1 49  ? 48.489  89.718  67.340  1.00 96.48  ? 124 PHE E CG    1 
ATOM 5133 C CD1   . PHE E 1 49  ? 48.996  88.515  66.919  1.00 103.30 ? 124 PHE E CD1   1 
ATOM 5134 C CD2   . PHE E 1 49  ? 48.621  90.077  68.670  1.00 97.51  ? 124 PHE E CD2   1 
ATOM 5135 C CE1   . PHE E 1 49  ? 49.627  87.682  67.812  1.00 97.87  ? 124 PHE E CE1   1 
ATOM 5136 C CE2   . PHE E 1 49  ? 49.249  89.258  69.562  1.00 99.80  ? 124 PHE E CE2   1 
ATOM 5137 C CZ    . PHE E 1 49  ? 49.753  88.056  69.132  1.00 107.34 ? 124 PHE E CZ    1 
ATOM 5138 N N     . ILE E 1 50  ? 46.026  93.094  65.424  1.00 86.80  ? 125 ILE E N     1 
ATOM 5139 C CA    . ILE E 1 50  ? 45.732  94.299  64.659  1.00 99.16  ? 125 ILE E CA    1 
ATOM 5140 C C     . ILE E 1 50  ? 45.555  95.487  65.609  1.00 98.14  ? 125 ILE E C     1 
ATOM 5141 O O     . ILE E 1 50  ? 46.282  96.487  65.529  1.00 85.16  ? 125 ILE E O     1 
ATOM 5142 C CB    . ILE E 1 50  ? 44.497  94.067  63.771  1.00 94.84  ? 125 ILE E CB    1 
ATOM 5143 C CG1   . ILE E 1 50  ? 44.457  92.618  63.287  1.00 89.08  ? 125 ILE E CG1   1 
ATOM 5144 C CG2   . ILE E 1 50  ? 44.527  94.953  62.554  1.00 112.13 ? 125 ILE E CG2   1 
ATOM 5145 C CD1   . ILE E 1 50  ? 43.541  92.389  62.056  1.00 86.01  ? 125 ILE E CD1   1 
ATOM 5146 N N     . LYS E 1 51  ? 44.612  95.370  66.560  1.00 87.32  ? 126 LYS E N     1 
ATOM 5147 C CA    . LYS E 1 51  ? 44.444  96.405  67.578  1.00 79.09  ? 126 LYS E CA    1 
ATOM 5148 C C     . LYS E 1 51  ? 45.759  96.725  68.266  1.00 90.79  ? 126 LYS E C     1 
ATOM 5149 O O     . LYS E 1 51  ? 46.008  97.884  68.604  1.00 98.43  ? 126 LYS E O     1 
ATOM 5150 C CB    . LYS E 1 51  ? 43.386  95.994  68.612  1.00 75.52  ? 126 LYS E CB    1 
ATOM 5151 C CG    . LYS E 1 51  ? 43.552  96.612  70.015  1.00 76.76  ? 126 LYS E CG    1 
ATOM 5152 C CD    . LYS E 1 51  ? 42.298  96.399  70.884  1.00 79.50  ? 126 LYS E CD    1 
ATOM 5153 C CE    . LYS E 1 51  ? 42.531  96.606  72.401  1.00 86.17  ? 126 LYS E CE    1 
ATOM 5154 N NZ    . LYS E 1 51  ? 43.622  95.770  73.031  1.00 83.39  ? 126 LYS E NZ    1 
ATOM 5155 N N     . VAL E 1 52  ? 46.632  95.734  68.450  1.00 99.97  ? 127 VAL E N     1 
ATOM 5156 C CA    . VAL E 1 52  ? 47.912  96.071  69.054  1.00 98.03  ? 127 VAL E CA    1 
ATOM 5157 C C     . VAL E 1 52  ? 48.828  96.744  68.052  1.00 86.69  ? 127 VAL E C     1 
ATOM 5158 O O     . VAL E 1 52  ? 49.738  97.475  68.451  1.00 76.27  ? 127 VAL E O     1 
ATOM 5159 C CB    . VAL E 1 52  ? 48.601  94.850  69.657  1.00 81.79  ? 127 VAL E CB    1 
ATOM 5160 C CG1   . VAL E 1 52  ? 49.476  94.208  68.615  1.00 65.80  ? 127 VAL E CG1   1 
ATOM 5161 C CG2   . VAL E 1 52  ? 49.409  95.299  70.852  1.00 84.80  ? 127 VAL E CG2   1 
ATOM 5162 N N     . GLY E 1 53  ? 48.608  96.527  66.754  1.00 80.98  ? 128 GLY E N     1 
ATOM 5163 C CA    . GLY E 1 53  ? 49.344  97.285  65.762  1.00 84.95  ? 128 GLY E CA    1 
ATOM 5164 C C     . GLY E 1 53  ? 48.861  98.714  65.604  1.00 101.95 ? 128 GLY E C     1 
ATOM 5165 O O     . GLY E 1 53  ? 49.651  99.605  65.276  1.00 92.64  ? 128 GLY E O     1 
ATOM 5166 N N     . ALA E 1 54  ? 47.561  98.953  65.789  1.00 97.36  ? 129 ALA E N     1 
ATOM 5167 C CA    . ALA E 1 54  ? 47.070  100.320 65.795  1.00 79.83  ? 129 ALA E CA    1 
ATOM 5168 C C     . ALA E 1 54  ? 47.870  101.087 66.837  1.00 92.98  ? 129 ALA E C     1 
ATOM 5169 O O     . ALA E 1 54  ? 48.728  101.893 66.469  1.00 101.23 ? 129 ALA E O     1 
ATOM 5170 C CB    . ALA E 1 54  ? 45.569  100.369 66.072  1.00 79.18  ? 129 ALA E CB    1 
ATOM 5171 N N     . GLU E 1 55  ? 47.681  100.768 68.123  1.00 89.09  ? 130 GLU E N     1 
ATOM 5172 C CA    . GLU E 1 55  ? 48.249  101.580 69.201  1.00 83.87  ? 130 GLU E CA    1 
ATOM 5173 C C     . GLU E 1 55  ? 49.774  101.767 69.083  1.00 88.92  ? 130 GLU E C     1 
ATOM 5174 O O     . GLU E 1 55  ? 50.272  102.880 69.279  1.00 104.37 ? 130 GLU E O     1 
ATOM 5175 C CB    . GLU E 1 55  ? 47.853  101.000 70.571  1.00 79.41  ? 130 GLU E CB    1 
ATOM 5176 C CG    . GLU E 1 55  ? 47.621  99.476  70.575  1.00 114.45 ? 130 GLU E CG    1 
ATOM 5177 C CD    . GLU E 1 55  ? 46.717  98.966  71.722  1.00 129.40 ? 130 GLU E CD    1 
ATOM 5178 O OE1   . GLU E 1 55  ? 46.440  97.717  71.794  1.00 107.89 ? 130 GLU E OE1   1 
ATOM 5179 O OE2   . GLU E 1 55  ? 46.291  99.819  72.541  1.00 124.59 ? 130 GLU E OE2   1 
ATOM 5180 N N     . TYR E 1 56  ? 50.548  100.699 68.827  1.00 89.95  ? 131 TYR E N     1 
ATOM 5181 C CA    . TYR E 1 56  ? 52.011  100.834 68.739  1.00 84.20  ? 131 TYR E CA    1 
ATOM 5182 C C     . TYR E 1 56  ? 52.620  100.770 67.336  1.00 81.52  ? 131 TYR E C     1 
ATOM 5183 O O     . TYR E 1 56  ? 53.844  100.912 67.227  1.00 92.13  ? 131 TYR E O     1 
ATOM 5184 C CB    . TYR E 1 56  ? 52.726  99.794  69.604  1.00 79.69  ? 131 TYR E CB    1 
ATOM 5185 C CG    . TYR E 1 56  ? 52.269  99.701  71.032  1.00 81.98  ? 131 TYR E CG    1 
ATOM 5186 C CD1   . TYR E 1 56  ? 50.967  99.323  71.337  1.00 76.25  ? 131 TYR E CD1   1 
ATOM 5187 C CD2   . TYR E 1 56  ? 53.157  99.922  72.080  1.00 80.97  ? 131 TYR E CD2   1 
ATOM 5188 C CE1   . TYR E 1 56  ? 50.538  99.210  72.629  1.00 80.09  ? 131 TYR E CE1   1 
ATOM 5189 C CE2   . TYR E 1 56  ? 52.741  99.798  73.399  1.00 77.19  ? 131 TYR E CE2   1 
ATOM 5190 C CZ    . TYR E 1 56  ? 51.422  99.429  73.667  1.00 85.92  ? 131 TYR E CZ    1 
ATOM 5191 O OH    . TYR E 1 56  ? 50.966  99.290  74.966  1.00 72.44  ? 131 TYR E OH    1 
ATOM 5192 N N     . GLY E 1 57  ? 51.840  100.514 66.271  1.00 75.87  ? 132 GLY E N     1 
ATOM 5193 C CA    . GLY E 1 57  ? 52.341  100.659 64.904  1.00 90.60  ? 132 GLY E CA    1 
ATOM 5194 C C     . GLY E 1 57  ? 53.225  99.538  64.356  1.00 96.95  ? 132 GLY E C     1 
ATOM 5195 O O     . GLY E 1 57  ? 53.662  98.642  65.069  1.00 112.82 ? 132 GLY E O     1 
ATOM 5196 N N     . GLU E 1 58  ? 53.568  99.665  63.058  1.00 105.30 ? 133 GLU E N     1 
ATOM 5197 C CA    . GLU E 1 58  ? 54.222  98.608  62.267  1.00 108.42 ? 133 GLU E CA    1 
ATOM 5198 C C     . GLU E 1 58  ? 55.499  98.056  62.907  1.00 107.99 ? 133 GLU E C     1 
ATOM 5199 O O     . GLU E 1 58  ? 55.973  96.996  62.486  1.00 101.54 ? 133 GLU E O     1 
ATOM 5200 C CB    . GLU E 1 58  ? 54.556  99.129  60.843  1.00 111.99 ? 133 GLU E CB    1 
ATOM 5201 C CG    . GLU E 1 58  ? 54.907  98.060  59.749  1.00 112.77 ? 133 GLU E CG    1 
ATOM 5202 C CD    . GLU E 1 58  ? 55.582  98.644  58.465  1.00 129.19 ? 133 GLU E CD    1 
ATOM 5203 O OE1   . GLU E 1 58  ? 56.321  99.658  58.568  1.00 120.30 ? 133 GLU E OE1   1 
ATOM 5204 O OE2   . GLU E 1 58  ? 55.383  98.078  57.353  1.00 104.39 ? 133 GLU E OE2   1 
ATOM 5205 N N     . HIS E 1 59  ? 56.093  98.755  63.879  1.00 121.51 ? 134 HIS E N     1 
ATOM 5206 C CA    . HIS E 1 59  ? 57.338  98.311  64.515  1.00 126.77 ? 134 HIS E CA    1 
ATOM 5207 C C     . HIS E 1 59  ? 57.094  97.991  65.988  1.00 120.21 ? 134 HIS E C     1 
ATOM 5208 O O     . HIS E 1 59  ? 57.084  98.892  66.838  1.00 109.54 ? 134 HIS E O     1 
ATOM 5209 C CB    . HIS E 1 59  ? 58.417  99.383  64.358  1.00 129.91 ? 134 HIS E CB    1 
ATOM 5210 C CG    . HIS E 1 59  ? 58.802  99.629  62.936  1.00 122.59 ? 134 HIS E CG    1 
ATOM 5211 N ND1   . HIS E 1 59  ? 59.876  99.007  62.339  1.00 124.29 ? 134 HIS E ND1   1 
ATOM 5212 C CD2   . HIS E 1 59  ? 58.231  100.399 61.978  1.00 108.72 ? 134 HIS E CD2   1 
ATOM 5213 C CE1   . HIS E 1 59  ? 59.962  99.397  61.079  1.00 120.92 ? 134 HIS E CE1   1 
ATOM 5214 N NE2   . HIS E 1 59  ? 58.972  100.236 60.834  1.00 109.30 ? 134 HIS E NE2   1 
ATOM 5215 N N     . VAL E 1 60  ? 57.014  96.694  66.301  1.00 126.19 ? 135 VAL E N     1 
ATOM 5216 C CA    . VAL E 1 60  ? 56.802  96.225  67.665  1.00 118.63 ? 135 VAL E CA    1 
ATOM 5217 C C     . VAL E 1 60  ? 57.796  95.125  67.983  1.00 110.76 ? 135 VAL E C     1 
ATOM 5218 O O     . VAL E 1 60  ? 58.261  94.396  67.096  1.00 93.27  ? 135 VAL E O     1 
ATOM 5219 C CB    . VAL E 1 60  ? 55.381  95.694  67.910  1.00 100.56 ? 135 VAL E CB    1 
ATOM 5220 C CG1   . VAL E 1 60  ? 54.966  95.983  69.342  1.00 102.57 ? 135 VAL E CG1   1 
ATOM 5221 C CG2   . VAL E 1 60  ? 54.425  96.274  66.924  1.00 94.89  ? 135 VAL E CG2   1 
ATOM 5222 N N     . ASN E 1 61  ? 58.081  94.979  69.277  1.00 104.75 ? 136 ASN E N     1 
ATOM 5223 C CA    . ASN E 1 61  ? 59.033  93.976  69.739  1.00 117.91 ? 136 ASN E CA    1 
ATOM 5224 C C     . ASN E 1 61  ? 58.230  92.720  70.042  1.00 121.87 ? 136 ASN E C     1 
ATOM 5225 O O     . ASN E 1 61  ? 57.651  92.564  71.127  1.00 109.21 ? 136 ASN E O     1 
ATOM 5226 C CB    . ASN E 1 61  ? 59.791  94.504  70.952  1.00 125.38 ? 136 ASN E CB    1 
ATOM 5227 C CG    . ASN E 1 61  ? 60.502  93.419  71.736  1.00 127.26 ? 136 ASN E CG    1 
ATOM 5228 O OD1   . ASN E 1 61  ? 60.606  92.261  71.314  1.00 110.95 ? 136 ASN E OD1   1 
ATOM 5229 N ND2   . ASN E 1 61  ? 61.008  93.803  72.902  1.00 138.02 ? 136 ASN E ND2   1 
ATOM 5230 N N     . VAL E 1 62  ? 58.297  91.777  69.106  1.00 112.53 ? 137 VAL E N     1 
ATOM 5231 C CA    . VAL E 1 62  ? 57.363  90.666  69.113  1.00 99.24  ? 137 VAL E CA    1 
ATOM 5232 C C     . VAL E 1 62  ? 57.827  89.625  70.118  1.00 103.00 ? 137 VAL E C     1 
ATOM 5233 O O     . VAL E 1 62  ? 57.049  89.152  70.950  1.00 98.71  ? 137 VAL E O     1 
ATOM 5234 C CB    . VAL E 1 62  ? 57.223  90.119  67.672  1.00 92.74  ? 137 VAL E CB    1 
ATOM 5235 C CG1   . VAL E 1 62  ? 55.935  90.618  66.973  1.00 55.36  ? 137 VAL E CG1   1 
ATOM 5236 C CG2   . VAL E 1 62  ? 58.372  90.610  66.835  1.00 92.62  ? 137 VAL E CG2   1 
ATOM 5237 N N     . GLU E 1 63  ? 59.130  89.357  70.140  1.00 103.66 ? 138 GLU E N     1 
ATOM 5238 C CA    . GLU E 1 63  ? 59.666  88.205  70.857  1.00 98.17  ? 138 GLU E CA    1 
ATOM 5239 C C     . GLU E 1 63  ? 59.551  88.366  72.367  1.00 105.51 ? 138 GLU E C     1 
ATOM 5240 O O     . GLU E 1 63  ? 59.519  87.366  73.103  1.00 120.74 ? 138 GLU E O     1 
ATOM 5241 C CB    . GLU E 1 63  ? 61.121  87.974  70.437  1.00 91.59  ? 138 GLU E CB    1 
ATOM 5242 C CG    . GLU E 1 63  ? 61.329  87.765  68.913  1.00 94.53  ? 138 GLU E CG    1 
ATOM 5243 C CD    . GLU E 1 63  ? 61.128  89.037  68.055  1.00 130.73 ? 138 GLU E CD    1 
ATOM 5244 O OE1   . GLU E 1 63  ? 60.644  90.065  68.586  1.00 134.55 ? 138 GLU E OE1   1 
ATOM 5245 O OE2   . GLU E 1 63  ? 61.457  89.013  66.844  1.00 130.98 ? 138 GLU E OE2   1 
ATOM 5246 N N     . GLU E 1 64  ? 59.506  89.599  72.858  1.00 93.57  ? 139 GLU E N     1 
ATOM 5247 C CA    . GLU E 1 64  ? 59.109  89.757  74.243  1.00 104.76 ? 139 GLU E CA    1 
ATOM 5248 C C     . GLU E 1 64  ? 57.612  89.717  74.369  1.00 103.36 ? 139 GLU E C     1 
ATOM 5249 O O     . GLU E 1 64  ? 57.101  89.378  75.448  1.00 96.58  ? 139 GLU E O     1 
ATOM 5250 C CB    . GLU E 1 64  ? 59.617  91.071  74.825  1.00 128.07 ? 139 GLU E CB    1 
ATOM 5251 C CG    . GLU E 1 64  ? 60.971  90.995  75.491  1.00 135.88 ? 139 GLU E CG    1 
ATOM 5252 C CD    . GLU E 1 64  ? 61.292  92.254  76.287  1.00 159.63 ? 139 GLU E CD    1 
ATOM 5253 O OE1   . GLU E 1 64  ? 62.134  92.172  77.208  1.00 180.64 ? 139 GLU E OE1   1 
ATOM 5254 O OE2   . GLU E 1 64  ? 60.698  93.322  76.000  1.00 148.97 ? 139 GLU E OE2   1 
ATOM 5255 N N     . LEU E 1 65  ? 56.911  90.002  73.265  1.00 95.54  ? 140 LEU E N     1 
ATOM 5256 C CA    . LEU E 1 65  ? 55.471  90.196  73.329  1.00 99.28  ? 140 LEU E CA    1 
ATOM 5257 C C     . LEU E 1 65  ? 54.813  88.855  73.573  1.00 96.21  ? 140 LEU E C     1 
ATOM 5258 O O     . LEU E 1 65  ? 54.360  88.573  74.695  1.00 97.09  ? 140 LEU E O     1 
ATOM 5259 C CB    . LEU E 1 65  ? 54.919  90.826  72.034  1.00 81.91  ? 140 LEU E CB    1 
ATOM 5260 C CG    . LEU E 1 65  ? 53.380  90.902  71.893  1.00 68.35  ? 140 LEU E CG    1 
ATOM 5261 C CD1   . LEU E 1 65  ? 52.745  91.296  73.218  1.00 87.56  ? 140 LEU E CD1   1 
ATOM 5262 C CD2   . LEU E 1 65  ? 52.868  91.844  70.779  1.00 52.86  ? 140 LEU E CD2   1 
ATOM 5263 N N     . LEU E 1 66  ? 54.817  88.018  72.544  1.00 77.48  ? 141 LEU E N     1 
ATOM 5264 C CA    . LEU E 1 66  ? 54.116  86.761  72.617  1.00 63.10  ? 141 LEU E CA    1 
ATOM 5265 C C     . LEU E 1 66  ? 54.783  85.885  73.666  1.00 69.82  ? 141 LEU E C     1 
ATOM 5266 O O     . LEU E 1 66  ? 56.024  85.833  73.742  1.00 73.30  ? 141 LEU E O     1 
ATOM 5267 C CB    . LEU E 1 66  ? 54.110  86.092  71.262  1.00 71.99  ? 141 LEU E CB    1 
ATOM 5268 C CG    . LEU E 1 66  ? 53.667  86.952  70.071  1.00 75.35  ? 141 LEU E CG    1 
ATOM 5269 C CD1   . LEU E 1 66  ? 54.816  87.329  69.101  1.00 74.63  ? 141 LEU E CD1   1 
ATOM 5270 C CD2   . LEU E 1 66  ? 52.575  86.243  69.323  1.00 64.21  ? 141 LEU E CD2   1 
ATOM 5271 N N     . PRO E 1 67  ? 54.007  85.240  74.522  1.00 61.60  ? 142 PRO E N     1 
ATOM 5272 C CA    . PRO E 1 67  ? 54.588  84.525  75.666  1.00 73.40  ? 142 PRO E CA    1 
ATOM 5273 C C     . PRO E 1 67  ? 55.264  83.227  75.258  1.00 90.35  ? 142 PRO E C     1 
ATOM 5274 O O     . PRO E 1 67  ? 55.107  82.697  74.145  1.00 68.23  ? 142 PRO E O     1 
ATOM 5275 C CB    . PRO E 1 67  ? 53.394  84.247  76.583  1.00 58.11  ? 142 PRO E CB    1 
ATOM 5276 C CG    . PRO E 1 67  ? 52.180  84.361  75.681  1.00 71.06  ? 142 PRO E CG    1 
ATOM 5277 C CD    . PRO E 1 67  ? 52.537  85.227  74.497  1.00 61.07  ? 142 PRO E CD    1 
ATOM 5278 N N     . SER E 1 68  ? 56.057  82.739  76.201  1.00 84.08  ? 143 SER E N     1 
ATOM 5279 C CA    . SER E 1 68  ? 56.723  81.481  76.022  1.00 49.94  ? 143 SER E CA    1 
ATOM 5280 C C     . SER E 1 68  ? 55.685  80.384  76.172  1.00 75.43  ? 143 SER E C     1 
ATOM 5281 O O     . SER E 1 68  ? 54.803  80.494  77.026  1.00 83.78  ? 143 SER E O     1 
ATOM 5282 C CB    . SER E 1 68  ? 57.797  81.322  77.072  1.00 54.31  ? 143 SER E CB    1 
ATOM 5283 O OG    . SER E 1 68  ? 57.140  81.207  78.327  1.00 62.16  ? 143 SER E OG    1 
ATOM 5284 N N     . PRO E 1 69  ? 55.743  79.338  75.347  1.00 81.87  ? 144 PRO E N     1 
ATOM 5285 C CA    . PRO E 1 69  ? 54.790  78.234  75.506  1.00 58.12  ? 144 PRO E CA    1 
ATOM 5286 C C     . PRO E 1 69  ? 54.648  77.729  76.938  1.00 64.83  ? 144 PRO E C     1 
ATOM 5287 O O     . PRO E 1 69  ? 53.560  77.276  77.297  1.00 73.11  ? 144 PRO E O     1 
ATOM 5288 C CB    . PRO E 1 69  ? 55.361  77.173  74.578  1.00 68.16  ? 144 PRO E CB    1 
ATOM 5289 C CG    . PRO E 1 69  ? 56.525  77.884  73.808  1.00 57.36  ? 144 PRO E CG    1 
ATOM 5290 C CD    . PRO E 1 69  ? 56.448  79.277  74.055  1.00 64.62  ? 144 PRO E CD    1 
ATOM 5291 N N     . ILE E 1 70  ? 55.657  77.852  77.803  1.00 62.39  ? 145 ILE E N     1 
ATOM 5292 C CA    . ILE E 1 70  ? 55.424  77.412  79.185  1.00 72.74  ? 145 ILE E CA    1 
ATOM 5293 C C     . ILE E 1 70  ? 54.557  78.385  79.988  1.00 72.02  ? 145 ILE E C     1 
ATOM 5294 O O     . ILE E 1 70  ? 53.886  77.986  80.960  1.00 61.68  ? 145 ILE E O     1 
ATOM 5295 C CB    . ILE E 1 70  ? 56.755  77.160  79.895  1.00 52.60  ? 145 ILE E CB    1 
ATOM 5296 C CG1   . ILE E 1 70  ? 56.535  76.996  81.401  1.00 19.08  ? 145 ILE E CG1   1 
ATOM 5297 C CG2   . ILE E 1 70  ? 57.753  78.178  79.473  1.00 50.03  ? 145 ILE E CG2   1 
ATOM 5298 C CD1   . ILE E 1 70  ? 57.732  76.276  82.064  1.00 40.00  ? 145 ILE E CD1   1 
ATOM 5299 N N     . THR E 1 71  ? 54.556  79.671  79.645  1.00 77.97  ? 146 THR E N     1 
ATOM 5300 C CA    . THR E 1 71  ? 53.665  80.531  80.415  1.00 80.88  ? 146 THR E CA    1 
ATOM 5301 C C     . THR E 1 71  ? 52.225  80.233  80.041  1.00 75.85  ? 146 THR E C     1 
ATOM 5302 O O     . THR E 1 71  ? 51.368  80.119  80.925  1.00 78.65  ? 146 THR E O     1 
ATOM 5303 C CB    . THR E 1 71  ? 54.024  82.036  80.291  1.00 81.32  ? 146 THR E CB    1 
ATOM 5304 O OG1   . THR E 1 71  ? 54.560  82.389  78.997  1.00 73.18  ? 146 THR E OG1   1 
ATOM 5305 C CG2   . THR E 1 71  ? 55.034  82.415  81.413  1.00 73.18  ? 146 THR E CG2   1 
ATOM 5306 N N     . LEU E 1 72  ? 51.964  79.982  78.751  1.00 66.43  ? 147 LEU E N     1 
ATOM 5307 C CA    . LEU E 1 72  ? 50.603  79.643  78.352  1.00 64.05  ? 147 LEU E CA    1 
ATOM 5308 C C     . LEU E 1 72  ? 50.130  78.350  78.990  1.00 75.54  ? 147 LEU E C     1 
ATOM 5309 O O     . LEU E 1 72  ? 48.935  78.212  79.259  1.00 74.21  ? 147 LEU E O     1 
ATOM 5310 C CB    . LEU E 1 72  ? 50.470  79.506  76.859  1.00 39.26  ? 147 LEU E CB    1 
ATOM 5311 C CG    . LEU E 1 72  ? 50.776  80.639  75.912  1.00 60.96  ? 147 LEU E CG    1 
ATOM 5312 C CD1   . LEU E 1 72  ? 51.866  80.248  74.906  1.00 53.35  ? 147 LEU E CD1   1 
ATOM 5313 C CD2   . LEU E 1 72  ? 49.499  80.959  75.188  1.00 64.87  ? 147 LEU E CD2   1 
ATOM 5314 N N     . SER E 1 73  ? 51.017  77.372  79.215  1.00 68.96  ? 148 SER E N     1 
ATOM 5315 C CA    . SER E 1 73  ? 50.588  76.290  80.090  1.00 72.82  ? 148 SER E CA    1 
ATOM 5316 C C     . SER E 1 73  ? 50.380  76.825  81.474  1.00 77.16  ? 148 SER E C     1 
ATOM 5317 O O     . SER E 1 73  ? 49.395  76.487  82.140  1.00 80.37  ? 148 SER E O     1 
ATOM 5318 C CB    . SER E 1 73  ? 51.589  75.153  80.201  1.00 76.12  ? 148 SER E CB    1 
ATOM 5319 O OG    . SER E 1 73  ? 51.342  74.515  81.473  1.00 76.45  ? 148 SER E OG    1 
ATOM 5320 N N     . ARG E 1 74  ? 51.335  77.638  81.930  1.00 69.34  ? 149 ARG E N     1 
ATOM 5321 C CA    . ARG E 1 74  ? 51.331  78.021  83.328  1.00 86.24  ? 149 ARG E CA    1 
ATOM 5322 C C     . ARG E 1 74  ? 50.094  78.853  83.623  1.00 86.97  ? 149 ARG E C     1 
ATOM 5323 O O     . ARG E 1 74  ? 49.376  78.584  84.601  1.00 67.57  ? 149 ARG E O     1 
ATOM 5324 C CB    . ARG E 1 74  ? 52.662  78.706  83.683  1.00 62.47  ? 149 ARG E CB    1 
ATOM 5325 C CG    . ARG E 1 74  ? 53.639  77.646  84.331  1.00 88.10  ? 149 ARG E CG    1 
ATOM 5326 C CD    . ARG E 1 74  ? 55.059  78.081  84.815  1.00 44.89  ? 149 ARG E CD    1 
ATOM 5327 N NE    . ARG E 1 74  ? 55.589  79.178  84.013  1.00 59.61  ? 149 ARG E NE    1 
ATOM 5328 C CZ    . ARG E 1 74  ? 56.886  79.458  83.831  1.00 61.66  ? 149 ARG E CZ    1 
ATOM 5329 N NH1   . ARG E 1 74  ? 57.844  78.677  84.353  1.00 30.48  ? 149 ARG E NH1   1 
ATOM 5330 N NH2   . ARG E 1 74  ? 57.221  80.532  83.087  1.00 59.88  ? 149 ARG E NH2   1 
ATOM 5331 N N     . LYS E 1 75  ? 49.761  79.772  82.708  1.00 84.85  ? 150 LYS E N     1 
ATOM 5332 C CA    . LYS E 1 75  ? 48.459  80.423  82.729  1.00 91.38  ? 150 LYS E CA    1 
ATOM 5333 C C     . LYS E 1 75  ? 47.348  79.393  82.685  1.00 84.06  ? 150 LYS E C     1 
ATOM 5334 O O     . LYS E 1 75  ? 46.691  79.151  83.697  1.00 84.29  ? 150 LYS E O     1 
ATOM 5335 C CB    . LYS E 1 75  ? 48.257  81.388  81.560  1.00 85.75  ? 150 LYS E CB    1 
ATOM 5336 C CG    . LYS E 1 75  ? 46.760  81.800  81.444  1.00 91.89  ? 150 LYS E CG    1 
ATOM 5337 C CD    . LYS E 1 75  ? 46.474  83.031  80.549  1.00 105.25 ? 150 LYS E CD    1 
ATOM 5338 C CE    . LYS E 1 75  ? 46.431  84.371  81.318  1.00 104.05 ? 150 LYS E CE    1 
ATOM 5339 N NZ    . LYS E 1 75  ? 45.080  84.892  81.639  1.00 112.88 ? 150 LYS E NZ    1 
ATOM 5340 N N     . VAL E 1 76  ? 47.197  78.727  81.539  1.00 83.12  ? 151 VAL E N     1 
ATOM 5341 C CA    . VAL E 1 76  ? 45.983  77.973  81.227  1.00 89.22  ? 151 VAL E CA    1 
ATOM 5342 C C     . VAL E 1 76  ? 45.552  77.118  82.415  1.00 78.10  ? 151 VAL E C     1 
ATOM 5343 O O     . VAL E 1 76  ? 44.358  76.933  82.673  1.00 65.55  ? 151 VAL E O     1 
ATOM 5344 C CB    . VAL E 1 76  ? 46.238  77.134  79.953  1.00 75.30  ? 151 VAL E CB    1 
ATOM 5345 C CG1   . VAL E 1 76  ? 46.691  75.729  80.322  1.00 74.10  ? 151 VAL E CG1   1 
ATOM 5346 C CG2   . VAL E 1 76  ? 45.053  77.184  78.951  1.00 47.16  ? 151 VAL E CG2   1 
ATOM 5347 N N     . THR E 1 77  ? 46.508  76.657  83.196  1.00 75.08  ? 152 THR E N     1 
ATOM 5348 C CA    . THR E 1 77  ? 46.204  75.920  84.399  1.00 82.89  ? 152 THR E CA    1 
ATOM 5349 C C     . THR E 1 77  ? 45.771  76.807  85.554  1.00 83.03  ? 152 THR E C     1 
ATOM 5350 O O     . THR E 1 77  ? 45.177  76.294  86.513  1.00 79.05  ? 152 THR E O     1 
ATOM 5351 C CB    . THR E 1 77  ? 47.435  75.126  84.796  1.00 105.12 ? 152 THR E CB    1 
ATOM 5352 O OG1   . THR E 1 77  ? 48.050  74.583  83.607  1.00 88.73  ? 152 THR E OG1   1 
ATOM 5353 C CG2   . THR E 1 77  ? 47.041  74.024  85.749  1.00 96.21  ? 152 THR E CG2   1 
ATOM 5354 N N     . SER E 1 78  ? 46.134  78.098  85.524  1.00 93.92  ? 153 SER E N     1 
ATOM 5355 C CA    . SER E 1 78  ? 45.716  79.054  86.557  1.00 93.92  ? 153 SER E CA    1 
ATOM 5356 C C     . SER E 1 78  ? 44.346  79.653  86.274  1.00 79.14  ? 153 SER E C     1 
ATOM 5357 O O     . SER E 1 78  ? 43.531  79.786  87.193  1.00 77.09  ? 153 SER E O     1 
ATOM 5358 C CB    . SER E 1 78  ? 46.755  80.163  86.705  1.00 91.86  ? 153 SER E CB    1 
ATOM 5359 O OG    . SER E 1 78  ? 48.006  79.641  87.157  1.00 109.89 ? 153 SER E OG    1 
ATOM 5360 N N     . ASP E 1 79  ? 44.107  80.040  85.014  1.00 78.69  ? 154 ASP E N     1 
ATOM 5361 C CA    . ASP E 1 79  ? 42.761  80.327  84.517  1.00 67.84  ? 154 ASP E CA    1 
ATOM 5362 C C     . ASP E 1 79  ? 41.804  79.253  84.981  1.00 74.67  ? 154 ASP E C     1 
ATOM 5363 O O     . ASP E 1 79  ? 40.676  79.538  85.390  1.00 79.44  ? 154 ASP E O     1 
ATOM 5364 C CB    . ASP E 1 79  ? 42.765  80.344  82.976  1.00 91.42  ? 154 ASP E CB    1 
ATOM 5365 C CG    . ASP E 1 79  ? 42.278  81.641  82.374  1.00 92.54  ? 154 ASP E CG    1 
ATOM 5366 O OD1   . ASP E 1 79  ? 42.242  82.632  83.114  1.00 99.82  ? 154 ASP E OD1   1 
ATOM 5367 O OD2   . ASP E 1 79  ? 41.963  81.684  81.152  1.00 92.09  ? 154 ASP E OD2   1 
ATOM 5368 N N     . ALA E 1 80  ? 42.251  77.998  84.912  1.00 87.86  ? 155 ALA E N     1 
ATOM 5369 C CA    . ALA E 1 80  ? 41.472  76.872  85.400  1.00 82.75  ? 155 ALA E CA    1 
ATOM 5370 C C     . ALA E 1 80  ? 41.010  77.128  86.817  1.00 75.58  ? 155 ALA E C     1 
ATOM 5371 O O     . ALA E 1 80  ? 39.813  77.100  87.103  1.00 72.11  ? 155 ALA E O     1 
ATOM 5372 C CB    . ALA E 1 80  ? 42.313  75.600  85.335  1.00 84.54  ? 155 ALA E CB    1 
ATOM 5373 N N     . LYS E 1 81  ? 41.965  77.419  87.702  1.00 82.86  ? 156 LYS E N     1 
ATOM 5374 C CA    . LYS E 1 81  ? 41.673  77.695  89.101  1.00 82.02  ? 156 LYS E CA    1 
ATOM 5375 C C     . LYS E 1 81  ? 40.594  78.758  89.250  1.00 86.98  ? 156 LYS E C     1 
ATOM 5376 O O     . LYS E 1 81  ? 39.547  78.519  89.867  1.00 80.08  ? 156 LYS E O     1 
ATOM 5377 C CB    . LYS E 1 81  ? 42.943  78.167  89.814  1.00 83.24  ? 156 LYS E CB    1 
ATOM 5378 C CG    . LYS E 1 81  ? 44.231  77.523  89.355  1.00 104.23 ? 156 LYS E CG    1 
ATOM 5379 C CD    . LYS E 1 81  ? 45.464  78.230  89.931  1.00 102.00 ? 156 LYS E CD    1 
ATOM 5380 C CE    . LYS E 1 81  ? 46.685  77.298  89.969  1.00 104.13 ? 156 LYS E CE    1 
ATOM 5381 N NZ    . LYS E 1 81  ? 47.958  78.069  89.976  1.00 100.20 ? 156 LYS E NZ    1 
ATOM 5382 N N     . GLU E 1 82  ? 40.833  79.952  88.698  1.00 82.03  ? 157 GLU E N     1 
ATOM 5383 C CA    . GLU E 1 82  ? 39.940  81.053  89.021  1.00 89.52  ? 157 GLU E CA    1 
ATOM 5384 C C     . GLU E 1 82  ? 38.537  80.704  88.619  1.00 78.27  ? 157 GLU E C     1 
ATOM 5385 O O     . GLU E 1 82  ? 37.637  80.623  89.455  1.00 93.16  ? 157 GLU E O     1 
ATOM 5386 C CB    . GLU E 1 82  ? 40.325  82.342  88.310  1.00 98.17  ? 157 GLU E CB    1 
ATOM 5387 C CG    . GLU E 1 82  ? 41.668  82.395  87.737  1.00 90.50  ? 157 GLU E CG    1 
ATOM 5388 C CD    . GLU E 1 82  ? 41.643  83.264  86.513  1.00 103.12 ? 157 GLU E CD    1 
ATOM 5389 O OE1   . GLU E 1 82  ? 40.522  83.676  86.090  1.00 85.17  ? 157 GLU E OE1   1 
ATOM 5390 O OE2   . GLU E 1 82  ? 42.736  83.529  85.980  1.00 115.08 ? 157 GLU E OE2   1 
ATOM 5391 N N     . LYS E 1 83  ? 38.350  80.430  87.344  1.00 65.88  ? 158 LYS E N     1 
ATOM 5392 C CA    . LYS E 1 83  ? 37.017  80.085  86.908  1.00 94.84  ? 158 LYS E CA    1 
ATOM 5393 C C     . LYS E 1 83  ? 36.453  78.821  87.576  1.00 98.09  ? 158 LYS E C     1 
ATOM 5394 O O     . LYS E 1 83  ? 35.250  78.579  87.452  1.00 96.08  ? 158 LYS E O     1 
ATOM 5395 C CB    . LYS E 1 83  ? 37.049  79.982  85.400  1.00 79.70  ? 158 LYS E CB    1 
ATOM 5396 C CG    . LYS E 1 83  ? 37.909  81.064  84.830  1.00 72.93  ? 158 LYS E CG    1 
ATOM 5397 C CD    . LYS E 1 83  ? 37.558  81.335  83.391  1.00 81.61  ? 158 LYS E CD    1 
ATOM 5398 C CE    . LYS E 1 83  ? 38.715  82.042  82.704  1.00 94.72  ? 158 LYS E CE    1 
ATOM 5399 N NZ    . LYS E 1 83  ? 39.334  83.031  83.641  1.00 100.37 ? 158 LYS E NZ    1 
ATOM 5400 N N     . LYS E 1 84  ? 37.251  78.024  88.300  1.00 85.80  ? 159 LYS E N     1 
ATOM 5401 C CA    . LYS E 1 84  ? 36.629  76.897  88.990  1.00 83.80  ? 159 LYS E CA    1 
ATOM 5402 C C     . LYS E 1 84  ? 36.032  77.351  90.319  1.00 91.61  ? 159 LYS E C     1 
ATOM 5403 O O     . LYS E 1 84  ? 34.825  77.596  90.379  1.00 98.52  ? 159 LYS E O     1 
ATOM 5404 C CB    . LYS E 1 84  ? 37.608  75.720  89.185  1.00 94.18  ? 159 LYS E CB    1 
ATOM 5405 C CG    . LYS E 1 84  ? 37.597  74.717  87.988  1.00 95.05  ? 159 LYS E CG    1 
ATOM 5406 C CD    . LYS E 1 84  ? 38.283  73.350  88.239  1.00 102.75 ? 159 LYS E CD    1 
ATOM 5407 C CE    . LYS E 1 84  ? 39.816  73.432  88.129  1.00 115.34 ? 159 LYS E CE    1 
ATOM 5408 N NZ    . LYS E 1 84  ? 40.490  72.129  87.857  1.00 119.09 ? 159 LYS E NZ    1 
ATOM 5409 N N     . ALA E 1 85  ? 36.835  77.568  91.364  1.00 98.22  ? 160 ALA E N     1 
ATOM 5410 C CA    . ALA E 1 85  ? 36.225  77.949  92.642  1.00 98.49  ? 160 ALA E CA    1 
ATOM 5411 C C     . ALA E 1 85  ? 35.487  79.293  92.578  1.00 97.87  ? 160 ALA E C     1 
ATOM 5412 O O     . ALA E 1 85  ? 34.842  79.668  93.567  1.00 89.18  ? 160 ALA E O     1 
ATOM 5413 C CB    . ALA E 1 85  ? 37.269  77.978  93.762  1.00 84.60  ? 160 ALA E CB    1 
ATOM 5414 N N     . LEU E 1 86  ? 35.589  80.033  91.461  1.00 88.71  ? 161 LEU E N     1 
ATOM 5415 C CA    . LEU E 1 86  ? 34.636  81.090  91.142  1.00 80.70  ? 161 LEU E CA    1 
ATOM 5416 C C     . LEU E 1 86  ? 33.231  80.517  91.204  1.00 90.14  ? 161 LEU E C     1 
ATOM 5417 O O     . LEU E 1 86  ? 32.492  80.765  92.162  1.00 90.89  ? 161 LEU E O     1 
ATOM 5418 C CB    . LEU E 1 86  ? 34.889  81.673  89.742  1.00 73.08  ? 161 LEU E CB    1 
ATOM 5419 C CG    . LEU E 1 86  ? 34.073  82.862  89.213  1.00 82.31  ? 161 LEU E CG    1 
ATOM 5420 C CD1   . LEU E 1 86  ? 34.801  83.514  88.053  1.00 93.78  ? 161 LEU E CD1   1 
ATOM 5421 C CD2   . LEU E 1 86  ? 32.638  82.557  88.805  1.00 48.17  ? 161 LEU E CD2   1 
ATOM 5422 N N     . ILE E 1 87  ? 32.884  79.695  90.211  1.00 84.34  ? 162 ILE E N     1 
ATOM 5423 C CA    . ILE E 1 87  ? 31.502  79.286  89.978  1.00 79.35  ? 162 ILE E CA    1 
ATOM 5424 C C     . ILE E 1 87  ? 31.061  78.276  91.025  1.00 83.14  ? 162 ILE E C     1 
ATOM 5425 O O     . ILE E 1 87  ? 29.912  77.826  91.002  1.00 91.53  ? 162 ILE E O     1 
ATOM 5426 C CB    . ILE E 1 87  ? 31.290  78.726  88.564  1.00 67.85  ? 162 ILE E CB    1 
ATOM 5427 C CG1   . ILE E 1 87  ? 32.227  79.404  87.590  1.00 80.20  ? 162 ILE E CG1   1 
ATOM 5428 C CG2   . ILE E 1 87  ? 29.903  79.001  88.092  1.00 64.63  ? 162 ILE E CG2   1 
ATOM 5429 C CD1   . ILE E 1 87  ? 32.262  78.725  86.282  1.00 84.60  ? 162 ILE E CD1   1 
ATOM 5430 N N     . SER E 1 88  ? 31.958  77.913  91.949  1.00 80.09  ? 163 SER E N     1 
ATOM 5431 C CA    . SER E 1 88  ? 31.581  77.004  93.034  1.00 102.83 ? 163 SER E CA    1 
ATOM 5432 C C     . SER E 1 88  ? 30.279  77.441  93.700  1.00 109.30 ? 163 SER E C     1 
ATOM 5433 O O     . SER E 1 88  ? 29.530  76.611  94.241  1.00 101.10 ? 163 SER E O     1 
ATOM 5434 C CB    . SER E 1 88  ? 32.707  76.939  94.070  1.00 108.80 ? 163 SER E CB    1 
ATOM 5435 O OG    . SER E 1 88  ? 32.987  78.220  94.607  1.00 117.13 ? 163 SER E OG    1 
ATOM 5436 N N     . ARG E 1 89  ? 29.982  78.736  93.630  1.00 116.71 ? 164 ARG E N     1 
ATOM 5437 C CA    . ARG E 1 89  ? 28.722  79.287  94.091  1.00 117.25 ? 164 ARG E CA    1 
ATOM 5438 C C     . ARG E 1 89  ? 27.616  78.864  93.135  1.00 107.82 ? 164 ARG E C     1 
ATOM 5439 O O     . ARG E 1 89  ? 26.820  77.983  93.467  1.00 107.00 ? 164 ARG E O     1 
ATOM 5440 C CB    . ARG E 1 89  ? 28.832  80.809  94.171  1.00 113.00 ? 164 ARG E CB    1 
ATOM 5441 C CG    . ARG E 1 89  ? 27.712  81.501  94.903  1.00 127.58 ? 164 ARG E CG    1 
ATOM 5442 C CD    . ARG E 1 89  ? 27.567  82.909  94.347  1.00 156.62 ? 164 ARG E CD    1 
ATOM 5443 N NE    . ARG E 1 89  ? 27.257  83.895  95.381  1.00 178.48 ? 164 ARG E NE    1 
ATOM 5444 C CZ    . ARG E 1 89  ? 27.415  85.210  95.237  1.00 182.46 ? 164 ARG E CZ    1 
ATOM 5445 N NH1   . ARG E 1 89  ? 27.889  85.705  94.098  1.00 187.91 ? 164 ARG E NH1   1 
ATOM 5446 N NH2   . ARG E 1 89  ? 27.107  86.035  96.233  1.00 178.99 ? 164 ARG E NH2   1 
ATOM 5447 N N     . GLU E 1 90  ? 27.610  79.423  91.921  1.00 101.96 ? 165 GLU E N     1 
ATOM 5448 C CA    . GLU E 1 90  ? 26.551  79.119  90.965  1.00 94.64  ? 165 GLU E CA    1 
ATOM 5449 C C     . GLU E 1 90  ? 26.353  77.629  90.764  1.00 91.73  ? 165 GLU E C     1 
ATOM 5450 O O     . GLU E 1 90  ? 25.240  77.186  90.458  1.00 91.07  ? 165 GLU E O     1 
ATOM 5451 C CB    . GLU E 1 90  ? 26.859  79.752  89.624  1.00 98.81  ? 165 GLU E CB    1 
ATOM 5452 C CG    . GLU E 1 90  ? 26.098  79.084  88.512  1.00 84.87  ? 165 GLU E CG    1 
ATOM 5453 C CD    . GLU E 1 90  ? 25.954  79.977  87.317  1.00 121.24 ? 165 GLU E CD    1 
ATOM 5454 O OE1   . GLU E 1 90  ? 26.530  81.091  87.340  1.00 126.18 ? 165 GLU E OE1   1 
ATOM 5455 O OE2   . GLU E 1 90  ? 25.261  79.566  86.360  1.00 123.62 ? 165 GLU E OE2   1 
ATOM 5456 N N     . ILE E 1 91  ? 27.426  76.846  90.898  1.00 100.37 ? 166 ILE E N     1 
ATOM 5457 C CA    . ILE E 1 91  ? 27.292  75.390  90.930  1.00 107.73 ? 166 ILE E CA    1 
ATOM 5458 C C     . ILE E 1 91  ? 26.473  74.978  92.145  1.00 107.13 ? 166 ILE E C     1 
ATOM 5459 O O     . ILE E 1 91  ? 25.365  74.438  92.015  1.00 102.48 ? 166 ILE E O     1 
ATOM 5460 C CB    . ILE E 1 91  ? 28.679  74.705  90.946  1.00 113.13 ? 166 ILE E CB    1 
ATOM 5461 C CG1   . ILE E 1 91  ? 29.404  74.776  89.587  1.00 79.54  ? 166 ILE E CG1   1 
ATOM 5462 C CG2   . ILE E 1 91  ? 28.582  73.241  91.438  1.00 101.19 ? 166 ILE E CG2   1 
ATOM 5463 C CD1   . ILE E 1 91  ? 28.550  74.438  88.407  1.00 71.85  ? 166 ILE E CD1   1 
ATOM 5464 N N     . LYS E 1 92  ? 26.988  75.286  93.348  1.00 99.35  ? 167 LYS E N     1 
ATOM 5465 C CA    . LYS E 1 92  ? 26.338  74.851  94.579  1.00 105.77 ? 167 LYS E CA    1 
ATOM 5466 C C     . LYS E 1 92  ? 24.888  75.329  94.631  1.00 115.53 ? 167 LYS E C     1 
ATOM 5467 O O     . LYS E 1 92  ? 24.042  74.702  95.284  1.00 113.44 ? 167 LYS E O     1 
ATOM 5468 C CB    . LYS E 1 92  ? 27.153  75.342  95.782  1.00 98.87  ? 167 LYS E CB    1 
ATOM 5469 C CG    . LYS E 1 92  ? 27.028  74.451  97.012  1.00 113.65 ? 167 LYS E CG    1 
ATOM 5470 C CD    . LYS E 1 92  ? 28.247  74.544  97.950  1.00 125.04 ? 167 LYS E CD    1 
ATOM 5471 C CE    . LYS E 1 92  ? 28.188  73.457  99.049  1.00 116.24 ? 167 LYS E CE    1 
ATOM 5472 N NZ    . LYS E 1 92  ? 29.440  73.341  99.859  1.00 92.13  ? 167 LYS E NZ    1 
ATOM 5473 N N     . SER E 1 93  ? 24.583  76.401  93.901  1.00 112.39 ? 168 SER E N     1 
ATOM 5474 C CA    . SER E 1 93  ? 23.223  76.900  93.810  1.00 95.84  ? 168 SER E CA    1 
ATOM 5475 C C     . SER E 1 93  ? 22.323  75.920  93.098  1.00 94.83  ? 168 SER E C     1 
ATOM 5476 O O     . SER E 1 93  ? 21.129  75.882  93.373  1.00 104.35 ? 168 SER E O     1 
ATOM 5477 C CB    . SER E 1 93  ? 23.219  78.238  93.078  1.00 117.77 ? 168 SER E CB    1 
ATOM 5478 O OG    . SER E 1 93  ? 24.372  79.005  93.412  1.00 115.28 ? 168 SER E OG    1 
ATOM 5479 N N     . ALA E 1 94  ? 22.864  75.147  92.159  1.00 100.31 ? 169 ALA E N     1 
ATOM 5480 C CA    . ALA E 1 94  ? 22.104  74.039  91.596  1.00 92.45  ? 169 ALA E CA    1 
ATOM 5481 C C     . ALA E 1 94  ? 22.125  72.831  92.523  1.00 97.26  ? 169 ALA E C     1 
ATOM 5482 O O     . ALA E 1 94  ? 21.128  72.110  92.625  1.00 94.79  ? 169 ALA E O     1 
ATOM 5483 C CB    . ALA E 1 94  ? 22.661  73.665  90.227  1.00 73.34  ? 169 ALA E CB    1 
ATOM 5484 N N     . VAL E 1 95  ? 23.253  72.600  93.202  1.00 90.27  ? 170 VAL E N     1 
ATOM 5485 C CA    . VAL E 1 95  ? 23.410  71.406  94.031  1.00 90.24  ? 170 VAL E CA    1 
ATOM 5486 C C     . VAL E 1 95  ? 22.384  71.391  95.138  1.00 104.08 ? 170 VAL E C     1 
ATOM 5487 O O     . VAL E 1 95  ? 21.750  70.364  95.407  1.00 114.57 ? 170 VAL E O     1 
ATOM 5488 C CB    . VAL E 1 95  ? 24.819  71.333  94.640  1.00 102.77 ? 170 VAL E CB    1 
ATOM 5489 C CG1   . VAL E 1 95  ? 24.986  70.009  95.423  1.00 77.90  ? 170 VAL E CG1   1 
ATOM 5490 C CG2   . VAL E 1 95  ? 25.886  71.512  93.591  1.00 100.86 ? 170 VAL E CG2   1 
ATOM 5491 N N     . GLU E 1 96  ? 22.277  72.507  95.860  1.00 110.67 ? 171 GLU E N     1 
ATOM 5492 C CA    . GLU E 1 96  ? 21.343  72.600  96.969  1.00 120.26 ? 171 GLU E CA    1 
ATOM 5493 C C     . GLU E 1 96  ? 19.924  72.897  96.505  1.00 114.43 ? 171 GLU E C     1 
ATOM 5494 O O     . GLU E 1 96  ? 18.980  72.596  97.242  1.00 104.04 ? 171 GLU E O     1 
ATOM 5495 C CB    . GLU E 1 96  ? 21.795  73.689  97.941  1.00 137.63 ? 171 GLU E CB    1 
ATOM 5496 C CG    . GLU E 1 96  ? 23.290  73.722  98.253  1.00 138.97 ? 171 GLU E CG    1 
ATOM 5497 C CD    . GLU E 1 96  ? 23.776  75.155  98.457  1.00 137.83 ? 171 GLU E CD    1 
ATOM 5498 O OE1   . GLU E 1 96  ? 23.316  76.028  97.681  1.00 129.27 ? 171 GLU E OE1   1 
ATOM 5499 O OE2   . GLU E 1 96  ? 24.583  75.409  99.391  1.00 114.89 ? 171 GLU E OE2   1 
ATOM 5500 N N     . LYS E 1 97  ? 19.765  73.454  95.291  1.00 113.93 ? 172 LYS E N     1 
ATOM 5501 C CA    . LYS E 1 97  ? 18.494  73.586  94.575  1.00 115.67 ? 172 LYS E CA    1 
ATOM 5502 C C     . LYS E 1 97  ? 17.971  72.245  94.045  1.00 119.80 ? 172 LYS E C     1 
ATOM 5503 O O     . LYS E 1 97  ? 16.912  72.223  93.407  1.00 121.17 ? 172 LYS E O     1 
ATOM 5504 C CB    . LYS E 1 97  ? 18.643  74.581  93.403  1.00 120.20 ? 172 LYS E CB    1 
ATOM 5505 C CG    . LYS E 1 97  ? 17.364  75.297  92.853  1.00 119.04 ? 172 LYS E CG    1 
ATOM 5506 C CD    . LYS E 1 97  ? 17.712  76.400  91.811  1.00 111.41 ? 172 LYS E CD    1 
ATOM 5507 C CE    . LYS E 1 97  ? 16.496  76.846  90.978  1.00 119.91 ? 172 LYS E CE    1 
ATOM 5508 N NZ    . LYS E 1 97  ? 16.864  77.688  89.782  1.00 97.32  ? 172 LYS E NZ    1 
ATOM 5509 N N     . ASP E 1 98  ? 18.713  71.147  94.221  1.00 118.50 ? 173 ASP E N     1 
ATOM 5510 C CA    . ASP E 1 98  ? 18.347  69.777  93.867  1.00 112.12 ? 173 ASP E CA    1 
ATOM 5511 C C     . ASP E 1 98  ? 18.182  69.545  92.375  1.00 121.09 ? 173 ASP E C     1 
ATOM 5512 O O     . ASP E 1 98  ? 17.914  68.406  91.979  1.00 126.91 ? 173 ASP E O     1 
ATOM 5513 C CB    . ASP E 1 98  ? 17.074  69.289  94.563  1.00 96.95  ? 173 ASP E CB    1 
ATOM 5514 C CG    . ASP E 1 98  ? 17.211  67.855  95.035  1.00 123.00 ? 173 ASP E CG    1 
ATOM 5515 O OD1   . ASP E 1 98  ? 17.012  66.923  94.216  1.00 117.37 ? 173 ASP E OD1   1 
ATOM 5516 O OD2   . ASP E 1 98  ? 17.531  67.671  96.232  1.00 133.89 ? 173 ASP E OD2   1 
ATOM 5517 N N     . GLY E 1 99  ? 18.312  70.574  91.537  1.00 122.48 ? 174 GLY E N     1 
ATOM 5518 C CA    . GLY E 1 99  ? 18.034  70.465  90.116  1.00 122.99 ? 174 GLY E CA    1 
ATOM 5519 C C     . GLY E 1 99  ? 19.249  70.221  89.242  1.00 115.45 ? 174 GLY E C     1 
ATOM 5520 O O     . GLY E 1 99  ? 19.232  70.520  88.042  1.00 109.42 ? 174 GLY E O     1 
ATOM 5521 N N     . ALA E 1 100 ? 20.308  69.674  89.835  1.00 116.25 ? 175 ALA E N     1 
ATOM 5522 C CA    . ALA E 1 100 ? 21.548  69.384  89.131  1.00 110.44 ? 175 ALA E CA    1 
ATOM 5523 C C     . ALA E 1 100 ? 21.638  67.907  88.778  1.00 114.20 ? 175 ALA E C     1 
ATOM 5524 O O     . ALA E 1 100 ? 21.176  67.040  89.532  1.00 109.46 ? 175 ALA E O     1 
ATOM 5525 C CB    . ALA E 1 100 ? 22.763  69.776  89.971  1.00 104.38 ? 175 ALA E CB    1 
ATOM 5526 N N     . SER E 1 101 ? 22.245  67.638  87.612  1.00 96.84  ? 176 SER E N     1 
ATOM 5527 C CA    . SER E 1 101 ? 22.537  66.295  87.129  1.00 99.01  ? 176 SER E CA    1 
ATOM 5528 C C     . SER E 1 101 ? 24.041  66.136  86.916  1.00 99.89  ? 176 SER E C     1 
ATOM 5529 O O     . SER E 1 101 ? 24.755  67.123  86.700  1.00 82.56  ? 176 SER E O     1 
ATOM 5530 C CB    . SER E 1 101 ? 21.792  66.012  85.817  1.00 91.27  ? 176 SER E CB    1 
ATOM 5531 O OG    . SER E 1 101 ? 20.557  66.711  85.776  1.00 101.72 ? 176 SER E OG    1 
ATOM 5532 N N     . ALA E 1 102 ? 24.519  64.882  86.999  1.00 99.59  ? 177 ALA E N     1 
ATOM 5533 C CA    . ALA E 1 102 ? 25.921  64.550  86.748  1.00 77.43  ? 177 ALA E CA    1 
ATOM 5534 C C     . ALA E 1 102 ? 26.078  63.175  86.089  1.00 84.23  ? 177 ALA E C     1 
ATOM 5535 O O     . ALA E 1 102 ? 25.470  62.189  86.534  1.00 69.97  ? 177 ALA E O     1 
ATOM 5536 C CB    . ALA E 1 102 ? 26.723  64.613  88.053  1.00 76.37  ? 177 ALA E CB    1 
ATOM 5537 N N     . THR E 1 103 ? 26.932  63.114  85.057  1.00 81.10  ? 178 THR E N     1 
ATOM 5538 C CA    . THR E 1 103 ? 27.269  61.894  84.322  1.00 62.57  ? 178 THR E CA    1 
ATOM 5539 C C     . THR E 1 103 ? 28.718  61.536  84.587  1.00 63.27  ? 178 THR E C     1 
ATOM 5540 O O     . THR E 1 103 ? 29.584  62.414  84.461  1.00 59.86  ? 178 THR E O     1 
ATOM 5541 C CB    . THR E 1 103 ? 27.087  62.117  82.827  1.00 64.25  ? 178 THR E CB    1 
ATOM 5542 O OG1   . THR E 1 103 ? 25.704  62.002  82.502  1.00 75.20  ? 178 THR E OG1   1 
ATOM 5543 C CG2   . THR E 1 103 ? 27.880  61.123  82.016  1.00 56.17  ? 178 THR E CG2   1 
ATOM 5544 N N     . ILE E 1 104 ? 28.995  60.255  84.955  1.00 53.85  ? 179 ILE E N     1 
ATOM 5545 C CA    . ILE E 1 104 ? 30.382  59.801  85.142  1.00 61.10  ? 179 ILE E CA    1 
ATOM 5546 C C     . ILE E 1 104 ? 30.676  58.470  84.437  1.00 62.11  ? 179 ILE E C     1 
ATOM 5547 O O     . ILE E 1 104 ? 29.777  57.661  84.190  1.00 68.83  ? 179 ILE E O     1 
ATOM 5548 C CB    . ILE E 1 104 ? 30.747  59.699  86.626  1.00 44.69  ? 179 ILE E CB    1 
ATOM 5549 C CG1   . ILE E 1 104 ? 30.446  58.331  87.142  1.00 58.31  ? 179 ILE E CG1   1 
ATOM 5550 C CG2   . ILE E 1 104 ? 29.858  60.516  87.434  1.00 50.22  ? 179 ILE E CG2   1 
ATOM 5551 C CD1   . ILE E 1 104 ? 31.237  58.049  88.385  1.00 78.89  ? 179 ILE E CD1   1 
ATOM 5552 N N     . ASP E 1 105 ? 31.952  58.265  84.077  1.00 56.20  ? 180 ASP E N     1 
ATOM 5553 C CA    . ASP E 1 105 ? 32.453  57.034  83.440  1.00 54.43  ? 180 ASP E CA    1 
ATOM 5554 C C     . ASP E 1 105 ? 33.975  57.020  83.593  1.00 62.91  ? 180 ASP E C     1 
ATOM 5555 O O     . ASP E 1 105 ? 34.578  57.948  84.151  1.00 54.08  ? 180 ASP E O     1 
ATOM 5556 C CB    . ASP E 1 105 ? 32.041  56.909  81.954  1.00 50.91  ? 180 ASP E CB    1 
ATOM 5557 C CG    . ASP E 1 105 ? 32.255  55.471  81.340  1.00 76.73  ? 180 ASP E CG    1 
ATOM 5558 O OD1   . ASP E 1 105 ? 33.146  54.663  81.754  1.00 56.78  ? 180 ASP E OD1   1 
ATOM 5559 O OD2   . ASP E 1 105 ? 31.508  55.163  80.378  1.00 92.46  ? 180 ASP E OD2   1 
ATOM 5560 N N     . LEU E 1 106 ? 34.591  55.934  83.110  1.00 65.41  ? 181 LEU E N     1 
ATOM 5561 C CA    . LEU E 1 106 ? 36.027  55.697  83.222  1.00 56.94  ? 181 LEU E CA    1 
ATOM 5562 C C     . LEU E 1 106 ? 36.601  55.487  81.834  1.00 54.37  ? 181 LEU E C     1 
ATOM 5563 O O     . LEU E 1 106 ? 36.019  54.762  81.016  1.00 71.32  ? 181 LEU E O     1 
ATOM 5564 C CB    . LEU E 1 106 ? 36.356  54.457  84.071  1.00 61.80  ? 181 LEU E CB    1 
ATOM 5565 C CG    . LEU E 1 106 ? 36.026  54.209  85.556  1.00 49.18  ? 181 LEU E CG    1 
ATOM 5566 C CD1   . LEU E 1 106 ? 37.218  54.398  86.497  1.00 40.92  ? 181 LEU E CD1   1 
ATOM 5567 C CD2   . LEU E 1 106 ? 34.881  55.032  86.016  1.00 57.38  ? 181 LEU E CD2   1 
ATOM 5568 N N     . TRP E 1 107 ? 37.747  56.108  81.589  1.00 39.36  ? 182 TRP E N     1 
ATOM 5569 C CA    . TRP E 1 107 ? 38.437  56.051  80.308  1.00 56.16  ? 182 TRP E CA    1 
ATOM 5570 C C     . TRP E 1 107 ? 39.909  55.811  80.605  1.00 55.45  ? 182 TRP E C     1 
ATOM 5571 O O     . TRP E 1 107 ? 40.286  55.656  81.768  1.00 61.46  ? 182 TRP E O     1 
ATOM 5572 C CB    . TRP E 1 107 ? 38.159  57.336  79.544  1.00 47.99  ? 182 TRP E CB    1 
ATOM 5573 C CG    . TRP E 1 107 ? 38.903  57.599  78.312  1.00 49.17  ? 182 TRP E CG    1 
ATOM 5574 C CD1   . TRP E 1 107 ? 38.618  57.113  77.087  1.00 55.53  ? 182 TRP E CD1   1 
ATOM 5575 C CD2   . TRP E 1 107 ? 40.003  58.503  78.141  1.00 42.11  ? 182 TRP E CD2   1 
ATOM 5576 N NE1   . TRP E 1 107 ? 39.489  57.624  76.153  1.00 51.86  ? 182 TRP E NE1   1 
ATOM 5577 C CE2   . TRP E 1 107 ? 40.356  58.478  76.779  1.00 51.91  ? 182 TRP E CE2   1 
ATOM 5578 C CE3   . TRP E 1 107 ? 40.738  59.311  79.007  1.00 47.88  ? 182 TRP E CE3   1 
ATOM 5579 C CZ2   . TRP E 1 107 ? 41.433  59.230  76.258  1.00 48.31  ? 182 TRP E CZ2   1 
ATOM 5580 C CZ3   . TRP E 1 107 ? 41.806  60.071  78.483  1.00 46.43  ? 182 TRP E CZ3   1 
ATOM 5581 C CH2   . TRP E 1 107 ? 42.139  60.016  77.123  1.00 39.10  ? 182 TRP E CH2   1 
ATOM 5582 N N     . THR E 1 108 ? 40.742  55.633  79.578  1.00 40.03  ? 183 THR E N     1 
ATOM 5583 C CA    . THR E 1 108 ? 42.171  55.736  79.846  1.00 45.83  ? 183 THR E CA    1 
ATOM 5584 C C     . THR E 1 108 ? 42.975  55.946  78.569  1.00 51.68  ? 183 THR E C     1 
ATOM 5585 O O     . THR E 1 108 ? 42.769  55.216  77.592  1.00 58.36  ? 183 THR E O     1 
ATOM 5586 C CB    . THR E 1 108 ? 42.707  54.503  80.576  1.00 53.69  ? 183 THR E CB    1 
ATOM 5587 O OG1   . THR E 1 108 ? 44.000  54.204  80.059  1.00 63.41  ? 183 THR E OG1   1 
ATOM 5588 C CG2   . THR E 1 108 ? 41.829  53.314  80.397  1.00 71.45  ? 183 THR E CG2   1 
ATOM 5589 N N     . ASP E 1 109 ? 44.003  56.813  78.647  1.00 35.98  ? 184 ASP E N     1 
ATOM 5590 C CA    . ASP E 1 109 ? 44.696  57.299  77.455  1.00 44.81  ? 184 ASP E CA    1 
ATOM 5591 C C     . ASP E 1 109 ? 45.538  56.195  76.884  1.00 60.07  ? 184 ASP E C     1 
ATOM 5592 O O     . ASP E 1 109 ? 45.913  55.259  77.594  1.00 63.77  ? 184 ASP E O     1 
ATOM 5593 C CB    . ASP E 1 109 ? 45.613  58.493  77.745  1.00 49.75  ? 184 ASP E CB    1 
ATOM 5594 C CG    . ASP E 1 109 ? 46.906  58.120  78.499  1.00 49.76  ? 184 ASP E CG    1 
ATOM 5595 O OD1   . ASP E 1 109 ? 47.998  57.975  77.891  1.00 42.07  ? 184 ASP E OD1   1 
ATOM 5596 O OD2   . ASP E 1 109 ? 46.841  58.038  79.734  1.00 51.05  ? 184 ASP E OD2   1 
ATOM 5597 N N     . ASN E 1 110 ? 45.818  56.249  75.591  1.00 43.86  ? 185 ASN E N     1 
ATOM 5598 C CA    . ASN E 1 110 ? 46.697  55.173  75.197  1.00 62.49  ? 185 ASN E CA    1 
ATOM 5599 C C     . ASN E 1 110 ? 47.943  55.753  74.652  1.00 43.88  ? 185 ASN E C     1 
ATOM 5600 O O     . ASN E 1 110 ? 48.185  55.626  73.462  1.00 65.11  ? 185 ASN E O     1 
ATOM 5601 C CB    . ASN E 1 110 ? 46.040  54.291  74.173  1.00 86.40  ? 185 ASN E CB    1 
ATOM 5602 C CG    . ASN E 1 110 ? 45.478  55.089  73.021  1.00 73.29  ? 185 ASN E CG    1 
ATOM 5603 O OD1   . ASN E 1 110 ? 44.538  55.871  73.210  1.00 66.40  ? 185 ASN E OD1   1 
ATOM 5604 N ND2   . ASN E 1 110 ? 46.050  54.904  71.823  1.00 55.43  ? 185 ASN E ND2   1 
ATOM 5605 N N     . TYR E 1 111 ? 48.820  56.175  75.532  1.00 47.06  ? 186 TYR E N     1 
ATOM 5606 C CA    . TYR E 1 111 ? 50.241  56.322  75.247  1.00 59.84  ? 186 TYR E CA    1 
ATOM 5607 C C     . TYR E 1 111 ? 50.862  55.983  76.596  1.00 68.08  ? 186 TYR E C     1 
ATOM 5608 O O     . TYR E 1 111 ? 51.595  55.004  76.739  1.00 56.23  ? 186 TYR E O     1 
ATOM 5609 C CB    . TYR E 1 111 ? 50.614  57.728  74.679  1.00 29.09  ? 186 TYR E CB    1 
ATOM 5610 C CG    . TYR E 1 111 ? 50.116  57.985  73.267  1.00 22.39  ? 186 TYR E CG    1 
ATOM 5611 C CD1   . TYR E 1 111 ? 50.922  57.830  72.180  1.00 41.03  ? 186 TYR E CD1   1 
ATOM 5612 C CD2   . TYR E 1 111 ? 48.806  58.333  73.030  1.00 45.63  ? 186 TYR E CD2   1 
ATOM 5613 C CE1   . TYR E 1 111 ? 50.416  58.022  70.878  1.00 47.09  ? 186 TYR E CE1   1 
ATOM 5614 C CE2   . TYR E 1 111 ? 48.285  58.498  71.754  1.00 44.99  ? 186 TYR E CE2   1 
ATOM 5615 C CZ    . TYR E 1 111 ? 49.086  58.364  70.675  1.00 45.76  ? 186 TYR E CZ    1 
ATOM 5616 O OH    . TYR E 1 111 ? 48.533  58.580  69.408  1.00 63.50  ? 186 TYR E OH    1 
ATOM 5617 N N     . ILE E 1 112 ? 50.533  56.820  77.592  1.00 68.41  ? 187 ILE E N     1 
ATOM 5618 C CA    . ILE E 1 112 ? 50.995  56.679  78.970  1.00 55.34  ? 187 ILE E CA    1 
ATOM 5619 C C     . ILE E 1 112 ? 50.169  55.714  79.807  1.00 52.89  ? 187 ILE E C     1 
ATOM 5620 O O     . ILE E 1 112 ? 50.671  55.166  80.796  1.00 51.75  ? 187 ILE E O     1 
ATOM 5621 C CB    . ILE E 1 112 ? 51.013  58.080  79.560  1.00 44.30  ? 187 ILE E CB    1 
ATOM 5622 C CG1   . ILE E 1 112 ? 51.973  58.928  78.718  1.00 47.75  ? 187 ILE E CG1   1 
ATOM 5623 C CG2   . ILE E 1 112 ? 51.397  58.019  81.019  1.00 47.74  ? 187 ILE E CG2   1 
ATOM 5624 C CD1   . ILE E 1 112 ? 53.425  58.941  79.217  1.00 46.94  ? 187 ILE E CD1   1 
ATOM 5625 N N     . LYS E 1 113 ? 48.915  55.502  79.426  1.00 59.18  ? 188 LYS E N     1 
ATOM 5626 C CA    . LYS E 1 113 ? 48.025  54.486  79.986  1.00 53.54  ? 188 LYS E CA    1 
ATOM 5627 C C     . LYS E 1 113 ? 47.683  54.753  81.447  1.00 56.85  ? 188 LYS E C     1 
ATOM 5628 O O     . LYS E 1 113 ? 47.564  53.809  82.232  1.00 69.94  ? 188 LYS E O     1 
ATOM 5629 C CB    . LYS E 1 113 ? 48.608  53.095  79.809  1.00 54.20  ? 188 LYS E CB    1 
ATOM 5630 C CG    . LYS E 1 113 ? 49.278  52.916  78.461  1.00 59.97  ? 188 LYS E CG    1 
ATOM 5631 C CD    . LYS E 1 113 ? 48.334  53.138  77.341  1.00 57.37  ? 188 LYS E CD    1 
ATOM 5632 C CE    . LYS E 1 113 ? 47.625  51.829  76.895  1.00 70.99  ? 188 LYS E CE    1 
ATOM 5633 N NZ    . LYS E 1 113 ? 48.504  50.865  76.143  1.00 49.89  ? 188 LYS E NZ    1 
ATOM 5634 N N     . ARG E 1 114 ? 47.553  56.045  81.806  1.00 57.79  ? 189 ARG E N     1 
ATOM 5635 C CA    . ARG E 1 114 ? 46.857  56.533  83.003  1.00 52.14  ? 189 ARG E CA    1 
ATOM 5636 C C     . ARG E 1 114 ? 45.354  56.404  82.792  1.00 49.85  ? 189 ARG E C     1 
ATOM 5637 O O     . ARG E 1 114 ? 44.895  56.270  81.661  1.00 59.01  ? 189 ARG E O     1 
ATOM 5638 C CB    . ARG E 1 114 ? 47.228  57.990  83.291  1.00 65.05  ? 189 ARG E CB    1 
ATOM 5639 C CG    . ARG E 1 114 ? 47.593  58.295  84.770  1.00 87.95  ? 189 ARG E CG    1 
ATOM 5640 C CD    . ARG E 1 114 ? 47.878  59.789  85.048  1.00 71.42  ? 189 ARG E CD    1 
ATOM 5641 N NE    . ARG E 1 114 ? 48.855  60.319  84.117  1.00 80.49  ? 189 ARG E NE    1 
ATOM 5642 C CZ    . ARG E 1 114 ? 50.151  60.365  84.375  1.00 89.44  ? 189 ARG E CZ    1 
ATOM 5643 N NH1   . ARG E 1 114 ? 50.586  59.925  85.551  1.00 84.91  ? 189 ARG E NH1   1 
ATOM 5644 N NH2   . ARG E 1 114 ? 50.999  60.849  83.465  1.00 82.66  ? 189 ARG E NH2   1 
ATOM 5645 N N     . ASN E 1 115 ? 44.580  56.413  83.877  1.00 47.58  ? 190 ASN E N     1 
ATOM 5646 C CA    . ASN E 1 115 ? 43.175  55.980  83.826  1.00 53.58  ? 190 ASN E CA    1 
ATOM 5647 C C     . ASN E 1 115 ? 42.276  56.962  84.551  1.00 61.83  ? 190 ASN E C     1 
ATOM 5648 O O     . ASN E 1 115 ? 42.460  57.213  85.742  1.00 81.61  ? 190 ASN E O     1 
ATOM 5649 C CB    . ASN E 1 115 ? 43.000  54.619  84.474  1.00 57.74  ? 190 ASN E CB    1 
ATOM 5650 C CG    . ASN E 1 115 ? 43.615  54.577  85.863  1.00 81.71  ? 190 ASN E CG    1 
ATOM 5651 O OD1   . ASN E 1 115 ? 44.520  55.367  86.194  1.00 78.77  ? 190 ASN E OD1   1 
ATOM 5652 N ND2   . ASN E 1 115 ? 43.132  53.666  86.687  1.00 89.39  ? 190 ASN E ND2   1 
ATOM 5653 N N     . PHE E 1 116 ? 41.261  57.451  83.873  1.00 58.11  ? 191 PHE E N     1 
ATOM 5654 C CA    . PHE E 1 116 ? 40.658  58.712  84.251  1.00 49.82  ? 191 PHE E CA    1 
ATOM 5655 C C     . PHE E 1 116 ? 39.222  58.572  84.716  1.00 57.71  ? 191 PHE E C     1 
ATOM 5656 O O     . PHE E 1 116 ? 38.502  57.655  84.304  1.00 59.17  ? 191 PHE E O     1 
ATOM 5657 C CB    . PHE E 1 116 ? 40.738  59.653  83.086  1.00 54.39  ? 191 PHE E CB    1 
ATOM 5658 C CG    . PHE E 1 116 ? 42.099  60.239  82.920  1.00 67.08  ? 191 PHE E CG    1 
ATOM 5659 C CD1   . PHE E 1 116 ? 42.982  59.722  82.016  1.00 52.77  ? 191 PHE E CD1   1 
ATOM 5660 C CD2   . PHE E 1 116 ? 42.513  61.300  83.722  1.00 75.16  ? 191 PHE E CD2   1 
ATOM 5661 C CE1   . PHE E 1 116 ? 44.256  60.262  81.895  1.00 65.30  ? 191 PHE E CE1   1 
ATOM 5662 C CE2   . PHE E 1 116 ? 43.772  61.841  83.594  1.00 62.49  ? 191 PHE E CE2   1 
ATOM 5663 C CZ    . PHE E 1 116 ? 44.648  61.316  82.686  1.00 63.22  ? 191 PHE E CZ    1 
ATOM 5664 N N     . LEU E 1 117 ? 38.806  59.510  85.578  1.00 58.60  ? 192 LEU E N     1 
ATOM 5665 C CA    . LEU E 1 117 ? 37.413  59.608  85.999  1.00 59.87  ? 192 LEU E CA    1 
ATOM 5666 C C     . LEU E 1 117 ? 36.799  60.871  85.435  1.00 59.13  ? 192 LEU E C     1 
ATOM 5667 O O     . LEU E 1 117 ? 37.137  61.977  85.865  1.00 57.06  ? 192 LEU E O     1 
ATOM 5668 C CB    . LEU E 1 117 ? 37.264  59.599  87.504  1.00 51.00  ? 192 LEU E CB    1 
ATOM 5669 C CG    . LEU E 1 117 ? 35.819  59.925  87.879  1.00 76.65  ? 192 LEU E CG    1 
ATOM 5670 C CD1   . LEU E 1 117 ? 34.738  59.093  87.127  1.00 75.04  ? 192 LEU E CD1   1 
ATOM 5671 C CD2   . LEU E 1 117 ? 35.696  59.764  89.386  1.00 87.17  ? 192 LEU E CD2   1 
ATOM 5672 N N     . GLY E 1 118 ? 35.890  60.684  84.480  1.00 65.82  ? 193 GLY E N     1 
ATOM 5673 C CA    . GLY E 1 118 ? 35.106  61.772  83.943  1.00 68.57  ? 193 GLY E CA    1 
ATOM 5674 C C     . GLY E 1 118 ? 33.858  62.067  84.767  1.00 80.78  ? 193 GLY E C     1 
ATOM 5675 O O     . GLY E 1 118 ? 33.147  61.156  85.232  1.00 64.43  ? 193 GLY E O     1 
ATOM 5676 N N     . VAL E 1 119 ? 33.593  63.366  84.910  1.00 63.67  ? 194 VAL E N     1 
ATOM 5677 C CA    . VAL E 1 119 ? 32.401  63.877  85.557  1.00 55.60  ? 194 VAL E CA    1 
ATOM 5678 C C     . VAL E 1 119 ? 31.907  65.071  84.762  1.00 74.59  ? 194 VAL E C     1 
ATOM 5679 O O     . VAL E 1 119 ? 32.707  65.912  84.339  1.00 80.78  ? 194 VAL E O     1 
ATOM 5680 C CB    . VAL E 1 119 ? 32.677  64.308  86.997  1.00 44.83  ? 194 VAL E CB    1 
ATOM 5681 C CG1   . VAL E 1 119 ? 31.383  64.324  87.709  1.00 66.06  ? 194 VAL E CG1   1 
ATOM 5682 C CG2   . VAL E 1 119 ? 33.641  63.397  87.657  1.00 46.30  ? 194 VAL E CG2   1 
ATOM 5683 N N     . THR E 1 120 ? 30.593  65.158  84.559  1.00 72.70  ? 195 THR E N     1 
ATOM 5684 C CA    . THR E 1 120 ? 29.980  66.365  84.017  1.00 63.71  ? 195 THR E CA    1 
ATOM 5685 C C     . THR E 1 120 ? 28.809  66.735  84.895  1.00 74.57  ? 195 THR E C     1 
ATOM 5686 O O     . THR E 1 120 ? 28.284  65.890  85.623  1.00 74.54  ? 195 THR E O     1 
ATOM 5687 C CB    . THR E 1 120 ? 29.427  66.202  82.617  1.00 69.87  ? 195 THR E CB    1 
ATOM 5688 O OG1   . THR E 1 120 ? 28.316  65.292  82.682  1.00 86.55  ? 195 THR E OG1   1 
ATOM 5689 C CG2   . THR E 1 120 ? 30.481  65.693  81.657  1.00 69.81  ? 195 THR E CG2   1 
ATOM 5690 N N     . LEU E 1 121 ? 28.379  67.996  84.772  1.00 74.75  ? 196 LEU E N     1 
ATOM 5691 C CA    . LEU E 1 121 ? 27.231  68.520  85.494  1.00 64.14  ? 196 LEU E CA    1 
ATOM 5692 C C     . LEU E 1 121 ? 26.213  69.060  84.516  1.00 70.12  ? 196 LEU E C     1 
ATOM 5693 O O     . LEU E 1 121 ? 26.572  69.587  83.457  1.00 68.39  ? 196 LEU E O     1 
ATOM 5694 C CB    . LEU E 1 121 ? 27.604  69.627  86.452  1.00 63.80  ? 196 LEU E CB    1 
ATOM 5695 C CG    . LEU E 1 121 ? 26.669  69.623  87.652  1.00 78.09  ? 196 LEU E CG    1 
ATOM 5696 C CD1   . LEU E 1 121 ? 27.081  68.546  88.689  1.00 79.58  ? 196 LEU E CD1   1 
ATOM 5697 C CD2   . LEU E 1 121 ? 26.582  71.009  88.256  1.00 62.79  ? 196 LEU E CD2   1 
ATOM 5698 N N     . HIS E 1 122 ? 24.938  68.918  84.898  1.00 83.19  ? 197 HIS E N     1 
ATOM 5699 C CA    . HIS E 1 122 ? 23.781  69.365  84.123  1.00 90.11  ? 197 HIS E CA    1 
ATOM 5700 C C     . HIS E 1 122 ? 22.777  70.049  85.049  1.00 93.77  ? 197 HIS E C     1 
ATOM 5701 O O     . HIS E 1 122 ? 22.454  69.515  86.118  1.00 94.78  ? 197 HIS E O     1 
ATOM 5702 C CB    . HIS E 1 122 ? 23.096  68.184  83.402  1.00 91.94  ? 197 HIS E CB    1 
ATOM 5703 C CG    . HIS E 1 122 ? 24.014  67.370  82.538  1.00 77.97  ? 197 HIS E CG    1 
ATOM 5704 N ND1   . HIS E 1 122 ? 23.982  67.426  81.160  1.00 79.56  ? 197 HIS E ND1   1 
ATOM 5705 C CD2   . HIS E 1 122 ? 24.981  66.477  82.855  1.00 65.69  ? 197 HIS E CD2   1 
ATOM 5706 C CE1   . HIS E 1 122 ? 24.901  66.615  80.669  1.00 70.16  ? 197 HIS E CE1   1 
ATOM 5707 N NE2   . HIS E 1 122 ? 25.521  66.029  81.677  1.00 60.73  ? 197 HIS E NE2   1 
ATOM 5708 N N     . TYR E 1 123 ? 22.290  71.222  84.636  1.00 91.75  ? 198 TYR E N     1 
ATOM 5709 C CA    . TYR E 1 123 ? 21.254  71.977  85.345  1.00 95.72  ? 198 TYR E CA    1 
ATOM 5710 C C     . TYR E 1 123 ? 20.600  72.914  84.333  1.00 110.41 ? 198 TYR E C     1 
ATOM 5711 O O     . TYR E 1 123 ? 20.972  72.927  83.156  1.00 114.61 ? 198 TYR E O     1 
ATOM 5712 C CB    . TYR E 1 123 ? 21.825  72.739  86.551  1.00 86.84  ? 198 TYR E CB    1 
ATOM 5713 C CG    . TYR E 1 123 ? 22.932  73.728  86.236  1.00 80.87  ? 198 TYR E CG    1 
ATOM 5714 C CD1   . TYR E 1 123 ? 23.011  74.355  84.996  1.00 86.88  ? 198 TYR E CD1   1 
ATOM 5715 C CD2   . TYR E 1 123 ? 23.910  74.010  87.166  1.00 65.96  ? 198 TYR E CD2   1 
ATOM 5716 C CE1   . TYR E 1 123 ? 24.003  75.224  84.692  1.00 84.23  ? 198 TYR E CE1   1 
ATOM 5717 C CE2   . TYR E 1 123 ? 24.915  74.885  86.876  1.00 72.35  ? 198 TYR E CE2   1 
ATOM 5718 C CZ    . TYR E 1 123 ? 24.957  75.497  85.629  1.00 88.59  ? 198 TYR E CZ    1 
ATOM 5719 O OH    . TYR E 1 123 ? 25.955  76.394  85.301  1.00 95.85  ? 198 TYR E OH    1 
ATOM 5720 N N     . HIS E 1 124 ? 19.672  73.752  84.807  1.00 115.12 ? 199 HIS E N     1 
ATOM 5721 C CA    . HIS E 1 124 ? 18.930  74.653  83.927  1.00 110.12 ? 199 HIS E CA    1 
ATOM 5722 C C     . HIS E 1 124 ? 19.298  76.111  84.144  1.00 101.41 ? 199 HIS E C     1 
ATOM 5723 O O     . HIS E 1 124 ? 19.792  76.744  83.216  1.00 113.77 ? 199 HIS E O     1 
ATOM 5724 C CB    . HIS E 1 124 ? 17.416  74.471  84.087  1.00 112.33 ? 199 HIS E CB    1 
ATOM 5725 C CG    . HIS E 1 124 ? 16.992  74.182  85.493  1.00 148.29 ? 199 HIS E CG    1 
ATOM 5726 N ND1   . HIS E 1 124 ? 17.042  72.915  86.040  1.00 144.11 ? 199 HIS E ND1   1 
ATOM 5727 C CD2   . HIS E 1 124 ? 16.515  74.995  86.468  1.00 154.97 ? 199 HIS E CD2   1 
ATOM 5728 C CE1   . HIS E 1 124 ? 16.608  72.959  87.288  1.00 146.19 ? 199 HIS E CE1   1 
ATOM 5729 N NE2   . HIS E 1 124 ? 16.284  74.210  87.573  1.00 156.07 ? 199 HIS E NE2   1 
ATOM 5730 N N     . GLU E 1 125 ? 19.039  76.665  85.333  1.00 114.32 ? 200 GLU E N     1 
ATOM 5731 C CA    . GLU E 1 125 ? 19.265  78.087  85.618  1.00 127.42 ? 200 GLU E CA    1 
ATOM 5732 C C     . GLU E 1 125 ? 18.519  79.000  84.644  1.00 132.66 ? 200 GLU E C     1 
ATOM 5733 O O     . GLU E 1 125 ? 19.033  79.332  83.569  1.00 127.38 ? 200 GLU E O     1 
ATOM 5734 C CB    . GLU E 1 125 ? 20.749  78.450  85.682  1.00 103.66 ? 200 GLU E CB    1 
ATOM 5735 C CG    . GLU E 1 125 ? 21.056  79.373  86.883  1.00 105.63 ? 200 GLU E CG    1 
ATOM 5736 C CD    . GLU E 1 125 ? 20.409  78.913  88.226  1.00 136.70 ? 200 GLU E CD    1 
ATOM 5737 O OE1   . GLU E 1 125 ? 21.025  78.102  88.979  1.00 118.33 ? 200 GLU E OE1   1 
ATOM 5738 O OE2   . GLU E 1 125 ? 19.279  79.378  88.535  1.00 134.47 ? 200 GLU E OE2   1 
ATOM 5739 N N     . ASN E 1 126 ? 17.275  79.325  84.988  1.00 130.16 ? 201 ASN E N     1 
ATOM 5740 C CA    . ASN E 1 126 ? 16.207  79.940  84.165  1.00 132.11 ? 201 ASN E CA    1 
ATOM 5741 C C     . ASN E 1 126 ? 15.970  78.990  82.990  1.00 127.18 ? 201 ASN E C     1 
ATOM 5742 O O     . ASN E 1 126 ? 16.007  77.764  83.167  1.00 137.55 ? 201 ASN E O     1 
ATOM 5743 C CB    . ASN E 1 126 ? 16.462  81.416  83.740  1.00 136.96 ? 201 ASN E CB    1 
ATOM 5744 C CG    . ASN E 1 126 ? 17.902  81.891  83.928  1.00 128.69 ? 201 ASN E CG    1 
ATOM 5745 O OD1   . ASN E 1 126 ? 18.430  81.886  85.041  1.00 138.72 ? 201 ASN E OD1   1 
ATOM 5746 N ND2   . ASN E 1 126 ? 18.530  82.333  82.835  1.00 108.37 ? 201 ASN E ND2   1 
ATOM 5747 N N     . ASN E 1 127 ? 15.737  79.490  81.791  1.00 122.69 ? 202 ASN E N     1 
ATOM 5748 C CA    . ASN E 1 127 ? 15.599  78.614  80.646  1.00 116.45 ? 202 ASN E CA    1 
ATOM 5749 C C     . ASN E 1 127 ? 16.955  78.694  79.985  1.00 126.01 ? 202 ASN E C     1 
ATOM 5750 O O     . ASN E 1 127 ? 17.289  79.690  79.340  1.00 117.43 ? 202 ASN E O     1 
ATOM 5751 C CB    . ASN E 1 127 ? 14.474  79.060  79.721  1.00 134.58 ? 202 ASN E CB    1 
ATOM 5752 C CG    . ASN E 1 127 ? 13.734  77.888  79.092  1.00 150.43 ? 202 ASN E CG    1 
ATOM 5753 O OD1   . ASN E 1 127 ? 12.496  77.856  79.083  1.00 146.47 ? 202 ASN E OD1   1 
ATOM 5754 N ND2   . ASN E 1 127 ? 14.489  76.913  78.565  1.00 138.21 ? 202 ASN E ND2   1 
ATOM 5755 N N     . GLU E 1 128 ? 17.763  77.667  80.229  1.00 140.78 ? 203 GLU E N     1 
ATOM 5756 C CA    . GLU E 1 128 ? 19.035  77.479  79.555  1.00 129.70 ? 203 GLU E CA    1 
ATOM 5757 C C     . GLU E 1 128 ? 19.254  76.015  79.204  1.00 116.22 ? 203 GLU E C     1 
ATOM 5758 O O     . GLU E 1 128 ? 19.164  75.639  78.031  1.00 118.38 ? 203 GLU E O     1 
ATOM 5759 C CB    . GLU E 1 128 ? 20.170  78.011  80.422  1.00 119.13 ? 203 GLU E CB    1 
ATOM 5760 C CG    . GLU E 1 128 ? 20.109  79.497  80.608  1.00 117.19 ? 203 GLU E CG    1 
ATOM 5761 C CD    . GLU E 1 128 ? 21.451  80.148  80.439  1.00 124.08 ? 203 GLU E CD    1 
ATOM 5762 O OE1   . GLU E 1 128 ? 22.100  80.411  81.468  1.00 119.39 ? 203 GLU E OE1   1 
ATOM 5763 O OE2   . GLU E 1 128 ? 21.859  80.389  79.282  1.00 127.62 ? 203 GLU E OE2   1 
ATOM 5764 N N     . LEU E 1 129 ? 19.438  75.181  80.241  1.00 106.77 ? 204 LEU E N     1 
ATOM 5765 C CA    . LEU E 1 129 ? 20.018  73.836  80.159  1.00 120.47 ? 204 LEU E CA    1 
ATOM 5766 C C     . LEU E 1 129 ? 21.485  73.821  79.753  1.00 110.19 ? 204 LEU E C     1 
ATOM 5767 O O     . LEU E 1 129 ? 21.806  73.650  78.573  1.00 116.53 ? 204 LEU E O     1 
ATOM 5768 C CB    . LEU E 1 129 ? 19.234  72.931  79.202  1.00 138.29 ? 204 LEU E CB    1 
ATOM 5769 C CG    . LEU E 1 129 ? 19.720  71.476  79.075  1.00 117.10 ? 204 LEU E CG    1 
ATOM 5770 C CD1   . LEU E 1 129 ? 19.893  70.792  80.436  1.00 111.00 ? 204 LEU E CD1   1 
ATOM 5771 C CD2   . LEU E 1 129 ? 18.756  70.697  78.202  1.00 101.04 ? 204 LEU E CD2   1 
ATOM 5772 N N     . ARG E 1 130 ? 22.378  74.069  80.707  1.00 105.34 ? 205 ARG E N     1 
ATOM 5773 C CA    . ARG E 1 130 ? 23.811  74.036  80.449  1.00 103.83 ? 205 ARG E CA    1 
ATOM 5774 C C     . ARG E 1 130 ? 24.441  72.697  80.846  1.00 103.06 ? 205 ARG E C     1 
ATOM 5775 O O     . ARG E 1 130 ? 24.212  72.200  81.958  1.00 91.55  ? 205 ARG E O     1 
ATOM 5776 C CB    . ARG E 1 130 ? 24.495  75.189  81.174  1.00 107.31 ? 205 ARG E CB    1 
ATOM 5777 C CG    . ARG E 1 130 ? 24.504  76.489  80.364  1.00 111.35 ? 205 ARG E CG    1 
ATOM 5778 C CD    . ARG E 1 130 ? 25.241  77.575  81.128  1.00 108.06 ? 205 ARG E CD    1 
ATOM 5779 N NE    . ARG E 1 130 ? 24.668  77.759  82.463  1.00 109.67 ? 205 ARG E NE    1 
ATOM 5780 C CZ    . ARG E 1 130 ? 24.123  78.895  82.890  1.00 116.97 ? 205 ARG E CZ    1 
ATOM 5781 N NH1   . ARG E 1 130 ? 24.106  79.959  82.096  1.00 111.02 ? 205 ARG E NH1   1 
ATOM 5782 N NH2   . ARG E 1 130 ? 23.603  78.975  84.110  1.00 115.78 ? 205 ARG E NH2   1 
ATOM 5783 N N     . ASP E 1 131 ? 25.246  72.136  79.921  1.00 110.75 ? 206 ASP E N     1 
ATOM 5784 C CA    . ASP E 1 131 ? 26.015  70.890  80.061  1.00 99.44  ? 206 ASP E CA    1 
ATOM 5785 C C     . ASP E 1 131 ? 27.509  71.232  80.169  1.00 92.53  ? 206 ASP E C     1 
ATOM 5786 O O     . ASP E 1 131 ? 28.115  71.804  79.243  1.00 72.06  ? 206 ASP E O     1 
ATOM 5787 C CB    . ASP E 1 131 ? 25.702  69.940  78.884  1.00 102.52 ? 206 ASP E CB    1 
ATOM 5788 C CG    . ASP E 1 131 ? 26.937  69.179  78.327  1.00 95.92  ? 206 ASP E CG    1 
ATOM 5789 O OD1   . ASP E 1 131 ? 27.438  69.551  77.222  1.00 92.24  ? 206 ASP E OD1   1 
ATOM 5790 O OD2   . ASP E 1 131 ? 27.362  68.184  78.965  1.00 70.96  ? 206 ASP E OD2   1 
ATOM 5791 N N     . LEU E 1 132 ? 28.096  70.907  81.316  1.00 73.51  ? 207 LEU E N     1 
ATOM 5792 C CA    . LEU E 1 132 ? 29.358  71.514  81.685  1.00 69.49  ? 207 LEU E CA    1 
ATOM 5793 C C     . LEU E 1 132 ? 30.263  70.492  82.357  1.00 74.19  ? 207 LEU E C     1 
ATOM 5794 O O     . LEU E 1 132 ? 29.867  69.875  83.354  1.00 66.72  ? 207 LEU E O     1 
ATOM 5795 C CB    . LEU E 1 132 ? 29.092  72.715  82.600  1.00 69.49  ? 207 LEU E CB    1 
ATOM 5796 C CG    . LEU E 1 132 ? 30.257  73.269  83.412  1.00 75.53  ? 207 LEU E CG    1 
ATOM 5797 C CD1   . LEU E 1 132 ? 31.088  74.314  82.619  1.00 74.16  ? 207 LEU E CD1   1 
ATOM 5798 C CD2   . LEU E 1 132 ? 29.776  73.783  84.767  1.00 52.73  ? 207 LEU E CD2   1 
ATOM 5799 N N     . ILE E 1 133 ? 31.488  70.367  81.823  1.00 82.66  ? 208 ILE E N     1 
ATOM 5800 C CA    . ILE E 1 133 ? 32.481  69.364  82.235  1.00 80.52  ? 208 ILE E CA    1 
ATOM 5801 C C     . ILE E 1 133 ? 33.065  69.774  83.579  1.00 62.24  ? 208 ILE E C     1 
ATOM 5802 O O     . ILE E 1 133 ? 33.730  70.809  83.683  1.00 70.39  ? 208 ILE E O     1 
ATOM 5803 C CB    . ILE E 1 133 ? 33.622  69.254  81.197  1.00 67.94  ? 208 ILE E CB    1 
ATOM 5804 C CG1   . ILE E 1 133 ? 33.217  68.669  79.837  1.00 52.84  ? 208 ILE E CG1   1 
ATOM 5805 C CG2   . ILE E 1 133 ? 34.772  68.479  81.744  1.00 55.17  ? 208 ILE E CG2   1 
ATOM 5806 C CD1   . ILE E 1 133 ? 34.357  68.774  78.764  1.00 42.96  ? 208 ILE E CD1   1 
ATOM 5807 N N     . LEU E 1 134 ? 32.887  68.947  84.602  1.00 59.70  ? 209 LEU E N     1 
ATOM 5808 C CA    . LEU E 1 134 ? 33.445  69.361  85.889  1.00 78.56  ? 209 LEU E CA    1 
ATOM 5809 C C     . LEU E 1 134 ? 34.937  69.068  85.979  1.00 78.41  ? 209 LEU E C     1 
ATOM 5810 O O     . LEU E 1 134 ? 35.763  69.957  86.256  1.00 71.92  ? 209 LEU E O     1 
ATOM 5811 C CB    . LEU E 1 134 ? 32.690  68.680  87.033  1.00 66.12  ? 209 LEU E CB    1 
ATOM 5812 C CG    . LEU E 1 134 ? 31.294  69.296  87.296  1.00 79.96  ? 209 LEU E CG    1 
ATOM 5813 C CD1   . LEU E 1 134 ? 31.132  69.663  88.735  1.00 74.84  ? 209 LEU E CD1   1 
ATOM 5814 C CD2   . LEU E 1 134 ? 30.956  70.541  86.454  1.00 73.38  ? 209 LEU E CD2   1 
ATOM 5815 N N     . GLY E 1 135 ? 35.297  67.841  85.683  1.00 76.62  ? 210 GLY E N     1 
ATOM 5816 C CA    . GLY E 1 135 ? 36.628  67.398  85.993  1.00 84.90  ? 210 GLY E CA    1 
ATOM 5817 C C     . GLY E 1 135 ? 36.927  66.081  85.328  1.00 68.81  ? 210 GLY E C     1 
ATOM 5818 O O     . GLY E 1 135 ? 36.027  65.330  84.935  1.00 69.77  ? 210 GLY E O     1 
ATOM 5819 N N     . LEU E 1 136 ? 38.215  65.855  85.153  1.00 63.69  ? 211 LEU E N     1 
ATOM 5820 C CA    . LEU E 1 136 ? 38.770  64.583  84.754  1.00 48.85  ? 211 LEU E CA    1 
ATOM 5821 C C     . LEU E 1 136 ? 39.994  64.401  85.627  1.00 65.50  ? 211 LEU E C     1 
ATOM 5822 O O     . LEU E 1 136 ? 41.013  65.068  85.406  1.00 77.52  ? 211 LEU E O     1 
ATOM 5823 C CB    . LEU E 1 136 ? 39.135  64.667  83.296  1.00 48.05  ? 211 LEU E CB    1 
ATOM 5824 C CG    . LEU E 1 136 ? 39.654  63.478  82.565  1.00 59.05  ? 211 LEU E CG    1 
ATOM 5825 C CD1   . LEU E 1 136 ? 38.527  62.435  82.515  1.00 59.45  ? 211 LEU E CD1   1 
ATOM 5826 C CD2   . LEU E 1 136 ? 40.080  63.987  81.186  1.00 35.51  ? 211 LEU E CD2   1 
ATOM 5827 N N     . LYS E 1 137 ? 39.930  63.502  86.591  1.00 56.32  ? 212 LYS E N     1 
ATOM 5828 C CA    . LYS E 1 137 ? 41.036  63.378  87.522  1.00 60.60  ? 212 LYS E CA    1 
ATOM 5829 C C     . LYS E 1 137 ? 41.612  62.001  87.351  1.00 64.59  ? 212 LYS E C     1 
ATOM 5830 O O     . LYS E 1 137 ? 40.868  61.035  87.181  1.00 71.76  ? 212 LYS E O     1 
ATOM 5831 C CB    . LYS E 1 137 ? 40.623  63.595  88.978  1.00 73.31  ? 212 LYS E CB    1 
ATOM 5832 C CG    . LYS E 1 137 ? 41.589  64.528  89.734  1.00 102.89 ? 212 LYS E CG    1 
ATOM 5833 C CD    . LYS E 1 137 ? 41.211  64.764  91.207  1.00 97.27  ? 212 LYS E CD    1 
ATOM 5834 C CE    . LYS E 1 137 ? 42.082  65.870  91.815  1.00 102.00 ? 212 LYS E CE    1 
ATOM 5835 N NZ    . LYS E 1 137 ? 42.215  65.750  93.293  1.00 107.29 ? 212 LYS E NZ    1 
ATOM 5836 N N     . SER E 1 138 ? 42.931  61.911  87.341  1.00 73.16  ? 213 SER E N     1 
ATOM 5837 C CA    . SER E 1 138 ? 43.485  60.577  87.187  1.00 67.24  ? 213 SER E CA    1 
ATOM 5838 C C     . SER E 1 138 ? 43.451  59.838  88.505  1.00 69.62  ? 213 SER E C     1 
ATOM 5839 O O     . SER E 1 138 ? 43.465  60.434  89.583  1.00 84.39  ? 213 SER E O     1 
ATOM 5840 C CB    . SER E 1 138 ? 44.918  60.608  86.695  1.00 64.48  ? 213 SER E CB    1 
ATOM 5841 O OG    . SER E 1 138 ? 45.673  59.719  87.469  1.00 63.27  ? 213 SER E OG    1 
ATOM 5842 N N     . LEU E 1 139 ? 43.463  58.521  88.409  1.00 68.33  ? 214 LEU E N     1 
ATOM 5843 C CA    . LEU E 1 139 ? 43.595  57.707  89.602  1.00 68.84  ? 214 LEU E CA    1 
ATOM 5844 C C     . LEU E 1 139 ? 45.038  57.579  90.022  1.00 80.94  ? 214 LEU E C     1 
ATOM 5845 O O     . LEU E 1 139 ? 45.343  56.828  90.950  1.00 89.58  ? 214 LEU E O     1 
ATOM 5846 C CB    . LEU E 1 139 ? 43.012  56.325  89.373  1.00 63.68  ? 214 LEU E CB    1 
ATOM 5847 C CG    . LEU E 1 139 ? 41.495  56.209  89.390  1.00 72.11  ? 214 LEU E CG    1 
ATOM 5848 C CD1   . LEU E 1 139 ? 40.783  57.554  89.366  1.00 54.59  ? 214 LEU E CD1   1 
ATOM 5849 C CD2   . LEU E 1 139 ? 41.096  55.403  88.193  1.00 73.72  ? 214 LEU E CD2   1 
ATOM 5850 N N     . ASP E 1 140 ? 45.928  58.275  89.333  1.00 92.91  ? 215 ASP E N     1 
ATOM 5851 C CA    . ASP E 1 140 ? 47.317  57.868  89.306  1.00 95.03  ? 215 ASP E CA    1 
ATOM 5852 C C     . ASP E 1 140 ? 47.238  56.398  88.967  1.00 88.86  ? 215 ASP E C     1 
ATOM 5853 O O     . ASP E 1 140 ? 46.396  56.008  88.149  1.00 96.98  ? 215 ASP E O     1 
ATOM 5854 C CB    . ASP E 1 140 ? 48.008  58.218  90.613  1.00 101.13 ? 215 ASP E CB    1 
ATOM 5855 C CG    . ASP E 1 140 ? 48.020  59.731  90.842  1.00 109.32 ? 215 ASP E CG    1 
ATOM 5856 O OD1   . ASP E 1 140 ? 49.073  60.349  90.561  1.00 116.34 ? 215 ASP E OD1   1 
ATOM 5857 O OD2   . ASP E 1 140 ? 46.963  60.302  91.230  1.00 85.42  ? 215 ASP E OD2   1 
ATOM 5858 N N     . PHE E 1 141 ? 48.062  55.554  89.537  1.00 73.28  ? 216 PHE E N     1 
ATOM 5859 C CA    . PHE E 1 141 ? 47.965  54.185  89.067  1.00 84.66  ? 216 PHE E CA    1 
ATOM 5860 C C     . PHE E 1 141 ? 47.305  53.268  90.067  1.00 91.66  ? 216 PHE E C     1 
ATOM 5861 O O     . PHE E 1 141 ? 47.196  52.056  89.831  1.00 99.58  ? 216 PHE E O     1 
ATOM 5862 C CB    . PHE E 1 141 ? 49.321  53.772  88.563  1.00 80.45  ? 216 PHE E CB    1 
ATOM 5863 C CG    . PHE E 1 141 ? 49.671  54.562  87.358  1.00 83.65  ? 216 PHE E CG    1 
ATOM 5864 C CD1   . PHE E 1 141 ? 50.251  55.823  87.487  1.00 91.48  ? 216 PHE E CD1   1 
ATOM 5865 C CD2   . PHE E 1 141 ? 49.242  54.147  86.107  1.00 78.63  ? 216 PHE E CD2   1 
ATOM 5866 C CE1   . PHE E 1 141 ? 50.510  56.614  86.374  1.00 91.06  ? 216 PHE E CE1   1 
ATOM 5867 C CE2   . PHE E 1 141 ? 49.501  54.922  84.981  1.00 85.53  ? 216 PHE E CE2   1 
ATOM 5868 C CZ    . PHE E 1 141 ? 50.141  56.163  85.112  1.00 84.19  ? 216 PHE E CZ    1 
ATOM 5869 N N     . GLU E 1 142 ? 46.819  53.845  91.154  1.00 87.32  ? 217 GLU E N     1 
ATOM 5870 C CA    . GLU E 1 142 ? 45.933  53.147  92.054  1.00 83.73  ? 217 GLU E CA    1 
ATOM 5871 C C     . GLU E 1 142 ? 44.774  52.586  91.243  1.00 84.32  ? 217 GLU E C     1 
ATOM 5872 O O     . GLU E 1 142 ? 44.415  53.108  90.187  1.00 80.37  ? 217 GLU E O     1 
ATOM 5873 C CB    . GLU E 1 142 ? 45.509  54.119  93.160  1.00 90.76  ? 217 GLU E CB    1 
ATOM 5874 C CG    . GLU E 1 142 ? 46.607  55.217  93.333  1.00 104.02 ? 217 GLU E CG    1 
ATOM 5875 C CD    . GLU E 1 142 ? 46.733  55.833  94.727  1.00 120.54 ? 217 GLU E CD    1 
ATOM 5876 O OE1   . GLU E 1 142 ? 45.703  56.192  95.341  1.00 122.09 ? 217 GLU E OE1   1 
ATOM 5877 O OE2   . GLU E 1 142 ? 47.889  55.978  95.195  1.00 128.13 ? 217 GLU E OE2   1 
ATOM 5878 N N     . ARG E 1 143 ? 44.256  51.461  91.696  1.00 92.84  ? 218 ARG E N     1 
ATOM 5879 C CA    . ARG E 1 143 ? 43.755  50.427  90.811  1.00 86.35  ? 218 ARG E CA    1 
ATOM 5880 C C     . ARG E 1 143 ? 42.279  50.554  90.474  1.00 86.73  ? 218 ARG E C     1 
ATOM 5881 O O     . ARG E 1 143 ? 41.742  49.657  89.815  1.00 91.70  ? 218 ARG E O     1 
ATOM 5882 C CB    . ARG E 1 143 ? 44.037  49.081  91.438  1.00 89.54  ? 218 ARG E CB    1 
ATOM 5883 C CG    . ARG E 1 143 ? 43.949  49.171  92.936  1.00 92.85  ? 218 ARG E CG    1 
ATOM 5884 C CD    . ARG E 1 143 ? 43.158  48.025  93.455  1.00 85.39  ? 218 ARG E CD    1 
ATOM 5885 N NE    . ARG E 1 143 ? 43.611  46.791  92.844  1.00 86.60  ? 218 ARG E NE    1 
ATOM 5886 C CZ    . ARG E 1 143 ? 43.332  45.598  93.335  1.00 96.80  ? 218 ARG E CZ    1 
ATOM 5887 N NH1   . ARG E 1 143 ? 42.598  45.521  94.442  1.00 89.34  ? 218 ARG E NH1   1 
ATOM 5888 N NH2   . ARG E 1 143 ? 43.790  44.502  92.731  1.00 98.91  ? 218 ARG E NH2   1 
ATOM 5889 N N     . SER E 1 144 ? 41.624  51.645  90.880  1.00 64.40  ? 219 SER E N     1 
ATOM 5890 C CA    . SER E 1 144 ? 40.313  52.039  90.328  1.00 73.59  ? 219 SER E CA    1 
ATOM 5891 C C     . SER E 1 144 ? 39.161  51.139  90.773  1.00 74.49  ? 219 SER E C     1 
ATOM 5892 O O     . SER E 1 144 ? 38.276  50.764  89.988  1.00 69.58  ? 219 SER E O     1 
ATOM 5893 C CB    . SER E 1 144 ? 40.352  52.091  88.798  1.00 88.62  ? 219 SER E CB    1 
ATOM 5894 O OG    . SER E 1 144 ? 39.669  50.973  88.232  1.00 92.17  ? 219 SER E OG    1 
ATOM 5895 N N     . THR E 1 145 ? 39.137  50.840  92.052  1.00 78.09  ? 220 THR E N     1 
ATOM 5896 C CA    . THR E 1 145 ? 37.966  50.172  92.564  1.00 75.74  ? 220 THR E CA    1 
ATOM 5897 C C     . THR E 1 145 ? 36.881  51.197  92.868  1.00 71.63  ? 220 THR E C     1 
ATOM 5898 O O     . THR E 1 145 ? 37.071  52.410  92.749  1.00 62.25  ? 220 THR E O     1 
ATOM 5899 C CB    . THR E 1 145 ? 38.354  49.371  93.786  1.00 71.14  ? 220 THR E CB    1 
ATOM 5900 O OG1   . THR E 1 145 ? 38.876  50.266  94.768  1.00 76.15  ? 220 THR E OG1   1 
ATOM 5901 C CG2   . THR E 1 145 ? 39.426  48.382  93.394  1.00 73.80  ? 220 THR E CG2   1 
ATOM 5902 N N     . ALA E 1 146 ? 35.726  50.705  93.294  1.00 74.32  ? 221 ALA E N     1 
ATOM 5903 C CA    . ALA E 1 146 ? 34.648  51.617  93.646  1.00 82.33  ? 221 ALA E CA    1 
ATOM 5904 C C     . ALA E 1 146 ? 35.166  52.716  94.562  1.00 71.95  ? 221 ALA E C     1 
ATOM 5905 O O     . ALA E 1 146 ? 34.802  53.889  94.435  1.00 69.59  ? 221 ALA E O     1 
ATOM 5906 C CB    . ALA E 1 146 ? 33.512  50.828  94.313  1.00 71.73  ? 221 ALA E CB    1 
ATOM 5907 N N     . GLU E 1 147 ? 36.102  52.358  95.418  1.00 73.89  ? 222 GLU E N     1 
ATOM 5908 C CA    . GLU E 1 147 ? 36.376  53.116  96.625  1.00 91.65  ? 222 GLU E CA    1 
ATOM 5909 C C     . GLU E 1 147 ? 37.228  54.359  96.320  1.00 90.65  ? 222 GLU E C     1 
ATOM 5910 O O     . GLU E 1 147 ? 36.909  55.485  96.738  1.00 71.61  ? 222 GLU E O     1 
ATOM 5911 C CB    . GLU E 1 147 ? 37.028  52.147  97.644  1.00 82.71  ? 222 GLU E CB    1 
ATOM 5912 C CG    . GLU E 1 147 ? 36.038  51.185  98.473  1.00 107.42 ? 222 GLU E CG    1 
ATOM 5913 C CD    . GLU E 1 147 ? 35.743  49.731  97.900  1.00 116.37 ? 222 GLU E CD    1 
ATOM 5914 O OE1   . GLU E 1 147 ? 34.646  49.157  98.191  1.00 89.70  ? 222 GLU E OE1   1 
ATOM 5915 O OE2   . GLU E 1 147 ? 36.593  49.144  97.189  1.00 107.28 ? 222 GLU E OE2   1 
ATOM 5916 N N     . ASN E 1 148 ? 38.291  54.180  95.556  1.00 81.95  ? 223 ASN E N     1 
ATOM 5917 C CA    . ASN E 1 148 ? 39.119  55.308  95.195  1.00 85.05  ? 223 ASN E CA    1 
ATOM 5918 C C     . ASN E 1 148 ? 38.555  56.073  94.008  1.00 79.70  ? 223 ASN E C     1 
ATOM 5919 O O     . ASN E 1 148 ? 39.020  57.185  93.737  1.00 68.61  ? 223 ASN E O     1 
ATOM 5920 C CB    . ASN E 1 148 ? 40.530  54.799  94.931  1.00 93.19  ? 223 ASN E CB    1 
ATOM 5921 C CG    . ASN E 1 148 ? 40.542  53.313  94.584  1.00 99.80  ? 223 ASN E CG    1 
ATOM 5922 O OD1   . ASN E 1 148 ? 39.626  52.821  93.918  1.00 91.51  ? 223 ASN E OD1   1 
ATOM 5923 N ND2   . ASN E 1 148 ? 41.566  52.589  95.049  1.00 116.20 ? 223 ASN E ND2   1 
ATOM 5924 N N     . ILE E 1 149 ? 37.568  55.508  93.305  1.00 70.91  ? 224 ILE E N     1 
ATOM 5925 C CA    . ILE E 1 149 ? 36.723  56.318  92.429  1.00 72.62  ? 224 ILE E CA    1 
ATOM 5926 C C     . ILE E 1 149 ? 35.993  57.376  93.255  1.00 83.12  ? 224 ILE E C     1 
ATOM 5927 O O     . ILE E 1 149 ? 36.161  58.586  93.046  1.00 81.49  ? 224 ILE E O     1 
ATOM 5928 C CB    . ILE E 1 149 ? 35.724  55.432  91.660  1.00 67.60  ? 224 ILE E CB    1 
ATOM 5929 C CG1   . ILE E 1 149 ? 36.411  54.455  90.718  1.00 55.15  ? 224 ILE E CG1   1 
ATOM 5930 C CG2   . ILE E 1 149 ? 34.752  56.284  90.855  1.00 73.08  ? 224 ILE E CG2   1 
ATOM 5931 C CD1   . ILE E 1 149 ? 35.468  53.404  90.136  1.00 54.49  ? 224 ILE E CD1   1 
ATOM 5932 N N     . TYR E 1 150 ? 35.208  56.922  94.244  1.00 88.74  ? 225 TYR E N     1 
ATOM 5933 C CA    . TYR E 1 150 ? 34.464  57.806  95.143  1.00 89.99  ? 225 TYR E CA    1 
ATOM 5934 C C     . TYR E 1 150 ? 35.355  58.940  95.592  1.00 83.01  ? 225 TYR E C     1 
ATOM 5935 O O     . TYR E 1 150 ? 35.021  60.120  95.442  1.00 74.15  ? 225 TYR E O     1 
ATOM 5936 C CB    . TYR E 1 150 ? 34.004  57.002  96.368  1.00 90.53  ? 225 TYR E CB    1 
ATOM 5937 C CG    . TYR E 1 150 ? 32.628  57.284  96.974  1.00 106.28 ? 225 TYR E CG    1 
ATOM 5938 C CD1   . TYR E 1 150 ? 31.863  56.219  97.465  1.00 127.65 ? 225 TYR E CD1   1 
ATOM 5939 C CD2   . TYR E 1 150 ? 32.107  58.586  97.113  1.00 101.80 ? 225 TYR E CD2   1 
ATOM 5940 C CE1   . TYR E 1 150 ? 30.604  56.409  98.047  1.00 133.42 ? 225 TYR E CE1   1 
ATOM 5941 C CE2   . TYR E 1 150 ? 30.821  58.797  97.706  1.00 102.33 ? 225 TYR E CE2   1 
ATOM 5942 C CZ    . TYR E 1 150 ? 30.082  57.681  98.168  1.00 130.37 ? 225 TYR E CZ    1 
ATOM 5943 O OH    . TYR E 1 150 ? 28.828  57.778  98.750  1.00 125.60 ? 225 TYR E OH    1 
ATOM 5944 N N     . LYS E 1 151 ? 36.540  58.568  96.074  1.00 83.48  ? 226 LYS E N     1 
ATOM 5945 C CA    . LYS E 1 151 ? 37.528  59.536  96.505  1.00 72.06  ? 226 LYS E CA    1 
ATOM 5946 C C     . LYS E 1 151 ? 37.701  60.618  95.444  1.00 82.60  ? 226 LYS E C     1 
ATOM 5947 O O     . LYS E 1 151 ? 37.423  61.804  95.686  1.00 81.23  ? 226 LYS E O     1 
ATOM 5948 C CB    . LYS E 1 151 ? 38.827  58.783  96.807  1.00 68.10  ? 226 LYS E CB    1 
ATOM 5949 C CG    . LYS E 1 151 ? 40.121  59.549  96.538  1.00 103.55 ? 226 LYS E CG    1 
ATOM 5950 C CD    . LYS E 1 151 ? 41.427  58.717  96.719  1.00 109.13 ? 226 LYS E CD    1 
ATOM 5951 C CE    . LYS E 1 151 ? 42.658  59.585  96.342  1.00 97.42  ? 226 LYS E CE    1 
ATOM 5952 N NZ    . LYS E 1 151 ? 43.989  58.910  96.419  1.00 101.11 ? 226 LYS E NZ    1 
ATOM 5953 N N     . LYS E 1 152 ? 38.042  60.211  94.222  1.00 83.48  ? 227 LYS E N     1 
ATOM 5954 C CA    . LYS E 1 152 ? 38.271  61.215  93.192  1.00 83.49  ? 227 LYS E CA    1 
ATOM 5955 C C     . LYS E 1 152 ? 37.017  62.018  92.952  1.00 79.97  ? 227 LYS E C     1 
ATOM 5956 O O     . LYS E 1 152 ? 37.087  63.189  92.582  1.00 86.84  ? 227 LYS E O     1 
ATOM 5957 C CB    . LYS E 1 152 ? 38.738  60.571  91.894  1.00 66.18  ? 227 LYS E CB    1 
ATOM 5958 C CG    . LYS E 1 152 ? 39.681  59.404  92.082  1.00 71.52  ? 227 LYS E CG    1 
ATOM 5959 C CD    . LYS E 1 152 ? 40.868  59.637  93.039  1.00 80.44  ? 227 LYS E CD    1 
ATOM 5960 C CE    . LYS E 1 152 ? 41.909  60.626  92.475  1.00 99.10  ? 227 LYS E CE    1 
ATOM 5961 N NZ    . LYS E 1 152 ? 43.238  60.612  93.194  1.00 94.33  ? 227 LYS E NZ    1 
ATOM 5962 N N     . LEU E 1 153 ? 35.862  61.423  93.192  1.00 79.73  ? 228 LEU E N     1 
ATOM 5963 C CA    . LEU E 1 153 ? 34.642  62.168  92.968  1.00 80.62  ? 228 LEU E CA    1 
ATOM 5964 C C     . LEU E 1 153 ? 34.543  63.319  93.951  1.00 91.15  ? 228 LEU E C     1 
ATOM 5965 O O     . LEU E 1 153 ? 34.319  64.474  93.559  1.00 92.16  ? 228 LEU E O     1 
ATOM 5966 C CB    . LEU E 1 153 ? 33.439  61.247  93.076  1.00 82.86  ? 228 LEU E CB    1 
ATOM 5967 C CG    . LEU E 1 153 ? 32.411  61.514  91.972  1.00 100.42 ? 228 LEU E CG    1 
ATOM 5968 C CD1   . LEU E 1 153 ? 31.074  60.898  92.326  1.00 105.06 ? 228 LEU E CD1   1 
ATOM 5969 C CD2   . LEU E 1 153 ? 32.233  62.998  91.659  1.00 94.43  ? 228 LEU E CD2   1 
ATOM 5970 N N     . LYS E 1 154 ? 34.710  63.034  95.238  1.00 87.24  ? 229 LYS E N     1 
ATOM 5971 C CA    . LYS E 1 154 ? 34.734  64.148  96.162  1.00 88.03  ? 229 LYS E CA    1 
ATOM 5972 C C     . LYS E 1 154 ? 35.822  65.114  95.747  1.00 86.84  ? 229 LYS E C     1 
ATOM 5973 O O     . LYS E 1 154 ? 35.582  66.318  95.663  1.00 84.86  ? 229 LYS E O     1 
ATOM 5974 C CB    . LYS E 1 154 ? 34.907  63.658  97.595  1.00 89.56  ? 229 LYS E CB    1 
ATOM 5975 C CG    . LYS E 1 154 ? 33.633  62.967  98.134  1.00 102.28 ? 229 LYS E CG    1 
ATOM 5976 C CD    . LYS E 1 154 ? 33.368  63.182  99.644  1.00 91.86  ? 229 LYS E CD    1 
ATOM 5977 C CE    . LYS E 1 154 ? 32.805  64.573  99.917  1.00 106.38 ? 229 LYS E CE    1 
ATOM 5978 N NZ    . LYS E 1 154 ? 31.690  64.918  98.986  1.00 98.53  ? 229 LYS E NZ    1 
ATOM 5979 N N     . ALA E 1 155 ? 36.974  64.588  95.340  1.00 83.49  ? 230 ALA E N     1 
ATOM 5980 C CA    . ALA E 1 155 ? 38.048  65.449  94.870  1.00 83.76  ? 230 ALA E CA    1 
ATOM 5981 C C     . ALA E 1 155 ? 37.547  66.439  93.827  1.00 86.19  ? 230 ALA E C     1 
ATOM 5982 O O     . ALA E 1 155 ? 37.695  67.650  93.998  1.00 90.86  ? 230 ALA E O     1 
ATOM 5983 C CB    . ALA E 1 155 ? 39.188  64.603  94.308  1.00 91.45  ? 230 ALA E CB    1 
ATOM 5984 N N     . ILE E 1 156 ? 36.912  65.945  92.757  1.00 93.02  ? 231 ILE E N     1 
ATOM 5985 C CA    . ILE E 1 156 ? 36.452  66.840  91.690  1.00 94.83  ? 231 ILE E CA    1 
ATOM 5986 C C     . ILE E 1 156 ? 35.391  67.789  92.213  1.00 96.56  ? 231 ILE E C     1 
ATOM 5987 O O     . ILE E 1 156 ? 35.492  69.010  92.060  1.00 99.86  ? 231 ILE E O     1 
ATOM 5988 C CB    . ILE E 1 156 ? 35.915  66.052  90.480  1.00 86.91  ? 231 ILE E CB    1 
ATOM 5989 C CG1   . ILE E 1 156 ? 37.071  65.402  89.724  1.00 75.84  ? 231 ILE E CG1   1 
ATOM 5990 C CG2   . ILE E 1 156 ? 35.065  66.985  89.563  1.00 70.09  ? 231 ILE E CG2   1 
ATOM 5991 C CD1   . ILE E 1 156 ? 36.715  64.854  88.378  1.00 52.47  ? 231 ILE E CD1   1 
ATOM 5992 N N     . PHE E 1 157 ? 34.346  67.238  92.821  1.00 90.92  ? 232 PHE E N     1 
ATOM 5993 C CA    . PHE E 1 157 ? 33.279  68.082  93.334  1.00 95.64  ? 232 PHE E CA    1 
ATOM 5994 C C     . PHE E 1 157 ? 33.775  69.033  94.421  1.00 91.04  ? 232 PHE E C     1 
ATOM 5995 O O     . PHE E 1 157 ? 33.287  70.162  94.524  1.00 79.35  ? 232 PHE E O     1 
ATOM 5996 C CB    . PHE E 1 157 ? 32.150  67.192  93.845  1.00 103.32 ? 232 PHE E CB    1 
ATOM 5997 C CG    . PHE E 1 157 ? 31.091  66.903  92.813  1.00 91.45  ? 232 PHE E CG    1 
ATOM 5998 C CD1   . PHE E 1 157 ? 30.185  65.883  93.001  1.00 95.50  ? 232 PHE E CD1   1 
ATOM 5999 C CD2   . PHE E 1 157 ? 30.985  67.665  91.665  1.00 85.87  ? 232 PHE E CD2   1 
ATOM 6000 C CE1   . PHE E 1 157 ? 29.185  65.625  92.053  1.00 102.43 ? 232 PHE E CE1   1 
ATOM 6001 C CE2   . PHE E 1 157 ? 29.984  67.406  90.716  1.00 75.29  ? 232 PHE E CE2   1 
ATOM 6002 C CZ    . PHE E 1 157 ? 29.086  66.398  90.910  1.00 80.71  ? 232 PHE E CZ    1 
ATOM 6003 N N     . SER E 1 158 ? 34.758  68.605  95.221  1.00 103.56 ? 233 SER E N     1 
ATOM 6004 C CA    . SER E 1 158 ? 35.228  69.430  96.330  1.00 95.80  ? 233 SER E CA    1 
ATOM 6005 C C     . SER E 1 158 ? 35.733  70.772  95.862  1.00 86.58  ? 233 SER E C     1 
ATOM 6006 O O     . SER E 1 158 ? 35.661  71.738  96.621  1.00 102.19 ? 233 SER E O     1 
ATOM 6007 C CB    . SER E 1 158 ? 36.347  68.738  97.104  1.00 95.93  ? 233 SER E CB    1 
ATOM 6008 O OG    . SER E 1 158 ? 35.931  67.471  97.579  1.00 105.45 ? 233 SER E OG    1 
ATOM 6009 N N     . GLN E 1 159 ? 36.272  70.852  94.639  1.00 89.56  ? 234 GLN E N     1 
ATOM 6010 C CA    . GLN E 1 159 ? 36.864  72.095  94.131  1.00 104.83 ? 234 GLN E CA    1 
ATOM 6011 C C     . GLN E 1 159 ? 35.819  73.150  93.815  1.00 102.01 ? 234 GLN E C     1 
ATOM 6012 O O     . GLN E 1 159 ? 36.171  74.270  93.421  1.00 103.50 ? 234 GLN E O     1 
ATOM 6013 C CB    . GLN E 1 159 ? 37.689  71.829  92.873  1.00 97.44  ? 234 GLN E CB    1 
ATOM 6014 C CG    . GLN E 1 159 ? 38.140  70.397  92.731  1.00 89.71  ? 234 GLN E CG    1 
ATOM 6015 C CD    . GLN E 1 159 ? 39.118  70.218  91.603  1.00 94.45  ? 234 GLN E CD    1 
ATOM 6016 O OE1   . GLN E 1 159 ? 38.980  70.831  90.544  1.00 88.18  ? 234 GLN E OE1   1 
ATOM 6017 N NE2   . GLN E 1 159 ? 40.135  69.387  91.829  1.00 110.50 ? 234 GLN E NE2   1 
ATOM 6018 N N     . PHE E 1 160 ? 34.559  72.756  93.841  1.00 99.07  ? 235 PHE E N     1 
ATOM 6019 C CA    . PHE E 1 160 ? 33.404  73.629  93.878  1.00 102.63 ? 235 PHE E CA    1 
ATOM 6020 C C     . PHE E 1 160 ? 32.745  73.672  95.251  1.00 103.38 ? 235 PHE E C     1 
ATOM 6021 O O     . PHE E 1 160 ? 31.597  74.111  95.362  1.00 104.97 ? 235 PHE E O     1 
ATOM 6022 C CB    . PHE E 1 160 ? 32.458  73.213  92.774  1.00 113.78 ? 235 PHE E CB    1 
ATOM 6023 C CG    . PHE E 1 160 ? 33.163  73.054  91.459  1.00 104.32 ? 235 PHE E CG    1 
ATOM 6024 C CD1   . PHE E 1 160 ? 33.803  71.866  91.136  1.00 98.91  ? 235 PHE E CD1   1 
ATOM 6025 C CD2   . PHE E 1 160 ? 33.233  74.104  90.574  1.00 95.14  ? 235 PHE E CD2   1 
ATOM 6026 C CE1   . PHE E 1 160 ? 34.473  71.722  89.943  1.00 96.93  ? 235 PHE E CE1   1 
ATOM 6027 C CE2   . PHE E 1 160 ? 33.893  73.965  89.378  1.00 104.76 ? 235 PHE E CE2   1 
ATOM 6028 C CZ    . PHE E 1 160 ? 34.519  72.770  89.060  1.00 102.57 ? 235 PHE E CZ    1 
ATOM 6029 N N     . ASN E 1 161 ? 33.407  73.119  96.268  1.00 110.79 ? 236 ASN E N     1 
ATOM 6030 C CA    . ASN E 1 161 ? 33.143  73.260  97.703  1.00 110.93 ? 236 ASN E CA    1 
ATOM 6031 C C     . ASN E 1 161 ? 32.158  72.230  98.242  1.00 116.61 ? 236 ASN E C     1 
ATOM 6032 O O     . ASN E 1 161 ? 31.880  72.249  99.447  1.00 125.97 ? 236 ASN E O     1 
ATOM 6033 C CB    . ASN E 1 161 ? 32.651  74.670  98.086  1.00 118.54 ? 236 ASN E CB    1 
ATOM 6034 C CG    . ASN E 1 161 ? 33.776  75.707  98.104  1.00 125.09 ? 236 ASN E CG    1 
ATOM 6035 O OD1   . ASN E 1 161 ? 34.341  76.060  97.057  1.00 112.24 ? 236 ASN E OD1   1 
ATOM 6036 N ND2   . ASN E 1 161 ? 34.096  76.209  99.301  1.00 119.80 ? 236 ASN E ND2   1 
ATOM 6037 N N     . VAL E 1 162 ? 31.629  71.335  97.418  1.00 110.92 ? 237 VAL E N     1 
ATOM 6038 C CA    . VAL E 1 162 ? 30.511  70.498  97.833  1.00 114.03 ? 237 VAL E CA    1 
ATOM 6039 C C     . VAL E 1 162 ? 31.024  69.171  98.385  1.00 110.06 ? 237 VAL E C     1 
ATOM 6040 O O     . VAL E 1 162 ? 31.518  68.318  97.638  1.00 101.20 ? 237 VAL E O     1 
ATOM 6041 C CB    . VAL E 1 162 ? 29.553  70.280  96.665  1.00 99.58  ? 237 VAL E CB    1 
ATOM 6042 C CG1   . VAL E 1 162 ? 28.127  70.326  97.180  1.00 110.60 ? 237 VAL E CG1   1 
ATOM 6043 C CG2   . VAL E 1 162 ? 29.830  71.344  95.596  1.00 79.73  ? 237 VAL E CG2   1 
ATOM 6044 N N     . GLU E 1 163 ? 30.907  68.991  99.701  1.00 96.71  ? 238 GLU E N     1 
ATOM 6045 C CA    . GLU E 1 163 ? 31.156  67.684  100.295 1.00 120.42 ? 238 GLU E CA    1 
ATOM 6046 C C     . GLU E 1 163 ? 29.877  66.876  100.474 1.00 121.26 ? 238 GLU E C     1 
ATOM 6047 O O     . GLU E 1 163 ? 29.943  65.666  100.760 1.00 91.67  ? 238 GLU E O     1 
ATOM 6048 C CB    . GLU E 1 163 ? 31.876  67.822  101.642 1.00 111.17 ? 238 GLU E CB    1 
ATOM 6049 C CG    . GLU E 1 163 ? 32.667  69.108  101.795 1.00 122.85 ? 238 GLU E CG    1 
ATOM 6050 C CD    . GLU E 1 163 ? 33.698  69.316  100.703 1.00 118.16 ? 238 GLU E CD    1 
ATOM 6051 O OE1   . GLU E 1 163 ? 33.416  70.062  99.750  1.00 105.88 ? 238 GLU E OE1   1 
ATOM 6052 O OE2   . GLU E 1 163 ? 34.796  68.736  100.798 1.00 130.75 ? 238 GLU E OE2   1 
ATOM 6053 N N     . ASP E 1 164 ? 28.719  67.503  100.284 1.00 116.77 ? 239 ASP E N     1 
ATOM 6054 C CA    . ASP E 1 164 ? 27.449  66.800  100.359 1.00 117.45 ? 239 ASP E CA    1 
ATOM 6055 C C     . ASP E 1 164 ? 27.002  66.541  98.936  1.00 117.25 ? 239 ASP E C     1 
ATOM 6056 O O     . ASP E 1 164 ? 26.460  67.421  98.265  1.00 112.26 ? 239 ASP E O     1 
ATOM 6057 C CB    . ASP E 1 164 ? 26.392  67.604  101.103 1.00 135.98 ? 239 ASP E CB    1 
ATOM 6058 C CG    . ASP E 1 164 ? 24.977  67.144  100.770 1.00 140.77 ? 239 ASP E CG    1 
ATOM 6059 O OD1   . ASP E 1 164 ? 24.296  67.805  99.949  1.00 139.93 ? 239 ASP E OD1   1 
ATOM 6060 O OD2   . ASP E 1 164 ? 24.559  66.100  101.316 1.00 147.03 ? 239 ASP E OD2   1 
ATOM 6061 N N     . LEU E 1 165 ? 27.168  65.317  98.507  1.00 121.07 ? 240 LEU E N     1 
ATOM 6062 C CA    . LEU E 1 165 ? 26.652  64.889  97.227  1.00 111.60 ? 240 LEU E CA    1 
ATOM 6063 C C     . LEU E 1 165 ? 25.601  63.870  97.617  1.00 121.34 ? 240 LEU E C     1 
ATOM 6064 O O     . LEU E 1 165 ? 25.925  62.741  98.002  1.00 108.99 ? 240 LEU E O     1 
ATOM 6065 C CB    . LEU E 1 165 ? 27.771  64.314  96.367  1.00 99.25  ? 240 LEU E CB    1 
ATOM 6066 C CG    . LEU E 1 165 ? 29.209  64.717  96.737  1.00 97.69  ? 240 LEU E CG    1 
ATOM 6067 C CD1   . LEU E 1 165 ? 30.170  64.020  95.818  1.00 96.75  ? 240 LEU E CD1   1 
ATOM 6068 C CD2   . LEU E 1 165 ? 29.494  66.221  96.705  1.00 105.44 ? 240 LEU E CD2   1 
ATOM 6069 N N     . SER E 1 166 ? 24.347  64.303  97.580  1.00 127.18 ? 241 SER E N     1 
ATOM 6070 C CA    . SER E 1 166 ? 23.212  63.481  97.975  1.00 126.26 ? 241 SER E CA    1 
ATOM 6071 C C     . SER E 1 166 ? 22.136  63.696  96.936  1.00 119.18 ? 241 SER E C     1 
ATOM 6072 O O     . SER E 1 166 ? 21.720  62.772  96.228  1.00 115.40 ? 241 SER E O     1 
ATOM 6073 C CB    . SER E 1 166 ? 22.715  63.854  99.372  1.00 123.67 ? 241 SER E CB    1 
ATOM 6074 O OG    . SER E 1 166 ? 23.754  63.750  100.334 1.00 124.49 ? 241 SER E OG    1 
ATOM 6075 N N     . SER E 1 167 ? 21.735  64.967  96.853  1.00 122.20 ? 242 SER E N     1 
ATOM 6076 C CA    . SER E 1 167 ? 20.697  65.544  96.010  1.00 113.76 ? 242 SER E CA    1 
ATOM 6077 C C     . SER E 1 167 ? 20.980  65.372  94.530  1.00 101.90 ? 242 SER E C     1 
ATOM 6078 O O     . SER E 1 167 ? 20.171  65.797  93.699  1.00 101.82 ? 242 SER E O     1 
ATOM 6079 C CB    . SER E 1 167 ? 20.571  67.040  96.314  1.00 131.85 ? 242 SER E CB    1 
ATOM 6080 O OG    . SER E 1 167 ? 21.804  67.724  96.087  1.00 107.86 ? 242 SER E OG    1 
ATOM 6081 N N     . ILE E 1 168 ? 22.145  64.805  94.201  1.00 126.14 ? 243 ILE E N     1 
ATOM 6082 C CA    . ILE E 1 168 ? 22.645  64.735  92.827  1.00 116.35 ? 243 ILE E CA    1 
ATOM 6083 C C     . ILE E 1 168 ? 22.089  63.517  92.118  1.00 95.41  ? 243 ILE E C     1 
ATOM 6084 O O     . ILE E 1 168 ? 22.355  62.371  92.513  1.00 88.86  ? 243 ILE E O     1 
ATOM 6085 C CB    . ILE E 1 168 ? 24.176  64.699  92.777  1.00 105.79 ? 243 ILE E CB    1 
ATOM 6086 C CG1   . ILE E 1 168 ? 24.781  65.331  94.041  1.00 93.12  ? 243 ILE E CG1   1 
ATOM 6087 C CG2   . ILE E 1 168 ? 24.659  65.298  91.434  1.00 86.55  ? 243 ILE E CG2   1 
ATOM 6088 C CD1   . ILE E 1 168 ? 26.109  65.917  93.798  1.00 78.68  ? 243 ILE E CD1   1 
ATOM 6089 N N     . LYS E 1 169 ? 21.383  63.776  91.030  1.00 93.31  ? 244 LYS E N     1 
ATOM 6090 C CA    . LYS E 1 169 ? 20.899  62.723  90.163  1.00 98.70  ? 244 LYS E CA    1 
ATOM 6091 C C     . LYS E 1 169 ? 22.064  62.272  89.306  1.00 92.61  ? 244 LYS E C     1 
ATOM 6092 O O     . LYS E 1 169 ? 22.570  63.054  88.491  1.00 86.77  ? 244 LYS E O     1 
ATOM 6093 C CB    . LYS E 1 169 ? 19.745  63.235  89.297  1.00 105.57 ? 244 LYS E CB    1 
ATOM 6094 C CG    . LYS E 1 169 ? 18.508  63.658  90.100  1.00 100.22 ? 244 LYS E CG    1 
ATOM 6095 C CD    . LYS E 1 169 ? 18.423  65.153  90.355  1.00 90.63  ? 244 LYS E CD    1 
ATOM 6096 C CE    . LYS E 1 169 ? 17.663  65.349  91.631  1.00 93.59  ? 244 LYS E CE    1 
ATOM 6097 N NZ    . LYS E 1 169 ? 16.767  66.523  91.582  1.00 107.27 ? 244 LYS E NZ    1 
ATOM 6098 N N     . PHE E 1 170 ? 22.466  61.011  89.485  1.00 84.45  ? 245 PHE E N     1 
ATOM 6099 C CA    . PHE E 1 170 ? 23.615  60.414  88.821  1.00 65.85  ? 245 PHE E CA    1 
ATOM 6100 C C     . PHE E 1 170 ? 23.166  59.386  87.796  1.00 74.01  ? 245 PHE E C     1 
ATOM 6101 O O     . PHE E 1 170 ? 22.462  58.426  88.134  1.00 68.99  ? 245 PHE E O     1 
ATOM 6102 C CB    . PHE E 1 170 ? 24.509  59.724  89.821  1.00 55.89  ? 245 PHE E CB    1 
ATOM 6103 C CG    . PHE E 1 170 ? 25.375  60.631  90.581  1.00 74.67  ? 245 PHE E CG    1 
ATOM 6104 C CD1   . PHE E 1 170 ? 25.087  60.928  91.899  1.00 78.64  ? 245 PHE E CD1   1 
ATOM 6105 C CD2   . PHE E 1 170 ? 26.520  61.167  89.996  1.00 83.03  ? 245 PHE E CD2   1 
ATOM 6106 C CE1   . PHE E 1 170 ? 25.918  61.744  92.621  1.00 81.02  ? 245 PHE E CE1   1 
ATOM 6107 C CE2   . PHE E 1 170 ? 27.368  61.999  90.714  1.00 80.84  ? 245 PHE E CE2   1 
ATOM 6108 C CZ    . PHE E 1 170 ? 27.064  62.291  92.028  1.00 79.44  ? 245 PHE E CZ    1 
ATOM 6109 N N     . VAL E 1 171 ? 23.614  59.559  86.565  1.00 63.10  ? 246 VAL E N     1 
ATOM 6110 C CA    . VAL E 1 171 ? 23.335  58.628  85.491  1.00 51.83  ? 246 VAL E CA    1 
ATOM 6111 C C     . VAL E 1 171 ? 24.654  58.079  84.972  1.00 60.44  ? 246 VAL E C     1 
ATOM 6112 O O     . VAL E 1 171 ? 25.617  58.832  84.786  1.00 66.74  ? 246 VAL E O     1 
ATOM 6113 C CB    . VAL E 1 171 ? 22.556  59.327  84.385  1.00 60.71  ? 246 VAL E CB    1 
ATOM 6114 C CG1   . VAL E 1 171 ? 23.191  60.666  84.176  1.00 87.67  ? 246 VAL E CG1   1 
ATOM 6115 C CG2   . VAL E 1 171 ? 22.598  58.519  83.111  1.00 67.17  ? 246 VAL E CG2   1 
ATOM 6116 N N     . THR E 1 172 ? 24.682  56.768  84.719  1.00 59.95  ? 247 THR E N     1 
ATOM 6117 C CA    . THR E 1 172 ? 25.918  56.037  84.482  1.00 49.30  ? 247 THR E CA    1 
ATOM 6118 C C     . THR E 1 172 ? 25.620  54.685  83.821  1.00 58.32  ? 247 THR E C     1 
ATOM 6119 O O     . THR E 1 172 ? 24.460  54.306  83.635  1.00 70.60  ? 247 THR E O     1 
ATOM 6120 C CB    . THR E 1 172 ? 26.644  55.863  85.803  1.00 55.83  ? 247 THR E CB    1 
ATOM 6121 O OG1   . THR E 1 172 ? 28.042  55.750  85.547  1.00 98.42  ? 247 THR E OG1   1 
ATOM 6122 C CG2   . THR E 1 172 ? 26.184  54.614  86.479  1.00 56.46  ? 247 THR E CG2   1 
ATOM 6123 N N     . ASP E 1 173 ? 26.686  53.957  83.452  1.00 64.33  ? 248 ASP E N     1 
ATOM 6124 C CA    . ASP E 1 173 ? 26.562  52.601  82.927  1.00 47.25  ? 248 ASP E CA    1 
ATOM 6125 C C     . ASP E 1 173 ? 26.633  51.624  84.076  1.00 60.50  ? 248 ASP E C     1 
ATOM 6126 O O     . ASP E 1 173 ? 26.817  51.996  85.237  1.00 58.54  ? 248 ASP E O     1 
ATOM 6127 C CB    . ASP E 1 173 ? 27.632  52.249  81.872  1.00 56.79  ? 248 ASP E CB    1 
ATOM 6128 C CG    . ASP E 1 173 ? 29.114  52.488  82.325  1.00 78.45  ? 248 ASP E CG    1 
ATOM 6129 O OD1   . ASP E 1 173 ? 29.454  52.337  83.513  1.00 91.59  ? 248 ASP E OD1   1 
ATOM 6130 O OD2   . ASP E 1 173 ? 29.973  52.796  81.456  1.00 78.74  ? 248 ASP E OD2   1 
ATOM 6131 N N     . ARG E 1 174 ? 26.481  50.353  83.745  1.00 68.38  ? 249 ARG E N     1 
ATOM 6132 C CA    . ARG E 1 174 ? 26.408  49.293  84.737  1.00 66.92  ? 249 ARG E CA    1 
ATOM 6133 C C     . ARG E 1 174 ? 27.739  48.589  84.985  1.00 68.05  ? 249 ARG E C     1 
ATOM 6134 O O     . ARG E 1 174 ? 27.747  47.463  85.500  1.00 69.54  ? 249 ARG E O     1 
ATOM 6135 C CB    . ARG E 1 174 ? 25.329  48.313  84.359  1.00 51.66  ? 249 ARG E CB    1 
ATOM 6136 C CG    . ARG E 1 174 ? 23.999  48.920  84.485  1.00 63.13  ? 249 ARG E CG    1 
ATOM 6137 C CD    . ARG E 1 174 ? 23.018  47.833  84.226  1.00 83.45  ? 249 ARG E CD    1 
ATOM 6138 N NE    . ARG E 1 174 ? 23.210  47.294  82.886  1.00 77.90  ? 249 ARG E NE    1 
ATOM 6139 C CZ    . ARG E 1 174 ? 22.886  46.061  82.532  1.00 59.62  ? 249 ARG E CZ    1 
ATOM 6140 N NH1   . ARG E 1 174 ? 22.370  45.230  83.427  1.00 83.70  ? 249 ARG E NH1   1 
ATOM 6141 N NH2   . ARG E 1 174 ? 23.071  45.667  81.283  1.00 58.57  ? 249 ARG E NH2   1 
ATOM 6142 N N     . GLY E 1 175 ? 28.845  49.161  84.526  1.00 56.31  ? 250 GLY E N     1 
ATOM 6143 C CA    . GLY E 1 175 ? 30.124  48.667  84.988  1.00 77.98  ? 250 GLY E CA    1 
ATOM 6144 C C     . GLY E 1 175 ? 30.143  48.557  86.500  1.00 78.02  ? 250 GLY E C     1 
ATOM 6145 O O     . GLY E 1 175 ? 29.689  49.472  87.196  1.00 66.59  ? 250 GLY E O     1 
ATOM 6146 N N     . ALA E 1 176 ? 30.635  47.440  87.035  1.00 70.61  ? 251 ALA E N     1 
ATOM 6147 C CA    . ALA E 1 176 ? 30.431  47.242  88.456  1.00 58.71  ? 251 ALA E CA    1 
ATOM 6148 C C     . ALA E 1 176 ? 31.276  48.208  89.299  1.00 60.50  ? 251 ALA E C     1 
ATOM 6149 O O     . ALA E 1 176 ? 30.907  48.492  90.442  1.00 51.00  ? 251 ALA E O     1 
ATOM 6150 C CB    . ALA E 1 176 ? 30.685  45.776  88.773  1.00 42.77  ? 251 ALA E CB    1 
ATOM 6151 N N     . ASN E 1 177 ? 32.368  48.760  88.743  1.00 65.09  ? 252 ASN E N     1 
ATOM 6152 C CA    . ASN E 1 177 ? 33.186  49.722  89.487  1.00 65.81  ? 252 ASN E CA    1 
ATOM 6153 C C     . ASN E 1 177 ? 32.370  50.950  89.848  1.00 81.58  ? 252 ASN E C     1 
ATOM 6154 O O     . ASN E 1 177 ? 32.313  51.370  91.009  1.00 84.62  ? 252 ASN E O     1 
ATOM 6155 C CB    . ASN E 1 177 ? 34.411  50.196  88.690  1.00 54.25  ? 252 ASN E CB    1 
ATOM 6156 C CG    . ASN E 1 177 ? 35.089  49.105  87.911  1.00 84.35  ? 252 ASN E CG    1 
ATOM 6157 O OD1   . ASN E 1 177 ? 34.451  48.239  87.253  1.00 76.26  ? 252 ASN E OD1   1 
ATOM 6158 N ND2   . ASN E 1 177 ? 36.418  49.150  87.949  1.00 78.40  ? 252 ASN E ND2   1 
ATOM 6159 N N     . VAL E 1 178 ? 31.774  51.581  88.848  1.00 76.95  ? 253 VAL E N     1 
ATOM 6160 C CA    . VAL E 1 178 ? 31.007  52.756  89.187  1.00 73.35  ? 253 VAL E CA    1 
ATOM 6161 C C     . VAL E 1 178 ? 29.669  52.342  89.810  1.00 79.61  ? 253 VAL E C     1 
ATOM 6162 O O     . VAL E 1 178 ? 29.147  53.064  90.667  1.00 91.38  ? 253 VAL E O     1 
ATOM 6163 C CB    . VAL E 1 178 ? 30.866  53.696  87.962  1.00 70.05  ? 253 VAL E CB    1 
ATOM 6164 C CG1   . VAL E 1 178 ? 31.944  53.420  86.949  1.00 69.16  ? 253 VAL E CG1   1 
ATOM 6165 C CG2   . VAL E 1 178 ? 29.512  53.596  87.288  1.00 67.61  ? 253 VAL E CG2   1 
ATOM 6166 N N     . VAL E 1 179 ? 29.105  51.174  89.460  1.00 63.87  ? 254 VAL E N     1 
ATOM 6167 C CA    . VAL E 1 179 ? 27.807  50.828  90.043  1.00 72.73  ? 254 VAL E CA    1 
ATOM 6168 C C     . VAL E 1 179 ? 27.942  50.739  91.551  1.00 87.66  ? 254 VAL E C     1 
ATOM 6169 O O     . VAL E 1 179 ? 27.284  51.480  92.297  1.00 82.79  ? 254 VAL E O     1 
ATOM 6170 C CB    . VAL E 1 179 ? 27.232  49.526  89.454  1.00 63.71  ? 254 VAL E CB    1 
ATOM 6171 C CG1   . VAL E 1 179 ? 26.171  48.984  90.363  1.00 65.72  ? 254 VAL E CG1   1 
ATOM 6172 C CG2   . VAL E 1 179 ? 26.540  49.802  88.182  1.00 66.35  ? 254 VAL E CG2   1 
ATOM 6173 N N     . LYS E 1 180 ? 28.850  49.872  92.015  1.00 84.37  ? 255 LYS E N     1 
ATOM 6174 C CA    . LYS E 1 180 ? 29.116  49.795  93.443  1.00 84.78  ? 255 LYS E CA    1 
ATOM 6175 C C     . LYS E 1 180 ? 29.475  51.165  94.004  1.00 88.11  ? 255 LYS E C     1 
ATOM 6176 O O     . LYS E 1 180 ? 28.820  51.652  94.931  1.00 99.31  ? 255 LYS E O     1 
ATOM 6177 C CB    . LYS E 1 180 ? 30.225  48.788  93.727  1.00 89.21  ? 255 LYS E CB    1 
ATOM 6178 C CG    . LYS E 1 180 ? 30.497  48.626  95.232  1.00 104.13 ? 255 LYS E CG    1 
ATOM 6179 C CD    . LYS E 1 180 ? 30.947  47.209  95.603  1.00 95.07  ? 255 LYS E CD    1 
ATOM 6180 C CE    . LYS E 1 180 ? 31.403  47.068  97.062  1.00 98.88  ? 255 LYS E CE    1 
ATOM 6181 N NZ    . LYS E 1 180 ? 32.189  45.801  97.295  1.00 96.55  ? 255 LYS E NZ    1 
ATOM 6182 N N     . SER E 1 181 ? 30.469  51.829  93.406  1.00 83.02  ? 256 SER E N     1 
ATOM 6183 C CA    . SER E 1 181 ? 30.982  53.095  93.944  1.00 98.85  ? 256 SER E CA    1 
ATOM 6184 C C     . SER E 1 181 ? 29.877  54.083  94.304  1.00 92.06  ? 256 SER E C     1 
ATOM 6185 O O     . SER E 1 181 ? 29.940  54.765  95.331  1.00 93.10  ? 256 SER E O     1 
ATOM 6186 C CB    . SER E 1 181 ? 31.908  53.751  92.927  1.00 89.05  ? 256 SER E CB    1 
ATOM 6187 O OG    . SER E 1 181 ? 31.145  54.566  92.050  1.00 94.37  ? 256 SER E OG    1 
ATOM 6188 N N     . LEU E 1 182 ? 28.874  54.194  93.461  1.00 83.53  ? 257 LEU E N     1 
ATOM 6189 C CA    . LEU E 1 182 ? 27.851  55.199  93.616  1.00 79.99  ? 257 LEU E CA    1 
ATOM 6190 C C     . LEU E 1 182 ? 26.636  54.689  94.351  1.00 81.83  ? 257 LEU E C     1 
ATOM 6191 O O     . LEU E 1 182 ? 25.618  55.382  94.376  1.00 86.10  ? 257 LEU E O     1 
ATOM 6192 C CB    . LEU E 1 182 ? 27.444  55.702  92.248  1.00 84.94  ? 257 LEU E CB    1 
ATOM 6193 C CG    . LEU E 1 182 ? 27.841  57.118  91.933  1.00 71.55  ? 257 LEU E CG    1 
ATOM 6194 C CD1   . LEU E 1 182 ? 27.234  57.446  90.606  1.00 82.96  ? 257 LEU E CD1   1 
ATOM 6195 C CD2   . LEU E 1 182 ? 27.279  58.009  92.987  1.00 78.95  ? 257 LEU E CD2   1 
ATOM 6196 N N     . ALA E 1 183 ? 26.694  53.474  94.893  1.00 78.33  ? 258 ALA E N     1 
ATOM 6197 C CA    . ALA E 1 183 ? 25.489  52.823  95.402  1.00 95.41  ? 258 ALA E CA    1 
ATOM 6198 C C     . ALA E 1 183 ? 24.668  53.744  96.297  1.00 107.25 ? 258 ALA E C     1 
ATOM 6199 O O     . ALA E 1 183 ? 23.429  53.720  96.250  1.00 109.12 ? 258 ALA E O     1 
ATOM 6200 C CB    . ALA E 1 183 ? 25.868  51.559  96.173  1.00 89.05  ? 258 ALA E CB    1 
ATOM 6201 N N     . ASN E 1 184 ? 25.351  54.602  97.076  1.00 105.93 ? 259 ASN E N     1 
ATOM 6202 C CA    . ASN E 1 184 ? 24.775  55.431  98.134  1.00 85.02  ? 259 ASN E CA    1 
ATOM 6203 C C     . ASN E 1 184 ? 24.037  56.672  97.633  1.00 90.55  ? 259 ASN E C     1 
ATOM 6204 O O     . ASN E 1 184 ? 23.362  57.320  98.438  1.00 88.14  ? 259 ASN E O     1 
ATOM 6205 C CB    . ASN E 1 184 ? 25.873  55.870  99.110  1.00 101.45 ? 259 ASN E CB    1 
ATOM 6206 C CG    . ASN E 1 184 ? 25.885  55.043  100.396 1.00 111.67 ? 259 ASN E CG    1 
ATOM 6207 O OD1   . ASN E 1 184 ? 24.888  54.394  100.733 1.00 104.77 ? 259 ASN E OD1   1 
ATOM 6208 N ND2   . ASN E 1 184 ? 27.012  55.072  101.124 1.00 96.39  ? 259 ASN E ND2   1 
ATOM 6209 N N     . ASN E 1 185 ? 24.125  57.020  96.348  1.00 90.16  ? 260 ASN E N     1 
ATOM 6210 C CA    . ASN E 1 185 ? 23.386  58.144  95.790  1.00 61.81  ? 260 ASN E CA    1 
ATOM 6211 C C     . ASN E 1 185 ? 22.303  57.652  94.866  1.00 79.44  ? 260 ASN E C     1 
ATOM 6212 O O     . ASN E 1 185 ? 22.079  56.443  94.687  1.00 85.24  ? 260 ASN E O     1 
ATOM 6213 C CB    . ASN E 1 185 ? 24.271  59.083  94.986  1.00 77.67  ? 260 ASN E CB    1 
ATOM 6214 C CG    . ASN E 1 185 ? 25.217  59.849  95.825  1.00 92.08  ? 260 ASN E CG    1 
ATOM 6215 O OD1   . ASN E 1 185 ? 26.301  59.353  96.182  1.00 65.29  ? 260 ASN E OD1   1 
ATOM 6216 N ND2   . ASN E 1 185 ? 24.837  61.091  96.143  1.00 102.97 ? 260 ASN E ND2   1 
ATOM 6217 N N     . ILE E 1 186 ? 21.652  58.611  94.230  1.00 83.55  ? 261 ILE E N     1 
ATOM 6218 C CA    . ILE E 1 186 ? 20.709  58.290  93.177  1.00 89.18  ? 261 ILE E CA    1 
ATOM 6219 C C     . ILE E 1 186 ? 21.519  57.951  91.933  1.00 92.06  ? 261 ILE E C     1 
ATOM 6220 O O     . ILE E 1 186 ? 22.253  58.797  91.406  1.00 77.39  ? 261 ILE E O     1 
ATOM 6221 C CB    . ILE E 1 186 ? 19.754  59.461  92.920  1.00 87.58  ? 261 ILE E CB    1 
ATOM 6222 C CG1   . ILE E 1 186 ? 20.078  60.624  93.870  1.00 89.24  ? 261 ILE E CG1   1 
ATOM 6223 C CG2   . ILE E 1 186 ? 18.309  58.992  93.043  1.00 86.16  ? 261 ILE E CG2   1 
ATOM 6224 C CD1   . ILE E 1 186 ? 19.339  61.913  93.530  1.00 97.68  ? 261 ILE E CD1   1 
ATOM 6225 N N     . ARG E 1 187 ? 21.389  56.709  91.468  1.00 88.96  ? 262 ARG E N     1 
ATOM 6226 C CA    . ARG E 1 187 ? 21.942  56.268  90.199  1.00 70.64  ? 262 ARG E CA    1 
ATOM 6227 C C     . ARG E 1 187 ? 20.820  55.992  89.216  1.00 64.60  ? 262 ARG E C     1 
ATOM 6228 O O     . ARG E 1 187 ? 19.811  55.367  89.558  1.00 75.18  ? 262 ARG E O     1 
ATOM 6229 C CB    . ARG E 1 187 ? 22.771  55.002  90.362  1.00 87.76  ? 262 ARG E CB    1 
ATOM 6230 C CG    . ARG E 1 187 ? 24.267  55.217  90.440  1.00 89.99  ? 262 ARG E CG    1 
ATOM 6231 C CD    . ARG E 1 187 ? 24.986  53.984  89.965  1.00 67.30  ? 262 ARG E CD    1 
ATOM 6232 N NE    . ARG E 1 187 ? 24.423  53.593  88.689  1.00 63.51  ? 262 ARG E NE    1 
ATOM 6233 C CZ    . ARG E 1 187 ? 23.689  52.512  88.510  1.00 70.56  ? 262 ARG E CZ    1 
ATOM 6234 N NH1   . ARG E 1 187 ? 23.447  51.718  89.542  1.00 91.64  ? 262 ARG E NH1   1 
ATOM 6235 N NH2   . ARG E 1 187 ? 23.212  52.226  87.310  1.00 61.87  ? 262 ARG E NH2   1 
ATOM 6236 N N     . ILE E 1 188 ? 21.004  56.443  87.997  1.00 52.04  ? 263 ILE E N     1 
ATOM 6237 C CA    . ILE E 1 188 ? 20.117  56.075  86.907  1.00 63.75  ? 263 ILE E CA    1 
ATOM 6238 C C     . ILE E 1 188 ? 20.993  55.379  85.868  1.00 66.32  ? 263 ILE E C     1 
ATOM 6239 O O     . ILE E 1 188 ? 22.220  55.458  85.917  1.00 68.70  ? 263 ILE E O     1 
ATOM 6240 C CB    . ILE E 1 188 ? 19.384  57.318  86.357  1.00 70.72  ? 263 ILE E CB    1 
ATOM 6241 C CG1   . ILE E 1 188 ? 18.772  58.090  87.537  1.00 68.69  ? 263 ILE E CG1   1 
ATOM 6242 C CG2   . ILE E 1 188 ? 18.316  56.960  85.348  1.00 58.87  ? 263 ILE E CG2   1 
ATOM 6243 C CD1   . ILE E 1 188 ? 17.772  59.137  87.159  1.00 49.05  ? 263 ILE E CD1   1 
ATOM 6244 N N     . ASN E 1 189 ? 20.380  54.618  84.980  1.00 60.15  ? 264 ASN E N     1 
ATOM 6245 C CA    . ASN E 1 189 ? 21.158  53.788  84.071  1.00 58.29  ? 264 ASN E CA    1 
ATOM 6246 C C     . ASN E 1 189 ? 21.258  54.440  82.714  1.00 66.15  ? 264 ASN E C     1 
ATOM 6247 O O     . ASN E 1 189 ? 20.288  55.028  82.226  1.00 84.66  ? 264 ASN E O     1 
ATOM 6248 C CB    . ASN E 1 189 ? 20.538  52.412  83.929  1.00 69.16  ? 264 ASN E CB    1 
ATOM 6249 C CG    . ASN E 1 189 ? 20.747  51.583  85.153  1.00 74.51  ? 264 ASN E CG    1 
ATOM 6250 O OD1   . ASN E 1 189 ? 21.601  51.893  85.985  1.00 65.08  ? 264 ASN E OD1   1 
ATOM 6251 N ND2   . ASN E 1 189 ? 19.981  50.519  85.280  1.00 82.22  ? 264 ASN E ND2   1 
ATOM 6252 N N     . CYS E 1 190 ? 22.424  54.360  82.102  1.00 52.28  ? 265 CYS E N     1 
ATOM 6253 C CA    . CYS E 1 190 ? 22.533  55.016  80.812  1.00 57.26  ? 265 CYS E CA    1 
ATOM 6254 C C     . CYS E 1 190 ? 21.654  54.228  79.877  1.00 61.78  ? 265 CYS E C     1 
ATOM 6255 O O     . CYS E 1 190 ? 21.820  53.007  79.786  1.00 67.53  ? 265 CYS E O     1 
ATOM 6256 C CB    . CYS E 1 190 ? 23.974  55.036  80.319  1.00 61.20  ? 265 CYS E CB    1 
ATOM 6257 S SG    . CYS E 1 190 ? 24.102  55.104  78.535  1.00 60.55  ? 265 CYS E SG    1 
ATOM 6258 N N     . SER E 1 191 ? 20.671  54.881  79.246  1.00 46.69  ? 266 SER E N     1 
ATOM 6259 C CA    . SER E 1 191 ? 19.733  54.079  78.466  1.00 46.24  ? 266 SER E CA    1 
ATOM 6260 C C     . SER E 1 191 ? 20.234  53.820  77.074  1.00 47.44  ? 266 SER E C     1 
ATOM 6261 O O     . SER E 1 191 ? 19.635  53.012  76.360  1.00 54.82  ? 266 SER E O     1 
ATOM 6262 C CB    . SER E 1 191 ? 18.339  54.699  78.402  1.00 41.51  ? 266 SER E CB    1 
ATOM 6263 O OG    . SER E 1 191 ? 17.999  55.262  79.666  1.00 61.80  ? 266 SER E OG    1 
ATOM 6264 N N     . SER E 1 192 ? 21.324  54.465  76.673  1.00 50.95  ? 267 SER E N     1 
ATOM 6265 C CA    . SER E 1 192 ? 21.898  54.105  75.383  1.00 64.69  ? 267 SER E CA    1 
ATOM 6266 C C     . SER E 1 192 ? 22.764  52.874  75.523  1.00 59.73  ? 267 SER E C     1 
ATOM 6267 O O     . SER E 1 192 ? 22.697  51.971  74.680  1.00 60.76  ? 267 SER E O     1 
ATOM 6268 C CB    . SER E 1 192 ? 22.700  55.262  74.789  1.00 57.26  ? 267 SER E CB    1 
ATOM 6269 O OG    . SER E 1 192 ? 23.742  55.584  75.666  1.00 70.54  ? 267 SER E OG    1 
ATOM 6270 N N     . HIS E 1 193 ? 23.572  52.830  76.590  1.00 64.85  ? 268 HIS E N     1 
ATOM 6271 C CA    . HIS E 1 193 ? 24.286  51.613  76.967  1.00 58.90  ? 268 HIS E CA    1 
ATOM 6272 C C     . HIS E 1 193 ? 23.337  50.433  77.013  1.00 62.60  ? 268 HIS E C     1 
ATOM 6273 O O     . HIS E 1 193 ? 23.517  49.437  76.295  1.00 56.42  ? 268 HIS E O     1 
ATOM 6274 C CB    . HIS E 1 193 ? 24.902  51.784  78.335  1.00 52.52  ? 268 HIS E CB    1 
ATOM 6275 C CG    . HIS E 1 193 ? 26.240  52.426  78.336  1.00 45.86  ? 268 HIS E CG    1 
ATOM 6276 N ND1   . HIS E 1 193 ? 26.547  53.472  79.174  1.00 57.14  ? 268 HIS E ND1   1 
ATOM 6277 C CD2   . HIS E 1 193 ? 27.381  52.116  77.686  1.00 54.57  ? 268 HIS E CD2   1 
ATOM 6278 C CE1   . HIS E 1 193 ? 27.815  53.807  79.012  1.00 79.92  ? 268 HIS E CE1   1 
ATOM 6279 N NE2   . HIS E 1 193 ? 28.348  52.993  78.120  1.00 77.88  ? 268 HIS E NE2   1 
ATOM 6280 N N     . LEU E 1 194 ? 22.286  50.572  77.838  1.00 58.44  ? 269 LEU E N     1 
ATOM 6281 C CA    . LEU E 1 194 ? 21.255  49.548  77.978  1.00 54.31  ? 269 LEU E CA    1 
ATOM 6282 C C     . LEU E 1 194 ? 20.732  49.131  76.624  1.00 52.69  ? 269 LEU E C     1 
ATOM 6283 O O     . LEU E 1 194 ? 20.798  47.951  76.268  1.00 52.89  ? 269 LEU E O     1 
ATOM 6284 C CB    . LEU E 1 194 ? 20.120  50.045  78.869  1.00 38.44  ? 269 LEU E CB    1 
ATOM 6285 C CG    . LEU E 1 194 ? 20.521  50.183  80.358  1.00 72.72  ? 269 LEU E CG    1 
ATOM 6286 C CD1   . LEU E 1 194 ? 19.702  49.217  81.194  1.00 70.66  ? 269 LEU E CD1   1 
ATOM 6287 C CD2   . LEU E 1 194 ? 22.080  50.046  80.732  1.00 76.38  ? 269 LEU E CD2   1 
ATOM 6288 N N     . LEU E 1 195 ? 20.292  50.103  75.818  1.00 45.70  ? 270 LEU E N     1 
ATOM 6289 C CA    . LEU E 1 195 ? 19.734  49.776  74.513  1.00 41.70  ? 270 LEU E CA    1 
ATOM 6290 C C     . LEU E 1 195 ? 20.738  49.108  73.625  1.00 42.90  ? 270 LEU E C     1 
ATOM 6291 O O     . LEU E 1 195 ? 20.337  48.428  72.690  1.00 48.97  ? 270 LEU E O     1 
ATOM 6292 C CB    . LEU E 1 195 ? 19.191  51.019  73.815  1.00 60.37  ? 270 LEU E CB    1 
ATOM 6293 C CG    . LEU E 1 195 ? 19.198  51.263  72.278  1.00 73.27  ? 270 LEU E CG    1 
ATOM 6294 C CD1   . LEU E 1 195 ? 18.275  50.419  71.376  1.00 45.90  ? 270 LEU E CD1   1 
ATOM 6295 C CD2   . LEU E 1 195 ? 18.856  52.734  72.073  1.00 76.45  ? 270 LEU E CD2   1 
ATOM 6296 N N     . SER E 1 196 ? 22.032  49.284  73.893  1.00 50.80  ? 271 SER E N     1 
ATOM 6297 C CA    . SER E 1 196 ? 23.053  48.602  73.105  1.00 57.11  ? 271 SER E CA    1 
ATOM 6298 C C     . SER E 1 196 ? 23.156  47.137  73.502  1.00 66.27  ? 271 SER E C     1 
ATOM 6299 O O     . SER E 1 196 ? 23.259  46.245  72.639  1.00 47.40  ? 271 SER E O     1 
ATOM 6300 C CB    . SER E 1 196 ? 24.388  49.292  73.296  1.00 51.67  ? 271 SER E CB    1 
ATOM 6301 O OG    . SER E 1 196 ? 25.335  48.738  72.410  1.00 92.44  ? 271 SER E OG    1 
ATOM 6302 N N     . ASN E 1 197 ? 23.120  46.894  74.817  1.00 63.21  ? 272 ASN E N     1 
ATOM 6303 C CA    . ASN E 1 197 ? 23.004  45.564  75.380  1.00 45.61  ? 272 ASN E CA    1 
ATOM 6304 C C     . ASN E 1 197 ? 21.872  44.798  74.727  1.00 47.85  ? 272 ASN E C     1 
ATOM 6305 O O     . ASN E 1 197 ? 22.083  43.748  74.122  1.00 53.74  ? 272 ASN E O     1 
ATOM 6306 C CB    . ASN E 1 197 ? 22.783  45.707  76.876  1.00 40.85  ? 272 ASN E CB    1 
ATOM 6307 C CG    . ASN E 1 197 ? 23.998  46.290  77.578  1.00 55.19  ? 272 ASN E CG    1 
ATOM 6308 O OD1   . ASN E 1 197 ? 23.957  46.688  78.746  1.00 55.72  ? 272 ASN E OD1   1 
ATOM 6309 N ND2   . ASN E 1 197 ? 25.098  46.352  76.851  1.00 62.35  ? 272 ASN E ND2   1 
ATOM 6310 N N     . VAL E 1 198 ? 20.667  45.358  74.783  1.00 42.15  ? 273 VAL E N     1 
ATOM 6311 C CA    . VAL E 1 198 ? 19.502  44.750  74.136  1.00 43.55  ? 273 VAL E CA    1 
ATOM 6312 C C     . VAL E 1 198 ? 19.826  44.336  72.713  1.00 50.63  ? 273 VAL E C     1 
ATOM 6313 O O     . VAL E 1 198 ? 19.540  43.219  72.271  1.00 45.75  ? 273 VAL E O     1 
ATOM 6314 C CB    . VAL E 1 198 ? 18.328  45.739  74.133  1.00 45.18  ? 273 VAL E CB    1 
ATOM 6315 C CG1   . VAL E 1 198 ? 17.066  45.031  73.697  1.00 72.39  ? 273 VAL E CG1   1 
ATOM 6316 C CG2   . VAL E 1 198 ? 18.156  46.386  75.479  1.00 52.76  ? 273 VAL E CG2   1 
ATOM 6317 N N     . LEU E 1 199 ? 20.373  45.265  71.957  1.00 53.19  ? 274 LEU E N     1 
ATOM 6318 C CA    . LEU E 1 199 ? 20.833  44.946  70.630  1.00 49.48  ? 274 LEU E CA    1 
ATOM 6319 C C     . LEU E 1 199 ? 21.943  43.914  70.699  1.00 54.30  ? 274 LEU E C     1 
ATOM 6320 O O     . LEU E 1 199 ? 21.956  42.927  69.956  1.00 47.40  ? 274 LEU E O     1 
ATOM 6321 C CB    . LEU E 1 199 ? 21.310  46.236  69.984  1.00 47.11  ? 274 LEU E CB    1 
ATOM 6322 C CG    . LEU E 1 199 ? 20.350  46.751  68.925  1.00 56.37  ? 274 LEU E CG    1 
ATOM 6323 C CD1   . LEU E 1 199 ? 19.380  47.789  69.415  1.00 50.71  ? 274 LEU E CD1   1 
ATOM 6324 C CD2   . LEU E 1 199 ? 21.168  47.299  67.805  1.00 65.28  ? 274 LEU E CD2   1 
ATOM 6325 N N     . GLU E 1 200 ? 22.884  44.142  71.605  1.00 56.29  ? 275 GLU E N     1 
ATOM 6326 C CA    . GLU E 1 200 ? 24.100  43.345  71.677  1.00 72.10  ? 275 GLU E CA    1 
ATOM 6327 C C     . GLU E 1 200 ? 23.785  41.869  71.761  1.00 57.88  ? 275 GLU E C     1 
ATOM 6328 O O     . GLU E 1 200 ? 24.303  41.060  70.990  1.00 47.26  ? 275 GLU E O     1 
ATOM 6329 C CB    . GLU E 1 200 ? 24.866  43.806  72.906  1.00 84.10  ? 275 GLU E CB    1 
ATOM 6330 C CG    . GLU E 1 200 ? 26.217  43.268  73.175  1.00 100.03 ? 275 GLU E CG    1 
ATOM 6331 C CD    . GLU E 1 200 ? 26.775  44.001  74.379  1.00 109.80 ? 275 GLU E CD    1 
ATOM 6332 O OE1   . GLU E 1 200 ? 27.453  43.368  75.220  1.00 136.69 ? 275 GLU E OE1   1 
ATOM 6333 O OE2   . GLU E 1 200 ? 26.473  45.217  74.497  1.00 87.76  ? 275 GLU E OE2   1 
ATOM 6334 N N     . ASN E 1 201 ? 22.912  41.522  72.693  1.00 59.03  ? 276 ASN E N     1 
ATOM 6335 C CA    . ASN E 1 201 ? 22.550  40.149  72.948  1.00 50.80  ? 276 ASN E CA    1 
ATOM 6336 C C     . ASN E 1 201 ? 21.554  39.648  71.929  1.00 66.07  ? 276 ASN E C     1 
ATOM 6337 O O     . ASN E 1 201 ? 21.813  38.630  71.279  1.00 71.87  ? 276 ASN E O     1 
ATOM 6338 C CB    . ASN E 1 201 ? 22.021  40.050  74.355  1.00 57.84  ? 276 ASN E CB    1 
ATOM 6339 C CG    . ASN E 1 201 ? 22.989  40.671  75.358  1.00 85.74  ? 276 ASN E CG    1 
ATOM 6340 O OD1   . ASN E 1 201 ? 24.203  40.803  75.096  1.00 91.85  ? 276 ASN E OD1   1 
ATOM 6341 N ND2   . ASN E 1 201 ? 22.461  41.065  76.506  1.00 64.94  ? 276 ASN E ND2   1 
ATOM 6342 N N     . SER E 1 202 ? 20.477  40.414  71.672  1.00 61.71  ? 277 SER E N     1 
ATOM 6343 C CA    . SER E 1 202 ? 19.500  39.993  70.662  1.00 55.30  ? 277 SER E CA    1 
ATOM 6344 C C     . SER E 1 202 ? 20.208  39.513  69.414  1.00 64.94  ? 277 SER E C     1 
ATOM 6345 O O     . SER E 1 202 ? 19.681  38.697  68.663  1.00 72.78  ? 277 SER E O     1 
ATOM 6346 C CB    . SER E 1 202 ? 18.576  41.138  70.212  1.00 55.17  ? 277 SER E CB    1 
ATOM 6347 O OG    . SER E 1 202 ? 17.668  41.580  71.193  1.00 61.89  ? 277 SER E OG    1 
ATOM 6348 N N     . PHE E 1 203 ? 21.395  40.025  69.159  1.00 63.65  ? 278 PHE E N     1 
ATOM 6349 C CA    . PHE E 1 203 ? 22.123  39.510  68.029  1.00 61.63  ? 278 PHE E CA    1 
ATOM 6350 C C     . PHE E 1 203 ? 22.922  38.259  68.374  1.00 79.42  ? 278 PHE E C     1 
ATOM 6351 O O     . PHE E 1 203 ? 23.005  37.347  67.541  1.00 83.46  ? 278 PHE E O     1 
ATOM 6352 C CB    . PHE E 1 203 ? 22.975  40.611  67.468  1.00 61.22  ? 278 PHE E CB    1 
ATOM 6353 C CG    . PHE E 1 203 ? 22.365  41.275  66.283  1.00 55.34  ? 278 PHE E CG    1 
ATOM 6354 C CD1   . PHE E 1 203 ? 22.378  40.665  65.053  1.00 56.85  ? 278 PHE E CD1   1 
ATOM 6355 C CD2   . PHE E 1 203 ? 21.821  42.533  66.381  1.00 65.25  ? 278 PHE E CD2   1 
ATOM 6356 C CE1   . PHE E 1 203 ? 21.843  41.291  63.936  1.00 51.62  ? 278 PHE E CE1   1 
ATOM 6357 C CE2   . PHE E 1 203 ? 21.287  43.168  65.253  1.00 70.05  ? 278 PHE E CE2   1 
ATOM 6358 C CZ    . PHE E 1 203 ? 21.305  42.535  64.027  1.00 52.42  ? 278 PHE E CZ    1 
ATOM 6359 N N     . GLU E 1 204 ? 23.534  38.188  69.573  1.00 82.85  ? 279 GLU E N     1 
ATOM 6360 C CA    . GLU E 1 204 ? 24.244  36.957  69.955  1.00 79.56  ? 279 GLU E CA    1 
ATOM 6361 C C     . GLU E 1 204 ? 23.309  35.771  69.827  1.00 88.93  ? 279 GLU E C     1 
ATOM 6362 O O     . GLU E 1 204 ? 23.704  34.685  69.371  1.00 92.50  ? 279 GLU E O     1 
ATOM 6363 C CB    . GLU E 1 204 ? 24.818  37.054  71.385  1.00 50.90  ? 279 GLU E CB    1 
ATOM 6364 C CG    . GLU E 1 204 ? 26.102  37.941  71.419  1.00 88.76  ? 279 GLU E CG    1 
ATOM 6365 C CD    . GLU E 1 204 ? 26.613  38.358  72.824  1.00 121.49 ? 279 GLU E CD    1 
ATOM 6366 O OE1   . GLU E 1 204 ? 27.737  37.922  73.188  1.00 123.41 ? 279 GLU E OE1   1 
ATOM 6367 O OE2   . GLU E 1 204 ? 25.930  39.146  73.545  1.00 103.56 ? 279 GLU E OE2   1 
ATOM 6368 N N     . GLU E 1 205 ? 22.042  36.022  70.097  1.00 86.18  ? 280 GLU E N     1 
ATOM 6369 C CA    . GLU E 1 205 ? 20.998  35.038  70.242  1.00 78.23  ? 280 GLU E CA    1 
ATOM 6370 C C     . GLU E 1 205 ? 20.196  34.807  68.973  1.00 73.49  ? 280 GLU E C     1 
ATOM 6371 O O     . GLU E 1 205 ? 19.141  34.190  69.056  1.00 79.72  ? 280 GLU E O     1 
ATOM 6372 C CB    . GLU E 1 205 ? 20.106  35.476  71.391  1.00 69.15  ? 280 GLU E CB    1 
ATOM 6373 C CG    . GLU E 1 205 ? 20.952  35.737  72.627  1.00 65.51  ? 280 GLU E CG    1 
ATOM 6374 C CD    . GLU E 1 205 ? 20.249  36.615  73.630  1.00 93.93  ? 280 GLU E CD    1 
ATOM 6375 O OE1   . GLU E 1 205 ? 20.934  37.128  74.557  1.00 95.08  ? 280 GLU E OE1   1 
ATOM 6376 O OE2   . GLU E 1 205 ? 19.013  36.796  73.471  1.00 89.34  ? 280 GLU E OE2   1 
ATOM 6377 N N     . THR E 1 206 ? 20.607  35.353  67.828  1.00 68.76  ? 281 THR E N     1 
ATOM 6378 C CA    . THR E 1 206 ? 20.072  34.952  66.519  1.00 73.58  ? 281 THR E CA    1 
ATOM 6379 C C     . THR E 1 206 ? 21.224  34.613  65.576  1.00 90.06  ? 281 THR E C     1 
ATOM 6380 O O     . THR E 1 206 ? 21.495  35.320  64.585  1.00 81.91  ? 281 THR E O     1 
ATOM 6381 C CB    . THR E 1 206 ? 19.171  36.031  65.924  1.00 85.09  ? 281 THR E CB    1 
ATOM 6382 O OG1   . THR E 1 206 ? 18.118  36.318  66.860  1.00 83.54  ? 281 THR E OG1   1 
ATOM 6383 C CG2   . THR E 1 206 ? 18.586  35.597  64.517  1.00 65.00  ? 281 THR E CG2   1 
ATOM 6384 N N     . PRO E 1 207 ? 21.910  33.504  65.852  1.00 79.57  ? 282 PRO E N     1 
ATOM 6385 C CA    . PRO E 1 207 ? 23.180  33.220  65.173  1.00 77.09  ? 282 PRO E CA    1 
ATOM 6386 C C     . PRO E 1 207 ? 23.083  33.014  63.655  1.00 71.46  ? 282 PRO E C     1 
ATOM 6387 O O     . PRO E 1 207 ? 24.123  32.945  62.989  1.00 70.88  ? 282 PRO E O     1 
ATOM 6388 C CB    . PRO E 1 207 ? 23.673  31.966  65.896  1.00 84.59  ? 282 PRO E CB    1 
ATOM 6389 C CG    . PRO E 1 207 ? 22.489  31.463  66.659  1.00 79.69  ? 282 PRO E CG    1 
ATOM 6390 C CD    . PRO E 1 207 ? 21.663  32.601  66.981  1.00 63.56  ? 282 PRO E CD    1 
ATOM 6391 N N     . GLU E 1 208 ? 21.896  32.867  63.084  1.00 75.88  ? 283 GLU E N     1 
ATOM 6392 C CA    . GLU E 1 208 ? 21.794  32.784  61.629  1.00 79.44  ? 283 GLU E CA    1 
ATOM 6393 C C     . GLU E 1 208 ? 21.910  34.136  60.967  1.00 69.14  ? 283 GLU E C     1 
ATOM 6394 O O     . GLU E 1 208 ? 22.176  34.218  59.755  1.00 57.13  ? 283 GLU E O     1 
ATOM 6395 C CB    . GLU E 1 208 ? 20.463  32.160  61.258  1.00 84.20  ? 283 GLU E CB    1 
ATOM 6396 C CG    . GLU E 1 208 ? 19.594  31.925  62.459  1.00 71.42  ? 283 GLU E CG    1 
ATOM 6397 C CD    . GLU E 1 208 ? 18.152  31.989  62.068  1.00 100.86 ? 283 GLU E CD    1 
ATOM 6398 O OE1   . GLU E 1 208 ? 17.901  32.407  60.914  1.00 95.11  ? 283 GLU E OE1   1 
ATOM 6399 O OE2   . GLU E 1 208 ? 17.282  31.614  62.889  1.00 109.04 ? 283 GLU E OE2   1 
ATOM 6400 N N     . LEU E 1 209 ? 21.569  35.174  61.724  1.00 76.79  ? 284 LEU E N     1 
ATOM 6401 C CA    . LEU E 1 209 ? 21.954  36.537  61.411  1.00 78.47  ? 284 LEU E CA    1 
ATOM 6402 C C     . LEU E 1 209 ? 23.357  36.873  61.909  1.00 71.72  ? 284 LEU E C     1 
ATOM 6403 O O     . LEU E 1 209 ? 24.175  37.415  61.165  1.00 64.51  ? 284 LEU E O     1 
ATOM 6404 C CB    . LEU E 1 209 ? 20.925  37.469  62.008  1.00 66.34  ? 284 LEU E CB    1 
ATOM 6405 C CG    . LEU E 1 209 ? 19.651  37.418  61.165  1.00 88.29  ? 284 LEU E CG    1 
ATOM 6406 C CD1   . LEU E 1 209 ? 18.697  38.479  61.672  1.00 103.90 ? 284 LEU E CD1   1 
ATOM 6407 C CD2   . LEU E 1 209 ? 19.908  37.600  59.646  1.00 65.97  ? 284 LEU E CD2   1 
ATOM 6408 N N     . ASN E 1 210 ? 23.658  36.557  63.166  1.00 66.49  ? 285 ASN E N     1 
ATOM 6409 C CA    . ASN E 1 210 ? 24.955  36.943  63.703  1.00 67.96  ? 285 ASN E CA    1 
ATOM 6410 C C     . ASN E 1 210 ? 26.113  36.362  62.897  1.00 70.77  ? 285 ASN E C     1 
ATOM 6411 O O     . ASN E 1 210 ? 27.228  36.896  62.922  1.00 76.65  ? 285 ASN E O     1 
ATOM 6412 C CB    . ASN E 1 210 ? 25.067  36.519  65.160  1.00 74.68  ? 285 ASN E CB    1 
ATOM 6413 C CG    . ASN E 1 210 ? 26.091  37.346  65.916  1.00 92.89  ? 285 ASN E CG    1 
ATOM 6414 O OD1   . ASN E 1 210 ? 26.268  38.536  65.651  1.00 93.53  ? 285 ASN E OD1   1 
ATOM 6415 N ND2   . ASN E 1 210 ? 26.772  36.722  66.857  1.00 101.52 ? 285 ASN E ND2   1 
ATOM 6416 N N     . MET E 1 211 ? 25.899  35.247  62.235  1.00 80.11  ? 286 MET E N     1 
ATOM 6417 C CA    . MET E 1 211 ? 27.000  34.658  61.482  1.00 76.91  ? 286 MET E CA    1 
ATOM 6418 C C     . MET E 1 211 ? 27.300  35.444  60.215  1.00 64.79  ? 286 MET E C     1 
ATOM 6419 O O     . MET E 1 211 ? 28.485  35.657  59.920  1.00 70.29  ? 286 MET E O     1 
ATOM 6420 C CB    . MET E 1 211 ? 26.721  33.177  61.222  1.00 81.98  ? 286 MET E CB    1 
ATOM 6421 C CG    . MET E 1 211 ? 27.785  32.491  60.393  1.00 107.89 ? 286 MET E CG    1 
ATOM 6422 S SD    . MET E 1 211 ? 27.046  31.206  59.353  1.00 113.24 ? 286 MET E SD    1 
ATOM 6423 C CE    . MET E 1 211 ? 25.371  31.848  59.123  1.00 95.58  ? 286 MET E CE    1 
ATOM 6424 N N     . PRO E 1 212 ? 26.324  35.871  59.409  1.00 60.92  ? 287 PRO E N     1 
ATOM 6425 C CA    . PRO E 1 212 ? 26.703  36.770  58.294  1.00 70.53  ? 287 PRO E CA    1 
ATOM 6426 C C     . PRO E 1 212 ? 27.293  38.101  58.786  1.00 73.26  ? 287 PRO E C     1 
ATOM 6427 O O     . PRO E 1 212 ? 28.319  38.561  58.259  1.00 59.57  ? 287 PRO E O     1 
ATOM 6428 C CB    . PRO E 1 212 ? 25.392  36.945  57.498  1.00 74.77  ? 287 PRO E CB    1 
ATOM 6429 C CG    . PRO E 1 212 ? 24.262  36.371  58.368  1.00 64.66  ? 287 PRO E CG    1 
ATOM 6430 C CD    . PRO E 1 212 ? 24.926  35.400  59.314  1.00 56.99  ? 287 PRO E CD    1 
ATOM 6431 N N     . ILE E 1 213 ? 26.706  38.693  59.835  1.00 66.45  ? 288 ILE E N     1 
ATOM 6432 C CA    . ILE E 1 213 ? 27.260  39.900  60.448  1.00 58.58  ? 288 ILE E CA    1 
ATOM 6433 C C     . ILE E 1 213 ? 28.739  39.737  60.723  1.00 63.35  ? 288 ILE E C     1 
ATOM 6434 O O     . ILE E 1 213 ? 29.564  40.549  60.301  1.00 73.01  ? 288 ILE E O     1 
ATOM 6435 C CB    . ILE E 1 213 ? 26.545  40.213  61.762  1.00 60.23  ? 288 ILE E CB    1 
ATOM 6436 C CG1   . ILE E 1 213 ? 25.234  40.909  61.496  1.00 66.26  ? 288 ILE E CG1   1 
ATOM 6437 C CG2   . ILE E 1 213 ? 27.472  40.994  62.698  1.00 40.66  ? 288 ILE E CG2   1 
ATOM 6438 C CD1   . ILE E 1 213 ? 24.699  41.415  62.756  1.00 59.86  ? 288 ILE E CD1   1 
ATOM 6439 N N     . LEU E 1 214 ? 29.093  38.707  61.479  1.00 71.19  ? 289 LEU E N     1 
ATOM 6440 C CA    . LEU E 1 214 ? 30.504  38.515  61.779  1.00 77.19  ? 289 LEU E CA    1 
ATOM 6441 C C     . LEU E 1 214 ? 31.298  38.245  60.502  1.00 68.59  ? 289 LEU E C     1 
ATOM 6442 O O     . LEU E 1 214 ? 32.439  38.695  60.363  1.00 53.72  ? 289 LEU E O     1 
ATOM 6443 C CB    . LEU E 1 214 ? 30.679  37.390  62.797  1.00 65.53  ? 289 LEU E CB    1 
ATOM 6444 C CG    . LEU E 1 214 ? 32.159  37.044  62.904  1.00 71.16  ? 289 LEU E CG    1 
ATOM 6445 C CD1   . LEU E 1 214 ? 32.588  37.024  64.357  1.00 81.53  ? 289 LEU E CD1   1 
ATOM 6446 C CD2   . LEU E 1 214 ? 32.474  35.708  62.177  1.00 82.26  ? 289 LEU E CD2   1 
ATOM 6447 N N     . ALA E 1 215 ? 30.715  37.510  59.558  1.00 68.25  ? 290 ALA E N     1 
ATOM 6448 C CA    . ALA E 1 215 ? 31.411  37.313  58.303  1.00 62.66  ? 290 ALA E CA    1 
ATOM 6449 C C     . ALA E 1 215 ? 31.826  38.655  57.769  1.00 59.35  ? 290 ALA E C     1 
ATOM 6450 O O     . ALA E 1 215 ? 33.011  38.873  57.526  1.00 63.00  ? 290 ALA E O     1 
ATOM 6451 C CB    . ALA E 1 215 ? 30.542  36.565  57.298  1.00 85.76  ? 290 ALA E CB    1 
ATOM 6452 N N     . CYS E 1 216 ? 30.878  39.606  57.729  1.00 54.95  ? 291 CYS E N     1 
ATOM 6453 C CA    . CYS E 1 216 ? 31.152  40.991  57.326  1.00 62.90  ? 291 CYS E CA    1 
ATOM 6454 C C     . CYS E 1 216 ? 32.363  41.593  58.029  1.00 56.67  ? 291 CYS E C     1 
ATOM 6455 O O     . CYS E 1 216 ? 33.282  42.101  57.379  1.00 47.06  ? 291 CYS E O     1 
ATOM 6456 C CB    . CYS E 1 216 ? 29.954  41.878  57.631  1.00 59.36  ? 291 CYS E CB    1 
ATOM 6457 S SG    . CYS E 1 216 ? 28.595  41.618  56.580  1.00 76.69  ? 291 CYS E SG    1 
ATOM 6458 N N     . LYS E 1 217 ? 32.358  41.578  59.367  1.00 46.36  ? 292 LYS E N     1 
ATOM 6459 C CA    . LYS E 1 217 ? 33.450  42.186  60.118  1.00 51.62  ? 292 LYS E CA    1 
ATOM 6460 C C     . LYS E 1 217 ? 34.794  41.742  59.579  1.00 56.72  ? 292 LYS E C     1 
ATOM 6461 O O     . LYS E 1 217 ? 35.702  42.556  59.392  1.00 68.41  ? 292 LYS E O     1 
ATOM 6462 C CB    . LYS E 1 217 ? 33.352  41.842  61.609  1.00 52.18  ? 292 LYS E CB    1 
ATOM 6463 C CG    . LYS E 1 217 ? 32.161  42.449  62.357  1.00 67.29  ? 292 LYS E CG    1 
ATOM 6464 C CD    . LYS E 1 217 ? 31.712  41.590  63.556  1.00 77.57  ? 292 LYS E CD    1 
ATOM 6465 C CE    . LYS E 1 217 ? 31.948  42.249  64.918  1.00 82.11  ? 292 LYS E CE    1 
ATOM 6466 N NZ    . LYS E 1 217 ? 33.291  42.906  65.019  1.00 96.50  ? 292 LYS E NZ    1 
ATOM 6467 N N     . ASN E 1 218 ? 34.931  40.459  59.290  1.00 57.67  ? 293 ASN E N     1 
ATOM 6468 C CA    . ASN E 1 218 ? 36.217  39.940  58.877  1.00 55.92  ? 293 ASN E CA    1 
ATOM 6469 C C     . ASN E 1 218 ? 36.471  40.136  57.399  1.00 64.69  ? 293 ASN E C     1 
ATOM 6470 O O     . ASN E 1 218 ? 37.622  40.043  56.958  1.00 72.10  ? 293 ASN E O     1 
ATOM 6471 C CB    . ASN E 1 218 ? 36.297  38.483  59.276  1.00 57.10  ? 293 ASN E CB    1 
ATOM 6472 C CG    . ASN E 1 218 ? 36.028  38.299  60.763  1.00 75.15  ? 293 ASN E CG    1 
ATOM 6473 O OD1   . ASN E 1 218 ? 36.866  38.641  61.609  1.00 70.48  ? 293 ASN E OD1   1 
ATOM 6474 N ND2   . ASN E 1 218 ? 34.840  37.788  61.094  1.00 80.37  ? 293 ASN E ND2   1 
ATOM 6475 N N     . ILE E 1 219 ? 35.423  40.403  56.631  1.00 62.14  ? 294 ILE E N     1 
ATOM 6476 C CA    . ILE E 1 219 ? 35.622  40.926  55.293  1.00 55.56  ? 294 ILE E CA    1 
ATOM 6477 C C     . ILE E 1 219 ? 36.338  42.243  55.398  1.00 55.62  ? 294 ILE E C     1 
ATOM 6478 O O     . ILE E 1 219 ? 37.340  42.489  54.718  1.00 45.06  ? 294 ILE E O     1 
ATOM 6479 C CB    . ILE E 1 219 ? 34.277  41.105  54.565  1.00 62.75  ? 294 ILE E CB    1 
ATOM 6480 C CG1   . ILE E 1 219 ? 33.356  39.912  54.794  1.00 63.41  ? 294 ILE E CG1   1 
ATOM 6481 C CG2   . ILE E 1 219 ? 34.505  41.365  53.071  1.00 53.11  ? 294 ILE E CG2   1 
ATOM 6482 C CD1   . ILE E 1 219 ? 34.047  38.533  54.636  1.00 81.41  ? 294 ILE E CD1   1 
ATOM 6483 N N     . VAL E 1 220 ? 35.809  43.115  56.260  1.00 60.35  ? 295 VAL E N     1 
ATOM 6484 C CA    . VAL E 1 220 ? 36.364  44.450  56.422  1.00 56.23  ? 295 VAL E CA    1 
ATOM 6485 C C     . VAL E 1 220 ? 37.819  44.342  56.768  1.00 52.23  ? 295 VAL E C     1 
ATOM 6486 O O     . VAL E 1 220 ? 38.693  44.807  56.030  1.00 57.49  ? 295 VAL E O     1 
ATOM 6487 C CB    . VAL E 1 220 ? 35.640  45.224  57.527  1.00 54.60  ? 295 VAL E CB    1 
ATOM 6488 C CG1   . VAL E 1 220 ? 36.409  46.498  57.779  1.00 49.86  ? 295 VAL E CG1   1 
ATOM 6489 C CG2   . VAL E 1 220 ? 34.194  45.493  57.177  1.00 56.20  ? 295 VAL E CG2   1 
ATOM 6490 N N     . LYS E 1 221 ? 38.099  43.670  57.875  1.00 48.68  ? 296 LYS E N     1 
ATOM 6491 C CA    . LYS E 1 221 ? 39.467  43.630  58.341  1.00 62.91  ? 296 LYS E CA    1 
ATOM 6492 C C     . LYS E 1 221 ? 40.394  43.066  57.255  1.00 59.10  ? 296 LYS E C     1 
ATOM 6493 O O     . LYS E 1 221 ? 41.601  43.345  57.265  1.00 56.71  ? 296 LYS E O     1 
ATOM 6494 C CB    . LYS E 1 221 ? 39.511  42.877  59.685  1.00 48.59  ? 296 LYS E CB    1 
ATOM 6495 C CG    . LYS E 1 221 ? 39.596  41.371  59.578  1.00 84.74  ? 296 LYS E CG    1 
ATOM 6496 C CD    . LYS E 1 221 ? 40.303  40.753  60.804  1.00 100.01 ? 296 LYS E CD    1 
ATOM 6497 C CE    . LYS E 1 221 ? 40.268  39.212  60.779  1.00 90.65  ? 296 LYS E CE    1 
ATOM 6498 N NZ    . LYS E 1 221 ? 39.488  38.646  61.937  1.00 72.98  ? 296 LYS E NZ    1 
ATOM 6499 N N     . TYR E 1 222 ? 39.834  42.369  56.263  1.00 58.04  ? 297 TYR E N     1 
ATOM 6500 C CA    . TYR E 1 222 ? 40.643  41.825  55.182  1.00 55.59  ? 297 TYR E CA    1 
ATOM 6501 C C     . TYR E 1 222 ? 41.059  42.913  54.192  1.00 57.58  ? 297 TYR E C     1 
ATOM 6502 O O     . TYR E 1 222 ? 42.239  43.033  53.850  1.00 60.20  ? 297 TYR E O     1 
ATOM 6503 C CB    . TYR E 1 222 ? 39.878  40.696  54.482  1.00 52.71  ? 297 TYR E CB    1 
ATOM 6504 C CG    . TYR E 1 222 ? 40.612  40.237  53.278  1.00 55.97  ? 297 TYR E CG    1 
ATOM 6505 C CD1   . TYR E 1 222 ? 41.888  39.739  53.406  1.00 66.95  ? 297 TYR E CD1   1 
ATOM 6506 C CD2   . TYR E 1 222 ? 40.073  40.366  52.007  1.00 55.05  ? 297 TYR E CD2   1 
ATOM 6507 C CE1   . TYR E 1 222 ? 42.609  39.346  52.315  1.00 81.56  ? 297 TYR E CE1   1 
ATOM 6508 C CE2   . TYR E 1 222 ? 40.783  39.975  50.890  1.00 60.66  ? 297 TYR E CE2   1 
ATOM 6509 C CZ    . TYR E 1 222 ? 42.065  39.459  51.048  1.00 79.47  ? 297 TYR E CZ    1 
ATOM 6510 O OH    . TYR E 1 222 ? 42.838  39.045  49.966  1.00 74.57  ? 297 TYR E OH    1 
ATOM 6511 N N     . PHE E 1 223 ? 40.100  43.711  53.714  1.00 58.84  ? 298 PHE E N     1 
ATOM 6512 C CA    . PHE E 1 223 ? 40.406  44.805  52.794  1.00 57.01  ? 298 PHE E CA    1 
ATOM 6513 C C     . PHE E 1 223 ? 41.431  45.738  53.406  1.00 59.03  ? 298 PHE E C     1 
ATOM 6514 O O     . PHE E 1 223 ? 42.393  46.177  52.747  1.00 51.65  ? 298 PHE E O     1 
ATOM 6515 C CB    . PHE E 1 223 ? 39.124  45.584  52.475  1.00 52.37  ? 298 PHE E CB    1 
ATOM 6516 C CG    . PHE E 1 223 ? 38.313  45.001  51.360  1.00 55.45  ? 298 PHE E CG    1 
ATOM 6517 C CD1   . PHE E 1 223 ? 37.739  43.757  51.475  1.00 64.06  ? 298 PHE E CD1   1 
ATOM 6518 C CD2   . PHE E 1 223 ? 38.116  45.702  50.194  1.00 63.09  ? 298 PHE E CD2   1 
ATOM 6519 C CE1   . PHE E 1 223 ? 36.998  43.218  50.435  1.00 52.62  ? 298 PHE E CE1   1 
ATOM 6520 C CE2   . PHE E 1 223 ? 37.378  45.165  49.162  1.00 62.41  ? 298 PHE E CE2   1 
ATOM 6521 C CZ    . PHE E 1 223 ? 36.820  43.924  49.293  1.00 55.73  ? 298 PHE E CZ    1 
ATOM 6522 N N     . LYS E 1 224 ? 41.222  46.045  54.685  1.00 53.46  ? 299 LYS E N     1 
ATOM 6523 C CA    . LYS E 1 224 ? 42.117  46.931  55.405  1.00 56.87  ? 299 LYS E CA    1 
ATOM 6524 C C     . LYS E 1 224 ? 43.541  46.387  55.405  1.00 56.58  ? 299 LYS E C     1 
ATOM 6525 O O     . LYS E 1 224 ? 44.495  47.152  55.208  1.00 70.69  ? 299 LYS E O     1 
ATOM 6526 C CB    . LYS E 1 224 ? 41.594  47.146  56.829  1.00 41.79  ? 299 LYS E CB    1 
ATOM 6527 C CG    . LYS E 1 224 ? 40.251  47.893  56.941  1.00 40.86  ? 299 LYS E CG    1 
ATOM 6528 C CD    . LYS E 1 224 ? 40.315  49.073  57.969  1.00 52.87  ? 299 LYS E CD    1 
ATOM 6529 C CE    . LYS E 1 224 ? 38.953  49.509  58.606  1.00 45.45  ? 299 LYS E CE    1 
ATOM 6530 N NZ    . LYS E 1 224 ? 38.451  50.893  58.216  1.00 73.00  ? 299 LYS E NZ    1 
ATOM 6531 N N     . LYS E 1 225 ? 43.702  45.062  55.598  1.00 63.16  ? 300 LYS E N     1 
ATOM 6532 C CA    . LYS E 1 225 ? 45.025  44.434  55.598  1.00 63.77  ? 300 LYS E CA    1 
ATOM 6533 C C     . LYS E 1 225 ? 45.556  44.234  54.192  1.00 47.45  ? 300 LYS E C     1 
ATOM 6534 O O     . LYS E 1 225 ? 46.702  44.566  53.899  1.00 58.48  ? 300 LYS E O     1 
ATOM 6535 C CB    . LYS E 1 225 ? 45.030  43.076  56.298  1.00 48.30  ? 300 LYS E CB    1 
ATOM 6536 C CG    . LYS E 1 225 ? 46.401  42.442  56.070  1.00 60.85  ? 300 LYS E CG    1 
ATOM 6537 C CD    . LYS E 1 225 ? 46.492  40.974  56.398  1.00 101.37 ? 300 LYS E CD    1 
ATOM 6538 C CE    . LYS E 1 225 ? 47.537  40.283  55.514  1.00 96.04  ? 300 LYS E CE    1 
ATOM 6539 N NZ    . LYS E 1 225 ? 47.769  38.907  56.038  1.00 112.26 ? 300 LYS E NZ    1 
ATOM 6540 N N     . ALA E 1 226 ? 44.753  43.695  53.313  1.00 47.81  ? 301 ALA E N     1 
ATOM 6541 C CA    . ALA E 1 226 ? 45.273  43.489  51.976  1.00 61.51  ? 301 ALA E CA    1 
ATOM 6542 C C     . ALA E 1 226 ? 45.398  44.776  51.223  1.00 72.23  ? 301 ALA E C     1 
ATOM 6543 O O     . ALA E 1 226 ? 45.852  44.750  50.065  1.00 73.32  ? 301 ALA E O     1 
ATOM 6544 C CB    . ALA E 1 226 ? 44.377  42.537  51.197  1.00 86.11  ? 301 ALA E CB    1 
ATOM 6545 N N     . ASN E 1 227 ? 44.955  45.871  51.854  1.00 73.24  ? 302 ASN E N     1 
ATOM 6546 C CA    . ASN E 1 227 ? 44.994  47.202  51.281  1.00 61.26  ? 302 ASN E CA    1 
ATOM 6547 C C     . ASN E 1 227 ? 44.410  47.126  49.878  1.00 67.72  ? 302 ASN E C     1 
ATOM 6548 O O     . ASN E 1 227 ? 45.099  47.259  48.856  1.00 66.76  ? 302 ASN E O     1 
ATOM 6549 C CB    . ASN E 1 227 ? 46.416  47.770  51.294  1.00 50.92  ? 302 ASN E CB    1 
ATOM 6550 C CG    . ASN E 1 227 ? 46.495  49.091  50.617  1.00 67.25  ? 302 ASN E CG    1 
ATOM 6551 O OD1   . ASN E 1 227 ? 45.540  49.884  50.685  1.00 68.31  ? 302 ASN E OD1   1 
ATOM 6552 N ND2   . ASN E 1 227 ? 47.622  49.356  49.934  1.00 57.16  ? 302 ASN E ND2   1 
ATOM 6553 N N     . LEU E 1 228 ? 43.155  46.706  49.877  1.00 54.79  ? 303 LEU E N     1 
ATOM 6554 C CA    . LEU E 1 228 ? 42.146  47.083  48.902  1.00 54.37  ? 303 LEU E CA    1 
ATOM 6555 C C     . LEU E 1 228 ? 41.446  48.276  49.534  1.00 68.90  ? 303 LEU E C     1 
ATOM 6556 O O     . LEU E 1 228 ? 42.056  48.974  50.346  1.00 90.18  ? 303 LEU E O     1 
ATOM 6557 C CB    . LEU E 1 228 ? 41.243  45.906  48.551  1.00 64.83  ? 303 LEU E CB    1 
ATOM 6558 C CG    . LEU E 1 228 ? 41.878  44.603  48.000  1.00 76.59  ? 303 LEU E CG    1 
ATOM 6559 C CD1   . LEU E 1 228 ? 43.345  44.772  47.608  1.00 81.13  ? 303 LEU E CD1   1 
ATOM 6560 C CD2   . LEU E 1 228 ? 41.703  43.355  48.909  1.00 58.80  ? 303 LEU E CD2   1 
ATOM 6561 N N     . GLN E 1 229 ? 40.219  48.561  49.137  1.00 66.52  ? 304 GLN E N     1 
ATOM 6562 C CA    . GLN E 1 229 ? 39.461  49.743  49.566  1.00 82.29  ? 304 GLN E CA    1 
ATOM 6563 C C     . GLN E 1 229 ? 39.728  50.925  48.660  1.00 81.31  ? 304 GLN E C     1 
ATOM 6564 O O     . GLN E 1 229 ? 38.917  51.860  48.603  1.00 66.30  ? 304 GLN E O     1 
ATOM 6565 C CB    . GLN E 1 229 ? 39.787  50.240  50.998  1.00 52.33  ? 304 GLN E CB    1 
ATOM 6566 C CG    . GLN E 1 229 ? 39.486  49.339  52.135  1.00 53.61  ? 304 GLN E CG    1 
ATOM 6567 C CD    . GLN E 1 229 ? 38.702  50.047  53.245  1.00 71.14  ? 304 GLN E CD    1 
ATOM 6568 O OE1   . GLN E 1 229 ? 37.466  49.961  53.320  1.00 41.58  ? 304 GLN E OE1   1 
ATOM 6569 N NE2   . GLN E 1 229 ? 39.427  50.756  54.120  1.00 88.62  ? 304 GLN E NE2   1 
ATOM 6570 N N     . HIS E 1 230 ? 40.828  50.887  47.919  1.00 79.22  ? 305 HIS E N     1 
ATOM 6571 C CA    . HIS E 1 230 ? 41.089  52.068  47.124  1.00 89.52  ? 305 HIS E CA    1 
ATOM 6572 C C     . HIS E 1 230 ? 40.339  52.021  45.813  1.00 78.65  ? 305 HIS E C     1 
ATOM 6573 O O     . HIS E 1 230 ? 39.961  53.069  45.273  1.00 81.35  ? 305 HIS E O     1 
ATOM 6574 C CB    . HIS E 1 230 ? 42.579  52.259  46.919  1.00 95.46  ? 305 HIS E CB    1 
ATOM 6575 C CG    . HIS E 1 230 ? 43.331  51.013  46.595  1.00 78.34  ? 305 HIS E CG    1 
ATOM 6576 N ND1   . HIS E 1 230 ? 43.612  50.636  45.299  1.00 71.14  ? 305 HIS E ND1   1 
ATOM 6577 C CD2   . HIS E 1 230 ? 43.938  50.109  47.395  1.00 80.32  ? 305 HIS E CD2   1 
ATOM 6578 C CE1   . HIS E 1 230 ? 44.329  49.530  45.314  1.00 74.81  ? 305 HIS E CE1   1 
ATOM 6579 N NE2   . HIS E 1 230 ? 44.541  49.187  46.571  1.00 85.28  ? 305 HIS E NE2   1 
ATOM 6580 N N     . ARG E 1 231 ? 40.071  50.827  45.324  1.00 77.88  ? 306 ARG E N     1 
ATOM 6581 C CA    . ARG E 1 231 ? 39.173  50.679  44.196  1.00 93.14  ? 306 ARG E CA    1 
ATOM 6582 C C     . ARG E 1 231 ? 37.859  50.262  44.815  1.00 70.84  ? 306 ARG E C     1 
ATOM 6583 O O     . ARG E 1 231 ? 37.590  49.079  44.950  1.00 66.98  ? 306 ARG E O     1 
ATOM 6584 C CB    . ARG E 1 231 ? 39.699  49.584  43.294  1.00 103.42 ? 306 ARG E CB    1 
ATOM 6585 C CG    . ARG E 1 231 ? 40.299  48.464  44.145  1.00 87.81  ? 306 ARG E CG    1 
ATOM 6586 C CD    . ARG E 1 231 ? 40.128  47.167  43.483  1.00 88.85  ? 306 ARG E CD    1 
ATOM 6587 N NE    . ARG E 1 231 ? 41.294  46.331  43.680  1.00 120.90 ? 306 ARG E NE    1 
ATOM 6588 C CZ    . ARG E 1 231 ? 41.403  45.094  43.215  1.00 137.98 ? 306 ARG E CZ    1 
ATOM 6589 N NH1   . ARG E 1 231 ? 40.410  44.546  42.527  1.00 142.93 ? 306 ARG E NH1   1 
ATOM 6590 N NH2   . ARG E 1 231 ? 42.506  44.400  43.442  1.00 138.13 ? 306 ARG E NH2   1 
ATOM 6591 N N     . LEU E 1 232 ? 37.037  51.239  45.181  1.00 64.76  ? 307 LEU E N     1 
ATOM 6592 C CA    . LEU E 1 232 ? 35.740  50.940  45.768  1.00 68.71  ? 307 LEU E CA    1 
ATOM 6593 C C     . LEU E 1 232 ? 34.710  52.038  45.506  1.00 86.50  ? 307 LEU E C     1 
ATOM 6594 O O     . LEU E 1 232 ? 33.575  51.759  45.095  1.00 93.31  ? 307 LEU E O     1 
ATOM 6595 C CB    . LEU E 1 232 ? 35.886  50.611  47.244  1.00 60.62  ? 307 LEU E CB    1 
ATOM 6596 C CG    . LEU E 1 232 ? 36.303  49.169  47.637  1.00 64.28  ? 307 LEU E CG    1 
ATOM 6597 C CD1   . LEU E 1 232 ? 36.181  48.929  49.127  1.00 71.03  ? 307 LEU E CD1   1 
ATOM 6598 C CD2   . LEU E 1 232 ? 35.552  48.052  46.919  1.00 65.67  ? 307 LEU E CD2   1 
ATOM 6599 N N     . ARG E 1 233 ? 35.065  53.269  45.874  1.00 78.17  ? 308 ARG E N     1 
ATOM 6600 C CA    . ARG E 1 233 ? 34.252  54.483  45.883  1.00 81.57  ? 308 ARG E CA    1 
ATOM 6601 C C     . ARG E 1 233 ? 33.509  54.612  47.192  1.00 73.69  ? 308 ARG E C     1 
ATOM 6602 O O     . ARG E 1 233 ? 32.951  55.666  47.469  1.00 83.10  ? 308 ARG E O     1 
ATOM 6603 C CB    . ARG E 1 233 ? 33.244  54.580  44.719  1.00 107.53 ? 308 ARG E CB    1 
ATOM 6604 C CG    . ARG E 1 233 ? 33.059  56.020  44.178  1.00 128.60 ? 308 ARG E CG    1 
ATOM 6605 C CD    . ARG E 1 233 ? 31.711  56.257  43.482  1.00 110.99 ? 308 ARG E CD    1 
ATOM 6606 N NE    . ARG E 1 233 ? 31.388  55.202  42.523  1.00 136.17 ? 308 ARG E NE    1 
ATOM 6607 C CZ    . ARG E 1 233 ? 31.571  55.287  41.207  1.00 138.69 ? 308 ARG E CZ    1 
ATOM 6608 N NH1   . ARG E 1 233 ? 32.080  56.392  40.670  1.00 122.02 ? 308 ARG E NH1   1 
ATOM 6609 N NH2   . ARG E 1 233 ? 31.235  54.261  40.424  1.00 135.51 ? 308 ARG E NH2   1 
ATOM 6610 N N     . SER E 1 234 ? 33.498  53.587  48.008  1.00 68.11  ? 309 SER E N     1 
ATOM 6611 C CA    . SER E 1 234 ? 33.364  53.766  49.439  1.00 67.01  ? 309 SER E CA    1 
ATOM 6612 C C     . SER E 1 234 ? 34.450  52.921  50.093  1.00 69.54  ? 309 SER E C     1 
ATOM 6613 O O     . SER E 1 234 ? 34.923  51.958  49.503  1.00 66.87  ? 309 SER E O     1 
ATOM 6614 C CB    . SER E 1 234 ? 31.974  53.383  49.938  1.00 54.84  ? 309 SER E CB    1 
ATOM 6615 O OG    . SER E 1 234 ? 31.315  54.522  50.466  1.00 78.50  ? 309 SER E OG    1 
ATOM 6616 N N     . SER E 1 235 ? 34.903  53.323  51.272  1.00 57.70  ? 310 SER E N     1 
ATOM 6617 C CA    . SER E 1 235 ? 35.752  52.459  52.068  1.00 43.05  ? 310 SER E CA    1 
ATOM 6618 C C     . SER E 1 235 ? 34.847  51.589  52.921  1.00 52.83  ? 310 SER E C     1 
ATOM 6619 O O     . SER E 1 235 ? 33.751  52.007  53.304  1.00 48.93  ? 310 SER E O     1 
ATOM 6620 C CB    . SER E 1 235 ? 36.703  53.273  52.944  1.00 46.02  ? 310 SER E CB    1 
ATOM 6621 O OG    . SER E 1 235 ? 35.994  54.202  53.747  1.00 44.98  ? 310 SER E OG    1 
ATOM 6622 N N     . LEU E 1 236 ? 35.273  50.354  53.177  1.00 57.79  ? 311 LEU E N     1 
ATOM 6623 C CA    . LEU E 1 236 ? 34.508  49.524  54.099  1.00 43.50  ? 311 LEU E CA    1 
ATOM 6624 C C     . LEU E 1 236 ? 34.751  50.022  55.505  1.00 48.16  ? 311 LEU E C     1 
ATOM 6625 O O     . LEU E 1 236 ? 35.843  50.504  55.829  1.00 53.37  ? 311 LEU E O     1 
ATOM 6626 C CB    . LEU E 1 236 ? 34.898  48.060  53.982  1.00 55.08  ? 311 LEU E CB    1 
ATOM 6627 C CG    . LEU E 1 236 ? 34.362  47.062  52.935  1.00 53.38  ? 311 LEU E CG    1 
ATOM 6628 C CD1   . LEU E 1 236 ? 33.686  47.686  51.735  1.00 48.01  ? 311 LEU E CD1   1 
ATOM 6629 C CD2   . LEU E 1 236 ? 35.525  46.170  52.492  1.00 54.73  ? 311 LEU E CD2   1 
ATOM 6630 N N     . LYS E 1 237 ? 33.706  49.992  56.312  1.00 47.02  ? 312 LYS E N     1 
ATOM 6631 C CA    . LYS E 1 237 ? 33.742  50.677  57.595  1.00 58.07  ? 312 LYS E CA    1 
ATOM 6632 C C     . LYS E 1 237 ? 33.622  49.614  58.667  1.00 51.01  ? 312 LYS E C     1 
ATOM 6633 O O     . LYS E 1 237 ? 32.513  49.190  58.993  1.00 54.06  ? 312 LYS E O     1 
ATOM 6634 C CB    . LYS E 1 237 ? 32.618  51.723  57.727  1.00 45.13  ? 312 LYS E CB    1 
ATOM 6635 C CG    . LYS E 1 237 ? 32.513  52.704  56.604  1.00 37.58  ? 312 LYS E CG    1 
ATOM 6636 C CD    . LYS E 1 237 ? 33.827  53.392  56.369  1.00 43.68  ? 312 LYS E CD    1 
ATOM 6637 C CE    . LYS E 1 237 ? 33.642  54.847  55.882  1.00 47.79  ? 312 LYS E CE    1 
ATOM 6638 N NZ    . LYS E 1 237 ? 33.466  54.916  54.441  1.00 37.66  ? 312 LYS E NZ    1 
ATOM 6639 N N     . SER E 1 238 ? 34.739  49.309  59.309  1.00 41.88  ? 313 SER E N     1 
ATOM 6640 C CA    . SER E 1 238 ? 34.739  48.340  60.394  1.00 61.73  ? 313 SER E CA    1 
ATOM 6641 C C     . SER E 1 238 ? 33.721  48.672  61.490  1.00 64.64  ? 313 SER E C     1 
ATOM 6642 O O     . SER E 1 238 ? 33.556  49.826  61.898  1.00 56.37  ? 313 SER E O     1 
ATOM 6643 C CB    . SER E 1 238 ? 36.143  48.247  60.994  1.00 53.81  ? 313 SER E CB    1 
ATOM 6644 O OG    . SER E 1 238 ? 36.086  48.512  62.376  1.00 48.17  ? 313 SER E OG    1 
ATOM 6645 N N     . GLU E 1 239 ? 33.129  47.596  61.996  1.00 78.75  ? 314 GLU E N     1 
ATOM 6646 C CA    . GLU E 1 239 ? 32.248  47.692  63.155  1.00 81.15  ? 314 GLU E CA    1 
ATOM 6647 C C     . GLU E 1 239 ? 33.233  47.766  64.283  1.00 82.93  ? 314 GLU E C     1 
ATOM 6648 O O     . GLU E 1 239 ? 34.164  46.980  64.307  1.00 92.21  ? 314 GLU E O     1 
ATOM 6649 C CB    . GLU E 1 239 ? 31.381  46.447  63.408  1.00 83.61  ? 314 GLU E CB    1 
ATOM 6650 C CG    . GLU E 1 239 ? 31.713  45.753  64.737  1.00 85.59  ? 314 GLU E CG    1 
ATOM 6651 C CD    . GLU E 1 239 ? 30.523  45.285  65.554  1.00 91.46  ? 314 GLU E CD    1 
ATOM 6652 O OE1   . GLU E 1 239 ? 29.585  44.760  64.918  1.00 94.54  ? 314 GLU E OE1   1 
ATOM 6653 O OE2   . GLU E 1 239 ? 30.542  45.434  66.796  1.00 89.81  ? 314 GLU E OE2   1 
ATOM 6654 N N     . CYS E 1 240 ? 33.102  48.683  65.179  1.00 80.61  ? 315 CYS E N     1 
ATOM 6655 C CA    . CYS E 1 240 ? 33.998  48.582  66.240  1.00 80.05  ? 315 CYS E CA    1 
ATOM 6656 C C     . CYS E 1 240 ? 33.196  48.034  67.392  1.00 80.83  ? 315 CYS E C     1 
ATOM 6657 O O     . CYS E 1 240 ? 32.000  48.355  67.515  1.00 80.34  ? 315 CYS E O     1 
ATOM 6658 C CB    . CYS E 1 240 ? 34.629  49.930  66.557  1.00 78.09  ? 315 CYS E CB    1 
ATOM 6659 S SG    . CYS E 1 240 ? 35.241  50.096  68.258  1.00 116.72 ? 315 CYS E SG    1 
ATOM 6660 N N     . PRO E 1 241 ? 33.780  47.212  68.266  1.00 99.32  ? 316 PRO E N     1 
ATOM 6661 C CA    . PRO E 1 241 ? 33.014  46.731  69.432  1.00 102.84 ? 316 PRO E CA    1 
ATOM 6662 C C     . PRO E 1 241 ? 32.461  47.840  70.320  1.00 90.87  ? 316 PRO E C     1 
ATOM 6663 O O     . PRO E 1 241 ? 31.281  47.803  70.680  1.00 103.66 ? 316 PRO E O     1 
ATOM 6664 C CB    . PRO E 1 241 ? 34.044  45.864  70.173  1.00 107.50 ? 316 PRO E CB    1 
ATOM 6665 C CG    . PRO E 1 241 ? 35.397  46.315  69.629  1.00 84.74  ? 316 PRO E CG    1 
ATOM 6666 C CD    . PRO E 1 241 ? 35.111  46.589  68.196  1.00 101.17 ? 316 PRO E CD    1 
ATOM 6667 N N     . THR E 1 242 ? 33.276  48.848  70.644  1.00 91.16  ? 317 THR E N     1 
ATOM 6668 C CA    . THR E 1 242 ? 33.005  49.826  71.702  1.00 88.74  ? 317 THR E CA    1 
ATOM 6669 C C     . THR E 1 242 ? 31.805  50.744  71.429  1.00 95.17  ? 317 THR E C     1 
ATOM 6670 O O     . THR E 1 242 ? 31.263  51.336  72.371  1.00 84.00  ? 317 THR E O     1 
ATOM 6671 C CB    . THR E 1 242 ? 34.289  50.656  71.932  1.00 105.64 ? 317 THR E CB    1 
ATOM 6672 O OG1   . THR E 1 242 ? 34.913  50.258  73.156  1.00 114.53 ? 317 THR E OG1   1 
ATOM 6673 C CG2   . THR E 1 242 ? 34.044  52.166  71.960  1.00 102.62 ? 317 THR E CG2   1 
ATOM 6674 N N     . ARG E 1 243 ? 31.356  50.876  70.189  1.00 93.07  ? 318 ARG E N     1 
ATOM 6675 C CA    . ARG E 1 243 ? 30.350  51.879  69.891  1.00 84.25  ? 318 ARG E CA    1 
ATOM 6676 C C     . ARG E 1 243 ? 29.121  51.231  69.258  1.00 93.75  ? 318 ARG E C     1 
ATOM 6677 O O     . ARG E 1 243 ? 29.144  50.066  68.844  1.00 94.81  ? 318 ARG E O     1 
ATOM 6678 C CB    . ARG E 1 243 ? 30.945  52.999  69.021  1.00 95.46  ? 318 ARG E CB    1 
ATOM 6679 C CG    . ARG E 1 243 ? 31.016  54.404  69.747  1.00 119.17 ? 318 ARG E CG    1 
ATOM 6680 C CD    . ARG E 1 243 ? 29.587  54.917  70.123  1.00 115.61 ? 318 ARG E CD    1 
ATOM 6681 N NE    . ARG E 1 243 ? 29.472  56.204  70.831  1.00 121.52 ? 318 ARG E NE    1 
ATOM 6682 C CZ    . ARG E 1 243 ? 29.458  56.338  72.159  1.00 115.13 ? 318 ARG E CZ    1 
ATOM 6683 N NH1   . ARG E 1 243 ? 29.598  55.267  72.925  1.00 105.41 ? 318 ARG E NH1   1 
ATOM 6684 N NH2   . ARG E 1 243 ? 29.326  57.537  72.730  1.00 103.17 ? 318 ARG E NH2   1 
ATOM 6685 N N     . TRP E 1 244 ? 28.023  52.008  69.210  1.00 111.19 ? 319 TRP E N     1 
ATOM 6686 C CA    . TRP E 1 244 ? 26.689  51.448  69.003  1.00 96.64  ? 319 TRP E CA    1 
ATOM 6687 C C     . TRP E 1 244 ? 26.527  51.107  67.548  1.00 86.97  ? 319 TRP E C     1 
ATOM 6688 O O     . TRP E 1 244 ? 26.273  51.985  66.713  1.00 64.07  ? 319 TRP E O     1 
ATOM 6689 C CB    . TRP E 1 244 ? 25.585  52.433  69.358  1.00 90.03  ? 319 TRP E CB    1 
ATOM 6690 C CG    . TRP E 1 244 ? 25.944  53.463  70.338  1.00 99.68  ? 319 TRP E CG    1 
ATOM 6691 C CD1   . TRP E 1 244 ? 26.070  54.811  70.116  1.00 105.42 ? 319 TRP E CD1   1 
ATOM 6692 C CD2   . TRP E 1 244 ? 26.211  53.251  71.731  1.00 110.08 ? 319 TRP E CD2   1 
ATOM 6693 N NE1   . TRP E 1 244 ? 26.411  55.451  71.292  1.00 116.86 ? 319 TRP E NE1   1 
ATOM 6694 C CE2   . TRP E 1 244 ? 26.503  54.518  72.298  1.00 113.31 ? 319 TRP E CE2   1 
ATOM 6695 C CE3   . TRP E 1 244 ? 26.240  52.110  72.555  1.00 93.06  ? 319 TRP E CE3   1 
ATOM 6696 C CZ2   . TRP E 1 244 ? 26.811  54.677  73.666  1.00 115.21 ? 319 TRP E CZ2   1 
ATOM 6697 C CZ3   . TRP E 1 244 ? 26.557  52.268  73.910  1.00 84.50  ? 319 TRP E CZ3   1 
ATOM 6698 C CH2   . TRP E 1 244 ? 26.839  53.541  74.450  1.00 99.15  ? 319 TRP E CH2   1 
ATOM 6699 N N     . ASN E 1 245 ? 26.565  49.820  67.287  1.00 89.75  ? 320 ASN E N     1 
ATOM 6700 C CA    . ASN E 1 245 ? 26.269  49.281  65.986  1.00 103.11 ? 320 ASN E CA    1 
ATOM 6701 C C     . ASN E 1 245 ? 26.793  50.236  64.910  1.00 81.36  ? 320 ASN E C     1 
ATOM 6702 O O     . ASN E 1 245 ? 26.085  50.728  64.033  1.00 89.00  ? 320 ASN E O     1 
ATOM 6703 C CB    . ASN E 1 245 ? 24.773  48.944  65.896  1.00 109.21 ? 320 ASN E CB    1 
ATOM 6704 C CG    . ASN E 1 245 ? 24.352  47.860  66.956  1.00 101.96 ? 320 ASN E CG    1 
ATOM 6705 O OD1   . ASN E 1 245 ? 24.468  48.079  68.178  1.00 82.47  ? 320 ASN E OD1   1 
ATOM 6706 N ND2   . ASN E 1 245 ? 23.897  46.691  66.476  1.00 88.24  ? 320 ASN E ND2   1 
ATOM 6707 N N     . SER E 1 246 ? 28.104  50.438  64.986  1.00 66.21  ? 321 SER E N     1 
ATOM 6708 C CA    . SER E 1 246 ? 28.859  50.641  63.767  1.00 75.97  ? 321 SER E CA    1 
ATOM 6709 C C     . SER E 1 246 ? 28.494  49.568  62.780  1.00 70.42  ? 321 SER E C     1 
ATOM 6710 O O     . SER E 1 246 ? 28.766  49.708  61.586  1.00 67.16  ? 321 SER E O     1 
ATOM 6711 C CB    . SER E 1 246 ? 30.345  50.557  64.073  1.00 72.44  ? 321 SER E CB    1 
ATOM 6712 O OG    . SER E 1 246 ? 30.510  49.880  65.302  1.00 58.42  ? 321 SER E OG    1 
ATOM 6713 N N     . THR E 1 247 ? 27.943  48.472  63.309  1.00 73.70  ? 322 THR E N     1 
ATOM 6714 C CA    . THR E 1 247 ? 27.292  47.415  62.565  1.00 66.35  ? 322 THR E CA    1 
ATOM 6715 C C     . THR E 1 247 ? 26.388  47.993  61.503  1.00 64.69  ? 322 THR E C     1 
ATOM 6716 O O     . THR E 1 247 ? 26.456  47.588  60.334  1.00 50.76  ? 322 THR E O     1 
ATOM 6717 C CB    . THR E 1 247 ? 26.494  46.562  63.554  1.00 76.17  ? 322 THR E CB    1 
ATOM 6718 O OG1   . THR E 1 247 ? 27.223  46.455  64.785  1.00 66.92  ? 322 THR E OG1   1 
ATOM 6719 C CG2   . THR E 1 247 ? 26.210  45.158  63.001  1.00 74.52  ? 322 THR E CG2   1 
ATOM 6720 N N     . TYR E 1 248 ? 25.543  48.958  61.889  1.00 61.19  ? 323 TYR E N     1 
ATOM 6721 C CA    . TYR E 1 248 ? 24.828  49.698  60.860  1.00 63.74  ? 323 TYR E CA    1 
ATOM 6722 C C     . TYR E 1 248 ? 25.867  50.167  59.851  1.00 68.79  ? 323 TYR E C     1 
ATOM 6723 O O     . TYR E 1 248 ? 25.922  49.634  58.728  1.00 61.72  ? 323 TYR E O     1 
ATOM 6724 C CB    . TYR E 1 248 ? 24.047  50.886  61.426  1.00 59.53  ? 323 TYR E CB    1 
ATOM 6725 C CG    . TYR E 1 248 ? 23.246  51.667  60.385  1.00 58.45  ? 323 TYR E CG    1 
ATOM 6726 C CD1   . TYR E 1 248 ? 23.409  51.438  59.031  1.00 67.50  ? 323 TYR E CD1   1 
ATOM 6727 C CD2   . TYR E 1 248 ? 22.297  52.593  60.762  1.00 57.08  ? 323 TYR E CD2   1 
ATOM 6728 C CE1   . TYR E 1 248 ? 22.690  52.109  58.086  1.00 74.87  ? 323 TYR E CE1   1 
ATOM 6729 C CE2   . TYR E 1 248 ? 21.575  53.276  59.829  1.00 62.47  ? 323 TYR E CE2   1 
ATOM 6730 C CZ    . TYR E 1 248 ? 21.769  53.030  58.478  1.00 84.28  ? 323 TYR E CZ    1 
ATOM 6731 O OH    . TYR E 1 248 ? 21.054  53.712  57.503  1.00 97.30  ? 323 TYR E OH    1 
ATOM 6732 N N     . THR E 1 249 ? 26.719  51.120  60.272  1.00 61.30  ? 324 THR E N     1 
ATOM 6733 C CA    . THR E 1 249 ? 27.626  51.792  59.345  1.00 49.09  ? 324 THR E CA    1 
ATOM 6734 C C     . THR E 1 249 ? 28.489  50.793  58.587  1.00 59.98  ? 324 THR E C     1 
ATOM 6735 O O     . THR E 1 249 ? 28.775  50.986  57.399  1.00 60.31  ? 324 THR E O     1 
ATOM 6736 C CB    . THR E 1 249 ? 28.504  52.803  60.074  1.00 39.99  ? 324 THR E CB    1 
ATOM 6737 O OG1   . THR E 1 249 ? 29.758  52.199  60.378  1.00 81.23  ? 324 THR E OG1   1 
ATOM 6738 C CG2   . THR E 1 249 ? 27.885  53.207  61.364  1.00 62.23  ? 324 THR E CG2   1 
ATOM 6739 N N     . MET E 1 250 ? 28.900  49.706  59.245  1.00 69.38  ? 325 MET E N     1 
ATOM 6740 C CA    . MET E 1 250 ? 29.541  48.627  58.510  1.00 60.08  ? 325 MET E CA    1 
ATOM 6741 C C     . MET E 1 250 ? 28.601  48.004  57.500  1.00 60.82  ? 325 MET E C     1 
ATOM 6742 O O     . MET E 1 250 ? 28.890  47.990  56.298  1.00 52.46  ? 325 MET E O     1 
ATOM 6743 C CB    . MET E 1 250 ? 30.016  47.535  59.426  1.00 58.03  ? 325 MET E CB    1 
ATOM 6744 C CG    . MET E 1 250 ? 30.461  46.396  58.556  1.00 57.19  ? 325 MET E CG    1 
ATOM 6745 S SD    . MET E 1 250 ? 30.890  45.141  59.664  1.00 63.39  ? 325 MET E SD    1 
ATOM 6746 C CE    . MET E 1 250 ? 29.372  45.124  60.569  1.00 64.40  ? 325 MET E CE    1 
ATOM 6747 N N     . LEU E 1 251 ? 27.476  47.453  57.978  1.00 58.34  ? 326 LEU E N     1 
ATOM 6748 C CA    . LEU E 1 251 ? 26.622  46.702  57.070  1.00 57.03  ? 326 LEU E CA    1 
ATOM 6749 C C     . LEU E 1 251 ? 26.253  47.568  55.892  1.00 67.81  ? 326 LEU E C     1 
ATOM 6750 O O     . LEU E 1 251 ? 26.383  47.142  54.742  1.00 72.55  ? 326 LEU E O     1 
ATOM 6751 C CB    . LEU E 1 251 ? 25.367  46.169  57.754  1.00 53.36  ? 326 LEU E CB    1 
ATOM 6752 C CG    . LEU E 1 251 ? 25.506  45.079  58.829  1.00 57.60  ? 326 LEU E CG    1 
ATOM 6753 C CD1   . LEU E 1 251 ? 24.144  44.651  59.268  1.00 53.68  ? 326 LEU E CD1   1 
ATOM 6754 C CD2   . LEU E 1 251 ? 26.366  43.866  58.452  1.00 49.56  ? 326 LEU E CD2   1 
ATOM 6755 N N     . ARG E 1 252 ? 25.885  48.824  56.143  1.00 60.24  ? 327 ARG E N     1 
ATOM 6756 C CA    . ARG E 1 252 ? 25.689  49.701  55.002  1.00 60.54  ? 327 ARG E CA    1 
ATOM 6757 C C     . ARG E 1 252 ? 26.969  49.829  54.192  1.00 54.46  ? 327 ARG E C     1 
ATOM 6758 O O     . ARG E 1 252 ? 26.935  49.788  52.963  1.00 53.94  ? 327 ARG E O     1 
ATOM 6759 C CB    . ARG E 1 252 ? 25.182  51.071  55.426  1.00 57.87  ? 327 ARG E CB    1 
ATOM 6760 C CG    . ARG E 1 252 ? 24.021  51.525  54.528  1.00 86.71  ? 327 ARG E CG    1 
ATOM 6761 C CD    . ARG E 1 252 ? 23.863  53.032  54.508  1.00 106.36 ? 327 ARG E CD    1 
ATOM 6762 N NE    . ARG E 1 252 ? 23.930  53.571  53.148  1.00 117.84 ? 327 ARG E NE    1 
ATOM 6763 C CZ    . ARG E 1 252 ? 24.468  54.748  52.827  1.00 122.31 ? 327 ARG E CZ    1 
ATOM 6764 N NH1   . ARG E 1 252 ? 25.014  55.535  53.757  1.00 120.30 ? 327 ARG E NH1   1 
ATOM 6765 N NH2   . ARG E 1 252 ? 24.475  55.134  51.559  1.00 126.16 ? 327 ARG E NH2   1 
ATOM 6766 N N     . SER E 1 253 ? 28.116  49.954  54.839  1.00 44.88  ? 328 SER E N     1 
ATOM 6767 C CA    . SER E 1 253 ? 29.273  50.276  54.023  1.00 51.18  ? 328 SER E CA    1 
ATOM 6768 C C     . SER E 1 253 ? 29.636  49.102  53.149  1.00 54.37  ? 328 SER E C     1 
ATOM 6769 O O     . SER E 1 253 ? 30.039  49.284  51.998  1.00 56.53  ? 328 SER E O     1 
ATOM 6770 C CB    . SER E 1 253 ? 30.453  50.690  54.881  1.00 52.68  ? 328 SER E CB    1 
ATOM 6771 O OG    . SER E 1 253 ? 31.170  49.557  55.302  1.00 59.57  ? 328 SER E OG    1 
ATOM 6772 N N     . ILE E 1 254 ? 29.469  47.892  53.691  1.00 66.03  ? 329 ILE E N     1 
ATOM 6773 C CA    . ILE E 1 254 ? 29.615  46.633  52.957  1.00 58.86  ? 329 ILE E CA    1 
ATOM 6774 C C     . ILE E 1 254 ? 28.494  46.478  51.944  1.00 61.08  ? 329 ILE E C     1 
ATOM 6775 O O     . ILE E 1 254 ? 28.693  45.946  50.843  1.00 62.24  ? 329 ILE E O     1 
ATOM 6776 C CB    . ILE E 1 254 ? 29.617  45.466  53.966  1.00 65.95  ? 329 ILE E CB    1 
ATOM 6777 C CG1   . ILE E 1 254 ? 31.024  44.942  54.233  1.00 70.11  ? 329 ILE E CG1   1 
ATOM 6778 C CG2   . ILE E 1 254 ? 28.706  44.355  53.544  1.00 56.46  ? 329 ILE E CG2   1 
ATOM 6779 C CD1   . ILE E 1 254 ? 31.189  44.451  55.665  1.00 69.99  ? 329 ILE E CD1   1 
ATOM 6780 N N     . LEU E 1 255 ? 27.297  46.952  52.303  1.00 55.88  ? 330 LEU E N     1 
ATOM 6781 C CA    . LEU E 1 255 ? 26.147  46.877  51.409  1.00 63.58  ? 330 LEU E CA    1 
ATOM 6782 C C     . LEU E 1 255 ? 26.304  47.802  50.201  1.00 69.66  ? 330 LEU E C     1 
ATOM 6783 O O     . LEU E 1 255 ? 26.002  47.409  49.067  1.00 63.55  ? 330 LEU E O     1 
ATOM 6784 C CB    . LEU E 1 255 ? 24.889  47.218  52.198  1.00 62.31  ? 330 LEU E CB    1 
ATOM 6785 C CG    . LEU E 1 255 ? 23.482  47.109  51.642  1.00 77.92  ? 330 LEU E CG    1 
ATOM 6786 C CD1   . LEU E 1 255 ? 22.976  45.656  51.590  1.00 74.22  ? 330 LEU E CD1   1 
ATOM 6787 C CD2   . LEU E 1 255 ? 22.588  47.980  52.527  1.00 85.30  ? 330 LEU E CD2   1 
ATOM 6788 N N     . ASP E 1 256 ? 26.774  49.035  50.422  1.00 71.67  ? 331 ASP E N     1 
ATOM 6789 C CA    . ASP E 1 256 ? 26.861  49.984  49.324  1.00 59.15  ? 331 ASP E CA    1 
ATOM 6790 C C     . ASP E 1 256 ? 27.932  49.585  48.316  1.00 72.03  ? 331 ASP E C     1 
ATOM 6791 O O     . ASP E 1 256 ? 27.966  50.136  47.214  1.00 83.47  ? 331 ASP E O     1 
ATOM 6792 C CB    . ASP E 1 256 ? 27.115  51.395  49.856  1.00 57.61  ? 331 ASP E CB    1 
ATOM 6793 C CG    . ASP E 1 256 ? 26.056  51.861  50.869  1.00 77.48  ? 331 ASP E CG    1 
ATOM 6794 O OD1   . ASP E 1 256 ? 26.410  52.640  51.790  1.00 70.81  ? 331 ASP E OD1   1 
ATOM 6795 O OD2   . ASP E 1 256 ? 24.872  51.468  50.751  1.00 83.73  ? 331 ASP E OD2   1 
ATOM 6796 N N     . ASN E 1 257 ? 28.826  48.672  48.673  1.00 69.53  ? 332 ASN E N     1 
ATOM 6797 C CA    . ASN E 1 257 ? 29.878  48.197  47.777  1.00 86.85  ? 332 ASN E CA    1 
ATOM 6798 C C     . ASN E 1 257 ? 29.609  46.820  47.192  1.00 86.40  ? 332 ASN E C     1 
ATOM 6799 O O     . ASN E 1 257 ? 30.513  46.207  46.604  1.00 84.17  ? 332 ASN E O     1 
ATOM 6800 C CB    . ASN E 1 257 ? 31.219  48.256  48.488  1.00 84.33  ? 332 ASN E CB    1 
ATOM 6801 C CG    . ASN E 1 257 ? 31.701  49.665  48.613  1.00 75.66  ? 332 ASN E CG    1 
ATOM 6802 O OD1   . ASN E 1 257 ? 31.204  50.428  49.463  1.00 69.46  ? 332 ASN E OD1   1 
ATOM 6803 N ND2   . ASN E 1 257 ? 32.615  50.059  47.716  1.00 74.86  ? 332 ASN E ND2   1 
ATOM 6804 N N     . TRP E 1 258 ? 28.390  46.327  47.352  1.00 83.85  ? 333 TRP E N     1 
ATOM 6805 C CA    . TRP E 1 258 ? 28.105  44.910  47.235  1.00 89.96  ? 333 TRP E CA    1 
ATOM 6806 C C     . TRP E 1 258 ? 28.758  44.191  46.055  1.00 86.06  ? 333 TRP E C     1 
ATOM 6807 O O     . TRP E 1 258 ? 29.455  43.189  46.240  1.00 73.39  ? 333 TRP E O     1 
ATOM 6808 C CB    . TRP E 1 258 ? 26.594  44.750  47.145  1.00 87.90  ? 333 TRP E CB    1 
ATOM 6809 C CG    . TRP E 1 258 ? 26.285  43.359  47.193  1.00 93.25  ? 333 TRP E CG    1 
ATOM 6810 C CD1   . TRP E 1 258 ? 25.733  42.613  46.219  1.00 97.65  ? 333 TRP E CD1   1 
ATOM 6811 C CD2   . TRP E 1 258 ? 26.598  42.472  48.263  1.00 90.49  ? 333 TRP E CD2   1 
ATOM 6812 N NE1   . TRP E 1 258 ? 25.637  41.310  46.629  1.00 89.78  ? 333 TRP E NE1   1 
ATOM 6813 C CE2   . TRP E 1 258 ? 26.169  41.201  47.883  1.00 74.96  ? 333 TRP E CE2   1 
ATOM 6814 C CE3   . TRP E 1 258 ? 27.173  42.641  49.521  1.00 87.36  ? 333 TRP E CE3   1 
ATOM 6815 C CZ2   . TRP E 1 258 ? 26.302  40.103  48.701  1.00 75.32  ? 333 TRP E CZ2   1 
ATOM 6816 C CZ3   . TRP E 1 258 ? 27.298  41.550  50.330  1.00 93.32  ? 333 TRP E CZ3   1 
ATOM 6817 C CH2   . TRP E 1 258 ? 26.866  40.294  49.918  1.00 81.58  ? 333 TRP E CH2   1 
ATOM 6818 N N     . GLU E 1 259 ? 28.560  44.687  44.836  1.00 84.17  ? 334 GLU E N     1 
ATOM 6819 C CA    . GLU E 1 259 ? 29.058  43.940  43.691  1.00 88.18  ? 334 GLU E CA    1 
ATOM 6820 C C     . GLU E 1 259 ? 30.573  43.975  43.654  1.00 93.55  ? 334 GLU E C     1 
ATOM 6821 O O     . GLU E 1 259 ? 31.218  42.951  43.381  1.00 79.80  ? 334 GLU E O     1 
ATOM 6822 C CB    . GLU E 1 259 ? 28.484  44.482  42.383  1.00 98.78  ? 334 GLU E CB    1 
ATOM 6823 C CG    . GLU E 1 259 ? 27.033  44.882  42.443  1.00 108.37 ? 334 GLU E CG    1 
ATOM 6824 C CD    . GLU E 1 259 ? 26.843  46.227  43.126  1.00 126.05 ? 334 GLU E CD    1 
ATOM 6825 O OE1   . GLU E 1 259 ? 27.671  47.145  42.877  1.00 127.66 ? 334 GLU E OE1   1 
ATOM 6826 O OE2   . GLU E 1 259 ? 25.888  46.346  43.933  1.00 114.83 ? 334 GLU E OE2   1 
ATOM 6827 N N     . SER E 1 260 ? 31.153  45.146  43.932  1.00 93.83  ? 335 SER E N     1 
ATOM 6828 C CA    . SER E 1 260 ? 32.606  45.270  43.910  1.00 94.91  ? 335 SER E CA    1 
ATOM 6829 C C     . SER E 1 260 ? 33.229  44.262  44.857  1.00 78.55  ? 335 SER E C     1 
ATOM 6830 O O     . SER E 1 260 ? 34.171  43.548  44.501  1.00 76.86  ? 335 SER E O     1 
ATOM 6831 C CB    . SER E 1 260 ? 33.026  46.693  44.285  1.00 93.85  ? 335 SER E CB    1 
ATOM 6832 O OG    . SER E 1 260 ? 32.212  47.665  43.649  1.00 108.85 ? 335 SER E OG    1 
ATOM 6833 N N     . VAL E 1 261 ? 32.659  44.142  46.047  1.00 76.80  ? 336 VAL E N     1 
ATOM 6834 C CA    . VAL E 1 261 ? 33.274  43.325  47.085  1.00 87.48  ? 336 VAL E CA    1 
ATOM 6835 C C     . VAL E 1 261 ? 33.424  41.875  46.631  1.00 86.69  ? 336 VAL E C     1 
ATOM 6836 O O     . VAL E 1 261 ? 34.517  41.301  46.706  1.00 83.57  ? 336 VAL E O     1 
ATOM 6837 C CB    . VAL E 1 261 ? 32.480  43.451  48.394  1.00 83.11  ? 336 VAL E CB    1 
ATOM 6838 C CG1   . VAL E 1 261 ? 32.465  42.144  49.149  1.00 52.01  ? 336 VAL E CG1   1 
ATOM 6839 C CG2   . VAL E 1 261 ? 33.104  44.553  49.225  1.00 57.08  ? 336 VAL E CG2   1 
ATOM 6840 N N     . ILE E 1 262 ? 32.348  41.264  46.126  1.00 93.05  ? 337 ILE E N     1 
ATOM 6841 C CA    . ILE E 1 262 ? 32.478  39.882  45.663  1.00 90.27  ? 337 ILE E CA    1 
ATOM 6842 C C     . ILE E 1 262 ? 33.431  39.791  44.491  1.00 85.51  ? 337 ILE E C     1 
ATOM 6843 O O     . ILE E 1 262 ? 34.168  38.812  44.357  1.00 91.01  ? 337 ILE E O     1 
ATOM 6844 C CB    . ILE E 1 262 ? 31.131  39.287  45.264  1.00 70.40  ? 337 ILE E CB    1 
ATOM 6845 C CG1   . ILE E 1 262 ? 30.002  40.130  45.786  1.00 83.30  ? 337 ILE E CG1   1 
ATOM 6846 C CG2   . ILE E 1 262 ? 31.101  37.877  45.698  1.00 98.12  ? 337 ILE E CG2   1 
ATOM 6847 C CD1   . ILE E 1 262 ? 29.165  40.602  44.643  1.00 100.72 ? 337 ILE E CD1   1 
ATOM 6848 N N     . GLN E 1 263 ? 33.361  40.752  43.578  1.00 83.45  ? 338 GLN E N     1 
ATOM 6849 C CA    . GLN E 1 263 ? 34.273  40.761  42.453  1.00 84.38  ? 338 GLN E CA    1 
ATOM 6850 C C     . GLN E 1 263 ? 35.662  40.614  43.053  1.00 86.85  ? 338 GLN E C     1 
ATOM 6851 O O     . GLN E 1 263 ? 36.309  39.563  42.932  1.00 78.57  ? 338 GLN E O     1 
ATOM 6852 C CB    . GLN E 1 263 ? 34.097  42.053  41.624  1.00 84.49  ? 338 GLN E CB    1 
ATOM 6853 C CG    . GLN E 1 263 ? 34.918  42.119  40.313  1.00 92.45  ? 338 GLN E CG    1 
ATOM 6854 C CD    . GLN E 1 263 ? 34.068  42.313  39.039  1.00 126.86 ? 338 GLN E CD    1 
ATOM 6855 O OE1   . GLN E 1 263 ? 33.000  42.932  39.079  1.00 141.57 ? 338 GLN E OE1   1 
ATOM 6856 N NE2   . GLN E 1 263 ? 34.551  41.784  37.902  1.00 134.45 ? 338 GLN E NE2   1 
ATOM 6857 N N     . ILE E 1 264 ? 36.057  41.630  43.814  1.00 87.14  ? 339 ILE E N     1 
ATOM 6858 C CA    . ILE E 1 264 ? 37.437  41.731  44.261  1.00 86.92  ? 339 ILE E CA    1 
ATOM 6859 C C     . ILE E 1 264 ? 37.809  40.508  45.068  1.00 88.43  ? 339 ILE E C     1 
ATOM 6860 O O     . ILE E 1 264 ? 38.944  40.021  45.012  1.00 96.76  ? 339 ILE E O     1 
ATOM 6861 C CB    . ILE E 1 264 ? 37.634  43.027  45.063  1.00 78.56  ? 339 ILE E CB    1 
ATOM 6862 C CG1   . ILE E 1 264 ? 37.360  44.240  44.183  1.00 75.24  ? 339 ILE E CG1   1 
ATOM 6863 C CG2   . ILE E 1 264 ? 39.027  43.102  45.596  1.00 86.41  ? 339 ILE E CG2   1 
ATOM 6864 C CD1   . ILE E 1 264 ? 36.782  45.383  44.942  1.00 74.63  ? 339 ILE E CD1   1 
ATOM 6865 N N     . LEU E 1 265 ? 36.849  39.982  45.815  1.00 86.58  ? 340 LEU E N     1 
ATOM 6866 C CA    . LEU E 1 265 ? 37.138  38.942  46.791  1.00 94.30  ? 340 LEU E CA    1 
ATOM 6867 C C     . LEU E 1 265 ? 37.238  37.569  46.153  1.00 92.32  ? 340 LEU E C     1 
ATOM 6868 O O     . LEU E 1 265 ? 38.159  36.800  46.455  1.00 89.19  ? 340 LEU E O     1 
ATOM 6869 C CB    . LEU E 1 265 ? 36.061  38.953  47.862  1.00 90.50  ? 340 LEU E CB    1 
ATOM 6870 C CG    . LEU E 1 265 ? 36.692  39.007  49.229  1.00 76.65  ? 340 LEU E CG    1 
ATOM 6871 C CD1   . LEU E 1 265 ? 35.692  39.511  50.223  1.00 56.65  ? 340 LEU E CD1   1 
ATOM 6872 C CD2   . LEU E 1 265 ? 37.148  37.614  49.543  1.00 86.81  ? 340 LEU E CD2   1 
ATOM 6873 N N     . SER E 1 266 ? 36.257  37.232  45.315  1.00 98.73  ? 341 SER E N     1 
ATOM 6874 C CA    . SER E 1 266 ? 36.343  36.022  44.517  1.00 95.06  ? 341 SER E CA    1 
ATOM 6875 C C     . SER E 1 266 ? 37.550  36.093  43.615  1.00 103.81 ? 341 SER E C     1 
ATOM 6876 O O     . SER E 1 266 ? 38.405  35.197  43.635  1.00 98.58  ? 341 SER E O     1 
ATOM 6877 C CB    . SER E 1 266 ? 35.063  35.826  43.706  1.00 102.17 ? 341 SER E CB    1 
ATOM 6878 O OG    . SER E 1 266 ? 33.939  35.695  44.567  1.00 112.61 ? 341 SER E OG    1 
ATOM 6879 N N     . GLU E 1 267 ? 37.680  37.200  42.875  1.00 93.49  ? 342 GLU E N     1 
ATOM 6880 C CA    . GLU E 1 267 ? 38.819  37.341  41.977  1.00 113.45 ? 342 GLU E CA    1 
ATOM 6881 C C     . GLU E 1 267 ? 40.146  37.390  42.735  1.00 107.90 ? 342 GLU E C     1 
ATOM 6882 O O     . GLU E 1 267 ? 41.215  37.364  42.113  1.00 96.53  ? 342 GLU E O     1 
ATOM 6883 C CB    . GLU E 1 267 ? 38.615  38.563  41.066  1.00 103.18 ? 342 GLU E CB    1 
ATOM 6884 C CG    . GLU E 1 267 ? 39.050  39.912  41.593  1.00 106.26 ? 342 GLU E CG    1 
ATOM 6885 C CD    . GLU E 1 267 ? 38.593  41.044  40.673  1.00 110.46 ? 342 GLU E CD    1 
ATOM 6886 O OE1   . GLU E 1 267 ? 37.816  40.759  39.733  1.00 106.82 ? 342 GLU E OE1   1 
ATOM 6887 O OE2   . GLU E 1 267 ? 39.002  42.209  40.886  1.00 117.52 ? 342 GLU E OE2   1 
ATOM 6888 N N     . ALA E 1 268 ? 40.102  37.447  44.058  1.00 103.51 ? 343 ALA E N     1 
ATOM 6889 C CA    . ALA E 1 268 ? 41.249  37.146  44.888  1.00 97.95  ? 343 ALA E CA    1 
ATOM 6890 C C     . ALA E 1 268 ? 41.267  35.698  45.336  1.00 101.73 ? 343 ALA E C     1 
ATOM 6891 O O     . ALA E 1 268 ? 42.150  35.324  46.118  1.00 112.12 ? 343 ALA E O     1 
ATOM 6892 C CB    . ALA E 1 268 ? 41.267  38.052  46.117  1.00 101.41 ? 343 ALA E CB    1 
ATOM 6893 N N     . GLY E 1 269 ? 40.296  34.886  44.902  1.00 82.25  ? 344 GLY E N     1 
ATOM 6894 C CA    . GLY E 1 269 ? 40.259  33.501  45.346  1.00 97.05  ? 344 GLY E CA    1 
ATOM 6895 C C     . GLY E 1 269 ? 40.097  33.342  46.835  1.00 102.74 ? 344 GLY E C     1 
ATOM 6896 O O     . GLY E 1 269 ? 40.226  32.227  47.365  1.00 95.47  ? 344 GLY E O     1 
ATOM 6897 N N     . GLU E 1 270 ? 39.844  34.449  47.521  1.00 111.20 ? 345 GLU E N     1 
ATOM 6898 C CA    . GLU E 1 270 ? 39.497  34.490  48.926  1.00 108.00 ? 345 GLU E CA    1 
ATOM 6899 C C     . GLU E 1 270 ? 37.994  34.416  49.135  1.00 109.37 ? 345 GLU E C     1 
ATOM 6900 O O     . GLU E 1 270 ? 37.532  34.644  50.253  1.00 101.78 ? 345 GLU E O     1 
ATOM 6901 C CB    . GLU E 1 270 ? 40.058  35.756  49.580  1.00 81.86  ? 345 GLU E CB    1 
ATOM 6902 C CG    . GLU E 1 270 ? 41.554  35.732  49.817  1.00 85.74  ? 345 GLU E CG    1 
ATOM 6903 C CD    . GLU E 1 270 ? 41.925  35.106  51.150  1.00 94.97  ? 345 GLU E CD    1 
ATOM 6904 O OE1   . GLU E 1 270 ? 41.219  34.165  51.551  1.00 92.38  ? 345 GLU E OE1   1 
ATOM 6905 O OE2   . GLU E 1 270 ? 42.912  35.553  51.800  1.00 97.48  ? 345 GLU E OE2   1 
ATOM 6906 N N     . THR E 1 271 ? 37.225  34.134  48.074  1.00 117.15 ? 346 THR E N     1 
ATOM 6907 C CA    . THR E 1 271 ? 35.759  34.168  48.075  1.00 116.12 ? 346 THR E CA    1 
ATOM 6908 C C     . THR E 1 271 ? 35.126  33.262  49.129  1.00 110.00 ? 346 THR E C     1 
ATOM 6909 O O     . THR E 1 271 ? 33.911  33.345  49.363  1.00 83.57  ? 346 THR E O     1 
ATOM 6910 C CB    . THR E 1 271 ? 35.251  33.749  46.697  1.00 116.66 ? 346 THR E CB    1 
ATOM 6911 O OG1   . THR E 1 271 ? 33.866  34.111  46.548  1.00 92.98  ? 346 THR E OG1   1 
ATOM 6912 C CG2   . THR E 1 271 ? 35.485  32.228  46.480  1.00 101.82 ? 346 THR E CG2   1 
ATOM 6913 N N     . GLN E 1 272 ? 35.907  32.389  49.760  1.00 109.51 ? 347 GLN E N     1 
ATOM 6914 C CA    . GLN E 1 272 ? 35.362  31.605  50.852  1.00 96.43  ? 347 GLN E CA    1 
ATOM 6915 C C     . GLN E 1 272 ? 34.812  32.474  51.981  1.00 92.76  ? 347 GLN E C     1 
ATOM 6916 O O     . GLN E 1 272 ? 34.124  31.952  52.858  1.00 100.63 ? 347 GLN E O     1 
ATOM 6917 C CB    . GLN E 1 272 ? 36.434  30.654  51.378  1.00 96.99  ? 347 GLN E CB    1 
ATOM 6918 C CG    . GLN E 1 272 ? 37.509  31.307  52.219  1.00 93.78  ? 347 GLN E CG    1 
ATOM 6919 C CD    . GLN E 1 272 ? 38.896  31.015  51.691  1.00 108.79 ? 347 GLN E CD    1 
ATOM 6920 O OE1   . GLN E 1 272 ? 39.100  30.904  50.474  1.00 129.48 ? 347 GLN E OE1   1 
ATOM 6921 N NE2   . GLN E 1 272 ? 39.863  30.881  52.599  1.00 89.14  ? 347 GLN E NE2   1 
ATOM 6922 N N     . ARG E 1 273 ? 35.086  33.775  51.984  1.00 97.55  ? 348 ARG E N     1 
ATOM 6923 C CA    . ARG E 1 273 ? 34.629  34.671  53.038  1.00 92.23  ? 348 ARG E CA    1 
ATOM 6924 C C     . ARG E 1 273 ? 33.260  35.271  52.766  1.00 91.36  ? 348 ARG E C     1 
ATOM 6925 O O     . ARG E 1 273 ? 32.671  35.880  53.665  1.00 91.35  ? 348 ARG E O     1 
ATOM 6926 C CB    . ARG E 1 273 ? 35.646  35.794  53.224  1.00 85.72  ? 348 ARG E CB    1 
ATOM 6927 C CG    . ARG E 1 273 ? 37.064  35.274  53.251  1.00 87.95  ? 348 ARG E CG    1 
ATOM 6928 C CD    . ARG E 1 273 ? 38.041  36.292  52.752  1.00 75.44  ? 348 ARG E CD    1 
ATOM 6929 N NE    . ARG E 1 273 ? 39.333  36.148  53.396  1.00 74.21  ? 348 ARG E NE    1 
ATOM 6930 C CZ    . ARG E 1 273 ? 39.558  36.463  54.661  1.00 70.46  ? 348 ARG E CZ    1 
ATOM 6931 N NH1   . ARG E 1 273 ? 38.558  36.926  55.428  1.00 59.56  ? 348 ARG E NH1   1 
ATOM 6932 N NH2   . ARG E 1 273 ? 40.786  36.303  55.147  1.00 67.31  ? 348 ARG E NH2   1 
ATOM 6933 N N     . ILE E 1 274 ? 32.759  35.143  51.545  1.00 87.98  ? 349 ILE E N     1 
ATOM 6934 C CA    . ILE E 1 274 ? 31.453  35.659  51.195  1.00 85.61  ? 349 ILE E CA    1 
ATOM 6935 C C     . ILE E 1 274 ? 30.385  34.554  51.213  1.00 95.65  ? 349 ILE E C     1 
ATOM 6936 O O     . ILE E 1 274 ? 29.226  34.811  50.902  1.00 87.94  ? 349 ILE E O     1 
ATOM 6937 C CB    . ILE E 1 274 ? 31.571  36.442  49.861  1.00 85.11  ? 349 ILE E CB    1 
ATOM 6938 C CG1   . ILE E 1 274 ? 30.246  36.776  49.177  1.00 99.40  ? 349 ILE E CG1   1 
ATOM 6939 C CG2   . ILE E 1 274 ? 32.588  35.834  48.901  1.00 80.53  ? 349 ILE E CG2   1 
ATOM 6940 C CD1   . ILE E 1 274 ? 30.042  38.283  48.929  1.00 88.41  ? 349 ILE E CD1   1 
ATOM 6941 N N     . VAL E 1 275 ? 30.742  33.340  51.662  1.00 110.30 ? 350 VAL E N     1 
ATOM 6942 C CA    . VAL E 1 275 ? 29.920  32.144  51.406  1.00 113.36 ? 350 VAL E CA    1 
ATOM 6943 C C     . VAL E 1 275 ? 28.615  32.117  52.193  1.00 114.99 ? 350 VAL E C     1 
ATOM 6944 O O     . VAL E 1 275 ? 27.669  31.436  51.779  1.00 125.99 ? 350 VAL E O     1 
ATOM 6945 C CB    . VAL E 1 275 ? 30.694  30.835  51.669  1.00 101.68 ? 350 VAL E CB    1 
ATOM 6946 C CG1   . VAL E 1 275 ? 31.912  30.758  50.787  1.00 113.63 ? 350 VAL E CG1   1 
ATOM 6947 C CG2   . VAL E 1 275 ? 31.038  30.670  53.153  1.00 102.36 ? 350 VAL E CG2   1 
ATOM 6948 N N     . HIS E 1 276 ? 28.525  32.776  53.344  1.00 106.02 ? 351 HIS E N     1 
ATOM 6949 C CA    . HIS E 1 276 ? 27.222  32.900  53.994  1.00 102.38 ? 351 HIS E CA    1 
ATOM 6950 C C     . HIS E 1 276 ? 26.820  34.370  53.901  1.00 100.39 ? 351 HIS E C     1 
ATOM 6951 O O     . HIS E 1 276 ? 27.267  35.209  54.688  1.00 117.89 ? 351 HIS E O     1 
ATOM 6952 C CB    . HIS E 1 276 ? 27.266  32.338  55.412  1.00 102.90 ? 351 HIS E CB    1 
ATOM 6953 C CG    . HIS E 1 276 ? 27.125  30.836  55.461  1.00 127.78 ? 351 HIS E CG    1 
ATOM 6954 N ND1   . HIS E 1 276 ? 28.188  29.990  55.716  1.00 106.16 ? 351 HIS E ND1   1 
ATOM 6955 C CD2   . HIS E 1 276 ? 26.045  30.032  55.269  1.00 123.73 ? 351 HIS E CD2   1 
ATOM 6956 C CE1   . HIS E 1 276 ? 27.766  28.739  55.698  1.00 113.23 ? 351 HIS E CE1   1 
ATOM 6957 N NE2   . HIS E 1 276 ? 26.469  28.736  55.429  1.00 120.32 ? 351 HIS E NE2   1 
ATOM 6958 N N     . ILE E 1 277 ? 25.903  34.647  52.975  1.00 95.54  ? 352 ILE E N     1 
ATOM 6959 C CA    . ILE E 1 277 ? 25.792  35.947  52.320  1.00 101.70 ? 352 ILE E CA    1 
ATOM 6960 C C     . ILE E 1 277 ? 24.432  36.591  52.554  1.00 126.77 ? 352 ILE E C     1 
ATOM 6961 O O     . ILE E 1 277 ? 24.288  37.478  53.406  1.00 132.77 ? 352 ILE E O     1 
ATOM 6962 C CB    . ILE E 1 277 ? 26.010  35.794  50.803  1.00 99.97  ? 352 ILE E CB    1 
ATOM 6963 C CG1   . ILE E 1 277 ? 26.323  34.329  50.427  1.00 119.22 ? 352 ILE E CG1   1 
ATOM 6964 C CG2   . ILE E 1 277 ? 27.032  36.752  50.332  1.00 88.54  ? 352 ILE E CG2   1 
ATOM 6965 C CD1   . ILE E 1 277 ? 26.599  34.074  48.933  1.00 108.74 ? 352 ILE E CD1   1 
ATOM 6966 N N     . ASN E 1 278 ? 23.433  36.124  51.799  1.00 132.08 ? 353 ASN E N     1 
ATOM 6967 C CA    . ASN E 1 278 ? 22.056  36.630  51.792  1.00 116.19 ? 353 ASN E CA    1 
ATOM 6968 C C     . ASN E 1 278 ? 22.024  38.155  51.804  1.00 113.02 ? 353 ASN E C     1 
ATOM 6969 O O     . ASN E 1 278 ? 21.507  38.792  52.724  1.00 110.30 ? 353 ASN E O     1 
ATOM 6970 C CB    . ASN E 1 278 ? 21.245  36.056  52.955  1.00 122.60 ? 353 ASN E CB    1 
ATOM 6971 C CG    . ASN E 1 278 ? 20.017  35.281  52.486  1.00 132.57 ? 353 ASN E CG    1 
ATOM 6972 O OD1   . ASN E 1 278 ? 19.519  35.491  51.372  1.00 134.78 ? 353 ASN E OD1   1 
ATOM 6973 N ND2   . ASN E 1 278 ? 19.523  34.379  53.337  1.00 124.55 ? 353 ASN E ND2   1 
ATOM 6974 N N     . LYS E 1 279 ? 22.575  38.728  50.727  1.00 107.03 ? 354 LYS E N     1 
ATOM 6975 C CA    . LYS E 1 279 ? 22.555  40.173  50.546  1.00 89.65  ? 354 LYS E CA    1 
ATOM 6976 C C     . LYS E 1 279 ? 21.151  40.722  50.707  1.00 94.76  ? 354 LYS E C     1 
ATOM 6977 O O     . LYS E 1 279 ? 20.971  41.889  51.070  1.00 99.28  ? 354 LYS E O     1 
ATOM 6978 C CB    . LYS E 1 279 ? 23.089  40.533  49.169  1.00 82.61  ? 354 LYS E CB    1 
ATOM 6979 C CG    . LYS E 1 279 ? 22.013  40.900  48.177  1.00 96.20  ? 354 LYS E CG    1 
ATOM 6980 C CD    . LYS E 1 279 ? 22.419  42.095  47.366  1.00 86.71  ? 354 LYS E CD    1 
ATOM 6981 C CE    . LYS E 1 279 ? 22.636  43.310  48.235  1.00 83.33  ? 354 LYS E CE    1 
ATOM 6982 N NZ    . LYS E 1 279 ? 23.193  44.420  47.419  1.00 88.27  ? 354 LYS E NZ    1 
ATOM 6983 N N     . SER E 1 280 ? 20.148  39.897  50.420  1.00 98.37  ? 355 SER E N     1 
ATOM 6984 C CA    . SER E 1 280 ? 18.779  40.209  50.799  1.00 110.82 ? 355 SER E CA    1 
ATOM 6985 C C     . SER E 1 280 ? 18.673  40.437  52.302  1.00 100.31 ? 355 SER E C     1 
ATOM 6986 O O     . SER E 1 280 ? 18.299  41.521  52.767  1.00 86.94  ? 355 SER E O     1 
ATOM 6987 C CB    . SER E 1 280 ? 17.860  39.057  50.366  1.00 119.74 ? 355 SER E CB    1 
ATOM 6988 O OG    . SER E 1 280 ? 18.110  37.866  51.107  1.00 110.65 ? 355 SER E OG    1 
ATOM 6989 N N     . ILE E 1 281 ? 19.034  39.419  53.079  1.00 99.20  ? 356 ILE E N     1 
ATOM 6990 C CA    . ILE E 1 281 ? 18.869  39.497  54.512  1.00 98.64  ? 356 ILE E CA    1 
ATOM 6991 C C     . ILE E 1 281 ? 19.743  40.609  55.103  1.00 96.32  ? 356 ILE E C     1 
ATOM 6992 O O     . ILE E 1 281 ? 19.403  41.179  56.143  1.00 90.87  ? 356 ILE E O     1 
ATOM 6993 C CB    . ILE E 1 281 ? 19.113  38.074  55.082  1.00 93.11  ? 356 ILE E CB    1 
ATOM 6994 C CG1   . ILE E 1 281 ? 17.765  37.403  55.499  1.00 106.10 ? 356 ILE E CG1   1 
ATOM 6995 C CG2   . ILE E 1 281 ? 20.190  38.068  56.167  1.00 66.52  ? 356 ILE E CG2   1 
ATOM 6996 C CD1   . ILE E 1 281 ? 16.484  37.667  54.560  1.00 73.87  ? 356 ILE E CD1   1 
ATOM 6997 N N     . ILE E 1 282 ? 20.809  41.010  54.415  1.00 98.22  ? 357 ILE E N     1 
ATOM 6998 C CA    . ILE E 1 282 ? 21.633  42.101  54.925  1.00 88.59  ? 357 ILE E CA    1 
ATOM 6999 C C     . ILE E 1 282 ? 20.936  43.440  54.752  1.00 76.43  ? 357 ILE E C     1 
ATOM 7000 O O     . ILE E 1 282 ? 20.770  44.183  55.723  1.00 74.83  ? 357 ILE E O     1 
ATOM 7001 C CB    . ILE E 1 282 ? 23.020  42.071  54.266  1.00 92.02  ? 357 ILE E CB    1 
ATOM 7002 C CG1   . ILE E 1 282 ? 23.922  41.155  55.098  1.00 94.00  ? 357 ILE E CG1   1 
ATOM 7003 C CG2   . ILE E 1 282 ? 23.604  43.468  54.122  1.00 67.26  ? 357 ILE E CG2   1 
ATOM 7004 C CD1   . ILE E 1 282 ? 23.247  40.604  56.383  1.00 88.10  ? 357 ILE E CD1   1 
ATOM 7005 N N     . GLN E 1 283 ? 20.466  43.747  53.542  1.00 77.59  ? 358 GLN E N     1 
ATOM 7006 C CA    . GLN E 1 283 ? 19.668  44.959  53.370  1.00 86.79  ? 358 GLN E CA    1 
ATOM 7007 C C     . GLN E 1 283 ? 18.622  45.073  54.467  1.00 85.77  ? 358 GLN E C     1 
ATOM 7008 O O     . GLN E 1 283 ? 18.387  46.158  55.014  1.00 85.99  ? 358 GLN E O     1 
ATOM 7009 C CB    . GLN E 1 283 ? 18.968  44.977  52.009  1.00 55.93  ? 358 GLN E CB    1 
ATOM 7010 C CG    . GLN E 1 283 ? 19.122  46.266  51.249  1.00 45.80  ? 358 GLN E CG    1 
ATOM 7011 C CD    . GLN E 1 283 ? 18.715  47.538  52.045  1.00 88.24  ? 358 GLN E CD    1 
ATOM 7012 O OE1   . GLN E 1 283 ? 19.158  48.642  51.720  1.00 107.10 ? 358 GLN E OE1   1 
ATOM 7013 N NE2   . GLN E 1 283 ? 17.850  47.393  53.045  1.00 73.64  ? 358 GLN E NE2   1 
ATOM 7014 N N     . THR E 1 284 ? 17.995  43.955  54.805  1.00 81.57  ? 359 THR E N     1 
ATOM 7015 C CA    . THR E 1 284 ? 17.001  43.950  55.863  1.00 81.37  ? 359 THR E CA    1 
ATOM 7016 C C     . THR E 1 284 ? 17.587  44.497  57.149  1.00 82.49  ? 359 THR E C     1 
ATOM 7017 O O     . THR E 1 284 ? 16.993  45.359  57.803  1.00 82.05  ? 359 THR E O     1 
ATOM 7018 C CB    . THR E 1 284 ? 16.494  42.527  56.079  1.00 92.26  ? 359 THR E CB    1 
ATOM 7019 O OG1   . THR E 1 284 ? 16.487  41.826  54.827  1.00 99.02  ? 359 THR E OG1   1 
ATOM 7020 C CG2   . THR E 1 284 ? 15.090  42.541  56.686  1.00 84.57  ? 359 THR E CG2   1 
ATOM 7021 N N     . MET E 1 285 ? 18.762  44.004  57.527  1.00 83.61  ? 360 MET E N     1 
ATOM 7022 C CA    . MET E 1 285 ? 19.335  44.429  58.792  1.00 84.27  ? 360 MET E CA    1 
ATOM 7023 C C     . MET E 1 285 ? 19.635  45.925  58.774  1.00 83.43  ? 360 MET E C     1 
ATOM 7024 O O     . MET E 1 285 ? 19.205  46.665  59.671  1.00 80.30  ? 360 MET E O     1 
ATOM 7025 C CB    . MET E 1 285 ? 20.600  43.629  59.104  1.00 89.03  ? 360 MET E CB    1 
ATOM 7026 C CG    . MET E 1 285 ? 20.703  42.235  58.505  1.00 77.39  ? 360 MET E CG    1 
ATOM 7027 S SD    . MET E 1 285 ? 21.636  41.228  59.657  1.00 87.27  ? 360 MET E SD    1 
ATOM 7028 C CE    . MET E 1 285 ? 20.545  41.506  61.026  1.00 61.71  ? 360 MET E CE    1 
ATOM 7029 N N     . VAL E 1 286 ? 20.341  46.402  57.742  1.00 56.52  ? 361 VAL E N     1 
ATOM 7030 C CA    . VAL E 1 286 ? 20.701  47.815  57.767  1.00 86.71  ? 361 VAL E CA    1 
ATOM 7031 C C     . VAL E 1 286 ? 19.451  48.698  57.840  1.00 91.95  ? 361 VAL E C     1 
ATOM 7032 O O     . VAL E 1 286 ? 19.469  49.775  58.458  1.00 80.15  ? 361 VAL E O     1 
ATOM 7033 C CB    . VAL E 1 286 ? 21.608  48.159  56.569  1.00 82.13  ? 361 VAL E CB    1 
ATOM 7034 C CG1   . VAL E 1 286 ? 21.962  46.909  55.814  1.00 65.40  ? 361 VAL E CG1   1 
ATOM 7035 C CG2   . VAL E 1 286 ? 20.976  49.235  55.678  1.00 88.55  ? 361 VAL E CG2   1 
ATOM 7036 N N     . ASN E 1 287 ? 18.333  48.237  57.273  1.00 92.00  ? 362 ASN E N     1 
ATOM 7037 C CA    . ASN E 1 287 ? 17.105  49.020  57.361  1.00 94.27  ? 362 ASN E CA    1 
ATOM 7038 C C     . ASN E 1 287 ? 16.518  48.959  58.767  1.00 84.30  ? 362 ASN E C     1 
ATOM 7039 O O     . ASN E 1 287 ? 16.255  50.001  59.376  1.00 89.88  ? 362 ASN E O     1 
ATOM 7040 C CB    . ASN E 1 287 ? 16.090  48.554  56.312  1.00 94.45  ? 362 ASN E CB    1 
ATOM 7041 C CG    . ASN E 1 287 ? 16.332  49.182  54.932  1.00 95.11  ? 362 ASN E CG    1 
ATOM 7042 O OD1   . ASN E 1 287 ? 15.740  48.758  53.934  1.00 77.25  ? 362 ASN E OD1   1 
ATOM 7043 N ND2   . ASN E 1 287 ? 17.215  50.188  54.873  1.00 93.42  ? 362 ASN E ND2   1 
ATOM 7044 N N     . ILE E 1 288 ? 16.322  47.749  59.305  1.00 80.18  ? 363 ILE E N     1 
ATOM 7045 C CA    . ILE E 1 288 ? 15.940  47.603  60.713  1.00 78.18  ? 363 ILE E CA    1 
ATOM 7046 C C     . ILE E 1 288 ? 16.863  48.435  61.583  1.00 86.35  ? 363 ILE E C     1 
ATOM 7047 O O     . ILE E 1 288 ? 16.426  49.215  62.446  1.00 67.36  ? 363 ILE E O     1 
ATOM 7048 C CB    . ILE E 1 288 ? 16.003  46.127  61.143  1.00 71.14  ? 363 ILE E CB    1 
ATOM 7049 C CG1   . ILE E 1 288 ? 15.107  45.273  60.278  1.00 81.92  ? 363 ILE E CG1   1 
ATOM 7050 C CG2   . ILE E 1 288 ? 15.567  45.982  62.586  1.00 67.32  ? 363 ILE E CG2   1 
ATOM 7051 C CD1   . ILE E 1 288 ? 13.634  45.634  60.421  1.00 111.53 ? 363 ILE E CD1   1 
ATOM 7052 N N     . LEU E 1 289 ? 18.165  48.269  61.355  1.00 74.40  ? 364 LEU E N     1 
ATOM 7053 C CA    . LEU E 1 289 ? 19.152  48.943  62.167  1.00 74.25  ? 364 LEU E CA    1 
ATOM 7054 C C     . LEU E 1 289 ? 19.010  50.449  62.053  1.00 80.75  ? 364 LEU E C     1 
ATOM 7055 O O     . LEU E 1 289 ? 19.313  51.177  63.013  1.00 77.18  ? 364 LEU E O     1 
ATOM 7056 C CB    . LEU E 1 289 ? 20.548  48.486  61.739  1.00 68.99  ? 364 LEU E CB    1 
ATOM 7057 C CG    . LEU E 1 289 ? 21.292  47.468  62.616  1.00 64.64  ? 364 LEU E CG    1 
ATOM 7058 C CD1   . LEU E 1 289 ? 20.484  46.985  63.830  1.00 34.25  ? 364 LEU E CD1   1 
ATOM 7059 C CD2   . LEU E 1 289 ? 21.802  46.300  61.776  1.00 60.42  ? 364 LEU E CD2   1 
ATOM 7060 N N     . ASP E 1 290 ? 18.506  50.930  60.909  1.00 69.78  ? 365 ASP E N     1 
ATOM 7061 C CA    . ASP E 1 290 ? 18.641  52.348  60.591  1.00 79.30  ? 365 ASP E CA    1 
ATOM 7062 C C     . ASP E 1 290 ? 17.811  53.263  61.483  1.00 83.48  ? 365 ASP E C     1 
ATOM 7063 O O     . ASP E 1 290 ? 18.208  54.405  61.733  1.00 79.86  ? 365 ASP E O     1 
ATOM 7064 C CB    . ASP E 1 290 ? 18.256  52.625  59.158  1.00 85.67  ? 365 ASP E CB    1 
ATOM 7065 C CG    . ASP E 1 290 ? 18.048  54.087  58.925  1.00 77.39  ? 365 ASP E CG    1 
ATOM 7066 O OD1   . ASP E 1 290 ? 19.051  54.825  58.885  1.00 72.81  ? 365 ASP E OD1   1 
ATOM 7067 O OD2   . ASP E 1 290 ? 16.880  54.503  58.841  1.00 95.05  ? 365 ASP E OD2   1 
ATOM 7068 N N     . GLY E 1 291 ? 16.653  52.823  61.921  1.00 78.54  ? 366 GLY E N     1 
ATOM 7069 C CA    . GLY E 1 291 ? 15.894  53.720  62.757  1.00 73.52  ? 366 GLY E CA    1 
ATOM 7070 C C     . GLY E 1 291 ? 16.241  53.682  64.219  1.00 74.41  ? 366 GLY E C     1 
ATOM 7071 O O     . GLY E 1 291 ? 15.634  54.415  65.007  1.00 80.22  ? 366 GLY E O     1 
ATOM 7072 N N     . PHE E 1 292 ? 17.162  52.803  64.621  1.00 79.92  ? 367 PHE E N     1 
ATOM 7073 C CA    . PHE E 1 292 ? 17.671  52.843  65.987  1.00 84.15  ? 367 PHE E CA    1 
ATOM 7074 C C     . PHE E 1 292 ? 18.679  53.959  66.123  1.00 70.66  ? 367 PHE E C     1 
ATOM 7075 O O     . PHE E 1 292 ? 18.893  54.482  67.222  1.00 56.16  ? 367 PHE E O     1 
ATOM 7076 C CB    . PHE E 1 292 ? 18.332  51.514  66.363  1.00 89.50  ? 367 PHE E CB    1 
ATOM 7077 C CG    . PHE E 1 292 ? 17.382  50.347  66.479  1.00 76.66  ? 367 PHE E CG    1 
ATOM 7078 C CD1   . PHE E 1 292 ? 17.068  49.823  67.721  1.00 58.72  ? 367 PHE E CD1   1 
ATOM 7079 C CD2   . PHE E 1 292 ? 16.852  49.748  65.342  1.00 81.10  ? 367 PHE E CD2   1 
ATOM 7080 C CE1   . PHE E 1 292 ? 16.223  48.756  67.831  1.00 68.74  ? 367 PHE E CE1   1 
ATOM 7081 C CE2   . PHE E 1 292 ? 15.996  48.671  65.439  1.00 86.00  ? 367 PHE E CE2   1 
ATOM 7082 C CZ    . PHE E 1 292 ? 15.681  48.167  66.687  1.00 85.55  ? 367 PHE E CZ    1 
ATOM 7083 N N     . GLU E 1 293 ? 19.296  54.300  64.993  1.00 71.10  ? 368 GLU E N     1 
ATOM 7084 C CA    . GLU E 1 293 ? 20.151  55.470  64.868  1.00 79.65  ? 368 GLU E CA    1 
ATOM 7085 C C     . GLU E 1 293 ? 19.511  56.686  65.503  1.00 71.22  ? 368 GLU E C     1 
ATOM 7086 O O     . GLU E 1 293 ? 20.045  57.294  66.444  1.00 61.27  ? 368 GLU E O     1 
ATOM 7087 C CB    . GLU E 1 293 ? 20.385  55.734  63.387  1.00 85.50  ? 368 GLU E CB    1 
ATOM 7088 C CG    . GLU E 1 293 ? 21.441  56.722  63.094  1.00 86.88  ? 368 GLU E CG    1 
ATOM 7089 C CD    . GLU E 1 293 ? 22.795  56.081  63.152  1.00 99.16  ? 368 GLU E CD    1 
ATOM 7090 O OE1   . GLU E 1 293 ? 23.010  55.172  64.008  1.00 81.91  ? 368 GLU E OE1   1 
ATOM 7091 O OE2   . GLU E 1 293 ? 23.634  56.479  62.317  1.00 111.57 ? 368 GLU E OE2   1 
ATOM 7092 N N     . ARG E 1 294 ? 18.366  57.066  64.952  1.00 61.44  ? 369 ARG E N     1 
ATOM 7093 C CA    . ARG E 1 294 ? 17.621  58.180  65.498  1.00 81.90  ? 369 ARG E CA    1 
ATOM 7094 C C     . ARG E 1 294 ? 17.490  58.041  67.012  1.00 74.86  ? 369 ARG E C     1 
ATOM 7095 O O     . ARG E 1 294 ? 17.951  58.907  67.768  1.00 59.01  ? 369 ARG E O     1 
ATOM 7096 C CB    . ARG E 1 294 ? 16.266  58.239  64.793  1.00 74.82  ? 369 ARG E CB    1 
ATOM 7097 C CG    . ARG E 1 294 ? 16.383  57.843  63.307  1.00 85.98  ? 369 ARG E CG    1 
ATOM 7098 C CD    . ARG E 1 294 ? 15.016  57.588  62.613  1.00 108.64 ? 369 ARG E CD    1 
ATOM 7099 N NE    . ARG E 1 294 ? 14.759  58.466  61.457  1.00 135.06 ? 369 ARG E NE    1 
ATOM 7100 C CZ    . ARG E 1 294 ? 14.948  58.133  60.177  1.00 132.87 ? 369 ARG E CZ    1 
ATOM 7101 N NH1   . ARG E 1 294 ? 15.405  56.931  59.851  1.00 117.29 ? 369 ARG E NH1   1 
ATOM 7102 N NH2   . ARG E 1 294 ? 14.678  59.007  59.212  1.00 140.23 ? 369 ARG E NH2   1 
ATOM 7103 N N     . ILE E 1 295 ? 16.959  56.909  67.476  1.00 64.53  ? 370 ILE E N     1 
ATOM 7104 C CA    . ILE E 1 295 ? 16.750  56.777  68.911  1.00 70.38  ? 370 ILE E CA    1 
ATOM 7105 C C     . ILE E 1 295 ? 18.066  56.961  69.637  1.00 56.03  ? 370 ILE E C     1 
ATOM 7106 O O     . ILE E 1 295 ? 18.122  57.589  70.696  1.00 48.28  ? 370 ILE E O     1 
ATOM 7107 C CB    . ILE E 1 295 ? 16.103  55.426  69.277  1.00 69.36  ? 370 ILE E CB    1 
ATOM 7108 C CG1   . ILE E 1 295 ? 15.380  54.802  68.103  1.00 65.26  ? 370 ILE E CG1   1 
ATOM 7109 C CG2   . ILE E 1 295 ? 15.101  55.609  70.398  1.00 55.55  ? 370 ILE E CG2   1 
ATOM 7110 C CD1   . ILE E 1 295 ? 14.408  53.778  68.566  1.00 51.66  ? 370 ILE E CD1   1 
ATOM 7111 N N     . PHE E 1 296 ? 19.145  56.417  69.082  1.00 57.10  ? 371 PHE E N     1 
ATOM 7112 C CA    . PHE E 1 296 ? 20.418  56.553  69.766  1.00 50.21  ? 371 PHE E CA    1 
ATOM 7113 C C     . PHE E 1 296 ? 20.762  58.013  69.899  1.00 62.79  ? 371 PHE E C     1 
ATOM 7114 O O     . PHE E 1 296 ? 21.118  58.479  70.994  1.00 41.77  ? 371 PHE E O     1 
ATOM 7115 C CB    . PHE E 1 296 ? 21.515  55.790  69.032  1.00 56.90  ? 371 PHE E CB    1 
ATOM 7116 C CG    . PHE E 1 296 ? 21.872  54.479  69.696  1.00 64.57  ? 371 PHE E CG    1 
ATOM 7117 C CD1   . PHE E 1 296 ? 21.861  53.284  68.979  1.00 67.59  ? 371 PHE E CD1   1 
ATOM 7118 C CD2   . PHE E 1 296 ? 22.198  54.440  71.041  1.00 61.00  ? 371 PHE E CD2   1 
ATOM 7119 C CE1   . PHE E 1 296 ? 22.156  52.076  69.588  1.00 55.25  ? 371 PHE E CE1   1 
ATOM 7120 C CE2   . PHE E 1 296 ? 22.494  53.244  71.652  1.00 69.16  ? 371 PHE E CE2   1 
ATOM 7121 C CZ    . PHE E 1 296 ? 22.463  52.050  70.922  1.00 64.15  ? 371 PHE E CZ    1 
ATOM 7122 N N     . LYS E 1 297 ? 20.538  58.766  68.809  1.00 69.91  ? 372 LYS E N     1 
ATOM 7123 C CA    . LYS E 1 297 ? 20.827  60.196  68.787  1.00 62.54  ? 372 LYS E CA    1 
ATOM 7124 C C     . LYS E 1 297 ? 19.959  60.958  69.795  1.00 58.63  ? 372 LYS E C     1 
ATOM 7125 O O     . LYS E 1 297 ? 20.480  61.703  70.638  1.00 49.18  ? 372 LYS E O     1 
ATOM 7126 C CB    . LYS E 1 297 ? 20.659  60.715  67.365  1.00 45.80  ? 372 LYS E CB    1 
ATOM 7127 C CG    . LYS E 1 297 ? 21.759  60.264  66.414  1.00 52.34  ? 372 LYS E CG    1 
ATOM 7128 C CD    . LYS E 1 297 ? 21.659  60.928  65.018  1.00 78.28  ? 372 LYS E CD    1 
ATOM 7129 C CE    . LYS E 1 297 ? 22.504  60.221  63.925  1.00 68.45  ? 372 LYS E CE    1 
ATOM 7130 N NZ    . LYS E 1 297 ? 22.422  60.923  62.596  1.00 80.88  ? 372 LYS E NZ    1 
ATOM 7131 N N     . GLU E 1 298 ? 18.635  60.746  69.763  1.00 58.14  ? 373 GLU E N     1 
ATOM 7132 C CA    . GLU E 1 298 ? 17.774  61.454  70.713  1.00 66.14  ? 373 GLU E CA    1 
ATOM 7133 C C     . GLU E 1 298 ? 18.046  61.036  72.141  1.00 67.00  ? 373 GLU E C     1 
ATOM 7134 O O     . GLU E 1 298 ? 17.652  61.750  73.069  1.00 81.87  ? 373 GLU E O     1 
ATOM 7135 C CB    . GLU E 1 298 ? 16.269  61.245  70.446  1.00 67.29  ? 373 GLU E CB    1 
ATOM 7136 C CG    . GLU E 1 298 ? 15.819  61.184  68.982  1.00 87.18  ? 373 GLU E CG    1 
ATOM 7137 C CD    . GLU E 1 298 ? 14.502  60.434  68.825  1.00 104.74 ? 373 GLU E CD    1 
ATOM 7138 O OE1   . GLU E 1 298 ? 13.615  60.635  69.697  1.00 111.71 ? 373 GLU E OE1   1 
ATOM 7139 O OE2   . GLU E 1 298 ? 14.373  59.633  67.857  1.00 95.81  ? 373 GLU E OE2   1 
ATOM 7140 N N     . LEU E 1 299 ? 18.670  59.889  72.352  1.00 55.36  ? 374 LEU E N     1 
ATOM 7141 C CA    . LEU E 1 299 ? 18.875  59.474  73.727  1.00 64.76  ? 374 LEU E CA    1 
ATOM 7142 C C     . LEU E 1 299 ? 20.094  60.157  74.331  1.00 67.04  ? 374 LEU E C     1 
ATOM 7143 O O     . LEU E 1 299 ? 20.133  60.428  75.542  1.00 73.26  ? 374 LEU E O     1 
ATOM 7144 C CB    . LEU E 1 299 ? 19.005  57.951  73.791  1.00 77.24  ? 374 LEU E CB    1 
ATOM 7145 C CG    . LEU E 1 299 ? 17.756  57.114  74.029  1.00 64.89  ? 374 LEU E CG    1 
ATOM 7146 C CD1   . LEU E 1 299 ? 17.583  56.942  75.511  1.00 75.17  ? 374 LEU E CD1   1 
ATOM 7147 C CD2   . LEU E 1 299 ? 16.533  57.800  73.433  1.00 71.02  ? 374 LEU E CD2   1 
ATOM 7148 N N     . GLN E 1 300 ? 21.105  60.425  73.524  1.00 56.53  ? 375 GLN E N     1 
ATOM 7149 C CA    . GLN E 1 300 ? 22.308  61.001  74.090  1.00 75.98  ? 375 GLN E CA    1 
ATOM 7150 C C     . GLN E 1 300 ? 22.383  62.521  73.941  1.00 87.02  ? 375 GLN E C     1 
ATOM 7151 O O     . GLN E 1 300 ? 23.344  63.124  74.430  1.00 82.30  ? 375 GLN E O     1 
ATOM 7152 C CB    . GLN E 1 300 ? 23.558  60.318  73.497  1.00 71.05  ? 375 GLN E CB    1 
ATOM 7153 C CG    . GLN E 1 300 ? 23.391  59.592  72.167  1.00 57.07  ? 375 GLN E CG    1 
ATOM 7154 C CD    . GLN E 1 300 ? 24.338  58.391  71.984  1.00 67.39  ? 375 GLN E CD    1 
ATOM 7155 O OE1   . GLN E 1 300 ? 25.086  58.279  70.983  1.00 68.34  ? 375 GLN E OE1   1 
ATOM 7156 N NE2   . GLN E 1 300 ? 24.283  57.468  72.937  1.00 74.14  ? 375 GLN E NE2   1 
ATOM 7157 N N     . THR E 1 301 ? 21.390  63.162  73.310  1.00 81.63  ? 376 THR E N     1 
ATOM 7158 C CA    . THR E 1 301 ? 21.387  64.617  73.284  1.00 65.86  ? 376 THR E CA    1 
ATOM 7159 C C     . THR E 1 301 ? 21.433  65.136  74.707  1.00 60.26  ? 376 THR E C     1 
ATOM 7160 O O     . THR E 1 301 ? 20.519  64.918  75.506  1.00 58.52  ? 376 THR E O     1 
ATOM 7161 C CB    . THR E 1 301 ? 20.130  65.140  72.593  1.00 73.76  ? 376 THR E CB    1 
ATOM 7162 O OG1   . THR E 1 301 ? 20.254  64.999  71.176  1.00 94.80  ? 376 THR E OG1   1 
ATOM 7163 C CG2   . THR E 1 301 ? 19.906  66.590  72.926  1.00 80.36  ? 376 THR E CG2   1 
ATOM 7164 N N     . CYS E 1 302 ? 22.507  65.809  75.049  1.00 64.06  ? 377 CYS E N     1 
ATOM 7165 C CA    . CYS E 1 302 ? 22.581  66.411  76.359  1.00 72.42  ? 377 CYS E CA    1 
ATOM 7166 C C     . CYS E 1 302 ? 22.414  67.915  76.310  1.00 88.45  ? 377 CYS E C     1 
ATOM 7167 O O     . CYS E 1 302 ? 22.513  68.551  77.365  1.00 97.62  ? 377 CYS E O     1 
ATOM 7168 C CB    . CYS E 1 302 ? 23.863  65.987  77.094  1.00 63.24  ? 377 CYS E CB    1 
ATOM 7169 S SG    . CYS E 1 302 ? 23.778  64.156  77.593  1.00 110.80 ? 377 CYS E SG    1 
ATOM 7170 N N     . SER E 1 303 ? 22.179  68.514  75.132  1.00 66.88  ? 378 SER E N     1 
ATOM 7171 C CA    . SER E 1 303 ? 21.529  69.825  75.129  1.00 67.65  ? 378 SER E CA    1 
ATOM 7172 C C     . SER E 1 303 ? 20.185  69.766  74.387  1.00 68.38  ? 378 SER E C     1 
ATOM 7173 O O     . SER E 1 303 ? 20.118  69.901  73.162  1.00 65.36  ? 378 SER E O     1 
ATOM 7174 C CB    . SER E 1 303 ? 22.479  70.869  74.534  1.00 101.32 ? 378 SER E CB    1 
ATOM 7175 O OG    . SER E 1 303 ? 23.711  70.919  75.256  1.00 116.25 ? 378 SER E OG    1 
ATOM 7176 N N     . SER E 1 304 ? 19.116  69.541  75.171  1.00 74.20  ? 379 SER E N     1 
ATOM 7177 C CA    . SER E 1 304 ? 17.662  69.559  75.021  1.00 75.70  ? 379 SER E CA    1 
ATOM 7178 C C     . SER E 1 304 ? 17.273  68.582  76.142  1.00 92.25  ? 379 SER E C     1 
ATOM 7179 O O     . SER E 1 304 ? 18.176  67.952  76.708  1.00 95.63  ? 379 SER E O     1 
ATOM 7180 C CB    . SER E 1 304 ? 17.198  69.132  73.623  1.00 78.08  ? 379 SER E CB    1 
ATOM 7181 O OG    . SER E 1 304 ? 16.225  68.095  73.674  1.00 84.82  ? 379 SER E OG    1 
ATOM 7182 N N     . PRO E 1 305 ? 16.019  68.384  76.526  1.00 80.23  ? 380 PRO E N     1 
ATOM 7183 C CA    . PRO E 1 305 ? 15.747  67.299  77.480  1.00 75.36  ? 380 PRO E CA    1 
ATOM 7184 C C     . PRO E 1 305 ? 15.653  65.938  76.793  1.00 88.49  ? 380 PRO E C     1 
ATOM 7185 O O     . PRO E 1 305 ? 15.255  65.817  75.626  1.00 76.42  ? 380 PRO E O     1 
ATOM 7186 C CB    . PRO E 1 305 ? 14.424  67.713  78.126  1.00 82.73  ? 380 PRO E CB    1 
ATOM 7187 C CG    . PRO E 1 305 ? 13.746  68.526  77.058  1.00 105.00 ? 380 PRO E CG    1 
ATOM 7188 C CD    . PRO E 1 305 ? 14.803  69.135  76.172  1.00 85.61  ? 380 PRO E CD    1 
ATOM 7189 N N     . SER E 1 306 ? 16.009  64.899  77.566  1.00 88.16  ? 381 SER E N     1 
ATOM 7190 C CA    . SER E 1 306 ? 16.362  63.560  77.072  1.00 75.79  ? 381 SER E CA    1 
ATOM 7191 C C     . SER E 1 306 ? 15.587  62.455  77.777  1.00 67.33  ? 381 SER E C     1 
ATOM 7192 O O     . SER E 1 306 ? 14.918  61.631  77.152  1.00 61.93  ? 381 SER E O     1 
ATOM 7193 C CB    . SER E 1 306 ? 17.851  63.337  77.260  1.00 74.75  ? 381 SER E CB    1 
ATOM 7194 O OG    . SER E 1 306 ? 18.277  64.134  78.364  1.00 91.40  ? 381 SER E OG    1 
ATOM 7195 N N     . LEU E 1 307 ? 15.715  62.434  79.098  1.00 77.52  ? 382 LEU E N     1 
ATOM 7196 C CA    . LEU E 1 307 ? 15.070  61.453  79.959  1.00 66.40  ? 382 LEU E CA    1 
ATOM 7197 C C     . LEU E 1 307 ? 13.629  61.154  79.588  1.00 66.09  ? 382 LEU E C     1 
ATOM 7198 O O     . LEU E 1 307 ? 13.222  59.994  79.474  1.00 81.69  ? 382 LEU E O     1 
ATOM 7199 C CB    . LEU E 1 307 ? 15.102  62.012  81.373  1.00 69.32  ? 382 LEU E CB    1 
ATOM 7200 C CG    . LEU E 1 307 ? 14.604  61.009  82.366  1.00 65.46  ? 382 LEU E CG    1 
ATOM 7201 C CD1   . LEU E 1 307 ? 15.556  59.886  82.201  1.00 68.05  ? 382 LEU E CD1   1 
ATOM 7202 C CD2   . LEU E 1 307 ? 14.657  61.547  83.770  1.00 72.27  ? 382 LEU E CD2   1 
ATOM 7203 N N     . CYS E 1 308 ? 12.843  62.200  79.408  1.00 60.92  ? 383 CYS E N     1 
ATOM 7204 C CA    . CYS E 1 308 ? 11.438  62.067  79.075  1.00 70.78  ? 383 CYS E CA    1 
ATOM 7205 C C     . CYS E 1 308 ? 11.192  61.212  77.828  1.00 70.21  ? 383 CYS E C     1 
ATOM 7206 O O     . CYS E 1 308 ? 10.076  60.720  77.640  1.00 74.57  ? 383 CYS E O     1 
ATOM 7207 C CB    . CYS E 1 308 ? 10.848  63.480  78.905  1.00 86.02  ? 383 CYS E CB    1 
ATOM 7208 S SG    . CYS E 1 308 ? 11.407  64.524  77.445  1.00 101.55 ? 383 CYS E SG    1 
ATOM 7209 N N     . PHE E 1 309 ? 12.189  61.008  76.977  1.00 55.70  ? 384 PHE E N     1 
ATOM 7210 C CA    . PHE E 1 309 ? 11.960  60.207  75.781  1.00 72.76  ? 384 PHE E CA    1 
ATOM 7211 C C     . PHE E 1 309 ? 12.241  58.720  75.961  1.00 62.79  ? 384 PHE E C     1 
ATOM 7212 O O     . PHE E 1 309 ? 12.055  57.951  75.015  1.00 51.35  ? 384 PHE E O     1 
ATOM 7213 C CB    . PHE E 1 309 ? 12.813  60.717  74.630  1.00 69.55  ? 384 PHE E CB    1 
ATOM 7214 C CG    . PHE E 1 309 ? 12.411  62.056  74.147  1.00 87.40  ? 384 PHE E CG    1 
ATOM 7215 C CD1   . PHE E 1 309 ? 13.140  62.686  73.137  1.00 90.80  ? 384 PHE E CD1   1 
ATOM 7216 C CD2   . PHE E 1 309 ? 11.295  62.694  74.691  1.00 80.18  ? 384 PHE E CD2   1 
ATOM 7217 C CE1   . PHE E 1 309 ? 12.775  63.933  72.675  1.00 81.75  ? 384 PHE E CE1   1 
ATOM 7218 C CE2   . PHE E 1 309 ? 10.927  63.940  74.245  1.00 78.06  ? 384 PHE E CE2   1 
ATOM 7219 C CZ    . PHE E 1 309 ? 11.669  64.559  73.225  1.00 86.06  ? 384 PHE E CZ    1 
ATOM 7220 N N     . VAL E 1 310 ? 12.678  58.293  77.136  1.00 61.69  ? 385 VAL E N     1 
ATOM 7221 C CA    . VAL E 1 310 ? 13.217  56.944  77.257  1.00 75.68  ? 385 VAL E CA    1 
ATOM 7222 C C     . VAL E 1 310 ? 12.118  55.913  77.027  1.00 73.29  ? 385 VAL E C     1 
ATOM 7223 O O     . VAL E 1 310 ? 12.203  55.057  76.131  1.00 61.77  ? 385 VAL E O     1 
ATOM 7224 C CB    . VAL E 1 310 ? 13.889  56.764  78.625  1.00 71.57  ? 385 VAL E CB    1 
ATOM 7225 C CG1   . VAL E 1 310 ? 14.123  55.295  78.863  1.00 73.27  ? 385 VAL E CG1   1 
ATOM 7226 C CG2   . VAL E 1 310 ? 15.183  57.558  78.676  1.00 52.16  ? 385 VAL E CG2   1 
ATOM 7227 N N     . VAL E 1 311 ? 11.057  56.010  77.816  1.00 68.69  ? 386 VAL E N     1 
ATOM 7228 C CA    . VAL E 1 311 ? 9.864   55.185  77.655  1.00 74.30  ? 386 VAL E CA    1 
ATOM 7229 C C     . VAL E 1 311 ? 9.378   55.119  76.199  1.00 78.35  ? 386 VAL E C     1 
ATOM 7230 O O     . VAL E 1 311 ? 9.365   54.026  75.606  1.00 65.42  ? 386 VAL E O     1 
ATOM 7231 C CB    . VAL E 1 311 ? 8.748   55.701  78.585  1.00 59.42  ? 386 VAL E CB    1 
ATOM 7232 C CG1   . VAL E 1 311 ? 7.443   55.014  78.283  1.00 50.79  ? 386 VAL E CG1   1 
ATOM 7233 C CG2   . VAL E 1 311 ? 9.141   55.565  80.047  1.00 54.11  ? 386 VAL E CG2   1 
ATOM 7234 N N     . PRO E 1 312 ? 8.992   56.228  75.553  1.00 77.65  ? 387 PRO E N     1 
ATOM 7235 C CA    . PRO E 1 312 ? 8.366   56.079  74.234  1.00 68.64  ? 387 PRO E CA    1 
ATOM 7236 C C     . PRO E 1 312 ? 9.351   55.592  73.210  1.00 68.61  ? 387 PRO E C     1 
ATOM 7237 O O     . PRO E 1 312 ? 8.959   54.920  72.245  1.00 60.28  ? 387 PRO E O     1 
ATOM 7238 C CB    . PRO E 1 312 ? 7.865   57.492  73.923  1.00 57.23  ? 387 PRO E CB    1 
ATOM 7239 C CG    . PRO E 1 312 ? 8.876   58.326  74.575  1.00 70.82  ? 387 PRO E CG    1 
ATOM 7240 C CD    . PRO E 1 312 ? 9.229   57.648  75.860  1.00 61.93  ? 387 PRO E CD    1 
ATOM 7241 N N     . SER E 1 313 ? 10.628  55.918  73.415  1.00 65.51  ? 388 SER E N     1 
ATOM 7242 C CA    . SER E 1 313 ? 11.680  55.367  72.588  1.00 59.89  ? 388 SER E CA    1 
ATOM 7243 C C     . SER E 1 313 ? 11.598  53.854  72.596  1.00 75.20  ? 388 SER E C     1 
ATOM 7244 O O     . SER E 1 313 ? 11.696  53.203  71.545  1.00 74.83  ? 388 SER E O     1 
ATOM 7245 C CB    . SER E 1 313 ? 13.031  55.838  73.113  1.00 64.56  ? 388 SER E CB    1 
ATOM 7246 O OG    . SER E 1 313 ? 13.196  57.237  72.972  1.00 68.82  ? 388 SER E OG    1 
ATOM 7247 N N     . ILE E 1 314 ? 11.384  53.275  73.781  1.00 76.37  ? 389 ILE E N     1 
ATOM 7248 C CA    . ILE E 1 314 ? 11.177  51.829  73.873  1.00 72.34  ? 389 ILE E CA    1 
ATOM 7249 C C     . ILE E 1 314 ? 10.000  51.407  73.008  1.00 76.20  ? 389 ILE E C     1 
ATOM 7250 O O     . ILE E 1 314 ? 10.131  50.547  72.131  1.00 76.44  ? 389 ILE E O     1 
ATOM 7251 C CB    . ILE E 1 314 ? 10.967  51.399  75.329  1.00 52.87  ? 389 ILE E CB    1 
ATOM 7252 C CG1   . ILE E 1 314 ? 12.291  51.463  76.079  1.00 58.89  ? 389 ILE E CG1   1 
ATOM 7253 C CG2   . ILE E 1 314 ? 10.438  50.048  75.345  1.00 46.36  ? 389 ILE E CG2   1 
ATOM 7254 C CD1   . ILE E 1 314 ? 12.171  51.264  77.566  1.00 50.38  ? 389 ILE E CD1   1 
ATOM 7255 N N     . LEU E 1 315 ? 8.836   52.020  73.232  1.00 65.42  ? 390 LEU E N     1 
ATOM 7256 C CA    . LEU E 1 315 ? 7.673   51.671  72.432  1.00 66.90  ? 390 LEU E CA    1 
ATOM 7257 C C     . LEU E 1 315 ? 8.021   51.679  70.944  1.00 67.21  ? 390 LEU E C     1 
ATOM 7258 O O     . LEU E 1 315 ? 7.791   50.693  70.236  1.00 64.40  ? 390 LEU E O     1 
ATOM 7259 C CB    . LEU E 1 315 ? 6.519   52.614  72.751  1.00 53.45  ? 390 LEU E CB    1 
ATOM 7260 C CG    . LEU E 1 315 ? 6.414   53.121  74.195  1.00 67.33  ? 390 LEU E CG    1 
ATOM 7261 C CD1   . LEU E 1 315 ? 5.086   53.815  74.372  1.00 55.82  ? 390 LEU E CD1   1 
ATOM 7262 C CD2   . LEU E 1 315 ? 6.602   52.070  75.292  1.00 65.30  ? 390 LEU E CD2   1 
ATOM 7263 N N     . LYS E 1 316 ? 8.668   52.746  70.478  1.00 62.76  ? 391 LYS E N     1 
ATOM 7264 C CA    . LYS E 1 316 ? 9.094   52.820  69.079  1.00 80.36  ? 391 LYS E CA    1 
ATOM 7265 C C     . LYS E 1 316 ? 10.045  51.679  68.705  1.00 85.78  ? 391 LYS E C     1 
ATOM 7266 O O     . LYS E 1 316 ? 10.152  51.314  67.517  1.00 76.30  ? 391 LYS E O     1 
ATOM 7267 C CB    . LYS E 1 316 ? 9.738   54.198  68.806  1.00 78.98  ? 391 LYS E CB    1 
ATOM 7268 C CG    . LYS E 1 316 ? 10.027  54.538  67.330  1.00 52.90  ? 391 LYS E CG    1 
ATOM 7269 C CD    . LYS E 1 316 ? 9.960   56.075  67.037  1.00 103.48 ? 391 LYS E CD    1 
ATOM 7270 C CE    . LYS E 1 316 ? 11.118  56.915  67.644  1.00 97.19  ? 391 LYS E CE    1 
ATOM 7271 N NZ    . LYS E 1 316 ? 12.150  57.327  66.636  1.00 83.29  ? 391 LYS E NZ    1 
ATOM 7272 N N     . VAL E 1 317 ? 10.731  51.097  69.694  1.00 73.53  ? 392 VAL E N     1 
ATOM 7273 C CA    . VAL E 1 317 ? 11.553  49.928  69.404  1.00 82.12  ? 392 VAL E CA    1 
ATOM 7274 C C     . VAL E 1 317 ? 10.695  48.729  69.045  1.00 84.08  ? 392 VAL E C     1 
ATOM 7275 O O     . VAL E 1 317 ? 11.082  47.896  68.212  1.00 69.15  ? 392 VAL E O     1 
ATOM 7276 C CB    . VAL E 1 317 ? 12.431  49.611  70.607  1.00 74.04  ? 392 VAL E CB    1 
ATOM 7277 C CG1   . VAL E 1 317 ? 12.914  48.185  70.494  1.00 64.40  ? 392 VAL E CG1   1 
ATOM 7278 C CG2   . VAL E 1 317 ? 13.542  50.632  70.704  1.00 69.79  ? 392 VAL E CG2   1 
ATOM 7279 N N     . LYS E 1 318 ? 9.531   48.621  69.679  1.00 73.33  ? 393 LYS E N     1 
ATOM 7280 C CA    . LYS E 1 318 ? 8.592   47.545  69.428  1.00 68.53  ? 393 LYS E CA    1 
ATOM 7281 C C     . LYS E 1 318 ? 7.870   47.684  68.090  1.00 71.58  ? 393 LYS E C     1 
ATOM 7282 O O     . LYS E 1 318 ? 7.823   46.739  67.304  1.00 66.58  ? 393 LYS E O     1 
ATOM 7283 C CB    . LYS E 1 318 ? 7.615   47.534  70.565  1.00 68.37  ? 393 LYS E CB    1 
ATOM 7284 C CG    . LYS E 1 318 ? 8.306   47.874  71.820  1.00 58.29  ? 393 LYS E CG    1 
ATOM 7285 C CD    . LYS E 1 318 ? 7.630   47.144  72.948  1.00 59.78  ? 393 LYS E CD    1 
ATOM 7286 C CE    . LYS E 1 318 ? 7.745   47.896  74.255  1.00 51.70  ? 393 LYS E CE    1 
ATOM 7287 N NZ    . LYS E 1 318 ? 7.629   46.945  75.398  1.00 75.67  ? 393 LYS E NZ    1 
ATOM 7288 N N     . GLU E 1 319 ? 7.291   48.843  67.805  1.00 69.58  ? 394 GLU E N     1 
ATOM 7289 C CA    . GLU E 1 319 ? 6.653   49.006  66.504  1.00 80.09  ? 394 GLU E CA    1 
ATOM 7290 C C     . GLU E 1 319 ? 7.650   48.863  65.366  1.00 83.56  ? 394 GLU E C     1 
ATOM 7291 O O     . GLU E 1 319 ? 7.255   48.728  64.196  1.00 72.18  ? 394 GLU E O     1 
ATOM 7292 C CB    . GLU E 1 319 ? 5.971   50.358  66.460  1.00 92.99  ? 394 GLU E CB    1 
ATOM 7293 C CG    . GLU E 1 319 ? 6.290   51.190  67.697  1.00 95.43  ? 394 GLU E CG    1 
ATOM 7294 C CD    . GLU E 1 319 ? 5.036   51.646  68.472  1.00 125.20 ? 394 GLU E CD    1 
ATOM 7295 O OE1   . GLU E 1 319 ? 5.179   52.249  69.570  1.00 114.85 ? 394 GLU E OE1   1 
ATOM 7296 O OE2   . GLU E 1 319 ? 3.907   51.403  67.980  1.00 135.05 ? 394 GLU E OE2   1 
ATOM 7297 N N     . ILE E 1 320 ? 8.936   48.936  65.702  1.00 85.03  ? 395 ILE E N     1 
ATOM 7298 C CA    . ILE E 1 320 ? 10.002  48.496  64.815  1.00 86.41  ? 395 ILE E CA    1 
ATOM 7299 C C     . ILE E 1 320 ? 9.984   46.969  64.676  1.00 79.25  ? 395 ILE E C     1 
ATOM 7300 O O     . ILE E 1 320 ? 10.010  46.429  63.566  1.00 78.60  ? 395 ILE E O     1 
ATOM 7301 C CB    . ILE E 1 320 ? 11.347  49.019  65.358  1.00 81.12  ? 395 ILE E CB    1 
ATOM 7302 C CG1   . ILE E 1 320 ? 11.619  50.433  64.877  1.00 76.80  ? 395 ILE E CG1   1 
ATOM 7303 C CG2   . ILE E 1 320 ? 12.498  48.139  64.930  1.00 95.94  ? 395 ILE E CG2   1 
ATOM 7304 C CD1   . ILE E 1 320 ? 12.048  50.472  63.396  1.00 78.08  ? 395 ILE E CD1   1 
ATOM 7305 N N     . CYS E 1 321 ? 9.944   46.253  65.797  1.00 73.19  ? 396 CYS E N     1 
ATOM 7306 C CA    . CYS E 1 321 ? 9.954   44.792  65.811  1.00 84.60  ? 396 CYS E CA    1 
ATOM 7307 C C     . CYS E 1 321 ? 8.569   44.172  65.915  1.00 95.81  ? 396 CYS E C     1 
ATOM 7308 O O     . CYS E 1 321 ? 8.479   42.956  66.123  1.00 85.75  ? 396 CYS E O     1 
ATOM 7309 C CB    . CYS E 1 321 ? 10.790  44.258  66.974  1.00 79.37  ? 396 CYS E CB    1 
ATOM 7310 S SG    . CYS E 1 321 ? 12.342  45.078  67.155  1.00 83.10  ? 396 CYS E SG    1 
ATOM 7311 N N     . SER E 1 322 ? 7.501   44.978  65.869  1.00 104.08 ? 397 SER E N     1 
ATOM 7312 C CA    . SER E 1 322 ? 6.146   44.429  65.892  1.00 97.08  ? 397 SER E CA    1 
ATOM 7313 C C     . SER E 1 322 ? 5.969   43.508  64.692  1.00 98.47  ? 397 SER E C     1 
ATOM 7314 O O     . SER E 1 322 ? 6.293   43.904  63.556  1.00 93.80  ? 397 SER E O     1 
ATOM 7315 C CB    . SER E 1 322 ? 5.095   45.535  65.868  1.00 104.23 ? 397 SER E CB    1 
ATOM 7316 O OG    . SER E 1 322 ? 5.240   46.329  64.697  1.00 116.51 ? 397 SER E OG    1 
ATOM 7317 N N     . PRO E 1 323 ? 5.472   42.286  64.896  1.00 99.43  ? 398 PRO E N     1 
ATOM 7318 C CA    . PRO E 1 323 ? 5.738   41.209  63.938  1.00 84.64  ? 398 PRO E CA    1 
ATOM 7319 C C     . PRO E 1 323 ? 5.139   41.473  62.573  1.00 90.07  ? 398 PRO E C     1 
ATOM 7320 O O     . PRO E 1 323 ? 4.217   42.268  62.399  1.00 97.00  ? 398 PRO E O     1 
ATOM 7321 C CB    . PRO E 1 323 ? 5.104   39.998  64.599  1.00 47.46  ? 398 PRO E CB    1 
ATOM 7322 C CG    . PRO E 1 323 ? 5.220   40.329  66.084  1.00 71.37  ? 398 PRO E CG    1 
ATOM 7323 C CD    . PRO E 1 323 ? 4.881   41.773  66.145  1.00 86.82  ? 398 PRO E CD    1 
ATOM 7324 N N     . ASP E 1 324 ? 5.722   40.814  61.589  1.00 93.86  ? 399 ASP E N     1 
ATOM 7325 C CA    . ASP E 1 324 ? 5.313   40.961  60.207  1.00 99.09  ? 399 ASP E CA    1 
ATOM 7326 C C     . ASP E 1 324 ? 5.355   39.567  59.601  1.00 105.32 ? 399 ASP E C     1 
ATOM 7327 O O     . ASP E 1 324 ? 6.371   38.873  59.702  1.00 108.45 ? 399 ASP E O     1 
ATOM 7328 C CB    . ASP E 1 324 ? 6.241   41.946  59.471  1.00 102.75 ? 399 ASP E CB    1 
ATOM 7329 C CG    . ASP E 1 324 ? 5.688   42.415  58.118  1.00 120.07 ? 399 ASP E CG    1 
ATOM 7330 O OD1   . ASP E 1 324 ? 5.903   41.725  57.093  1.00 126.20 ? 399 ASP E OD1   1 
ATOM 7331 O OD2   . ASP E 1 324 ? 5.072   43.502  58.068  1.00 119.73 ? 399 ASP E OD2   1 
ATOM 7332 N N     . VAL E 1 325 ? 4.241   39.144  59.018  1.00 119.11 ? 400 VAL E N     1 
ATOM 7333 C CA    . VAL E 1 325 ? 4.149   37.840  58.371  1.00 131.57 ? 400 VAL E CA    1 
ATOM 7334 C C     . VAL E 1 325 ? 4.447   38.036  56.889  1.00 124.90 ? 400 VAL E C     1 
ATOM 7335 O O     . VAL E 1 325 ? 3.712   38.729  56.175  1.00 125.20 ? 400 VAL E O     1 
ATOM 7336 C CB    . VAL E 1 325 ? 2.772   37.195  58.598  1.00 118.36 ? 400 VAL E CB    1 
ATOM 7337 C CG1   . VAL E 1 325 ? 2.693   35.875  57.873  1.00 122.47 ? 400 VAL E CG1   1 
ATOM 7338 C CG2   . VAL E 1 325 ? 2.524   36.998  60.099  1.00 102.18 ? 400 VAL E CG2   1 
ATOM 7339 N N     . GLY E 1 326 ? 5.504   37.390  56.421  1.00 113.28 ? 401 GLY E N     1 
ATOM 7340 C CA    . GLY E 1 326 ? 6.288   37.904  55.323  1.00 117.28 ? 401 GLY E CA    1 
ATOM 7341 C C     . GLY E 1 326 ? 7.646   38.390  55.763  1.00 107.45 ? 401 GLY E C     1 
ATOM 7342 O O     . GLY E 1 326 ? 8.425   38.863  54.926  1.00 110.97 ? 401 GLY E O     1 
ATOM 7343 N N     . ASP E 1 327 ? 7.958   38.273  57.047  1.00 88.13  ? 402 ASP E N     1 
ATOM 7344 C CA    . ASP E 1 327 ? 9.318   38.429  57.529  1.00 90.63  ? 402 ASP E CA    1 
ATOM 7345 C C     . ASP E 1 327 ? 9.956   37.055  57.452  1.00 96.50  ? 402 ASP E C     1 
ATOM 7346 O O     . ASP E 1 327 ? 9.578   36.169  58.226  1.00 96.01  ? 402 ASP E O     1 
ATOM 7347 C CB    . ASP E 1 327 ? 9.330   38.939  58.969  1.00 93.42  ? 402 ASP E CB    1 
ATOM 7348 C CG    . ASP E 1 327 ? 9.304   40.460  59.063  1.00 115.75 ? 402 ASP E CG    1 
ATOM 7349 O OD1   . ASP E 1 327 ? 9.145   41.144  58.020  1.00 119.66 ? 402 ASP E OD1   1 
ATOM 7350 O OD2   . ASP E 1 327 ? 9.440   40.976  60.197  1.00 116.51 ? 402 ASP E OD2   1 
ATOM 7351 N N     . VAL E 1 328 ? 10.943  36.882  56.554  1.00 101.91 ? 403 VAL E N     1 
ATOM 7352 C CA    . VAL E 1 328 ? 11.650  35.604  56.481  1.00 91.15  ? 403 VAL E CA    1 
ATOM 7353 C C     . VAL E 1 328 ? 12.089  35.244  57.898  1.00 89.01  ? 403 VAL E C     1 
ATOM 7354 O O     . VAL E 1 328 ? 12.372  36.123  58.716  1.00 89.12  ? 403 VAL E O     1 
ATOM 7355 C CB    . VAL E 1 328 ? 12.820  35.638  55.474  1.00 89.78  ? 403 VAL E CB    1 
ATOM 7356 C CG1   . VAL E 1 328 ? 12.851  36.946  54.642  1.00 86.63  ? 403 VAL E CG1   1 
ATOM 7357 C CG2   . VAL E 1 328 ? 14.154  35.352  56.147  1.00 94.60  ? 403 VAL E CG2   1 
ATOM 7358 N N     . ALA E 1 329 ? 12.005  33.956  58.235  1.00 98.35  ? 404 ALA E N     1 
ATOM 7359 C CA    . ALA E 1 329 ? 11.852  33.575  59.642  1.00 108.65 ? 404 ALA E CA    1 
ATOM 7360 C C     . ALA E 1 329 ? 12.983  34.118  60.498  1.00 104.56 ? 404 ALA E C     1 
ATOM 7361 O O     . ALA E 1 329 ? 12.765  34.558  61.639  1.00 87.36  ? 404 ALA E O     1 
ATOM 7362 C CB    . ALA E 1 329 ? 11.773  32.059  59.765  1.00 112.74 ? 404 ALA E CB    1 
ATOM 7363 N N     . ASP E 1 330 ? 14.194  34.107  59.941  1.00 115.58 ? 405 ASP E N     1 
ATOM 7364 C CA    . ASP E 1 330 ? 15.363  34.759  60.515  1.00 110.40 ? 405 ASP E CA    1 
ATOM 7365 C C     . ASP E 1 330 ? 15.023  36.160  61.045  1.00 93.70  ? 405 ASP E C     1 
ATOM 7366 O O     . ASP E 1 330 ? 15.063  36.400  62.263  1.00 80.79  ? 405 ASP E O     1 
ATOM 7367 C CB    . ASP E 1 330 ? 16.462  34.805  59.431  1.00 123.79 ? 405 ASP E CB    1 
ATOM 7368 C CG    . ASP E 1 330 ? 16.491  33.530  58.528  1.00 124.38 ? 405 ASP E CG    1 
ATOM 7369 O OD1   . ASP E 1 330 ? 17.607  33.107  58.123  1.00 124.61 ? 405 ASP E OD1   1 
ATOM 7370 O OD2   . ASP E 1 330 ? 15.411  32.964  58.214  1.00 113.10 ? 405 ASP E OD2   1 
ATOM 7371 N N     . ILE E 1 331 ? 14.622  37.067  60.132  1.00 90.01  ? 406 ILE E N     1 
ATOM 7372 C CA    . ILE E 1 331 ? 14.197  38.441  60.409  1.00 68.68  ? 406 ILE E CA    1 
ATOM 7373 C C     . ILE E 1 331 ? 13.278  38.465  61.619  1.00 80.47  ? 406 ILE E C     1 
ATOM 7374 O O     . ILE E 1 331 ? 13.508  39.207  62.579  1.00 69.97  ? 406 ILE E O     1 
ATOM 7375 C CB    . ILE E 1 331 ? 13.420  39.042  59.220  1.00 81.56  ? 406 ILE E CB    1 
ATOM 7376 C CG1   . ILE E 1 331 ? 14.189  39.023  57.894  1.00 98.86  ? 406 ILE E CG1   1 
ATOM 7377 C CG2   . ILE E 1 331 ? 12.913  40.417  59.549  1.00 83.59  ? 406 ILE E CG2   1 
ATOM 7378 C CD1   . ILE E 1 331 ? 13.302  39.477  56.695  1.00 81.77  ? 406 ILE E CD1   1 
ATOM 7379 N N     . ALA E 1 332 ? 12.231  37.640  61.589  1.00 89.26  ? 407 ALA E N     1 
ATOM 7380 C CA    . ALA E 1 332 ? 11.247  37.697  62.655  1.00 76.72  ? 407 ALA E CA    1 
ATOM 7381 C C     . ALA E 1 332 ? 11.726  37.029  63.940  1.00 71.61  ? 407 ALA E C     1 
ATOM 7382 O O     . ALA E 1 332 ? 11.108  37.244  64.985  1.00 73.32  ? 407 ALA E O     1 
ATOM 7383 C CB    . ALA E 1 332 ? 9.927   37.095  62.179  1.00 75.78  ? 407 ALA E CB    1 
ATOM 7384 N N     . LYS E 1 333 ? 12.817  36.255  63.917  1.00 65.70  ? 408 LYS E N     1 
ATOM 7385 C CA    . LYS E 1 333 ? 13.345  35.808  65.200  1.00 60.42  ? 408 LYS E CA    1 
ATOM 7386 C C     . LYS E 1 333 ? 14.152  36.897  65.875  1.00 75.22  ? 408 LYS E C     1 
ATOM 7387 O O     . LYS E 1 333 ? 14.118  37.040  67.105  1.00 68.11  ? 408 LYS E O     1 
ATOM 7388 C CB    . LYS E 1 333 ? 14.223  34.574  65.064  1.00 70.70  ? 408 LYS E CB    1 
ATOM 7389 C CG    . LYS E 1 333 ? 14.179  33.756  66.371  1.00 70.81  ? 408 LYS E CG    1 
ATOM 7390 C CD    . LYS E 1 333 ? 15.510  33.240  66.861  1.00 49.74  ? 408 LYS E CD    1 
ATOM 7391 C CE    . LYS E 1 333 ? 16.184  32.361  65.828  1.00 60.48  ? 408 LYS E CE    1 
ATOM 7392 N NZ    . LYS E 1 333 ? 17.480  31.734  66.325  1.00 85.10  ? 408 LYS E NZ    1 
ATOM 7393 N N     . LEU E 1 334 ? 14.921  37.643  65.089  1.00 79.78  ? 409 LEU E N     1 
ATOM 7394 C CA    . LEU E 1 334 ? 15.579  38.822  65.628  1.00 74.79  ? 409 LEU E CA    1 
ATOM 7395 C C     . LEU E 1 334 ? 14.545  39.741  66.270  1.00 68.70  ? 409 LEU E C     1 
ATOM 7396 O O     . LEU E 1 334 ? 14.628  40.042  67.467  1.00 67.95  ? 409 LEU E O     1 
ATOM 7397 C CB    . LEU E 1 334 ? 16.361  39.517  64.507  1.00 64.13  ? 409 LEU E CB    1 
ATOM 7398 C CG    . LEU E 1 334 ? 17.555  40.400  64.846  1.00 62.85  ? 409 LEU E CG    1 
ATOM 7399 C CD1   . LEU E 1 334 ? 17.018  41.619  65.503  1.00 77.12  ? 409 LEU E CD1   1 
ATOM 7400 C CD2   . LEU E 1 334 ? 18.549  39.754  65.803  1.00 64.34  ? 409 LEU E CD2   1 
ATOM 7401 N N     . LYS E 1 335 ? 13.530  40.137  65.486  1.00 51.63  ? 410 LYS E N     1 
ATOM 7402 C CA    . LYS E 1 335 ? 12.475  41.008  65.979  1.00 58.09  ? 410 LYS E CA    1 
ATOM 7403 C C     . LYS E 1 335 ? 11.961  40.514  67.317  1.00 65.36  ? 410 LYS E C     1 
ATOM 7404 O O     . LYS E 1 335 ? 11.858  41.275  68.288  1.00 60.62  ? 410 LYS E O     1 
ATOM 7405 C CB    . LYS E 1 335 ? 11.323  41.073  64.966  1.00 70.14  ? 410 LYS E CB    1 
ATOM 7406 C CG    . LYS E 1 335 ? 11.461  42.068  63.812  1.00 65.10  ? 410 LYS E CG    1 
ATOM 7407 C CD    . LYS E 1 335 ? 10.094  42.356  63.127  1.00 91.73  ? 410 LYS E CD    1 
ATOM 7408 C CE    . LYS E 1 335 ? 10.155  43.456  62.022  1.00 90.34  ? 410 LYS E CE    1 
ATOM 7409 N NZ    . LYS E 1 335 ? 8.836   44.155  61.823  1.00 73.14  ? 410 LYS E NZ    1 
ATOM 7410 N N     . VAL E 1 336 ? 11.659  39.221  67.387  1.00 58.68  ? 411 VAL E N     1 
ATOM 7411 C CA    . VAL E 1 336 ? 11.073  38.673  68.600  1.00 76.20  ? 411 VAL E CA    1 
ATOM 7412 C C     . VAL E 1 336 ? 12.096  38.647  69.719  1.00 78.73  ? 411 VAL E C     1 
ATOM 7413 O O     . VAL E 1 336 ? 11.760  38.808  70.907  1.00 67.35  ? 411 VAL E O     1 
ATOM 7414 C CB    . VAL E 1 336 ? 10.507  37.278  68.309  1.00 72.34  ? 411 VAL E CB    1 
ATOM 7415 C CG1   . VAL E 1 336 ? 10.428  36.470  69.597  1.00 60.68  ? 411 VAL E CG1   1 
ATOM 7416 C CG2   . VAL E 1 336 ? 9.148   37.416  67.624  1.00 82.81  ? 411 VAL E CG2   1 
ATOM 7417 N N     . ASN E 1 337 ? 13.359  38.462  69.349  1.00 74.56  ? 412 ASN E N     1 
ATOM 7418 C CA    . ASN E 1 337 ? 14.413  38.369  70.333  1.00 56.05  ? 412 ASN E CA    1 
ATOM 7419 C C     . ASN E 1 337 ? 14.731  39.731  70.913  1.00 61.12  ? 412 ASN E C     1 
ATOM 7420 O O     . ASN E 1 337 ? 14.971  39.852  72.115  1.00 59.37  ? 412 ASN E O     1 
ATOM 7421 C CB    . ASN E 1 337 ? 15.621  37.735  69.686  1.00 76.13  ? 412 ASN E CB    1 
ATOM 7422 C CG    . ASN E 1 337 ? 15.954  36.395  70.301  1.00 105.63 ? 412 ASN E CG    1 
ATOM 7423 O OD1   . ASN E 1 337 ? 15.956  36.251  71.534  1.00 108.79 ? 412 ASN E OD1   1 
ATOM 7424 N ND2   . ASN E 1 337 ? 16.224  35.396  69.453  1.00 97.61  ? 412 ASN E ND2   1 
ATOM 7425 N N     . ILE E 1 338 ? 14.712  40.775  70.080  1.00 64.43  ? 413 ILE E N     1 
ATOM 7426 C CA    . ILE E 1 338 ? 14.642  42.146  70.595  1.00 62.38  ? 413 ILE E CA    1 
ATOM 7427 C C     . ILE E 1 338 ? 13.515  42.288  71.611  1.00 66.10  ? 413 ILE E C     1 
ATOM 7428 O O     . ILE E 1 338 ? 13.756  42.574  72.791  1.00 64.39  ? 413 ILE E O     1 
ATOM 7429 C CB    . ILE E 1 338 ? 14.450  43.153  69.458  1.00 54.58  ? 413 ILE E CB    1 
ATOM 7430 C CG1   . ILE E 1 338 ? 15.648  43.130  68.532  1.00 59.50  ? 413 ILE E CG1   1 
ATOM 7431 C CG2   . ILE E 1 338 ? 14.282  44.496  70.031  1.00 37.25  ? 413 ILE E CG2   1 
ATOM 7432 C CD1   . ILE E 1 338 ? 15.601  44.226  67.530  1.00 44.09  ? 413 ILE E CD1   1 
ATOM 7433 N N     . ILE E 1 339 ? 12.261  42.106  71.166  1.00 58.25  ? 414 ILE E N     1 
ATOM 7434 C CA    . ILE E 1 339 ? 11.151  42.519  72.029  1.00 73.28  ? 414 ILE E CA    1 
ATOM 7435 C C     . ILE E 1 339 ? 11.244  41.839  73.389  1.00 68.31  ? 414 ILE E C     1 
ATOM 7436 O O     . ILE E 1 339 ? 10.806  42.404  74.393  1.00 78.39  ? 414 ILE E O     1 
ATOM 7437 C CB    . ILE E 1 339 ? 9.745   42.327  71.374  1.00 67.75  ? 414 ILE E CB    1 
ATOM 7438 C CG1   . ILE E 1 339 ? 9.727   41.191  70.367  1.00 94.72  ? 414 ILE E CG1   1 
ATOM 7439 C CG2   . ILE E 1 339 ? 9.298   43.583  70.622  1.00 65.21  ? 414 ILE E CG2   1 
ATOM 7440 C CD1   . ILE E 1 339 ? 8.777   41.418  69.137  1.00 88.79  ? 414 ILE E CD1   1 
ATOM 7441 N N     . LYS E 1 340 ? 11.916  40.700  73.474  1.00 59.79  ? 415 LYS E N     1 
ATOM 7442 C CA    . LYS E 1 340 ? 12.078  40.051  74.767  1.00 63.79  ? 415 LYS E CA    1 
ATOM 7443 C C     . LYS E 1 340 ? 13.032  40.824  75.683  1.00 68.14  ? 415 LYS E C     1 
ATOM 7444 O O     . LYS E 1 340 ? 12.693  41.132  76.834  1.00 58.75  ? 415 LYS E O     1 
ATOM 7445 C CB    . LYS E 1 340 ? 12.553  38.626  74.532  1.00 60.00  ? 415 LYS E CB    1 
ATOM 7446 C CG    . LYS E 1 340 ? 13.034  37.855  75.733  1.00 49.16  ? 415 LYS E CG    1 
ATOM 7447 C CD    . LYS E 1 340 ? 13.584  36.518  75.240  1.00 79.32  ? 415 LYS E CD    1 
ATOM 7448 C CE    . LYS E 1 340 ? 12.637  35.839  74.182  1.00 105.54 ? 415 LYS E CE    1 
ATOM 7449 N NZ    . LYS E 1 340 ? 13.063  35.891  72.720  1.00 94.23  ? 415 LYS E NZ    1 
ATOM 7450 N N     . ASN E 1 341 ? 14.240  41.136  75.208  1.00 62.14  ? 416 ASN E N     1 
ATOM 7451 C CA    . ASN E 1 341 ? 15.176  41.851  76.077  1.00 69.25  ? 416 ASN E CA    1 
ATOM 7452 C C     . ASN E 1 341 ? 14.875  43.329  76.185  1.00 67.30  ? 416 ASN E C     1 
ATOM 7453 O O     . ASN E 1 341 ? 15.405  43.982  77.095  1.00 55.75  ? 416 ASN E O     1 
ATOM 7454 C CB    . ASN E 1 341 ? 16.625  41.758  75.629  1.00 49.23  ? 416 ASN E CB    1 
ATOM 7455 C CG    . ASN E 1 341 ? 16.856  40.723  74.647  1.00 54.30  ? 416 ASN E CG    1 
ATOM 7456 O OD1   . ASN E 1 341 ? 17.769  39.914  74.811  1.00 66.48  ? 416 ASN E OD1   1 
ATOM 7457 N ND2   . ASN E 1 341 ? 16.090  40.746  73.570  1.00 52.61  ? 416 ASN E ND2   1 
ATOM 7458 N N     . VAL E 1 342 ? 14.107  43.872  75.240  1.00 52.29  ? 417 VAL E N     1 
ATOM 7459 C CA    . VAL E 1 342 ? 13.486  45.161  75.463  1.00 59.61  ? 417 VAL E CA    1 
ATOM 7460 C C     . VAL E 1 342 ? 12.830  45.194  76.833  1.00 77.47  ? 417 VAL E C     1 
ATOM 7461 O O     . VAL E 1 342 ? 12.937  46.192  77.572  1.00 56.80  ? 417 VAL E O     1 
ATOM 7462 C CB    . VAL E 1 342 ? 12.466  45.431  74.358  1.00 64.55  ? 417 VAL E CB    1 
ATOM 7463 C CG1   . VAL E 1 342 ? 11.653  46.647  74.717  1.00 67.20  ? 417 VAL E CG1   1 
ATOM 7464 C CG2   . VAL E 1 342 ? 13.195  45.628  73.075  1.00 70.12  ? 417 VAL E CG2   1 
ATOM 7465 N N     . ARG E 1 343 ? 12.137  44.092  77.185  1.00 76.57  ? 418 ARG E N     1 
ATOM 7466 C CA    . ARG E 1 343 ? 11.526  43.941  78.506  1.00 69.66  ? 418 ARG E CA    1 
ATOM 7467 C C     . ARG E 1 343 ? 12.561  43.656  79.579  1.00 65.88  ? 418 ARG E C     1 
ATOM 7468 O O     . ARG E 1 343 ? 12.516  44.248  80.656  1.00 68.59  ? 418 ARG E O     1 
ATOM 7469 C CB    . ARG E 1 343 ? 10.524  42.791  78.530  1.00 84.98  ? 418 ARG E CB    1 
ATOM 7470 C CG    . ARG E 1 343 ? 9.274   42.853  77.685  1.00 86.16  ? 418 ARG E CG    1 
ATOM 7471 C CD    . ARG E 1 343 ? 8.454   41.571  78.001  1.00 89.25  ? 418 ARG E CD    1 
ATOM 7472 N NE    . ARG E 1 343 ? 9.087   40.717  79.021  1.00 73.77  ? 418 ARG E NE    1 
ATOM 7473 C CZ    . ARG E 1 343 ? 9.443   39.454  78.817  1.00 78.30  ? 418 ARG E CZ    1 
ATOM 7474 N NH1   . ARG E 1 343 ? 9.210   38.896  77.636  1.00 68.44  ? 418 ARG E NH1   1 
ATOM 7475 N NH2   . ARG E 1 343 ? 10.014  38.749  79.790  1.00 85.16  ? 418 ARG E NH2   1 
ATOM 7476 N N     . ILE E 1 344 ? 13.425  42.667  79.353  1.00 55.59  ? 419 ILE E N     1 
ATOM 7477 C CA    . ILE E 1 344 ? 14.184  42.112  80.464  1.00 56.88  ? 419 ILE E CA    1 
ATOM 7478 C C     . ILE E 1 344 ? 15.546  42.748  80.677  1.00 75.68  ? 419 ILE E C     1 
ATOM 7479 O O     . ILE E 1 344 ? 16.121  42.587  81.763  1.00 80.40  ? 419 ILE E O     1 
ATOM 7480 C CB    . ILE E 1 344 ? 14.348  40.607  80.259  1.00 69.47  ? 419 ILE E CB    1 
ATOM 7481 C CG1   . ILE E 1 344 ? 15.292  40.357  79.097  1.00 65.84  ? 419 ILE E CG1   1 
ATOM 7482 C CG2   . ILE E 1 344 ? 13.002  39.993  79.923  1.00 87.44  ? 419 ILE E CG2   1 
ATOM 7483 C CD1   . ILE E 1 344 ? 14.892  39.188  78.227  1.00 64.41  ? 419 ILE E CD1   1 
ATOM 7484 N N     . ILE E 1 345 ? 16.068  43.496  79.699  1.00 79.37  ? 420 ILE E N     1 
ATOM 7485 C CA    . ILE E 1 345 ? 17.262  44.312  79.934  1.00 72.47  ? 420 ILE E CA    1 
ATOM 7486 C C     . ILE E 1 345 ? 16.840  45.761  80.094  1.00 66.63  ? 420 ILE E C     1 
ATOM 7487 O O     . ILE E 1 345 ? 17.183  46.416  81.088  1.00 60.58  ? 420 ILE E O     1 
ATOM 7488 C CB    . ILE E 1 345 ? 18.330  44.236  78.833  1.00 51.37  ? 420 ILE E CB    1 
ATOM 7489 C CG1   . ILE E 1 345 ? 18.409  42.883  78.185  1.00 54.17  ? 420 ILE E CG1   1 
ATOM 7490 C CG2   . ILE E 1 345 ? 19.699  44.540  79.427  1.00 53.43  ? 420 ILE E CG2   1 
ATOM 7491 C CD1   . ILE E 1 345 ? 19.583  42.807  77.217  1.00 46.03  ? 420 ILE E CD1   1 
ATOM 7492 N N     . TRP E 1 346 ? 16.176  46.300  79.069  1.00 61.99  ? 421 TRP E N     1 
ATOM 7493 C CA    . TRP E 1 346 ? 15.967  47.737  79.074  1.00 61.65  ? 421 TRP E CA    1 
ATOM 7494 C C     . TRP E 1 346 ? 14.910  48.084  80.097  1.00 61.21  ? 421 TRP E C     1 
ATOM 7495 O O     . TRP E 1 346 ? 15.252  48.708  81.103  1.00 64.71  ? 421 TRP E O     1 
ATOM 7496 C CB    . TRP E 1 346 ? 15.592  48.298  77.699  1.00 57.83  ? 421 TRP E CB    1 
ATOM 7497 C CG    . TRP E 1 346 ? 15.744  49.825  77.655  1.00 55.46  ? 421 TRP E CG    1 
ATOM 7498 C CD1   . TRP E 1 346 ? 15.971  50.681  78.717  1.00 62.09  ? 421 TRP E CD1   1 
ATOM 7499 C CD2   . TRP E 1 346 ? 15.683  50.648  76.501  1.00 42.63  ? 421 TRP E CD2   1 
ATOM 7500 N NE1   . TRP E 1 346 ? 16.051  51.983  78.274  1.00 53.93  ? 421 TRP E NE1   1 
ATOM 7501 C CE2   . TRP E 1 346 ? 15.886  51.981  76.917  1.00 48.23  ? 421 TRP E CE2   1 
ATOM 7502 C CE3   . TRP E 1 346 ? 15.501  50.387  75.152  1.00 42.27  ? 421 TRP E CE3   1 
ATOM 7503 C CZ2   . TRP E 1 346 ? 15.899  53.021  76.037  1.00 56.16  ? 421 TRP E CZ2   1 
ATOM 7504 C CZ3   . TRP E 1 346 ? 15.507  51.425  74.279  1.00 45.28  ? 421 TRP E CZ3   1 
ATOM 7505 C CH2   . TRP E 1 346 ? 15.699  52.725  74.720  1.00 57.64  ? 421 TRP E CH2   1 
ATOM 7506 N N     . GLU E 1 347 ? 13.646  47.686  79.865  1.00 63.70  ? 422 GLU E N     1 
ATOM 7507 C CA    . GLU E 1 347 ? 12.557  48.128  80.743  1.00 55.79  ? 422 GLU E CA    1 
ATOM 7508 C C     . GLU E 1 347 ? 12.863  47.809  82.205  1.00 65.53  ? 422 GLU E C     1 
ATOM 7509 O O     . GLU E 1 347 ? 12.592  48.618  83.100  1.00 66.39  ? 422 GLU E O     1 
ATOM 7510 C CB    . GLU E 1 347 ? 11.229  47.484  80.330  1.00 52.02  ? 422 GLU E CB    1 
ATOM 7511 C CG    . GLU E 1 347 ? 10.710  47.775  78.897  1.00 66.45  ? 422 GLU E CG    1 
ATOM 7512 C CD    . GLU E 1 347 ? 9.376   47.035  78.545  1.00 79.99  ? 422 GLU E CD    1 
ATOM 7513 O OE1   . GLU E 1 347 ? 8.876   47.189  77.411  1.00 67.96  ? 422 GLU E OE1   1 
ATOM 7514 O OE2   . GLU E 1 347 ? 8.813   46.292  79.385  1.00 79.94  ? 422 GLU E OE2   1 
ATOM 7515 N N     . GLU E 1 348 ? 13.484  46.648  82.452  1.00 73.55  ? 423 GLU E N     1 
ATOM 7516 C CA    . GLU E 1 348 ? 13.706  46.136  83.806  1.00 70.52  ? 423 GLU E CA    1 
ATOM 7517 C C     . GLU E 1 348 ? 14.588  47.058  84.638  1.00 63.44  ? 423 GLU E C     1 
ATOM 7518 O O     . GLU E 1 348 ? 14.585  46.998  85.872  1.00 62.47  ? 423 GLU E O     1 
ATOM 7519 C CB    . GLU E 1 348 ? 14.343  44.743  83.714  1.00 77.95  ? 423 GLU E CB    1 
ATOM 7520 C CG    . GLU E 1 348 ? 13.464  43.605  84.218  1.00 97.81  ? 423 GLU E CG    1 
ATOM 7521 C CD    . GLU E 1 348 ? 14.280  42.507  84.876  1.00 118.99 ? 423 GLU E CD    1 
ATOM 7522 O OE1   . GLU E 1 348 ? 14.228  42.398  86.125  1.00 123.14 ? 423 GLU E OE1   1 
ATOM 7523 O OE2   . GLU E 1 348 ? 14.989  41.774  84.144  1.00 124.07 ? 423 GLU E OE2   1 
ATOM 7524 N N     . ASN E 1 349 ? 15.404  47.857  83.985  1.00 72.87  ? 424 ASN E N     1 
ATOM 7525 C CA    . ASN E 1 349 ? 16.340  48.714  84.676  1.00 79.72  ? 424 ASN E CA    1 
ATOM 7526 C C     . ASN E 1 349 ? 15.832  50.142  84.819  1.00 82.31  ? 424 ASN E C     1 
ATOM 7527 O O     . ASN E 1 349 ? 16.608  51.021  85.196  1.00 98.08  ? 424 ASN E O     1 
ATOM 7528 C CB    . ASN E 1 349 ? 17.690  48.692  83.963  1.00 70.39  ? 424 ASN E CB    1 
ATOM 7529 C CG    . ASN E 1 349 ? 18.367  47.366  84.058  1.00 64.64  ? 424 ASN E CG    1 
ATOM 7530 O OD1   . ASN E 1 349 ? 18.919  47.011  85.100  1.00 63.15  ? 424 ASN E OD1   1 
ATOM 7531 N ND2   . ASN E 1 349 ? 18.359  46.624  82.955  1.00 69.69  ? 424 ASN E ND2   1 
ATOM 7532 N N     . LEU E 1 350 ? 14.589  50.424  84.450  1.00 65.94  ? 425 LEU E N     1 
ATOM 7533 C CA    . LEU E 1 350 ? 14.157  51.807  84.578  1.00 75.14  ? 425 LEU E CA    1 
ATOM 7534 C C     . LEU E 1 350 ? 13.839  52.155  86.037  1.00 85.06  ? 425 LEU E C     1 
ATOM 7535 O O     . LEU E 1 350 ? 13.667  51.277  86.892  1.00 88.17  ? 425 LEU E O     1 
ATOM 7536 C CB    . LEU E 1 350 ? 12.968  52.083  83.669  1.00 76.16  ? 425 LEU E CB    1 
ATOM 7537 C CG    . LEU E 1 350 ? 13.276  51.866  82.188  1.00 62.48  ? 425 LEU E CG    1 
ATOM 7538 C CD1   . LEU E 1 350 ? 12.216  52.483  81.311  1.00 58.49  ? 425 LEU E CD1   1 
ATOM 7539 C CD2   . LEU E 1 350 ? 14.627  52.409  81.829  1.00 64.60  ? 425 LEU E CD2   1 
ATOM 7540 N N     . SER E 1 351 ? 13.789  53.463  86.314  1.00 82.01  ? 426 SER E N     1 
ATOM 7541 C CA    . SER E 1 351 ? 13.526  54.028  87.636  1.00 94.08  ? 426 SER E CA    1 
ATOM 7542 C C     . SER E 1 351 ? 12.284  54.911  87.591  1.00 93.25  ? 426 SER E C     1 
ATOM 7543 O O     . SER E 1 351 ? 11.813  55.295  86.510  1.00 91.58  ? 426 SER E O     1 
ATOM 7544 C CB    . SER E 1 351 ? 14.700  54.875  88.134  1.00 98.90  ? 426 SER E CB    1 
ATOM 7545 O OG    . SER E 1 351 ? 14.309  56.244  88.114  1.00 85.39  ? 426 SER E OG    1 
ATOM 7546 N N     . ILE E 1 352 ? 11.759  55.243  88.785  1.00 86.62  ? 427 ILE E N     1 
ATOM 7547 C CA    . ILE E 1 352 ? 10.580  56.112  88.847  1.00 102.62 ? 427 ILE E CA    1 
ATOM 7548 C C     . ILE E 1 352 ? 10.832  57.393  88.066  1.00 96.78  ? 427 ILE E C     1 
ATOM 7549 O O     . ILE E 1 352 ? 9.902   57.965  87.471  1.00 92.15  ? 427 ILE E O     1 
ATOM 7550 C CB    . ILE E 1 352 ? 10.155  56.419  90.307  1.00 104.20 ? 427 ILE E CB    1 
ATOM 7551 C CG1   . ILE E 1 352 ? 10.223  55.169  91.198  1.00 108.96 ? 427 ILE E CG1   1 
ATOM 7552 C CG2   . ILE E 1 352 ? 8.710   56.988  90.334  1.00 82.13  ? 427 ILE E CG2   1 
ATOM 7553 C CD1   . ILE E 1 352 ? 9.231   55.192  92.402  1.00 109.15 ? 427 ILE E CD1   1 
ATOM 7554 N N     . TRP E 1 353 ? 12.100  57.824  88.002  1.00 82.83  ? 428 TRP E N     1 
ATOM 7555 C CA    . TRP E 1 353 ? 12.459  59.015  87.240  1.00 83.34  ? 428 TRP E CA    1 
ATOM 7556 C C     . TRP E 1 353 ? 12.016  58.925  85.772  1.00 77.84  ? 428 TRP E C     1 
ATOM 7557 O O     . TRP E 1 353 ? 11.472  59.892  85.239  1.00 84.04  ? 428 TRP E O     1 
ATOM 7558 C CB    . TRP E 1 353 ? 13.962  59.265  87.354  1.00 82.50  ? 428 TRP E CB    1 
ATOM 7559 C CG    . TRP E 1 353 ? 14.495  59.443  88.801  1.00 84.42  ? 428 TRP E CG    1 
ATOM 7560 C CD1   . TRP E 1 353 ? 14.872  58.455  89.668  1.00 85.27  ? 428 TRP E CD1   1 
ATOM 7561 C CD2   . TRP E 1 353 ? 14.731  60.683  89.499  1.00 84.48  ? 428 TRP E CD2   1 
ATOM 7562 N NE1   . TRP E 1 353 ? 15.310  58.993  90.859  1.00 78.18  ? 428 TRP E NE1   1 
ATOM 7563 C CE2   . TRP E 1 353 ? 15.229  60.357  90.781  1.00 77.58  ? 428 TRP E CE2   1 
ATOM 7564 C CE3   . TRP E 1 353 ? 14.553  62.033  89.170  1.00 85.71  ? 428 TRP E CE3   1 
ATOM 7565 C CZ2   . TRP E 1 353 ? 15.563  61.326  91.720  1.00 84.19  ? 428 TRP E CZ2   1 
ATOM 7566 C CZ3   . TRP E 1 353 ? 14.880  62.991  90.106  1.00 85.67  ? 428 TRP E CZ3   1 
ATOM 7567 C CH2   . TRP E 1 353 ? 15.385  62.634  91.366  1.00 93.43  ? 428 TRP E CH2   1 
ATOM 7568 N N     . HIS E 1 354 ? 12.194  57.779  85.107  1.00 64.00  ? 429 HIS E N     1 
ATOM 7569 C CA    . HIS E 1 354 ? 11.848  57.715  83.681  1.00 67.57  ? 429 HIS E CA    1 
ATOM 7570 C C     . HIS E 1 354 ? 10.364  57.872  83.417  1.00 72.90  ? 429 HIS E C     1 
ATOM 7571 O O     . HIS E 1 354 ? 9.970   58.320  82.327  1.00 59.29  ? 429 HIS E O     1 
ATOM 7572 C CB    . HIS E 1 354 ? 12.278  56.396  83.075  1.00 60.22  ? 429 HIS E CB    1 
ATOM 7573 C CG    . HIS E 1 354 ? 13.748  56.162  83.145  1.00 77.28  ? 429 HIS E CG    1 
ATOM 7574 N ND1   . HIS E 1 354 ? 14.575  56.278  82.045  1.00 71.72  ? 429 HIS E ND1   1 
ATOM 7575 C CD2   . HIS E 1 354 ? 14.546  55.832  84.188  1.00 74.64  ? 429 HIS E CD2   1 
ATOM 7576 C CE1   . HIS E 1 354 ? 15.820  56.022  82.406  1.00 62.70  ? 429 HIS E CE1   1 
ATOM 7577 N NE2   . HIS E 1 354 ? 15.829  55.749  83.701  1.00 73.92  ? 429 HIS E NE2   1 
ATOM 7578 N N     . TYR E 1 355 ? 9.541   57.382  84.347  1.00 89.26  ? 430 TYR E N     1 
ATOM 7579 C CA    . TYR E 1 355 ? 8.092   57.379  84.186  1.00 97.33  ? 430 TYR E CA    1 
ATOM 7580 C C     . TYR E 1 355 ? 7.512   58.708  84.595  1.00 89.71  ? 430 TYR E C     1 
ATOM 7581 O O     . TYR E 1 355 ? 6.590   59.230  83.948  1.00 80.92  ? 430 TYR E O     1 
ATOM 7582 C CB    . TYR E 1 355 ? 7.449   56.288  85.040  1.00 89.17  ? 430 TYR E CB    1 
ATOM 7583 C CG    . TYR E 1 355 ? 8.118   54.936  85.016  1.00 92.54  ? 430 TYR E CG    1 
ATOM 7584 C CD1   . TYR E 1 355 ? 8.738   54.429  86.154  1.00 88.01  ? 430 TYR E CD1   1 
ATOM 7585 C CD2   . TYR E 1 355 ? 8.111   54.152  83.871  1.00 90.49  ? 430 TYR E CD2   1 
ATOM 7586 C CE1   . TYR E 1 355 ? 9.328   53.172  86.153  1.00 88.29  ? 430 TYR E CE1   1 
ATOM 7587 C CE2   . TYR E 1 355 ? 8.708   52.895  83.855  1.00 85.69  ? 430 TYR E CE2   1 
ATOM 7588 C CZ    . TYR E 1 355 ? 9.310   52.405  85.001  1.00 95.38  ? 430 TYR E CZ    1 
ATOM 7589 O OH    . TYR E 1 355 ? 9.895   51.145  84.993  1.00 97.08  ? 430 TYR E OH    1 
ATOM 7590 N N     . THR E 1 356 ? 8.018   59.210  85.720  1.00 78.14  ? 431 THR E N     1 
ATOM 7591 C CA    . THR E 1 356 ? 7.785   60.583  86.121  1.00 75.94  ? 431 THR E CA    1 
ATOM 7592 C C     . THR E 1 356 ? 8.125   61.528  84.971  1.00 88.25  ? 431 THR E C     1 
ATOM 7593 O O     . THR E 1 356 ? 7.274   62.283  84.492  1.00 89.81  ? 431 THR E O     1 
ATOM 7594 C CB    . THR E 1 356 ? 8.624   60.857  87.371  1.00 76.52  ? 431 THR E CB    1 
ATOM 7595 O OG1   . THR E 1 356 ? 8.162   60.020  88.439  1.00 86.05  ? 431 THR E OG1   1 
ATOM 7596 C CG2   . THR E 1 356 ? 8.564   62.286  87.799  1.00 65.02  ? 431 THR E CG2   1 
ATOM 7597 N N     . ALA E 1 357 ? 9.351   61.438  84.454  1.00 91.45  ? 432 ALA E N     1 
ATOM 7598 C CA    . ALA E 1 357 ? 9.751   62.316  83.359  1.00 81.31  ? 432 ALA E CA    1 
ATOM 7599 C C     . ALA E 1 357 ? 8.937   62.094  82.103  1.00 72.08  ? 432 ALA E C     1 
ATOM 7600 O O     . ALA E 1 357 ? 9.032   62.890  81.177  1.00 71.59  ? 432 ALA E O     1 
ATOM 7601 C CB    . ALA E 1 357 ? 11.228  62.128  83.011  1.00 85.56  ? 432 ALA E CB    1 
ATOM 7602 N N     . PHE E 1 358 ? 8.208   61.000  81.999  1.00 81.81  ? 433 PHE E N     1 
ATOM 7603 C CA    . PHE E 1 358 ? 7.333   60.925  80.852  1.00 75.57  ? 433 PHE E CA    1 
ATOM 7604 C C     . PHE E 1 358 ? 6.049   61.689  81.096  1.00 86.90  ? 433 PHE E C     1 
ATOM 7605 O O     . PHE E 1 358 ? 5.462   62.257  80.167  1.00 83.99  ? 433 PHE E O     1 
ATOM 7606 C CB    . PHE E 1 358 ? 7.011   59.500  80.527  1.00 69.52  ? 433 PHE E CB    1 
ATOM 7607 C CG    . PHE E 1 358 ? 6.677   59.333  79.128  1.00 69.79  ? 433 PHE E CG    1 
ATOM 7608 C CD1   . PHE E 1 358 ? 7.169   60.233  78.223  1.00 65.90  ? 433 PHE E CD1   1 
ATOM 7609 C CD2   . PHE E 1 358 ? 5.860   58.311  78.698  1.00 80.60  ? 433 PHE E CD2   1 
ATOM 7610 C CE1   . PHE E 1 358 ? 6.891   60.095  76.903  1.00 78.17  ? 433 PHE E CE1   1 
ATOM 7611 C CE2   . PHE E 1 358 ? 5.563   58.161  77.366  1.00 81.93  ? 433 PHE E CE2   1 
ATOM 7612 C CZ    . PHE E 1 358 ? 6.078   59.054  76.462  1.00 82.15  ? 433 PHE E CZ    1 
ATOM 7613 N N     . PHE E 1 359 ? 5.600   61.695  82.348  1.00 93.76  ? 434 PHE E N     1 
ATOM 7614 C CA    . PHE E 1 359 ? 4.381   62.409  82.710  1.00 104.65 ? 434 PHE E CA    1 
ATOM 7615 C C     . PHE E 1 359 ? 4.556   63.913  82.546  1.00 91.45  ? 434 PHE E C     1 
ATOM 7616 O O     . PHE E 1 359 ? 3.679   64.593  82.008  1.00 106.16 ? 434 PHE E O     1 
ATOM 7617 C CB    . PHE E 1 359 ? 3.996   62.060  84.148  1.00 110.26 ? 434 PHE E CB    1 
ATOM 7618 C CG    . PHE E 1 359 ? 2.614   62.466  84.510  1.00 113.20 ? 434 PHE E CG    1 
ATOM 7619 C CD1   . PHE E 1 359 ? 1.752   62.981  83.533  1.00 117.00 ? 434 PHE E CD1   1 
ATOM 7620 C CD2   . PHE E 1 359 ? 2.169   62.336  85.813  1.00 102.23 ? 434 PHE E CD2   1 
ATOM 7621 C CE1   . PHE E 1 359 ? 0.478   63.378  83.839  1.00 107.93 ? 434 PHE E CE1   1 
ATOM 7622 C CE2   . PHE E 1 359 ? 0.895   62.726  86.141  1.00 117.39 ? 434 PHE E CE2   1 
ATOM 7623 C CZ    . PHE E 1 359 ? 0.043   63.252  85.151  1.00 136.82 ? 434 PHE E CZ    1 
ATOM 7624 N N     . PHE E 1 360 ? 5.706   64.419  82.890  1.00 86.18  ? 435 PHE E N     1 
ATOM 7625 C CA    . PHE E 1 360 ? 6.066   65.821  82.870  1.00 74.41  ? 435 PHE E CA    1 
ATOM 7626 C C     . PHE E 1 360 ? 6.355   66.304  81.492  1.00 78.21  ? 435 PHE E C     1 
ATOM 7627 O O     . PHE E 1 360 ? 6.997   67.354  81.337  1.00 86.70  ? 435 PHE E O     1 
ATOM 7628 C CB    . PHE E 1 360 ? 7.266   66.074  83.771  1.00 64.14  ? 435 PHE E CB    1 
ATOM 7629 C CG    . PHE E 1 360 ? 6.973   65.885  85.216  1.00 71.21  ? 435 PHE E CG    1 
ATOM 7630 C CD1   . PHE E 1 360 ? 7.946   66.154  86.169  1.00 74.51  ? 435 PHE E CD1   1 
ATOM 7631 C CD2   . PHE E 1 360 ? 5.729   65.444  85.635  1.00 76.16  ? 435 PHE E CD2   1 
ATOM 7632 C CE1   . PHE E 1 360 ? 7.698   66.009  87.528  1.00 79.95  ? 435 PHE E CE1   1 
ATOM 7633 C CE2   . PHE E 1 360 ? 5.473   65.267  87.000  1.00 93.61  ? 435 PHE E CE2   1 
ATOM 7634 C CZ    . PHE E 1 360 ? 6.460   65.555  87.951  1.00 83.23  ? 435 PHE E CZ    1 
ATOM 7635 N N     . TYR E 1 361 ? 6.001   65.450  80.533  1.00 64.15  ? 436 TYR E N     1 
ATOM 7636 C CA    . TYR E 1 361 ? 5.801   65.829  79.143  1.00 78.59  ? 436 TYR E CA    1 
ATOM 7637 C C     . TYR E 1 361 ? 4.315   65.693  78.898  1.00 95.69  ? 436 TYR E C     1 
ATOM 7638 O O     . TYR E 1 361 ? 3.785   64.569  78.897  1.00 93.25  ? 436 TYR E O     1 
ATOM 7639 C CB    . TYR E 1 361 ? 6.593   64.940  78.197  1.00 74.85  ? 436 TYR E CB    1 
ATOM 7640 C CG    . TYR E 1 361 ? 6.518   65.207  76.703  1.00 67.09  ? 436 TYR E CG    1 
ATOM 7641 C CD1   . TYR E 1 361 ? 7.650   65.567  76.003  1.00 67.66  ? 436 TYR E CD1   1 
ATOM 7642 C CD2   . TYR E 1 361 ? 5.365   64.982  75.976  1.00 75.83  ? 436 TYR E CD2   1 
ATOM 7643 C CE1   . TYR E 1 361 ? 7.636   65.754  74.624  1.00 75.00  ? 436 TYR E CE1   1 
ATOM 7644 C CE2   . TYR E 1 361 ? 5.340   65.167  74.577  1.00 85.84  ? 436 TYR E CE2   1 
ATOM 7645 C CZ    . TYR E 1 361 ? 6.489   65.553  73.907  1.00 79.73  ? 436 TYR E CZ    1 
ATOM 7646 O OH    . TYR E 1 361 ? 6.519   65.746  72.524  1.00 81.74  ? 436 TYR E OH    1 
ATOM 7647 N N     . PRO E 1 362 ? 3.628   66.809  78.698  1.00 106.99 ? 437 PRO E N     1 
ATOM 7648 C CA    . PRO E 1 362 ? 2.201   66.902  79.020  1.00 106.16 ? 437 PRO E CA    1 
ATOM 7649 C C     . PRO E 1 362 ? 1.310   66.115  78.072  1.00 115.51 ? 437 PRO E C     1 
ATOM 7650 O O     . PRO E 1 362 ? 0.191   65.737  78.461  1.00 125.59 ? 437 PRO E O     1 
ATOM 7651 C CB    . PRO E 1 362 ? 1.932   68.408  78.930  1.00 108.57 ? 437 PRO E CB    1 
ATOM 7652 C CG    . PRO E 1 362 ? 3.282   69.021  79.211  1.00 110.03 ? 437 PRO E CG    1 
ATOM 7653 C CD    . PRO E 1 362 ? 4.239   68.133  78.509  1.00 102.89 ? 437 PRO E CD    1 
ATOM 7654 N N     . PRO E 1 363 ? 1.729   65.840  76.824  1.00 92.47  ? 438 PRO E N     1 
ATOM 7655 C CA    . PRO E 1 363 ? 0.936   64.874  76.050  1.00 107.11 ? 438 PRO E CA    1 
ATOM 7656 C C     . PRO E 1 363 ? 1.093   63.442  76.541  1.00 94.85  ? 438 PRO E C     1 
ATOM 7657 O O     . PRO E 1 363 ? 1.216   62.525  75.726  1.00 85.42  ? 438 PRO E O     1 
ATOM 7658 C CB    . PRO E 1 363 ? 1.473   65.046  74.626  1.00 100.67 ? 438 PRO E CB    1 
ATOM 7659 C CG    . PRO E 1 363 ? 1.853   66.478  74.588  1.00 96.68  ? 438 PRO E CG    1 
ATOM 7660 C CD    . PRO E 1 363 ? 2.449   66.763  75.932  1.00 77.63  ? 438 PRO E CD    1 
ATOM 7661 N N     . ALA E 1 364 ? 1.000   63.251  77.872  1.00 106.38 ? 439 ALA E N     1 
ATOM 7662 C CA    . ALA E 1 364 ? 0.925   61.947  78.528  1.00 107.66 ? 439 ALA E CA    1 
ATOM 7663 C C     . ALA E 1 364 ? -0.516  61.753  78.982  1.00 121.16 ? 439 ALA E C     1 
ATOM 7664 O O     . ALA E 1 364 ? -0.944  62.281  80.016  1.00 126.52 ? 439 ALA E O     1 
ATOM 7665 C CB    . ALA E 1 364 ? 1.885   61.843  79.714  1.00 91.78  ? 439 ALA E CB    1 
ATOM 7666 N N     . LEU E 1 365 ? -1.227  60.936  78.219  1.00 115.73 ? 440 LEU E N     1 
ATOM 7667 C CA    . LEU E 1 365 ? -2.534  60.394  78.534  1.00 102.36 ? 440 LEU E CA    1 
ATOM 7668 C C     . LEU E 1 365 ? -2.377  58.933  78.938  1.00 127.07 ? 440 LEU E C     1 
ATOM 7669 O O     . LEU E 1 365 ? -2.711  58.526  80.055  1.00 136.67 ? 440 LEU E O     1 
ATOM 7670 C CB    . LEU E 1 365 ? -3.416  60.536  77.288  1.00 97.06  ? 440 LEU E CB    1 
ATOM 7671 C CG    . LEU E 1 365 ? -2.580  60.629  75.998  1.00 90.71  ? 440 LEU E CG    1 
ATOM 7672 C CD1   . LEU E 1 365 ? -3.118  59.752  74.879  1.00 76.97  ? 440 LEU E CD1   1 
ATOM 7673 C CD2   . LEU E 1 365 ? -2.443  62.074  75.518  1.00 96.54  ? 440 LEU E CD2   1 
ATOM 7674 N N     . HIS E 1 366 ? -1.837  58.151  78.001  1.00 132.20 ? 441 HIS E N     1 
ATOM 7675 C CA    . HIS E 1 366 ? -1.523  56.729  78.118  1.00 130.92 ? 441 HIS E CA    1 
ATOM 7676 C C     . HIS E 1 366 ? -0.734  56.336  79.359  1.00 132.37 ? 441 HIS E C     1 
ATOM 7677 O O     . HIS E 1 366 ? -0.926  55.228  79.869  1.00 147.17 ? 441 HIS E O     1 
ATOM 7678 C CB    . HIS E 1 366 ? -0.704  56.364  76.897  1.00 115.67 ? 441 HIS E CB    1 
ATOM 7679 C CG    . HIS E 1 366 ? 0.113   57.515  76.419  1.00 114.44 ? 441 HIS E CG    1 
ATOM 7680 N ND1   . HIS E 1 366 ? -0.282  58.325  75.377  1.00 128.36 ? 441 HIS E ND1   1 
ATOM 7681 C CD2   . HIS E 1 366 ? 1.243   58.063  76.917  1.00 113.54 ? 441 HIS E CD2   1 
ATOM 7682 C CE1   . HIS E 1 366 ? 0.605   59.290  75.214  1.00 115.28 ? 441 HIS E CE1   1 
ATOM 7683 N NE2   . HIS E 1 366 ? 1.539   59.154  76.137  1.00 113.22 ? 441 HIS E NE2   1 
ATOM 7684 N N     . MET E 1 367 ? 0.165   57.197  79.856  1.00 121.88 ? 442 MET E N     1 
ATOM 7685 C CA    . MET E 1 367 ? 1.162   56.744  80.832  1.00 134.13 ? 442 MET E CA    1 
ATOM 7686 C C     . MET E 1 367 ? 0.521   56.144  82.080  1.00 130.99 ? 442 MET E C     1 
ATOM 7687 O O     . MET E 1 367 ? 1.231   55.561  82.915  1.00 111.88 ? 442 MET E O     1 
ATOM 7688 C CB    . MET E 1 367 ? 2.108   57.892  81.226  1.00 143.50 ? 442 MET E CB    1 
ATOM 7689 C CG    . MET E 1 367 ? 3.625   57.542  81.111  1.00 132.91 ? 442 MET E CG    1 
ATOM 7690 S SD    . MET E 1 367 ? 4.497   56.815  82.547  1.00 136.22 ? 442 MET E SD    1 
ATOM 7691 C CE    . MET E 1 367 ? 5.949   56.116  81.772  1.00 105.63 ? 442 MET E CE    1 
ATOM 7692 N N     . GLN E 1 368 ? -0.807  56.215  82.169  1.00 130.30 ? 443 GLN E N     1 
ATOM 7693 C CA    . GLN E 1 368 ? -1.614  55.867  83.324  1.00 131.58 ? 443 GLN E CA    1 
ATOM 7694 C C     . GLN E 1 368 ? -1.133  54.596  84.018  1.00 126.49 ? 443 GLN E C     1 
ATOM 7695 O O     . GLN E 1 368 ? -0.523  54.657  85.095  1.00 110.68 ? 443 GLN E O     1 
ATOM 7696 C CB    . GLN E 1 368 ? -3.056  55.709  82.822  1.00 114.66 ? 443 GLN E CB    1 
ATOM 7697 C CG    . GLN E 1 368 ? -3.983  55.011  83.760  1.00 130.61 ? 443 GLN E CG    1 
ATOM 7698 C CD    . GLN E 1 368 ? -3.877  55.551  85.161  1.00 143.82 ? 443 GLN E CD    1 
ATOM 7699 O OE1   . GLN E 1 368 ? -3.513  54.825  86.090  1.00 140.64 ? 443 GLN E OE1   1 
ATOM 7700 N NE2   . GLN E 1 368 ? -4.183  56.838  85.325  1.00 146.42 ? 443 GLN E NE2   1 
ATOM 7701 N N     . GLN E 1 369 ? -1.383  53.453  83.385  1.00 135.80 ? 444 GLN E N     1 
ATOM 7702 C CA    . GLN E 1 369 ? -0.883  52.149  83.802  1.00 137.12 ? 444 GLN E CA    1 
ATOM 7703 C C     . GLN E 1 369 ? -1.085  51.883  85.285  1.00 138.70 ? 444 GLN E C     1 
ATOM 7704 O O     . GLN E 1 369 ? -2.070  52.317  85.886  1.00 150.70 ? 444 GLN E O     1 
ATOM 7705 C CB    . GLN E 1 369 ? 0.603   52.029  83.460  1.00 137.36 ? 444 GLN E CB    1 
ATOM 7706 C CG    . GLN E 1 369 ? 0.900   52.229  81.993  1.00 135.07 ? 444 GLN E CG    1 
ATOM 7707 C CD    . GLN E 1 369 ? -0.186  51.638  81.121  1.00 135.87 ? 444 GLN E CD    1 
ATOM 7708 O OE1   . GLN E 1 369 ? -0.992  52.367  80.535  1.00 126.87 ? 444 GLN E OE1   1 
ATOM 7709 N NE2   . GLN E 1 369 ? -0.231  50.308  81.046  1.00 143.00 ? 444 GLN E NE2   1 
ATOM 7710 N N     . GLU E 1 370 ? -0.111  51.216  85.882  1.00 139.22 ? 445 GLU E N     1 
ATOM 7711 C CA    . GLU E 1 370 ? 0.076   51.173  87.321  1.00 143.10 ? 445 GLU E CA    1 
ATOM 7712 C C     . GLU E 1 370 ? 0.869   52.372  87.805  1.00 132.50 ? 445 GLU E C     1 
ATOM 7713 O O     . GLU E 1 370 ? 1.042   52.553  89.015  1.00 127.47 ? 445 GLU E O     1 
ATOM 7714 C CB    . GLU E 1 370 ? 0.820   49.891  87.702  1.00 151.17 ? 445 GLU E CB    1 
ATOM 7715 C CG    . GLU E 1 370 ? 2.291   49.855  87.202  1.00 148.51 ? 445 GLU E CG    1 
ATOM 7716 C CD    . GLU E 1 370 ? 2.448   49.519  85.706  1.00 143.14 ? 445 GLU E CD    1 
ATOM 7717 O OE1   . GLU E 1 370 ? 1.429   49.430  84.981  1.00 135.84 ? 445 GLU E OE1   1 
ATOM 7718 O OE2   . GLU E 1 370 ? 3.604   49.333  85.261  1.00 139.77 ? 445 GLU E OE2   1 
ATOM 7719 N N     . LYS E 1 371 ? 1.342   53.190  86.872  1.00 123.12 ? 446 LYS E N     1 
ATOM 7720 C CA    . LYS E 1 371 ? 2.490   54.038  87.129  1.00 114.27 ? 446 LYS E CA    1 
ATOM 7721 C C     . LYS E 1 371 ? 2.123   55.227  88.000  1.00 111.91 ? 446 LYS E C     1 
ATOM 7722 O O     . LYS E 1 371 ? 2.814   55.520  88.986  1.00 97.82  ? 446 LYS E O     1 
ATOM 7723 C CB    . LYS E 1 371 ? 3.079   54.495  85.799  1.00 118.45 ? 446 LYS E CB    1 
ATOM 7724 C CG    . LYS E 1 371 ? 3.532   53.357  84.903  1.00 120.85 ? 446 LYS E CG    1 
ATOM 7725 C CD    . LYS E 1 371 ? 4.530   52.441  85.590  1.00 99.98  ? 446 LYS E CD    1 
ATOM 7726 C CE    . LYS E 1 371 ? 5.342   51.704  84.547  1.00 87.81  ? 446 LYS E CE    1 
ATOM 7727 N NZ    . LYS E 1 371 ? 4.478   51.239  83.425  1.00 83.39  ? 446 LYS E NZ    1 
ATOM 7728 N N     . VAL E 1 372 ? 1.020   55.902  87.664  1.00 118.86 ? 447 VAL E N     1 
ATOM 7729 C CA    . VAL E 1 372 ? 0.607   57.133  88.329  1.00 102.74 ? 447 VAL E CA    1 
ATOM 7730 C C     . VAL E 1 372 ? 0.510   56.879  89.824  1.00 95.93  ? 447 VAL E C     1 
ATOM 7731 O O     . VAL E 1 372 ? 0.632   57.802  90.639  1.00 83.94  ? 447 VAL E O     1 
ATOM 7732 C CB    . VAL E 1 372 ? -0.720  57.641  87.753  1.00 89.55  ? 447 VAL E CB    1 
ATOM 7733 C CG1   . VAL E 1 372 ? -1.777  56.596  87.948  1.00 117.97 ? 447 VAL E CG1   1 
ATOM 7734 C CG2   . VAL E 1 372 ? -1.110  58.941  88.413  1.00 101.86 ? 447 VAL E CG2   1 
ATOM 7735 N N     . ALA E 1 373 ? 0.326   55.611  90.188  1.00 103.41 ? 448 ALA E N     1 
ATOM 7736 C CA    . ALA E 1 373 ? 0.428   55.198  91.577  1.00 113.51 ? 448 ALA E CA    1 
ATOM 7737 C C     . ALA E 1 373 ? 1.777   55.604  92.177  1.00 118.92 ? 448 ALA E C     1 
ATOM 7738 O O     . ALA E 1 373 ? 1.853   56.590  92.925  1.00 100.52 ? 448 ALA E O     1 
ATOM 7739 C CB    . ALA E 1 373 ? 0.215   53.684  91.684  1.00 101.38 ? 448 ALA E CB    1 
ATOM 7740 N N     . GLN E 1 374 ? 2.858   54.895  91.820  1.00 118.15 ? 449 GLN E N     1 
ATOM 7741 C CA    . GLN E 1 374 ? 4.151   55.243  92.393  1.00 100.28 ? 449 GLN E CA    1 
ATOM 7742 C C     . GLN E 1 374 ? 4.618   56.598  91.903  1.00 103.62 ? 449 GLN E C     1 
ATOM 7743 O O     . GLN E 1 374 ? 5.424   57.238  92.588  1.00 109.49 ? 449 GLN E O     1 
ATOM 7744 C CB    . GLN E 1 374 ? 5.210   54.186  92.074  1.00 95.58  ? 449 GLN E CB    1 
ATOM 7745 C CG    . GLN E 1 374 ? 4.882   52.777  92.534  1.00 117.93 ? 449 GLN E CG    1 
ATOM 7746 C CD    . GLN E 1 374 ? 4.668   51.809  91.362  1.00 131.44 ? 449 GLN E CD    1 
ATOM 7747 O OE1   . GLN E 1 374 ? 3.574   51.741  90.790  1.00 130.80 ? 449 GLN E OE1   1 
ATOM 7748 N NE2   . GLN E 1 374 ? 5.716   51.058  91.004  1.00 116.75 ? 449 GLN E NE2   1 
ATOM 7749 N N     . ILE E 1 375 ? 4.116   57.045  90.743  1.00 91.34  ? 450 ILE E N     1 
ATOM 7750 C CA    . ILE E 1 375 ? 4.481   58.360  90.216  1.00 93.33  ? 450 ILE E CA    1 
ATOM 7751 C C     . ILE E 1 375 ? 4.224   59.423  91.265  1.00 110.64 ? 450 ILE E C     1 
ATOM 7752 O O     . ILE E 1 375 ? 5.121   60.174  91.658  1.00 107.59 ? 450 ILE E O     1 
ATOM 7753 C CB    . ILE E 1 375 ? 3.687   58.687  88.944  1.00 82.89  ? 450 ILE E CB    1 
ATOM 7754 C CG1   . ILE E 1 375 ? 4.245   57.983  87.727  1.00 71.21  ? 450 ILE E CG1   1 
ATOM 7755 C CG2   . ILE E 1 375 ? 3.695   60.181  88.708  1.00 93.14  ? 450 ILE E CG2   1 
ATOM 7756 C CD1   . ILE E 1 375 ? 3.858   58.669  86.427  1.00 85.87  ? 450 ILE E CD1   1 
ATOM 7757 N N     . LYS E 1 376 ? 2.978   59.489  91.732  1.00 120.27 ? 451 LYS E N     1 
ATOM 7758 C CA    . LYS E 1 376 ? 2.599   60.513  92.692  1.00 116.43 ? 451 LYS E CA    1 
ATOM 7759 C C     . LYS E 1 376 ? 3.253   60.256  94.043  1.00 114.10 ? 451 LYS E C     1 
ATOM 7760 O O     . LYS E 1 376 ? 3.742   61.193  94.682  1.00 111.78 ? 451 LYS E O     1 
ATOM 7761 C CB    . LYS E 1 376 ? 1.079   60.561  92.800  1.00 112.67 ? 451 LYS E CB    1 
ATOM 7762 C CG    . LYS E 1 376 ? 0.507   61.839  93.368  1.00 119.92 ? 451 LYS E CG    1 
ATOM 7763 C CD    . LYS E 1 376 ? -0.959  61.988  92.942  1.00 139.34 ? 451 LYS E CD    1 
ATOM 7764 C CE    . LYS E 1 376 ? -1.707  63.099  93.702  1.00 147.14 ? 451 LYS E CE    1 
ATOM 7765 N NZ    . LYS E 1 376 ? -3.193  63.122  93.419  1.00 137.23 ? 451 LYS E NZ    1 
ATOM 7766 N N     . GLU E 1 377 ? 3.295   58.990  94.481  1.00 119.44 ? 452 GLU E N     1 
ATOM 7767 C CA    . GLU E 1 377 ? 4.040   58.658  95.693  1.00 123.05 ? 452 GLU E CA    1 
ATOM 7768 C C     . GLU E 1 377 ? 5.414   59.280  95.630  1.00 122.93 ? 452 GLU E C     1 
ATOM 7769 O O     . GLU E 1 377 ? 5.891   59.868  96.601  1.00 120.47 ? 452 GLU E O     1 
ATOM 7770 C CB    . GLU E 1 377 ? 4.177   57.144  95.879  1.00 129.77 ? 452 GLU E CB    1 
ATOM 7771 C CG    . GLU E 1 377 ? 5.014   56.764  97.115  1.00 129.37 ? 452 GLU E CG    1 
ATOM 7772 C CD    . GLU E 1 377 ? 5.968   55.612  96.862  1.00 137.13 ? 452 GLU E CD    1 
ATOM 7773 O OE1   . GLU E 1 377 ? 6.599   55.594  95.780  1.00 128.05 ? 452 GLU E OE1   1 
ATOM 7774 O OE2   . GLU E 1 377 ? 6.085   54.729  97.746  1.00 142.89 ? 452 GLU E OE2   1 
ATOM 7775 N N     . PHE E 1 378 ? 6.063   59.149  94.477  1.00 127.65 ? 453 PHE E N     1 
ATOM 7776 C CA    . PHE E 1 378 ? 7.290   59.871  94.199  1.00 128.52 ? 453 PHE E CA    1 
ATOM 7777 C C     . PHE E 1 378 ? 7.112   61.388  94.239  1.00 129.98 ? 453 PHE E C     1 
ATOM 7778 O O     . PHE E 1 378 ? 7.507   61.998  95.235  1.00 142.64 ? 453 PHE E O     1 
ATOM 7779 C CB    . PHE E 1 378 ? 7.851   59.438  92.847  1.00 128.79 ? 453 PHE E CB    1 
ATOM 7780 C CG    . PHE E 1 378 ? 9.174   60.064  92.509  1.00 122.09 ? 453 PHE E CG    1 
ATOM 7781 C CD1   . PHE E 1 378 ? 10.302  59.782  93.270  1.00 109.02 ? 453 PHE E CD1   1 
ATOM 7782 C CD2   . PHE E 1 378 ? 9.292   60.914  91.417  1.00 108.68 ? 453 PHE E CD2   1 
ATOM 7783 C CE1   . PHE E 1 378 ? 11.521  60.340  92.958  1.00 100.57 ? 453 PHE E CE1   1 
ATOM 7784 C CE2   . PHE E 1 378 ? 10.507  61.478  91.099  1.00 112.70 ? 453 PHE E CE2   1 
ATOM 7785 C CZ    . PHE E 1 378 ? 11.629  61.188  91.874  1.00 112.00 ? 453 PHE E CZ    1 
ATOM 7786 N N     . CYS E 1 379 ? 6.485   62.014  93.222  1.00 118.30 ? 454 CYS E N     1 
ATOM 7787 C CA    . CYS E 1 379 ? 6.699   63.458  93.054  1.00 117.60 ? 454 CYS E CA    1 
ATOM 7788 C C     . CYS E 1 379 ? 6.378   64.215  94.325  1.00 117.38 ? 454 CYS E C     1 
ATOM 7789 O O     . CYS E 1 379 ? 7.043   65.199  94.647  1.00 121.19 ? 454 CYS E O     1 
ATOM 7790 C CB    . CYS E 1 379 ? 5.889   64.040  91.897  1.00 98.30  ? 454 CYS E CB    1 
ATOM 7791 S SG    . CYS E 1 379 ? 4.768   62.913  91.181  1.00 103.67 ? 454 CYS E SG    1 
ATOM 7792 N N     . LEU E 1 380 ? 5.413   63.732  95.088  1.00 118.77 ? 455 LEU E N     1 
ATOM 7793 C CA    . LEU E 1 380 ? 5.113   64.365  96.355  1.00 116.52 ? 455 LEU E CA    1 
ATOM 7794 C C     . LEU E 1 380 ? 6.071   63.931  97.452  1.00 119.77 ? 455 LEU E C     1 
ATOM 7795 O O     . LEU E 1 380 ? 6.260   64.673  98.413  1.00 144.83 ? 455 LEU E O     1 
ATOM 7796 C CB    . LEU E 1 380 ? 3.665   64.073  96.735  1.00 124.09 ? 455 LEU E CB    1 
ATOM 7797 C CG    . LEU E 1 380 ? 2.676   64.510  95.642  1.00 128.32 ? 455 LEU E CG    1 
ATOM 7798 C CD1   . LEU E 1 380 ? 1.251   64.111  95.990  1.00 108.25 ? 455 LEU E CD1   1 
ATOM 7799 C CD2   . LEU E 1 380 ? 2.767   66.014  95.351  1.00 123.58 ? 455 LEU E CD2   1 
ATOM 7800 N N     . SER E 1 381 ? 6.691   62.756  97.330  1.00 127.41 ? 456 SER E N     1 
ATOM 7801 C CA    . SER E 1 381 ? 7.636   62.307  98.356  1.00 136.32 ? 456 SER E CA    1 
ATOM 7802 C C     . SER E 1 381 ? 8.705   63.359  98.638  1.00 139.58 ? 456 SER E C     1 
ATOM 7803 O O     . SER E 1 381 ? 9.089   63.566  99.796  1.00 144.51 ? 456 SER E O     1 
ATOM 7804 C CB    . SER E 1 381 ? 8.294   60.985  97.937  1.00 129.10 ? 456 SER E CB    1 
ATOM 7805 O OG    . SER E 1 381 ? 9.075   60.423  98.971  1.00 114.17 ? 456 SER E OG    1 
ATOM 7806 N N     . LYS E 1 382 ? 9.253   63.977  97.589  1.00 139.63 ? 457 LYS E N     1 
ATOM 7807 C CA    . LYS E 1 382 ? 10.196  65.084  97.735  1.00 158.40 ? 457 LYS E CA    1 
ATOM 7808 C C     . LYS E 1 382 ? 9.576   66.479  97.554  1.00 167.23 ? 457 LYS E C     1 
ATOM 7809 O O     . LYS E 1 382 ? 10.238  67.475  97.882  1.00 172.20 ? 457 LYS E O     1 
ATOM 7810 C CB    . LYS E 1 382 ? 11.370  64.901  96.748  1.00 163.95 ? 457 LYS E CB    1 
ATOM 7811 C CG    . LYS E 1 382 ? 12.714  64.417  97.350  1.00 141.08 ? 457 LYS E CG    1 
ATOM 7812 C CD    . LYS E 1 382 ? 13.779  64.276  96.248  1.00 128.49 ? 457 LYS E CD    1 
ATOM 7813 C CE    . LYS E 1 382 ? 15.205  64.208  96.794  1.00 120.95 ? 457 LYS E CE    1 
ATOM 7814 N NZ    . LYS E 1 382 ? 16.251  64.241  95.715  1.00 112.05 ? 457 LYS E NZ    1 
ATOM 7815 N N     . MET E 1 383 ? 8.333   66.590  97.064  1.00 153.63 ? 458 MET E N     1 
ATOM 7816 C CA    . MET E 1 383 ? 7.797   67.906  96.698  1.00 158.41 ? 458 MET E CA    1 
ATOM 7817 C C     . MET E 1 383 ? 7.552   68.768  97.926  1.00 167.92 ? 458 MET E C     1 
ATOM 7818 O O     . MET E 1 383 ? 8.019   69.911  98.005  1.00 163.90 ? 458 MET E O     1 
ATOM 7819 C CB    . MET E 1 383 ? 6.498   67.745  95.908  1.00 150.22 ? 458 MET E CB    1 
ATOM 7820 C CG    . MET E 1 383 ? 5.831   69.032  95.454  1.00 148.58 ? 458 MET E CG    1 
ATOM 7821 S SD    . MET E 1 383 ? 4.824   68.706  93.987  1.00 146.18 ? 458 MET E SD    1 
ATOM 7822 C CE    . MET E 1 383 ? 3.379   69.716  94.300  1.00 144.18 ? 458 MET E CE    1 
ATOM 7823 N N     . GLU E 1 384 ? 6.806   68.226  98.889  1.00 176.74 ? 459 GLU E N     1 
ATOM 7824 C CA    . GLU E 1 384 ? 6.465   68.948  100.109 1.00 188.76 ? 459 GLU E CA    1 
ATOM 7825 C C     . GLU E 1 384 ? 7.712   69.315  100.914 1.00 200.94 ? 459 GLU E C     1 
ATOM 7826 O O     . GLU E 1 384 ? 7.944   70.494  101.219 1.00 197.61 ? 459 GLU E O     1 
ATOM 7827 C CB    . GLU E 1 384 ? 5.508   68.090  100.948 1.00 186.51 ? 459 GLU E CB    1 
ATOM 7828 C CG    . GLU E 1 384 ? 5.872   66.590  100.952 1.00 175.08 ? 459 GLU E CG    1 
ATOM 7829 C CD    . GLU E 1 384 ? 5.384   65.824  102.182 1.00 178.94 ? 459 GLU E CD    1 
ATOM 7830 O OE1   . GLU E 1 384 ? 4.198   65.967  102.558 1.00 187.30 ? 459 GLU E OE1   1 
ATOM 7831 O OE2   . GLU E 1 384 ? 6.196   65.068  102.767 1.00 165.55 ? 459 GLU E OE2   1 
ATOM 7832 N N     . ASP E 1 385 ? 8.537   68.309  101.263 1.00 199.73 ? 460 ASP E N     1 
ATOM 7833 C CA    . ASP E 1 385 ? 9.513   68.487  102.340 1.00 201.83 ? 460 ASP E CA    1 
ATOM 7834 C C     . ASP E 1 385 ? 10.761  69.250  101.889 1.00 202.91 ? 460 ASP E C     1 
ATOM 7835 O O     . ASP E 1 385 ? 11.207  70.171  102.591 1.00 198.42 ? 460 ASP E O     1 
ATOM 7836 C CB    . ASP E 1 385 ? 9.877   67.132  102.986 1.00 185.47 ? 460 ASP E CB    1 
ATOM 7837 C CG    . ASP E 1 385 ? 10.382  66.089  101.992 1.00 188.38 ? 460 ASP E CG    1 
ATOM 7838 O OD1   . ASP E 1 385 ? 10.809  66.450  100.874 1.00 188.29 ? 460 ASP E OD1   1 
ATOM 7839 O OD2   . ASP E 1 385 ? 10.370  64.888  102.354 1.00 180.51 ? 460 ASP E OD2   1 
ATOM 7840 N N     . LEU E 1 386 ? 11.310  68.960  100.708 1.00 189.64 ? 461 LEU E N     1 
ATOM 7841 C CA    . LEU E 1 386 ? 12.481  69.722  100.289 1.00 179.15 ? 461 LEU E CA    1 
ATOM 7842 C C     . LEU E 1 386 ? 11.910  70.956  99.617  1.00 168.50 ? 461 LEU E C     1 
ATOM 7843 O O     . LEU E 1 386 ? 11.440  70.919  98.475  1.00 156.56 ? 461 LEU E O     1 
ATOM 7844 C CB    . LEU E 1 386 ? 13.399  68.916  99.372  1.00 182.70 ? 461 LEU E CB    1 
ATOM 7845 C CG    . LEU E 1 386 ? 14.729  68.377  99.947  1.00 180.19 ? 461 LEU E CG    1 
ATOM 7846 C CD1   . LEU E 1 386 ? 15.108  67.019  99.329  1.00 152.34 ? 461 LEU E CD1   1 
ATOM 7847 C CD2   . LEU E 1 386 ? 15.900  69.374  99.817  1.00 148.45 ? 461 LEU E CD2   1 
ATOM 7848 N N     . GLU E 1 387 ? 11.940  72.047  100.366 1.00 156.47 ? 462 GLU E N     1 
ATOM 7849 C CA    . GLU E 1 387 ? 11.560  73.362  99.908  1.00 150.63 ? 462 GLU E CA    1 
ATOM 7850 C C     . GLU E 1 387 ? 12.549  74.270  100.585 1.00 149.14 ? 462 GLU E C     1 
ATOM 7851 O O     . GLU E 1 387 ? 12.730  74.161  101.800 1.00 153.60 ? 462 GLU E O     1 
ATOM 7852 C CB    . GLU E 1 387 ? 10.124  73.714  100.291 1.00 153.04 ? 462 GLU E CB    1 
ATOM 7853 C CG    . GLU E 1 387 ? 9.329   74.272  99.137  1.00 151.38 ? 462 GLU E CG    1 
ATOM 7854 C CD    . GLU E 1 387 ? 9.462   73.421  97.886  1.00 154.29 ? 462 GLU E CD    1 
ATOM 7855 O OE1   . GLU E 1 387 ? 10.521  73.474  97.217  1.00 128.15 ? 462 GLU E OE1   1 
ATOM 7856 O OE2   . GLU E 1 387 ? 8.501   72.690  97.572  1.00 167.06 ? 462 GLU E OE2   1 
ATOM 7857 N N     . LEU E 1 388 ? 13.231  75.102  99.812  1.00 139.64 ? 463 LEU E N     1 
ATOM 7858 C CA    . LEU E 1 388 ? 14.357  75.820  100.378 1.00 140.15 ? 463 LEU E CA    1 
ATOM 7859 C C     . LEU E 1 388 ? 14.523  77.166  99.667  1.00 132.50 ? 463 LEU E C     1 
ATOM 7860 O O     . LEU E 1 388 ? 13.532  77.841  99.346  1.00 111.82 ? 463 LEU E O     1 
ATOM 7861 C CB    . LEU E 1 388 ? 15.636  74.948  100.296 1.00 141.93 ? 463 LEU E CB    1 
ATOM 7862 C CG    . LEU E 1 388 ? 15.679  73.455  100.752 1.00 136.49 ? 463 LEU E CG    1 
ATOM 7863 C CD1   . LEU E 1 388 ? 16.854  72.707  100.128 1.00 128.23 ? 463 LEU E CD1   1 
ATOM 7864 C CD2   . LEU E 1 388 ? 15.686  73.221  102.282 1.00 102.36 ? 463 LEU E CD2   1 
ATOM 7865 N N     . PRO E 1 422 ? -5.114  78.299  99.042  1.00 131.16 ? 517 PRO E N     1 
ATOM 7866 C CA    . PRO E 1 422 ? -3.877  78.236  98.260  1.00 141.64 ? 517 PRO E CA    1 
ATOM 7867 C C     . PRO E 1 422 ? -3.354  76.830  97.886  1.00 142.66 ? 517 PRO E C     1 
ATOM 7868 O O     . PRO E 1 422 ? -2.180  76.548  98.143  1.00 126.39 ? 517 PRO E O     1 
ATOM 7869 C CB    . PRO E 1 422 ? -2.889  78.971  99.171  1.00 129.82 ? 517 PRO E CB    1 
ATOM 7870 C CG    . PRO E 1 422 ? -3.753  80.115  99.752  1.00 120.41 ? 517 PRO E CG    1 
ATOM 7871 C CD    . PRO E 1 422 ? -5.191  79.564  99.807  1.00 137.53 ? 517 PRO E CD    1 
ATOM 7872 N N     . VAL E 1 423 ? -4.230  75.988  97.309  1.00 153.85 ? 518 VAL E N     1 
ATOM 7873 C CA    . VAL E 1 423 ? -3.892  74.863  96.420  1.00 143.83 ? 518 VAL E CA    1 
ATOM 7874 C C     . VAL E 1 423 ? -2.773  73.946  96.916  1.00 134.47 ? 518 VAL E C     1 
ATOM 7875 O O     . VAL E 1 423 ? -1.604  74.136  96.560  1.00 127.22 ? 518 VAL E O     1 
ATOM 7876 C CB    . VAL E 1 423 ? -3.567  75.356  94.999  1.00 139.09 ? 518 VAL E CB    1 
ATOM 7877 C CG1   . VAL E 1 423 ? -3.501  74.169  94.058  1.00 113.07 ? 518 VAL E CG1   1 
ATOM 7878 C CG2   . VAL E 1 423 ? -4.621  76.339  94.528  1.00 134.38 ? 518 VAL E CG2   1 
ATOM 7879 N N     . SER E 1 424 ? -3.119  72.980  97.793  1.00 148.24 ? 519 SER E N     1 
ATOM 7880 C CA    . SER E 1 424 ? -2.206  71.989  98.379  1.00 136.87 ? 519 SER E CA    1 
ATOM 7881 C C     . SER E 1 424 ? -1.389  71.248  97.323  1.00 132.18 ? 519 SER E C     1 
ATOM 7882 O O     . SER E 1 424 ? -1.850  71.072  96.185  1.00 129.87 ? 519 SER E O     1 
ATOM 7883 C CB    . SER E 1 424 ? -2.980  70.972  99.240  1.00 113.35 ? 519 SER E CB    1 
ATOM 7884 O OG    . SER E 1 424 ? -3.966  70.259  98.511  1.00 113.76 ? 519 SER E OG    1 
ATOM 7885 N N     . PRO E 1 425 ? -0.166  70.807  97.665  1.00 133.38 ? 520 PRO E N     1 
ATOM 7886 C CA    . PRO E 1 425 ? 0.695   70.177  96.647  1.00 132.58 ? 520 PRO E CA    1 
ATOM 7887 C C     . PRO E 1 425 ? 0.013   69.027  95.920  1.00 122.17 ? 520 PRO E C     1 
ATOM 7888 O O     . PRO E 1 425 ? 0.171   68.863  94.702  1.00 107.16 ? 520 PRO E O     1 
ATOM 7889 C CB    . PRO E 1 425 ? 1.922   69.728  97.465  1.00 125.15 ? 520 PRO E CB    1 
ATOM 7890 C CG    . PRO E 1 425 ? 1.531   69.825  98.905  1.00 98.32  ? 520 PRO E CG    1 
ATOM 7891 C CD    . PRO E 1 425 ? 0.487   70.872  98.986  1.00 113.17 ? 520 PRO E CD    1 
ATOM 7892 N N     . SER E 1 426 ? -0.804  68.267  96.649  1.00 125.61 ? 521 SER E N     1 
ATOM 7893 C CA    . SER E 1 426 ? -1.513  67.113  96.107  1.00 139.57 ? 521 SER E CA    1 
ATOM 7894 C C     . SER E 1 426 ? -2.532  67.487  95.031  1.00 125.05 ? 521 SER E C     1 
ATOM 7895 O O     . SER E 1 426 ? -2.880  66.648  94.191  1.00 107.26 ? 521 SER E O     1 
ATOM 7896 C CB    . SER E 1 426 ? -2.206  66.365  97.255  1.00 133.68 ? 521 SER E CB    1 
ATOM 7897 O OG    . SER E 1 426 ? -1.344  66.231  98.385  1.00 113.10 ? 521 SER E OG    1 
ATOM 7898 N N     . ASP E 1 427 ? -3.037  68.712  95.037  1.00 128.65 ? 522 ASP E N     1 
ATOM 7899 C CA    . ASP E 1 427 ? -3.973  69.069  93.984  1.00 135.60 ? 522 ASP E CA    1 
ATOM 7900 C C     . ASP E 1 427 ? -3.244  69.340  92.678  1.00 134.74 ? 522 ASP E C     1 
ATOM 7901 O O     . ASP E 1 427 ? -3.654  68.860  91.614  1.00 127.73 ? 522 ASP E O     1 
ATOM 7902 C CB    . ASP E 1 427 ? -4.793  70.289  94.388  1.00 138.40 ? 522 ASP E CB    1 
ATOM 7903 C CG    . ASP E 1 427 ? -5.526  70.898  93.208  1.00 153.82 ? 522 ASP E CG    1 
ATOM 7904 O OD1   . ASP E 1 427 ? -4.911  71.717  92.488  1.00 154.79 ? 522 ASP E OD1   1 
ATOM 7905 O OD2   . ASP E 1 427 ? -6.705  70.543  92.985  1.00 146.96 ? 522 ASP E OD2   1 
ATOM 7906 N N     . GLU E 1 428 ? -2.156  70.112  92.758  1.00 134.16 ? 523 GLU E N     1 
ATOM 7907 C CA    . GLU E 1 428 ? -1.458  70.606  91.576  1.00 127.96 ? 523 GLU E CA    1 
ATOM 7908 C C     . GLU E 1 428 ? -1.090  69.474  90.628  1.00 123.17 ? 523 GLU E C     1 
ATOM 7909 O O     . GLU E 1 428 ? -1.057  69.664  89.404  1.00 98.44  ? 523 GLU E O     1 
ATOM 7910 C CB    . GLU E 1 428 ? -0.241  71.382  92.057  1.00 122.32 ? 523 GLU E CB    1 
ATOM 7911 C CG    . GLU E 1 428 ? -0.383  71.698  93.554  1.00 121.99 ? 523 GLU E CG    1 
ATOM 7912 C CD    . GLU E 1 428 ? 0.596   72.742  94.060  1.00 140.19 ? 523 GLU E CD    1 
ATOM 7913 O OE1   . GLU E 1 428 ? 0.740   72.893  95.292  1.00 142.92 ? 523 GLU E OE1   1 
ATOM 7914 O OE2   . GLU E 1 428 ? 1.222   73.425  93.230  1.00 143.01 ? 523 GLU E OE2   1 
ATOM 7915 N N     . PHE E 1 429 ? -0.840  68.285  91.183  1.00 126.07 ? 524 PHE E N     1 
ATOM 7916 C CA    . PHE E 1 429 ? -0.826  67.039  90.430  1.00 121.42 ? 524 PHE E CA    1 
ATOM 7917 C C     . PHE E 1 429 ? -2.141  66.890  89.683  1.00 128.30 ? 524 PHE E C     1 
ATOM 7918 O O     . PHE E 1 429 ? -2.182  66.935  88.448  1.00 119.87 ? 524 PHE E O     1 
ATOM 7919 C CB    . PHE E 1 429 ? -0.618  65.843  91.371  1.00 115.21 ? 524 PHE E CB    1 
ATOM 7920 C CG    . PHE E 1 429 ? -0.295  64.516  90.663  1.00 144.47 ? 524 PHE E CG    1 
ATOM 7921 C CD1   . PHE E 1 429 ? 0.963   63.923  90.803  1.00 147.85 ? 524 PHE E CD1   1 
ATOM 7922 C CD2   . PHE E 1 429 ? -1.245  63.850  89.885  1.00 144.51 ? 524 PHE E CD2   1 
ATOM 7923 C CE1   . PHE E 1 429 ? 1.272   62.703  90.179  1.00 129.81 ? 524 PHE E CE1   1 
ATOM 7924 C CE2   . PHE E 1 429 ? -0.939  62.632  89.260  1.00 141.91 ? 524 PHE E CE2   1 
ATOM 7925 C CZ    . PHE E 1 429 ? 0.323   62.060  89.414  1.00 130.73 ? 524 PHE E CZ    1 
ATOM 7926 N N     . GLU E 1 430 ? -3.224  66.697  90.439  1.00 128.09 ? 525 GLU E N     1 
ATOM 7927 C CA    . GLU E 1 430 ? -4.502  66.419  89.803  1.00 118.17 ? 525 GLU E CA    1 
ATOM 7928 C C     . GLU E 1 430 ? -4.937  67.587  88.946  1.00 110.70 ? 525 GLU E C     1 
ATOM 7929 O O     . GLU E 1 430 ? -5.461  67.406  87.839  1.00 101.32 ? 525 GLU E O     1 
ATOM 7930 C CB    . GLU E 1 430 ? -5.545  66.079  90.855  1.00 112.48 ? 525 GLU E CB    1 
ATOM 7931 C CG    . GLU E 1 430 ? -5.542  64.602  91.201  1.00 125.66 ? 525 GLU E CG    1 
ATOM 7932 C CD    . GLU E 1 430 ? -5.536  63.716  89.956  1.00 141.18 ? 525 GLU E CD    1 
ATOM 7933 O OE1   . GLU E 1 430 ? -6.310  63.995  89.007  1.00 141.98 ? 525 GLU E OE1   1 
ATOM 7934 O OE2   . GLU E 1 430 ? -4.746  62.744  89.922  1.00 138.99 ? 525 GLU E OE2   1 
ATOM 7935 N N     . PHE E 1 431 ? -4.690  68.799  89.416  1.00 118.72 ? 526 PHE E N     1 
ATOM 7936 C CA    . PHE E 1 431 ? -4.883  69.923  88.526  1.00 131.65 ? 526 PHE E CA    1 
ATOM 7937 C C     . PHE E 1 431 ? -4.026  69.748  87.282  1.00 128.23 ? 526 PHE E C     1 
ATOM 7938 O O     . PHE E 1 431 ? -4.533  69.822  86.152  1.00 126.58 ? 526 PHE E O     1 
ATOM 7939 C CB    . PHE E 1 431 ? -4.599  71.237  89.253  1.00 133.23 ? 526 PHE E CB    1 
ATOM 7940 C CG    . PHE E 1 431 ? -5.738  72.225  89.151  1.00 150.33 ? 526 PHE E CG    1 
ATOM 7941 C CD1   . PHE E 1 431 ? -5.811  73.120  88.082  1.00 159.32 ? 526 PHE E CD1   1 
ATOM 7942 C CD2   . PHE E 1 431 ? -6.756  72.235  90.098  1.00 141.82 ? 526 PHE E CD2   1 
ATOM 7943 C CE1   . PHE E 1 431 ? -6.865  74.023  87.973  1.00 157.45 ? 526 PHE E CE1   1 
ATOM 7944 C CE2   . PHE E 1 431 ? -7.814  73.131  89.994  1.00 142.91 ? 526 PHE E CE2   1 
ATOM 7945 C CZ    . PHE E 1 431 ? -7.869  74.027  88.931  1.00 150.11 ? 526 PHE E CZ    1 
ATOM 7946 N N     . TYR E 1 432 ? -2.737  69.438  87.464  1.00 113.30 ? 527 TYR E N     1 
ATOM 7947 C CA    . TYR E 1 432 ? -1.946  69.089  86.295  1.00 120.86 ? 527 TYR E CA    1 
ATOM 7948 C C     . TYR E 1 432 ? -2.641  67.970  85.527  1.00 114.55 ? 527 TYR E C     1 
ATOM 7949 O O     . TYR E 1 432 ? -2.944  68.110  84.338  1.00 97.52  ? 527 TYR E O     1 
ATOM 7950 C CB    . TYR E 1 432 ? -0.505  68.703  86.677  1.00 118.85 ? 527 TYR E CB    1 
ATOM 7951 C CG    . TYR E 1 432 ? 0.351   68.421  85.449  1.00 113.61 ? 527 TYR E CG    1 
ATOM 7952 C CD1   . TYR E 1 432 ? 0.331   69.290  84.374  1.00 119.23 ? 527 TYR E CD1   1 
ATOM 7953 C CD2   . TYR E 1 432 ? 1.140   67.285  85.344  1.00 97.68  ? 527 TYR E CD2   1 
ATOM 7954 C CE1   . TYR E 1 432 ? 1.067   69.056  83.233  1.00 119.42 ? 527 TYR E CE1   1 
ATOM 7955 C CE2   . TYR E 1 432 ? 1.890   67.038  84.193  1.00 101.20 ? 527 TYR E CE2   1 
ATOM 7956 C CZ    . TYR E 1 432 ? 1.846   67.938  83.136  1.00 111.10 ? 527 TYR E CZ    1 
ATOM 7957 O OH    . TYR E 1 432 ? 2.563   67.752  81.966  1.00 97.93  ? 527 TYR E OH    1 
ATOM 7958 N N     . ARG E 1 433 ? -3.005  66.897  86.229  1.00 108.00 ? 528 ARG E N     1 
ATOM 7959 C CA    . ARG E 1 433 ? -3.639  65.762  85.572  1.00 115.28 ? 528 ARG E CA    1 
ATOM 7960 C C     . ARG E 1 433 ? -4.737  66.203  84.606  1.00 126.96 ? 528 ARG E C     1 
ATOM 7961 O O     . ARG E 1 433 ? -4.857  65.663  83.497  1.00 112.89 ? 528 ARG E O     1 
ATOM 7962 C CB    . ARG E 1 433 ? -4.187  64.818  86.630  1.00 115.84 ? 528 ARG E CB    1 
ATOM 7963 C CG    . ARG E 1 433 ? -3.328  63.632  86.830  1.00 106.50 ? 528 ARG E CG    1 
ATOM 7964 C CD    . ARG E 1 433 ? -3.458  62.773  85.592  1.00 121.17 ? 528 ARG E CD    1 
ATOM 7965 N NE    . ARG E 1 433 ? -4.167  61.518  85.844  1.00 124.51 ? 528 ARG E NE    1 
ATOM 7966 C CZ    . ARG E 1 433 ? -4.633  60.714  84.888  1.00 120.84 ? 528 ARG E CZ    1 
ATOM 7967 N NH1   . ARG E 1 433 ? -4.482  61.037  83.608  1.00 119.37 ? 528 ARG E NH1   1 
ATOM 7968 N NH2   . ARG E 1 433 ? -5.257  59.588  85.208  1.00 114.82 ? 528 ARG E NH2   1 
ATOM 7969 N N     . LYS E 1 434 ? -5.515  67.223  84.979  1.00 126.89 ? 529 LYS E N     1 
ATOM 7970 C CA    . LYS E 1 434 ? -6.465  67.707  83.985  1.00 132.10 ? 529 LYS E CA    1 
ATOM 7971 C C     . LYS E 1 434 ? -5.799  68.527  82.887  1.00 122.63 ? 529 LYS E C     1 
ATOM 7972 O O     . LYS E 1 434 ? -6.509  69.000  81.995  1.00 129.58 ? 529 LYS E O     1 
ATOM 7973 C CB    . LYS E 1 434 ? -7.619  68.507  84.617  1.00 139.85 ? 529 LYS E CB    1 
ATOM 7974 C CG    . LYS E 1 434 ? -8.902  68.507  83.712  1.00 141.09 ? 529 LYS E CG    1 
ATOM 7975 C CD    . LYS E 1 434 ? -10.231 68.926  84.373  1.00 141.90 ? 529 LYS E CD    1 
ATOM 7976 C CE    . LYS E 1 434 ? -11.408 68.587  83.435  1.00 128.39 ? 529 LYS E CE    1 
ATOM 7977 N NZ    . LYS E 1 434 ? -12.729 69.121  83.864  1.00 122.82 ? 529 LYS E NZ    1 
ATOM 7978 N N     . GLU E 1 435 ? -4.491  68.757  82.919  1.00 103.22 ? 530 GLU E N     1 
ATOM 7979 C CA    . GLU E 1 435 ? -3.890  69.437  81.780  1.00 117.67 ? 530 GLU E CA    1 
ATOM 7980 C C     . GLU E 1 435 ? -3.938  68.537  80.551  1.00 114.32 ? 530 GLU E C     1 
ATOM 7981 O O     . GLU E 1 435 ? -3.637  67.340  80.635  1.00 96.29  ? 530 GLU E O     1 
ATOM 7982 C CB    . GLU E 1 435 ? -2.462  69.858  82.088  1.00 121.34 ? 530 GLU E CB    1 
ATOM 7983 C CG    . GLU E 1 435 ? -2.385  70.855  83.218  1.00 119.42 ? 530 GLU E CG    1 
ATOM 7984 C CD    . GLU E 1 435 ? -3.016  72.178  82.882  1.00 123.61 ? 530 GLU E CD    1 
ATOM 7985 O OE1   . GLU E 1 435 ? -2.287  73.086  82.408  1.00 122.55 ? 530 GLU E OE1   1 
ATOM 7986 O OE2   . GLU E 1 435 ? -4.232  72.317  83.146  1.00 122.42 ? 530 GLU E OE2   1 
ATOM 7987 N N     . ILE E 1 436 ? -4.380  69.117  79.427  1.00 102.48 ? 531 ILE E N     1 
ATOM 7988 C CA    . ILE E 1 436 ? -4.687  68.403  78.188  1.00 103.27 ? 531 ILE E CA    1 
ATOM 7989 C C     . ILE E 1 436 ? -4.193  69.213  76.990  1.00 103.82 ? 531 ILE E C     1 
ATOM 7990 O O     . ILE E 1 436 ? -4.766  70.264  76.684  1.00 76.51  ? 531 ILE E O     1 
ATOM 7991 C CB    . ILE E 1 436 ? -6.198  68.167  78.054  1.00 103.11 ? 531 ILE E CB    1 
ATOM 7992 C CG1   . ILE E 1 436 ? -6.806  67.624  79.358  1.00 107.45 ? 531 ILE E CG1   1 
ATOM 7993 C CG2   . ILE E 1 436 ? -6.495  67.303  76.843  1.00 116.36 ? 531 ILE E CG2   1 
ATOM 7994 C CD1   . ILE E 1 436 ? -6.301  66.255  79.817  1.00 112.35 ? 531 ILE E CD1   1 
ATOM 7995 N N     . VAL E 1 437 ? -3.227  68.668  76.233  1.00 116.19 ? 532 VAL E N     1 
ATOM 7996 C CA    . VAL E 1 437 ? -2.416  69.439  75.285  1.00 115.42 ? 532 VAL E CA    1 
ATOM 7997 C C     . VAL E 1 437 ? -2.349  68.753  73.921  1.00 118.94 ? 532 VAL E C     1 
ATOM 7998 O O     . VAL E 1 437 ? -2.257  67.523  73.844  1.00 121.10 ? 532 VAL E O     1 
ATOM 7999 C CB    . VAL E 1 437 ? -0.988  69.644  75.839  1.00 96.72  ? 532 VAL E CB    1 
ATOM 8000 C CG1   . VAL E 1 437 ? -0.096  70.292  74.818  1.00 61.30  ? 532 VAL E CG1   1 
ATOM 8001 C CG2   . VAL E 1 437 ? -1.030  70.473  77.118  1.00 104.95 ? 532 VAL E CG2   1 
ATOM 8002 N N     . ILE E 1 438 ? -2.395  69.554  72.837  1.00 107.02 ? 533 ILE E N     1 
ATOM 8003 C CA    . ILE E 1 438 ? -2.063  69.046  71.503  1.00 121.58 ? 533 ILE E CA    1 
ATOM 8004 C C     . ILE E 1 438 ? -0.546  68.980  71.339  1.00 126.61 ? 533 ILE E C     1 
ATOM 8005 O O     . ILE E 1 438 ? 0.216   69.601  72.074  1.00 116.08 ? 533 ILE E O     1 
ATOM 8006 C CB    . ILE E 1 438 ? -2.703  69.878  70.373  1.00 134.89 ? 533 ILE E CB    1 
ATOM 8007 C CG1   . ILE E 1 438 ? -2.980  68.987  69.147  1.00 144.62 ? 533 ILE E CG1   1 
ATOM 8008 C CG2   . ILE E 1 438 ? -1.788  71.024  69.967  1.00 138.95 ? 533 ILE E CG2   1 
ATOM 8009 C CD1   . ILE E 1 438 ? -3.174  69.729  67.825  1.00 140.45 ? 533 ILE E CD1   1 
ATOM 8010 N N     . LEU E 1 439 ? -0.099  68.197  70.364  1.00 134.59 ? 534 LEU E N     1 
ATOM 8011 C CA    . LEU E 1 439 ? 1.324   68.038  70.093  1.00 135.95 ? 534 LEU E CA    1 
ATOM 8012 C C     . LEU E 1 439 ? 1.736   68.931  68.928  1.00 144.27 ? 534 LEU E C     1 
ATOM 8013 O O     . LEU E 1 439 ? 1.352   68.686  67.779  1.00 145.45 ? 534 LEU E O     1 
ATOM 8014 C CB    . LEU E 1 439 ? 1.644   66.576  69.815  1.00 138.27 ? 534 LEU E CB    1 
ATOM 8015 C CG    . LEU E 1 439 ? 1.846   65.885  71.152  1.00 127.15 ? 534 LEU E CG    1 
ATOM 8016 C CD1   . LEU E 1 439 ? 1.362   64.438  71.119  1.00 127.20 ? 534 LEU E CD1   1 
ATOM 8017 C CD2   . LEU E 1 439 ? 3.316   65.998  71.512  1.00 102.92 ? 534 LEU E CD2   1 
ATOM 8018 N N     . SER E 1 440 ? 2.525   69.962  69.234  1.00 144.54 ? 535 SER E N     1 
ATOM 8019 C CA    . SER E 1 440 ? 3.184   70.766  68.214  1.00 144.63 ? 535 SER E CA    1 
ATOM 8020 C C     . SER E 1 440 ? 4.418   70.040  67.714  1.00 150.04 ? 535 SER E C     1 
ATOM 8021 O O     . SER E 1 440 ? 5.242   69.587  68.514  1.00 142.82 ? 535 SER E O     1 
ATOM 8022 C CB    . SER E 1 440 ? 3.606   72.126  68.767  1.00 139.09 ? 535 SER E CB    1 
ATOM 8023 O OG    . SER E 1 440 ? 2.508   72.997  68.916  1.00 153.65 ? 535 SER E OG    1 
ATOM 8024 N N     . GLU E 1 441 ? 4.564   69.957  66.391  1.00 155.49 ? 536 GLU E N     1 
ATOM 8025 C CA    . GLU E 1 441 ? 5.845   69.540  65.831  1.00 161.65 ? 536 GLU E CA    1 
ATOM 8026 C C     . GLU E 1 441 ? 6.987   70.339  66.445  1.00 155.14 ? 536 GLU E C     1 
ATOM 8027 O O     . GLU E 1 441 ? 8.068   69.792  66.697  1.00 153.44 ? 536 GLU E O     1 
ATOM 8028 C CB    . GLU E 1 441 ? 5.820   69.699  64.306  1.00 171.28 ? 536 GLU E CB    1 
ATOM 8029 C CG    . GLU E 1 441 ? 7.132   70.149  63.666  1.00 162.68 ? 536 GLU E CG    1 
ATOM 8030 C CD    . GLU E 1 441 ? 6.992   70.398  62.171  1.00 162.76 ? 536 GLU E CD    1 
ATOM 8031 O OE1   . GLU E 1 441 ? 7.599   69.641  61.381  1.00 162.23 ? 536 GLU E OE1   1 
ATOM 8032 O OE2   . GLU E 1 441 ? 6.263   71.340  61.788  1.00 162.30 ? 536 GLU E OE2   1 
ATOM 8033 N N     . ASP E 1 442 ? 6.742   71.612  66.748  1.00 150.38 ? 537 ASP E N     1 
ATOM 8034 C CA    . ASP E 1 442 ? 7.727   72.500  67.340  1.00 141.13 ? 537 ASP E CA    1 
ATOM 8035 C C     . ASP E 1 442 ? 7.729   72.451  68.850  1.00 123.51 ? 537 ASP E C     1 
ATOM 8036 O O     . ASP E 1 442 ? 8.426   73.254  69.470  1.00 118.83 ? 537 ASP E O     1 
ATOM 8037 C CB    . ASP E 1 442 ? 7.481   73.935  66.887  1.00 154.51 ? 537 ASP E CB    1 
ATOM 8038 C CG    . ASP E 1 442 ? 7.382   74.051  65.389  1.00 165.25 ? 537 ASP E CG    1 
ATOM 8039 O OD1   . ASP E 1 442 ? 7.002   73.048  64.748  1.00 154.44 ? 537 ASP E OD1   1 
ATOM 8040 O OD2   . ASP E 1 442 ? 7.687   75.137  64.852  1.00 173.80 ? 537 ASP E OD2   1 
ATOM 8041 N N     . PHE E 1 443 ? 6.965   71.541  69.450  1.00 124.09 ? 538 PHE E N     1 
ATOM 8042 C CA    . PHE E 1 443 ? 6.823   71.521  70.896  1.00 119.75 ? 538 PHE E CA    1 
ATOM 8043 C C     . PHE E 1 443 ? 8.185   71.581  71.560  1.00 102.48 ? 538 PHE E C     1 
ATOM 8044 O O     . PHE E 1 443 ? 9.143   70.966  71.094  1.00 112.94 ? 538 PHE E O     1 
ATOM 8045 C CB    . PHE E 1 443 ? 6.098   70.256  71.339  1.00 104.50 ? 538 PHE E CB    1 
ATOM 8046 C CG    . PHE E 1 443 ? 5.579   70.323  72.735  1.00 105.46 ? 538 PHE E CG    1 
ATOM 8047 C CD1   . PHE E 1 443 ? 5.705   71.481  73.486  1.00 109.30 ? 538 PHE E CD1   1 
ATOM 8048 C CD2   . PHE E 1 443 ? 4.948   69.239  73.302  1.00 108.57 ? 538 PHE E CD2   1 
ATOM 8049 C CE1   . PHE E 1 443 ? 5.225   71.551  74.779  1.00 117.75 ? 538 PHE E CE1   1 
ATOM 8050 C CE2   . PHE E 1 443 ? 4.458   69.300  74.603  1.00 110.19 ? 538 PHE E CE2   1 
ATOM 8051 C CZ    . PHE E 1 443 ? 4.592   70.457  75.339  1.00 107.19 ? 538 PHE E CZ    1 
ATOM 8052 N N     . LYS E 1 444 ? 8.282   72.384  72.608  1.00 85.84  ? 539 LYS E N     1 
ATOM 8053 C CA    . LYS E 1 444 ? 9.444   72.392  73.483  1.00 100.13 ? 539 LYS E CA    1 
ATOM 8054 C C     . LYS E 1 444 ? 8.905   72.408  74.899  1.00 98.05  ? 539 LYS E C     1 
ATOM 8055 O O     . LYS E 1 444 ? 8.270   73.377  75.315  1.00 116.45 ? 539 LYS E O     1 
ATOM 8056 C CB    . LYS E 1 444 ? 10.349  73.589  73.194  1.00 91.23  ? 539 LYS E CB    1 
ATOM 8057 C CG    . LYS E 1 444 ? 10.913  73.563  71.763  1.00 100.53 ? 539 LYS E CG    1 
ATOM 8058 C CD    . LYS E 1 444 ? 11.245  74.956  71.217  1.00 113.91 ? 539 LYS E CD    1 
ATOM 8059 C CE    . LYS E 1 444 ? 9.997   75.730  70.706  1.00 113.31 ? 539 LYS E CE    1 
ATOM 8060 N NZ    . LYS E 1 444 ? 10.354  76.953  69.911  1.00 67.67  ? 539 LYS E NZ    1 
ATOM 8061 N N     . VAL E 1 445 ? 9.128   71.326  75.627  1.00 86.85  ? 540 VAL E N     1 
ATOM 8062 C CA    . VAL E 1 445 ? 8.524   71.199  76.938  1.00 90.25  ? 540 VAL E CA    1 
ATOM 8063 C C     . VAL E 1 445 ? 9.412   71.792  78.006  1.00 109.96 ? 540 VAL E C     1 
ATOM 8064 O O     . VAL E 1 445 ? 8.952   72.012  79.143  1.00 111.99 ? 540 VAL E O     1 
ATOM 8065 C CB    . VAL E 1 445 ? 8.216   69.714  77.169  1.00 96.27  ? 540 VAL E CB    1 
ATOM 8066 C CG1   . VAL E 1 445 ? 8.251   69.024  75.827  1.00 91.29  ? 540 VAL E CG1   1 
ATOM 8067 C CG2   . VAL E 1 445 ? 9.207   69.079  78.143  1.00 86.49  ? 540 VAL E CG2   1 
ATOM 8068 N N     . MET E 1 446 ? 10.676  72.056  77.678  1.00 112.22 ? 541 MET E N     1 
ATOM 8069 C CA    . MET E 1 446 ? 11.509  72.869  78.545  1.00 111.52 ? 541 MET E CA    1 
ATOM 8070 C C     . MET E 1 446 ? 10.776  74.148  78.900  1.00 129.31 ? 541 MET E C     1 
ATOM 8071 O O     . MET E 1 446 ? 10.590  74.472  80.079  1.00 129.54 ? 541 MET E O     1 
ATOM 8072 C CB    . MET E 1 446 ? 12.821  73.197  77.839  1.00 107.82 ? 541 MET E CB    1 
ATOM 8073 C CG    . MET E 1 446 ? 13.951  72.292  78.149  1.00 95.11  ? 541 MET E CG    1 
ATOM 8074 S SD    . MET E 1 446 ? 15.472  73.219  77.965  1.00 117.98 ? 541 MET E SD    1 
ATOM 8075 C CE    . MET E 1 446 ? 15.500  73.471  76.195  1.00 110.45 ? 541 MET E CE    1 
ATOM 8076 N N     . GLU E 1 447 ? 10.326  74.874  77.866  1.00 124.72 ? 542 GLU E N     1 
ATOM 8077 C CA    . GLU E 1 447 ? 9.685   76.173  78.029  1.00 125.23 ? 542 GLU E CA    1 
ATOM 8078 C C     . GLU E 1 447 ? 8.209   76.065  78.371  1.00 126.97 ? 542 GLU E C     1 
ATOM 8079 O O     . GLU E 1 447 ? 7.671   76.967  79.022  1.00 129.84 ? 542 GLU E O     1 
ATOM 8080 C CB    . GLU E 1 447 ? 9.838   77.000  76.760  1.00 122.87 ? 542 GLU E CB    1 
ATOM 8081 C CG    . GLU E 1 447 ? 8.922   76.576  75.646  1.00 101.74 ? 542 GLU E CG    1 
ATOM 8082 C CD    . GLU E 1 447 ? 8.951   77.572  74.537  1.00 117.01 ? 542 GLU E CD    1 
ATOM 8083 O OE1   . GLU E 1 447 ? 9.018   77.164  73.355  1.00 87.82  ? 542 GLU E OE1   1 
ATOM 8084 O OE2   . GLU E 1 447 ? 8.933   78.780  74.865  1.00 138.29 ? 542 GLU E OE2   1 
ATOM 8085 N N     . TRP E 1 448 ? 7.529   75.018  77.900  1.00 131.71 ? 543 TRP E N     1 
ATOM 8086 C CA    . TRP E 1 448 ? 6.180   74.751  78.377  1.00 122.97 ? 543 TRP E CA    1 
ATOM 8087 C C     . TRP E 1 448 ? 6.149   74.845  79.891  1.00 112.96 ? 543 TRP E C     1 
ATOM 8088 O O     . TRP E 1 448 ? 5.438   75.669  80.460  1.00 125.29 ? 543 TRP E O     1 
ATOM 8089 C CB    . TRP E 1 448 ? 5.684   73.378  77.922  1.00 127.33 ? 543 TRP E CB    1 
ATOM 8090 C CG    . TRP E 1 448 ? 4.200   73.183  78.195  1.00 128.24 ? 543 TRP E CG    1 
ATOM 8091 C CD1   . TRP E 1 448 ? 3.181   73.261  77.278  1.00 126.83 ? 543 TRP E CD1   1 
ATOM 8092 C CD2   . TRP E 1 448 ? 3.572   72.905  79.467  1.00 120.38 ? 543 TRP E CD2   1 
ATOM 8093 N NE1   . TRP E 1 448 ? 1.970   73.039  77.897  1.00 120.02 ? 543 TRP E NE1   1 
ATOM 8094 C CE2   . TRP E 1 448 ? 2.182   72.822  79.237  1.00 116.55 ? 543 TRP E CE2   1 
ATOM 8095 C CE3   . TRP E 1 448 ? 4.050   72.704  80.769  1.00 120.67 ? 543 TRP E CE3   1 
ATOM 8096 C CZ2   . TRP E 1 448 ? 1.267   72.555  80.265  1.00 112.88 ? 543 TRP E CZ2   1 
ATOM 8097 C CZ3   . TRP E 1 448 ? 3.138   72.437  81.787  1.00 113.29 ? 543 TRP E CZ3   1 
ATOM 8098 C CH2   . TRP E 1 448 ? 1.766   72.369  81.528  1.00 105.69 ? 543 TRP E CH2   1 
ATOM 8099 N N     . TRP E 1 449 ? 6.931   74.013  80.565  1.00 116.71 ? 544 TRP E N     1 
ATOM 8100 C CA    . TRP E 1 449 ? 6.942   74.081  82.017  1.00 126.94 ? 544 TRP E CA    1 
ATOM 8101 C C     . TRP E 1 449 ? 7.358   75.452  82.555  1.00 136.42 ? 544 TRP E C     1 
ATOM 8102 O O     . TRP E 1 449 ? 7.213   75.683  83.761  1.00 131.31 ? 544 TRP E O     1 
ATOM 8103 C CB    . TRP E 1 449 ? 7.818   72.946  82.552  1.00 125.20 ? 544 TRP E CB    1 
ATOM 8104 C CG    . TRP E 1 449 ? 6.949   71.784  82.680  1.00 115.72 ? 544 TRP E CG    1 
ATOM 8105 C CD1   . TRP E 1 449 ? 6.621   70.897  81.705  1.00 106.74 ? 544 TRP E CD1   1 
ATOM 8106 C CD2   . TRP E 1 449 ? 6.162   71.444  83.825  1.00 118.54 ? 544 TRP E CD2   1 
ATOM 8107 N NE1   . TRP E 1 449 ? 5.705   69.991  82.189  1.00 108.70 ? 544 TRP E NE1   1 
ATOM 8108 C CE2   . TRP E 1 449 ? 5.415   70.304  83.492  1.00 103.06 ? 544 TRP E CE2   1 
ATOM 8109 C CE3   . TRP E 1 449 ? 6.045   71.974  85.115  1.00 116.42 ? 544 TRP E CE3   1 
ATOM 8110 C CZ2   . TRP E 1 449 ? 4.554   69.693  84.393  1.00 99.63  ? 544 TRP E CZ2   1 
ATOM 8111 C CZ3   . TRP E 1 449 ? 5.191   71.360  86.010  1.00 109.38 ? 544 TRP E CZ3   1 
ATOM 8112 C CH2   . TRP E 1 449 ? 4.458   70.236  85.647  1.00 108.75 ? 544 TRP E CH2   1 
ATOM 8113 N N     . ASN E 1 450 ? 7.910   76.342  81.713  1.00 141.05 ? 545 ASN E N     1 
ATOM 8114 C CA    . ASN E 1 450 ? 8.106   77.757  82.046  1.00 136.19 ? 545 ASN E CA    1 
ATOM 8115 C C     . ASN E 1 450 ? 6.913   78.661  81.708  1.00 134.79 ? 545 ASN E C     1 
ATOM 8116 O O     . ASN E 1 450 ? 6.599   79.569  82.484  1.00 137.55 ? 545 ASN E O     1 
ATOM 8117 C CB    . ASN E 1 450 ? 9.377   78.286  81.382  1.00 129.58 ? 545 ASN E CB    1 
ATOM 8118 C CG    . ASN E 1 450 ? 10.479  78.558  82.395  1.00 138.38 ? 545 ASN E CG    1 
ATOM 8119 O OD1   . ASN E 1 450 ? 10.292  78.376  83.611  1.00 123.86 ? 545 ASN E OD1   1 
ATOM 8120 N ND2   . ASN E 1 450 ? 11.636  78.990  81.903  1.00 139.84 ? 545 ASN E ND2   1 
ATOM 8121 N N     . LEU E 1 451 ? 6.261   78.481  80.551  1.00 130.21 ? 546 LEU E N     1 
ATOM 8122 C CA    . LEU E 1 451 ? 5.099   79.316  80.221  1.00 120.78 ? 546 LEU E CA    1 
ATOM 8123 C C     . LEU E 1 451 ? 3.948   79.070  81.204  1.00 107.36 ? 546 LEU E C     1 
ATOM 8124 O O     . LEU E 1 451 ? 3.431   80.001  81.825  1.00 125.68 ? 546 LEU E O     1 
ATOM 8125 C CB    . LEU E 1 451 ? 4.655   79.075  78.764  1.00 120.52 ? 546 LEU E CB    1 
ATOM 8126 C CG    . LEU E 1 451 ? 5.020   80.062  77.627  1.00 120.80 ? 546 LEU E CG    1 
ATOM 8127 C CD1   . LEU E 1 451 ? 6.534   80.268  77.482  1.00 124.51 ? 546 LEU E CD1   1 
ATOM 8128 C CD2   . LEU E 1 451 ? 4.401   79.668  76.269  1.00 87.24  ? 546 LEU E CD2   1 
ATOM 8129 N N     . ASN E 1 452 ? 3.578   77.819  81.406  1.00 113.18 ? 547 ASN E N     1 
ATOM 8130 C CA    . ASN E 1 452 ? 2.581   77.428  82.394  1.00 109.16 ? 547 ASN E CA    1 
ATOM 8131 C C     . ASN E 1 452 ? 3.205   77.246  83.776  1.00 118.13 ? 547 ASN E C     1 
ATOM 8132 O O     . ASN E 1 452 ? 2.602   76.607  84.653  1.00 106.92 ? 547 ASN E O     1 
ATOM 8133 C CB    . ASN E 1 452 ? 1.857   76.153  81.940  1.00 112.14 ? 547 ASN E CB    1 
ATOM 8134 C CG    . ASN E 1 452 ? 1.196   76.292  80.537  1.00 125.60 ? 547 ASN E CG    1 
ATOM 8135 O OD1   . ASN E 1 452 ? 1.776   76.851  79.590  1.00 100.88 ? 547 ASN E OD1   1 
ATOM 8136 N ND2   . ASN E 1 452 ? -0.029  75.772  80.416  1.00 140.87 ? 547 ASN E ND2   1 
ATOM 8137 N N     . SER E 1 453 ? 4.450   77.704  83.928  1.00 124.45 ? 548 SER E N     1 
ATOM 8138 C CA    . SER E 1 453 ? 5.157   77.643  85.198  1.00 133.54 ? 548 SER E CA    1 
ATOM 8139 C C     . SER E 1 453 ? 4.384   78.372  86.273  1.00 136.34 ? 548 SER E C     1 
ATOM 8140 O O     . SER E 1 453 ? 3.631   79.312  85.998  1.00 141.75 ? 548 SER E O     1 
ATOM 8141 C CB    . SER E 1 453 ? 6.531   78.288  85.093  1.00 127.90 ? 548 SER E CB    1 
ATOM 8142 O OG    . SER E 1 453 ? 6.381   79.633  84.678  1.00 120.51 ? 548 SER E OG    1 
ATOM 8143 N N     . LYS E 1 454 ? 4.559   77.896  87.508  1.00 128.68 ? 549 LYS E N     1 
ATOM 8144 C CA    . LYS E 1 454 ? 3.985   78.495  88.703  1.00 132.58 ? 549 LYS E CA    1 
ATOM 8145 C C     . LYS E 1 454 ? 2.487   78.238  88.699  1.00 139.84 ? 549 LYS E C     1 
ATOM 8146 O O     . LYS E 1 454 ? 1.828   78.350  89.734  1.00 128.97 ? 549 LYS E O     1 
ATOM 8147 C CB    . LYS E 1 454 ? 4.255   80.005  88.784  1.00 149.49 ? 549 LYS E CB    1 
ATOM 8148 C CG    . LYS E 1 454 ? 5.678   80.482  88.450  1.00 155.23 ? 549 LYS E CG    1 
ATOM 8149 C CD    . LYS E 1 454 ? 5.713   82.022  88.350  1.00 148.29 ? 549 LYS E CD    1 
ATOM 8150 C CE    . LYS E 1 454 ? 6.859   82.633  89.173  1.00 160.13 ? 549 LYS E CE    1 
ATOM 8151 N NZ    . LYS E 1 454 ? 6.583   84.015  89.730  1.00 118.38 ? 549 LYS E NZ    1 
ATOM 8152 N N     . LYS E 1 455 ? 1.942   77.889  87.532  1.00 148.45 ? 550 LYS E N     1 
ATOM 8153 C CA    . LYS E 1 455 ? 0.546   77.498  87.431  1.00 144.61 ? 550 LYS E CA    1 
ATOM 8154 C C     . LYS E 1 455 ? 0.351   76.115  88.006  1.00 138.73 ? 550 LYS E C     1 
ATOM 8155 O O     . LYS E 1 455 ? -0.792  75.670  88.165  1.00 147.76 ? 550 LYS E O     1 
ATOM 8156 C CB    . LYS E 1 455 ? 0.081   77.571  85.971  1.00 135.95 ? 550 LYS E CB    1 
ATOM 8157 C CG    . LYS E 1 455 ? -1.406  77.391  85.738  1.00 113.30 ? 550 LYS E CG    1 
ATOM 8158 C CD    . LYS E 1 455 ? -1.740  77.593  84.272  1.00 98.44  ? 550 LYS E CD    1 
ATOM 8159 C CE    . LYS E 1 455 ? -3.045  76.904  83.934  1.00 82.35  ? 550 LYS E CE    1 
ATOM 8160 N NZ    . LYS E 1 455 ? -3.388  77.094  82.513  1.00 88.62  ? 550 LYS E NZ    1 
ATOM 8161 N N     . TYR E 1 456 ? 1.459   75.433  88.286  1.00 122.70 ? 551 TYR E N     1 
ATOM 8162 C CA    . TYR E 1 456 ? 1.521   74.302  89.204  1.00 124.77 ? 551 TYR E CA    1 
ATOM 8163 C C     . TYR E 1 456 ? 2.768   74.591  90.017  1.00 138.93 ? 551 TYR E C     1 
ATOM 8164 O O     . TYR E 1 456 ? 3.826   73.998  89.793  1.00 147.66 ? 551 TYR E O     1 
ATOM 8165 C CB    . TYR E 1 456 ? 1.549   72.979  88.450  1.00 122.33 ? 551 TYR E CB    1 
ATOM 8166 C CG    . TYR E 1 456 ? 0.327   72.917  87.610  1.00 123.68 ? 551 TYR E CG    1 
ATOM 8167 C CD1   . TYR E 1 456 ? 0.322   73.406  86.297  1.00 126.92 ? 551 TYR E CD1   1 
ATOM 8168 C CD2   . TYR E 1 456 ? -0.855  72.469  88.153  1.00 118.71 ? 551 TYR E CD2   1 
ATOM 8169 C CE1   . TYR E 1 456 ? -0.833  73.396  85.539  1.00 124.22 ? 551 TYR E CE1   1 
ATOM 8170 C CE2   . TYR E 1 456 ? -1.995  72.450  87.416  1.00 133.49 ? 551 TYR E CE2   1 
ATOM 8171 C CZ    . TYR E 1 456 ? -1.993  72.909  86.114  1.00 135.07 ? 551 TYR E CZ    1 
ATOM 8172 O OH    . TYR E 1 456 ? -3.184  72.873  85.427  1.00 135.42 ? 551 TYR E OH    1 
ATOM 8173 N N     . PRO E 1 457 ? 2.689   75.547  90.926  1.00 146.65 ? 552 PRO E N     1 
ATOM 8174 C CA    . PRO E 1 457 ? 3.901   76.169  91.485  1.00 146.15 ? 552 PRO E CA    1 
ATOM 8175 C C     . PRO E 1 457 ? 4.810   75.261  92.304  1.00 143.15 ? 552 PRO E C     1 
ATOM 8176 O O     . PRO E 1 457 ? 6.021   75.246  92.063  1.00 147.42 ? 552 PRO E O     1 
ATOM 8177 C CB    . PRO E 1 457 ? 3.331   77.296  92.352  1.00 144.55 ? 552 PRO E CB    1 
ATOM 8178 C CG    . PRO E 1 457 ? 1.960   76.811  92.724  1.00 151.78 ? 552 PRO E CG    1 
ATOM 8179 C CD    . PRO E 1 457 ? 1.455   76.053  91.544  1.00 146.63 ? 552 PRO E CD    1 
ATOM 8180 N N     . LYS E 1 458 ? 4.270   74.504  93.266  1.00 132.79 ? 553 LYS E N     1 
ATOM 8181 C CA    . LYS E 1 458 ? 5.115   73.539  93.968  1.00 145.70 ? 553 LYS E CA    1 
ATOM 8182 C C     . LYS E 1 458 ? 5.460   72.344  93.078  1.00 157.43 ? 553 LYS E C     1 
ATOM 8183 O O     . LYS E 1 458 ? 6.302   71.517  93.457  1.00 149.25 ? 553 LYS E O     1 
ATOM 8184 C CB    . LYS E 1 458 ? 4.442   73.103  95.283  1.00 141.86 ? 553 LYS E CB    1 
ATOM 8185 C CG    . LYS E 1 458 ? 5.110   73.716  96.515  1.00 141.53 ? 553 LYS E CG    1 
ATOM 8186 C CD    . LYS E 1 458 ? 4.301   73.596  97.798  1.00 131.19 ? 553 LYS E CD    1 
ATOM 8187 C CE    . LYS E 1 458 ? 4.933   74.501  98.861  1.00 134.29 ? 553 LYS E CE    1 
ATOM 8188 N NZ    . LYS E 1 458 ? 4.149   74.592  100.117 1.00 106.24 ? 553 LYS E NZ    1 
ATOM 8189 N N     . LEU E 1 459 ? 4.831   72.263  91.901  1.00 155.53 ? 554 LEU E N     1 
ATOM 8190 C CA    . LEU E 1 459 ? 5.113   71.328  90.814  1.00 137.11 ? 554 LEU E CA    1 
ATOM 8191 C C     . LEU E 1 459 ? 6.149   71.900  89.842  1.00 132.85 ? 554 LEU E C     1 
ATOM 8192 O O     . LEU E 1 459 ? 7.212   71.305  89.649  1.00 131.85 ? 554 LEU E O     1 
ATOM 8193 C CB    . LEU E 1 459 ? 3.813   70.980  90.081  1.00 126.43 ? 554 LEU E CB    1 
ATOM 8194 C CG    . LEU E 1 459 ? 3.711   69.599  89.468  1.00 103.54 ? 554 LEU E CG    1 
ATOM 8195 C CD1   . LEU E 1 459 ? 3.512   68.611  90.594  1.00 86.68  ? 554 LEU E CD1   1 
ATOM 8196 C CD2   . LEU E 1 459 ? 2.573   69.573  88.474  1.00 110.11 ? 554 LEU E CD2   1 
ATOM 8197 N N     . SER E 1 460 ? 5.864   73.078  89.264  1.00 134.68 ? 555 SER E N     1 
ATOM 8198 C CA    . SER E 1 460 ? 6.505   73.628  88.066  1.00 133.65 ? 555 SER E CA    1 
ATOM 8199 C C     . SER E 1 460 ? 8.011   73.404  88.028  1.00 132.69 ? 555 SER E C     1 
ATOM 8200 O O     . SER E 1 460 ? 8.576   73.166  86.953  1.00 119.29 ? 555 SER E O     1 
ATOM 8201 C CB    . SER E 1 460 ? 6.240   75.142  87.955  1.00 140.15 ? 555 SER E CB    1 
ATOM 8202 O OG    . SER E 1 460 ? 4.878   75.474  87.694  1.00 143.06 ? 555 SER E OG    1 
ATOM 8203 N N     . LYS E 1 461 ? 8.666   73.494  89.187  1.00 127.54 ? 556 LYS E N     1 
ATOM 8204 C CA    . LYS E 1 461 ? 10.098  73.254  89.263  1.00 121.89 ? 556 LYS E CA    1 
ATOM 8205 C C     . LYS E 1 461 ? 10.474  71.766  89.373  1.00 131.01 ? 556 LYS E C     1 
ATOM 8206 O O     . LYS E 1 461 ? 11.644  71.432  89.155  1.00 127.85 ? 556 LYS E O     1 
ATOM 8207 C CB    . LYS E 1 461 ? 10.690  74.060  90.432  1.00 129.50 ? 556 LYS E CB    1 
ATOM 8208 C CG    . LYS E 1 461 ? 10.680  75.600  90.225  1.00 144.36 ? 556 LYS E CG    1 
ATOM 8209 C CD    . LYS E 1 461 ? 11.964  76.308  90.737  1.00 135.51 ? 556 LYS E CD    1 
ATOM 8210 C CE    . LYS E 1 461 ? 11.782  76.935  92.121  1.00 123.56 ? 556 LYS E CE    1 
ATOM 8211 N NZ    . LYS E 1 461 ? 13.073  77.316  92.764  1.00 131.39 ? 556 LYS E NZ    1 
ATOM 8212 N N     . LEU E 1 462 ? 9.541   70.852  89.679  1.00 130.98 ? 557 LEU E N     1 
ATOM 8213 C CA    . LEU E 1 462 ? 9.890   69.427  89.635  1.00 114.29 ? 557 LEU E CA    1 
ATOM 8214 C C     . LEU E 1 462 ? 10.155  68.969  88.211  1.00 99.50  ? 557 LEU E C     1 
ATOM 8215 O O     . LEU E 1 462 ? 11.182  68.348  87.933  1.00 104.52 ? 557 LEU E O     1 
ATOM 8216 C CB    . LEU E 1 462 ? 8.801   68.559  90.258  1.00 114.80 ? 557 LEU E CB    1 
ATOM 8217 C CG    . LEU E 1 462 ? 9.224   67.945  91.595  1.00 123.16 ? 557 LEU E CG    1 
ATOM 8218 C CD1   . LEU E 1 462 ? 8.443   66.645  91.927  1.00 93.37  ? 557 LEU E CD1   1 
ATOM 8219 C CD2   . LEU E 1 462 ? 10.751  67.764  91.643  1.00 105.87 ? 557 LEU E CD2   1 
ATOM 8220 N N     . ALA E 1 463 ? 9.243   69.278  87.290  1.00 90.39  ? 558 ALA E N     1 
ATOM 8221 C CA    . ALA E 1 463 ? 9.536   69.073  85.883  1.00 86.23  ? 558 ALA E CA    1 
ATOM 8222 C C     . ALA E 1 463 ? 10.718  69.908  85.421  1.00 99.31  ? 558 ALA E C     1 
ATOM 8223 O O     . ALA E 1 463 ? 11.156  69.751  84.282  1.00 95.12  ? 558 ALA E O     1 
ATOM 8224 C CB    . ALA E 1 463 ? 8.309   69.380  85.028  1.00 71.20  ? 558 ALA E CB    1 
ATOM 8225 N N     . LEU E 1 464 ? 11.208  70.832  86.241  1.00 107.05 ? 559 LEU E N     1 
ATOM 8226 C CA    . LEU E 1 464 ? 12.499  71.432  85.939  1.00 109.29 ? 559 LEU E CA    1 
ATOM 8227 C C     . LEU E 1 464 ? 13.627  70.478  86.286  1.00 103.89 ? 559 LEU E C     1 
ATOM 8228 O O     . LEU E 1 464 ? 14.471  70.163  85.443  1.00 97.35  ? 559 LEU E O     1 
ATOM 8229 C CB    . LEU E 1 464 ? 12.670  72.744  86.696  1.00 114.90 ? 559 LEU E CB    1 
ATOM 8230 C CG    . LEU E 1 464 ? 12.282  74.036  86.004  1.00 118.96 ? 559 LEU E CG    1 
ATOM 8231 C CD1   . LEU E 1 464 ? 10.956  73.895  85.248  1.00 116.04 ? 559 LEU E CD1   1 
ATOM 8232 C CD2   . LEU E 1 464 ? 12.229  75.123  87.064  1.00 120.51 ? 559 LEU E CD2   1 
ATOM 8233 N N     . SER E 1 465 ? 13.645  69.983  87.520  1.00 100.67 ? 560 SER E N     1 
ATOM 8234 C CA    . SER E 1 465 ? 14.744  69.115  87.895  1.00 99.69  ? 560 SER E CA    1 
ATOM 8235 C C     . SER E 1 465 ? 14.715  67.817  87.115  1.00 95.54  ? 560 SER E C     1 
ATOM 8236 O O     . SER E 1 465 ? 15.752  67.162  87.020  1.00 110.08 ? 560 SER E O     1 
ATOM 8237 C CB    . SER E 1 465 ? 14.734  68.828  89.399  1.00 93.91  ? 560 SER E CB    1 
ATOM 8238 O OG    . SER E 1 465 ? 14.265  67.525  89.690  1.00 69.63  ? 560 SER E OG    1 
ATOM 8239 N N     . LEU E 1 466 ? 13.553  67.426  86.571  1.00 97.75  ? 561 LEU E N     1 
ATOM 8240 C CA    . LEU E 1 466 ? 13.439  66.152  85.851  1.00 106.32 ? 561 LEU E CA    1 
ATOM 8241 C C     . LEU E 1 466 ? 13.884  66.247  84.394  1.00 92.58  ? 561 LEU E C     1 
ATOM 8242 O O     . LEU E 1 466 ? 14.680  65.424  83.931  1.00 91.31  ? 561 LEU E O     1 
ATOM 8243 C CB    . LEU E 1 466 ? 12.009  65.613  85.936  1.00 95.67  ? 561 LEU E CB    1 
ATOM 8244 C CG    . LEU E 1 466 ? 11.806  64.537  87.018  1.00 93.39  ? 561 LEU E CG    1 
ATOM 8245 C CD1   . LEU E 1 466 ? 11.973  63.149  86.435  1.00 92.96  ? 561 LEU E CD1   1 
ATOM 8246 C CD2   . LEU E 1 466 ? 12.760  64.711  88.190  1.00 79.91  ? 561 LEU E CD2   1 
ATOM 8247 N N     . LEU E 1 467 ? 13.396  67.242  83.658  1.00 89.85  ? 562 LEU E N     1 
ATOM 8248 C CA    . LEU E 1 467 ? 13.765  67.366  82.249  1.00 99.30  ? 562 LEU E CA    1 
ATOM 8249 C C     . LEU E 1 467 ? 15.222  67.799  82.052  1.00 89.99  ? 562 LEU E C     1 
ATOM 8250 O O     . LEU E 1 467 ? 15.679  67.861  80.902  1.00 91.17  ? 562 LEU E O     1 
ATOM 8251 C CB    . LEU E 1 467 ? 12.816  68.349  81.524  1.00 116.70 ? 562 LEU E CB    1 
ATOM 8252 C CG    . LEU E 1 467 ? 11.269  68.267  81.626  1.00 121.94 ? 562 LEU E CG    1 
ATOM 8253 C CD1   . LEU E 1 467 ? 10.574  69.588  81.246  1.00 108.84 ? 562 LEU E CD1   1 
ATOM 8254 C CD2   . LEU E 1 467 ? 10.676  67.129  80.810  1.00 124.03 ? 562 LEU E CD2   1 
ATOM 8255 N N     . SER E 1 468 ? 15.941  68.130  83.132  1.00 88.61  ? 563 SER E N     1 
ATOM 8256 C CA    . SER E 1 468 ? 17.372  68.444  83.112  1.00 97.53  ? 563 SER E CA    1 
ATOM 8257 C C     . SER E 1 468 ? 18.236  67.234  83.444  1.00 101.50 ? 563 SER E C     1 
ATOM 8258 O O     . SER E 1 468 ? 19.441  67.391  83.670  1.00 100.30 ? 563 SER E O     1 
ATOM 8259 C CB    . SER E 1 468 ? 17.705  69.596  84.082  1.00 106.23 ? 563 SER E CB    1 
ATOM 8260 O OG    . SER E 1 468 ? 18.330  69.139  85.281  1.00 101.41 ? 563 SER E OG    1 
ATOM 8261 N N     . ILE E 1 469 ? 17.642  66.050  83.553  1.00 85.93  ? 564 ILE E N     1 
ATOM 8262 C CA    . ILE E 1 469 ? 18.424  64.837  83.728  1.00 75.89  ? 564 ILE E CA    1 
ATOM 8263 C C     . ILE E 1 469 ? 18.732  64.239  82.356  1.00 94.24  ? 564 ILE E C     1 
ATOM 8264 O O     . ILE E 1 469 ? 17.854  64.207  81.461  1.00 76.96  ? 564 ILE E O     1 
ATOM 8265 C CB    . ILE E 1 469 ? 17.711  63.863  84.663  1.00 78.07  ? 564 ILE E CB    1 
ATOM 8266 C CG1   . ILE E 1 469 ? 18.240  64.066  86.074  1.00 93.36  ? 564 ILE E CG1   1 
ATOM 8267 C CG2   . ILE E 1 469 ? 17.954  62.451  84.249  1.00 81.20  ? 564 ILE E CG2   1 
ATOM 8268 C CD1   . ILE E 1 469 ? 17.168  64.399  87.045  1.00 106.28 ? 564 ILE E CD1   1 
ATOM 8269 N N     . PRO E 1 470 ? 19.999  63.824  82.145  1.00 87.39  ? 565 PRO E N     1 
ATOM 8270 C CA    . PRO E 1 470 ? 20.514  63.619  80.786  1.00 68.29  ? 565 PRO E CA    1 
ATOM 8271 C C     . PRO E 1 470 ? 20.104  62.323  80.117  1.00 79.20  ? 565 PRO E C     1 
ATOM 8272 O O     . PRO E 1 470 ? 20.224  62.251  78.883  1.00 89.57  ? 565 PRO E O     1 
ATOM 8273 C CB    . PRO E 1 470 ? 22.038  63.676  80.978  1.00 59.41  ? 565 PRO E CB    1 
ATOM 8274 C CG    . PRO E 1 470 ? 22.258  63.686  82.491  1.00 68.31  ? 565 PRO E CG    1 
ATOM 8275 C CD    . PRO E 1 470 ? 20.967  63.333  83.134  1.00 66.34  ? 565 PRO E CD    1 
ATOM 8276 N N     . ALA E 1 471 ? 19.725  61.280  80.865  1.00 53.76  ? 566 ALA E N     1 
ATOM 8277 C CA    . ALA E 1 471 ? 19.298  59.998  80.298  1.00 69.62  ? 566 ALA E CA    1 
ATOM 8278 C C     . ALA E 1 471 ? 20.423  59.153  79.722  1.00 67.02  ? 566 ALA E C     1 
ATOM 8279 O O     . ALA E 1 471 ? 20.143  58.062  79.240  1.00 70.82  ? 566 ALA E O     1 
ATOM 8280 C CB    . ALA E 1 471 ? 18.248  60.133  79.177  1.00 55.87  ? 566 ALA E CB    1 
ATOM 8281 N N     . SER E 1 472 ? 21.662  59.631  79.691  1.00 56.91  ? 567 SER E N     1 
ATOM 8282 C CA    . SER E 1 472 ? 22.709  58.878  79.023  1.00 53.89  ? 567 SER E CA    1 
ATOM 8283 C C     . SER E 1 472 ? 24.084  59.354  79.476  1.00 64.10  ? 567 SER E C     1 
ATOM 8284 O O     . SER E 1 472 ? 24.278  60.516  79.845  1.00 62.10  ? 567 SER E O     1 
ATOM 8285 C CB    . SER E 1 472 ? 22.580  59.002  77.510  1.00 51.63  ? 567 SER E CB    1 
ATOM 8286 O OG    . SER E 1 472 ? 23.785  59.508  76.997  1.00 65.90  ? 567 SER E OG    1 
ATOM 8287 N N     . SER E 1 473 ? 25.058  58.456  79.350  1.00 62.49  ? 568 SER E N     1 
ATOM 8288 C CA    . SER E 1 473 ? 26.403  58.668  79.856  1.00 57.75  ? 568 SER E CA    1 
ATOM 8289 C C     . SER E 1 473 ? 27.290  59.333  78.821  1.00 66.47  ? 568 SER E C     1 
ATOM 8290 O O     . SER E 1 473 ? 28.485  59.532  79.070  1.00 71.87  ? 568 SER E O     1 
ATOM 8291 C CB    . SER E 1 473 ? 26.991  57.330  80.331  1.00 59.24  ? 568 SER E CB    1 
ATOM 8292 O OG    . SER E 1 473 ? 28.366  57.139  79.996  1.00 75.69  ? 568 SER E OG    1 
ATOM 8293 N N     . ALA E 1 474 ? 26.708  59.721  77.683  1.00 53.66  ? 569 ALA E N     1 
ATOM 8294 C CA    . ALA E 1 474 ? 27.491  60.196  76.549  1.00 55.23  ? 569 ALA E CA    1 
ATOM 8295 C C     . ALA E 1 474 ? 28.238  61.503  76.843  1.00 60.07  ? 569 ALA E C     1 
ATOM 8296 O O     . ALA E 1 474 ? 29.367  61.705  76.379  1.00 49.96  ? 569 ALA E O     1 
ATOM 8297 C CB    . ALA E 1 474 ? 26.571  60.355  75.350  1.00 52.53  ? 569 ALA E CB    1 
ATOM 8298 N N     . ALA E 1 475 ? 27.638  62.411  77.606  1.00 71.89  ? 570 ALA E N     1 
ATOM 8299 C CA    . ALA E 1 475 ? 28.382  63.609  77.987  1.00 69.02  ? 570 ALA E CA    1 
ATOM 8300 C C     . ALA E 1 475 ? 29.780  63.244  78.461  1.00 57.52  ? 570 ALA E C     1 
ATOM 8301 O O     . ALA E 1 475 ? 30.750  63.946  78.164  1.00 61.50  ? 570 ALA E O     1 
ATOM 8302 C CB    . ALA E 1 475 ? 27.641  64.377  79.076  1.00 74.44  ? 570 ALA E CB    1 
ATOM 8303 N N     . SER E 1 476 ? 29.898  62.123  79.162  1.00 49.22  ? 571 SER E N     1 
ATOM 8304 C CA    . SER E 1 476 ? 31.199  61.645  79.590  1.00 57.05  ? 571 SER E CA    1 
ATOM 8305 C C     . SER E 1 476 ? 32.056  61.226  78.403  1.00 53.85  ? 571 SER E C     1 
ATOM 8306 O O     . SER E 1 476 ? 33.238  61.583  78.309  1.00 41.70  ? 571 SER E O     1 
ATOM 8307 C CB    . SER E 1 476 ? 31.015  60.488  80.570  1.00 63.11  ? 571 SER E CB    1 
ATOM 8308 O OG    . SER E 1 476 ? 30.822  60.965  81.890  1.00 62.62  ? 571 SER E OG    1 
ATOM 8309 N N     . GLU E 1 477 ? 31.502  60.436  77.497  1.00 58.53  ? 572 GLU E N     1 
ATOM 8310 C CA    . GLU E 1 477 ? 32.351  59.990  76.405  1.00 53.84  ? 572 GLU E CA    1 
ATOM 8311 C C     . GLU E 1 477 ? 32.801  61.179  75.576  1.00 63.15  ? 572 GLU E C     1 
ATOM 8312 O O     . GLU E 1 477 ? 33.945  61.207  75.110  1.00 72.65  ? 572 GLU E O     1 
ATOM 8313 C CB    . GLU E 1 477 ? 31.653  58.932  75.547  1.00 52.45  ? 572 GLU E CB    1 
ATOM 8314 C CG    . GLU E 1 477 ? 32.122  57.493  75.853  1.00 94.66  ? 572 GLU E CG    1 
ATOM 8315 C CD    . GLU E 1 477 ? 31.058  56.641  76.563  1.00 116.02 ? 572 GLU E CD    1 
ATOM 8316 O OE1   . GLU E 1 477 ? 29.854  56.767  76.196  1.00 99.97  ? 572 GLU E OE1   1 
ATOM 8317 O OE2   . GLU E 1 477 ? 31.432  55.850  77.479  1.00 108.05 ? 572 GLU E OE2   1 
ATOM 8318 N N     . ARG E 1 478 ? 31.939  62.201  75.428  1.00 62.20  ? 573 ARG E N     1 
ATOM 8319 C CA    . ARG E 1 478 ? 32.313  63.365  74.626  1.00 57.75  ? 573 ARG E CA    1 
ATOM 8320 C C     . ARG E 1 478 ? 33.558  64.003  75.189  1.00 53.41  ? 573 ARG E C     1 
ATOM 8321 O O     . ARG E 1 478 ? 34.527  64.280  74.467  1.00 49.36  ? 573 ARG E O     1 
ATOM 8322 C CB    . ARG E 1 478 ? 31.193  64.392  74.597  1.00 66.00  ? 573 ARG E CB    1 
ATOM 8323 C CG    . ARG E 1 478 ? 29.938  63.933  73.917  1.00 75.61  ? 573 ARG E CG    1 
ATOM 8324 C CD    . ARG E 1 478 ? 28.989  65.120  73.769  1.00 81.58  ? 573 ARG E CD    1 
ATOM 8325 N NE    . ARG E 1 478 ? 27.606  64.674  73.625  1.00 84.19  ? 573 ARG E NE    1 
ATOM 8326 C CZ    . ARG E 1 478 ? 26.658  64.847  74.545  1.00 90.55  ? 573 ARG E CZ    1 
ATOM 8327 N NH1   . ARG E 1 478 ? 26.926  65.485  75.698  1.00 72.76  ? 573 ARG E NH1   1 
ATOM 8328 N NH2   . ARG E 1 478 ? 25.432  64.387  74.299  1.00 83.25  ? 573 ARG E NH2   1 
ATOM 8329 N N     . THR E 1 479 ? 33.535  64.230  76.494  1.00 49.73  ? 574 THR E N     1 
ATOM 8330 C CA    . THR E 1 479 ? 34.705  64.672  77.236  1.00 50.42  ? 574 THR E CA    1 
ATOM 8331 C C     . THR E 1 479 ? 35.942  63.853  76.898  1.00 52.40  ? 574 THR E C     1 
ATOM 8332 O O     . THR E 1 479 ? 36.993  64.420  76.565  1.00 44.15  ? 574 THR E O     1 
ATOM 8333 C CB    . THR E 1 479 ? 34.368  64.554  78.709  1.00 47.59  ? 574 THR E CB    1 
ATOM 8334 O OG1   . THR E 1 479 ? 33.317  65.475  78.982  1.00 52.31  ? 574 THR E OG1   1 
ATOM 8335 C CG2   . THR E 1 479 ? 35.549  64.782  79.568  1.00 24.04  ? 574 THR E CG2   1 
ATOM 8336 N N     . PHE E 1 480 ? 35.828  62.510  76.981  1.00 41.21  ? 575 PHE E N     1 
ATOM 8337 C CA    . PHE E 1 480 ? 36.955  61.635  76.659  1.00 45.72  ? 575 PHE E CA    1 
ATOM 8338 C C     . PHE E 1 480 ? 37.444  61.862  75.238  1.00 41.32  ? 575 PHE E C     1 
ATOM 8339 O O     . PHE E 1 480 ? 38.642  62.037  74.994  1.00 34.30  ? 575 PHE E O     1 
ATOM 8340 C CB    . PHE E 1 480 ? 36.559  60.176  76.831  1.00 44.16  ? 575 PHE E CB    1 
ATOM 8341 C CG    . PHE E 1 480 ? 36.176  59.826  78.219  1.00 55.00  ? 575 PHE E CG    1 
ATOM 8342 C CD1   . PHE E 1 480 ? 35.230  58.820  78.464  1.00 61.83  ? 575 PHE E CD1   1 
ATOM 8343 C CD2   . PHE E 1 480 ? 36.749  60.480  79.288  1.00 45.98  ? 575 PHE E CD2   1 
ATOM 8344 C CE1   . PHE E 1 480 ? 34.837  58.481  79.747  1.00 45.55  ? 575 PHE E CE1   1 
ATOM 8345 C CE2   . PHE E 1 480 ? 36.368  60.138  80.587  1.00 57.44  ? 575 PHE E CE2   1 
ATOM 8346 C CZ    . PHE E 1 480 ? 35.395  59.132  80.807  1.00 51.06  ? 575 PHE E CZ    1 
ATOM 8347 N N     . SER E 1 481 ? 36.526  61.844  74.285  1.00 32.95  ? 576 SER E N     1 
ATOM 8348 C CA    . SER E 1 481 ? 36.906  62.033  72.903  1.00 34.49  ? 576 SER E CA    1 
ATOM 8349 C C     . SER E 1 481 ? 37.820  63.234  72.782  1.00 42.70  ? 576 SER E C     1 
ATOM 8350 O O     . SER E 1 481 ? 38.953  63.122  72.286  1.00 37.79  ? 576 SER E O     1 
ATOM 8351 C CB    . SER E 1 481 ? 35.643  62.197  72.073  1.00 45.12  ? 576 SER E CB    1 
ATOM 8352 O OG    . SER E 1 481 ? 35.934  62.125  70.692  1.00 80.45  ? 576 SER E OG    1 
ATOM 8353 N N     . LEU E 1 482 ? 37.364  64.367  73.351  1.00 44.39  ? 577 LEU E N     1 
ATOM 8354 C CA    . LEU E 1 482 ? 38.125  65.613  73.450  1.00 31.92  ? 577 LEU E CA    1 
ATOM 8355 C C     . LEU E 1 482 ? 39.478  65.393  74.111  1.00 40.43  ? 577 LEU E C     1 
ATOM 8356 O O     . LEU E 1 482 ? 40.509  65.827  73.592  1.00 42.87  ? 577 LEU E O     1 
ATOM 8357 C CB    . LEU E 1 482 ? 37.310  66.641  74.238  1.00 35.59  ? 577 LEU E CB    1 
ATOM 8358 C CG    . LEU E 1 482 ? 35.977  67.297  73.807  1.00 37.86  ? 577 LEU E CG    1 
ATOM 8359 C CD1   . LEU E 1 482 ? 35.259  68.067  74.967  1.00 39.54  ? 577 LEU E CD1   1 
ATOM 8360 C CD2   . LEU E 1 482 ? 36.196  68.232  72.628  1.00 24.53  ? 577 LEU E CD2   1 
ATOM 8361 N N     . ALA E 1 483 ? 39.494  64.679  75.246  1.00 44.05  ? 578 ALA E N     1 
ATOM 8362 C CA    . ALA E 1 483 ? 40.733  64.413  75.981  1.00 39.67  ? 578 ALA E CA    1 
ATOM 8363 C C     . ALA E 1 483 ? 41.766  63.673  75.143  1.00 42.85  ? 578 ALA E C     1 
ATOM 8364 O O     . ALA E 1 483 ? 42.973  63.819  75.361  1.00 34.09  ? 578 ALA E O     1 
ATOM 8365 C CB    . ALA E 1 483 ? 40.417  63.612  77.232  1.00 25.35  ? 578 ALA E CB    1 
ATOM 8366 N N     . GLY E 1 484 ? 41.320  62.861  74.202  1.00 43.19  ? 579 GLY E N     1 
ATOM 8367 C CA    . GLY E 1 484 ? 42.294  62.162  73.421  1.00 43.13  ? 579 GLY E CA    1 
ATOM 8368 C C     . GLY E 1 484 ? 42.781  62.926  72.234  1.00 49.36  ? 579 GLY E C     1 
ATOM 8369 O O     . GLY E 1 484 ? 43.714  62.471  71.551  1.00 50.32  ? 579 GLY E O     1 
ATOM 8370 N N     . ASN E 1 485 ? 42.141  64.057  71.940  1.00 44.60  ? 580 ASN E N     1 
ATOM 8371 C CA    . ASN E 1 485 ? 42.746  64.976  70.985  1.00 47.24  ? 580 ASN E CA    1 
ATOM 8372 C C     . ASN E 1 485 ? 43.722  65.895  71.657  1.00 46.10  ? 580 ASN E C     1 
ATOM 8373 O O     . ASN E 1 485 ? 44.559  66.497  70.977  1.00 59.50  ? 580 ASN E O     1 
ATOM 8374 C CB    . ASN E 1 485 ? 41.701  65.789  70.243  1.00 26.21  ? 580 ASN E CB    1 
ATOM 8375 C CG    . ASN E 1 485 ? 40.665  64.906  69.557  1.00 51.64  ? 580 ASN E CG    1 
ATOM 8376 O OD1   . ASN E 1 485 ? 40.871  64.401  68.438  1.00 56.97  ? 580 ASN E OD1   1 
ATOM 8377 N ND2   . ASN E 1 485 ? 39.547  64.699  70.237  1.00 55.11  ? 580 ASN E ND2   1 
ATOM 8378 N N     . ILE E 1 486 ? 43.648  65.985  72.976  1.00 44.62  ? 581 ILE E N     1 
ATOM 8379 C CA    . ILE E 1 486 ? 44.717  66.628  73.712  1.00 42.51  ? 581 ILE E CA    1 
ATOM 8380 C C     . ILE E 1 486 ? 45.903  65.678  73.818  1.00 50.26  ? 581 ILE E C     1 
ATOM 8381 O O     . ILE E 1 486 ? 47.045  66.076  73.579  1.00 56.61  ? 581 ILE E O     1 
ATOM 8382 C CB    . ILE E 1 486 ? 44.234  67.094  75.103  1.00 36.09  ? 581 ILE E CB    1 
ATOM 8383 C CG1   . ILE E 1 486 ? 42.913  67.835  75.043  1.00 49.53  ? 581 ILE E CG1   1 
ATOM 8384 C CG2   . ILE E 1 486 ? 45.149  68.038  75.653  1.00 33.67  ? 581 ILE E CG2   1 
ATOM 8385 C CD1   . ILE E 1 486 ? 42.897  68.984  74.041  1.00 53.38  ? 581 ILE E CD1   1 
ATOM 8386 N N     . ILE E 1 487 ? 45.686  64.404  74.142  1.00 36.13  ? 582 ILE E N     1 
ATOM 8387 C CA    . ILE E 1 487 ? 46.805  63.553  74.546  1.00 47.86  ? 582 ILE E CA    1 
ATOM 8388 C C     . ILE E 1 487 ? 47.221  62.668  73.375  1.00 55.75  ? 582 ILE E C     1 
ATOM 8389 O O     . ILE E 1 487 ? 46.714  61.551  73.185  1.00 53.32  ? 582 ILE E O     1 
ATOM 8390 C CB    . ILE E 1 487 ? 46.444  62.702  75.753  1.00 40.55  ? 582 ILE E CB    1 
ATOM 8391 C CG1   . ILE E 1 487 ? 45.835  63.553  76.829  1.00 29.26  ? 582 ILE E CG1   1 
ATOM 8392 C CG2   . ILE E 1 487 ? 47.628  61.942  76.246  1.00 32.06  ? 582 ILE E CG2   1 
ATOM 8393 C CD1   . ILE E 1 487 ? 45.287  62.647  77.920  1.00 40.71  ? 582 ILE E CD1   1 
ATOM 8394 N N     . THR E 1 488 ? 48.272  63.089  72.698  1.00 36.17  ? 583 THR E N     1 
ATOM 8395 C CA    . THR E 1 488 ? 48.598  62.551  71.411  1.00 33.51  ? 583 THR E CA    1 
ATOM 8396 C C     . THR E 1 488 ? 50.051  62.091  71.448  1.00 42.55  ? 583 THR E C     1 
ATOM 8397 O O     . THR E 1 488 ? 50.730  62.153  72.472  1.00 40.62  ? 583 THR E O     1 
ATOM 8398 C CB    . THR E 1 488 ? 48.271  63.605  70.335  1.00 36.94  ? 583 THR E CB    1 
ATOM 8399 O OG1   . THR E 1 488 ? 49.407  64.393  69.973  1.00 43.11  ? 583 THR E OG1   1 
ATOM 8400 C CG2   . THR E 1 488 ? 47.314  64.550  70.880  1.00 38.01  ? 583 THR E CG2   1 
ATOM 8401 N N     . GLU E 1 489 ? 50.534  61.579  70.332  1.00 43.78  ? 584 GLU E N     1 
ATOM 8402 C CA    . GLU E 1 489 ? 51.884  61.066  70.328  1.00 37.21  ? 584 GLU E CA    1 
ATOM 8403 C C     . GLU E 1 489 ? 52.860  62.108  70.827  1.00 42.16  ? 584 GLU E C     1 
ATOM 8404 O O     . GLU E 1 489 ? 53.594  61.885  71.794  1.00 44.13  ? 584 GLU E O     1 
ATOM 8405 C CB    . GLU E 1 489 ? 52.242  60.640  68.922  1.00 45.38  ? 584 GLU E CB    1 
ATOM 8406 C CG    . GLU E 1 489 ? 52.651  59.230  68.802  1.00 51.08  ? 584 GLU E CG    1 
ATOM 8407 C CD    . GLU E 1 489 ? 53.281  58.964  67.466  1.00 73.41  ? 584 GLU E CD    1 
ATOM 8408 O OE1   . GLU E 1 489 ? 54.271  59.675  67.129  1.00 78.21  ? 584 GLU E OE1   1 
ATOM 8409 O OE2   . GLU E 1 489 ? 52.767  58.061  66.760  1.00 71.37  ? 584 GLU E OE2   1 
ATOM 8410 N N     . LYS E 1 490 ? 52.875  63.262  70.177  1.00 34.77  ? 585 LYS E N     1 
ATOM 8411 C CA    . LYS E 1 490 ? 53.914  64.230  70.484  1.00 51.40  ? 585 LYS E CA    1 
ATOM 8412 C C     . LYS E 1 490 ? 53.548  65.101  71.694  1.00 46.18  ? 585 LYS E C     1 
ATOM 8413 O O     . LYS E 1 490 ? 54.426  65.650  72.380  1.00 30.38  ? 585 LYS E O     1 
ATOM 8414 C CB    . LYS E 1 490 ? 54.181  65.007  69.204  1.00 44.65  ? 585 LYS E CB    1 
ATOM 8415 C CG    . LYS E 1 490 ? 54.310  64.037  68.034  1.00 55.69  ? 585 LYS E CG    1 
ATOM 8416 C CD    . LYS E 1 490 ? 54.902  64.623  66.727  1.00 49.51  ? 585 LYS E CD    1 
ATOM 8417 C CE    . LYS E 1 490 ? 55.202  63.493  65.690  1.00 47.26  ? 585 LYS E CE    1 
ATOM 8418 N NZ    . LYS E 1 490 ? 55.814  62.181  66.230  1.00 48.14  ? 585 LYS E NZ    1 
ATOM 8419 N N     . ARG E 1 491 ? 52.284  65.107  72.038  1.00 33.85  ? 586 ARG E N     1 
ATOM 8420 C CA    . ARG E 1 491 ? 51.787  65.781  73.206  1.00 36.38  ? 586 ARG E CA    1 
ATOM 8421 C C     . ARG E 1 491 ? 51.840  64.896  74.443  1.00 43.42  ? 586 ARG E C     1 
ATOM 8422 O O     . ARG E 1 491 ? 51.201  65.233  75.442  1.00 53.38  ? 586 ARG E O     1 
ATOM 8423 C CB    . ARG E 1 491 ? 50.355  66.301  72.940  1.00 40.44  ? 586 ARG E CB    1 
ATOM 8424 C CG    . ARG E 1 491 ? 50.263  67.410  71.793  1.00 49.38  ? 586 ARG E CG    1 
ATOM 8425 C CD    . ARG E 1 491 ? 48.999  68.379  71.856  1.00 50.39  ? 586 ARG E CD    1 
ATOM 8426 N NE    . ARG E 1 491 ? 49.089  69.477  72.846  1.00 53.17  ? 586 ARG E NE    1 
ATOM 8427 C CZ    . ARG E 1 491 ? 48.049  70.102  73.420  1.00 56.41  ? 586 ARG E CZ    1 
ATOM 8428 N NH1   . ARG E 1 491 ? 46.804  69.759  73.120  1.00 67.28  ? 586 ARG E NH1   1 
ATOM 8429 N NH2   . ARG E 1 491 ? 48.249  71.072  74.303  1.00 53.29  ? 586 ARG E NH2   1 
ATOM 8430 N N     . ASN E 1 492 ? 52.520  63.741  74.384  1.00 34.93  ? 587 ASN E N     1 
ATOM 8431 C CA    . ASN E 1 492 ? 52.374  62.705  75.420  1.00 33.36  ? 587 ASN E CA    1 
ATOM 8432 C C     . ASN E 1 492 ? 52.869  63.136  76.797  1.00 44.03  ? 587 ASN E C     1 
ATOM 8433 O O     . ASN E 1 492 ? 52.446  62.562  77.814  1.00 34.16  ? 587 ASN E O     1 
ATOM 8434 C CB    . ASN E 1 492 ? 53.123  61.441  74.990  1.00 32.55  ? 587 ASN E CB    1 
ATOM 8435 C CG    . ASN E 1 492 ? 54.630  61.500  75.267  1.00 41.35  ? 587 ASN E CG    1 
ATOM 8436 O OD1   . ASN E 1 492 ? 55.067  61.349  76.418  1.00 39.51  ? 587 ASN E OD1   1 
ATOM 8437 N ND2   . ASN E 1 492 ? 55.435  61.680  74.198  1.00 33.37  ? 587 ASN E ND2   1 
ATOM 8438 N N     . ARG E 1 493 ? 53.772  64.126  76.826  1.00 44.28  ? 588 ARG E N     1 
ATOM 8439 C CA    . ARG E 1 493 ? 54.378  64.708  78.021  1.00 43.99  ? 588 ARG E CA    1 
ATOM 8440 C C     . ARG E 1 493 ? 53.400  65.445  78.955  1.00 57.31  ? 588 ARG E C     1 
ATOM 8441 O O     . ARG E 1 493 ? 53.658  65.532  80.163  1.00 52.25  ? 588 ARG E O     1 
ATOM 8442 C CB    . ARG E 1 493 ? 55.459  65.666  77.547  1.00 48.64  ? 588 ARG E CB    1 
ATOM 8443 C CG    . ARG E 1 493 ? 56.706  64.955  77.140  1.00 55.28  ? 588 ARG E CG    1 
ATOM 8444 C CD    . ARG E 1 493 ? 56.800  63.751  78.017  1.00 52.39  ? 588 ARG E CD    1 
ATOM 8445 N NE    . ARG E 1 493 ? 58.000  63.693  78.816  1.00 47.90  ? 588 ARG E NE    1 
ATOM 8446 C CZ    . ARG E 1 493 ? 58.098  62.885  79.860  1.00 55.02  ? 588 ARG E CZ    1 
ATOM 8447 N NH1   . ARG E 1 493 ? 57.072  62.120  80.204  1.00 51.69  ? 588 ARG E NH1   1 
ATOM 8448 N NH2   . ARG E 1 493 ? 59.214  62.821  80.547  1.00 55.43  ? 588 ARG E NH2   1 
ATOM 8449 N N     . ILE E 1 494 ? 52.274  65.942  78.431  1.00 47.49  ? 589 ILE E N     1 
ATOM 8450 C CA    . ILE E 1 494 ? 51.346  66.751  79.202  1.00 48.76  ? 589 ILE E CA    1 
ATOM 8451 C C     . ILE E 1 494 ? 50.860  66.009  80.435  1.00 47.78  ? 589 ILE E C     1 
ATOM 8452 O O     . ILE E 1 494 ? 50.911  64.783  80.519  1.00 64.28  ? 589 ILE E O     1 
ATOM 8453 C CB    . ILE E 1 494 ? 50.163  67.153  78.315  1.00 48.65  ? 589 ILE E CB    1 
ATOM 8454 C CG1   . ILE E 1 494 ? 49.199  68.071  79.059  1.00 48.04  ? 589 ILE E CG1   1 
ATOM 8455 C CG2   . ILE E 1 494 ? 49.442  65.940  77.878  1.00 41.82  ? 589 ILE E CG2   1 
ATOM 8456 C CD1   . ILE E 1 494 ? 48.456  68.997  78.108  1.00 53.92  ? 589 ILE E CD1   1 
ATOM 8457 N N     . GLY E 1 495 ? 50.457  66.770  81.431  1.00 47.27  ? 590 GLY E N     1 
ATOM 8458 C CA    . GLY E 1 495 ? 50.065  66.205  82.695  1.00 51.23  ? 590 GLY E CA    1 
ATOM 8459 C C     . GLY E 1 495 ? 48.576  66.210  82.859  1.00 55.89  ? 590 GLY E C     1 
ATOM 8460 O O     . GLY E 1 495 ? 47.873  66.842  82.069  1.00 52.87  ? 590 GLY E O     1 
ATOM 8461 N N     . GLN E 1 496 ? 48.134  65.493  83.911  1.00 61.70  ? 591 GLN E N     1 
ATOM 8462 C CA    . GLN E 1 496 ? 46.725  65.401  84.320  1.00 54.14  ? 591 GLN E CA    1 
ATOM 8463 C C     . GLN E 1 496 ? 46.094  66.775  84.440  1.00 71.21  ? 591 GLN E C     1 
ATOM 8464 O O     . GLN E 1 496 ? 45.149  67.115  83.713  1.00 67.04  ? 591 GLN E O     1 
ATOM 8465 C CB    . GLN E 1 496 ? 46.617  64.663  85.658  1.00 40.42  ? 591 GLN E CB    1 
ATOM 8466 C CG    . GLN E 1 496 ? 48.002  64.403  86.257  1.00 64.57  ? 591 GLN E CG    1 
ATOM 8467 C CD    . GLN E 1 496 ? 48.086  63.129  87.081  1.00 88.60  ? 591 GLN E CD    1 
ATOM 8468 O OE1   . GLN E 1 496 ? 49.001  62.295  86.887  1.00 82.92  ? 591 GLN E OE1   1 
ATOM 8469 N NE2   . GLN E 1 496 ? 47.137  62.970  88.021  1.00 87.43  ? 591 GLN E NE2   1 
ATOM 8470 N N     . GLN E 1 497 ? 46.627  67.575  85.369  1.00 73.42  ? 592 GLN E N     1 
ATOM 8471 C CA    . GLN E 1 497 ? 46.268  68.962  85.570  1.00 53.53  ? 592 GLN E CA    1 
ATOM 8472 C C     . GLN E 1 497 ? 46.151  69.649  84.221  1.00 61.50  ? 592 GLN E C     1 
ATOM 8473 O O     . GLN E 1 497 ? 45.027  69.874  83.759  1.00 61.74  ? 592 GLN E O     1 
ATOM 8474 C CB    . GLN E 1 497 ? 47.331  69.623  86.423  1.00 80.54  ? 592 GLN E CB    1 
ATOM 8475 C CG    . GLN E 1 497 ? 46.822  70.308  87.669  1.00 110.87 ? 592 GLN E CG    1 
ATOM 8476 C CD    . GLN E 1 497 ? 47.526  71.644  87.909  1.00 113.27 ? 592 GLN E CD    1 
ATOM 8477 O OE1   . GLN E 1 497 ? 48.627  71.890  87.401  1.00 107.02 ? 592 GLN E OE1   1 
ATOM 8478 N NE2   . GLN E 1 497 ? 46.870  72.530  88.650  1.00 138.04 ? 592 GLN E NE2   1 
ATOM 8479 N N     . THR E 1 498 ? 47.281  69.868  83.527  1.00 55.90  ? 593 THR E N     1 
ATOM 8480 C CA    . THR E 1 498 ? 47.265  70.642  82.284  1.00 39.48  ? 593 THR E CA    1 
ATOM 8481 C C     . THR E 1 498 ? 46.205  70.152  81.324  1.00 50.74  ? 593 THR E C     1 
ATOM 8482 O O     . THR E 1 498 ? 45.799  70.900  80.435  1.00 46.29  ? 593 THR E O     1 
ATOM 8483 C CB    . THR E 1 498 ? 48.609  70.598  81.559  1.00 45.42  ? 593 THR E CB    1 
ATOM 8484 O OG1   . THR E 1 498 ? 49.680  70.626  82.504  1.00 70.81  ? 593 THR E OG1   1 
ATOM 8485 C CG2   . THR E 1 498 ? 48.761  71.788  80.637  1.00 42.37  ? 593 THR E CG2   1 
ATOM 8486 N N     . VAL E 1 499 ? 45.789  68.890  81.428  1.00 56.20  ? 594 VAL E N     1 
ATOM 8487 C CA    . VAL E 1 499 ? 44.656  68.444  80.627  1.00 53.51  ? 594 VAL E CA    1 
ATOM 8488 C C     . VAL E 1 499 ? 43.343  68.824  81.281  1.00 51.74  ? 594 VAL E C     1 
ATOM 8489 O O     . VAL E 1 499 ? 42.438  69.364  80.638  1.00 45.33  ? 594 VAL E O     1 
ATOM 8490 C CB    . VAL E 1 499 ? 44.718  66.934  80.362  1.00 39.13  ? 594 VAL E CB    1 
ATOM 8491 C CG1   . VAL E 1 499 ? 43.413  66.500  79.777  1.00 42.54  ? 594 VAL E CG1   1 
ATOM 8492 C CG2   . VAL E 1 499 ? 45.764  66.669  79.357  1.00 44.25  ? 594 VAL E CG2   1 
ATOM 8493 N N     . ASP E 1 500 ? 43.192  68.520  82.559  1.00 58.75  ? 595 ASP E N     1 
ATOM 8494 C CA    . ASP E 1 500 ? 41.901  68.785  83.166  1.00 62.99  ? 595 ASP E CA    1 
ATOM 8495 C C     . ASP E 1 500 ? 41.594  70.264  83.050  1.00 63.50  ? 595 ASP E C     1 
ATOM 8496 O O     . ASP E 1 500 ? 40.458  70.650  82.744  1.00 64.06  ? 595 ASP E O     1 
ATOM 8497 C CB    . ASP E 1 500 ? 41.892  68.290  84.611  1.00 62.98  ? 595 ASP E CB    1 
ATOM 8498 C CG    . ASP E 1 500 ? 41.284  69.276  85.566  1.00 81.27  ? 595 ASP E CG    1 
ATOM 8499 O OD1   . ASP E 1 500 ? 40.107  69.074  85.955  1.00 82.48  ? 595 ASP E OD1   1 
ATOM 8500 O OD2   . ASP E 1 500 ? 41.997  70.242  85.947  1.00 91.53  ? 595 ASP E OD2   1 
ATOM 8501 N N     . SER E 1 501 ? 42.637  71.093  83.166  1.00 64.05  ? 596 SER E N     1 
ATOM 8502 C CA    . SER E 1 501 ? 42.502  72.540  83.027  1.00 58.56  ? 596 SER E CA    1 
ATOM 8503 C C     . SER E 1 501 ? 42.036  72.916  81.630  1.00 58.05  ? 596 SER E C     1 
ATOM 8504 O O     . SER E 1 501 ? 40.947  73.474  81.450  1.00 57.96  ? 596 SER E O     1 
ATOM 8505 C CB    . SER E 1 501 ? 43.831  73.202  83.363  1.00 57.78  ? 596 SER E CB    1 
ATOM 8506 O OG    . SER E 1 501 ? 44.070  73.064  84.757  1.00 79.13  ? 596 SER E OG    1 
ATOM 8507 N N     . LEU E 1 502 ? 42.819  72.546  80.620  1.00 57.60  ? 597 LEU E N     1 
ATOM 8508 C CA    . LEU E 1 502 ? 42.421  72.758  79.232  1.00 52.71  ? 597 LEU E CA    1 
ATOM 8509 C C     . LEU E 1 502 ? 40.981  72.346  78.972  1.00 50.20  ? 597 LEU E C     1 
ATOM 8510 O O     . LEU E 1 502 ? 40.323  72.913  78.099  1.00 51.64  ? 597 LEU E O     1 
ATOM 8511 C CB    . LEU E 1 502 ? 43.311  71.920  78.321  1.00 50.45  ? 597 LEU E CB    1 
ATOM 8512 C CG    . LEU E 1 502 ? 44.353  72.435  77.364  1.00 46.84  ? 597 LEU E CG    1 
ATOM 8513 C CD1   . LEU E 1 502 ? 43.809  73.673  76.746  1.00 60.80  ? 597 LEU E CD1   1 
ATOM 8514 C CD2   . LEU E 1 502 ? 45.677  72.658  78.058  1.00 54.06  ? 597 LEU E CD2   1 
ATOM 8515 N N     . LEU E 1 503 ? 40.499  71.312  79.655  1.00 40.98  ? 598 LEU E N     1 
ATOM 8516 C CA    . LEU E 1 503 ? 39.212  70.759  79.266  1.00 51.62  ? 598 LEU E CA    1 
ATOM 8517 C C     . LEU E 1 503 ? 38.070  71.531  79.885  1.00 64.91  ? 598 LEU E C     1 
ATOM 8518 O O     . LEU E 1 503 ? 37.079  71.839  79.201  1.00 60.65  ? 598 LEU E O     1 
ATOM 8519 C CB    . LEU E 1 503 ? 39.127  69.278  79.653  1.00 67.93  ? 598 LEU E CB    1 
ATOM 8520 C CG    . LEU E 1 503 ? 39.620  68.178  78.678  1.00 69.03  ? 598 LEU E CG    1 
ATOM 8521 C CD1   . LEU E 1 503 ? 39.030  66.806  79.043  1.00 51.35  ? 598 LEU E CD1   1 
ATOM 8522 C CD2   . LEU E 1 503 ? 39.372  68.497  77.170  1.00 47.18  ? 598 LEU E CD2   1 
ATOM 8523 N N     . PHE E 1 504 ? 38.212  71.844  81.180  1.00 66.19  ? 599 PHE E N     1 
ATOM 8524 C CA    . PHE E 1 504 ? 37.214  72.629  81.893  1.00 64.78  ? 599 PHE E CA    1 
ATOM 8525 C C     . PHE E 1 504 ? 36.923  73.945  81.160  1.00 62.09  ? 599 PHE E C     1 
ATOM 8526 O O     . PHE E 1 504 ? 35.761  74.276  80.881  1.00 53.58  ? 599 PHE E O     1 
ATOM 8527 C CB    . PHE E 1 504 ? 37.708  72.866  83.319  1.00 60.83  ? 599 PHE E CB    1 
ATOM 8528 C CG    . PHE E 1 504 ? 36.798  73.743  84.116  1.00 92.11  ? 599 PHE E CG    1 
ATOM 8529 C CD1   . PHE E 1 504 ? 35.881  73.187  84.989  1.00 101.58 ? 599 PHE E CD1   1 
ATOM 8530 C CD2   . PHE E 1 504 ? 36.826  75.124  83.968  1.00 75.79  ? 599 PHE E CD2   1 
ATOM 8531 C CE1   . PHE E 1 504 ? 35.022  73.989  85.697  1.00 89.71  ? 599 PHE E CE1   1 
ATOM 8532 C CE2   . PHE E 1 504 ? 35.973  75.922  84.667  1.00 64.98  ? 599 PHE E CE2   1 
ATOM 8533 C CZ    . PHE E 1 504 ? 35.076  75.362  85.535  1.00 89.25  ? 599 PHE E CZ    1 
ATOM 8534 N N     . LEU E 1 505 ? 37.990  74.670  80.801  1.00 49.85  ? 600 LEU E N     1 
ATOM 8535 C CA    . LEU E 1 505 ? 37.898  75.944  80.095  1.00 58.63  ? 600 LEU E CA    1 
ATOM 8536 C C     . LEU E 1 505 ? 37.073  75.835  78.819  1.00 63.06  ? 600 LEU E C     1 
ATOM 8537 O O     . LEU E 1 505 ? 36.068  76.532  78.656  1.00 65.70  ? 600 LEU E O     1 
ATOM 8538 C CB    . LEU E 1 505 ? 39.300  76.469  79.745  1.00 59.19  ? 600 LEU E CB    1 
ATOM 8539 C CG    . LEU E 1 505 ? 40.427  76.587  80.788  1.00 78.04  ? 600 LEU E CG    1 
ATOM 8540 C CD1   . LEU E 1 505 ? 41.137  77.949  80.722  1.00 69.53  ? 600 LEU E CD1   1 
ATOM 8541 C CD2   . LEU E 1 505 ? 39.999  76.266  82.244  1.00 67.04  ? 600 LEU E CD2   1 
ATOM 8542 N N     . ASN E 1 506 ? 37.500  74.983  77.886  1.00 64.69  ? 601 ASN E N     1 
ATOM 8543 C CA    . ASN E 1 506 ? 36.754  74.809  76.652  1.00 55.53  ? 601 ASN E CA    1 
ATOM 8544 C C     . ASN E 1 506 ? 35.284  74.548  76.942  1.00 66.25  ? 601 ASN E C     1 
ATOM 8545 O O     . ASN E 1 506 ? 34.418  75.017  76.200  1.00 65.30  ? 601 ASN E O     1 
ATOM 8546 C CB    . ASN E 1 506 ? 37.373  73.669  75.848  1.00 68.31  ? 601 ASN E CB    1 
ATOM 8547 C CG    . ASN E 1 506 ? 36.830  73.582  74.426  1.00 91.94  ? 601 ASN E CG    1 
ATOM 8548 O OD1   . ASN E 1 506 ? 36.536  74.614  73.791  1.00 85.33  ? 601 ASN E OD1   1 
ATOM 8549 N ND2   . ASN E 1 506 ? 36.704  72.340  73.910  1.00 64.96  ? 601 ASN E ND2   1 
ATOM 8550 N N     . SER E 1 507 ? 34.971  73.850  78.042  1.00 56.43  ? 602 SER E N     1 
ATOM 8551 C CA    . SER E 1 507 ? 33.565  73.734  78.404  1.00 57.52  ? 602 SER E CA    1 
ATOM 8552 C C     . SER E 1 507 ? 33.041  75.018  79.025  1.00 66.74  ? 602 SER E C     1 
ATOM 8553 O O     . SER E 1 507 ? 31.875  75.366  78.830  1.00 64.53  ? 602 SER E O     1 
ATOM 8554 C CB    . SER E 1 507 ? 33.341  72.574  79.365  1.00 66.08  ? 602 SER E CB    1 
ATOM 8555 O OG    . SER E 1 507 ? 32.087  71.933  79.080  1.00 70.57  ? 602 SER E OG    1 
ATOM 8556 N N     . PHE E 1 508 ? 33.883  75.738  79.769  1.00 75.26  ? 603 PHE E N     1 
ATOM 8557 C CA    . PHE E 1 508 ? 33.479  77.026  80.341  1.00 69.38  ? 603 PHE E CA    1 
ATOM 8558 C C     . PHE E 1 508 ? 33.126  78.048  79.266  1.00 65.27  ? 603 PHE E C     1 
ATOM 8559 O O     . PHE E 1 508 ? 32.028  78.611  79.262  1.00 66.77  ? 603 PHE E O     1 
ATOM 8560 C CB    . PHE E 1 508 ? 34.595  77.565  81.218  1.00 70.14  ? 603 PHE E CB    1 
ATOM 8561 C CG    . PHE E 1 508 ? 34.344  78.949  81.737  1.00 93.56  ? 603 PHE E CG    1 
ATOM 8562 C CD1   . PHE E 1 508 ? 33.631  79.147  82.912  1.00 96.93  ? 603 PHE E CD1   1 
ATOM 8563 C CD2   . PHE E 1 508 ? 34.854  80.057  81.075  1.00 100.49 ? 603 PHE E CD2   1 
ATOM 8564 C CE1   . PHE E 1 508 ? 33.426  80.417  83.398  1.00 85.50  ? 603 PHE E CE1   1 
ATOM 8565 C CE2   . PHE E 1 508 ? 34.639  81.338  81.554  1.00 94.65  ? 603 PHE E CE2   1 
ATOM 8566 C CZ    . PHE E 1 508 ? 33.927  81.512  82.714  1.00 92.32  ? 603 PHE E CZ    1 
ATOM 8567 N N     . TYR E 1 509 ? 34.061  78.314  78.355  1.00 60.85  ? 604 TYR E N     1 
ATOM 8568 C CA    . TYR E 1 509 ? 33.783  79.227  77.251  1.00 59.91  ? 604 TYR E CA    1 
ATOM 8569 C C     . TYR E 1 509 ? 32.553  78.820  76.457  1.00 61.51  ? 604 TYR E C     1 
ATOM 8570 O O     . TYR E 1 509 ? 31.905  79.667  75.856  1.00 72.47  ? 604 TYR E O     1 
ATOM 8571 C CB    . TYR E 1 509 ? 35.001  79.316  76.345  1.00 57.52  ? 604 TYR E CB    1 
ATOM 8572 C CG    . TYR E 1 509 ? 36.220  79.814  77.096  1.00 79.72  ? 604 TYR E CG    1 
ATOM 8573 C CD1   . TYR E 1 509 ? 37.494  79.403  76.760  1.00 81.63  ? 604 TYR E CD1   1 
ATOM 8574 C CD2   . TYR E 1 509 ? 36.091  80.703  78.150  1.00 87.52  ? 604 TYR E CD2   1 
ATOM 8575 C CE1   . TYR E 1 509 ? 38.605  79.858  77.464  1.00 74.32  ? 604 TYR E CE1   1 
ATOM 8576 C CE2   . TYR E 1 509 ? 37.193  81.157  78.854  1.00 92.77  ? 604 TYR E CE2   1 
ATOM 8577 C CZ    . TYR E 1 509 ? 38.448  80.729  78.506  1.00 86.97  ? 604 TYR E CZ    1 
ATOM 8578 O OH    . TYR E 1 509 ? 39.545  81.191  79.207  1.00 113.30 ? 604 TYR E OH    1 
ATOM 8579 N N     . LYS E 1 510 ? 32.217  77.540  76.433  1.00 80.60  ? 605 LYS E N     1 
ATOM 8580 C CA    . LYS E 1 510 ? 31.065  77.087  75.662  1.00 82.80  ? 605 LYS E CA    1 
ATOM 8581 C C     . LYS E 1 510 ? 29.755  77.328  76.415  1.00 71.15  ? 605 LYS E C     1 
ATOM 8582 O O     . LYS E 1 510 ? 28.761  77.745  75.819  1.00 71.34  ? 605 LYS E O     1 
ATOM 8583 C CB    . LYS E 1 510 ? 31.248  75.598  75.292  1.00 86.83  ? 605 LYS E CB    1 
ATOM 8584 C CG    . LYS E 1 510 ? 31.580  75.321  73.791  1.00 98.47  ? 605 LYS E CG    1 
ATOM 8585 C CD    . LYS E 1 510 ? 32.548  74.115  73.534  1.00 96.66  ? 605 LYS E CD    1 
ATOM 8586 C CE    . LYS E 1 510 ? 31.855  72.745  73.396  1.00 69.54  ? 605 LYS E CE    1 
ATOM 8587 N NZ    . LYS E 1 510 ? 32.902  71.710  73.376  1.00 52.58  ? 605 LYS E NZ    1 
ATOM 8588 N N     . ASN E 1 511 ? 29.718  77.062  77.716  1.00 61.18  ? 606 ASN E N     1 
ATOM 8589 C CA    . ASN E 1 511 ? 28.484  77.280  78.455  1.00 80.09  ? 606 ASN E CA    1 
ATOM 8590 C C     . ASN E 1 511 ? 28.231  78.766  78.662  1.00 102.89 ? 606 ASN E C     1 
ATOM 8591 O O     . ASN E 1 511 ? 27.111  79.259  78.463  1.00 101.74 ? 606 ASN E O     1 
ATOM 8592 C CB    . ASN E 1 511 ? 28.563  76.590  79.809  1.00 76.88  ? 606 ASN E CB    1 
ATOM 8593 C CG    . ASN E 1 511 ? 28.495  75.100  79.703  1.00 96.84  ? 606 ASN E CG    1 
ATOM 8594 O OD1   . ASN E 1 511 ? 27.605  74.452  80.265  1.00 101.38 ? 606 ASN E OD1   1 
ATOM 8595 N ND2   . ASN E 1 511 ? 29.439  74.532  78.979  1.00 113.19 ? 606 ASN E ND2   1 
ATOM 8596 N N     . PHE E 1 512 ? 29.268  79.471  79.111  1.00 91.42  ? 607 PHE E N     1 
ATOM 8597 C CA    . PHE E 1 512 ? 29.186  80.763  79.764  1.00 74.06  ? 607 PHE E CA    1 
ATOM 8598 C C     . PHE E 1 512 ? 29.586  81.966  78.898  1.00 87.69  ? 607 PHE E C     1 
ATOM 8599 O O     . PHE E 1 512 ? 29.689  83.072  79.436  1.00 101.89 ? 607 PHE E O     1 
ATOM 8600 C CB    . PHE E 1 512 ? 30.038  80.718  81.032  1.00 85.26  ? 607 PHE E CB    1 
ATOM 8601 C CG    . PHE E 1 512 ? 29.531  79.758  82.077  1.00 85.47  ? 607 PHE E CG    1 
ATOM 8602 C CD1   . PHE E 1 512 ? 28.332  79.093  81.917  1.00 83.13  ? 607 PHE E CD1   1 
ATOM 8603 C CD2   . PHE E 1 512 ? 30.245  79.549  83.245  1.00 86.32  ? 607 PHE E CD2   1 
ATOM 8604 C CE1   . PHE E 1 512 ? 27.875  78.224  82.896  1.00 93.90  ? 607 PHE E CE1   1 
ATOM 8605 C CE2   . PHE E 1 512 ? 29.781  78.688  84.227  1.00 78.97  ? 607 PHE E CE2   1 
ATOM 8606 C CZ    . PHE E 1 512 ? 28.601  78.026  84.054  1.00 88.67  ? 607 PHE E CZ    1 
ATOM 8607 N N     . CYS E 1 513 ? 29.881  81.808  77.609  1.00 74.73  ? 608 CYS E N     1 
ATOM 8608 C CA    . CYS E 1 513 ? 30.418  82.944  76.860  1.00 84.96  ? 608 CYS E CA    1 
ATOM 8609 C C     . CYS E 1 513 ? 29.754  83.126  75.499  1.00 96.46  ? 608 CYS E C     1 
ATOM 8610 O O     . CYS E 1 513 ? 29.837  82.242  74.641  1.00 82.61  ? 608 CYS E O     1 
ATOM 8611 C CB    . CYS E 1 513 ? 31.936  82.816  76.691  1.00 86.71  ? 608 CYS E CB    1 
ATOM 8612 S SG    . CYS E 1 513 ? 32.939  83.296  78.154  1.00 105.04 ? 608 CYS E SG    1 
ATOM 8613 N N     . LYS E 1 514 ? 29.106  84.285  75.307  1.00 120.68 ? 609 LYS E N     1 
ATOM 8614 C CA    . LYS E 1 514 ? 28.792  84.812  73.968  1.00 127.55 ? 609 LYS E CA    1 
ATOM 8615 C C     . LYS E 1 514 ? 29.599  86.080  73.716  1.00 128.82 ? 609 LYS E C     1 
ATOM 8616 O O     . LYS E 1 514 ? 30.721  86.216  74.212  1.00 120.97 ? 609 LYS E O     1 
ATOM 8617 C CB    . LYS E 1 514 ? 27.305  85.117  73.793  1.00 109.39 ? 609 LYS E CB    1 
ATOM 8618 C CG    . LYS E 1 514 ? 26.412  83.933  74.024  1.00 99.71  ? 609 LYS E CG    1 
ATOM 8619 C CD    . LYS E 1 514 ? 25.719  84.094  75.359  1.00 118.71 ? 609 LYS E CD    1 
ATOM 8620 C CE    . LYS E 1 514 ? 25.793  82.836  76.199  1.00 99.28  ? 609 LYS E CE    1 
ATOM 8621 N NZ    . LYS E 1 514 ? 27.174  82.553  76.656  1.00 82.45  ? 609 LYS E NZ    1 
ATOM 8622 O "O5'" . DG  F 2 1   ? 26.780  61.243  67.271  1.00 25.86  ? 2   DG  F "O5'" 1 
ATOM 8623 C "C5'" . DG  F 2 1   ? 27.340  61.820  68.513  1.00 38.29  ? 2   DG  F "C5'" 1 
ATOM 8624 C "C4'" . DG  F 2 1   ? 28.889  62.172  68.433  1.00 74.88  ? 2   DG  F "C4'" 1 
ATOM 8625 O "O4'" . DG  F 2 1   ? 29.694  61.126  67.802  1.00 83.55  ? 2   DG  F "O4'" 1 
ATOM 8626 C "C3'" . DG  F 2 1   ? 29.304  63.479  67.702  1.00 99.90  ? 2   DG  F "C3'" 1 
ATOM 8627 O "O3'" . DG  F 2 1   ? 30.031  64.376  68.590  1.00 103.32 ? 2   DG  F "O3'" 1 
ATOM 8628 C "C2'" . DG  F 2 1   ? 30.213  63.004  66.549  1.00 71.77  ? 2   DG  F "C2'" 1 
ATOM 8629 C "C1'" . DG  F 2 1   ? 30.791  61.725  67.103  1.00 70.09  ? 2   DG  F "C1'" 1 
ATOM 8630 N N9    . DG  F 2 1   ? 31.194  60.819  66.034  1.00 58.22  ? 2   DG  F N9    1 
ATOM 8631 C C8    . DG  F 2 1   ? 30.343  60.267  65.139  1.00 63.35  ? 2   DG  F C8    1 
ATOM 8632 N N7    . DG  F 2 1   ? 30.914  59.504  64.278  1.00 53.59  ? 2   DG  F N7    1 
ATOM 8633 C C5    . DG  F 2 1   ? 32.242  59.545  64.600  1.00 42.40  ? 2   DG  F C5    1 
ATOM 8634 C C6    . DG  F 2 1   ? 33.327  58.867  63.984  1.00 46.04  ? 2   DG  F C6    1 
ATOM 8635 O O6    . DG  F 2 1   ? 33.275  58.101  63.021  1.00 48.83  ? 2   DG  F O6    1 
ATOM 8636 N N1    . DG  F 2 1   ? 34.560  59.137  64.596  1.00 39.52  ? 2   DG  F N1    1 
ATOM 8637 C C2    . DG  F 2 1   ? 34.715  59.988  65.676  1.00 54.41  ? 2   DG  F C2    1 
ATOM 8638 N N2    . DG  F 2 1   ? 35.993  60.135  66.129  1.00 38.01  ? 2   DG  F N2    1 
ATOM 8639 N N3    . DG  F 2 1   ? 33.668  60.642  66.284  1.00 56.38  ? 2   DG  F N3    1 
ATOM 8640 C C4    . DG  F 2 1   ? 32.461  60.360  65.680  1.00 45.46  ? 2   DG  F C4    1 
ATOM 8641 P P     . DA  F 2 2   ? 30.407  65.875  68.108  1.00 91.18  ? 3   DA  F P     1 
ATOM 8642 O OP1   . DA  F 2 2   ? 29.605  66.833  68.909  1.00 97.19  ? 3   DA  F OP1   1 
ATOM 8643 O OP2   . DA  F 2 2   ? 30.466  65.894  66.626  1.00 51.49  ? 3   DA  F OP2   1 
ATOM 8644 O "O5'" . DA  F 2 2   ? 31.908  66.060  68.578  1.00 74.82  ? 3   DA  F "O5'" 1 
ATOM 8645 C "C5'" . DA  F 2 2   ? 32.821  64.986  68.368  1.00 96.03  ? 3   DA  F "C5'" 1 
ATOM 8646 C "C4'" . DA  F 2 2   ? 34.155  65.500  67.850  1.00 81.49  ? 3   DA  F "C4'" 1 
ATOM 8647 O "O4'" . DA  F 2 2   ? 34.747  64.549  66.897  1.00 76.23  ? 3   DA  F "O4'" 1 
ATOM 8648 C "C3'" . DA  F 2 2   ? 34.100  66.820  67.113  1.00 57.77  ? 3   DA  F "C3'" 1 
ATOM 8649 O "O3'" . DA  F 2 2   ? 35.406  67.439  67.254  1.00 84.11  ? 3   DA  F "O3'" 1 
ATOM 8650 C "C2'" . DA  F 2 2   ? 33.819  66.354  65.680  1.00 48.67  ? 3   DA  F "C2'" 1 
ATOM 8651 C "C1'" . DA  F 2 2   ? 34.687  65.082  65.584  1.00 57.42  ? 3   DA  F "C1'" 1 
ATOM 8652 N N9    . DA  F 2 2   ? 34.172  64.060  64.613  1.00 54.46  ? 3   DA  F N9    1 
ATOM 8653 C C8    . DA  F 2 2   ? 32.867  63.872  64.223  1.00 58.85  ? 3   DA  F C8    1 
ATOM 8654 N N7    . DA  F 2 2   ? 32.710  62.928  63.327  1.00 53.82  ? 3   DA  F N7    1 
ATOM 8655 C C5    . DA  F 2 2   ? 33.993  62.470  63.086  1.00 37.37  ? 3   DA  F C5    1 
ATOM 8656 C C6    . DA  F 2 2   ? 34.495  61.460  62.224  1.00 36.76  ? 3   DA  F C6    1 
ATOM 8657 N N6    . DA  F 2 2   ? 33.708  60.707  61.433  1.00 40.55  ? 3   DA  F N6    1 
ATOM 8658 N N1    . DA  F 2 2   ? 35.827  61.229  62.226  1.00 29.15  ? 3   DA  F N1    1 
ATOM 8659 C C2    . DA  F 2 2   ? 36.596  61.960  63.046  1.00 38.10  ? 3   DA  F C2    1 
ATOM 8660 N N3    . DA  F 2 2   ? 36.239  62.942  63.892  1.00 40.64  ? 3   DA  F N3    1 
ATOM 8661 C C4    . DA  F 2 2   ? 34.909  63.143  63.867  1.00 36.15  ? 3   DA  F C4    1 
ATOM 8662 P P     . DG  F 2 3   ? 35.709  68.999  66.980  1.00 76.97  ? 4   DG  F P     1 
ATOM 8663 O OP1   . DG  F 2 3   ? 35.636  69.807  68.230  1.00 47.92  ? 4   DG  F OP1   1 
ATOM 8664 O OP2   . DG  F 2 3   ? 35.165  69.310  65.623  1.00 53.27  ? 4   DG  F OP2   1 
ATOM 8665 O "O5'" . DG  F 2 3   ? 37.225  68.979  66.605  1.00 47.63  ? 4   DG  F "O5'" 1 
ATOM 8666 C "C5'" . DG  F 2 3   ? 37.499  68.789  65.296  1.00 22.57  ? 4   DG  F "C5'" 1 
ATOM 8667 C "C4'" . DG  F 2 3   ? 38.913  68.460  65.152  1.00 36.52  ? 4   DG  F "C4'" 1 
ATOM 8668 O "O4'" . DG  F 2 3   ? 38.958  67.204  64.522  1.00 58.13  ? 4   DG  F "O4'" 1 
ATOM 8669 C "C3'" . DG  F 2 3   ? 39.656  69.351  64.203  1.00 54.58  ? 4   DG  F "C3'" 1 
ATOM 8670 O "O3'" . DG  F 2 3   ? 41.031  69.119  64.372  1.00 53.29  ? 4   DG  F "O3'" 1 
ATOM 8671 C "C2'" . DG  F 2 3   ? 39.126  68.855  62.844  1.00 34.42  ? 4   DG  F "C2'" 1 
ATOM 8672 C "C1'" . DG  F 2 3   ? 38.891  67.380  63.134  1.00 46.86  ? 4   DG  F "C1'" 1 
ATOM 8673 N N9    . DG  F 2 3   ? 37.629  66.825  62.678  1.00 42.99  ? 4   DG  F N9    1 
ATOM 8674 C C8    . DG  F 2 3   ? 36.373  67.102  63.133  1.00 32.36  ? 4   DG  F C8    1 
ATOM 8675 N N7    . DG  F 2 3   ? 35.455  66.408  62.526  1.00 37.72  ? 4   DG  F N7    1 
ATOM 8676 C C5    . DG  F 2 3   ? 36.147  65.621  61.622  1.00 24.79  ? 4   DG  F C5    1 
ATOM 8677 C C6    . DG  F 2 3   ? 35.677  64.641  60.719  1.00 32.29  ? 4   DG  F C6    1 
ATOM 8678 O O6    . DG  F 2 3   ? 34.497  64.266  60.528  1.00 41.97  ? 4   DG  F O6    1 
ATOM 8679 N N1    . DG  F 2 3   ? 36.723  64.045  60.011  1.00 18.47  ? 4   DG  F N1    1 
ATOM 8680 C C2    . DG  F 2 3   ? 38.040  64.360  60.161  1.00 24.19  ? 4   DG  F C2    1 
ATOM 8681 N N2    . DG  F 2 3   ? 38.878  63.694  59.394  1.00 31.12  ? 4   DG  F N2    1 
ATOM 8682 N N3    . DG  F 2 3   ? 38.509  65.227  61.042  1.00 30.19  ? 4   DG  F N3    1 
ATOM 8683 C C4    . DG  F 2 3   ? 37.488  65.831  61.730  1.00 34.14  ? 4   DG  F C4    1 
ATOM 8684 P P     . DA  F 2 4   ? 42.095  70.102  63.718  1.00 51.94  ? 5   DA  F P     1 
ATOM 8685 O OP1   . DA  F 2 4   ? 43.479  69.684  63.930  1.00 58.55  ? 5   DA  F OP1   1 
ATOM 8686 O OP2   . DA  F 2 4   ? 41.684  71.410  64.216  1.00 58.50  ? 5   DA  F OP2   1 
ATOM 8687 O "O5'" . DA  F 2 4   ? 41.904  69.843  62.189  1.00 42.97  ? 5   DA  F "O5'" 1 
ATOM 8688 C "C5'" . DA  F 2 4   ? 42.544  68.760  61.560  1.00 32.49  ? 5   DA  F "C5'" 1 
ATOM 8689 C "C4'" . DA  F 2 4   ? 41.902  68.483  60.190  1.00 52.55  ? 5   DA  F "C4'" 1 
ATOM 8690 O "O4'" . DA  F 2 4   ? 40.470  68.324  60.297  1.00 42.94  ? 5   DA  F "O4'" 1 
ATOM 8691 C "C3'" . DA  F 2 4   ? 42.035  69.575  59.104  1.00 44.57  ? 5   DA  F "C3'" 1 
ATOM 8692 O "O3'" . DA  F 2 4   ? 43.142  69.328  58.321  1.00 42.28  ? 5   DA  F "O3'" 1 
ATOM 8693 C "C2'" . DA  F 2 4   ? 40.694  69.458  58.284  1.00 41.89  ? 5   DA  F "C2'" 1 
ATOM 8694 C "C1'" . DA  F 2 4   ? 40.033  68.275  58.958  1.00 35.65  ? 5   DA  F "C1'" 1 
ATOM 8695 N N9    . DA  F 2 4   ? 38.581  68.141  58.918  1.00 29.67  ? 5   DA  F N9    1 
ATOM 8696 C C8    . DA  F 2 4   ? 37.674  68.671  59.780  1.00 32.86  ? 5   DA  F C8    1 
ATOM 8697 N N7    . DA  F 2 4   ? 36.434  68.248  59.590  1.00 31.45  ? 5   DA  F N7    1 
ATOM 8698 C C5    . DA  F 2 4   ? 36.548  67.333  58.562  1.00 30.24  ? 5   DA  F C5    1 
ATOM 8699 C C6    . DA  F 2 4   ? 35.583  66.514  57.875  1.00 33.71  ? 5   DA  F C6    1 
ATOM 8700 N N6    . DA  F 2 4   ? 34.259  66.507  58.157  1.00 26.42  ? 5   DA  F N6    1 
ATOM 8701 N N1    . DA  F 2 4   ? 36.043  65.697  56.891  1.00 33.55  ? 5   DA  F N1    1 
ATOM 8702 C C2    . DA  F 2 4   ? 37.388  65.675  56.633  1.00 33.77  ? 5   DA  F C2    1 
ATOM 8703 N N3    . DA  F 2 4   ? 38.383  66.378  57.214  1.00 30.11  ? 5   DA  F N3    1 
ATOM 8704 C C4    . DA  F 2 4   ? 37.878  67.229  58.154  1.00 30.68  ? 5   DA  F C4    1 
ATOM 8705 P P     . DA  F 2 5   ? 43.500  70.328  57.132  1.00 66.88  ? 6   DA  F P     1 
ATOM 8706 O OP1   . DA  F 2 5   ? 44.985  70.429  56.956  1.00 33.92  ? 6   DA  F OP1   1 
ATOM 8707 O OP2   . DA  F 2 5   ? 42.741  71.512  57.602  1.00 65.19  ? 6   DA  F OP2   1 
ATOM 8708 O "O5'" . DA  F 2 5   ? 42.821  69.657  55.812  1.00 27.18  ? 6   DA  F "O5'" 1 
ATOM 8709 C "C5'" . DA  F 2 5   ? 43.536  68.636  55.137  1.00 34.63  ? 6   DA  F "C5'" 1 
ATOM 8710 C "C4'" . DA  F 2 5   ? 42.735  68.071  54.000  1.00 45.89  ? 6   DA  F "C4'" 1 
ATOM 8711 O "O4'" . DA  F 2 5   ? 41.359  67.885  54.407  1.00 50.45  ? 6   DA  F "O4'" 1 
ATOM 8712 C "C3'" . DA  F 2 5   ? 42.677  68.985  52.820  1.00 60.85  ? 6   DA  F "C3'" 1 
ATOM 8713 O "O3'" . DA  F 2 5   ? 42.926  68.286  51.706  1.00 51.27  ? 6   DA  F "O3'" 1 
ATOM 8714 C "C2'" . DA  F 2 5   ? 41.255  69.559  52.829  1.00 56.14  ? 6   DA  F "C2'" 1 
ATOM 8715 C "C1'" . DA  F 2 5   ? 40.473  68.433  53.459  1.00 40.17  ? 6   DA  F "C1'" 1 
ATOM 8716 N N9    . DA  F 2 5   ? 39.279  68.858  54.203  1.00 30.13  ? 6   DA  F N9    1 
ATOM 8717 C C8    . DA  F 2 5   ? 39.231  69.762  55.240  1.00 35.29  ? 6   DA  F C8    1 
ATOM 8718 N N7    . DA  F 2 5   ? 38.038  69.899  55.787  1.00 28.83  ? 6   DA  F N7    1 
ATOM 8719 C C5    . DA  F 2 5   ? 37.254  69.014  55.076  1.00 31.33  ? 6   DA  F C5    1 
ATOM 8720 C C6    . DA  F 2 5   ? 35.860  68.666  55.178  1.00 36.37  ? 6   DA  F C6    1 
ATOM 8721 N N6    . DA  F 2 5   ? 35.030  69.236  56.062  1.00 26.34  ? 6   DA  F N6    1 
ATOM 8722 N N1    . DA  F 2 5   ? 35.369  67.713  54.312  1.00 27.84  ? 6   DA  F N1    1 
ATOM 8723 C C2    . DA  F 2 5   ? 36.241  67.149  53.425  1.00 32.38  ? 6   DA  F C2    1 
ATOM 8724 N N3    . DA  F 2 5   ? 37.575  67.404  53.237  1.00 27.11  ? 6   DA  F N3    1 
ATOM 8725 C C4    . DA  F 2 5   ? 38.009  68.364  54.086  1.00 25.33  ? 6   DA  F C4    1 
ATOM 8726 P P     . DC  F 2 6   ? 43.560  69.090  50.502  1.00 70.43  ? 7   DC  F P     1 
ATOM 8727 O OP1   . DC  F 2 6   ? 44.504  68.171  49.830  1.00 25.78  ? 7   DC  F OP1   1 
ATOM 8728 O OP2   . DC  F 2 6   ? 43.842  70.491  51.027  1.00 49.73  ? 7   DC  F OP2   1 
ATOM 8729 O "O5'" . DC  F 2 6   ? 42.357  69.191  49.507  1.00 58.92  ? 7   DC  F "O5'" 1 
ATOM 8730 C "C5'" . DC  F 2 6   ? 41.807  68.060  49.093  1.00 40.97  ? 7   DC  F "C5'" 1 
ATOM 8731 C "C4'" . DC  F 2 6   ? 40.318  68.185  49.115  1.00 47.09  ? 7   DC  F "C4'" 1 
ATOM 8732 O "O4'" . DC  F 2 6   ? 39.839  69.076  50.126  1.00 52.38  ? 7   DC  F "O4'" 1 
ATOM 8733 C "C3'" . DC  F 2 6   ? 39.708  68.764  47.881  1.00 43.96  ? 7   DC  F "C3'" 1 
ATOM 8734 O "O3'" . DC  F 2 6   ? 39.625  67.759  46.951  1.00 39.15  ? 7   DC  F "O3'" 1 
ATOM 8735 C "C2'" . DC  F 2 6   ? 38.316  69.217  48.390  1.00 40.86  ? 7   DC  F "C2'" 1 
ATOM 8736 C "C1'" . DC  F 2 6   ? 38.458  69.041  49.884  1.00 40.47  ? 7   DC  F "C1'" 1 
ATOM 8737 N N1    . DC  F 2 6   ? 37.588  69.897  50.885  1.00 37.10  ? 7   DC  F N1    1 
ATOM 8738 C C2    . DC  F 2 6   ? 36.210  69.585  51.005  1.00 45.27  ? 7   DC  F C2    1 
ATOM 8739 O O2    . DC  F 2 6   ? 35.732  68.735  50.240  1.00 46.50  ? 7   DC  F O2    1 
ATOM 8740 N N3    . DC  F 2 6   ? 35.434  70.230  51.934  1.00 31.09  ? 7   DC  F N3    1 
ATOM 8741 C C4    . DC  F 2 6   ? 36.014  71.117  52.743  1.00 41.79  ? 7   DC  F C4    1 
ATOM 8742 N N4    . DC  F 2 6   ? 35.235  71.724  53.643  1.00 40.52  ? 7   DC  F N4    1 
ATOM 8743 C C5    . DC  F 2 6   ? 37.421  71.423  52.664  1.00 27.38  ? 7   DC  F C5    1 
ATOM 8744 C C6    . DC  F 2 6   ? 38.155  70.791  51.735  1.00 30.22  ? 7   DC  F C6    1 
ATOM 8745 P P     . DA  F 2 7   ? 39.614  68.073  45.389  1.00 67.75  ? 8   DA  F P     1 
ATOM 8746 O OP1   . DA  F 2 7   ? 40.804  67.442  44.792  1.00 66.10  ? 8   DA  F OP1   1 
ATOM 8747 O OP2   . DA  F 2 7   ? 39.344  69.522  45.239  1.00 90.05  ? 8   DA  F OP2   1 
ATOM 8748 O "O5'" . DA  F 2 7   ? 38.300  67.339  44.881  1.00 65.75  ? 8   DA  F "O5'" 1 
ATOM 8749 C "C5'" . DA  F 2 7   ? 37.129  67.496  45.635  1.00 59.41  ? 8   DA  F "C5'" 1 
ATOM 8750 C "C4'" . DA  F 2 7   ? 35.914  66.833  45.023  1.00 61.54  ? 8   DA  F "C4'" 1 
ATOM 8751 O "O4'" . DA  F 2 7   ? 34.758  67.324  45.740  1.00 63.21  ? 8   DA  F "O4'" 1 
ATOM 8752 C "C3'" . DA  F 2 7   ? 35.608  67.269  43.618  1.00 81.03  ? 8   DA  F "C3'" 1 
ATOM 8753 O "O3'" . DA  F 2 7   ? 34.500  66.426  43.080  1.00 109.11 ? 8   DA  F "O3'" 1 
ATOM 8754 C "C2'" . DA  F 2 7   ? 35.190  68.729  43.891  1.00 71.44  ? 8   DA  F "C2'" 1 
ATOM 8755 C "C1'" . DA  F 2 7   ? 34.445  68.618  45.247  1.00 59.76  ? 8   DA  F "C1'" 1 
ATOM 8756 N N9    . DA  F 2 7   ? 34.831  69.626  46.267  1.00 48.70  ? 8   DA  F N9    1 
ATOM 8757 C C8    . DA  F 2 7   ? 36.053  70.232  46.413  1.00 52.99  ? 8   DA  F C8    1 
ATOM 8758 N N7    . DA  F 2 7   ? 36.120  71.083  47.426  1.00 53.21  ? 8   DA  F N7    1 
ATOM 8759 C C5    . DA  F 2 7   ? 34.853  71.045  47.990  1.00 43.44  ? 8   DA  F C5    1 
ATOM 8760 C C6    . DA  F 2 7   ? 34.272  71.734  49.118  1.00 41.90  ? 8   DA  F C6    1 
ATOM 8761 N N6    . DA  F 2 7   ? 34.954  72.599  49.898  1.00 43.01  ? 8   DA  F N6    1 
ATOM 8762 N N1    . DA  F 2 7   ? 32.962  71.506  49.390  1.00 29.89  ? 8   DA  F N1    1 
ATOM 8763 C C2    . DA  F 2 7   ? 32.294  70.606  48.618  1.00 39.89  ? 8   DA  F C2    1 
ATOM 8764 N N3    . DA  F 2 7   ? 32.738  69.877  47.556  1.00 47.42  ? 8   DA  F N3    1 
ATOM 8765 C C4    . DA  F 2 7   ? 34.035  70.156  47.284  1.00 42.45  ? 8   DA  F C4    1 
ATOM 8766 P P     . DA  F 2 8   ? 34.044  66.457  41.523  1.00 88.92  ? 9   DA  F P     1 
ATOM 8767 O OP1   . DA  F 2 8   ? 33.409  65.153  41.151  1.00 86.46  ? 9   DA  F OP1   1 
ATOM 8768 O OP2   . DA  F 2 8   ? 35.251  66.890  40.764  1.00 73.07  ? 9   DA  F OP2   1 
ATOM 8769 O "O5'" . DA  F 2 8   ? 32.832  67.518  41.537  1.00 63.52  ? 9   DA  F "O5'" 1 
ATOM 8770 C "C5'" . DA  F 2 8   ? 31.693  67.267  42.386  1.00 82.86  ? 9   DA  F "C5'" 1 
ATOM 8771 C "C4'" . DA  F 2 8   ? 30.961  68.548  42.805  1.00 81.49  ? 9   DA  F "C4'" 1 
ATOM 8772 O "O4'" . DA  F 2 8   ? 31.726  69.321  43.753  1.00 78.85  ? 9   DA  F "O4'" 1 
ATOM 8773 C "C3'" . DA  F 2 8   ? 30.634  69.497  41.683  1.00 89.68  ? 9   DA  F "C3'" 1 
ATOM 8774 O "O3'" . DA  F 2 8   ? 29.275  69.397  41.422  1.00 91.51  ? 9   DA  F "O3'" 1 
ATOM 8775 C "C2'" . DA  F 2 8   ? 31.035  70.906  42.212  1.00 80.04  ? 9   DA  F "C2'" 1 
ATOM 8776 C "C1'" . DA  F 2 8   ? 31.290  70.653  43.695  1.00 63.18  ? 9   DA  F "C1'" 1 
ATOM 8777 N N9    . DA  F 2 8   ? 32.356  71.464  44.266  1.00 43.78  ? 9   DA  F N9    1 
ATOM 8778 C C8    . DA  F 2 8   ? 33.661  71.453  43.890  1.00 48.70  ? 9   DA  F C8    1 
ATOM 8779 N N7    . DA  F 2 8   ? 34.436  72.240  44.604  1.00 49.86  ? 9   DA  F N7    1 
ATOM 8780 C C5    . DA  F 2 8   ? 33.570  72.817  45.512  1.00 36.94  ? 9   DA  F C5    1 
ATOM 8781 C C6    . DA  F 2 8   ? 33.781  73.772  46.524  1.00 35.61  ? 9   DA  F C6    1 
ATOM 8782 N N6    . DA  F 2 8   ? 34.990  74.291  46.789  1.00 42.06  ? 9   DA  F N6    1 
ATOM 8783 N N1    . DA  F 2 8   ? 32.712  74.153  47.261  1.00 33.97  ? 9   DA  F N1    1 
ATOM 8784 C C2    . DA  F 2 8   ? 31.498  73.598  46.981  1.00 38.41  ? 9   DA  F C2    1 
ATOM 8785 N N3    . DA  F 2 8   ? 31.175  72.703  46.022  1.00 33.78  ? 9   DA  F N3    1 
ATOM 8786 C C4    . DA  F 2 8   ? 32.274  72.349  45.322  1.00 34.56  ? 9   DA  F C4    1 
ATOM 8787 P P     . DC  F 2 9   ? 28.708  70.081  40.105  1.00 91.86  ? 10  DC  F P     1 
ATOM 8788 O OP1   . DC  F 2 9   ? 27.338  69.542  39.897  1.00 62.84  ? 10  DC  F OP1   1 
ATOM 8789 O OP2   . DC  F 2 9   ? 29.795  69.988  39.085  1.00 72.55  ? 10  DC  F OP2   1 
ATOM 8790 O "O5'" . DC  F 2 9   ? 28.450  71.561  40.595  1.00 62.76  ? 10  DC  F "O5'" 1 
ATOM 8791 C "C5'" . DC  F 2 9   ? 27.341  71.757  41.385  1.00 55.60  ? 10  DC  F "C5'" 1 
ATOM 8792 C "C4'" . DC  F 2 9   ? 27.498  72.992  42.183  1.00 59.75  ? 10  DC  F "C4'" 1 
ATOM 8793 O "O4'" . DC  F 2 9   ? 28.861  73.180  42.511  1.00 59.23  ? 10  DC  F "O4'" 1 
ATOM 8794 C "C3'" . DC  F 2 9   ? 27.159  74.261  41.444  1.00 91.02  ? 10  DC  F "C3'" 1 
ATOM 8795 O "O3'" . DC  F 2 9   ? 25.826  74.576  41.676  1.00 111.36 ? 10  DC  F "O3'" 1 
ATOM 8796 C "C2'" . DC  F 2 9   ? 28.108  75.303  42.072  1.00 78.00  ? 10  DC  F "C2'" 1 
ATOM 8797 C "C1'" . DC  F 2 9   ? 28.898  74.452  43.066  1.00 56.43  ? 10  DC  F "C1'" 1 
ATOM 8798 N N1    . DC  F 2 9   ? 30.315  74.854  43.248  1.00 41.16  ? 10  DC  F N1    1 
ATOM 8799 C C2    . DC  F 2 9   ? 30.646  75.833  44.257  1.00 42.01  ? 10  DC  F C2    1 
ATOM 8800 O O2    . DC  F 2 9   ? 29.705  76.341  44.976  1.00 38.96  ? 10  DC  F O2    1 
ATOM 8801 N N3    . DC  F 2 9   ? 31.968  76.196  44.415  1.00 17.70  ? 10  DC  F N3    1 
ATOM 8802 C C4    . DC  F 2 9   ? 32.885  75.608  43.629  1.00 34.86  ? 10  DC  F C4    1 
ATOM 8803 N N4    . DC  F 2 9   ? 34.160  75.966  43.791  1.00 42.49  ? 10  DC  F N4    1 
ATOM 8804 C C5    . DC  F 2 9   ? 32.542  74.629  42.609  1.00 30.17  ? 10  DC  F C5    1 
ATOM 8805 C C6    . DC  F 2 9   ? 31.269  74.285  42.465  1.00 22.12  ? 10  DC  F C6    1 
ATOM 8806 P P     . DA  F 2 10  ? 25.106  75.579  40.673  1.00 117.21 ? 11  DA  F P     1 
ATOM 8807 O OP1   . DA  F 2 10  ? 23.641  75.305  40.712  1.00 112.85 ? 11  DA  F OP1   1 
ATOM 8808 O OP2   . DA  F 2 10  ? 25.945  75.543  39.448  1.00 98.95  ? 11  DA  F OP2   1 
ATOM 8809 O "O5'" . DA  F 2 10  ? 25.337  76.968  41.357  1.00 80.46  ? 11  DA  F "O5'" 1 
ATOM 8810 C "C5'" . DA  F 2 10  ? 24.935  77.115  42.644  1.00 76.69  ? 11  DA  F "C5'" 1 
ATOM 8811 C "C4'" . DA  F 2 10  ? 25.754  78.182  43.240  1.00 79.65  ? 11  DA  F "C4'" 1 
ATOM 8812 O "O4'" . DA  F 2 10  ? 27.145  77.879  43.031  1.00 70.70  ? 11  DA  F "O4'" 1 
ATOM 8813 C "C3'" . DA  F 2 10  ? 25.570  79.557  42.587  1.00 93.84  ? 11  DA  F "C3'" 1 
ATOM 8814 O "O3'" . DA  F 2 10  ? 25.549  80.490  43.626  1.00 117.07 ? 11  DA  F "O3'" 1 
ATOM 8815 C "C2'" . DA  F 2 10  ? 26.858  79.708  41.782  1.00 73.26  ? 11  DA  F "C2'" 1 
ATOM 8816 C "C1'" . DA  F 2 10  ? 27.754  79.110  42.818  1.00 59.89  ? 11  DA  F "C1'" 1 
ATOM 8817 N N9    . DA  F 2 10  ? 29.178  78.969  42.498  1.00 41.69  ? 11  DA  F N9    1 
ATOM 8818 C C8    . DA  F 2 10  ? 29.768  78.148  41.551  1.00 46.56  ? 11  DA  F C8    1 
ATOM 8819 N N7    . DA  F 2 10  ? 31.100  78.218  41.529  1.00 33.22  ? 11  DA  F N7    1 
ATOM 8820 C C5    . DA  F 2 10  ? 31.399  79.154  42.525  1.00 34.80  ? 11  DA  F C5    1 
ATOM 8821 C C6    . DA  F 2 10  ? 32.637  79.667  43.007  1.00 41.80  ? 11  DA  F C6    1 
ATOM 8822 N N6    . DA  F 2 10  ? 33.828  79.288  42.497  1.00 33.12  ? 11  DA  F N6    1 
ATOM 8823 N N1    . DA  F 2 10  ? 32.594  80.581  44.052  1.00 41.82  ? 11  DA  F N1    1 
ATOM 8824 C C2    . DA  F 2 10  ? 31.373  80.949  44.565  1.00 45.00  ? 11  DA  F C2    1 
ATOM 8825 N N3    . DA  F 2 10  ? 30.128  80.520  44.196  1.00 43.87  ? 11  DA  F N3    1 
ATOM 8826 C C4    . DA  F 2 10  ? 30.222  79.615  43.151  1.00 40.57  ? 11  DA  F C4    1 
ATOM 8827 P P     . DA  F 2 11  ? 24.713  81.854  43.512  1.00 130.56 ? 12  DA  F P     1 
ATOM 8828 O OP1   . DA  F 2 11  ? 23.282  81.591  43.797  1.00 116.98 ? 12  DA  F OP1   1 
ATOM 8829 O OP2   . DA  F 2 11  ? 25.112  82.531  42.256  1.00 103.68 ? 12  DA  F OP2   1 
ATOM 8830 O "O5'" . DA  F 2 11  ? 25.250  82.666  44.759  1.00 106.35 ? 12  DA  F "O5'" 1 
ATOM 8831 C "C5'" . DA  F 2 11  ? 25.469  83.984  44.627  1.00 98.85  ? 12  DA  F "C5'" 1 
ATOM 8832 C "C4'" . DA  F 2 11  ? 26.932  84.309  44.330  1.00 102.78 ? 12  DA  F "C4'" 1 
ATOM 8833 O "O4'" . DA  F 2 11  ? 27.637  83.324  43.525  1.00 77.08  ? 12  DA  F "O4'" 1 
ATOM 8834 C "C3'" . DA  F 2 11  ? 27.073  85.571  43.521  1.00 116.57 ? 12  DA  F "C3'" 1 
ATOM 8835 O "O3'" . DA  F 2 11  ? 27.334  86.613  44.340  1.00 117.47 ? 12  DA  F "O3'" 1 
ATOM 8836 C "C2'" . DA  F 2 11  ? 28.220  85.312  42.523  1.00 93.72  ? 12  DA  F "C2'" 1 
ATOM 8837 C "C1'" . DA  F 2 11  ? 28.780  84.037  43.071  1.00 69.78  ? 12  DA  F "C1'" 1 
ATOM 8838 N N9    . DA  F 2 11  ? 29.627  83.277  42.136  1.00 66.04  ? 12  DA  F N9    1 
ATOM 8839 C C8    . DA  F 2 11  ? 29.248  82.441  41.086  1.00 65.98  ? 12  DA  F C8    1 
ATOM 8840 N N7    . DA  F 2 11  ? 30.276  81.877  40.438  1.00 41.05  ? 12  DA  F N7    1 
ATOM 8841 C C5    . DA  F 2 11  ? 31.385  82.382  41.102  1.00 45.72  ? 12  DA  F C5    1 
ATOM 8842 C C6    . DA  F 2 11  ? 32.757  82.188  40.898  1.00 50.88  ? 12  DA  F C6    1 
ATOM 8843 N N6    . DA  F 2 11  ? 33.220  81.401  39.927  1.00 42.86  ? 12  DA  F N6    1 
ATOM 8844 N N1    . DA  F 2 11  ? 33.644  82.874  41.724  1.00 60.77  ? 12  DA  F N1    1 
ATOM 8845 C C2    . DA  F 2 11  ? 33.138  83.690  42.703  1.00 66.28  ? 12  DA  F C2    1 
ATOM 8846 N N3    . DA  F 2 11  ? 31.838  83.951  42.998  1.00 53.98  ? 12  DA  F N3    1 
ATOM 8847 C C4    . DA  F 2 11  ? 31.008  83.263  42.144  1.00 56.05  ? 12  DA  F C4    1 
ATOM 8848 P P     . DC  F 2 12  ? 26.963  88.029  43.746  1.00 104.10 ? 13  DC  F P     1 
ATOM 8849 O OP1   . DC  F 2 12  ? 26.617  88.897  44.905  1.00 84.58  ? 13  DC  F OP1   1 
ATOM 8850 O OP2   . DC  F 2 12  ? 25.999  87.674  42.640  1.00 66.71  ? 13  DC  F OP2   1 
ATOM 8851 O "O5'" . DC  F 2 12  ? 28.343  88.484  43.081  1.00 94.14  ? 13  DC  F "O5'" 1 
ATOM 8852 C "C5'" . DC  F 2 12  ? 29.474  88.609  43.896  1.00 87.01  ? 13  DC  F "C5'" 1 
ATOM 8853 C "C4'" . DC  F 2 12  ? 30.737  88.410  43.096  1.00 91.05  ? 13  DC  F "C4'" 1 
ATOM 8854 O "O4'" . DC  F 2 12  ? 30.649  87.251  42.250  1.00 84.84  ? 13  DC  F "O4'" 1 
ATOM 8855 C "C3'" . DC  F 2 12  ? 31.055  89.502  42.103  1.00 106.72 ? 13  DC  F "C3'" 1 
ATOM 8856 O "O3'" . DC  F 2 12  ? 31.759  90.555  42.741  1.00 118.34 ? 13  DC  F "O3'" 1 
ATOM 8857 C "C2'" . DC  F 2 12  ? 31.947  88.769  41.073  1.00 99.85  ? 13  DC  F "C2'" 1 
ATOM 8858 C "C1'" . DC  F 2 12  ? 31.815  87.301  41.479  1.00 70.64  ? 13  DC  F "C1'" 1 
ATOM 8859 N N1    . DC  F 2 12  ? 31.732  86.383  40.327  1.00 56.31  ? 13  DC  F N1    1 
ATOM 8860 C C2    . DC  F 2 12  ? 32.915  85.860  39.800  1.00 62.23  ? 13  DC  F C2    1 
ATOM 8861 O O2    . DC  F 2 12  ? 33.997  86.162  40.337  1.00 66.76  ? 13  DC  F O2    1 
ATOM 8862 N N3    . DC  F 2 12  ? 32.848  85.025  38.723  1.00 58.71  ? 13  DC  F N3    1 
ATOM 8863 C C4    . DC  F 2 12  ? 31.661  84.716  38.185  1.00 57.39  ? 13  DC  F C4    1 
ATOM 8864 N N4    . DC  F 2 12  ? 31.639  83.888  37.124  1.00 56.61  ? 13  DC  F N4    1 
ATOM 8865 C C5    . DC  F 2 12  ? 30.448  85.249  38.711  1.00 58.23  ? 13  DC  F C5    1 
ATOM 8866 C C6    . DC  F 2 12  ? 30.532  86.084  39.767  1.00 64.36  ? 13  DC  F C6    1 
ATOM 8867 P P     . DA  F 2 13  ? 32.204  91.836  41.881  1.00 124.77 ? 14  DA  F P     1 
ATOM 8868 O OP1   . DA  F 2 13  ? 32.429  92.961  42.853  1.00 100.19 ? 14  DA  F OP1   1 
ATOM 8869 O OP2   . DA  F 2 13  ? 31.178  91.878  40.791  1.00 83.06  ? 14  DA  F OP2   1 
ATOM 8870 O "O5'" . DA  F 2 13  ? 33.613  91.405  41.202  1.00 81.42  ? 14  DA  F "O5'" 1 
ATOM 8871 C "C5'" . DA  F 2 13  ? 34.822  91.473  41.949  1.00 67.00  ? 14  DA  F "C5'" 1 
ATOM 8872 C "C4'" . DA  F 2 13  ? 35.981  90.954  41.124  1.00 83.53  ? 14  DA  F "C4'" 1 
ATOM 8873 O "O4'" . DA  F 2 13  ? 35.632  89.722  40.468  1.00 83.83  ? 14  DA  F "O4'" 1 
ATOM 8874 C "C3'" . DA  F 2 13  ? 36.444  91.898  40.039  1.00 82.52  ? 14  DA  F "C3'" 1 
ATOM 8875 O "O3'" . DA  F 2 13  ? 37.726  92.181  40.274  1.00 87.96  ? 14  DA  F "O3'" 1 
ATOM 8876 C "C2'" . DA  F 2 13  ? 36.287  91.139  38.721  1.00 72.10  ? 14  DA  F "C2'" 1 
ATOM 8877 C "C1'" . DA  F 2 13  ? 36.181  89.704  39.175  1.00 77.34  ? 14  DA  F "C1'" 1 
ATOM 8878 N N9    . DA  F 2 13  ? 35.277  88.937  38.378  1.00 57.10  ? 14  DA  F N9    1 
ATOM 8879 C C8    . DA  F 2 13  ? 33.922  88.961  38.444  1.00 61.08  ? 14  DA  F C8    1 
ATOM 8880 N N7    . DA  F 2 13  ? 33.337  88.138  37.614  1.00 59.90  ? 14  DA  F N7    1 
ATOM 8881 C C5    . DA  F 2 13  ? 34.403  87.523  36.962  1.00 68.50  ? 14  DA  F C5    1 
ATOM 8882 C C6    . DA  F 2 13  ? 34.482  86.510  35.937  1.00 67.07  ? 14  DA  F C6    1 
ATOM 8883 N N6    . DA  F 2 13  ? 33.413  85.923  35.359  1.00 57.57  ? 14  DA  F N6    1 
ATOM 8884 N N1    . DA  F 2 13  ? 35.713  86.143  35.530  1.00 63.36  ? 14  DA  F N1    1 
ATOM 8885 C C2    . DA  F 2 13  ? 36.779  86.731  36.103  1.00 69.60  ? 14  DA  F C2    1 
ATOM 8886 N N3    . DA  F 2 13  ? 36.824  87.678  37.056  1.00 61.64  ? 14  DA  F N3    1 
ATOM 8887 C C4    . DA  F 2 13  ? 35.602  88.027  37.436  1.00 55.50  ? 14  DA  F C4    1 
ATOM 8888 P P     . DA  F 2 14  ? 38.366  93.438  39.554  1.00 106.47 ? 15  DA  F P     1 
ATOM 8889 O OP1   . DA  F 2 14  ? 39.510  93.838  40.401  1.00 68.37  ? 15  DA  F OP1   1 
ATOM 8890 O OP2   . DA  F 2 14  ? 37.269  94.412  39.361  1.00 113.93 ? 15  DA  F OP2   1 
ATOM 8891 O "O5'" . DA  F 2 14  ? 38.858  92.808  38.162  1.00 95.75  ? 15  DA  F "O5'" 1 
ATOM 8892 C "C5'" . DA  F 2 14  ? 39.702  91.669  38.208  1.00 98.98  ? 15  DA  F "C5'" 1 
ATOM 8893 C "C4'" . DA  F 2 14  ? 39.881  90.994  36.852  1.00 106.41 ? 15  DA  F "C4'" 1 
ATOM 8894 O "O4'" . DA  F 2 14  ? 38.681  90.296  36.458  1.00 88.73  ? 15  DA  F "O4'" 1 
ATOM 8895 C "C3'" . DA  F 2 14  ? 40.262  91.897  35.661  1.00 122.95 ? 15  DA  F "C3'" 1 
ATOM 8896 O "O3'" . DA  F 2 14  ? 41.426  91.359  35.037  1.00 117.90 ? 15  DA  F "O3'" 1 
ATOM 8897 C "C2'" . DA  F 2 14  ? 39.046  91.778  34.731  1.00 114.01 ? 15  DA  F "C2'" 1 
ATOM 8898 C "C1'" . DA  F 2 14  ? 38.595  90.366  35.058  1.00 76.94  ? 15  DA  F "C1'" 1 
ATOM 8899 N N9    . DA  F 2 14  ? 37.229  90.109  34.717  1.00 70.73  ? 15  DA  F N9    1 
ATOM 8900 C C8    . DA  F 2 14  ? 36.137  90.767  35.210  1.00 84.96  ? 15  DA  F C8    1 
ATOM 8901 N N7    . DA  F 2 14  ? 35.001  90.300  34.764  1.00 87.09  ? 15  DA  F N7    1 
ATOM 8902 C C5    . DA  F 2 14  ? 35.380  89.249  33.917  1.00 79.54  ? 15  DA  F C5    1 
ATOM 8903 C C6    . DA  F 2 14  ? 34.628  88.335  33.122  1.00 77.40  ? 15  DA  F C6    1 
ATOM 8904 N N6    . DA  F 2 14  ? 33.286  88.371  33.057  1.00 74.36  ? 15  DA  F N6    1 
ATOM 8905 N N1    . DA  F 2 14  ? 35.312  87.385  32.402  1.00 66.89  ? 15  DA  F N1    1 
ATOM 8906 C C2    . DA  F 2 14  ? 36.653  87.378  32.478  1.00 75.90  ? 15  DA  F C2    1 
ATOM 8907 N N3    . DA  F 2 14  ? 37.462  88.196  33.188  1.00 85.89  ? 15  DA  F N3    1 
ATOM 8908 C C4    . DA  F 2 14  ? 36.750  89.119  33.886  1.00 73.49  ? 15  DA  F C4    1 
ATOM 8909 P P     . DG  F 2 15  ? 42.490  92.301  34.289  1.00 121.72 ? 16  DG  F P     1 
ATOM 8910 O OP1   . DG  F 2 15  ? 43.743  92.230  35.083  1.00 84.25  ? 16  DG  F OP1   1 
ATOM 8911 O OP2   . DG  F 2 15  ? 41.849  93.607  33.948  1.00 106.92 ? 16  DG  F OP2   1 
ATOM 8912 O "O5'" . DG  F 2 15  ? 42.775  91.496  32.943  1.00 104.61 ? 16  DG  F "O5'" 1 
ATOM 8913 C "C5'" . DG  F 2 15  ? 41.715  91.194  32.073  1.00 88.13  ? 16  DG  F "C5'" 1 
ATOM 8914 C "C4'" . DG  F 2 15  ? 41.991  89.893  31.385  1.00 89.75  ? 16  DG  F "C4'" 1 
ATOM 8915 O "O4'" . DG  F 2 15  ? 40.770  89.155  31.267  1.00 106.57 ? 16  DG  F "O4'" 1 
ATOM 8916 C "C3'" . DG  F 2 15  ? 42.467  90.020  29.973  1.00 86.00  ? 16  DG  F "C3'" 1 
ATOM 8917 O "O3'" . DG  F 2 15  ? 43.046  88.785  29.573  1.00 95.66  ? 16  DG  F "O3'" 1 
ATOM 8918 C "C2'" . DG  F 2 15  ? 41.157  90.309  29.245  1.00 83.74  ? 16  DG  F "C2'" 1 
ATOM 8919 C "C1'" . DG  F 2 15  ? 40.159  89.454  30.033  1.00 84.08  ? 16  DG  F "C1'" 1 
ATOM 8920 N N9    . DG  F 2 15  ? 38.862  90.096  30.323  1.00 79.90  ? 16  DG  F N9    1 
ATOM 8921 C C8    . DG  F 2 15  ? 38.624  91.236  31.080  1.00 82.32  ? 16  DG  F C8    1 
ATOM 8922 N N7    . DG  F 2 15  ? 37.346  91.537  31.196  1.00 81.45  ? 16  DG  F N7    1 
ATOM 8923 C C5    . DG  F 2 15  ? 36.693  90.530  30.484  1.00 70.94  ? 16  DG  F C5    1 
ATOM 8924 C C6    . DG  F 2 15  ? 35.290  90.327  30.234  1.00 80.19  ? 16  DG  F C6    1 
ATOM 8925 O O6    . DG  F 2 15  ? 34.314  91.034  30.619  1.00 75.24  ? 16  DG  F O6    1 
ATOM 8926 N N1    . DG  F 2 15  ? 35.069  89.168  29.443  1.00 60.45  ? 16  DG  F N1    1 
ATOM 8927 C C2    . DG  F 2 15  ? 36.074  88.336  28.965  1.00 65.12  ? 16  DG  F C2    1 
ATOM 8928 N N2    . DG  F 2 15  ? 35.680  87.282  28.249  1.00 58.40  ? 16  DG  F N2    1 
ATOM 8929 N N3    . DG  F 2 15  ? 37.385  88.523  29.185  1.00 69.66  ? 16  DG  F N3    1 
ATOM 8930 C C4    . DG  F 2 15  ? 37.618  89.632  29.945  1.00 72.91  ? 16  DG  F C4    1 
ATOM 8931 O "O5'" . DC  G 3 1   ? 28.225  83.834  26.801  1.00 83.87  ? 1   DC  G "O5'" 1 
ATOM 8932 C "C5'" . DC  G 3 1   ? 28.401  84.079  25.398  1.00 60.15  ? 1   DC  G "C5'" 1 
ATOM 8933 C "C4'" . DC  G 3 1   ? 29.850  84.393  25.129  1.00 79.38  ? 1   DC  G "C4'" 1 
ATOM 8934 O "O4'" . DC  G 3 1   ? 30.164  85.650  25.701  1.00 82.85  ? 1   DC  G "O4'" 1 
ATOM 8935 C "C3'" . DC  G 3 1   ? 30.781  83.477  25.857  1.00 98.21  ? 1   DC  G "C3'" 1 
ATOM 8936 O "O3'" . DC  G 3 1   ? 31.001  82.364  25.116  1.00 114.86 ? 1   DC  G "O3'" 1 
ATOM 8937 C "C2'" . DC  G 3 1   ? 32.058  84.283  26.045  1.00 69.30  ? 1   DC  G "C2'" 1 
ATOM 8938 C "C1'" . DC  G 3 1   ? 31.544  85.689  25.989  1.00 62.74  ? 1   DC  G "C1'" 1 
ATOM 8939 N N1    . DC  G 3 1   ? 31.694  86.447  27.166  1.00 54.72  ? 1   DC  G N1    1 
ATOM 8940 C C2    . DC  G 3 1   ? 32.962  86.764  27.617  1.00 58.35  ? 1   DC  G C2    1 
ATOM 8941 O O2    . DC  G 3 1   ? 33.944  86.265  27.036  1.00 55.06  ? 1   DC  G O2    1 
ATOM 8942 N N3    . DC  G 3 1   ? 33.086  87.590  28.709  1.00 53.00  ? 1   DC  G N3    1 
ATOM 8943 C C4    . DC  G 3 1   ? 31.971  88.088  29.295  1.00 59.92  ? 1   DC  G C4    1 
ATOM 8944 N N4    . DC  G 3 1   ? 32.107  88.889  30.355  1.00 65.20  ? 1   DC  G N4    1 
ATOM 8945 C C5    . DC  G 3 1   ? 30.668  87.783  28.815  1.00 54.99  ? 1   DC  G C5    1 
ATOM 8946 C C6    . DC  G 3 1   ? 30.580  86.975  27.751  1.00 61.29  ? 1   DC  G C6    1 
ATOM 8947 P P     . DT  G 3 2   ? 31.199  81.007  25.925  1.00 130.67 ? 2   DT  G P     1 
ATOM 8948 O OP1   . DT  G 3 2   ? 30.210  80.044  25.341  1.00 90.90  ? 2   DT  G OP1   1 
ATOM 8949 O OP2   . DT  G 3 2   ? 31.072  81.409  27.361  1.00 101.64 ? 2   DT  G OP2   1 
ATOM 8950 O "O5'" . DT  G 3 2   ? 32.749  80.640  25.636  1.00 113.43 ? 2   DT  G "O5'" 1 
ATOM 8951 C "C5'" . DT  G 3 2   ? 33.614  80.196  26.707  1.00 103.72 ? 2   DT  G "C5'" 1 
ATOM 8952 C "C4'" . DT  G 3 2   ? 34.715  81.207  27.007  1.00 87.75  ? 2   DT  G "C4'" 1 
ATOM 8953 O "O4'" . DT  G 3 2   ? 34.155  82.311  27.694  1.00 77.21  ? 2   DT  G "O4'" 1 
ATOM 8954 C "C3'" . DT  G 3 2   ? 35.789  80.717  27.960  1.00 91.77  ? 2   DT  G "C3'" 1 
ATOM 8955 O "O3'" . DT  G 3 2   ? 36.815  80.124  27.231  1.00 109.67 ? 2   DT  G "O3'" 1 
ATOM 8956 C "C2'" . DT  G 3 2   ? 36.258  81.993  28.699  1.00 72.48  ? 2   DT  G "C2'" 1 
ATOM 8957 C "C1'" . DT  G 3 2   ? 35.195  83.011  28.325  1.00 73.22  ? 2   DT  G "C1'" 1 
ATOM 8958 N N1    . DT  G 3 2   ? 34.558  83.711  29.391  1.00 56.15  ? 2   DT  G N1    1 
ATOM 8959 C C2    . DT  G 3 2   ? 35.265  84.596  30.215  1.00 63.27  ? 2   DT  G C2    1 
ATOM 8960 O O2    . DT  G 3 2   ? 36.474  84.744  30.171  1.00 55.95  ? 2   DT  G O2    1 
ATOM 8961 N N3    . DT  G 3 2   ? 34.479  85.271  31.133  1.00 59.50  ? 2   DT  G N3    1 
ATOM 8962 C C4    . DT  G 3 2   ? 33.083  85.156  31.267  1.00 67.09  ? 2   DT  G C4    1 
ATOM 8963 O O4    . DT  G 3 2   ? 32.437  85.784  32.127  1.00 44.30  ? 2   DT  G O4    1 
ATOM 8964 C C5    . DT  G 3 2   ? 32.436  84.231  30.315  1.00 63.86  ? 2   DT  G C5    1 
ATOM 8965 C C7    . DT  G 3 2   ? 30.957  84.017  30.330  1.00 67.00  ? 2   DT  G C7    1 
ATOM 8966 C C6    . DT  G 3 2   ? 33.196  83.588  29.445  1.00 47.22  ? 2   DT  G C6    1 
ATOM 8967 P P     . DT  G 3 3   ? 37.849  79.155  27.974  1.00 120.55 ? 3   DT  G P     1 
ATOM 8968 O OP1   . DT  G 3 3   ? 38.166  78.053  27.024  1.00 126.04 ? 3   DT  G OP1   1 
ATOM 8969 O OP2   . DT  G 3 3   ? 37.226  78.799  29.266  1.00 89.95  ? 3   DT  G OP2   1 
ATOM 8970 O "O5'" . DT  G 3 3   ? 39.109  80.130  28.232  1.00 107.96 ? 3   DT  G "O5'" 1 
ATOM 8971 C "C5'" . DT  G 3 3   ? 39.877  79.962  29.373  1.00 101.69 ? 3   DT  G "C5'" 1 
ATOM 8972 C "C4'" . DT  G 3 3   ? 39.867  81.187  30.280  1.00 103.36 ? 3   DT  G "C4'" 1 
ATOM 8973 O "O4'" . DT  G 3 3   ? 38.534  81.676  30.542  1.00 98.32  ? 3   DT  G "O4'" 1 
ATOM 8974 C "C3'" . DT  G 3 3   ? 40.422  80.889  31.660  1.00 104.49 ? 3   DT  G "C3'" 1 
ATOM 8975 O "O3'" . DT  G 3 3   ? 41.762  81.225  31.696  1.00 131.63 ? 3   DT  G "O3'" 1 
ATOM 8976 C "C2'" . DT  G 3 3   ? 39.597  81.750  32.631  1.00 90.08  ? 3   DT  G "C2'" 1 
ATOM 8977 C "C1'" . DT  G 3 3   ? 38.621  82.463  31.716  1.00 93.79  ? 3   DT  G "C1'" 1 
ATOM 8978 N N1    . DT  G 3 3   ? 37.254  82.688  32.345  1.00 88.01  ? 3   DT  G N1    1 
ATOM 8979 C C2    . DT  G 3 3   ? 37.091  83.751  33.251  1.00 82.51  ? 3   DT  G C2    1 
ATOM 8980 O O2    . DT  G 3 3   ? 37.999  84.511  33.571  1.00 83.41  ? 3   DT  G O2    1 
ATOM 8981 N N3    . DT  G 3 3   ? 35.818  83.895  33.765  1.00 72.38  ? 3   DT  G N3    1 
ATOM 8982 C C4    . DT  G 3 3   ? 34.712  83.102  33.488  1.00 73.20  ? 3   DT  G C4    1 
ATOM 8983 O O4    . DT  G 3 3   ? 33.607  83.304  34.010  1.00 61.13  ? 3   DT  G O4    1 
ATOM 8984 C C5    . DT  G 3 3   ? 34.947  82.012  32.539  1.00 77.33  ? 3   DT  G C5    1 
ATOM 8985 C C7    . DT  G 3 3   ? 33.818  81.112  32.153  1.00 66.13  ? 3   DT  G C7    1 
ATOM 8986 C C6    . DT  G 3 3   ? 36.194  81.851  32.028  1.00 76.65  ? 3   DT  G C6    1 
ATOM 8987 P P     . DG  G 3 4   ? 42.708  80.492  32.752  1.00 146.51 ? 4   DG  G P     1 
ATOM 8988 O OP1   . DG  G 3 4   ? 44.120  80.828  32.400  1.00 145.60 ? 4   DG  G OP1   1 
ATOM 8989 O OP2   . DG  G 3 4   ? 42.248  79.076  32.693  1.00 98.13  ? 4   DG  G OP2   1 
ATOM 8990 O "O5'" . DG  G 3 4   ? 42.356  81.233  34.147  1.00 97.26  ? 4   DG  G "O5'" 1 
ATOM 8991 C "C5'" . DG  G 3 4   ? 42.755  82.575  34.299  1.00 100.56 ? 4   DG  G "C5'" 1 
ATOM 8992 C "C4'" . DG  G 3 4   ? 42.143  83.229  35.519  1.00 102.52 ? 4   DG  G "C4'" 1 
ATOM 8993 O "O4'" . DG  G 3 4   ? 40.710  83.140  35.505  1.00 95.68  ? 4   DG  G "O4'" 1 
ATOM 8994 C "C3'" . DG  G 3 4   ? 42.579  82.669  36.876  1.00 98.83  ? 4   DG  G "C3'" 1 
ATOM 8995 O "O3'" . DG  G 3 4   ? 43.157  83.706  37.598  1.00 106.64 ? 4   DG  G "O3'" 1 
ATOM 8996 C "C2'" . DG  G 3 4   ? 41.266  82.234  37.526  1.00 93.97  ? 4   DG  G "C2'" 1 
ATOM 8997 C "C1'" . DG  G 3 4   ? 40.303  83.170  36.849  1.00 86.09  ? 4   DG  G "C1'" 1 
ATOM 8998 N N9    . DG  G 3 4   ? 38.877  82.825  36.918  1.00 77.45  ? 4   DG  G N9    1 
ATOM 8999 C C8    . DG  G 3 4   ? 38.216  81.837  36.200  1.00 82.05  ? 4   DG  G C8    1 
ATOM 9000 N N7    . DG  G 3 4   ? 36.921  81.810  36.416  1.00 81.02  ? 4   DG  G N7    1 
ATOM 9001 C C5    . DG  G 3 4   ? 36.705  82.872  37.321  1.00 78.70  ? 4   DG  G C5    1 
ATOM 9002 C C6    . DG  G 3 4   ? 35.483  83.351  37.923  1.00 72.07  ? 4   DG  G C6    1 
ATOM 9003 O O6    . DG  G 3 4   ? 34.313  82.912  37.761  1.00 64.09  ? 4   DG  G O6    1 
ATOM 9004 N N1    . DG  G 3 4   ? 35.723  84.438  38.790  1.00 56.34  ? 4   DG  G N1    1 
ATOM 9005 C C2    . DG  G 3 4   ? 36.979  84.997  39.028  1.00 69.97  ? 4   DG  G C2    1 
ATOM 9006 N N2    . DG  G 3 4   ? 37.026  86.055  39.881  1.00 68.42  ? 4   DG  G N2    1 
ATOM 9007 N N3    . DG  G 3 4   ? 38.114  84.558  38.461  1.00 65.52  ? 4   DG  G N3    1 
ATOM 9008 C C4    . DG  G 3 4   ? 37.902  83.503  37.629  1.00 58.73  ? 4   DG  G C4    1 
ATOM 9009 P P     . DT  G 3 5   ? 43.656  83.490  39.105  1.00 134.40 ? 5   DT  G P     1 
ATOM 9010 O OP1   . DT  G 3 5   ? 44.830  84.393  39.222  1.00 103.71 ? 5   DT  G OP1   1 
ATOM 9011 O OP2   . DT  G 3 5   ? 43.745  82.026  39.408  1.00 113.98 ? 5   DT  G OP2   1 
ATOM 9012 O "O5'" . DT  G 3 5   ? 42.523  84.186  39.998  1.00 103.55 ? 5   DT  G "O5'" 1 
ATOM 9013 C "C5'" . DT  G 3 5   ? 42.914  84.991  41.093  1.00 86.40  ? 5   DT  G "C5'" 1 
ATOM 9014 C "C4'" . DT  G 3 5   ? 41.815  85.060  42.131  1.00 94.33  ? 5   DT  G "C4'" 1 
ATOM 9015 O "O4'" . DT  G 3 5   ? 40.585  84.592  41.585  1.00 77.01  ? 5   DT  G "O4'" 1 
ATOM 9016 C "C3'" . DT  G 3 5   ? 42.044  84.235  43.372  1.00 75.26  ? 5   DT  G "C3'" 1 
ATOM 9017 O "O3'" . DT  G 3 5   ? 42.620  85.108  44.341  1.00 71.71  ? 5   DT  G "O3'" 1 
ATOM 9018 C "C2'" . DT  G 3 5   ? 40.621  83.698  43.734  1.00 81.48  ? 5   DT  G "C2'" 1 
ATOM 9019 C "C1'" . DT  G 3 5   ? 39.720  84.280  42.637  1.00 66.48  ? 5   DT  G "C1'" 1 
ATOM 9020 N N1    . DT  G 3 5   ? 38.773  83.358  42.020  1.00 56.99  ? 5   DT  G N1    1 
ATOM 9021 C C2    . DT  G 3 5   ? 37.382  83.455  42.259  1.00 56.61  ? 5   DT  G C2    1 
ATOM 9022 O O2    . DT  G 3 5   ? 36.865  84.220  43.069  1.00 57.76  ? 5   DT  G O2    1 
ATOM 9023 N N3    . DT  G 3 5   ? 36.627  82.570  41.520  1.00 54.23  ? 5   DT  G N3    1 
ATOM 9024 C C4    . DT  G 3 5   ? 37.117  81.630  40.578  1.00 60.71  ? 5   DT  G C4    1 
ATOM 9025 O O4    . DT  G 3 5   ? 36.384  80.849  39.959  1.00 45.00  ? 5   DT  G O4    1 
ATOM 9026 C C5    . DT  G 3 5   ? 38.550  81.631  40.374  1.00 52.78  ? 5   DT  G C5    1 
ATOM 9027 C C7    . DT  G 3 5   ? 39.148  80.680  39.415  1.00 50.81  ? 5   DT  G C7    1 
ATOM 9028 C C6    . DT  G 3 5   ? 39.293  82.485  41.073  1.00 52.36  ? 5   DT  G C6    1 
ATOM 9029 P P     . DT  G 3 6   ? 42.253  85.042  45.893  1.00 119.87 ? 6   DT  G P     1 
ATOM 9030 O OP1   . DT  G 3 6   ? 42.831  86.216  46.600  1.00 106.35 ? 6   DT  G OP1   1 
ATOM 9031 O OP2   . DT  G 3 6   ? 42.595  83.663  46.319  1.00 122.95 ? 6   DT  G OP2   1 
ATOM 9032 O "O5'" . DT  G 3 6   ? 40.693  85.333  45.938  1.00 77.62  ? 6   DT  G "O5'" 1 
ATOM 9033 C "C5'" . DT  G 3 6   ? 40.157  85.957  47.061  1.00 95.70  ? 6   DT  G "C5'" 1 
ATOM 9034 C "C4'" . DT  G 3 6   ? 38.830  85.344  47.399  1.00 89.17  ? 6   DT  G "C4'" 1 
ATOM 9035 O "O4'" . DT  G 3 6   ? 38.334  84.613  46.259  1.00 77.89  ? 6   DT  G "O4'" 1 
ATOM 9036 C "C3'" . DT  G 3 6   ? 38.887  84.322  48.536  1.00 87.66  ? 6   DT  G "C3'" 1 
ATOM 9037 O "O3'" . DT  G 3 6   ? 38.353  84.878  49.739  1.00 98.01  ? 6   DT  G "O3'" 1 
ATOM 9038 C "C2'" . DT  G 3 6   ? 38.041  83.159  48.027  1.00 80.38  ? 6   DT  G "C2'" 1 
ATOM 9039 C "C1'" . DT  G 3 6   ? 37.388  83.750  46.784  1.00 83.67  ? 6   DT  G "C1'" 1 
ATOM 9040 N N1    . DT  G 3 6   ? 37.025  82.727  45.811  1.00 65.63  ? 6   DT  G N1    1 
ATOM 9041 C C2    . DT  G 3 6   ? 35.656  82.461  45.586  1.00 71.11  ? 6   DT  G C2    1 
ATOM 9042 O O2    . DT  G 3 6   ? 34.726  83.098  46.123  1.00 85.81  ? 6   DT  G O2    1 
ATOM 9043 N N3    . DT  G 3 6   ? 35.408  81.446  44.702  1.00 42.83  ? 6   DT  G N3    1 
ATOM 9044 C C4    . DT  G 3 6   ? 36.347  80.686  44.032  1.00 54.88  ? 6   DT  G C4    1 
ATOM 9045 O O4    . DT  G 3 6   ? 36.019  79.780  43.236  1.00 50.64  ? 6   DT  G O4    1 
ATOM 9046 C C5    . DT  G 3 6   ? 37.751  81.005  44.337  1.00 54.11  ? 6   DT  G C5    1 
ATOM 9047 C C7    . DT  G 3 6   ? 38.854  80.219  43.669  1.00 42.42  ? 6   DT  G C7    1 
ATOM 9048 C C6    . DT  G 3 6   ? 38.015  81.997  45.216  1.00 39.78  ? 6   DT  G C6    1 
ATOM 9049 P P     . DG  G 3 7   ? 38.283  83.985  51.079  1.00 101.16 ? 7   DG  G P     1 
ATOM 9050 O OP1   . DG  G 3 7   ? 38.169  84.837  52.325  1.00 74.25  ? 7   DG  G OP1   1 
ATOM 9051 O OP2   . DG  G 3 7   ? 39.319  82.932  50.924  1.00 82.13  ? 7   DG  G OP2   1 
ATOM 9052 O "O5'" . DG  G 3 7   ? 36.912  83.211  50.903  1.00 91.96  ? 7   DG  G "O5'" 1 
ATOM 9053 C "C5'" . DG  G 3 7   ? 35.740  83.768  51.410  1.00 83.90  ? 7   DG  G "C5'" 1 
ATOM 9054 C "C4'" . DG  G 3 7   ? 34.530  83.124  50.769  1.00 85.95  ? 7   DG  G "C4'" 1 
ATOM 9055 O "O4'" . DG  G 3 7   ? 34.913  82.347  49.627  1.00 70.37  ? 7   DG  G "O4'" 1 
ATOM 9056 C "C3'" . DG  G 3 7   ? 33.783  82.156  51.658  1.00 76.79  ? 7   DG  G "C3'" 1 
ATOM 9057 O "O3'" . DG  G 3 7   ? 32.651  82.774  52.117  1.00 87.33  ? 7   DG  G "O3'" 1 
ATOM 9058 C "C2'" . DG  G 3 7   ? 33.425  80.970  50.734  1.00 75.58  ? 7   DG  G "C2'" 1 
ATOM 9059 C "C1'" . DG  G 3 7   ? 33.881  81.422  49.374  1.00 64.59  ? 7   DG  G "C1'" 1 
ATOM 9060 N N9    . DG  G 3 7   ? 34.475  80.413  48.533  1.00 52.72  ? 7   DG  G N9    1 
ATOM 9061 C C8    . DG  G 3 7   ? 35.817  80.266  48.361  1.00 60.40  ? 7   DG  G C8    1 
ATOM 9062 N N7    . DG  G 3 7   ? 36.145  79.350  47.496  1.00 59.07  ? 7   DG  G N7    1 
ATOM 9063 C C5    . DG  G 3 7   ? 34.942  78.878  47.008  1.00 53.12  ? 7   DG  G C5    1 
ATOM 9064 C C6    . DG  G 3 7   ? 34.714  77.877  46.025  1.00 50.07  ? 7   DG  G C6    1 
ATOM 9065 O O6    . DG  G 3 7   ? 35.589  77.222  45.400  1.00 48.50  ? 7   DG  G O6    1 
ATOM 9066 N N1    . DG  G 3 7   ? 33.335  77.649  45.800  1.00 28.45  ? 7   DG  G N1    1 
ATOM 9067 C C2    . DG  G 3 7   ? 32.324  78.311  46.469  1.00 44.80  ? 7   DG  G C2    1 
ATOM 9068 N N2    . DG  G 3 7   ? 31.060  77.929  46.142  1.00 31.09  ? 7   DG  G N2    1 
ATOM 9069 N N3    . DG  G 3 7   ? 32.534  79.304  47.403  1.00 57.99  ? 7   DG  G N3    1 
ATOM 9070 C C4    . DG  G 3 7   ? 33.874  79.525  47.617  1.00 55.75  ? 7   DG  G C4    1 
ATOM 9071 P P     . DT  G 3 8   ? 31.843  82.121  53.322  1.00 123.75 ? 8   DT  G P     1 
ATOM 9072 O OP1   . DT  G 3 8   ? 31.969  83.122  54.430  1.00 105.71 ? 8   DT  G OP1   1 
ATOM 9073 O OP2   . DT  G 3 8   ? 32.451  80.772  53.495  1.00 93.59  ? 8   DT  G OP2   1 
ATOM 9074 O "O5'" . DT  G 3 8   ? 30.330  81.942  52.738  1.00 85.57  ? 8   DT  G "O5'" 1 
ATOM 9075 C "C5'" . DT  G 3 8   ? 30.139  81.701  51.321  1.00 79.51  ? 8   DT  G "C5'" 1 
ATOM 9076 C "C4'" . DT  G 3 8   ? 29.404  80.378  51.026  1.00 90.22  ? 8   DT  G "C4'" 1 
ATOM 9077 O "O4'" . DT  G 3 8   ? 30.198  79.533  50.132  1.00 78.31  ? 8   DT  G "O4'" 1 
ATOM 9078 C "C3'" . DT  G 3 8   ? 29.017  79.513  52.238  1.00 95.44  ? 8   DT  G "C3'" 1 
ATOM 9079 O "O3'" . DT  G 3 8   ? 27.585  79.255  52.220  1.00 103.36 ? 8   DT  G "O3'" 1 
ATOM 9080 C "C2'" . DT  G 3 8   ? 29.863  78.218  52.070  1.00 87.48  ? 8   DT  G "C2'" 1 
ATOM 9081 C "C1'" . DT  G 3 8   ? 30.144  78.173  50.565  1.00 68.16  ? 8   DT  G "C1'" 1 
ATOM 9082 N N1    . DT  G 3 8   ? 31.474  77.480  50.137  1.00 45.95  ? 8   DT  G N1    1 
ATOM 9083 C C2    . DT  G 3 8   ? 31.458  76.411  49.208  1.00 50.13  ? 8   DT  G C2    1 
ATOM 9084 O O2    . DT  G 3 8   ? 30.425  75.913  48.743  1.00 47.34  ? 8   DT  G O2    1 
ATOM 9085 N N3    . DT  G 3 8   ? 32.712  75.919  48.855  1.00 34.46  ? 8   DT  G N3    1 
ATOM 9086 C C4    . DT  G 3 8   ? 33.937  76.370  49.300  1.00 40.25  ? 8   DT  G C4    1 
ATOM 9087 O O4    . DT  G 3 8   ? 34.995  75.877  48.930  1.00 35.01  ? 8   DT  G O4    1 
ATOM 9088 C C5    . DT  G 3 8   ? 33.889  77.472  50.243  1.00 53.72  ? 8   DT  G C5    1 
ATOM 9089 C C7    . DT  G 3 8   ? 35.179  78.028  50.784  1.00 52.12  ? 8   DT  G C7    1 
ATOM 9090 C C6    . DT  G 3 8   ? 32.670  77.959  50.620  1.00 43.61  ? 8   DT  G C6    1 
ATOM 9091 P P     . DT  G 3 9   ? 26.846  78.512  53.446  1.00 111.07 ? 9   DT  G P     1 
ATOM 9092 O OP1   . DT  G 3 9   ? 25.450  78.983  53.592  1.00 119.93 ? 9   DT  G OP1   1 
ATOM 9093 O OP2   . DT  G 3 9   ? 27.746  78.748  54.604  1.00 104.59 ? 9   DT  G OP2   1 
ATOM 9094 O "O5'" . DT  G 3 9   ? 26.703  77.000  52.899  1.00 81.84  ? 9   DT  G "O5'" 1 
ATOM 9095 C "C5'" . DT  G 3 9   ? 26.570  76.806  51.477  1.00 79.92  ? 9   DT  G "C5'" 1 
ATOM 9096 C "C4'" . DT  G 3 9   ? 26.236  75.358  51.074  1.00 90.74  ? 9   DT  G "C4'" 1 
ATOM 9097 O "O4'" . DT  G 3 9   ? 27.360  74.730  50.389  1.00 76.78  ? 9   DT  G "O4'" 1 
ATOM 9098 C "C3'" . DT  G 3 9   ? 25.795  74.395  52.173  1.00 88.47  ? 9   DT  G "C3'" 1 
ATOM 9099 O "O3'" . DT  G 3 9   ? 24.686  73.619  51.684  1.00 95.99  ? 9   DT  G "O3'" 1 
ATOM 9100 C "C2'" . DT  G 3 9   ? 27.038  73.539  52.405  1.00 74.82  ? 9   DT  G "C2'" 1 
ATOM 9101 C "C1'" . DT  G 3 9   ? 27.775  73.565  51.066  1.00 54.51  ? 9   DT  G "C1'" 1 
ATOM 9102 N N1    . DT  G 3 9   ? 29.326  73.594  51.218  1.00 49.40  ? 9   DT  G N1    1 
ATOM 9103 C C2    . DT  G 3 9   ? 30.105  72.766  50.405  1.00 47.78  ? 9   DT  G C2    1 
ATOM 9104 O O2    . DT  G 3 9   ? 29.616  72.006  49.558  1.00 55.86  ? 9   DT  G O2    1 
ATOM 9105 N N3    . DT  G 3 9   ? 31.480  72.855  50.618  1.00 29.83  ? 9   DT  G N3    1 
ATOM 9106 C C4    . DT  G 3 9   ? 32.137  73.641  51.548  1.00 32.43  ? 9   DT  G C4    1 
ATOM 9107 O O4    . DT  G 3 9   ? 33.363  73.642  51.649  1.00 21.26  ? 9   DT  G O4    1 
ATOM 9108 C C5    . DT  G 3 9   ? 31.268  74.484  52.382  1.00 42.36  ? 9   DT  G C5    1 
ATOM 9109 C C7    . DT  G 3 9   ? 31.869  75.391  53.425  1.00 37.02  ? 9   DT  G C7    1 
ATOM 9110 C C6    . DT  G 3 9   ? 29.922  74.422  52.182  1.00 36.98  ? 9   DT  G C6    1 
ATOM 9111 P P     . DG  G 3 10  ? 24.075  72.371  52.489  1.00 93.61  ? 10  DG  G P     1 
ATOM 9112 O OP1   . DG  G 3 10  ? 22.615  72.538  52.497  1.00 93.03  ? 10  DG  G OP1   1 
ATOM 9113 O OP2   . DG  G 3 10  ? 24.776  72.191  53.799  1.00 64.62  ? 10  DG  G OP2   1 
ATOM 9114 O "O5'" . DG  G 3 10  ? 24.206  71.196  51.419  1.00 77.29  ? 10  DG  G "O5'" 1 
ATOM 9115 C "C5'" . DG  G 3 10  ? 25.256  71.219  50.462  1.00 79.19  ? 10  DG  G "C5'" 1 
ATOM 9116 C "C4'" . DG  G 3 10  ? 26.039  69.922  50.537  1.00 78.79  ? 10  DG  G "C4'" 1 
ATOM 9117 O "O4'" . DG  G 3 10  ? 27.451  70.166  50.877  1.00 81.26  ? 10  DG  G "O4'" 1 
ATOM 9118 C "C3'" . DG  G 3 10  ? 25.557  68.954  51.602  1.00 49.71  ? 10  DG  G "C3'" 1 
ATOM 9119 O "O3'" . DG  G 3 10  ? 25.880  67.672  51.125  1.00 62.66  ? 10  DG  G "O3'" 1 
ATOM 9120 C "C2'" . DG  G 3 10  ? 26.437  69.377  52.786  1.00 46.56  ? 10  DG  G "C2'" 1 
ATOM 9121 C "C1'" . DG  G 3 10  ? 27.770  69.431  52.065  1.00 54.83  ? 10  DG  G "C1'" 1 
ATOM 9122 N N9    . DG  G 3 10  ? 28.879  70.108  52.790  1.00 38.73  ? 10  DG  G N9    1 
ATOM 9123 C C8    . DG  G 3 10  ? 28.756  71.063  53.772  1.00 42.11  ? 10  DG  G C8    1 
ATOM 9124 N N7    . DG  G 3 10  ? 29.924  71.528  54.227  1.00 35.13  ? 10  DG  G N7    1 
ATOM 9125 C C5    . DG  G 3 10  ? 30.881  70.833  53.505  1.00 28.58  ? 10  DG  G C5    1 
ATOM 9126 C C6    . DG  G 3 10  ? 32.312  70.932  53.580  1.00 34.36  ? 10  DG  G C6    1 
ATOM 9127 O O6    . DG  G 3 10  ? 32.982  71.683  54.334  1.00 29.65  ? 10  DG  G O6    1 
ATOM 9128 N N1    . DG  G 3 10  ? 32.948  70.039  52.688  1.00 21.95  ? 10  DG  G N1    1 
ATOM 9129 C C2    . DG  G 3 10  ? 32.239  69.168  51.842  1.00 34.79  ? 10  DG  G C2    1 
ATOM 9130 N N2    . DG  G 3 10  ? 32.981  68.399  51.055  1.00 36.01  ? 10  DG  G N2    1 
ATOM 9131 N N3    . DG  G 3 10  ? 30.882  69.069  51.763  1.00 22.80  ? 10  DG  G N3    1 
ATOM 9132 C C4    . DG  G 3 10  ? 30.272  69.932  52.617  1.00 27.11  ? 10  DG  G C4    1 
ATOM 9133 P P     . DT  G 3 11  ? 25.426  66.299  51.852  1.00 109.96 ? 11  DT  G P     1 
ATOM 9134 O OP1   . DT  G 3 11  ? 24.649  65.499  50.844  1.00 67.05  ? 11  DT  G OP1   1 
ATOM 9135 O OP2   . DT  G 3 11  ? 24.859  66.641  53.210  1.00 51.88  ? 11  DT  G OP2   1 
ATOM 9136 O "O5'" . DT  G 3 11  ? 26.790  65.449  51.785  1.00 64.17  ? 11  DT  G "O5'" 1 
ATOM 9137 C "C5'" . DT  G 3 11  ? 27.390  65.356  50.477  1.00 54.11  ? 11  DT  G "C5'" 1 
ATOM 9138 C "C4'" . DT  G 3 11  ? 28.798  64.807  50.498  1.00 56.64  ? 11  DT  G "C4'" 1 
ATOM 9139 O "O4'" . DT  G 3 11  ? 29.732  65.712  51.168  1.00 67.39  ? 11  DT  G "O4'" 1 
ATOM 9140 C "C3'" . DT  G 3 11  ? 28.924  63.460  51.164  1.00 53.13  ? 11  DT  G "C3'" 1 
ATOM 9141 O "O3'" . DT  G 3 11  ? 29.514  62.579  50.242  1.00 51.80  ? 11  DT  G "O3'" 1 
ATOM 9142 C "C2'" . DT  G 3 11  ? 29.802  63.731  52.405  1.00 57.83  ? 11  DT  G "C2'" 1 
ATOM 9143 C "C1'" . DT  G 3 11  ? 30.600  64.953  51.981  1.00 51.01  ? 11  DT  G "C1'" 1 
ATOM 9144 N N1    . DT  G 3 11  ? 31.157  65.844  53.112  1.00 28.50  ? 11  DT  G N1    1 
ATOM 9145 C C2    . DT  G 3 11  ? 32.517  66.008  53.182  1.00 40.68  ? 11  DT  G C2    1 
ATOM 9146 O O2    . DT  G 3 11  ? 33.299  65.441  52.436  1.00 53.08  ? 11  DT  G O2    1 
ATOM 9147 N N3    . DT  G 3 11  ? 32.958  66.857  54.151  1.00 36.36  ? 11  DT  G N3    1 
ATOM 9148 C C4    . DT  G 3 11  ? 32.196  67.563  55.043  1.00 35.91  ? 11  DT  G C4    1 
ATOM 9149 O O4    . DT  G 3 11  ? 32.697  68.304  55.894  1.00 38.56  ? 11  DT  G O4    1 
ATOM 9150 C C5    . DT  G 3 11  ? 30.776  67.381  54.926  1.00 25.34  ? 11  DT  G C5    1 
ATOM 9151 C C7    . DT  G 3 11  ? 29.878  68.141  55.870  1.00 16.67  ? 11  DT  G C7    1 
ATOM 9152 C C6    . DT  G 3 11  ? 30.315  66.535  53.969  1.00 25.99  ? 11  DT  G C6    1 
ATOM 9153 P P     . DT  G 3 12  ? 29.543  61.000  50.518  1.00 84.99  ? 12  DT  G P     1 
ATOM 9154 O OP1   . DT  G 3 12  ? 29.758  60.314  49.221  1.00 30.31  ? 12  DT  G OP1   1 
ATOM 9155 O OP2   . DT  G 3 12  ? 28.438  60.640  51.460  1.00 65.62  ? 12  DT  G OP2   1 
ATOM 9156 O "O5'" . DT  G 3 12  ? 30.966  60.813  51.213  1.00 67.61  ? 12  DT  G "O5'" 1 
ATOM 9157 C "C5'" . DT  G 3 12  ? 32.128  60.903  50.428  1.00 41.16  ? 12  DT  G "C5'" 1 
ATOM 9158 C "C4'" . DT  G 3 12  ? 33.325  61.118  51.306  1.00 54.63  ? 12  DT  G "C4'" 1 
ATOM 9159 O "O4'" . DT  G 3 12  ? 33.129  62.227  52.190  1.00 53.01  ? 12  DT  G "O4'" 1 
ATOM 9160 C "C3'" . DT  G 3 12  ? 33.563  59.984  52.234  1.00 65.35  ? 12  DT  G "C3'" 1 
ATOM 9161 O "O3'" . DT  G 3 12  ? 34.333  59.029  51.525  1.00 75.45  ? 12  DT  G "O3'" 1 
ATOM 9162 C "C2'" . DT  G 3 12  ? 34.318  60.645  53.423  1.00 54.85  ? 12  DT  G "C2'" 1 
ATOM 9163 C "C1'" . DT  G 3 12  ? 34.093  62.149  53.209  1.00 39.90  ? 12  DT  G "C1'" 1 
ATOM 9164 N N1    . DT  G 3 12  ? 33.533  62.894  54.385  1.00 37.92  ? 12  DT  G N1    1 
ATOM 9165 C C2    . DT  G 3 12  ? 34.337  63.764  55.099  1.00 39.46  ? 12  DT  G C2    1 
ATOM 9166 O O2    . DT  G 3 12  ? 35.509  63.914  54.828  1.00 46.69  ? 12  DT  G O2    1 
ATOM 9167 N N3    . DT  G 3 12  ? 33.710  64.433  56.156  1.00 19.56  ? 12  DT  G N3    1 
ATOM 9168 C C4    . DT  G 3 12  ? 32.342  64.335  56.492  1.00 34.45  ? 12  DT  G C4    1 
ATOM 9169 O O4    . DT  G 3 12  ? 31.793  64.970  57.437  1.00 25.60  ? 12  DT  G O4    1 
ATOM 9170 C C5    . DT  G 3 12  ? 31.583  63.407  55.674  1.00 37.32  ? 12  DT  G C5    1 
ATOM 9171 C C7    . DT  G 3 12  ? 30.134  63.180  55.961  1.00 42.08  ? 12  DT  G C7    1 
ATOM 9172 C C6    . DT  G 3 12  ? 32.202  62.758  54.675  1.00 34.50  ? 12  DT  G C6    1 
ATOM 9173 P P     . DC  G 3 13  ? 34.551  57.587  52.156  1.00 69.76  ? 13  DC  G P     1 
ATOM 9174 O OP1   . DC  G 3 13  ? 35.065  56.628  51.122  1.00 38.84  ? 13  DC  G OP1   1 
ATOM 9175 O OP2   . DC  G 3 13  ? 33.289  57.423  52.954  1.00 51.65  ? 13  DC  G OP2   1 
ATOM 9176 O "O5'" . DC  G 3 13  ? 35.740  57.870  53.153  1.00 49.64  ? 13  DC  G "O5'" 1 
ATOM 9177 C "C5'" . DC  G 3 13  ? 36.980  58.295  52.678  1.00 37.63  ? 13  DC  G "C5'" 1 
ATOM 9178 C "C4'" . DC  G 3 13  ? 37.771  58.722  53.869  1.00 49.19  ? 13  DC  G "C4'" 1 
ATOM 9179 O "O4'" . DC  G 3 13  ? 37.049  59.757  54.531  1.00 43.29  ? 13  DC  G "O4'" 1 
ATOM 9180 C "C3'" . DC  G 3 13  ? 37.841  57.666  54.955  1.00 58.00  ? 13  DC  G "C3'" 1 
ATOM 9181 O "O3'" . DC  G 3 13  ? 38.953  56.848  54.772  1.00 57.63  ? 13  DC  G "O3'" 1 
ATOM 9182 C "C2'" . DC  G 3 13  ? 37.953  58.487  56.243  1.00 46.93  ? 13  DC  G "C2'" 1 
ATOM 9183 C "C1'" . DC  G 3 13  ? 37.610  59.894  55.783  1.00 33.33  ? 13  DC  G "C1'" 1 
ATOM 9184 N N1    . DC  G 3 13  ? 36.660  60.511  56.552  1.00 24.41  ? 13  DC  G N1    1 
ATOM 9185 C C2    . DC  G 3 13  ? 37.065  61.433  57.503  1.00 33.14  ? 13  DC  G C2    1 
ATOM 9186 O O2    . DC  G 3 13  ? 38.274  61.635  57.659  1.00 28.50  ? 13  DC  G O2    1 
ATOM 9187 N N3    . DC  G 3 13  ? 36.130  62.074  58.232  1.00 28.13  ? 13  DC  G N3    1 
ATOM 9188 C C4    . DC  G 3 13  ? 34.850  61.812  58.012  1.00 29.40  ? 13  DC  G C4    1 
ATOM 9189 N N4    . DC  G 3 13  ? 33.958  62.447  58.753  1.00 28.39  ? 13  DC  G N4    1 
ATOM 9190 C C5    . DC  G 3 13  ? 34.434  60.859  57.046  1.00 28.82  ? 13  DC  G C5    1 
ATOM 9191 C C6    . DC  G 3 13  ? 35.377  60.239  56.343  1.00 21.29  ? 13  DC  G C6    1 
ATOM 9192 P P     . DT  G 3 14  ? 38.961  55.431  55.467  1.00 56.99  ? 14  DT  G P     1 
ATOM 9193 O OP1   . DT  G 3 14  ? 39.818  54.650  54.571  1.00 24.43  ? 14  DT  G OP1   1 
ATOM 9194 O OP2   . DT  G 3 14  ? 37.543  55.139  55.777  1.00 51.31  ? 14  DT  G OP2   1 
ATOM 9195 O "O5'" . DT  G 3 14  ? 39.624  55.730  56.875  1.00 45.91  ? 14  DT  G "O5'" 1 
ATOM 9196 C "C5'" . DT  G 3 14  ? 41.000  56.072  56.943  1.00 45.97  ? 14  DT  G "C5'" 1 
ATOM 9197 C "C4'" . DT  G 3 14  ? 41.290  56.796  58.248  1.00 45.68  ? 14  DT  G "C4'" 1 
ATOM 9198 O "O4'" . DT  G 3 14  ? 40.325  57.823  58.400  1.00 43.33  ? 14  DT  G "O4'" 1 
ATOM 9199 C "C3'" . DT  G 3 14  ? 41.073  55.987  59.487  1.00 50.18  ? 14  DT  G "C3'" 1 
ATOM 9200 O "O3'" . DT  G 3 14  ? 42.180  55.164  59.744  1.00 64.71  ? 14  DT  G "O3'" 1 
ATOM 9201 C "C2'" . DT  G 3 14  ? 40.906  57.069  60.545  1.00 44.56  ? 14  DT  G "C2'" 1 
ATOM 9202 C "C1'" . DT  G 3 14  ? 40.181  58.146  59.765  1.00 42.95  ? 14  DT  G "C1'" 1 
ATOM 9203 N N1    . DT  G 3 14  ? 38.718  58.297  59.989  1.00 32.66  ? 14  DT  G N1    1 
ATOM 9204 C C2    . DT  G 3 14  ? 38.227  59.323  60.784  1.00 29.27  ? 14  DT  G C2    1 
ATOM 9205 O O2    . DT  G 3 14  ? 38.938  60.092  61.433  1.00 36.69  ? 14  DT  G O2    1 
ATOM 9206 N N3    . DT  G 3 14  ? 36.882  59.412  60.812  1.00 17.61  ? 14  DT  G N3    1 
ATOM 9207 C C4    . DT  G 3 14  ? 35.995  58.618  60.147  1.00 30.44  ? 14  DT  G C4    1 
ATOM 9208 O O4    . DT  G 3 14  ? 34.787  58.781  60.242  1.00 33.99  ? 14  DT  G O4    1 
ATOM 9209 C C5    . DT  G 3 14  ? 36.577  57.571  59.319  1.00 42.03  ? 14  DT  G C5    1 
ATOM 9210 C C7    . DT  G 3 14  ? 35.709  56.625  58.537  1.00 38.15  ? 14  DT  G C7    1 
ATOM 9211 C C6    . DT  G 3 14  ? 37.891  57.491  59.266  1.00 35.39  ? 14  DT  G C6    1 
ATOM 9212 P P     . DC  G 3 15  ? 41.962  53.775  60.523  1.00 54.22  ? 15  DC  G P     1 
ATOM 9213 O OP1   . DC  G 3 15  ? 43.218  52.994  60.337  1.00 31.95  ? 15  DC  G OP1   1 
ATOM 9214 O OP2   . DC  G 3 15  ? 40.632  53.292  60.153  1.00 35.01  ? 15  DC  G OP2   1 
ATOM 9215 O "O5'" . DC  G 3 15  ? 41.647  54.231  62.032  1.00 46.97  ? 15  DC  G "O5'" 1 
ATOM 9216 C "C5'" . DC  G 3 15  ? 42.623  54.863  62.848  1.00 42.01  ? 15  DC  G "C5'" 1 
ATOM 9217 C "C4'" . DC  G 3 15  ? 41.922  55.551  63.996  1.00 52.90  ? 15  DC  G "C4'" 1 
ATOM 9218 O "O4'" . DC  G 3 15  ? 40.793  56.243  63.475  1.00 58.12  ? 15  DC  G "O4'" 1 
ATOM 9219 C "C3'" . DC  G 3 15  ? 41.277  54.658  65.023  1.00 55.06  ? 15  DC  G "C3'" 1 
ATOM 9220 O "O3'" . DC  G 3 15  ? 42.268  54.195  66.012  1.00 96.04  ? 15  DC  G "O3'" 1 
ATOM 9221 C "C2'" . DC  G 3 15  ? 40.256  55.626  65.649  1.00 61.51  ? 15  DC  G "C2'" 1 
ATOM 9222 C "C1'" . DC  G 3 15  ? 39.980  56.626  64.535  1.00 52.16  ? 15  DC  G "C1'" 1 
ATOM 9223 N N1    . DC  G 3 15  ? 38.677  56.562  64.042  1.00 44.99  ? 15  DC  G N1    1 
ATOM 9224 C C2    . DC  G 3 15  ? 37.682  57.444  64.508  1.00 48.85  ? 15  DC  G C2    1 
ATOM 9225 O O2    . DC  G 3 15  ? 37.957  58.274  65.387  1.00 58.61  ? 15  DC  G O2    1 
ATOM 9226 N N3    . DC  G 3 15  ? 36.442  57.357  63.973  1.00 41.01  ? 15  DC  G N3    1 
ATOM 9227 C C4    . DC  G 3 15  ? 36.204  56.434  63.020  1.00 50.97  ? 15  DC  G C4    1 
ATOM 9228 N N4    . DC  G 3 15  ? 34.975  56.336  62.523  1.00 41.71  ? 15  DC  G N4    1 
ATOM 9229 C C5    . DC  G 3 15  ? 37.218  55.552  62.549  1.00 55.11  ? 15  DC  G C5    1 
ATOM 9230 C C6    . DC  G 3 15  ? 38.427  55.661  63.078  1.00 45.90  ? 15  DC  G C6    1 
ATOM 9231 P P     . DT  G 3 16  ? 42.479  52.620  66.358  1.00 90.41  ? 16  DT  G P     1 
ATOM 9232 O OP1   . DT  G 3 16  ? 42.660  52.518  67.823  1.00 87.99  ? 16  DT  G OP1   1 
ATOM 9233 O OP2   . DT  G 3 16  ? 43.639  52.141  65.568  1.00 69.02  ? 16  DT  G OP2   1 
ATOM 9234 O "O5'" . DT  G 3 16  ? 41.120  51.924  65.866  1.00 48.22  ? 16  DT  G "O5'" 1 
ATOM 9235 C "C5'" . DT  G 3 16  ? 40.233  51.297  66.791  1.00 77.76  ? 16  DT  G "C5'" 1 
ATOM 9236 C "C4'" . DT  G 3 16  ? 39.796  52.221  67.936  1.00 85.15  ? 16  DT  G "C4'" 1 
ATOM 9237 O "O4'" . DT  G 3 16  ? 39.312  53.472  67.404  1.00 105.13 ? 16  DT  G "O4'" 1 
ATOM 9238 C "C3'" . DT  G 3 16  ? 38.647  51.678  68.769  1.00 109.40 ? 16  DT  G "C3'" 1 
ATOM 9239 O "O3'" . DT  G 3 16  ? 39.147  50.934  69.871  1.00 131.82 ? 16  DT  G "O3'" 1 
ATOM 9240 C "C2'" . DT  G 3 16  ? 37.887  52.938  69.193  1.00 91.18  ? 16  DT  G "C2'" 1 
ATOM 9241 C "C1'" . DT  G 3 16  ? 38.042  53.809  67.953  1.00 95.51  ? 16  DT  G "C1'" 1 
ATOM 9242 N N1    . DT  G 3 16  ? 36.966  53.593  66.864  1.00 91.86  ? 16  DT  G N1    1 
ATOM 9243 C C2    . DT  G 3 16  ? 35.833  54.427  66.795  1.00 95.67  ? 16  DT  G C2    1 
ATOM 9244 O O2    . DT  G 3 16  ? 35.610  55.352  67.570  1.00 100.67 ? 16  DT  G O2    1 
ATOM 9245 N N3    . DT  G 3 16  ? 34.958  54.119  65.770  1.00 86.91  ? 16  DT  G N3    1 
ATOM 9246 C C4    . DT  G 3 16  ? 35.095  53.108  64.827  1.00 82.71  ? 16  DT  G C4    1 
ATOM 9247 O O4    . DT  G 3 16  ? 34.260  52.924  63.942  1.00 90.91  ? 16  DT  G O4    1 
ATOM 9248 C C5    . DT  G 3 16  ? 36.304  52.296  64.951  1.00 83.93  ? 16  DT  G C5    1 
ATOM 9249 C C7    . DT  G 3 16  ? 36.578  51.180  63.993  1.00 95.71  ? 16  DT  G C7    1 
ATOM 9250 C C6    . DT  G 3 16  ? 37.159  52.578  65.934  1.00 78.69  ? 16  DT  G C6    1 
ATOM 9251 P P     . DG  G 3 17  ? 38.555  49.466  70.146  1.00 144.84 ? 17  DG  G P     1 
ATOM 9252 O OP1   . DG  G 3 17  ? 39.137  48.424  69.239  1.00 120.86 ? 17  DG  G OP1   1 
ATOM 9253 O OP2   . DG  G 3 17  ? 37.107  49.775  70.180  1.00 100.44 ? 17  DG  G OP2   1 
ATOM 9254 O "O5'" . DG  G 3 17  ? 38.991  49.134  71.645  1.00 127.18 ? 17  DG  G "O5'" 1 
ATOM 9255 C "C5'" . DG  G 3 17  ? 40.339  49.171  72.052  1.00 120.60 ? 17  DG  G "C5'" 1 
ATOM 9256 C "C4'" . DG  G 3 17  ? 40.398  48.607  73.441  1.00 111.71 ? 17  DG  G "C4'" 1 
ATOM 9257 O "O4'" . DG  G 3 17  ? 39.959  49.637  74.409  1.00 126.43 ? 17  DG  G "O4'" 1 
ATOM 9258 C "C3'" . DG  G 3 17  ? 39.468  47.407  73.605  1.00 73.37  ? 17  DG  G "C3'" 1 
ATOM 9259 O "O3'" . DG  G 3 17  ? 40.255  46.161  73.788  1.00 107.49 ? 17  DG  G "O3'" 1 
ATOM 9260 C "C2'" . DG  G 3 17  ? 38.594  47.772  74.843  1.00 99.44  ? 17  DG  G "C2'" 1 
ATOM 9261 C "C1'" . DG  G 3 17  ? 39.292  49.015  75.495  1.00 117.05 ? 17  DG  G "C1'" 1 
ATOM 9262 N N9    . DG  G 3 17  ? 38.333  49.990  76.234  1.00 118.16 ? 17  DG  G N9    1 
ATOM 9263 C C8    . DG  G 3 17  ? 37.144  50.477  75.722  1.00 118.99 ? 17  DG  G C8    1 
ATOM 9264 N N7    . DG  G 3 17  ? 36.460  51.250  76.538  1.00 115.22 ? 17  DG  G N7    1 
ATOM 9265 C C5    . DG  G 3 17  ? 37.205  51.310  77.710  1.00 133.80 ? 17  DG  G C5    1 
ATOM 9266 C C6    . DG  G 3 17  ? 36.923  52.025  78.945  1.00 141.97 ? 17  DG  G C6    1 
ATOM 9267 O O6    . DG  G 3 17  ? 35.931  52.756  79.223  1.00 125.02 ? 17  DG  G O6    1 
ATOM 9268 N N1    . DG  G 3 17  ? 37.926  51.827  79.905  1.00 131.79 ? 17  DG  G N1    1 
ATOM 9269 C C2    . DG  G 3 17  ? 39.055  51.048  79.723  1.00 127.91 ? 17  DG  G C2    1 
ATOM 9270 N N2    . DG  G 3 17  ? 39.888  50.987  80.786  1.00 97.91  ? 17  DG  G N2    1 
ATOM 9271 N N3    . DG  G 3 17  ? 39.346  50.364  78.567  1.00 131.76 ? 17  DG  G N3    1 
ATOM 9272 C C4    . DG  G 3 17  ? 38.375  50.537  77.589  1.00 127.11 ? 17  DG  G C4    1 
ATOM 9273 P P     . DG  G 3 18  ? 40.670  45.174  72.565  1.00 111.42 ? 18  DG  G P     1 
ATOM 9274 O OP1   . DG  G 3 18  ? 41.334  45.967  71.507  1.00 130.48 ? 18  DG  G OP1   1 
ATOM 9275 O OP2   . DG  G 3 18  ? 39.514  44.300  72.244  1.00 84.49  ? 18  DG  G OP2   1 
ATOM 9276 O "O5'" . DG  G 3 18  ? 41.787  44.198  73.192  1.00 96.64  ? 18  DG  G "O5'" 1 
ATOM 9277 C "C5'" . DG  G 3 18  ? 42.974  44.722  73.796  1.00 93.02  ? 18  DG  G "C5'" 1 
ATOM 9278 C "C4'" . DG  G 3 18  ? 43.076  44.394  75.312  1.00 120.55 ? 18  DG  G "C4'" 1 
ATOM 9279 O "O4'" . DG  G 3 18  ? 42.076  45.135  76.090  1.00 87.90  ? 18  DG  G "O4'" 1 
ATOM 9280 C "C3'" . DG  G 3 18  ? 42.933  42.913  75.756  1.00 118.29 ? 18  DG  G "C3'" 1 
ATOM 9281 O "O3'" . DG  G 3 18  ? 43.846  42.673  76.913  1.00 110.66 ? 18  DG  G "O3'" 1 
ATOM 9282 C "C2'" . DG  G 3 18  ? 41.453  42.869  76.174  1.00 94.13  ? 18  DG  G "C2'" 1 
ATOM 9283 C "C1'" . DG  G 3 18  ? 41.349  44.212  76.891  1.00 84.95  ? 18  DG  G "C1'" 1 
ATOM 9284 N N9    . DG  G 3 18  ? 40.004  44.727  77.065  1.00 80.27  ? 18  DG  G N9    1 
ATOM 9285 C C8    . DG  G 3 18  ? 38.846  44.304  76.456  1.00 87.85  ? 18  DG  G C8    1 
ATOM 9286 N N7    . DG  G 3 18  ? 37.781  45.002  76.824  1.00 77.25  ? 18  DG  G N7    1 
ATOM 9287 C C5    . DG  G 3 18  ? 38.280  45.935  77.726  1.00 73.45  ? 18  DG  G C5    1 
ATOM 9288 C C6    . DG  G 3 18  ? 37.617  46.962  78.448  1.00 79.84  ? 18  DG  G C6    1 
ATOM 9289 O O6    . DG  G 3 18  ? 36.415  47.264  78.426  1.00 94.12  ? 18  DG  G O6    1 
ATOM 9290 N N1    . DG  G 3 18  ? 38.494  47.682  79.262  1.00 83.00  ? 18  DG  G N1    1 
ATOM 9291 C C2    . DG  G 3 18  ? 39.853  47.446  79.360  1.00 104.21 ? 18  DG  G C2    1 
ATOM 9292 N N2    . DG  G 3 18  ? 40.549  48.249  80.204  1.00 109.40 ? 18  DG  G N2    1 
ATOM 9293 N N3    . DG  G 3 18  ? 40.490  46.492  78.671  1.00 94.17  ? 18  DG  G N3    1 
ATOM 9294 C C4    . DG  G 3 18  ? 39.644  45.780  77.880  1.00 81.78  ? 18  DG  G C4    1 
ATOM 9295 P P     . DG  G 3 19  ? 44.298  41.200  77.416  1.00 133.94 ? 19  DG  G P     1 
ATOM 9296 O OP1   . DG  G 3 19  ? 45.099  40.519  76.364  1.00 119.69 ? 19  DG  G OP1   1 
ATOM 9297 O OP2   . DG  G 3 19  ? 43.131  40.460  77.971  1.00 101.60 ? 19  DG  G OP2   1 
ATOM 9298 O "O5'" . DG  G 3 19  ? 45.295  41.542  78.636  1.00 115.68 ? 19  DG  G "O5'" 1 
ATOM 9299 C "C5'" . DG  G 3 19  ? 45.589  42.912  79.024  1.00 64.42  ? 19  DG  G "C5'" 1 
ATOM 9300 C "C4'" . DG  G 3 19  ? 44.553  43.462  80.012  1.00 88.27  ? 19  DG  G "C4'" 1 
ATOM 9301 O "O4'" . DG  G 3 19  ? 43.236  43.114  79.550  1.00 82.46  ? 19  DG  G "O4'" 1 
ATOM 9302 C "C3'" . DG  G 3 19  ? 44.597  42.965  81.510  1.00 104.44 ? 19  DG  G "C3'" 1 
ATOM 9303 O "O3'" . DG  G 3 19  ? 44.812  44.094  82.471  1.00 106.22 ? 19  DG  G "O3'" 1 
ATOM 9304 C "C2'" . DG  G 3 19  ? 43.207  42.335  81.713  1.00 91.65  ? 19  DG  G "C2'" 1 
ATOM 9305 C "C1'" . DG  G 3 19  ? 42.428  43.125  80.685  1.00 84.43  ? 19  DG  G "C1'" 1 
ATOM 9306 N N9    . DG  G 3 19  ? 41.082  42.655  80.372  1.00 83.32  ? 19  DG  G N9    1 
ATOM 9307 C C8    . DG  G 3 19  ? 40.677  41.516  79.674  1.00 85.96  ? 19  DG  G C8    1 
ATOM 9308 N N7    . DG  G 3 19  ? 39.365  41.418  79.550  1.00 67.53  ? 19  DG  G N7    1 
ATOM 9309 C C5    . DG  G 3 19  ? 38.893  42.578  80.189  1.00 77.39  ? 19  DG  G C5    1 
ATOM 9310 C C6    . DG  G 3 19  ? 37.564  43.056  80.386  1.00 63.41  ? 19  DG  G C6    1 
ATOM 9311 O O6    . DG  G 3 19  ? 36.509  42.534  80.041  1.00 59.43  ? 19  DG  G O6    1 
ATOM 9312 N N1    . DG  G 3 19  ? 37.544  44.271  81.081  1.00 61.85  ? 19  DG  G N1    1 
ATOM 9313 C C2    . DG  G 3 19  ? 38.677  44.957  81.528  1.00 78.10  ? 19  DG  G C2    1 
ATOM 9314 N N2    . DG  G 3 19  ? 38.466  46.136  82.167  1.00 72.76  ? 19  DG  G N2    1 
ATOM 9315 N N3    . DG  G 3 19  ? 39.924  44.515  81.365  1.00 67.38  ? 19  DG  G N3    1 
ATOM 9316 C C4    . DG  G 3 19  ? 39.951  43.334  80.689  1.00 76.39  ? 19  DG  G C4    1 
ATOM 9317 P P     . DT  G 3 20  ? 44.973  43.851  84.078  1.00 118.82 ? 20  DT  G P     1 
ATOM 9318 O OP1   . DT  G 3 20  ? 45.892  44.912  84.620  1.00 75.09  ? 20  DT  G OP1   1 
ATOM 9319 O OP2   . DT  G 3 20  ? 44.969  42.396  84.451  1.00 57.33  ? 20  DT  G OP2   1 
ATOM 9320 O "O5'" . DT  G 3 20  ? 43.571  44.232  84.653  1.00 99.94  ? 20  DT  G "O5'" 1 
ATOM 9321 C "C5'" . DT  G 3 20  ? 43.464  45.080  85.734  1.00 79.21  ? 20  DT  G "C5'" 1 
ATOM 9322 C "C4'" . DT  G 3 20  ? 42.021  45.388  85.881  1.00 64.72  ? 20  DT  G "C4'" 1 
ATOM 9323 O "O4'" . DT  G 3 20  ? 41.323  44.615  84.908  1.00 74.32  ? 20  DT  G "O4'" 1 
ATOM 9324 C "C3'" . DT  G 3 20  ? 41.428  44.956  87.193  1.00 65.30  ? 20  DT  G "C3'" 1 
ATOM 9325 O "O3'" . DT  G 3 20  ? 41.236  46.047  87.954  1.00 76.81  ? 20  DT  G "O3'" 1 
ATOM 9326 C "C2'" . DT  G 3 20  ? 40.092  44.326  86.830  1.00 56.36  ? 20  DT  G "C2'" 1 
ATOM 9327 C "C1'" . DT  G 3 20  ? 40.022  44.529  85.339  1.00 63.02  ? 20  DT  G "C1'" 1 
ATOM 9328 N N1    . DT  G 3 20  ? 39.341  43.449  84.651  1.00 63.12  ? 20  DT  G N1    1 
ATOM 9329 C C2    . DT  G 3 20  ? 37.979  43.476  84.692  1.00 68.40  ? 20  DT  G C2    1 
ATOM 9330 O O2    . DT  G 3 20  ? 37.355  44.355  85.290  1.00 61.50  ? 20  DT  G O2    1 
ATOM 9331 N N3    . DT  G 3 20  ? 37.352  42.445  84.032  1.00 61.33  ? 20  DT  G N3    1 
ATOM 9332 C C4    . DT  G 3 20  ? 37.940  41.403  83.361  1.00 56.80  ? 20  DT  G C4    1 
ATOM 9333 O O4    . DT  G 3 20  ? 37.273  40.531  82.822  1.00 44.87  ? 20  DT  G O4    1 
ATOM 9334 C C5    . DT  G 3 20  ? 39.405  41.425  83.326  1.00 65.55  ? 20  DT  G C5    1 
ATOM 9335 C C7    . DT  G 3 20  ? 40.156  40.335  82.588  1.00 42.94  ? 20  DT  G C7    1 
ATOM 9336 C C6    . DT  G 3 20  ? 40.039  42.448  83.975  1.00 57.76  ? 20  DT  G C6    1 
ATOM 9337 P P     . DC  G 3 21  ? 41.459  45.904  89.516  1.00 89.12  ? 21  DC  G P     1 
ATOM 9338 O OP1   . DC  G 3 21  ? 42.244  47.070  89.965  1.00 80.79  ? 21  DC  G OP1   1 
ATOM 9339 O OP2   . DC  G 3 21  ? 41.979  44.535  89.721  1.00 82.18  ? 21  DC  G OP2   1 
ATOM 9340 O "O5'" . DC  G 3 21  ? 39.988  46.014  90.095  1.00 70.26  ? 21  DC  G "O5'" 1 
ATOM 9341 C "C5'" . DC  G 3 21  ? 39.301  47.187  89.954  1.00 60.20  ? 21  DC  G "C5'" 1 
ATOM 9342 C "C4'" . DC  G 3 21  ? 37.846  46.902  89.982  1.00 55.28  ? 21  DC  G "C4'" 1 
ATOM 9343 O "O4'" . DC  G 3 21  ? 37.543  45.994  88.928  1.00 70.84  ? 21  DC  G "O4'" 1 
ATOM 9344 C "C3'" . DC  G 3 21  ? 37.391  46.209  91.236  1.00 63.06  ? 21  DC  G "C3'" 1 
ATOM 9345 O "O3'" . DC  G 3 21  ? 36.737  47.170  92.072  1.00 84.11  ? 21  DC  G "O3'" 1 
ATOM 9346 C "C2'" . DC  G 3 21  ? 36.442  45.073  90.742  1.00 58.30  ? 21  DC  G "C2'" 1 
ATOM 9347 C "C1'" . DC  G 3 21  ? 36.361  45.312  89.253  1.00 54.41  ? 21  DC  G "C1'" 1 
ATOM 9348 N N1    . DC  G 3 21  ? 36.318  44.077  88.393  1.00 58.98  ? 21  DC  G N1    1 
ATOM 9349 C C2    . DC  G 3 21  ? 35.152  43.791  87.651  1.00 50.97  ? 21  DC  G C2    1 
ATOM 9350 O O2    . DC  G 3 21  ? 34.182  44.522  87.795  1.00 60.80  ? 21  DC  G O2    1 
ATOM 9351 N N3    . DC  G 3 21  ? 35.131  42.707  86.804  1.00 44.28  ? 21  DC  G N3    1 
ATOM 9352 C C4    . DC  G 3 21  ? 36.240  41.899  86.718  1.00 62.71  ? 21  DC  G C4    1 
ATOM 9353 N N4    . DC  G 3 21  ? 36.211  40.799  85.878  1.00 36.58  ? 21  DC  G N4    1 
ATOM 9354 C C5    . DC  G 3 21  ? 37.443  42.210  87.469  1.00 53.74  ? 21  DC  G C5    1 
ATOM 9355 C C6    . DC  G 3 21  ? 37.439  43.300  88.262  1.00 46.08  ? 21  DC  G C6    1 
ATOM 9356 P P     . DA  G 3 22  ? 35.862  46.701  93.342  1.00 98.08  ? 22  DA  G P     1 
ATOM 9357 O OP1   . DA  G 3 22  ? 35.784  47.790  94.369  1.00 75.08  ? 22  DA  G OP1   1 
ATOM 9358 O OP2   . DA  G 3 22  ? 36.384  45.360  93.687  1.00 83.41  ? 22  DA  G OP2   1 
ATOM 9359 O "O5'" . DA  G 3 22  ? 34.391  46.496  92.730  1.00 86.80  ? 22  DA  G "O5'" 1 
ATOM 9360 C "C5'" . DA  G 3 22  ? 33.358  45.939  93.511  1.00 67.08  ? 22  DA  G "C5'" 1 
ATOM 9361 C "C4'" . DA  G 3 22  ? 32.428  45.139  92.649  1.00 70.85  ? 22  DA  G "C4'" 1 
ATOM 9362 O "O4'" . DA  G 3 22  ? 33.199  44.285  91.813  1.00 73.71  ? 22  DA  G "O4'" 1 
ATOM 9363 C "C3'" . DA  G 3 22  ? 31.510  44.177  93.400  1.00 96.64  ? 22  DA  G "C3'" 1 
ATOM 9364 O "O3'" . DA  G 3 22  ? 30.260  44.774  93.627  1.00 112.36 ? 22  DA  G "O3'" 1 
ATOM 9365 C "C2'" . DA  G 3 22  ? 31.409  42.915  92.489  1.00 77.55  ? 22  DA  G "C2'" 1 
ATOM 9366 C "C1'" . DA  G 3 22  ? 32.333  43.275  91.348  1.00 67.30  ? 22  DA  G "C1'" 1 
ATOM 9367 N N9    . DA  G 3 22  ? 33.154  42.259  90.717  1.00 40.84  ? 22  DA  G N9    1 
ATOM 9368 C C8    . DA  G 3 22  ? 34.519  42.258  90.678  1.00 49.89  ? 22  DA  G C8    1 
ATOM 9369 N N7    . DA  G 3 22  ? 35.037  41.342  89.896  1.00 39.22  ? 22  DA  G N7    1 
ATOM 9370 C C5    . DA  G 3 22  ? 33.933  40.739  89.343  1.00 38.15  ? 22  DA  G C5    1 
ATOM 9371 C C6    . DA  G 3 22  ? 33.811  39.670  88.400  1.00 40.19  ? 22  DA  G C6    1 
ATOM 9372 N N6    . DA  G 3 22  ? 34.872  39.054  87.856  1.00 31.91  ? 22  DA  G N6    1 
ATOM 9373 N N1    . DA  G 3 22  ? 32.552  39.280  88.041  1.00 28.40  ? 22  DA  G N1    1 
ATOM 9374 C C2    . DA  G 3 22  ? 31.497  39.955  88.616  1.00 44.61  ? 22  DA  G C2    1 
ATOM 9375 N N3    . DA  G 3 22  ? 31.505  40.986  89.519  1.00 35.15  ? 22  DA  G N3    1 
ATOM 9376 C C4    . DA  G 3 22  ? 32.757  41.319  89.831  1.00 29.17  ? 22  DA  G C4    1 
ATOM 9377 P P     . DC  G 3 23  ? 29.441  44.317  94.916  1.00 121.24 ? 23  DC  G P     1 
ATOM 9378 O OP1   . DC  G 3 23  ? 28.268  45.232  95.118  1.00 82.65  ? 23  DC  G OP1   1 
ATOM 9379 O OP2   . DC  G 3 23  ? 30.506  44.215  95.954  1.00 91.71  ? 23  DC  G OP2   1 
ATOM 9380 O "O5'" . DC  G 3 23  ? 28.968  42.843  94.490  1.00 85.88  ? 23  DC  G "O5'" 1 
ATOM 9381 C "C5'" . DC  G 3 23  ? 28.094  42.712  93.421  1.00 84.78  ? 23  DC  G "C5'" 1 
ATOM 9382 C "C4'" . DC  G 3 23  ? 27.992  41.280  93.021  1.00 83.66  ? 23  DC  G "C4'" 1 
ATOM 9383 O "O4'" . DC  G 3 23  ? 29.225  40.847  92.473  1.00 78.74  ? 23  DC  G "O4'" 1 
ATOM 9384 C "C3'" . DC  G 3 23  ? 27.721  40.332  94.155  1.00 88.37  ? 23  DC  G "C3'" 1 
ATOM 9385 O "O3'" . DC  G 3 23  ? 26.483  39.795  93.939  1.00 113.57 ? 23  DC  G "O3'" 1 
ATOM 9386 C "C2'" . DC  G 3 23  ? 28.820  39.270  94.025  1.00 71.18  ? 23  DC  G "C2'" 1 
ATOM 9387 C "C1'" . DC  G 3 23  ? 29.274  39.476  92.602  1.00 48.71  ? 23  DC  G "C1'" 1 
ATOM 9388 N N1    . DC  G 3 23  ? 30.672  39.111  92.358  1.00 49.67  ? 23  DC  G N1    1 
ATOM 9389 C C2    . DC  G 3 23  ? 31.007  38.090  91.411  1.00 47.43  ? 23  DC  G C2    1 
ATOM 9390 O O2    . DC  G 3 23  ? 30.072  37.485  90.810  1.00 48.49  ? 23  DC  G O2    1 
ATOM 9391 N N3    . DC  G 3 23  ? 32.357  37.796  91.195  1.00 24.57  ? 23  DC  G N3    1 
ATOM 9392 C C4    . DC  G 3 23  ? 33.310  38.516  91.908  1.00 45.51  ? 23  DC  G C4    1 
ATOM 9393 N N4    . DC  G 3 23  ? 34.619  38.243  91.725  1.00 33.33  ? 23  DC  G N4    1 
ATOM 9394 C C5    . DC  G 3 23  ? 32.950  39.544  92.852  1.00 43.37  ? 23  DC  G C5    1 
ATOM 9395 C C6    . DC  G 3 23  ? 31.647  39.797  93.034  1.00 49.79  ? 23  DC  G C6    1 
ATOM 9396 P P     . DG  G 3 24  ? 25.489  39.581  95.168  1.00 129.83 ? 24  DG  G P     1 
ATOM 9397 O OP1   . DG  G 3 24  ? 24.315  40.434  94.834  1.00 120.55 ? 24  DG  G OP1   1 
ATOM 9398 O OP2   . DG  G 3 24  ? 26.244  39.811  96.446  1.00 71.68  ? 24  DG  G OP2   1 
ATOM 9399 O "O5'" . DG  G 3 24  ? 25.129  38.021  95.016  1.00 89.50  ? 24  DG  G "O5'" 1 
ATOM 9400 C "C5'" . DG  G 3 24  ? 26.197  37.097  94.817  1.00 86.54  ? 24  DG  G "C5'" 1 
ATOM 9401 C "C4'" . DG  G 3 24  ? 25.835  35.990  93.844  1.00 101.12 ? 24  DG  G "C4'" 1 
ATOM 9402 O "O4'" . DG  G 3 24  ? 26.919  35.797  92.905  1.00 87.34  ? 24  DG  G "O4'" 1 
ATOM 9403 C "C3'" . DG  G 3 24  ? 25.632  34.636  94.507  1.00 111.59 ? 24  DG  G "C3'" 1 
ATOM 9404 O "O3'" . DG  G 3 24  ? 24.603  33.883  93.859  1.00 132.31 ? 24  DG  G "O3'" 1 
ATOM 9405 C "C2'" . DG  G 3 24  ? 26.991  33.949  94.399  1.00 98.44  ? 24  DG  G "C2'" 1 
ATOM 9406 C "C1'" . DG  G 3 24  ? 27.768  34.774  93.371  1.00 80.19  ? 24  DG  G "C1'" 1 
ATOM 9407 N N9    . DG  G 3 24  ? 29.018  35.356  93.917  1.00 71.93  ? 24  DG  G N9    1 
ATOM 9408 C C8    . DG  G 3 24  ? 29.161  36.306  94.933  1.00 62.47  ? 24  DG  G C8    1 
ATOM 9409 N N7    . DG  G 3 24  ? 30.421  36.625  95.199  1.00 53.67  ? 24  DG  G N7    1 
ATOM 9410 C C5    . DG  G 3 24  ? 31.171  35.810  94.337  1.00 48.57  ? 24  DG  G C5    1 
ATOM 9411 C C6    . DG  G 3 24  ? 32.605  35.683  94.176  1.00 59.64  ? 24  DG  G C6    1 
ATOM 9412 O O6    . DG  G 3 24  ? 33.531  36.308  94.802  1.00 48.04  ? 24  DG  G O6    1 
ATOM 9413 N N1    . DG  G 3 24  ? 32.929  34.714  93.144  1.00 48.00  ? 24  DG  G N1    1 
ATOM 9414 C C2    . DG  G 3 24  ? 31.982  33.974  92.401  1.00 48.08  ? 24  DG  G C2    1 
ATOM 9415 N N2    . DG  G 3 24  ? 32.469  33.116  91.486  1.00 42.57  ? 24  DG  G N2    1 
ATOM 9416 N N3    . DG  G 3 24  ? 30.648  34.071  92.566  1.00 43.48  ? 24  DG  G N3    1 
ATOM 9417 C C4    . DG  G 3 24  ? 30.314  35.009  93.538  1.00 59.19  ? 24  DG  G C4    1 
ATOM 9418 P P     . DC  G 3 25  ? 23.708  32.893  94.754  1.00 144.36 ? 25  DC  G P     1 
ATOM 9419 O OP1   . DC  G 3 25  ? 22.271  32.994  94.366  1.00 100.88 ? 25  DC  G OP1   1 
ATOM 9420 O OP2   . DC  G 3 25  ? 24.161  33.215  96.136  1.00 111.37 ? 25  DC  G OP2   1 
ATOM 9421 O "O5'" . DC  G 3 25  ? 24.222  31.420  94.360  1.00 135.42 ? 25  DC  G "O5'" 1 
ATOM 9422 C "C5'" . DC  G 3 25  ? 25.481  30.909  94.851  1.00 106.26 ? 25  DC  G "C5'" 1 
ATOM 9423 C "C4'" . DC  G 3 25  ? 26.046  29.940  93.838  1.00 99.90  ? 25  DC  G "C4'" 1 
ATOM 9424 O "O4'" . DC  G 3 25  ? 27.227  30.474  93.195  1.00 100.09 ? 25  DC  G "O4'" 1 
ATOM 9425 C "C3'" . DC  G 3 25  ? 26.361  28.552  94.329  1.00 107.75 ? 25  DC  G "C3'" 1 
ATOM 9426 O "O3'" . DC  G 3 25  ? 25.825  27.581  93.410  1.00 114.44 ? 25  DC  G "O3'" 1 
ATOM 9427 C "C2'" . DC  G 3 25  ? 27.888  28.514  94.367  1.00 100.60 ? 25  DC  G "C2'" 1 
ATOM 9428 C "C1'" . DC  G 3 25  ? 28.354  29.716  93.525  1.00 71.31  ? 25  DC  G "C1'" 1 
ATOM 9429 N N1    . DC  G 3 25  ? 29.287  30.602  94.266  1.00 73.36  ? 25  DC  G N1    1 
ATOM 9430 C C2    . DC  G 3 25  ? 30.674  30.586  93.993  1.00 75.15  ? 25  DC  G C2    1 
ATOM 9431 O O2    . DC  G 3 25  ? 31.129  29.830  93.092  1.00 73.34  ? 25  DC  G O2    1 
ATOM 9432 N N3    . DC  G 3 25  ? 31.487  31.411  94.734  1.00 53.72  ? 25  DC  G N3    1 
ATOM 9433 C C4    . DC  G 3 25  ? 30.964  32.205  95.696  1.00 58.34  ? 25  DC  G C4    1 
ATOM 9434 N N4    . DC  G 3 25  ? 31.800  33.011  96.403  1.00 56.92  ? 25  DC  G N4    1 
ATOM 9435 C C5    . DC  G 3 25  ? 29.571  32.211  95.976  1.00 61.36  ? 25  DC  G C5    1 
ATOM 9436 C C6    . DC  G 3 25  ? 28.789  31.402  95.258  1.00 73.08  ? 25  DC  G C6    1 
ATOM 9437 O "O5'" . DG  H 4 1   ? 42.182  30.707  95.521  1.00 107.45 ? 1   DG  H "O5'" 1 
ATOM 9438 C "C5'" . DG  H 4 1   ? 41.782  29.418  95.919  1.00 120.70 ? 1   DG  H "C5'" 1 
ATOM 9439 C "C4'" . DG  H 4 1   ? 41.014  28.720  94.808  1.00 128.60 ? 1   DG  H "C4'" 1 
ATOM 9440 O "O4'" . DG  H 4 1   ? 39.591  28.936  94.983  1.00 116.27 ? 1   DG  H "O4'" 1 
ATOM 9441 C "C3'" . DG  H 4 1   ? 41.318  29.178  93.374  1.00 123.11 ? 1   DG  H "C3'" 1 
ATOM 9442 O "O3'" . DG  H 4 1   ? 41.115  28.070  92.484  1.00 149.88 ? 1   DG  H "O3'" 1 
ATOM 9443 C "C2'" . DG  H 4 1   ? 40.254  30.235  93.155  1.00 105.11 ? 1   DG  H "C2'" 1 
ATOM 9444 C "C1'" . DG  H 4 1   ? 39.068  29.538  93.808  1.00 116.84 ? 1   DG  H "C1'" 1 
ATOM 9445 N N9    . DG  H 4 1   ? 37.981  30.424  94.218  1.00 107.34 ? 1   DG  H N9    1 
ATOM 9446 C C8    . DG  H 4 1   ? 38.080  31.519  95.053  1.00 87.17  ? 1   DG  H C8    1 
ATOM 9447 N N7    . DG  H 4 1   ? 36.945  32.107  95.282  1.00 59.71  ? 1   DG  H N7    1 
ATOM 9448 C C5    . DG  H 4 1   ? 36.022  31.360  94.567  1.00 75.84  ? 1   DG  H C5    1 
ATOM 9449 C C6    . DG  H 4 1   ? 34.620  31.534  94.457  1.00 76.72  ? 1   DG  H C6    1 
ATOM 9450 O O6    . DG  H 4 1   ? 33.931  32.411  95.015  1.00 64.14  ? 1   DG  H O6    1 
ATOM 9451 N N1    . DG  H 4 1   ? 34.021  30.549  93.615  1.00 64.80  ? 1   DG  H N1    1 
ATOM 9452 C C2    . DG  H 4 1   ? 34.723  29.519  92.985  1.00 85.46  ? 1   DG  H C2    1 
ATOM 9453 N N2    . DG  H 4 1   ? 33.997  28.668  92.241  1.00 85.64  ? 1   DG  H N2    1 
ATOM 9454 N N3    . DG  H 4 1   ? 36.055  29.341  93.095  1.00 95.05  ? 1   DG  H N3    1 
ATOM 9455 C C4    . DG  H 4 1   ? 36.635  30.305  93.902  1.00 95.24  ? 1   DG  H C4    1 
ATOM 9456 P P     . DC  H 4 2   ? 41.294  28.233  90.895  1.00 141.12 ? 2   DC  H P     1 
ATOM 9457 O OP1   . DC  H 4 2   ? 41.619  26.911  90.305  1.00 155.41 ? 2   DC  H OP1   1 
ATOM 9458 O OP2   . DC  H 4 2   ? 42.270  29.325  90.728  1.00 130.62 ? 2   DC  H OP2   1 
ATOM 9459 O "O5'" . DC  H 4 2   ? 39.821  28.613  90.370  1.00 134.85 ? 2   DC  H "O5'" 1 
ATOM 9460 C "C5'" . DC  H 4 2   ? 38.777  27.590  90.320  1.00 138.91 ? 2   DC  H "C5'" 1 
ATOM 9461 C "C4'" . DC  H 4 2   ? 37.666  27.908  89.292  1.00 139.43 ? 2   DC  H "C4'" 1 
ATOM 9462 O "O4'" . DC  H 4 2   ? 36.722  28.861  89.857  1.00 128.93 ? 2   DC  H "O4'" 1 
ATOM 9463 C "C3'" . DC  H 4 2   ? 38.115  28.538  87.962  1.00 133.60 ? 2   DC  H "C3'" 1 
ATOM 9464 O "O3'" . DC  H 4 2   ? 37.160  28.192  86.899  1.00 127.43 ? 2   DC  H "O3'" 1 
ATOM 9465 C "C2'" . DC  H 4 2   ? 38.074  30.027  88.308  1.00 110.35 ? 2   DC  H "C2'" 1 
ATOM 9466 C "C1'" . DC  H 4 2   ? 36.771  30.067  89.090  1.00 111.44 ? 2   DC  H "C1'" 1 
ATOM 9467 N N1    . DC  H 4 2   ? 36.643  31.214  89.974  1.00 88.85  ? 2   DC  H N1    1 
ATOM 9468 C C2    . DC  H 4 2   ? 35.351  31.705  90.293  1.00 78.99  ? 2   DC  H C2    1 
ATOM 9469 O O2    . DC  H 4 2   ? 34.332  31.147  89.806  1.00 70.49  ? 2   DC  H O2    1 
ATOM 9470 N N3    . DC  H 4 2   ? 35.256  32.775  91.133  1.00 69.58  ? 2   DC  H N3    1 
ATOM 9471 C C4    . DC  H 4 2   ? 36.379  33.343  91.627  1.00 77.26  ? 2   DC  H C4    1 
ATOM 9472 N N4    . DC  H 4 2   ? 36.244  34.401  92.440  1.00 62.36  ? 2   DC  H N4    1 
ATOM 9473 C C5    . DC  H 4 2   ? 37.689  32.849  91.301  1.00 83.44  ? 2   DC  H C5    1 
ATOM 9474 C C6    . DC  H 4 2   ? 37.773  31.796  90.477  1.00 75.17  ? 2   DC  H C6    1 
ATOM 9475 P P     . DG  H 4 3   ? 36.932  29.164  85.625  1.00 147.87 ? 3   DG  H P     1 
ATOM 9476 O OP1   . DG  H 4 3   ? 36.431  28.387  84.456  1.00 120.31 ? 3   DG  H OP1   1 
ATOM 9477 O OP2   . DG  H 4 3   ? 38.205  29.915  85.437  1.00 114.15 ? 3   DG  H OP2   1 
ATOM 9478 O "O5'" . DG  H 4 3   ? 35.743  30.139  86.107  1.00 104.13 ? 3   DG  H "O5'" 1 
ATOM 9479 C "C5'" . DG  H 4 3   ? 34.589  29.606  86.815  1.00 101.46 ? 3   DG  H "C5'" 1 
ATOM 9480 C "C4'" . DG  H 4 3   ? 33.302  29.945  86.101  1.00 107.04 ? 3   DG  H "C4'" 1 
ATOM 9481 O "O4'" . DG  H 4 3   ? 32.653  31.077  86.729  1.00 86.69  ? 3   DG  H "O4'" 1 
ATOM 9482 C "C3'" . DG  H 4 3   ? 33.503  30.369  84.674  1.00 96.93  ? 3   DG  H "C3'" 1 
ATOM 9483 O "O3'" . DG  H 4 3   ? 32.293  30.240  83.996  1.00 110.79 ? 3   DG  H "O3'" 1 
ATOM 9484 C "C2'" . DG  H 4 3   ? 33.887  31.826  84.835  1.00 67.81  ? 3   DG  H "C2'" 1 
ATOM 9485 C "C1'" . DG  H 4 3   ? 33.023  32.249  86.030  1.00 73.90  ? 3   DG  H "C1'" 1 
ATOM 9486 N N9    . DG  H 4 3   ? 33.766  33.132  86.911  1.00 58.41  ? 3   DG  H N9    1 
ATOM 9487 C C8    . DG  H 4 3   ? 35.149  33.248  86.972  1.00 56.32  ? 3   DG  H C8    1 
ATOM 9488 N N7    . DG  H 4 3   ? 35.565  34.165  87.805  1.00 45.71  ? 3   DG  H N7    1 
ATOM 9489 C C5    . DG  H 4 3   ? 34.378  34.705  88.331  1.00 50.06  ? 3   DG  H C5    1 
ATOM 9490 C C6    . DG  H 4 3   ? 34.200  35.749  89.310  1.00 44.81  ? 3   DG  H C6    1 
ATOM 9491 O O6    . DG  H 4 3   ? 35.091  36.391  89.883  1.00 33.74  ? 3   DG  H O6    1 
ATOM 9492 N N1    . DG  H 4 3   ? 32.835  36.022  89.583  1.00 24.38  ? 3   DG  H N1    1 
ATOM 9493 C C2    . DG  H 4 3   ? 31.772  35.339  88.960  1.00 49.09  ? 3   DG  H C2    1 
ATOM 9494 N N2    . DG  H 4 3   ? 30.518  35.726  89.336  1.00 42.51  ? 3   DG  H N2    1 
ATOM 9495 N N3    . DG  H 4 3   ? 31.932  34.330  88.026  1.00 43.57  ? 3   DG  H N3    1 
ATOM 9496 C C4    . DG  H 4 3   ? 33.257  34.083  87.773  1.00 44.94  ? 3   DG  H C4    1 
ATOM 9497 P P     . DT  H 4 4   ? 32.129  30.980  82.591  1.00 132.51 ? 4   DT  H P     1 
ATOM 9498 O OP1   . DT  H 4 4   ? 31.127  30.342  81.691  1.00 69.07  ? 4   DT  H OP1   1 
ATOM 9499 O OP2   . DT  H 4 4   ? 33.548  31.033  82.127  1.00 109.80 ? 4   DT  H OP2   1 
ATOM 9500 O "O5'" . DT  H 4 4   ? 31.408  32.355  83.013  1.00 89.63  ? 4   DT  H "O5'" 1 
ATOM 9501 C "C5'" . DT  H 4 4   ? 30.086  32.280  83.523  1.00 76.62  ? 4   DT  H "C5'" 1 
ATOM 9502 C "C4'" . DT  H 4 4   ? 29.490  33.659  83.755  1.00 87.61  ? 4   DT  H "C4'" 1 
ATOM 9503 O "O4'" . DT  H 4 4   ? 30.201  34.339  84.815  1.00 77.48  ? 4   DT  H "O4'" 1 
ATOM 9504 C "C3'" . DT  H 4 4   ? 29.529  34.580  82.551  1.00 88.28  ? 4   DT  H "C3'" 1 
ATOM 9505 O "O3'" . DT  H 4 4   ? 28.213  34.582  81.899  1.00 95.64  ? 4   DT  H "O3'" 1 
ATOM 9506 C "C2'" . DT  H 4 4   ? 29.924  35.946  83.123  1.00 78.28  ? 4   DT  H "C2'" 1 
ATOM 9507 C "C1'" . DT  H 4 4   ? 30.175  35.725  84.611  1.00 51.82  ? 4   DT  H "C1'" 1 
ATOM 9508 N N1    . DT  H 4 4   ? 31.504  36.244  85.066  1.00 42.52  ? 4   DT  H N1    1 
ATOM 9509 C C2    . DT  H 4 4   ? 31.589  37.236  86.082  1.00 41.83  ? 4   DT  H C2    1 
ATOM 9510 O O2    . DT  H 4 4   ? 30.598  37.775  86.633  1.00 44.97  ? 4   DT  H O2    1 
ATOM 9511 N N3    . DT  H 4 4   ? 32.864  37.584  86.415  1.00 19.50  ? 4   DT  H N3    1 
ATOM 9512 C C4    . DT  H 4 4   ? 34.015  37.058  85.863  1.00 31.86  ? 4   DT  H C4    1 
ATOM 9513 O O4    . DT  H 4 4   ? 35.123  37.420  86.201  1.00 34.85  ? 4   DT  H O4    1 
ATOM 9514 C C5    . DT  H 4 4   ? 33.848  36.080  84.826  1.00 33.77  ? 4   DT  H C5    1 
ATOM 9515 C C7    . DT  H 4 4   ? 35.056  35.506  84.172  1.00 44.81  ? 4   DT  H C7    1 
ATOM 9516 C C6    . DT  H 4 4   ? 32.625  35.715  84.481  1.00 33.13  ? 4   DT  H C6    1 
ATOM 9517 P P     . DG  H 4 5   ? 27.368  35.926  81.607  1.00 78.36  ? 5   DG  H P     1 
ATOM 9518 O OP1   . DG  H 4 5   ? 26.083  35.554  80.955  1.00 50.03  ? 5   DG  H OP1   1 
ATOM 9519 O OP2   . DG  H 4 5   ? 28.298  36.871  80.944  1.00 86.27  ? 5   DG  H OP2   1 
ATOM 9520 O "O5'" . DG  H 4 5   ? 26.936  36.475  83.051  1.00 78.14  ? 5   DG  H "O5'" 1 
ATOM 9521 C "C5'" . DG  H 4 5   ? 26.005  37.581  83.138  1.00 80.57  ? 5   DG  H "C5'" 1 
ATOM 9522 C "C4'" . DG  H 4 5   ? 26.693  38.923  83.481  1.00 67.60  ? 5   DG  H "C4'" 1 
ATOM 9523 O "O4'" . DG  H 4 5   ? 28.116  38.760  83.689  1.00 57.89  ? 5   DG  H "O4'" 1 
ATOM 9524 C "C3'" . DG  H 4 5   ? 26.557  40.011  82.429  1.00 63.91  ? 5   DG  H "C3'" 1 
ATOM 9525 O "O3'" . DG  H 4 5   ? 25.730  41.049  82.935  1.00 70.78  ? 5   DG  H "O3'" 1 
ATOM 9526 C "C2'" . DG  H 4 5   ? 28.010  40.472  82.181  1.00 67.56  ? 5   DG  H "C2'" 1 
ATOM 9527 C "C1'" . DG  H 4 5   ? 28.731  39.971  83.425  1.00 49.64  ? 5   DG  H "C1'" 1 
ATOM 9528 N N9    . DG  H 4 5   ? 30.132  39.690  83.213  1.00 39.31  ? 5   DG  H N9    1 
ATOM 9529 C C8    . DG  H 4 5   ? 30.663  38.776  82.318  1.00 51.05  ? 5   DG  H C8    1 
ATOM 9530 N N7    . DG  H 4 5   ? 31.971  38.681  82.354  1.00 37.25  ? 5   DG  H N7    1 
ATOM 9531 C C5    . DG  H 4 5   ? 32.319  39.607  83.318  1.00 31.29  ? 5   DG  H C5    1 
ATOM 9532 C C6    . DG  H 4 5   ? 33.588  39.945  83.757  1.00 33.89  ? 5   DG  H C6    1 
ATOM 9533 O O6    . DG  H 4 5   ? 34.667  39.470  83.339  1.00 41.27  ? 5   DG  H O6    1 
ATOM 9534 N N1    . DG  H 4 5   ? 33.556  40.936  84.756  1.00 25.87  ? 5   DG  H N1    1 
ATOM 9535 C C2    . DG  H 4 5   ? 32.391  41.526  85.258  1.00 42.73  ? 5   DG  H C2    1 
ATOM 9536 N N2    . DG  H 4 5   ? 32.563  42.501  86.252  1.00 27.48  ? 5   DG  H N2    1 
ATOM 9537 N N3    . DG  H 4 5   ? 31.134  41.182  84.825  1.00 28.67  ? 5   DG  H N3    1 
ATOM 9538 C C4    . DG  H 4 5   ? 31.196  40.242  83.859  1.00 27.68  ? 5   DG  H C4    1 
ATOM 9539 P P     . DA  H 4 6   ? 24.869  41.964  81.928  1.00 85.26  ? 6   DA  H P     1 
ATOM 9540 O OP1   . DA  H 4 6   ? 23.481  42.161  82.434  1.00 61.64  ? 6   DA  H OP1   1 
ATOM 9541 O OP2   . DA  H 4 6   ? 25.128  41.581  80.513  1.00 53.31  ? 6   DA  H OP2   1 
ATOM 9542 O "O5'" . DA  H 4 6   ? 25.579  43.334  82.119  1.00 68.91  ? 6   DA  H "O5'" 1 
ATOM 9543 C "C5'" . DA  H 4 6   ? 26.815  43.563  81.511  1.00 59.54  ? 6   DA  H "C5'" 1 
ATOM 9544 C "C4'" . DA  H 4 6   ? 27.508  44.602  82.305  1.00 49.07  ? 6   DA  H "C4'" 1 
ATOM 9545 O "O4'" . DA  H 4 6   ? 28.487  43.966  83.072  1.00 55.91  ? 6   DA  H "O4'" 1 
ATOM 9546 C "C3'" . DA  H 4 6   ? 28.173  45.702  81.519  1.00 62.22  ? 6   DA  H "C3'" 1 
ATOM 9547 O "O3'" . DA  H 4 6   ? 27.317  46.838  81.588  1.00 69.35  ? 6   DA  H "O3'" 1 
ATOM 9548 C "C2'" . DA  H 4 6   ? 29.426  45.963  82.327  1.00 70.54  ? 6   DA  H "C2'" 1 
ATOM 9549 C "C1'" . DA  H 4 6   ? 29.688  44.638  82.998  1.00 52.66  ? 6   DA  H "C1'" 1 
ATOM 9550 N N9    . DA  H 4 6   ? 30.635  43.793  82.294  1.00 40.24  ? 6   DA  H N9    1 
ATOM 9551 C C8    . DA  H 4 6   ? 30.375  42.818  81.384  1.00 36.54  ? 6   DA  H C8    1 
ATOM 9552 N N7    . DA  H 4 6   ? 31.462  42.196  80.964  1.00 33.83  ? 6   DA  H N7    1 
ATOM 9553 C C5    . DA  H 4 6   ? 32.481  42.812  81.654  1.00 24.12  ? 6   DA  H C5    1 
ATOM 9554 C C6    . DA  H 4 6   ? 33.859  42.637  81.636  1.00 27.48  ? 6   DA  H C6    1 
ATOM 9555 N N6    . DA  H 4 6   ? 34.457  41.739  80.861  1.00 39.40  ? 6   DA  H N6    1 
ATOM 9556 N N1    . DA  H 4 6   ? 34.613  43.394  82.460  1.00 37.58  ? 6   DA  H N1    1 
ATOM 9557 C C2    . DA  H 4 6   ? 33.995  44.295  83.254  1.00 49.22  ? 6   DA  H C2    1 
ATOM 9558 N N3    . DA  H 4 6   ? 32.684  44.592  83.330  1.00 36.83  ? 6   DA  H N3    1 
ATOM 9559 C C4    . DA  H 4 6   ? 31.985  43.791  82.486  1.00 35.49  ? 6   DA  H C4    1 
ATOM 9560 P P     . DC  H 4 7   ? 27.358  48.030  80.518  1.00 64.08  ? 7   DC  H P     1 
ATOM 9561 O OP1   . DC  H 4 7   ? 26.202  48.863  80.972  1.00 61.77  ? 7   DC  H OP1   1 
ATOM 9562 O OP2   . DC  H 4 7   ? 27.356  47.487  79.136  1.00 47.69  ? 7   DC  H OP2   1 
ATOM 9563 O "O5'" . DC  H 4 7   ? 28.726  48.782  80.862  1.00 45.22  ? 7   DC  H "O5'" 1 
ATOM 9564 C "C5'" . DC  H 4 7   ? 29.868  48.638  80.036  1.00 36.90  ? 7   DC  H "C5'" 1 
ATOM 9565 C "C4'" . DC  H 4 7   ? 31.086  49.141  80.790  1.00 54.37  ? 7   DC  H "C4'" 1 
ATOM 9566 O "O4'" . DC  H 4 7   ? 31.672  48.027  81.518  1.00 52.38  ? 7   DC  H "O4'" 1 
ATOM 9567 C "C3'" . DC  H 4 7   ? 32.194  49.797  79.948  1.00 52.78  ? 7   DC  H "C3'" 1 
ATOM 9568 O "O3'" . DC  H 4 7   ? 32.156  51.235  80.133  1.00 57.06  ? 7   DC  H "O3'" 1 
ATOM 9569 C "C2'" . DC  H 4 7   ? 33.497  49.205  80.511  1.00 64.37  ? 7   DC  H "C2'" 1 
ATOM 9570 C "C1'" . DC  H 4 7   ? 33.053  47.924  81.282  1.00 48.66  ? 7   DC  H "C1'" 1 
ATOM 9571 N N1    . DC  H 4 7   ? 33.308  46.706  80.505  1.00 38.05  ? 7   DC  H N1    1 
ATOM 9572 C C2    . DC  H 4 7   ? 34.587  46.217  80.431  1.00 46.58  ? 7   DC  H C2    1 
ATOM 9573 O O2    . DC  H 4 7   ? 35.484  46.792  81.093  1.00 55.29  ? 7   DC  H O2    1 
ATOM 9574 N N3    . DC  H 4 7   ? 34.824  45.118  79.649  1.00 37.46  ? 7   DC  H N3    1 
ATOM 9575 C C4    . DC  H 4 7   ? 33.827  44.557  78.969  1.00 37.78  ? 7   DC  H C4    1 
ATOM 9576 N N4    . DC  H 4 7   ? 34.092  43.496  78.194  1.00 52.87  ? 7   DC  H N4    1 
ATOM 9577 C C5    . DC  H 4 7   ? 32.516  45.048  79.049  1.00 36.12  ? 7   DC  H C5    1 
ATOM 9578 C C6    . DC  H 4 7   ? 32.306  46.125  79.805  1.00 45.80  ? 7   DC  H C6    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   76  ?   ?   ?   A . n 
A 1 2   SER 2   77  ?   ?   ?   A . n 
A 1 3   HIS 3   78  ?   ?   ?   A . n 
A 1 4   MET 4   79  ?   ?   ?   A . n 
A 1 5   SER 5   80  ?   ?   ?   A . n 
A 1 6   ARG 6   81  81  ARG ARG A . n 
A 1 7   GLU 7   82  82  GLU GLU A . n 
A 1 8   LEU 8   83  83  LEU LEU A . n 
A 1 9   LYS 9   84  84  LYS LYS A . n 
A 1 10  THR 10  85  85  THR THR A . n 
A 1 11  VAL 11  86  86  VAL VAL A . n 
A 1 12  SER 12  87  87  SER SER A . n 
A 1 13  ALA 13  88  88  ALA ALA A . n 
A 1 14  ASP 14  89  89  ASP ASP A . n 
A 1 15  CYS 15  90  90  CYS CYS A . n 
A 1 16  LYS 16  91  91  LYS LYS A . n 
A 1 17  LYS 17  92  92  LYS LYS A . n 
A 1 18  GLU 18  93  93  GLU GLU A . n 
A 1 19  ALA 19  94  94  ALA ALA A . n 
A 1 20  ILE 20  95  95  ILE ILE A . n 
A 1 21  GLU 21  96  96  GLU GLU A . n 
A 1 22  LYS 22  97  97  LYS LYS A . n 
A 1 23  CYS 23  98  98  CYS CYS A . n 
A 1 24  ALA 24  99  99  ALA ALA A . n 
A 1 25  GLN 25  100 100 GLN GLN A . n 
A 1 26  TRP 26  101 101 TRP TRP A . n 
A 1 27  VAL 27  102 102 VAL VAL A . n 
A 1 28  VAL 28  103 103 VAL VAL A . n 
A 1 29  ARG 29  104 104 ARG ARG A . n 
A 1 30  ASP 30  105 105 ASP ASP A . n 
A 1 31  CYS 31  106 106 CYS CYS A . n 
A 1 32  ARG 32  107 107 ARG ARG A . n 
A 1 33  PRO 33  108 108 PRO PRO A . n 
A 1 34  PHE 34  109 109 PHE PHE A . n 
A 1 35  SER 35  110 110 SER SER A . n 
A 1 36  ALA 36  111 111 ALA ALA A . n 
A 1 37  VAL 37  112 112 VAL VAL A . n 
A 1 38  SER 38  113 113 SER SER A . n 
A 1 39  GLY 39  114 114 GLY GLY A . n 
A 1 40  SER 40  115 115 SER SER A . n 
A 1 41  GLY 41  116 116 GLY GLY A . n 
A 1 42  PHE 42  117 117 PHE PHE A . n 
A 1 43  ILE 43  118 118 ILE ILE A . n 
A 1 44  ASP 44  119 119 ASP ASP A . n 
A 1 45  MET 45  120 120 MET MET A . n 
A 1 46  ILE 46  121 121 ILE ILE A . n 
A 1 47  LYS 47  122 122 LYS LYS A . n 
A 1 48  PHE 48  123 123 PHE PHE A . n 
A 1 49  PHE 49  124 124 PHE PHE A . n 
A 1 50  ILE 50  125 125 ILE ILE A . n 
A 1 51  LYS 51  126 126 LYS LYS A . n 
A 1 52  VAL 52  127 127 VAL VAL A . n 
A 1 53  GLY 53  128 128 GLY GLY A . n 
A 1 54  ALA 54  129 129 ALA ALA A . n 
A 1 55  GLU 55  130 130 GLU GLU A . n 
A 1 56  TYR 56  131 131 TYR TYR A . n 
A 1 57  GLY 57  132 132 GLY GLY A . n 
A 1 58  GLU 58  133 133 GLU GLU A . n 
A 1 59  HIS 59  134 134 HIS HIS A . n 
A 1 60  VAL 60  135 135 VAL VAL A . n 
A 1 61  ASN 61  136 136 ASN ASN A . n 
A 1 62  VAL 62  137 137 VAL VAL A . n 
A 1 63  GLU 63  138 138 GLU GLU A . n 
A 1 64  GLU 64  139 139 GLU GLU A . n 
A 1 65  LEU 65  140 140 LEU LEU A . n 
A 1 66  LEU 66  141 141 LEU LEU A . n 
A 1 67  PRO 67  142 142 PRO PRO A . n 
A 1 68  SER 68  143 143 SER SER A . n 
A 1 69  PRO 69  144 144 PRO PRO A . n 
A 1 70  ILE 70  145 145 ILE ILE A . n 
A 1 71  THR 71  146 146 THR THR A . n 
A 1 72  LEU 72  147 147 LEU LEU A . n 
A 1 73  SER 73  148 148 SER SER A . n 
A 1 74  ARG 74  149 149 ARG ARG A . n 
A 1 75  LYS 75  150 150 LYS LYS A . n 
A 1 76  VAL 76  151 151 VAL VAL A . n 
A 1 77  THR 77  152 152 THR THR A . n 
A 1 78  SER 78  153 153 SER SER A . n 
A 1 79  ASP 79  154 154 ASP ASP A . n 
A 1 80  ALA 80  155 155 ALA ALA A . n 
A 1 81  LYS 81  156 156 LYS LYS A . n 
A 1 82  GLU 82  157 157 GLU GLU A . n 
A 1 83  LYS 83  158 158 LYS LYS A . n 
A 1 84  LYS 84  159 159 LYS LYS A . n 
A 1 85  ALA 85  160 160 ALA ALA A . n 
A 1 86  LEU 86  161 161 LEU LEU A . n 
A 1 87  ILE 87  162 162 ILE ILE A . n 
A 1 88  SER 88  163 163 SER SER A . n 
A 1 89  ARG 89  164 164 ARG ARG A . n 
A 1 90  GLU 90  165 165 GLU GLU A . n 
A 1 91  ILE 91  166 166 ILE ILE A . n 
A 1 92  LYS 92  167 167 LYS LYS A . n 
A 1 93  SER 93  168 168 SER SER A . n 
A 1 94  ALA 94  169 169 ALA ALA A . n 
A 1 95  VAL 95  170 170 VAL VAL A . n 
A 1 96  GLU 96  171 171 GLU GLU A . n 
A 1 97  LYS 97  172 172 LYS LYS A . n 
A 1 98  ASP 98  173 173 ASP ASP A . n 
A 1 99  GLY 99  174 174 GLY GLY A . n 
A 1 100 ALA 100 175 175 ALA ALA A . n 
A 1 101 SER 101 176 176 SER SER A . n 
A 1 102 ALA 102 177 177 ALA ALA A . n 
A 1 103 THR 103 178 178 THR THR A . n 
A 1 104 ILE 104 179 179 ILE ILE A . n 
A 1 105 ASP 105 180 180 ASP ASP A . n 
A 1 106 LEU 106 181 181 LEU LEU A . n 
A 1 107 TRP 107 182 182 TRP TRP A . n 
A 1 108 THR 108 183 183 THR THR A . n 
A 1 109 ASP 109 184 184 ASP ASP A . n 
A 1 110 ASN 110 185 185 ASN ASN A . n 
A 1 111 TYR 111 186 186 TYR TYR A . n 
A 1 112 ILE 112 187 187 ILE ILE A . n 
A 1 113 LYS 113 188 188 LYS LYS A . n 
A 1 114 ARG 114 189 189 ARG ARG A . n 
A 1 115 ASN 115 190 190 ASN ASN A . n 
A 1 116 PHE 116 191 191 PHE PHE A . n 
A 1 117 LEU 117 192 192 LEU LEU A . n 
A 1 118 GLY 118 193 193 GLY GLY A . n 
A 1 119 VAL 119 194 194 VAL VAL A . n 
A 1 120 THR 120 195 195 THR THR A . n 
A 1 121 LEU 121 196 196 LEU LEU A . n 
A 1 122 HIS 122 197 197 HIS HIS A . n 
A 1 123 TYR 123 198 198 TYR TYR A . n 
A 1 124 HIS 124 199 199 HIS HIS A . n 
A 1 125 GLU 125 200 200 GLU GLU A . n 
A 1 126 ASN 126 201 201 ASN ASN A . n 
A 1 127 ASN 127 202 202 ASN ASN A . n 
A 1 128 GLU 128 203 203 GLU GLU A . n 
A 1 129 LEU 129 204 204 LEU LEU A . n 
A 1 130 ARG 130 205 205 ARG ARG A . n 
A 1 131 ASP 131 206 206 ASP ASP A . n 
A 1 132 LEU 132 207 207 LEU LEU A . n 
A 1 133 ILE 133 208 208 ILE ILE A . n 
A 1 134 LEU 134 209 209 LEU LEU A . n 
A 1 135 GLY 135 210 210 GLY GLY A . n 
A 1 136 LEU 136 211 211 LEU LEU A . n 
A 1 137 LYS 137 212 212 LYS LYS A . n 
A 1 138 SER 138 213 213 SER SER A . n 
A 1 139 LEU 139 214 214 LEU LEU A . n 
A 1 140 ASP 140 215 215 ASP ASP A . n 
A 1 141 PHE 141 216 216 PHE PHE A . n 
A 1 142 GLU 142 217 217 GLU GLU A . n 
A 1 143 ARG 143 218 218 ARG ARG A . n 
A 1 144 SER 144 219 219 SER SER A . n 
A 1 145 THR 145 220 220 THR THR A . n 
A 1 146 ALA 146 221 221 ALA ALA A . n 
A 1 147 GLU 147 222 222 GLU GLU A . n 
A 1 148 ASN 148 223 223 ASN ASN A . n 
A 1 149 ILE 149 224 224 ILE ILE A . n 
A 1 150 TYR 150 225 225 TYR TYR A . n 
A 1 151 LYS 151 226 226 LYS LYS A . n 
A 1 152 LYS 152 227 227 LYS LYS A . n 
A 1 153 LEU 153 228 228 LEU LEU A . n 
A 1 154 LYS 154 229 229 LYS LYS A . n 
A 1 155 ALA 155 230 230 ALA ALA A . n 
A 1 156 ILE 156 231 231 ILE ILE A . n 
A 1 157 PHE 157 232 232 PHE PHE A . n 
A 1 158 SER 158 233 233 SER SER A . n 
A 1 159 GLN 159 234 234 GLN GLN A . n 
A 1 160 PHE 160 235 235 PHE PHE A . n 
A 1 161 ASN 161 236 236 ASN ASN A . n 
A 1 162 VAL 162 237 237 VAL VAL A . n 
A 1 163 GLU 163 238 238 GLU GLU A . n 
A 1 164 ASP 164 239 239 ASP ASP A . n 
A 1 165 LEU 165 240 240 LEU LEU A . n 
A 1 166 SER 166 241 241 SER SER A . n 
A 1 167 SER 167 242 242 SER SER A . n 
A 1 168 ILE 168 243 243 ILE ILE A . n 
A 1 169 LYS 169 244 244 LYS LYS A . n 
A 1 170 PHE 170 245 245 PHE PHE A . n 
A 1 171 VAL 171 246 246 VAL VAL A . n 
A 1 172 THR 172 247 247 THR THR A . n 
A 1 173 ASP 173 248 248 ASP ASP A . n 
A 1 174 ARG 174 249 249 ARG ARG A . n 
A 1 175 GLY 175 250 250 GLY GLY A . n 
A 1 176 ALA 176 251 251 ALA ALA A . n 
A 1 177 ASN 177 252 252 ASN ASN A . n 
A 1 178 VAL 178 253 253 VAL VAL A . n 
A 1 179 VAL 179 254 254 VAL VAL A . n 
A 1 180 LYS 180 255 255 LYS LYS A . n 
A 1 181 SER 181 256 256 SER SER A . n 
A 1 182 LEU 182 257 257 LEU LEU A . n 
A 1 183 ALA 183 258 258 ALA ALA A . n 
A 1 184 ASN 184 259 259 ASN ASN A . n 
A 1 185 ASN 185 260 260 ASN ASN A . n 
A 1 186 ILE 186 261 261 ILE ILE A . n 
A 1 187 ARG 187 262 262 ARG ARG A . n 
A 1 188 ILE 188 263 263 ILE ILE A . n 
A 1 189 ASN 189 264 264 ASN ASN A . n 
A 1 190 CYS 190 265 265 CYS CYS A . n 
A 1 191 SER 191 266 266 SER SER A . n 
A 1 192 SER 192 267 267 SER SER A . n 
A 1 193 HIS 193 268 268 HIS HIS A . n 
A 1 194 LEU 194 269 269 LEU LEU A . n 
A 1 195 LEU 195 270 270 LEU LEU A . n 
A 1 196 SER 196 271 271 SER SER A . n 
A 1 197 ASN 197 272 272 ASN ASN A . n 
A 1 198 VAL 198 273 273 VAL VAL A . n 
A 1 199 LEU 199 274 274 LEU LEU A . n 
A 1 200 GLU 200 275 275 GLU GLU A . n 
A 1 201 ASN 201 276 276 ASN ASN A . n 
A 1 202 SER 202 277 277 SER SER A . n 
A 1 203 PHE 203 278 278 PHE PHE A . n 
A 1 204 GLU 204 279 279 GLU GLU A . n 
A 1 205 GLU 205 280 280 GLU GLU A . n 
A 1 206 THR 206 281 281 THR THR A . n 
A 1 207 PRO 207 282 282 PRO PRO A . n 
A 1 208 GLU 208 283 283 GLU GLU A . n 
A 1 209 LEU 209 284 284 LEU LEU A . n 
A 1 210 ASN 210 285 285 ASN ASN A . n 
A 1 211 MET 211 286 286 MET MET A . n 
A 1 212 PRO 212 287 287 PRO PRO A . n 
A 1 213 ILE 213 288 288 ILE ILE A . n 
A 1 214 LEU 214 289 289 LEU LEU A . n 
A 1 215 ALA 215 290 290 ALA ALA A . n 
A 1 216 CYS 216 291 291 CYS CYS A . n 
A 1 217 LYS 217 292 292 LYS LYS A . n 
A 1 218 ASN 218 293 293 ASN ASN A . n 
A 1 219 ILE 219 294 294 ILE ILE A . n 
A 1 220 VAL 220 295 295 VAL VAL A . n 
A 1 221 LYS 221 296 296 LYS LYS A . n 
A 1 222 TYR 222 297 297 TYR TYR A . n 
A 1 223 PHE 223 298 298 PHE PHE A . n 
A 1 224 LYS 224 299 299 LYS LYS A . n 
A 1 225 LYS 225 300 300 LYS LYS A . n 
A 1 226 ALA 226 301 301 ALA ALA A . n 
A 1 227 ASN 227 302 302 ASN ASN A . n 
A 1 228 LEU 228 303 303 LEU LEU A . n 
A 1 229 GLN 229 304 304 GLN GLN A . n 
A 1 230 HIS 230 305 305 HIS HIS A . n 
A 1 231 ARG 231 306 306 ARG ARG A . n 
A 1 232 LEU 232 307 307 LEU LEU A . n 
A 1 233 ARG 233 308 308 ARG ARG A . n 
A 1 234 SER 234 309 309 SER SER A . n 
A 1 235 SER 235 310 310 SER SER A . n 
A 1 236 LEU 236 311 311 LEU LEU A . n 
A 1 237 LYS 237 312 312 LYS LYS A . n 
A 1 238 SER 238 313 313 SER SER A . n 
A 1 239 GLU 239 314 314 GLU GLU A . n 
A 1 240 CYS 240 315 315 CYS CYS A . n 
A 1 241 PRO 241 316 316 PRO PRO A . n 
A 1 242 THR 242 317 317 THR THR A . n 
A 1 243 ARG 243 318 318 ARG ARG A . n 
A 1 244 TRP 244 319 319 TRP TRP A . n 
A 1 245 ASN 245 320 320 ASN ASN A . n 
A 1 246 SER 246 321 321 SER SER A . n 
A 1 247 THR 247 322 322 THR THR A . n 
A 1 248 TYR 248 323 323 TYR TYR A . n 
A 1 249 THR 249 324 324 THR THR A . n 
A 1 250 MET 250 325 325 MET MET A . n 
A 1 251 LEU 251 326 326 LEU LEU A . n 
A 1 252 ARG 252 327 327 ARG ARG A . n 
A 1 253 SER 253 328 328 SER SER A . n 
A 1 254 ILE 254 329 329 ILE ILE A . n 
A 1 255 LEU 255 330 330 LEU LEU A . n 
A 1 256 ASP 256 331 331 ASP ASP A . n 
A 1 257 ASN 257 332 332 ASN ASN A . n 
A 1 258 TRP 258 333 333 TRP TRP A . n 
A 1 259 GLU 259 334 334 GLU GLU A . n 
A 1 260 SER 260 335 335 SER SER A . n 
A 1 261 VAL 261 336 336 VAL VAL A . n 
A 1 262 ILE 262 337 337 ILE ILE A . n 
A 1 263 GLN 263 338 338 GLN GLN A . n 
A 1 264 ILE 264 339 339 ILE ILE A . n 
A 1 265 LEU 265 340 340 LEU LEU A . n 
A 1 266 SER 266 341 341 SER SER A . n 
A 1 267 GLU 267 342 342 GLU GLU A . n 
A 1 268 ALA 268 343 343 ALA ALA A . n 
A 1 269 GLY 269 344 344 GLY GLY A . n 
A 1 270 GLU 270 345 345 GLU GLU A . n 
A 1 271 THR 271 346 346 THR THR A . n 
A 1 272 GLN 272 347 347 GLN GLN A . n 
A 1 273 ARG 273 348 348 ARG ARG A . n 
A 1 274 ILE 274 349 349 ILE ILE A . n 
A 1 275 VAL 275 350 350 VAL VAL A . n 
A 1 276 HIS 276 351 351 HIS HIS A . n 
A 1 277 ILE 277 352 352 ILE ILE A . n 
A 1 278 ASN 278 353 353 ASN ASN A . n 
A 1 279 LYS 279 354 354 LYS LYS A . n 
A 1 280 SER 280 355 355 SER SER A . n 
A 1 281 ILE 281 356 356 ILE ILE A . n 
A 1 282 ILE 282 357 357 ILE ILE A . n 
A 1 283 GLN 283 358 358 GLN GLN A . n 
A 1 284 THR 284 359 359 THR THR A . n 
A 1 285 MET 285 360 360 MET MET A . n 
A 1 286 VAL 286 361 361 VAL VAL A . n 
A 1 287 ASN 287 362 362 ASN ASN A . n 
A 1 288 ILE 288 363 363 ILE ILE A . n 
A 1 289 LEU 289 364 364 LEU LEU A . n 
A 1 290 ASP 290 365 365 ASP ASP A . n 
A 1 291 GLY 291 366 366 GLY GLY A . n 
A 1 292 PHE 292 367 367 PHE PHE A . n 
A 1 293 GLU 293 368 368 GLU GLU A . n 
A 1 294 ARG 294 369 369 ARG ARG A . n 
A 1 295 ILE 295 370 370 ILE ILE A . n 
A 1 296 PHE 296 371 371 PHE PHE A . n 
A 1 297 LYS 297 372 372 LYS LYS A . n 
A 1 298 GLU 298 373 373 GLU GLU A . n 
A 1 299 LEU 299 374 374 LEU LEU A . n 
A 1 300 GLN 300 375 375 GLN GLN A . n 
A 1 301 THR 301 376 376 THR THR A . n 
A 1 302 CYS 302 377 377 CYS CYS A . n 
A 1 303 SER 303 378 378 SER SER A . n 
A 1 304 SER 304 379 379 SER SER A . n 
A 1 305 PRO 305 380 380 PRO PRO A . n 
A 1 306 SER 306 381 381 SER SER A . n 
A 1 307 LEU 307 382 382 LEU LEU A . n 
A 1 308 CYS 308 383 383 CYS CYS A . n 
A 1 309 PHE 309 384 384 PHE PHE A . n 
A 1 310 VAL 310 385 385 VAL VAL A . n 
A 1 311 VAL 311 386 386 VAL VAL A . n 
A 1 312 PRO 312 387 387 PRO PRO A . n 
A 1 313 SER 313 388 388 SER SER A . n 
A 1 314 ILE 314 389 389 ILE ILE A . n 
A 1 315 LEU 315 390 390 LEU LEU A . n 
A 1 316 LYS 316 391 391 LYS LYS A . n 
A 1 317 VAL 317 392 392 VAL VAL A . n 
A 1 318 LYS 318 393 393 LYS LYS A . n 
A 1 319 GLU 319 394 394 GLU GLU A . n 
A 1 320 ILE 320 395 395 ILE ILE A . n 
A 1 321 CYS 321 396 396 CYS CYS A . n 
A 1 322 SER 322 397 397 SER SER A . n 
A 1 323 PRO 323 398 398 PRO PRO A . n 
A 1 324 ASP 324 399 399 ASP ASP A . n 
A 1 325 VAL 325 400 400 VAL VAL A . n 
A 1 326 GLY 326 401 401 GLY GLY A . n 
A 1 327 ASP 327 402 402 ASP ASP A . n 
A 1 328 VAL 328 403 403 VAL VAL A . n 
A 1 329 ALA 329 404 404 ALA ALA A . n 
A 1 330 ASP 330 405 405 ASP ASP A . n 
A 1 331 ILE 331 406 406 ILE ILE A . n 
A 1 332 ALA 332 407 407 ALA ALA A . n 
A 1 333 LYS 333 408 408 LYS LYS A . n 
A 1 334 LEU 334 409 409 LEU LEU A . n 
A 1 335 LYS 335 410 410 LYS LYS A . n 
A 1 336 VAL 336 411 411 VAL VAL A . n 
A 1 337 ASN 337 412 412 ASN ASN A . n 
A 1 338 ILE 338 413 413 ILE ILE A . n 
A 1 339 ILE 339 414 414 ILE ILE A . n 
A 1 340 LYS 340 415 415 LYS LYS A . n 
A 1 341 ASN 341 416 416 ASN ASN A . n 
A 1 342 VAL 342 417 417 VAL VAL A . n 
A 1 343 ARG 343 418 418 ARG ARG A . n 
A 1 344 ILE 344 419 419 ILE ILE A . n 
A 1 345 ILE 345 420 420 ILE ILE A . n 
A 1 346 TRP 346 421 421 TRP TRP A . n 
A 1 347 GLU 347 422 422 GLU GLU A . n 
A 1 348 GLU 348 423 423 GLU GLU A . n 
A 1 349 ASN 349 424 424 ASN ASN A . n 
A 1 350 LEU 350 425 425 LEU LEU A . n 
A 1 351 SER 351 426 426 SER SER A . n 
A 1 352 ILE 352 427 427 ILE ILE A . n 
A 1 353 TRP 353 428 428 TRP TRP A . n 
A 1 354 HIS 354 429 429 HIS HIS A . n 
A 1 355 TYR 355 430 430 TYR TYR A . n 
A 1 356 THR 356 431 431 THR THR A . n 
A 1 357 ALA 357 432 432 ALA ALA A . n 
A 1 358 PHE 358 433 433 PHE PHE A . n 
A 1 359 PHE 359 434 434 PHE PHE A . n 
A 1 360 PHE 360 435 435 PHE PHE A . n 
A 1 361 TYR 361 436 436 TYR TYR A . n 
A 1 362 PRO 362 437 437 PRO PRO A . n 
A 1 363 PRO 363 438 438 PRO PRO A . n 
A 1 364 ALA 364 439 439 ALA ALA A . n 
A 1 365 LEU 365 440 440 LEU LEU A . n 
A 1 366 HIS 366 441 441 HIS HIS A . n 
A 1 367 MET 367 442 442 MET MET A . n 
A 1 368 GLN 368 443 443 GLN GLN A . n 
A 1 369 GLN 369 444 444 GLN GLN A . n 
A 1 370 GLU 370 445 445 GLU GLU A . n 
A 1 371 LYS 371 446 446 LYS LYS A . n 
A 1 372 VAL 372 447 447 VAL VAL A . n 
A 1 373 ALA 373 448 448 ALA ALA A . n 
A 1 374 GLN 374 449 449 GLN GLN A . n 
A 1 375 ILE 375 450 450 ILE ILE A . n 
A 1 376 LYS 376 451 451 LYS LYS A . n 
A 1 377 GLU 377 452 452 GLU GLU A . n 
A 1 378 PHE 378 453 453 PHE PHE A . n 
A 1 379 CYS 379 454 454 CYS CYS A . n 
A 1 380 LEU 380 455 455 LEU LEU A . n 
A 1 381 SER 381 456 456 SER SER A . n 
A 1 382 LYS 382 457 457 LYS LYS A . n 
A 1 383 MET 383 458 458 MET MET A . n 
A 1 384 GLU 384 459 459 GLU GLU A . n 
A 1 385 ASP 385 460 460 ASP ASP A . n 
A 1 386 LEU 386 461 461 LEU LEU A . n 
A 1 387 GLU 387 462 462 GLU GLU A . n 
A 1 388 LEU 388 463 463 LEU LEU A . n 
A 1 389 ILE 389 484 ?   ?   ?   A . n 
A 1 390 ASN 390 485 ?   ?   ?   A . n 
A 1 391 ARG 391 486 ?   ?   ?   A . n 
A 1 392 MET 392 487 ?   ?   ?   A . n 
A 1 393 SER 393 488 ?   ?   ?   A . n 
A 1 394 SER 394 489 ?   ?   ?   A . n 
A 1 395 PHE 395 490 ?   ?   ?   A . n 
A 1 396 ASN 396 491 ?   ?   ?   A . n 
A 1 397 GLU 397 492 ?   ?   ?   A . n 
A 1 398 LEU 398 493 ?   ?   ?   A . n 
A 1 399 SER 399 494 ?   ?   ?   A . n 
A 1 400 ALA 400 495 ?   ?   ?   A . n 
A 1 401 THR 401 496 ?   ?   ?   A . n 
A 1 402 GLN 402 497 ?   ?   ?   A . n 
A 1 403 LEU 403 498 ?   ?   ?   A . n 
A 1 404 ASN 404 499 ?   ?   ?   A . n 
A 1 405 GLN 405 500 ?   ?   ?   A . n 
A 1 406 SER 406 501 ?   ?   ?   A . n 
A 1 407 ASP 407 502 ?   ?   ?   A . n 
A 1 408 SER 408 503 ?   ?   ?   A . n 
A 1 409 ASN 409 504 ?   ?   ?   A . n 
A 1 410 SER 410 505 ?   ?   ?   A . n 
A 1 411 HIS 411 506 ?   ?   ?   A . n 
A 1 412 ASN 412 507 ?   ?   ?   A . n 
A 1 413 SER 413 508 ?   ?   ?   A . n 
A 1 414 ILE 414 509 ?   ?   ?   A . n 
A 1 415 ASP 415 510 ?   ?   ?   A . n 
A 1 416 LEU 416 511 ?   ?   ?   A . n 
A 1 417 THR 417 512 ?   ?   ?   A . n 
A 1 418 SER 418 513 ?   ?   ?   A . n 
A 1 419 HIS 419 514 ?   ?   ?   A . n 
A 1 420 SER 420 515 ?   ?   ?   A . n 
A 1 421 LYS 421 516 ?   ?   ?   A . n 
A 1 422 PRO 422 517 517 PRO PRO A . n 
A 1 423 VAL 423 518 518 VAL VAL A . n 
A 1 424 SER 424 519 519 SER SER A . n 
A 1 425 PRO 425 520 520 PRO PRO A . n 
A 1 426 SER 426 521 521 SER SER A . n 
A 1 427 ASP 427 522 522 ASP ASP A . n 
A 1 428 GLU 428 523 523 GLU GLU A . n 
A 1 429 PHE 429 524 524 PHE PHE A . n 
A 1 430 GLU 430 525 525 GLU GLU A . n 
A 1 431 PHE 431 526 526 PHE PHE A . n 
A 1 432 TYR 432 527 527 TYR TYR A . n 
A 1 433 ARG 433 528 528 ARG ARG A . n 
A 1 434 LYS 434 529 529 LYS LYS A . n 
A 1 435 GLU 435 530 530 GLU GLU A . n 
A 1 436 ILE 436 531 531 ILE ILE A . n 
A 1 437 VAL 437 532 532 VAL VAL A . n 
A 1 438 ILE 438 533 533 ILE ILE A . n 
A 1 439 LEU 439 534 534 LEU LEU A . n 
A 1 440 SER 440 535 535 SER SER A . n 
A 1 441 GLU 441 536 536 GLU GLU A . n 
A 1 442 ASP 442 537 537 ASP ASP A . n 
A 1 443 PHE 443 538 538 PHE PHE A . n 
A 1 444 LYS 444 539 539 LYS LYS A . n 
A 1 445 VAL 445 540 540 VAL VAL A . n 
A 1 446 MET 446 541 541 MET MET A . n 
A 1 447 GLU 447 542 542 GLU GLU A . n 
A 1 448 TRP 448 543 543 TRP TRP A . n 
A 1 449 TRP 449 544 544 TRP TRP A . n 
A 1 450 ASN 450 545 545 ASN ASN A . n 
A 1 451 LEU 451 546 546 LEU LEU A . n 
A 1 452 ASN 452 547 547 ASN ASN A . n 
A 1 453 SER 453 548 548 SER SER A . n 
A 1 454 LYS 454 549 549 LYS LYS A . n 
A 1 455 LYS 455 550 550 LYS LYS A . n 
A 1 456 TYR 456 551 551 TYR TYR A . n 
A 1 457 PRO 457 552 552 PRO PRO A . n 
A 1 458 LYS 458 553 553 LYS LYS A . n 
A 1 459 LEU 459 554 554 LEU LEU A . n 
A 1 460 SER 460 555 555 SER SER A . n 
A 1 461 LYS 461 556 556 LYS LYS A . n 
A 1 462 LEU 462 557 557 LEU LEU A . n 
A 1 463 ALA 463 558 558 ALA ALA A . n 
A 1 464 LEU 464 559 559 LEU LEU A . n 
A 1 465 SER 465 560 560 SER SER A . n 
A 1 466 LEU 466 561 561 LEU LEU A . n 
A 1 467 LEU 467 562 562 LEU LEU A . n 
A 1 468 SER 468 563 563 SER SER A . n 
A 1 469 ILE 469 564 564 ILE ILE A . n 
A 1 470 PRO 470 565 565 PRO PRO A . n 
A 1 471 ALA 471 566 566 ALA ALA A . n 
A 1 472 SER 472 567 567 SER SER A . n 
A 1 473 SER 473 568 568 SER SER A . n 
A 1 474 ALA 474 569 569 ALA ALA A . n 
A 1 475 ALA 475 570 570 ALA ALA A . n 
A 1 476 SER 476 571 571 SER SER A . n 
A 1 477 GLU 477 572 572 GLU GLU A . n 
A 1 478 ARG 478 573 573 ARG ARG A . n 
A 1 479 THR 479 574 574 THR THR A . n 
A 1 480 PHE 480 575 575 PHE PHE A . n 
A 1 481 SER 481 576 576 SER SER A . n 
A 1 482 LEU 482 577 577 LEU LEU A . n 
A 1 483 ALA 483 578 578 ALA ALA A . n 
A 1 484 GLY 484 579 579 GLY GLY A . n 
A 1 485 ASN 485 580 580 ASN ASN A . n 
A 1 486 ILE 486 581 581 ILE ILE A . n 
A 1 487 ILE 487 582 582 ILE ILE A . n 
A 1 488 THR 488 583 583 THR THR A . n 
A 1 489 GLU 489 584 584 GLU GLU A . n 
A 1 490 LYS 490 585 585 LYS LYS A . n 
A 1 491 ARG 491 586 586 ARG ARG A . n 
A 1 492 ASN 492 587 587 ASN ASN A . n 
A 1 493 ARG 493 588 588 ARG ARG A . n 
A 1 494 ILE 494 589 589 ILE ILE A . n 
A 1 495 GLY 495 590 590 GLY GLY A . n 
A 1 496 GLN 496 591 591 GLN GLN A . n 
A 1 497 GLN 497 592 592 GLN GLN A . n 
A 1 498 THR 498 593 593 THR THR A . n 
A 1 499 VAL 499 594 594 VAL VAL A . n 
A 1 500 ASP 500 595 595 ASP ASP A . n 
A 1 501 SER 501 596 596 SER SER A . n 
A 1 502 LEU 502 597 597 LEU LEU A . n 
A 1 503 LEU 503 598 598 LEU LEU A . n 
A 1 504 PHE 504 599 599 PHE PHE A . n 
A 1 505 LEU 505 600 600 LEU LEU A . n 
A 1 506 ASN 506 601 601 ASN ASN A . n 
A 1 507 SER 507 602 602 SER SER A . n 
A 1 508 PHE 508 603 603 PHE PHE A . n 
A 1 509 TYR 509 604 604 TYR TYR A . n 
A 1 510 LYS 510 605 605 LYS LYS A . n 
A 1 511 ASN 511 606 606 ASN ASN A . n 
A 1 512 PHE 512 607 607 PHE PHE A . n 
A 1 513 CYS 513 608 608 CYS CYS A . n 
A 1 514 LYS 514 609 609 LYS LYS A . n 
A 1 515 LEU 515 610 ?   ?   ?   A . n 
A 1 516 ASP 516 611 ?   ?   ?   A . n 
A 1 517 ILE 517 612 ?   ?   ?   A . n 
B 2 1   DG  1   2   2   DG  DG  B . n 
B 2 2   DA  2   3   3   DA  DA  B . n 
B 2 3   DG  3   4   4   DG  DG  B . n 
B 2 4   DA  4   5   5   DA  DA  B . n 
B 2 5   DA  5   6   6   DA  DA  B . n 
B 2 6   DC  6   7   7   DC  DC  B . n 
B 2 7   DA  7   8   8   DA  DA  B . n 
B 2 8   DA  8   9   9   DA  DA  B . n 
B 2 9   DC  9   10  10  DC  DC  B . n 
B 2 10  DA  10  11  11  DA  DA  B . n 
B 2 11  DA  11  12  12  DA  DA  B . n 
B 2 12  DC  12  13  13  DC  DC  B . n 
B 2 13  DA  13  14  14  DA  DA  B . n 
B 2 14  DA  14  15  15  DA  DA  B . n 
B 2 15  DG  15  16  16  DG  DG  B . n 
C 3 1   DC  1   1   1   DC  DC  C . n 
C 3 2   DT  2   2   2   DT  DT  C . n 
C 3 3   DT  3   3   3   DT  DT  C . n 
C 3 4   DG  4   4   4   DG  DG  C . n 
C 3 5   DT  5   5   5   DT  DT  C . n 
C 3 6   DT  6   6   6   DT  DT  C . n 
C 3 7   DG  7   7   7   DG  DG  C . n 
C 3 8   DT  8   8   8   DT  DT  C . n 
C 3 9   DT  9   9   9   DT  DT  C . n 
C 3 10  DG  10  10  10  DG  DG  C . n 
C 3 11  DT  11  11  11  DT  DT  C . n 
C 3 12  DT  12  12  12  DT  DT  C . n 
C 3 13  DC  13  13  13  DC  DC  C . n 
C 3 14  DT  14  14  14  DT  DT  C . n 
C 3 15  DC  15  15  15  DC  DC  C . n 
C 3 16  DT  16  16  16  DT  DT  C . n 
C 3 17  DG  17  17  17  DG  DG  C . n 
C 3 18  DG  18  18  18  DG  DG  C . n 
C 3 19  DG  19  19  19  DG  DG  C . n 
C 3 20  DT  20  20  20  DT  DT  C . n 
C 3 21  DC  21  21  21  DC  DC  C . n 
C 3 22  DA  22  22  22  DA  DA  C . n 
C 3 23  DC  23  23  23  DC  DC  C . n 
C 3 24  DG  24  24  24  DG  DG  C . n 
C 3 25  DC  25  25  25  DC  DC  C . n 
C 3 26  DG  26  26  ?   ?   ?   C . n 
D 4 1   DG  1   1   1   DG  DG  D . n 
D 4 2   DC  2   2   2   DC  DC  D . n 
D 4 3   DG  3   3   3   DG  DG  D . n 
D 4 4   DT  4   4   4   DT  DT  D . n 
D 4 5   DG  5   5   5   DG  DG  D . n 
D 4 6   DA  6   6   6   DA  DA  D . n 
D 4 7   DC  7   7   7   DC  DC  D . n 
E 1 1   GLY 1   76  ?   ?   ?   E . n 
E 1 2   SER 2   77  ?   ?   ?   E . n 
E 1 3   HIS 3   78  ?   ?   ?   E . n 
E 1 4   MET 4   79  ?   ?   ?   E . n 
E 1 5   SER 5   80  ?   ?   ?   E . n 
E 1 6   ARG 6   81  81  ARG ARG E . n 
E 1 7   GLU 7   82  82  GLU GLU E . n 
E 1 8   LEU 8   83  83  LEU LEU E . n 
E 1 9   LYS 9   84  84  LYS LYS E . n 
E 1 10  THR 10  85  85  THR THR E . n 
E 1 11  VAL 11  86  86  VAL VAL E . n 
E 1 12  SER 12  87  87  SER SER E . n 
E 1 13  ALA 13  88  88  ALA ALA E . n 
E 1 14  ASP 14  89  89  ASP ASP E . n 
E 1 15  CYS 15  90  90  CYS CYS E . n 
E 1 16  LYS 16  91  91  LYS LYS E . n 
E 1 17  LYS 17  92  92  LYS LYS E . n 
E 1 18  GLU 18  93  93  GLU GLU E . n 
E 1 19  ALA 19  94  94  ALA ALA E . n 
E 1 20  ILE 20  95  95  ILE ILE E . n 
E 1 21  GLU 21  96  96  GLU GLU E . n 
E 1 22  LYS 22  97  97  LYS LYS E . n 
E 1 23  CYS 23  98  98  CYS CYS E . n 
E 1 24  ALA 24  99  99  ALA ALA E . n 
E 1 25  GLN 25  100 100 GLN GLN E . n 
E 1 26  TRP 26  101 101 TRP TRP E . n 
E 1 27  VAL 27  102 102 VAL VAL E . n 
E 1 28  VAL 28  103 103 VAL VAL E . n 
E 1 29  ARG 29  104 104 ARG ARG E . n 
E 1 30  ASP 30  105 105 ASP ASP E . n 
E 1 31  CYS 31  106 106 CYS CYS E . n 
E 1 32  ARG 32  107 107 ARG ARG E . n 
E 1 33  PRO 33  108 108 PRO PRO E . n 
E 1 34  PHE 34  109 109 PHE PHE E . n 
E 1 35  SER 35  110 110 SER SER E . n 
E 1 36  ALA 36  111 111 ALA ALA E . n 
E 1 37  VAL 37  112 112 VAL VAL E . n 
E 1 38  SER 38  113 113 SER SER E . n 
E 1 39  GLY 39  114 114 GLY GLY E . n 
E 1 40  SER 40  115 115 SER SER E . n 
E 1 41  GLY 41  116 116 GLY GLY E . n 
E 1 42  PHE 42  117 117 PHE PHE E . n 
E 1 43  ILE 43  118 118 ILE ILE E . n 
E 1 44  ASP 44  119 119 ASP ASP E . n 
E 1 45  MET 45  120 120 MET MET E . n 
E 1 46  ILE 46  121 121 ILE ILE E . n 
E 1 47  LYS 47  122 122 LYS LYS E . n 
E 1 48  PHE 48  123 123 PHE PHE E . n 
E 1 49  PHE 49  124 124 PHE PHE E . n 
E 1 50  ILE 50  125 125 ILE ILE E . n 
E 1 51  LYS 51  126 126 LYS LYS E . n 
E 1 52  VAL 52  127 127 VAL VAL E . n 
E 1 53  GLY 53  128 128 GLY GLY E . n 
E 1 54  ALA 54  129 129 ALA ALA E . n 
E 1 55  GLU 55  130 130 GLU GLU E . n 
E 1 56  TYR 56  131 131 TYR TYR E . n 
E 1 57  GLY 57  132 132 GLY GLY E . n 
E 1 58  GLU 58  133 133 GLU GLU E . n 
E 1 59  HIS 59  134 134 HIS HIS E . n 
E 1 60  VAL 60  135 135 VAL VAL E . n 
E 1 61  ASN 61  136 136 ASN ASN E . n 
E 1 62  VAL 62  137 137 VAL VAL E . n 
E 1 63  GLU 63  138 138 GLU GLU E . n 
E 1 64  GLU 64  139 139 GLU GLU E . n 
E 1 65  LEU 65  140 140 LEU LEU E . n 
E 1 66  LEU 66  141 141 LEU LEU E . n 
E 1 67  PRO 67  142 142 PRO PRO E . n 
E 1 68  SER 68  143 143 SER SER E . n 
E 1 69  PRO 69  144 144 PRO PRO E . n 
E 1 70  ILE 70  145 145 ILE ILE E . n 
E 1 71  THR 71  146 146 THR THR E . n 
E 1 72  LEU 72  147 147 LEU LEU E . n 
E 1 73  SER 73  148 148 SER SER E . n 
E 1 74  ARG 74  149 149 ARG ARG E . n 
E 1 75  LYS 75  150 150 LYS LYS E . n 
E 1 76  VAL 76  151 151 VAL VAL E . n 
E 1 77  THR 77  152 152 THR THR E . n 
E 1 78  SER 78  153 153 SER SER E . n 
E 1 79  ASP 79  154 154 ASP ASP E . n 
E 1 80  ALA 80  155 155 ALA ALA E . n 
E 1 81  LYS 81  156 156 LYS LYS E . n 
E 1 82  GLU 82  157 157 GLU GLU E . n 
E 1 83  LYS 83  158 158 LYS LYS E . n 
E 1 84  LYS 84  159 159 LYS LYS E . n 
E 1 85  ALA 85  160 160 ALA ALA E . n 
E 1 86  LEU 86  161 161 LEU LEU E . n 
E 1 87  ILE 87  162 162 ILE ILE E . n 
E 1 88  SER 88  163 163 SER SER E . n 
E 1 89  ARG 89  164 164 ARG ARG E . n 
E 1 90  GLU 90  165 165 GLU GLU E . n 
E 1 91  ILE 91  166 166 ILE ILE E . n 
E 1 92  LYS 92  167 167 LYS LYS E . n 
E 1 93  SER 93  168 168 SER SER E . n 
E 1 94  ALA 94  169 169 ALA ALA E . n 
E 1 95  VAL 95  170 170 VAL VAL E . n 
E 1 96  GLU 96  171 171 GLU GLU E . n 
E 1 97  LYS 97  172 172 LYS LYS E . n 
E 1 98  ASP 98  173 173 ASP ASP E . n 
E 1 99  GLY 99  174 174 GLY GLY E . n 
E 1 100 ALA 100 175 175 ALA ALA E . n 
E 1 101 SER 101 176 176 SER SER E . n 
E 1 102 ALA 102 177 177 ALA ALA E . n 
E 1 103 THR 103 178 178 THR THR E . n 
E 1 104 ILE 104 179 179 ILE ILE E . n 
E 1 105 ASP 105 180 180 ASP ASP E . n 
E 1 106 LEU 106 181 181 LEU LEU E . n 
E 1 107 TRP 107 182 182 TRP TRP E . n 
E 1 108 THR 108 183 183 THR THR E . n 
E 1 109 ASP 109 184 184 ASP ASP E . n 
E 1 110 ASN 110 185 185 ASN ASN E . n 
E 1 111 TYR 111 186 186 TYR TYR E . n 
E 1 112 ILE 112 187 187 ILE ILE E . n 
E 1 113 LYS 113 188 188 LYS LYS E . n 
E 1 114 ARG 114 189 189 ARG ARG E . n 
E 1 115 ASN 115 190 190 ASN ASN E . n 
E 1 116 PHE 116 191 191 PHE PHE E . n 
E 1 117 LEU 117 192 192 LEU LEU E . n 
E 1 118 GLY 118 193 193 GLY GLY E . n 
E 1 119 VAL 119 194 194 VAL VAL E . n 
E 1 120 THR 120 195 195 THR THR E . n 
E 1 121 LEU 121 196 196 LEU LEU E . n 
E 1 122 HIS 122 197 197 HIS HIS E . n 
E 1 123 TYR 123 198 198 TYR TYR E . n 
E 1 124 HIS 124 199 199 HIS HIS E . n 
E 1 125 GLU 125 200 200 GLU GLU E . n 
E 1 126 ASN 126 201 201 ASN ASN E . n 
E 1 127 ASN 127 202 202 ASN ASN E . n 
E 1 128 GLU 128 203 203 GLU GLU E . n 
E 1 129 LEU 129 204 204 LEU LEU E . n 
E 1 130 ARG 130 205 205 ARG ARG E . n 
E 1 131 ASP 131 206 206 ASP ASP E . n 
E 1 132 LEU 132 207 207 LEU LEU E . n 
E 1 133 ILE 133 208 208 ILE ILE E . n 
E 1 134 LEU 134 209 209 LEU LEU E . n 
E 1 135 GLY 135 210 210 GLY GLY E . n 
E 1 136 LEU 136 211 211 LEU LEU E . n 
E 1 137 LYS 137 212 212 LYS LYS E . n 
E 1 138 SER 138 213 213 SER SER E . n 
E 1 139 LEU 139 214 214 LEU LEU E . n 
E 1 140 ASP 140 215 215 ASP ASP E . n 
E 1 141 PHE 141 216 216 PHE PHE E . n 
E 1 142 GLU 142 217 217 GLU GLU E . n 
E 1 143 ARG 143 218 218 ARG ARG E . n 
E 1 144 SER 144 219 219 SER SER E . n 
E 1 145 THR 145 220 220 THR THR E . n 
E 1 146 ALA 146 221 221 ALA ALA E . n 
E 1 147 GLU 147 222 222 GLU GLU E . n 
E 1 148 ASN 148 223 223 ASN ASN E . n 
E 1 149 ILE 149 224 224 ILE ILE E . n 
E 1 150 TYR 150 225 225 TYR TYR E . n 
E 1 151 LYS 151 226 226 LYS LYS E . n 
E 1 152 LYS 152 227 227 LYS LYS E . n 
E 1 153 LEU 153 228 228 LEU LEU E . n 
E 1 154 LYS 154 229 229 LYS LYS E . n 
E 1 155 ALA 155 230 230 ALA ALA E . n 
E 1 156 ILE 156 231 231 ILE ILE E . n 
E 1 157 PHE 157 232 232 PHE PHE E . n 
E 1 158 SER 158 233 233 SER SER E . n 
E 1 159 GLN 159 234 234 GLN GLN E . n 
E 1 160 PHE 160 235 235 PHE PHE E . n 
E 1 161 ASN 161 236 236 ASN ASN E . n 
E 1 162 VAL 162 237 237 VAL VAL E . n 
E 1 163 GLU 163 238 238 GLU GLU E . n 
E 1 164 ASP 164 239 239 ASP ASP E . n 
E 1 165 LEU 165 240 240 LEU LEU E . n 
E 1 166 SER 166 241 241 SER SER E . n 
E 1 167 SER 167 242 242 SER SER E . n 
E 1 168 ILE 168 243 243 ILE ILE E . n 
E 1 169 LYS 169 244 244 LYS LYS E . n 
E 1 170 PHE 170 245 245 PHE PHE E . n 
E 1 171 VAL 171 246 246 VAL VAL E . n 
E 1 172 THR 172 247 247 THR THR E . n 
E 1 173 ASP 173 248 248 ASP ASP E . n 
E 1 174 ARG 174 249 249 ARG ARG E . n 
E 1 175 GLY 175 250 250 GLY GLY E . n 
E 1 176 ALA 176 251 251 ALA ALA E . n 
E 1 177 ASN 177 252 252 ASN ASN E . n 
E 1 178 VAL 178 253 253 VAL VAL E . n 
E 1 179 VAL 179 254 254 VAL VAL E . n 
E 1 180 LYS 180 255 255 LYS LYS E . n 
E 1 181 SER 181 256 256 SER SER E . n 
E 1 182 LEU 182 257 257 LEU LEU E . n 
E 1 183 ALA 183 258 258 ALA ALA E . n 
E 1 184 ASN 184 259 259 ASN ASN E . n 
E 1 185 ASN 185 260 260 ASN ASN E . n 
E 1 186 ILE 186 261 261 ILE ILE E . n 
E 1 187 ARG 187 262 262 ARG ARG E . n 
E 1 188 ILE 188 263 263 ILE ILE E . n 
E 1 189 ASN 189 264 264 ASN ASN E . n 
E 1 190 CYS 190 265 265 CYS CYS E . n 
E 1 191 SER 191 266 266 SER SER E . n 
E 1 192 SER 192 267 267 SER SER E . n 
E 1 193 HIS 193 268 268 HIS HIS E . n 
E 1 194 LEU 194 269 269 LEU LEU E . n 
E 1 195 LEU 195 270 270 LEU LEU E . n 
E 1 196 SER 196 271 271 SER SER E . n 
E 1 197 ASN 197 272 272 ASN ASN E . n 
E 1 198 VAL 198 273 273 VAL VAL E . n 
E 1 199 LEU 199 274 274 LEU LEU E . n 
E 1 200 GLU 200 275 275 GLU GLU E . n 
E 1 201 ASN 201 276 276 ASN ASN E . n 
E 1 202 SER 202 277 277 SER SER E . n 
E 1 203 PHE 203 278 278 PHE PHE E . n 
E 1 204 GLU 204 279 279 GLU GLU E . n 
E 1 205 GLU 205 280 280 GLU GLU E . n 
E 1 206 THR 206 281 281 THR THR E . n 
E 1 207 PRO 207 282 282 PRO PRO E . n 
E 1 208 GLU 208 283 283 GLU GLU E . n 
E 1 209 LEU 209 284 284 LEU LEU E . n 
E 1 210 ASN 210 285 285 ASN ASN E . n 
E 1 211 MET 211 286 286 MET MET E . n 
E 1 212 PRO 212 287 287 PRO PRO E . n 
E 1 213 ILE 213 288 288 ILE ILE E . n 
E 1 214 LEU 214 289 289 LEU LEU E . n 
E 1 215 ALA 215 290 290 ALA ALA E . n 
E 1 216 CYS 216 291 291 CYS CYS E . n 
E 1 217 LYS 217 292 292 LYS LYS E . n 
E 1 218 ASN 218 293 293 ASN ASN E . n 
E 1 219 ILE 219 294 294 ILE ILE E . n 
E 1 220 VAL 220 295 295 VAL VAL E . n 
E 1 221 LYS 221 296 296 LYS LYS E . n 
E 1 222 TYR 222 297 297 TYR TYR E . n 
E 1 223 PHE 223 298 298 PHE PHE E . n 
E 1 224 LYS 224 299 299 LYS LYS E . n 
E 1 225 LYS 225 300 300 LYS LYS E . n 
E 1 226 ALA 226 301 301 ALA ALA E . n 
E 1 227 ASN 227 302 302 ASN ASN E . n 
E 1 228 LEU 228 303 303 LEU LEU E . n 
E 1 229 GLN 229 304 304 GLN GLN E . n 
E 1 230 HIS 230 305 305 HIS HIS E . n 
E 1 231 ARG 231 306 306 ARG ARG E . n 
E 1 232 LEU 232 307 307 LEU LEU E . n 
E 1 233 ARG 233 308 308 ARG ARG E . n 
E 1 234 SER 234 309 309 SER SER E . n 
E 1 235 SER 235 310 310 SER SER E . n 
E 1 236 LEU 236 311 311 LEU LEU E . n 
E 1 237 LYS 237 312 312 LYS LYS E . n 
E 1 238 SER 238 313 313 SER SER E . n 
E 1 239 GLU 239 314 314 GLU GLU E . n 
E 1 240 CYS 240 315 315 CYS CYS E . n 
E 1 241 PRO 241 316 316 PRO PRO E . n 
E 1 242 THR 242 317 317 THR THR E . n 
E 1 243 ARG 243 318 318 ARG ARG E . n 
E 1 244 TRP 244 319 319 TRP TRP E . n 
E 1 245 ASN 245 320 320 ASN ASN E . n 
E 1 246 SER 246 321 321 SER SER E . n 
E 1 247 THR 247 322 322 THR THR E . n 
E 1 248 TYR 248 323 323 TYR TYR E . n 
E 1 249 THR 249 324 324 THR THR E . n 
E 1 250 MET 250 325 325 MET MET E . n 
E 1 251 LEU 251 326 326 LEU LEU E . n 
E 1 252 ARG 252 327 327 ARG ARG E . n 
E 1 253 SER 253 328 328 SER SER E . n 
E 1 254 ILE 254 329 329 ILE ILE E . n 
E 1 255 LEU 255 330 330 LEU LEU E . n 
E 1 256 ASP 256 331 331 ASP ASP E . n 
E 1 257 ASN 257 332 332 ASN ASN E . n 
E 1 258 TRP 258 333 333 TRP TRP E . n 
E 1 259 GLU 259 334 334 GLU GLU E . n 
E 1 260 SER 260 335 335 SER SER E . n 
E 1 261 VAL 261 336 336 VAL VAL E . n 
E 1 262 ILE 262 337 337 ILE ILE E . n 
E 1 263 GLN 263 338 338 GLN GLN E . n 
E 1 264 ILE 264 339 339 ILE ILE E . n 
E 1 265 LEU 265 340 340 LEU LEU E . n 
E 1 266 SER 266 341 341 SER SER E . n 
E 1 267 GLU 267 342 342 GLU GLU E . n 
E 1 268 ALA 268 343 343 ALA ALA E . n 
E 1 269 GLY 269 344 344 GLY GLY E . n 
E 1 270 GLU 270 345 345 GLU GLU E . n 
E 1 271 THR 271 346 346 THR THR E . n 
E 1 272 GLN 272 347 347 GLN GLN E . n 
E 1 273 ARG 273 348 348 ARG ARG E . n 
E 1 274 ILE 274 349 349 ILE ILE E . n 
E 1 275 VAL 275 350 350 VAL VAL E . n 
E 1 276 HIS 276 351 351 HIS HIS E . n 
E 1 277 ILE 277 352 352 ILE ILE E . n 
E 1 278 ASN 278 353 353 ASN ASN E . n 
E 1 279 LYS 279 354 354 LYS LYS E . n 
E 1 280 SER 280 355 355 SER SER E . n 
E 1 281 ILE 281 356 356 ILE ILE E . n 
E 1 282 ILE 282 357 357 ILE ILE E . n 
E 1 283 GLN 283 358 358 GLN GLN E . n 
E 1 284 THR 284 359 359 THR THR E . n 
E 1 285 MET 285 360 360 MET MET E . n 
E 1 286 VAL 286 361 361 VAL VAL E . n 
E 1 287 ASN 287 362 362 ASN ASN E . n 
E 1 288 ILE 288 363 363 ILE ILE E . n 
E 1 289 LEU 289 364 364 LEU LEU E . n 
E 1 290 ASP 290 365 365 ASP ASP E . n 
E 1 291 GLY 291 366 366 GLY GLY E . n 
E 1 292 PHE 292 367 367 PHE PHE E . n 
E 1 293 GLU 293 368 368 GLU GLU E . n 
E 1 294 ARG 294 369 369 ARG ARG E . n 
E 1 295 ILE 295 370 370 ILE ILE E . n 
E 1 296 PHE 296 371 371 PHE PHE E . n 
E 1 297 LYS 297 372 372 LYS LYS E . n 
E 1 298 GLU 298 373 373 GLU GLU E . n 
E 1 299 LEU 299 374 374 LEU LEU E . n 
E 1 300 GLN 300 375 375 GLN GLN E . n 
E 1 301 THR 301 376 376 THR THR E . n 
E 1 302 CYS 302 377 377 CYS CYS E . n 
E 1 303 SER 303 378 378 SER SER E . n 
E 1 304 SER 304 379 379 SER SER E . n 
E 1 305 PRO 305 380 380 PRO PRO E . n 
E 1 306 SER 306 381 381 SER SER E . n 
E 1 307 LEU 307 382 382 LEU LEU E . n 
E 1 308 CYS 308 383 383 CYS CYS E . n 
E 1 309 PHE 309 384 384 PHE PHE E . n 
E 1 310 VAL 310 385 385 VAL VAL E . n 
E 1 311 VAL 311 386 386 VAL VAL E . n 
E 1 312 PRO 312 387 387 PRO PRO E . n 
E 1 313 SER 313 388 388 SER SER E . n 
E 1 314 ILE 314 389 389 ILE ILE E . n 
E 1 315 LEU 315 390 390 LEU LEU E . n 
E 1 316 LYS 316 391 391 LYS LYS E . n 
E 1 317 VAL 317 392 392 VAL VAL E . n 
E 1 318 LYS 318 393 393 LYS LYS E . n 
E 1 319 GLU 319 394 394 GLU GLU E . n 
E 1 320 ILE 320 395 395 ILE ILE E . n 
E 1 321 CYS 321 396 396 CYS CYS E . n 
E 1 322 SER 322 397 397 SER SER E . n 
E 1 323 PRO 323 398 398 PRO PRO E . n 
E 1 324 ASP 324 399 399 ASP ASP E . n 
E 1 325 VAL 325 400 400 VAL VAL E . n 
E 1 326 GLY 326 401 401 GLY GLY E . n 
E 1 327 ASP 327 402 402 ASP ASP E . n 
E 1 328 VAL 328 403 403 VAL VAL E . n 
E 1 329 ALA 329 404 404 ALA ALA E . n 
E 1 330 ASP 330 405 405 ASP ASP E . n 
E 1 331 ILE 331 406 406 ILE ILE E . n 
E 1 332 ALA 332 407 407 ALA ALA E . n 
E 1 333 LYS 333 408 408 LYS LYS E . n 
E 1 334 LEU 334 409 409 LEU LEU E . n 
E 1 335 LYS 335 410 410 LYS LYS E . n 
E 1 336 VAL 336 411 411 VAL VAL E . n 
E 1 337 ASN 337 412 412 ASN ASN E . n 
E 1 338 ILE 338 413 413 ILE ILE E . n 
E 1 339 ILE 339 414 414 ILE ILE E . n 
E 1 340 LYS 340 415 415 LYS LYS E . n 
E 1 341 ASN 341 416 416 ASN ASN E . n 
E 1 342 VAL 342 417 417 VAL VAL E . n 
E 1 343 ARG 343 418 418 ARG ARG E . n 
E 1 344 ILE 344 419 419 ILE ILE E . n 
E 1 345 ILE 345 420 420 ILE ILE E . n 
E 1 346 TRP 346 421 421 TRP TRP E . n 
E 1 347 GLU 347 422 422 GLU GLU E . n 
E 1 348 GLU 348 423 423 GLU GLU E . n 
E 1 349 ASN 349 424 424 ASN ASN E . n 
E 1 350 LEU 350 425 425 LEU LEU E . n 
E 1 351 SER 351 426 426 SER SER E . n 
E 1 352 ILE 352 427 427 ILE ILE E . n 
E 1 353 TRP 353 428 428 TRP TRP E . n 
E 1 354 HIS 354 429 429 HIS HIS E . n 
E 1 355 TYR 355 430 430 TYR TYR E . n 
E 1 356 THR 356 431 431 THR THR E . n 
E 1 357 ALA 357 432 432 ALA ALA E . n 
E 1 358 PHE 358 433 433 PHE PHE E . n 
E 1 359 PHE 359 434 434 PHE PHE E . n 
E 1 360 PHE 360 435 435 PHE PHE E . n 
E 1 361 TYR 361 436 436 TYR TYR E . n 
E 1 362 PRO 362 437 437 PRO PRO E . n 
E 1 363 PRO 363 438 438 PRO PRO E . n 
E 1 364 ALA 364 439 439 ALA ALA E . n 
E 1 365 LEU 365 440 440 LEU LEU E . n 
E 1 366 HIS 366 441 441 HIS HIS E . n 
E 1 367 MET 367 442 442 MET MET E . n 
E 1 368 GLN 368 443 443 GLN GLN E . n 
E 1 369 GLN 369 444 444 GLN GLN E . n 
E 1 370 GLU 370 445 445 GLU GLU E . n 
E 1 371 LYS 371 446 446 LYS LYS E . n 
E 1 372 VAL 372 447 447 VAL VAL E . n 
E 1 373 ALA 373 448 448 ALA ALA E . n 
E 1 374 GLN 374 449 449 GLN GLN E . n 
E 1 375 ILE 375 450 450 ILE ILE E . n 
E 1 376 LYS 376 451 451 LYS LYS E . n 
E 1 377 GLU 377 452 452 GLU GLU E . n 
E 1 378 PHE 378 453 453 PHE PHE E . n 
E 1 379 CYS 379 454 454 CYS CYS E . n 
E 1 380 LEU 380 455 455 LEU LEU E . n 
E 1 381 SER 381 456 456 SER SER E . n 
E 1 382 LYS 382 457 457 LYS LYS E . n 
E 1 383 MET 383 458 458 MET MET E . n 
E 1 384 GLU 384 459 459 GLU GLU E . n 
E 1 385 ASP 385 460 460 ASP ASP E . n 
E 1 386 LEU 386 461 461 LEU LEU E . n 
E 1 387 GLU 387 462 462 GLU GLU E . n 
E 1 388 LEU 388 463 463 LEU LEU E . n 
E 1 389 ILE 389 484 ?   ?   ?   E . n 
E 1 390 ASN 390 485 ?   ?   ?   E . n 
E 1 391 ARG 391 486 ?   ?   ?   E . n 
E 1 392 MET 392 487 ?   ?   ?   E . n 
E 1 393 SER 393 488 ?   ?   ?   E . n 
E 1 394 SER 394 489 ?   ?   ?   E . n 
E 1 395 PHE 395 490 ?   ?   ?   E . n 
E 1 396 ASN 396 491 ?   ?   ?   E . n 
E 1 397 GLU 397 492 ?   ?   ?   E . n 
E 1 398 LEU 398 493 ?   ?   ?   E . n 
E 1 399 SER 399 494 ?   ?   ?   E . n 
E 1 400 ALA 400 495 ?   ?   ?   E . n 
E 1 401 THR 401 496 ?   ?   ?   E . n 
E 1 402 GLN 402 497 ?   ?   ?   E . n 
E 1 403 LEU 403 498 ?   ?   ?   E . n 
E 1 404 ASN 404 499 ?   ?   ?   E . n 
E 1 405 GLN 405 500 ?   ?   ?   E . n 
E 1 406 SER 406 501 ?   ?   ?   E . n 
E 1 407 ASP 407 502 ?   ?   ?   E . n 
E 1 408 SER 408 503 ?   ?   ?   E . n 
E 1 409 ASN 409 504 ?   ?   ?   E . n 
E 1 410 SER 410 505 ?   ?   ?   E . n 
E 1 411 HIS 411 506 ?   ?   ?   E . n 
E 1 412 ASN 412 507 ?   ?   ?   E . n 
E 1 413 SER 413 508 ?   ?   ?   E . n 
E 1 414 ILE 414 509 ?   ?   ?   E . n 
E 1 415 ASP 415 510 ?   ?   ?   E . n 
E 1 416 LEU 416 511 ?   ?   ?   E . n 
E 1 417 THR 417 512 ?   ?   ?   E . n 
E 1 418 SER 418 513 ?   ?   ?   E . n 
E 1 419 HIS 419 514 ?   ?   ?   E . n 
E 1 420 SER 420 515 ?   ?   ?   E . n 
E 1 421 LYS 421 516 ?   ?   ?   E . n 
E 1 422 PRO 422 517 517 PRO PRO E . n 
E 1 423 VAL 423 518 518 VAL VAL E . n 
E 1 424 SER 424 519 519 SER SER E . n 
E 1 425 PRO 425 520 520 PRO PRO E . n 
E 1 426 SER 426 521 521 SER SER E . n 
E 1 427 ASP 427 522 522 ASP ASP E . n 
E 1 428 GLU 428 523 523 GLU GLU E . n 
E 1 429 PHE 429 524 524 PHE PHE E . n 
E 1 430 GLU 430 525 525 GLU GLU E . n 
E 1 431 PHE 431 526 526 PHE PHE E . n 
E 1 432 TYR 432 527 527 TYR TYR E . n 
E 1 433 ARG 433 528 528 ARG ARG E . n 
E 1 434 LYS 434 529 529 LYS LYS E . n 
E 1 435 GLU 435 530 530 GLU GLU E . n 
E 1 436 ILE 436 531 531 ILE ILE E . n 
E 1 437 VAL 437 532 532 VAL VAL E . n 
E 1 438 ILE 438 533 533 ILE ILE E . n 
E 1 439 LEU 439 534 534 LEU LEU E . n 
E 1 440 SER 440 535 535 SER SER E . n 
E 1 441 GLU 441 536 536 GLU GLU E . n 
E 1 442 ASP 442 537 537 ASP ASP E . n 
E 1 443 PHE 443 538 538 PHE PHE E . n 
E 1 444 LYS 444 539 539 LYS LYS E . n 
E 1 445 VAL 445 540 540 VAL VAL E . n 
E 1 446 MET 446 541 541 MET MET E . n 
E 1 447 GLU 447 542 542 GLU GLU E . n 
E 1 448 TRP 448 543 543 TRP TRP E . n 
E 1 449 TRP 449 544 544 TRP TRP E . n 
E 1 450 ASN 450 545 545 ASN ASN E . n 
E 1 451 LEU 451 546 546 LEU LEU E . n 
E 1 452 ASN 452 547 547 ASN ASN E . n 
E 1 453 SER 453 548 548 SER SER E . n 
E 1 454 LYS 454 549 549 LYS LYS E . n 
E 1 455 LYS 455 550 550 LYS LYS E . n 
E 1 456 TYR 456 551 551 TYR TYR E . n 
E 1 457 PRO 457 552 552 PRO PRO E . n 
E 1 458 LYS 458 553 553 LYS LYS E . n 
E 1 459 LEU 459 554 554 LEU LEU E . n 
E 1 460 SER 460 555 555 SER SER E . n 
E 1 461 LYS 461 556 556 LYS LYS E . n 
E 1 462 LEU 462 557 557 LEU LEU E . n 
E 1 463 ALA 463 558 558 ALA ALA E . n 
E 1 464 LEU 464 559 559 LEU LEU E . n 
E 1 465 SER 465 560 560 SER SER E . n 
E 1 466 LEU 466 561 561 LEU LEU E . n 
E 1 467 LEU 467 562 562 LEU LEU E . n 
E 1 468 SER 468 563 563 SER SER E . n 
E 1 469 ILE 469 564 564 ILE ILE E . n 
E 1 470 PRO 470 565 565 PRO PRO E . n 
E 1 471 ALA 471 566 566 ALA ALA E . n 
E 1 472 SER 472 567 567 SER SER E . n 
E 1 473 SER 473 568 568 SER SER E . n 
E 1 474 ALA 474 569 569 ALA ALA E . n 
E 1 475 ALA 475 570 570 ALA ALA E . n 
E 1 476 SER 476 571 571 SER SER E . n 
E 1 477 GLU 477 572 572 GLU GLU E . n 
E 1 478 ARG 478 573 573 ARG ARG E . n 
E 1 479 THR 479 574 574 THR THR E . n 
E 1 480 PHE 480 575 575 PHE PHE E . n 
E 1 481 SER 481 576 576 SER SER E . n 
E 1 482 LEU 482 577 577 LEU LEU E . n 
E 1 483 ALA 483 578 578 ALA ALA E . n 
E 1 484 GLY 484 579 579 GLY GLY E . n 
E 1 485 ASN 485 580 580 ASN ASN E . n 
E 1 486 ILE 486 581 581 ILE ILE E . n 
E 1 487 ILE 487 582 582 ILE ILE E . n 
E 1 488 THR 488 583 583 THR THR E . n 
E 1 489 GLU 489 584 584 GLU GLU E . n 
E 1 490 LYS 490 585 585 LYS LYS E . n 
E 1 491 ARG 491 586 586 ARG ARG E . n 
E 1 492 ASN 492 587 587 ASN ASN E . n 
E 1 493 ARG 493 588 588 ARG ARG E . n 
E 1 494 ILE 494 589 589 ILE ILE E . n 
E 1 495 GLY 495 590 590 GLY GLY E . n 
E 1 496 GLN 496 591 591 GLN GLN E . n 
E 1 497 GLN 497 592 592 GLN GLN E . n 
E 1 498 THR 498 593 593 THR THR E . n 
E 1 499 VAL 499 594 594 VAL VAL E . n 
E 1 500 ASP 500 595 595 ASP ASP E . n 
E 1 501 SER 501 596 596 SER SER E . n 
E 1 502 LEU 502 597 597 LEU LEU E . n 
E 1 503 LEU 503 598 598 LEU LEU E . n 
E 1 504 PHE 504 599 599 PHE PHE E . n 
E 1 505 LEU 505 600 600 LEU LEU E . n 
E 1 506 ASN 506 601 601 ASN ASN E . n 
E 1 507 SER 507 602 602 SER SER E . n 
E 1 508 PHE 508 603 603 PHE PHE E . n 
E 1 509 TYR 509 604 604 TYR TYR E . n 
E 1 510 LYS 510 605 605 LYS LYS E . n 
E 1 511 ASN 511 606 606 ASN ASN E . n 
E 1 512 PHE 512 607 607 PHE PHE E . n 
E 1 513 CYS 513 608 608 CYS CYS E . n 
E 1 514 LYS 514 609 609 LYS LYS E . n 
E 1 515 LEU 515 610 ?   ?   ?   E . n 
E 1 516 ASP 516 611 ?   ?   ?   E . n 
E 1 517 ILE 517 612 ?   ?   ?   E . n 
F 2 1   DG  1   2   2   DG  DG  F . n 
F 2 2   DA  2   3   3   DA  DA  F . n 
F 2 3   DG  3   4   4   DG  DG  F . n 
F 2 4   DA  4   5   5   DA  DA  F . n 
F 2 5   DA  5   6   6   DA  DA  F . n 
F 2 6   DC  6   7   7   DC  DC  F . n 
F 2 7   DA  7   8   8   DA  DA  F . n 
F 2 8   DA  8   9   9   DA  DA  F . n 
F 2 9   DC  9   10  10  DC  DC  F . n 
F 2 10  DA  10  11  11  DA  DA  F . n 
F 2 11  DA  11  12  12  DA  DA  F . n 
F 2 12  DC  12  13  13  DC  DC  F . n 
F 2 13  DA  13  14  14  DA  DA  F . n 
F 2 14  DA  14  15  15  DA  DA  F . n 
F 2 15  DG  15  16  16  DG  DG  F . n 
G 3 1   DC  1   1   1   DC  DC  G . n 
G 3 2   DT  2   2   2   DT  DT  G . n 
G 3 3   DT  3   3   3   DT  DT  G . n 
G 3 4   DG  4   4   4   DG  DG  G . n 
G 3 5   DT  5   5   5   DT  DT  G . n 
G 3 6   DT  6   6   6   DT  DT  G . n 
G 3 7   DG  7   7   7   DG  DG  G . n 
G 3 8   DT  8   8   8   DT  DT  G . n 
G 3 9   DT  9   9   9   DT  DT  G . n 
G 3 10  DG  10  10  10  DG  DG  G . n 
G 3 11  DT  11  11  11  DT  DT  G . n 
G 3 12  DT  12  12  12  DT  DT  G . n 
G 3 13  DC  13  13  13  DC  DC  G . n 
G 3 14  DT  14  14  14  DT  DT  G . n 
G 3 15  DC  15  15  15  DC  DC  G . n 
G 3 16  DT  16  16  16  DT  DT  G . n 
G 3 17  DG  17  17  17  DG  DG  G . n 
G 3 18  DG  18  18  18  DG  DG  G . n 
G 3 19  DG  19  19  19  DG  DG  G . n 
G 3 20  DT  20  20  20  DT  DT  G . n 
G 3 21  DC  21  21  21  DC  DC  G . n 
G 3 22  DA  22  22  22  DA  DA  G . n 
G 3 23  DC  23  23  23  DC  DC  G . n 
G 3 24  DG  24  24  24  DG  DG  G . n 
G 3 25  DC  25  25  25  DC  DC  G . n 
G 3 26  DG  26  26  ?   ?   ?   G . n 
H 4 1   DG  1   1   1   DG  DG  H . n 
H 4 2   DC  2   2   2   DC  DC  H . n 
H 4 3   DG  3   3   3   DG  DG  H . n 
H 4 4   DT  4   4   4   DT  DT  H . n 
H 4 5   DG  5   5   5   DG  DG  H . n 
H 4 6   DA  6   6   6   DA  DA  H . n 
H 4 7   DC  7   7   7   DC  DC  H . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   octameric 
_pdbx_struct_assembly.oligomeric_count     8 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 20860 ? 
1 MORE         -166  ? 
1 'SSA (A^2)'  53680 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-09-19 
2 'Structure model' 1 1 2019-01-23 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'          
2 2 'Structure model' '_citation.page_first'              
3 2 'Structure model' '_citation.page_last'               
4 2 'Structure model' '_citation.pdbx_database_id_DOI'    
5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
6 2 'Structure model' '_citation.title'                   
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10_2155: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                  2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                  3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? AMoRE  ? ? ? .                  4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   E ASN 412 ? ? ND2 E ASN 416 ? ? 2.04 
2 1 N6  C DA  22  ? ? O4  D DT  4   ? ? 2.07 
3 1 NH2 E ARG 262 ? ? OD1 E ASN 264 ? ? 2.11 
4 1 OE2 A GLU 530 ? ? OH  A TYR 551 ? ? 2.12 
5 1 OE1 E GLU 203 ? ? NH1 E ARG 205 ? ? 2.15 
6 1 O   E LYS 150 ? ? N   E SER 153 ? ? 2.18 
7 1 N2  C DG  24  ? ? O2  D DC  2   ? ? 2.18 
8 1 O   A PHE 384 ? ? OG  A SER 388 ? ? 2.18 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 CB    A TRP 101 ? ? CG    A TRP 101 ? ? 1.383 1.498 -0.115 0.018 N 
2  1 "C5'" B DG  2   ? ? "C4'" B DG  2   ? ? 1.590 1.512 0.078  0.007 N 
3  1 "O3'" B DG  2   ? ? "C3'" B DG  2   ? ? 1.526 1.435 0.091  0.013 N 
4  1 "O3'" B DG  4   ? ? "C3'" B DG  4   ? ? 1.377 1.419 -0.042 0.006 N 
5  1 "O3'" B DA  6   ? ? "C3'" B DA  6   ? ? 1.363 1.419 -0.056 0.006 N 
6  1 "O3'" B DA  11  ? ? "C3'" B DA  11  ? ? 1.346 1.419 -0.073 0.006 N 
7  1 N3    B DA  11  ? ? C4    B DA  11  ? ? 1.382 1.344 0.038  0.006 N 
8  1 "O3'" B DA  12  ? ? "C3'" B DA  12  ? ? 1.356 1.419 -0.063 0.006 N 
9  1 "O3'" B DC  13  ? ? "C3'" B DC  13  ? ? 1.366 1.419 -0.053 0.006 N 
10 1 C2    C DG  4   ? ? N3    C DG  4   ? ? 1.373 1.323 0.050  0.008 N 
11 1 "O3'" C DT  5   ? ? "C3'" C DT  5   ? ? 1.364 1.419 -0.055 0.006 N 
12 1 C5    C DT  6   ? ? C6    C DT  6   ? ? 1.382 1.339 0.043  0.007 N 
13 1 "O3'" C DG  7   ? ? "C3'" C DG  7   ? ? 1.373 1.419 -0.046 0.006 N 
14 1 "O3'" C DC  13  ? ? "C3'" C DC  13  ? ? 1.373 1.419 -0.046 0.006 N 
15 1 N9    C DG  17  ? ? C4    C DG  17  ? ? 1.430 1.375 0.055  0.008 N 
16 1 C2    D DG  3   ? ? N3    D DG  3   ? ? 1.374 1.323 0.051  0.008 N 
17 1 "O3'" D DC  7   ? ? "C3'" D DC  7   ? ? 1.544 1.435 0.109  0.013 N 
18 1 "C5'" F DG  2   ? ? "C4'" F DG  2   ? ? 1.591 1.512 0.079  0.007 N 
19 1 C2    F DG  2   ? ? N3    F DG  2   ? ? 1.376 1.323 0.053  0.008 N 
20 1 "O3'" F DA  5   ? ? "C3'" F DA  5   ? ? 1.378 1.419 -0.041 0.006 N 
21 1 "O3'" F DA  6   ? ? "C3'" F DA  6   ? ? 1.339 1.419 -0.080 0.006 N 
22 1 "O3'" F DC  7   ? ? "C3'" F DC  7   ? ? 1.372 1.419 -0.047 0.006 N 
23 1 "C1'" F DC  7   ? ? N1    F DC  7   ? ? 1.578 1.488 0.090  0.013 N 
24 1 N3    F DA  11  ? ? C4    F DA  11  ? ? 1.386 1.344 0.042  0.006 N 
25 1 "O3'" F DA  12  ? ? "C3'" F DA  12  ? ? 1.351 1.419 -0.068 0.006 N 
26 1 "O3'" F DA  14  ? ? "C3'" F DA  14  ? ? 1.334 1.419 -0.085 0.006 N 
27 1 "O3'" G DC  1   ? ? "C3'" G DC  1   ? ? 1.355 1.419 -0.064 0.006 N 
28 1 "O3'" G DT  3   ? ? "C3'" G DT  3   ? ? 1.382 1.419 -0.037 0.006 N 
29 1 "O3'" G DG  7   ? ? "C3'" G DG  7   ? ? 1.369 1.419 -0.050 0.006 N 
30 1 C2    G DG  7   ? ? N3    G DG  7   ? ? 1.379 1.323 0.056  0.008 N 
31 1 "C1'" G DC  13  ? ? N1    G DC  13  ? ? 1.369 1.468 -0.099 0.014 N 
32 1 N1    G DC  13  ? ? C6    G DC  13  ? ? 1.328 1.367 -0.039 0.006 N 
33 1 C2    G DG  17  ? ? N3    G DG  17  ? ? 1.374 1.323 0.051  0.008 N 
34 1 N9    G DG  17  ? ? C4    G DG  17  ? ? 1.462 1.375 0.087  0.008 N 
35 1 "C5'" G DG  18  ? ? "C4'" G DG  18  ? ? 1.554 1.512 0.042  0.007 N 
36 1 "O3'" G DT  20  ? ? "C3'" G DT  20  ? ? 1.344 1.419 -0.075 0.006 N 
37 1 "O3'" G DC  23  ? ? "C3'" G DC  23  ? ? 1.367 1.419 -0.052 0.006 N 
38 1 N3    G DC  23  ? ? C4    G DC  23  ? ? 1.391 1.335 0.056  0.007 N 
39 1 C6    G DG  24  ? ? N1    G DG  24  ? ? 1.452 1.391 0.061  0.007 N 
40 1 C2    H DG  3   ? ? N3    H DG  3   ? ? 1.384 1.323 0.061  0.008 N 
41 1 C2    H DG  5   ? ? N3    H DG  5   ? ? 1.373 1.323 0.050  0.008 N 
42 1 C2    H DG  5   ? ? N2    H DG  5   ? ? 1.403 1.341 0.062  0.010 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CA    A LEU 141 ? ? CB    A LEU 141 ? ? CG    A LEU 141 ? ? 100.88 115.30 -14.42 2.30 N 
2  1 CA    A LEU 463 ? ? CB    A LEU 463 ? ? CG    A LEU 463 ? ? 129.24 115.30 13.94  2.30 N 
3  1 CA    A LEU 597 ? ? CB    A LEU 597 ? ? CG    A LEU 597 ? ? 129.20 115.30 13.90  2.30 N 
4  1 "O4'" B DG  2   ? ? "C4'" B DG  2   ? ? "C3'" B DG  2   ? ? 100.69 104.50 -3.81  0.40 N 
5  1 "O4'" B DG  2   ? ? "C1'" B DG  2   ? ? N9    B DG  2   ? ? 110.24 108.30 1.94   0.30 N 
6  1 "O5'" B DA  3   ? ? P     B DA  3   ? ? OP1   B DA  3   ? ? 99.64  105.70 -6.06  0.90 N 
7  1 "O4'" B DA  3   ? ? "C1'" B DA  3   ? ? N9    B DA  3   ? ? 110.21 108.30 1.91   0.30 N 
8  1 "O3'" B DA  5   ? ? P     B DA  6   ? ? OP1   B DA  6   ? ? 117.13 110.50 6.63   1.10 Y 
9  1 "C1'" B DC  7   ? ? "O4'" B DC  7   ? ? "C4'" B DC  7   ? ? 104.04 110.10 -6.06  1.00 N 
10 1 "C3'" B DC  7   ? ? "C2'" B DC  7   ? ? "C1'" B DC  7   ? ? 97.00  102.40 -5.40  0.80 N 
11 1 "O4'" B DC  7   ? ? "C1'" B DC  7   ? ? N1    B DC  7   ? ? 111.94 108.30 3.64   0.30 N 
12 1 "C1'" B DC  10  ? ? "O4'" B DC  10  ? ? "C4'" B DC  10  ? ? 103.02 110.10 -7.08  1.00 N 
13 1 "O4'" B DA  11  ? ? "C1'" B DA  11  ? ? N9    B DA  11  ? ? 110.78 108.30 2.48   0.30 N 
14 1 "O4'" B DA  12  ? ? "C1'" B DA  12  ? ? N9    B DA  12  ? ? 113.20 108.30 4.90   0.30 N 
15 1 "O4'" B DC  13  ? ? "C4'" B DC  13  ? ? "C3'" B DC  13  ? ? 100.15 104.50 -4.35  0.40 N 
16 1 "C1'" B DC  13  ? ? "O4'" B DC  13  ? ? "C4'" B DC  13  ? ? 103.48 110.10 -6.62  1.00 N 
17 1 "O4'" B DC  13  ? ? "C1'" B DC  13  ? ? N1    B DC  13  ? ? 110.95 108.30 2.65   0.30 N 
18 1 "C1'" B DA  15  ? ? "O4'" B DA  15  ? ? "C4'" B DA  15  ? ? 103.00 110.10 -7.10  1.00 N 
19 1 "O4'" B DA  15  ? ? "C1'" B DA  15  ? ? N9    B DA  15  ? ? 111.94 108.30 3.64   0.30 N 
20 1 "O4'" C DT  3   ? ? "C1'" C DT  3   ? ? N1    C DT  3   ? ? 112.67 108.30 4.37   0.30 N 
21 1 "C3'" C DG  4   ? ? "C2'" C DG  4   ? ? "C1'" C DG  4   ? ? 96.49  102.40 -5.91  0.80 N 
22 1 "O4'" C DG  4   ? ? "C1'" C DG  4   ? ? N9    C DG  4   ? ? 112.38 108.30 4.08   0.30 N 
23 1 "O4'" C DT  5   ? ? "C4'" C DT  5   ? ? "C3'" C DT  5   ? ? 101.92 104.50 -2.58  0.40 N 
24 1 "O4'" C DT  6   ? ? "C1'" C DT  6   ? ? N1    C DT  6   ? ? 111.30 108.30 3.00   0.30 N 
25 1 "O5'" C DT  9   ? ? P     C DT  9   ? ? OP2   C DT  9   ? ? 120.61 110.70 9.91   1.20 N 
26 1 "O5'" C DG  10  ? ? P     C DG  10  ? ? OP1   C DG  10  ? ? 96.11  105.70 -9.59  0.90 N 
27 1 "O5'" C DG  10  ? ? P     C DG  10  ? ? OP2   C DG  10  ? ? 120.28 110.70 9.58   1.20 N 
28 1 "O5'" C DT  11  ? ? P     C DT  11  ? ? OP1   C DT  11  ? ? 99.68  105.70 -6.02  0.90 N 
29 1 "O5'" C DT  12  ? ? P     C DT  12  ? ? OP1   C DT  12  ? ? 94.05  105.70 -11.65 0.90 N 
30 1 "O4'" C DT  12  ? ? "C4'" C DT  12  ? ? "C3'" C DT  12  ? ? 101.27 104.50 -3.23  0.40 N 
31 1 "O4'" C DC  13  ? ? "C4'" C DC  13  ? ? "C3'" C DC  13  ? ? 99.36  104.50 -5.14  0.40 N 
32 1 "O4'" C DT  14  ? ? "C4'" C DT  14  ? ? "C3'" C DT  14  ? ? 101.30 104.50 -3.20  0.40 N 
33 1 "O5'" C DC  15  ? ? P     C DC  15  ? ? OP1   C DC  15  ? ? 117.98 110.70 7.28   1.20 N 
34 1 "O4'" C DG  17  ? ? "C1'" C DG  17  ? ? N9    C DG  17  ? ? 110.62 108.30 2.32   0.30 N 
35 1 "C3'" C DT  20  ? ? "C2'" C DT  20  ? ? "C1'" C DT  20  ? ? 96.30  102.40 -6.10  0.80 N 
36 1 "O5'" C DA  22  ? ? P     C DA  22  ? ? OP2   C DA  22  ? ? 99.05  105.70 -6.65  0.90 N 
37 1 "C1'" C DA  22  ? ? "O4'" C DA  22  ? ? "C4'" C DA  22  ? ? 103.22 110.10 -6.88  1.00 N 
38 1 "O5'" C DC  25  ? ? P     C DC  25  ? ? OP2   C DC  25  ? ? 98.20  105.70 -7.50  0.90 N 
39 1 "O4'" D DA  6   ? ? "C1'" D DA  6   ? ? N9    D DA  6   ? ? 112.84 108.30 4.54   0.30 N 
40 1 C     E SER 378 ? ? N     E SER 379 ? ? CA    E SER 379 ? ? 136.79 121.70 15.09  2.50 Y 
41 1 "O4'" F DA  3   ? ? "C1'" F DA  3   ? ? N9    F DA  3   ? ? 110.95 108.30 2.65   0.30 N 
42 1 OP1   F DG  4   ? ? P     F DG  4   ? ? OP2   F DG  4   ? ? 129.12 119.60 9.52   1.50 N 
43 1 "O5'" F DG  4   ? ? P     F DG  4   ? ? OP2   F DG  4   ? ? 97.93  105.70 -7.77  0.90 N 
44 1 "C1'" F DA  5   ? ? "O4'" F DA  5   ? ? "C4'" F DA  5   ? ? 103.93 110.10 -6.17  1.00 N 
45 1 "O4'" F DC  7   ? ? "C4'" F DC  7   ? ? "C3'" F DC  7   ? ? 101.88 104.50 -2.62  0.40 N 
46 1 "C1'" F DC  7   ? ? "O4'" F DC  7   ? ? "C4'" F DC  7   ? ? 101.09 110.10 -9.01  1.00 N 
47 1 "O4'" F DC  7   ? ? "C1'" F DC  7   ? ? N1    F DC  7   ? ? 114.82 108.30 6.52   0.30 N 
48 1 "O4'" F DA  8   ? ? "C4'" F DA  8   ? ? "C3'" F DA  8   ? ? 101.67 104.50 -2.83  0.40 N 
49 1 "C1'" F DC  10  ? ? "O4'" F DC  10  ? ? "C4'" F DC  10  ? ? 103.90 110.10 -6.20  1.00 N 
50 1 "C3'" F DA  11  ? ? "C2'" F DA  11  ? ? "C1'" F DA  11  ? ? 95.78  102.40 -6.62  0.80 N 
51 1 "O4'" F DA  11  ? ? "C1'" F DA  11  ? ? N9    F DA  11  ? ? 111.95 108.30 3.65   0.30 N 
52 1 "C1'" F DA  12  ? ? "O4'" F DA  12  ? ? "C4'" F DA  12  ? ? 103.11 110.10 -6.99  1.00 N 
53 1 "O4'" F DA  12  ? ? "C1'" F DA  12  ? ? N9    F DA  12  ? ? 113.97 108.30 5.67   0.30 N 
54 1 "O4'" F DC  13  ? ? "C4'" F DC  13  ? ? "C3'" F DC  13  ? ? 102.06 104.50 -2.44  0.40 N 
55 1 "O4'" F DC  13  ? ? "C1'" F DC  13  ? ? N1    F DC  13  ? ? 111.18 108.30 2.88   0.30 N 
56 1 "O4'" G DC  1   ? ? "C4'" G DC  1   ? ? "C3'" G DC  1   ? ? 102.07 104.50 -2.43  0.40 N 
57 1 "O4'" G DT  3   ? ? "C1'" G DT  3   ? ? N1    G DT  3   ? ? 111.70 108.30 3.40   0.30 N 
58 1 "O4'" G DT  5   ? ? "C1'" G DT  5   ? ? N1    G DT  5   ? ? 102.98 108.00 -5.02  0.70 N 
59 1 "O4'" G DT  6   ? ? "C1'" G DT  6   ? ? N1    G DT  6   ? ? 110.77 108.30 2.47   0.30 N 
60 1 "O5'" G DG  10  ? ? P     G DG  10  ? ? OP1   G DG  10  ? ? 99.73  105.70 -5.97  0.90 N 
61 1 "O5'" G DT  11  ? ? P     G DT  11  ? ? OP1   G DT  11  ? ? 97.42  105.70 -8.28  0.90 N 
62 1 "O5'" G DT  11  ? ? P     G DT  11  ? ? OP2   G DT  11  ? ? 118.38 110.70 7.68   1.20 N 
63 1 N3    G DT  12  ? ? C4    G DT  12  ? ? O4    G DT  12  ? ? 124.32 119.90 4.42   0.60 N 
64 1 "O4'" G DC  13  ? ? "C4'" G DC  13  ? ? "C3'" G DC  13  ? ? 101.33 104.50 -3.17  0.40 N 
65 1 "O4'" G DT  14  ? ? "C4'" G DT  14  ? ? "C3'" G DT  14  ? ? 101.79 104.50 -2.71  0.40 N 
66 1 "O5'" G DC  15  ? ? P     G DC  15  ? ? OP2   G DC  15  ? ? 98.80  105.70 -6.90  0.90 N 
67 1 "O4'" G DC  15  ? ? "C4'" G DC  15  ? ? "C3'" G DC  15  ? ? 101.43 104.50 -3.07  0.40 N 
68 1 "O4'" G DG  17  ? ? "C1'" G DG  17  ? ? N9    G DG  17  ? ? 112.28 108.30 3.98   0.30 N 
69 1 C8    G DG  17  ? ? N9    G DG  17  ? ? C4    G DG  17  ? ? 103.65 106.40 -2.75  0.40 N 
70 1 "O4'" G DG  19  ? ? "C1'" G DG  19  ? ? N9    G DG  19  ? ? 110.95 108.30 2.65   0.30 N 
71 1 "O5'" G DT  20  ? ? P     G DT  20  ? ? OP2   G DT  20  ? ? 98.19  105.70 -7.51  0.90 N 
72 1 "O4'" G DG  24  ? ? "C1'" G DG  24  ? ? N9    G DG  24  ? ? 110.17 108.30 1.87   0.30 N 
73 1 "O5'" H DT  4   ? ? P     H DT  4   ? ? OP2   H DT  4   ? ? 118.48 110.70 7.78   1.20 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ILE A 95  ? ? -57.21  -72.32  
2  1 CYS A 106 ? ? 45.80   71.77   
3  1 SER A 110 ? ? -56.30  -9.36   
4  1 GLU A 157 ? ? -52.39  -74.41  
5  1 LEU A 161 ? ? -47.06  -72.40  
6  1 SER A 168 ? ? -55.86  -72.32  
7  1 ASP A 173 ? ? 71.28   -1.35   
8  1 GLU A 200 ? ? 55.25   89.06   
9  1 ASN A 201 ? ? 66.27   -126.73 
10 1 GLU A 203 ? ? -143.11 -60.22  
11 1 LEU A 204 ? ? 73.74   83.16   
12 1 ASP A 215 ? ? 58.91   -135.67 
13 1 ARG A 249 ? ? -110.86 77.72   
14 1 ASN A 252 ? ? -45.32  -80.50  
15 1 LEU A 303 ? ? -92.42  -157.23 
16 1 GLN A 304 ? ? 81.77   -20.96  
17 1 LEU A 307 ? ? -149.84 -55.93  
18 1 ARG A 308 ? ? 89.38   -13.70  
19 1 ARG A 318 ? ? 175.21  156.98  
20 1 ASN A 320 ? ? 23.67   58.04   
21 1 SER A 321 ? ? -51.74  -7.50   
22 1 ILE A 352 ? ? -84.58  -154.76 
23 1 ASN A 353 ? ? 65.79   75.99   
24 1 SER A 381 ? ? -130.16 -54.53  
25 1 TRP A 421 ? ? -78.82  -72.16  
26 1 PRO A 438 ? ? -77.65  44.94   
27 1 MET A 442 ? ? -54.61  -6.04   
28 1 GLN A 444 ? ? 47.83   -141.14 
29 1 ALA A 448 ? ? -49.57  -70.26  
30 1 GLU A 459 ? ? -58.60  -72.40  
31 1 GLU A 462 ? ? -63.80  1.64    
32 1 VAL A 518 ? ? 64.99   80.13   
33 1 PHE A 524 ? ? -56.10  -70.78  
34 1 LYS A 549 ? ? 71.91   -21.94  
35 1 LEU A 557 ? ? -81.11  -71.30  
36 1 ALA A 566 ? ? 80.38   -8.69   
37 1 CYS E 106 ? ? 49.38   70.87   
38 1 SER E 110 ? ? -56.28  -3.93   
39 1 LEU E 140 ? ? -71.61  -72.32  
40 1 LYS E 159 ? ? -83.11  -76.94  
41 1 LEU E 161 ? ? -52.96  -72.43  
42 1 ARG E 164 ? ? -71.31  -70.89  
43 1 ASP E 173 ? ? 65.02   -3.12   
44 1 ASN E 185 ? ? -119.71 79.29   
45 1 TYR E 186 ? ? -146.86 -62.85  
46 1 GLU E 200 ? ? 56.26   88.41   
47 1 ASN E 201 ? ? 59.07   -141.14 
48 1 GLU E 203 ? ? -139.33 -67.94  
49 1 LEU E 204 ? ? 66.02   80.86   
50 1 ASP E 215 ? ? 49.46   -141.72 
51 1 SER E 219 ? ? 71.79   45.10   
52 1 ASN E 236 ? ? 88.71   -0.55   
53 1 SER E 241 ? ? -136.39 -60.55  
54 1 LEU E 303 ? ? -93.35  -157.11 
55 1 GLN E 304 ? ? 88.47   -19.53  
56 1 LEU E 307 ? ? -152.23 -54.39  
57 1 ARG E 308 ? ? 87.65   -10.92  
58 1 ASN E 320 ? ? 36.19   59.41   
59 1 ILE E 352 ? ? -120.19 -78.72  
60 1 SER E 379 ? ? 154.60  171.30  
61 1 SER E 381 ? ? -128.71 -56.74  
62 1 PRO E 438 ? ? -71.97  46.76   
63 1 MET E 442 ? ? -58.05  -5.57   
64 1 GLN E 443 ? ? -41.24  -73.29  
65 1 GLN E 444 ? ? 47.65   -143.13 
66 1 ALA E 448 ? ? -55.04  -74.84  
67 1 PHE E 453 ? ? -60.50  -74.69  
68 1 VAL E 518 ? ? 47.57   82.95   
69 1 LYS E 549 ? ? 71.48   -17.69  
70 1 ALA E 566 ? ? 73.43   -3.86   
71 1 GLN E 592 ? ? -43.12  -70.52  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 GLU A 217 ? ? ARG A 218 ? ? -145.16 
2 1 ARG A 318 ? ? TRP A 319 ? ? -146.69 
3 1 GLN A 444 ? ? GLU A 445 ? ? 149.37  
4 1 GLU A 445 ? ? LYS A 446 ? ? -149.81 
5 1 GLU E 217 ? ? ARG E 218 ? ? -144.50 
6 1 ASN E 302 ? ? LEU E 303 ? ? 149.80  
7 1 ASN E 320 ? ? SER E 321 ? ? 146.04  
8 1 VAL E 400 ? ? GLY E 401 ? ? -149.87 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 76  ? A GLY 1   
2  1 Y 1 A SER 77  ? A SER 2   
3  1 Y 1 A HIS 78  ? A HIS 3   
4  1 Y 1 A MET 79  ? A MET 4   
5  1 Y 1 A SER 80  ? A SER 5   
6  1 Y 1 A ILE 484 ? A ILE 389 
7  1 Y 1 A ASN 485 ? A ASN 390 
8  1 Y 1 A ARG 486 ? A ARG 391 
9  1 Y 1 A MET 487 ? A MET 392 
10 1 Y 1 A SER 488 ? A SER 393 
11 1 Y 1 A SER 489 ? A SER 394 
12 1 Y 1 A PHE 490 ? A PHE 395 
13 1 Y 1 A ASN 491 ? A ASN 396 
14 1 Y 1 A GLU 492 ? A GLU 397 
15 1 Y 1 A LEU 493 ? A LEU 398 
16 1 Y 1 A SER 494 ? A SER 399 
17 1 Y 1 A ALA 495 ? A ALA 400 
18 1 Y 1 A THR 496 ? A THR 401 
19 1 Y 1 A GLN 497 ? A GLN 402 
20 1 Y 1 A LEU 498 ? A LEU 403 
21 1 Y 1 A ASN 499 ? A ASN 404 
22 1 Y 1 A GLN 500 ? A GLN 405 
23 1 Y 1 A SER 501 ? A SER 406 
24 1 Y 1 A ASP 502 ? A ASP 407 
25 1 Y 1 A SER 503 ? A SER 408 
26 1 Y 1 A ASN 504 ? A ASN 409 
27 1 Y 1 A SER 505 ? A SER 410 
28 1 Y 1 A HIS 506 ? A HIS 411 
29 1 Y 1 A ASN 507 ? A ASN 412 
30 1 Y 1 A SER 508 ? A SER 413 
31 1 Y 1 A ILE 509 ? A ILE 414 
32 1 Y 1 A ASP 510 ? A ASP 415 
33 1 Y 1 A LEU 511 ? A LEU 416 
34 1 Y 1 A THR 512 ? A THR 417 
35 1 Y 1 A SER 513 ? A SER 418 
36 1 Y 1 A HIS 514 ? A HIS 419 
37 1 Y 1 A SER 515 ? A SER 420 
38 1 Y 1 A LYS 516 ? A LYS 421 
39 1 Y 1 A LEU 610 ? A LEU 515 
40 1 Y 1 A ASP 611 ? A ASP 516 
41 1 Y 1 A ILE 612 ? A ILE 517 
42 1 Y 1 C DG  26  ? C DG  26  
43 1 Y 1 E GLY 76  ? E GLY 1   
44 1 Y 1 E SER 77  ? E SER 2   
45 1 Y 1 E HIS 78  ? E HIS 3   
46 1 Y 1 E MET 79  ? E MET 4   
47 1 Y 1 E SER 80  ? E SER 5   
48 1 Y 1 E ILE 484 ? E ILE 389 
49 1 Y 1 E ASN 485 ? E ASN 390 
50 1 Y 1 E ARG 486 ? E ARG 391 
51 1 Y 1 E MET 487 ? E MET 392 
52 1 Y 1 E SER 488 ? E SER 393 
53 1 Y 1 E SER 489 ? E SER 394 
54 1 Y 1 E PHE 490 ? E PHE 395 
55 1 Y 1 E ASN 491 ? E ASN 396 
56 1 Y 1 E GLU 492 ? E GLU 397 
57 1 Y 1 E LEU 493 ? E LEU 398 
58 1 Y 1 E SER 494 ? E SER 399 
59 1 Y 1 E ALA 495 ? E ALA 400 
60 1 Y 1 E THR 496 ? E THR 401 
61 1 Y 1 E GLN 497 ? E GLN 402 
62 1 Y 1 E LEU 498 ? E LEU 403 
63 1 Y 1 E ASN 499 ? E ASN 404 
64 1 Y 1 E GLN 500 ? E GLN 405 
65 1 Y 1 E SER 501 ? E SER 406 
66 1 Y 1 E ASP 502 ? E ASP 407 
67 1 Y 1 E SER 503 ? E SER 408 
68 1 Y 1 E ASN 504 ? E ASN 409 
69 1 Y 1 E SER 505 ? E SER 410 
70 1 Y 1 E HIS 506 ? E HIS 411 
71 1 Y 1 E ASN 507 ? E ASN 412 
72 1 Y 1 E SER 508 ? E SER 413 
73 1 Y 1 E ILE 509 ? E ILE 414 
74 1 Y 1 E ASP 510 ? E ASP 415 
75 1 Y 1 E LEU 511 ? E LEU 416 
76 1 Y 1 E THR 512 ? E THR 417 
77 1 Y 1 E SER 513 ? E SER 418 
78 1 Y 1 E HIS 514 ? E HIS 419 
79 1 Y 1 E SER 515 ? E SER 420 
80 1 Y 1 E LYS 516 ? E LYS 421 
81 1 Y 1 E LEU 610 ? E LEU 515 
82 1 Y 1 E ASP 611 ? E ASP 516 
83 1 Y 1 E ILE 612 ? E ILE 517 
84 1 Y 1 G DG  26  ? G DG  26  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
6DWZ 'double helix'        
6DWZ 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 1  1_555 C DC 15 1_555 0.377  -0.471 0.256  -0.129  8.989   -7.001  1  B_DG2:DC15_C B 2  ? C 15 ? 19 1 
1 B DA 2  1_555 C DT 14 1_555 -0.181 -0.284 0.138  4.526   -0.888  -3.072  2  B_DA3:DT14_C B 3  ? C 14 ? 20 1 
1 B DG 3  1_555 C DC 13 1_555 -0.128 -0.334 0.088  2.989   -2.163  -2.941  3  B_DG4:DC13_C B 4  ? C 13 ? 19 1 
1 B DA 4  1_555 C DT 12 1_555 0.143  -0.308 0.336  4.180   -6.441  -5.458  4  B_DA5:DT12_C B 5  ? C 12 ? 20 1 
1 B DA 5  1_555 C DT 11 1_555 0.087  -0.265 0.418  10.119  -1.613  0.167   5  B_DA6:DT11_C B 6  ? C 11 ? 20 1 
1 B DC 6  1_555 C DG 10 1_555 -0.772 -0.235 -0.474 19.431  0.570   -5.088  6  B_DC7:DG10_C B 7  ? C 10 ? 19 1 
1 B DA 7  1_555 C DT 9  1_555 0.622  -0.315 -0.018 12.964  -14.684 -8.422  7  B_DA8:DT9_C  B 8  ? C 9  ? 20 1 
1 B DA 8  1_555 C DT 8  1_555 0.818  -0.337 0.127  5.841   -9.974  -3.508  8  B_DA9:DT8_C  B 9  ? C 8  ? 20 1 
1 B DC 9  1_555 C DG 7  1_555 -0.217 -0.309 0.168  -0.037  -8.685  -9.131  9  B_DC10:DG7_C B 10 ? C 7  ? 19 1 
1 B DA 10 1_555 C DT 6  1_555 1.151  -0.211 -0.103 3.951   -13.061 -19.678 10 B_DA11:DT6_C B 11 ? C 6  ? 20 1 
1 B DA 11 1_555 C DT 5  1_555 -1.025 -0.373 0.823  11.779  -5.517  -8.927  11 B_DA12:DT5_C B 12 ? C 5  ? 20 1 
1 B DC 12 1_555 C DG 4  1_555 1.509  -0.693 0.881  1.828   -15.334 -4.597  12 B_DC13:DG4_C B 13 ? C 4  ? 19 1 
1 B DA 13 1_555 C DT 3  1_555 0.055  0.117  1.014  9.385   -13.391 3.152   13 B_DA14:DT3_C B 14 ? C 3  ? 20 1 
1 B DA 14 1_555 C DT 2  1_555 -0.575 -0.129 0.285  6.680   -9.265  -11.913 14 B_DA15:DT2_C B 15 ? C 2  ? 20 1 
1 B DG 15 1_555 C DC 1  1_555 2.009  0.015  0.335  4.066   -14.221 5.468   15 B_DG16:DC1_C B 16 ? C 1  ? 19 1 
1 C DG 19 1_555 D DC 7  1_555 -0.385 0.097  1.139  -2.700  -4.803  1.008   16 C_DG19:DC7_D C 19 ? D 7  ? 19 1 
1 C DT 20 1_555 D DA 6  1_555 -0.078 -0.095 0.928  3.825   -6.087  -9.676  17 C_DT20:DA6_D C 20 ? D 6  ? 20 1 
1 C DC 21 1_555 D DG 5  1_555 -1.015 -0.163 0.121  4.823   -16.640 -6.122  18 C_DC21:DG5_D C 21 ? D 5  ? 19 1 
1 C DA 22 1_555 D DT 4  1_555 -0.008 -0.706 -0.049 0.109   -6.418  -13.320 19 C_DA22:DT4_D C 22 ? D 4  ? ?  1 
1 C DC 23 1_555 D DG 3  1_555 0.105  -0.281 -0.021 3.754   -3.655  -4.960  20 C_DC23:DG3_D C 23 ? D 3  ? 19 1 
1 C DG 24 1_555 D DC 2  1_555 0.032  -0.350 0.076  -0.336  -3.303  6.114   21 C_DG24:DC2_D C 24 ? D 2  ? 22 1 
1 C DC 25 1_555 D DG 1  1_555 1.642  -0.578 0.117  7.119   -13.716 -12.428 22 C_DC25:DG1_D C 25 ? D 1  ? 19 1 
1 F DG 1  1_555 G DC 15 1_555 -0.068 -0.430 0.407  -10.408 -3.386  -8.319  23 F_DG2:DC15_G F 2  ? G 15 ? 19 1 
1 F DA 2  1_555 G DT 14 1_555 0.173  -0.441 0.096  -0.719  -6.540  -4.509  24 F_DA3:DT14_G F 3  ? G 14 ? 20 1 
1 F DG 3  1_555 G DC 13 1_555 0.080  -0.316 0.144  1.439   1.903   -3.478  25 F_DG4:DC13_G F 4  ? G 13 ? 19 1 
1 F DA 4  1_555 G DT 12 1_555 -1.044 -0.484 0.042  0.311   -5.553  1.638   26 F_DA5:DT12_G F 5  ? G 12 ? 20 1 
1 F DA 5  1_555 G DT 11 1_555 0.438  -0.373 0.360  10.474  0.807   -5.292  27 F_DA6:DT11_G F 6  ? G 11 ? 20 1 
1 F DC 6  1_555 G DG 10 1_555 -0.543 -0.387 0.206  11.421  1.880   -8.157  28 F_DC7:DG10_G F 7  ? G 10 ? 19 1 
1 F DA 7  1_555 G DT 9  1_555 0.311  -0.508 -0.013 15.148  -13.690 3.281   29 F_DA8:DT9_G  F 8  ? G 9  ? 20 1 
1 F DA 8  1_555 G DT 8  1_555 0.119  -0.522 0.120  9.217   -11.608 1.780   30 F_DA9:DT8_G  F 9  ? G 8  ? 20 1 
1 F DC 9  1_555 G DG 7  1_555 -0.796 -0.544 0.062  0.055   -7.556  -2.721  31 F_DC10:DG7_G F 10 ? G 7  ? 19 1 
1 F DA 10 1_555 G DT 6  1_555 0.107  -0.046 -0.041 0.815   -8.132  -20.327 32 F_DA11:DT6_G F 11 ? G 6  ? 20 1 
1 F DA 11 1_555 G DT 5  1_555 0.060  0.073  0.357  6.364   -6.788  -2.626  33 F_DA12:DT5_G F 12 ? G 5  ? 20 1 
1 F DC 12 1_555 G DG 4  1_555 1.292  -0.672 0.669  0.419   -17.362 -6.487  34 F_DC13:DG4_G F 13 ? G 4  ? 19 1 
1 F DA 13 1_555 G DT 3  1_555 -0.230 -0.135 0.263  -3.428  -14.152 -2.068  35 F_DA14:DT3_G F 14 ? G 3  ? 20 1 
1 F DA 14 1_555 G DT 2  1_555 0.469  -0.343 0.705  5.386   -11.926 -2.283  36 F_DA15:DT2_G F 15 ? G 2  ? 20 1 
1 F DG 15 1_555 G DC 1  1_555 0.732  -0.381 0.926  8.046   -16.769 4.196   37 F_DG16:DC1_G F 16 ? G 1  ? 19 1 
1 G DG 19 1_555 H DC 7  1_555 -1.147 -0.609 1.362  -2.777  -10.519 -7.595  38 G_DG19:DC7_H G 19 ? H 7  ? 19 1 
1 G DT 20 1_555 H DA 6  1_555 -0.327 -0.128 1.917  -7.542  -9.285  -0.928  39 G_DT20:DA6_H G 20 ? H 6  ? 20 1 
1 G DC 21 1_555 H DG 5  1_555 -1.383 -0.029 0.103  7.543   -16.372 -0.653  40 G_DC21:DG5_H G 21 ? H 5  ? 19 1 
1 G DA 22 1_555 H DT 4  1_555 -0.440 -0.735 -0.062 -4.079  -2.524  -6.514  41 G_DA22:DT4_H G 22 ? H 4  ? 20 1 
1 G DC 23 1_555 H DG 3  1_555 0.191  -0.474 0.014  -0.607  -2.427  0.581   42 G_DC23:DG3_H G 23 ? H 3  ? 19 1 
1 G DG 24 1_555 H DC 2  1_555 1.543  0.548  0.382  6.618   -5.539  9.881   43 G_DG24:DC2_H G 24 ? H 2  ? ?  1 
1 G DC 25 1_555 H DG 1  1_555 1.194  -0.660 0.137  14.281  -12.738 -12.411 44 G_DC25:DG1_H G 25 ? H 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 1  1_555 C DC 15 1_555 B DA 2  1_555 C DT 14 1_555 -0.474 -0.086 3.375 -2.922 10.128 27.244 -2.458 0.281  3.173 20.551  
5.929   29.176 1  BB_DG2DA3:DT14DC15_CC B 2  ? C 15 ? B 3  ? C 14 ? 
1 B DA 2  1_555 C DT 14 1_555 B DG 3  1_555 C DC 13 1_555 -0.678 0.394  3.612 -4.388 6.638  37.803 -0.327 0.416  3.679 10.109  
6.682   38.601 2  BB_DA3DG4:DC13DT14_CC B 3  ? C 14 ? B 4  ? C 13 ? 
1 B DG 3  1_555 C DC 13 1_555 B DA 4  1_555 C DT 12 1_555 0.082  -0.677 3.250 -4.201 5.550  29.047 -2.439 -1.010 3.030 10.869  
8.228   29.852 3  BB_DG4DA5:DT12DC13_CC B 4  ? C 13 ? B 5  ? C 12 ? 
1 B DA 4  1_555 C DT 12 1_555 B DA 5  1_555 C DT 11 1_555 -0.476 -0.473 3.262 -0.992 0.167  34.683 -0.819 0.647  3.272 0.279   
1.664   34.697 4  BB_DA5DA6:DT11DT12_CC B 5  ? C 12 ? B 6  ? C 11 ? 
1 B DA 5  1_555 C DT 11 1_555 B DC 6  1_555 C DG 10 1_555 0.240  -0.745 3.208 5.247  -4.890 23.988 -0.249 1.024  3.270 -11.441 
-12.278 25.023 5  BB_DA6DC7:DG10DT11_CC B 6  ? C 11 ? B 7  ? C 10 ? 
1 B DC 6  1_555 C DG 10 1_555 B DA 7  1_555 C DT 9  1_555 -1.265 0.681  3.525 -4.026 2.067  50.839 0.633  1.162  3.632 2.402   
4.679   51.027 6  BB_DC7DA8:DT9DG10_CC  B 7  ? C 10 ? B 8  ? C 9  ? 
1 B DA 7  1_555 C DT 9  1_555 B DA 8  1_555 C DT 8  1_555 0.536  -0.540 3.415 -3.243 1.955  32.429 -1.311 -1.534 3.310 3.486   
5.782   32.644 7  BB_DA8DA9:DT8DT9_CC   B 8  ? C 9  ? B 9  ? C 8  ? 
1 B DA 8  1_555 C DT 8  1_555 B DC 9  1_555 C DG 7  1_555 0.563  -0.885 3.397 1.719  -0.056 29.217 -1.739 -0.727 3.426 -0.111  
-3.403  29.266 8  BB_DA9DC10:DG7DT8_CC  B 9  ? C 8  ? B 10 ? C 7  ? 
1 B DC 9  1_555 C DG 7  1_555 B DA 10 1_555 C DT 6  1_555 -0.448 -0.852 3.258 0.478  4.718  38.472 -1.850 0.732  3.130 7.127   
-0.723  38.753 9  BB_DC10DA11:DT6DG7_CC B 10 ? C 7  ? B 11 ? C 6  ? 
1 B DA 10 1_555 C DT 6  1_555 B DA 11 1_555 C DT 5  1_555 0.608  -0.552 2.840 -5.295 -1.227 22.807 -1.004 -3.024 2.657 -3.047  
13.151  23.438 10 BB_DA11DA12:DT5DT6_CC B 11 ? C 6  ? B 12 ? C 5  ? 
1 B DA 11 1_555 C DT 5  1_555 B DC 12 1_555 C DG 4  1_555 0.935  -1.079 3.724 1.473  -1.538 48.452 -1.178 -1.007 3.780 -1.873  
-1.793  48.496 11 BB_DA12DC13:DG4DT5_CC B 12 ? C 5  ? B 13 ? C 4  ? 
1 B DC 12 1_555 C DG 4  1_555 B DA 13 1_555 C DT 3  1_555 -0.147 -0.827 2.659 1.612  4.262  35.960 -1.806 0.418  2.539 6.869   
-2.598  36.238 12 BB_DC13DA14:DT3DG4_CC B 13 ? C 4  ? B 14 ? C 3  ? 
1 B DA 13 1_555 C DT 3  1_555 B DA 14 1_555 C DT 2  1_555 -0.607 -1.320 3.250 2.975  -3.006 22.182 -2.265 2.646  3.289 -7.722  
-7.643  22.577 13 BB_DA14DA15:DT2DT3_CC B 14 ? C 3  ? B 15 ? C 2  ? 
1 B DA 14 1_555 C DT 2  1_555 B DG 15 1_555 C DC 1  1_555 0.673  -0.101 3.493 0.625  -1.778 49.172 0.021  -0.758 3.502 -2.136  
-0.751  49.206 14 BB_DA15DG16:DC1DT2_CC B 15 ? C 2  ? B 16 ? C 1  ? 
1 C DG 19 1_555 D DC 7  1_555 C DT 20 1_555 D DA 6  1_555 -0.887 -1.226 3.190 -0.590 1.819  28.405 -2.896 1.674  3.124 3.701   
1.200   28.468 15 CC_DG19DT20:DA6DC7_DD C 19 ? D 7  ? C 20 ? D 6  ? 
1 C DT 20 1_555 D DA 6  1_555 C DC 21 1_555 D DG 5  1_555 -0.504 -0.515 3.111 2.490  -0.079 30.388 -0.964 1.428  3.062 -0.151  
-4.741  30.487 16 CC_DT20DC21:DG5DA6_DD C 20 ? D 6  ? C 21 ? D 5  ? 
1 C DC 21 1_555 D DG 5  1_555 C DA 22 1_555 D DT 4  1_555 -0.257 -0.408 3.506 -0.979 9.465  40.286 -1.654 0.253  3.336 13.516  
1.397   41.349 17 CC_DC21DA22:DT4DG5_DD C 21 ? D 5  ? C 22 ? D 4  ? 
1 C DA 22 1_555 D DT 4  1_555 C DC 23 1_555 D DG 3  1_555 0.574  -1.121 3.176 -2.244 4.435  33.019 -2.646 -1.350 2.961 7.748   
3.920   33.381 18 CC_DA22DC23:DG3DT4_DD C 22 ? D 4  ? C 23 ? D 3  ? 
1 C DC 23 1_555 D DG 3  1_555 C DG 24 1_555 D DC 2  1_555 0.530  0.551  3.525 1.523  -2.249 36.766 1.199  -0.616 3.505 -3.559  
-2.411  36.862 19 CC_DC23DG24:DC2DG3_DD C 23 ? D 3  ? C 24 ? D 2  ? 
1 C DG 24 1_555 D DC 2  1_555 C DC 25 1_555 D DG 1  1_555 -0.670 -0.009 3.179 0.693  3.579  39.475 -0.419 1.067  3.154 5.285   
-1.023  39.636 20 CC_DG24DC25:DG1DC2_DD C 24 ? D 2  ? C 25 ? D 1  ? 
1 F DG 1  1_555 G DC 15 1_555 F DA 2  1_555 G DT 14 1_555 -0.396 -0.291 3.308 -0.476 9.484  29.334 -2.400 0.652  3.072 18.139  
0.911   30.801 21 FF_DG2DA3:DT14DC15_GG F 2  ? G 15 ? F 3  ? G 14 ? 
1 F DA 2  1_555 G DT 14 1_555 F DG 3  1_555 G DC 13 1_555 -0.614 0.535  3.449 -6.064 6.107  37.505 -0.010 0.115  3.543 9.348   
9.282   38.445 22 FF_DA3DG4:DC13DT14_GG F 3  ? G 14 ? F 4  ? G 13 ? 
1 F DG 3  1_555 G DC 13 1_555 F DA 4  1_555 G DT 12 1_555 0.575  -0.581 3.350 -0.114 7.767  22.643 -3.917 -1.424 2.984 19.075  
0.280   23.922 23 FF_DG4DA5:DT12DC13_GG F 4  ? G 13 ? F 5  ? G 12 ? 
1 F DA 4  1_555 G DT 12 1_555 F DA 5  1_555 G DT 11 1_555 -0.862 0.048  3.097 -2.088 -1.481 44.321 0.194  0.957  3.129 -1.961  
2.766   44.391 24 FF_DA5DA6:DT11DT12_GG F 5  ? G 12 ? F 6  ? G 11 ? 
1 F DA 5  1_555 G DT 11 1_555 F DC 6  1_555 G DG 10 1_555 0.472  -1.118 3.379 -1.713 -2.134 22.685 -2.028 -1.829 3.423 -5.399  
4.334   22.847 25 FF_DA6DC7:DG10DT11_GG F 6  ? G 11 ? F 7  ? G 10 ? 
1 F DC 6  1_555 G DG 10 1_555 F DA 7  1_555 G DT 9  1_555 -1.037 0.741  3.227 1.452  2.060  44.016 0.797  1.516  3.223 2.746   
-1.935  44.084 26 FF_DC7DA8:DT9DG10_GG  F 7  ? G 10 ? F 8  ? G 9  ? 
1 F DA 7  1_555 G DT 9  1_555 F DA 8  1_555 G DT 8  1_555 0.367  0.085  3.359 -4.616 0.568  34.315 0.054  -1.341 3.285 0.958   
7.779   34.620 27 FF_DA8DA9:DT8DT9_GG   F 8  ? G 9  ? F 9  ? G 8  ? 
1 F DA 8  1_555 G DT 8  1_555 F DC 9  1_555 G DG 7  1_555 0.273  -0.736 3.491 1.092  0.655  28.570 -1.649 -0.289 3.481 1.326   
-2.211  28.598 28 FF_DA9DC10:DG7DT8_GG  F 9  ? G 8  ? F 10 ? G 7  ? 
1 F DC 9  1_555 G DG 7  1_555 F DA 10 1_555 G DT 6  1_555 -0.696 -0.876 3.394 0.369  2.240  34.718 -1.816 1.222  3.325 3.749   
-0.618  34.790 29 FF_DC10DA11:DT6DG7_GG F 10 ? G 7  ? F 11 ? G 6  ? 
1 F DA 10 1_555 G DT 6  1_555 F DA 11 1_555 G DT 5  1_555 0.811  -0.755 3.023 -0.292 -2.528 32.245 -0.938 -1.505 3.064 -4.542  
0.525   32.342 30 FF_DA11DA12:DT5DT6_GG F 11 ? G 6  ? F 12 ? G 5  ? 
1 F DA 11 1_555 G DT 5  1_555 F DC 12 1_555 G DG 4  1_555 0.886  -0.905 3.486 1.190  0.985  42.957 -1.339 -1.084 3.488 1.345   
-1.625  42.983 31 FF_DA12DC13:DG4DT5_GG F 12 ? G 5  ? F 13 ? G 4  ? 
1 F DC 12 1_555 G DG 4  1_555 F DA 13 1_555 G DT 3  1_555 -0.166 -1.176 3.116 0.143  7.003  32.722 -3.104 0.310  2.810 12.255  
-0.250  33.443 32 FF_DC13DA14:DT3DG4_GG F 13 ? G 4  ? F 14 ? G 3  ? 
1 F DA 13 1_555 G DT 3  1_555 F DA 14 1_555 G DT 2  1_555 0.000  -0.760 2.956 -2.089 -5.347 35.005 -0.526 -0.282 3.031 -8.815  
3.444   35.458 33 FF_DA14DA15:DT2DT3_GG F 14 ? G 3  ? F 15 ? G 2  ? 
1 F DA 14 1_555 G DT 2  1_555 F DG 15 1_555 G DC 1  1_555 -0.077 -0.532 3.318 -2.553 -4.127 39.590 -0.293 -0.189 3.353 -6.065  
3.752   39.875 34 FF_DA15DG16:DC1DT2_GG F 15 ? G 2  ? F 16 ? G 1  ? 
1 G DG 19 1_555 H DC 7  1_555 G DT 20 1_555 H DA 6  1_555 -0.204 -1.392 3.378 -5.542 3.136  36.324 -2.636 -0.444 3.246 4.982   
8.806   36.859 35 GG_DG19DT20:DA6DC7_HH G 19 ? H 7  ? G 20 ? H 6  ? 
1 G DT 20 1_555 H DA 6  1_555 G DC 21 1_555 H DG 5  1_555 -0.650 -0.574 2.491 9.763  -0.291 32.092 -0.960 2.308  2.209 -0.511  
-17.170 33.508 36 GG_DT20DC21:DG5DA6_HH G 20 ? H 6  ? G 21 ? H 5  ? 
1 G DC 21 1_555 H DG 5  1_555 G DA 22 1_555 H DT 4  1_555 -0.427 -0.011 3.636 -4.184 10.997 37.172 -1.512 0.071  3.520 16.744  
6.371   38.927 37 GG_DC21DA22:DT4DG5_HH G 21 ? H 5  ? G 22 ? H 4  ? 
1 G DA 22 1_555 H DT 4  1_555 G DC 23 1_555 H DG 3  1_555 0.096  -0.335 3.296 -0.994 -0.557 36.710 -0.456 -0.289 3.297 -0.884  
1.578   36.727 38 GG_DA22DC23:DG3DT4_HH G 22 ? H 4  ? G 23 ? H 3  ? 
1 G DC 23 1_555 H DG 3  1_555 G DG 24 1_555 H DC 2  1_555 0.465  0.171  3.334 -0.562 0.569  39.982 0.183  -0.745 3.329 0.833   
0.821   39.989 39 GG_DC23DG24:DC2DG3_HH G 23 ? H 3  ? G 24 ? H 2  ? 
1 G DG 24 1_555 H DC 2  1_555 G DC 25 1_555 H DG 1  1_555 -1.215 -0.162 3.230 0.130  0.172  34.129 -0.304 2.090  3.225 0.294   
-0.221  34.130 40 GG_DG24DC25:DG1DC2_HH G 24 ? H 2  ? G 25 ? H 1  ? 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#