data_6DZT
# 
_entry.id   6DZT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6DZT         
WWPDB D_1000235493 
EMDB  EMD-8938     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB 'Cryo-EM structure of nucleosome in complex with a single chain antibody fragment' EMD-8938 'associated EM volume' 
EMDB .                                                                                  EMD-8945 'other EM volume'      
EMDB .                                                                                  EMD-8949 'other EM volume'      
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6DZT 
_pdbx_database_status.recvd_initial_deposition_date   2018-07-05 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Yadav, K.N.S.' 1 ? 
'Zhou, B.-R.'   2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            10 
_citation.language                  ? 
_citation.page_first                2301 
_citation.page_last                 2301 
_citation.title                     
'Atomic resolution cryo-EM structure of a native-like CENP-A nucleosome aided by an antibody fragment.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-019-10247-4 
_citation.pdbx_database_id_PubMed   31127102 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zhou, B.R.'    1 0000-0002-5375-7977 
primary 'Yadav, K.N.S.' 2 ?                   
primary 'Borgnia, M.'   3 ?                   
primary 'Hong, J.'      4 ?                   
primary 'Cao, B.'       5 ?                   
primary 'Olins, A.L.'   6 ?                   
primary 'Olins, D.E.'   7 ?                   
primary 'Bai, Y.'       8 ?                   
primary 'Zhang, P.'     9 ?                   
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6DZT 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.0 
_cell.length_a_esd                 ? 
_cell.length_b                     1.0 
_cell.length_b_esd                 ? 
_cell.length_c                     1.0 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6DZT 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Histone H3'    15421.101 2 ? ? ? ? 
2 polymer man 'Histone H4'    11521.611 2 ? ? ? ? 
3 polymer man 'Histone H2A'   13388.727 2 ? ? ? ? 
4 polymer man 'Histone H2B'   13840.224 2 ? ? ? ? 
5 polymer syn 'DNA (147-MER)' 45610.043 1 ? ? ? ? 
6 polymer syn 'DNA (147-MER)' 45138.770 1 ? ? ? ? 
7 polymer man scFv            29030.146 2 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;MITGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKR
KTVTAMDVVYALKRQGRTLYGFGG
;
;MITGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKR
KTVTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIP
RHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA
;
;MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIP
RHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA
;
C,G ? 
4 'polypeptide(L)'        no no 
;MIPPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLA
HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
;MIPPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLA
HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DG)(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)
(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)
(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)
(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)
(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)
(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)
(DA)(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)
(DT)(DC)(DT)(DC)(DG)(DA)(DT)
;
;ATCGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTA
CGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DG)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)
(DG)(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)
(DA)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)
(DA)(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)
(DC)(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)
(DG)(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)
(DG)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)
(DA)(DT)(DC)(DC)(DG)(DA)(DT)
;
;ATCGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCC
CCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCGAT
;
J   ? 
7 'polypeptide(L)'        no no 
;MKSSHHHHHHENLYFQSNAMEVQLQQSGPELVEPGTSVKMPCKASGYTFTSYTIQWVKQTPRQGLEWIGYIYPYNAGTKY
NEKFKGKATLTSDKSSSTVYMELSSLTSEDSAVYYCARKSSRLRSTLDYWGQGTSVTVSSGGGGSGGGGSGGGGSMDIKM
TQSPSSMHASLGERVTITCKASQDIRSYLSWYQQKPWKSPKTLIYYATSLADGVPSRFSGSGSGQDFSLTINNLESDDTA
TYYCLQHGESPYTFGSGTKLEIKRA
;
;MKSSHHHHHHENLYFQSNAMEVQLQQSGPELVEPGTSVKMPCKASGYTFTSYTIQWVKQTPRQGLEWIGYIYPYNAGTKY
NEKFKGKATLTSDKSSSTVYMELSSLTSEDSAVYYCARKSSRLRSTLDYWGQGTSVTVSSGGGGSGGGGSGGGGSMDIKM
TQSPSSMHASLGERVTITCKASQDIRSYLSWYQQKPWKSPKTLIYYATSLADGVPSRFSGSGSGQDFSLTINNLESDDTA
TYYCLQHGESPYTFGSGTKLEIKRA
;
M,N ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ARG n 
1 4   THR n 
1 5   LYS n 
1 6   GLN n 
1 7   THR n 
1 8   ALA n 
1 9   ARG n 
1 10  LYS n 
1 11  SER n 
1 12  THR n 
1 13  GLY n 
1 14  GLY n 
1 15  LYS n 
1 16  ALA n 
1 17  PRO n 
1 18  ARG n 
1 19  LYS n 
1 20  GLN n 
1 21  LEU n 
1 22  ALA n 
1 23  THR n 
1 24  LYS n 
1 25  ALA n 
1 26  ALA n 
1 27  ARG n 
1 28  LYS n 
1 29  SER n 
1 30  ALA n 
1 31  PRO n 
1 32  ALA n 
1 33  THR n 
1 34  GLY n 
1 35  GLY n 
1 36  VAL n 
1 37  LYS n 
1 38  LYS n 
1 39  PRO n 
1 40  HIS n 
1 41  ARG n 
1 42  TYR n 
1 43  ARG n 
1 44  PRO n 
1 45  GLY n 
1 46  THR n 
1 47  VAL n 
1 48  ALA n 
1 49  LEU n 
1 50  ARG n 
1 51  GLU n 
1 52  ILE n 
1 53  ARG n 
1 54  ARG n 
1 55  TYR n 
1 56  GLN n 
1 57  LYS n 
1 58  SER n 
1 59  THR n 
1 60  GLU n 
1 61  LEU n 
1 62  LEU n 
1 63  ILE n 
1 64  ARG n 
1 65  LYS n 
1 66  LEU n 
1 67  PRO n 
1 68  PHE n 
1 69  GLN n 
1 70  ARG n 
1 71  LEU n 
1 72  VAL n 
1 73  ARG n 
1 74  GLU n 
1 75  ILE n 
1 76  ALA n 
1 77  GLN n 
1 78  ASP n 
1 79  PHE n 
1 80  LYS n 
1 81  THR n 
1 82  ASP n 
1 83  LEU n 
1 84  ARG n 
1 85  PHE n 
1 86  GLN n 
1 87  SER n 
1 88  SER n 
1 89  ALA n 
1 90  VAL n 
1 91  MET n 
1 92  ALA n 
1 93  LEU n 
1 94  GLN n 
1 95  GLU n 
1 96  ALA n 
1 97  SER n 
1 98  GLU n 
1 99  ALA n 
1 100 TYR n 
1 101 LEU n 
1 102 VAL n 
1 103 GLY n 
1 104 LEU n 
1 105 PHE n 
1 106 GLU n 
1 107 ASP n 
1 108 THR n 
1 109 ASN n 
1 110 LEU n 
1 111 CYS n 
1 112 ALA n 
1 113 ILE n 
1 114 HIS n 
1 115 ALA n 
1 116 LYS n 
1 117 ARG n 
1 118 VAL n 
1 119 THR n 
1 120 ILE n 
1 121 MET n 
1 122 PRO n 
1 123 LYS n 
1 124 ASP n 
1 125 ILE n 
1 126 GLN n 
1 127 LEU n 
1 128 ALA n 
1 129 ARG n 
1 130 ARG n 
1 131 ILE n 
1 132 ARG n 
1 133 GLY n 
1 134 GLU n 
1 135 ARG n 
1 136 ALA n 
2 1   MET n 
2 2   ILE n 
2 3   THR n 
2 4   GLY n 
2 5   ARG n 
2 6   GLY n 
2 7   LYS n 
2 8   GLY n 
2 9   GLY n 
2 10  LYS n 
2 11  GLY n 
2 12  LEU n 
2 13  GLY n 
2 14  LYS n 
2 15  GLY n 
2 16  GLY n 
2 17  ALA n 
2 18  LYS n 
2 19  ARG n 
2 20  HIS n 
2 21  ARG n 
2 22  LYS n 
2 23  VAL n 
2 24  LEU n 
2 25  ARG n 
2 26  ASP n 
2 27  ASN n 
2 28  ILE n 
2 29  GLN n 
2 30  GLY n 
2 31  ILE n 
2 32  THR n 
2 33  LYS n 
2 34  PRO n 
2 35  ALA n 
2 36  ILE n 
2 37  ARG n 
2 38  ARG n 
2 39  LEU n 
2 40  ALA n 
2 41  ARG n 
2 42  ARG n 
2 43  GLY n 
2 44  GLY n 
2 45  VAL n 
2 46  LYS n 
2 47  ARG n 
2 48  ILE n 
2 49  SER n 
2 50  GLY n 
2 51  LEU n 
2 52  ILE n 
2 53  TYR n 
2 54  GLU n 
2 55  GLU n 
2 56  THR n 
2 57  ARG n 
2 58  GLY n 
2 59  VAL n 
2 60  LEU n 
2 61  LYS n 
2 62  VAL n 
2 63  PHE n 
2 64  LEU n 
2 65  GLU n 
2 66  ASN n 
2 67  VAL n 
2 68  ILE n 
2 69  ARG n 
2 70  ASP n 
2 71  ALA n 
2 72  VAL n 
2 73  THR n 
2 74  TYR n 
2 75  THR n 
2 76  GLU n 
2 77  HIS n 
2 78  ALA n 
2 79  LYS n 
2 80  ARG n 
2 81  LYS n 
2 82  THR n 
2 83  VAL n 
2 84  THR n 
2 85  ALA n 
2 86  MET n 
2 87  ASP n 
2 88  VAL n 
2 89  VAL n 
2 90  TYR n 
2 91  ALA n 
2 92  LEU n 
2 93  LYS n 
2 94  ARG n 
2 95  GLN n 
2 96  GLY n 
2 97  ARG n 
2 98  THR n 
2 99  LEU n 
2 100 TYR n 
2 101 GLY n 
2 102 PHE n 
2 103 GLY n 
2 104 GLY n 
3 1   MET n 
3 2   SER n 
3 3   GLY n 
3 4   ARG n 
3 5   GLY n 
3 6   LYS n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  VAL n 
3 11  LYS n 
3 12  GLY n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  SER n 
3 17  ARG n 
3 18  SER n 
3 19  ASN n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  ILE n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  MET n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  ALA n 
3 60  ALA n 
3 61  GLU n 
3 62  VAL n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  ILE n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  SER n 
3 99  GLY n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 ALA n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
3 120 THR n 
3 121 GLU n 
3 122 LYS n 
3 123 LYS n 
3 124 ALA n 
4 1   MET n 
4 2   ILE n 
4 3   PRO n 
4 4   PRO n 
4 5   LYS n 
4 6   THR n 
4 7   SER n 
4 8   GLY n 
4 9   LYS n 
4 10  ALA n 
4 11  ALA n 
4 12  LYS n 
4 13  LYS n 
4 14  ALA n 
4 15  GLY n 
4 16  LYS n 
4 17  ALA n 
4 18  GLN n 
4 19  LYS n 
4 20  ASN n 
4 21  ILE n 
4 22  THR n 
4 23  LYS n 
4 24  THR n 
4 25  ASP n 
4 26  LYS n 
4 27  LYS n 
4 28  LYS n 
4 29  LYS n 
4 30  ARG n 
4 31  LYS n 
4 32  ARG n 
4 33  LYS n 
4 34  GLU n 
4 35  SER n 
4 36  TYR n 
4 37  ALA n 
4 38  ILE n 
4 39  TYR n 
4 40  ILE n 
4 41  TYR n 
4 42  LYS n 
4 43  VAL n 
4 44  LEU n 
4 45  LYS n 
4 46  GLN n 
4 47  VAL n 
4 48  HIS n 
4 49  PRO n 
4 50  ASP n 
4 51  THR n 
4 52  GLY n 
4 53  ILE n 
4 54  SER n 
4 55  SER n 
4 56  LYS n 
4 57  ALA n 
4 58  MET n 
4 59  SER n 
4 60  ILE n 
4 61  MET n 
4 62  ASN n 
4 63  SER n 
4 64  PHE n 
4 65  VAL n 
4 66  ASN n 
4 67  ASP n 
4 68  ILE n 
4 69  PHE n 
4 70  GLU n 
4 71  ARG n 
4 72  ILE n 
4 73  ALA n 
4 74  ALA n 
4 75  GLU n 
4 76  ALA n 
4 77  SER n 
4 78  ARG n 
4 79  LEU n 
4 80  ALA n 
4 81  HIS n 
4 82  TYR n 
4 83  ASN n 
4 84  LYS n 
4 85  ARG n 
4 86  SER n 
4 87  THR n 
4 88  ILE n 
4 89  THR n 
4 90  SER n 
4 91  ARG n 
4 92  GLU n 
4 93  ILE n 
4 94  GLN n 
4 95  THR n 
4 96  ALA n 
4 97  VAL n 
4 98  ARG n 
4 99  LEU n 
4 100 LEU n 
4 101 LEU n 
4 102 PRO n 
4 103 GLY n 
4 104 GLU n 
4 105 LEU n 
4 106 ALA n 
4 107 LYS n 
4 108 HIS n 
4 109 ALA n 
4 110 VAL n 
4 111 SER n 
4 112 GLU n 
4 113 GLY n 
4 114 THR n 
4 115 LYS n 
4 116 ALA n 
4 117 VAL n 
4 118 THR n 
4 119 LYS n 
4 120 TYR n 
4 121 THR n 
4 122 SER n 
4 123 SER n 
4 124 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DG  n 
5 5   DG  n 
5 6   DA  n 
5 7   DT  n 
5 8   DG  n 
5 9   DT  n 
5 10  DA  n 
5 11  DT  n 
5 12  DA  n 
5 13  DT  n 
5 14  DA  n 
5 15  DT  n 
5 16  DC  n 
5 17  DT  n 
5 18  DG  n 
5 19  DA  n 
5 20  DC  n 
5 21  DA  n 
5 22  DC  n 
5 23  DG  n 
5 24  DT  n 
5 25  DG  n 
5 26  DC  n 
5 27  DC  n 
5 28  DT  n 
5 29  DG  n 
5 30  DG  n 
5 31  DA  n 
5 32  DG  n 
5 33  DA  n 
5 34  DC  n 
5 35  DT  n 
5 36  DA  n 
5 37  DG  n 
5 38  DG  n 
5 39  DG  n 
5 40  DA  n 
5 41  DG  n 
5 42  DT  n 
5 43  DA  n 
5 44  DA  n 
5 45  DT  n 
5 46  DC  n 
5 47  DC  n 
5 48  DC  n 
5 49  DC  n 
5 50  DT  n 
5 51  DT  n 
5 52  DG  n 
5 53  DG  n 
5 54  DC  n 
5 55  DG  n 
5 56  DG  n 
5 57  DT  n 
5 58  DT  n 
5 59  DA  n 
5 60  DA  n 
5 61  DA  n 
5 62  DA  n 
5 63  DC  n 
5 64  DG  n 
5 65  DC  n 
5 66  DG  n 
5 67  DG  n 
5 68  DG  n 
5 69  DG  n 
5 70  DG  n 
5 71  DA  n 
5 72  DC  n 
5 73  DA  n 
5 74  DG  n 
5 75  DC  n 
5 76  DG  n 
5 77  DC  n 
5 78  DG  n 
5 79  DT  n 
5 80  DA  n 
5 81  DC  n 
5 82  DG  n 
5 83  DT  n 
5 84  DG  n 
5 85  DC  n 
5 86  DG  n 
5 87  DT  n 
5 88  DT  n 
5 89  DT  n 
5 90  DA  n 
5 91  DA  n 
5 92  DG  n 
5 93  DC  n 
5 94  DG  n 
5 95  DG  n 
5 96  DT  n 
5 97  DG  n 
5 98  DC  n 
5 99  DT  n 
5 100 DA  n 
5 101 DG  n 
5 102 DA  n 
5 103 DG  n 
5 104 DC  n 
5 105 DT  n 
5 106 DG  n 
5 107 DT  n 
5 108 DC  n 
5 109 DT  n 
5 110 DA  n 
5 111 DC  n 
5 112 DG  n 
5 113 DA  n 
5 114 DC  n 
5 115 DC  n 
5 116 DA  n 
5 117 DA  n 
5 118 DT  n 
5 119 DT  n 
5 120 DG  n 
5 121 DA  n 
5 122 DG  n 
5 123 DC  n 
5 124 DG  n 
5 125 DG  n 
5 126 DC  n 
5 127 DC  n 
5 128 DT  n 
5 129 DC  n 
5 130 DG  n 
5 131 DG  n 
5 132 DC  n 
5 133 DA  n 
5 134 DC  n 
5 135 DC  n 
5 136 DG  n 
5 137 DG  n 
5 138 DG  n 
5 139 DA  n 
5 140 DT  n 
5 141 DT  n 
5 142 DC  n 
5 143 DT  n 
5 144 DC  n 
5 145 DG  n 
5 146 DA  n 
5 147 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DG  n 
6 5   DA  n 
6 6   DG  n 
6 7   DA  n 
6 8   DA  n 
6 9   DT  n 
6 10  DC  n 
6 11  DC  n 
6 12  DC  n 
6 13  DG  n 
6 14  DG  n 
6 15  DT  n 
6 16  DG  n 
6 17  DC  n 
6 18  DC  n 
6 19  DG  n 
6 20  DA  n 
6 21  DG  n 
6 22  DG  n 
6 23  DC  n 
6 24  DC  n 
6 25  DG  n 
6 26  DC  n 
6 27  DT  n 
6 28  DC  n 
6 29  DA  n 
6 30  DA  n 
6 31  DT  n 
6 32  DT  n 
6 33  DG  n 
6 34  DG  n 
6 35  DT  n 
6 36  DC  n 
6 37  DG  n 
6 38  DT  n 
6 39  DA  n 
6 40  DG  n 
6 41  DA  n 
6 42  DC  n 
6 43  DA  n 
6 44  DG  n 
6 45  DC  n 
6 46  DT  n 
6 47  DC  n 
6 48  DT  n 
6 49  DA  n 
6 50  DG  n 
6 51  DC  n 
6 52  DA  n 
6 53  DC  n 
6 54  DC  n 
6 55  DG  n 
6 56  DC  n 
6 57  DT  n 
6 58  DT  n 
6 59  DA  n 
6 60  DA  n 
6 61  DA  n 
6 62  DC  n 
6 63  DG  n 
6 64  DC  n 
6 65  DA  n 
6 66  DC  n 
6 67  DG  n 
6 68  DT  n 
6 69  DA  n 
6 70  DC  n 
6 71  DG  n 
6 72  DC  n 
6 73  DG  n 
6 74  DC  n 
6 75  DT  n 
6 76  DG  n 
6 77  DT  n 
6 78  DC  n 
6 79  DC  n 
6 80  DC  n 
6 81  DC  n 
6 82  DC  n 
6 83  DG  n 
6 84  DC  n 
6 85  DG  n 
6 86  DT  n 
6 87  DT  n 
6 88  DT  n 
6 89  DT  n 
6 90  DA  n 
6 91  DA  n 
6 92  DC  n 
6 93  DC  n 
6 94  DG  n 
6 95  DC  n 
6 96  DC  n 
6 97  DA  n 
6 98  DA  n 
6 99  DG  n 
6 100 DG  n 
6 101 DG  n 
6 102 DG  n 
6 103 DA  n 
6 104 DT  n 
6 105 DT  n 
6 106 DA  n 
6 107 DC  n 
6 108 DT  n 
6 109 DC  n 
6 110 DC  n 
6 111 DC  n 
6 112 DT  n 
6 113 DA  n 
6 114 DG  n 
6 115 DT  n 
6 116 DC  n 
6 117 DT  n 
6 118 DC  n 
6 119 DC  n 
6 120 DA  n 
6 121 DG  n 
6 122 DG  n 
6 123 DC  n 
6 124 DA  n 
6 125 DC  n 
6 126 DG  n 
6 127 DT  n 
6 128 DG  n 
6 129 DT  n 
6 130 DC  n 
6 131 DA  n 
6 132 DG  n 
6 133 DA  n 
6 134 DT  n 
6 135 DA  n 
6 136 DT  n 
6 137 DA  n 
6 138 DT  n 
6 139 DA  n 
6 140 DC  n 
6 141 DA  n 
6 142 DT  n 
6 143 DC  n 
6 144 DC  n 
6 145 DG  n 
6 146 DA  n 
6 147 DT  n 
7 1   MET n 
7 2   LYS n 
7 3   SER n 
7 4   SER n 
7 5   HIS n 
7 6   HIS n 
7 7   HIS n 
7 8   HIS n 
7 9   HIS n 
7 10  HIS n 
7 11  GLU n 
7 12  ASN n 
7 13  LEU n 
7 14  TYR n 
7 15  PHE n 
7 16  GLN n 
7 17  SER n 
7 18  ASN n 
7 19  ALA n 
7 20  MET n 
7 21  GLU n 
7 22  VAL n 
7 23  GLN n 
7 24  LEU n 
7 25  GLN n 
7 26  GLN n 
7 27  SER n 
7 28  GLY n 
7 29  PRO n 
7 30  GLU n 
7 31  LEU n 
7 32  VAL n 
7 33  GLU n 
7 34  PRO n 
7 35  GLY n 
7 36  THR n 
7 37  SER n 
7 38  VAL n 
7 39  LYS n 
7 40  MET n 
7 41  PRO n 
7 42  CYS n 
7 43  LYS n 
7 44  ALA n 
7 45  SER n 
7 46  GLY n 
7 47  TYR n 
7 48  THR n 
7 49  PHE n 
7 50  THR n 
7 51  SER n 
7 52  TYR n 
7 53  THR n 
7 54  ILE n 
7 55  GLN n 
7 56  TRP n 
7 57  VAL n 
7 58  LYS n 
7 59  GLN n 
7 60  THR n 
7 61  PRO n 
7 62  ARG n 
7 63  GLN n 
7 64  GLY n 
7 65  LEU n 
7 66  GLU n 
7 67  TRP n 
7 68  ILE n 
7 69  GLY n 
7 70  TYR n 
7 71  ILE n 
7 72  TYR n 
7 73  PRO n 
7 74  TYR n 
7 75  ASN n 
7 76  ALA n 
7 77  GLY n 
7 78  THR n 
7 79  LYS n 
7 80  TYR n 
7 81  ASN n 
7 82  GLU n 
7 83  LYS n 
7 84  PHE n 
7 85  LYS n 
7 86  GLY n 
7 87  LYS n 
7 88  ALA n 
7 89  THR n 
7 90  LEU n 
7 91  THR n 
7 92  SER n 
7 93  ASP n 
7 94  LYS n 
7 95  SER n 
7 96  SER n 
7 97  SER n 
7 98  THR n 
7 99  VAL n 
7 100 TYR n 
7 101 MET n 
7 102 GLU n 
7 103 LEU n 
7 104 SER n 
7 105 SER n 
7 106 LEU n 
7 107 THR n 
7 108 SER n 
7 109 GLU n 
7 110 ASP n 
7 111 SER n 
7 112 ALA n 
7 113 VAL n 
7 114 TYR n 
7 115 TYR n 
7 116 CYS n 
7 117 ALA n 
7 118 ARG n 
7 119 LYS n 
7 120 SER n 
7 121 SER n 
7 122 ARG n 
7 123 LEU n 
7 124 ARG n 
7 125 SER n 
7 126 THR n 
7 127 LEU n 
7 128 ASP n 
7 129 TYR n 
7 130 TRP n 
7 131 GLY n 
7 132 GLN n 
7 133 GLY n 
7 134 THR n 
7 135 SER n 
7 136 VAL n 
7 137 THR n 
7 138 VAL n 
7 139 SER n 
7 140 SER n 
7 141 GLY n 
7 142 GLY n 
7 143 GLY n 
7 144 GLY n 
7 145 SER n 
7 146 GLY n 
7 147 GLY n 
7 148 GLY n 
7 149 GLY n 
7 150 SER n 
7 151 GLY n 
7 152 GLY n 
7 153 GLY n 
7 154 GLY n 
7 155 SER n 
7 156 MET n 
7 157 ASP n 
7 158 ILE n 
7 159 LYS n 
7 160 MET n 
7 161 THR n 
7 162 GLN n 
7 163 SER n 
7 164 PRO n 
7 165 SER n 
7 166 SER n 
7 167 MET n 
7 168 HIS n 
7 169 ALA n 
7 170 SER n 
7 171 LEU n 
7 172 GLY n 
7 173 GLU n 
7 174 ARG n 
7 175 VAL n 
7 176 THR n 
7 177 ILE n 
7 178 THR n 
7 179 CYS n 
7 180 LYS n 
7 181 ALA n 
7 182 SER n 
7 183 GLN n 
7 184 ASP n 
7 185 ILE n 
7 186 ARG n 
7 187 SER n 
7 188 TYR n 
7 189 LEU n 
7 190 SER n 
7 191 TRP n 
7 192 TYR n 
7 193 GLN n 
7 194 GLN n 
7 195 LYS n 
7 196 PRO n 
7 197 TRP n 
7 198 LYS n 
7 199 SER n 
7 200 PRO n 
7 201 LYS n 
7 202 THR n 
7 203 LEU n 
7 204 ILE n 
7 205 TYR n 
7 206 TYR n 
7 207 ALA n 
7 208 THR n 
7 209 SER n 
7 210 LEU n 
7 211 ALA n 
7 212 ASP n 
7 213 GLY n 
7 214 VAL n 
7 215 PRO n 
7 216 SER n 
7 217 ARG n 
7 218 PHE n 
7 219 SER n 
7 220 GLY n 
7 221 SER n 
7 222 GLY n 
7 223 SER n 
7 224 GLY n 
7 225 GLN n 
7 226 ASP n 
7 227 PHE n 
7 228 SER n 
7 229 LEU n 
7 230 THR n 
7 231 ILE n 
7 232 ASN n 
7 233 ASN n 
7 234 LEU n 
7 235 GLU n 
7 236 SER n 
7 237 ASP n 
7 238 ASP n 
7 239 THR n 
7 240 ALA n 
7 241 THR n 
7 242 TYR n 
7 243 TYR n 
7 244 CYS n 
7 245 LEU n 
7 246 GLN n 
7 247 HIS n 
7 248 GLY n 
7 249 GLU n 
7 250 SER n 
7 251 PRO n 
7 252 TYR n 
7 253 THR n 
7 254 PHE n 
7 255 GLY n 
7 256 SER n 
7 257 GLY n 
7 258 THR n 
7 259 LYS n 
7 260 LEU n 
7 261 GLU n 
7 262 ILE n 
7 263 LYS n 
7 264 ARG n 
7 265 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 136 'Fruit fly'   ? 
;His3, His3:CG31613, CG31613, His3:CG33803, CG33803, His3:CG33806, CG33806, His3:CG33809, CG33809, His3:CG33812, CG33812, His3:CG33815, CG33815, His3:CG33818, CG33818, His3:CG33821, CG33821, His3:CG33824, CG33824, His3:CG33827, CG33827, His3:CG33830, CG33830, His3:CG33833, CG33833, His3:CG33836, CG33836, His3:CG33839, CG33839, His3:CG33842, CG33842, His3:CG33845, CG33845, His3:CG33848, CG33848, His3:CG33851, CG33851, His3:CG33854, CG33854, His3:CG33857, CG33857, His3:CG33860, CG33860, His3:CG33863, CG33863, His3:CG33866, CG33866
;
? ? ? ? ? ? 'Drosophila melanogaster' 7227  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 104 'Fruit fly'   ? 
;His4, H4, His4r, H4r, CG3379, His4:CG31611, CG31611, His4:CG33869, CG33869, His4:CG33871, CG33871, His4:CG33873, CG33873, His4:CG33875, CG33875, His4:CG33877, CG33877, His4:CG33879, CG33879, His4:CG33881, CG33881, His4:CG33883, CG33883, His4:CG33885, CG33885, His4:CG33887, CG33887, His4:CG33889, CG33889, His4:CG33891, CG33891, His4:CG33893, CG33893, His4:CG33895, CG33895, His4:CG33897, CG33897, His4:CG33899, CG33899, His4:CG33901, CG33901, His4:CG33903, CG33903, His4:CG33905, CG33905, His4:CG33907, CG33907, His4:CG33909, CG33909
;
? ? ? ? ? ? 'Drosophila melanogaster' 7227  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 124 'Fruit fly'   ? 
;His2A, H2a, His2A:CG31618, CG31618, His2A:CG33808, CG33808, His2A:CG33814, CG33814, His2A:CG33817, CG33817, His2A:CG33820, CG33820, His2A:CG33823, CG33823, His2A:CG33826, CG33826, His2A:CG33829, CG33829, His2A:CG33832, CG33832, His2A:CG33835, CG33835, His2A:CG33838, CG33838, His2A:CG33841, CG33841, His2A:CG33844, CG33844, His2A:CG33847, CG33847, His2A:CG33850, CG33850, His2A:CG33862, CG33862, His2A:CG33865, CG33865
;
? ? ? ? ? ? 'Drosophila melanogaster' 7227  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 124 'Fruit fly'   ? 
;His2B, His2B:CG17949, CG17949, His2B:CG33868, CG33868, His2B:CG33870, CG33870, His2B:CG33872, CG33872, His2B:CG33874, CG33874, His2B:CG33876, CG33876, His2B:CG33878, CG33878, His2B:CG33880, CG33880, His2B:CG33882, CG33882, His2B:CG33884, CG33884, His2B:CG33886, CG33886, His2B:CG33888, CG33888, His2B:CG33890, CG33890, His2B:CG33892, CG33892, His2B:CG33894, CG33894, His2B:CG33896, CG33896, His2B:CG33898, CG33898, His2B:CG33900, CG33900, His2B:CG33902, CG33902, His2B:CG33904, CG33904, His2B:CG33906, CG33906, His2B:CG33908, CG33908, His2B:CG33910, CG33910
;
? ? ? ? ? ? 'Drosophila melanogaster' 7227  ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7 1 sample 'Biological sequence' 1 265 'house mouse' ? ? ? ? ? ? ? ? 'Mus musculus'            10090 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample 1 147 'Escherichia coli' ? 562 ? 
6 1 sample 1 147 'Escherichia coli' ? 562 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP H3_DROME  P02299 ? 1 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
1 
2 UNP H4_DROME  P84040 ? 2 
;TGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2 
3 UNP H2A_DROME P84051 ? 3 
;MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIP
RHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA
;
1 
4 UNP H2B_DROME P02283 ? 4 
;PPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
;
2 
5 PDB 6DZT      6DZT   ? 5 ? 1 
6 PDB 6DZT      6DZT   ? 6 ? 1 
7 PDB 6DZT      6DZT   ? 7 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6DZT A 1 ? 136 ? P02299 1 ? 136 ? 0 135 
2  2 6DZT B 3 ? 104 ? P84040 2 ? 103 ? 1 102 
3  3 6DZT C 1 ? 124 ? P84051 1 ? 124 ? 1 124 
4  4 6DZT D 3 ? 124 ? P02283 2 ? 123 ? 1 122 
5  1 6DZT E 1 ? 136 ? P02299 1 ? 136 ? 0 135 
6  2 6DZT F 3 ? 104 ? P84040 2 ? 103 ? 1 102 
7  3 6DZT G 1 ? 124 ? P84051 1 ? 124 ? 1 124 
8  4 6DZT H 3 ? 124 ? P02283 2 ? 123 ? 1 122 
9  5 6DZT I 1 ? 147 ? 6DZT   1 ? 147 ? 1 147 
10 6 6DZT J 1 ? 147 ? 6DZT   1 ? 147 ? 1 147 
11 7 6DZT M 1 ? 265 ? 6DZT   3 ? 267 ? 3 267 
12 7 6DZT N 1 ? 265 ? 6DZT   3 ? 267 ? 3 267 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 6DZT MET B 1 ? UNP P84040 ? ? 'initiating methionine' -1 1 
2 6DZT ILE B 2 ? UNP P84040 ? ? 'expression tag'        0  2 
4 6DZT MET D 1 ? UNP P02283 ? ? 'initiating methionine' -1 3 
4 6DZT ILE D 2 ? UNP P02283 ? ? 'expression tag'        0  4 
6 6DZT MET F 1 ? UNP P84040 ? ? 'initiating methionine' -1 5 
6 6DZT ILE F 2 ? UNP P84040 ? ? 'expression tag'        0  6 
8 6DZT MET H 1 ? UNP P02283 ? ? 'initiating methionine' -1 7 
8 6DZT ILE H 2 ? UNP P02283 ? ? 'expression tag'        0  8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6DZT 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6DZT 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       'GeoStd + Monomer Library' 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.0080  ? 16523 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.8800  ? 23586 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 0.0516  ? 2655  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.0074  ? 1956  ? f_plane_restr      ? ? 
'ELECTRON MICROSCOPY' ? 21.4380 ? 8912  ? f_dihedral_angle_d ? ? 
# 
_struct.entry_id                     6DZT 
_struct.title                        'Cryo-EM structure of nucleosome in complex with a single chain antibody fragment' 
_struct.pdbx_descriptor              'Histone H3, Histone H4, Histone H2A, Histone H2B, scFv/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6DZT 
_struct_keywords.text            'Nucleosome, Single chain antibody, charge-charge interaction, acidic patch., NUCLEAR PROTEIN' 
_struct_keywords.pdbx_keywords   'NUCLEAR PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 45  ? GLN A 56  ? GLY A 44  GLN A 55  1 ? 12 
HELX_P HELX_P2  AA2 ARG A 64  ? ALA A 76  ? ARG A 63  ALA A 75  1 ? 13 
HELX_P HELX_P3  AA3 GLN A 77  ? PHE A 79  ? GLN A 76  PHE A 78  5 ? 3  
HELX_P HELX_P4  AA4 GLN A 86  ? ALA A 115 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P5  AA5 MET A 121 ? ARG A 132 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P6  AA6 ASN B 27  ? ILE B 31  ? ASN B 25  ILE B 29  5 ? 5  
HELX_P HELX_P7  AA7 THR B 32  ? GLY B 43  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P8  AA8 LEU B 51  ? ALA B 78  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P9  AA9 THR B 84  ? ARG B 94  ? THR B 82  ARG B 92  1 ? 11 
HELX_P HELX_P10 AB1 SER C 16  ? GLY C 22  ? SER C 16  GLY C 22  1 ? 7  
HELX_P HELX_P11 AB2 PRO C 26  ? LYS C 36  ? PRO C 26  LYS C 36  1 ? 11 
HELX_P HELX_P12 AB3 GLY C 46  ? ASN C 73  ? GLY C 46  ASN C 73  1 ? 28 
HELX_P HELX_P13 AB4 ILE C 79  ? ASN C 89  ? ILE C 79  ASN C 89  1 ? 11 
HELX_P HELX_P14 AB5 ASP C 90  ? LEU C 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P15 AB6 GLN C 112 ? LEU C 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P16 AB7 TYR D 36  ? HIS D 48  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P17 AB8 SER D 54  ? ASN D 83  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P18 AB9 THR D 89  ? LEU D 101 ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P19 AC1 GLU D 104 ? THR D 121 ? GLU D 102 THR D 119 1 ? 18 
HELX_P HELX_P20 AC2 GLY E 45  ? GLN E 56  ? GLY E 44  GLN E 55  1 ? 12 
HELX_P HELX_P21 AC3 ARG E 64  ? ALA E 76  ? ARG E 63  ALA E 75  1 ? 13 
HELX_P HELX_P22 AC4 GLN E 77  ? PHE E 79  ? GLN E 76  PHE E 78  5 ? 3  
HELX_P HELX_P23 AC5 GLN E 86  ? ALA E 115 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P24 AC6 MET E 121 ? GLY E 133 ? MET E 120 GLY E 132 1 ? 13 
HELX_P HELX_P25 AC7 ASN F 27  ? ILE F 31  ? ASN F 25  ILE F 29  5 ? 5  
HELX_P HELX_P26 AC8 THR F 32  ? GLY F 43  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P27 AC9 LEU F 51  ? ALA F 78  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P28 AD1 THR F 84  ? ARG F 94  ? THR F 82  ARG F 92  1 ? 11 
HELX_P HELX_P29 AD2 SER G 16  ? GLY G 22  ? SER G 16  GLY G 22  1 ? 7  
HELX_P HELX_P30 AD3 PRO G 26  ? LYS G 36  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P31 AD4 GLY G 46  ? ASN G 73  ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P32 AD5 ILE G 79  ? ASN G 89  ? ILE G 79  ASN G 89  1 ? 11 
HELX_P HELX_P33 AD6 ASP G 90  ? LEU G 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P34 AD7 GLN G 112 ? LEU G 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P35 AD8 TYR H 36  ? HIS H 48  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P36 AD9 SER H 54  ? ASN H 83  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P37 AE1 THR H 89  ? LEU H 101 ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P38 AE2 GLU H 104 ? SER H 122 ? GLU H 102 SER H 120 1 ? 19 
HELX_P HELX_P39 AE3 THR K 48  ? THR K 50  ? THR M 50  THR M 52  5 ? 3  
HELX_P HELX_P40 AE4 THR L 48  ? THR L 50  ? THR N 50  THR N 52  5 ? 3  
HELX_P HELX_P41 AE5 GLU L 82  ? LYS L 85  ? GLU N 84  LYS N 87  5 ? 4  
HELX_P HELX_P42 AE6 GLU L 235 ? THR L 239 ? GLU N 237 THR N 241 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1   disulf ? ? K CYS 42  SG ? ? ? 1_555 K CYS 116 SG ? ? M CYS 44  M CYS 118 1_555 ? ? ? ? ? ? ?            2.017 ? 
disulf2   disulf ? ? K CYS 179 SG ? ? ? 1_555 K CYS 244 SG ? ? M CYS 181 M CYS 246 1_555 ? ? ? ? ? ? ?            2.028 ? 
disulf3   disulf ? ? L CYS 42  SG ? ? ? 1_555 L CYS 116 SG ? ? N CYS 44  N CYS 118 1_555 ? ? ? ? ? ? ?            2.025 ? 
disulf4   disulf ? ? L CYS 179 SG ? ? ? 1_555 L CYS 244 SG ? ? N CYS 181 N CYS 246 1_555 ? ? ? ? ? ? ?            2.028 ? 
hydrog1   hydrog ? ? I DA  1   N1 ? ? ? 1_555 J DT  147 N3 ? ? I DA  1   J DT  147 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2   hydrog ? ? I DA  1   N6 ? ? ? 1_555 J DT  147 O4 ? ? I DA  1   J DT  147 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3   hydrog ? ? I DT  2   N3 ? ? ? 1_555 J DA  146 N1 ? ? I DT  2   J DA  146 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4   hydrog ? ? I DT  2   O4 ? ? ? 1_555 J DA  146 N6 ? ? I DT  2   J DA  146 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5   hydrog ? ? I DC  3   N3 ? ? ? 1_555 J DG  145 N1 ? ? I DC  3   J DG  145 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6   hydrog ? ? I DC  3   N4 ? ? ? 1_555 J DG  145 O6 ? ? I DC  3   J DG  145 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7   hydrog ? ? I DC  3   O2 ? ? ? 1_555 J DG  145 N2 ? ? I DC  3   J DG  145 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8   hydrog ? ? I DG  4   N1 ? ? ? 1_555 J DC  144 N3 ? ? I DG  4   J DC  144 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9   hydrog ? ? I DG  4   N2 ? ? ? 1_555 J DC  144 O2 ? ? I DG  4   J DC  144 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10  hydrog ? ? I DG  4   O6 ? ? ? 1_555 J DC  144 N4 ? ? I DG  4   J DC  144 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11  hydrog ? ? I DG  5   N1 ? ? ? 1_555 J DC  143 N3 ? ? I DG  5   J DC  143 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12  hydrog ? ? I DG  5   N2 ? ? ? 1_555 J DC  143 O2 ? ? I DG  5   J DC  143 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13  hydrog ? ? I DG  5   O6 ? ? ? 1_555 J DC  143 N4 ? ? I DG  5   J DC  143 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14  hydrog ? ? I DA  6   N1 ? ? ? 1_555 J DT  142 N3 ? ? I DA  6   J DT  142 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15  hydrog ? ? I DA  6   N6 ? ? ? 1_555 J DT  142 O4 ? ? I DA  6   J DT  142 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16  hydrog ? ? I DT  7   N3 ? ? ? 1_555 J DA  141 N1 ? ? I DT  7   J DA  141 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17  hydrog ? ? I DT  7   O4 ? ? ? 1_555 J DA  141 N6 ? ? I DT  7   J DA  141 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18  hydrog ? ? I DG  8   N1 ? ? ? 1_555 J DC  140 N3 ? ? I DG  8   J DC  140 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19  hydrog ? ? I DG  8   N2 ? ? ? 1_555 J DC  140 O2 ? ? I DG  8   J DC  140 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20  hydrog ? ? I DG  8   O6 ? ? ? 1_555 J DC  140 N4 ? ? I DG  8   J DC  140 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21  hydrog ? ? I DT  9   N3 ? ? ? 1_555 J DA  139 N1 ? ? I DT  9   J DA  139 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22  hydrog ? ? I DT  9   O4 ? ? ? 1_555 J DA  139 N6 ? ? I DT  9   J DA  139 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23  hydrog ? ? I DA  10  N1 ? ? ? 1_555 J DT  138 N3 ? ? I DA  10  J DT  138 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24  hydrog ? ? I DA  10  N6 ? ? ? 1_555 J DT  138 O4 ? ? I DA  10  J DT  138 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25  hydrog ? ? I DT  11  N3 ? ? ? 1_555 J DA  137 N1 ? ? I DT  11  J DA  137 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26  hydrog ? ? I DT  11  O4 ? ? ? 1_555 J DA  137 N6 ? ? I DT  11  J DA  137 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27  hydrog ? ? I DA  12  N1 ? ? ? 1_555 J DT  136 N3 ? ? I DA  12  J DT  136 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28  hydrog ? ? I DA  12  N6 ? ? ? 1_555 J DT  136 O4 ? ? I DA  12  J DT  136 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29  hydrog ? ? I DT  13  N3 ? ? ? 1_555 J DA  135 N1 ? ? I DT  13  J DA  135 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30  hydrog ? ? I DT  13  O4 ? ? ? 1_555 J DA  135 N6 ? ? I DT  13  J DA  135 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31  hydrog ? ? I DA  14  N1 ? ? ? 1_555 J DT  134 N3 ? ? I DA  14  J DT  134 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32  hydrog ? ? I DA  14  N6 ? ? ? 1_555 J DT  134 O4 ? ? I DA  14  J DT  134 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33  hydrog ? ? I DT  15  N3 ? ? ? 1_555 J DA  133 N1 ? ? I DT  15  J DA  133 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34  hydrog ? ? I DT  15  O4 ? ? ? 1_555 J DA  133 N6 ? ? I DT  15  J DA  133 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35  hydrog ? ? I DC  16  N3 ? ? ? 1_555 J DG  132 N1 ? ? I DC  16  J DG  132 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36  hydrog ? ? I DC  16  N4 ? ? ? 1_555 J DG  132 O6 ? ? I DC  16  J DG  132 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37  hydrog ? ? I DC  16  O2 ? ? ? 1_555 J DG  132 N2 ? ? I DC  16  J DG  132 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38  hydrog ? ? I DT  17  N3 ? ? ? 1_555 J DA  131 N1 ? ? I DT  17  J DA  131 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39  hydrog ? ? I DT  17  O4 ? ? ? 1_555 J DA  131 N6 ? ? I DT  17  J DA  131 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40  hydrog ? ? I DG  18  N1 ? ? ? 1_555 J DC  130 N3 ? ? I DG  18  J DC  130 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41  hydrog ? ? I DG  18  N2 ? ? ? 1_555 J DC  130 O2 ? ? I DG  18  J DC  130 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42  hydrog ? ? I DG  18  O6 ? ? ? 1_555 J DC  130 N4 ? ? I DG  18  J DC  130 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43  hydrog ? ? I DA  19  N1 ? ? ? 1_555 J DT  129 N3 ? ? I DA  19  J DT  129 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44  hydrog ? ? I DA  19  N6 ? ? ? 1_555 J DT  129 O4 ? ? I DA  19  J DT  129 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45  hydrog ? ? I DC  20  N3 ? ? ? 1_555 J DG  128 N1 ? ? I DC  20  J DG  128 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46  hydrog ? ? I DC  20  N4 ? ? ? 1_555 J DG  128 O6 ? ? I DC  20  J DG  128 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47  hydrog ? ? I DC  20  O2 ? ? ? 1_555 J DG  128 N2 ? ? I DC  20  J DG  128 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48  hydrog ? ? I DA  21  N1 ? ? ? 1_555 J DT  127 N3 ? ? I DA  21  J DT  127 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49  hydrog ? ? I DA  21  N6 ? ? ? 1_555 J DT  127 O4 ? ? I DA  21  J DT  127 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50  hydrog ? ? I DC  22  N3 ? ? ? 1_555 J DG  126 N1 ? ? I DC  22  J DG  126 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51  hydrog ? ? I DC  22  N4 ? ? ? 1_555 J DG  126 O6 ? ? I DC  22  J DG  126 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52  hydrog ? ? I DC  22  O2 ? ? ? 1_555 J DG  126 N2 ? ? I DC  22  J DG  126 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53  hydrog ? ? I DG  23  N1 ? ? ? 1_555 J DC  125 N3 ? ? I DG  23  J DC  125 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54  hydrog ? ? I DG  23  N2 ? ? ? 1_555 J DC  125 O2 ? ? I DG  23  J DC  125 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55  hydrog ? ? I DG  23  O6 ? ? ? 1_555 J DC  125 N4 ? ? I DG  23  J DC  125 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56  hydrog ? ? I DT  24  N3 ? ? ? 1_555 J DA  124 N1 ? ? I DT  24  J DA  124 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57  hydrog ? ? I DT  24  O4 ? ? ? 1_555 J DA  124 N6 ? ? I DT  24  J DA  124 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58  hydrog ? ? I DG  25  N1 ? ? ? 1_555 J DC  123 N3 ? ? I DG  25  J DC  123 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59  hydrog ? ? I DG  25  N2 ? ? ? 1_555 J DC  123 O2 ? ? I DG  25  J DC  123 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60  hydrog ? ? I DG  25  O6 ? ? ? 1_555 J DC  123 N4 ? ? I DG  25  J DC  123 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61  hydrog ? ? I DC  26  N3 ? ? ? 1_555 J DG  122 N1 ? ? I DC  26  J DG  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62  hydrog ? ? I DC  26  N4 ? ? ? 1_555 J DG  122 O6 ? ? I DC  26  J DG  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63  hydrog ? ? I DC  26  O2 ? ? ? 1_555 J DG  122 N2 ? ? I DC  26  J DG  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64  hydrog ? ? I DC  27  N3 ? ? ? 1_555 J DG  121 N1 ? ? I DC  27  J DG  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65  hydrog ? ? I DC  27  N4 ? ? ? 1_555 J DG  121 O6 ? ? I DC  27  J DG  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66  hydrog ? ? I DC  27  O2 ? ? ? 1_555 J DG  121 N2 ? ? I DC  27  J DG  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67  hydrog ? ? I DT  28  N3 ? ? ? 1_555 J DA  120 N1 ? ? I DT  28  J DA  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68  hydrog ? ? I DT  28  O4 ? ? ? 1_555 J DA  120 N6 ? ? I DT  28  J DA  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69  hydrog ? ? I DG  29  N1 ? ? ? 1_555 J DC  119 N3 ? ? I DG  29  J DC  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70  hydrog ? ? I DG  29  N2 ? ? ? 1_555 J DC  119 O2 ? ? I DG  29  J DC  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71  hydrog ? ? I DG  29  O6 ? ? ? 1_555 J DC  119 N4 ? ? I DG  29  J DC  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72  hydrog ? ? I DG  30  N1 ? ? ? 1_555 J DC  118 N3 ? ? I DG  30  J DC  118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73  hydrog ? ? I DG  30  N2 ? ? ? 1_555 J DC  118 O2 ? ? I DG  30  J DC  118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74  hydrog ? ? I DG  30  O6 ? ? ? 1_555 J DC  118 N4 ? ? I DG  30  J DC  118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75  hydrog ? ? I DA  31  N1 ? ? ? 1_555 J DT  117 N3 ? ? I DA  31  J DT  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76  hydrog ? ? I DA  31  N6 ? ? ? 1_555 J DT  117 O4 ? ? I DA  31  J DT  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77  hydrog ? ? I DG  32  N1 ? ? ? 1_555 J DC  116 N3 ? ? I DG  32  J DC  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78  hydrog ? ? I DG  32  N2 ? ? ? 1_555 J DC  116 O2 ? ? I DG  32  J DC  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79  hydrog ? ? I DG  32  O6 ? ? ? 1_555 J DC  116 N4 ? ? I DG  32  J DC  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80  hydrog ? ? I DA  33  N1 ? ? ? 1_555 J DT  115 N3 ? ? I DA  33  J DT  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81  hydrog ? ? I DA  33  N6 ? ? ? 1_555 J DT  115 O4 ? ? I DA  33  J DT  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82  hydrog ? ? I DC  34  N3 ? ? ? 1_555 J DG  114 N1 ? ? I DC  34  J DG  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83  hydrog ? ? I DC  34  N4 ? ? ? 1_555 J DG  114 O6 ? ? I DC  34  J DG  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84  hydrog ? ? I DC  34  O2 ? ? ? 1_555 J DG  114 N2 ? ? I DC  34  J DG  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85  hydrog ? ? I DT  35  N3 ? ? ? 1_555 J DA  113 N1 ? ? I DT  35  J DA  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86  hydrog ? ? I DT  35  O4 ? ? ? 1_555 J DA  113 N6 ? ? I DT  35  J DA  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog87  hydrog ? ? I DA  36  N1 ? ? ? 1_555 J DT  112 N3 ? ? I DA  36  J DT  112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog88  hydrog ? ? I DA  36  N6 ? ? ? 1_555 J DT  112 O4 ? ? I DA  36  J DT  112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog89  hydrog ? ? I DG  37  N1 ? ? ? 1_555 J DC  111 N3 ? ? I DG  37  J DC  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog90  hydrog ? ? I DG  37  N2 ? ? ? 1_555 J DC  111 O2 ? ? I DG  37  J DC  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog91  hydrog ? ? I DG  37  O6 ? ? ? 1_555 J DC  111 N4 ? ? I DG  37  J DC  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog92  hydrog ? ? I DG  38  N1 ? ? ? 1_555 J DC  110 N3 ? ? I DG  38  J DC  110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog93  hydrog ? ? I DG  38  N2 ? ? ? 1_555 J DC  110 O2 ? ? I DG  38  J DC  110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog94  hydrog ? ? I DG  38  O6 ? ? ? 1_555 J DC  110 N4 ? ? I DG  38  J DC  110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog95  hydrog ? ? I DG  39  N1 ? ? ? 1_555 J DC  109 N3 ? ? I DG  39  J DC  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog96  hydrog ? ? I DG  39  N2 ? ? ? 1_555 J DC  109 O2 ? ? I DG  39  J DC  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog97  hydrog ? ? I DG  39  O6 ? ? ? 1_555 J DC  109 N4 ? ? I DG  39  J DC  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog98  hydrog ? ? I DA  40  N1 ? ? ? 1_555 J DT  108 N3 ? ? I DA  40  J DT  108 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog99  hydrog ? ? I DA  40  N6 ? ? ? 1_555 J DT  108 O4 ? ? I DA  40  J DT  108 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog100 hydrog ? ? I DG  41  N1 ? ? ? 1_555 J DC  107 N3 ? ? I DG  41  J DC  107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog101 hydrog ? ? I DG  41  N2 ? ? ? 1_555 J DC  107 O2 ? ? I DG  41  J DC  107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog102 hydrog ? ? I DG  41  O6 ? ? ? 1_555 J DC  107 N4 ? ? I DG  41  J DC  107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog103 hydrog ? ? I DT  42  N3 ? ? ? 1_555 J DA  106 N1 ? ? I DT  42  J DA  106 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog104 hydrog ? ? I DT  42  O4 ? ? ? 1_555 J DA  106 N6 ? ? I DT  42  J DA  106 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog105 hydrog ? ? I DA  43  N1 ? ? ? 1_555 J DT  105 N3 ? ? I DA  43  J DT  105 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog106 hydrog ? ? I DA  43  N6 ? ? ? 1_555 J DT  105 O4 ? ? I DA  43  J DT  105 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog107 hydrog ? ? I DA  44  N1 ? ? ? 1_555 J DT  104 N3 ? ? I DA  44  J DT  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog108 hydrog ? ? I DA  44  N6 ? ? ? 1_555 J DT  104 O4 ? ? I DA  44  J DT  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog109 hydrog ? ? I DT  45  N3 ? ? ? 1_555 J DA  103 N1 ? ? I DT  45  J DA  103 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog110 hydrog ? ? I DT  45  O4 ? ? ? 1_555 J DA  103 N6 ? ? I DT  45  J DA  103 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog111 hydrog ? ? I DC  46  N3 ? ? ? 1_555 J DG  102 N1 ? ? I DC  46  J DG  102 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog112 hydrog ? ? I DC  46  N4 ? ? ? 1_555 J DG  102 O6 ? ? I DC  46  J DG  102 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog113 hydrog ? ? I DC  46  O2 ? ? ? 1_555 J DG  102 N2 ? ? I DC  46  J DG  102 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog114 hydrog ? ? I DC  47  N3 ? ? ? 1_555 J DG  101 N1 ? ? I DC  47  J DG  101 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog115 hydrog ? ? I DC  47  N4 ? ? ? 1_555 J DG  101 O6 ? ? I DC  47  J DG  101 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog116 hydrog ? ? I DC  47  O2 ? ? ? 1_555 J DG  101 N2 ? ? I DC  47  J DG  101 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog117 hydrog ? ? I DC  48  N3 ? ? ? 1_555 J DG  100 N1 ? ? I DC  48  J DG  100 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog118 hydrog ? ? I DC  48  N4 ? ? ? 1_555 J DG  100 O6 ? ? I DC  48  J DG  100 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog119 hydrog ? ? I DC  48  O2 ? ? ? 1_555 J DG  100 N2 ? ? I DC  48  J DG  100 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog120 hydrog ? ? I DC  49  N3 ? ? ? 1_555 J DG  99  N1 ? ? I DC  49  J DG  99  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog121 hydrog ? ? I DC  49  N4 ? ? ? 1_555 J DG  99  O6 ? ? I DC  49  J DG  99  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog122 hydrog ? ? I DC  49  O2 ? ? ? 1_555 J DG  99  N2 ? ? I DC  49  J DG  99  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog123 hydrog ? ? I DT  50  N3 ? ? ? 1_555 J DA  98  N1 ? ? I DT  50  J DA  98  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog124 hydrog ? ? I DT  50  O4 ? ? ? 1_555 J DA  98  N6 ? ? I DT  50  J DA  98  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog125 hydrog ? ? I DT  51  N3 ? ? ? 1_555 J DA  97  N1 ? ? I DT  51  J DA  97  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog126 hydrog ? ? I DT  51  O4 ? ? ? 1_555 J DA  97  N6 ? ? I DT  51  J DA  97  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog127 hydrog ? ? I DG  52  N1 ? ? ? 1_555 J DC  96  N3 ? ? I DG  52  J DC  96  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog128 hydrog ? ? I DG  52  N2 ? ? ? 1_555 J DC  96  O2 ? ? I DG  52  J DC  96  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog129 hydrog ? ? I DG  52  O6 ? ? ? 1_555 J DC  96  N4 ? ? I DG  52  J DC  96  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog130 hydrog ? ? I DG  53  N1 ? ? ? 1_555 J DC  95  N3 ? ? I DG  53  J DC  95  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog131 hydrog ? ? I DG  53  N2 ? ? ? 1_555 J DC  95  O2 ? ? I DG  53  J DC  95  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog132 hydrog ? ? I DG  53  O6 ? ? ? 1_555 J DC  95  N4 ? ? I DG  53  J DC  95  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog133 hydrog ? ? I DC  54  N3 ? ? ? 1_555 J DG  94  N1 ? ? I DC  54  J DG  94  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog134 hydrog ? ? I DC  54  N4 ? ? ? 1_555 J DG  94  O6 ? ? I DC  54  J DG  94  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog135 hydrog ? ? I DC  54  O2 ? ? ? 1_555 J DG  94  N2 ? ? I DC  54  J DG  94  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog136 hydrog ? ? I DG  55  N1 ? ? ? 1_555 J DC  93  N3 ? ? I DG  55  J DC  93  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog137 hydrog ? ? I DG  55  N2 ? ? ? 1_555 J DC  93  O2 ? ? I DG  55  J DC  93  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog138 hydrog ? ? I DG  55  O6 ? ? ? 1_555 J DC  93  N4 ? ? I DG  55  J DC  93  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog139 hydrog ? ? I DG  56  N1 ? ? ? 1_555 J DC  92  N3 ? ? I DG  56  J DC  92  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog140 hydrog ? ? I DG  56  N2 ? ? ? 1_555 J DC  92  O2 ? ? I DG  56  J DC  92  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog141 hydrog ? ? I DG  56  O6 ? ? ? 1_555 J DC  92  N4 ? ? I DG  56  J DC  92  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog142 hydrog ? ? I DT  57  N3 ? ? ? 1_555 J DA  91  N1 ? ? I DT  57  J DA  91  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog143 hydrog ? ? I DT  57  O4 ? ? ? 1_555 J DA  91  N6 ? ? I DT  57  J DA  91  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog144 hydrog ? ? I DT  58  N3 ? ? ? 1_555 J DA  90  N1 ? ? I DT  58  J DA  90  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog145 hydrog ? ? I DT  58  O4 ? ? ? 1_555 J DA  90  N6 ? ? I DT  58  J DA  90  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog146 hydrog ? ? I DA  59  N1 ? ? ? 1_555 J DT  89  N3 ? ? I DA  59  J DT  89  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog147 hydrog ? ? I DA  59  N6 ? ? ? 1_555 J DT  89  O4 ? ? I DA  59  J DT  89  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog148 hydrog ? ? I DA  60  N1 ? ? ? 1_555 J DT  88  N3 ? ? I DA  60  J DT  88  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog149 hydrog ? ? I DA  60  N6 ? ? ? 1_555 J DT  88  O4 ? ? I DA  60  J DT  88  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog150 hydrog ? ? I DA  61  N1 ? ? ? 1_555 J DT  87  N3 ? ? I DA  61  J DT  87  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog151 hydrog ? ? I DA  61  N6 ? ? ? 1_555 J DT  87  O4 ? ? I DA  61  J DT  87  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog152 hydrog ? ? I DA  62  N1 ? ? ? 1_555 J DT  86  N3 ? ? I DA  62  J DT  86  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog153 hydrog ? ? I DA  62  N6 ? ? ? 1_555 J DT  86  O4 ? ? I DA  62  J DT  86  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog154 hydrog ? ? I DC  63  N3 ? ? ? 1_555 J DG  85  N1 ? ? I DC  63  J DG  85  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog155 hydrog ? ? I DC  63  N4 ? ? ? 1_555 J DG  85  O6 ? ? I DC  63  J DG  85  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog156 hydrog ? ? I DC  63  O2 ? ? ? 1_555 J DG  85  N2 ? ? I DC  63  J DG  85  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog157 hydrog ? ? I DG  64  N1 ? ? ? 1_555 J DC  84  N3 ? ? I DG  64  J DC  84  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog158 hydrog ? ? I DG  64  N2 ? ? ? 1_555 J DC  84  O2 ? ? I DG  64  J DC  84  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog159 hydrog ? ? I DG  64  O6 ? ? ? 1_555 J DC  84  N4 ? ? I DG  64  J DC  84  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog160 hydrog ? ? I DC  65  N3 ? ? ? 1_555 J DG  83  N1 ? ? I DC  65  J DG  83  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog161 hydrog ? ? I DC  65  N4 ? ? ? 1_555 J DG  83  O6 ? ? I DC  65  J DG  83  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog162 hydrog ? ? I DC  65  O2 ? ? ? 1_555 J DG  83  N2 ? ? I DC  65  J DG  83  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog163 hydrog ? ? I DG  66  N1 ? ? ? 1_555 J DC  82  N3 ? ? I DG  66  J DC  82  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog164 hydrog ? ? I DG  66  N2 ? ? ? 1_555 J DC  82  O2 ? ? I DG  66  J DC  82  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog165 hydrog ? ? I DG  66  O6 ? ? ? 1_555 J DC  82  N4 ? ? I DG  66  J DC  82  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog166 hydrog ? ? I DG  67  N1 ? ? ? 1_555 J DC  81  N3 ? ? I DG  67  J DC  81  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog167 hydrog ? ? I DG  67  N2 ? ? ? 1_555 J DC  81  O2 ? ? I DG  67  J DC  81  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog168 hydrog ? ? I DG  67  O6 ? ? ? 1_555 J DC  81  N4 ? ? I DG  67  J DC  81  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog169 hydrog ? ? I DG  68  N1 ? ? ? 1_555 J DC  80  N3 ? ? I DG  68  J DC  80  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog170 hydrog ? ? I DG  68  N2 ? ? ? 1_555 J DC  80  O2 ? ? I DG  68  J DC  80  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog171 hydrog ? ? I DG  68  O6 ? ? ? 1_555 J DC  80  N4 ? ? I DG  68  J DC  80  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog172 hydrog ? ? I DG  69  N1 ? ? ? 1_555 J DC  79  N3 ? ? I DG  69  J DC  79  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog173 hydrog ? ? I DG  69  N2 ? ? ? 1_555 J DC  79  O2 ? ? I DG  69  J DC  79  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog174 hydrog ? ? I DG  69  O6 ? ? ? 1_555 J DC  79  N4 ? ? I DG  69  J DC  79  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog175 hydrog ? ? I DG  70  N1 ? ? ? 1_555 J DC  78  N3 ? ? I DG  70  J DC  78  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog176 hydrog ? ? I DG  70  N2 ? ? ? 1_555 J DC  78  O2 ? ? I DG  70  J DC  78  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog177 hydrog ? ? I DG  70  O6 ? ? ? 1_555 J DC  78  N4 ? ? I DG  70  J DC  78  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog178 hydrog ? ? I DA  71  N1 ? ? ? 1_555 J DT  77  N3 ? ? I DA  71  J DT  77  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog179 hydrog ? ? I DA  71  N6 ? ? ? 1_555 J DT  77  O4 ? ? I DA  71  J DT  77  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog180 hydrog ? ? I DC  72  N3 ? ? ? 1_555 J DG  76  N1 ? ? I DC  72  J DG  76  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog181 hydrog ? ? I DC  72  N4 ? ? ? 1_555 J DG  76  O6 ? ? I DC  72  J DG  76  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog182 hydrog ? ? I DC  72  O2 ? ? ? 1_555 J DG  76  N2 ? ? I DC  72  J DG  76  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog183 hydrog ? ? I DA  73  N1 ? ? ? 1_555 J DT  75  N3 ? ? I DA  73  J DT  75  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog184 hydrog ? ? I DA  73  N6 ? ? ? 1_555 J DT  75  O4 ? ? I DA  73  J DT  75  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog185 hydrog ? ? I DG  74  N1 ? ? ? 1_555 J DC  74  N3 ? ? I DG  74  J DC  74  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog186 hydrog ? ? I DG  74  N2 ? ? ? 1_555 J DC  74  O2 ? ? I DG  74  J DC  74  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog187 hydrog ? ? I DG  74  O6 ? ? ? 1_555 J DC  74  N4 ? ? I DG  74  J DC  74  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog188 hydrog ? ? I DC  75  N3 ? ? ? 1_555 J DG  73  N1 ? ? I DC  75  J DG  73  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog189 hydrog ? ? I DC  75  N4 ? ? ? 1_555 J DG  73  O6 ? ? I DC  75  J DG  73  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog190 hydrog ? ? I DC  75  O2 ? ? ? 1_555 J DG  73  N2 ? ? I DC  75  J DG  73  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog191 hydrog ? ? I DG  76  N1 ? ? ? 1_555 J DC  72  N3 ? ? I DG  76  J DC  72  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog192 hydrog ? ? I DG  76  N2 ? ? ? 1_555 J DC  72  O2 ? ? I DG  76  J DC  72  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog193 hydrog ? ? I DG  76  O6 ? ? ? 1_555 J DC  72  N4 ? ? I DG  76  J DC  72  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog194 hydrog ? ? I DC  77  N3 ? ? ? 1_555 J DG  71  N1 ? ? I DC  77  J DG  71  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog195 hydrog ? ? I DC  77  N4 ? ? ? 1_555 J DG  71  O6 ? ? I DC  77  J DG  71  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog196 hydrog ? ? I DC  77  O2 ? ? ? 1_555 J DG  71  N2 ? ? I DC  77  J DG  71  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog197 hydrog ? ? I DG  78  N1 ? ? ? 1_555 J DC  70  N3 ? ? I DG  78  J DC  70  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog198 hydrog ? ? I DG  78  N2 ? ? ? 1_555 J DC  70  O2 ? ? I DG  78  J DC  70  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog199 hydrog ? ? I DG  78  O6 ? ? ? 1_555 J DC  70  N4 ? ? I DG  78  J DC  70  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog200 hydrog ? ? I DT  79  N3 ? ? ? 1_555 J DA  69  N1 ? ? I DT  79  J DA  69  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog201 hydrog ? ? I DT  79  O4 ? ? ? 1_555 J DA  69  N6 ? ? I DT  79  J DA  69  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog202 hydrog ? ? I DA  80  N1 ? ? ? 1_555 J DT  68  N3 ? ? I DA  80  J DT  68  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog203 hydrog ? ? I DA  80  N6 ? ? ? 1_555 J DT  68  O4 ? ? I DA  80  J DT  68  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog204 hydrog ? ? I DC  81  N3 ? ? ? 1_555 J DG  67  N1 ? ? I DC  81  J DG  67  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog205 hydrog ? ? I DC  81  N4 ? ? ? 1_555 J DG  67  O6 ? ? I DC  81  J DG  67  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog206 hydrog ? ? I DC  81  O2 ? ? ? 1_555 J DG  67  N2 ? ? I DC  81  J DG  67  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog207 hydrog ? ? I DG  82  N1 ? ? ? 1_555 J DC  66  N3 ? ? I DG  82  J DC  66  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog208 hydrog ? ? I DG  82  N2 ? ? ? 1_555 J DC  66  O2 ? ? I DG  82  J DC  66  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog209 hydrog ? ? I DG  82  O6 ? ? ? 1_555 J DC  66  N4 ? ? I DG  82  J DC  66  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog210 hydrog ? ? I DT  83  N3 ? ? ? 1_555 J DA  65  N1 ? ? I DT  83  J DA  65  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog211 hydrog ? ? I DT  83  O4 ? ? ? 1_555 J DA  65  N6 ? ? I DT  83  J DA  65  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog212 hydrog ? ? I DG  84  N1 ? ? ? 1_555 J DC  64  N3 ? ? I DG  84  J DC  64  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog213 hydrog ? ? I DG  84  N2 ? ? ? 1_555 J DC  64  O2 ? ? I DG  84  J DC  64  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog214 hydrog ? ? I DG  84  O6 ? ? ? 1_555 J DC  64  N4 ? ? I DG  84  J DC  64  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog215 hydrog ? ? I DC  85  N3 ? ? ? 1_555 J DG  63  N1 ? ? I DC  85  J DG  63  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog216 hydrog ? ? I DC  85  N4 ? ? ? 1_555 J DG  63  O6 ? ? I DC  85  J DG  63  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog217 hydrog ? ? I DC  85  O2 ? ? ? 1_555 J DG  63  N2 ? ? I DC  85  J DG  63  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog218 hydrog ? ? I DG  86  N1 ? ? ? 1_555 J DC  62  N3 ? ? I DG  86  J DC  62  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog219 hydrog ? ? I DG  86  N2 ? ? ? 1_555 J DC  62  O2 ? ? I DG  86  J DC  62  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog220 hydrog ? ? I DG  86  O6 ? ? ? 1_555 J DC  62  N4 ? ? I DG  86  J DC  62  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog221 hydrog ? ? I DT  87  N3 ? ? ? 1_555 J DA  61  N1 ? ? I DT  87  J DA  61  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog222 hydrog ? ? I DT  87  O4 ? ? ? 1_555 J DA  61  N6 ? ? I DT  87  J DA  61  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog223 hydrog ? ? I DT  88  N3 ? ? ? 1_555 J DA  60  N1 ? ? I DT  88  J DA  60  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog224 hydrog ? ? I DT  88  O4 ? ? ? 1_555 J DA  60  N6 ? ? I DT  88  J DA  60  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog225 hydrog ? ? I DT  89  N3 ? ? ? 1_555 J DA  59  N1 ? ? I DT  89  J DA  59  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog226 hydrog ? ? I DT  89  O4 ? ? ? 1_555 J DA  59  N6 ? ? I DT  89  J DA  59  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog227 hydrog ? ? I DA  90  N1 ? ? ? 1_555 J DT  58  N3 ? ? I DA  90  J DT  58  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog228 hydrog ? ? I DA  90  N6 ? ? ? 1_555 J DT  58  O4 ? ? I DA  90  J DT  58  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog229 hydrog ? ? I DA  91  N1 ? ? ? 1_555 J DT  57  N3 ? ? I DA  91  J DT  57  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog230 hydrog ? ? I DA  91  N6 ? ? ? 1_555 J DT  57  O4 ? ? I DA  91  J DT  57  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog231 hydrog ? ? I DG  92  N1 ? ? ? 1_555 J DC  56  N3 ? ? I DG  92  J DC  56  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog232 hydrog ? ? I DG  92  N2 ? ? ? 1_555 J DC  56  O2 ? ? I DG  92  J DC  56  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog233 hydrog ? ? I DG  92  O6 ? ? ? 1_555 J DC  56  N4 ? ? I DG  92  J DC  56  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog234 hydrog ? ? I DC  93  N3 ? ? ? 1_555 J DG  55  N1 ? ? I DC  93  J DG  55  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog235 hydrog ? ? I DC  93  N4 ? ? ? 1_555 J DG  55  O6 ? ? I DC  93  J DG  55  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog236 hydrog ? ? I DC  93  O2 ? ? ? 1_555 J DG  55  N2 ? ? I DC  93  J DG  55  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog237 hydrog ? ? I DG  94  N1 ? ? ? 1_555 J DC  54  N3 ? ? I DG  94  J DC  54  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog238 hydrog ? ? I DG  94  N2 ? ? ? 1_555 J DC  54  O2 ? ? I DG  94  J DC  54  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog239 hydrog ? ? I DG  94  O6 ? ? ? 1_555 J DC  54  N4 ? ? I DG  94  J DC  54  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog240 hydrog ? ? I DG  95  N1 ? ? ? 1_555 J DC  53  N3 ? ? I DG  95  J DC  53  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog241 hydrog ? ? I DG  95  N2 ? ? ? 1_555 J DC  53  O2 ? ? I DG  95  J DC  53  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog242 hydrog ? ? I DG  95  O6 ? ? ? 1_555 J DC  53  N4 ? ? I DG  95  J DC  53  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog243 hydrog ? ? I DT  96  N3 ? ? ? 1_555 J DA  52  N1 ? ? I DT  96  J DA  52  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog244 hydrog ? ? I DT  96  O4 ? ? ? 1_555 J DA  52  N6 ? ? I DT  96  J DA  52  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog245 hydrog ? ? I DG  97  N1 ? ? ? 1_555 J DC  51  N3 ? ? I DG  97  J DC  51  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog246 hydrog ? ? I DG  97  N2 ? ? ? 1_555 J DC  51  O2 ? ? I DG  97  J DC  51  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog247 hydrog ? ? I DG  97  O6 ? ? ? 1_555 J DC  51  N4 ? ? I DG  97  J DC  51  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog248 hydrog ? ? I DC  98  N3 ? ? ? 1_555 J DG  50  N1 ? ? I DC  98  J DG  50  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog249 hydrog ? ? I DC  98  N4 ? ? ? 1_555 J DG  50  O6 ? ? I DC  98  J DG  50  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog250 hydrog ? ? I DC  98  O2 ? ? ? 1_555 J DG  50  N2 ? ? I DC  98  J DG  50  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog251 hydrog ? ? I DT  99  N3 ? ? ? 1_555 J DA  49  N1 ? ? I DT  99  J DA  49  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog252 hydrog ? ? I DT  99  O4 ? ? ? 1_555 J DA  49  N6 ? ? I DT  99  J DA  49  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog253 hydrog ? ? I DA  100 N1 ? ? ? 1_555 J DT  48  N3 ? ? I DA  100 J DT  48  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog254 hydrog ? ? I DA  100 N6 ? ? ? 1_555 J DT  48  O4 ? ? I DA  100 J DT  48  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog255 hydrog ? ? I DG  101 N1 ? ? ? 1_555 J DC  47  N3 ? ? I DG  101 J DC  47  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog256 hydrog ? ? I DG  101 N2 ? ? ? 1_555 J DC  47  O2 ? ? I DG  101 J DC  47  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog257 hydrog ? ? I DG  101 O6 ? ? ? 1_555 J DC  47  N4 ? ? I DG  101 J DC  47  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog258 hydrog ? ? I DA  102 N1 ? ? ? 1_555 J DT  46  N3 ? ? I DA  102 J DT  46  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog259 hydrog ? ? I DA  102 N6 ? ? ? 1_555 J DT  46  O4 ? ? I DA  102 J DT  46  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog260 hydrog ? ? I DG  103 N1 ? ? ? 1_555 J DC  45  N3 ? ? I DG  103 J DC  45  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog261 hydrog ? ? I DG  103 N2 ? ? ? 1_555 J DC  45  O2 ? ? I DG  103 J DC  45  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog262 hydrog ? ? I DG  103 O6 ? ? ? 1_555 J DC  45  N4 ? ? I DG  103 J DC  45  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog263 hydrog ? ? I DC  104 N3 ? ? ? 1_555 J DG  44  N1 ? ? I DC  104 J DG  44  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog264 hydrog ? ? I DC  104 N4 ? ? ? 1_555 J DG  44  O6 ? ? I DC  104 J DG  44  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog265 hydrog ? ? I DC  104 O2 ? ? ? 1_555 J DG  44  N2 ? ? I DC  104 J DG  44  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog266 hydrog ? ? I DT  105 N3 ? ? ? 1_555 J DA  43  N1 ? ? I DT  105 J DA  43  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog267 hydrog ? ? I DT  105 O4 ? ? ? 1_555 J DA  43  N6 ? ? I DT  105 J DA  43  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog268 hydrog ? ? I DG  106 N1 ? ? ? 1_555 J DC  42  N3 ? ? I DG  106 J DC  42  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog269 hydrog ? ? I DG  106 N2 ? ? ? 1_555 J DC  42  O2 ? ? I DG  106 J DC  42  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog270 hydrog ? ? I DG  106 O6 ? ? ? 1_555 J DC  42  N4 ? ? I DG  106 J DC  42  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog271 hydrog ? ? I DT  107 N3 ? ? ? 1_555 J DA  41  N1 ? ? I DT  107 J DA  41  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog272 hydrog ? ? I DT  107 O4 ? ? ? 1_555 J DA  41  N6 ? ? I DT  107 J DA  41  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog273 hydrog ? ? I DC  108 N3 ? ? ? 1_555 J DG  40  N1 ? ? I DC  108 J DG  40  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog274 hydrog ? ? I DC  108 N4 ? ? ? 1_555 J DG  40  O6 ? ? I DC  108 J DG  40  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog275 hydrog ? ? I DC  108 O2 ? ? ? 1_555 J DG  40  N2 ? ? I DC  108 J DG  40  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog276 hydrog ? ? I DT  109 N3 ? ? ? 1_555 J DA  39  N1 ? ? I DT  109 J DA  39  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog277 hydrog ? ? I DT  109 O4 ? ? ? 1_555 J DA  39  N6 ? ? I DT  109 J DA  39  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog278 hydrog ? ? I DA  110 N1 ? ? ? 1_555 J DT  38  N3 ? ? I DA  110 J DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog279 hydrog ? ? I DA  110 N6 ? ? ? 1_555 J DT  38  O4 ? ? I DA  110 J DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog280 hydrog ? ? I DC  111 N3 ? ? ? 1_555 J DG  37  N1 ? ? I DC  111 J DG  37  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog281 hydrog ? ? I DC  111 N4 ? ? ? 1_555 J DG  37  O6 ? ? I DC  111 J DG  37  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog282 hydrog ? ? I DC  111 O2 ? ? ? 1_555 J DG  37  N2 ? ? I DC  111 J DG  37  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog283 hydrog ? ? I DG  112 N1 ? ? ? 1_555 J DC  36  N3 ? ? I DG  112 J DC  36  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog284 hydrog ? ? I DG  112 N2 ? ? ? 1_555 J DC  36  O2 ? ? I DG  112 J DC  36  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog285 hydrog ? ? I DG  112 O6 ? ? ? 1_555 J DC  36  N4 ? ? I DG  112 J DC  36  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog286 hydrog ? ? I DA  113 N1 ? ? ? 1_555 J DT  35  N3 ? ? I DA  113 J DT  35  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog287 hydrog ? ? I DA  113 N6 ? ? ? 1_555 J DT  35  O4 ? ? I DA  113 J DT  35  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog288 hydrog ? ? I DC  114 N3 ? ? ? 1_555 J DG  34  N1 ? ? I DC  114 J DG  34  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog289 hydrog ? ? I DC  114 N4 ? ? ? 1_555 J DG  34  O6 ? ? I DC  114 J DG  34  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog290 hydrog ? ? I DC  114 O2 ? ? ? 1_555 J DG  34  N2 ? ? I DC  114 J DG  34  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog291 hydrog ? ? I DC  115 N3 ? ? ? 1_555 J DG  33  N1 ? ? I DC  115 J DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog292 hydrog ? ? I DC  115 N4 ? ? ? 1_555 J DG  33  O6 ? ? I DC  115 J DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog293 hydrog ? ? I DC  115 O2 ? ? ? 1_555 J DG  33  N2 ? ? I DC  115 J DG  33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog294 hydrog ? ? I DA  116 N1 ? ? ? 1_555 J DT  32  N3 ? ? I DA  116 J DT  32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog295 hydrog ? ? I DA  116 N6 ? ? ? 1_555 J DT  32  O4 ? ? I DA  116 J DT  32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog296 hydrog ? ? I DA  117 N1 ? ? ? 1_555 J DT  31  N3 ? ? I DA  117 J DT  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog297 hydrog ? ? I DA  117 N6 ? ? ? 1_555 J DT  31  O4 ? ? I DA  117 J DT  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog298 hydrog ? ? I DT  118 N3 ? ? ? 1_555 J DA  30  N1 ? ? I DT  118 J DA  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog299 hydrog ? ? I DT  118 O4 ? ? ? 1_555 J DA  30  N6 ? ? I DT  118 J DA  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog300 hydrog ? ? I DT  119 N3 ? ? ? 1_555 J DA  29  N1 ? ? I DT  119 J DA  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog301 hydrog ? ? I DT  119 O4 ? ? ? 1_555 J DA  29  N6 ? ? I DT  119 J DA  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog302 hydrog ? ? I DG  120 N1 ? ? ? 1_555 J DC  28  N3 ? ? I DG  120 J DC  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog303 hydrog ? ? I DG  120 N2 ? ? ? 1_555 J DC  28  O2 ? ? I DG  120 J DC  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog304 hydrog ? ? I DG  120 O6 ? ? ? 1_555 J DC  28  N4 ? ? I DG  120 J DC  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog305 hydrog ? ? I DA  121 N1 ? ? ? 1_555 J DT  27  N3 ? ? I DA  121 J DT  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog306 hydrog ? ? I DA  121 N6 ? ? ? 1_555 J DT  27  O4 ? ? I DA  121 J DT  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog307 hydrog ? ? I DG  122 N1 ? ? ? 1_555 J DC  26  N3 ? ? I DG  122 J DC  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog308 hydrog ? ? I DG  122 N2 ? ? ? 1_555 J DC  26  O2 ? ? I DG  122 J DC  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog309 hydrog ? ? I DG  122 O6 ? ? ? 1_555 J DC  26  N4 ? ? I DG  122 J DC  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog310 hydrog ? ? I DC  123 N3 ? ? ? 1_555 J DG  25  N1 ? ? I DC  123 J DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog311 hydrog ? ? I DC  123 N4 ? ? ? 1_555 J DG  25  O6 ? ? I DC  123 J DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog312 hydrog ? ? I DC  123 O2 ? ? ? 1_555 J DG  25  N2 ? ? I DC  123 J DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog313 hydrog ? ? I DG  124 N1 ? ? ? 1_555 J DC  24  N3 ? ? I DG  124 J DC  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog314 hydrog ? ? I DG  124 N2 ? ? ? 1_555 J DC  24  O2 ? ? I DG  124 J DC  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog315 hydrog ? ? I DG  124 O6 ? ? ? 1_555 J DC  24  N4 ? ? I DG  124 J DC  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog316 hydrog ? ? I DG  125 N1 ? ? ? 1_555 J DC  23  N3 ? ? I DG  125 J DC  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog317 hydrog ? ? I DG  125 N2 ? ? ? 1_555 J DC  23  O2 ? ? I DG  125 J DC  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog318 hydrog ? ? I DG  125 O6 ? ? ? 1_555 J DC  23  N4 ? ? I DG  125 J DC  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog319 hydrog ? ? I DC  126 N3 ? ? ? 1_555 J DG  22  N1 ? ? I DC  126 J DG  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog320 hydrog ? ? I DC  126 N4 ? ? ? 1_555 J DG  22  O6 ? ? I DC  126 J DG  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog321 hydrog ? ? I DC  126 O2 ? ? ? 1_555 J DG  22  N2 ? ? I DC  126 J DG  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog322 hydrog ? ? I DC  127 N3 ? ? ? 1_555 J DG  21  N1 ? ? I DC  127 J DG  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog323 hydrog ? ? I DC  127 N4 ? ? ? 1_555 J DG  21  O6 ? ? I DC  127 J DG  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog324 hydrog ? ? I DC  127 O2 ? ? ? 1_555 J DG  21  N2 ? ? I DC  127 J DG  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog325 hydrog ? ? I DT  128 N3 ? ? ? 1_555 J DA  20  N1 ? ? I DT  128 J DA  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog326 hydrog ? ? I DT  128 O4 ? ? ? 1_555 J DA  20  N6 ? ? I DT  128 J DA  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog327 hydrog ? ? I DC  129 N3 ? ? ? 1_555 J DG  19  N1 ? ? I DC  129 J DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog328 hydrog ? ? I DC  129 N4 ? ? ? 1_555 J DG  19  O6 ? ? I DC  129 J DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog329 hydrog ? ? I DC  129 O2 ? ? ? 1_555 J DG  19  N2 ? ? I DC  129 J DG  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog330 hydrog ? ? I DG  130 N1 ? ? ? 1_555 J DC  18  N3 ? ? I DG  130 J DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog331 hydrog ? ? I DG  130 N2 ? ? ? 1_555 J DC  18  O2 ? ? I DG  130 J DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog332 hydrog ? ? I DG  130 O6 ? ? ? 1_555 J DC  18  N4 ? ? I DG  130 J DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog333 hydrog ? ? I DG  131 N1 ? ? ? 1_555 J DC  17  N3 ? ? I DG  131 J DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog334 hydrog ? ? I DG  131 N2 ? ? ? 1_555 J DC  17  O2 ? ? I DG  131 J DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog335 hydrog ? ? I DG  131 O6 ? ? ? 1_555 J DC  17  N4 ? ? I DG  131 J DC  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog336 hydrog ? ? I DC  132 N3 ? ? ? 1_555 J DG  16  N1 ? ? I DC  132 J DG  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog337 hydrog ? ? I DC  132 N4 ? ? ? 1_555 J DG  16  O6 ? ? I DC  132 J DG  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog338 hydrog ? ? I DC  132 O2 ? ? ? 1_555 J DG  16  N2 ? ? I DC  132 J DG  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog339 hydrog ? ? I DA  133 N1 ? ? ? 1_555 J DT  15  N3 ? ? I DA  133 J DT  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog340 hydrog ? ? I DA  133 N6 ? ? ? 1_555 J DT  15  O4 ? ? I DA  133 J DT  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog341 hydrog ? ? I DC  134 N3 ? ? ? 1_555 J DG  14  N1 ? ? I DC  134 J DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog342 hydrog ? ? I DC  134 N4 ? ? ? 1_555 J DG  14  O6 ? ? I DC  134 J DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog343 hydrog ? ? I DC  134 O2 ? ? ? 1_555 J DG  14  N2 ? ? I DC  134 J DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog344 hydrog ? ? I DC  135 N3 ? ? ? 1_555 J DG  13  N1 ? ? I DC  135 J DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog345 hydrog ? ? I DC  135 N4 ? ? ? 1_555 J DG  13  O6 ? ? I DC  135 J DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog346 hydrog ? ? I DC  135 O2 ? ? ? 1_555 J DG  13  N2 ? ? I DC  135 J DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog347 hydrog ? ? I DG  136 N1 ? ? ? 1_555 J DC  12  N3 ? ? I DG  136 J DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog348 hydrog ? ? I DG  136 N2 ? ? ? 1_555 J DC  12  O2 ? ? I DG  136 J DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog349 hydrog ? ? I DG  136 O6 ? ? ? 1_555 J DC  12  N4 ? ? I DG  136 J DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog350 hydrog ? ? I DG  137 N1 ? ? ? 1_555 J DC  11  N3 ? ? I DG  137 J DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog351 hydrog ? ? I DG  137 N2 ? ? ? 1_555 J DC  11  O2 ? ? I DG  137 J DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog352 hydrog ? ? I DG  137 O6 ? ? ? 1_555 J DC  11  N4 ? ? I DG  137 J DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog353 hydrog ? ? I DG  138 N1 ? ? ? 1_555 J DC  10  N3 ? ? I DG  138 J DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog354 hydrog ? ? I DG  138 N2 ? ? ? 1_555 J DC  10  O2 ? ? I DG  138 J DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog355 hydrog ? ? I DG  138 O6 ? ? ? 1_555 J DC  10  N4 ? ? I DG  138 J DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog356 hydrog ? ? I DA  139 N1 ? ? ? 1_555 J DT  9   N3 ? ? I DA  139 J DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog357 hydrog ? ? I DA  139 N6 ? ? ? 1_555 J DT  9   O4 ? ? I DA  139 J DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog358 hydrog ? ? I DT  140 N3 ? ? ? 1_555 J DA  8   N1 ? ? I DT  140 J DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog359 hydrog ? ? I DT  140 O4 ? ? ? 1_555 J DA  8   N6 ? ? I DT  140 J DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog360 hydrog ? ? I DT  141 N3 ? ? ? 1_555 J DA  7   N1 ? ? I DT  141 J DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog361 hydrog ? ? I DT  141 O4 ? ? ? 1_555 J DA  7   N6 ? ? I DT  141 J DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog362 hydrog ? ? I DC  142 N3 ? ? ? 1_555 J DG  6   N1 ? ? I DC  142 J DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog363 hydrog ? ? I DC  142 N4 ? ? ? 1_555 J DG  6   O6 ? ? I DC  142 J DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog364 hydrog ? ? I DC  142 O2 ? ? ? 1_555 J DG  6   N2 ? ? I DC  142 J DG  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog365 hydrog ? ? I DT  143 N3 ? ? ? 1_555 J DA  5   N1 ? ? I DT  143 J DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog366 hydrog ? ? I DT  143 O4 ? ? ? 1_555 J DA  5   N6 ? ? I DT  143 J DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog367 hydrog ? ? I DC  144 N3 ? ? ? 1_555 J DG  4   N1 ? ? I DC  144 J DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog368 hydrog ? ? I DC  144 N4 ? ? ? 1_555 J DG  4   O6 ? ? I DC  144 J DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog369 hydrog ? ? I DC  144 O2 ? ? ? 1_555 J DG  4   N2 ? ? I DC  144 J DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog370 hydrog ? ? I DG  145 N1 ? ? ? 1_555 J DC  3   N3 ? ? I DG  145 J DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog371 hydrog ? ? I DG  145 N2 ? ? ? 1_555 J DC  3   O2 ? ? I DG  145 J DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog372 hydrog ? ? I DG  145 O6 ? ? ? 1_555 J DC  3   N4 ? ? I DG  145 J DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog373 hydrog ? ? I DT  147 N3 ? ? ? 1_555 J DA  1   N1 ? ? I DT  147 J DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog374 hydrog ? ? I DT  147 O4 ? ? ? 1_555 J DA  1   N6 ? ? I DT  147 J DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 4 ? 
AB3 ? 6 ? 
AB4 ? 4 ? 
AB5 ? 4 ? 
AB6 ? 2 ? 
AB7 ? 4 ? 
AB8 ? 2 ? 
AB9 ? 6 ? 
AC1 ? 4 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA2 1 2 ? parallel      
AA3 1 2 ? parallel      
AA4 1 2 ? parallel      
AA5 1 2 ? parallel      
AA6 1 2 ? parallel      
AA7 1 2 ? parallel      
AA8 1 2 ? parallel      
AA9 1 2 ? parallel      
AB1 1 2 ? parallel      
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? parallel      
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB3 4 5 ? anti-parallel 
AB3 5 6 ? anti-parallel 
AB4 1 2 ? parallel      
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? parallel      
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? parallel      
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AB9 4 5 ? anti-parallel 
AB9 5 6 ? anti-parallel 
AC1 1 2 ? parallel      
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? parallel      
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC5 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 84  ? PHE A 85  ? ARG A 83  PHE A 84  
AA1 2 THR B 82  ? VAL B 83  ? THR B 80  VAL B 81  
AA2 1 THR A 119 ? ILE A 120 ? THR A 118 ILE A 119 
AA2 2 ARG B 47  ? ILE B 48  ? ARG B 45  ILE B 46  
AA3 1 THR B 98  ? TYR B 100 ? THR B 96  TYR B 98  
AA3 2 VAL G 100 ? ILE G 102 ? VAL G 100 ILE G 102 
AA4 1 ARG C 42  ? VAL C 43  ? ARG C 42  VAL C 43  
AA4 2 THR D 87  ? ILE D 88  ? THR D 85  ILE D 86  
AA5 1 ARG C 77  ? ILE C 78  ? ARG C 77  ILE C 78  
AA5 2 GLY D 52  ? ILE D 53  ? GLY D 50  ILE D 51  
AA6 1 VAL C 100 ? ILE C 102 ? VAL C 100 ILE C 102 
AA6 2 THR F 98  ? TYR F 100 ? THR F 96  TYR F 98  
AA7 1 ARG E 84  ? PHE E 85  ? ARG E 83  PHE E 84  
AA7 2 THR F 82  ? VAL F 83  ? THR F 80  VAL F 81  
AA8 1 THR E 119 ? ILE E 120 ? THR E 118 ILE E 119 
AA8 2 ARG F 47  ? ILE F 48  ? ARG F 45  ILE F 46  
AA9 1 ARG G 42  ? VAL G 43  ? ARG G 42  VAL G 43  
AA9 2 THR H 87  ? ILE H 88  ? THR H 85  ILE H 86  
AB1 1 ARG G 77  ? ILE G 78  ? ARG G 77  ILE G 78  
AB1 2 GLY H 52  ? ILE H 53  ? GLY H 50  ILE H 51  
AB2 1 GLN K 23  ? GLN K 26  ? GLN M 25  GLN M 28  
AB2 2 VAL K 38  ? SER K 45  ? VAL M 40  SER M 47  
AB2 3 THR K 98  ? LEU K 103 ? THR M 100 LEU M 105 
AB2 4 ALA K 88  ? ASP K 93  ? ALA M 90  ASP M 95  
AB3 1 GLU K 30  ? VAL K 32  ? GLU M 32  VAL M 34  
AB3 2 THR K 134 ? VAL K 138 ? THR M 136 VAL M 140 
AB3 3 ALA K 112 ? SER K 120 ? ALA M 114 SER M 122 
AB3 4 TYR K 52  ? THR K 60  ? TYR M 54  THR M 62  
AB3 5 GLY K 64  ? TYR K 72  ? GLY M 66  TYR M 74  
AB3 6 GLY K 77  ? TYR K 80  ? GLY M 79  TYR M 82  
AB4 1 GLU K 30  ? VAL K 32  ? GLU M 32  VAL M 34  
AB4 2 THR K 134 ? VAL K 138 ? THR M 136 VAL M 140 
AB4 3 ALA K 112 ? SER K 120 ? ALA M 114 SER M 122 
AB4 4 LEU K 127 ? TRP K 130 ? LEU M 129 TRP M 132 
AB5 1 THR K 161 ? GLN K 162 ? THR M 163 GLN M 164 
AB5 2 VAL K 175 ? LYS K 180 ? VAL M 177 LYS M 182 
AB5 3 PHE K 227 ? ILE K 231 ? PHE M 229 ILE M 233 
AB5 4 PHE K 218 ? GLY K 222 ? PHE M 220 GLY M 224 
AB6 1 SER K 166 ? ALA K 169 ? SER M 168 ALA M 171 
AB6 2 LYS K 259 ? ILE K 262 ? LYS M 261 ILE M 264 
AB7 1 SER K 209 ? LEU K 210 ? SER M 211 LEU M 212 
AB7 2 LYS K 201 ? TYR K 205 ? LYS M 203 TYR M 207 
AB7 3 LEU K 189 ? GLN K 194 ? LEU M 191 GLN M 196 
AB7 4 THR K 241 ? GLN K 246 ? THR M 243 GLN M 248 
AB8 1 GLN L 23  ? LEU L 24  ? GLN N 25  LEU N 26  
AB8 2 ALA L 44  ? SER L 45  ? ALA N 46  SER N 47  
AB9 1 GLU L 30  ? LEU L 31  ? GLU N 32  LEU N 33  
AB9 2 THR L 134 ? THR L 137 ? THR N 136 THR N 139 
AB9 3 VAL L 113 ? SER L 120 ? VAL N 115 SER N 122 
AB9 4 TYR L 52  ? THR L 60  ? TYR N 54  THR N 62  
AB9 5 GLY L 64  ? TYR L 72  ? GLY N 66  TYR N 74  
AB9 6 GLY L 77  ? TYR L 80  ? GLY N 79  TYR N 82  
AC1 1 GLU L 30  ? LEU L 31  ? GLU N 32  LEU N 33  
AC1 2 THR L 134 ? THR L 137 ? THR N 136 THR N 139 
AC1 3 VAL L 113 ? SER L 120 ? VAL N 115 SER N 122 
AC1 4 LEU L 127 ? TRP L 130 ? LEU N 129 TRP N 132 
AC2 1 VAL L 38  ? PRO L 41  ? VAL N 40  PRO N 43  
AC2 2 THR L 98  ? LEU L 103 ? THR N 100 LEU N 105 
AC2 3 ALA L 88  ? ASP L 93  ? ALA N 90  ASP N 95  
AC3 1 THR L 161 ? GLN L 162 ? THR N 163 GLN N 164 
AC3 2 VAL L 175 ? LYS L 180 ? VAL N 177 LYS N 182 
AC3 3 ASP L 226 ? ILE L 231 ? ASP N 228 ILE N 233 
AC3 4 SER L 219 ? SER L 223 ? SER N 221 SER N 225 
AC4 1 SER L 166 ? ALA L 169 ? SER N 168 ALA N 171 
AC4 2 LYS L 259 ? ILE L 262 ? LYS N 261 ILE N 264 
AC5 1 SER L 209 ? LEU L 210 ? SER N 211 LEU N 212 
AC5 2 LYS L 201 ? TYR L 205 ? LYS N 203 TYR N 207 
AC5 3 LEU L 189 ? GLN L 194 ? LEU N 191 GLN N 196 
AC5 4 THR L 241 ? GLN L 246 ? THR N 243 GLN N 248 
AC5 5 THR L 253 ? PHE L 254 ? THR N 255 PHE N 256 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 84  ? N ARG A 83  O VAL B 83  ? O VAL B 81  
AA2 1 2 N ILE A 120 ? N ILE A 119 O ARG B 47  ? O ARG B 45  
AA3 1 2 N THR B 98  ? N THR B 96  O THR G 101 ? O THR G 101 
AA4 1 2 N ARG C 42  ? N ARG C 42  O ILE D 88  ? O ILE D 86  
AA5 1 2 N ILE C 78  ? N ILE C 78  O GLY D 52  ? O GLY D 50  
AA6 1 2 N THR C 101 ? N THR C 101 O THR F 98  ? O THR F 96  
AA7 1 2 N ARG E 84  ? N ARG E 83  O VAL F 83  ? O VAL F 81  
AA8 1 2 N ILE E 120 ? N ILE E 119 O ARG F 47  ? O ARG F 45  
AA9 1 2 N ARG G 42  ? N ARG G 42  O ILE H 88  ? O ILE H 86  
AB1 1 2 N ILE G 78  ? N ILE G 78  O GLY H 52  ? O GLY H 50  
AB2 1 2 N GLN K 23  ? N GLN M 25  O SER K 45  ? O SER M 47  
AB2 2 3 N MET K 40  ? N MET M 42  O MET K 101 ? O MET M 103 
AB2 3 4 O TYR K 100 ? O TYR M 102 N THR K 91  ? N THR M 93  
AB3 1 2 N VAL K 32  ? N VAL M 34  O THR K 137 ? O THR M 139 
AB3 2 3 O VAL K 136 ? O VAL M 138 N ALA K 112 ? N ALA M 114 
AB3 3 4 O TYR K 115 ? O TYR M 117 N VAL K 57  ? N VAL M 59  
AB3 4 5 N TRP K 56  ? N TRP M 58  O ILE K 68  ? O ILE M 70  
AB3 5 6 N TYR K 72  ? N TYR M 74  O GLY K 77  ? O GLY M 79  
AB4 1 2 N VAL K 32  ? N VAL M 34  O THR K 137 ? O THR M 139 
AB4 2 3 O VAL K 136 ? O VAL M 138 N ALA K 112 ? N ALA M 114 
AB4 3 4 N ARG K 118 ? N ARG M 120 O TYR K 129 ? O TYR M 131 
AB5 1 2 N THR K 161 ? N THR M 163 O LYS K 180 ? O LYS M 182 
AB5 2 3 N ILE K 177 ? N ILE M 179 O LEU K 229 ? O LEU M 231 
AB5 3 4 O SER K 228 ? O SER M 230 N SER K 221 ? N SER M 223 
AB6 1 2 N MET K 167 ? N MET M 169 O LYS K 259 ? O LYS M 261 
AB7 1 2 O SER K 209 ? O SER M 211 N TYR K 205 ? N TYR M 207 
AB7 2 3 O LYS K 201 ? O LYS M 203 N GLN K 193 ? N GLN M 195 
AB7 3 4 N SER K 190 ? N SER M 192 O LEU K 245 ? O LEU M 247 
AB8 1 2 N GLN L 23  ? N GLN N 25  O SER L 45  ? O SER N 47  
AB9 1 2 N GLU L 30  ? N GLU N 32  O SER L 135 ? O SER N 137 
AB9 2 3 O THR L 134 ? O THR N 136 N TYR L 114 ? N TYR N 116 
AB9 3 4 O ALA L 117 ? O ALA N 119 N GLN L 55  ? N GLN N 57  
AB9 4 5 N LYS L 58  ? N LYS N 60  O GLU L 66  ? O GLU N 68  
AB9 5 6 N TYR L 70  ? N TYR N 72  O LYS L 79  ? O LYS N 81  
AC1 1 2 N GLU L 30  ? N GLU N 32  O SER L 135 ? O SER N 137 
AC1 2 3 O THR L 134 ? O THR N 136 N TYR L 114 ? N TYR N 116 
AC1 3 4 N ARG L 118 ? N ARG N 120 O TYR L 129 ? O TYR N 131 
AC2 1 2 N MET L 40  ? N MET N 42  O MET L 101 ? O MET N 103 
AC2 2 3 O GLU L 102 ? O GLU N 104 N THR L 89  ? N THR N 91  
AC3 1 2 N THR L 161 ? N THR N 163 O LYS L 180 ? O LYS N 182 
AC3 2 3 N ILE L 177 ? N ILE N 179 O LEU L 229 ? O LEU N 231 
AC3 3 4 O THR L 230 ? O THR N 232 N SER L 219 ? N SER N 221 
AC4 1 2 N MET L 167 ? N MET N 169 O GLU L 261 ? O GLU N 263 
AC5 1 2 O SER L 209 ? O SER N 211 N TYR L 205 ? N TYR N 207 
AC5 2 3 O LEU L 203 ? O LEU N 205 N TRP L 191 ? N TRP N 193 
AC5 3 4 N SER L 190 ? N SER N 192 O LEU L 245 ? O LEU N 247 
AC5 4 5 N GLN L 246 ? N GLN N 248 O THR L 253 ? O THR N 255 
# 
_atom_sites.entry_id                    6DZT 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N     . LYS A 1 38  ? 113.719 96.382  81.117  1.00 74.46  ? 37  LYS A N     1 
ATOM 2     C CA    . LYS A 1 38  ? 114.252 96.548  82.464  1.00 74.46  ? 37  LYS A CA    1 
ATOM 3     C C     . LYS A 1 38  ? 114.443 98.018  82.815  1.00 74.46  ? 37  LYS A C     1 
ATOM 4     O O     . LYS A 1 38  ? 115.326 98.677  82.264  1.00 74.46  ? 37  LYS A O     1 
ATOM 5     C CB    . LYS A 1 38  ? 115.585 95.807  82.614  1.00 74.46  ? 37  LYS A CB    1 
ATOM 6     C CG    . LYS A 1 38  ? 116.177 95.879  84.009  1.00 74.46  ? 37  LYS A CG    1 
ATOM 7     C CD    . LYS A 1 38  ? 115.267 95.216  85.031  1.00 74.46  ? 37  LYS A CD    1 
ATOM 8     C CE    . LYS A 1 38  ? 115.094 93.726  84.751  1.00 74.46  ? 37  LYS A CE    1 
ATOM 9     N NZ    . LYS A 1 38  ? 113.832 93.188  85.336  1.00 74.46  ? 37  LYS A NZ    1 
ATOM 10    N N     . PRO A 1 39  ? 113.612 98.536  83.717  1.00 70.30  ? 38  PRO A N     1 
ATOM 11    C CA    . PRO A 1 39  ? 113.795 99.919  84.165  1.00 70.30  ? 38  PRO A CA    1 
ATOM 12    C C     . PRO A 1 39  ? 115.059 100.057 84.994  1.00 70.30  ? 38  PRO A C     1 
ATOM 13    O O     . PRO A 1 39  ? 115.467 99.137  85.708  1.00 70.30  ? 38  PRO A O     1 
ATOM 14    C CB    . PRO A 1 39  ? 112.541 100.196 85.005  1.00 70.30  ? 38  PRO A CB    1 
ATOM 15    C CG    . PRO A 1 39  ? 111.567 99.122  84.629  1.00 70.30  ? 38  PRO A CG    1 
ATOM 16    C CD    . PRO A 1 39  ? 112.399 97.930  84.292  1.00 70.30  ? 38  PRO A CD    1 
ATOM 17    N N     . HIS A 1 40  ? 115.694 101.218 84.867  1.00 60.93  ? 39  HIS A N     1 
ATOM 18    C CA    . HIS A 1 40  ? 116.919 101.489 85.601  1.00 60.93  ? 39  HIS A CA    1 
ATOM 19    C C     . HIS A 1 40  ? 116.612 101.669 87.078  1.00 60.93  ? 39  HIS A C     1 
ATOM 20    O O     . HIS A 1 40  ? 115.542 102.153 87.453  1.00 60.93  ? 39  HIS A O     1 
ATOM 21    C CB    . HIS A 1 40  ? 117.606 102.734 85.046  1.00 60.93  ? 39  HIS A CB    1 
ATOM 22    C CG    . HIS A 1 40  ? 118.937 103.017 85.666  1.00 60.93  ? 39  HIS A CG    1 
ATOM 23    N ND1   . HIS A 1 40  ? 119.078 103.757 86.819  1.00 60.93  ? 39  HIS A ND1   1 
ATOM 24    C CD2   . HIS A 1 40  ? 120.188 102.657 85.295  1.00 60.93  ? 39  HIS A CD2   1 
ATOM 25    C CE1   . HIS A 1 40  ? 120.357 103.841 87.132  1.00 60.93  ? 39  HIS A CE1   1 
ATOM 26    N NE2   . HIS A 1 40  ? 121.052 103.183 86.223  1.00 60.93  ? 39  HIS A NE2   1 
ATOM 27    N N     . ARG A 1 41  ? 117.556 101.271 87.921  1.00 50.98  ? 40  ARG A N     1 
ATOM 28    C CA    . ARG A 1 41  ? 117.337 101.301 89.355  1.00 50.98  ? 40  ARG A CA    1 
ATOM 29    C C     . ARG A 1 41  ? 118.665 101.467 90.068  1.00 50.98  ? 40  ARG A C     1 
ATOM 30    O O     . ARG A 1 41  ? 119.570 100.652 89.882  1.00 50.98  ? 40  ARG A O     1 
ATOM 31    C CB    . ARG A 1 41  ? 116.646 100.026 89.815  1.00 50.98  ? 40  ARG A CB    1 
ATOM 32    C CG    . ARG A 1 41  ? 116.274 100.067 91.242  1.00 50.98  ? 40  ARG A CG    1 
ATOM 33    C CD    . ARG A 1 41  ? 115.227 99.061  91.570  1.00 50.98  ? 40  ARG A CD    1 
ATOM 34    N NE    . ARG A 1 41  ? 114.753 99.320  92.913  1.00 50.98  ? 40  ARG A NE    1 
ATOM 35    C CZ    . ARG A 1 41  ? 113.684 100.043 93.184  1.00 50.98  ? 40  ARG A CZ    1 
ATOM 36    N NH1   . ARG A 1 41  ? 112.967 100.545 92.197  1.00 50.98  ? 40  ARG A NH1   1 
ATOM 37    N NH2   . ARG A 1 41  ? 113.328 100.249 94.436  1.00 50.98  ? 40  ARG A NH2   1 
ATOM 38    N N     . TYR A 1 42  ? 118.775 102.513 90.877  1.00 51.11  ? 41  TYR A N     1 
ATOM 39    C CA    . TYR A 1 42  ? 119.980 102.744 91.651  1.00 51.11  ? 41  TYR A CA    1 
ATOM 40    C C     . TYR A 1 42  ? 119.993 101.847 92.875  1.00 51.11  ? 41  TYR A C     1 
ATOM 41    O O     . TYR A 1 42  ? 118.948 101.477 93.411  1.00 51.11  ? 41  TYR A O     1 
ATOM 42    C CB    . TYR A 1 42  ? 120.079 104.206 92.076  1.00 51.11  ? 41  TYR A CB    1 
ATOM 43    C CG    . TYR A 1 42  ? 120.579 105.122 90.994  1.00 51.11  ? 41  TYR A CG    1 
ATOM 44    C CD1   . TYR A 1 42  ? 121.875 105.026 90.533  1.00 51.11  ? 41  TYR A CD1   1 
ATOM 45    C CD2   . TYR A 1 42  ? 119.754 106.079 90.429  1.00 51.11  ? 41  TYR A CD2   1 
ATOM 46    C CE1   . TYR A 1 42  ? 122.338 105.853 89.546  1.00 51.11  ? 41  TYR A CE1   1 
ATOM 47    C CE2   . TYR A 1 42  ? 120.207 106.909 89.440  1.00 51.11  ? 41  TYR A CE2   1 
ATOM 48    C CZ    . TYR A 1 42  ? 121.501 106.789 89.005  1.00 51.11  ? 41  TYR A CZ    1 
ATOM 49    O OH    . TYR A 1 42  ? 121.977 107.612 88.019  1.00 51.11  ? 41  TYR A OH    1 
ATOM 50    N N     . ARG A 1 43  ? 121.177 101.492 93.303  1.00 50.02  ? 42  ARG A N     1 
ATOM 51    C CA    . ARG A 1 43  ? 121.314 100.633 94.464  1.00 50.02  ? 42  ARG A CA    1 
ATOM 52    C C     . ARG A 1 43  ? 121.102 101.451 95.735  1.00 50.02  ? 42  ARG A C     1 
ATOM 53    O O     . ARG A 1 43  ? 121.294 102.665 95.714  1.00 50.02  ? 42  ARG A O     1 
ATOM 54    C CB    . ARG A 1 43  ? 122.685 99.971  94.462  1.00 50.02  ? 42  ARG A CB    1 
ATOM 55    C CG    . ARG A 1 43  ? 122.684 98.656  93.720  1.00 50.02  ? 42  ARG A CG    1 
ATOM 56    C CD    . ARG A 1 43  ? 124.078 98.179  93.430  1.00 50.02  ? 42  ARG A CD    1 
ATOM 57    N NE    . ARG A 1 43  ? 124.990 98.465  94.526  1.00 50.02  ? 42  ARG A NE    1 
ATOM 58    C CZ    . ARG A 1 43  ? 126.305 98.573  94.387  1.00 50.02  ? 42  ARG A CZ    1 
ATOM 59    N NH1   . ARG A 1 43  ? 126.860 98.428  93.193  1.00 50.02  ? 42  ARG A NH1   1 
ATOM 60    N NH2   . ARG A 1 43  ? 127.064 98.834  95.438  1.00 50.02  ? 42  ARG A NH2   1 
ATOM 61    N N     . PRO A 1 44  ? 120.656 100.824 96.843  1.00 40.65  ? 43  PRO A N     1 
ATOM 62    C CA    . PRO A 1 44  ? 120.350 101.598 98.054  1.00 40.65  ? 43  PRO A CA    1 
ATOM 63    C C     . PRO A 1 44  ? 121.558 102.251 98.700  1.00 40.65  ? 43  PRO A C     1 
ATOM 64    O O     . PRO A 1 44  ? 122.489 101.579 99.147  1.00 40.65  ? 43  PRO A O     1 
ATOM 65    C CB    . PRO A 1 44  ? 119.727 100.553 98.981  1.00 40.65  ? 43  PRO A CB    1 
ATOM 66    C CG    . PRO A 1 44  ? 119.183 99.549  98.080  1.00 40.65  ? 43  PRO A CG    1 
ATOM 67    C CD    . PRO A 1 44  ? 120.165 99.444  96.972  1.00 40.65  ? 43  PRO A CD    1 
ATOM 68    N N     . GLY A 1 45  ? 121.539 103.574 98.747  1.00 36.17  ? 44  GLY A N     1 
ATOM 69    C CA    . GLY A 1 45  ? 122.654 104.324 99.269  1.00 36.17  ? 44  GLY A CA    1 
ATOM 70    C C     . GLY A 1 45  ? 123.195 105.328 98.280  1.00 36.17  ? 44  GLY A C     1 
ATOM 71    O O     . GLY A 1 45  ? 123.827 106.308 98.670  1.00 36.17  ? 44  GLY A O     1 
ATOM 72    N N     . THR A 1 46  ? 122.948 105.099 96.995  1.00 39.44  ? 45  THR A N     1 
ATOM 73    C CA    . THR A 1 46  ? 123.400 105.987 95.935  1.00 39.44  ? 45  THR A CA    1 
ATOM 74    C C     . THR A 1 46  ? 122.636 107.301 95.920  1.00 39.44  ? 45  THR A C     1 
ATOM 75    O O     . THR A 1 46  ? 123.240 108.378 95.950  1.00 39.44  ? 45  THR A O     1 
ATOM 76    C CB    . THR A 1 46  ? 123.255 105.292 94.582  1.00 39.44  ? 45  THR A CB    1 
ATOM 77    O OG1   . THR A 1 46  ? 124.076 104.126 94.566  1.00 39.44  ? 45  THR A OG1   1 
ATOM 78    C CG2   . THR A 1 46  ? 123.692 106.200 93.469  1.00 39.44  ? 45  THR A CG2   1 
ATOM 79    N N     . VAL A 1 47  ? 121.307 107.222 95.889  1.00 32.92  ? 46  VAL A N     1 
ATOM 80    C CA    . VAL A 1 47  ? 120.474 108.414 95.873  1.00 32.92  ? 46  VAL A CA    1 
ATOM 81    C C     . VAL A 1 47  ? 120.563 109.145 97.198  1.00 32.92  ? 46  VAL A C     1 
ATOM 82    O O     . VAL A 1 47  ? 120.484 110.375 97.236  1.00 32.92  ? 46  VAL A O     1 
ATOM 83    C CB    . VAL A 1 47  ? 119.032 108.021 95.520  1.00 32.92  ? 46  VAL A CB    1 
ATOM 84    C CG1   . VAL A 1 47  ? 118.192 109.230 95.242  1.00 32.92  ? 46  VAL A CG1   1 
ATOM 85    C CG2   . VAL A 1 47  ? 119.042 107.122 94.326  1.00 32.92  ? 46  VAL A CG2   1 
ATOM 86    N N     . ALA A 1 48  ? 120.784 108.416 98.292  1.00 29.48  ? 47  ALA A N     1 
ATOM 87    C CA    . ALA A 1 48  ? 120.938 109.041 99.599  1.00 29.48  ? 47  ALA A CA    1 
ATOM 88    C C     . ALA A 1 48  ? 122.209 109.871 99.674  1.00 29.48  ? 47  ALA A C     1 
ATOM 89    O O     . ALA A 1 48  ? 122.194 110.988 100.189 1.00 29.48  ? 47  ALA A O     1 
ATOM 90    C CB    . ALA A 1 48  ? 120.925 107.979 100.689 1.00 29.48  ? 47  ALA A CB    1 
ATOM 91    N N     . LEU A 1 49  ? 123.317 109.356 99.142  1.00 29.10  ? 48  LEU A N     1 
ATOM 92    C CA    . LEU A 1 49  ? 124.556 110.127 99.109  1.00 29.10  ? 48  LEU A CA    1 
ATOM 93    C C     . LEU A 1 49  ? 124.452 111.296 98.145  1.00 29.10  ? 48  LEU A C     1 
ATOM 94    O O     . LEU A 1 49  ? 125.010 112.371 98.400  1.00 29.10  ? 48  LEU A O     1 
ATOM 95    C CB    . LEU A 1 49  ? 125.719 109.233 98.715  1.00 29.10  ? 48  LEU A CB    1 
ATOM 96    C CG    . LEU A 1 49  ? 126.343 108.356 99.786  1.00 29.10  ? 48  LEU A CG    1 
ATOM 97    C CD1   . LEU A 1 49  ? 127.040 107.216 99.112  1.00 29.10  ? 48  LEU A CD1   1 
ATOM 98    C CD2   . LEU A 1 49  ? 127.319 109.152 100.612 1.00 29.10  ? 48  LEU A CD2   1 
ATOM 99    N N     . ARG A 1 50  ? 123.728 111.104 97.041  1.00 36.70  ? 49  ARG A N     1 
ATOM 100   C CA    . ARG A 1 50  ? 123.459 112.182 96.100  1.00 36.70  ? 49  ARG A CA    1 
ATOM 101   C C     . ARG A 1 50  ? 122.686 113.330 96.725  1.00 36.70  ? 49  ARG A C     1 
ATOM 102   O O     . ARG A 1 50  ? 123.035 114.491 96.506  1.00 36.70  ? 49  ARG A O     1 
ATOM 103   C CB    . ARG A 1 50  ? 122.682 111.639 94.915  1.00 36.70  ? 49  ARG A CB    1 
ATOM 104   C CG    . ARG A 1 50  ? 122.814 112.461 93.686  1.00 36.70  ? 49  ARG A CG    1 
ATOM 105   C CD    . ARG A 1 50  ? 122.543 111.629 92.481  1.00 36.70  ? 49  ARG A CD    1 
ATOM 106   N NE    . ARG A 1 50  ? 121.124 111.354 92.333  1.00 36.70  ? 49  ARG A NE    1 
ATOM 107   C CZ    . ARG A 1 50  ? 120.648 110.208 91.873  1.00 36.70  ? 49  ARG A CZ    1 
ATOM 108   N NH1   . ARG A 1 50  ? 121.492 109.248 91.538  1.00 36.70  ? 49  ARG A NH1   1 
ATOM 109   N NH2   . ARG A 1 50  ? 119.346 110.022 91.757  1.00 36.70  ? 49  ARG A NH2   1 
ATOM 110   N N     . GLU A 1 51  ? 121.667 113.050 97.527  1.00 27.54  ? 50  GLU A N     1 
ATOM 111   C CA    . GLU A 1 51  ? 120.974 114.152 98.168  1.00 27.54  ? 50  GLU A CA    1 
ATOM 112   C C     . GLU A 1 51  ? 121.651 114.639 99.441  1.00 27.54  ? 50  GLU A C     1 
ATOM 113   O O     . GLU A 1 51  ? 121.371 115.760 99.861  1.00 27.54  ? 50  GLU A O     1 
ATOM 114   C CB    . GLU A 1 51  ? 119.512 113.803 98.448  1.00 27.54  ? 50  GLU A CB    1 
ATOM 115   C CG    . GLU A 1 51  ? 119.278 112.573 99.230  1.00 27.54  ? 50  GLU A CG    1 
ATOM 116   C CD    . GLU A 1 51  ? 117.929 111.974 98.931  1.00 27.54  ? 50  GLU A CD    1 
ATOM 117   O OE1   . GLU A 1 51  ? 117.134 112.638 98.243  1.00 27.54  ? 50  GLU A OE1   1 
ATOM 118   O OE2   . GLU A 1 51  ? 117.656 110.845 99.383  1.00 27.54  ? 50  GLU A OE2   1 
ATOM 119   N N     . ILE A 1 52  ? 122.566 113.873 100.036 1.00 22.73  ? 51  ILE A N     1 
ATOM 120   C CA    . ILE A 1 52  ? 123.464 114.462 101.029 1.00 22.73  ? 51  ILE A CA    1 
ATOM 121   C C     . ILE A 1 52  ? 124.301 115.554 100.385 1.00 22.73  ? 51  ILE A C     1 
ATOM 122   O O     . ILE A 1 52  ? 124.386 116.675 100.898 1.00 22.73  ? 51  ILE A O     1 
ATOM 123   C CB    . ILE A 1 52  ? 124.356 113.389 101.677 1.00 22.73  ? 51  ILE A CB    1 
ATOM 124   C CG1   . ILE A 1 52  ? 123.581 112.545 102.666 1.00 22.73  ? 51  ILE A CG1   1 
ATOM 125   C CG2   . ILE A 1 52  ? 125.500 114.015 102.422 1.00 22.73  ? 51  ILE A CG2   1 
ATOM 126   C CD1   . ILE A 1 52  ? 124.308 111.322 103.051 1.00 22.73  ? 51  ILE A CD1   1 
ATOM 127   N N     . ARG A 1 53  ? 124.886 115.261 99.222  1.00 25.92  ? 52  ARG A N     1 
ATOM 128   C CA    . ARG A 1 53  ? 125.660 116.264 98.498  1.00 25.92  ? 52  ARG A CA    1 
ATOM 129   C C     . ARG A 1 53  ? 124.806 117.403 97.967  1.00 25.92  ? 52  ARG A C     1 
ATOM 130   O O     . ARG A 1 53  ? 125.308 118.519 97.832  1.00 25.92  ? 52  ARG A O     1 
ATOM 131   C CB    . ARG A 1 53  ? 126.410 115.613 97.350  1.00 25.92  ? 52  ARG A CB    1 
ATOM 132   C CG    . ARG A 1 53  ? 127.414 114.629 97.824  1.00 25.92  ? 52  ARG A CG    1 
ATOM 133   C CD    . ARG A 1 53  ? 128.334 114.206 96.729  1.00 25.92  ? 52  ARG A CD    1 
ATOM 134   N NE    . ARG A 1 53  ? 129.166 113.100 97.176  1.00 25.92  ? 52  ARG A NE    1 
ATOM 135   C CZ    . ARG A 1 53  ? 128.978 111.838 96.816  1.00 25.92  ? 52  ARG A CZ    1 
ATOM 136   N NH1   . ARG A 1 53  ? 127.992 111.521 95.993  1.00 25.92  ? 52  ARG A NH1   1 
ATOM 137   N NH2   . ARG A 1 53  ? 129.783 110.896 97.277  1.00 25.92  ? 52  ARG A NH2   1 
ATOM 138   N N     . ARG A 1 54  ? 123.544 117.153 97.656  1.00 26.45  ? 53  ARG A N     1 
ATOM 139   C CA    . ARG A 1 54  ? 122.642 118.223 97.264  1.00 26.45  ? 53  ARG A CA    1 
ATOM 140   C C     . ARG A 1 54  ? 122.277 119.152 98.406  1.00 26.45  ? 53  ARG A C     1 
ATOM 141   O O     . ARG A 1 54  ? 122.433 120.363 98.261  1.00 26.45  ? 53  ARG A O     1 
ATOM 142   C CB    . ARG A 1 54  ? 121.360 117.646 96.667  1.00 26.45  ? 53  ARG A CB    1 
ATOM 143   C CG    . ARG A 1 54  ? 120.311 118.673 96.332  1.00 26.45  ? 53  ARG A CG    1 
ATOM 144   C CD    . ARG A 1 54  ? 119.016 118.010 95.913  1.00 26.45  ? 53  ARG A CD    1 
ATOM 145   N NE    . ARG A 1 54  ? 119.284 116.729 95.269  1.00 26.45  ? 53  ARG A NE    1 
ATOM 146   C CZ    . ARG A 1 54  ? 118.356 115.847 94.917  1.00 26.45  ? 53  ARG A CZ    1 
ATOM 147   N NH1   . ARG A 1 54  ? 117.077 116.098 95.143  1.00 26.45  ? 53  ARG A NH1   1 
ATOM 148   N NH2   . ARG A 1 54  ? 118.717 114.711 94.340  1.00 26.45  ? 53  ARG A NH2   1 
ATOM 149   N N     . TYR A 1 55  ? 121.813 118.631 99.536  1.00 20.93  ? 54  TYR A N     1 
ATOM 150   C CA    . TYR A 1 55  ? 121.344 119.473 100.624 1.00 20.93  ? 54  TYR A CA    1 
ATOM 151   C C     . TYR A 1 55  ? 122.464 120.006 101.488 1.00 20.93  ? 54  TYR A C     1 
ATOM 152   O O     . TYR A 1 55  ? 122.218 120.885 102.309 1.00 20.93  ? 54  TYR A O     1 
ATOM 153   C CB    . TYR A 1 55  ? 120.335 118.717 101.483 1.00 20.93  ? 54  TYR A CB    1 
ATOM 154   C CG    . TYR A 1 55  ? 119.082 118.408 100.732 1.00 20.93  ? 54  TYR A CG    1 
ATOM 155   C CD1   . TYR A 1 55  ? 118.325 119.418 100.187 1.00 20.93  ? 54  TYR A CD1   1 
ATOM 156   C CD2   . TYR A 1 55  ? 118.672 117.109 100.543 1.00 20.93  ? 54  TYR A CD2   1 
ATOM 157   C CE1   . TYR A 1 55  ? 117.187 119.142 99.483  1.00 20.93  ? 54  TYR A CE1   1 
ATOM 158   C CE2   . TYR A 1 55  ? 117.544 116.820 99.836  1.00 20.93  ? 54  TYR A CE2   1 
ATOM 159   C CZ    . TYR A 1 55  ? 116.802 117.839 99.312  1.00 20.93  ? 54  TYR A CZ    1 
ATOM 160   O OH    . TYR A 1 55  ? 115.663 117.549 98.610  1.00 20.93  ? 54  TYR A OH    1 
ATOM 161   N N     . GLN A 1 56  ? 123.681 119.514 101.327 1.00 22.51  ? 55  GLN A N     1 
ATOM 162   C CA    . GLN A 1 56  ? 124.831 120.132 101.962 1.00 22.51  ? 55  GLN A CA    1 
ATOM 163   C C     . GLN A 1 56  ? 125.479 121.195 101.095 1.00 22.51  ? 55  GLN A C     1 
ATOM 164   O O     . GLN A 1 56  ? 126.501 121.754 101.486 1.00 22.51  ? 55  GLN A O     1 
ATOM 165   C CB    . GLN A 1 56  ? 125.858 119.077 102.318 1.00 22.51  ? 55  GLN A CB    1 
ATOM 166   C CG    . GLN A 1 56  ? 125.712 118.554 103.697 1.00 22.51  ? 55  GLN A CG    1 
ATOM 167   C CD    . GLN A 1 56  ? 126.692 117.482 103.968 1.00 22.51  ? 55  GLN A CD    1 
ATOM 168   O OE1   . GLN A 1 56  ? 127.391 117.050 103.069 1.00 22.51  ? 55  GLN A OE1   1 
ATOM 169   N NE2   . GLN A 1 56  ? 126.759 117.035 105.203 1.00 22.51  ? 55  GLN A NE2   1 
ATOM 170   N N     . LYS A 1 57  ? 124.914 121.474 99.926  1.00 24.69  ? 56  LYS A N     1 
ATOM 171   C CA    . LYS A 1 57  ? 125.374 122.538 99.052  1.00 24.69  ? 56  LYS A CA    1 
ATOM 172   C C     . LYS A 1 57  ? 124.400 123.700 99.004  1.00 24.69  ? 56  LYS A C     1 
ATOM 173   O O     . LYS A 1 57  ? 124.811 124.831 98.734  1.00 24.69  ? 56  LYS A O     1 
ATOM 174   C CB    . LYS A 1 57  ? 125.588 121.991 97.640  1.00 24.69  ? 56  LYS A CB    1 
ATOM 175   C CG    . LYS A 1 57  ? 126.451 122.840 96.758  1.00 24.69  ? 56  LYS A CG    1 
ATOM 176   C CD    . LYS A 1 57  ? 126.484 122.304 95.350  1.00 24.69  ? 56  LYS A CD    1 
ATOM 177   C CE    . LYS A 1 57  ? 127.421 121.130 95.246  1.00 24.69  ? 56  LYS A CE    1 
ATOM 178   N NZ    . LYS A 1 57  ? 127.705 120.769 93.834  1.00 24.69  ? 56  LYS A NZ    1 
ATOM 179   N N     . SER A 1 58  ? 123.132 123.446 99.283  1.00 23.13  ? 57  SER A N     1 
ATOM 180   C CA    . SER A 1 58  ? 122.098 124.460 99.319  1.00 23.13  ? 57  SER A CA    1 
ATOM 181   C C     . SER A 1 58  ? 122.166 125.233 100.625 1.00 23.13  ? 57  SER A C     1 
ATOM 182   O O     . SER A 1 58  ? 122.799 124.818 101.594 1.00 23.13  ? 57  SER A O     1 
ATOM 183   C CB    . SER A 1 58  ? 120.725 123.817 99.169  1.00 23.13  ? 57  SER A CB    1 
ATOM 184   O OG    . SER A 1 58  ? 120.663 123.043 97.991  1.00 23.13  ? 57  SER A OG    1 
ATOM 185   N N     . THR A 1 59  ? 121.510 126.387 100.635 1.00 22.85  ? 58  THR A N     1 
ATOM 186   C CA    . THR A 1 59  ? 121.346 127.187 101.834 1.00 22.85  ? 58  THR A CA    1 
ATOM 187   C C     . THR A 1 59  ? 119.894 127.373 102.226 1.00 22.85  ? 58  THR A C     1 
ATOM 188   O O     . THR A 1 59  ? 119.629 128.001 103.254 1.00 22.85  ? 58  THR A O     1 
ATOM 189   C CB    . THR A 1 59  ? 121.974 128.577 101.658 1.00 22.85  ? 58  THR A CB    1 
ATOM 190   O OG1   . THR A 1 59  ? 121.106 129.388 100.860 1.00 22.85  ? 58  THR A OG1   1 
ATOM 191   C CG2   . THR A 1 59  ? 123.332 128.493 100.993 1.00 22.85  ? 58  THR A CG2   1 
ATOM 192   N N     . GLU A 1 60  ? 118.959 126.828 101.455 1.00 24.08  ? 59  GLU A N     1 
ATOM 193   C CA    . GLU A 1 60  ? 117.535 127.091 101.592 1.00 24.08  ? 59  GLU A CA    1 
ATOM 194   C C     . GLU A 1 60  ? 116.967 126.498 102.878 1.00 24.08  ? 59  GLU A C     1 
ATOM 195   O O     . GLU A 1 60  ? 117.645 125.797 103.630 1.00 24.08  ? 59  GLU A O     1 
ATOM 196   C CB    . GLU A 1 60  ? 116.796 126.499 100.406 1.00 24.08  ? 59  GLU A CB    1 
ATOM 197   C CG    . GLU A 1 60  ? 117.141 125.044 100.201 1.00 24.08  ? 59  GLU A CG    1 
ATOM 198   C CD    . GLU A 1 60  ? 116.320 124.392 99.116  1.00 24.08  ? 59  GLU A CD    1 
ATOM 199   O OE1   . GLU A 1 60  ? 116.910 123.712 98.250  1.00 24.08  ? 59  GLU A OE1   1 
ATOM 200   O OE2   . GLU A 1 60  ? 115.082 124.563 99.126  1.00 24.08  ? 59  GLU A OE2   1 
ATOM 201   N N     . LEU A 1 61  ? 115.695 126.790 103.126 1.00 22.19  ? 60  LEU A N     1 
ATOM 202   C CA    . LEU A 1 61  ? 114.996 126.209 104.259 1.00 22.19  ? 60  LEU A CA    1 
ATOM 203   C C     . LEU A 1 61  ? 114.323 124.914 103.839 1.00 22.19  ? 60  LEU A C     1 
ATOM 204   O O     . LEU A 1 61  ? 113.672 124.847 102.795 1.00 22.19  ? 60  LEU A O     1 
ATOM 205   C CB    . LEU A 1 61  ? 113.962 127.183 104.816 1.00 22.19  ? 60  LEU A CB    1 
ATOM 206   C CG    . LEU A 1 61  ? 114.487 128.387 105.600 1.00 22.19  ? 60  LEU A CG    1 
ATOM 207   C CD1   . LEU A 1 61  ? 113.341 129.279 106.000 1.00 22.19  ? 60  LEU A CD1   1 
ATOM 208   C CD2   . LEU A 1 61  ? 115.277 127.969 106.819 1.00 22.19  ? 60  LEU A CD2   1 
ATOM 209   N N     . LEU A 1 62  ? 114.471 123.884 104.668 1.00 19.22  ? 61  LEU A N     1 
ATOM 210   C CA    . LEU A 1 62  ? 114.102 122.531 104.284 1.00 19.22  ? 61  LEU A CA    1 
ATOM 211   C C     . LEU A 1 62  ? 112.719 122.108 104.753 1.00 19.22  ? 61  LEU A C     1 
ATOM 212   O O     . LEU A 1 62  ? 112.227 121.071 104.304 1.00 19.22  ? 61  LEU A O     1 
ATOM 213   C CB    . LEU A 1 62  ? 115.142 121.544 104.811 1.00 19.22  ? 61  LEU A CB    1 
ATOM 214   C CG    . LEU A 1 62  ? 116.513 121.717 104.176 1.00 19.22  ? 61  LEU A CG    1 
ATOM 215   C CD1   . LEU A 1 62  ? 117.500 120.836 104.857 1.00 19.22  ? 61  LEU A CD1   1 
ATOM 216   C CD2   . LEU A 1 62  ? 116.461 121.407 102.712 1.00 19.22  ? 61  LEU A CD2   1 
ATOM 217   N N     . ILE A 1 63  ? 112.099 122.858 105.630 1.00 23.39  ? 62  ILE A N     1 
ATOM 218   C CA    . ILE A 1 63  ? 110.714 122.648 106.028 1.00 23.39  ? 62  ILE A CA    1 
ATOM 219   C C     . ILE A 1 63  ? 109.850 123.606 105.228 1.00 23.39  ? 62  ILE A C     1 
ATOM 220   O O     . ILE A 1 63  ? 110.281 124.708 104.892 1.00 23.39  ? 62  ILE A O     1 
ATOM 221   C CB    . ILE A 1 63  ? 110.548 122.853 107.548 1.00 23.39  ? 62  ILE A CB    1 
ATOM 222   C CG1   . ILE A 1 63  ? 111.637 122.109 108.306 1.00 23.39  ? 62  ILE A CG1   1 
ATOM 223   C CG2   . ILE A 1 63  ? 109.202 122.368 108.035 1.00 23.39  ? 62  ILE A CG2   1 
ATOM 224   C CD1   . ILE A 1 63  ? 111.573 122.316 109.789 1.00 23.39  ? 62  ILE A CD1   1 
ATOM 225   N N     . ARG A 1 64  ? 108.638 123.177 104.880 1.00 28.63  ? 63  ARG A N     1 
ATOM 226   C CA    . ARG A 1 64  ? 107.684 124.067 104.240 1.00 28.63  ? 63  ARG A CA    1 
ATOM 227   C C     . ARG A 1 64  ? 107.303 125.197 105.190 1.00 28.63  ? 63  ARG A C     1 
ATOM 228   O O     . ARG A 1 64  ? 107.284 125.036 106.408 1.00 28.63  ? 63  ARG A O     1 
ATOM 229   C CB    . ARG A 1 64  ? 106.429 123.309 103.820 1.00 28.63  ? 63  ARG A CB    1 
ATOM 230   C CG    . ARG A 1 64  ? 106.618 122.131 102.903 1.00 28.63  ? 63  ARG A CG    1 
ATOM 231   C CD    . ARG A 1 64  ? 106.993 122.570 101.523 1.00 28.63  ? 63  ARG A CD    1 
ATOM 232   N NE    . ARG A 1 64  ? 108.398 122.307 101.283 1.00 28.63  ? 63  ARG A NE    1 
ATOM 233   C CZ    . ARG A 1 64  ? 109.129 122.919 100.365 1.00 28.63  ? 63  ARG A CZ    1 
ATOM 234   N NH1   . ARG A 1 64  ? 108.587 123.852 99.595  1.00 28.63  ? 63  ARG A NH1   1 
ATOM 235   N NH2   . ARG A 1 64  ? 110.406 122.598 100.225 1.00 28.63  ? 63  ARG A NH2   1 
ATOM 236   N N     . LYS A 1 65  ? 106.999 126.357 104.618 1.00 28.35  ? 64  LYS A N     1 
ATOM 237   C CA    . LYS A 1 65  ? 106.874 127.566 105.417 1.00 28.35  ? 64  LYS A CA    1 
ATOM 238   C C     . LYS A 1 65  ? 105.544 127.651 106.154 1.00 28.35  ? 64  LYS A C     1 
ATOM 239   O O     . LYS A 1 65  ? 105.515 128.019 107.331 1.00 28.35  ? 64  LYS A O     1 
ATOM 240   C CB    . LYS A 1 65  ? 107.085 128.790 104.532 1.00 28.35  ? 64  LYS A CB    1 
ATOM 241   C CG    . LYS A 1 65  ? 108.536 129.212 104.437 1.00 28.35  ? 64  LYS A CG    1 
ATOM 242   C CD    . LYS A 1 65  ? 108.758 130.210 103.319 1.00 28.35  ? 64  LYS A CD    1 
ATOM 243   C CE    . LYS A 1 65  ? 108.732 129.533 101.947 1.00 28.35  ? 64  LYS A CE    1 
ATOM 244   N NZ    . LYS A 1 65  ? 108.296 130.442 100.844 1.00 28.35  ? 64  LYS A NZ    1 
ATOM 245   N N     . LEU A 1 66  ? 104.445 127.305 105.500 1.00 28.11  ? 65  LEU A N     1 
ATOM 246   C CA    . LEU A 1 66  ? 103.139 127.355 106.146 1.00 28.11  ? 65  LEU A CA    1 
ATOM 247   C C     . LEU A 1 66  ? 102.916 126.311 107.245 1.00 28.11  ? 65  LEU A C     1 
ATOM 248   O O     . LEU A 1 66  ? 102.316 126.672 108.264 1.00 28.11  ? 65  LEU A O     1 
ATOM 249   C CB    . LEU A 1 66  ? 102.021 127.259 105.108 1.00 28.11  ? 65  LEU A CB    1 
ATOM 250   C CG    . LEU A 1 66  ? 101.761 128.419 104.163 1.00 28.11  ? 65  LEU A CG    1 
ATOM 251   C CD1   . LEU A 1 66  ? 100.322 128.346 103.704 1.00 28.11  ? 65  LEU A CD1   1 
ATOM 252   C CD2   . LEU A 1 66  ? 102.047 129.751 104.828 1.00 28.11  ? 65  LEU A CD2   1 
ATOM 253   N N     . PRO A 1 67  ? 103.332 125.036 107.116 1.00 26.51  ? 66  PRO A N     1 
ATOM 254   C CA    . PRO A 1 67  ? 103.257 124.144 108.281 1.00 26.51  ? 66  PRO A CA    1 
ATOM 255   C C     . PRO A 1 67  ? 104.096 124.580 109.465 1.00 26.51  ? 66  PRO A C     1 
ATOM 256   O O     . PRO A 1 67  ? 103.654 124.408 110.609 1.00 26.51  ? 66  PRO A O     1 
ATOM 257   C CB    . PRO A 1 67  ? 103.759 122.815 107.723 1.00 26.51  ? 66  PRO A CB    1 
ATOM 258   C CG    . PRO A 1 67  ? 103.372 122.850 106.368 1.00 26.51  ? 66  PRO A CG    1 
ATOM 259   C CD    . PRO A 1 67  ? 103.631 124.222 105.922 1.00 26.51  ? 66  PRO A CD    1 
ATOM 260   N N     . PHE A 1 68  ? 105.268 125.165 109.235 1.00 21.81  ? 67  PHE A N     1 
ATOM 261   C CA    . PHE A 1 68  ? 106.051 125.678 110.345 1.00 21.81  ? 67  PHE A CA    1 
ATOM 262   C C     . PHE A 1 68  ? 105.395 126.890 110.984 1.00 21.81  ? 67  PHE A C     1 
ATOM 263   O O     . PHE A 1 68  ? 105.451 127.050 112.206 1.00 21.81  ? 67  PHE A O     1 
ATOM 264   C CB    . PHE A 1 68  ? 107.457 126.033 109.892 1.00 21.81  ? 67  PHE A CB    1 
ATOM 265   C CG    . PHE A 1 68  ? 108.404 126.207 111.023 1.00 21.81  ? 67  PHE A CG    1 
ATOM 266   C CD1   . PHE A 1 68  ? 109.029 125.120 111.574 1.00 21.81  ? 67  PHE A CD1   1 
ATOM 267   C CD2   . PHE A 1 68  ? 108.645 127.451 111.556 1.00 21.81  ? 67  PHE A CD2   1 
ATOM 268   C CE1   . PHE A 1 68  ? 109.881 125.270 112.611 1.00 21.81  ? 67  PHE A CE1   1 
ATOM 269   C CE2   . PHE A 1 68  ? 109.483 127.598 112.599 1.00 21.81  ? 67  PHE A CE2   1 
ATOM 270   C CZ    . PHE A 1 68  ? 110.108 126.508 113.126 1.00 21.81  ? 67  PHE A CZ    1 
ATOM 271   N N     . GLN A 1 69  ? 104.781 127.752 110.179 1.00 25.64  ? 68  GLN A N     1 
ATOM 272   C CA    . GLN A 1 69  ? 104.101 128.915 110.730 1.00 25.64  ? 68  GLN A CA    1 
ATOM 273   C C     . GLN A 1 69  ? 102.894 128.509 111.561 1.00 25.64  ? 68  GLN A C     1 
ATOM 274   O O     . GLN A 1 69  ? 102.659 129.069 112.637 1.00 25.64  ? 68  GLN A O     1 
ATOM 275   C CB    . GLN A 1 69  ? 103.694 129.838 109.597 1.00 25.64  ? 68  GLN A CB    1 
ATOM 276   C CG    . GLN A 1 69  ? 102.997 131.072 110.028 1.00 25.64  ? 68  GLN A CG    1 
ATOM 277   C CD    . GLN A 1 69  ? 102.663 131.946 108.864 1.00 25.64  ? 68  GLN A CD    1 
ATOM 278   O OE1   . GLN A 1 69  ? 103.350 131.927 107.849 1.00 25.64  ? 68  GLN A OE1   1 
ATOM 279   N NE2   . GLN A 1 69  ? 101.591 132.712 108.988 1.00 25.64  ? 68  GLN A NE2   1 
ATOM 280   N N     . ARG A 1 70  ? 102.147 127.507 111.098 1.00 27.05  ? 69  ARG A N     1 
ATOM 281   C CA    . ARG A 1 70  ? 101.041 126.976 111.883 1.00 27.05  ? 69  ARG A CA    1 
ATOM 282   C C     . ARG A 1 70  ? 101.515 126.321 113.171 1.00 27.05  ? 69  ARG A C     1 
ATOM 283   O O     . ARG A 1 70  ? 100.854 126.458 114.200 1.00 27.05  ? 69  ARG A O     1 
ATOM 284   C CB    . ARG A 1 70  ? 100.248 125.977 111.058 1.00 27.05  ? 69  ARG A CB    1 
ATOM 285   C CG    . ARG A 1 70  ? 99.368  126.617 110.032 1.00 27.05  ? 69  ARG A CG    1 
ATOM 286   C CD    . ARG A 1 70  ? 98.277  125.680 109.598 1.00 27.05  ? 69  ARG A CD    1 
ATOM 287   N NE    . ARG A 1 70  ? 98.817  124.513 108.920 1.00 27.05  ? 69  ARG A NE    1 
ATOM 288   C CZ    . ARG A 1 70  ? 99.033  124.454 107.617 1.00 27.05  ? 69  ARG A CZ    1 
ATOM 289   N NH1   . ARG A 1 70  ? 98.759  125.493 106.854 1.00 27.05  ? 69  ARG A NH1   1 
ATOM 290   N NH2   . ARG A 1 70  ? 99.527  123.358 107.080 1.00 27.05  ? 69  ARG A NH2   1 
ATOM 291   N N     . LEU A 1 71  ? 102.652 125.624 113.145 1.00 23.61  ? 70  LEU A N     1 
ATOM 292   C CA    . LEU A 1 71  ? 103.167 125.027 114.371 1.00 23.61  ? 70  LEU A CA    1 
ATOM 293   C C     . LEU A 1 71  ? 103.601 126.090 115.374 1.00 23.61  ? 70  LEU A C     1 
ATOM 294   O O     . LEU A 1 71  ? 103.343 125.954 116.574 1.00 23.61  ? 70  LEU A O     1 
ATOM 295   C CB    . LEU A 1 71  ? 104.332 124.097 114.050 1.00 23.61  ? 70  LEU A CB    1 
ATOM 296   C CG    . LEU A 1 71  ? 105.059 123.558 115.275 1.00 23.61  ? 70  LEU A CG    1 
ATOM 297   C CD1   . LEU A 1 71  ? 104.253 122.498 115.954 1.00 23.61  ? 70  LEU A CD1   1 
ATOM 298   C CD2   . LEU A 1 71  ? 106.400 123.060 114.936 1.00 23.61  ? 70  LEU A CD2   1 
ATOM 299   N N     . VAL A 1 72  ? 104.240 127.160 114.897 1.00 22.16  ? 71  VAL A N     1 
ATOM 300   C CA    . VAL A 1 72  ? 104.668 128.252 115.769 1.00 22.16  ? 71  VAL A CA    1 
ATOM 301   C C     . VAL A 1 72  ? 103.468 128.927 116.417 1.00 22.16  ? 71  VAL A C     1 
ATOM 302   O O     . VAL A 1 72  ? 103.451 129.166 117.630 1.00 22.16  ? 71  VAL A O     1 
ATOM 303   C CB    . VAL A 1 72  ? 105.520 129.248 114.964 1.00 22.16  ? 71  VAL A CB    1 
ATOM 304   C CG1   . VAL A 1 72  ? 105.594 130.580 115.637 1.00 22.16  ? 71  VAL A CG1   1 
ATOM 305   C CG2   . VAL A 1 72  ? 106.887 128.708 114.786 1.00 22.16  ? 71  VAL A CG2   1 
ATOM 306   N N     . ARG A 1 73  ? 102.425 129.196 115.631 1.00 25.26  ? 72  ARG A N     1 
ATOM 307   C CA    . ARG A 1 73  ? 101.237 129.838 116.176 1.00 25.26  ? 72  ARG A CA    1 
ATOM 308   C C     . ARG A 1 73  ? 100.426 128.918 117.070 1.00 25.26  ? 72  ARG A C     1 
ATOM 309   O O     . ARG A 1 73  ? 99.739  129.408 117.966 1.00 25.26  ? 72  ARG A O     1 
ATOM 310   C CB    . ARG A 1 73  ? 100.369 130.358 115.047 1.00 25.26  ? 72  ARG A CB    1 
ATOM 311   C CG    . ARG A 1 73  ? 101.033 131.439 114.265 1.00 25.26  ? 72  ARG A CG    1 
ATOM 312   C CD    . ARG A 1 73  ? 100.178 131.895 113.132 1.00 25.26  ? 72  ARG A CD    1 
ATOM 313   N NE    . ARG A 1 73  ? 100.928 132.740 112.221 1.00 25.26  ? 72  ARG A NE    1 
ATOM 314   C CZ    . ARG A 1 73  ? 101.044 134.050 112.357 1.00 25.26  ? 72  ARG A CZ    1 
ATOM 315   N NH1   . ARG A 1 73  ? 100.454 134.664 113.365 1.00 25.26  ? 72  ARG A NH1   1 
ATOM 316   N NH2   . ARG A 1 73  ? 101.747 134.745 111.484 1.00 25.26  ? 72  ARG A NH2   1 
ATOM 317   N N     . GLU A 1 74  ? 100.490 127.605 116.857 1.00 31.34  ? 73  GLU A N     1 
ATOM 318   C CA    . GLU A 1 74  ? 99.853  126.664 117.769 1.00 31.34  ? 73  GLU A CA    1 
ATOM 319   C C     . GLU A 1 74  ? 100.591 126.572 119.095 1.00 31.34  ? 73  GLU A C     1 
ATOM 320   O O     . GLU A 1 74  ? 99.959  126.477 120.150 1.00 31.34  ? 73  GLU A O     1 
ATOM 321   C CB    . GLU A 1 74  ? 99.786  125.284 117.136 1.00 31.34  ? 73  GLU A CB    1 
ATOM 322   C CG    . GLU A 1 74  ? 99.056  124.273 117.974 1.00 31.34  ? 73  GLU A CG    1 
ATOM 323   C CD    . GLU A 1 74  ? 99.151  122.886 117.419 1.00 31.34  ? 73  GLU A CD    1 
ATOM 324   O OE1   . GLU A 1 74  ? 99.831  122.715 116.391 1.00 31.34  ? 73  GLU A OE1   1 
ATOM 325   O OE2   . GLU A 1 74  ? 98.556  121.964 118.013 1.00 31.34  ? 73  GLU A OE2   1 
ATOM 326   N N     . ILE A 1 75  ? 101.925 126.578 119.059 1.00 23.95  ? 74  ILE A N     1 
ATOM 327   C CA    . ILE A 1 75  ? 102.714 126.506 120.284 1.00 23.95  ? 74  ILE A CA    1 
ATOM 328   C C     . ILE A 1 75  ? 102.547 127.776 121.103 1.00 23.95  ? 74  ILE A C     1 
ATOM 329   O O     . ILE A 1 75  ? 102.360 127.722 122.322 1.00 23.95  ? 74  ILE A O     1 
ATOM 330   C CB    . ILE A 1 75  ? 104.190 126.231 119.946 1.00 23.95  ? 74  ILE A CB    1 
ATOM 331   C CG1   . ILE A 1 75  ? 104.362 124.785 119.498 1.00 23.95  ? 74  ILE A CG1   1 
ATOM 332   C CG2   . ILE A 1 75  ? 105.097 126.525 121.123 1.00 23.95  ? 74  ILE A CG2   1 
ATOM 333   C CD1   . ILE A 1 75  ? 105.772 124.383 119.256 1.00 23.95  ? 74  ILE A CD1   1 
ATOM 334   N N     . ALA A 1 76  ? 102.541 128.931 120.449 1.00 27.02  ? 75  ALA A N     1 
ATOM 335   C CA    . ALA A 1 76  ? 102.405 130.190 121.167 1.00 27.02  ? 75  ALA A CA    1 
ATOM 336   C C     . ALA A 1 76  ? 101.011 130.434 121.724 1.00 27.02  ? 75  ALA A C     1 
ATOM 337   O O     . ALA A 1 76  ? 100.836 131.389 122.481 1.00 27.02  ? 75  ALA A O     1 
ATOM 338   C CB    . ALA A 1 76  ? 102.789 131.349 120.259 1.00 27.02  ? 75  ALA A CB    1 
ATOM 339   N N     . GLN A 1 77  ? 100.019 129.610 121.376 1.00 33.13  ? 76  GLN A N     1 
ATOM 340   C CA    . GLN A 1 77  ? 98.683  129.763 121.938 1.00 33.13  ? 76  GLN A CA    1 
ATOM 341   C C     . GLN A 1 77  ? 98.624  129.326 123.390 1.00 33.13  ? 76  GLN A C     1 
ATOM 342   O O     . GLN A 1 77  ? 97.679  129.679 124.101 1.00 33.13  ? 76  GLN A O     1 
ATOM 343   C CB    . GLN A 1 77  ? 97.674  128.957 121.135 1.00 33.13  ? 76  GLN A CB    1 
ATOM 344   C CG    . GLN A 1 77  ? 96.963  129.747 120.073 1.00 33.13  ? 76  GLN A CG    1 
ATOM 345   C CD    . GLN A 1 77  ? 96.217  128.859 119.109 1.00 33.13  ? 76  GLN A CD    1 
ATOM 346   O OE1   . GLN A 1 77  ? 95.863  127.729 119.439 1.00 33.13  ? 76  GLN A OE1   1 
ATOM 347   N NE2   . GLN A 1 77  ? 95.994  129.354 117.900 1.00 33.13  ? 76  GLN A NE2   1 
ATOM 348   N N     . ASP A 1 78  ? 99.602  128.550 123.843 1.00 31.13  ? 77  ASP A N     1 
ATOM 349   C CA    . ASP A 1 78  ? 99.644  128.096 125.221 1.00 31.13  ? 77  ASP A CA    1 
ATOM 350   C C     . ASP A 1 78  ? 100.417 129.032 126.126 1.00 31.13  ? 77  ASP A C     1 
ATOM 351   O O     . ASP A 1 78  ? 100.670 128.680 127.279 1.00 31.13  ? 77  ASP A O     1 
ATOM 352   C CB    . ASP A 1 78  ? 100.256 126.704 125.289 1.00 31.13  ? 77  ASP A CB    1 
ATOM 353   C CG    . ASP A 1 78  ? 99.518  125.704 124.435 1.00 31.13  ? 77  ASP A CG    1 
ATOM 354   O OD1   . ASP A 1 78  ? 98.817  124.842 124.999 1.00 31.13  ? 77  ASP A OD1   1 
ATOM 355   O OD2   . ASP A 1 78  ? 99.640  125.766 123.199 1.00 31.13  ? 77  ASP A OD2   1 
ATOM 356   N N     . PHE A 1 79  ? 100.808 130.196 125.638 1.00 25.70  ? 78  PHE A N     1 
ATOM 357   C CA    . PHE A 1 79  ? 101.540 131.176 126.426 1.00 25.70  ? 78  PHE A CA    1 
ATOM 358   C C     . PHE A 1 79  ? 100.829 132.510 126.505 1.00 25.70  ? 78  PHE A C     1 
ATOM 359   O O     . PHE A 1 79  ? 100.810 133.126 127.569 1.00 25.70  ? 78  PHE A O     1 
ATOM 360   C CB    . PHE A 1 79  ? 102.941 131.372 125.850 1.00 25.70  ? 78  PHE A CB    1 
ATOM 361   C CG    . PHE A 1 79  ? 103.721 130.114 125.762 1.00 25.70  ? 78  PHE A CG    1 
ATOM 362   C CD1   . PHE A 1 79  ? 103.816 129.280 126.850 1.00 25.70  ? 78  PHE A CD1   1 
ATOM 363   C CD2   . PHE A 1 79  ? 104.338 129.750 124.593 1.00 25.70  ? 78  PHE A CD2   1 
ATOM 364   C CE1   . PHE A 1 79  ? 104.517 128.117 126.778 1.00 25.70  ? 78  PHE A CE1   1 
ATOM 365   C CE2   . PHE A 1 79  ? 105.037 128.582 124.518 1.00 25.70  ? 78  PHE A CE2   1 
ATOM 366   C CZ    . PHE A 1 79  ? 105.127 127.767 125.615 1.00 25.70  ? 78  PHE A CZ    1 
ATOM 367   N N     . LYS A 1 80  ? 100.236 132.965 125.409 1.00 31.52  ? 79  LYS A N     1 
ATOM 368   C CA    . LYS A 1 80  ? 99.427  134.169 125.415 1.00 31.52  ? 79  LYS A CA    1 
ATOM 369   C C     . LYS A 1 80  ? 98.451  134.085 124.258 1.00 31.52  ? 79  LYS A C     1 
ATOM 370   O O     . LYS A 1 80  ? 98.855  133.828 123.124 1.00 31.52  ? 79  LYS A O     1 
ATOM 371   C CB    . LYS A 1 80  ? 100.281 135.426 125.294 1.00 31.52  ? 79  LYS A CB    1 
ATOM 372   C CG    . LYS A 1 80  ? 99.498  136.694 125.489 1.00 31.52  ? 79  LYS A CG    1 
ATOM 373   C CD    . LYS A 1 80  ? 100.352 137.913 125.251 1.00 31.52  ? 79  LYS A CD    1 
ATOM 374   C CE    . LYS A 1 80  ? 99.495  139.116 124.922 1.00 31.52  ? 79  LYS A CE    1 
ATOM 375   N NZ    . LYS A 1 80  ? 98.671  138.866 123.715 1.00 31.52  ? 79  LYS A NZ    1 
ATOM 376   N N     . THR A 1 81  ? 97.175  134.293 124.548 1.00 37.23  ? 80  THR A N     1 
ATOM 377   C CA    . THR A 1 81  ? 96.168  134.223 123.512 1.00 37.23  ? 80  THR A CA    1 
ATOM 378   C C     . THR A 1 81  ? 96.149  135.506 122.686 1.00 37.23  ? 80  THR A C     1 
ATOM 379   O O     . THR A 1 81  ? 96.497  136.590 123.162 1.00 37.23  ? 80  THR A O     1 
ATOM 380   C CB    . THR A 1 81  ? 94.792  133.947 124.115 1.00 37.23  ? 80  THR A CB    1 
ATOM 381   O OG1   . THR A 1 81  ? 93.820  133.858 123.067 1.00 37.23  ? 80  THR A OG1   1 
ATOM 382   C CG2   . THR A 1 81  ? 94.391  135.028 125.101 1.00 37.23  ? 80  THR A CG2   1 
ATOM 383   N N     . ASP A 1 82  ? 95.750  135.344 121.423 1.00 41.47  ? 81  ASP A N     1 
ATOM 384   C CA    . ASP A 1 82  ? 95.686  136.394 120.405 1.00 41.47  ? 81  ASP A CA    1 
ATOM 385   C C     . ASP A 1 82  ? 97.029  137.104 120.238 1.00 41.47  ? 81  ASP A C     1 
ATOM 386   O O     . ASP A 1 82  ? 97.174  138.302 120.477 1.00 41.47  ? 81  ASP A O     1 
ATOM 387   C CB    . ASP A 1 82  ? 94.559  137.383 120.704 1.00 41.47  ? 81  ASP A CB    1 
ATOM 388   C CG    . ASP A 1 82  ? 93.256  136.993 120.035 1.00 41.47  ? 81  ASP A CG    1 
ATOM 389   O OD1   . ASP A 1 82  ? 92.238  137.682 120.254 1.00 41.47  ? 81  ASP A OD1   1 
ATOM 390   O OD2   . ASP A 1 82  ? 93.253  135.997 119.282 1.00 41.47  ? 81  ASP A OD2   1 
ATOM 391   N N     . LEU A 1 83  ? 98.018  136.328 119.823 1.00 32.09  ? 82  LEU A N     1 
ATOM 392   C CA    . LEU A 1 83  ? 99.323  136.867 119.495 1.00 32.09  ? 82  LEU A CA    1 
ATOM 393   C C     . LEU A 1 83  ? 99.428  137.090 118.002 1.00 32.09  ? 82  LEU A C     1 
ATOM 394   O O     . LEU A 1 83  ? 98.806  136.382 117.208 1.00 32.09  ? 82  LEU A O     1 
ATOM 395   C CB    . LEU A 1 83  ? 100.433 135.923 119.933 1.00 32.09  ? 82  LEU A CB    1 
ATOM 396   C CG    . LEU A 1 83  ? 100.939 136.046 121.350 1.00 32.09  ? 82  LEU A CG    1 
ATOM 397   C CD1   . LEU A 1 83  ? 101.754 134.837 121.607 1.00 32.09  ? 82  LEU A CD1   1 
ATOM 398   C CD2   . LEU A 1 83  ? 101.767 137.285 121.528 1.00 32.09  ? 82  LEU A CD2   1 
ATOM 399   N N     . ARG A 1 84  ? 100.221 138.074 117.626 1.00 31.21  ? 83  ARG A N     1 
ATOM 400   C CA    . ARG A 1 84  ? 100.584 138.287 116.243 1.00 31.21  ? 83  ARG A CA    1 
ATOM 401   C C     . ARG A 1 84  ? 102.079 138.089 116.098 1.00 31.21  ? 83  ARG A C     1 
ATOM 402   O O     . ARG A 1 84  ? 102.841 138.289 117.041 1.00 31.21  ? 83  ARG A O     1 
ATOM 403   C CB    . ARG A 1 84  ? 100.177 139.675 115.776 1.00 31.21  ? 83  ARG A CB    1 
ATOM 404   C CG    . ARG A 1 84  ? 98.712  139.908 115.927 1.00 31.21  ? 83  ARG A CG    1 
ATOM 405   C CD    . ARG A 1 84  ? 98.387  141.363 115.926 1.00 31.21  ? 83  ARG A CD    1 
ATOM 406   N NE    . ARG A 1 84  ? 98.191  141.897 114.584 1.00 31.21  ? 83  ARG A NE    1 
ATOM 407   C CZ    . ARG A 1 84  ? 97.053  141.815 113.903 1.00 31.21  ? 83  ARG A CZ    1 
ATOM 408   N NH1   . ARG A 1 84  ? 96.000  141.211 114.427 1.00 31.21  ? 83  ARG A NH1   1 
ATOM 409   N NH2   . ARG A 1 84  ? 96.972  142.342 112.693 1.00 31.21  ? 83  ARG A NH2   1 
ATOM 410   N N     . PHE A 1 85  ? 102.482 137.651 114.923 1.00 24.85  ? 84  PHE A N     1 
ATOM 411   C CA    . PHE A 1 85  ? 103.875 137.431 114.610 1.00 24.85  ? 84  PHE A CA    1 
ATOM 412   C C     . PHE A 1 85  ? 104.233 138.269 113.402 1.00 24.85  ? 84  PHE A C     1 
ATOM 413   O O     . PHE A 1 85  ? 103.436 138.413 112.480 1.00 24.85  ? 84  PHE A O     1 
ATOM 414   C CB    . PHE A 1 85  ? 104.156 135.962 114.311 1.00 24.85  ? 84  PHE A CB    1 
ATOM 415   C CG    . PHE A 1 85  ? 104.215 135.094 115.521 1.00 24.85  ? 84  PHE A CG    1 
ATOM 416   C CD1   . PHE A 1 85  ? 105.417 134.819 116.125 1.00 24.85  ? 84  PHE A CD1   1 
ATOM 417   C CD2   . PHE A 1 85  ? 103.069 134.538 116.041 1.00 24.85  ? 84  PHE A CD2   1 
ATOM 418   C CE1   . PHE A 1 85  ? 105.465 134.018 117.235 1.00 24.85  ? 84  PHE A CE1   1 
ATOM 419   C CE2   . PHE A 1 85  ? 103.115 133.741 117.146 1.00 24.85  ? 84  PHE A CE2   1 
ATOM 420   C CZ    . PHE A 1 85  ? 104.309 133.482 117.741 1.00 24.85  ? 84  PHE A CZ    1 
ATOM 421   N N     . GLN A 1 86  ? 105.439 138.812 113.403 1.00 25.89  ? 85  GLN A N     1 
ATOM 422   C CA    . GLN A 1 86  ? 105.925 139.449 112.199 1.00 25.89  ? 85  GLN A CA    1 
ATOM 423   C C     . GLN A 1 86  ? 106.254 138.395 111.149 1.00 25.89  ? 85  GLN A C     1 
ATOM 424   O O     . GLN A 1 86  ? 106.300 137.197 111.422 1.00 25.89  ? 85  GLN A O     1 
ATOM 425   C CB    . GLN A 1 86  ? 107.142 140.302 112.504 1.00 25.89  ? 85  GLN A CB    1 
ATOM 426   C CG    . GLN A 1 86  ? 106.829 141.475 113.364 1.00 25.89  ? 85  GLN A CG    1 
ATOM 427   C CD    . GLN A 1 86  ? 107.963 142.456 113.413 1.00 25.89  ? 85  GLN A CD    1 
ATOM 428   O OE1   . GLN A 1 86  ? 109.123 142.088 113.250 1.00 25.89  ? 85  GLN A OE1   1 
ATOM 429   N NE2   . GLN A 1 86  ? 107.637 143.719 113.639 1.00 25.89  ? 85  GLN A NE2   1 
ATOM 430   N N     . SER A 1 87  ? 106.463 138.849 109.920 1.00 25.01  ? 86  SER A N     1 
ATOM 431   C CA    . SER A 1 87  ? 106.852 137.915 108.880 1.00 25.01  ? 86  SER A CA    1 
ATOM 432   C C     . SER A 1 87  ? 108.268 137.419 109.081 1.00 25.01  ? 86  SER A C     1 
ATOM 433   O O     . SER A 1 87  ? 108.572 136.287 108.701 1.00 25.01  ? 86  SER A O     1 
ATOM 434   C CB    . SER A 1 87  ? 106.714 138.566 107.509 1.00 25.01  ? 86  SER A CB    1 
ATOM 435   O OG    . SER A 1 87  ? 107.886 139.278 107.166 1.00 25.01  ? 86  SER A OG    1 
ATOM 436   N N     . SER A 1 88  ? 109.124 138.233 109.691 1.00 22.82  ? 87  SER A N     1 
ATOM 437   C CA    . SER A 1 88  ? 110.505 137.884 109.964 1.00 22.82  ? 87  SER A CA    1 
ATOM 438   C C     . SER A 1 88  ? 110.689 137.146 111.272 1.00 22.82  ? 87  SER A C     1 
ATOM 439   O O     . SER A 1 88  ? 111.721 136.506 111.451 1.00 22.82  ? 87  SER A O     1 
ATOM 440   C CB    . SER A 1 88  ? 111.368 139.138 109.978 1.00 22.82  ? 87  SER A CB    1 
ATOM 441   O OG    . SER A 1 88  ? 110.704 140.185 110.649 1.00 22.82  ? 87  SER A OG    1 
ATOM 442   N N     . ALA A 1 89  ? 109.713 137.199 112.177 1.00 20.41  ? 88  ALA A N     1 
ATOM 443   C CA    . ALA A 1 89  ? 109.811 136.440 113.416 1.00 20.41  ? 88  ALA A CA    1 
ATOM 444   C C     . ALA A 1 89  ? 109.709 134.948 113.156 1.00 20.41  ? 88  ALA A C     1 
ATOM 445   O O     . ALA A 1 89  ? 110.479 134.158 113.712 1.00 20.41  ? 88  ALA A O     1 
ATOM 446   C CB    . ALA A 1 89  ? 108.724 136.888 114.377 1.00 20.41  ? 88  ALA A CB    1 
ATOM 447   N N     . VAL A 1 90  ? 108.787 134.545 112.283 1.00 21.25  ? 89  VAL A N     1 
ATOM 448   C CA    . VAL A 1 90  ? 108.647 133.138 111.942 1.00 21.25  ? 89  VAL A CA    1 
ATOM 449   C C     . VAL A 1 90  ? 109.797 132.680 111.057 1.00 21.25  ? 89  VAL A C     1 
ATOM 450   O O     . VAL A 1 90  ? 110.213 131.519 111.121 1.00 21.25  ? 89  VAL A O     1 
ATOM 451   C CB    . VAL A 1 90  ? 107.274 132.912 111.294 1.00 21.25  ? 89  VAL A CB    1 
ATOM 452   C CG1   . VAL A 1 90  ? 106.973 131.446 111.170 1.00 21.25  ? 89  VAL A CG1   1 
ATOM 453   C CG2   . VAL A 1 90  ? 106.209 133.584 112.117 1.00 21.25  ? 89  VAL A CG2   1 
ATOM 454   N N     . MET A 1 91  ? 110.385 133.588 110.277 1.00 23.30  ? 90  MET A N     1 
ATOM 455   C CA    . MET A 1 91  ? 111.588 133.251 109.524 1.00 23.30  ? 90  MET A CA    1 
ATOM 456   C C     . MET A 1 91  ? 112.783 133.039 110.443 1.00 23.30  ? 90  MET A C     1 
ATOM 457   O O     . MET A 1 91  ? 113.578 132.123 110.222 1.00 23.30  ? 90  MET A O     1 
ATOM 458   C CB    . MET A 1 91  ? 111.893 134.338 108.506 1.00 23.30  ? 90  MET A CB    1 
ATOM 459   C CG    . MET A 1 91  ? 111.015 134.288 107.281 1.00 23.30  ? 90  MET A CG    1 
ATOM 460   S SD    . MET A 1 91  ? 110.825 132.624 106.613 1.00 23.30  ? 90  MET A SD    1 
ATOM 461   C CE    . MET A 1 91  ? 109.061 132.398 106.790 1.00 23.30  ? 90  MET A CE    1 
ATOM 462   N N     . ALA A 1 92  ? 112.918 133.867 111.480 1.00 19.95  ? 91  ALA A N     1 
ATOM 463   C CA    . ALA A 1 92  ? 113.981 133.685 112.459 1.00 19.95  ? 91  ALA A CA    1 
ATOM 464   C C     . ALA A 1 92  ? 113.809 132.388 113.227 1.00 19.95  ? 91  ALA A C     1 
ATOM 465   O O     . ALA A 1 92  ? 114.790 131.679 113.493 1.00 19.95  ? 91  ALA A O     1 
ATOM 466   C CB    . ALA A 1 92  ? 114.011 134.867 113.419 1.00 19.95  ? 91  ALA A CB    1 
ATOM 467   N N     . LEU A 1 93  ? 112.565 132.051 113.569 1.00 17.67  ? 92  LEU A N     1 
ATOM 468   C CA    . LEU A 1 93  ? 112.292 130.796 114.257 1.00 17.67  ? 92  LEU A CA    1 
ATOM 469   C C     . LEU A 1 93  ? 112.592 129.600 113.372 1.00 17.67  ? 92  LEU A C     1 
ATOM 470   O O     . LEU A 1 93  ? 113.107 128.588 113.851 1.00 17.67  ? 92  LEU A O     1 
ATOM 471   C CB    . LEU A 1 93  ? 110.843 130.759 114.723 1.00 17.67  ? 92  LEU A CB    1 
ATOM 472   C CG    . LEU A 1 93  ? 110.548 131.469 116.032 1.00 17.67  ? 92  LEU A CG    1 
ATOM 473   C CD1   . LEU A 1 93  ? 109.114 131.892 116.090 1.00 17.67  ? 92  LEU A CD1   1 
ATOM 474   C CD2   . LEU A 1 93  ? 110.879 130.579 117.187 1.00 17.67  ? 92  LEU A CD2   1 
ATOM 475   N N     . GLN A 1 94  ? 112.318 129.706 112.071 1.00 19.38  ? 93  GLN A N     1 
ATOM 476   C CA    . GLN A 1 94  ? 112.594 128.592 111.172 1.00 19.38  ? 93  GLN A CA    1 
ATOM 477   C C     . GLN A 1 94  ? 114.081 128.410 110.929 1.00 19.38  ? 93  GLN A C     1 
ATOM 478   O O     . GLN A 1 94  ? 114.559 127.275 110.855 1.00 19.38  ? 93  GLN A O     1 
ATOM 479   C CB    . GLN A 1 94  ? 111.872 128.789 109.855 1.00 19.38  ? 93  GLN A CB    1 
ATOM 480   C CG    . GLN A 1 94  ? 111.853 127.554 109.025 1.00 19.38  ? 93  GLN A CG    1 
ATOM 481   C CD    . GLN A 1 94  ? 110.815 127.608 107.965 1.00 19.38  ? 93  GLN A CD    1 
ATOM 482   O OE1   . GLN A 1 94  ? 109.937 128.461 107.989 1.00 19.38  ? 93  GLN A OE1   1 
ATOM 483   N NE2   . GLN A 1 94  ? 110.901 126.699 107.018 1.00 19.38  ? 93  GLN A NE2   1 
ATOM 484   N N     . GLU A 1 95  ? 114.828 129.511 110.808 1.00 20.51  ? 94  GLU A N     1 
ATOM 485   C CA    . GLU A 1 95  ? 116.273 129.417 110.647 1.00 20.51  ? 94  GLU A CA    1 
ATOM 486   C C     . GLU A 1 95  ? 116.921 128.795 111.872 1.00 20.51  ? 94  GLU A C     1 
ATOM 487   O O     . GLU A 1 95  ? 117.762 127.896 111.754 1.00 20.51  ? 94  GLU A O     1 
ATOM 488   C CB    . GLU A 1 95  ? 116.868 130.794 110.382 1.00 20.51  ? 94  GLU A CB    1 
ATOM 489   C CG    . GLU A 1 95  ? 116.495 131.391 109.049 1.00 20.51  ? 94  GLU A CG    1 
ATOM 490   C CD    . GLU A 1 95  ? 117.293 130.831 107.897 1.00 20.51  ? 94  GLU A CD    1 
ATOM 491   O OE1   . GLU A 1 95  ? 118.376 130.262 108.139 1.00 20.51  ? 94  GLU A OE1   1 
ATOM 492   O OE2   . GLU A 1 95  ? 116.838 130.961 106.743 1.00 20.51  ? 94  GLU A OE2   1 
ATOM 493   N N     . ALA A 1 96  ? 116.498 129.229 113.061 1.00 16.80  ? 95  ALA A N     1 
ATOM 494   C CA    . ALA A 1 96  ? 117.049 128.687 114.295 1.00 16.80  ? 95  ALA A CA    1 
ATOM 495   C C     . ALA A 1 96  ? 116.671 127.228 114.495 1.00 16.80  ? 95  ALA A C     1 
ATOM 496   O O     . ALA A 1 96  ? 117.498 126.425 114.939 1.00 16.80  ? 95  ALA A O     1 
ATOM 497   C CB    . ALA A 1 96  ? 116.560 129.515 115.466 1.00 16.80  ? 95  ALA A CB    1 
ATOM 498   N N     . SER A 1 97  ? 115.434 126.862 114.150 1.00 17.51  ? 96  SER A N     1 
ATOM 499   C CA    . SER A 1 97  ? 114.965 125.498 114.341 1.00 17.51  ? 96  SER A CA    1 
ATOM 500   C C     . SER A 1 97  ? 115.656 124.532 113.400 1.00 17.51  ? 96  SER A C     1 
ATOM 501   O O     . SER A 1 97  ? 116.046 123.434 113.809 1.00 17.51  ? 96  SER A O     1 
ATOM 502   C CB    . SER A 1 97  ? 113.465 125.440 114.128 1.00 17.51  ? 96  SER A CB    1 
ATOM 503   O OG    . SER A 1 97  ? 112.824 126.403 114.926 1.00 17.51  ? 96  SER A OG    1 
ATOM 504   N N     . GLU A 1 98  ? 115.822 124.918 112.138 1.00 20.26  ? 97  GLU A N     1 
ATOM 505   C CA    . GLU A 1 98  ? 116.499 124.035 111.207 1.00 20.26  ? 97  GLU A CA    1 
ATOM 506   C C     . GLU A 1 98  ? 117.985 123.947 111.477 1.00 20.26  ? 97  GLU A C     1 
ATOM 507   O O     . GLU A 1 98  ? 118.572 122.887 111.266 1.00 20.26  ? 97  GLU A O     1 
ATOM 508   C CB    . GLU A 1 98  ? 116.261 124.489 109.786 1.00 20.26  ? 97  GLU A CB    1 
ATOM 509   C CG    . GLU A 1 98  ? 114.858 124.283 109.343 1.00 20.26  ? 97  GLU A CG    1 
ATOM 510   C CD    . GLU A 1 98  ? 114.686 124.629 107.904 1.00 20.26  ? 97  GLU A CD    1 
ATOM 511   O OE1   . GLU A 1 98  ? 115.705 124.647 107.189 1.00 20.26  ? 97  GLU A OE1   1 
ATOM 512   O OE2   . GLU A 1 98  ? 113.544 124.885 107.485 1.00 20.26  ? 97  GLU A OE2   1 
ATOM 513   N N     . ALA A 1 99  ? 118.609 125.025 111.956 1.00 16.38  ? 98  ALA A N     1 
ATOM 514   C CA    . ALA A 1 99  ? 120.005 124.932 112.365 1.00 16.38  ? 98  ALA A CA    1 
ATOM 515   C C     . ALA A 1 99  ? 120.173 124.018 113.565 1.00 16.38  ? 98  ALA A C     1 
ATOM 516   O O     . ALA A 1 99  ? 121.134 123.246 113.631 1.00 16.38  ? 98  ALA A O     1 
ATOM 517   C CB    . ALA A 1 99  ? 120.543 126.314 112.678 1.00 16.38  ? 98  ALA A CB    1 
ATOM 518   N N     . TYR A 1 100 ? 119.224 124.064 114.502 1.00 15.59  ? 99  TYR A N     1 
ATOM 519   C CA    . TYR A 1 100 ? 119.234 123.160 115.646 1.00 15.59  ? 99  TYR A CA    1 
ATOM 520   C C     . TYR A 1 100 ? 119.105 121.708 115.214 1.00 15.59  ? 99  TYR A C     1 
ATOM 521   O O     . TYR A 1 100 ? 119.860 120.844 115.671 1.00 15.59  ? 99  TYR A O     1 
ATOM 522   C CB    . TYR A 1 100 ? 118.103 123.522 116.597 1.00 15.59  ? 99  TYR A CB    1 
ATOM 523   C CG    . TYR A 1 100 ? 117.982 122.584 117.760 1.00 15.59  ? 99  TYR A CG    1 
ATOM 524   C CD1   . TYR A 1 100 ? 118.891 122.628 118.791 1.00 15.59  ? 99  TYR A CD1   1 
ATOM 525   C CD2   . TYR A 1 100 ? 116.960 121.653 117.830 1.00 15.59  ? 99  TYR A CD2   1 
ATOM 526   C CE1   . TYR A 1 100 ? 118.797 121.780 119.850 1.00 15.59  ? 99  TYR A CE1   1 
ATOM 527   C CE2   . TYR A 1 100 ? 116.864 120.796 118.885 1.00 15.59  ? 99  TYR A CE2   1 
ATOM 528   C CZ    . TYR A 1 100 ? 117.785 120.870 119.893 1.00 15.59  ? 99  TYR A CZ    1 
ATOM 529   O OH    . TYR A 1 100 ? 117.698 120.029 120.964 1.00 15.59  ? 99  TYR A OH    1 
ATOM 530   N N     . LEU A 1 101 ? 118.153 121.421 114.326 1.00 14.81  ? 100 LEU A N     1 
ATOM 531   C CA    . LEU A 1 101 ? 117.903 120.039 113.940 1.00 14.81  ? 100 LEU A CA    1 
ATOM 532   C C     . LEU A 1 101 ? 119.018 119.485 113.069 1.00 14.81  ? 100 LEU A C     1 
ATOM 533   O O     . LEU A 1 101 ? 119.385 118.317 113.207 1.00 14.81  ? 100 LEU A O     1 
ATOM 534   C CB    . LEU A 1 101 ? 116.567 119.930 113.229 1.00 14.81  ? 100 LEU A CB    1 
ATOM 535   C CG    . LEU A 1 101 ? 115.359 119.907 114.150 1.00 14.81  ? 100 LEU A CG    1 
ATOM 536   C CD1   . LEU A 1 101 ? 114.122 119.959 113.327 1.00 14.81  ? 100 LEU A CD1   1 
ATOM 537   C CD2   . LEU A 1 101 ? 115.372 118.676 114.994 1.00 14.81  ? 100 LEU A CD2   1 
ATOM 538   N N     . VAL A 1 102 ? 119.590 120.306 112.188 1.00 15.01  ? 101 VAL A N     1 
ATOM 539   C CA    . VAL A 1 102 ? 120.727 119.868 111.388 1.00 15.01  ? 101 VAL A CA    1 
ATOM 540   C C     . VAL A 1 102 ? 121.944 119.612 112.271 1.00 15.01  ? 101 VAL A C     1 
ATOM 541   O O     . VAL A 1 102 ? 122.624 118.590 112.126 1.00 15.01  ? 101 VAL A O     1 
ATOM 542   C CB    . VAL A 1 102 ? 121.009 120.898 110.280 1.00 15.01  ? 101 VAL A CB    1 
ATOM 543   C CG1   . VAL A 1 102 ? 122.373 120.724 109.704 1.00 15.01  ? 101 VAL A CG1   1 
ATOM 544   C CG2   . VAL A 1 102 ? 119.990 120.763 109.189 1.00 15.01  ? 101 VAL A CG2   1 
ATOM 545   N N     . GLY A 1 103 ? 122.205 120.493 113.237 1.00 16.29  ? 102 GLY A N     1 
ATOM 546   C CA    . GLY A 1 103 ? 123.315 120.269 114.141 1.00 16.29  ? 102 GLY A CA    1 
ATOM 547   C C     . GLY A 1 103 ? 123.116 119.124 115.104 1.00 16.29  ? 102 GLY A C     1 
ATOM 548   O O     . GLY A 1 103 ? 124.096 118.603 115.634 1.00 16.29  ? 102 GLY A O     1 
ATOM 549   N N     . LEU A 1 104 ? 121.873 118.726 115.350 1.00 16.20  ? 103 LEU A N     1 
ATOM 550   C CA    . LEU A 1 104 ? 121.625 117.549 116.172 1.00 16.20  ? 103 LEU A CA    1 
ATOM 551   C C     . LEU A 1 104 ? 121.725 116.266 115.364 1.00 16.20  ? 103 LEU A C     1 
ATOM 552   O O     . LEU A 1 104 ? 122.172 115.242 115.884 1.00 16.20  ? 103 LEU A O     1 
ATOM 553   C CB    . LEU A 1 104 ? 120.256 117.653 116.831 1.00 16.20  ? 103 LEU A CB    1 
ATOM 554   C CG    . LEU A 1 104 ? 119.878 116.547 117.805 1.00 16.20  ? 103 LEU A CG    1 
ATOM 555   C CD1   . LEU A 1 104 ? 120.739 116.599 119.030 1.00 16.20  ? 103 LEU A CD1   1 
ATOM 556   C CD2   . LEU A 1 104 ? 118.455 116.693 118.168 1.00 16.20  ? 103 LEU A CD2   1 
ATOM 557   N N     . PHE A 1 105 ? 121.316 116.292 114.098 1.00 15.15  ? 104 PHE A N     1 
ATOM 558   C CA    . PHE A 1 105 ? 121.516 115.131 113.243 1.00 15.15  ? 104 PHE A CA    1 
ATOM 559   C C     . PHE A 1 105 ? 122.983 114.890 112.935 1.00 15.15  ? 104 PHE A C     1 
ATOM 560   O O     . PHE A 1 105 ? 123.377 113.735 112.759 1.00 15.15  ? 104 PHE A O     1 
ATOM 561   C CB    . PHE A 1 105 ? 120.730 115.288 111.951 1.00 15.15  ? 104 PHE A CB    1 
ATOM 562   C CG    . PHE A 1 105 ? 119.291 114.923 112.081 1.00 15.15  ? 104 PHE A CG    1 
ATOM 563   C CD1   . PHE A 1 105 ? 118.923 113.707 112.606 1.00 15.15  ? 104 PHE A CD1   1 
ATOM 564   C CD2   . PHE A 1 105 ? 118.306 115.797 111.682 1.00 15.15  ? 104 PHE A CD2   1 
ATOM 565   C CE1   . PHE A 1 105 ? 117.609 113.379 112.731 1.00 15.15  ? 104 PHE A CE1   1 
ATOM 566   C CE2   . PHE A 1 105 ? 116.991 115.474 111.811 1.00 15.15  ? 104 PHE A CE2   1 
ATOM 567   C CZ    . PHE A 1 105 ? 116.642 114.264 112.328 1.00 15.15  ? 104 PHE A CZ    1 
ATOM 568   N N     . GLU A 1 106 ? 123.803 115.941 112.915 1.00 17.63  ? 105 GLU A N     1 
ATOM 569   C CA    . GLU A 1 106 ? 125.240 115.756 112.747 1.00 17.63  ? 105 GLU A CA    1 
ATOM 570   C C     . GLU A 1 106 ? 125.900 115.054 113.925 1.00 17.63  ? 105 GLU A C     1 
ATOM 571   O O     . GLU A 1 106 ? 126.939 114.422 113.737 1.00 17.63  ? 105 GLU A O     1 
ATOM 572   C CB    . GLU A 1 106 ? 125.919 117.098 112.510 1.00 17.63  ? 105 GLU A CB    1 
ATOM 573   C CG    . GLU A 1 106 ? 125.601 117.661 111.158 1.00 17.63  ? 105 GLU A CG    1 
ATOM 574   C CD    . GLU A 1 106 ? 126.217 119.007 110.887 1.00 17.63  ? 105 GLU A CD    1 
ATOM 575   O OE1   . GLU A 1 106 ? 126.799 119.610 111.813 1.00 17.63  ? 105 GLU A OE1   1 
ATOM 576   O OE2   . GLU A 1 106 ? 126.113 119.463 109.730 1.00 17.63  ? 105 GLU A OE2   1 
ATOM 577   N N     . ASP A 1 107 ? 125.331 115.148 115.123 1.00 20.24  ? 106 ASP A N     1 
ATOM 578   C CA    . ASP A 1 107 ? 125.821 114.445 116.301 1.00 20.24  ? 106 ASP A CA    1 
ATOM 579   C C     . ASP A 1 107 ? 125.210 113.066 116.464 1.00 20.24  ? 106 ASP A C     1 
ATOM 580   O O     . ASP A 1 107 ? 125.885 112.144 116.936 1.00 20.24  ? 106 ASP A O     1 
ATOM 581   C CB    . ASP A 1 107 ? 125.522 115.267 117.550 1.00 20.24  ? 106 ASP A CB    1 
ATOM 582   C CG    . ASP A 1 107 ? 126.420 116.475 117.677 1.00 20.24  ? 106 ASP A CG    1 
ATOM 583   O OD1   . ASP A 1 107 ? 127.520 116.467 117.087 1.00 20.24  ? 106 ASP A OD1   1 
ATOM 584   O OD2   . ASP A 1 107 ? 126.028 117.435 118.372 1.00 20.24  ? 106 ASP A OD2   1 
ATOM 585   N N     . THR A 1 108 ? 123.939 112.934 116.092 1.00 18.34  ? 107 THR A N     1 
ATOM 586   C CA    . THR A 1 108 ? 123.276 111.641 116.002 1.00 18.34  ? 107 THR A CA    1 
ATOM 587   C C     . THR A 1 108 ? 123.998 110.706 115.041 1.00 18.34  ? 107 THR A C     1 
ATOM 588   O O     . THR A 1 108 ? 124.123 109.508 115.311 1.00 18.34  ? 107 THR A O     1 
ATOM 589   C CB    . THR A 1 108 ? 121.841 111.875 115.557 1.00 18.34  ? 107 THR A CB    1 
ATOM 590   O OG1   . THR A 1 108 ? 121.195 112.721 116.504 1.00 18.34  ? 107 THR A OG1   1 
ATOM 591   C CG2   . THR A 1 108 ? 121.083 110.603 115.444 1.00 18.34  ? 107 THR A CG2   1 
ATOM 592   N N     . ASN A 1 109 ? 124.496 111.239 113.923 1.00 17.16  ? 108 ASN A N     1 
ATOM 593   C CA    . ASN A 1 109 ? 125.227 110.416 112.966 1.00 17.16  ? 108 ASN A CA    1 
ATOM 594   C C     . ASN A 1 109 ? 126.535 109.906 113.545 1.00 17.16  ? 108 ASN A C     1 
ATOM 595   O O     . ASN A 1 109 ? 126.929 108.767 113.282 1.00 17.16  ? 108 ASN A O     1 
ATOM 596   C CB    . ASN A 1 109 ? 125.489 111.217 111.699 1.00 17.16  ? 108 ASN A CB    1 
ATOM 597   C CG    . ASN A 1 109 ? 125.724 110.350 110.505 1.00 17.16  ? 108 ASN A CG    1 
ATOM 598   O OD1   . ASN A 1 109 ? 125.154 109.275 110.380 1.00 17.16  ? 108 ASN A OD1   1 
ATOM 599   N ND2   . ASN A 1 109 ? 126.565 110.816 109.608 1.00 17.16  ? 108 ASN A ND2   1 
ATOM 600   N N     . LEU A 1 110 ? 127.214 110.724 114.345 1.00 17.78  ? 109 LEU A N     1 
ATOM 601   C CA    . LEU A 1 110 ? 128.442 110.284 114.992 1.00 17.78  ? 109 LEU A CA    1 
ATOM 602   C C     . LEU A 1 110 ? 128.162 109.232 116.048 1.00 17.78  ? 109 LEU A C     1 
ATOM 603   O O     . LEU A 1 110 ? 128.935 108.285 116.205 1.00 17.78  ? 109 LEU A O     1 
ATOM 604   C CB    . LEU A 1 110 ? 129.156 111.472 115.617 1.00 17.78  ? 109 LEU A CB    1 
ATOM 605   C CG    . LEU A 1 110 ? 129.692 112.570 114.719 1.00 17.78  ? 109 LEU A CG    1 
ATOM 606   C CD1   . LEU A 1 110 ? 129.879 113.796 115.552 1.00 17.78  ? 109 LEU A CD1   1 
ATOM 607   C CD2   . LEU A 1 110 ? 130.998 112.155 114.131 1.00 17.78  ? 109 LEU A CD2   1 
ATOM 608   N N     . CYS A 1 111 ? 127.053 109.373 116.772 1.00 19.60  ? 110 CYS A N     1 
ATOM 609   C CA    . CYS A 1 111 ? 126.673 108.350 117.741 1.00 19.60  ? 110 CYS A CA    1 
ATOM 610   C C     . CYS A 1 111 ? 126.259 107.049 117.069 1.00 19.60  ? 110 CYS A C     1 
ATOM 611   O O     . CYS A 1 111 ? 126.411 105.981 117.660 1.00 19.60  ? 110 CYS A O     1 
ATOM 612   C CB    . CYS A 1 111 ? 125.546 108.859 118.628 1.00 19.60  ? 110 CYS A CB    1 
ATOM 613   S SG    . CYS A 1 111 ? 125.990 110.246 119.660 1.00 19.60  ? 110 CYS A SG    1 
ATOM 614   N N     . ALA A 1 112 ? 125.721 107.113 115.853 1.00 19.75  ? 111 ALA A N     1 
ATOM 615   C CA    . ALA A 1 112 ? 125.383 105.898 115.117 1.00 19.75  ? 111 ALA A CA    1 
ATOM 616   C C     . ALA A 1 112 ? 126.616 105.217 114.560 1.00 19.75  ? 111 ALA A C     1 
ATOM 617   O O     . ALA A 1 112 ? 126.699 103.990 114.552 1.00 19.75  ? 111 ALA A O     1 
ATOM 618   C CB    . ALA A 1 112 ? 124.425 106.219 113.978 1.00 19.75  ? 111 ALA A CB    1 
ATOM 619   N N     . ILE A 1 113 ? 127.570 106.001 114.068 1.00 19.81  ? 112 ILE A N     1 
ATOM 620   C CA    . ILE A 1 113 ? 128.809 105.460 113.526 1.00 19.81  ? 112 ILE A CA    1 
ATOM 621   C C     . ILE A 1 113 ? 129.683 104.890 114.636 1.00 19.81  ? 112 ILE A C     1 
ATOM 622   O O     . ILE A 1 113 ? 130.397 103.902 114.429 1.00 19.81  ? 112 ILE A O     1 
ATOM 623   C CB    . ILE A 1 113 ? 129.488 106.576 112.710 1.00 19.81  ? 112 ILE A CB    1 
ATOM 624   C CG1   . ILE A 1 113 ? 128.793 106.701 111.363 1.00 19.81  ? 112 ILE A CG1   1 
ATOM 625   C CG2   . ILE A 1 113 ? 130.969 106.366 112.512 1.00 19.81  ? 112 ILE A CG2   1 
ATOM 626   C CD1   . ILE A 1 113 ? 129.096 107.962 110.663 1.00 19.81  ? 112 ILE A CD1   1 
ATOM 627   N N     . HIS A 1 114 ? 129.591 105.454 115.840 1.00 19.64  ? 113 HIS A N     1 
ATOM 628   C CA    . HIS A 1 114 ? 130.317 104.933 116.993 1.00 19.64  ? 113 HIS A CA    1 
ATOM 629   C C     . HIS A 1 114 ? 129.849 103.540 117.379 1.00 19.64  ? 113 HIS A C     1 
ATOM 630   O O     . HIS A 1 114 ? 130.649 102.709 117.820 1.00 19.64  ? 113 HIS A O     1 
ATOM 631   C CB    . HIS A 1 114 ? 130.139 105.881 118.165 1.00 19.64  ? 113 HIS A CB    1 
ATOM 632   C CG    . HIS A 1 114 ? 130.932 105.505 119.369 1.00 19.64  ? 113 HIS A CG    1 
ATOM 633   N ND1   . HIS A 1 114 ? 132.304 105.546 119.390 1.00 19.64  ? 113 HIS A ND1   1 
ATOM 634   C CD2   . HIS A 1 114 ? 130.547 105.093 120.597 1.00 19.64  ? 113 HIS A CD2   1 
ATOM 635   C CE1   . HIS A 1 114 ? 132.732 105.169 120.577 1.00 19.64  ? 113 HIS A CE1   1 
ATOM 636   N NE2   . HIS A 1 114 ? 131.687 104.886 121.327 1.00 19.64  ? 113 HIS A NE2   1 
ATOM 637   N N     . ALA A 1 115 ? 128.567 103.259 117.207 1.00 19.73  ? 114 ALA A N     1 
ATOM 638   C CA    . ALA A 1 115 ? 127.998 101.956 117.495 1.00 19.73  ? 114 ALA A CA    1 
ATOM 639   C C     . ALA A 1 115 ? 128.139 100.988 116.343 1.00 19.73  ? 114 ALA A C     1 
ATOM 640   O O     . ALA A 1 115 ? 127.503 99.932  116.383 1.00 19.73  ? 114 ALA A O     1 
ATOM 641   C CB    . ALA A 1 115 ? 126.529 102.104 117.874 1.00 19.73  ? 114 ALA A CB    1 
ATOM 642   N N     . LYS A 1 116 ? 128.960 101.344 115.349 1.00 22.76  ? 115 LYS A N     1 
ATOM 643   C CA    . LYS A 1 116 ? 129.215 100.568 114.135 1.00 22.76  ? 115 LYS A CA    1 
ATOM 644   C C     . LYS A 1 116 ? 127.929 100.298 113.361 1.00 22.76  ? 115 LYS A C     1 
ATOM 645   O O     . LYS A 1 116 ? 127.603 99.163  113.022 1.00 22.76  ? 115 LYS A O     1 
ATOM 646   C CB    . LYS A 1 116 ? 129.966 99.277  114.450 1.00 22.76  ? 115 LYS A CB    1 
ATOM 647   C CG    . LYS A 1 116 ? 131.374 99.523  114.953 1.00 22.76  ? 115 LYS A CG    1 
ATOM 648   C CD    . LYS A 1 116 ? 132.025 98.245  115.405 1.00 22.76  ? 115 LYS A CD    1 
ATOM 649   C CE    . LYS A 1 116 ? 131.285 97.646  116.583 1.00 22.76  ? 115 LYS A CE    1 
ATOM 650   N NZ    . LYS A 1 116 ? 131.286 98.550  117.765 1.00 22.76  ? 115 LYS A NZ    1 
ATOM 651   N N     . ARG A 1 117 ? 127.204 101.374 113.072 1.00 22.35  ? 116 ARG A N     1 
ATOM 652   C CA    . ARG A 1 117 ? 126.007 101.354 112.257 1.00 22.35  ? 116 ARG A CA    1 
ATOM 653   C C     . ARG A 1 117 ? 126.121 102.426 111.190 1.00 22.35  ? 116 ARG A C     1 
ATOM 654   O O     . ARG A 1 117 ? 127.070 103.205 111.159 1.00 22.35  ? 116 ARG A O     1 
ATOM 655   C CB    . ARG A 1 117 ? 124.753 101.601 113.090 1.00 22.35  ? 116 ARG A CB    1 
ATOM 656   C CG    . ARG A 1 117 ? 124.233 100.408 113.824 1.00 22.35  ? 116 ARG A CG    1 
ATOM 657   C CD    . ARG A 1 117 ? 122.959 100.756 114.535 1.00 22.35  ? 116 ARG A CD    1 
ATOM 658   N NE    . ARG A 1 117 ? 123.219 101.296 115.862 1.00 22.35  ? 116 ARG A NE    1 
ATOM 659   C CZ    . ARG A 1 117 ? 122.925 102.534 116.234 1.00 22.35  ? 116 ARG A CZ    1 
ATOM 660   N NH1   . ARG A 1 117 ? 122.358 103.365 115.381 1.00 22.35  ? 116 ARG A NH1   1 
ATOM 661   N NH2   . ARG A 1 117 ? 123.198 102.940 117.456 1.00 22.35  ? 116 ARG A NH2   1 
ATOM 662   N N     . VAL A 1 118 ? 125.148 102.439 110.287 1.00 25.66  ? 117 VAL A N     1 
ATOM 663   C CA    . VAL A 1 118 ? 124.932 103.571 109.398 1.00 25.66  ? 117 VAL A CA    1 
ATOM 664   C C     . VAL A 1 118 ? 123.506 104.089 109.463 1.00 25.66  ? 117 VAL A C     1 
ATOM 665   O O     . VAL A 1 118 ? 123.213 105.131 108.860 1.00 25.66  ? 117 VAL A O     1 
ATOM 666   C CB    . VAL A 1 118 ? 125.305 103.229 107.941 1.00 25.66  ? 117 VAL A CB    1 
ATOM 667   C CG1   . VAL A 1 118 ? 126.793 103.096 107.791 1.00 25.66  ? 117 VAL A CG1   1 
ATOM 668   C CG2   . VAL A 1 118 ? 124.630 101.966 107.503 1.00 25.66  ? 117 VAL A CG2   1 
ATOM 669   N N     . THR A 1 119 ? 122.613 103.402 110.161 1.00 24.40  ? 118 THR A N     1 
ATOM 670   C CA    . THR A 1 119 ? 121.274 103.894 110.428 1.00 24.40  ? 118 THR A CA    1 
ATOM 671   C C     . THR A 1 119 ? 121.297 104.708 111.709 1.00 24.40  ? 118 THR A C     1 
ATOM 672   O O     . THR A 1 119 ? 121.956 104.323 112.677 1.00 24.40  ? 118 THR A O     1 
ATOM 673   C CB    . THR A 1 119 ? 120.316 102.718 110.572 1.00 24.40  ? 118 THR A CB    1 
ATOM 674   O OG1   . THR A 1 119 ? 120.611 101.751 109.565 1.00 24.40  ? 118 THR A OG1   1 
ATOM 675   C CG2   . THR A 1 119 ? 118.895 103.151 110.415 1.00 24.40  ? 118 THR A CG2   1 
ATOM 676   N N     . ILE A 1 120 ? 120.603 105.838 111.719 1.00 21.04  ? 119 ILE A N     1 
ATOM 677   C CA    . ILE A 1 120 ? 120.422 106.571 112.964 1.00 21.04  ? 119 ILE A CA    1 
ATOM 678   C C     . ILE A 1 120 ? 119.157 106.071 113.633 1.00 21.04  ? 119 ILE A C     1 
ATOM 679   O O     . ILE A 1 120 ? 118.211 105.661 112.966 1.00 21.04  ? 119 ILE A O     1 
ATOM 680   C CB    . ILE A 1 120 ? 120.383 108.091 112.727 1.00 21.04  ? 119 ILE A CB    1 
ATOM 681   C CG1   . ILE A 1 120 ? 119.264 108.479 111.762 1.00 21.04  ? 119 ILE A CG1   1 
ATOM 682   C CG2   . ILE A 1 120 ? 121.723 108.575 112.243 1.00 21.04  ? 119 ILE A CG2   1 
ATOM 683   C CD1   . ILE A 1 120 ? 118.875 109.926 111.821 1.00 21.04  ? 119 ILE A CD1   1 
ATOM 684   N N     . MET A 1 121 ? 119.143 106.083 114.954 1.00 24.66  ? 120 MET A N     1 
ATOM 685   C CA    . MET A 1 121 ? 118.071 105.521 115.760 1.00 24.66  ? 120 MET A CA    1 
ATOM 686   C C     . MET A 1 121 ? 117.709 106.476 116.882 1.00 24.66  ? 120 MET A C     1 
ATOM 687   O O     . MET A 1 121 ? 118.465 107.407 117.190 1.00 24.66  ? 120 MET A O     1 
ATOM 688   C CB    . MET A 1 121 ? 118.508 104.154 116.308 1.00 24.66  ? 120 MET A CB    1 
ATOM 689   C CG    . MET A 1 121 ? 118.242 103.042 115.333 1.00 24.66  ? 120 MET A CG    1 
ATOM 690   S SD    . MET A 1 121 ? 119.258 101.592 115.576 1.00 24.66  ? 120 MET A SD    1 
ATOM 691   C CE    . MET A 1 121 ? 119.201 100.931 113.922 1.00 24.66  ? 120 MET A CE    1 
ATOM 692   N N     . PRO A 1 122 ? 116.517 106.319 117.473 1.00 21.82  ? 121 PRO A N     1 
ATOM 693   C CA    . PRO A 1 122 ? 116.148 107.171 118.610 1.00 21.82  ? 121 PRO A CA    1 
ATOM 694   C C     . PRO A 1 122 ? 117.078 107.073 119.802 1.00 21.82  ? 121 PRO A C     1 
ATOM 695   O O     . PRO A 1 122 ? 117.215 108.057 120.534 1.00 21.82  ? 121 PRO A O     1 
ATOM 696   C CB    . PRO A 1 122 ? 114.742 106.678 118.949 1.00 21.82  ? 121 PRO A CB    1 
ATOM 697   C CG    . PRO A 1 122 ? 114.205 106.269 117.671 1.00 21.82  ? 121 PRO A CG    1 
ATOM 698   C CD    . PRO A 1 122 ? 115.325 105.650 116.922 1.00 21.82  ? 121 PRO A CD    1 
ATOM 699   N N     . LYS A 1 123 ? 117.760 105.945 119.997 1.00 22.74  ? 122 LYS A N     1 
ATOM 700   C CA    . LYS A 1 123 ? 118.766 105.887 121.048 1.00 22.74  ? 122 LYS A CA    1 
ATOM 701   C C     . LYS A 1 123 ? 119.992 106.721 120.698 1.00 22.74  ? 122 LYS A C     1 
ATOM 702   O O     . LYS A 1 123 ? 120.635 107.266 121.597 1.00 22.74  ? 122 LYS A O     1 
ATOM 703   C CB    . LYS A 1 123 ? 119.144 104.439 121.343 1.00 22.74  ? 122 LYS A CB    1 
ATOM 704   C CG    . LYS A 1 123 ? 119.785 103.666 120.215 1.00 22.74  ? 122 LYS A CG    1 
ATOM 705   C CD    . LYS A 1 123 ? 120.698 102.592 120.782 1.00 22.74  ? 122 LYS A CD    1 
ATOM 706   C CE    . LYS A 1 123 ? 121.062 101.548 119.754 1.00 22.74  ? 122 LYS A CE    1 
ATOM 707   N NZ    . LYS A 1 123 ? 120.074 100.437 119.679 1.00 22.74  ? 122 LYS A NZ    1 
ATOM 708   N N     . ASP A 1 124 ? 120.291 106.889 119.405 1.00 22.95  ? 123 ASP A N     1 
ATOM 709   C CA    . ASP A 1 124 ? 121.358 107.798 119.001 1.00 22.95  ? 123 ASP A CA    1 
ATOM 710   C C     . ASP A 1 124 ? 120.972 109.242 119.252 1.00 22.95  ? 123 ASP A C     1 
ATOM 711   O O     . ASP A 1 124 ? 121.808 110.039 119.696 1.00 22.95  ? 123 ASP A O     1 
ATOM 712   C CB    . ASP A 1 124 ? 121.704 107.621 117.526 1.00 22.95  ? 123 ASP A CB    1 
ATOM 713   C CG    . ASP A 1 124 ? 121.966 106.198 117.147 1.00 22.95  ? 123 ASP A CG    1 
ATOM 714   O OD1   . ASP A 1 124 ? 122.776 105.533 117.805 1.00 22.95  ? 123 ASP A OD1   1 
ATOM 715   O OD2   . ASP A 1 124 ? 121.376 105.735 116.163 1.00 22.95  ? 123 ASP A OD2   1 
ATOM 716   N N     . ILE A 1 125 ? 119.715 109.601 118.957 1.00 21.33  ? 124 ILE A N     1 
ATOM 717   C CA    . ILE A 1 125 ? 119.253 110.964 119.231 1.00 21.33  ? 124 ILE A CA    1 
ATOM 718   C C     . ILE A 1 125 ? 119.284 111.248 120.725 1.00 21.33  ? 124 ILE A C     1 
ATOM 719   O O     . ILE A 1 125 ? 119.743 112.311 121.158 1.00 21.33  ? 124 ILE A O     1 
ATOM 720   C CB    . ILE A 1 125 ? 117.849 111.207 118.644 1.00 21.33  ? 124 ILE A CB    1 
ATOM 721   C CG1   . ILE A 1 125 ? 117.907 111.291 117.127 1.00 21.33  ? 124 ILE A CG1   1 
ATOM 722   C CG2   . ILE A 1 125 ? 117.246 112.496 119.183 1.00 21.33  ? 124 ILE A CG2   1 
ATOM 723   C CD1   . ILE A 1 125 ? 116.660 111.831 116.477 1.00 21.33  ? 124 ILE A CD1   1 
ATOM 724   N N     . GLN A 1 126 ? 118.865 110.277 121.535 1.00 22.67  ? 125 GLN A N     1 
ATOM 725   C CA    . GLN A 1 126 ? 118.849 110.460 122.979 1.00 22.67  ? 125 GLN A CA    1 
ATOM 726   C C     . GLN A 1 126 ? 120.254 110.536 123.564 1.00 22.67  ? 125 GLN A C     1 
ATOM 727   O O     . GLN A 1 126 ? 120.495 111.313 124.495 1.00 22.67  ? 125 GLN A O     1 
ATOM 728   C CB    . GLN A 1 126 ? 118.057 109.334 123.624 1.00 22.67  ? 125 GLN A CB    1 
ATOM 729   C CG    . GLN A 1 126 ? 116.566 109.462 123.434 1.00 22.67  ? 125 GLN A CG    1 
ATOM 730   C CD    . GLN A 1 126 ? 115.869 108.137 123.544 1.00 22.67  ? 125 GLN A CD    1 
ATOM 731   O OE1   . GLN A 1 126 ? 116.329 107.245 124.251 1.00 22.67  ? 125 GLN A OE1   1 
ATOM 732   N NE2   . GLN A 1 126 ? 114.758 107.989 122.838 1.00 22.67  ? 125 GLN A NE2   1 
ATOM 733   N N     . LEU A 1 127 ? 121.199 109.771 123.013 1.00 19.56  ? 126 LEU A N     1 
ATOM 734   C CA    . LEU A 1 127 ? 122.577 109.847 123.482 1.00 19.56  ? 126 LEU A CA    1 
ATOM 735   C C     . LEU A 1 127 ? 123.198 111.191 123.150 1.00 19.56  ? 126 LEU A C     1 
ATOM 736   O O     . LEU A 1 127 ? 123.865 111.800 123.995 1.00 19.56  ? 126 LEU A O     1 
ATOM 737   C CB    . LEU A 1 127 ? 123.411 108.726 122.876 1.00 19.56  ? 126 LEU A CB    1 
ATOM 738   C CG    . LEU A 1 127 ? 124.788 108.680 123.526 1.00 19.56  ? 126 LEU A CG    1 
ATOM 739   C CD1   . LEU A 1 127 ? 124.673 108.015 124.859 1.00 19.56  ? 126 LEU A CD1   1 
ATOM 740   C CD2   . LEU A 1 127 ? 125.809 107.994 122.670 1.00 19.56  ? 126 LEU A CD2   1 
ATOM 741   N N     . ALA A 1 128 ? 122.986 111.672 121.922 1.00 20.72  ? 127 ALA A N     1 
ATOM 742   C CA    . ALA A 1 128 ? 123.521 112.970 121.536 1.00 20.72  ? 127 ALA A CA    1 
ATOM 743   C C     . ALA A 1 128 ? 122.925 114.090 122.367 1.00 20.72  ? 127 ALA A C     1 
ATOM 744   O O     . ALA A 1 128 ? 123.655 114.972 122.826 1.00 20.72  ? 127 ALA A O     1 
ATOM 745   C CB    . ALA A 1 128 ? 123.265 113.220 120.058 1.00 20.72  ? 127 ALA A CB    1 
ATOM 746   N N     . ARG A 1 129 ? 121.623 114.032 122.633 1.00 20.71  ? 128 ARG A N     1 
ATOM 747   C CA    . ARG A 1 129 ? 120.950 115.058 123.407 1.00 20.71  ? 128 ARG A CA    1 
ATOM 748   C C     . ARG A 1 129 ? 121.305 115.051 124.879 1.00 20.71  ? 128 ARG A C     1 
ATOM 749   O O     . ARG A 1 129 ? 121.288 116.113 125.497 1.00 20.71  ? 128 ARG A O     1 
ATOM 750   C CB    . ARG A 1 129 ? 119.446 114.908 123.279 1.00 20.71  ? 128 ARG A CB    1 
ATOM 751   C CG    . ARG A 1 129 ? 118.869 115.605 122.101 1.00 20.71  ? 128 ARG A CG    1 
ATOM 752   C CD    . ARG A 1 129 ? 117.397 115.725 122.255 1.00 20.71  ? 128 ARG A CD    1 
ATOM 753   N NE    . ARG A 1 129 ? 117.030 116.917 122.993 1.00 20.71  ? 128 ARG A NE    1 
ATOM 754   C CZ    . ARG A 1 129 ? 115.885 117.057 123.645 1.00 20.71  ? 128 ARG A CZ    1 
ATOM 755   N NH1   . ARG A 1 129 ? 115.001 116.075 123.656 1.00 20.71  ? 128 ARG A NH1   1 
ATOM 756   N NH2   . ARG A 1 129 ? 115.621 118.180 124.285 1.00 20.71  ? 128 ARG A NH2   1 
ATOM 757   N N     . ARG A 1 130 ? 121.608 113.902 125.471 1.00 24.43  ? 129 ARG A N     1 
ATOM 758   C CA    . ARG A 1 130 ? 122.013 113.931 126.866 1.00 24.43  ? 129 ARG A CA    1 
ATOM 759   C C     . ARG A 1 130 ? 123.511 114.093 127.059 1.00 24.43  ? 129 ARG A C     1 
ATOM 760   O O     . ARG A 1 130 ? 123.945 114.346 128.183 1.00 24.43  ? 129 ARG A O     1 
ATOM 761   C CB    . ARG A 1 130 ? 121.537 112.684 127.600 1.00 24.43  ? 129 ARG A CB    1 
ATOM 762   C CG    . ARG A 1 130 ? 122.428 111.508 127.499 1.00 24.43  ? 129 ARG A CG    1 
ATOM 763   C CD    . ARG A 1 130 ? 122.003 110.468 128.503 1.00 24.43  ? 129 ARG A CD    1 
ATOM 764   N NE    . ARG A 1 130 ? 122.302 110.869 129.873 1.00 24.43  ? 129 ARG A NE    1 
ATOM 765   C CZ    . ARG A 1 130 ? 122.094 110.097 130.936 1.00 24.43  ? 129 ARG A CZ    1 
ATOM 766   N NH1   . ARG A 1 130 ? 121.587 108.881 130.789 1.00 24.43  ? 129 ARG A NH1   1 
ATOM 767   N NH2   . ARG A 1 130 ? 122.403 110.535 132.147 1.00 24.43  ? 129 ARG A NH2   1 
ATOM 768   N N     . ILE A 1 131 ? 124.316 113.960 126.012 1.00 20.14  ? 130 ILE A N     1 
ATOM 769   C CA    . ILE A 1 131 ? 125.697 114.399 126.140 1.00 20.14  ? 130 ILE A CA    1 
ATOM 770   C C     . ILE A 1 131 ? 125.792 115.902 125.919 1.00 20.14  ? 130 ILE A C     1 
ATOM 771   O O     . ILE A 1 131 ? 126.567 116.592 126.586 1.00 20.14  ? 130 ILE A O     1 
ATOM 772   C CB    . ILE A 1 131 ? 126.595 113.598 125.184 1.00 20.14  ? 130 ILE A CB    1 
ATOM 773   C CG1   . ILE A 1 131 ? 126.665 112.156 125.645 1.00 20.14  ? 130 ILE A CG1   1 
ATOM 774   C CG2   . ILE A 1 131 ? 127.998 114.105 125.170 1.00 20.14  ? 130 ILE A CG2   1 
ATOM 775   C CD1   . ILE A 1 131 ? 127.282 111.270 124.639 1.00 20.14  ? 130 ILE A CD1   1 
ATOM 776   N N     . ARG A 1 132 ? 124.962 116.448 125.031 1.00 19.66  ? 131 ARG A N     1 
ATOM 777   C CA    . ARG A 1 132 ? 124.877 117.893 124.871 1.00 19.66  ? 131 ARG A CA    1 
ATOM 778   C C     . ARG A 1 132 ? 124.269 118.601 126.073 1.00 19.66  ? 131 ARG A C     1 
ATOM 779   O O     . ARG A 1 132 ? 124.444 119.813 126.201 1.00 19.66  ? 131 ARG A O     1 
ATOM 780   C CB    . ARG A 1 132 ? 124.063 118.238 123.631 1.00 19.66  ? 131 ARG A CB    1 
ATOM 781   C CG    . ARG A 1 132 ? 124.851 118.230 122.362 1.00 19.66  ? 131 ARG A CG    1 
ATOM 782   C CD    . ARG A 1 132 ? 123.998 117.797 121.195 1.00 19.66  ? 131 ARG A CD    1 
ATOM 783   N NE    . ARG A 1 132 ? 123.130 118.839 120.675 1.00 19.66  ? 131 ARG A NE    1 
ATOM 784   C CZ    . ARG A 1 132 ? 123.386 119.515 119.564 1.00 19.66  ? 131 ARG A CZ    1 
ATOM 785   N NH1   . ARG A 1 132 ? 124.484 119.252 118.880 1.00 19.66  ? 131 ARG A NH1   1 
ATOM 786   N NH2   . ARG A 1 132 ? 122.550 120.449 119.138 1.00 19.66  ? 131 ARG A NH2   1 
ATOM 787   N N     . GLY A 1 133 ? 123.563 117.899 126.948 1.00 23.70  ? 132 GLY A N     1 
ATOM 788   C CA    . GLY A 1 133 ? 122.987 118.533 128.116 1.00 23.70  ? 132 GLY A CA    1 
ATOM 789   C C     . GLY A 1 133 ? 121.565 119.006 127.939 1.00 23.70  ? 132 GLY A C     1 
ATOM 790   O O     . GLY A 1 133 ? 121.200 120.068 128.451 1.00 23.70  ? 132 GLY A O     1 
ATOM 791   N N     . GLU A 1 134 ? 120.745 118.246 127.228 1.00 25.15  ? 133 GLU A N     1 
ATOM 792   C CA    . GLU A 1 134 ? 119.346 118.580 127.015 1.00 25.15  ? 133 GLU A CA    1 
ATOM 793   C C     . GLU A 1 134 ? 118.392 117.548 127.586 1.00 25.15  ? 133 GLU A C     1 
ATOM 794   O O     . GLU A 1 134 ? 117.240 117.882 127.873 1.00 25.15  ? 133 GLU A O     1 
ATOM 795   C CB    . GLU A 1 134 ? 119.063 118.759 125.518 1.00 25.15  ? 133 GLU A CB    1 
ATOM 796   C CG    . GLU A 1 134 ? 119.953 119.787 124.855 1.00 25.15  ? 133 GLU A CG    1 
ATOM 797   C CD    . GLU A 1 134 ? 119.960 119.681 123.351 1.00 25.15  ? 133 GLU A CD    1 
ATOM 798   O OE1   . GLU A 1 134 ? 119.193 118.868 122.804 1.00 25.15  ? 133 GLU A OE1   1 
ATOM 799   O OE2   . GLU A 1 134 ? 120.734 120.415 122.708 1.00 25.15  ? 133 GLU A OE2   1 
ATOM 800   N N     . ARG A 1 135 ? 118.835 116.307 127.751 1.00 27.61  ? 134 ARG A N     1 
ATOM 801   C CA    . ARG A 1 135 ? 118.075 115.295 128.463 1.00 27.61  ? 134 ARG A CA    1 
ATOM 802   C C     . ARG A 1 135 ? 118.654 115.133 129.860 1.00 27.61  ? 134 ARG A C     1 
ATOM 803   O O     . ARG A 1 135 ? 119.766 115.591 130.136 1.00 27.61  ? 134 ARG A O     1 
ATOM 804   C CB    . ARG A 1 135 ? 118.107 113.961 127.725 1.00 27.61  ? 134 ARG A CB    1 
ATOM 805   C CG    . ARG A 1 135 ? 117.478 113.982 126.350 1.00 27.61  ? 134 ARG A CG    1 
ATOM 806   C CD    . ARG A 1 135 ? 117.560 112.619 125.696 1.00 27.61  ? 134 ARG A CD    1 
ATOM 807   N NE    . ARG A 1 135 ? 116.726 111.631 126.374 1.00 27.61  ? 134 ARG A NE    1 
ATOM 808   C CZ    . ARG A 1 135 ? 117.187 110.584 127.051 1.00 27.61  ? 134 ARG A CZ    1 
ATOM 809   N NH1   . ARG A 1 135 ? 118.490 110.368 127.146 1.00 27.61  ? 134 ARG A NH1   1 
ATOM 810   N NH2   . ARG A 1 135 ? 116.340 109.744 127.627 1.00 27.61  ? 134 ARG A NH2   1 
ATOM 811   N N     . HIS B 2 20  ? 85.711  135.447 116.073 1.00 82.10  ? 18  HIS B N     1 
ATOM 812   C CA    . HIS B 2 20  ? 86.239  134.393 115.213 1.00 82.10  ? 18  HIS B CA    1 
ATOM 813   C C     . HIS B 2 20  ? 87.763  134.308 115.332 1.00 82.10  ? 18  HIS B C     1 
ATOM 814   O O     . HIS B 2 20  ? 88.504  135.102 114.754 1.00 82.10  ? 18  HIS B O     1 
ATOM 815   C CB    . HIS B 2 20  ? 85.796  134.613 113.756 1.00 82.10  ? 18  HIS B CB    1 
ATOM 816   C CG    . HIS B 2 20  ? 86.020  136.003 113.243 1.00 82.10  ? 18  HIS B CG    1 
ATOM 817   N ND1   . HIS B 2 20  ? 87.113  136.342 112.472 1.00 82.10  ? 18  HIS B ND1   1 
ATOM 818   C CD2   . HIS B 2 20  ? 85.296  137.137 113.385 1.00 82.10  ? 18  HIS B CD2   1 
ATOM 819   C CE1   . HIS B 2 20  ? 87.048  137.624 112.161 1.00 82.10  ? 18  HIS B CE1   1 
ATOM 820   N NE2   . HIS B 2 20  ? 85.956  138.130 112.704 1.00 82.10  ? 18  HIS B NE2   1 
ATOM 821   N N     . ARG B 2 21  ? 88.229  133.344 116.119 1.00 77.01  ? 19  ARG B N     1 
ATOM 822   C CA    . ARG B 2 21  ? 89.640  133.222 116.456 1.00 77.01  ? 19  ARG B CA    1 
ATOM 823   C C     . ARG B 2 21  ? 90.124  131.827 116.090 1.00 77.01  ? 19  ARG B C     1 
ATOM 824   O O     . ARG B 2 21  ? 89.501  130.820 116.434 1.00 77.01  ? 19  ARG B O     1 
ATOM 825   C CB    . ARG B 2 21  ? 89.892  133.502 117.950 1.00 77.01  ? 19  ARG B CB    1 
ATOM 826   C CG    . ARG B 2 21  ? 90.252  134.949 118.285 1.00 77.01  ? 19  ARG B CG    1 
ATOM 827   C CD    . ARG B 2 21  ? 89.112  135.922 118.045 1.00 77.01  ? 19  ARG B CD    1 
ATOM 828   N NE    . ARG B 2 21  ? 89.437  137.290 118.432 1.00 77.01  ? 19  ARG B NE    1 
ATOM 829   C CZ    . ARG B 2 21  ? 88.716  138.351 118.083 1.00 77.01  ? 19  ARG B CZ    1 
ATOM 830   N NH1   . ARG B 2 21  ? 87.643  138.201 117.317 1.00 77.01  ? 19  ARG B NH1   1 
ATOM 831   N NH2   . ARG B 2 21  ? 89.078  139.562 118.484 1.00 77.01  ? 19  ARG B NH2   1 
ATOM 832   N N     . LYS B 2 22  ? 91.256  131.781 115.394 1.00 67.98  ? 20  LYS B N     1 
ATOM 833   C CA    . LYS B 2 22  ? 91.764  130.545 114.821 1.00 67.98  ? 20  LYS B CA    1 
ATOM 834   C C     . LYS B 2 22  ? 92.570  129.797 115.875 1.00 67.98  ? 20  LYS B C     1 
ATOM 835   O O     . LYS B 2 22  ? 93.623  130.272 116.311 1.00 67.98  ? 20  LYS B O     1 
ATOM 836   C CB    . LYS B 2 22  ? 92.626  130.828 113.588 1.00 67.98  ? 20  LYS B CB    1 
ATOM 837   C CG    . LYS B 2 22  ? 93.028  129.581 112.808 1.00 67.98  ? 20  LYS B CG    1 
ATOM 838   C CD    . LYS B 2 22  ? 93.981  129.915 111.674 1.00 67.98  ? 20  LYS B CD    1 
ATOM 839   C CE    . LYS B 2 22  ? 93.263  130.610 110.532 1.00 67.98  ? 20  LYS B CE    1 
ATOM 840   N NZ    . LYS B 2 22  ? 94.158  130.891 109.375 1.00 67.98  ? 20  LYS B NZ    1 
ATOM 841   N N     . VAL B 2 23  ? 92.066  128.636 116.284 1.00 56.27  ? 21  VAL B N     1 
ATOM 842   C CA    . VAL B 2 23  ? 92.692  127.805 117.304 1.00 56.27  ? 21  VAL B CA    1 
ATOM 843   C C     . VAL B 2 23  ? 93.157  126.524 116.627 1.00 56.27  ? 21  VAL B C     1 
ATOM 844   O O     . VAL B 2 23  ? 92.341  125.709 116.182 1.00 56.27  ? 21  VAL B O     1 
ATOM 845   C CB    . VAL B 2 23  ? 91.740  127.515 118.470 1.00 56.27  ? 21  VAL B CB    1 
ATOM 846   C CG1   . VAL B 2 23  ? 92.357  126.505 119.412 1.00 56.27  ? 21  VAL B CG1   1 
ATOM 847   C CG2   . VAL B 2 23  ? 91.433  128.799 119.212 1.00 56.27  ? 21  VAL B CG2   1 
ATOM 848   N N     . LEU B 2 24  ? 94.472  126.356 116.546 1.00 44.99  ? 22  LEU B N     1 
ATOM 849   C CA    . LEU B 2 24  ? 95.078  125.277 115.783 1.00 44.99  ? 22  LEU B CA    1 
ATOM 850   C C     . LEU B 2 24  ? 95.272  124.051 116.665 1.00 44.99  ? 22  LEU B C     1 
ATOM 851   O O     . LEU B 2 24  ? 95.492  124.180 117.871 1.00 44.99  ? 22  LEU B O     1 
ATOM 852   C CB    . LEU B 2 24  ? 96.412  125.753 115.219 1.00 44.99  ? 22  LEU B CB    1 
ATOM 853   C CG    . LEU B 2 24  ? 96.343  126.927 114.245 1.00 44.99  ? 22  LEU B CG    1 
ATOM 854   C CD1   . LEU B 2 24  ? 97.712  127.489 113.985 1.00 44.99  ? 22  LEU B CD1   1 
ATOM 855   C CD2   . LEU B 2 24  ? 95.712  126.486 112.945 1.00 44.99  ? 22  LEU B CD2   1 
ATOM 856   N N     . ARG B 2 25  ? 95.174  122.861 116.072 1.00 44.50  ? 23  ARG B N     1 
ATOM 857   C CA    . ARG B 2 25  ? 95.396  121.623 116.809 1.00 44.50  ? 23  ARG B CA    1 
ATOM 858   C C     . ARG B 2 25  ? 96.257  120.676 115.984 1.00 44.50  ? 23  ARG B C     1 
ATOM 859   O O     . ARG B 2 25  ? 95.920  120.346 114.844 1.00 44.50  ? 23  ARG B O     1 
ATOM 860   C CB    . ARG B 2 25  ? 94.089  120.897 117.176 1.00 44.50  ? 23  ARG B CB    1 
ATOM 861   C CG    . ARG B 2 25  ? 93.319  121.454 118.374 1.00 44.50  ? 23  ARG B CG    1 
ATOM 862   C CD    . ARG B 2 25  ? 92.365  122.578 117.982 1.00 44.50  ? 23  ARG B CD    1 
ATOM 863   N NE    . ARG B 2 25  ? 91.635  123.122 119.126 1.00 44.50  ? 23  ARG B NE    1 
ATOM 864   C CZ    . ARG B 2 25  ? 90.485  122.643 119.587 1.00 44.50  ? 23  ARG B CZ    1 
ATOM 865   N NH1   . ARG B 2 25  ? 89.897  123.214 120.627 1.00 44.50  ? 23  ARG B NH1   1 
ATOM 866   N NH2   . ARG B 2 25  ? 89.922  121.593 119.011 1.00 44.50  ? 23  ARG B NH2   1 
ATOM 867   N N     . ASP B 2 26  ? 97.368  120.246 116.593 1.00 39.53  ? 24  ASP B N     1 
ATOM 868   C CA    . ASP B 2 26  ? 98.246  119.170 116.117 1.00 39.53  ? 24  ASP B CA    1 
ATOM 869   C C     . ASP B 2 26  ? 98.816  119.479 114.730 1.00 39.53  ? 24  ASP B C     1 
ATOM 870   O O     . ASP B 2 26  ? 98.489  118.843 113.728 1.00 39.53  ? 24  ASP B O     1 
ATOM 871   C CB    . ASP B 2 26  ? 97.520  117.819 116.140 1.00 39.53  ? 24  ASP B CB    1 
ATOM 872   C CG    . ASP B 2 26  ? 98.471  116.637 116.040 1.00 39.53  ? 24  ASP B CG    1 
ATOM 873   O OD1   . ASP B 2 26  ? 99.011  116.369 114.951 1.00 39.53  ? 24  ASP B OD1   1 
ATOM 874   O OD2   . ASP B 2 26  ? 98.678  115.967 117.073 1.00 39.53  ? 24  ASP B OD2   1 
ATOM 875   N N     . ASN B 2 27  ? 99.646  120.514 114.685 1.00 32.75  ? 25  ASN B N     1 
ATOM 876   C CA    . ASN B 2 27  ? 100.403 120.829 113.490 1.00 32.75  ? 25  ASN B CA    1 
ATOM 877   C C     . ASN B 2 27  ? 101.841 120.364 113.592 1.00 32.75  ? 25  ASN B C     1 
ATOM 878   O O     . ASN B 2 27  ? 102.669 120.781 112.780 1.00 32.75  ? 25  ASN B O     1 
ATOM 879   C CB    . ASN B 2 27  ? 100.354 122.331 113.200 1.00 32.75  ? 25  ASN B CB    1 
ATOM 880   C CG    . ASN B 2 27  ? 98.951  122.863 113.178 1.00 32.75  ? 25  ASN B CG    1 
ATOM 881   O OD1   . ASN B 2 27  ? 98.262  122.807 112.166 1.00 32.75  ? 25  ASN B OD1   1 
ATOM 882   N ND2   . ASN B 2 27  ? 98.517  123.381 114.300 1.00 32.75  ? 25  ASN B ND2   1 
ATOM 883   N N     . ILE B 2 28  ? 102.158 119.503 114.558 1.00 29.27  ? 26  ILE B N     1 
ATOM 884   C CA    . ILE B 2 28  ? 103.477 118.901 114.611 1.00 29.27  ? 26  ILE B CA    1 
ATOM 885   C C     . ILE B 2 28  ? 103.635 117.856 113.516 1.00 29.27  ? 26  ILE B C     1 
ATOM 886   O O     . ILE B 2 28  ? 104.759 117.535 113.128 1.00 29.27  ? 26  ILE B O     1 
ATOM 887   C CB    . ILE B 2 28  ? 103.727 118.344 116.029 1.00 29.27  ? 26  ILE B CB    1 
ATOM 888   C CG1   . ILE B 2 28  ? 105.209 118.091 116.282 1.00 29.27  ? 26  ILE B CG1   1 
ATOM 889   C CG2   . ILE B 2 28  ? 102.918 117.095 116.278 1.00 29.27  ? 26  ILE B CG2   1 
ATOM 890   C CD1   . ILE B 2 28  ? 106.095 119.238 115.934 1.00 29.27  ? 26  ILE B CD1   1 
ATOM 891   N N     . GLN B 2 29  ? 102.537 117.353 112.964 1.00 28.90  ? 27  GLN B N     1 
ATOM 892   C CA    . GLN B 2 29  ? 102.590 116.474 111.809 1.00 28.90  ? 27  GLN B CA    1 
ATOM 893   C C     . GLN B 2 29  ? 102.731 117.232 110.502 1.00 28.90  ? 27  GLN B C     1 
ATOM 894   O O     . GLN B 2 29  ? 102.824 116.599 109.449 1.00 28.90  ? 27  GLN B O     1 
ATOM 895   C CB    . GLN B 2 29  ? 101.344 115.600 111.764 1.00 28.90  ? 27  GLN B CB    1 
ATOM 896   C CG    . GLN B 2 29  ? 101.184 114.740 112.987 1.00 28.90  ? 27  GLN B CG    1 
ATOM 897   C CD    . GLN B 2 29  ? 102.190 113.624 113.033 1.00 28.90  ? 27  GLN B CD    1 
ATOM 898   O OE1   . GLN B 2 29  ? 102.763 113.333 114.077 1.00 28.90  ? 27  GLN B OE1   1 
ATOM 899   N NE2   . GLN B 2 29  ? 102.404 112.982 111.897 1.00 28.90  ? 27  GLN B NE2   1 
ATOM 900   N N     . GLY B 2 30  ? 102.737 118.564 110.540 1.00 27.00  ? 28  GLY B N     1 
ATOM 901   C CA    . GLY B 2 30  ? 103.047 119.343 109.360 1.00 27.00  ? 28  GLY B CA    1 
ATOM 902   C C     . GLY B 2 30  ? 104.507 119.325 108.989 1.00 27.00  ? 28  GLY B C     1 
ATOM 903   O O     . GLY B 2 30  ? 104.853 119.673 107.859 1.00 27.00  ? 28  GLY B O     1 
ATOM 904   N N     . ILE B 2 31  ? 105.370 118.949 109.928 1.00 24.96  ? 29  ILE B N     1 
ATOM 905   C CA    . ILE B 2 31  ? 106.768 118.637 109.655 1.00 24.96  ? 29  ILE B CA    1 
ATOM 906   C C     . ILE B 2 31  ? 106.777 117.187 109.194 1.00 24.96  ? 29  ILE B C     1 
ATOM 907   O O     . ILE B 2 31  ? 106.674 116.259 109.993 1.00 24.96  ? 29  ILE B O     1 
ATOM 908   C CB    . ILE B 2 31  ? 107.668 118.868 110.871 1.00 24.96  ? 29  ILE B CB    1 
ATOM 909   C CG1   . ILE B 2 31  ? 107.797 120.357 111.157 1.00 24.96  ? 29  ILE B CG1   1 
ATOM 910   C CG2   . ILE B 2 31  ? 109.055 118.380 110.619 1.00 24.96  ? 29  ILE B CG2   1 
ATOM 911   C CD1   . ILE B 2 31  ? 106.827 120.884 112.103 1.00 24.96  ? 29  ILE B CD1   1 
ATOM 912   N N     . THR B 2 32  ? 106.844 116.997 107.890 1.00 23.58  ? 30  THR B N     1 
ATOM 913   C CA    . THR B 2 32  ? 106.522 115.717 107.306 1.00 23.58  ? 30  THR B CA    1 
ATOM 914   C C     . THR B 2 32  ? 107.737 114.808 107.358 1.00 23.58  ? 30  THR B C     1 
ATOM 915   O O     . THR B 2 32  ? 108.817 115.199 107.790 1.00 23.58  ? 30  THR B O     1 
ATOM 916   C CB    . THR B 2 32  ? 106.001 115.918 105.889 1.00 23.58  ? 30  THR B CB    1 
ATOM 917   O OG1   . THR B 2 32  ? 106.955 116.659 105.129 1.00 23.58  ? 30  THR B OG1   1 
ATOM 918   C CG2   . THR B 2 32  ? 104.734 116.715 105.924 1.00 23.58  ? 30  THR B CG2   1 
ATOM 919   N N     . LYS B 2 33  ? 107.536 113.559 106.959 1.00 23.26  ? 31  LYS B N     1 
ATOM 920   C CA    . LYS B 2 33  ? 108.651 112.618 106.858 1.00 23.26  ? 31  LYS B CA    1 
ATOM 921   C C     . LYS B 2 33  ? 109.706 113.039 105.831 1.00 23.26  ? 31  LYS B C     1 
ATOM 922   O O     . LYS B 2 33  ? 110.905 112.951 106.155 1.00 23.26  ? 31  LYS B O     1 
ATOM 923   C CB    . LYS B 2 33  ? 108.094 111.210 106.607 1.00 23.26  ? 31  LYS B CB    1 
ATOM 924   C CG    . LYS B 2 33  ? 109.108 110.110 106.563 1.00 23.26  ? 31  LYS B CG    1 
ATOM 925   C CD    . LYS B 2 33  ? 108.435 108.760 106.577 1.00 23.26  ? 31  LYS B CD    1 
ATOM 926   C CE    . LYS B 2 33  ? 108.251 108.220 105.184 1.00 23.26  ? 31  LYS B CE    1 
ATOM 927   N NZ    . LYS B 2 33  ? 109.511 107.648 104.648 1.00 23.26  ? 31  LYS B NZ    1 
ATOM 928   N N     . PRO B 2 34  ? 109.371 113.521 104.624 1.00 21.16  ? 32  PRO B N     1 
ATOM 929   C CA    . PRO B 2 34  ? 110.421 114.017 103.732 1.00 21.16  ? 32  PRO B CA    1 
ATOM 930   C C     . PRO B 2 34  ? 111.102 115.302 104.164 1.00 21.16  ? 32  PRO B C     1 
ATOM 931   O O     . PRO B 2 34  ? 112.192 115.577 103.664 1.00 21.16  ? 32  PRO B O     1 
ATOM 932   C CB    . PRO B 2 34  ? 109.665 114.234 102.417 1.00 21.16  ? 32  PRO B CB    1 
ATOM 933   C CG    . PRO B 2 34  ? 108.317 114.392 102.801 1.00 21.16  ? 32  PRO B CG    1 
ATOM 934   C CD    . PRO B 2 34  ? 108.138 113.384 103.827 1.00 21.16  ? 32  PRO B CD    1 
ATOM 935   N N     . ALA B 2 35  ? 110.530 116.102 105.056 1.00 19.77  ? 33  ALA B N     1 
ATOM 936   C CA    . ALA B 2 35  ? 111.227 117.268 105.585 1.00 19.77  ? 33  ALA B CA    1 
ATOM 937   C C     . ALA B 2 35  ? 112.294 116.893 106.592 1.00 19.77  ? 33  ALA B C     1 
ATOM 938   O O     . ALA B 2 35  ? 113.401 117.441 106.563 1.00 19.77  ? 33  ALA B O     1 
ATOM 939   C CB    . ALA B 2 35  ? 110.234 118.227 106.238 1.00 19.77  ? 33  ALA B CB    1 
ATOM 940   N N     . ILE B 2 36  ? 111.976 115.947 107.471 1.00 18.97  ? 34  ILE B N     1 
ATOM 941   C CA    . ILE B 2 36  ? 112.941 115.418 108.424 1.00 18.97  ? 34  ILE B CA    1 
ATOM 942   C C     . ILE B 2 36  ? 114.040 114.659 107.699 1.00 18.97  ? 34  ILE B C     1 
ATOM 943   O O     . ILE B 2 36  ? 115.207 114.687 108.107 1.00 18.97  ? 34  ILE B O     1 
ATOM 944   C CB    . ILE B 2 36  ? 112.204 114.547 109.455 1.00 18.97  ? 34  ILE B CB    1 
ATOM 945   C CG1   . ILE B 2 36  ? 111.158 115.389 110.162 1.00 18.97  ? 34  ILE B CG1   1 
ATOM 946   C CG2   . ILE B 2 36  ? 113.141 113.948 110.459 1.00 18.97  ? 34  ILE B CG2   1 
ATOM 947   C CD1   . ILE B 2 36  ? 110.188 114.605 110.954 1.00 18.97  ? 34  ILE B CD1   1 
ATOM 948   N N     . ARG B 2 37  ? 113.702 114.020 106.576 1.00 21.79  ? 35  ARG B N     1 
ATOM 949   C CA    . ARG B 2 37  ? 114.739 113.372 105.782 1.00 21.79  ? 35  ARG B CA    1 
ATOM 950   C C     . ARG B 2 37  ? 115.663 114.384 105.124 1.00 21.79  ? 35  ARG B C     1 
ATOM 951   O O     . ARG B 2 37  ? 116.858 114.129 105.001 1.00 21.79  ? 35  ARG B O     1 
ATOM 952   C CB    . ARG B 2 37  ? 114.126 112.468 104.732 1.00 21.79  ? 35  ARG B CB    1 
ATOM 953   C CG    . ARG B 2 37  ? 113.597 111.196 105.289 1.00 21.79  ? 35  ARG B CG    1 
ATOM 954   C CD    . ARG B 2 37  ? 112.983 110.371 104.199 1.00 21.79  ? 35  ARG B CD    1 
ATOM 955   N NE    . ARG B 2 37  ? 114.013 109.717 103.413 1.00 21.79  ? 35  ARG B NE    1 
ATOM 956   C CZ    . ARG B 2 37  ? 114.508 108.522 103.699 1.00 21.79  ? 35  ARG B CZ    1 
ATOM 957   N NH1   . ARG B 2 37  ? 114.061 107.857 104.749 1.00 21.79  ? 35  ARG B NH1   1 
ATOM 958   N NH2   . ARG B 2 37  ? 115.441 107.988 102.931 1.00 21.79  ? 35  ARG B NH2   1 
ATOM 959   N N     . ARG B 2 38  ? 115.148 115.547 104.726 1.00 16.31  ? 36  ARG B N     1 
ATOM 960   C CA    . ARG B 2 38  ? 116.009 116.586 104.161 1.00 16.31  ? 36  ARG B CA    1 
ATOM 961   C C     . ARG B 2 38  ? 116.925 117.187 105.214 1.00 16.31  ? 36  ARG B C     1 
ATOM 962   O O     . ARG B 2 38  ? 118.092 117.486 104.936 1.00 16.31  ? 36  ARG B O     1 
ATOM 963   C CB    . ARG B 2 38  ? 115.167 117.682 103.534 1.00 16.31  ? 36  ARG B CB    1 
ATOM 964   C CG    . ARG B 2 38  ? 114.655 117.358 102.185 1.00 16.31  ? 36  ARG B CG    1 
ATOM 965   C CD    . ARG B 2 38  ? 114.068 118.577 101.547 1.00 16.31  ? 36  ARG B CD    1 
ATOM 966   N NE    . ARG B 2 38  ? 112.847 119.014 102.201 1.00 16.31  ? 36  ARG B NE    1 
ATOM 967   C CZ    . ARG B 2 38  ? 111.642 118.568 101.888 1.00 16.31  ? 36  ARG B CZ    1 
ATOM 968   N NH1   . ARG B 2 38  ? 111.506 117.666 100.938 1.00 16.31  ? 36  ARG B NH1   1 
ATOM 969   N NH2   . ARG B 2 38  ? 110.580 119.021 102.525 1.00 16.31  ? 36  ARG B NH2   1 
ATOM 970   N N     . LEU B 2 39  ? 116.405 117.389 106.424 1.00 17.72  ? 37  LEU B N     1 
ATOM 971   C CA    . LEU B 2 39  ? 117.243 117.874 107.516 1.00 17.72  ? 37  LEU B CA    1 
ATOM 972   C C     . LEU B 2 39  ? 118.312 116.862 107.882 1.00 17.72  ? 37  LEU B C     1 
ATOM 973   O O     . LEU B 2 39  ? 119.439 117.234 108.217 1.00 17.72  ? 37  LEU B O     1 
ATOM 974   C CB    . LEU B 2 39  ? 116.391 118.199 108.734 1.00 17.72  ? 37  LEU B CB    1 
ATOM 975   C CG    . LEU B 2 39  ? 115.347 119.293 108.587 1.00 17.72  ? 37  LEU B CG    1 
ATOM 976   C CD1   . LEU B 2 39  ? 114.342 119.128 109.676 1.00 17.72  ? 37  LEU B CD1   1 
ATOM 977   C CD2   . LEU B 2 39  ? 115.988 120.638 108.674 1.00 17.72  ? 37  LEU B CD2   1 
ATOM 978   N N     . ALA B 2 40  ? 117.999 115.573 107.772 1.00 17.11  ? 38  ALA B N     1 
ATOM 979   C CA    . ALA B 2 40  ? 119.007 114.553 108.022 1.00 17.11  ? 38  ALA B CA    1 
ATOM 980   C C     . ALA B 2 40  ? 120.021 114.467 106.890 1.00 17.11  ? 38  ALA B C     1 
ATOM 981   O O     . ALA B 2 40  ? 121.184 114.154 107.128 1.00 17.11  ? 38  ALA B O     1 
ATOM 982   C CB    . ALA B 2 40  ? 118.334 113.213 108.248 1.00 17.11  ? 38  ALA B CB    1 
ATOM 983   N N     . ARG B 2 41  ? 119.609 114.745 105.653 1.00 17.82  ? 39  ARG B N     1 
ATOM 984   C CA    . ARG B 2 41  ? 120.564 114.784 104.548 1.00 17.82  ? 39  ARG B CA    1 
ATOM 985   C C     . ARG B 2 41  ? 121.514 115.964 104.658 1.00 17.82  ? 39  ARG B C     1 
ATOM 986   O O     . ARG B 2 41  ? 122.685 115.841 104.307 1.00 17.82  ? 39  ARG B O     1 
ATOM 987   C CB    . ARG B 2 41  ? 119.848 114.857 103.207 1.00 17.82  ? 39  ARG B CB    1 
ATOM 988   C CG    . ARG B 2 41  ? 119.091 113.639 102.794 1.00 17.82  ? 39  ARG B CG    1 
ATOM 989   C CD    . ARG B 2 41  ? 119.872 112.395 102.974 1.00 17.82  ? 39  ARG B CD    1 
ATOM 990   N NE    . ARG B 2 41  ? 119.177 111.265 102.390 1.00 17.82  ? 39  ARG B NE    1 
ATOM 991   C CZ    . ARG B 2 41  ? 118.787 110.208 103.076 1.00 17.82  ? 39  ARG B CZ    1 
ATOM 992   N NH1   . ARG B 2 41  ? 119.032 110.138 104.368 1.00 17.82  ? 39  ARG B NH1   1 
ATOM 993   N NH2   . ARG B 2 41  ? 118.169 109.220 102.469 1.00 17.82  ? 39  ARG B NH2   1 
ATOM 994   N N     . ARG B 2 42  ? 121.030 117.118 105.113 1.00 15.96  ? 40  ARG B N     1 
ATOM 995   C CA    . ARG B 2 42  ? 121.946 118.216 105.402 1.00 15.96  ? 40  ARG B CA    1 
ATOM 996   C C     . ARG B 2 42  ? 122.825 117.890 106.601 1.00 15.96  ? 40  ARG B C     1 
ATOM 997   O O     . ARG B 2 42  ? 123.989 118.292 106.650 1.00 15.96  ? 40  ARG B O     1 
ATOM 998   C CB    . ARG B 2 42  ? 121.174 119.511 105.631 1.00 15.96  ? 40  ARG B CB    1 
ATOM 999   C CG    . ARG B 2 42  ? 122.054 120.737 105.686 1.00 15.96  ? 40  ARG B CG    1 
ATOM 1000  C CD    . ARG B 2 42  ? 121.271 122.018 105.630 1.00 15.96  ? 40  ARG B CD    1 
ATOM 1001  N NE    . ARG B 2 42  ? 120.888 122.342 104.269 1.00 15.96  ? 40  ARG B NE    1 
ATOM 1002  C CZ    . ARG B 2 42  ? 120.053 123.314 103.936 1.00 15.96  ? 40  ARG B CZ    1 
ATOM 1003  N NH1   . ARG B 2 42  ? 119.507 124.070 104.865 1.00 15.96  ? 40  ARG B NH1   1 
ATOM 1004  N NH2   . ARG B 2 42  ? 119.769 123.521 102.668 1.00 15.96  ? 40  ARG B NH2   1 
ATOM 1005  N N     . GLY B 2 43  ? 122.302 117.137 107.565 1.00 16.89  ? 41  GLY B N     1 
ATOM 1006  C CA    . GLY B 2 43  ? 123.120 116.632 108.648 1.00 16.89  ? 41  GLY B CA    1 
ATOM 1007  C C     . GLY B 2 43  ? 124.085 115.533 108.262 1.00 16.89  ? 41  GLY B C     1 
ATOM 1008  O O     . GLY B 2 43  ? 124.933 115.171 109.080 1.00 16.89  ? 41  GLY B O     1 
ATOM 1009  N N     . GLY B 2 44  ? 123.968 114.978 107.065 1.00 18.90  ? 42  GLY B N     1 
ATOM 1010  C CA    . GLY B 2 44  ? 124.899 113.986 106.580 1.00 18.90  ? 42  GLY B CA    1 
ATOM 1011  C C     . GLY B 2 44  ? 124.489 112.552 106.784 1.00 18.90  ? 42  GLY B C     1 
ATOM 1012  O O     . GLY B 2 44  ? 125.345 111.672 106.707 1.00 18.90  ? 42  GLY B O     1 
ATOM 1013  N N     . VAL B 2 45  ? 123.218 112.287 107.015 1.00 18.41  ? 43  VAL B N     1 
ATOM 1014  C CA    . VAL B 2 45  ? 122.744 110.974 107.422 1.00 18.41  ? 43  VAL B CA    1 
ATOM 1015  C C     . VAL B 2 45  ? 122.359 110.170 106.190 1.00 18.41  ? 43  VAL B C     1 
ATOM 1016  O O     . VAL B 2 45  ? 121.603 110.646 105.339 1.00 18.41  ? 43  VAL B O     1 
ATOM 1017  C CB    . VAL B 2 45  ? 121.562 111.109 108.390 1.00 18.41  ? 43  VAL B CB    1 
ATOM 1018  C CG1   . VAL B 2 45  ? 121.010 109.778 108.737 1.00 18.41  ? 43  VAL B CG1   1 
ATOM 1019  C CG2   . VAL B 2 45  ? 121.998 111.835 109.627 1.00 18.41  ? 43  VAL B CG2   1 
ATOM 1020  N N     . LYS B 2 46  ? 122.875 108.943 106.098 1.00 24.71  ? 44  LYS B N     1 
ATOM 1021  C CA    . LYS B 2 46  ? 122.641 108.113 104.925 1.00 24.71  ? 44  LYS B CA    1 
ATOM 1022  C C     . LYS B 2 46  ? 121.408 107.236 105.079 1.00 24.71  ? 44  LYS B C     1 
ATOM 1023  O O     . LYS B 2 46  ? 120.629 107.092 104.134 1.00 24.71  ? 44  LYS B O     1 
ATOM 1024  C CB    . LYS B 2 46  ? 123.867 107.252 104.655 1.00 24.71  ? 44  LYS B CB    1 
ATOM 1025  C CG    . LYS B 2 46  ? 123.928 106.678 103.271 1.00 24.71  ? 44  LYS B CG    1 
ATOM 1026  C CD    . LYS B 2 46  ? 125.005 105.626 103.172 1.00 24.71  ? 44  LYS B CD    1 
ATOM 1027  C CE    . LYS B 2 46  ? 125.200 105.201 101.741 1.00 24.71  ? 44  LYS B CE    1 
ATOM 1028  N NZ    . LYS B 2 46  ? 126.156 104.086 101.594 1.00 24.71  ? 44  LYS B NZ    1 
ATOM 1029  N N     . ARG B 2 47  ? 121.206 106.641 106.247 1.00 25.75  ? 45  ARG B N     1 
ATOM 1030  C CA    . ARG B 2 47  ? 120.090 105.736 106.471 1.00 25.75  ? 45  ARG B CA    1 
ATOM 1031  C C     . ARG B 2 47  ? 119.368 106.160 107.735 1.00 25.75  ? 45  ARG B C     1 
ATOM 1032  O O     . ARG B 2 47  ? 120.009 106.549 108.712 1.00 25.75  ? 45  ARG B O     1 
ATOM 1033  C CB    . ARG B 2 47  ? 120.584 104.299 106.584 1.00 25.75  ? 45  ARG B CB    1 
ATOM 1034  C CG    . ARG B 2 47  ? 119.604 103.261 106.176 1.00 25.75  ? 45  ARG B CG    1 
ATOM 1035  C CD    . ARG B 2 47  ? 120.309 101.975 105.881 1.00 25.75  ? 45  ARG B CD    1 
ATOM 1036  N NE    . ARG B 2 47  ? 119.384 100.946 105.439 1.00 25.75  ? 45  ARG B NE    1 
ATOM 1037  C CZ    . ARG B 2 47  ? 118.784 100.092 106.255 1.00 25.75  ? 45  ARG B CZ    1 
ATOM 1038  N NH1   . ARG B 2 47  ? 119.007 100.147 107.555 1.00 25.75  ? 45  ARG B NH1   1 
ATOM 1039  N NH2   . ARG B 2 47  ? 117.954 99.184  105.773 1.00 25.75  ? 45  ARG B NH2   1 
ATOM 1040  N N     . ILE B 2 48  ? 118.041 106.110 107.708 1.00 24.11  ? 46  ILE B N     1 
ATOM 1041  C CA    . ILE B 2 48  ? 117.188 106.686 108.741 1.00 24.11  ? 46  ILE B CA    1 
ATOM 1042  C C     . ILE B 2 48  ? 116.167 105.649 109.181 1.00 24.11  ? 46  ILE B C     1 
ATOM 1043  O O     . ILE B 2 48  ? 115.395 105.149 108.359 1.00 24.11  ? 46  ILE B O     1 
ATOM 1044  C CB    . ILE B 2 48  ? 116.463 107.946 108.228 1.00 24.11  ? 46  ILE B CB    1 
ATOM 1045  C CG1   . ILE B 2 48  ? 117.447 109.021 107.813 1.00 24.11  ? 46  ILE B CG1   1 
ATOM 1046  C CG2   . ILE B 2 48  ? 115.562 108.500 109.272 1.00 24.11  ? 46  ILE B CG2   1 
ATOM 1047  C CD1   . ILE B 2 48  ? 116.839 110.081 107.014 1.00 24.11  ? 46  ILE B CD1   1 
ATOM 1048  N N     . SER B 2 49  ? 116.135 105.352 110.476 1.00 24.69  ? 47  SER B N     1 
ATOM 1049  C CA    . SER B 2 49  ? 115.144 104.440 111.023 1.00 24.69  ? 47  SER B CA    1 
ATOM 1050  C C     . SER B 2 49  ? 113.753 105.055 110.980 1.00 24.69  ? 47  SER B C     1 
ATOM 1051  O O     . SER B 2 49  ? 113.577 106.258 110.819 1.00 24.69  ? 47  SER B O     1 
ATOM 1052  C CB    . SER B 2 49  ? 115.490 104.061 112.451 1.00 24.69  ? 47  SER B CB    1 
ATOM 1053  O OG    . SER B 2 49  ? 114.492 103.251 113.020 1.00 24.69  ? 47  SER B OG    1 
ATOM 1054  N N     . GLY B 2 50  ? 112.751 104.209 111.141 1.00 23.54  ? 48  GLY B N     1 
ATOM 1055  C CA    . GLY B 2 50  ? 111.385 104.644 110.965 1.00 23.54  ? 48  GLY B CA    1 
ATOM 1056  C C     . GLY B 2 50  ? 110.804 105.304 112.188 1.00 23.54  ? 48  GLY B C     1 
ATOM 1057  O O     . GLY B 2 50  ? 109.742 105.926 112.123 1.00 23.54  ? 48  GLY B O     1 
ATOM 1058  N N     . LEU B 2 51  ? 111.484 105.168 113.315 1.00 22.89  ? 49  LEU B N     1 
ATOM 1059  C CA    . LEU B 2 51  ? 111.066 105.798 114.553 1.00 22.89  ? 49  LEU B CA    1 
ATOM 1060  C C     . LEU B 2 51  ? 111.751 107.127 114.786 1.00 22.89  ? 49  LEU B C     1 
ATOM 1061  O O     . LEU B 2 51  ? 111.546 107.740 115.832 1.00 22.89  ? 49  LEU B O     1 
ATOM 1062  C CB    . LEU B 2 51  ? 111.340 104.867 115.727 1.00 22.89  ? 49  LEU B CB    1 
ATOM 1063  C CG    . LEU B 2 51  ? 110.767 103.466 115.618 1.00 22.89  ? 49  LEU B CG    1 
ATOM 1064  C CD1   . LEU B 2 51  ? 111.389 102.592 116.662 1.00 22.89  ? 49  LEU B CD1   1 
ATOM 1065  C CD2   . LEU B 2 51  ? 109.278 103.531 115.804 1.00 22.89  ? 49  LEU B CD2   1 
ATOM 1066  N N     . ILE B 2 52  ? 112.558 107.580 113.830 1.00 20.21  ? 50  ILE B N     1 
ATOM 1067  C CA    . ILE B 2 52  ? 113.297 108.825 113.963 1.00 20.21  ? 50  ILE B CA    1 
ATOM 1068  C C     . ILE B 2 52  ? 112.365 110.018 113.853 1.00 20.21  ? 50  ILE B C     1 
ATOM 1069  O O     . ILE B 2 52  ? 112.587 111.049 114.492 1.00 20.21  ? 50  ILE B O     1 
ATOM 1070  C CB    . ILE B 2 52  ? 114.427 108.828 112.913 1.00 20.21  ? 50  ILE B CB    1 
ATOM 1071  C CG1   . ILE B 2 52  ? 115.612 108.060 113.453 1.00 20.21  ? 50  ILE B CG1   1 
ATOM 1072  C CG2   . ILE B 2 52  ? 114.880 110.223 112.494 1.00 20.21  ? 50  ILE B CG2   1 
ATOM 1073  C CD1   . ILE B 2 52  ? 116.209 108.699 114.626 1.00 20.21  ? 50  ILE B CD1   1 
ATOM 1074  N N     . TYR B 2 53  ? 111.269 109.875 113.118 1.00 22.13  ? 51  TYR B N     1 
ATOM 1075  C CA    . TYR B 2 53  ? 110.403 111.010 112.838 1.00 22.13  ? 51  TYR B CA    1 
ATOM 1076  C C     . TYR B 2 53  ? 109.602 111.443 114.058 1.00 22.13  ? 51  TYR B C     1 
ATOM 1077  O O     . TYR B 2 53  ? 109.489 112.642 114.324 1.00 22.13  ? 51  TYR B O     1 
ATOM 1078  C CB    . TYR B 2 53  ? 109.507 110.667 111.657 1.00 22.13  ? 51  TYR B CB    1 
ATOM 1079  C CG    . TYR B 2 53  ? 110.309 110.088 110.522 1.00 22.13  ? 51  TYR B CG    1 
ATOM 1080  C CD1   . TYR B 2 53  ? 111.229 110.860 109.836 1.00 22.13  ? 51  TYR B CD1   1 
ATOM 1081  C CD2   . TYR B 2 53  ? 110.180 108.764 110.166 1.00 22.13  ? 51  TYR B CD2   1 
ATOM 1082  C CE1   . TYR B 2 53  ? 111.980 110.332 108.816 1.00 22.13  ? 51  TYR B CE1   1 
ATOM 1083  C CE2   . TYR B 2 53  ? 110.928 108.231 109.149 1.00 22.13  ? 51  TYR B CE2   1 
ATOM 1084  C CZ    . TYR B 2 53  ? 111.825 109.019 108.481 1.00 22.13  ? 51  TYR B CZ    1 
ATOM 1085  O OH    . TYR B 2 53  ? 112.562 108.484 107.460 1.00 22.13  ? 51  TYR B OH    1 
ATOM 1086  N N     . GLU B 2 54  ? 109.099 110.502 114.851 1.00 24.70  ? 52  GLU B N     1 
ATOM 1087  C CA    . GLU B 2 54  ? 108.377 110.894 116.053 1.00 24.70  ? 52  GLU B CA    1 
ATOM 1088  C C     . GLU B 2 54  ? 109.296 111.390 117.158 1.00 24.70  ? 52  GLU B C     1 
ATOM 1089  O O     . GLU B 2 54  ? 108.877 112.227 117.958 1.00 24.70  ? 52  GLU B O     1 
ATOM 1090  C CB    . GLU B 2 54  ? 107.536 109.738 116.567 1.00 24.70  ? 52  GLU B CB    1 
ATOM 1091  C CG    . GLU B 2 54  ? 106.264 109.534 115.789 1.00 24.70  ? 52  GLU B CG    1 
ATOM 1092  C CD    . GLU B 2 54  ? 105.485 110.816 115.586 1.00 24.70  ? 52  GLU B CD    1 
ATOM 1093  O OE1   . GLU B 2 54  ? 105.139 111.477 116.586 1.00 24.70  ? 52  GLU B OE1   1 
ATOM 1094  O OE2   . GLU B 2 54  ? 105.207 111.163 114.421 1.00 24.70  ? 52  GLU B OE2   1 
ATOM 1095  N N     . GLU B 2 55  ? 110.523 110.885 117.226 1.00 23.84  ? 53  GLU B N     1 
ATOM 1096  C CA    . GLU B 2 55  ? 111.532 111.409 118.136 1.00 23.84  ? 53  GLU B CA    1 
ATOM 1097  C C     . GLU B 2 55  ? 111.926 112.831 117.758 1.00 23.84  ? 53  GLU B C     1 
ATOM 1098  O O     . GLU B 2 55  ? 112.036 113.705 118.624 1.00 23.84  ? 53  GLU B O     1 
ATOM 1099  C CB    . GLU B 2 55  ? 112.743 110.478 118.107 1.00 23.84  ? 53  GLU B CB    1 
ATOM 1100  C CG    . GLU B 2 55  ? 113.933 110.860 118.955 1.00 23.84  ? 53  GLU B CG    1 
ATOM 1101  C CD    . GLU B 2 55  ? 113.700 110.727 120.444 1.00 23.84  ? 53  GLU B CD    1 
ATOM 1102  O OE1   . GLU B 2 55  ? 113.010 109.778 120.864 1.00 23.84  ? 53  GLU B OE1   1 
ATOM 1103  O OE2   . GLU B 2 55  ? 114.234 111.561 121.202 1.00 23.84  ? 53  GLU B OE2   1 
ATOM 1104  N N     . THR B 2 56  ? 112.081 113.078 116.458 1.00 21.22  ? 54  THR B N     1 
ATOM 1105  C CA    . THR B 2 56  ? 112.499 114.375 115.942 1.00 21.22  ? 54  THR B CA    1 
ATOM 1106  C C     . THR B 2 56  ? 111.416 115.426 116.119 1.00 21.22  ? 54  THR B C     1 
ATOM 1107  O O     . THR B 2 56  ? 111.715 116.586 116.427 1.00 21.22  ? 54  THR B O     1 
ATOM 1108  C CB    . THR B 2 56  ? 112.873 114.216 114.473 1.00 21.22  ? 54  THR B CB    1 
ATOM 1109  O OG1   . THR B 2 56  ? 113.968 113.305 114.379 1.00 21.22  ? 54  THR B OG1   1 
ATOM 1110  C CG2   . THR B 2 56  ? 113.277 115.528 113.842 1.00 21.22  ? 54  THR B CG2   1 
ATOM 1111  N N     . ARG B 2 57  ? 110.153 115.037 115.949 1.00 21.19  ? 55  ARG B N     1 
ATOM 1112  C CA    . ARG B 2 57  ? 109.058 115.974 116.160 1.00 21.19  ? 55  ARG B CA    1 
ATOM 1113  C C     . ARG B 2 57  ? 108.961 116.403 117.617 1.00 21.19  ? 55  ARG B C     1 
ATOM 1114  O O     . ARG B 2 57  ? 108.695 117.572 117.907 1.00 21.19  ? 55  ARG B O     1 
ATOM 1115  C CB    . ARG B 2 57  ? 107.752 115.349 115.697 1.00 21.19  ? 55  ARG B CB    1 
ATOM 1116  C CG    . ARG B 2 57  ? 107.613 115.314 114.214 1.00 21.19  ? 55  ARG B CG    1 
ATOM 1117  C CD    . ARG B 2 57  ? 106.316 114.677 113.819 1.00 21.19  ? 55  ARG B CD    1 
ATOM 1118  N NE    . ARG B 2 57  ? 106.241 114.508 112.380 1.00 21.19  ? 55  ARG B NE    1 
ATOM 1119  C CZ    . ARG B 2 57  ? 106.188 113.332 111.779 1.00 21.19  ? 55  ARG B CZ    1 
ATOM 1120  N NH1   . ARG B 2 57  ? 106.188 112.226 112.492 1.00 21.19  ? 55  ARG B NH1   1 
ATOM 1121  N NH2   . ARG B 2 57  ? 106.125 113.264 110.468 1.00 21.19  ? 55  ARG B NH2   1 
ATOM 1122  N N     . GLY B 2 58  ? 109.229 115.488 118.545 1.00 19.54  ? 56  GLY B N     1 
ATOM 1123  C CA    . GLY B 2 58  ? 109.224 115.853 119.949 1.00 19.54  ? 56  GLY B CA    1 
ATOM 1124  C C     . GLY B 2 58  ? 110.396 116.733 120.330 1.00 19.54  ? 56  GLY B C     1 
ATOM 1125  O O     . GLY B 2 58  ? 110.253 117.654 121.140 1.00 19.54  ? 56  GLY B O     1 
ATOM 1126  N N     . VAL B 2 59  ? 111.562 116.478 119.735 1.00 18.86  ? 57  VAL B N     1 
ATOM 1127  C CA    . VAL B 2 59  ? 112.734 117.318 119.972 1.00 18.86  ? 57  VAL B CA    1 
ATOM 1128  C C     . VAL B 2 59  ? 112.503 118.737 119.460 1.00 18.86  ? 57  VAL B C     1 
ATOM 1129  O O     . VAL B 2 59  ? 112.796 119.722 120.156 1.00 18.86  ? 57  VAL B O     1 
ATOM 1130  C CB    . VAL B 2 59  ? 113.965 116.670 119.321 1.00 18.86  ? 57  VAL B CB    1 
ATOM 1131  C CG1   . VAL B 2 59  ? 115.096 117.622 119.286 1.00 18.86  ? 57  VAL B CG1   1 
ATOM 1132  C CG2   . VAL B 2 59  ? 114.369 115.461 120.089 1.00 18.86  ? 57  VAL B CG2   1 
ATOM 1133  N N     . LEU B 2 60  ? 111.952 118.862 118.251 1.00 18.14  ? 58  LEU B N     1 
ATOM 1134  C CA    . LEU B 2 60  ? 111.658 120.172 117.683 1.00 18.14  ? 58  LEU B CA    1 
ATOM 1135  C C     . LEU B 2 60  ? 110.587 120.899 118.479 1.00 18.14  ? 58  LEU B C     1 
ATOM 1136  O O     . LEU B 2 60  ? 110.679 122.114 118.675 1.00 18.14  ? 58  LEU B O     1 
ATOM 1137  C CB    . LEU B 2 60  ? 111.227 120.024 116.228 1.00 18.14  ? 58  LEU B CB    1 
ATOM 1138  C CG    . LEU B 2 60  ? 110.747 121.284 115.518 1.00 18.14  ? 58  LEU B CG    1 
ATOM 1139  C CD1   . LEU B 2 60  ? 111.882 122.248 115.363 1.00 18.14  ? 58  LEU B CD1   1 
ATOM 1140  C CD2   . LEU B 2 60  ? 110.146 120.957 114.186 1.00 18.14  ? 58  LEU B CD2   1 
ATOM 1141  N N     . LYS B 2 61  ? 109.584 120.171 118.972 1.00 18.97  ? 59  LYS B N     1 
ATOM 1142  C CA    . LYS B 2 61  ? 108.534 120.792 119.766 1.00 18.97  ? 59  LYS B CA    1 
ATOM 1143  C C     . LYS B 2 61  ? 109.062 121.304 121.096 1.00 18.97  ? 59  LYS B C     1 
ATOM 1144  O O     . LYS B 2 61  ? 108.654 122.373 121.549 1.00 18.97  ? 59  LYS B O     1 
ATOM 1145  C CB    . LYS B 2 61  ? 107.403 119.802 119.994 1.00 18.97  ? 59  LYS B CB    1 
ATOM 1146  C CG    . LYS B 2 61  ? 106.073 120.443 120.245 1.00 18.97  ? 59  LYS B CG    1 
ATOM 1147  C CD    . LYS B 2 61  ? 104.981 119.414 120.218 1.00 18.97  ? 59  LYS B CD    1 
ATOM 1148  C CE    . LYS B 2 61  ? 103.656 120.007 120.637 1.00 18.97  ? 59  LYS B CE    1 
ATOM 1149  N NZ    . LYS B 2 61  ? 103.232 121.106 119.738 1.00 18.97  ? 59  LYS B NZ    1 
ATOM 1150  N N     . VAL B 2 62  ? 109.981 120.572 121.723 1.00 16.93  ? 60  VAL B N     1 
ATOM 1151  C CA    . VAL B 2 62  ? 110.564 121.025 122.983 1.00 16.93  ? 60  VAL B CA    1 
ATOM 1152  C C     . VAL B 2 62  ? 111.427 122.263 122.768 1.00 16.93  ? 60  VAL B C     1 
ATOM 1153  O O     . VAL B 2 62  ? 111.355 123.228 123.545 1.00 16.93  ? 60  VAL B O     1 
ATOM 1154  C CB    . VAL B 2 62  ? 111.342 119.866 123.631 1.00 16.93  ? 60  VAL B CB    1 
ATOM 1155  C CG1   . VAL B 2 62  ? 112.362 120.350 124.622 1.00 16.93  ? 60  VAL B CG1   1 
ATOM 1156  C CG2   . VAL B 2 62  ? 110.381 118.937 124.311 1.00 16.93  ? 60  VAL B CG2   1 
ATOM 1157  N N     . PHE B 2 63  ? 112.207 122.280 121.681 1.00 13.60  ? 61  PHE B N     1 
ATOM 1158  C CA    . PHE B 2 63  ? 113.029 123.443 121.345 1.00 13.60  ? 61  PHE B CA    1 
ATOM 1159  C C     . PHE B 2 63  ? 112.176 124.677 121.089 1.00 13.60  ? 61  PHE B C     1 
ATOM 1160  O O     . PHE B 2 63  ? 112.462 125.768 121.600 1.00 13.60  ? 61  PHE B O     1 
ATOM 1161  C CB    . PHE B 2 63  ? 113.884 123.122 120.122 1.00 13.60  ? 61  PHE B CB    1 
ATOM 1162  C CG    . PHE B 2 63  ? 114.718 124.265 119.641 1.00 13.60  ? 61  PHE B CG    1 
ATOM 1163  C CD1   . PHE B 2 63  ? 115.885 124.601 120.288 1.00 13.60  ? 61  PHE B CD1   1 
ATOM 1164  C CD2   . PHE B 2 63  ? 114.346 124.996 118.531 1.00 13.60  ? 61  PHE B CD2   1 
ATOM 1165  C CE1   . PHE B 2 63  ? 116.645 125.642 119.848 1.00 13.60  ? 61  PHE B CE1   1 
ATOM 1166  C CE2   . PHE B 2 63  ? 115.102 126.042 118.105 1.00 13.60  ? 61  PHE B CE2   1 
ATOM 1167  C CZ    . PHE B 2 63  ? 116.254 126.359 118.758 1.00 13.60  ? 61  PHE B CZ    1 
ATOM 1168  N N     . LEU B 2 64  ? 111.100 124.514 120.325 1.00 15.68  ? 62  LEU B N     1 
ATOM 1169  C CA    . LEU B 2 64  ? 110.258 125.647 119.983 1.00 15.68  ? 62  LEU B CA    1 
ATOM 1170  C C     . LEU B 2 64  ? 109.428 126.127 121.159 1.00 15.68  ? 62  LEU B C     1 
ATOM 1171  O O     . LEU B 2 64  ? 109.185 127.327 121.268 1.00 15.68  ? 62  LEU B O     1 
ATOM 1172  C CB    . LEU B 2 64  ? 109.350 125.288 118.822 1.00 15.68  ? 62  LEU B CB    1 
ATOM 1173  C CG    . LEU B 2 64  ? 109.938 125.484 117.438 1.00 15.68  ? 62  LEU B CG    1 
ATOM 1174  C CD1   . LEU B 2 64  ? 108.833 125.360 116.459 1.00 15.68  ? 62  LEU B CD1   1 
ATOM 1175  C CD2   . LEU B 2 64  ? 110.584 126.832 117.322 1.00 15.68  ? 62  LEU B CD2   1 
ATOM 1176  N N     . GLU B 2 65  ? 108.992 125.222 122.038 1.00 19.09  ? 63  GLU B N     1 
ATOM 1177  C CA    . GLU B 2 65  ? 108.337 125.626 123.277 1.00 19.09  ? 63  GLU B CA    1 
ATOM 1178  C C     . GLU B 2 65  ? 109.254 126.493 124.119 1.00 19.09  ? 63  GLU B C     1 
ATOM 1179  O O     . GLU B 2 65  ? 108.846 127.556 124.601 1.00 19.09  ? 63  GLU B O     1 
ATOM 1180  C CB    . GLU B 2 65  ? 107.916 124.396 124.076 1.00 19.09  ? 63  GLU B CB    1 
ATOM 1181  C CG    . GLU B 2 65  ? 106.600 123.768 123.686 1.00 19.09  ? 63  GLU B CG    1 
ATOM 1182  C CD    . GLU B 2 65  ? 106.474 122.339 124.203 1.00 19.09  ? 63  GLU B CD    1 
ATOM 1183  O OE1   . GLU B 2 65  ? 106.965 122.056 125.315 1.00 19.09  ? 63  GLU B OE1   1 
ATOM 1184  O OE2   . GLU B 2 65  ? 105.891 121.490 123.499 1.00 19.09  ? 63  GLU B OE2   1 
ATOM 1185  N N     . ASN B 2 66  ? 110.520 126.079 124.250 1.00 16.45  ? 64  ASN B N     1 
ATOM 1186  C CA    . ASN B 2 66  ? 111.477 126.819 125.065 1.00 16.45  ? 64  ASN B CA    1 
ATOM 1187  C C     . ASN B 2 66  ? 111.794 128.190 124.494 1.00 16.45  ? 64  ASN B C     1 
ATOM 1188  O O     . ASN B 2 66  ? 111.918 129.151 125.252 1.00 16.45  ? 64  ASN B O     1 
ATOM 1189  C CB    . ASN B 2 66  ? 112.762 126.019 125.212 1.00 16.45  ? 64  ASN B CB    1 
ATOM 1190  C CG    . ASN B 2 66  ? 112.635 124.895 126.197 1.00 16.45  ? 64  ASN B CG    1 
ATOM 1191  O OD1   . ASN B 2 66  ? 112.137 125.078 127.299 1.00 16.45  ? 64  ASN B OD1   1 
ATOM 1192  N ND2   . ASN B 2 66  ? 113.085 123.719 125.806 1.00 16.45  ? 64  ASN B ND2   1 
ATOM 1193  N N     . VAL B 2 67  ? 111.937 128.310 123.180 1.00 15.09  ? 65  VAL B N     1 
ATOM 1194  C CA    . VAL B 2 67  ? 112.253 129.612 122.587 1.00 15.09  ? 65  VAL B CA    1 
ATOM 1195  C C     . VAL B 2 67  ? 111.035 130.522 122.556 1.00 15.09  ? 65  VAL B C     1 
ATOM 1196  O O     . VAL B 2 67  ? 111.133 131.709 122.877 1.00 15.09  ? 65  VAL B O     1 
ATOM 1197  C CB    . VAL B 2 67  ? 112.856 129.432 121.180 1.00 15.09  ? 65  VAL B CB    1 
ATOM 1198  C CG1   . VAL B 2 67  ? 113.193 130.761 120.570 1.00 15.09  ? 65  VAL B CG1   1 
ATOM 1199  C CG2   . VAL B 2 67  ? 114.091 128.612 121.256 1.00 15.09  ? 65  VAL B CG2   1 
ATOM 1200  N N     . ILE B 2 68  ? 109.870 129.987 122.184 1.00 16.98  ? 66  ILE B N     1 
ATOM 1201  C CA    . ILE B 2 68  ? 108.666 130.793 122.048 1.00 16.98  ? 66  ILE B CA    1 
ATOM 1202  C C     . ILE B 2 68  ? 108.172 131.285 123.404 1.00 16.98  ? 66  ILE B C     1 
ATOM 1203  O O     . ILE B 2 68  ? 107.654 132.399 123.499 1.00 16.98  ? 66  ILE B O     1 
ATOM 1204  C CB    . ILE B 2 68  ? 107.613 129.978 121.269 1.00 16.98  ? 66  ILE B CB    1 
ATOM 1205  C CG1   . ILE B 2 68  ? 107.946 129.981 119.783 1.00 16.98  ? 66  ILE B CG1   1 
ATOM 1206  C CG2   . ILE B 2 68  ? 106.231 130.526 121.404 1.00 16.98  ? 66  ILE B CG2   1 
ATOM 1207  C CD1   . ILE B 2 68  ? 107.103 129.055 118.975 1.00 16.98  ? 66  ILE B CD1   1 
ATOM 1208  N N     . ARG B 2 69  ? 108.398 130.526 124.481 1.00 19.80  ? 67  ARG B N     1 
ATOM 1209  C CA    . ARG B 2 69  ? 108.042 131.001 125.818 1.00 19.80  ? 67  ARG B CA    1 
ATOM 1210  C C     . ARG B 2 69  ? 108.825 132.255 126.200 1.00 19.80  ? 67  ARG B C     1 
ATOM 1211  O O     . ARG B 2 69  ? 108.249 133.237 126.683 1.00 19.80  ? 67  ARG B O     1 
ATOM 1212  C CB    . ARG B 2 69  ? 108.287 129.889 126.829 1.00 19.80  ? 67  ARG B CB    1 
ATOM 1213  C CG    . ARG B 2 69  ? 107.752 130.161 128.207 1.00 19.80  ? 67  ARG B CG    1 
ATOM 1214  C CD    . ARG B 2 69  ? 108.198 129.089 129.171 1.00 19.80  ? 67  ARG B CD    1 
ATOM 1215  N NE    . ARG B 2 69  ? 107.725 127.772 128.764 1.00 19.80  ? 67  ARG B NE    1 
ATOM 1216  C CZ    . ARG B 2 69  ? 108.516 126.748 128.461 1.00 19.80  ? 67  ARG B CZ    1 
ATOM 1217  N NH1   . ARG B 2 69  ? 109.832 126.882 128.522 1.00 19.80  ? 67  ARG B NH1   1 
ATOM 1218  N NH2   . ARG B 2 69  ? 107.989 125.590 128.102 1.00 19.80  ? 67  ARG B NH2   1 
ATOM 1219  N N     . ASP B 2 70  ? 110.129 132.267 125.922 1.00 17.23  ? 68  ASP B N     1 
ATOM 1220  C CA    . ASP B 2 70  ? 110.944 133.443 126.198 1.00 17.23  ? 68  ASP B CA    1 
ATOM 1221  C C     . ASP B 2 70  ? 110.629 134.596 125.262 1.00 17.23  ? 68  ASP B C     1 
ATOM 1222  O O     . ASP B 2 70  ? 110.678 135.751 125.682 1.00 17.23  ? 68  ASP B O     1 
ATOM 1223  C CB    . ASP B 2 70  ? 112.420 133.095 126.094 1.00 17.23  ? 68  ASP B CB    1 
ATOM 1224  C CG    . ASP B 2 70  ? 112.914 132.324 127.279 1.00 17.23  ? 68  ASP B CG    1 
ATOM 1225  O OD1   . ASP B 2 70  ? 112.153 132.180 128.254 1.00 17.23  ? 68  ASP B OD1   1 
ATOM 1226  O OD2   . ASP B 2 70  ? 114.066 131.853 127.242 1.00 17.23  ? 68  ASP B OD2   1 
ATOM 1227  N N     . ALA B 2 71  ? 110.315 134.314 123.998 1.00 16.66  ? 69  ALA B N     1 
ATOM 1228  C CA    . ALA B 2 71  ? 110.001 135.387 123.061 1.00 16.66  ? 69  ALA B CA    1 
ATOM 1229  C C     . ALA B 2 71  ? 108.689 136.063 123.418 1.00 16.66  ? 69  ALA B C     1 
ATOM 1230  O O     . ALA B 2 71  ? 108.561 137.284 123.304 1.00 16.66  ? 69  ALA B O     1 
ATOM 1231  C CB    . ALA B 2 71  ? 109.952 134.840 121.641 1.00 16.66  ? 69  ALA B CB    1 
ATOM 1232  N N     . VAL B 2 72  ? 107.715 135.293 123.900 1.00 17.32  ? 70  VAL B N     1 
ATOM 1233  C CA    . VAL B 2 72  ? 106.459 135.868 124.364 1.00 17.32  ? 70  VAL B CA    1 
ATOM 1234  C C     . VAL B 2 72  ? 106.648 136.598 125.691 1.00 17.32  ? 70  VAL B C     1 
ATOM 1235  O O     . VAL B 2 72  ? 105.988 137.608 125.938 1.00 17.32  ? 70  VAL B O     1 
ATOM 1236  C CB    . VAL B 2 72  ? 105.402 134.752 124.424 1.00 17.32  ? 70  VAL B CB    1 
ATOM 1237  C CG1   . VAL B 2 72  ? 104.120 135.191 125.079 1.00 17.32  ? 70  VAL B CG1   1 
ATOM 1238  C CG2   . VAL B 2 72  ? 105.093 134.303 123.032 1.00 17.32  ? 70  VAL B CG2   1 
ATOM 1239  N N     . THR B 2 73  ? 107.582 136.153 126.539 1.00 15.06  ? 71  THR B N     1 
ATOM 1240  C CA    . THR B 2 73  ? 107.894 136.905 127.756 1.00 15.06  ? 71  THR B CA    1 
ATOM 1241  C C     . THR B 2 73  ? 108.519 138.261 127.437 1.00 15.06  ? 71  THR B C     1 
ATOM 1242  O O     . THR B 2 73  ? 108.125 139.283 128.008 1.00 15.06  ? 71  THR B O     1 
ATOM 1243  C CB    . THR B 2 73  ? 108.818 136.086 128.653 1.00 15.06  ? 71  THR B CB    1 
ATOM 1244  O OG1   . THR B 2 73  ? 108.212 134.822 128.926 1.00 15.06  ? 71  THR B OG1   1 
ATOM 1245  C CG2   . THR B 2 73  ? 109.045 136.776 129.955 1.00 15.06  ? 71  THR B CG2   1 
ATOM 1246  N N     . TYR B 2 74  ? 109.470 138.289 126.499 1.00 12.88  ? 72  TYR B N     1 
ATOM 1247  C CA    . TYR B 2 74  ? 110.047 139.543 126.016 1.00 12.88  ? 72  TYR B CA    1 
ATOM 1248  C C     . TYR B 2 74  ? 109.010 140.422 125.337 1.00 12.88  ? 72  TYR B C     1 
ATOM 1249  O O     . TYR B 2 74  ? 109.112 141.648 125.385 1.00 12.88  ? 72  TYR B O     1 
ATOM 1250  C CB    . TYR B 2 74  ? 111.177 139.262 125.026 1.00 12.88  ? 72  TYR B CB    1 
ATOM 1251  C CG    . TYR B 2 74  ? 112.514 138.965 125.635 1.00 12.88  ? 72  TYR B CG    1 
ATOM 1252  C CD1   . TYR B 2 74  ? 113.193 139.919 126.346 1.00 12.88  ? 72  TYR B CD1   1 
ATOM 1253  C CD2   . TYR B 2 74  ? 113.102 137.731 125.478 1.00 12.88  ? 72  TYR B CD2   1 
ATOM 1254  C CE1   . TYR B 2 74  ? 114.411 139.645 126.899 1.00 12.88  ? 72  TYR B CE1   1 
ATOM 1255  C CE2   . TYR B 2 74  ? 114.312 137.445 126.033 1.00 12.88  ? 72  TYR B CE2   1 
ATOM 1256  C CZ    . TYR B 2 74  ? 114.963 138.403 126.737 1.00 12.88  ? 72  TYR B CZ    1 
ATOM 1257  O OH    . TYR B 2 74  ? 116.182 138.128 127.286 1.00 12.88  ? 72  TYR B OH    1 
ATOM 1258  N N     . THR B 2 75  ? 108.028 139.817 124.678 1.00 17.57  ? 73  THR B N     1 
ATOM 1259  C CA    . THR B 2 75  ? 107.005 140.585 123.980 1.00 17.57  ? 73  THR B CA    1 
ATOM 1260  C C     . THR B 2 75  ? 106.030 141.216 124.954 1.00 17.57  ? 73  THR B C     1 
ATOM 1261  O O     . THR B 2 75  ? 105.704 142.399 124.844 1.00 17.57  ? 73  THR B O     1 
ATOM 1262  C CB    . THR B 2 75  ? 106.279 139.674 122.998 1.00 17.57  ? 73  THR B CB    1 
ATOM 1263  O OG1   . THR B 2 75  ? 107.185 139.299 121.960 1.00 17.57  ? 73  THR B OG1   1 
ATOM 1264  C CG2   . THR B 2 75  ? 105.090 140.347 122.395 1.00 17.57  ? 73  THR B CG2   1 
ATOM 1265  N N     . GLU B 2 76  ? 105.560 140.447 125.927 1.00 21.29  ? 74  GLU B N     1 
ATOM 1266  C CA    . GLU B 2 76  ? 104.588 140.962 126.870 1.00 21.29  ? 74  GLU B CA    1 
ATOM 1267  C C     . GLU B 2 76  ? 105.221 141.828 127.945 1.00 21.29  ? 74  GLU B C     1 
ATOM 1268  O O     . GLU B 2 76  ? 104.492 142.511 128.664 1.00 21.29  ? 74  GLU B O     1 
ATOM 1269  C CB    . GLU B 2 76  ? 103.802 139.809 127.491 1.00 21.29  ? 74  GLU B CB    1 
ATOM 1270  C CG    . GLU B 2 76  ? 104.498 139.089 128.626 1.00 21.29  ? 74  GLU B CG    1 
ATOM 1271  C CD    . GLU B 2 76  ? 103.868 137.736 128.930 1.00 21.29  ? 74  GLU B CD    1 
ATOM 1272  O OE1   . GLU B 2 76  ? 102.739 137.486 128.455 1.00 21.29  ? 74  GLU B OE1   1 
ATOM 1273  O OE2   . GLU B 2 76  ? 104.498 136.922 129.641 1.00 21.29  ? 74  GLU B OE2   1 
ATOM 1274  N N     . HIS B 2 77  ? 106.548 141.832 128.075 1.00 17.12  ? 75  HIS B N     1 
ATOM 1275  C CA    . HIS B 2 77  ? 107.173 142.869 128.887 1.00 17.12  ? 75  HIS B CA    1 
ATOM 1276  C C     . HIS B 2 77  ? 107.090 144.225 128.211 1.00 17.12  ? 75  HIS B C     1 
ATOM 1277  O O     . HIS B 2 77  ? 106.887 145.245 128.874 1.00 17.12  ? 75  HIS B O     1 
ATOM 1278  C CB    . HIS B 2 77  ? 108.626 142.536 129.168 1.00 17.12  ? 75  HIS B CB    1 
ATOM 1279  C CG    . HIS B 2 77  ? 109.327 143.580 129.974 1.00 17.12  ? 75  HIS B CG    1 
ATOM 1280  N ND1   . HIS B 2 77  ? 109.122 143.735 131.324 1.00 17.12  ? 75  HIS B ND1   1 
ATOM 1281  C CD2   . HIS B 2 77  ? 110.220 144.528 129.619 1.00 17.12  ? 75  HIS B CD2   1 
ATOM 1282  C CE1   . HIS B 2 77  ? 109.867 144.727 131.767 1.00 17.12  ? 75  HIS B CE1   1 
ATOM 1283  N NE2   . HIS B 2 77  ? 110.543 145.225 130.753 1.00 17.12  ? 75  HIS B NE2   1 
ATOM 1284  N N     . ALA B 2 78  ? 107.234 144.263 126.896 1.00 18.83  ? 76  ALA B N     1 
ATOM 1285  C CA    . ALA B 2 78  ? 107.166 145.500 126.139 1.00 18.83  ? 76  ALA B CA    1 
ATOM 1286  C C     . ALA B 2 78  ? 105.745 145.982 125.912 1.00 18.83  ? 76  ALA B C     1 
ATOM 1287  O O     . ALA B 2 78  ? 105.568 146.997 125.234 1.00 18.83  ? 76  ALA B O     1 
ATOM 1288  C CB    . ALA B 2 78  ? 107.860 145.320 124.797 1.00 18.83  ? 76  ALA B CB    1 
ATOM 1289  N N     . LYS B 2 79  ? 104.756 145.266 126.457 1.00 22.84  ? 77  LYS B N     1 
ATOM 1290  C CA    . LYS B 2 79  ? 103.330 145.555 126.340 1.00 22.84  ? 77  LYS B CA    1 
ATOM 1291  C C     . LYS B 2 79  ? 102.868 145.563 124.890 1.00 22.84  ? 77  LYS B C     1 
ATOM 1292  O O     . LYS B 2 79  ? 102.026 146.368 124.497 1.00 22.84  ? 77  LYS B O     1 
ATOM 1293  C CB    . LYS B 2 79  ? 102.962 146.861 127.043 1.00 22.84  ? 77  LYS B CB    1 
ATOM 1294  C CG    . LYS B 2 79  ? 102.920 146.749 128.544 1.00 22.84  ? 77  LYS B CG    1 
ATOM 1295  C CD    . LYS B 2 79  ? 102.584 148.076 129.163 1.00 22.84  ? 77  LYS B CD    1 
ATOM 1296  C CE    . LYS B 2 79  ? 103.665 149.096 128.873 1.00 22.84  ? 77  LYS B CE    1 
ATOM 1297  N NZ    . LYS B 2 79  ? 104.823 148.936 129.787 1.00 22.84  ? 77  LYS B NZ    1 
ATOM 1298  N N     . ARG B 2 80  ? 103.416 144.657 124.094 1.00 22.60  ? 78  ARG B N     1 
ATOM 1299  C CA    . ARG B 2 80  ? 103.034 144.486 122.704 1.00 22.60  ? 78  ARG B CA    1 
ATOM 1300  C C     . ARG B 2 80  ? 102.117 143.285 122.552 1.00 22.60  ? 78  ARG B C     1 
ATOM 1301  O O     . ARG B 2 80  ? 101.993 142.448 123.443 1.00 22.60  ? 78  ARG B O     1 
ATOM 1302  C CB    . ARG B 2 80  ? 104.266 144.303 121.825 1.00 22.60  ? 78  ARG B CB    1 
ATOM 1303  C CG    . ARG B 2 80  ? 105.135 145.514 121.719 1.00 22.60  ? 78  ARG B CG    1 
ATOM 1304  C CD    . ARG B 2 80  ? 106.222 145.298 120.704 1.00 22.60  ? 78  ARG B CD    1 
ATOM 1305  N NE    . ARG B 2 80  ? 107.480 144.962 121.348 1.00 22.60  ? 78  ARG B NE    1 
ATOM 1306  C CZ    . ARG B 2 80  ? 108.019 143.755 121.333 1.00 22.60  ? 78  ARG B CZ    1 
ATOM 1307  N NH1   . ARG B 2 80  ? 107.410 142.772 120.699 1.00 22.60  ? 78  ARG B NH1   1 
ATOM 1308  N NH2   . ARG B 2 80  ? 109.166 143.531 121.946 1.00 22.60  ? 78  ARG B NH2   1 
ATOM 1309  N N     . LYS B 2 81  ? 101.461 143.221 121.405 1.00 28.63  ? 79  LYS B N     1 
ATOM 1310  C CA    . LYS B 2 81  ? 100.703 142.051 121.005 1.00 28.63  ? 79  LYS B CA    1 
ATOM 1311  C C     . LYS B 2 81  ? 101.372 141.320 119.861 1.00 28.63  ? 79  LYS B C     1 
ATOM 1312  O O     . LYS B 2 81  ? 100.965 140.209 119.531 1.00 28.63  ? 79  LYS B O     1 
ATOM 1313  C CB    . LYS B 2 81  ? 99.278  142.445 120.600 1.00 28.63  ? 79  LYS B CB    1 
ATOM 1314  C CG    . LYS B 2 81  ? 98.315  142.604 121.755 1.00 28.63  ? 79  LYS B CG    1 
ATOM 1315  C CD    . LYS B 2 81  ? 98.326  144.020 122.270 1.00 28.63  ? 79  LYS B CD    1 
ATOM 1316  C CE    . LYS B 2 81  ? 97.639  144.127 123.605 1.00 28.63  ? 79  LYS B CE    1 
ATOM 1317  N NZ    . LYS B 2 81  ? 97.929  145.441 124.231 1.00 28.63  ? 79  LYS B NZ    1 
ATOM 1318  N N     . THR B 2 82  ? 102.397 141.917 119.262 1.00 27.17  ? 80  THR B N     1 
ATOM 1319  C CA    . THR B 2 82  ? 103.112 141.376 118.114 1.00 27.17  ? 80  THR B CA    1 
ATOM 1320  C C     . THR B 2 82  ? 104.454 140.863 118.599 1.00 27.17  ? 80  THR B C     1 
ATOM 1321  O O     . THR B 2 82  ? 105.190 141.591 119.266 1.00 27.17  ? 80  THR B O     1 
ATOM 1322  C CB    . THR B 2 82  ? 103.294 142.441 117.036 1.00 27.17  ? 80  THR B CB    1 
ATOM 1323  O OG1   . THR B 2 82  ? 102.017 142.947 116.647 1.00 27.17  ? 80  THR B OG1   1 
ATOM 1324  C CG2   . THR B 2 82  ? 103.956 141.873 115.822 1.00 27.17  ? 80  THR B CG2   1 
ATOM 1325  N N     . VAL B 2 83  ? 104.768 139.611 118.284 1.00 21.62  ? 81  VAL B N     1 
ATOM 1326  C CA    . VAL B 2 83  ? 106.110 139.096 118.526 1.00 21.62  ? 81  VAL B CA    1 
ATOM 1327  C C     . VAL B 2 83  ? 106.981 139.520 117.353 1.00 21.62  ? 81  VAL B C     1 
ATOM 1328  O O     . VAL B 2 83  ? 106.790 139.052 116.231 1.00 21.62  ? 81  VAL B O     1 
ATOM 1329  C CB    . VAL B 2 83  ? 106.116 137.577 118.705 1.00 21.62  ? 81  VAL B CB    1 
ATOM 1330  C CG1   . VAL B 2 83  ? 107.477 137.110 119.111 1.00 21.62  ? 81  VAL B CG1   1 
ATOM 1331  C CG2   . VAL B 2 83  ? 105.117 137.169 119.738 1.00 21.62  ? 81  VAL B CG2   1 
ATOM 1332  N N     . THR B 2 84  ? 107.925 140.414 117.605 1.00 20.29  ? 82  THR B N     1 
ATOM 1333  C CA    . THR B 2 84  ? 108.819 140.894 116.569 1.00 20.29  ? 82  THR B CA    1 
ATOM 1334  C C     . THR B 2 84  ? 109.993 139.936 116.406 1.00 20.29  ? 82  THR B C     1 
ATOM 1335  O O     . THR B 2 84  ? 110.138 138.964 117.143 1.00 20.29  ? 82  THR B O     1 
ATOM 1336  C CB    . THR B 2 84  ? 109.287 142.305 116.896 1.00 20.29  ? 82  THR B CB    1 
ATOM 1337  O OG1   . THR B 2 84  ? 110.107 142.277 118.063 1.00 20.29  ? 82  THR B OG1   1 
ATOM 1338  C CG2   . THR B 2 84  ? 108.111 143.193 117.170 1.00 20.29  ? 82  THR B CG2   1 
ATOM 1339  N N     . ALA B 2 85  ? 110.838 140.199 115.410 1.00 17.96  ? 83  ALA B N     1 
ATOM 1340  C CA    . ALA B 2 85  ? 111.993 139.340 115.185 1.00 17.96  ? 83  ALA B CA    1 
ATOM 1341  C C     . ALA B 2 85  ? 113.056 139.557 116.236 1.00 17.96  ? 83  ALA B C     1 
ATOM 1342  O O     . ALA B 2 85  ? 113.840 138.647 116.517 1.00 17.96  ? 83  ALA B O     1 
ATOM 1343  C CB    . ALA B 2 85  ? 112.579 139.584 113.804 1.00 17.96  ? 83  ALA B CB    1 
ATOM 1344  N N     . MET B 2 86  ? 113.092 140.744 116.838 1.00 20.45  ? 84  MET B N     1 
ATOM 1345  C CA    . MET B 2 86  ? 114.066 141.010 117.882 1.00 20.45  ? 84  MET B CA    1 
ATOM 1346  C C     . MET B 2 86  ? 113.763 140.232 119.144 1.00 20.45  ? 84  MET B C     1 
ATOM 1347  O O     . MET B 2 86  ? 114.689 139.842 119.849 1.00 20.45  ? 84  MET B O     1 
ATOM 1348  C CB    . MET B 2 86  ? 114.128 142.498 118.187 1.00 20.45  ? 84  MET B CB    1 
ATOM 1349  C CG    . MET B 2 86  ? 114.883 143.302 117.162 1.00 20.45  ? 84  MET B CG    1 
ATOM 1350  S SD    . MET B 2 86  ? 116.315 142.438 116.502 1.00 20.45  ? 84  MET B SD    1 
ATOM 1351  C CE    . MET B 2 86  ? 117.457 142.537 117.873 1.00 20.45  ? 84  MET B CE    1 
ATOM 1352  N N     . ASP B 2 87  ? 112.487 139.972 119.430 1.00 18.21  ? 85  ASP B N     1 
ATOM 1353  C CA    . ASP B 2 87  ? 112.126 139.142 120.574 1.00 18.21  ? 85  ASP B CA    1 
ATOM 1354  C C     . ASP B 2 87  ? 112.613 137.718 120.397 1.00 18.21  ? 85  ASP B C     1 
ATOM 1355  O O     . ASP B 2 87  ? 113.098 137.103 121.348 1.00 18.21  ? 85  ASP B O     1 
ATOM 1356  C CB    . ASP B 2 87  ? 110.621 139.154 120.771 1.00 18.21  ? 85  ASP B CB    1 
ATOM 1357  C CG    . ASP B 2 87  ? 110.088 140.525 121.057 1.00 18.21  ? 85  ASP B CG    1 
ATOM 1358  O OD1   . ASP B 2 87  ? 110.870 141.396 121.476 1.00 18.21  ? 85  ASP B OD1   1 
ATOM 1359  O OD2   . ASP B 2 87  ? 108.876 140.735 120.874 1.00 18.21  ? 85  ASP B OD2   1 
ATOM 1360  N N     . VAL B 2 88  ? 112.525 137.196 119.174 1.00 14.89  ? 86  VAL B N     1 
ATOM 1361  C CA    . VAL B 2 88  ? 113.046 135.871 118.863 1.00 14.89  ? 86  VAL B CA    1 
ATOM 1362  C C     . VAL B 2 88  ? 114.562 135.850 118.964 1.00 14.89  ? 86  VAL B C     1 
ATOM 1363  O O     . VAL B 2 88  ? 115.143 134.897 119.485 1.00 14.89  ? 86  VAL B O     1 
ATOM 1364  C CB    . VAL B 2 88  ? 112.567 135.440 117.469 1.00 14.89  ? 86  VAL B CB    1 
ATOM 1365  C CG1   . VAL B 2 88  ? 113.025 134.061 117.165 1.00 14.89  ? 86  VAL B CG1   1 
ATOM 1366  C CG2   . VAL B 2 88  ? 111.074 135.513 117.392 1.00 14.89  ? 86  VAL B CG2   1 
ATOM 1367  N N     . VAL B 2 89  ? 115.221 136.906 118.489 1.00 14.30  ? 87  VAL B N     1 
ATOM 1368  C CA    . VAL B 2 89  ? 116.678 136.967 118.529 1.00 14.30  ? 87  VAL B CA    1 
ATOM 1369  C C     . VAL B 2 89  ? 117.183 137.052 119.966 1.00 14.30  ? 87  VAL B C     1 
ATOM 1370  O O     . VAL B 2 89  ? 118.159 136.391 120.333 1.00 14.30  ? 87  VAL B O     1 
ATOM 1371  C CB    . VAL B 2 89  ? 117.168 138.136 117.654 1.00 14.30  ? 87  VAL B CB    1 
ATOM 1372  C CG1   . VAL B 2 89  ? 118.601 138.444 117.891 1.00 14.30  ? 87  VAL B CG1   1 
ATOM 1373  C CG2   . VAL B 2 89  ? 116.999 137.776 116.210 1.00 14.30  ? 87  VAL B CG2   1 
ATOM 1374  N N     . TYR B 2 90  ? 116.480 137.793 120.821 1.00 14.84  ? 88  TYR B N     1 
ATOM 1375  C CA    . TYR B 2 90  ? 116.857 137.868 122.229 1.00 14.84  ? 88  TYR B CA    1 
ATOM 1376  C C     . TYR B 2 90  ? 116.564 136.567 122.959 1.00 14.84  ? 88  TYR B C     1 
ATOM 1377  O O     . TYR B 2 90  ? 117.356 136.132 123.803 1.00 14.84  ? 88  TYR B O     1 
ATOM 1378  C CB    . TYR B 2 90  ? 116.125 139.019 122.905 1.00 14.84  ? 88  TYR B CB    1 
ATOM 1379  C CG    . TYR B 2 90  ? 116.486 140.372 122.378 1.00 14.84  ? 88  TYR B CG    1 
ATOM 1380  C CD1   . TYR B 2 90  ? 117.746 140.622 121.877 1.00 14.84  ? 88  TYR B CD1   1 
ATOM 1381  C CD2   . TYR B 2 90  ? 115.572 141.403 122.386 1.00 14.84  ? 88  TYR B CD2   1 
ATOM 1382  C CE1   . TYR B 2 90  ? 118.087 141.844 121.393 1.00 14.84  ? 88  TYR B CE1   1 
ATOM 1383  C CE2   . TYR B 2 90  ? 115.904 142.641 121.895 1.00 14.84  ? 88  TYR B CE2   1 
ATOM 1384  C CZ    . TYR B 2 90  ? 117.168 142.851 121.404 1.00 14.84  ? 88  TYR B CZ    1 
ATOM 1385  O OH    . TYR B 2 90  ? 117.519 144.085 120.916 1.00 14.84  ? 88  TYR B OH    1 
ATOM 1386  N N     . ALA B 2 91  ? 115.426 135.936 122.648 1.00 14.84  ? 89  ALA B N     1 
ATOM 1387  C CA    . ALA B 2 91  ? 115.067 134.654 123.239 1.00 14.84  ? 89  ALA B CA    1 
ATOM 1388  C C     . ALA B 2 91  ? 116.037 133.555 122.857 1.00 14.84  ? 89  ALA B C     1 
ATOM 1389  O O     . ALA B 2 91  ? 116.258 132.632 123.640 1.00 14.84  ? 89  ALA B O     1 
ATOM 1390  C CB    . ALA B 2 91  ? 113.666 134.265 122.800 1.00 14.84  ? 89  ALA B CB    1 
ATOM 1391  N N     . LEU B 2 92  ? 116.603 133.621 121.659 1.00 13.48  ? 90  LEU B N     1 
ATOM 1392  C CA    . LEU B 2 92  ? 117.624 132.667 121.256 1.00 13.48  ? 90  LEU B CA    1 
ATOM 1393  C C     . LEU B 2 92  ? 118.965 132.987 121.879 1.00 13.48  ? 90  LEU B C     1 
ATOM 1394  O O     . LEU B 2 92  ? 119.693 132.077 122.274 1.00 13.48  ? 90  LEU B O     1 
ATOM 1395  C CB    . LEU B 2 92  ? 117.759 132.655 119.745 1.00 13.48  ? 90  LEU B CB    1 
ATOM 1396  C CG    . LEU B 2 92  ? 116.644 131.974 118.989 1.00 13.48  ? 90  LEU B CG    1 
ATOM 1397  C CD1   . LEU B 2 92  ? 116.611 132.515 117.597 1.00 13.48  ? 90  LEU B CD1   1 
ATOM 1398  C CD2   . LEU B 2 92  ? 116.893 130.507 119.006 1.00 13.48  ? 90  LEU B CD2   1 
ATOM 1399  N N     . LYS B 2 93  ? 119.312 134.271 121.955 1.00 14.48  ? 91  LYS B N     1 
ATOM 1400  C CA    . LYS B 2 93  ? 120.583 134.703 122.520 1.00 14.48  ? 91  LYS B CA    1 
ATOM 1401  C C     . LYS B 2 93  ? 120.855 134.377 123.973 1.00 14.48  ? 91  LYS B C     1 
ATOM 1402  O O     . LYS B 2 93  ? 121.998 134.103 124.341 1.00 14.48  ? 91  LYS B O     1 
ATOM 1403  C CB    . LYS B 2 93  ? 120.734 136.203 122.300 1.00 14.48  ? 91  LYS B CB    1 
ATOM 1404  C CG    . LYS B 2 93  ? 121.998 136.838 122.816 1.00 14.48  ? 91  LYS B CG    1 
ATOM 1405  C CD    . LYS B 2 93  ? 122.261 138.156 122.114 1.00 14.48  ? 91  LYS B CD    1 
ATOM 1406  C CE    . LYS B 2 93  ? 121.042 139.079 122.149 1.00 14.48  ? 91  LYS B CE    1 
ATOM 1407  N NZ    . LYS B 2 93  ? 120.963 139.972 120.951 1.00 14.48  ? 91  LYS B NZ    1 
ATOM 1408  N N     . ARG B 2 94  ? 119.828 134.364 124.808 1.00 16.09  ? 92  ARG B N     1 
ATOM 1409  C CA    . ARG B 2 94  ? 120.046 133.970 126.192 1.00 16.09  ? 92  ARG B CA    1 
ATOM 1410  C C     . ARG B 2 94  ? 119.884 132.442 126.431 1.00 16.09  ? 92  ARG B C     1 
ATOM 1411  O O     . ARG B 2 94  ? 119.859 131.949 127.559 1.00 16.09  ? 92  ARG B O     1 
ATOM 1412  C CB    . ARG B 2 94  ? 119.013 134.644 127.089 1.00 16.09  ? 92  ARG B CB    1 
ATOM 1413  C CG    . ARG B 2 94  ? 117.580 134.306 126.815 1.00 16.09  ? 92  ARG B CG    1 
ATOM 1414  C CD    . ARG B 2 94  ? 116.720 135.061 127.794 1.00 16.09  ? 92  ARG B CD    1 
ATOM 1415  N NE    . ARG B 2 94  ? 116.981 134.597 129.144 1.00 16.09  ? 92  ARG B NE    1 
ATOM 1416  C CZ    . ARG B 2 94  ? 116.390 133.543 129.687 1.00 16.09  ? 92  ARG B CZ    1 
ATOM 1417  N NH1   . ARG B 2 94  ? 115.491 132.858 128.999 1.00 16.09  ? 92  ARG B NH1   1 
ATOM 1418  N NH2   . ARG B 2 94  ? 116.695 133.176 130.918 1.00 16.09  ? 92  ARG B NH2   1 
ATOM 1419  N N     . GLN B 2 95  ? 119.832 131.696 125.333 1.00 15.62  ? 93  GLN B N     1 
ATOM 1420  C CA    . GLN B 2 95  ? 119.880 130.244 125.360 1.00 15.62  ? 93  GLN B CA    1 
ATOM 1421  C C     . GLN B 2 95  ? 121.184 129.828 124.704 1.00 15.62  ? 93  GLN B C     1 
ATOM 1422  O O     . GLN B 2 95  ? 121.403 128.638 124.486 1.00 15.62  ? 93  GLN B O     1 
ATOM 1423  C CB    . GLN B 2 95  ? 118.716 129.496 124.729 1.00 15.62  ? 93  GLN B CB    1 
ATOM 1424  C CG    . GLN B 2 95  ? 117.408 129.984 125.263 1.00 15.62  ? 93  GLN B CG    1 
ATOM 1425  C CD    . GLN B 2 95  ? 116.234 129.425 124.537 1.00 15.62  ? 93  GLN B CD    1 
ATOM 1426  O OE1   . GLN B 2 95  ? 116.383 128.612 123.631 1.00 15.62  ? 93  GLN B OE1   1 
ATOM 1427  N NE2   . GLN B 2 95  ? 115.050 129.848 124.933 1.00 15.62  ? 93  GLN B NE2   1 
ATOM 1428  N N     . GLY B 2 96  ? 122.055 130.779 124.390 1.00 13.67  ? 94  GLY B N     1 
ATOM 1429  C CA    . GLY B 2 96  ? 123.313 130.463 123.758 1.00 13.67  ? 94  GLY B CA    1 
ATOM 1430  C C     . GLY B 2 96  ? 123.192 130.038 122.321 1.00 13.67  ? 94  GLY B C     1 
ATOM 1431  O O     . GLY B 2 96  ? 123.949 129.176 121.873 1.00 13.67  ? 94  GLY B O     1 
ATOM 1432  N N     . ARG B 2 97  ? 122.249 130.610 121.586 1.00 15.63  ? 95  ARG B N     1 
ATOM 1433  C CA    . ARG B 2 97  ? 121.951 130.262 120.205 1.00 15.63  ? 95  ARG B CA    1 
ATOM 1434  C C     . ARG B 2 97  ? 121.820 131.510 119.366 1.00 15.63  ? 95  ARG B C     1 
ATOM 1435  O O     . ARG B 2 97  ? 120.804 131.730 118.713 1.00 15.63  ? 95  ARG B O     1 
ATOM 1436  C CB    . ARG B 2 97  ? 120.692 129.426 120.102 1.00 15.63  ? 95  ARG B CB    1 
ATOM 1437  C CG    . ARG B 2 97  ? 120.862 128.081 120.696 1.00 15.63  ? 95  ARG B CG    1 
ATOM 1438  C CD    . ARG B 2 97  ? 119.959 127.088 120.096 1.00 15.63  ? 95  ARG B CD    1 
ATOM 1439  N NE    . ARG B 2 97  ? 120.547 125.766 120.231 1.00 15.63  ? 95  ARG B NE    1 
ATOM 1440  C CZ    . ARG B 2 97  ? 121.274 125.187 119.286 1.00 15.63  ? 95  ARG B CZ    1 
ATOM 1441  N NH1   . ARG B 2 97  ? 121.486 125.804 118.134 1.00 15.63  ? 95  ARG B NH1   1 
ATOM 1442  N NH2   . ARG B 2 97  ? 121.779 123.986 119.487 1.00 15.63  ? 95  ARG B NH2   1 
ATOM 1443  N N     . THR B 2 98  ? 122.845 132.363 119.442 1.00 19.21  ? 96  THR B N     1 
ATOM 1444  C CA    . THR B 2 98  ? 122.929 133.617 118.700 1.00 19.21  ? 96  THR B CA    1 
ATOM 1445  C C     . THR B 2 98  ? 122.666 133.440 117.212 1.00 19.21  ? 96  THR B C     1 
ATOM 1446  O O     . THR B 2 98  ? 123.212 132.545 116.574 1.00 19.21  ? 96  THR B O     1 
ATOM 1447  C CB    . THR B 2 98  ? 124.316 134.213 118.904 1.00 19.21  ? 96  THR B CB    1 
ATOM 1448  O OG1   . THR B 2 98  ? 124.684 134.082 120.279 1.00 19.21  ? 96  THR B OG1   1 
ATOM 1449  C CG2   . THR B 2 98  ? 124.344 135.661 118.525 1.00 19.21  ? 96  THR B CG2   1 
ATOM 1450  N N     . LEU B 2 99  ? 121.804 134.281 116.669 1.00 18.16  ? 97  LEU B N     1 
ATOM 1451  C CA    . LEU B 2 99  ? 121.383 134.192 115.283 1.00 18.16  ? 97  LEU B CA    1 
ATOM 1452  C C     . LEU B 2 99  ? 121.704 135.507 114.591 1.00 18.16  ? 97  LEU B C     1 
ATOM 1453  O O     . LEU B 2 99  ? 121.261 136.568 115.034 1.00 18.16  ? 97  LEU B O     1 
ATOM 1454  C CB    . LEU B 2 99  ? 119.895 133.874 115.208 1.00 18.16  ? 97  LEU B CB    1 
ATOM 1455  C CG    . LEU B 2 99  ? 119.166 133.940 113.882 1.00 18.16  ? 97  LEU B CG    1 
ATOM 1456  C CD1   . LEU B 2 99  ? 119.385 132.696 113.099 1.00 18.16  ? 97  LEU B CD1   1 
ATOM 1457  C CD2   . LEU B 2 99  ? 117.721 134.108 114.182 1.00 18.16  ? 97  LEU B CD2   1 
ATOM 1458  N N     . TYR B 2 100 ? 122.485 135.435 113.517 1.00 35.70  ? 98  TYR B N     1 
ATOM 1459  C CA    . TYR B 2 100 ? 122.888 136.615 112.769 1.00 35.70  ? 98  TYR B CA    1 
ATOM 1460  C C     . TYR B 2 100 ? 122.014 136.753 111.538 1.00 35.70  ? 98  TYR B C     1 
ATOM 1461  O O     . TYR B 2 100 ? 121.804 135.781 110.817 1.00 35.70  ? 98  TYR B O     1 
ATOM 1462  C CB    . TYR B 2 100 ? 124.343 136.523 112.326 1.00 35.70  ? 98  TYR B CB    1 
ATOM 1463  C CG    . TYR B 2 100 ? 125.392 136.696 113.388 1.00 35.70  ? 98  TYR B CG    1 
ATOM 1464  C CD1   . TYR B 2 100 ? 125.064 136.937 114.706 1.00 35.70  ? 98  TYR B CD1   1 
ATOM 1465  C CD2   . TYR B 2 100 ? 126.725 136.619 113.053 1.00 35.70  ? 98  TYR B CD2   1 
ATOM 1466  C CE1   . TYR B 2 100 ? 126.028 137.079 115.649 1.00 35.70  ? 98  TYR B CE1   1 
ATOM 1467  C CE2   . TYR B 2 100 ? 127.694 136.774 113.988 1.00 35.70  ? 98  TYR B CE2   1 
ATOM 1468  C CZ    . TYR B 2 100 ? 127.342 136.996 115.282 1.00 35.70  ? 98  TYR B CZ    1 
ATOM 1469  O OH    . TYR B 2 100 ? 128.331 137.139 116.211 1.00 35.70  ? 98  TYR B OH    1 
ATOM 1470  N N     . GLY B 2 101 ? 121.514 137.952 111.293 1.00 24.86  ? 99  GLY B N     1 
ATOM 1471  C CA    . GLY B 2 101 ? 120.816 138.182 110.052 1.00 24.86  ? 99  GLY B CA    1 
ATOM 1472  C C     . GLY B 2 101 ? 119.469 138.838 110.187 1.00 24.86  ? 99  GLY B C     1 
ATOM 1473  O O     . GLY B 2 101 ? 118.844 139.177 109.183 1.00 24.86  ? 99  GLY B O     1 
ATOM 1474  N N     . PHE B 2 102 ? 119.004 139.017 111.417 1.00 22.03  ? 100 PHE B N     1 
ATOM 1475  C CA    . PHE B 2 102 ? 117.680 139.560 111.666 1.00 22.03  ? 100 PHE B CA    1 
ATOM 1476  C C     . PHE B 2 102 ? 117.696 140.763 112.589 1.00 22.03  ? 100 PHE B C     1 
ATOM 1477  O O     . PHE B 2 102 ? 116.678 141.040 113.228 1.00 22.03  ? 100 PHE B O     1 
ATOM 1478  C CB    . PHE B 2 102 ? 116.762 138.486 112.260 1.00 22.03  ? 100 PHE B CB    1 
ATOM 1479  C CG    . PHE B 2 102 ? 116.478 137.357 111.329 1.00 22.03  ? 100 PHE B CG    1 
ATOM 1480  C CD1   . PHE B 2 102 ? 115.401 137.409 110.475 1.00 22.03  ? 100 PHE B CD1   1 
ATOM 1481  C CD2   . PHE B 2 102 ? 117.285 136.244 111.305 1.00 22.03  ? 100 PHE B CD2   1 
ATOM 1482  C CE1   . PHE B 2 102 ? 115.143 136.377 109.617 1.00 22.03  ? 100 PHE B CE1   1 
ATOM 1483  C CE2   . PHE B 2 102 ? 117.025 135.212 110.447 1.00 22.03  ? 100 PHE B CE2   1 
ATOM 1484  C CZ    . PHE B 2 102 ? 115.957 135.279 109.605 1.00 22.03  ? 100 PHE B CZ    1 
ATOM 1485  N N     . GLY B 2 103 ? 118.806 141.479 112.676 1.00 21.86  ? 101 GLY B N     1 
ATOM 1486  C CA    . GLY B 2 103 ? 118.948 142.549 113.637 1.00 21.86  ? 101 GLY B CA    1 
ATOM 1487  C C     . GLY B 2 103 ? 119.434 141.996 114.955 1.00 21.86  ? 101 GLY B C     1 
ATOM 1488  O O     . GLY B 2 103 ? 120.028 142.706 115.757 1.00 21.86  ? 101 GLY B O     1 
ATOM 1489  N N     . LYS C 3 13  ? 111.579 157.322 164.328 1.00 66.19  ? 13  LYS C N     1 
ATOM 1490  C CA    . LYS C 3 13  ? 112.645 156.327 164.394 1.00 66.19  ? 13  LYS C CA    1 
ATOM 1491  C C     . LYS C 3 13  ? 112.981 155.755 163.022 1.00 66.19  ? 13  LYS C C     1 
ATOM 1492  O O     . LYS C 3 13  ? 112.189 155.850 162.085 1.00 66.19  ? 13  LYS C O     1 
ATOM 1493  C CB    . LYS C 3 13  ? 112.262 155.189 165.343 1.00 66.19  ? 13  LYS C CB    1 
ATOM 1494  C CG    . LYS C 3 13  ? 112.102 155.618 166.783 1.00 66.19  ? 13  LYS C CG    1 
ATOM 1495  C CD    . LYS C 3 13  ? 113.402 156.182 167.316 1.00 66.19  ? 13  LYS C CD    1 
ATOM 1496  C CE    . LYS C 3 13  ? 114.460 155.104 167.451 1.00 66.19  ? 13  LYS C CE    1 
ATOM 1497  N NZ    . LYS C 3 13  ? 115.712 155.669 168.017 1.00 66.19  ? 13  LYS C NZ    1 
ATOM 1498  N N     . ALA C 3 14  ? 114.166 155.157 162.919 1.00 56.72  ? 14  ALA C N     1 
ATOM 1499  C CA    . ALA C 3 14  ? 114.606 154.528 161.679 1.00 56.72  ? 14  ALA C CA    1 
ATOM 1500  C C     . ALA C 3 14  ? 114.124 153.087 161.648 1.00 56.72  ? 14  ALA C C     1 
ATOM 1501  O O     . ALA C 3 14  ? 114.323 152.337 162.607 1.00 56.72  ? 14  ALA C O     1 
ATOM 1502  C CB    . ALA C 3 14  ? 116.124 154.594 161.560 1.00 56.72  ? 14  ALA C CB    1 
ATOM 1503  N N     . LYS C 3 15  ? 113.482 152.701 160.554 1.00 44.78  ? 15  LYS C N     1 
ATOM 1504  C CA    . LYS C 3 15  ? 113.061 151.330 160.331 1.00 44.78  ? 15  LYS C CA    1 
ATOM 1505  C C     . LYS C 3 15  ? 113.722 150.809 159.066 1.00 44.78  ? 15  LYS C C     1 
ATOM 1506  O O     . LYS C 3 15  ? 113.829 151.529 158.071 1.00 44.78  ? 15  LYS C O     1 
ATOM 1507  C CB    . LYS C 3 15  ? 111.540 151.231 160.212 1.00 44.78  ? 15  LYS C CB    1 
ATOM 1508  C CG    . LYS C 3 15  ? 111.004 149.820 160.343 1.00 44.78  ? 15  LYS C CG    1 
ATOM 1509  C CD    . LYS C 3 15  ? 109.516 149.770 160.066 1.00 44.78  ? 15  LYS C CD    1 
ATOM 1510  C CE    . LYS C 3 15  ? 108.969 148.361 160.227 1.00 44.78  ? 15  LYS C CE    1 
ATOM 1511  N NZ    . LYS C 3 15  ? 107.589 148.232 159.691 1.00 44.78  ? 15  LYS C NZ    1 
ATOM 1512  N N     . SER C 3 16  ? 114.178 149.564 159.116 1.00 36.50  ? 16  SER C N     1 
ATOM 1513  C CA    . SER C 3 16  ? 114.805 148.956 157.961 1.00 36.50  ? 16  SER C CA    1 
ATOM 1514  C C     . SER C 3 16  ? 113.776 148.679 156.881 1.00 36.50  ? 16  SER C C     1 
ATOM 1515  O O     . SER C 3 16  ? 112.607 148.391 157.148 1.00 36.50  ? 16  SER C O     1 
ATOM 1516  C CB    . SER C 3 16  ? 115.504 147.656 158.344 1.00 36.50  ? 16  SER C CB    1 
ATOM 1517  O OG    . SER C 3 16  ? 116.606 147.900 159.191 1.00 36.50  ? 16  SER C OG    1 
ATOM 1518  N N     . ARG C 3 17  ? 114.230 148.764 155.640 1.00 28.90  ? 17  ARG C N     1 
ATOM 1519  C CA    . ARG C 3 17  ? 113.391 148.383 154.523 1.00 28.90  ? 17  ARG C CA    1 
ATOM 1520  C C     . ARG C 3 17  ? 113.169 146.886 154.449 1.00 28.90  ? 17  ARG C C     1 
ATOM 1521  O O     . ARG C 3 17  ? 112.166 146.455 153.873 1.00 28.90  ? 17  ARG C O     1 
ATOM 1522  C CB    . ARG C 3 17  ? 114.005 148.885 153.233 1.00 28.90  ? 17  ARG C CB    1 
ATOM 1523  C CG    . ARG C 3 17  ? 114.225 150.355 153.241 1.00 28.90  ? 17  ARG C CG    1 
ATOM 1524  C CD    . ARG C 3 17  ? 114.287 150.862 151.848 1.00 28.90  ? 17  ARG C CD    1 
ATOM 1525  N NE    . ARG C 3 17  ? 115.657 151.089 151.442 1.00 28.90  ? 17  ARG C NE    1 
ATOM 1526  C CZ    . ARG C 3 17  ? 116.036 151.231 150.186 1.00 28.90  ? 17  ARG C CZ    1 
ATOM 1527  N NH1   . ARG C 3 17  ? 115.142 151.161 149.217 1.00 28.90  ? 17  ARG C NH1   1 
ATOM 1528  N NH2   . ARG C 3 17  ? 117.307 151.441 149.907 1.00 28.90  ? 17  ARG C NH2   1 
ATOM 1529  N N     . SER C 3 18  ? 114.066 146.092 155.028 1.00 27.09  ? 18  SER C N     1 
ATOM 1530  C CA    . SER C 3 18  ? 113.808 144.674 155.196 1.00 27.09  ? 18  SER C CA    1 
ATOM 1531  C C     . SER C 3 18  ? 112.626 144.422 156.116 1.00 27.09  ? 18  SER C C     1 
ATOM 1532  O O     . SER C 3 18  ? 111.785 143.575 155.810 1.00 27.09  ? 18  SER C O     1 
ATOM 1533  C CB    . SER C 3 18  ? 115.043 143.978 155.745 1.00 27.09  ? 18  SER C CB    1 
ATOM 1534  O OG    . SER C 3 18  ? 116.056 143.920 154.768 1.00 27.09  ? 18  SER C OG    1 
ATOM 1535  N N     . ASN C 3 19  ? 112.536 145.142 157.228 1.00 32.32  ? 19  ASN C N     1 
ATOM 1536  C CA    . ASN C 3 19  ? 111.389 145.009 158.111 1.00 32.32  ? 19  ASN C CA    1 
ATOM 1537  C C     . ASN C 3 19  ? 110.133 145.625 157.539 1.00 32.32  ? 19  ASN C C     1 
ATOM 1538  O O     . ASN C 3 19  ? 109.038 145.157 157.861 1.00 32.32  ? 19  ASN C O     1 
ATOM 1539  C CB    . ASN C 3 19  ? 111.673 145.642 159.470 1.00 32.32  ? 19  ASN C CB    1 
ATOM 1540  C CG    . ASN C 3 19  ? 112.817 144.978 160.192 1.00 32.32  ? 19  ASN C CG    1 
ATOM 1541  O OD1   . ASN C 3 19  ? 113.459 145.588 161.041 1.00 32.32  ? 19  ASN C OD1   1 
ATOM 1542  N ND2   . ASN C 3 19  ? 113.072 143.716 159.870 1.00 32.32  ? 19  ASN C ND2   1 
ATOM 1543  N N     . ARG C 3 20  ? 110.258 146.665 156.717 1.00 30.78  ? 20  ARG C N     1 
ATOM 1544  C CA    . ARG C 3 20  ? 109.091 147.176 156.011 1.00 30.78  ? 20  ARG C CA    1 
ATOM 1545  C C     . ARG C 3 20  ? 108.570 146.162 155.008 1.00 30.78  ? 20  ARG C C     1 
ATOM 1546  O O     . ARG C 3 20  ? 107.361 146.066 154.793 1.00 30.78  ? 20  ARG C O     1 
ATOM 1547  C CB    . ARG C 3 20  ? 109.428 148.481 155.306 1.00 30.78  ? 20  ARG C CB    1 
ATOM 1548  C CG    . ARG C 3 20  ? 109.611 149.659 156.221 1.00 30.78  ? 20  ARG C CG    1 
ATOM 1549  C CD    . ARG C 3 20  ? 109.753 150.923 155.413 1.00 30.78  ? 20  ARG C CD    1 
ATOM 1550  N NE    . ARG C 3 20  ? 108.666 151.036 154.450 1.00 30.78  ? 20  ARG C NE    1 
ATOM 1551  C CZ    . ARG C 3 20  ? 108.722 151.768 153.344 1.00 30.78  ? 20  ARG C CZ    1 
ATOM 1552  N NH1   . ARG C 3 20  ? 109.819 152.452 153.061 1.00 30.78  ? 20  ARG C NH1   1 
ATOM 1553  N NH2   . ARG C 3 20  ? 107.684 151.816 152.522 1.00 30.78  ? 20  ARG C NH2   1 
ATOM 1554  N N     . ALA C 3 21  ? 109.465 145.399 154.386 1.00 25.80  ? 21  ALA C N     1 
ATOM 1555  C CA    . ALA C 3 21  ? 109.066 144.386 153.421 1.00 25.80  ? 21  ALA C CA    1 
ATOM 1556  C C     . ALA C 3 21  ? 108.829 143.023 154.049 1.00 25.80  ? 21  ALA C C     1 
ATOM 1557  O O     . ALA C 3 21  ? 108.246 142.152 153.402 1.00 25.80  ? 21  ALA C O     1 
ATOM 1558  C CB    . ALA C 3 21  ? 110.129 144.263 152.339 1.00 25.80  ? 21  ALA C CB    1 
ATOM 1559  N N     . GLY C 3 22  ? 109.266 142.814 155.283 1.00 23.78  ? 22  GLY C N     1 
ATOM 1560  C CA    . GLY C 3 22  ? 109.118 141.523 155.913 1.00 23.78  ? 22  GLY C CA    1 
ATOM 1561  C C     . GLY C 3 22  ? 110.191 140.527 155.565 1.00 23.78  ? 22  GLY C C     1 
ATOM 1562  O O     . GLY C 3 22  ? 109.949 139.323 155.641 1.00 23.78  ? 22  GLY C O     1 
ATOM 1563  N N     . LEU C 3 23  ? 111.377 140.983 155.199 1.00 22.12  ? 23  LEU C N     1 
ATOM 1564  C CA    . LEU C 3 23  ? 112.389 140.111 154.642 1.00 22.12  ? 23  LEU C CA    1 
ATOM 1565  C C     . LEU C 3 23  ? 113.513 139.886 155.641 1.00 22.12  ? 23  LEU C C     1 
ATOM 1566  O O     . LEU C 3 23  ? 113.639 140.581 156.646 1.00 22.12  ? 23  LEU C O     1 
ATOM 1567  C CB    . LEU C 3 23  ? 112.934 140.698 153.343 1.00 22.12  ? 23  LEU C CB    1 
ATOM 1568  C CG    . LEU C 3 23  ? 111.922 140.866 152.223 1.00 22.12  ? 23  LEU C CG    1 
ATOM 1569  C CD1   . LEU C 3 23  ? 112.526 141.649 151.113 1.00 22.12  ? 23  LEU C CD1   1 
ATOM 1570  C CD2   . LEU C 3 23  ? 111.473 139.532 151.740 1.00 22.12  ? 23  LEU C CD2   1 
ATOM 1571  N N     . GLN C 3 24  ? 114.343 138.890 155.355 1.00 22.09  ? 24  GLN C N     1 
ATOM 1572  C CA    . GLN C 3 24  ? 115.574 138.685 156.095 1.00 22.09  ? 24  GLN C CA    1 
ATOM 1573  C C     . GLN C 3 24  ? 116.804 139.131 155.333 1.00 22.09  ? 24  GLN C C     1 
ATOM 1574  O O     . GLN C 3 24  ? 117.898 139.091 155.888 1.00 22.09  ? 24  GLN C O     1 
ATOM 1575  C CB    . GLN C 3 24  ? 115.739 137.211 156.479 1.00 22.09  ? 24  GLN C CB    1 
ATOM 1576  C CG    . GLN C 3 24  ? 114.626 136.652 157.344 1.00 22.09  ? 24  GLN C CG    1 
ATOM 1577  C CD    . GLN C 3 24  ? 114.513 137.348 158.682 1.00 22.09  ? 24  GLN C CD    1 
ATOM 1578  O OE1   . GLN C 3 24  ? 115.511 137.626 159.335 1.00 22.09  ? 24  GLN C OE1   1 
ATOM 1579  N NE2   . GLN C 3 24  ? 113.288 137.637 159.094 1.00 22.09  ? 24  GLN C NE2   1 
ATOM 1580  N N     . PHE C 3 25  ? 116.647 139.560 154.084 1.00 19.80  ? 25  PHE C N     1 
ATOM 1581  C CA    . PHE C 3 25  ? 117.728 139.969 153.206 1.00 19.80  ? 25  PHE C CA    1 
ATOM 1582  C C     . PHE C 3 25  ? 117.776 141.493 153.102 1.00 19.80  ? 25  PHE C C     1 
ATOM 1583  O O     . PHE C 3 25  ? 116.745 142.154 153.211 1.00 19.80  ? 25  PHE C O     1 
ATOM 1584  C CB    . PHE C 3 25  ? 117.535 139.338 151.835 1.00 19.80  ? 25  PHE C CB    1 
ATOM 1585  C CG    . PHE C 3 25  ? 118.266 138.044 151.671 1.00 19.80  ? 25  PHE C CG    1 
ATOM 1586  C CD1   . PHE C 3 25  ? 118.127 137.040 152.601 1.00 19.80  ? 25  PHE C CD1   1 
ATOM 1587  C CD2   . PHE C 3 25  ? 119.105 137.841 150.604 1.00 19.80  ? 25  PHE C CD2   1 
ATOM 1588  C CE1   . PHE C 3 25  ? 118.798 135.862 152.461 1.00 19.80  ? 25  PHE C CE1   1 
ATOM 1589  C CE2   . PHE C 3 25  ? 119.779 136.660 150.473 1.00 19.80  ? 25  PHE C CE2   1 
ATOM 1590  C CZ    . PHE C 3 25  ? 119.621 135.673 151.402 1.00 19.80  ? 25  PHE C CZ    1 
ATOM 1591  N N     . PRO C 3 26  ? 118.960 142.084 152.917 1.00 20.57  ? 26  PRO C N     1 
ATOM 1592  C CA    . PRO C 3 26  ? 119.084 143.545 153.049 1.00 20.57  ? 26  PRO C CA    1 
ATOM 1593  C C     . PRO C 3 26  ? 118.627 144.300 151.808 1.00 20.57  ? 26  PRO C C     1 
ATOM 1594  O O     . PRO C 3 26  ? 119.347 144.377 150.813 1.00 20.57  ? 26  PRO C O     1 
ATOM 1595  C CB    . PRO C 3 26  ? 120.579 143.743 153.304 1.00 20.57  ? 26  PRO C CB    1 
ATOM 1596  C CG    . PRO C 3 26  ? 121.218 142.592 152.697 1.00 20.57  ? 26  PRO C CG    1 
ATOM 1597  C CD    . PRO C 3 26  ? 120.277 141.452 152.734 1.00 20.57  ? 26  PRO C CD    1 
ATOM 1598  N N     . VAL C 3 27  ? 117.450 144.919 151.898 1.00 19.61  ? 27  VAL C N     1 
ATOM 1599  C CA    . VAL C 3 27  ? 116.919 145.702 150.788 1.00 19.61  ? 27  VAL C CA    1 
ATOM 1600  C C     . VAL C 3 27  ? 117.787 146.927 150.517 1.00 19.61  ? 27  VAL C C     1 
ATOM 1601  O O     . VAL C 3 27  ? 118.027 147.273 149.359 1.00 19.61  ? 27  VAL C O     1 
ATOM 1602  C CB    . VAL C 3 27  ? 115.448 146.069 151.079 1.00 19.61  ? 27  VAL C CB    1 
ATOM 1603  C CG1   . VAL C 3 27  ? 114.907 147.054 150.090 1.00 19.61  ? 27  VAL C CG1   1 
ATOM 1604  C CG2   . VAL C 3 27  ? 114.596 144.833 151.065 1.00 19.61  ? 27  VAL C CG2   1 
ATOM 1605  N N     . GLY C 3 28  ? 118.350 147.540 151.558 1.00 22.31  ? 28  GLY C N     1 
ATOM 1606  C CA    . GLY C 3 28  ? 119.191 148.710 151.353 1.00 22.31  ? 28  GLY C CA    1 
ATOM 1607  C C     . GLY C 3 28  ? 120.534 148.391 150.727 1.00 22.31  ? 28  GLY C C     1 
ATOM 1608  O O     . GLY C 3 28  ? 121.020 149.134 149.870 1.00 22.31  ? 28  GLY C O     1 
ATOM 1609  N N     . ARG C 3 29  ? 121.145 147.279 151.130 1.00 22.47  ? 29  ARG C N     1 
ATOM 1610  C CA    . ARG C 3 29  ? 122.398 146.858 150.516 1.00 22.47  ? 29  ARG C CA    1 
ATOM 1611  C C     . ARG C 3 29  ? 122.189 146.402 149.080 1.00 22.47  ? 29  ARG C C     1 
ATOM 1612  O O     . ARG C 3 29  ? 123.018 146.678 148.209 1.00 22.47  ? 29  ARG C O     1 
ATOM 1613  C CB    . ARG C 3 29  ? 123.034 145.748 151.342 1.00 22.47  ? 29  ARG C CB    1 
ATOM 1614  C CG    . ARG C 3 29  ? 124.262 145.144 150.737 1.00 22.47  ? 29  ARG C CG    1 
ATOM 1615  C CD    . ARG C 3 29  ? 124.690 143.941 151.497 1.00 22.47  ? 29  ARG C CD    1 
ATOM 1616  N NE    . ARG C 3 29  ? 125.167 144.297 152.819 1.00 22.47  ? 29  ARG C NE    1 
ATOM 1617  C CZ    . ARG C 3 29  ? 125.805 143.462 153.619 1.00 22.47  ? 29  ARG C CZ    1 
ATOM 1618  N NH1   . ARG C 3 29  ? 126.041 142.228 153.224 1.00 22.47  ? 29  ARG C NH1   1 
ATOM 1619  N NH2   . ARG C 3 29  ? 126.208 143.863 154.807 1.00 22.47  ? 29  ARG C NH2   1 
ATOM 1620  N N     . ILE C 3 30  ? 121.073 145.727 148.803 1.00 18.79  ? 30  ILE C N     1 
ATOM 1621  C CA    . ILE C 3 30  ? 120.785 145.330 147.431 1.00 18.79  ? 30  ILE C CA    1 
ATOM 1622  C C     . ILE C 3 30  ? 120.453 146.550 146.574 1.00 18.79  ? 30  ILE C C     1 
ATOM 1623  O O     . ILE C 3 30  ? 120.789 146.588 145.385 1.00 18.79  ? 30  ILE C O     1 
ATOM 1624  C CB    . ILE C 3 30  ? 119.683 144.252 147.455 1.00 18.79  ? 30  ILE C CB    1 
ATOM 1625  C CG1   . ILE C 3 30  ? 120.285 142.948 147.955 1.00 18.79  ? 30  ILE C CG1   1 
ATOM 1626  C CG2   . ILE C 3 30  ? 119.069 143.995 146.106 1.00 18.79  ? 30  ILE C CG2   1 
ATOM 1627  C CD1   . ILE C 3 30  ? 119.322 142.030 148.591 1.00 18.79  ? 30  ILE C CD1   1 
ATOM 1628  N N     . HIS C 3 31  ? 119.886 147.601 147.174 1.00 20.27  ? 31  HIS C N     1 
ATOM 1629  C CA    . HIS C 3 31  ? 119.685 148.861 146.465 1.00 20.27  ? 31  HIS C CA    1 
ATOM 1630  C C     . HIS C 3 31  ? 121.005 149.515 146.109 1.00 20.27  ? 31  HIS C C     1 
ATOM 1631  O O     . HIS C 3 31  ? 121.179 150.007 144.993 1.00 20.27  ? 31  HIS C O     1 
ATOM 1632  C CB    . HIS C 3 31  ? 118.856 149.811 147.317 1.00 20.27  ? 31  HIS C CB    1 
ATOM 1633  C CG    . HIS C 3 31  ? 118.298 150.977 146.564 1.00 20.27  ? 31  HIS C CG    1 
ATOM 1634  N ND1   . HIS C 3 31  ? 117.869 150.886 145.261 1.00 20.27  ? 31  HIS C ND1   1 
ATOM 1635  C CD2   . HIS C 3 31  ? 118.082 152.257 146.938 1.00 20.27  ? 31  HIS C CD2   1 
ATOM 1636  C CE1   . HIS C 3 31  ? 117.412 152.057 144.865 1.00 20.27  ? 31  HIS C CE1   1 
ATOM 1637  N NE2   . HIS C 3 31  ? 117.535 152.908 145.863 1.00 20.27  ? 31  HIS C NE2   1 
ATOM 1638  N N     . ARG C 3 32  ? 121.947 149.525 147.044 1.00 20.91  ? 32  ARG C N     1 
ATOM 1639  C CA    . ARG C 3 32  ? 123.261 150.085 146.770 1.00 20.91  ? 32  ARG C CA    1 
ATOM 1640  C C     . ARG C 3 32  ? 124.035 149.273 145.744 1.00 20.91  ? 32  ARG C C     1 
ATOM 1641  O O     . ARG C 3 32  ? 124.758 149.847 144.934 1.00 20.91  ? 32  ARG C O     1 
ATOM 1642  C CB    . ARG C 3 32  ? 124.062 150.186 148.064 1.00 20.91  ? 32  ARG C CB    1 
ATOM 1643  C CG    . ARG C 3 32  ? 125.331 150.978 147.948 1.00 20.91  ? 32  ARG C CG    1 
ATOM 1644  C CD    . ARG C 3 32  ? 126.511 150.078 148.084 1.00 20.91  ? 32  ARG C CD    1 
ATOM 1645  N NE    . ARG C 3 32  ? 126.522 149.451 149.389 1.00 20.91  ? 32  ARG C NE    1 
ATOM 1646  C CZ    . ARG C 3 32  ? 127.124 148.304 149.657 1.00 20.91  ? 32  ARG C CZ    1 
ATOM 1647  N NH1   . ARG C 3 32  ? 127.759 147.651 148.703 1.00 20.91  ? 32  ARG C NH1   1 
ATOM 1648  N NH2   . ARG C 3 32  ? 127.085 147.818 150.881 1.00 20.91  ? 32  ARG C NH2   1 
ATOM 1649  N N     . LEU C 3 33  ? 123.895 147.951 145.753 1.00 16.17  ? 33  LEU C N     1 
ATOM 1650  C CA    . LEU C 3 33  ? 124.570 147.124 144.762 1.00 16.17  ? 33  LEU C CA    1 
ATOM 1651  C C     . LEU C 3 33  ? 123.944 147.248 143.383 1.00 16.17  ? 33  LEU C C     1 
ATOM 1652  O O     . LEU C 3 33  ? 124.639 147.088 142.382 1.00 16.17  ? 33  LEU C O     1 
ATOM 1653  C CB    . LEU C 3 33  ? 124.554 145.663 145.190 1.00 16.17  ? 33  LEU C CB    1 
ATOM 1654  C CG    . LEU C 3 33  ? 125.400 145.234 146.376 1.00 16.17  ? 33  LEU C CG    1 
ATOM 1655  C CD1   . LEU C 3 33  ? 125.142 143.787 146.645 1.00 16.17  ? 33  LEU C CD1   1 
ATOM 1656  C CD2   . LEU C 3 33  ? 126.854 145.463 146.108 1.00 16.17  ? 33  LEU C CD2   1 
ATOM 1657  N N     . LEU C 3 34  ? 122.643 147.505 143.300 1.00 18.26  ? 34  LEU C N     1 
ATOM 1658  C CA    . LEU C 3 34  ? 122.038 147.786 142.008 1.00 18.26  ? 34  LEU C CA    1 
ATOM 1659  C C     . LEU C 3 34  ? 122.396 149.173 141.506 1.00 18.26  ? 34  LEU C C     1 
ATOM 1660  O O     . LEU C 3 34  ? 122.514 149.371 140.296 1.00 18.26  ? 34  LEU C O     1 
ATOM 1661  C CB    . LEU C 3 34  ? 120.523 147.640 142.092 1.00 18.26  ? 34  LEU C CB    1 
ATOM 1662  C CG    . LEU C 3 34  ? 119.945 146.234 141.973 1.00 18.26  ? 34  LEU C CG    1 
ATOM 1663  C CD1   . LEU C 3 34  ? 118.523 146.218 142.444 1.00 18.26  ? 34  LEU C CD1   1 
ATOM 1664  C CD2   . LEU C 3 34  ? 120.025 145.757 140.558 1.00 18.26  ? 34  LEU C CD2   1 
ATOM 1665  N N     . ARG C 3 35  ? 122.567 150.139 142.410 1.00 21.96  ? 35  ARG C N     1 
ATOM 1666  C CA    . ARG C 3 35  ? 122.937 151.491 142.002 1.00 21.96  ? 35  ARG C CA    1 
ATOM 1667  C C     . ARG C 3 35  ? 124.392 151.564 141.568 1.00 21.96  ? 35  ARG C C     1 
ATOM 1668  O O     . ARG C 3 35  ? 124.718 152.207 140.568 1.00 21.96  ? 35  ARG C O     1 
ATOM 1669  C CB    . ARG C 3 35  ? 122.682 152.469 143.141 1.00 21.96  ? 35  ARG C CB    1 
ATOM 1670  C CG    . ARG C 3 35  ? 121.262 152.943 143.254 1.00 21.96  ? 35  ARG C CG    1 
ATOM 1671  C CD    . ARG C 3 35  ? 121.167 154.149 144.155 1.00 21.96  ? 35  ARG C CD    1 
ATOM 1672  N NE    . ARG C 3 35  ? 120.952 153.796 145.553 1.00 21.96  ? 35  ARG C NE    1 
ATOM 1673  C CZ    . ARG C 3 35  ? 121.900 153.802 146.485 1.00 21.96  ? 35  ARG C CZ    1 
ATOM 1674  N NH1   . ARG C 3 35  ? 123.145 154.139 146.176 1.00 21.96  ? 35  ARG C NH1   1 
ATOM 1675  N NH2   . ARG C 3 35  ? 121.604 153.464 147.731 1.00 21.96  ? 35  ARG C NH2   1 
ATOM 1676  N N     . LYS C 3 36  ? 125.285 150.922 142.311 1.00 19.44  ? 36  LYS C N     1 
ATOM 1677  C CA    . LYS C 3 36  ? 126.712 150.960 142.024 1.00 19.44  ? 36  LYS C CA    1 
ATOM 1678  C C     . LYS C 3 36  ? 127.175 149.783 141.187 1.00 19.44  ? 36  LYS C C     1 
ATOM 1679  O O     . LYS C 3 36  ? 128.341 149.391 141.272 1.00 19.44  ? 36  LYS C O     1 
ATOM 1680  C CB    . LYS C 3 36  ? 127.505 151.012 143.328 1.00 19.44  ? 36  LYS C CB    1 
ATOM 1681  C CG    . LYS C 3 36  ? 127.267 152.252 144.152 1.00 19.44  ? 36  LYS C CG    1 
ATOM 1682  C CD    . LYS C 3 36  ? 127.872 153.474 143.502 1.00 19.44  ? 36  LYS C CD    1 
ATOM 1683  C CE    . LYS C 3 36  ? 126.885 154.627 143.477 1.00 19.44  ? 36  LYS C CE    1 
ATOM 1684  N NZ    . LYS C 3 36  ? 127.505 155.878 142.963 1.00 19.44  ? 36  LYS C NZ    1 
ATOM 1685  N N     . GLY C 3 37  ? 126.301 149.210 140.374 1.00 18.90  ? 37  GLY C N     1 
ATOM 1686  C CA    . GLY C 3 37  ? 126.644 147.992 139.680 1.00 18.90  ? 37  GLY C CA    1 
ATOM 1687  C C     . GLY C 3 37  ? 126.569 148.097 138.180 1.00 18.90  ? 37  GLY C C     1 
ATOM 1688  O O     . GLY C 3 37  ? 126.772 147.096 137.491 1.00 18.90  ? 37  GLY C O     1 
ATOM 1689  N N     . ASN C 3 38  ? 126.289 149.304 137.680 1.00 17.90  ? 38  ASN C N     1 
ATOM 1690  C CA    . ASN C 3 38  ? 126.199 149.628 136.252 1.00 17.90  ? 38  ASN C CA    1 
ATOM 1691  C C     . ASN C 3 38  ? 125.153 148.769 135.552 1.00 17.90  ? 38  ASN C C     1 
ATOM 1692  O O     . ASN C 3 38  ? 125.438 148.032 134.615 1.00 17.90  ? 38  ASN C O     1 
ATOM 1693  C CB    . ASN C 3 38  ? 127.557 149.506 135.551 1.00 17.90  ? 38  ASN C CB    1 
ATOM 1694  C CG    . ASN C 3 38  ? 128.614 150.328 136.202 1.00 17.90  ? 38  ASN C CG    1 
ATOM 1695  O OD1   . ASN C 3 38  ? 128.462 151.531 136.354 1.00 17.90  ? 38  ASN C OD1   1 
ATOM 1696  N ND2   . ASN C 3 38  ? 129.696 149.686 136.606 1.00 17.90  ? 38  ASN C ND2   1 
ATOM 1697  N N     . TYR C 3 39  ? 123.924 148.875 136.038 1.00 16.17  ? 39  TYR C N     1 
ATOM 1698  C CA    . TYR C 3 39  ? 122.818 148.101 135.508 1.00 16.17  ? 39  TYR C CA    1 
ATOM 1699  C C     . TYR C 3 39  ? 121.823 148.979 134.773 1.00 16.17  ? 39  TYR C C     1 
ATOM 1700  O O     . TYR C 3 39  ? 121.371 148.628 133.684 1.00 16.17  ? 39  TYR C O     1 
ATOM 1701  C CB    . TYR C 3 39  ? 122.133 147.333 136.638 1.00 16.17  ? 39  TYR C CB    1 
ATOM 1702  C CG    . TYR C 3 39  ? 122.959 146.202 137.170 1.00 16.17  ? 39  TYR C CG    1 
ATOM 1703  C CD1   . TYR C 3 39  ? 123.395 145.199 136.337 1.00 16.17  ? 39  TYR C CD1   1 
ATOM 1704  C CD2   . TYR C 3 39  ? 123.318 146.147 138.498 1.00 16.17  ? 39  TYR C CD2   1 
ATOM 1705  C CE1   . TYR C 3 39  ? 124.157 144.174 136.809 1.00 16.17  ? 39  TYR C CE1   1 
ATOM 1706  C CE2   . TYR C 3 39  ? 124.082 145.124 138.981 1.00 16.17  ? 39  TYR C CE2   1 
ATOM 1707  C CZ    . TYR C 3 39  ? 124.496 144.138 138.131 1.00 16.17  ? 39  TYR C CZ    1 
ATOM 1708  O OH    . TYR C 3 39  ? 125.262 143.105 138.600 1.00 16.17  ? 39  TYR C OH    1 
ATOM 1709  N N     . ALA C 3 40  ? 121.483 150.124 135.341 1.00 22.43  ? 40  ALA C N     1 
ATOM 1710  C CA    . ALA C 3 40  ? 120.731 151.144 134.643 1.00 22.43  ? 40  ALA C CA    1 
ATOM 1711  C C     . ALA C 3 40  ? 121.131 152.496 135.198 1.00 22.43  ? 40  ALA C C     1 
ATOM 1712  O O     . ALA C 3 40  ? 121.936 152.600 136.121 1.00 22.43  ? 40  ALA C O     1 
ATOM 1713  C CB    . ALA C 3 40  ? 119.226 150.926 134.769 1.00 22.43  ? 40  ALA C CB    1 
ATOM 1714  N N     . GLU C 3 41  ? 120.552 153.544 134.626 1.00 29.33  ? 41  GLU C N     1 
ATOM 1715  C CA    . GLU C 3 41  ? 120.870 154.892 135.067 1.00 29.33  ? 41  GLU C CA    1 
ATOM 1716  C C     . GLU C 3 41  ? 120.058 155.247 136.305 1.00 29.33  ? 41  GLU C C     1 
ATOM 1717  O O     . GLU C 3 41  ? 120.469 156.086 137.111 1.00 29.33  ? 41  GLU C O     1 
ATOM 1718  C CB    . GLU C 3 41  ? 120.621 155.861 133.906 1.00 29.33  ? 41  GLU C CB    1 
ATOM 1719  C CG    . GLU C 3 41  ? 121.178 157.271 134.038 1.00 29.33  ? 41  GLU C CG    1 
ATOM 1720  C CD    . GLU C 3 41  ? 120.153 158.292 134.512 1.00 29.33  ? 41  GLU C CD    1 
ATOM 1721  O OE1   . GLU C 3 41  ? 118.965 158.139 134.177 1.00 29.33  ? 41  GLU C OE1   1 
ATOM 1722  O OE2   . GLU C 3 41  ? 120.535 159.255 135.211 1.00 29.33  ? 41  GLU C OE2   1 
ATOM 1723  N N     . ARG C 3 42  ? 118.921 154.580 136.494 1.00 30.94  ? 42  ARG C N     1 
ATOM 1724  C CA    . ARG C 3 42  ? 118.046 154.760 137.641 1.00 30.94  ? 42  ARG C CA    1 
ATOM 1725  C C     . ARG C 3 42  ? 117.614 153.395 138.150 1.00 30.94  ? 42  ARG C C     1 
ATOM 1726  O O     . ARG C 3 42  ? 117.544 152.435 137.388 1.00 30.94  ? 42  ARG C O     1 
ATOM 1727  C CB    . ARG C 3 42  ? 116.797 155.562 137.291 1.00 30.94  ? 42  ARG C CB    1 
ATOM 1728  C CG    . ARG C 3 42  ? 117.045 156.844 136.555 1.00 30.94  ? 42  ARG C CG    1 
ATOM 1729  C CD    . ARG C 3 42  ? 115.789 157.615 136.339 1.00 30.94  ? 42  ARG C CD    1 
ATOM 1730  N NE    . ARG C 3 42  ? 115.475 158.383 137.527 1.00 30.94  ? 42  ARG C NE    1 
ATOM 1731  C CZ    . ARG C 3 42  ? 114.855 159.551 137.518 1.00 30.94  ? 42  ARG C CZ    1 
ATOM 1732  N NH1   . ARG C 3 42  ? 114.485 160.097 136.374 1.00 30.94  ? 42  ARG C NH1   1 
ATOM 1733  N NH2   . ARG C 3 42  ? 114.614 160.181 138.651 1.00 30.94  ? 42  ARG C NH2   1 
ATOM 1734  N N     . VAL C 3 43  ? 117.326 153.306 139.446 1.00 25.50  ? 43  VAL C N     1 
ATOM 1735  C CA    . VAL C 3 43  ? 116.839 152.080 140.068 1.00 25.50  ? 43  VAL C CA    1 
ATOM 1736  C C     . VAL C 3 43  ? 115.573 152.399 140.845 1.00 25.50  ? 43  VAL C C     1 
ATOM 1737  O O     . VAL C 3 43  ? 115.594 153.234 141.752 1.00 25.50  ? 43  VAL C O     1 
ATOM 1738  C CB    . VAL C 3 43  ? 117.890 151.447 140.997 1.00 25.50  ? 43  VAL C CB    1 
ATOM 1739  C CG1   . VAL C 3 43  ? 117.294 150.294 141.750 1.00 25.50  ? 43  VAL C CG1   1 
ATOM 1740  C CG2   . VAL C 3 43  ? 119.065 150.969 140.209 1.00 25.50  ? 43  VAL C CG2   1 
ATOM 1741  N N     . GLY C 3 44  ? 114.480 151.726 140.501 1.00 22.85  ? 44  GLY C N     1 
ATOM 1742  C CA    . GLY C 3 44  ? 113.219 151.918 141.183 1.00 22.85  ? 44  GLY C CA    1 
ATOM 1743  C C     . GLY C 3 44  ? 113.249 151.449 142.620 1.00 22.85  ? 44  GLY C C     1 
ATOM 1744  O O     . GLY C 3 44  ? 114.144 150.739 143.064 1.00 22.85  ? 44  GLY C O     1 
ATOM 1745  N N     . ALA C 3 45  ? 112.236 151.861 143.372 1.00 20.76  ? 45  ALA C N     1 
ATOM 1746  C CA    . ALA C 3 45  ? 112.229 151.595 144.804 1.00 20.76  ? 45  ALA C CA    1 
ATOM 1747  C C     . ALA C 3 45  ? 111.768 150.185 145.136 1.00 20.76  ? 45  ALA C C     1 
ATOM 1748  O O     . ALA C 3 45  ? 112.119 149.663 146.197 1.00 20.76  ? 45  ALA C O     1 
ATOM 1749  C CB    . ALA C 3 45  ? 111.340 152.603 145.515 1.00 20.76  ? 45  ALA C CB    1 
ATOM 1750  N N     . GLY C 3 46  ? 110.983 149.564 144.268 1.00 17.57  ? 46  GLY C N     1 
ATOM 1751  C CA    . GLY C 3 46  ? 110.511 148.219 144.467 1.00 17.57  ? 46  GLY C CA    1 
ATOM 1752  C C     . GLY C 3 46  ? 111.380 147.160 143.862 1.00 17.57  ? 46  GLY C C     1 
ATOM 1753  O O     . GLY C 3 46  ? 111.142 145.974 144.095 1.00 17.57  ? 46  GLY C O     1 
ATOM 1754  N N     . ALA C 3 47  ? 112.371 147.541 143.080 1.00 16.82  ? 47  ALA C N     1 
ATOM 1755  C CA    . ALA C 3 47  ? 113.369 146.623 142.553 1.00 16.82  ? 47  ALA C CA    1 
ATOM 1756  C C     . ALA C 3 47  ? 114.209 145.937 143.632 1.00 16.82  ? 47  ALA C C     1 
ATOM 1757  O O     . ALA C 3 47  ? 114.365 144.715 143.545 1.00 16.82  ? 47  ALA C O     1 
ATOM 1758  C CB    . ALA C 3 47  ? 114.264 147.339 141.541 1.00 16.82  ? 47  ALA C CB    1 
ATOM 1759  N N     . PRO C 3 48  ? 114.760 146.615 144.658 1.00 16.96  ? 48  PRO C N     1 
ATOM 1760  C CA    . PRO C 3 48  ? 115.498 145.849 145.667 1.00 16.96  ? 48  PRO C CA    1 
ATOM 1761  C C     . PRO C 3 48  ? 114.602 145.036 146.568 1.00 16.96  ? 48  PRO C C     1 
ATOM 1762  O O     . PRO C 3 48  ? 115.040 144.005 147.077 1.00 16.96  ? 48  PRO C O     1 
ATOM 1763  C CB    . PRO C 3 48  ? 116.237 146.930 146.455 1.00 16.96  ? 48  PRO C CB    1 
ATOM 1764  C CG    . PRO C 3 48  ? 116.112 148.101 145.681 1.00 16.96  ? 48  PRO C CG    1 
ATOM 1765  C CD    . PRO C 3 48  ? 114.861 148.043 145.001 1.00 16.96  ? 48  PRO C CD    1 
ATOM 1766  N N     . VAL C 3 49  ? 113.352 145.452 146.742 1.00 16.82  ? 49  VAL C N     1 
ATOM 1767  C CA    . VAL C 3 49  ? 112.388 144.682 147.512 1.00 16.82  ? 49  VAL C CA    1 
ATOM 1768  C C     . VAL C 3 49  ? 112.058 143.379 146.805 1.00 16.82  ? 49  VAL C C     1 
ATOM 1769  O O     . VAL C 3 49  ? 112.112 142.300 147.408 1.00 16.82  ? 49  VAL C O     1 
ATOM 1770  C CB    . VAL C 3 49  ? 111.138 145.537 147.751 1.00 16.82  ? 49  VAL C CB    1 
ATOM 1771  C CG1   . VAL C 3 49  ? 110.215 144.850 148.677 1.00 16.82  ? 49  VAL C CG1   1 
ATOM 1772  C CG2   . VAL C 3 49  ? 111.538 146.860 148.307 1.00 16.82  ? 49  VAL C CG2   1 
ATOM 1773  N N     . TYR C 3 50  ? 111.747 143.459 145.509 1.00 15.38  ? 50  TYR C N     1 
ATOM 1774  C CA    . TYR C 3 50  ? 111.484 142.278 144.698 1.00 15.38  ? 50  TYR C CA    1 
ATOM 1775  C C     . TYR C 3 50  ? 112.698 141.365 144.622 1.00 15.38  ? 50  TYR C C     1 
ATOM 1776  O O     . TYR C 3 50  ? 112.570 140.144 144.762 1.00 15.38  ? 50  TYR C O     1 
ATOM 1777  C CB    . TYR C 3 50  ? 111.077 142.710 143.296 1.00 15.38  ? 50  TYR C CB    1 
ATOM 1778  C CG    . TYR C 3 50  ? 110.128 141.788 142.592 1.00 15.38  ? 50  TYR C CG    1 
ATOM 1779  C CD1   . TYR C 3 50  ? 108.809 142.136 142.422 1.00 15.38  ? 50  TYR C CD1   1 
ATOM 1780  C CD2   . TYR C 3 50  ? 110.548 140.563 142.110 1.00 15.38  ? 50  TYR C CD2   1 
ATOM 1781  C CE1   . TYR C 3 50  ? 107.947 141.309 141.787 1.00 15.38  ? 50  TYR C CE1   1 
ATOM 1782  C CE2   . TYR C 3 50  ? 109.685 139.721 141.477 1.00 15.38  ? 50  TYR C CE2   1 
ATOM 1783  C CZ    . TYR C 3 50  ? 108.391 140.102 141.317 1.00 15.38  ? 50  TYR C CZ    1 
ATOM 1784  O OH    . TYR C 3 50  ? 107.519 139.270 140.680 1.00 15.38  ? 50  TYR C OH    1 
ATOM 1785  N N     . LEU C 3 51  ? 113.885 141.935 144.423 1.00 13.65  ? 51  LEU C N     1 
ATOM 1786  C CA    . LEU C 3 51  ? 115.072 141.117 144.247 1.00 13.65  ? 51  LEU C CA    1 
ATOM 1787  C C     . LEU C 3 51  ? 115.516 140.477 145.555 1.00 13.65  ? 51  LEU C C     1 
ATOM 1788  O O     . LEU C 3 51  ? 115.965 139.328 145.553 1.00 13.65  ? 51  LEU C O     1 
ATOM 1789  C CB    . LEU C 3 51  ? 116.177 141.973 143.636 1.00 13.65  ? 51  LEU C CB    1 
ATOM 1790  C CG    . LEU C 3 51  ? 117.457 141.341 143.110 1.00 13.65  ? 51  LEU C CG    1 
ATOM 1791  C CD1   . LEU C 3 51  ? 117.168 140.059 142.405 1.00 13.65  ? 51  LEU C CD1   1 
ATOM 1792  C CD2   . LEU C 3 51  ? 118.123 142.277 142.172 1.00 13.65  ? 51  LEU C CD2   1 
ATOM 1793  N N     . ALA C 3 52  ? 115.357 141.171 146.680 1.00 15.17  ? 52  ALA C N     1 
ATOM 1794  C CA    . ALA C 3 52  ? 115.671 140.579 147.970 1.00 15.17  ? 52  ALA C CA    1 
ATOM 1795  C C     . ALA C 3 52  ? 114.688 139.483 148.326 1.00 15.17  ? 52  ALA C C     1 
ATOM 1796  O O     . ALA C 3 52  ? 115.073 138.477 148.929 1.00 15.17  ? 52  ALA C O     1 
ATOM 1797  C CB    . ALA C 3 52  ? 115.678 141.655 149.045 1.00 15.17  ? 52  ALA C CB    1 
ATOM 1798  N N     . ALA C 3 53  ? 113.422 139.637 147.936 1.00 15.61  ? 53  ALA C N     1 
ATOM 1799  C CA    . ALA C 3 53  ? 112.447 138.587 148.199 1.00 15.61  ? 53  ALA C CA    1 
ATOM 1800  C C     . ALA C 3 53  ? 112.719 137.345 147.369 1.00 15.61  ? 53  ALA C C     1 
ATOM 1801  O O     . ALA C 3 53  ? 112.588 136.225 147.869 1.00 15.61  ? 53  ALA C O     1 
ATOM 1802  C CB    . ALA C 3 53  ? 111.052 139.102 147.930 1.00 15.61  ? 53  ALA C CB    1 
ATOM 1803  N N     . VAL C 3 54  ? 113.120 137.519 146.110 1.00 14.62  ? 54  VAL C N     1 
ATOM 1804  C CA    . VAL C 3 54  ? 113.427 136.374 145.256 1.00 14.62  ? 54  VAL C CA    1 
ATOM 1805  C C     . VAL C 3 54  ? 114.686 135.662 145.733 1.00 14.62  ? 54  VAL C C     1 
ATOM 1806  O O     . VAL C 3 54  ? 114.736 134.428 145.784 1.00 14.62  ? 54  VAL C O     1 
ATOM 1807  C CB    . VAL C 3 54  ? 113.538 136.835 143.792 1.00 14.62  ? 54  VAL C CB    1 
ATOM 1808  C CG1   . VAL C 3 54  ? 114.100 135.755 142.917 1.00 14.62  ? 54  VAL C CG1   1 
ATOM 1809  C CG2   . VAL C 3 54  ? 112.184 137.238 143.284 1.00 14.62  ? 54  VAL C CG2   1 
ATOM 1810  N N     . MET C 3 55  ? 115.707 136.423 146.127 1.00 16.48  ? 55  MET C N     1 
ATOM 1811  C CA    . MET C 3 55  ? 116.935 135.827 146.643 1.00 16.48  ? 55  MET C CA    1 
ATOM 1812  C C     . MET C 3 55  ? 116.716 135.103 147.959 1.00 16.48  ? 55  MET C C     1 
ATOM 1813  O O     . MET C 3 55  ? 117.288 134.031 148.171 1.00 16.48  ? 55  MET C O     1 
ATOM 1814  C CB    . MET C 3 55  ? 117.985 136.904 146.829 1.00 16.48  ? 55  MET C CB    1 
ATOM 1815  C CG    . MET C 3 55  ? 118.992 136.976 145.739 1.00 16.48  ? 55  MET C CG    1 
ATOM 1816  S SD    . MET C 3 55  ? 120.226 138.189 146.182 1.00 16.48  ? 55  MET C SD    1 
ATOM 1817  C CE    . MET C 3 55  ? 119.297 139.639 145.827 1.00 16.48  ? 55  MET C CE    1 
ATOM 1818  N N     . GLU C 3 56  ? 115.882 135.653 148.839 1.00 19.18  ? 56  GLU C N     1 
ATOM 1819  C CA    . GLU C 3 56  ? 115.579 134.988 150.096 1.00 19.18  ? 56  GLU C CA    1 
ATOM 1820  C C     . GLU C 3 56  ? 114.748 133.738 149.875 1.00 19.18  ? 56  GLU C C     1 
ATOM 1821  O O     . GLU C 3 56  ? 114.948 132.737 150.566 1.00 19.18  ? 56  GLU C O     1 
ATOM 1822  C CB    . GLU C 3 56  ? 114.864 135.954 151.025 1.00 19.18  ? 56  GLU C CB    1 
ATOM 1823  C CG    . GLU C 3 56  ? 114.496 135.370 152.346 1.00 19.18  ? 56  GLU C CG    1 
ATOM 1824  C CD    . GLU C 3 56  ? 113.582 136.259 153.118 1.00 19.18  ? 56  GLU C CD    1 
ATOM 1825  O OE1   . GLU C 3 56  ? 113.765 137.481 153.029 1.00 19.18  ? 56  GLU C OE1   1 
ATOM 1826  O OE2   . GLU C 3 56  ? 112.681 135.744 153.808 1.00 19.18  ? 56  GLU C OE2   1 
ATOM 1827  N N     . TYR C 3 57  ? 113.845 133.760 148.891 1.00 17.28  ? 57  TYR C N     1 
ATOM 1828  C CA    . TYR C 3 57  ? 113.072 132.570 148.556 1.00 17.28  ? 57  TYR C CA    1 
ATOM 1829  C C     . TYR C 3 57  ? 113.968 131.450 148.057 1.00 17.28  ? 57  TYR C C     1 
ATOM 1830  O O     . TYR C 3 57  ? 113.831 130.300 148.480 1.00 17.28  ? 57  TYR C O     1 
ATOM 1831  C CB    . TYR C 3 57  ? 112.013 132.892 147.500 1.00 17.28  ? 57  TYR C CB    1 
ATOM 1832  C CG    . TYR C 3 57  ? 111.452 131.648 146.870 1.00 17.28  ? 57  TYR C CG    1 
ATOM 1833  C CD1   . TYR C 3 57  ? 110.600 130.827 147.582 1.00 17.28  ? 57  TYR C CD1   1 
ATOM 1834  C CD2   . TYR C 3 57  ? 111.796 131.273 145.579 1.00 17.28  ? 57  TYR C CD2   1 
ATOM 1835  C CE1   . TYR C 3 57  ? 110.108 129.683 147.037 1.00 17.28  ? 57  TYR C CE1   1 
ATOM 1836  C CE2   . TYR C 3 57  ? 111.312 130.117 145.033 1.00 17.28  ? 57  TYR C CE2   1 
ATOM 1837  C CZ    . TYR C 3 57  ? 110.467 129.333 145.767 1.00 17.28  ? 57  TYR C CZ    1 
ATOM 1838  O OH    . TYR C 3 57  ? 109.966 128.184 145.223 1.00 17.28  ? 57  TYR C OH    1 
ATOM 1839  N N     . LEU C 3 58  ? 114.878 131.766 147.136 1.00 15.26  ? 58  LEU C N     1 
ATOM 1840  C CA    . LEU C 3 58  ? 115.736 130.737 146.557 1.00 15.26  ? 58  LEU C CA    1 
ATOM 1841  C C     . LEU C 3 58  ? 116.727 130.199 147.574 1.00 15.26  ? 58  LEU C C     1 
ATOM 1842  O O     . LEU C 3 58  ? 116.989 128.987 147.611 1.00 15.26  ? 58  LEU C O     1 
ATOM 1843  C CB    . LEU C 3 58  ? 116.463 131.294 145.341 1.00 15.26  ? 58  LEU C CB    1 
ATOM 1844  C CG    . LEU C 3 58  ? 115.661 131.271 144.050 1.00 15.26  ? 58  LEU C CG    1 
ATOM 1845  C CD1   . LEU C 3 58  ? 116.310 132.150 143.037 1.00 15.26  ? 58  LEU C CD1   1 
ATOM 1846  C CD2   . LEU C 3 58  ? 115.562 129.873 143.529 1.00 15.26  ? 58  LEU C CD2   1 
ATOM 1847  N N     . ALA C 3 59  ? 117.260 131.080 148.425 1.00 17.05  ? 59  ALA C N     1 
ATOM 1848  C CA    . ALA C 3 59  ? 118.133 130.648 149.506 1.00 17.05  ? 59  ALA C CA    1 
ATOM 1849  C C     . ALA C 3 59  ? 117.402 129.754 150.485 1.00 17.05  ? 59  ALA C C     1 
ATOM 1850  O O     . ALA C 3 59  ? 117.941 128.731 150.906 1.00 17.05  ? 59  ALA C O     1 
ATOM 1851  C CB    . ALA C 3 59  ? 118.707 131.857 150.233 1.00 17.05  ? 59  ALA C CB    1 
ATOM 1852  N N     . ALA C 3 60  ? 116.160 130.102 150.830 1.00 18.66  ? 60  ALA C N     1 
ATOM 1853  C CA    . ALA C 3 60  ? 115.378 129.294 151.753 1.00 18.66  ? 60  ALA C CA    1 
ATOM 1854  C C     . ALA C 3 60  ? 115.018 127.949 151.163 1.00 18.66  ? 60  ALA C C     1 
ATOM 1855  O O     . ALA C 3 60  ? 114.988 126.954 151.884 1.00 18.66  ? 60  ALA C O     1 
ATOM 1856  C CB    . ALA C 3 60  ? 114.116 130.041 152.152 1.00 18.66  ? 60  ALA C CB    1 
ATOM 1857  N N     . GLU C 3 61  ? 114.783 127.892 149.859 1.00 22.20  ? 61  GLU C N     1 
ATOM 1858  C CA    . GLU C 3 61  ? 114.429 126.632 149.218 1.00 22.20  ? 61  GLU C CA    1 
ATOM 1859  C C     . GLU C 3 61  ? 115.605 125.665 149.205 1.00 22.20  ? 61  GLU C C     1 
ATOM 1860  O O     . GLU C 3 61  ? 115.475 124.508 149.636 1.00 22.20  ? 61  GLU C O     1 
ATOM 1861  C CB    . GLU C 3 61  ? 113.932 126.907 147.806 1.00 22.20  ? 61  GLU C CB    1 
ATOM 1862  C CG    . GLU C 3 61  ? 113.483 125.682 147.069 1.00 22.20  ? 61  GLU C CG    1 
ATOM 1863  C CD    . GLU C 3 61  ? 112.106 125.202 147.481 1.00 22.20  ? 61  GLU C CD    1 
ATOM 1864  O OE1   . GLU C 3 61  ? 111.376 125.951 148.157 1.00 22.20  ? 61  GLU C OE1   1 
ATOM 1865  O OE2   . GLU C 3 61  ? 111.746 124.069 147.114 1.00 22.20  ? 61  GLU C OE2   1 
ATOM 1866  N N     . VAL C 3 62  ? 116.773 126.133 148.753 1.00 18.60  ? 62  VAL C N     1 
ATOM 1867  C CA    . VAL C 3 62  ? 117.935 125.249 148.740 1.00 18.60  ? 62  VAL C CA    1 
ATOM 1868  C C     . VAL C 3 62  ? 118.404 124.934 150.162 1.00 18.60  ? 62  VAL C C     1 
ATOM 1869  O O     . VAL C 3 62  ? 118.846 123.815 150.433 1.00 18.60  ? 62  VAL C O     1 
ATOM 1870  C CB    . VAL C 3 62  ? 119.049 125.843 147.848 1.00 18.60  ? 62  VAL C CB    1 
ATOM 1871  C CG1   . VAL C 3 62  ? 119.566 127.111 148.390 1.00 18.60  ? 62  VAL C CG1   1 
ATOM 1872  C CG2   . VAL C 3 62  ? 120.191 124.889 147.685 1.00 18.60  ? 62  VAL C CG2   1 
ATOM 1873  N N     . LEU C 3 63  ? 118.207 125.847 151.116 1.00 20.07  ? 63  LEU C N     1 
ATOM 1874  C CA    . LEU C 3 63  ? 118.616 125.584 152.488 1.00 20.07  ? 63  LEU C CA    1 
ATOM 1875  C C     . LEU C 3 63  ? 117.702 124.590 153.179 1.00 20.07  ? 63  LEU C C     1 
ATOM 1876  O O     . LEU C 3 63  ? 118.180 123.768 153.961 1.00 20.07  ? 63  LEU C O     1 
ATOM 1877  C CB    . LEU C 3 63  ? 118.655 126.882 153.280 1.00 20.07  ? 63  LEU C CB    1 
ATOM 1878  C CG    . LEU C 3 63  ? 119.978 127.625 153.292 1.00 20.07  ? 63  LEU C CG    1 
ATOM 1879  C CD1   . LEU C 3 63  ? 119.803 128.860 154.089 1.00 20.07  ? 63  LEU C CD1   1 
ATOM 1880  C CD2   . LEU C 3 63  ? 121.066 126.778 153.871 1.00 20.07  ? 63  LEU C CD2   1 
ATOM 1881  N N     . GLU C 3 64  ? 116.401 124.626 152.901 1.00 25.58  ? 64  GLU C N     1 
ATOM 1882  C CA    . GLU C 3 64  ? 115.505 123.644 153.488 1.00 25.58  ? 64  GLU C CA    1 
ATOM 1883  C C     . GLU C 3 64  ? 115.724 122.256 152.911 1.00 25.58  ? 64  GLU C C     1 
ATOM 1884  O O     . GLU C 3 64  ? 115.705 121.270 153.657 1.00 25.58  ? 64  GLU C O     1 
ATOM 1885  C CB    . GLU C 3 64  ? 114.059 124.060 153.286 1.00 25.58  ? 64  GLU C CB    1 
ATOM 1886  C CG    . GLU C 3 64  ? 113.107 123.215 154.080 1.00 25.58  ? 64  GLU C CG    1 
ATOM 1887  C CD    . GLU C 3 64  ? 111.819 123.914 154.374 1.00 25.58  ? 64  GLU C CD    1 
ATOM 1888  O OE1   . GLU C 3 64  ? 111.629 125.039 153.877 1.00 25.58  ? 64  GLU C OE1   1 
ATOM 1889  O OE2   . GLU C 3 64  ? 110.995 123.337 155.104 1.00 25.58  ? 64  GLU C OE2   1 
ATOM 1890  N N     . LEU C 3 65  ? 115.944 122.151 151.597 1.00 20.02  ? 65  LEU C N     1 
ATOM 1891  C CA    . LEU C 3 65  ? 116.233 120.838 151.026 1.00 20.02  ? 65  LEU C CA    1 
ATOM 1892  C C     . LEU C 3 65  ? 117.574 120.298 151.509 1.00 20.02  ? 65  LEU C C     1 
ATOM 1893  O O     . LEU C 3 65  ? 117.712 119.094 151.751 1.00 20.02  ? 65  LEU C O     1 
ATOM 1894  C CB    . LEU C 3 65  ? 116.195 120.909 149.508 1.00 20.02  ? 65  LEU C CB    1 
ATOM 1895  C CG    . LEU C 3 65  ? 114.857 121.308 148.913 1.00 20.02  ? 65  LEU C CG    1 
ATOM 1896  C CD1   . LEU C 3 65  ? 115.031 121.640 147.467 1.00 20.02  ? 65  LEU C CD1   1 
ATOM 1897  C CD2   . LEU C 3 65  ? 113.873 120.194 149.080 1.00 20.02  ? 65  LEU C CD2   1 
ATOM 1898  N N     . ALA C 3 66  ? 118.555 121.177 151.715 1.00 21.63  ? 66  ALA C N     1 
ATOM 1899  C CA    . ALA C 3 66  ? 119.840 120.745 152.246 1.00 21.63  ? 66  ALA C CA    1 
ATOM 1900  C C     . ALA C 3 66  ? 119.741 120.350 153.711 1.00 21.63  ? 66  ALA C C     1 
ATOM 1901  O O     . ALA C 3 66  ? 120.452 119.453 154.162 1.00 21.63  ? 66  ALA C O     1 
ATOM 1902  C CB    . ALA C 3 66  ? 120.867 121.850 152.057 1.00 21.63  ? 66  ALA C CB    1 
ATOM 1903  N N     . GLY C 3 67  ? 118.858 120.994 154.471 1.00 24.24  ? 67  GLY C N     1 
ATOM 1904  C CA    . GLY C 3 67  ? 118.681 120.609 155.859 1.00 24.24  ? 67  GLY C CA    1 
ATOM 1905  C C     . GLY C 3 67  ? 117.956 119.289 156.005 1.00 24.24  ? 67  GLY C C     1 
ATOM 1906  O O     . GLY C 3 67  ? 118.246 118.509 156.914 1.00 24.24  ? 67  GLY C O     1 
ATOM 1907  N N     . ASN C 3 68  ? 117.011 119.014 155.105 1.00 26.00  ? 68  ASN C N     1 
ATOM 1908  C CA    . ASN C 3 68  ? 116.376 117.701 155.076 1.00 26.00  ? 68  ASN C CA    1 
ATOM 1909  C C     . ASN C 3 68  ? 117.360 116.617 154.665 1.00 26.00  ? 68  ASN C C     1 
ATOM 1910  O O     . ASN C 3 68  ? 117.339 115.511 155.218 1.00 26.00  ? 68  ASN C O     1 
ATOM 1911  C CB    . ASN C 3 68  ? 115.191 117.718 154.127 1.00 26.00  ? 68  ASN C CB    1 
ATOM 1912  C CG    . ASN C 3 68  ? 114.114 118.646 154.577 1.00 26.00  ? 68  ASN C CG    1 
ATOM 1913  O OD1   . ASN C 3 68  ? 114.048 119.005 155.743 1.00 26.00  ? 68  ASN C OD1   1 
ATOM 1914  N ND2   . ASN C 3 68  ? 113.251 119.041 153.659 1.00 26.00  ? 68  ASN C ND2   1 
ATOM 1915  N N     . ALA C 3 69  ? 118.234 116.917 153.701 1.00 25.57  ? 69  ALA C N     1 
ATOM 1916  C CA    . ALA C 3 69  ? 119.273 115.970 153.314 1.00 25.57  ? 69  ALA C CA    1 
ATOM 1917  C C     . ALA C 3 69  ? 120.280 115.746 154.425 1.00 25.57  ? 69  ALA C C     1 
ATOM 1918  O O     . ALA C 3 69  ? 120.838 114.654 154.533 1.00 25.57  ? 69  ALA C O     1 
ATOM 1919  C CB    . ALA C 3 69  ? 119.990 116.457 152.062 1.00 25.57  ? 69  ALA C CB    1 
ATOM 1920  N N     . ALA C 3 70  ? 120.540 116.760 155.244 1.00 27.97  ? 70  ALA C N     1 
ATOM 1921  C CA    . ALA C 3 70  ? 121.393 116.585 156.407 1.00 27.97  ? 70  ALA C CA    1 
ATOM 1922  C C     . ALA C 3 70  ? 120.737 115.737 157.474 1.00 27.97  ? 70  ALA C C     1 
ATOM 1923  O O     . ALA C 3 70  ? 121.409 114.900 158.076 1.00 27.97  ? 70  ALA C O     1 
ATOM 1924  C CB    . ALA C 3 70  ? 121.762 117.938 157.010 1.00 27.97  ? 70  ALA C CB    1 
ATOM 1925  N N     . ARG C 3 71  ? 119.450 115.945 157.724 1.00 32.48  ? 71  ARG C N     1 
ATOM 1926  C CA    . ARG C 3 71  ? 118.721 115.155 158.703 1.00 32.48  ? 71  ARG C CA    1 
ATOM 1927  C C     . ARG C 3 71  ? 118.579 113.702 158.290 1.00 32.48  ? 71  ARG C C     1 
ATOM 1928  O O     . ARG C 3 71  ? 118.576 112.825 159.156 1.00 32.48  ? 71  ARG C O     1 
ATOM 1929  C CB    . ARG C 3 71  ? 117.343 115.762 158.918 1.00 32.48  ? 71  ARG C CB    1 
ATOM 1930  C CG    . ARG C 3 71  ? 116.673 115.368 160.197 1.00 32.48  ? 71  ARG C CG    1 
ATOM 1931  C CD    . ARG C 3 71  ? 115.300 115.983 160.247 1.00 32.48  ? 71  ARG C CD    1 
ATOM 1932  N NE    . ARG C 3 71  ? 114.621 115.830 158.967 1.00 32.48  ? 71  ARG C NE    1 
ATOM 1933  C CZ    . ARG C 3 71  ? 113.788 116.725 158.450 1.00 32.48  ? 71  ARG C CZ    1 
ATOM 1934  N NH1   . ARG C 3 71  ? 113.529 117.847 159.102 1.00 32.48  ? 71  ARG C NH1   1 
ATOM 1935  N NH2   . ARG C 3 71  ? 113.223 116.496 157.277 1.00 32.48  ? 71  ARG C NH2   1 
ATOM 1936  N N     . ASP C 3 72  ? 118.468 113.427 156.991 1.00 35.19  ? 72  ASP C N     1 
ATOM 1937  C CA    . ASP C 3 72  ? 118.412 112.043 156.535 1.00 35.19  ? 72  ASP C CA    1 
ATOM 1938  C C     . ASP C 3 72  ? 119.763 111.350 156.649 1.00 35.19  ? 72  ASP C C     1 
ATOM 1939  O O     . ASP C 3 72  ? 119.827 110.118 156.644 1.00 35.19  ? 72  ASP C O     1 
ATOM 1940  C CB    . ASP C 3 72  ? 117.910 111.990 155.100 1.00 35.19  ? 72  ASP C CB    1 
ATOM 1941  C CG    . ASP C 3 72  ? 116.478 112.441 154.978 1.00 35.19  ? 72  ASP C CG    1 
ATOM 1942  O OD1   . ASP C 3 72  ? 115.735 112.308 155.971 1.00 35.19  ? 72  ASP C OD1   1 
ATOM 1943  O OD2   . ASP C 3 72  ? 116.090 112.928 153.893 1.00 35.19  ? 72  ASP C OD2   1 
ATOM 1944  N N     . ASN C 3 73  ? 120.844 112.112 156.741 1.00 34.94  ? 73  ASN C N     1 
ATOM 1945  C CA    . ASN C 3 73  ? 122.183 111.591 156.956 1.00 34.94  ? 73  ASN C CA    1 
ATOM 1946  C C     . ASN C 3 73  ? 122.519 111.557 158.450 1.00 34.94  ? 73  ASN C C     1 
ATOM 1947  O O     . ASN C 3 73  ? 123.643 111.207 158.823 1.00 34.94  ? 73  ASN C O     1 
ATOM 1948  C CB    . ASN C 3 73  ? 123.169 112.456 156.151 1.00 34.94  ? 73  ASN C CB    1 
ATOM 1949  C CG    . ASN C 3 73  ? 124.576 111.884 156.070 1.00 34.94  ? 73  ASN C CG    1 
ATOM 1950  O OD1   . ASN C 3 73  ? 124.796 110.691 156.265 1.00 34.94  ? 73  ASN C OD1   1 
ATOM 1951  N ND2   . ASN C 3 73  ? 125.538 112.747 155.783 1.00 34.94  ? 73  ASN C ND2   1 
ATOM 1952  N N     . LYS C 3 74  ? 121.537 111.884 159.301 1.00 36.41  ? 74  LYS C N     1 
ATOM 1953  C CA    . LYS C 3 74  ? 121.667 111.956 160.762 1.00 36.41  ? 74  LYS C CA    1 
ATOM 1954  C C     . LYS C 3 74  ? 122.759 112.933 161.190 1.00 36.41  ? 74  LYS C C     1 
ATOM 1955  O O     . LYS C 3 74  ? 123.537 112.665 162.104 1.00 36.41  ? 74  LYS C O     1 
ATOM 1956  C CB    . LYS C 3 74  ? 121.886 110.574 161.384 1.00 36.41  ? 74  LYS C CB    1 
ATOM 1957  C CG    . LYS C 3 74  ? 120.623 109.748 161.490 1.00 36.41  ? 74  LYS C CG    1 
ATOM 1958  C CD    . LYS C 3 74  ? 120.785 108.632 162.496 1.00 36.41  ? 74  LYS C CD    1 
ATOM 1959  C CE    . LYS C 3 74  ? 120.631 109.133 163.921 1.00 36.41  ? 74  LYS C CE    1 
ATOM 1960  N NZ    . LYS C 3 74  ? 120.594 108.007 164.900 1.00 36.41  ? 74  LYS C NZ    1 
ATOM 1961  N N     . LYS C 3 75  ? 122.809 114.079 160.525 1.00 38.36  ? 75  LYS C N     1 
ATOM 1962  C CA    . LYS C 3 75  ? 123.691 115.175 160.886 1.00 38.36  ? 75  LYS C CA    1 
ATOM 1963  C C     . LYS C 3 75  ? 122.862 116.415 161.182 1.00 38.36  ? 75  LYS C C     1 
ATOM 1964  O O     . LYS C 3 75  ? 121.729 116.557 160.726 1.00 38.36  ? 75  LYS C O     1 
ATOM 1965  C CB    . LYS C 3 75  ? 124.699 115.461 159.770 1.00 38.36  ? 75  LYS C CB    1 
ATOM 1966  C CG    . LYS C 3 75  ? 125.445 114.248 159.277 1.00 38.36  ? 75  LYS C CG    1 
ATOM 1967  C CD    . LYS C 3 75  ? 126.586 113.894 160.195 1.00 38.36  ? 75  LYS C CD    1 
ATOM 1968  C CE    . LYS C 3 75  ? 127.679 113.181 159.442 1.00 38.36  ? 75  LYS C CE    1 
ATOM 1969  N NZ    . LYS C 3 75  ? 128.511 114.147 158.679 1.00 38.36  ? 75  LYS C NZ    1 
ATOM 1970  N N     . THR C 3 76  ? 123.437 117.314 161.978 1.00 39.50  ? 76  THR C N     1 
ATOM 1971  C CA    . THR C 3 76  ? 122.780 118.567 162.305 1.00 39.50  ? 76  THR C CA    1 
ATOM 1972  C C     . THR C 3 76  ? 123.457 119.781 161.706 1.00 39.50  ? 76  THR C C     1 
ATOM 1973  O O     . THR C 3 76  ? 123.017 120.897 161.977 1.00 39.50  ? 76  THR C O     1 
ATOM 1974  C CB    . THR C 3 76  ? 122.692 118.772 163.825 1.00 39.50  ? 76  THR C CB    1 
ATOM 1975  O OG1   . THR C 3 76  ? 123.933 119.298 164.313 1.00 39.50  ? 76  THR C OG1   1 
ATOM 1976  C CG2   . THR C 3 76  ? 122.382 117.466 164.534 1.00 39.50  ? 76  THR C CG2   1 
ATOM 1977  N N     . ARG C 3 77  ? 124.510 119.605 160.922 1.00 35.52  ? 77  ARG C N     1 
ATOM 1978  C CA    . ARG C 3 77  ? 125.148 120.696 160.212 1.00 35.52  ? 77  ARG C CA    1 
ATOM 1979  C C     . ARG C 3 77  ? 125.096 120.413 158.725 1.00 35.52  ? 77  ARG C C     1 
ATOM 1980  O O     . ARG C 3 77  ? 125.328 119.281 158.299 1.00 35.52  ? 77  ARG C O     1 
ATOM 1981  C CB    . ARG C 3 77  ? 126.589 120.881 160.653 1.00 35.52  ? 77  ARG C CB    1 
ATOM 1982  C CG    . ARG C 3 77  ? 126.727 121.768 161.841 1.00 35.52  ? 77  ARG C CG    1 
ATOM 1983  C CD    . ARG C 3 77  ? 127.982 122.564 161.749 1.00 35.52  ? 77  ARG C CD    1 
ATOM 1984  N NE    . ARG C 3 77  ? 129.156 121.788 162.117 1.00 35.52  ? 77  ARG C NE    1 
ATOM 1985  C CZ    . ARG C 3 77  ? 129.608 121.668 163.358 1.00 35.52  ? 77  ARG C CZ    1 
ATOM 1986  N NH1   . ARG C 3 77  ? 128.981 122.263 164.358 1.00 35.52  ? 77  ARG C NH1   1 
ATOM 1987  N NH2   . ARG C 3 77  ? 130.690 120.948 163.598 1.00 35.52  ? 77  ARG C NH2   1 
ATOM 1988  N N     . ILE C 3 78  ? 124.788 121.440 157.943 1.00 22.43  ? 78  ILE C N     1 
ATOM 1989  C CA    . ILE C 3 78  ? 124.831 121.325 156.496 1.00 22.43  ? 78  ILE C CA    1 
ATOM 1990  C C     . ILE C 3 78  ? 126.280 121.435 156.049 1.00 22.43  ? 78  ILE C C     1 
ATOM 1991  O O     . ILE C 3 78  ? 126.984 122.380 156.411 1.00 22.43  ? 78  ILE C O     1 
ATOM 1992  C CB    . ILE C 3 78  ? 123.956 122.396 155.844 1.00 22.43  ? 78  ILE C CB    1 
ATOM 1993  C CG1   . ILE C 3 78  ? 122.522 122.253 156.325 1.00 22.43  ? 78  ILE C CG1   1 
ATOM 1994  C CG2   . ILE C 3 78  ? 124.007 122.297 154.356 1.00 22.43  ? 78  ILE C CG2   1 
ATOM 1995  C CD1   . ILE C 3 78  ? 121.636 123.354 155.883 1.00 22.43  ? 78  ILE C CD1   1 
ATOM 1996  N N     . ILE C 3 79  ? 126.741 120.448 155.291 1.00 18.77  ? 79  ILE C N     1 
ATOM 1997  C CA    . ILE C 3 79  ? 128.067 120.461 154.684 1.00 18.77  ? 79  ILE C CA    1 
ATOM 1998  C C     . ILE C 3 79  ? 127.813 120.585 153.185 1.00 18.77  ? 79  ILE C C     1 
ATOM 1999  O O     . ILE C 3 79  ? 126.646 120.504 152.790 1.00 18.77  ? 79  ILE C O     1 
ATOM 2000  C CB    . ILE C 3 79  ? 128.870 119.213 155.093 1.00 18.77  ? 79  ILE C CB    1 
ATOM 2001  C CG1   . ILE C 3 79  ? 128.215 117.948 154.577 1.00 18.77  ? 79  ILE C CG1   1 
ATOM 2002  C CG2   . ILE C 3 79  ? 129.042 119.170 156.583 1.00 18.77  ? 79  ILE C CG2   1 
ATOM 2003  C CD1   . ILE C 3 79  ? 129.127 116.792 154.581 1.00 18.77  ? 79  ILE C CD1   1 
ATOM 2004  N N     . PRO C 3 80  ? 128.815 120.839 152.327 1.00 16.68  ? 80  PRO C N     1 
ATOM 2005  C CA    . PRO C 3 80  ? 128.541 120.959 150.883 1.00 16.68  ? 80  PRO C CA    1 
ATOM 2006  C C     . PRO C 3 80  ? 127.927 119.737 150.216 1.00 16.68  ? 80  PRO C C     1 
ATOM 2007  O O     . PRO C 3 80  ? 127.291 119.886 149.166 1.00 16.68  ? 80  PRO C O     1 
ATOM 2008  C CB    . PRO C 3 80  ? 129.925 121.241 150.310 1.00 16.68  ? 80  PRO C CB    1 
ATOM 2009  C CG    . PRO C 3 80  ? 130.591 121.955 151.341 1.00 16.68  ? 80  PRO C CG    1 
ATOM 2010  C CD    . PRO C 3 80  ? 130.144 121.404 152.627 1.00 16.68  ? 80  PRO C CD    1 
ATOM 2011  N N     . ARG C 3 81  ? 128.103 118.547 150.789 1.00 18.61  ? 81  ARG C N     1 
ATOM 2012  C CA    . ARG C 3 81  ? 127.483 117.343 150.257 1.00 18.61  ? 81  ARG C CA    1 
ATOM 2013  C C     . ARG C 3 81  ? 125.966 117.436 150.295 1.00 18.61  ? 81  ARG C C     1 
ATOM 2014  O O     . ARG C 3 81  ? 125.293 116.998 149.363 1.00 18.61  ? 81  ARG C O     1 
ATOM 2015  C CB    . ARG C 3 81  ? 127.973 116.134 151.045 1.00 18.61  ? 81  ARG C CB    1 
ATOM 2016  C CG    . ARG C 3 81  ? 127.379 114.819 150.640 1.00 18.61  ? 81  ARG C CG    1 
ATOM 2017  C CD    . ARG C 3 81  ? 127.590 114.565 149.178 1.00 18.61  ? 81  ARG C CD    1 
ATOM 2018  N NE    . ARG C 3 81  ? 127.786 113.161 148.864 1.00 18.61  ? 81  ARG C NE    1 
ATOM 2019  C CZ    . ARG C 3 81  ? 127.510 112.641 147.682 1.00 18.61  ? 81  ARG C CZ    1 
ATOM 2020  N NH1   . ARG C 3 81  ? 127.025 113.413 146.731 1.00 18.61  ? 81  ARG C NH1   1 
ATOM 2021  N NH2   . ARG C 3 81  ? 127.706 111.360 147.453 1.00 18.61  ? 81  ARG C NH2   1 
ATOM 2022  N N     . HIS C 3 82  ? 125.412 118.041 151.340 1.00 20.22  ? 82  HIS C N     1 
ATOM 2023  C CA    . HIS C 3 82  ? 123.966 118.145 151.453 1.00 20.22  ? 82  HIS C CA    1 
ATOM 2024  C C     . HIS C 3 82  ? 123.392 119.170 150.495 1.00 20.22  ? 82  HIS C C     1 
ATOM 2025  O O     . HIS C 3 82  ? 122.308 118.953 149.952 1.00 20.22  ? 82  HIS C O     1 
ATOM 2026  C CB    . HIS C 3 82  ? 123.590 118.471 152.889 1.00 20.22  ? 82  HIS C CB    1 
ATOM 2027  C CG    . HIS C 3 82  ? 124.166 117.517 153.880 1.00 20.22  ? 82  HIS C CG    1 
ATOM 2028  N ND1   . HIS C 3 82  ? 124.658 117.916 155.100 1.00 20.22  ? 82  HIS C ND1   1 
ATOM 2029  C CD2   . HIS C 3 82  ? 124.344 116.179 153.824 1.00 20.22  ? 82  HIS C CD2   1 
ATOM 2030  C CE1   . HIS C 3 82  ? 125.106 116.864 155.758 1.00 20.22  ? 82  HIS C CE1   1 
ATOM 2031  N NE2   . HIS C 3 82  ? 124.933 115.799 155.002 1.00 20.22  ? 82  HIS C NE2   1 
ATOM 2032  N N     . LEU C 3 83  ? 124.118 120.261 150.247 1.00 18.84  ? 83  LEU C N     1 
ATOM 2033  C CA    . LEU C 3 83  ? 123.725 121.216 149.217 1.00 18.84  ? 83  LEU C CA    1 
ATOM 2034  C C     . LEU C 3 83  ? 123.766 120.587 147.839 1.00 18.84  ? 83  LEU C C     1 
ATOM 2035  O O     . LEU C 3 83  ? 122.862 120.810 147.029 1.00 18.84  ? 83  LEU C O     1 
ATOM 2036  C CB    . LEU C 3 83  ? 124.635 122.434 149.249 1.00 18.84  ? 83  LEU C CB    1 
ATOM 2037  C CG    . LEU C 3 83  ? 124.667 123.275 150.508 1.00 18.84  ? 83  LEU C CG    1 
ATOM 2038  C CD1   . LEU C 3 83  ? 125.911 124.093 150.511 1.00 18.84  ? 83  LEU C CD1   1 
ATOM 2039  C CD2   . LEU C 3 83  ? 123.462 124.161 150.530 1.00 18.84  ? 83  LEU C CD2   1 
ATOM 2040  N N     . GLN C 3 84  ? 124.790 119.781 147.561 1.00 19.88  ? 84  GLN C N     1 
ATOM 2041  C CA    . GLN C 3 84  ? 124.883 119.121 146.264 1.00 19.88  ? 84  GLN C CA    1 
ATOM 2042  C C     . GLN C 3 84  ? 123.770 118.097 146.076 1.00 19.88  ? 84  GLN C C     1 
ATOM 2043  O O     . GLN C 3 84  ? 123.160 118.034 145.007 1.00 19.88  ? 84  GLN C O     1 
ATOM 2044  C CB    . GLN C 3 84  ? 126.251 118.471 146.111 1.00 19.88  ? 84  GLN C CB    1 
ATOM 2045  C CG    . GLN C 3 84  ? 126.344 117.459 145.007 1.00 19.88  ? 84  GLN C CG    1 
ATOM 2046  C CD    . GLN C 3 84  ? 126.846 118.054 143.733 1.00 19.88  ? 84  GLN C CD    1 
ATOM 2047  O OE1   . GLN C 3 84  ? 127.051 119.253 143.646 1.00 19.88  ? 84  GLN C OE1   1 
ATOM 2048  N NE2   . GLN C 3 84  ? 127.051 117.220 142.730 1.00 19.88  ? 84  GLN C NE2   1 
ATOM 2049  N N     . LEU C 3 85  ? 123.479 117.299 147.107 1.00 19.34  ? 85  LEU C N     1 
ATOM 2050  C CA    . LEU C 3 85  ? 122.381 116.339 147.022 1.00 19.34  ? 85  LEU C CA    1 
ATOM 2051  C C     . LEU C 3 85  ? 121.041 117.027 146.833 1.00 19.34  ? 85  LEU C C     1 
ATOM 2052  O O     . LEU C 3 85  ? 120.247 116.598 145.989 1.00 19.34  ? 85  LEU C O     1 
ATOM 2053  C CB    . LEU C 3 85  ? 122.320 115.477 148.274 1.00 19.34  ? 85  LEU C CB    1 
ATOM 2054  C CG    . LEU C 3 85  ? 123.400 114.436 148.524 1.00 19.34  ? 85  LEU C CG    1 
ATOM 2055  C CD1   . LEU C 3 85  ? 123.222 113.862 149.908 1.00 19.34  ? 85  LEU C CD1   1 
ATOM 2056  C CD2   . LEU C 3 85  ? 123.363 113.356 147.476 1.00 19.34  ? 85  LEU C CD2   1 
ATOM 2057  N N     . ALA C 3 86  ? 120.803 118.110 147.578 1.00 18.71  ? 86  ALA C N     1 
ATOM 2058  C CA    . ALA C 3 86  ? 119.585 118.896 147.452 1.00 18.71  ? 86  ALA C CA    1 
ATOM 2059  C C     . ALA C 3 86  ? 119.417 119.475 146.057 1.00 18.71  ? 86  ALA C C     1 
ATOM 2060  O O     . ALA C 3 86  ? 118.313 119.470 145.510 1.00 18.71  ? 86  ALA C O     1 
ATOM 2061  C CB    . ALA C 3 86  ? 119.609 120.019 148.475 1.00 18.71  ? 86  ALA C CB    1 
ATOM 2062  N N     . ILE C 3 87  ? 120.498 119.977 145.465 1.00 19.55  ? 87  ILE C N     1 
ATOM 2063  C CA    . ILE C 3 87  ? 120.383 120.632 144.170 1.00 19.55  ? 87  ILE C CA    1 
ATOM 2064  C C     . ILE C 3 87  ? 120.253 119.613 143.049 1.00 19.55  ? 87  ILE C C     1 
ATOM 2065  O O     . ILE C 3 87  ? 119.397 119.752 142.173 1.00 19.55  ? 87  ILE C O     1 
ATOM 2066  C CB    . ILE C 3 87  ? 121.576 121.580 143.970 1.00 19.55  ? 87  ILE C CB    1 
ATOM 2067  C CG1   . ILE C 3 87  ? 121.368 122.815 144.824 1.00 19.55  ? 87  ILE C CG1   1 
ATOM 2068  C CG2   . ILE C 3 87  ? 121.725 121.994 142.532 1.00 19.55  ? 87  ILE C CG2   1 
ATOM 2069  C CD1   . ILE C 3 87  ? 122.612 123.512 145.188 1.00 19.55  ? 87  ILE C CD1   1 
ATOM 2070  N N     . ARG C 3 88  ? 121.058 118.553 143.067 1.00 19.77  ? 88  ARG C N     1 
ATOM 2071  C CA    . ARG C 3 88  ? 121.013 117.598 141.972 1.00 19.77  ? 88  ARG C CA    1 
ATOM 2072  C C     . ARG C 3 88  ? 119.872 116.600 142.080 1.00 19.77  ? 88  ARG C C     1 
ATOM 2073  O O     . ARG C 3 88  ? 119.599 115.909 141.099 1.00 19.77  ? 88  ARG C O     1 
ATOM 2074  C CB    . ARG C 3 88  ? 122.332 116.846 141.872 1.00 19.77  ? 88  ARG C CB    1 
ATOM 2075  C CG    . ARG C 3 88  ? 123.532 117.732 141.831 1.00 19.77  ? 88  ARG C CG    1 
ATOM 2076  C CD    . ARG C 3 88  ? 123.755 118.364 140.502 1.00 19.77  ? 88  ARG C CD    1 
ATOM 2077  N NE    . ARG C 3 88  ? 124.802 119.369 140.600 1.00 19.77  ? 88  ARG C NE    1 
ATOM 2078  C CZ    . ARG C 3 88  ? 124.753 120.563 140.029 1.00 19.77  ? 88  ARG C CZ    1 
ATOM 2079  N NH1   . ARG C 3 88  ? 123.708 120.912 139.301 1.00 19.77  ? 88  ARG C NH1   1 
ATOM 2080  N NH2   . ARG C 3 88  ? 125.755 121.405 140.185 1.00 19.77  ? 88  ARG C NH2   1 
ATOM 2081  N N     . ASN C 3 89  ? 119.184 116.512 143.219 1.00 21.12  ? 89  ASN C N     1 
ATOM 2082  C CA    . ASN C 3 89  ? 117.992 115.684 143.332 1.00 21.12  ? 89  ASN C CA    1 
ATOM 2083  C C     . ASN C 3 89  ? 116.719 116.431 142.980 1.00 21.12  ? 89  ASN C C     1 
ATOM 2084  O O     . ASN C 3 89  ? 115.630 116.008 143.374 1.00 21.12  ? 89  ASN C O     1 
ATOM 2085  C CB    . ASN C 3 89  ? 117.888 115.118 144.742 1.00 21.12  ? 89  ASN C CB    1 
ATOM 2086  C CG    . ASN C 3 89  ? 118.654 113.850 144.907 1.00 21.12  ? 89  ASN C CG    1 
ATOM 2087  O OD1   . ASN C 3 89  ? 118.624 112.980 144.045 1.00 21.12  ? 89  ASN C OD1   1 
ATOM 2088  N ND2   . ASN C 3 89  ? 119.347 113.725 146.021 1.00 21.12  ? 89  ASN C ND2   1 
ATOM 2089  N N     . ASP C 3 90  ? 116.819 117.522 142.238 1.00 24.06  ? 90  ASP C N     1 
ATOM 2090  C CA    . ASP C 3 90  ? 115.674 118.374 141.973 1.00 24.06  ? 90  ASP C CA    1 
ATOM 2091  C C     . ASP C 3 90  ? 115.811 118.897 140.557 1.00 24.06  ? 90  ASP C C     1 
ATOM 2092  O O     . ASP C 3 90  ? 116.849 119.461 140.217 1.00 24.06  ? 90  ASP C O     1 
ATOM 2093  C CB    . ASP C 3 90  ? 115.631 119.513 142.986 1.00 24.06  ? 90  ASP C CB    1 
ATOM 2094  C CG    . ASP C 3 90  ? 114.291 120.186 143.053 1.00 24.06  ? 90  ASP C CG    1 
ATOM 2095  O OD1   . ASP C 3 90  ? 113.402 119.872 142.240 1.00 24.06  ? 90  ASP C OD1   1 
ATOM 2096  O OD2   . ASP C 3 90  ? 114.101 121.030 143.948 1.00 24.06  ? 90  ASP C OD2   1 
ATOM 2097  N N     . GLU C 3 91  ? 114.764 118.718 139.751 1.00 26.41  ? 91  GLU C N     1 
ATOM 2098  C CA    . GLU C 3 91  ? 114.843 118.989 138.318 1.00 26.41  ? 91  GLU C CA    1 
ATOM 2099  C C     . GLU C 3 91  ? 114.988 120.480 138.045 1.00 26.41  ? 91  GLU C C     1 
ATOM 2100  O O     . GLU C 3 91  ? 115.805 120.894 137.218 1.00 26.41  ? 91  GLU C O     1 
ATOM 2101  C CB    . GLU C 3 91  ? 113.597 118.424 137.634 1.00 26.41  ? 91  GLU C CB    1 
ATOM 2102  C CG    . GLU C 3 91  ? 113.670 118.166 136.130 1.00 26.41  ? 91  GLU C CG    1 
ATOM 2103  C CD    . GLU C 3 91  ? 113.293 119.352 135.260 1.00 26.41  ? 91  GLU C CD    1 
ATOM 2104  O OE1   . GLU C 3 91  ? 112.596 120.267 135.734 1.00 26.41  ? 91  GLU C OE1   1 
ATOM 2105  O OE2   . GLU C 3 91  ? 113.664 119.350 134.069 1.00 26.41  ? 91  GLU C OE2   1 
ATOM 2106  N N     . GLU C 3 92  ? 114.244 121.307 138.778 1.00 23.56  ? 92  GLU C N     1 
ATOM 2107  C CA    . GLU C 3 92  ? 114.272 122.747 138.552 1.00 23.56  ? 92  GLU C CA    1 
ATOM 2108  C C     . GLU C 3 92  ? 115.546 123.382 139.086 1.00 23.56  ? 92  GLU C C     1 
ATOM 2109  O O     . GLU C 3 92  ? 116.136 124.242 138.427 1.00 23.56  ? 92  GLU C O     1 
ATOM 2110  C CB    . GLU C 3 92  ? 113.051 123.399 139.192 1.00 23.56  ? 92  GLU C CB    1 
ATOM 2111  C CG    . GLU C 3 92  ? 111.779 123.280 138.377 1.00 23.56  ? 92  GLU C CG    1 
ATOM 2112  C CD    . GLU C 3 92  ? 110.529 123.341 139.232 1.00 23.56  ? 92  GLU C CD    1 
ATOM 2113  O OE1   . GLU C 3 92  ? 110.647 123.522 140.459 1.00 23.56  ? 92  GLU C OE1   1 
ATOM 2114  O OE2   . GLU C 3 92  ? 109.421 123.190 138.678 1.00 23.56  ? 92  GLU C OE2   1 
ATOM 2115  N N     . LEU C 3 93  ? 115.988 122.975 140.273 1.00 20.12  ? 93  LEU C N     1 
ATOM 2116  C CA    . LEU C 3 93  ? 117.239 123.487 140.809 1.00 20.12  ? 93  LEU C CA    1 
ATOM 2117  C C     . LEU C 3 93  ? 118.445 122.983 140.037 1.00 20.12  ? 93  LEU C C     1 
ATOM 2118  O O     . LEU C 3 93  ? 119.453 123.685 139.960 1.00 20.12  ? 93  LEU C O     1 
ATOM 2119  C CB    . LEU C 3 93  ? 117.377 123.115 142.281 1.00 20.12  ? 93  LEU C CB    1 
ATOM 2120  C CG    . LEU C 3 93  ? 116.467 123.798 143.294 1.00 20.12  ? 93  LEU C CG    1 
ATOM 2121  C CD1   . LEU C 3 93  ? 116.918 123.450 144.688 1.00 20.12  ? 93  LEU C CD1   1 
ATOM 2122  C CD2   . LEU C 3 93  ? 116.461 125.291 143.108 1.00 20.12  ? 93  LEU C CD2   1 
ATOM 2123  N N     . ASN C 3 94  ? 118.362 121.803 139.440 1.00 20.32  ? 94  ASN C N     1 
ATOM 2124  C CA    . ASN C 3 94  ? 119.432 121.337 138.581 1.00 20.32  ? 94  ASN C CA    1 
ATOM 2125  C C     . ASN C 3 94  ? 119.442 122.036 137.238 1.00 20.32  ? 94  ASN C C     1 
ATOM 2126  O O     . ASN C 3 94  ? 120.511 122.204 136.656 1.00 20.32  ? 94  ASN C O     1 
ATOM 2127  C CB    . ASN C 3 94  ? 119.317 119.831 138.373 1.00 20.32  ? 94  ASN C CB    1 
ATOM 2128  C CG    . ASN C 3 94  ? 120.648 119.187 138.117 1.00 20.32  ? 94  ASN C CG    1 
ATOM 2129  O OD1   . ASN C 3 94  ? 121.691 119.787 138.343 1.00 20.32  ? 94  ASN C OD1   1 
ATOM 2130  N ND2   . ASN C 3 94  ? 120.623 117.959 137.639 1.00 20.32  ? 94  ASN C ND2   1 
ATOM 2131  N N     . LYS C 3 95  ? 118.282 122.437 136.721 1.00 20.20  ? 95  LYS C N     1 
ATOM 2132  C CA    . LYS C 3 95  ? 118.267 123.259 135.520 1.00 20.20  ? 95  LYS C CA    1 
ATOM 2133  C C     . LYS C 3 95  ? 118.789 124.659 135.806 1.00 20.20  ? 95  LYS C C     1 
ATOM 2134  O O     . LYS C 3 95  ? 119.443 125.261 134.952 1.00 20.20  ? 95  LYS C O     1 
ATOM 2135  C CB    . LYS C 3 95  ? 116.855 123.307 134.947 1.00 20.20  ? 95  LYS C CB    1 
ATOM 2136  C CG    . LYS C 3 95  ? 116.693 124.073 133.648 1.00 20.20  ? 95  LYS C CG    1 
ATOM 2137  C CD    . LYS C 3 95  ? 117.410 123.408 132.490 1.00 20.20  ? 95  LYS C CD    1 
ATOM 2138  C CE    . LYS C 3 95  ? 116.704 122.133 132.041 1.00 20.20  ? 95  LYS C CE    1 
ATOM 2139  N NZ    . LYS C 3 95  ? 117.349 121.494 130.852 1.00 20.20  ? 95  LYS C NZ    1 
ATOM 2140  N N     . LEU C 3 96  ? 118.535 125.184 137.003 1.00 16.21  ? 96  LEU C N     1 
ATOM 2141  C CA    . LEU C 3 96  ? 119.089 126.480 137.378 1.00 16.21  ? 96  LEU C CA    1 
ATOM 2142  C C     . LEU C 3 96  ? 120.596 126.426 137.606 1.00 16.21  ? 96  LEU C C     1 
ATOM 2143  O O     . LEU C 3 96  ? 121.306 127.357 137.224 1.00 16.21  ? 96  LEU C O     1 
ATOM 2144  C CB    . LEU C 3 96  ? 118.393 127.000 138.631 1.00 16.21  ? 96  LEU C CB    1 
ATOM 2145  C CG    . LEU C 3 96  ? 118.786 128.379 139.152 1.00 16.21  ? 96  LEU C CG    1 
ATOM 2146  C CD1   . LEU C 3 96  ? 118.362 129.444 138.181 1.00 16.21  ? 96  LEU C CD1   1 
ATOM 2147  C CD2   . LEU C 3 96  ? 118.174 128.614 140.502 1.00 16.21  ? 96  LEU C CD2   1 
ATOM 2148  N N     . LEU C 3 97  ? 121.110 125.356 138.198 1.00 15.76  ? 97  LEU C N     1 
ATOM 2149  C CA    . LEU C 3 97  ? 122.525 125.316 138.535 1.00 15.76  ? 97  LEU C CA    1 
ATOM 2150  C C     . LEU C 3 97  ? 123.245 124.226 137.762 1.00 15.76  ? 97  LEU C C     1 
ATOM 2151  O O     . LEU C 3 97  ? 123.981 123.427 138.340 1.00 15.76  ? 97  LEU C O     1 
ATOM 2152  C CB    . LEU C 3 97  ? 122.713 125.103 140.032 1.00 15.76  ? 97  LEU C CB    1 
ATOM 2153  C CG    . LEU C 3 97  ? 122.162 126.190 140.942 1.00 15.76  ? 97  LEU C CG    1 
ATOM 2154  C CD1   . LEU C 3 97  ? 122.556 125.886 142.332 1.00 15.76  ? 97  LEU C CD1   1 
ATOM 2155  C CD2   . LEU C 3 97  ? 122.692 127.537 140.540 1.00 15.76  ? 97  LEU C CD2   1 
ATOM 2156  N N     . SER C 3 98  ? 123.017 124.174 136.455 1.00 16.74  ? 98  SER C N     1 
ATOM 2157  C CA    . SER C 3 98  ? 123.549 123.093 135.640 1.00 16.74  ? 98  SER C CA    1 
ATOM 2158  C C     . SER C 3 98  ? 125.026 123.288 135.328 1.00 16.74  ? 98  SER C C     1 
ATOM 2159  O O     . SER C 3 98  ? 125.800 122.329 135.364 1.00 16.74  ? 98  SER C O     1 
ATOM 2160  C CB    . SER C 3 98  ? 122.743 122.973 134.354 1.00 16.74  ? 98  SER C CB    1 
ATOM 2161  O OG    . SER C 3 98  ? 122.730 124.200 133.660 1.00 16.74  ? 98  SER C OG    1 
ATOM 2162  N N     . GLY C 3 99  ? 125.433 124.510 135.018 1.00 13.93  ? 99  GLY C N     1 
ATOM 2163  C CA    . GLY C 3 99  ? 126.827 124.768 134.736 1.00 13.93  ? 99  GLY C CA    1 
ATOM 2164  C C     . GLY C 3 99  ? 127.561 125.271 135.951 1.00 13.93  ? 99  GLY C C     1 
ATOM 2165  O O     . GLY C 3 99  ? 128.423 126.140 135.853 1.00 13.93  ? 99  GLY C O     1 
ATOM 2166  N N     . VAL C 3 100 ? 127.221 124.717 137.105 1.00 14.53  ? 100 VAL C N     1 
ATOM 2167  C CA    . VAL C 3 100 ? 127.746 125.145 138.389 1.00 14.53  ? 100 VAL C CA    1 
ATOM 2168  C C     . VAL C 3 100 ? 128.382 123.940 139.054 1.00 14.53  ? 100 VAL C C     1 
ATOM 2169  O O     . VAL C 3 100 ? 127.761 122.880 139.154 1.00 14.53  ? 100 VAL C O     1 
ATOM 2170  C CB    . VAL C 3 100 ? 126.641 125.747 139.278 1.00 14.53  ? 100 VAL C CB    1 
ATOM 2171  C CG1   . VAL C 3 100 ? 127.059 125.779 140.700 1.00 14.53  ? 100 VAL C CG1   1 
ATOM 2172  C CG2   . VAL C 3 100 ? 126.299 127.131 138.826 1.00 14.53  ? 100 VAL C CG2   1 
ATOM 2173  N N     . THR C 3 101 ? 129.634 124.095 139.465 1.00 14.59  ? 101 THR C N     1 
ATOM 2174  C CA    . THR C 3 101 ? 130.327 123.128 140.292 1.00 14.59  ? 101 THR C CA    1 
ATOM 2175  C C     . THR C 3 101 ? 130.251 123.575 141.738 1.00 14.59  ? 101 THR C C     1 
ATOM 2176  O O     . THR C 3 101 ? 130.495 124.739 142.047 1.00 14.59  ? 101 THR C O     1 
ATOM 2177  C CB    . THR C 3 101 ? 131.784 123.018 139.855 1.00 14.59  ? 101 THR C CB    1 
ATOM 2178  O OG1   . THR C 3 101 ? 131.841 122.690 138.463 1.00 14.59  ? 101 THR C OG1   1 
ATOM 2179  C CG2   . THR C 3 101 ? 132.528 121.980 140.659 1.00 14.59  ? 101 THR C CG2   1 
ATOM 2180  N N     . ILE C 3 102 ? 129.894 122.658 142.622 1.00 15.72  ? 102 ILE C N     1 
ATOM 2181  C CA    . ILE C 3 102 ? 129.882 122.908 144.055 1.00 15.72  ? 102 ILE C CA    1 
ATOM 2182  C C     . ILE C 3 102 ? 131.112 122.240 144.638 1.00 15.72  ? 102 ILE C C     1 
ATOM 2183  O O     . ILE C 3 102 ? 131.329 121.042 144.437 1.00 15.72  ? 102 ILE C O     1 
ATOM 2184  C CB    . ILE C 3 102 ? 128.588 122.399 144.697 1.00 15.72  ? 102 ILE C CB    1 
ATOM 2185  C CG1   . ILE C 3 102 ? 127.470 123.374 144.401 1.00 15.72  ? 102 ILE C CG1   1 
ATOM 2186  C CG2   . ILE C 3 102 ? 128.731 122.232 146.177 1.00 15.72  ? 102 ILE C CG2   1 
ATOM 2187  C CD1   . ILE C 3 102 ? 126.158 122.808 144.636 1.00 15.72  ? 102 ILE C CD1   1 
ATOM 2188  N N     . ALA C 3 103 ? 131.937 123.021 145.318 1.00 17.40  ? 103 ALA C N     1 
ATOM 2189  C CA    . ALA C 3 103 ? 133.195 122.516 145.831 1.00 17.40  ? 103 ALA C CA    1 
ATOM 2190  C C     . ALA C 3 103 ? 132.957 121.592 147.010 1.00 17.40  ? 103 ALA C C     1 
ATOM 2191  O O     . ALA C 3 103 ? 132.146 121.893 147.886 1.00 17.40  ? 103 ALA C O     1 
ATOM 2192  C CB    . ALA C 3 103 ? 134.088 123.669 146.253 1.00 17.40  ? 103 ALA C CB    1 
ATOM 2193  N N     . GLN C 3 104 ? 133.680 120.466 147.017 1.00 20.84  ? 104 GLN C N     1 
ATOM 2194  C CA    . GLN C 3 104 ? 133.562 119.394 148.011 1.00 20.84  ? 104 GLN C CA    1 
ATOM 2195  C C     . GLN C 3 104 ? 132.147 118.839 148.070 1.00 20.84  ? 104 GLN C C     1 
ATOM 2196  O O     . GLN C 3 104 ? 131.659 118.461 149.131 1.00 20.84  ? 104 GLN C O     1 
ATOM 2197  C CB    . GLN C 3 104 ? 134.028 119.843 149.398 1.00 20.84  ? 104 GLN C CB    1 
ATOM 2198  C CG    . GLN C 3 104 ? 135.521 119.991 149.541 1.00 20.84  ? 104 GLN C CG    1 
ATOM 2199  C CD    . GLN C 3 104 ? 136.226 118.655 149.653 1.00 20.84  ? 104 GLN C CD    1 
ATOM 2200  O OE1   . GLN C 3 104 ? 135.899 117.838 150.514 1.00 20.84  ? 104 GLN C OE1   1 
ATOM 2201  N NE2   . GLN C 3 104 ? 137.203 118.427 148.785 1.00 20.84  ? 104 GLN C NE2   1 
ATOM 2202  N N     . GLY C 3 105 ? 131.494 118.765 146.919 1.00 18.25  ? 105 GLY C N     1 
ATOM 2203  C CA    . GLY C 3 105 ? 130.113 118.345 146.860 1.00 18.25  ? 105 GLY C CA    1 
ATOM 2204  C C     . GLY C 3 105 ? 129.917 116.920 146.402 1.00 18.25  ? 105 GLY C C     1 
ATOM 2205  O O     . GLY C 3 105 ? 128.901 116.308 146.720 1.00 18.25  ? 105 GLY C O     1 
ATOM 2206  N N     . GLY C 3 106 ? 130.863 116.379 145.644 1.00 18.60  ? 106 GLY C N     1 
ATOM 2207  C CA    . GLY C 3 106 ? 130.731 115.019 145.166 1.00 18.60  ? 106 GLY C CA    1 
ATOM 2208  C C     . GLY C 3 106 ? 129.754 114.906 144.010 1.00 18.60  ? 106 GLY C C     1 
ATOM 2209  O O     . GLY C 3 106 ? 129.454 115.877 143.323 1.00 18.60  ? 106 GLY C O     1 
ATOM 2210  N N     . VAL C 3 107 ? 129.260 113.690 143.793 1.00 19.77  ? 107 VAL C N     1 
ATOM 2211  C CA    . VAL C 3 107 ? 128.315 113.379 142.735 1.00 19.77  ? 107 VAL C CA    1 
ATOM 2212  C C     . VAL C 3 107 ? 127.106 112.689 143.350 1.00 19.77  ? 107 VAL C C     1 
ATOM 2213  O O     . VAL C 3 107 ? 127.084 112.378 144.536 1.00 19.77  ? 107 VAL C O     1 
ATOM 2214  C CB    . VAL C 3 107 ? 128.933 112.493 141.637 1.00 19.77  ? 107 VAL C CB    1 
ATOM 2215  C CG1   . VAL C 3 107 ? 130.083 113.187 140.971 1.00 19.77  ? 107 VAL C CG1   1 
ATOM 2216  C CG2   . VAL C 3 107 ? 129.370 111.183 142.218 1.00 19.77  ? 107 VAL C CG2   1 
ATOM 2217  N N     . LEU C 3 108 ? 126.103 112.454 142.536 1.00 22.36  ? 108 LEU C N     1 
ATOM 2218  C CA    . LEU C 3 108 ? 124.984 111.622 142.946 1.00 22.36  ? 108 LEU C CA    1 
ATOM 2219  C C     . LEU C 3 108 ? 125.324 110.152 142.744 1.00 22.36  ? 108 LEU C C     1 
ATOM 2220  O O     . LEU C 3 108 ? 125.942 109.788 141.742 1.00 22.36  ? 108 LEU C O     1 
ATOM 2221  C CB    . LEU C 3 108 ? 123.739 111.955 142.136 1.00 22.36  ? 108 LEU C CB    1 
ATOM 2222  C CG    . LEU C 3 108 ? 122.802 113.100 142.516 1.00 22.36  ? 108 LEU C CG    1 
ATOM 2223  C CD1   . LEU C 3 108 ? 121.684 113.158 141.512 1.00 22.36  ? 108 LEU C CD1   1 
ATOM 2224  C CD2   . LEU C 3 108 ? 122.236 112.933 143.895 1.00 22.36  ? 108 LEU C CD2   1 
ATOM 2225  N N     . PRO C 3 109 ? 124.933 109.290 143.679 1.00 24.99  ? 109 PRO C N     1 
ATOM 2226  C CA    . PRO C 3 109 ? 125.112 107.847 143.482 1.00 24.99  ? 109 PRO C CA    1 
ATOM 2227  C C     . PRO C 3 109 ? 124.275 107.299 142.343 1.00 24.99  ? 109 PRO C C     1 
ATOM 2228  O O     . PRO C 3 109 ? 123.046 107.286 142.423 1.00 24.99  ? 109 PRO C O     1 
ATOM 2229  C CB    . PRO C 3 109 ? 124.667 107.256 144.821 1.00 24.99  ? 109 PRO C CB    1 
ATOM 2230  C CG    . PRO C 3 109 ? 124.803 108.359 145.781 1.00 24.99  ? 109 PRO C CG    1 
ATOM 2231  C CD    . PRO C 3 109 ? 124.465 109.598 145.036 1.00 24.99  ? 109 PRO C CD    1 
ATOM 2232  N N     . ASN C 3 110 ? 124.933 106.846 141.277 1.00 26.85  ? 110 ASN C N     1 
ATOM 2233  C CA    . ASN C 3 110 ? 124.227 106.365 140.094 1.00 26.85  ? 110 ASN C CA    1 
ATOM 2234  C C     . ASN C 3 110 ? 125.151 105.400 139.360 1.00 26.85  ? 110 ASN C C     1 
ATOM 2235  O O     . ASN C 3 110 ? 126.208 105.802 138.875 1.00 26.85  ? 110 ASN C O     1 
ATOM 2236  C CB    . ASN C 3 110 ? 123.806 107.522 139.202 1.00 26.85  ? 110 ASN C CB    1 
ATOM 2237  C CG    . ASN C 3 110 ? 122.996 107.073 138.006 1.00 26.85  ? 110 ASN C CG    1 
ATOM 2238  O OD1   . ASN C 3 110 ? 122.082 106.260 138.129 1.00 26.85  ? 110 ASN C OD1   1 
ATOM 2239  N ND2   . ASN C 3 110 ? 123.327 107.602 136.837 1.00 26.85  ? 110 ASN C ND2   1 
ATOM 2240  N N     . ILE C 3 111 ? 124.751 104.136 139.299 1.00 28.78  ? 111 ILE C N     1 
ATOM 2241  C CA    . ILE C 3 111 ? 125.388 103.132 138.458 1.00 28.78  ? 111 ILE C CA    1 
ATOM 2242  C C     . ILE C 3 111 ? 124.400 102.747 137.369 1.00 28.78  ? 111 ILE C C     1 
ATOM 2243  O O     . ILE C 3 111 ? 123.204 102.587 137.638 1.00 28.78  ? 111 ILE C O     1 
ATOM 2244  C CB    . ILE C 3 111 ? 125.806 101.898 139.273 1.00 28.78  ? 111 ILE C CB    1 
ATOM 2245  C CG1   . ILE C 3 111 ? 126.496 102.316 140.561 1.00 28.78  ? 111 ILE C CG1   1 
ATOM 2246  C CG2   . ILE C 3 111 ? 126.715 101.007 138.462 1.00 28.78  ? 111 ILE C CG2   1 
ATOM 2247  C CD1   . ILE C 3 111 ? 126.951 101.168 141.396 1.00 28.78  ? 111 ILE C CD1   1 
ATOM 2248  N N     . GLN C 3 112 ? 124.890 102.616 136.143 1.00 31.03  ? 112 GLN C N     1 
ATOM 2249  C CA    . GLN C 3 112 ? 124.059 102.151 135.049 1.00 31.03  ? 112 GLN C CA    1 
ATOM 2250  C C     . GLN C 3 112 ? 123.702 100.687 135.250 1.00 31.03  ? 112 GLN C C     1 
ATOM 2251  O O     . GLN C 3 112 ? 124.451 99.924  135.860 1.00 31.03  ? 112 GLN C O     1 
ATOM 2252  C CB    . GLN C 3 112 ? 124.781 102.345 133.725 1.00 31.03  ? 112 GLN C CB    1 
ATOM 2253  C CG    . GLN C 3 112 ? 125.291 103.755 133.537 1.00 31.03  ? 112 GLN C CG    1 
ATOM 2254  C CD    . GLN C 3 112 ? 124.217 104.703 133.061 1.00 31.03  ? 112 GLN C CD    1 
ATOM 2255  O OE1   . GLN C 3 112 ? 123.907 105.696 133.716 1.00 31.03  ? 112 GLN C OE1   1 
ATOM 2256  N NE2   . GLN C 3 112 ? 123.642 104.402 131.908 1.00 31.03  ? 112 GLN C NE2   1 
ATOM 2257  N N     . ALA C 3 113 ? 122.530 100.303 134.739 1.00 36.08  ? 113 ALA C N     1 
ATOM 2258  C CA    . ALA C 3 113 ? 121.988 98.969  134.950 1.00 36.08  ? 113 ALA C CA    1 
ATOM 2259  C C     . ALA C 3 113 ? 122.804 97.875  134.285 1.00 36.08  ? 113 ALA C C     1 
ATOM 2260  O O     . ALA C 3 113 ? 122.852 96.759  134.807 1.00 36.08  ? 113 ALA C O     1 
ATOM 2261  C CB    . ALA C 3 113 ? 120.556 98.912  134.436 1.00 36.08  ? 113 ALA C CB    1 
ATOM 2262  N N     . VAL C 3 114 ? 123.455 98.172  133.161 1.00 33.67  ? 114 VAL C N     1 
ATOM 2263  C CA    . VAL C 3 114 ? 124.236 97.184  132.427 1.00 33.67  ? 114 VAL C CA    1 
ATOM 2264  C C     . VAL C 3 114 ? 125.497 96.777  133.171 1.00 33.67  ? 114 VAL C C     1 
ATOM 2265  O O     . VAL C 3 114 ? 125.980 95.649  132.991 1.00 33.67  ? 114 VAL C O     1 
ATOM 2266  C CB    . VAL C 3 114 ? 124.575 97.758  131.038 1.00 33.67  ? 114 VAL C CB    1 
ATOM 2267  C CG1   . VAL C 3 114 ? 124.996 96.668  130.080 1.00 33.67  ? 114 VAL C CG1   1 
ATOM 2268  C CG2   . VAL C 3 114 ? 123.392 98.523  130.490 1.00 33.67  ? 114 VAL C CG2   1 
ATOM 2269  N N     . LEU C 3 115 ? 126.029 97.639  134.028 1.00 30.24  ? 115 LEU C N     1 
ATOM 2270  C CA    . LEU C 3 115 ? 127.260 97.337  134.738 1.00 30.24  ? 115 LEU C CA    1 
ATOM 2271  C C     . LEU C 3 115 ? 127.041 96.480  135.972 1.00 30.24  ? 115 LEU C C     1 
ATOM 2272  O O     . LEU C 3 115 ? 128.000 95.892  136.474 1.00 30.24  ? 115 LEU C O     1 
ATOM 2273  C CB    . LEU C 3 115 ? 127.961 98.633  135.132 1.00 30.24  ? 115 LEU C CB    1 
ATOM 2274  C CG    . LEU C 3 115 ? 128.166 99.642  134.008 1.00 30.24  ? 115 LEU C CG    1 
ATOM 2275  C CD1   . LEU C 3 115 ? 128.904 100.809 134.555 1.00 30.24  ? 115 LEU C CD1   1 
ATOM 2276  C CD2   . LEU C 3 115 ? 128.936 99.037  132.874 1.00 30.24  ? 115 LEU C CD2   1 
ATOM 2277  N N     . LEU C 3 116 ? 125.814 96.396  136.468 1.00 37.60  ? 116 LEU C N     1 
ATOM 2278  C CA    . LEU C 3 116 ? 125.509 95.511  137.575 1.00 37.60  ? 116 LEU C CA    1 
ATOM 2279  C C     . LEU C 3 116 ? 125.497 94.063  137.095 1.00 37.60  ? 116 LEU C C     1 
ATOM 2280  O O     . LEU C 3 116 ? 125.061 93.780  135.979 1.00 37.60  ? 116 LEU C O     1 
ATOM 2281  C CB    . LEU C 3 116 ? 124.160 95.865  138.181 1.00 37.60  ? 116 LEU C CB    1 
ATOM 2282  C CG    . LEU C 3 116 ? 124.002 97.313  138.621 1.00 37.60  ? 116 LEU C CG    1 
ATOM 2283  C CD1   . LEU C 3 116 ? 122.544 97.623  138.871 1.00 37.60  ? 116 LEU C CD1   1 
ATOM 2284  C CD2   . LEU C 3 116 ? 124.832 97.576  139.854 1.00 37.60  ? 116 LEU C CD2   1 
ATOM 2285  N N     . PRO C 3 117 ? 125.973 93.129  137.918 1.00 44.01  ? 117 PRO C N     1 
ATOM 2286  C CA    . PRO C 3 117 ? 126.039 91.728  137.488 1.00 44.01  ? 117 PRO C CA    1 
ATOM 2287  C C     . PRO C 3 117 ? 124.659 91.094  137.435 1.00 44.01  ? 117 PRO C C     1 
ATOM 2288  O O     . PRO C 3 117 ? 123.675 91.625  137.952 1.00 44.01  ? 117 PRO C O     1 
ATOM 2289  C CB    . PRO C 3 117 ? 126.909 91.078  138.562 1.00 44.01  ? 117 PRO C CB    1 
ATOM 2290  C CG    . PRO C 3 117 ? 126.657 91.896  139.757 1.00 44.01  ? 117 PRO C CG    1 
ATOM 2291  C CD    . PRO C 3 117 ? 126.502 93.297  139.282 1.00 44.01  ? 117 PRO C CD    1 
ATOM 2292  N N     . LYS C 3 118 ? 124.602 89.944  136.768 1.00 50.20  ? 118 LYS C N     1 
ATOM 2293  C CA    . LYS C 3 118 ? 123.376 89.158  136.671 1.00 50.20  ? 118 LYS C CA    1 
ATOM 2294  C C     . LYS C 3 118 ? 122.966 88.647  138.052 1.00 50.20  ? 118 LYS C C     1 
ATOM 2295  O O     . LYS C 3 118 ? 121.777 88.556  138.362 1.00 50.20  ? 118 LYS C O     1 
ATOM 2296  C CB    . LYS C 3 118 ? 123.569 87.995  135.685 1.00 50.20  ? 118 LYS C CB    1 
ATOM 2297  C CG    . LYS C 3 118 ? 122.312 87.176  135.362 1.00 50.20  ? 118 LYS C CG    1 
ATOM 2298  C CD    . LYS C 3 118 ? 122.223 85.889  136.183 1.00 50.20  ? 118 LYS C CD    1 
ATOM 2299  C CE    . LYS C 3 118 ? 120.974 85.118  135.857 1.00 50.20  ? 118 LYS C CE    1 
ATOM 2300  N NZ    . LYS C 3 118 ? 120.838 83.928  136.726 1.00 50.20  ? 118 LYS C NZ    1 
ATOM 2301  N N     . ARG D 4 30  ? 141.868 144.200 157.867 1.00 63.94  ? 28  ARG D N     1 
ATOM 2302  C CA    . ARG D 4 30  ? 140.464 144.441 158.152 1.00 63.94  ? 28  ARG D CA    1 
ATOM 2303  C C     . ARG D 4 30  ? 139.885 145.571 157.286 1.00 63.94  ? 28  ARG D C     1 
ATOM 2304  O O     . ARG D 4 30  ? 140.196 146.750 157.453 1.00 63.94  ? 28  ARG D O     1 
ATOM 2305  C CB    . ARG D 4 30  ? 140.279 144.694 159.661 1.00 63.94  ? 28  ARG D CB    1 
ATOM 2306  C CG    . ARG D 4 30  ? 141.172 145.750 160.312 1.00 63.94  ? 28  ARG D CG    1 
ATOM 2307  C CD    . ARG D 4 30  ? 140.947 145.796 161.823 1.00 63.94  ? 28  ARG D CD    1 
ATOM 2308  N NE    . ARG D 4 30  ? 139.613 146.277 162.176 1.00 63.94  ? 28  ARG D NE    1 
ATOM 2309  C CZ    . ARG D 4 30  ? 139.055 146.120 163.370 1.00 63.94  ? 28  ARG D CZ    1 
ATOM 2310  N NH1   . ARG D 4 30  ? 139.709 145.488 164.328 1.00 63.94  ? 28  ARG D NH1   1 
ATOM 2311  N NH2   . ARG D 4 30  ? 137.841 146.591 163.608 1.00 63.94  ? 28  ARG D NH2   1 
ATOM 2312  N N     . LYS D 4 31  ? 139.076 145.185 156.303 1.00 60.40  ? 29  LYS D N     1 
ATOM 2313  C CA    . LYS D 4 31  ? 138.448 146.144 155.401 1.00 60.40  ? 29  LYS D CA    1 
ATOM 2314  C C     . LYS D 4 31  ? 137.057 145.665 154.984 1.00 60.40  ? 29  LYS D C     1 
ATOM 2315  O O     . LYS D 4 31  ? 136.649 145.829 153.833 1.00 60.40  ? 29  LYS D O     1 
ATOM 2316  C CB    . LYS D 4 31  ? 139.341 146.400 154.189 1.00 60.40  ? 29  LYS D CB    1 
ATOM 2317  C CG    . LYS D 4 31  ? 139.178 147.760 153.510 1.00 60.40  ? 29  LYS D CG    1 
ATOM 2318  C CD    . LYS D 4 31  ? 139.688 148.898 154.364 1.00 60.40  ? 29  LYS D CD    1 
ATOM 2319  C CE    . LYS D 4 31  ? 139.524 150.217 153.630 1.00 60.40  ? 29  LYS D CE    1 
ATOM 2320  N NZ    . LYS D 4 31  ? 139.773 151.393 154.498 1.00 60.40  ? 29  LYS D NZ    1 
ATOM 2321  N N     . ARG D 4 32  ? 136.331 145.044 155.922 1.00 51.94  ? 30  ARG D N     1 
ATOM 2322  C CA    . ARG D 4 32  ? 134.867 144.921 155.896 1.00 51.94  ? 30  ARG D CA    1 
ATOM 2323  C C     . ARG D 4 32  ? 134.362 144.158 154.662 1.00 51.94  ? 30  ARG D C     1 
ATOM 2324  O O     . ARG D 4 32  ? 133.756 144.726 153.754 1.00 51.94  ? 30  ARG D O     1 
ATOM 2325  C CB    . ARG D 4 32  ? 134.238 146.316 155.982 1.00 51.94  ? 30  ARG D CB    1 
ATOM 2326  C CG    . ARG D 4 32  ? 132.857 146.325 156.551 1.00 51.94  ? 30  ARG D CG    1 
ATOM 2327  C CD    . ARG D 4 32  ? 132.194 147.675 156.492 1.00 51.94  ? 30  ARG D CD    1 
ATOM 2328  N NE    . ARG D 4 32  ? 130.749 147.520 156.379 1.00 51.94  ? 30  ARG D NE    1 
ATOM 2329  C CZ    . ARG D 4 32  ? 129.924 147.402 157.414 1.00 51.94  ? 30  ARG D CZ    1 
ATOM 2330  N NH1   . ARG D 4 32  ? 130.398 147.435 158.650 1.00 51.94  ? 30  ARG D NH1   1 
ATOM 2331  N NH2   . ARG D 4 32  ? 128.621 147.257 157.213 1.00 51.94  ? 30  ARG D NH2   1 
ATOM 2332  N N     . LYS D 4 33  ? 134.659 142.854 154.636 1.00 48.58  ? 31  LYS D N     1 
ATOM 2333  C CA    . LYS D 4 33  ? 134.495 142.071 153.412 1.00 48.58  ? 31  LYS D CA    1 
ATOM 2334  C C     . LYS D 4 33  ? 133.046 141.786 153.013 1.00 48.58  ? 31  LYS D C     1 
ATOM 2335  O O     . LYS D 4 33  ? 132.837 141.360 151.873 1.00 48.58  ? 31  LYS D O     1 
ATOM 2336  C CB    . LYS D 4 33  ? 135.269 140.763 153.512 1.00 48.58  ? 31  LYS D CB    1 
ATOM 2337  C CG    . LYS D 4 33  ? 136.752 140.949 153.291 1.00 48.58  ? 31  LYS D CG    1 
ATOM 2338  C CD    . LYS D 4 33  ? 137.516 139.648 153.379 1.00 48.58  ? 31  LYS D CD    1 
ATOM 2339  C CE    . LYS D 4 33  ? 137.659 139.227 154.819 1.00 48.58  ? 31  LYS D CE    1 
ATOM 2340  N NZ    . LYS D 4 33  ? 138.505 140.214 155.538 1.00 48.58  ? 31  LYS D NZ    1 
ATOM 2341  N N     . GLU D 4 34  ? 132.066 141.985 153.902 1.00 37.20  ? 32  GLU D N     1 
ATOM 2342  C CA    . GLU D 4 34  ? 130.659 142.221 153.536 1.00 37.20  ? 32  GLU D CA    1 
ATOM 2343  C C     . GLU D 4 34  ? 130.029 141.040 152.780 1.00 37.20  ? 32  GLU D C     1 
ATOM 2344  O O     . GLU D 4 34  ? 129.867 141.061 151.563 1.00 37.20  ? 32  GLU D O     1 
ATOM 2345  C CB    . GLU D 4 34  ? 130.555 143.510 152.720 1.00 37.20  ? 32  GLU D CB    1 
ATOM 2346  C CG    . GLU D 4 34  ? 129.157 144.039 152.521 1.00 37.20  ? 32  GLU D CG    1 
ATOM 2347  C CD    . GLU D 4 34  ? 129.118 145.182 151.539 1.00 37.20  ? 32  GLU D CD    1 
ATOM 2348  O OE1   . GLU D 4 34  ? 130.171 145.514 150.961 1.00 37.20  ? 32  GLU D OE1   1 
ATOM 2349  O OE2   . GLU D 4 34  ? 128.032 145.749 151.336 1.00 37.20  ? 32  GLU D OE2   1 
ATOM 2350  N N     . SER D 4 35  ? 129.760 139.968 153.516 1.00 27.42  ? 33  SER D N     1 
ATOM 2351  C CA    . SER D 4 35  ? 129.111 138.786 152.960 1.00 27.42  ? 33  SER D CA    1 
ATOM 2352  C C     . SER D 4 35  ? 127.599 138.852 153.120 1.00 27.42  ? 33  SER D C     1 
ATOM 2353  O O     . SER D 4 35  ? 127.039 139.833 153.602 1.00 27.42  ? 33  SER D O     1 
ATOM 2354  C CB    . SER D 4 35  ? 129.634 137.516 153.629 1.00 27.42  ? 33  SER D CB    1 
ATOM 2355  O OG    . SER D 4 35  ? 131.007 137.317 153.358 1.00 27.42  ? 33  SER D OG    1 
ATOM 2356  N N     . TYR D 4 36  ? 126.936 137.775 152.690 1.00 19.98  ? 34  TYR D N     1 
ATOM 2357  C CA    . TYR D 4 36  ? 125.514 137.537 152.913 1.00 19.98  ? 34  TYR D CA    1 
ATOM 2358  C C     . TYR D 4 36  ? 125.270 136.528 154.012 1.00 19.98  ? 34  TYR D C     1 
ATOM 2359  O O     . TYR D 4 36  ? 124.152 136.013 154.142 1.00 19.98  ? 34  TYR D O     1 
ATOM 2360  C CB    . TYR D 4 36  ? 124.849 137.042 151.635 1.00 19.98  ? 34  TYR D CB    1 
ATOM 2361  C CG    . TYR D 4 36  ? 124.499 138.099 150.638 1.00 19.98  ? 34  TYR D CG    1 
ATOM 2362  C CD1   . TYR D 4 36  ? 123.585 139.092 150.945 1.00 19.98  ? 34  TYR D CD1   1 
ATOM 2363  C CD2   . TYR D 4 36  ? 125.059 138.087 149.378 1.00 19.98  ? 34  TYR D CD2   1 
ATOM 2364  C CE1   . TYR D 4 36  ? 123.258 140.054 150.034 1.00 19.98  ? 34  TYR D CE1   1 
ATOM 2365  C CE2   . TYR D 4 36  ? 124.735 139.041 148.458 1.00 19.98  ? 34  TYR D CE2   1 
ATOM 2366  C CZ    . TYR D 4 36  ? 123.834 140.022 148.791 1.00 19.98  ? 34  TYR D CZ    1 
ATOM 2367  O OH    . TYR D 4 36  ? 123.510 140.982 147.867 1.00 19.98  ? 34  TYR D OH    1 
ATOM 2368  N N     . ALA D 4 37  ? 126.295 136.240 154.810 1.00 20.98  ? 35  ALA D N     1 
ATOM 2369  C CA    . ALA D 4 37  ? 126.288 135.059 155.655 1.00 20.98  ? 35  ALA D CA    1 
ATOM 2370  C C     . ALA D 4 37  ? 125.321 135.192 156.817 1.00 20.98  ? 35  ALA D C     1 
ATOM 2371  O O     . ALA D 4 37  ? 124.671 134.213 157.187 1.00 20.98  ? 35  ALA D O     1 
ATOM 2372  C CB    . ALA D 4 37  ? 127.695 134.781 156.155 1.00 20.98  ? 35  ALA D CB    1 
ATOM 2373  N N     . ILE D 4 38  ? 125.173 136.387 157.392 1.00 23.94  ? 36  ILE D N     1 
ATOM 2374  C CA    . ILE D 4 38  ? 124.255 136.517 158.517 1.00 23.94  ? 36  ILE D CA    1 
ATOM 2375  C C     . ILE D 4 38  ? 122.797 136.483 158.087 1.00 23.94  ? 36  ILE D C     1 
ATOM 2376  O O     . ILE D 4 38  ? 121.960 135.974 158.832 1.00 23.94  ? 36  ILE D O     1 
ATOM 2377  C CB    . ILE D 4 38  ? 124.569 137.774 159.354 1.00 23.94  ? 36  ILE D CB    1 
ATOM 2378  C CG1   . ILE D 4 38  ? 124.292 139.059 158.602 1.00 23.94  ? 36  ILE D CG1   1 
ATOM 2379  C CG2   . ILE D 4 38  ? 126.011 137.769 159.780 1.00 23.94  ? 36  ILE D CG2   1 
ATOM 2380  C CD1   . ILE D 4 38  ? 124.183 140.222 159.502 1.00 23.94  ? 36  ILE D CD1   1 
ATOM 2381  N N     . TYR D 4 39  ? 122.480 136.919 156.875 1.00 22.78  ? 37  TYR D N     1 
ATOM 2382  C CA    . TYR D 4 39  ? 121.123 136.797 156.369 1.00 22.78  ? 37  TYR D CA    1 
ATOM 2383  C C     . TYR D 4 39  ? 120.794 135.376 155.958 1.00 22.78  ? 37  TYR D C     1 
ATOM 2384  O O     . TYR D 4 39  ? 119.664 134.919 156.161 1.00 22.78  ? 37  TYR D O     1 
ATOM 2385  C CB    . TYR D 4 39  ? 120.925 137.733 155.190 1.00 22.78  ? 37  TYR D CB    1 
ATOM 2386  C CG    . TYR D 4 39  ? 121.508 139.078 155.437 1.00 22.78  ? 37  TYR D CG    1 
ATOM 2387  C CD1   . TYR D 4 39  ? 120.924 139.943 156.336 1.00 22.78  ? 37  TYR D CD1   1 
ATOM 2388  C CD2   . TYR D 4 39  ? 122.655 139.477 154.794 1.00 22.78  ? 37  TYR D CD2   1 
ATOM 2389  C CE1   . TYR D 4 39  ? 121.453 141.164 156.571 1.00 22.78  ? 37  TYR D CE1   1 
ATOM 2390  C CE2   . TYR D 4 39  ? 123.197 140.695 155.032 1.00 22.78  ? 37  TYR D CE2   1 
ATOM 2391  C CZ    . TYR D 4 39  ? 122.588 141.534 155.917 1.00 22.78  ? 37  TYR D CZ    1 
ATOM 2392  O OH    . TYR D 4 39  ? 123.123 142.764 156.144 1.00 22.78  ? 37  TYR D OH    1 
ATOM 2393  N N     . ILE D 4 40  ? 121.768 134.665 155.389 1.00 20.84  ? 38  ILE D N     1 
ATOM 2394  C CA    . ILE D 4 40  ? 121.559 133.256 155.084 1.00 20.84  ? 38  ILE D CA    1 
ATOM 2395  C C     . ILE D 4 40  ? 121.423 132.455 156.369 1.00 20.84  ? 38  ILE D C     1 
ATOM 2396  O O     . ILE D 4 40  ? 120.626 131.516 156.439 1.00 20.84  ? 38  ILE D O     1 
ATOM 2397  C CB    . ILE D 4 40  ? 122.694 132.750 154.172 1.00 20.84  ? 38  ILE D CB    1 
ATOM 2398  C CG1   . ILE D 4 40  ? 122.590 133.404 152.806 1.00 20.84  ? 38  ILE D CG1   1 
ATOM 2399  C CG2   . ILE D 4 40  ? 122.612 131.279 153.929 1.00 20.84  ? 38  ILE D CG2   1 
ATOM 2400  C CD1   . ILE D 4 40  ? 123.833 133.313 152.029 1.00 20.84  ? 38  ILE D CD1   1 
ATOM 2401  N N     . TYR D 4 41  ? 122.113 132.865 157.432 1.00 25.49  ? 39  TYR D N     1 
ATOM 2402  C CA    . TYR D 4 41  ? 121.947 132.195 158.714 1.00 25.49  ? 39  TYR D CA    1 
ATOM 2403  C C     . TYR D 4 41  ? 120.606 132.506 159.364 1.00 25.49  ? 39  TYR D C     1 
ATOM 2404  O O     . TYR D 4 41  ? 120.037 131.634 160.012 1.00 25.49  ? 39  TYR D O     1 
ATOM 2405  C CB    . TYR D 4 41  ? 123.078 132.565 159.656 1.00 25.49  ? 39  TYR D CB    1 
ATOM 2406  C CG    . TYR D 4 41  ? 123.334 131.505 160.683 1.00 25.49  ? 39  TYR D CG    1 
ATOM 2407  C CD1   . TYR D 4 41  ? 124.175 130.446 160.406 1.00 25.49  ? 39  TYR D CD1   1 
ATOM 2408  C CD2   . TYR D 4 41  ? 122.719 131.550 161.921 1.00 25.49  ? 39  TYR D CD2   1 
ATOM 2409  C CE1   . TYR D 4 41  ? 124.403 129.466 161.330 1.00 25.49  ? 39  TYR D CE1   1 
ATOM 2410  C CE2   . TYR D 4 41  ? 122.941 130.575 162.854 1.00 25.49  ? 39  TYR D CE2   1 
ATOM 2411  C CZ    . TYR D 4 41  ? 123.785 129.534 162.551 1.00 25.49  ? 39  TYR D CZ    1 
ATOM 2412  O OH    . TYR D 4 41  ? 124.020 128.550 163.478 1.00 25.49  ? 39  TYR D OH    1 
ATOM 2413  N N     . LYS D 4 42  ? 120.081 133.722 159.204 1.00 22.63  ? 40  LYS D N     1 
ATOM 2414  C CA    . LYS D 4 42  ? 118.734 134.018 159.698 1.00 22.63  ? 40  LYS D CA    1 
ATOM 2415  C C     . LYS D 4 42  ? 117.671 133.219 158.955 1.00 22.63  ? 40  LYS D C     1 
ATOM 2416  O O     . LYS D 4 42  ? 116.723 132.703 159.566 1.00 22.63  ? 40  LYS D O     1 
ATOM 2417  C CB    . LYS D 4 42  ? 118.439 135.502 159.560 1.00 22.63  ? 40  LYS D CB    1 
ATOM 2418  C CG    . LYS D 4 42  ? 119.155 136.398 160.521 1.00 22.63  ? 40  LYS D CG    1 
ATOM 2419  C CD    . LYS D 4 42  ? 118.891 137.831 160.149 1.00 22.63  ? 40  LYS D CD    1 
ATOM 2420  C CE    . LYS D 4 42  ? 119.974 138.736 160.654 1.00 22.63  ? 40  LYS D CE    1 
ATOM 2421  N NZ    . LYS D 4 42  ? 119.946 140.034 159.950 1.00 22.63  ? 40  LYS D NZ    1 
ATOM 2422  N N     . VAL D 4 43  ? 117.813 133.106 157.636 1.00 23.52  ? 41  VAL D N     1 
ATOM 2423  C CA    . VAL D 4 43  ? 116.894 132.307 156.830 1.00 23.52  ? 41  VAL D CA    1 
ATOM 2424  C C     . VAL D 4 43  ? 116.965 130.834 157.224 1.00 23.52  ? 41  VAL D C     1 
ATOM 2425  O O     . VAL D 4 43  ? 115.933 130.157 157.353 1.00 23.52  ? 41  VAL D O     1 
ATOM 2426  C CB    . VAL D 4 43  ? 117.218 132.528 155.342 1.00 23.52  ? 41  VAL D CB    1 
ATOM 2427  C CG1   . VAL D 4 43  ? 116.631 131.462 154.495 1.00 23.52  ? 41  VAL D CG1   1 
ATOM 2428  C CG2   . VAL D 4 43  ? 116.719 133.871 154.898 1.00 23.52  ? 41  VAL D CG2   1 
ATOM 2429  N N     . LEU D 4 44  ? 118.175 130.331 157.470 1.00 23.54  ? 42  LEU D N     1 
ATOM 2430  C CA    . LEU D 4 44  ? 118.337 128.953 157.910 1.00 23.54  ? 42  LEU D CA    1 
ATOM 2431  C C     . LEU D 4 44  ? 117.745 128.730 159.292 1.00 23.54  ? 42  LEU D C     1 
ATOM 2432  O O     . LEU D 4 44  ? 117.109 127.706 159.528 1.00 23.54  ? 42  LEU D O     1 
ATOM 2433  C CB    . LEU D 4 44  ? 119.811 128.571 157.896 1.00 23.54  ? 42  LEU D CB    1 
ATOM 2434  C CG    . LEU D 4 44  ? 120.206 127.249 158.542 1.00 23.54  ? 42  LEU D CG    1 
ATOM 2435  C CD1   . LEU D 4 44  ? 119.747 126.110 157.692 1.00 23.54  ? 42  LEU D CD1   1 
ATOM 2436  C CD2   . LEU D 4 44  ? 121.676 127.209 158.715 1.00 23.54  ? 42  LEU D CD2   1 
ATOM 2437  N N     . LYS D 4 45  ? 117.924 129.671 160.215 1.00 27.04  ? 43  LYS D N     1 
ATOM 2438  C CA    . LYS D 4 45  ? 117.326 129.526 161.536 1.00 27.04  ? 43  LYS D CA    1 
ATOM 2439  C C     . LYS D 4 45  ? 115.816 129.626 161.520 1.00 27.04  ? 43  LYS D C     1 
ATOM 2440  O O     . LYS D 4 45  ? 115.183 129.169 162.470 1.00 27.04  ? 43  LYS D O     1 
ATOM 2441  C CB    . LYS D 4 45  ? 117.869 130.565 162.512 1.00 27.04  ? 43  LYS D CB    1 
ATOM 2442  C CG    . LYS D 4 45  ? 119.323 130.422 162.916 1.00 27.04  ? 43  LYS D CG    1 
ATOM 2443  C CD    . LYS D 4 45  ? 119.600 129.268 163.870 1.00 27.04  ? 43  LYS D CD    1 
ATOM 2444  C CE    . LYS D 4 45  ? 120.242 128.080 163.176 1.00 27.04  ? 43  LYS D CE    1 
ATOM 2445  N NZ    . LYS D 4 45  ? 120.689 127.049 164.136 1.00 27.04  ? 43  LYS D NZ    1 
ATOM 2446  N N     . GLN D 4 46  ? 115.221 130.216 160.490 1.00 26.47  ? 44  GLN D N     1 
ATOM 2447  C CA    . GLN D 4 46  ? 113.771 130.205 160.411 1.00 26.47  ? 44  GLN D CA    1 
ATOM 2448  C C     . GLN D 4 46  ? 113.189 129.049 159.606 1.00 26.47  ? 44  GLN D C     1 
ATOM 2449  O O     . GLN D 4 46  ? 111.995 128.778 159.745 1.00 26.47  ? 44  GLN D O     1 
ATOM 2450  C CB    . GLN D 4 46  ? 113.257 131.539 159.855 1.00 26.47  ? 44  GLN D CB    1 
ATOM 2451  C CG    . GLN D 4 46  ? 113.031 131.595 158.376 1.00 26.47  ? 44  GLN D CG    1 
ATOM 2452  C CD    . GLN D 4 46  ? 112.505 132.942 157.944 1.00 26.47  ? 44  GLN D CD    1 
ATOM 2453  O OE1   . GLN D 4 46  ? 112.157 133.775 158.776 1.00 26.47  ? 44  GLN D OE1   1 
ATOM 2454  N NE2   . GLN D 4 46  ? 112.452 133.169 156.641 1.00 26.47  ? 44  GLN D NE2   1 
ATOM 2455  N N     . VAL D 4 47  ? 113.979 128.345 158.791 1.00 26.62  ? 45  VAL D N     1 
ATOM 2456  C CA    . VAL D 4 47  ? 113.429 127.146 158.147 1.00 26.62  ? 45  VAL D CA    1 
ATOM 2457  C C     . VAL D 4 47  ? 113.807 125.874 158.907 1.00 26.62  ? 45  VAL D C     1 
ATOM 2458  O O     . VAL D 4 47  ? 113.045 124.907 158.922 1.00 26.62  ? 45  VAL D O     1 
ATOM 2459  C CB    . VAL D 4 47  ? 113.829 127.034 156.658 1.00 26.62  ? 45  VAL D CB    1 
ATOM 2460  C CG1   . VAL D 4 47  ? 113.203 128.147 155.858 1.00 26.62  ? 45  VAL D CG1   1 
ATOM 2461  C CG2   . VAL D 4 47  ? 115.321 127.025 156.456 1.00 26.62  ? 45  VAL D CG2   1 
ATOM 2462  N N     . HIS D 4 48  ? 114.974 125.857 159.539 1.00 28.30  ? 46  HIS D N     1 
ATOM 2463  C CA    . HIS D 4 48  ? 115.468 124.729 160.322 1.00 28.30  ? 46  HIS D CA    1 
ATOM 2464  C C     . HIS D 4 48  ? 116.081 125.282 161.595 1.00 28.30  ? 46  HIS D C     1 
ATOM 2465  O O     . HIS D 4 48  ? 117.277 125.604 161.610 1.00 28.30  ? 46  HIS D O     1 
ATOM 2466  C CB    . HIS D 4 48  ? 116.514 123.929 159.543 1.00 28.30  ? 46  HIS D CB    1 
ATOM 2467  C CG    . HIS D 4 48  ? 115.941 122.971 158.552 1.00 28.30  ? 46  HIS D CG    1 
ATOM 2468  N ND1   . HIS D 4 48  ? 115.362 121.779 158.920 1.00 28.30  ? 46  HIS D ND1   1 
ATOM 2469  C CD2   . HIS D 4 48  ? 115.873 123.020 157.204 1.00 28.30  ? 46  HIS D CD2   1 
ATOM 2470  C CE1   . HIS D 4 48  ? 114.945 121.144 157.843 1.00 28.30  ? 46  HIS D CE1   1 
ATOM 2471  N NE2   . HIS D 4 48  ? 115.243 121.876 156.788 1.00 28.30  ? 46  HIS D NE2   1 
ATOM 2472  N N     . PRO D 4 49  ? 115.323 125.418 162.687 1.00 29.82  ? 47  PRO D N     1 
ATOM 2473  C CA    . PRO D 4 49  ? 115.841 126.130 163.861 1.00 29.82  ? 47  PRO D CA    1 
ATOM 2474  C C     . PRO D 4 49  ? 116.904 125.378 164.639 1.00 29.82  ? 47  PRO D C     1 
ATOM 2475  O O     . PRO D 4 49  ? 117.592 125.992 165.460 1.00 29.82  ? 47  PRO D O     1 
ATOM 2476  C CB    . PRO D 4 49  ? 114.587 126.343 164.713 1.00 29.82  ? 47  PRO D CB    1 
ATOM 2477  C CG    . PRO D 4 49  ? 113.445 126.112 163.790 1.00 29.82  ? 47  PRO D CG    1 
ATOM 2478  C CD    . PRO D 4 49  ? 113.904 125.086 162.839 1.00 29.82  ? 47  PRO D CD    1 
ATOM 2479  N N     . ASP D 4 50  ? 117.083 124.084 164.397 1.00 32.63  ? 48  ASP D N     1 
ATOM 2480  C CA    . ASP D 4 50  ? 118.088 123.301 165.092 1.00 32.63  ? 48  ASP D CA    1 
ATOM 2481  C C     . ASP D 4 50  ? 119.290 122.936 164.234 1.00 32.63  ? 48  ASP D C     1 
ATOM 2482  O O     . ASP D 4 50  ? 120.284 122.451 164.780 1.00 32.63  ? 48  ASP D O     1 
ATOM 2483  C CB    . ASP D 4 50  ? 117.459 122.017 165.646 1.00 32.63  ? 48  ASP D CB    1 
ATOM 2484  C CG    . ASP D 4 50  ? 116.504 121.371 164.665 1.00 32.63  ? 48  ASP D CG    1 
ATOM 2485  O OD1   . ASP D 4 50  ? 116.332 121.919 163.559 1.00 32.63  ? 48  ASP D OD1   1 
ATOM 2486  O OD2   . ASP D 4 50  ? 115.913 120.324 164.997 1.00 32.63  ? 48  ASP D OD2   1 
ATOM 2487  N N     . THR D 4 51  ? 119.239 123.163 162.928 1.00 30.27  ? 49  THR D N     1 
ATOM 2488  C CA    . THR D 4 51  ? 120.316 122.848 162.006 1.00 30.27  ? 49  THR D CA    1 
ATOM 2489  C C     . THR D 4 51  ? 121.251 124.041 161.859 1.00 30.27  ? 49  THR D C     1 
ATOM 2490  O O     . THR D 4 51  ? 120.816 125.180 161.711 1.00 30.27  ? 49  THR D O     1 
ATOM 2491  C CB    . THR D 4 51  ? 119.733 122.450 160.645 1.00 30.27  ? 49  THR D CB    1 
ATOM 2492  O OG1   . THR D 4 51  ? 118.854 121.336 160.816 1.00 30.27  ? 49  THR D OG1   1 
ATOM 2493  C CG2   . THR D 4 51  ? 120.799 122.051 159.669 1.00 30.27  ? 49  THR D CG2   1 
ATOM 2494  N N     . GLY D 4 52  ? 122.549 123.770 161.924 1.00 28.14  ? 50  GLY D N     1 
ATOM 2495  C CA    . GLY D 4 52  ? 123.542 124.785 161.648 1.00 28.14  ? 50  GLY D CA    1 
ATOM 2496  C C     . GLY D 4 52  ? 124.116 124.654 160.256 1.00 28.14  ? 50  GLY D C     1 
ATOM 2497  O O     . GLY D 4 52  ? 123.521 124.000 159.405 1.00 28.14  ? 50  GLY D O     1 
ATOM 2498  N N     . ILE D 4 53  ? 125.275 125.257 160.008 1.00 24.34  ? 51  ILE D N     1 
ATOM 2499  C CA    . ILE D 4 53  ? 125.881 125.240 158.684 1.00 24.34  ? 51  ILE D CA    1 
ATOM 2500  C C     . ILE D 4 53  ? 127.380 125.423 158.863 1.00 24.34  ? 51  ILE D C     1 
ATOM 2501  O O     . ILE D 4 53  ? 127.828 126.144 159.753 1.00 24.34  ? 51  ILE D O     1 
ATOM 2502  C CB    . ILE D 4 53  ? 125.233 126.316 157.770 1.00 24.34  ? 51  ILE D CB    1 
ATOM 2503  C CG1   . ILE D 4 53  ? 125.705 126.214 156.329 1.00 24.34  ? 51  ILE D CG1   1 
ATOM 2504  C CG2   . ILE D 4 53  ? 125.431 127.709 158.298 1.00 24.34  ? 51  ILE D CG2   1 
ATOM 2505  C CD1   . ILE D 4 53  ? 124.691 126.686 155.342 1.00 24.34  ? 51  ILE D CD1   1 
ATOM 2506  N N     . SER D 4 54  ? 128.160 124.719 158.053 1.00 22.62  ? 52  SER D N     1 
ATOM 2507  C CA    . SER D 4 54  ? 129.608 124.826 158.123 1.00 22.62  ? 52  SER D CA    1 
ATOM 2508  C C     . SER D 4 54  ? 130.067 126.040 157.326 1.00 22.62  ? 52  SER D C     1 
ATOM 2509  O O     . SER D 4 54  ? 129.293 126.664 156.601 1.00 22.62  ? 52  SER D O     1 
ATOM 2510  C CB    . SER D 4 54  ? 130.257 123.548 157.623 1.00 22.62  ? 52  SER D CB    1 
ATOM 2511  O OG    . SER D 4 54  ? 129.892 123.306 156.287 1.00 22.62  ? 52  SER D OG    1 
ATOM 2512  N N     . SER D 4 55  ? 131.341 126.390 157.440 1.00 20.94  ? 53  SER D N     1 
ATOM 2513  C CA    . SER D 4 55  ? 131.861 127.564 156.763 1.00 20.94  ? 53  SER D CA    1 
ATOM 2514  C C     . SER D 4 55  ? 132.002 127.382 155.266 1.00 20.94  ? 53  SER D C     1 
ATOM 2515  O O     . SER D 4 55  ? 131.768 128.335 154.522 1.00 20.94  ? 53  SER D O     1 
ATOM 2516  C CB    . SER D 4 55  ? 133.219 127.949 157.337 1.00 20.94  ? 53  SER D CB    1 
ATOM 2517  O OG    . SER D 4 55  ? 134.243 127.278 156.640 1.00 20.94  ? 53  SER D OG    1 
ATOM 2518  N N     . LYS D 4 56  ? 132.357 126.186 154.803 1.00 19.01  ? 54  LYS D N     1 
ATOM 2519  C CA    . LYS D 4 56  ? 132.405 125.927 153.373 1.00 19.01  ? 54  LYS D CA    1 
ATOM 2520  C C     . LYS D 4 56  ? 131.017 125.931 152.753 1.00 19.01  ? 54  LYS D C     1 
ATOM 2521  O O     . LYS D 4 56  ? 130.846 126.437 151.643 1.00 19.01  ? 54  LYS D O     1 
ATOM 2522  C CB    . LYS D 4 56  ? 133.103 124.599 153.110 1.00 19.01  ? 54  LYS D CB    1 
ATOM 2523  C CG    . LYS D 4 56  ? 133.608 124.432 151.689 1.00 19.01  ? 54  LYS D CG    1 
ATOM 2524  C CD    . LYS D 4 56  ? 134.793 125.329 151.422 1.00 19.01  ? 54  LYS D CD    1 
ATOM 2525  C CE    . LYS D 4 56  ? 135.154 125.353 149.952 1.00 19.01  ? 54  LYS D CE    1 
ATOM 2526  N NZ    . LYS D 4 56  ? 135.403 123.993 149.432 1.00 19.01  ? 54  LYS D NZ    1 
ATOM 2527  N N     . ALA D 4 57  ? 130.017 125.415 153.460 1.00 17.48  ? 55  ALA D N     1 
ATOM 2528  C CA    . ALA D 4 57  ? 128.651 125.478 152.961 1.00 17.48  ? 55  ALA D CA    1 
ATOM 2529  C C     . ALA D 4 57  ? 128.099 126.893 153.011 1.00 17.48  ? 55  ALA D C     1 
ATOM 2530  O O     . ALA D 4 57  ? 127.305 127.276 152.149 1.00 17.48  ? 55  ALA D O     1 
ATOM 2531  C CB    . ALA D 4 57  ? 127.763 124.536 153.755 1.00 17.48  ? 55  ALA D CB    1 
ATOM 2532  N N     . MET D 4 58  ? 128.519 127.690 153.991 1.00 19.33  ? 56  MET D N     1 
ATOM 2533  C CA    . MET D 4 58  ? 128.132 129.093 154.016 1.00 19.33  ? 56  MET D CA    1 
ATOM 2534  C C     . MET D 4 58  ? 128.798 129.874 152.895 1.00 19.33  ? 56  MET D C     1 
ATOM 2535  O O     . MET D 4 58  ? 128.197 130.795 152.340 1.00 19.33  ? 56  MET D O     1 
ATOM 2536  C CB    . MET D 4 58  ? 128.474 129.694 155.372 1.00 19.33  ? 56  MET D CB    1 
ATOM 2537  C CG    . MET D 4 58  ? 127.887 131.055 155.611 1.00 19.33  ? 56  MET D CG    1 
ATOM 2538  S SD    . MET D 4 58  ? 126.214 131.227 154.983 1.00 19.33  ? 56  MET D SD    1 
ATOM 2539  C CE    . MET D 4 58  ? 125.303 130.933 156.474 1.00 19.33  ? 56  MET D CE    1 
ATOM 2540  N N     . SER D 4 59  ? 130.014 129.490 152.519 1.00 17.12  ? 57  SER D N     1 
ATOM 2541  C CA    . SER D 4 59  ? 130.683 130.110 151.382 1.00 17.12  ? 57  SER D CA    1 
ATOM 2542  C C     . SER D 4 59  ? 130.004 129.739 150.072 1.00 17.12  ? 57  SER D C     1 
ATOM 2543  O O     . SER D 4 59  ? 129.873 130.576 149.175 1.00 17.12  ? 57  SER D O     1 
ATOM 2544  C CB    . SER D 4 59  ? 132.148 129.692 151.379 1.00 17.12  ? 57  SER D CB    1 
ATOM 2545  O OG    . SER D 4 59  ? 132.862 130.310 150.338 1.00 17.12  ? 57  SER D OG    1 
ATOM 2546  N N     . ILE D 4 60  ? 129.538 128.497 149.959 1.00 13.53  ? 58  ILE D N     1 
ATOM 2547  C CA    . ILE D 4 60  ? 128.800 128.063 148.779 1.00 13.53  ? 58  ILE D CA    1 
ATOM 2548  C C     . ILE D 4 60  ? 127.457 128.764 148.687 1.00 13.53  ? 58  ILE D C     1 
ATOM 2549  O O     . ILE D 4 60  ? 127.028 129.169 147.602 1.00 13.53  ? 58  ILE D O     1 
ATOM 2550  C CB    . ILE D 4 60  ? 128.658 126.535 148.801 1.00 13.53  ? 58  ILE D CB    1 
ATOM 2551  C CG1   . ILE D 4 60  ? 130.011 125.922 148.531 1.00 13.53  ? 58  ILE D CG1   1 
ATOM 2552  C CG2   . ILE D 4 60  ? 127.712 126.040 147.754 1.00 13.53  ? 58  ILE D CG2   1 
ATOM 2553  C CD1   . ILE D 4 60  ? 130.067 124.527 148.770 1.00 13.53  ? 58  ILE D CD1   1 
ATOM 2554  N N     . MET D 4 61  ? 126.783 128.962 149.819 1.00 14.93  ? 59  MET D N     1 
ATOM 2555  C CA    . MET D 4 61  ? 125.500 129.654 149.803 1.00 14.93  ? 59  MET D CA    1 
ATOM 2556  C C     . MET D 4 61  ? 125.657 131.137 149.516 1.00 14.93  ? 59  MET D C     1 
ATOM 2557  O O     . MET D 4 61  ? 124.796 131.733 148.861 1.00 14.93  ? 59  MET D O     1 
ATOM 2558  C CB    . MET D 4 61  ? 124.781 129.442 151.123 1.00 14.93  ? 59  MET D CB    1 
ATOM 2559  C CG    . MET D 4 61  ? 124.111 128.104 151.237 1.00 14.93  ? 59  MET D CG    1 
ATOM 2560  S SD    . MET D 4 61  ? 122.814 127.870 150.028 1.00 14.93  ? 59  MET D SD    1 
ATOM 2561  C CE    . MET D 4 61  ? 121.825 129.310 150.342 1.00 14.93  ? 59  MET D CE    1 
ATOM 2562  N N     . ASN D 4 62  ? 126.761 131.735 149.955 1.00 13.27  ? 60  ASN D N     1 
ATOM 2563  C CA    . ASN D 4 62  ? 127.052 133.122 149.613 1.00 13.27  ? 60  ASN D CA    1 
ATOM 2564  C C     . ASN D 4 62  ? 127.349 133.280 148.128 1.00 13.27  ? 60  ASN D C     1 
ATOM 2565  O O     . ASN D 4 62  ? 126.885 134.238 147.499 1.00 13.27  ? 60  ASN D O     1 
ATOM 2566  C CB    . ASN D 4 62  ? 128.214 133.613 150.462 1.00 13.27  ? 60  ASN D CB    1 
ATOM 2567  C CG    . ASN D 4 62  ? 128.457 135.075 150.316 1.00 13.27  ? 60  ASN D CG    1 
ATOM 2568  O OD1   . ASN D 4 62  ? 127.542 135.841 150.079 1.00 13.27  ? 60  ASN D OD1   1 
ATOM 2569  N ND2   . ASN D 4 62  ? 129.703 135.478 150.451 1.00 13.27  ? 60  ASN D ND2   1 
ATOM 2570  N N     . SER D 4 63  ? 128.098 132.337 147.547 1.00 13.74  ? 61  SER D N     1 
ATOM 2571  C CA    . SER D 4 63  ? 128.335 132.349 146.105 1.00 13.74  ? 61  SER D CA    1 
ATOM 2572  C C     . SER D 4 63  ? 127.049 132.139 145.319 1.00 13.74  ? 61  SER D C     1 
ATOM 2573  O O     . SER D 4 63  ? 126.859 132.750 144.266 1.00 13.74  ? 61  SER D O     1 
ATOM 2574  C CB    . SER D 4 63  ? 129.355 131.285 145.722 1.00 13.74  ? 61  SER D CB    1 
ATOM 2575  O OG    . SER D 4 63  ? 130.483 131.325 146.562 1.00 13.74  ? 61  SER D OG    1 
ATOM 2576  N N     . PHE D 4 64  ? 126.148 131.302 145.832 1.00 14.58  ? 62  PHE D N     1 
ATOM 2577  C CA    . PHE D 4 64  ? 124.859 131.069 145.189 1.00 14.58  ? 62  PHE D CA    1 
ATOM 2578  C C     . PHE D 4 64  ? 124.005 132.325 145.172 1.00 14.58  ? 62  PHE D C     1 
ATOM 2579  O O     . PHE D 4 64  ? 123.413 132.664 144.142 1.00 14.58  ? 62  PHE D O     1 
ATOM 2580  C CB    . PHE D 4 64  ? 124.135 129.939 145.911 1.00 14.58  ? 62  PHE D CB    1 
ATOM 2581  C CG    . PHE D 4 64  ? 122.724 129.728 145.462 1.00 14.58  ? 62  PHE D CG    1 
ATOM 2582  C CD1   . PHE D 4 64  ? 122.441 129.364 144.167 1.00 14.58  ? 62  PHE D CD1   1 
ATOM 2583  C CD2   . PHE D 4 64  ? 121.678 129.870 146.348 1.00 14.58  ? 62  PHE D CD2   1 
ATOM 2584  C CE1   . PHE D 4 64  ? 121.151 129.168 143.762 1.00 14.58  ? 62  PHE D CE1   1 
ATOM 2585  C CE2   . PHE D 4 64  ? 120.390 129.677 145.939 1.00 14.58  ? 62  PHE D CE2   1 
ATOM 2586  C CZ    . PHE D 4 64  ? 120.127 129.323 144.648 1.00 14.58  ? 62  PHE D CZ    1 
ATOM 2587  N N     . VAL D 4 65  ? 123.949 133.036 146.296 1.00 14.26  ? 63  VAL D N     1 
ATOM 2588  C CA    . VAL D 4 65  ? 123.118 134.231 146.393 1.00 14.26  ? 63  VAL D CA    1 
ATOM 2589  C C     . VAL D 4 65  ? 123.683 135.360 145.534 1.00 14.26  ? 63  VAL D C     1 
ATOM 2590  O O     . VAL D 4 65  ? 122.934 136.054 144.833 1.00 14.26  ? 63  VAL D O     1 
ATOM 2591  C CB    . VAL D 4 65  ? 122.966 134.618 147.876 1.00 14.26  ? 63  VAL D CB    1 
ATOM 2592  C CG1   . VAL D 4 65  ? 122.419 135.980 148.034 1.00 14.26  ? 63  VAL D CG1   1 
ATOM 2593  C CG2   . VAL D 4 65  ? 122.035 133.659 148.551 1.00 14.26  ? 63  VAL D CG2   1 
ATOM 2594  N N     . ASN D 4 66  ? 125.011 135.520 145.523 1.00 14.74  ? 64  ASN D N     1 
ATOM 2595  C CA    . ASN D 4 66  ? 125.651 136.498 144.645 1.00 14.74  ? 64  ASN D CA    1 
ATOM 2596  C C     . ASN D 4 66  ? 125.428 136.177 143.174 1.00 14.74  ? 64  ASN D C     1 
ATOM 2597  O O     . ASN D 4 66  ? 125.203 137.079 142.360 1.00 14.74  ? 64  ASN D O     1 
ATOM 2598  C CB    . ASN D 4 66  ? 127.144 136.541 144.928 1.00 14.74  ? 64  ASN D CB    1 
ATOM 2599  C CG    . ASN D 4 66  ? 127.495 137.468 146.040 1.00 14.74  ? 64  ASN D CG    1 
ATOM 2600  O OD1   . ASN D 4 66  ? 127.001 138.584 146.108 1.00 14.74  ? 64  ASN D OD1   1 
ATOM 2601  N ND2   . ASN D 4 66  ? 128.372 137.024 146.917 1.00 14.74  ? 64  ASN D ND2   1 
ATOM 2602  N N     . ASP D 4 67  ? 125.465 134.892 142.824 1.00 14.13  ? 65  ASP D N     1 
ATOM 2603  C CA    . ASP D 4 67  ? 125.279 134.459 141.447 1.00 14.13  ? 65  ASP D CA    1 
ATOM 2604  C C     . ASP D 4 67  ? 123.870 134.738 140.960 1.00 14.13  ? 65  ASP D C     1 
ATOM 2605  O O     . ASP D 4 67  ? 123.685 135.263 139.861 1.00 14.13  ? 65  ASP D O     1 
ATOM 2606  C CB    . ASP D 4 67  ? 125.597 132.974 141.351 1.00 14.13  ? 65  ASP D CB    1 
ATOM 2607  C CG    . ASP D 4 67  ? 125.636 132.461 139.935 1.00 14.13  ? 65  ASP D CG    1 
ATOM 2608  O OD1   . ASP D 4 67  ? 126.303 133.074 139.082 1.00 14.13  ? 65  ASP D OD1   1 
ATOM 2609  O OD2   . ASP D 4 67  ? 125.022 131.408 139.683 1.00 14.13  ? 65  ASP D OD2   1 
ATOM 2610  N N     . ILE D 4 68  ? 122.858 134.412 141.764 1.00 12.69  ? 66  ILE D N     1 
ATOM 2611  C CA    . ILE D 4 68  ? 121.501 134.639 141.281 1.00 12.69  ? 66  ILE D CA    1 
ATOM 2612  C C     . ILE D 4 68  ? 121.150 136.118 141.304 1.00 12.69  ? 66  ILE D C     1 
ATOM 2613  O O     . ILE D 4 68  ? 120.358 136.573 140.465 1.00 12.69  ? 66  ILE D O     1 
ATOM 2614  C CB    . ILE D 4 68  ? 120.473 133.791 142.051 1.00 12.69  ? 66  ILE D CB    1 
ATOM 2615  C CG1   . ILE D 4 68  ? 120.520 134.087 143.544 1.00 12.69  ? 66  ILE D CG1   1 
ATOM 2616  C CG2   . ILE D 4 68  ? 120.691 132.325 141.762 1.00 12.69  ? 66  ILE D CG2   1 
ATOM 2617  C CD1   . ILE D 4 68  ? 119.630 133.211 144.387 1.00 12.69  ? 66  ILE D CD1   1 
ATOM 2618  N N     . PHE D 4 69  ? 121.756 136.899 142.211 1.00 13.99  ? 67  PHE D N     1 
ATOM 2619  C CA    . PHE D 4 69  ? 121.630 138.353 142.148 1.00 13.99  ? 67  PHE D CA    1 
ATOM 2620  C C     . PHE D 4 69  ? 122.147 138.890 140.827 1.00 13.99  ? 67  PHE D C     1 
ATOM 2621  O O     . PHE D 4 69  ? 121.450 139.640 140.141 1.00 13.99  ? 67  PHE D O     1 
ATOM 2622  C CB    . PHE D 4 69  ? 122.387 139.017 143.301 1.00 13.99  ? 67  PHE D CB    1 
ATOM 2623  C CG    . PHE D 4 69  ? 122.522 140.516 143.158 1.00 13.99  ? 67  PHE D CG    1 
ATOM 2624  C CD1   . PHE D 4 69  ? 121.467 141.343 143.464 1.00 13.99  ? 67  PHE D CD1   1 
ATOM 2625  C CD2   . PHE D 4 69  ? 123.701 141.096 142.719 1.00 13.99  ? 67  PHE D CD2   1 
ATOM 2626  C CE1   . PHE D 4 69  ? 121.575 142.697 143.329 1.00 13.99  ? 67  PHE D CE1   1 
ATOM 2627  C CE2   . PHE D 4 69  ? 123.798 142.455 142.573 1.00 13.99  ? 67  PHE D CE2   1 
ATOM 2628  C CZ    . PHE D 4 69  ? 122.734 143.249 142.885 1.00 13.99  ? 67  PHE D CZ    1 
ATOM 2629  N N     . GLU D 4 70  ? 123.375 138.524 140.459 1.00 14.52  ? 68  GLU D N     1 
ATOM 2630  C CA    . GLU D 4 70  ? 123.954 139.092 139.253 1.00 14.52  ? 68  GLU D CA    1 
ATOM 2631  C C     . GLU D 4 70  ? 123.428 138.462 137.976 1.00 14.52  ? 68  GLU D C     1 
ATOM 2632  O O     . GLU D 4 70  ? 123.730 138.969 136.900 1.00 14.52  ? 68  GLU D O     1 
ATOM 2633  C CB    . GLU D 4 70  ? 125.469 138.986 139.297 1.00 14.52  ? 68  GLU D CB    1 
ATOM 2634  C CG    . GLU D 4 70  ? 125.999 137.593 139.147 1.00 14.52  ? 68  GLU D CG    1 
ATOM 2635  C CD    . GLU D 4 70  ? 127.511 137.561 139.129 1.00 14.52  ? 68  GLU D CD    1 
ATOM 2636  O OE1   . GLU D 4 70  ? 128.106 138.650 139.028 1.00 14.52  ? 68  GLU D OE1   1 
ATOM 2637  O OE2   . GLU D 4 70  ? 128.100 136.463 139.234 1.00 14.52  ? 68  GLU D OE2   1 
ATOM 2638  N N     . ARG D 4 71  ? 122.665 137.381 138.054 1.00 11.65  ? 69  ARG D N     1 
ATOM 2639  C CA    . ARG D 4 71  ? 121.956 136.898 136.878 1.00 11.65  ? 69  ARG D CA    1 
ATOM 2640  C C     . ARG D 4 71  ? 120.645 137.638 136.667 1.00 11.65  ? 69  ARG D C     1 
ATOM 2641  O O     . ARG D 4 71  ? 120.338 138.052 135.542 1.00 11.65  ? 69  ARG D O     1 
ATOM 2642  C CB    . ARG D 4 71  ? 121.715 135.396 136.995 1.00 11.65  ? 69  ARG D CB    1 
ATOM 2643  C CG    . ARG D 4 71  ? 122.963 134.619 136.745 1.00 11.65  ? 69  ARG D CG    1 
ATOM 2644  C CD    . ARG D 4 71  ? 122.959 133.255 137.353 1.00 11.65  ? 69  ARG D CD    1 
ATOM 2645  N NE    . ARG D 4 71  ? 122.266 132.259 136.566 1.00 11.65  ? 69  ARG D NE    1 
ATOM 2646  C CZ    . ARG D 4 71  ? 122.213 130.981 136.904 1.00 11.65  ? 69  ARG D CZ    1 
ATOM 2647  N NH1   . ARG D 4 71  ? 122.818 130.572 138.000 1.00 11.65  ? 69  ARG D NH1   1 
ATOM 2648  N NH2   . ARG D 4 71  ? 121.565 130.117 136.149 1.00 11.65  ? 69  ARG D NH2   1 
ATOM 2649  N N     . ILE D 4 72  ? 119.879 137.842 137.742 1.00 12.32  ? 70  ILE D N     1 
ATOM 2650  C CA    . ILE D 4 72  ? 118.614 138.560 137.621 1.00 12.32  ? 70  ILE D CA    1 
ATOM 2651  C C     . ILE D 4 72  ? 118.852 140.031 137.315 1.00 12.32  ? 70  ILE D C     1 
ATOM 2652  O O     . ILE D 4 72  ? 118.141 140.628 136.501 1.00 12.32  ? 70  ILE D O     1 
ATOM 2653  C CB    . ILE D 4 72  ? 117.776 138.352 138.890 1.00 12.32  ? 70  ILE D CB    1 
ATOM 2654  C CG1   . ILE D 4 72  ? 117.403 136.888 139.008 1.00 12.32  ? 70  ILE D CG1   1 
ATOM 2655  C CG2   . ILE D 4 72  ? 116.517 139.153 138.850 1.00 12.32  ? 70  ILE D CG2   1 
ATOM 2656  C CD1   . ILE D 4 72  ? 116.708 136.556 140.259 1.00 12.32  ? 70  ILE D CD1   1 
ATOM 2657  N N     . ALA D 4 73  ? 119.889 140.622 137.905 1.00 13.24  ? 71  ALA D N     1 
ATOM 2658  C CA    . ALA D 4 73  ? 120.173 142.030 137.671 1.00 13.24  ? 71  ALA D CA    1 
ATOM 2659  C C     . ALA D 4 73  ? 120.663 142.270 136.256 1.00 13.24  ? 71  ALA D C     1 
ATOM 2660  O O     . ALA D 4 73  ? 120.325 143.286 135.645 1.00 13.24  ? 71  ALA D O     1 
ATOM 2661  C CB    . ALA D 4 73  ? 121.189 142.525 138.688 1.00 13.24  ? 71  ALA D CB    1 
ATOM 2662  N N     . ALA D 4 74  ? 121.419 141.324 135.699 1.00 13.28  ? 72  ALA D N     1 
ATOM 2663  C CA    . ALA D 4 74  ? 121.891 141.454 134.326 1.00 13.28  ? 72  ALA D CA    1 
ATOM 2664  C C     . ALA D 4 74  ? 120.760 141.275 133.325 1.00 13.28  ? 72  ALA D C     1 
ATOM 2665  O O     . ALA D 4 74  ? 120.698 141.998 132.328 1.00 13.28  ? 72  ALA D O     1 
ATOM 2666  C CB    . ALA D 4 74  ? 123.007 140.459 134.060 1.00 13.28  ? 72  ALA D CB    1 
ATOM 2667  N N     . GLU D 4 75  ? 119.836 140.350 133.584 1.00 15.51  ? 73  GLU D N     1 
ATOM 2668  C CA    . GLU D 4 75  ? 118.697 140.202 132.682 1.00 15.51  ? 73  GLU D CA    1 
ATOM 2669  C C     . GLU D 4 75  ? 117.751 141.393 132.765 1.00 15.51  ? 73  GLU D C     1 
ATOM 2670  O O     . GLU D 4 75  ? 117.167 141.798 131.755 1.00 15.51  ? 73  GLU D O     1 
ATOM 2671  C CB    . GLU D 4 75  ? 117.953 138.909 132.985 1.00 15.51  ? 73  GLU D CB    1 
ATOM 2672  C CG    . GLU D 4 75  ? 117.053 138.439 131.870 1.00 15.51  ? 73  GLU D CG    1 
ATOM 2673  C CD    . GLU D 4 75  ? 117.755 138.399 130.529 1.00 15.51  ? 73  GLU D CD    1 
ATOM 2674  O OE1   . GLU D 4 75  ? 118.786 137.710 130.415 1.00 15.51  ? 73  GLU D OE1   1 
ATOM 2675  O OE2   . GLU D 4 75  ? 117.279 139.058 129.581 1.00 15.51  ? 73  GLU D OE2   1 
ATOM 2676  N N     . ALA D 4 76  ? 117.612 141.995 133.946 1.00 14.54  ? 74  ALA D N     1 
ATOM 2677  C CA    . ALA D 4 76  ? 116.752 143.165 134.077 1.00 14.54  ? 74  ALA D CA    1 
ATOM 2678  C C     . ALA D 4 76  ? 117.380 144.389 133.431 1.00 14.54  ? 74  ALA D C     1 
ATOM 2679  O O     . ALA D 4 76  ? 116.677 145.205 132.821 1.00 14.54  ? 74  ALA D O     1 
ATOM 2680  C CB    . ALA D 4 76  ? 116.459 143.421 135.545 1.00 14.54  ? 74  ALA D CB    1 
ATOM 2681  N N     . SER D 4 77  ? 118.702 144.531 133.558 1.00 14.37  ? 75  SER D N     1 
ATOM 2682  C CA    . SER D 4 77  ? 119.450 145.551 132.834 1.00 14.37  ? 75  SER D CA    1 
ATOM 2683  C C     . SER D 4 77  ? 119.278 145.419 131.338 1.00 14.37  ? 75  SER D C     1 
ATOM 2684  O O     . SER D 4 77  ? 119.068 146.415 130.637 1.00 14.37  ? 75  SER D O     1 
ATOM 2685  C CB    . SER D 4 77  ? 120.924 145.428 133.179 1.00 14.37  ? 75  SER D CB    1 
ATOM 2686  O OG    . SER D 4 77  ? 121.654 146.519 132.666 1.00 14.37  ? 75  SER D OG    1 
ATOM 2687  N N     . ARG D 4 78  ? 119.334 144.190 130.847 1.00 15.21  ? 76  ARG D N     1 
ATOM 2688  C CA    . ARG D 4 78  ? 119.227 143.911 129.430 1.00 15.21  ? 76  ARG D CA    1 
ATOM 2689  C C     . ARG D 4 78  ? 117.816 144.188 128.924 1.00 15.21  ? 76  ARG D C     1 
ATOM 2690  O O     . ARG D 4 78  ? 117.649 144.706 127.824 1.00 15.21  ? 76  ARG D O     1 
ATOM 2691  C CB    . ARG D 4 78  ? 119.660 142.466 129.213 1.00 15.21  ? 76  ARG D CB    1 
ATOM 2692  C CG    . ARG D 4 78  ? 120.295 142.175 127.918 1.00 15.21  ? 76  ARG D CG    1 
ATOM 2693  C CD    . ARG D 4 78  ? 120.857 140.760 127.859 1.00 15.21  ? 76  ARG D CD    1 
ATOM 2694  N NE    . ARG D 4 78  ? 121.939 140.504 128.805 1.00 15.21  ? 76  ARG D NE    1 
ATOM 2695  C CZ    . ARG D 4 78  ? 121.923 139.532 129.710 1.00 15.21  ? 76  ARG D CZ    1 
ATOM 2696  N NH1   . ARG D 4 78  ? 120.891 138.711 129.777 1.00 15.21  ? 76  ARG D NH1   1 
ATOM 2697  N NH2   . ARG D 4 78  ? 122.948 139.362 130.528 1.00 15.21  ? 76  ARG D NH2   1 
ATOM 2698  N N     . LEU D 4 79  ? 116.793 143.915 129.739 1.00 14.99  ? 77  LEU D N     1 
ATOM 2699  C CA    . LEU D 4 79  ? 115.412 144.230 129.362 1.00 14.99  ? 77  LEU D CA    1 
ATOM 2700  C C     . LEU D 4 79  ? 115.164 145.726 129.296 1.00 14.99  ? 77  LEU D C     1 
ATOM 2701  O O     . LEU D 4 79  ? 114.454 146.206 128.403 1.00 14.99  ? 77  LEU D O     1 
ATOM 2702  C CB    . LEU D 4 79  ? 114.436 143.629 130.359 1.00 14.99  ? 77  LEU D CB    1 
ATOM 2703  C CG    . LEU D 4 79  ? 114.082 142.165 130.348 1.00 14.99  ? 77  LEU D CG    1 
ATOM 2704  C CD1   . LEU D 4 79  ? 113.667 141.830 131.727 1.00 14.99  ? 77  LEU D CD1   1 
ATOM 2705  C CD2   . LEU D 4 79  ? 112.961 141.942 129.402 1.00 14.99  ? 77  LEU D CD2   1 
ATOM 2706  N N     . ALA D 4 80  ? 115.689 146.471 130.269 1.00 17.77  ? 78  ALA D N     1 
ATOM 2707  C CA    . ALA D 4 80  ? 115.560 147.921 130.233 1.00 17.77  ? 78  ALA D CA    1 
ATOM 2708  C C     . ALA D 4 80  ? 116.291 148.518 129.043 1.00 17.77  ? 78  ALA D C     1 
ATOM 2709  O O     . ALA D 4 80  ? 115.796 149.466 128.435 1.00 17.77  ? 78  ALA D O     1 
ATOM 2710  C CB    . ALA D 4 80  ? 116.083 148.528 131.529 1.00 17.77  ? 78  ALA D CB    1 
ATOM 2711  N N     . HIS D 4 81  ? 117.446 147.969 128.678 1.00 18.65  ? 79  HIS D N     1 
ATOM 2712  C CA    . HIS D 4 81  ? 118.143 148.446 127.491 1.00 18.65  ? 79  HIS D CA    1 
ATOM 2713  C C     . HIS D 4 81  ? 117.419 148.081 126.204 1.00 18.65  ? 79  HIS D C     1 
ATOM 2714  O O     . HIS D 4 81  ? 117.471 148.847 125.241 1.00 18.65  ? 79  HIS D O     1 
ATOM 2715  C CB    . HIS D 4 81  ? 119.564 147.892 127.467 1.00 18.65  ? 79  HIS D CB    1 
ATOM 2716  C CG    . HIS D 4 81  ? 120.364 148.324 126.280 1.00 18.65  ? 79  HIS D CG    1 
ATOM 2717  N ND1   . HIS D 4 81  ? 121.079 149.501 126.254 1.00 18.65  ? 79  HIS D ND1   1 
ATOM 2718  C CD2   . HIS D 4 81  ? 120.569 147.733 125.079 1.00 18.65  ? 79  HIS D CD2   1 
ATOM 2719  C CE1   . HIS D 4 81  ? 121.686 149.619 125.087 1.00 18.65  ? 79  HIS D CE1   1 
ATOM 2720  N NE2   . HIS D 4 81  ? 121.391 148.560 124.356 1.00 18.65  ? 79  HIS D NE2   1 
ATOM 2721  N N     . TYR D 4 82  ? 116.756 146.926 126.159 1.00 16.75  ? 80  TYR D N     1 
ATOM 2722  C CA    . TYR D 4 82  ? 115.992 146.552 124.973 1.00 16.75  ? 80  TYR D CA    1 
ATOM 2723  C C     . TYR D 4 82  ? 114.784 147.441 124.775 1.00 16.75  ? 80  TYR D C     1 
ATOM 2724  O O     . TYR D 4 82  ? 114.453 147.777 123.638 1.00 16.75  ? 80  TYR D O     1 
ATOM 2725  C CB    . TYR D 4 82  ? 115.504 145.111 125.060 1.00 16.75  ? 80  TYR D CB    1 
ATOM 2726  C CG    . TYR D 4 82  ? 116.564 144.047 125.030 1.00 16.75  ? 80  TYR D CG    1 
ATOM 2727  C CD1   . TYR D 4 82  ? 117.819 144.296 124.500 1.00 16.75  ? 80  TYR D CD1   1 
ATOM 2728  C CD2   . TYR D 4 82  ? 116.303 142.784 125.539 1.00 16.75  ? 80  TYR D CD2   1 
ATOM 2729  C CE1   . TYR D 4 82  ? 118.773 143.323 124.475 1.00 16.75  ? 80  TYR D CE1   1 
ATOM 2730  C CE2   . TYR D 4 82  ? 117.252 141.803 125.516 1.00 16.75  ? 80  TYR D CE2   1 
ATOM 2731  C CZ    . TYR D 4 82  ? 118.481 142.074 124.974 1.00 16.75  ? 80  TYR D CZ    1 
ATOM 2732  O OH    . TYR D 4 82  ? 119.436 141.090 124.950 1.00 16.75  ? 80  TYR D OH    1 
ATOM 2733  N N     . ASN D 4 83  ? 114.095 147.806 125.850 1.00 20.07  ? 81  ASN D N     1 
ATOM 2734  C CA    . ASN D 4 83  ? 112.872 148.585 125.728 1.00 20.07  ? 81  ASN D CA    1 
ATOM 2735  C C     . ASN D 4 83  ? 113.103 150.080 125.817 1.00 20.07  ? 81  ASN D C     1 
ATOM 2736  O O     . ASN D 4 83  ? 112.131 150.830 125.927 1.00 20.07  ? 81  ASN D O     1 
ATOM 2737  C CB    . ASN D 4 83  ? 111.878 148.148 126.787 1.00 20.07  ? 81  ASN D CB    1 
ATOM 2738  C CG    . ASN D 4 83  ? 111.570 146.698 126.693 1.00 20.07  ? 81  ASN D CG    1 
ATOM 2739  O OD1   . ASN D 4 83  ? 110.785 146.286 125.863 1.00 20.07  ? 81  ASN D OD1   1 
ATOM 2740  N ND2   . ASN D 4 83  ? 112.218 145.900 127.516 1.00 20.07  ? 81  ASN D ND2   1 
ATOM 2741  N N     . LYS D 4 84  ? 114.365 150.514 125.762 1.00 22.85  ? 82  LYS D N     1 
ATOM 2742  C CA    . LYS D 4 84  ? 114.789 151.915 125.812 1.00 22.85  ? 82  LYS D CA    1 
ATOM 2743  C C     . LYS D 4 84  ? 114.319 152.611 127.080 1.00 22.85  ? 82  LYS D C     1 
ATOM 2744  O O     . LYS D 4 84  ? 113.845 153.746 127.044 1.00 22.85  ? 82  LYS D O     1 
ATOM 2745  C CB    . LYS D 4 84  ? 114.339 152.679 124.571 1.00 22.85  ? 82  LYS D CB    1 
ATOM 2746  C CG    . LYS D 4 84  ? 114.844 152.055 123.301 1.00 22.85  ? 82  LYS D CG    1 
ATOM 2747  C CD    . LYS D 4 84  ? 114.387 152.818 122.103 1.00 22.85  ? 82  LYS D CD    1 
ATOM 2748  C CE    . LYS D 4 84  ? 114.850 152.123 120.856 1.00 22.85  ? 82  LYS D CE    1 
ATOM 2749  N NZ    . LYS D 4 84  ? 114.144 150.830 120.720 1.00 22.85  ? 82  LYS D NZ    1 
ATOM 2750  N N     . ARG D 4 85  ? 114.439 151.921 128.202 1.00 27.17  ? 83  ARG D N     1 
ATOM 2751  C CA    . ARG D 4 85  ? 114.153 152.476 129.508 1.00 27.17  ? 83  ARG D CA    1 
ATOM 2752  C C     . ARG D 4 85  ? 115.448 152.808 130.224 1.00 27.17  ? 83  ARG D C     1 
ATOM 2753  O O     . ARG D 4 85  ? 116.515 152.293 129.898 1.00 27.17  ? 83  ARG D O     1 
ATOM 2754  C CB    . ARG D 4 85  ? 113.340 151.495 130.336 1.00 27.17  ? 83  ARG D CB    1 
ATOM 2755  C CG    . ARG D 4 85  ? 111.994 151.198 129.774 1.00 27.17  ? 83  ARG D CG    1 
ATOM 2756  C CD    . ARG D 4 85  ? 111.117 152.405 129.876 1.00 27.17  ? 83  ARG D CD    1 
ATOM 2757  N NE    . ARG D 4 85  ? 109.711 152.037 129.897 1.00 27.17  ? 83  ARG D NE    1 
ATOM 2758  C CZ    . ARG D 4 85  ? 108.924 152.055 128.832 1.00 27.17  ? 83  ARG D CZ    1 
ATOM 2759  N NH1   . ARG D 4 85  ? 109.407 152.434 127.657 1.00 27.17  ? 83  ARG D NH1   1 
ATOM 2760  N NH2   . ARG D 4 85  ? 107.656 151.692 128.944 1.00 27.17  ? 83  ARG D NH2   1 
ATOM 2761  N N     . SER D 4 86  ? 115.348 153.686 131.211 1.00 30.24  ? 84  SER D N     1 
ATOM 2762  C CA    . SER D 4 86  ? 116.501 154.079 132.001 1.00 30.24  ? 84  SER D CA    1 
ATOM 2763  C C     . SER D 4 86  ? 116.416 153.570 133.426 1.00 30.24  ? 84  SER D C     1 
ATOM 2764  O O     . SER D 4 86  ? 117.386 153.695 134.170 1.00 30.24  ? 84  SER D O     1 
ATOM 2765  C CB    . SER D 4 86  ? 116.660 155.599 132.013 1.00 30.24  ? 84  SER D CB    1 
ATOM 2766  O OG    . SER D 4 86  ? 116.669 156.111 130.698 1.00 30.24  ? 84  SER D OG    1 
ATOM 2767  N N     . THR D 4 87  ? 115.294 152.981 133.815 1.00 27.39  ? 85  THR D N     1 
ATOM 2768  C CA    . THR D 4 87  ? 115.047 152.570 135.184 1.00 27.39  ? 85  THR D CA    1 
ATOM 2769  C C     . THR D 4 87  ? 114.886 151.063 135.221 1.00 27.39  ? 85  THR D C     1 
ATOM 2770  O O     . THR D 4 87  ? 114.217 150.487 134.361 1.00 27.39  ? 85  THR D O     1 
ATOM 2771  C CB    . THR D 4 87  ? 113.786 153.241 135.735 1.00 27.39  ? 85  THR D CB    1 
ATOM 2772  O OG1   . THR D 4 87  ? 113.766 154.613 135.340 1.00 27.39  ? 85  THR D OG1   1 
ATOM 2773  C CG2   . THR D 4 87  ? 113.743 153.177 137.238 1.00 27.39  ? 85  THR D CG2   1 
ATOM 2774  N N     . ILE D 4 88  ? 115.511 150.427 136.202 1.00 20.00  ? 86  ILE D N     1 
ATOM 2775  C CA    . ILE D 4 88  ? 115.186 149.054 136.551 1.00 20.00  ? 86  ILE D CA    1 
ATOM 2776  C C     . ILE D 4 88  ? 114.135 149.106 137.640 1.00 20.00  ? 86  ILE D C     1 
ATOM 2777  O O     . ILE D 4 88  ? 114.368 149.670 138.710 1.00 20.00  ? 86  ILE D O     1 
ATOM 2778  C CB    . ILE D 4 88  ? 116.422 148.278 137.014 1.00 20.00  ? 86  ILE D CB    1 
ATOM 2779  C CG1   . ILE D 4 88  ? 117.308 147.960 135.823 1.00 20.00  ? 86  ILE D CG1   1 
ATOM 2780  C CG2   . ILE D 4 88  ? 116.006 146.996 137.668 1.00 20.00  ? 86  ILE D CG2   1 
ATOM 2781  C CD1   . ILE D 4 88  ? 118.518 147.202 136.188 1.00 20.00  ? 86  ILE D CD1   1 
ATOM 2782  N N     . THR D 4 89  ? 112.971 148.547 137.358 1.00 18.22  ? 87  THR D N     1 
ATOM 2783  C CA    . THR D 4 89  ? 111.858 148.519 138.283 1.00 18.22  ? 87  THR D CA    1 
ATOM 2784  C C     . THR D 4 89  ? 111.521 147.077 138.641 1.00 18.22  ? 87  THR D C     1 
ATOM 2785  O O     . THR D 4 89  ? 112.168 146.127 138.191 1.00 18.22  ? 87  THR D O     1 
ATOM 2786  C CB    . THR D 4 89  ? 110.656 149.237 137.677 1.00 18.22  ? 87  THR D CB    1 
ATOM 2787  O OG1   . THR D 4 89  ? 110.465 148.793 136.336 1.00 18.22  ? 87  THR D OG1   1 
ATOM 2788  C CG2   . THR D 4 89  ? 110.892 150.716 137.649 1.00 18.22  ? 87  THR D CG2   1 
ATOM 2789  N N     . SER D 4 90  ? 110.484 146.916 139.460 1.00 16.74  ? 88  SER D N     1 
ATOM 2790  C CA    . SER D 4 90  ? 110.024 145.585 139.823 1.00 16.74  ? 88  SER D CA    1 
ATOM 2791  C C     . SER D 4 90  ? 109.387 144.844 138.659 1.00 16.74  ? 88  SER D C     1 
ATOM 2792  O O     . SER D 4 90  ? 109.371 143.617 138.675 1.00 16.74  ? 88  SER D O     1 
ATOM 2793  C CB    . SER D 4 90  ? 109.047 145.664 140.988 1.00 16.74  ? 88  SER D CB    1 
ATOM 2794  O OG    . SER D 4 90  ? 108.154 146.742 140.835 1.00 16.74  ? 88  SER D OG    1 
ATOM 2795  N N     . ARG D 4 91  ? 108.912 145.549 137.634 1.00 17.81  ? 89  ARG D N     1 
ATOM 2796  C CA    . ARG D 4 91  ? 108.422 144.880 136.436 1.00 17.81  ? 89  ARG D CA    1 
ATOM 2797  C C     . ARG D 4 91  ? 109.561 144.257 135.634 1.00 17.81  ? 89  ARG D C     1 
ATOM 2798  O O     . ARG D 4 91  ? 109.429 143.137 135.126 1.00 17.81  ? 89  ARG D O     1 
ATOM 2799  C CB    . ARG D 4 91  ? 107.626 145.873 135.602 1.00 17.81  ? 89  ARG D CB    1 
ATOM 2800  C CG    . ARG D 4 91  ? 107.088 145.317 134.328 1.00 17.81  ? 89  ARG D CG    1 
ATOM 2801  C CD    . ARG D 4 91  ? 106.184 146.294 133.622 1.00 17.81  ? 89  ARG D CD    1 
ATOM 2802  N NE    . ARG D 4 91  ? 105.915 145.869 132.254 1.00 17.81  ? 89  ARG D NE    1 
ATOM 2803  C CZ    . ARG D 4 91  ? 104.981 144.995 131.904 1.00 17.81  ? 89  ARG D CZ    1 
ATOM 2804  N NH1   . ARG D 4 91  ? 104.212 144.433 132.817 1.00 17.81  ? 89  ARG D NH1   1 
ATOM 2805  N NH2   . ARG D 4 91  ? 104.821 144.679 130.635 1.00 17.81  ? 89  ARG D NH2   1 
ATOM 2806  N N     . GLU D 4 92  ? 110.705 144.941 135.548 1.00 16.50  ? 90  GLU D N     1 
ATOM 2807  C CA    . GLU D 4 92  ? 111.898 144.332 134.967 1.00 16.50  ? 90  GLU D CA    1 
ATOM 2808  C C     . GLU D 4 92  ? 112.427 143.184 135.811 1.00 16.50  ? 90  GLU D C     1 
ATOM 2809  O O     . GLU D 4 92  ? 112.892 142.183 135.261 1.00 16.50  ? 90  GLU D O     1 
ATOM 2810  C CB    . GLU D 4 92  ? 113.002 145.365 134.770 1.00 16.50  ? 90  GLU D CB    1 
ATOM 2811  C CG    . GLU D 4 92  ? 112.933 146.170 133.504 1.00 16.50  ? 90  GLU D CG    1 
ATOM 2812  C CD    . GLU D 4 92  ? 112.050 147.373 133.613 1.00 16.50  ? 90  GLU D CD    1 
ATOM 2813  O OE1   . GLU D 4 92  ? 111.499 147.601 134.703 1.00 16.50  ? 90  GLU D OE1   1 
ATOM 2814  O OE2   . GLU D 4 92  ? 111.911 148.102 132.610 1.00 16.50  ? 90  GLU D OE2   1 
ATOM 2815  N N     . ILE D 4 93  ? 112.400 143.316 137.140 1.00 13.76  ? 91  ILE D N     1 
ATOM 2816  C CA    . ILE D 4 93  ? 112.870 142.216 137.984 1.00 13.76  ? 91  ILE D CA    1 
ATOM 2817  C C     . ILE D 4 93  ? 111.936 141.016 137.867 1.00 13.76  ? 91  ILE D C     1 
ATOM 2818  O O     . ILE D 4 93  ? 112.392 139.869 137.845 1.00 13.76  ? 91  ILE D O     1 
ATOM 2819  C CB    . ILE D 4 93  ? 113.041 142.680 139.448 1.00 13.76  ? 91  ILE D CB    1 
ATOM 2820  C CG1   . ILE D 4 93  ? 114.044 143.822 139.551 1.00 13.76  ? 91  ILE D CG1   1 
ATOM 2821  C CG2   . ILE D 4 93  ? 113.527 141.562 140.337 1.00 13.76  ? 91  ILE D CG2   1 
ATOM 2822  C CD1   . ILE D 4 93  ? 115.452 143.446 139.246 1.00 13.76  ? 91  ILE D CD1   1 
ATOM 2823  N N     . GLN D 4 94  ? 110.639 141.249 137.702 1.00 14.50  ? 92  GLN D N     1 
ATOM 2824  C CA    . GLN D 4 94  ? 109.698 140.150 137.546 1.00 14.50  ? 92  GLN D CA    1 
ATOM 2825  C C     . GLN D 4 94  ? 109.859 139.457 136.202 1.00 14.50  ? 92  GLN D C     1 
ATOM 2826  O O     . GLN D 4 94  ? 109.805 138.226 136.129 1.00 14.50  ? 92  GLN D O     1 
ATOM 2827  C CB    . GLN D 4 94  ? 108.281 140.669 137.718 1.00 14.50  ? 92  GLN D CB    1 
ATOM 2828  C CG    . GLN D 4 94  ? 107.221 139.673 137.407 1.00 14.50  ? 92  GLN D CG    1 
ATOM 2829  C CD    . GLN D 4 94  ? 105.879 140.126 137.849 1.00 14.50  ? 92  GLN D CD    1 
ATOM 2830  O OE1   . GLN D 4 94  ? 105.753 140.842 138.828 1.00 14.50  ? 92  GLN D OE1   1 
ATOM 2831  N NE2   . GLN D 4 94  ? 104.853 139.721 137.126 1.00 14.50  ? 92  GLN D NE2   1 
ATOM 2832  N N     . THR D 4 95  ? 110.076 140.221 135.132 1.00 14.05  ? 93  THR D N     1 
ATOM 2833  C CA    . THR D 4 95  ? 110.317 139.605 133.832 1.00 14.05  ? 93  THR D CA    1 
ATOM 2834  C C     . THR D 4 95  ? 111.637 138.846 133.810 1.00 14.05  ? 93  THR D C     1 
ATOM 2835  O O     . THR D 4 95  ? 111.731 137.782 133.194 1.00 14.05  ? 93  THR D O     1 
ATOM 2836  C CB    . THR D 4 95  ? 110.292 140.666 132.746 1.00 14.05  ? 93  THR D CB    1 
ATOM 2837  O OG1   . THR D 4 95  ? 109.130 141.476 132.908 1.00 14.05  ? 93  THR D OG1   1 
ATOM 2838  C CG2   . THR D 4 95  ? 110.255 140.040 131.391 1.00 14.05  ? 93  THR D CG2   1 
ATOM 2839  N N     . ALA D 4 96  ? 112.654 139.352 134.508 1.00 13.33  ? 94  ALA D N     1 
ATOM 2840  C CA    . ALA D 4 96  ? 113.921 138.640 134.602 1.00 13.33  ? 94  ALA D CA    1 
ATOM 2841  C C     . ALA D 4 96  ? 113.781 137.352 135.392 1.00 13.33  ? 94  ALA D C     1 
ATOM 2842  O O     . ALA D 4 96  ? 114.428 136.353 135.069 1.00 13.33  ? 94  ALA D O     1 
ATOM 2843  C CB    . ALA D 4 96  ? 114.971 139.532 135.239 1.00 13.33  ? 94  ALA D CB    1 
ATOM 2844  N N     . VAL D 4 97  ? 112.934 137.347 136.418 1.00 13.93  ? 95  VAL D N     1 
ATOM 2845  C CA    . VAL D 4 97  ? 112.703 136.129 137.188 1.00 13.93  ? 95  VAL D CA    1 
ATOM 2846  C C     . VAL D 4 97  ? 111.946 135.107 136.350 1.00 13.93  ? 95  VAL D C     1 
ATOM 2847  O O     . VAL D 4 97  ? 112.271 133.917 136.357 1.00 13.93  ? 95  VAL D O     1 
ATOM 2848  C CB    . VAL D 4 97  ? 111.978 136.476 138.503 1.00 13.93  ? 95  VAL D CB    1 
ATOM 2849  C CG1   . VAL D 4 97  ? 111.357 135.274 139.135 1.00 13.93  ? 95  VAL D CG1   1 
ATOM 2850  C CG2   . VAL D 4 97  ? 112.951 137.068 139.465 1.00 13.93  ? 95  VAL D CG2   1 
ATOM 2851  N N     . ARG D 4 98  ? 110.967 135.559 135.574 1.00 14.54  ? 96  ARG D N     1 
ATOM 2852  C CA    . ARG D 4 98  ? 110.254 134.665 134.672 1.00 14.54  ? 96  ARG D CA    1 
ATOM 2853  C C     . ARG D 4 98  ? 111.127 134.130 133.546 1.00 14.54  ? 96  ARG D C     1 
ATOM 2854  O O     . ARG D 4 98  ? 110.895 133.013 133.086 1.00 14.54  ? 96  ARG D O     1 
ATOM 2855  C CB    . ARG D 4 98  ? 109.040 135.370 134.076 1.00 14.54  ? 96  ARG D CB    1 
ATOM 2856  C CG    . ARG D 4 98  ? 107.963 135.684 135.073 1.00 14.54  ? 96  ARG D CG    1 
ATOM 2857  C CD    . ARG D 4 98  ? 106.674 136.083 134.394 1.00 14.54  ? 96  ARG D CD    1 
ATOM 2858  N NE    . ARG D 4 98  ? 106.883 137.012 133.285 1.00 14.54  ? 96  ARG D NE    1 
ATOM 2859  C CZ    . ARG D 4 98  ? 106.495 138.286 133.283 1.00 14.54  ? 96  ARG D CZ    1 
ATOM 2860  N NH1   . ARG D 4 98  ? 105.875 138.797 134.335 1.00 14.54  ? 96  ARG D NH1   1 
ATOM 2861  N NH2   . ARG D 4 98  ? 106.725 139.054 132.228 1.00 14.54  ? 96  ARG D NH2   1 
ATOM 2862  N N     . LEU D 4 99  ? 112.126 134.886 133.101 1.00 13.96  ? 97  LEU D N     1 
ATOM 2863  C CA    . LEU D 4 99  ? 113.028 134.384 132.070 1.00 13.96  ? 97  LEU D CA    1 
ATOM 2864  C C     . LEU D 4 99  ? 114.060 133.424 132.633 1.00 13.96  ? 97  LEU D C     1 
ATOM 2865  O O     . LEU D 4 99  ? 114.415 132.443 131.978 1.00 13.96  ? 97  LEU D O     1 
ATOM 2866  C CB    . LEU D 4 99  ? 113.734 135.537 131.369 1.00 13.96  ? 97  LEU D CB    1 
ATOM 2867  C CG    . LEU D 4 99  ? 112.916 136.380 130.400 1.00 13.96  ? 97  LEU D CG    1 
ATOM 2868  C CD1   . LEU D 4 99  ? 113.670 137.626 130.048 1.00 13.96  ? 97  LEU D CD1   1 
ATOM 2869  C CD2   . LEU D 4 99  ? 112.573 135.598 129.172 1.00 13.96  ? 97  LEU D CD2   1 
ATOM 2870  N N     . LEU D 4 100 ? 114.554 133.677 133.840 1.00 14.58  ? 98  LEU D N     1 
ATOM 2871  C CA    . LEU D 4 100 ? 115.672 132.900 134.356 1.00 14.58  ? 98  LEU D CA    1 
ATOM 2872  C C     . LEU D 4 100 ? 115.247 131.674 135.143 1.00 14.58  ? 98  LEU D C     1 
ATOM 2873  O O     . LEU D 4 100 ? 115.901 130.638 135.037 1.00 14.58  ? 98  LEU D O     1 
ATOM 2874  C CB    . LEU D 4 100 ? 116.542 133.789 135.228 1.00 14.58  ? 98  LEU D CB    1 
ATOM 2875  C CG    . LEU D 4 100 ? 117.477 134.698 134.452 1.00 14.58  ? 98  LEU D CG    1 
ATOM 2876  C CD1   . LEU D 4 100 ? 117.715 135.907 135.244 1.00 14.58  ? 98  LEU D CD1   1 
ATOM 2877  C CD2   . LEU D 4 100 ? 118.776 133.990 134.256 1.00 14.58  ? 98  LEU D CD2   1 
ATOM 2878  N N     . LEU D 4 101 ? 114.185 131.756 135.934 1.00 15.62  ? 99  LEU D N     1 
ATOM 2879  C CA    . LEU D 4 101 ? 113.986 130.601 136.805 1.00 15.62  ? 99  LEU D CA    1 
ATOM 2880  C C     . LEU D 4 101 ? 113.101 129.558 136.129 1.00 15.62  ? 99  LEU D C     1 
ATOM 2881  O O     . LEU D 4 101 ? 112.142 129.910 135.445 1.00 15.62  ? 99  LEU D O     1 
ATOM 2882  C CB    . LEU D 4 101 ? 113.360 131.015 138.130 1.00 15.62  ? 99  LEU D CB    1 
ATOM 2883  C CG    . LEU D 4 101 ? 114.024 132.077 138.996 1.00 15.62  ? 99  LEU D CG    1 
ATOM 2884  C CD1   . LEU D 4 101 ? 113.468 131.992 140.366 1.00 15.62  ? 99  LEU D CD1   1 
ATOM 2885  C CD2   . LEU D 4 101 ? 115.501 131.914 139.049 1.00 15.62  ? 99  LEU D CD2   1 
ATOM 2886  N N     . PRO D 4 102 ? 113.402 128.272 136.306 1.00 18.33  ? 100 PRO D N     1 
ATOM 2887  C CA    . PRO D 4 102 ? 112.679 127.229 135.571 1.00 18.33  ? 100 PRO D CA    1 
ATOM 2888  C C     . PRO D 4 102 ? 111.413 126.792 136.287 1.00 18.33  ? 100 PRO D C     1 
ATOM 2889  O O     . PRO D 4 102 ? 111.438 126.470 137.474 1.00 18.33  ? 100 PRO D O     1 
ATOM 2890  C CB    . PRO D 4 102 ? 113.692 126.079 135.512 1.00 18.33  ? 100 PRO D CB    1 
ATOM 2891  C CG    . PRO D 4 102 ? 114.949 126.611 136.081 1.00 18.33  ? 100 PRO D CG    1 
ATOM 2892  C CD    . PRO D 4 102 ? 114.582 127.715 136.976 1.00 18.33  ? 100 PRO D CD    1 
ATOM 2893  N N     . GLY D 4 103 ? 110.310 126.756 135.552 1.00 20.14  ? 101 GLY D N     1 
ATOM 2894  C CA    . GLY D 4 103 ? 109.111 126.086 136.013 1.00 20.14  ? 101 GLY D CA    1 
ATOM 2895  C C     . GLY D 4 103 ? 108.335 126.778 137.107 1.00 20.14  ? 101 GLY D C     1 
ATOM 2896  O O     . GLY D 4 103 ? 107.879 127.908 136.933 1.00 20.14  ? 101 GLY D O     1 
ATOM 2897  N N     . GLU D 4 104 ? 108.159 126.094 138.235 1.00 23.73  ? 102 GLU D N     1 
ATOM 2898  C CA    . GLU D 4 104 ? 107.414 126.619 139.369 1.00 23.73  ? 102 GLU D CA    1 
ATOM 2899  C C     . GLU D 4 104 ? 108.299 127.343 140.368 1.00 23.73  ? 102 GLU D C     1 
ATOM 2900  O O     . GLU D 4 104 ? 107.781 127.945 141.316 1.00 23.73  ? 102 GLU D O     1 
ATOM 2901  C CB    . GLU D 4 104 ? 106.648 125.502 140.066 1.00 23.73  ? 102 GLU D CB    1 
ATOM 2902  C CG    . GLU D 4 104 ? 105.418 125.068 139.321 1.00 23.73  ? 102 GLU D CG    1 
ATOM 2903  C CD    . GLU D 4 104 ? 104.281 124.756 140.250 1.00 23.73  ? 102 GLU D CD    1 
ATOM 2904  O OE1   . GLU D 4 104 ? 104.500 124.782 141.476 1.00 23.73  ? 102 GLU D OE1   1 
ATOM 2905  O OE2   . GLU D 4 104 ? 103.165 124.498 139.762 1.00 23.73  ? 102 GLU D OE2   1 
ATOM 2906  N N     . LEU D 4 105 ? 109.617 127.300 140.175 1.00 19.46  ? 103 LEU D N     1 
ATOM 2907  C CA    . LEU D 4 105 ? 110.502 128.235 140.857 1.00 19.46  ? 103 LEU D CA    1 
ATOM 2908  C C     . LEU D 4 105 ? 110.142 129.663 140.511 1.00 19.46  ? 103 LEU D C     1 
ATOM 2909  O O     . LEU D 4 105 ? 110.036 130.516 141.396 1.00 19.46  ? 103 LEU D O     1 
ATOM 2910  C CB    . LEU D 4 105 ? 111.948 127.977 140.464 1.00 19.46  ? 103 LEU D CB    1 
ATOM 2911  C CG    . LEU D 4 105 ? 112.765 126.967 141.224 1.00 19.46  ? 103 LEU D CG    1 
ATOM 2912  C CD1   . LEU D 4 105 ? 114.124 126.974 140.635 1.00 19.46  ? 103 LEU D CD1   1 
ATOM 2913  C CD2   . LEU D 4 105 ? 112.808 127.373 142.650 1.00 19.46  ? 103 LEU D CD2   1 
ATOM 2914  N N     . ALA D 4 106 ? 109.926 129.931 139.233 1.00 19.62  ? 104 ALA D N     1 
ATOM 2915  C CA    . ALA D 4 106 ? 109.513 131.234 138.754 1.00 19.62  ? 104 ALA D CA    1 
ATOM 2916  C C     . ALA D 4 106 ? 108.082 131.553 139.092 1.00 19.62  ? 104 ALA D C     1 
ATOM 2917  O O     . ALA D 4 106 ? 107.665 132.683 138.892 1.00 19.62  ? 104 ALA D O     1 
ATOM 2918  C CB    . ALA D 4 106 ? 109.697 131.322 137.244 1.00 19.62  ? 104 ALA D CB    1 
ATOM 2919  N N     . LYS D 4 107 ? 107.310 130.592 139.571 1.00 20.66  ? 105 LYS D N     1 
ATOM 2920  C CA    . LYS D 4 107 ? 105.950 130.840 140.006 1.00 20.66  ? 105 LYS D CA    1 
ATOM 2921  C C     . LYS D 4 107 ? 105.884 131.208 141.474 1.00 20.66  ? 105 LYS D C     1 
ATOM 2922  O O     . LYS D 4 107 ? 105.099 132.073 141.857 1.00 20.66  ? 105 LYS D O     1 
ATOM 2923  C CB    . LYS D 4 107 ? 105.089 129.607 139.742 1.00 20.66  ? 105 LYS D CB    1 
ATOM 2924  C CG    . LYS D 4 107 ? 103.629 129.778 140.046 1.00 20.66  ? 105 LYS D CG    1 
ATOM 2925  C CD    . LYS D 4 107 ? 103.036 128.479 140.512 1.00 20.66  ? 105 LYS D CD    1 
ATOM 2926  C CE    . LYS D 4 107 ? 101.701 128.712 141.158 1.00 20.66  ? 105 LYS D CE    1 
ATOM 2927  N NZ    . LYS D 4 107 ? 101.808 129.702 142.252 1.00 20.66  ? 105 LYS D NZ    1 
ATOM 2928  N N     . HIS D 4 108 ? 106.701 130.576 142.306 1.00 22.85  ? 106 HIS D N     1 
ATOM 2929  C CA    . HIS D 4 108 ? 106.736 130.939 143.714 1.00 22.85  ? 106 HIS D CA    1 
ATOM 2930  C C     . HIS D 4 108 ? 107.628 132.137 144.004 1.00 22.85  ? 106 HIS D C     1 
ATOM 2931  O O     . HIS D 4 108 ? 107.364 132.871 144.962 1.00 22.85  ? 106 HIS D O     1 
ATOM 2932  C CB    . HIS D 4 108 ? 107.187 129.748 144.550 1.00 22.85  ? 106 HIS D CB    1 
ATOM 2933  C CG    . HIS D 4 108 ? 106.253 128.583 144.491 1.00 22.85  ? 106 HIS D CG    1 
ATOM 2934  N ND1   . HIS D 4 108 ? 104.917 128.715 144.193 1.00 22.85  ? 106 HIS D ND1   1 
ATOM 2935  C CD2   . HIS D 4 108 ? 106.461 127.265 144.695 1.00 22.85  ? 106 HIS D CD2   1 
ATOM 2936  C CE1   . HIS D 4 108 ? 104.344 127.528 144.210 1.00 22.85  ? 106 HIS D CE1   1 
ATOM 2937  N NE2   . HIS D 4 108 ? 105.260 126.630 144.513 1.00 22.85  ? 106 HIS D NE2   1 
ATOM 2938  N N     . ALA D 4 109 ? 108.662 132.374 143.194 1.00 18.84  ? 107 ALA D N     1 
ATOM 2939  C CA    . ALA D 4 109 ? 109.504 133.546 143.391 1.00 18.84  ? 107 ALA D CA    1 
ATOM 2940  C C     . ALA D 4 109 ? 108.784 134.826 143.008 1.00 18.84  ? 107 ALA D C     1 
ATOM 2941  O O     . ALA D 4 109 ? 108.991 135.864 143.645 1.00 18.84  ? 107 ALA D O     1 
ATOM 2942  C CB    . ALA D 4 109 ? 110.785 133.402 142.587 1.00 18.84  ? 107 ALA D CB    1 
ATOM 2943  N N     . VAL D 4 110 ? 107.925 134.768 141.993 1.00 16.87  ? 108 VAL D N     1 
ATOM 2944  C CA    . VAL D 4 110 ? 107.092 135.909 141.638 1.00 16.87  ? 108 VAL D CA    1 
ATOM 2945  C C     . VAL D 4 110 ? 106.087 136.204 142.743 1.00 16.87  ? 108 VAL D C     1 
ATOM 2946  O O     . VAL D 4 110 ? 105.842 137.367 143.076 1.00 16.87  ? 108 VAL D O     1 
ATOM 2947  C CB    . VAL D 4 110 ? 106.428 135.657 140.272 1.00 16.87  ? 108 VAL D CB    1 
ATOM 2948  C CG1   . VAL D 4 110 ? 105.296 136.589 140.025 1.00 16.87  ? 108 VAL D CG1   1 
ATOM 2949  C CG2   . VAL D 4 110 ? 107.438 135.881 139.188 1.00 16.87  ? 108 VAL D CG2   1 
ATOM 2950  N N     . SER D 4 111 ? 105.553 135.164 143.381 1.00 19.09  ? 109 SER D N     1 
ATOM 2951  C CA    . SER D 4 111 ? 104.627 135.358 144.491 1.00 19.09  ? 109 SER D CA    1 
ATOM 2952  C C     . SER D 4 111 ? 105.315 135.983 145.692 1.00 19.09  ? 109 SER D C     1 
ATOM 2953  O O     . SER D 4 111 ? 104.761 136.889 146.322 1.00 19.09  ? 109 SER D O     1 
ATOM 2954  C CB    . SER D 4 111 ? 103.998 134.031 144.880 1.00 19.09  ? 109 SER D CB    1 
ATOM 2955  O OG    . SER D 4 111 ? 103.224 133.524 143.816 1.00 19.09  ? 109 SER D OG    1 
ATOM 2956  N N     . GLU D 4 112 ? 106.536 135.542 145.992 1.00 21.45  ? 110 GLU D N     1 
ATOM 2957  C CA    . GLU D 4 112 ? 107.287 136.111 147.106 1.00 21.45  ? 110 GLU D CA    1 
ATOM 2958  C C     . GLU D 4 112 ? 107.662 137.566 146.852 1.00 21.45  ? 110 GLU D C     1 
ATOM 2959  O O     . GLU D 4 112 ? 107.525 138.415 147.741 1.00 21.45  ? 110 GLU D O     1 
ATOM 2960  C CB    . GLU D 4 112 ? 108.532 135.277 147.362 1.00 21.45  ? 110 GLU D CB    1 
ATOM 2961  C CG    . GLU D 4 112 ? 108.244 134.023 148.119 1.00 21.45  ? 110 GLU D CG    1 
ATOM 2962  C CD    . GLU D 4 112 ? 107.592 134.289 149.454 1.00 21.45  ? 110 GLU D CD    1 
ATOM 2963  O OE1   . GLU D 4 112 ? 106.591 133.617 149.770 1.00 21.45  ? 110 GLU D OE1   1 
ATOM 2964  O OE2   . GLU D 4 112 ? 108.078 135.162 150.198 1.00 21.45  ? 110 GLU D OE2   1 
ATOM 2965  N N     . GLY D 4 113 ? 108.109 137.881 145.635 1.00 19.01  ? 111 GLY D N     1 
ATOM 2966  C CA    . GLY D 4 113 ? 108.472 139.252 145.323 1.00 19.01  ? 111 GLY D CA    1 
ATOM 2967  C C     . GLY D 4 113 ? 107.285 140.191 145.269 1.00 19.01  ? 111 GLY D C     1 
ATOM 2968  O O     . GLY D 4 113 ? 107.371 141.337 145.718 1.00 19.01  ? 111 GLY D O     1 
ATOM 2969  N N     . THR D 4 114 ? 106.162 139.719 144.733 1.00 19.71  ? 112 THR D N     1 
ATOM 2970  C CA    . THR D 4 114 ? 104.952 140.527 144.684 1.00 19.71  ? 112 THR D CA    1 
ATOM 2971  C C     . THR D 4 114 ? 104.400 140.767 146.080 1.00 19.71  ? 112 THR D C     1 
ATOM 2972  O O     . THR D 4 114 ? 103.934 141.870 146.388 1.00 19.71  ? 112 THR D O     1 
ATOM 2973  C CB    . THR D 4 114 ? 103.922 139.834 143.800 1.00 19.71  ? 112 THR D CB    1 
ATOM 2974  O OG1   . THR D 4 114 ? 104.465 139.668 142.491 1.00 19.71  ? 112 THR D OG1   1 
ATOM 2975  C CG2   . THR D 4 114 ? 102.684 140.657 143.675 1.00 19.71  ? 112 THR D CG2   1 
ATOM 2976  N N     . LYS D 4 115 ? 104.500 139.764 146.953 1.00 20.85  ? 113 LYS D N     1 
ATOM 2977  C CA    . LYS D 4 115 ? 104.052 139.916 148.329 1.00 20.85  ? 113 LYS D CA    1 
ATOM 2978  C C     . LYS D 4 115 ? 104.915 140.914 149.081 1.00 20.85  ? 113 LYS D C     1 
ATOM 2979  O O     . LYS D 4 115 ? 104.402 141.739 149.841 1.00 20.85  ? 113 LYS D O     1 
ATOM 2980  C CB    . LYS D 4 115 ? 104.066 138.555 149.013 1.00 20.85  ? 113 LYS D CB    1 
ATOM 2981  C CG    . LYS D 4 115 ? 103.648 138.563 150.452 1.00 20.85  ? 113 LYS D CG    1 
ATOM 2982  C CD    . LYS D 4 115 ? 103.801 137.193 151.057 1.00 20.85  ? 113 LYS D CD    1 
ATOM 2983  C CE    . LYS D 4 115 ? 105.245 136.757 151.044 1.00 20.85  ? 113 LYS D CE    1 
ATOM 2984  N NZ    . LYS D 4 115 ? 105.438 135.428 151.681 1.00 20.85  ? 113 LYS D NZ    1 
ATOM 2985  N N     . ALA D 4 116 ? 106.227 140.882 148.850 1.00 20.93  ? 114 ALA D N     1 
ATOM 2986  C CA    . ALA D 4 116 ? 107.118 141.824 149.523 1.00 20.93  ? 114 ALA D CA    1 
ATOM 2987  C C     . ALA D 4 116 ? 106.924 143.247 149.022 1.00 20.93  ? 114 ALA D C     1 
ATOM 2988  O O     . ALA D 4 116 ? 106.994 144.193 149.808 1.00 20.93  ? 114 ALA D O     1 
ATOM 2989  C CB    . ALA D 4 116 ? 108.565 141.405 149.340 1.00 20.93  ? 114 ALA D CB    1 
ATOM 2990  N N     . VAL D 4 117 ? 106.663 143.423 147.728 1.00 22.07  ? 115 VAL D N     1 
ATOM 2991  C CA    . VAL D 4 117 ? 106.446 144.768 147.202 1.00 22.07  ? 115 VAL D CA    1 
ATOM 2992  C C     . VAL D 4 117 ? 105.113 145.329 147.687 1.00 22.07  ? 115 VAL D C     1 
ATOM 2993  O O     . VAL D 4 117 ? 105.023 146.500 148.082 1.00 22.07  ? 115 VAL D O     1 
ATOM 2994  C CB    . VAL D 4 117 ? 106.558 144.746 145.666 1.00 22.07  ? 115 VAL D CB    1 
ATOM 2995  C CG1   . VAL D 4 117 ? 105.936 145.966 145.042 1.00 22.07  ? 115 VAL D CG1   1 
ATOM 2996  C CG2   . VAL D 4 117 ? 107.995 144.670 145.267 1.00 22.07  ? 115 VAL D CG2   1 
ATOM 2997  N N     . THR D 4 118 ? 104.069 144.493 147.703 1.00 23.82  ? 116 THR D N     1 
ATOM 2998  C CA    . THR D 4 118 ? 102.766 144.883 148.235 1.00 23.82  ? 116 THR D CA    1 
ATOM 2999  C C     . THR D 4 118 ? 102.839 145.239 149.712 1.00 23.82  ? 116 THR D C     1 
ATOM 3000  O O     . THR D 4 118 ? 102.225 146.219 150.140 1.00 23.82  ? 116 THR D O     1 
ATOM 3001  C CB    . THR D 4 118 ? 101.774 143.746 148.003 1.00 23.82  ? 116 THR D CB    1 
ATOM 3002  O OG1   . THR D 4 118 ? 101.640 143.517 146.600 1.00 23.82  ? 116 THR D OG1   1 
ATOM 3003  C CG2   . THR D 4 118 ? 100.426 144.055 148.573 1.00 23.82  ? 116 THR D CG2   1 
ATOM 3004  N N     . LYS D 4 119 ? 103.609 144.486 150.493 1.00 26.19  ? 117 LYS D N     1 
ATOM 3005  C CA    . LYS D 4 119 ? 103.798 144.822 151.896 1.00 26.19  ? 117 LYS D CA    1 
ATOM 3006  C C     . LYS D 4 119 ? 104.603 146.101 152.070 1.00 26.19  ? 117 LYS D C     1 
ATOM 3007  O O     . LYS D 4 119 ? 104.303 146.899 152.959 1.00 26.19  ? 117 LYS D O     1 
ATOM 3008  C CB    . LYS D 4 119 ? 104.487 143.660 152.604 1.00 26.19  ? 117 LYS D CB    1 
ATOM 3009  C CG    . LYS D 4 119 ? 104.736 143.860 154.063 1.00 26.19  ? 117 LYS D CG    1 
ATOM 3010  C CD    . LYS D 4 119 ? 104.660 142.551 154.796 1.00 26.19  ? 117 LYS D CD    1 
ATOM 3011  C CE    . LYS D 4 119 ? 105.230 142.686 156.196 1.00 26.19  ? 117 LYS D CE    1 
ATOM 3012  N NZ    . LYS D 4 119 ? 104.928 144.017 156.793 1.00 26.19  ? 117 LYS D NZ    1 
ATOM 3013  N N     . TYR D 4 120 ? 105.605 146.322 151.222 1.00 26.73  ? 118 TYR D N     1 
ATOM 3014  C CA    . TYR D 4 120 ? 106.501 147.459 151.386 1.00 26.73  ? 118 TYR D CA    1 
ATOM 3015  C C     . TYR D 4 120 ? 105.812 148.772 151.055 1.00 26.73  ? 118 TYR D C     1 
ATOM 3016  O O     . TYR D 4 120 ? 106.030 149.776 151.739 1.00 26.73  ? 118 TYR D O     1 
ATOM 3017  C CB    . TYR D 4 120 ? 107.731 147.249 150.511 1.00 26.73  ? 118 TYR D CB    1 
ATOM 3018  C CG    . TYR D 4 120 ? 108.721 148.378 150.466 1.00 26.73  ? 118 TYR D CG    1 
ATOM 3019  C CD1   . TYR D 4 120 ? 109.705 148.499 151.428 1.00 26.73  ? 118 TYR D CD1   1 
ATOM 3020  C CD2   . TYR D 4 120 ? 108.709 149.288 149.422 1.00 26.73  ? 118 TYR D CD2   1 
ATOM 3021  C CE1   . TYR D 4 120 ? 110.620 149.513 151.375 1.00 26.73  ? 118 TYR D CE1   1 
ATOM 3022  C CE2   . TYR D 4 120 ? 109.612 150.305 149.366 1.00 26.73  ? 118 TYR D CE2   1 
ATOM 3023  C CZ    . TYR D 4 120 ? 110.566 150.412 150.341 1.00 26.73  ? 118 TYR D CZ    1 
ATOM 3024  O OH    . TYR D 4 120 ? 111.469 151.435 150.269 1.00 26.73  ? 118 TYR D OH    1 
ATOM 3025  N N     . THR D 4 121 ? 104.973 148.795 150.017 1.00 29.04  ? 119 THR D N     1 
ATOM 3026  C CA    . THR D 4 121 ? 104.287 150.050 149.714 1.00 29.04  ? 119 THR D CA    1 
ATOM 3027  C C     . THR D 4 121 ? 103.129 150.347 150.657 1.00 29.04  ? 119 THR D C     1 
ATOM 3028  O O     . THR D 4 121 ? 102.539 151.425 150.556 1.00 29.04  ? 119 THR D O     1 
ATOM 3029  C CB    . THR D 4 121 ? 103.773 150.080 148.281 1.00 29.04  ? 119 THR D CB    1 
ATOM 3030  O OG1   . THR D 4 121 ? 102.621 149.240 148.161 1.00 29.04  ? 119 THR D OG1   1 
ATOM 3031  C CG2   . THR D 4 121 ? 104.844 149.656 147.313 1.00 29.04  ? 119 THR D CG2   1 
ATOM 3032  N N     . SER D 4 122 ? 102.784 149.433 151.559 1.00 31.52  ? 120 SER D N     1 
ATOM 3033  C CA    . SER D 4 122 ? 101.852 149.709 152.639 1.00 31.52  ? 120 SER D CA    1 
ATOM 3034  C C     . SER D 4 122 ? 102.560 150.174 153.904 1.00 31.52  ? 120 SER D C     1 
ATOM 3035  O O     . SER D 4 122 ? 101.908 150.330 154.942 1.00 31.52  ? 120 SER D O     1 
ATOM 3036  C CB    . SER D 4 122 ? 101.011 148.470 152.934 1.00 31.52  ? 120 SER D CB    1 
ATOM 3037  O OG    . SER D 4 122 ? 100.342 148.028 151.770 1.00 31.52  ? 120 SER D OG    1 
ATOM 3038  N N     . SER D 4 123 ? 103.874 150.396 153.822 1.00 34.62  ? 121 SER D N     1 
ATOM 3039  C CA    . SER D 4 123 ? 104.752 150.838 154.913 1.00 34.62  ? 121 SER D CA    1 
ATOM 3040  C C     . SER D 4 123 ? 104.669 149.959 156.155 1.00 34.62  ? 121 SER D C     1 
ATOM 3041  O O     . SER D 4 123 ? 105.348 148.939 156.250 1.00 34.62  ? 121 SER D O     1 
ATOM 3042  C CB    . SER D 4 123 ? 104.461 152.295 155.284 1.00 34.62  ? 121 SER D CB    1 
ATOM 3043  O OG    . SER D 4 123 ? 104.513 153.135 154.146 1.00 34.62  ? 121 SER D OG    1 
ATOM 3044  N N     . PRO E 1 39  ? 143.377 80.612  147.806 1.00 62.48  ? 38  PRO E N     1 
ATOM 3045  C CA    . PRO E 1 39  ? 142.877 81.688  148.667 1.00 62.48  ? 38  PRO E CA    1 
ATOM 3046  C C     . PRO E 1 39  ? 141.583 82.293  148.157 1.00 62.48  ? 38  PRO E C     1 
ATOM 3047  O O     . PRO E 1 39  ? 141.001 81.796  147.194 1.00 62.48  ? 38  PRO E O     1 
ATOM 3048  C CB    . PRO E 1 39  ? 144.003 82.722  148.623 1.00 62.48  ? 38  PRO E CB    1 
ATOM 3049  C CG    . PRO E 1 39  ? 144.654 82.499  147.316 1.00 62.48  ? 38  PRO E CG    1 
ATOM 3050  C CD    . PRO E 1 39  ? 144.596 81.012  147.084 1.00 62.48  ? 38  PRO E CD    1 
ATOM 3051  N N     . HIS E 1 40  ? 141.137 83.363  148.806 1.00 59.10  ? 39  HIS E N     1 
ATOM 3052  C CA    . HIS E 1 40  ? 139.937 84.049  148.361 1.00 59.10  ? 39  HIS E CA    1 
ATOM 3053  C C     . HIS E 1 40  ? 140.260 84.951  147.182 1.00 59.10  ? 39  HIS E C     1 
ATOM 3054  O O     . HIS E 1 40  ? 141.349 85.522  147.094 1.00 59.10  ? 39  HIS E O     1 
ATOM 3055  C CB    . HIS E 1 40  ? 139.333 84.866  149.498 1.00 59.10  ? 39  HIS E CB    1 
ATOM 3056  C CG    . HIS E 1 40  ? 137.988 85.430  149.175 1.00 59.10  ? 39  HIS E CG    1 
ATOM 3057  N ND1   . HIS E 1 40  ? 137.812 86.716  148.717 1.00 59.10  ? 39  HIS E ND1   1 
ATOM 3058  C CD2   . HIS E 1 40  ? 136.755 84.876  149.224 1.00 59.10  ? 39  HIS E CD2   1 
ATOM 3059  C CE1   . HIS E 1 40  ? 136.528 86.932  148.503 1.00 59.10  ? 39  HIS E CE1   1 
ATOM 3060  N NE2   . HIS E 1 40  ? 135.864 85.832  148.805 1.00 59.10  ? 39  HIS E NE2   1 
ATOM 3061  N N     . ARG E 1 41  ? 139.298 85.090  146.279 1.00 50.15  ? 40  ARG E N     1 
ATOM 3062  C CA    . ARG E 1 41  ? 139.519 85.830  145.044 1.00 50.15  ? 40  ARG E CA    1 
ATOM 3063  C C     . ARG E 1 41  ? 138.177 86.355  144.575 1.00 50.15  ? 40  ARG E C     1 
ATOM 3064  O O     . ARG E 1 41  ? 137.278 85.561  144.295 1.00 50.15  ? 40  ARG E O     1 
ATOM 3065  C CB    . ARG E 1 41  ? 140.137 84.918  143.998 1.00 50.15  ? 40  ARG E CB    1 
ATOM 3066  C CG    . ARG E 1 41  ? 140.504 85.603  142.732 1.00 50.15  ? 40  ARG E CG    1 
ATOM 3067  C CD    . ARG E 1 41  ? 141.675 86.484  142.981 1.00 50.15  ? 40  ARG E CD    1 
ATOM 3068  N NE    . ARG E 1 41  ? 141.996 87.297  141.825 1.00 50.15  ? 40  ARG E NE    1 
ATOM 3069  C CZ    . ARG E 1 41  ? 142.867 86.953  140.897 1.00 50.15  ? 40  ARG E CZ    1 
ATOM 3070  N NH1   . ARG E 1 41  ? 143.525 85.813  140.998 1.00 50.15  ? 40  ARG E NH1   1 
ATOM 3071  N NH2   . ARG E 1 41  ? 143.086 87.758  139.875 1.00 50.15  ? 40  ARG E NH2   1 
ATOM 3072  N N     . TYR E 1 42  ? 138.029 87.671  144.496 1.00 50.41  ? 41  TYR E N     1 
ATOM 3073  C CA    . TYR E 1 42  ? 136.809 88.221  143.930 1.00 50.41  ? 41  TYR E CA    1 
ATOM 3074  C C     . TYR E 1 42  ? 136.867 88.164  142.412 1.00 50.41  ? 41  TYR E C     1 
ATOM 3075  O O     . TYR E 1 42  ? 137.935 88.229  141.802 1.00 50.41  ? 41  TYR E O     1 
ATOM 3076  C CB    . TYR E 1 42  ? 136.586 89.660  144.384 1.00 50.41  ? 41  TYR E CB    1 
ATOM 3077  C CG    . TYR E 1 42  ? 136.106 89.802  145.804 1.00 50.41  ? 41  TYR E CG    1 
ATOM 3078  C CD1   . TYR E 1 42  ? 134.829 89.411  146.165 1.00 50.41  ? 41  TYR E CD1   1 
ATOM 3079  C CD2   . TYR E 1 42  ? 136.923 90.345  146.779 1.00 50.41  ? 41  TYR E CD2   1 
ATOM 3080  C CE1   . TYR E 1 42  ? 134.388 89.541  147.455 1.00 50.41  ? 41  TYR E CE1   1 
ATOM 3081  C CE2   . TYR E 1 42  ? 136.490 90.476  148.069 1.00 50.41  ? 41  TYR E CE2   1 
ATOM 3082  C CZ    . TYR E 1 42  ? 135.223 90.074  148.400 1.00 50.41  ? 41  TYR E CZ    1 
ATOM 3083  O OH    . TYR E 1 42  ? 134.788 90.210  149.692 1.00 50.41  ? 41  TYR E OH    1 
ATOM 3084  N N     . ARG E 1 43  ? 135.714 88.033  141.809 1.00 49.35  ? 42  ARG E N     1 
ATOM 3085  C CA    . ARG E 1 43  ? 135.645 87.933  140.364 1.00 49.35  ? 42  ARG E CA    1 
ATOM 3086  C C     . ARG E 1 43  ? 135.832 89.310  139.738 1.00 49.35  ? 42  ARG E C     1 
ATOM 3087  O O     . ARG E 1 43  ? 135.557 90.322  140.382 1.00 49.35  ? 42  ARG E O     1 
ATOM 3088  C CB    . ARG E 1 43  ? 134.314 87.330  139.947 1.00 49.35  ? 42  ARG E CB    1 
ATOM 3089  C CG    . ARG E 1 43  ? 134.129 85.942  140.489 1.00 49.35  ? 42  ARG E CG    1 
ATOM 3090  C CD    . ARG E 1 43  ? 133.327 85.076  139.573 1.00 49.35  ? 42  ARG E CD    1 
ATOM 3091  N NE    . ARG E 1 43  ? 131.900 85.282  139.763 1.00 49.35  ? 42  ARG E NE    1 
ATOM 3092  C CZ    . ARG E 1 43  ? 131.004 85.222  138.786 1.00 49.35  ? 42  ARG E CZ    1 
ATOM 3093  N NH1   . ARG E 1 43  ? 131.391 84.954  137.549 1.00 49.35  ? 42  ARG E NH1   1 
ATOM 3094  N NH2   . ARG E 1 43  ? 129.724 85.427  139.050 1.00 49.35  ? 42  ARG E NH2   1 
ATOM 3095  N N     . PRO E 1 44  ? 136.349 89.375  138.506 1.00 39.93  ? 43  PRO E N     1 
ATOM 3096  C CA    . PRO E 1 44  ? 136.606 90.675  137.878 1.00 39.93  ? 43  PRO E CA    1 
ATOM 3097  C C     . PRO E 1 44  ? 135.325 91.447  137.603 1.00 39.93  ? 43  PRO E C     1 
ATOM 3098  O O     . PRO E 1 44  ? 134.442 90.987  136.878 1.00 39.93  ? 43  PRO E O     1 
ATOM 3099  C CB    . PRO E 1 44  ? 137.324 90.299  136.582 1.00 39.93  ? 43  PRO E CB    1 
ATOM 3100  C CG    . PRO E 1 44  ? 137.979 89.046  136.892 1.00 39.93  ? 43  PRO E CG    1 
ATOM 3101  C CD    . PRO E 1 44  ? 137.019 88.301  137.761 1.00 39.93  ? 43  PRO E CD    1 
ATOM 3102  N N     . GLY E 1 45  ? 135.237 92.627  138.198 1.00 35.23  ? 44  GLY E N     1 
ATOM 3103  C CA    . GLY E 1 45  ? 134.043 93.440  138.159 1.00 35.23  ? 44  GLY E CA    1 
ATOM 3104  C C     . GLY E 1 45  ? 133.416 93.690  139.506 1.00 35.23  ? 44  GLY E C     1 
ATOM 3105  O O     . GLY E 1 45  ? 132.569 94.581  139.617 1.00 35.23  ? 44  GLY E O     1 
ATOM 3106  N N     . THR E 1 46  ? 133.797 92.952  140.543 1.00 36.30  ? 45  THR E N     1 
ATOM 3107  C CA    . THR E 1 46  ? 133.204 93.098  141.864 1.00 36.30  ? 45  THR E CA    1 
ATOM 3108  C C     . THR E 1 46  ? 133.840 94.240  142.641 1.00 36.30  ? 45  THR E C     1 
ATOM 3109  O O     . THR E 1 46  ? 133.137 95.099  143.183 1.00 36.30  ? 45  THR E O     1 
ATOM 3110  C CB    . THR E 1 46  ? 133.345 91.788  142.631 1.00 36.30  ? 45  THR E CB    1 
ATOM 3111  O OG1   . THR E 1 46  ? 132.697 90.753  141.895 1.00 36.30  ? 45  THR E OG1   1 
ATOM 3112  C CG2   . THR E 1 46  ? 132.697 91.892  143.972 1.00 36.30  ? 45  THR E CG2   1 
ATOM 3113  N N     . VAL E 1 47  ? 135.170 94.269  142.686 1.00 30.95  ? 46  VAL E N     1 
ATOM 3114  C CA    . VAL E 1 47  ? 135.875 95.346  143.361 1.00 30.95  ? 46  VAL E CA    1 
ATOM 3115  C C     . VAL E 1 47  ? 135.726 96.647  142.591 1.00 30.95  ? 46  VAL E C     1 
ATOM 3116  O O     . VAL E 1 47  ? 135.749 97.727  143.182 1.00 30.95  ? 46  VAL E O     1 
ATOM 3117  C CB    . VAL E 1 47  ? 137.344 94.942  143.555 1.00 30.95  ? 46  VAL E CB    1 
ATOM 3118  C CG1   . VAL E 1 47  ? 138.048 95.869  144.504 1.00 30.95  ? 46  VAL E CG1   1 
ATOM 3119  C CG2   . VAL E 1 47  ? 137.410 93.538  144.065 1.00 30.95  ? 46  VAL E CG2   1 
ATOM 3120  N N     . ALA E 1 48  ? 135.508 96.571  141.278 1.00 27.71  ? 47  ALA E N     1 
ATOM 3121  C CA    . ALA E 1 48  ? 135.240 97.764  140.486 1.00 27.71  ? 47  ALA E CA    1 
ATOM 3122  C C     . ALA E 1 48  ? 133.917 98.406  140.874 1.00 27.71  ? 47  ALA E C     1 
ATOM 3123  O O     . ALA E 1 48  ? 133.844 99.621  141.060 1.00 27.71  ? 47  ALA E O     1 
ATOM 3124  C CB    . ALA E 1 48  ? 135.249 97.415  139.005 1.00 27.71  ? 47  ALA E CB    1 
ATOM 3125  N N     . LEU E 1 49  ? 132.864 97.605  141.032 1.00 24.70  ? 48  LEU E N     1 
ATOM 3126  C CA    . LEU E 1 49  ? 131.578 98.140  141.462 1.00 24.70  ? 48  LEU E CA    1 
ATOM 3127  C C     . LEU E 1 49  ? 131.612 98.605  142.907 1.00 24.70  ? 48  LEU E C     1 
ATOM 3128  O O     . LEU E 1 49  ? 130.954 99.594  143.256 1.00 24.70  ? 48  LEU E O     1 
ATOM 3129  C CB    . LEU E 1 49  ? 130.495 97.091  141.287 1.00 24.70  ? 48  LEU E CB    1 
ATOM 3130  C CG    . LEU E 1 49  ? 129.918 96.927  139.895 1.00 24.70  ? 48  LEU E CG    1 
ATOM 3131  C CD1   . LEU E 1 49  ? 129.405 95.539  139.777 1.00 24.70  ? 48  LEU E CD1   1 
ATOM 3132  C CD2   . LEU E 1 49  ? 128.807 97.913  139.682 1.00 24.70  ? 48  LEU E CD2   1 
ATOM 3133  N N     . ARG E 1 50  ? 132.380 97.916  143.749 1.00 32.54  ? 49  ARG E N     1 
ATOM 3134  C CA    . ARG E 1 50  ? 132.587 98.362  145.121 1.00 32.54  ? 49  ARG E CA    1 
ATOM 3135  C C     . ARG E 1 50  ? 133.286 99.712  145.169 1.00 32.54  ? 49  ARG E C     1 
ATOM 3136  O O     . ARG E 1 50  ? 132.930 100.576 145.975 1.00 32.54  ? 49  ARG E O     1 
ATOM 3137  C CB    . ARG E 1 50  ? 133.401 97.320  145.872 1.00 32.54  ? 49  ARG E CB    1 
ATOM 3138  C CG    . ARG E 1 50  ? 133.225 97.365  147.346 1.00 32.54  ? 49  ARG E CG    1 
ATOM 3139  C CD    . ARG E 1 50  ? 133.561 96.040  147.945 1.00 32.54  ? 49  ARG E CD    1 
ATOM 3140  N NE    . ARG E 1 50  ? 134.990 95.779  147.885 1.00 32.54  ? 49  ARG E NE    1 
ATOM 3141  C CZ    . ARG E 1 50  ? 135.507 94.578  147.684 1.00 32.54  ? 49  ARG E CZ    1 
ATOM 3142  N NH1   . ARG E 1 50  ? 134.709 93.539  147.519 1.00 32.54  ? 49  ARG E NH1   1 
ATOM 3143  N NH2   . ARG E 1 50  ? 136.819 94.423  147.639 1.00 32.54  ? 49  ARG E NH2   1 
ATOM 3144  N N     . GLU E 1 51  ? 134.262 99.923  144.290 1.00 25.12  ? 50  GLU E N     1 
ATOM 3145  C CA    . GLU E 1 51  ? 134.950 101.202 144.232 1.00 25.12  ? 50  GLU E CA    1 
ATOM 3146  C C     . GLU E 1 51  ? 134.076 102.288 143.633 1.00 25.12  ? 50  GLU E C     1 
ATOM 3147  O O     . GLU E 1 51  ? 134.230 103.456 143.989 1.00 25.12  ? 50  GLU E O     1 
ATOM 3148  C CB    . GLU E 1 51  ? 136.234 101.062 143.430 1.00 25.12  ? 50  GLU E CB    1 
ATOM 3149  C CG    . GLU E 1 51  ? 137.401 100.577 144.227 1.00 25.12  ? 50  GLU E CG    1 
ATOM 3150  C CD    . GLU E 1 51  ? 138.545 100.121 143.354 1.00 25.12  ? 50  GLU E CD    1 
ATOM 3151  O OE1   . GLU E 1 51  ? 138.353 99.965  142.137 1.00 25.12  ? 50  GLU E OE1   1 
ATOM 3152  O OE2   . GLU E 1 51  ? 139.650 99.914  143.886 1.00 25.12  ? 50  GLU E OE2   1 
ATOM 3153  N N     . ILE E 1 52  ? 133.172 101.931 142.724 1.00 18.61  ? 51  ILE E N     1 
ATOM 3154  C CA    . ILE E 1 52  ? 132.210 102.901 142.210 1.00 18.61  ? 51  ILE E CA    1 
ATOM 3155  C C     . ILE E 1 52  ? 131.320 103.399 143.336 1.00 18.61  ? 51  ILE E C     1 
ATOM 3156  O O     . ILE E 1 52  ? 131.118 104.608 143.497 1.00 18.61  ? 51  ILE E O     1 
ATOM 3157  C CB    . ILE E 1 52  ? 131.386 102.286 141.065 1.00 18.61  ? 51  ILE E CB    1 
ATOM 3158  C CG1   . ILE E 1 52  ? 132.225 102.151 139.809 1.00 18.61  ? 51  ILE E CG1   1 
ATOM 3159  C CG2   . ILE E 1 52  ? 130.188 103.123 140.746 1.00 18.61  ? 51  ILE E CG2   1 
ATOM 3160  C CD1   . ILE E 1 52  ? 131.662 101.201 138.838 1.00 18.61  ? 51  ILE E CD1   1 
ATOM 3161  N N     . ARG E 1 53  ? 130.832 102.483 144.174 1.00 23.63  ? 52  ARG E N     1 
ATOM 3162  C CA    . ARG E 1 53  ? 130.022 102.894 145.316 1.00 23.63  ? 52  ARG E CA    1 
ATOM 3163  C C     . ARG E 1 53  ? 130.834 103.629 146.374 1.00 23.63  ? 52  ARG E C     1 
ATOM 3164  O O     . ARG E 1 53  ? 130.286 104.463 147.093 1.00 23.63  ? 52  ARG E O     1 
ATOM 3165  C CB    . ARG E 1 53  ? 129.335 101.683 145.925 1.00 23.63  ? 52  ARG E CB    1 
ATOM 3166  C CG    . ARG E 1 53  ? 128.474 100.971 144.941 1.00 23.63  ? 52  ARG E CG    1 
ATOM 3167  C CD    . ARG E 1 53  ? 127.547 99.995  145.593 1.00 23.63  ? 52  ARG E CD    1 
ATOM 3168  N NE    . ARG E 1 53  ? 127.053 99.040  144.610 1.00 23.63  ? 52  ARG E NE    1 
ATOM 3169  C CZ    . ARG E 1 53  ? 127.545 97.817  144.462 1.00 23.63  ? 52  ARG E CZ    1 
ATOM 3170  N NH1   . ARG E 1 53  ? 128.531 97.405  145.243 1.00 23.63  ? 52  ARG E NH1   1 
ATOM 3171  N NH2   . ARG E 1 53  ? 127.049 97.008  143.542 1.00 23.63  ? 52  ARG E NH2   1 
ATOM 3172  N N     . ARG E 1 54  ? 132.129 103.345 146.486 1.00 23.56  ? 53  ARG E N     1 
ATOM 3173  C CA    . ARG E 1 54  ? 132.966 104.031 147.464 1.00 23.56  ? 53  ARG E CA    1 
ATOM 3174  C C     . ARG E 1 54  ? 133.285 105.457 147.046 1.00 23.56  ? 53  ARG E C     1 
ATOM 3175  O O     . ARG E 1 54  ? 133.224 106.374 147.866 1.00 23.56  ? 53  ARG E O     1 
ATOM 3176  C CB    . ARG E 1 54  ? 134.257 103.258 147.678 1.00 23.56  ? 53  ARG E CB    1 
ATOM 3177  C CG    . ARG E 1 54  ? 135.118 103.820 148.772 1.00 23.56  ? 53  ARG E CG    1 
ATOM 3178  C CD    . ARG E 1 54  ? 136.163 102.829 149.172 1.00 23.56  ? 53  ARG E CD    1 
ATOM 3179  N NE    . ARG E 1 54  ? 137.377 102.927 148.377 1.00 23.56  ? 53  ARG E NE    1 
ATOM 3180  C CZ    . ARG E 1 54  ? 138.188 101.901 148.149 1.00 23.56  ? 53  ARG E CZ    1 
ATOM 3181  N NH1   . ARG E 1 54  ? 137.882 100.703 148.625 1.00 23.56  ? 53  ARG E NH1   1 
ATOM 3182  N NH2   . ARG E 1 54  ? 139.287 102.061 147.425 1.00 23.56  ? 53  ARG E NH2   1 
ATOM 3183  N N     . TYR E 1 55  ? 133.645 105.667 145.785 1.00 18.27  ? 54  TYR E N     1 
ATOM 3184  C CA    . TYR E 1 55  ? 134.022 106.999 145.337 1.00 18.27  ? 54  TYR E CA    1 
ATOM 3185  C C     . TYR E 1 55  ? 132.839 107.832 144.884 1.00 18.27  ? 54  TYR E C     1 
ATOM 3186  O O     . TYR E 1 55  ? 132.997 109.036 144.696 1.00 18.27  ? 54  TYR E O     1 
ATOM 3187  C CB    . TYR E 1 55  ? 135.055 106.907 144.221 1.00 18.27  ? 54  TYR E CB    1 
ATOM 3188  C CG    . TYR E 1 55  ? 136.337 106.311 144.706 1.00 18.27  ? 54  TYR E CG    1 
ATOM 3189  C CD1   . TYR E 1 55  ? 137.018 106.875 145.760 1.00 18.27  ? 54  TYR E CD1   1 
ATOM 3190  C CD2   . TYR E 1 55  ? 136.849 105.166 144.141 1.00 18.27  ? 54  TYR E CD2   1 
ATOM 3191  C CE1   . TYR E 1 55  ? 138.171 106.324 146.223 1.00 18.27  ? 54  TYR E CE1   1 
ATOM 3192  C CE2   . TYR E 1 55  ? 137.995 104.607 144.597 1.00 18.27  ? 54  TYR E CE2   1 
ATOM 3193  C CZ    . TYR E 1 55  ? 138.655 105.189 145.635 1.00 18.27  ? 54  TYR E CZ    1 
ATOM 3194  O OH    . TYR E 1 55  ? 139.821 104.629 146.089 1.00 18.27  ? 54  TYR E OH    1 
ATOM 3195  N N     . GLN E 1 56  ? 131.666 107.240 144.714 1.00 20.91  ? 55  GLN E N     1 
ATOM 3196  C CA    . GLN E 1 56  ? 130.466 108.021 144.488 1.00 20.91  ? 55  GLN E CA    1 
ATOM 3197  C C     . GLN E 1 56  ? 129.761 108.402 145.776 1.00 20.91  ? 55  GLN E C     1 
ATOM 3198  O O     . GLN E 1 56  ? 128.736 109.086 145.724 1.00 20.91  ? 55  GLN E O     1 
ATOM 3199  C CB    . GLN E 1 56  ? 129.500 107.255 143.599 1.00 20.91  ? 55  GLN E CB    1 
ATOM 3200  C CG    . GLN E 1 56  ? 129.766 107.393 142.140 1.00 20.91  ? 55  GLN E CG    1 
ATOM 3201  C CD    . GLN E 1 56  ? 128.809 106.590 141.341 1.00 20.91  ? 55  GLN E CD    1 
ATOM 3202  O OE1   . GLN E 1 56  ? 128.195 105.672 141.855 1.00 20.91  ? 55  GLN E OE1   1 
ATOM 3203  N NE2   . GLN E 1 56  ? 128.661 106.926 140.080 1.00 20.91  ? 55  GLN E NE2   1 
ATOM 3204  N N     . LYS E 1 57  ? 130.270 107.960 146.920 1.00 22.45  ? 56  LYS E N     1 
ATOM 3205  C CA    . LYS E 1 57  ? 129.736 108.321 148.222 1.00 22.45  ? 56  LYS E CA    1 
ATOM 3206  C C     . LYS E 1 57  ? 130.579 109.369 148.921 1.00 22.45  ? 56  LYS E C     1 
ATOM 3207  O O     . LYS E 1 57  ? 130.069 110.093 149.778 1.00 22.45  ? 56  LYS E O     1 
ATOM 3208  C CB    . LYS E 1 57  ? 129.640 107.079 149.105 1.00 22.45  ? 56  LYS E CB    1 
ATOM 3209  C CG    . LYS E 1 57  ? 128.631 107.165 150.222 1.00 22.45  ? 56  LYS E CG    1 
ATOM 3210  C CD    . LYS E 1 57  ? 128.463 105.826 150.910 1.00 22.45  ? 56  LYS E CD    1 
ATOM 3211  C CE    . LYS E 1 57  ? 127.914 104.796 149.944 1.00 22.45  ? 56  LYS E CE    1 
ATOM 3212  N NZ    . LYS E 1 57  ? 127.840 103.434 150.531 1.00 22.45  ? 56  LYS E NZ    1 
ATOM 3213  N N     . SER E 1 58  ? 131.849 109.466 148.569 1.00 21.88  ? 57  SER E N     1 
ATOM 3214  C CA    . SER E 1 58  ? 132.771 110.408 149.171 1.00 21.88  ? 57  SER E CA    1 
ATOM 3215  C C     . SER E 1 58  ? 132.771 111.708 148.391 1.00 21.88  ? 57  SER E C     1 
ATOM 3216  O O     . SER E 1 58  ? 132.200 111.818 147.307 1.00 21.88  ? 57  SER E O     1 
ATOM 3217  C CB    . SER E 1 58  ? 134.179 109.821 149.221 1.00 21.88  ? 57  SER E CB    1 
ATOM 3218  O OG    . SER E 1 58  ? 134.781 109.845 147.945 1.00 21.88  ? 57  SER E OG    1 
ATOM 3219  N N     . THR E 1 59  ? 133.406 112.715 148.979 1.00 22.18  ? 58  THR E N     1 
ATOM 3220  C CA    . THR E 1 59  ? 133.543 114.026 148.373 1.00 22.18  ? 58  THR E CA    1 
ATOM 3221  C C     . THR E 1 59  ? 134.982 114.488 148.273 1.00 22.18  ? 58  THR E C     1 
ATOM 3222  O O     . THR E 1 59  ? 135.214 115.679 148.062 1.00 22.18  ? 58  THR E O     1 
ATOM 3223  C CB    . THR E 1 59  ? 132.753 115.076 149.165 1.00 22.18  ? 58  THR E CB    1 
ATOM 3224  O OG1   . THR E 1 59  ? 133.226 115.111 150.515 1.00 22.18  ? 58  THR E OG1   1 
ATOM 3225  C CG2   . THR E 1 59  ? 131.284 114.757 149.166 1.00 22.18  ? 58  THR E CG2   1 
ATOM 3226  N N     . GLU E 1 60  ? 135.946 113.589 148.419 1.00 24.57  ? 59  GLU E N     1 
ATOM 3227  C CA    . GLU E 1 60  ? 137.341 113.964 148.508 1.00 24.57  ? 59  GLU E CA    1 
ATOM 3228  C C     . GLU E 1 60  ? 137.894 114.346 147.141 1.00 24.57  ? 59  GLU E C     1 
ATOM 3229  O O     . GLU E 1 60  ? 137.280 114.127 146.101 1.00 24.57  ? 59  GLU E O     1 
ATOM 3230  C CB    . GLU E 1 60  ? 138.156 112.813 149.082 1.00 24.57  ? 59  GLU E CB    1 
ATOM 3231  C CG    . GLU E 1 60  ? 137.819 112.410 150.509 1.00 24.57  ? 59  GLU E CG    1 
ATOM 3232  C CD    . GLU E 1 60  ? 137.630 113.567 151.485 1.00 24.57  ? 59  GLU E CD    1 
ATOM 3233  O OE1   . GLU E 1 60  ? 136.721 113.463 152.338 1.00 24.57  ? 59  GLU E OE1   1 
ATOM 3234  O OE2   . GLU E 1 60  ? 138.421 114.538 151.471 1.00 24.57  ? 59  GLU E OE2   1 
ATOM 3235  N N     . LEU E 1 61  ? 139.079 114.939 147.158 1.00 23.55  ? 60  LEU E N     1 
ATOM 3236  C CA    . LEU E 1 61  ? 139.828 115.141 145.933 1.00 23.55  ? 60  LEU E CA    1 
ATOM 3237  C C     . LEU E 1 61  ? 140.620 113.876 145.641 1.00 23.55  ? 60  LEU E C     1 
ATOM 3238  O O     . LEU E 1 61  ? 141.344 113.375 146.503 1.00 23.55  ? 60  LEU E O     1 
ATOM 3239  C CB    . LEU E 1 61  ? 140.745 116.355 146.055 1.00 23.55  ? 60  LEU E CB    1 
ATOM 3240  C CG    . LEU E 1 61  ? 140.049 117.719 146.005 1.00 23.55  ? 60  LEU E CG    1 
ATOM 3241  C CD1   . LEU E 1 61  ? 141.037 118.848 146.141 1.00 23.55  ? 60  LEU E CD1   1 
ATOM 3242  C CD2   . LEU E 1 61  ? 139.257 117.887 144.736 1.00 23.55  ? 60  LEU E CD2   1 
ATOM 3243  N N     . LEU E 1 62  ? 140.460 113.347 144.431 1.00 20.50  ? 61  LEU E N     1 
ATOM 3244  C CA    . LEU E 1 62  ? 140.990 112.040 144.077 1.00 20.50  ? 61  LEU E CA    1 
ATOM 3245  C C     . LEU E 1 62  ? 142.372 112.093 143.456 1.00 20.50  ? 61  LEU E C     1 
ATOM 3246  O O     . LEU E 1 62  ? 143.001 111.048 143.284 1.00 20.50  ? 61  LEU E O     1 
ATOM 3247  C CB    . LEU E 1 62  ? 140.031 111.340 143.119 1.00 20.50  ? 61  LEU E CB    1 
ATOM 3248  C CG    . LEU E 1 62  ? 138.619 111.188 143.669 1.00 20.50  ? 61  LEU E CG    1 
ATOM 3249  C CD1   . LEU E 1 62  ? 137.661 110.885 142.565 1.00 20.50  ? 61  LEU E CD1   1 
ATOM 3250  C CD2   . LEU E 1 62  ? 138.572 110.110 144.709 1.00 20.50  ? 61  LEU E CD2   1 
ATOM 3251  N N     . ILE E 1 63  ? 142.846 113.255 143.116 1.00 22.81  ? 62  ILE E N     1 
ATOM 3252  C CA    . ILE E 1 63  ? 144.224 113.456 142.696 1.00 22.81  ? 62  ILE E CA    1 
ATOM 3253  C C     . ILE E 1 63  ? 145.011 113.895 143.917 1.00 22.81  ? 62  ILE E C     1 
ATOM 3254  O O     . ILE E 1 63  ? 144.474 114.549 144.812 1.00 22.81  ? 62  ILE E O     1 
ATOM 3255  C CB    . ILE E 1 63  ? 144.300 114.486 141.549 1.00 22.81  ? 62  ILE E CB    1 
ATOM 3256  C CG1   . ILE E 1 63  ? 143.264 114.162 140.481 1.00 22.81  ? 62  ILE E CG1   1 
ATOM 3257  C CG2   . ILE E 1 63  ? 145.663 114.505 140.902 1.00 22.81  ? 62  ILE E CG2   1 
ATOM 3258  C CD1   . ILE E 1 63  ? 143.225 115.159 139.361 1.00 22.81  ? 62  ILE E CD1   1 
ATOM 3259  N N     . ARG E 1 64  ? 146.275 113.498 143.985 1.00 28.84  ? 63  ARG E N     1 
ATOM 3260  C CA    . ARG E 1 64  ? 147.162 113.963 145.033 1.00 28.84  ? 63  ARG E CA    1 
ATOM 3261  C C     . ARG E 1 64  ? 147.416 115.461 144.883 1.00 28.84  ? 63  ARG E C     1 
ATOM 3262  O O     . ARG E 1 64  ? 147.361 116.015 143.789 1.00 28.84  ? 63  ARG E O     1 
ATOM 3263  C CB    . ARG E 1 64  ? 148.482 113.205 144.976 1.00 28.84  ? 63  ARG E CB    1 
ATOM 3264  C CG    . ARG E 1 64  ? 148.412 111.700 145.069 1.00 28.84  ? 63  ARG E CG    1 
ATOM 3265  C CD    . ARG E 1 64  ? 148.034 111.252 146.442 1.00 28.84  ? 63  ARG E CD    1 
ATOM 3266  N NE    . ARG E 1 64  ? 146.623 110.921 146.488 1.00 28.84  ? 63  ARG E NE    1 
ATOM 3267  C CZ    . ARG E 1 64  ? 145.907 110.845 147.597 1.00 28.84  ? 63  ARG E CZ    1 
ATOM 3268  N NH1   . ARG E 1 64  ? 146.475 111.094 148.769 1.00 28.84  ? 63  ARG E NH1   1 
ATOM 3269  N NH2   . ARG E 1 64  ? 144.623 110.531 147.527 1.00 28.84  ? 63  ARG E NH2   1 
ATOM 3270  N N     . LYS E 1 65  ? 147.708 116.118 146.003 1.00 28.05  ? 64  LYS E N     1 
ATOM 3271  C CA    . LYS E 1 65  ? 147.793 117.574 146.004 1.00 28.05  ? 64  LYS E CA    1 
ATOM 3272  C C     . LYS E 1 65  ? 149.089 118.076 145.379 1.00 28.05  ? 64  LYS E C     1 
ATOM 3273  O O     . LYS E 1 65  ? 149.075 119.008 144.570 1.00 28.05  ? 64  LYS E O     1 
ATOM 3274  C CB    . LYS E 1 65  ? 147.659 118.109 147.427 1.00 28.05  ? 64  LYS E CB    1 
ATOM 3275  C CG    . LYS E 1 65  ? 146.418 117.658 148.143 1.00 28.05  ? 64  LYS E CG    1 
ATOM 3276  C CD    . LYS E 1 65  ? 145.204 118.379 147.651 1.00 28.05  ? 64  LYS E CD    1 
ATOM 3277  C CE    . LYS E 1 65  ? 143.956 117.844 148.318 1.00 28.05  ? 64  LYS E CE    1 
ATOM 3278  N NZ    . LYS E 1 65  ? 143.700 116.431 147.936 1.00 28.05  ? 64  LYS E NZ    1 
ATOM 3279  N N     . LEU E 1 66  ? 150.220 117.489 145.757 1.00 28.13  ? 65  LEU E N     1 
ATOM 3280  C CA    . LEU E 1 66  ? 151.502 117.975 145.256 1.00 28.13  ? 65  LEU E CA    1 
ATOM 3281  C C     . LEU E 1 66  ? 151.763 117.708 143.773 1.00 28.13  ? 65  LEU E C     1 
ATOM 3282  O O     . LEU E 1 66  ? 152.309 118.614 143.120 1.00 28.13  ? 65  LEU E O     1 
ATOM 3283  C CB    . LEU E 1 66  ? 152.644 117.422 146.116 1.00 28.13  ? 65  LEU E CB    1 
ATOM 3284  C CG    . LEU E 1 66  ? 152.792 117.991 147.516 1.00 28.13  ? 65  LEU E CG    1 
ATOM 3285  C CD1   . LEU E 1 66  ? 154.034 117.423 148.158 1.00 28.13  ? 65  LEU E CD1   1 
ATOM 3286  C CD2   . LEU E 1 66  ? 152.857 119.498 147.460 1.00 28.13  ? 65  LEU E CD2   1 
ATOM 3287  N N     . PRO E 1 67  ? 151.441 116.537 143.181 1.00 26.25  ? 66  PRO E N     1 
ATOM 3288  C CA    . PRO E 1 67  ? 151.550 116.431 141.717 1.00 26.25  ? 66  PRO E CA    1 
ATOM 3289  C C     . PRO E 1 67  ? 150.668 117.393 140.948 1.00 26.25  ? 66  PRO E C     1 
ATOM 3290  O O     . PRO E 1 67  ? 151.103 117.925 139.919 1.00 26.25  ? 66  PRO E O     1 
ATOM 3291  C CB    . PRO E 1 67  ? 151.139 114.983 141.455 1.00 26.25  ? 66  PRO E CB    1 
ATOM 3292  C CG    . PRO E 1 67  ? 151.513 114.296 142.619 1.00 26.25  ? 66  PRO E CG    1 
ATOM 3293  C CD    . PRO E 1 67  ? 151.233 115.191 143.744 1.00 26.25  ? 66  PRO E CD    1 
ATOM 3294  N N     . PHE E 1 68  ? 149.453 117.656 141.429 1.00 20.74  ? 67  PHE E N     1 
ATOM 3295  C CA    . PHE E 1 68  ? 148.596 118.614 140.752 1.00 20.74  ? 67  PHE E CA    1 
ATOM 3296  C C     . PHE E 1 68  ? 149.120 120.032 140.875 1.00 20.74  ? 67  PHE E C     1 
ATOM 3297  O O     . PHE E 1 68  ? 149.046 120.798 139.911 1.00 20.74  ? 67  PHE E O     1 
ATOM 3298  C CB    . PHE E 1 68  ? 147.175 118.549 141.294 1.00 20.74  ? 67  PHE E CB    1 
ATOM 3299  C CG    . PHE E 1 68  ? 146.192 119.272 140.441 1.00 20.74  ? 67  PHE E CG    1 
ATOM 3300  C CD1   . PHE E 1 68  ? 145.658 118.660 139.335 1.00 20.74  ? 67  PHE E CD1   1 
ATOM 3301  C CD2   . PHE E 1 68  ? 145.832 120.571 140.720 1.00 20.74  ? 67  PHE E CD2   1 
ATOM 3302  C CE1   . PHE E 1 68  ? 144.776 119.315 138.543 1.00 20.74  ? 67  PHE E CE1   1 
ATOM 3303  C CE2   . PHE E 1 68  ? 144.965 121.228 139.924 1.00 20.74  ? 67  PHE E CE2   1 
ATOM 3304  C CZ    . PHE E 1 68  ? 144.430 120.600 138.837 1.00 20.74  ? 67  PHE E CZ    1 
ATOM 3305  N N     . GLN E 1 69  ? 149.642 120.405 142.039 1.00 25.18  ? 68  GLN E N     1 
ATOM 3306  C CA    . GLN E 1 69  ? 150.203 121.739 142.200 1.00 25.18  ? 68  GLN E CA    1 
ATOM 3307  C C     . GLN E 1 69  ? 151.442 121.930 141.338 1.00 25.18  ? 68  GLN E C     1 
ATOM 3308  O O     . GLN E 1 69  ? 151.623 122.993 140.737 1.00 25.18  ? 68  GLN E O     1 
ATOM 3309  C CB    . GLN E 1 69  ? 150.517 121.976 143.666 1.00 25.18  ? 68  GLN E CB    1 
ATOM 3310  C CG    . GLN E 1 69  ? 151.315 123.196 143.947 1.00 25.18  ? 68  GLN E CG    1 
ATOM 3311  C CD    . GLN E 1 69  ? 151.494 123.392 145.406 1.00 25.18  ? 68  GLN E CD    1 
ATOM 3312  O OE1   . GLN E 1 69  ? 150.821 122.755 146.205 1.00 25.18  ? 68  GLN E OE1   1 
ATOM 3313  N NE2   . GLN E 1 69  ? 152.403 124.272 145.779 1.00 25.18  ? 68  GLN E NE2   1 
ATOM 3314  N N     . ARG E 1 70  ? 152.281 120.898 141.226 1.00 26.77  ? 69  ARG E N     1 
ATOM 3315  C CA    . ARG E 1 70  ? 153.423 120.964 140.323 1.00 26.77  ? 69  ARG E CA    1 
ATOM 3316  C C     . ARG E 1 70  ? 153.002 121.073 138.868 1.00 26.77  ? 69  ARG E C     1 
ATOM 3317  O O     . ARG E 1 70  ? 153.630 121.805 138.101 1.00 26.77  ? 69  ARG E O     1 
ATOM 3318  C CB    . ARG E 1 70  ? 154.304 119.742 140.510 1.00 26.77  ? 69  ARG E CB    1 
ATOM 3319  C CG    . ARG E 1 70  ? 155.286 119.887 141.621 1.00 26.77  ? 69  ARG E CG    1 
ATOM 3320  C CD    . ARG E 1 70  ? 156.409 118.915 141.455 1.00 26.77  ? 69  ARG E CD    1 
ATOM 3321  N NE    . ARG E 1 70  ? 155.927 117.548 141.418 1.00 26.77  ? 69  ARG E NE    1 
ATOM 3322  C CZ    . ARG E 1 70  ? 155.740 116.806 142.496 1.00 26.77  ? 69  ARG E CZ    1 
ATOM 3323  N NH1   . ARG E 1 70  ? 155.990 117.302 143.694 1.00 26.77  ? 69  ARG E NH1   1 
ATOM 3324  N NH2   . ARG E 1 70  ? 155.291 115.571 142.370 1.00 26.77  ? 69  ARG E NH2   1 
ATOM 3325  N N     . LEU E 1 71  ? 151.940 120.372 138.476 1.00 24.14  ? 70  LEU E N     1 
ATOM 3326  C CA    . LEU E 1 71  ? 151.446 120.464 137.108 1.00 24.14  ? 70  LEU E CA    1 
ATOM 3327  C C     . LEU E 1 71  ? 150.882 121.848 136.812 1.00 24.14  ? 70  LEU E C     1 
ATOM 3328  O O     . LEU E 1 71  ? 151.057 122.379 135.711 1.00 24.14  ? 70  LEU E O     1 
ATOM 3329  C CB    . LEU E 1 71  ? 150.392 119.388 136.885 1.00 24.14  ? 70  LEU E CB    1 
ATOM 3330  C CG    . LEU E 1 71  ? 149.564 119.458 135.621 1.00 24.14  ? 70  LEU E CG    1 
ATOM 3331  C CD1   . LEU E 1 71  ? 150.442 119.180 134.444 1.00 24.14  ? 70  LEU E CD1   1 
ATOM 3332  C CD2   . LEU E 1 71  ? 148.457 118.472 135.703 1.00 24.14  ? 70  LEU E CD2   1 
ATOM 3333  N N     . VAL E 1 72  ? 150.215 122.453 137.795 1.00 23.74  ? 71  VAL E N     1 
ATOM 3334  C CA    . VAL E 1 72  ? 149.675 123.800 137.633 1.00 23.74  ? 71  VAL E CA    1 
ATOM 3335  C C     . VAL E 1 72  ? 150.796 124.818 137.479 1.00 23.74  ? 71  VAL E C     1 
ATOM 3336  O O     . VAL E 1 72  ? 150.753 125.678 136.592 1.00 23.74  ? 71  VAL E O     1 
ATOM 3337  C CB    . VAL E 1 72  ? 148.746 124.134 138.812 1.00 23.74  ? 71  VAL E CB    1 
ATOM 3338  C CG1   . VAL E 1 72  ? 148.476 125.597 138.895 1.00 23.74  ? 71  VAL E CG1   1 
ATOM 3339  C CG2   . VAL E 1 72  ? 147.448 123.444 138.617 1.00 23.74  ? 71  VAL E CG2   1 
ATOM 3340  N N     . ARG E 1 73  ? 151.832 124.713 138.306 1.00 26.60  ? 72  ARG E N     1 
ATOM 3341  C CA    . ARG E 1 73  ? 152.964 125.620 138.193 1.00 26.60  ? 72  ARG E CA    1 
ATOM 3342  C C     . ARG E 1 73  ? 153.779 125.398 136.930 1.00 26.60  ? 72  ARG E C     1 
ATOM 3343  O O     . ARG E 1 73  ? 154.399 126.341 136.440 1.00 26.60  ? 72  ARG E O     1 
ATOM 3344  C CB    . ARG E 1 73  ? 153.855 125.472 139.410 1.00 26.60  ? 72  ARG E CB    1 
ATOM 3345  C CG    . ARG E 1 73  ? 153.156 125.849 140.658 1.00 26.60  ? 72  ARG E CG    1 
ATOM 3346  C CD    . ARG E 1 73  ? 154.037 125.706 141.842 1.00 26.60  ? 72  ARG E CD    1 
ATOM 3347  N NE    . ARG E 1 73  ? 153.291 126.027 143.043 1.00 26.60  ? 72  ARG E NE    1 
ATOM 3348  C CZ    . ARG E 1 73  ? 153.149 127.252 143.523 1.00 26.60  ? 72  ARG E CZ    1 
ATOM 3349  N NH1   . ARG E 1 73  ? 153.716 128.278 142.910 1.00 26.60  ? 72  ARG E NH1   1 
ATOM 3350  N NH2   . ARG E 1 73  ? 152.445 127.447 144.622 1.00 26.60  ? 72  ARG E NH2   1 
ATOM 3351  N N     . GLU E 1 74  ? 153.793 124.187 136.394 1.00 31.02  ? 73  GLU E N     1 
ATOM 3352  C CA    . GLU E 1 74  ? 154.445 123.914 135.125 1.00 31.02  ? 73  GLU E CA    1 
ATOM 3353  C C     . GLU E 1 74  ? 153.668 124.433 133.925 1.00 31.02  ? 73  GLU E C     1 
ATOM 3354  O O     . GLU E 1 74  ? 154.281 124.904 132.965 1.00 31.02  ? 73  GLU E O     1 
ATOM 3355  C CB    . GLU E 1 74  ? 154.649 122.413 134.983 1.00 31.02  ? 73  GLU E CB    1 
ATOM 3356  C CG    . GLU E 1 74  ? 155.431 121.980 133.787 1.00 31.02  ? 73  GLU E CG    1 
ATOM 3357  C CD    . GLU E 1 74  ? 155.019 120.613 133.309 1.00 31.02  ? 73  GLU E CD    1 
ATOM 3358  O OE1   . GLU E 1 74  ? 153.935 120.484 132.705 1.00 31.02  ? 73  GLU E OE1   1 
ATOM 3359  O OE2   . GLU E 1 74  ? 155.774 119.658 133.554 1.00 31.02  ? 73  GLU E OE2   1 
ATOM 3360  N N     . ILE E 1 75  ? 152.340 124.350 133.950 1.00 24.99  ? 74  ILE E N     1 
ATOM 3361  C CA    . ILE E 1 75  ? 151.540 124.917 132.871 1.00 24.99  ? 74  ILE E CA    1 
ATOM 3362  C C     . ILE E 1 75  ? 151.595 126.437 132.913 1.00 24.99  ? 74  ILE E C     1 
ATOM 3363  O O     . ILE E 1 75  ? 151.689 127.098 131.874 1.00 24.99  ? 74  ILE E O     1 
ATOM 3364  C CB    . ILE E 1 75  ? 150.098 124.383 132.953 1.00 24.99  ? 74  ILE E CB    1 
ATOM 3365  C CG1   . ILE E 1 75  ? 150.077 122.910 132.581 1.00 24.99  ? 74  ILE E CG1   1 
ATOM 3366  C CG2   . ILE E 1 75  ? 149.168 125.125 132.035 1.00 24.99  ? 74  ILE E CG2   1 
ATOM 3367  C CD1   . ILE E 1 75  ? 148.752 122.278 132.709 1.00 24.99  ? 74  ILE E CD1   1 
ATOM 3368  N N     . ALA E 1 76  ? 151.608 127.015 134.109 1.00 27.67  ? 75  ALA E N     1 
ATOM 3369  C CA    . ALA E 1 76  ? 151.644 128.462 134.252 1.00 27.67  ? 75  ALA E CA    1 
ATOM 3370  C C     . ALA E 1 76  ? 152.985 129.080 133.900 1.00 27.67  ? 75  ALA E C     1 
ATOM 3371  O O     . ALA E 1 76  ? 153.060 130.303 133.792 1.00 27.67  ? 75  ALA E O     1 
ATOM 3372  C CB    . ALA E 1 76  ? 151.278 128.857 135.674 1.00 27.67  ? 75  ALA E CB    1 
ATOM 3373  N N     . GLN E 1 77  ? 154.040 128.282 133.733 1.00 32.64  ? 76  GLN E N     1 
ATOM 3374  C CA    . GLN E 1 77  ? 155.334 128.801 133.313 1.00 32.64  ? 76  GLN E CA    1 
ATOM 3375  C C     . GLN E 1 77  ? 155.319 129.313 131.888 1.00 32.64  ? 76  GLN E C     1 
ATOM 3376  O O     . GLN E 1 77  ? 156.114 130.190 131.549 1.00 32.64  ? 76  GLN E O     1 
ATOM 3377  C CB    . GLN E 1 77  ? 156.394 127.720 133.404 1.00 32.64  ? 76  GLN E CB    1 
ATOM 3378  C CG    . GLN E 1 77  ? 156.988 127.517 134.753 1.00 32.64  ? 76  GLN E CG    1 
ATOM 3379  C CD    . GLN E 1 77  ? 157.983 126.385 134.749 1.00 32.64  ? 76  GLN E CD    1 
ATOM 3380  O OE1   . GLN E 1 77  ? 158.086 125.636 133.777 1.00 32.64  ? 76  GLN E OE1   1 
ATOM 3381  N NE2   . GLN E 1 77  ? 158.714 126.243 135.842 1.00 32.64  ? 76  GLN E NE2   1 
ATOM 3382  N N     . ASP E 1 78  ? 154.448 128.777 131.044 1.00 31.93  ? 77  ASP E N     1 
ATOM 3383  C CA    . ASP E 1 78  ? 154.408 129.169 129.648 1.00 31.93  ? 77  ASP E CA    1 
ATOM 3384  C C     . ASP E 1 78  ? 153.742 130.512 129.431 1.00 31.93  ? 77  ASP E C     1 
ATOM 3385  O O     . ASP E 1 78  ? 153.796 131.037 128.319 1.00 31.93  ? 77  ASP E O     1 
ATOM 3386  C CB    . ASP E 1 78  ? 153.665 128.118 128.839 1.00 31.93  ? 77  ASP E CB    1 
ATOM 3387  C CG    . ASP E 1 78  ? 154.333 126.773 128.897 1.00 31.93  ? 77  ASP E CG    1 
ATOM 3388  O OD1   . ASP E 1 78  ? 155.562 126.727 129.112 1.00 31.93  ? 77  ASP E OD1   1 
ATOM 3389  O OD2   . ASP E 1 78  ? 153.625 125.759 128.726 1.00 31.93  ? 77  ASP E OD2   1 
ATOM 3390  N N     . PHE E 1 79  ? 153.093 131.065 130.450 1.00 25.63  ? 78  PHE E N     1 
ATOM 3391  C CA    . PHE E 1 79  ? 152.346 132.306 130.322 1.00 25.63  ? 78  PHE E CA    1 
ATOM 3392  C C     . PHE E 1 79  ? 152.997 133.464 131.051 1.00 25.63  ? 78  PHE E C     1 
ATOM 3393  O O     . PHE E 1 79  ? 152.922 134.600 130.581 1.00 25.63  ? 78  PHE E O     1 
ATOM 3394  C CB    . PHE E 1 79  ? 150.921 132.115 130.836 1.00 25.63  ? 78  PHE E CB    1 
ATOM 3395  C CG    . PHE E 1 79  ? 150.228 130.944 130.242 1.00 25.63  ? 78  PHE E CG    1 
ATOM 3396  C CD1   . PHE E 1 79  ? 150.089 130.834 128.882 1.00 25.63  ? 78  PHE E CD1   1 
ATOM 3397  C CD2   . PHE E 1 79  ? 149.722 129.949 131.040 1.00 25.63  ? 78  PHE E CD2   1 
ATOM 3398  C CE1   . PHE E 1 79  ? 149.450 129.751 128.328 1.00 25.63  ? 78  PHE E CE1   1 
ATOM 3399  C CE2   . PHE E 1 79  ? 149.088 128.864 130.488 1.00 25.63  ? 78  PHE E CE2   1 
ATOM 3400  C CZ    . PHE E 1 79  ? 148.952 128.768 129.132 1.00 25.63  ? 78  PHE E CZ    1 
ATOM 3401  N N     . LYS E 1 80  ? 153.635 133.208 132.186 1.00 32.26  ? 79  LYS E N     1 
ATOM 3402  C CA    . LYS E 1 80  ? 154.374 134.243 132.887 1.00 32.26  ? 79  LYS E CA    1 
ATOM 3403  C C     . LYS E 1 80  ? 155.460 133.585 133.718 1.00 32.26  ? 79  LYS E C     1 
ATOM 3404  O O     . LYS E 1 80  ? 155.215 132.561 134.357 1.00 32.26  ? 79  LYS E O     1 
ATOM 3405  C CB    . LYS E 1 80  ? 153.449 135.078 133.771 1.00 32.26  ? 79  LYS E CB    1 
ATOM 3406  C CG    . LYS E 1 80  ? 154.049 136.386 134.204 1.00 32.26  ? 79  LYS E CG    1 
ATOM 3407  C CD    . LYS E 1 80  ? 152.999 137.324 134.746 1.00 32.26  ? 79  LYS E CD    1 
ATOM 3408  C CE    . LYS E 1 80  ? 153.625 138.613 135.252 1.00 32.26  ? 79  LYS E CE    1 
ATOM 3409  N NZ    . LYS E 1 80  ? 154.481 138.384 136.448 1.00 32.26  ? 79  LYS E NZ    1 
ATOM 3410  N N     . THR E 1 81  ? 156.652 134.164 133.701 1.00 37.68  ? 80  THR E N     1 
ATOM 3411  C CA    . THR E 1 81  ? 157.746 133.629 134.494 1.00 37.68  ? 80  THR E CA    1 
ATOM 3412  C C     . THR E 1 81  ? 157.671 134.133 135.929 1.00 37.68  ? 80  THR E C     1 
ATOM 3413  O O     . THR E 1 81  ? 157.281 135.272 136.194 1.00 37.68  ? 80  THR E O     1 
ATOM 3414  C CB    . THR E 1 81  ? 159.103 134.001 133.896 1.00 37.68  ? 80  THR E CB    1 
ATOM 3415  O OG1   . THR E 1 81  ? 159.216 135.425 133.806 1.00 37.68  ? 80  THR E OG1   1 
ATOM 3416  C CG2   . THR E 1 81  ? 159.280 133.388 132.523 1.00 37.68  ? 80  THR E CG2   1 
ATOM 3417  N N     . ASP E 1 82  ? 158.078 133.249 136.847 1.00 42.78  ? 81  ASP E N     1 
ATOM 3418  C CA    . ASP E 1 82  ? 158.119 133.480 138.293 1.00 42.78  ? 81  ASP E CA    1 
ATOM 3419  C C     . ASP E 1 82  ? 156.746 133.920 138.802 1.00 42.78  ? 81  ASP E C     1 
ATOM 3420  O O     . ASP E 1 82  ? 156.590 134.972 139.420 1.00 42.78  ? 81  ASP E O     1 
ATOM 3421  C CB    . ASP E 1 82  ? 159.217 134.485 138.663 1.00 42.78  ? 81  ASP E CB    1 
ATOM 3422  C CG    . ASP E 1 82  ? 159.658 134.392 140.126 1.00 42.78  ? 81  ASP E CG    1 
ATOM 3423  O OD1   . ASP E 1 82  ? 158.816 134.256 141.039 1.00 42.78  ? 81  ASP E OD1   1 
ATOM 3424  O OD2   . ASP E 1 82  ? 160.882 134.450 140.363 1.00 42.78  ? 81  ASP E OD2   1 
ATOM 3425  N N     . LEU E 1 83  ? 155.736 133.117 138.492 1.00 35.24  ? 82  LEU E N     1 
ATOM 3426  C CA    . LEU E 1 83  ? 154.398 133.355 139.001 1.00 35.24  ? 82  LEU E CA    1 
ATOM 3427  C C     . LEU E 1 83  ? 154.308 132.871 140.434 1.00 35.24  ? 82  LEU E C     1 
ATOM 3428  O O     . LEU E 1 83  ? 155.253 132.326 141.007 1.00 35.24  ? 82  LEU E O     1 
ATOM 3429  C CB    . LEU E 1 83  ? 153.349 132.661 138.150 1.00 35.24  ? 82  LEU E CB    1 
ATOM 3430  C CG    . LEU E 1 83  ? 152.663 133.475 137.075 1.00 35.24  ? 82  LEU E CG    1 
ATOM 3431  C CD1   . LEU E 1 83  ? 151.888 132.526 136.238 1.00 35.24  ? 82  LEU E CD1   1 
ATOM 3432  C CD2   . LEU E 1 83  ? 151.759 134.519 137.666 1.00 35.24  ? 82  LEU E CD2   1 
ATOM 3433  N N     . ARG E 1 84  ? 153.132 133.027 141.009 1.00 31.62  ? 83  ARG E N     1 
ATOM 3434  C CA    . ARG E 1 84  ? 152.922 132.757 142.414 1.00 31.62  ? 83  ARG E CA    1 
ATOM 3435  C C     . ARG E 1 84  ? 151.450 132.455 142.575 1.00 31.62  ? 83  ARG E C     1 
ATOM 3436  O O     . ARG E 1 84  ? 150.622 133.063 141.905 1.00 31.62  ? 83  ARG E O     1 
ATOM 3437  C CB    . ARG E 1 84  ? 153.358 133.965 143.239 1.00 31.62  ? 83  ARG E CB    1 
ATOM 3438  C CG    . ARG E 1 84  ? 153.170 133.867 144.696 1.00 31.62  ? 83  ARG E CG    1 
ATOM 3439  C CD    . ARG E 1 84  ? 153.904 135.003 145.352 1.00 31.62  ? 83  ARG E CD    1 
ATOM 3440  N NE    . ARG E 1 84  ? 155.341 134.845 145.219 1.00 31.62  ? 83  ARG E NE    1 
ATOM 3441  C CZ    . ARG E 1 84  ? 156.179 134.818 146.245 1.00 31.62  ? 83  ARG E CZ    1 
ATOM 3442  N NH1   . ARG E 1 84  ? 155.725 134.950 147.480 1.00 31.62  ? 83  ARG E NH1   1 
ATOM 3443  N NH2   . ARG E 1 84  ? 157.477 134.669 146.035 1.00 31.62  ? 83  ARG E NH2   1 
ATOM 3444  N N     . PHE E 1 85  ? 151.131 131.470 143.389 1.00 24.72  ? 84  PHE E N     1 
ATOM 3445  C CA    . PHE E 1 85  ? 149.766 131.009 143.527 1.00 24.72  ? 84  PHE E CA    1 
ATOM 3446  C C     . PHE E 1 85  ? 149.373 131.058 144.987 1.00 24.72  ? 84  PHE E C     1 
ATOM 3447  O O     . PHE E 1 85  ? 150.183 130.787 145.868 1.00 24.72  ? 84  PHE E O     1 
ATOM 3448  C CB    . PHE E 1 85  ? 149.607 129.586 143.016 1.00 24.72  ? 84  PHE E CB    1 
ATOM 3449  C CG    . PHE E 1 85  ? 149.575 129.475 141.535 1.00 24.72  ? 84  PHE E CG    1 
ATOM 3450  C CD1   . PHE E 1 85  ? 148.375 129.447 140.863 1.00 24.72  ? 84  PHE E CD1   1 
ATOM 3451  C CD2   . PHE E 1 85  ? 150.742 129.377 140.814 1.00 24.72  ? 84  PHE E CD2   1 
ATOM 3452  C CE1   . PHE E 1 85  ? 148.344 129.339 139.499 1.00 24.72  ? 84  PHE E CE1   1 
ATOM 3453  C CE2   . PHE E 1 85  ? 150.714 129.272 139.459 1.00 24.72  ? 84  PHE E CE2   1 
ATOM 3454  C CZ    . PHE E 1 85  ? 149.516 129.254 138.801 1.00 24.72  ? 84  PHE E CZ    1 
ATOM 3455  N N     . GLN E 1 86  ? 148.120 131.389 145.242 1.00 25.76  ? 85  GLN E N     1 
ATOM 3456  C CA    . GLN E 1 86  ? 147.594 131.219 146.577 1.00 25.76  ? 85  GLN E CA    1 
ATOM 3457  C C     . GLN E 1 86  ? 147.396 129.737 146.851 1.00 25.76  ? 85  GLN E C     1 
ATOM 3458  O O     . GLN E 1 86  ? 147.423 128.906 145.947 1.00 25.76  ? 85  GLN E O     1 
ATOM 3459  C CB    . GLN E 1 86  ? 146.288 131.979 146.732 1.00 25.76  ? 85  GLN E CB    1 
ATOM 3460  C CG    . GLN E 1 86  ? 146.466 133.450 146.808 1.00 25.76  ? 85  GLN E CG    1 
ATOM 3461  C CD    . GLN E 1 86  ? 145.213 134.131 147.243 1.00 25.76  ? 85  GLN E CD    1 
ATOM 3462  O OE1   . GLN E 1 86  ? 144.129 133.571 147.140 1.00 25.76  ? 85  GLN E OE1   1 
ATOM 3463  N NE2   . GLN E 1 86  ? 145.345 135.350 147.737 1.00 25.76  ? 85  GLN E NE2   1 
ATOM 3464  N N     . SER E 1 87  ? 147.184 129.391 148.116 1.00 23.32  ? 86  SER E N     1 
ATOM 3465  C CA    . SER E 1 87  ? 146.851 128.011 148.435 1.00 23.32  ? 86  SER E CA    1 
ATOM 3466  C C     . SER E 1 87  ? 145.460 127.663 147.938 1.00 23.32  ? 86  SER E C     1 
ATOM 3467  O O     . SER E 1 87  ? 145.175 126.505 147.622 1.00 23.32  ? 86  SER E O     1 
ATOM 3468  C CB    . SER E 1 87  ? 146.947 127.783 149.935 1.00 23.32  ? 86  SER E CB    1 
ATOM 3469  O OG    . SER E 1 87  ? 145.779 128.248 150.578 1.00 23.32  ? 86  SER E OG    1 
ATOM 3470  N N     . SER E 1 88  ? 144.592 128.663 147.840 1.00 22.12  ? 87  SER E N     1 
ATOM 3471  C CA    . SER E 1 88  ? 143.211 128.500 147.446 1.00 22.12  ? 87  SER E CA    1 
ATOM 3472  C C     . SER E 1 88  ? 143.031 128.462 145.947 1.00 22.12  ? 87  SER E C     1 
ATOM 3473  O O     . SER E 1 88  ? 142.073 127.857 145.477 1.00 22.12  ? 87  SER E O     1 
ATOM 3474  C CB    . SER E 1 88  ? 142.389 129.642 148.014 1.00 22.12  ? 87  SER E CB    1 
ATOM 3475  O OG    . SER E 1 88  ? 142.523 129.691 149.410 1.00 22.12  ? 87  SER E OG    1 
ATOM 3476  N N     . ALA E 1 89  ? 143.936 129.078 145.187 1.00 19.61  ? 88  ALA E N     1 
ATOM 3477  C CA    . ALA E 1 89  ? 143.833 129.051 143.736 1.00 19.61  ? 88  ALA E CA    1 
ATOM 3478  C C     . ALA E 1 89  ? 144.088 127.657 143.193 1.00 19.61  ? 88  ALA E C     1 
ATOM 3479  O O     . ALA E 1 89  ? 143.406 127.209 142.268 1.00 19.61  ? 88  ALA E O     1 
ATOM 3480  C CB    . ALA E 1 89  ? 144.808 130.046 143.131 1.00 19.61  ? 88  ALA E CB    1 
ATOM 3481  N N     . VAL E 1 90  ? 145.032 126.935 143.791 1.00 20.86  ? 89  VAL E N     1 
ATOM 3482  C CA    . VAL E 1 90  ? 145.322 125.581 143.345 1.00 20.86  ? 89  VAL E CA    1 
ATOM 3483  C C     . VAL E 1 90  ? 144.221 124.623 143.793 1.00 20.86  ? 89  VAL E C     1 
ATOM 3484  O O     . VAL E 1 90  ? 143.905 123.655 143.097 1.00 20.86  ? 89  VAL E O     1 
ATOM 3485  C CB    . VAL E 1 90  ? 146.711 125.169 143.853 1.00 20.86  ? 89  VAL E CB    1 
ATOM 3486  C CG1   . VAL E 1 90  ? 147.119 123.838 143.302 1.00 20.86  ? 89  VAL E CG1   1 
ATOM 3487  C CG2   . VAL E 1 90  ? 147.721 126.215 143.471 1.00 20.86  ? 89  VAL E CG2   1 
ATOM 3488  N N     . MET E 1 91  ? 143.565 124.910 144.918 1.00 22.65  ? 90  MET E N     1 
ATOM 3489  C CA    . MET E 1 91  ? 142.427 124.091 145.326 1.00 22.65  ? 90  MET E CA    1 
ATOM 3490  C C     . MET E 1 91  ? 141.214 124.347 144.449 1.00 22.65  ? 90  MET E C     1 
ATOM 3491  O O     . MET E 1 91  ? 140.454 123.420 144.154 1.00 22.65  ? 90  MET E O     1 
ATOM 3492  C CB    . MET E 1 91  ? 142.077 124.342 146.787 1.00 22.65  ? 90  MET E CB    1 
ATOM 3493  C CG    . MET E 1 91  ? 143.071 123.784 147.767 1.00 22.65  ? 90  MET E CG    1 
ATOM 3494  S SD    . MET E 1 91  ? 143.393 122.032 147.521 1.00 22.65  ? 90  MET E SD    1 
ATOM 3495  C CE    . MET E 1 91  ? 145.122 122.092 147.070 1.00 22.65  ? 90  MET E CE    1 
ATOM 3496  N N     . ALA E 1 92  ? 141.016 125.593 144.020 1.00 18.72  ? 91  ALA E N     1 
ATOM 3497  C CA    . ALA E 1 92  ? 139.950 125.901 143.078 1.00 18.72  ? 91  ALA E CA    1 
ATOM 3498  C C     . ALA E 1 92  ? 140.219 125.290 141.721 1.00 18.72  ? 91  ALA E C     1 
ATOM 3499  O O     . ALA E 1 92  ? 139.282 124.929 141.012 1.00 18.72  ? 91  ALA E O     1 
ATOM 3500  C CB    . ALA E 1 92  ? 139.780 127.409 142.943 1.00 18.72  ? 91  ALA E CB    1 
ATOM 3501  N N     . LEU E 1 93  ? 141.489 125.182 141.340 1.00 17.25  ? 92  LEU E N     1 
ATOM 3502  C CA    . LEU E 1 93  ? 141.834 124.505 140.101 1.00 17.25  ? 92  LEU E CA    1 
ATOM 3503  C C     . LEU E 1 93  ? 141.632 123.004 140.209 1.00 17.25  ? 92  LEU E C     1 
ATOM 3504  O O     . LEU E 1 93  ? 141.185 122.375 139.250 1.00 17.25  ? 92  LEU E O     1 
ATOM 3505  C CB    . LEU E 1 93  ? 143.275 124.819 139.726 1.00 17.25  ? 92  LEU E CB    1 
ATOM 3506  C CG    . LEU E 1 93  ? 143.478 126.091 138.920 1.00 17.25  ? 92  LEU E CG    1 
ATOM 3507  C CD1   . LEU E 1 93  ? 144.885 126.579 139.050 1.00 17.25  ? 92  LEU E CD1   1 
ATOM 3508  C CD2   . LEU E 1 93  ? 143.140 125.847 137.482 1.00 17.25  ? 92  LEU E CD2   1 
ATOM 3509  N N     . GLN E 1 94  ? 141.925 122.419 141.367 1.00 20.47  ? 93  GLN E N     1 
ATOM 3510  C CA    . GLN E 1 94  ? 141.775 120.980 141.525 1.00 20.47  ? 93  GLN E CA    1 
ATOM 3511  C C     . GLN E 1 94  ? 140.320 120.561 141.607 1.00 20.47  ? 93  GLN E C     1 
ATOM 3512  O O     . GLN E 1 94  ? 139.952 119.522 141.051 1.00 20.47  ? 93  GLN E O     1 
ATOM 3513  C CB    . GLN E 1 94  ? 142.528 120.507 142.756 1.00 20.47  ? 93  GLN E CB    1 
ATOM 3514  C CG    . GLN E 1 94  ? 142.747 119.026 142.772 1.00 20.47  ? 93  GLN E CG    1 
ATOM 3515  C CD    . GLN E 1 94  ? 143.785 118.615 143.773 1.00 20.47  ? 93  GLN E CD    1 
ATOM 3516  O OE1   . GLN E 1 94  ? 144.400 119.452 144.423 1.00 20.47  ? 93  GLN E OE1   1 
ATOM 3517  N NE2   . GLN E 1 94  ? 143.990 117.320 143.907 1.00 20.47  ? 93  GLN E NE2   1 
ATOM 3518  N N     . GLU E 1 95  ? 139.483 121.354 142.284 1.00 20.21  ? 94  GLU E N     1 
ATOM 3519  C CA    . GLU E 1 95  ? 138.050 121.081 142.330 1.00 20.21  ? 94  GLU E CA    1 
ATOM 3520  C C     . GLU E 1 95  ? 137.441 121.107 140.939 1.00 20.21  ? 94  GLU E C     1 
ATOM 3521  O O     . GLU E 1 95  ? 136.711 120.190 140.550 1.00 20.21  ? 94  GLU E O     1 
ATOM 3522  C CB    . GLU E 1 95  ? 137.355 122.103 143.222 1.00 20.21  ? 94  GLU E CB    1 
ATOM 3523  C CG    . GLU E 1 95  ? 137.567 121.883 144.690 1.00 20.21  ? 94  GLU E CG    1 
ATOM 3524  C CD    . GLU E 1 95  ? 136.695 120.781 145.236 1.00 20.21  ? 94  GLU E CD    1 
ATOM 3525  O OE1   . GLU E 1 95  ? 135.641 120.516 144.636 1.00 20.21  ? 94  GLU E OE1   1 
ATOM 3526  O OE2   . GLU E 1 95  ? 137.062 120.170 146.258 1.00 20.21  ? 94  GLU E OE2   1 
ATOM 3527  N N     . ALA E 1 96  ? 137.781 122.127 140.162 1.00 17.59  ? 95  ALA E N     1 
ATOM 3528  C CA    . ALA E 1 96  ? 137.251 122.280 138.818 1.00 17.59  ? 95  ALA E CA    1 
ATOM 3529  C C     . ALA E 1 96  ? 137.778 121.214 137.870 1.00 17.59  ? 95  ALA E C     1 
ATOM 3530  O O     . ALA E 1 96  ? 137.034 120.722 137.018 1.00 17.59  ? 95  ALA E O     1 
ATOM 3531  C CB    . ALA E 1 96  ? 137.599 123.659 138.302 1.00 17.59  ? 95  ALA E CB    1 
ATOM 3532  N N     . SER E 1 97  ? 139.047 120.827 138.017 1.00 18.25  ? 96  SER E N     1 
ATOM 3533  C CA    . SER E 1 97  ? 139.628 119.817 137.144 1.00 18.25  ? 96  SER E CA    1 
ATOM 3534  C C     . SER E 1 97  ? 139.049 118.441 137.412 1.00 18.25  ? 96  SER E C     1 
ATOM 3535  O O     . SER E 1 97  ? 138.751 117.697 136.473 1.00 18.25  ? 96  SER E O     1 
ATOM 3536  C CB    . SER E 1 97  ? 141.132 119.789 137.330 1.00 18.25  ? 96  SER E CB    1 
ATOM 3537  O OG    . SER E 1 97  ? 141.675 121.043 137.007 1.00 18.25  ? 96  SER E OG    1 
ATOM 3538  N N     . GLU E 1 98  ? 138.877 118.081 138.683 1.00 21.33  ? 97  GLU E N     1 
ATOM 3539  C CA    . GLU E 1 98  ? 138.293 116.787 138.997 1.00 21.33  ? 97  GLU E CA    1 
ATOM 3540  C C     . GLU E 1 98  ? 136.817 116.743 138.646 1.00 21.33  ? 97  GLU E C     1 
ATOM 3541  O O     . GLU E 1 98  ? 136.308 115.703 138.227 1.00 21.33  ? 97  GLU E O     1 
ATOM 3542  C CB    . GLU E 1 98  ? 138.507 116.468 140.463 1.00 21.33  ? 97  GLU E CB    1 
ATOM 3543  C CG    . GLU E 1 98  ? 139.945 116.241 140.777 1.00 21.33  ? 97  GLU E CG    1 
ATOM 3544  C CD    . GLU E 1 98  ? 140.135 115.628 142.120 1.00 21.33  ? 97  GLU E CD    1 
ATOM 3545  O OE1   . GLU E 1 98  ? 141.148 115.936 142.772 1.00 21.33  ? 97  GLU E OE1   1 
ATOM 3546  O OE2   . GLU E 1 98  ? 139.269 114.840 142.534 1.00 21.33  ? 97  GLU E OE2   1 
ATOM 3547  N N     . ALA E 1 99  ? 136.116 117.871 138.781 1.00 16.75  ? 98  ALA E N     1 
ATOM 3548  C CA    . ALA E 1 99  ? 134.725 117.920 138.359 1.00 16.75  ? 98  ALA E CA    1 
ATOM 3549  C C     . ALA E 1 99  ? 134.596 117.782 136.853 1.00 16.75  ? 98  ALA E C     1 
ATOM 3550  O O     . ALA E 1 99  ? 133.689 117.096 136.365 1.00 16.75  ? 98  ALA E O     1 
ATOM 3551  C CB    . ALA E 1 99  ? 134.091 119.217 138.824 1.00 16.75  ? 98  ALA E CB    1 
ATOM 3552  N N     . TYR E 1 100 ? 135.517 118.392 136.107 1.00 15.52  ? 99  TYR E N     1 
ATOM 3553  C CA    . TYR E 1 100 ? 135.519 118.271 134.658 1.00 15.52  ? 99  TYR E CA    1 
ATOM 3554  C C     . TYR E 1 100 ? 135.787 116.841 134.221 1.00 15.52  ? 99  TYR E C     1 
ATOM 3555  O O     . TYR E 1 100 ? 135.100 116.317 133.339 1.00 15.52  ? 99  TYR E O     1 
ATOM 3556  C CB    . TYR E 1 100 ? 136.565 119.211 134.072 1.00 15.52  ? 99  TYR E CB    1 
ATOM 3557  C CG    . TYR E 1 100 ? 136.762 119.043 132.596 1.00 15.52  ? 99  TYR E CG    1 
ATOM 3558  C CD1   . TYR E 1 100 ? 135.826 119.520 131.704 1.00 15.52  ? 99  TYR E CD1   1 
ATOM 3559  C CD2   . TYR E 1 100 ? 137.886 118.407 132.094 1.00 15.52  ? 99  TYR E CD2   1 
ATOM 3560  C CE1   . TYR E 1 100 ? 135.992 119.366 130.367 1.00 15.52  ? 99  TYR E CE1   1 
ATOM 3561  C CE2   . TYR E 1 100 ? 138.053 118.244 130.755 1.00 15.52  ? 99  TYR E CE2   1 
ATOM 3562  C CZ    . TYR E 1 100 ? 137.105 118.727 129.895 1.00 15.52  ? 99  TYR E CZ    1 
ATOM 3563  O OH    . TYR E 1 100 ? 137.273 118.578 128.546 1.00 15.52  ? 99  TYR E OH    1 
ATOM 3564  N N     . LEU E 1 101 ? 136.757 116.182 134.850 1.00 15.37  ? 100 LEU E N     1 
ATOM 3565  C CA    . LEU E 1 101 ? 137.095 114.828 134.442 1.00 15.37  ? 100 LEU E CA    1 
ATOM 3566  C C     . LEU E 1 101 ? 136.034 113.819 134.851 1.00 15.37  ? 100 LEU E C     1 
ATOM 3567  O O     . LEU E 1 101 ? 135.763 112.890 134.093 1.00 15.37  ? 100 LEU E O     1 
ATOM 3568  C CB    . LEU E 1 101 ? 138.446 114.433 135.009 1.00 15.37  ? 100 LEU E CB    1 
ATOM 3569  C CG    . LEU E 1 101 ? 139.623 115.050 134.283 1.00 15.37  ? 100 LEU E CG    1 
ATOM 3570  C CD1   . LEU E 1 101 ? 140.852 114.802 135.081 1.00 15.37  ? 100 LEU E CD1   1 
ATOM 3571  C CD2   . LEU E 1 101 ? 139.754 114.450 132.923 1.00 15.37  ? 100 LEU E CD2   1 
ATOM 3572  N N     . VAL E 1 102 ? 135.406 113.988 136.015 1.00 14.88  ? 101 VAL E N     1 
ATOM 3573  C CA    . VAL E 1 102 ? 134.324 113.092 136.415 1.00 14.88  ? 101 VAL E CA    1 
ATOM 3574  C C     . VAL E 1 102 ? 133.111 113.265 135.506 1.00 14.88  ? 101 VAL E C     1 
ATOM 3575  O O     . VAL E 1 102 ? 132.519 112.279 135.042 1.00 14.88  ? 101 VAL E O     1 
ATOM 3576  C CB    . VAL E 1 102 ? 133.983 113.327 137.897 1.00 14.88  ? 101 VAL E CB    1 
ATOM 3577  C CG1   . VAL E 1 102 ? 132.661 112.737 138.254 1.00 14.88  ? 101 VAL E CG1   1 
ATOM 3578  C CG2   . VAL E 1 102 ? 135.042 112.727 138.765 1.00 14.88  ? 101 VAL E CG2   1 
ATOM 3579  N N     . GLY E 1 103 ? 132.753 114.510 135.188 1.00 17.00  ? 102 GLY E N     1 
ATOM 3580  C CA    . GLY E 1 103 ? 131.656 114.742 134.272 1.00 17.00  ? 102 GLY E CA    1 
ATOM 3581  C C     . GLY E 1 103 ? 131.942 114.340 132.847 1.00 17.00  ? 102 GLY E C     1 
ATOM 3582  O O     . GLY E 1 103 ? 131.004 114.125 132.078 1.00 17.00  ? 102 GLY E O     1 
ATOM 3583  N N     . LEU E 1 104 ? 133.212 114.236 132.474 1.00 15.90  ? 103 LEU E N     1 
ATOM 3584  C CA    . LEU E 1 104 ? 133.548 113.693 131.166 1.00 15.90  ? 103 LEU E CA    1 
ATOM 3585  C C     . LEU E 1 104 ? 133.514 112.176 131.163 1.00 15.90  ? 103 LEU E C     1 
ATOM 3586  O O     . LEU E 1 104 ? 133.127 111.567 130.165 1.00 15.90  ? 103 LEU E O     1 
ATOM 3587  C CB    . LEU E 1 104 ? 134.922 114.191 130.736 1.00 15.90  ? 103 LEU E CB    1 
ATOM 3588  C CG    . LEU E 1 104 ? 135.380 113.802 129.341 1.00 15.90  ? 103 LEU E CG    1 
ATOM 3589  C CD1   . LEU E 1 104 ? 134.435 114.324 128.301 1.00 15.90  ? 103 LEU E CD1   1 
ATOM 3590  C CD2   . LEU E 1 104 ? 136.728 114.346 129.132 1.00 15.90  ? 103 LEU E CD2   1 
ATOM 3591  N N     . PHE E 1 105 ? 133.927 111.545 132.261 1.00 16.15  ? 104 PHE E N     1 
ATOM 3592  C CA    . PHE E 1 105 ? 133.885 110.092 132.339 1.00 16.15  ? 104 PHE E CA    1 
ATOM 3593  C C     . PHE E 1 105 ? 132.469 109.556 132.403 1.00 16.15  ? 104 PHE E C     1 
ATOM 3594  O O     . PHE E 1 105 ? 132.236 108.427 131.970 1.00 16.15  ? 104 PHE E O     1 
ATOM 3595  C CB    . PHE E 1 105 ? 134.683 109.603 133.536 1.00 16.15  ? 104 PHE E CB    1 
ATOM 3596  C CG    . PHE E 1 105 ? 136.137 109.477 133.263 1.00 16.15  ? 104 PHE E CG    1 
ATOM 3597  C CD1   . PHE E 1 105 ? 136.579 108.807 132.146 1.00 16.15  ? 104 PHE E CD1   1 
ATOM 3598  C CD2   . PHE E 1 105 ? 137.064 110.041 134.108 1.00 16.15  ? 104 PHE E CD2   1 
ATOM 3599  C CE1   . PHE E 1 105 ? 137.916 108.698 131.886 1.00 16.15  ? 104 PHE E CE1   1 
ATOM 3600  C CE2   . PHE E 1 105 ? 138.401 109.936 133.847 1.00 16.15  ? 104 PHE E CE2   1 
ATOM 3601  C CZ    . PHE E 1 105 ? 138.824 109.262 132.738 1.00 16.15  ? 104 PHE E CZ    1 
ATOM 3602  N N     . GLU E 1 106 ? 131.511 110.347 132.881 1.00 18.74  ? 105 GLU E N     1 
ATOM 3603  C CA    . GLU E 1 106 ? 130.113 109.923 132.809 1.00 18.74  ? 105 GLU E CA    1 
ATOM 3604  C C     . GLU E 1 106 ? 129.609 109.863 131.365 1.00 18.74  ? 105 GLU E C     1 
ATOM 3605  O O     . GLU E 1 106 ? 128.966 108.886 130.957 1.00 18.74  ? 105 GLU E O     1 
ATOM 3606  C CB    . GLU E 1 106 ? 129.259 110.846 133.659 1.00 18.74  ? 105 GLU E CB    1 
ATOM 3607  C CG    . GLU E 1 106 ? 129.618 110.724 135.109 1.00 18.74  ? 105 GLU E CG    1 
ATOM 3608  C CD    . GLU E 1 106 ? 128.910 111.707 135.990 1.00 18.74  ? 105 GLU E CD    1 
ATOM 3609  O OE1   . GLU E 1 106 ? 128.091 112.488 135.468 1.00 18.74  ? 105 GLU E OE1   1 
ATOM 3610  O OE2   . GLU E 1 106 ? 129.168 111.700 137.211 1.00 18.74  ? 105 GLU E OE2   1 
ATOM 3611  N N     . ASP E 1 107 ? 129.928 110.880 130.563 1.00 19.79  ? 106 ASP E N     1 
ATOM 3612  C CA    . ASP E 1 107 ? 129.575 110.866 129.147 1.00 19.79  ? 106 ASP E CA    1 
ATOM 3613  C C     . ASP E 1 107 ? 130.328 109.791 128.379 1.00 19.79  ? 106 ASP E C     1 
ATOM 3614  O O     . ASP E 1 107 ? 129.773 109.181 127.462 1.00 19.79  ? 106 ASP E O     1 
ATOM 3615  C CB    . ASP E 1 107 ? 129.856 112.230 128.533 1.00 19.79  ? 106 ASP E CB    1 
ATOM 3616  C CG    . ASP E 1 107 ? 129.007 113.324 129.136 1.00 19.79  ? 106 ASP E CG    1 
ATOM 3617  O OD1   . ASP E 1 107 ? 127.905 113.017 129.634 1.00 19.79  ? 106 ASP E OD1   1 
ATOM 3618  O OD2   . ASP E 1 107 ? 129.433 114.497 129.109 1.00 19.79  ? 106 ASP E OD2   1 
ATOM 3619  N N     . THR E 1 108 ? 131.587 109.555 128.738 1.00 18.06  ? 107 THR E N     1 
ATOM 3620  C CA    . THR E 1 108 ? 132.373 108.480 128.147 1.00 18.06  ? 107 THR E CA    1 
ATOM 3621  C C     . THR E 1 108 ? 131.774 107.113 128.450 1.00 18.06  ? 107 THR E C     1 
ATOM 3622  O O     . THR E 1 108 ? 131.760 106.227 127.588 1.00 18.06  ? 107 THR E O     1 
ATOM 3623  C CB    . THR E 1 108 ? 133.791 108.571 128.679 1.00 18.06  ? 107 THR E CB    1 
ATOM 3624  O OG1   . THR E 1 108 ? 134.281 109.891 128.458 1.00 18.06  ? 107 THR E OG1   1 
ATOM 3625  C CG2   . THR E 1 108 ? 134.676 107.604 128.005 1.00 18.06  ? 107 THR E CG2   1 
ATOM 3626  N N     . ASN E 1 109 ? 131.260 106.930 129.666 1.00 17.28  ? 108 ASN E N     1 
ATOM 3627  C CA    . ASN E 1 109 ? 130.587 105.688 130.020 1.00 17.28  ? 108 ASN E CA    1 
ATOM 3628  C C     . ASN E 1 109 ? 129.309 105.503 129.220 1.00 17.28  ? 108 ASN E C     1 
ATOM 3629  O O     . ASN E 1 109 ? 128.983 104.382 128.820 1.00 17.28  ? 108 ASN E O     1 
ATOM 3630  C CB    . ASN E 1 109 ? 130.290 105.680 131.513 1.00 17.28  ? 108 ASN E CB    1 
ATOM 3631  C CG    . ASN E 1 109 ? 130.170 104.294 132.075 1.00 17.28  ? 108 ASN E CG    1 
ATOM 3632  O OD1   . ASN E 1 109 ? 130.768 103.352 131.575 1.00 17.28  ? 108 ASN E OD1   1 
ATOM 3633  N ND2   . ASN E 1 109 ? 129.398 104.164 133.131 1.00 17.28  ? 108 ASN E ND2   1 
ATOM 3634  N N     . LEU E 1 110 ? 128.579 106.592 128.968 1.00 17.62  ? 109 LEU E N     1 
ATOM 3635  C CA    . LEU E 1 110 ? 127.390 106.501 128.120 1.00 17.62  ? 109 LEU E CA    1 
ATOM 3636  C C     . LEU E 1 110 ? 127.744 106.139 126.682 1.00 17.62  ? 109 LEU E C     1 
ATOM 3637  O O     . LEU E 1 110 ? 127.030 105.363 126.041 1.00 17.62  ? 109 LEU E O     1 
ATOM 3638  C CB    . LEU E 1 110 ? 126.623 107.813 128.149 1.00 17.62  ? 109 LEU E CB    1 
ATOM 3639  C CG    . LEU E 1 110 ? 125.942 108.188 129.449 1.00 17.62  ? 109 LEU E CG    1 
ATOM 3640  C CD1   . LEU E 1 110 ? 125.500 109.612 129.352 1.00 17.62  ? 109 LEU E CD1   1 
ATOM 3641  C CD2   . LEU E 1 110 ? 124.774 107.291 129.683 1.00 17.62  ? 109 LEU E CD2   1 
ATOM 3642  N N     . CYS E 1 111 ? 128.842 106.688 126.161 1.00 19.41  ? 110 CYS E N     1 
ATOM 3643  C CA    . CYS E 1 111 ? 129.294 106.329 124.818 1.00 19.41  ? 110 CYS E CA    1 
ATOM 3644  C C     . CYS E 1 111 ? 129.750 104.883 124.728 1.00 19.41  ? 110 CYS E C     1 
ATOM 3645  O O     . CYS E 1 111 ? 129.561 104.247 123.690 1.00 19.41  ? 110 CYS E O     1 
ATOM 3646  C CB    . CYS E 1 111 ? 130.435 107.235 124.366 1.00 19.41  ? 110 CYS E CB    1 
ATOM 3647  S SG    . CYS E 1 111 ? 130.047 108.956 124.250 1.00 19.41  ? 110 CYS E SG    1 
ATOM 3648  N N     . ALA E 1 112 ? 130.375 104.359 125.781 1.00 20.60  ? 111 ALA E N     1 
ATOM 3649  C CA    . ALA E 1 112 ? 130.775 102.958 125.784 1.00 20.60  ? 111 ALA E CA    1 
ATOM 3650  C C     . ALA E 1 112 ? 129.573 102.038 125.851 1.00 20.60  ? 111 ALA E C     1 
ATOM 3651  O O     . ALA E 1 112 ? 129.533 101.017 125.164 1.00 20.60  ? 111 ALA E O     1 
ATOM 3652  C CB    . ALA E 1 112 ? 131.704 102.680 126.957 1.00 20.60  ? 111 ALA E CB    1 
ATOM 3653  N N     . ILE E 1 113 ? 128.588 102.380 126.679 1.00 20.09  ? 112 ILE E N     1 
ATOM 3654  C CA    . ILE E 1 113 ? 127.390 101.564 126.824 1.00 20.09  ? 112 ILE E CA    1 
ATOM 3655  C C     . ILE E 1 113 ? 126.548 101.599 125.555 1.00 20.09  ? 112 ILE E C     1 
ATOM 3656  O O     . ILE E 1 113 ? 125.921 100.599 125.191 1.00 20.09  ? 112 ILE E O     1 
ATOM 3657  C CB    . ILE E 1 113 ? 126.637 102.053 128.076 1.00 20.09  ? 112 ILE E CB    1 
ATOM 3658  C CG1   . ILE E 1 113 ? 127.323 101.516 129.320 1.00 20.09  ? 112 ILE E CG1   1 
ATOM 3659  C CG2   . ILE E 1 113 ? 125.190 101.640 128.104 1.00 20.09  ? 112 ILE E CG2   1 
ATOM 3660  C CD1   . ILE E 1 113 ? 126.890 102.189 130.563 1.00 20.09  ? 112 ILE E CD1   1 
ATOM 3661  N N     . HIS E 1 114 ? 126.570 102.720 124.834 1.00 20.34  ? 113 HIS E N     1 
ATOM 3662  C CA    . HIS E 1 114 ? 125.827 102.850 123.586 1.00 20.34  ? 113 HIS E CA    1 
ATOM 3663  C C     . HIS E 1 114 ? 126.345 101.908 122.512 1.00 20.34  ? 113 HIS E C     1 
ATOM 3664  O O     . HIS E 1 114 ? 125.567 101.366 121.722 1.00 20.34  ? 113 HIS E O     1 
ATOM 3665  C CB    . HIS E 1 114 ? 125.927 104.285 123.103 1.00 20.34  ? 113 HIS E CB    1 
ATOM 3666  C CG    . HIS E 1 114 ? 125.108 104.575 121.895 1.00 20.34  ? 113 HIS E CG    1 
ATOM 3667  N ND1   . HIS E 1 114 ? 123.747 104.752 121.955 1.00 20.34  ? 113 HIS E ND1   1 
ATOM 3668  C CD2   . HIS E 1 114 ? 125.456 104.745 120.601 1.00 20.34  ? 113 HIS E CD2   1 
ATOM 3669  C CE1   . HIS E 1 114 ? 123.289 105.008 120.747 1.00 20.34  ? 113 HIS E CE1   1 
ATOM 3670  N NE2   . HIS E 1 114 ? 124.305 105.008 119.906 1.00 20.34  ? 113 HIS E NE2   1 
ATOM 3671  N N     . ALA E 1 115 ? 127.650 101.697 122.472 1.00 21.19  ? 114 ALA E N     1 
ATOM 3672  C CA    . ALA E 1 115 ? 128.273 100.798 121.519 1.00 21.19  ? 114 ALA E CA    1 
ATOM 3673  C C     . ALA E 1 115 ? 128.267 99.354  121.983 1.00 21.19  ? 114 ALA E C     1 
ATOM 3674  O O     . ALA E 1 115 ? 129.002 98.548  121.406 1.00 21.19  ? 114 ALA E O     1 
ATOM 3675  C CB    . ALA E 1 115 ? 129.703 101.248 121.247 1.00 21.19  ? 114 ALA E CB    1 
ATOM 3676  N N     . LYS E 1 116 ? 127.459 99.037  123.001 1.00 24.02  ? 115 LYS E N     1 
ATOM 3677  C CA    . LYS E 1 116 ? 127.314 97.705  123.592 1.00 24.02  ? 115 LYS E CA    1 
ATOM 3678  C C     . LYS E 1 116 ? 128.647 97.162  124.102 1.00 24.02  ? 115 LYS E C     1 
ATOM 3679  O O     . LYS E 1 116 ? 129.033 96.028  123.826 1.00 24.02  ? 115 LYS E O     1 
ATOM 3680  C CB    . LYS E 1 116 ? 126.643 96.739  122.621 1.00 24.02  ? 115 LYS E CB    1 
ATOM 3681  C CG    . LYS E 1 116 ? 125.146 96.956  122.521 1.00 24.02  ? 115 LYS E CG    1 
ATOM 3682  C CD    . LYS E 1 116 ? 124.520 96.086  121.453 1.00 24.02  ? 115 LYS E CD    1 
ATOM 3683  C CE    . LYS E 1 116 ? 125.017 96.462  120.072 1.00 24.02  ? 115 LYS E CE    1 
ATOM 3684  N NZ    . LYS E 1 116 ? 124.666 97.865  119.710 1.00 24.02  ? 115 LYS E NZ    1 
ATOM 3685  N N     . ARG E 1 117 ? 129.349 97.998  124.858 1.00 23.15  ? 116 ARG E N     1 
ATOM 3686  C CA    . ARG E 1 117 ? 130.569 97.644  125.558 1.00 23.15  ? 116 ARG E CA    1 
ATOM 3687  C C     . ARG E 1 117 ? 130.425 98.049  127.013 1.00 23.15  ? 116 ARG E C     1 
ATOM 3688  O O     . ARG E 1 117 ? 129.500 98.761  127.394 1.00 23.15  ? 116 ARG E O     1 
ATOM 3689  C CB    . ARG E 1 117 ? 131.786 98.340  124.959 1.00 23.15  ? 116 ARG E CB    1 
ATOM 3690  C CG    . ARG E 1 117 ? 132.290 97.754  123.681 1.00 23.15  ? 116 ARG E CG    1 
ATOM 3691  C CD    . ARG E 1 117 ? 133.567 98.430  123.272 1.00 23.15  ? 116 ARG E CD    1 
ATOM 3692  N NE    . ARG E 1 117 ? 133.305 99.704  122.623 1.00 23.15  ? 116 ARG E NE    1 
ATOM 3693  C CZ    . ARG E 1 117 ? 133.567 100.886 123.161 1.00 23.15  ? 116 ARG E CZ    1 
ATOM 3694  N NH1   . ARG E 1 117 ? 134.108 100.957 124.362 1.00 23.15  ? 116 ARG E NH1   1 
ATOM 3695  N NH2   . ARG E 1 117 ? 133.295 101.991 122.499 1.00 23.15  ? 116 ARG E NH2   1 
ATOM 3696  N N     . VAL E 1 118 ? 131.341 97.568  127.842 1.00 25.43  ? 117 VAL E N     1 
ATOM 3697  C CA    . VAL E 1 118 ? 131.475 98.064  129.202 1.00 25.43  ? 117 VAL E CA    1 
ATOM 3698  C C     . VAL E 1 118 ? 132.853 98.640  129.480 1.00 25.43  ? 117 VAL E C     1 
ATOM 3699  O O     . VAL E 1 118 ? 133.058 99.229  130.551 1.00 25.43  ? 117 VAL E O     1 
ATOM 3700  C CB    . VAL E 1 118 ? 131.130 96.974  130.237 1.00 25.43  ? 117 VAL E CB    1 
ATOM 3701  C CG1   . VAL E 1 118 ? 129.680 96.584  130.124 1.00 25.43  ? 117 VAL E CG1   1 
ATOM 3702  C CG2   . VAL E 1 118 ? 131.990 95.770  130.049 1.00 25.43  ? 117 VAL E CG2   1 
ATOM 3703  N N     . THR E 1 119 ? 133.799 98.499  128.561 1.00 23.70  ? 118 THR E N     1 
ATOM 3704  C CA    . THR E 1 119 ? 135.086 99.161  128.666 1.00 23.70  ? 118 THR E CA    1 
ATOM 3705  C C     . THR E 1 119 ? 135.010 100.521 127.990 1.00 23.70  ? 118 THR E C     1 
ATOM 3706  O O     . THR E 1 119 ? 134.411 100.651 126.921 1.00 23.70  ? 118 THR E O     1 
ATOM 3707  C CB    . THR E 1 119 ? 136.156 98.297  128.007 1.00 23.70  ? 118 THR E CB    1 
ATOM 3708  O OG1   . THR E 1 119 ? 135.980 96.940  128.412 1.00 23.70  ? 118 THR E OG1   1 
ATOM 3709  C CG2   . THR E 1 119 ? 137.534 98.735  128.395 1.00 23.70  ? 118 THR E CG2   1 
ATOM 3710  N N     . ILE E 1 120 ? 135.599 101.540 128.609 1.00 20.81  ? 119 ILE E N     1 
ATOM 3711  C CA    . ILE E 1 120 ? 135.692 102.842 127.960 1.00 20.81  ? 119 ILE E CA    1 
ATOM 3712  C C     . ILE E 1 120 ? 137.020 102.924 127.230 1.00 20.81  ? 119 ILE E C     1 
ATOM 3713  O O     . ILE E 1 120 ? 138.017 102.348 127.662 1.00 20.81  ? 119 ILE E O     1 
ATOM 3714  C CB    . ILE E 1 120 ? 135.522 103.991 128.969 1.00 20.81  ? 119 ILE E CB    1 
ATOM 3715  C CG1   . ILE E 1 120 ? 136.587 103.946 130.056 1.00 20.81  ? 119 ILE E CG1   1 
ATOM 3716  C CG2   . ILE E 1 120 ? 134.151 103.948 129.582 1.00 20.81  ? 119 ILE E CG2   1 
ATOM 3717  C CD1   . ILE E 1 120 ? 136.786 105.241 130.749 1.00 20.81  ? 119 ILE E CD1   1 
ATOM 3718  N N     . MET E 1 121 ? 137.026 103.610 126.098 1.00 23.30  ? 120 MET E N     1 
ATOM 3719  C CA    . MET E 1 121 ? 138.141 103.667 125.168 1.00 23.30  ? 120 MET E CA    1 
ATOM 3720  C C     . MET E 1 121 ? 138.353 105.102 124.708 1.00 23.30  ? 120 MET E C     1 
ATOM 3721  O O     . MET E 1 121 ? 137.490 105.966 124.924 1.00 23.30  ? 120 MET E O     1 
ATOM 3722  C CB    . MET E 1 121 ? 137.867 102.734 123.978 1.00 23.30  ? 120 MET E CB    1 
ATOM 3723  C CG    . MET E 1 121 ? 137.966 101.285 124.358 1.00 23.30  ? 120 MET E CG    1 
ATOM 3724  S SD    . MET E 1 121 ? 137.624 100.088 123.086 1.00 23.30  ? 120 MET E SD    1 
ATOM 3725  C CE    . MET E 1 121 ? 137.697 98.614  124.088 1.00 23.30  ? 120 MET E CE    1 
ATOM 3726  N N     . PRO E 1 122 ? 139.525 105.409 124.135 1.00 21.45  ? 121 PRO E N     1 
ATOM 3727  C CA    . PRO E 1 122 ? 139.755 106.769 123.627 1.00 21.45  ? 121 PRO E CA    1 
ATOM 3728  C C     . PRO E 1 122 ? 138.787 107.215 122.558 1.00 21.45  ? 121 PRO E C     1 
ATOM 3729  O O     . PRO E 1 122 ? 138.538 108.415 122.443 1.00 21.45  ? 121 PRO E O     1 
ATOM 3730  C CB    . PRO E 1 122 ? 141.179 106.683 123.082 1.00 21.45  ? 121 PRO E CB    1 
ATOM 3731  C CG    . PRO E 1 122 ? 141.812 105.716 123.922 1.00 21.45  ? 121 PRO E CG    1 
ATOM 3732  C CD    . PRO E 1 122 ? 140.803 104.679 124.223 1.00 21.45  ? 121 PRO E CD    1 
ATOM 3733  N N     . LYS E 1 123 ? 138.219 106.291 121.788 1.00 21.97  ? 122 LYS E N     1 
ATOM 3734  C CA    . LYS E 1 123 ? 137.168 106.656 120.852 1.00 21.97  ? 122 LYS E CA    1 
ATOM 3735  C C     . LYS E 1 123 ? 135.904 107.106 121.572 1.00 21.97  ? 122 LYS E C     1 
ATOM 3736  O O     . LYS E 1 123 ? 135.201 107.992 121.080 1.00 21.97  ? 122 LYS E O     1 
ATOM 3737  C CB    . LYS E 1 123 ? 136.882 105.485 119.922 1.00 21.97  ? 122 LYS E CB    1 
ATOM 3738  C CG    . LYS E 1 123 ? 136.569 104.187 120.620 1.00 21.97  ? 122 LYS E CG    1 
ATOM 3739  C CD    . LYS E 1 123 ? 136.226 103.090 119.642 1.00 21.97  ? 122 LYS E CD    1 
ATOM 3740  C CE    . LYS E 1 123 ? 135.193 103.540 118.632 1.00 21.97  ? 122 LYS E CE    1 
ATOM 3741  N NZ    . LYS E 1 123 ? 134.641 102.400 117.857 1.00 21.97  ? 122 LYS E NZ    1 
ATOM 3742  N N     . ASP E 1 124 ? 135.627 106.550 122.755 1.00 21.32  ? 123 ASP E N     1 
ATOM 3743  C CA    . ASP E 1 124 ? 134.504 107.017 123.557 1.00 21.32  ? 123 ASP E CA    1 
ATOM 3744  C C     . ASP E 1 124 ? 134.766 108.405 124.107 1.00 21.32  ? 123 ASP E C     1 
ATOM 3745  O O     . ASP E 1 124 ? 133.853 109.236 124.145 1.00 21.32  ? 123 ASP E O     1 
ATOM 3746  C CB    . ASP E 1 124 ? 134.228 106.061 124.711 1.00 21.32  ? 123 ASP E CB    1 
ATOM 3747  C CG    . ASP E 1 124 ? 134.108 104.641 124.279 1.00 21.32  ? 123 ASP E CG    1 
ATOM 3748  O OD1   . ASP E 1 124 ? 133.246 104.336 123.453 1.00 21.32  ? 123 ASP E OD1   1 
ATOM 3749  O OD2   . ASP E 1 124 ? 134.858 103.804 124.787 1.00 21.32  ? 123 ASP E OD2   1 
ATOM 3750  N N     . ILE E 1 125 ? 136.005 108.672 124.536 1.00 19.40  ? 124 ILE E N     1 
ATOM 3751  C CA    . ILE E 1 125 ? 136.355 110.016 125.004 1.00 19.40  ? 124 ILE E CA    1 
ATOM 3752  C C     . ILE E 1 125 ? 136.245 111.031 123.871 1.00 19.40  ? 124 ILE E C     1 
ATOM 3753  O O     . ILE E 1 125 ? 135.703 112.129 124.050 1.00 19.40  ? 124 ILE E O     1 
ATOM 3754  C CB    . ILE E 1 125 ? 137.758 110.019 125.630 1.00 19.40  ? 124 ILE E CB    1 
ATOM 3755  C CG1   . ILE E 1 125 ? 137.732 109.352 126.995 1.00 19.40  ? 124 ILE E CG1   1 
ATOM 3756  C CG2   . ILE E 1 125 ? 138.300 111.428 125.767 1.00 19.40  ? 124 ILE E CG2   1 
ATOM 3757  C CD1   . ILE E 1 125 ? 138.998 109.492 127.774 1.00 19.40  ? 124 ILE E CD1   1 
ATOM 3758  N N     . GLN E 1 126 ? 136.723 110.666 122.683 1.00 19.30  ? 125 GLN E N     1 
ATOM 3759  C CA    . GLN E 1 126 ? 136.698 111.573 121.544 1.00 19.30  ? 125 GLN E CA    1 
ATOM 3760  C C     . GLN E 1 126 ? 135.280 111.843 121.069 1.00 19.30  ? 125 GLN E C     1 
ATOM 3761  O O     . GLN E 1 126 ? 134.958 112.977 120.700 1.00 19.30  ? 125 GLN E O     1 
ATOM 3762  C CB    . GLN E 1 126 ? 137.543 111.000 120.418 1.00 19.30  ? 125 GLN E CB    1 
ATOM 3763  C CG    . GLN E 1 126 ? 139.028 111.141 120.657 1.00 19.30  ? 125 GLN E CG    1 
ATOM 3764  C CD    . GLN E 1 126 ? 139.829 110.036 120.023 1.00 19.30  ? 125 GLN E CD    1 
ATOM 3765  O OE1   . GLN E 1 126 ? 139.683 109.745 118.842 1.00 19.30  ? 125 GLN E OE1   1 
ATOM 3766  N NE2   . GLN E 1 126 ? 140.690 109.411 120.809 1.00 19.30  ? 125 GLN E NE2   1 
ATOM 3767  N N     . LEU E 1 127 ? 134.408 110.832 121.100 1.00 17.22  ? 126 LEU E N     1 
ATOM 3768  C CA    . LEU E 1 127 ? 133.006 111.065 120.772 1.00 17.22  ? 126 LEU E CA    1 
ATOM 3769  C C     . LEU E 1 127 ? 132.341 111.947 121.815 1.00 17.22  ? 126 LEU E C     1 
ATOM 3770  O O     . LEU E 1 127 ? 131.601 112.870 121.468 1.00 17.22  ? 126 LEU E O     1 
ATOM 3771  C CB    . LEU E 1 127 ? 132.254 109.744 120.638 1.00 17.22  ? 126 LEU E CB    1 
ATOM 3772  C CG    . LEU E 1 127 ? 130.769 109.926 120.316 1.00 17.22  ? 126 LEU E CG    1 
ATOM 3773  C CD1   . LEU E 1 127 ? 130.590 110.366 118.902 1.00 17.22  ? 126 LEU E CD1   1 
ATOM 3774  C CD2   . LEU E 1 127 ? 129.966 108.698 120.574 1.00 17.22  ? 126 LEU E CD2   1 
ATOM 3775  N N     . ALA E 1 128 ? 132.611 111.693 123.097 1.00 19.61  ? 127 ALA E N     1 
ATOM 3776  C CA    . ALA E 1 128 ? 131.990 112.474 124.160 1.00 19.61  ? 127 ALA E CA    1 
ATOM 3777  C C     . ALA E 1 128 ? 132.405 113.933 124.109 1.00 19.61  ? 127 ALA E C     1 
ATOM 3778  O O     . ALA E 1 128 ? 131.581 114.805 124.362 1.00 19.61  ? 127 ALA E O     1 
ATOM 3779  C CB    . ALA E 1 128 ? 132.346 111.877 125.516 1.00 19.61  ? 127 ALA E CB    1 
ATOM 3780  N N     . ARG E 1 129 ? 133.649 114.219 123.739 1.00 17.98  ? 128 ARG E N     1 
ATOM 3781  C CA    . ARG E 1 129 ? 134.093 115.596 123.590 1.00 17.98  ? 128 ARG E CA    1 
ATOM 3782  C C     . ARG E 1 129 ? 133.630 116.244 122.298 1.00 17.98  ? 128 ARG E C     1 
ATOM 3783  O O     . ARG E 1 129 ? 133.393 117.455 122.284 1.00 17.98  ? 128 ARG E O     1 
ATOM 3784  C CB    . ARG E 1 129 ? 135.607 115.666 123.664 1.00 17.98  ? 128 ARG E CB    1 
ATOM 3785  C CG    . ARG E 1 129 ? 136.146 115.314 125.007 1.00 17.98  ? 128 ARG E CG    1 
ATOM 3786  C CD    . ARG E 1 129 ? 137.630 115.463 125.027 1.00 17.98  ? 128 ARG E CD    1 
ATOM 3787  N NE    . ARG E 1 129 ? 138.026 116.832 125.298 1.00 17.98  ? 128 ARG E NE    1 
ATOM 3788  C CZ    . ARG E 1 129 ? 139.010 117.458 124.669 1.00 17.98  ? 128 ARG E CZ    1 
ATOM 3789  N NH1   . ARG E 1 129 ? 139.701 116.836 123.733 1.00 17.98  ? 128 ARG E NH1   1 
ATOM 3790  N NH2   . ARG E 1 129 ? 139.305 118.704 124.982 1.00 17.98  ? 128 ARG E NH2   1 
ATOM 3791  N N     . ARG E 1 130 ? 133.476 115.480 121.218 1.00 20.19  ? 129 ARG E N     1 
ATOM 3792  C CA    . ARG E 1 130 ? 132.944 116.052 119.992 1.00 20.19  ? 129 ARG E CA    1 
ATOM 3793  C C     . ARG E 1 130 ? 131.465 116.402 120.104 1.00 20.19  ? 129 ARG E C     1 
ATOM 3794  O O     . ARG E 1 130 ? 131.033 117.403 119.528 1.00 20.19  ? 129 ARG E O     1 
ATOM 3795  C CB    . ARG E 1 130 ? 133.168 115.090 118.832 1.00 20.19  ? 129 ARG E CB    1 
ATOM 3796  C CG    . ARG E 1 130 ? 132.853 115.687 117.488 1.00 20.19  ? 129 ARG E CG    1 
ATOM 3797  C CD    . ARG E 1 130 ? 133.590 114.990 116.390 1.00 20.19  ? 129 ARG E CD    1 
ATOM 3798  N NE    . ARG E 1 130 ? 133.243 115.550 115.093 1.00 20.19  ? 129 ARG E NE    1 
ATOM 3799  C CZ    . ARG E 1 130 ? 133.500 114.958 113.935 1.00 20.19  ? 129 ARG E CZ    1 
ATOM 3800  N NH1   . ARG E 1 130 ? 134.108 113.782 113.911 1.00 20.19  ? 129 ARG E NH1   1 
ATOM 3801  N NH2   . ARG E 1 130 ? 133.142 115.541 112.800 1.00 20.19  ? 129 ARG E NH2   1 
ATOM 3802  N N     . ILE E 1 131 ? 130.673 115.610 120.830 1.00 19.84  ? 130 ILE E N     1 
ATOM 3803  C CA    . ILE E 1 131 ? 129.262 115.960 120.981 1.00 19.84  ? 130 ILE E CA    1 
ATOM 3804  C C     . ILE E 1 131 ? 129.113 117.181 121.881 1.00 19.84  ? 130 ILE E C     1 
ATOM 3805  O O     . ILE E 1 131 ? 128.290 118.063 121.618 1.00 19.84  ? 130 ILE E O     1 
ATOM 3806  C CB    . ILE E 1 131 ? 128.433 114.769 121.502 1.00 19.84  ? 130 ILE E CB    1 
ATOM 3807  C CG1   . ILE E 1 131 ? 128.600 113.518 120.648 1.00 19.84  ? 130 ILE E CG1   1 
ATOM 3808  C CG2   . ILE E 1 131 ? 126.973 115.094 121.487 1.00 19.84  ? 130 ILE E CG2   1 
ATOM 3809  C CD1   . ILE E 1 131 ? 128.431 113.720 119.193 1.00 19.84  ? 130 ILE E CD1   1 
ATOM 3810  N N     . ARG E 1 132 ? 129.925 117.278 122.928 1.00 17.74  ? 131 ARG E N     1 
ATOM 3811  C CA    . ARG E 1 132 ? 129.897 118.439 123.805 1.00 17.74  ? 131 ARG E CA    1 
ATOM 3812  C C     . ARG E 1 132 ? 130.438 119.698 123.150 1.00 17.74  ? 131 ARG E C     1 
ATOM 3813  O O     . ARG E 1 132 ? 130.018 120.795 123.521 1.00 17.74  ? 131 ARG E O     1 
ATOM 3814  C CB    . ARG E 1 132 ? 130.675 118.158 125.092 1.00 17.74  ? 131 ARG E CB    1 
ATOM 3815  C CG    . ARG E 1 132 ? 130.014 117.111 125.934 1.00 17.74  ? 131 ARG E CG    1 
ATOM 3816  C CD    . ARG E 1 132 ? 130.325 117.192 127.396 1.00 17.74  ? 131 ARG E CD    1 
ATOM 3817  N NE    . ARG E 1 132 ? 131.732 117.405 127.678 1.00 17.74  ? 131 ARG E NE    1 
ATOM 3818  C CZ    . ARG E 1 132 ? 132.268 117.283 128.886 1.00 17.74  ? 131 ARG E CZ    1 
ATOM 3819  N NH1   . ARG E 1 132 ? 131.519 116.940 129.918 1.00 17.74  ? 131 ARG E NH1   1 
ATOM 3820  N NH2   . ARG E 1 132 ? 133.550 117.516 129.061 1.00 17.74  ? 131 ARG E NH2   1 
ATOM 3821  N N     . GLY E 1 133 ? 131.334 119.575 122.181 1.00 19.97  ? 132 GLY E N     1 
ATOM 3822  C CA    . GLY E 1 133 ? 131.760 120.739 121.433 1.00 19.97  ? 132 GLY E CA    1 
ATOM 3823  C C     . GLY E 1 133 ? 133.085 121.279 121.910 1.00 19.97  ? 132 GLY E C     1 
ATOM 3824  O O     . GLY E 1 133 ? 133.245 122.485 122.108 1.00 19.97  ? 132 GLY E O     1 
ATOM 3825  N N     . GLU E 1 134 ? 134.043 120.385 122.101 1.00 21.39  ? 133 GLU E N     1 
ATOM 3826  C CA    . GLU E 1 134 ? 135.363 120.753 122.575 1.00 21.39  ? 133 GLU E CA    1 
ATOM 3827  C C     . GLU E 1 134 ? 136.408 120.487 121.506 1.00 21.39  ? 133 GLU E C     1 
ATOM 3828  O O     . GLU E 1 134 ? 136.564 119.359 121.047 1.00 21.39  ? 133 GLU E O     1 
ATOM 3829  C CB    . GLU E 1 134 ? 135.696 119.986 123.851 1.00 21.39  ? 133 GLU E CB    1 
ATOM 3830  C CG    . GLU E 1 134 ? 134.571 119.991 124.864 1.00 21.39  ? 133 GLU E CG    1 
ATOM 3831  C CD    . GLU E 1 134 ? 134.919 119.256 126.133 1.00 21.39  ? 133 GLU E CD    1 
ATOM 3832  O OE1   . GLU E 1 134 ? 135.912 118.509 126.134 1.00 21.39  ? 133 GLU E OE1   1 
ATOM 3833  O OE2   . GLU E 1 134 ? 134.198 119.417 127.134 1.00 21.39  ? 133 GLU E OE2   1 
ATOM 3834  N N     . ARG F 2 21  ? 164.248 130.217 141.428 1.00 57.78  ? 19  ARG F N     1 
ATOM 3835  C CA    . ARG F 2 21  ? 163.269 129.229 140.989 1.00 57.78  ? 19  ARG F CA    1 
ATOM 3836  C C     . ARG F 2 21  ? 163.846 128.335 139.894 1.00 57.78  ? 19  ARG F C     1 
ATOM 3837  O O     . ARG F 2 21  ? 164.788 128.720 139.200 1.00 57.78  ? 19  ARG F O     1 
ATOM 3838  C CB    . ARG F 2 21  ? 161.998 129.924 140.500 1.00 57.78  ? 19  ARG F CB    1 
ATOM 3839  C CG    . ARG F 2 21  ? 160.720 129.181 140.848 1.00 57.78  ? 19  ARG F CG    1 
ATOM 3840  C CD    . ARG F 2 21  ? 159.498 129.953 140.406 1.00 57.78  ? 19  ARG F CD    1 
ATOM 3841  N NE    . ARG F 2 21  ? 159.139 131.024 141.330 1.00 57.78  ? 19  ARG F NE    1 
ATOM 3842  C CZ    . ARG F 2 21  ? 158.151 130.943 142.215 1.00 57.78  ? 19  ARG F CZ    1 
ATOM 3843  N NH1   . ARG F 2 21  ? 157.429 129.835 142.300 1.00 57.78  ? 19  ARG F NH1   1 
ATOM 3844  N NH2   . ARG F 2 21  ? 157.881 131.967 143.016 1.00 57.78  ? 19  ARG F NH2   1 
ATOM 3845  N N     . LYS F 2 22  ? 163.287 127.137 139.753 1.00 62.27  ? 20  LYS F N     1 
ATOM 3846  C CA    . LYS F 2 22  ? 163.758 126.149 138.796 1.00 62.27  ? 20  LYS F CA    1 
ATOM 3847  C C     . LYS F 2 22  ? 162.610 125.699 137.897 1.00 62.27  ? 20  LYS F C     1 
ATOM 3848  O O     . LYS F 2 22  ? 161.456 125.612 138.323 1.00 62.27  ? 20  LYS F O     1 
ATOM 3849  C CB    . LYS F 2 22  ? 164.380 124.957 139.535 1.00 62.27  ? 20  LYS F CB    1 
ATOM 3850  C CG    . LYS F 2 22  ? 165.042 123.904 138.661 1.00 62.27  ? 20  LYS F CG    1 
ATOM 3851  C CD    . LYS F 2 22  ? 165.736 122.860 139.510 1.00 62.27  ? 20  LYS F CD    1 
ATOM 3852  C CE    . LYS F 2 22  ? 164.727 122.000 140.245 1.00 62.27  ? 20  LYS F CE    1 
ATOM 3853  N NZ    . LYS F 2 22  ? 165.389 120.896 140.984 1.00 62.27  ? 20  LYS F NZ    1 
ATOM 3854  N N     . VAL F 2 23  ? 162.938 125.423 136.635 1.00 55.89  ? 21  VAL F N     1 
ATOM 3855  C CA    . VAL F 2 23  ? 161.958 125.017 135.632 1.00 55.89  ? 21  VAL F CA    1 
ATOM 3856  C C     . VAL F 2 23  ? 161.551 123.568 135.886 1.00 55.89  ? 21  VAL F C     1 
ATOM 3857  O O     . VAL F 2 23  ? 162.398 122.717 136.179 1.00 55.89  ? 21  VAL F O     1 
ATOM 3858  C CB    . VAL F 2 23  ? 162.534 125.217 134.213 1.00 55.89  ? 21  VAL F CB    1 
ATOM 3859  C CG1   . VAL F 2 23  ? 161.645 124.616 133.140 1.00 55.89  ? 21  VAL F CG1   1 
ATOM 3860  C CG2   . VAL F 2 23  ? 162.756 126.695 133.939 1.00 55.89  ? 21  VAL F CG2   1 
ATOM 3861  N N     . LEU F 2 24  ? 160.254 123.286 135.804 1.00 48.02  ? 22  LEU F N     1 
ATOM 3862  C CA    . LEU F 2 24  ? 159.704 121.953 135.981 1.00 48.02  ? 22  LEU F CA    1 
ATOM 3863  C C     . LEU F 2 24  ? 159.365 121.371 134.616 1.00 48.02  ? 22  LEU F C     1 
ATOM 3864  O O     . LEU F 2 24  ? 158.894 122.093 133.733 1.00 48.02  ? 22  LEU F O     1 
ATOM 3865  C CB    . LEU F 2 24  ? 158.438 121.992 136.838 1.00 48.02  ? 22  LEU F CB    1 
ATOM 3866  C CG    . LEU F 2 24  ? 158.462 122.263 138.345 1.00 48.02  ? 22  LEU F CG    1 
ATOM 3867  C CD1   . LEU F 2 24  ? 158.613 123.743 138.662 1.00 48.02  ? 22  LEU F CD1   1 
ATOM 3868  C CD2   . LEU F 2 24  ? 157.216 121.720 138.997 1.00 48.02  ? 22  LEU F CD2   1 
ATOM 3869  N N     . ARG F 2 25  ? 159.594 120.070 134.435 1.00 49.50  ? 23  ARG F N     1 
ATOM 3870  C CA    . ARG F 2 25  ? 159.237 119.394 133.191 1.00 49.50  ? 23  ARG F CA    1 
ATOM 3871  C C     . ARG F 2 25  ? 158.485 118.104 133.474 1.00 49.50  ? 23  ARG F C     1 
ATOM 3872  O O     . ARG F 2 25  ? 158.845 117.361 134.392 1.00 49.50  ? 23  ARG F O     1 
ATOM 3873  C CB    . ARG F 2 25  ? 160.465 119.072 132.327 1.00 49.50  ? 23  ARG F CB    1 
ATOM 3874  C CG    . ARG F 2 25  ? 160.951 120.212 131.457 1.00 49.50  ? 23  ARG F CG    1 
ATOM 3875  C CD    . ARG F 2 25  ? 161.960 121.056 132.197 1.00 49.50  ? 23  ARG F CD    1 
ATOM 3876  N NE    . ARG F 2 25  ? 163.185 120.308 132.479 1.00 49.50  ? 23  ARG F NE    1 
ATOM 3877  C CZ    . ARG F 2 25  ? 164.132 120.697 133.325 1.00 49.50  ? 23  ARG F CZ    1 
ATOM 3878  N NH1   . ARG F 2 25  ? 164.014 121.836 133.991 1.00 49.50  ? 23  ARG F NH1   1 
ATOM 3879  N NH2   . ARG F 2 25  ? 165.204 119.943 133.502 1.00 49.50  ? 23  ARG F NH2   1 
ATOM 3880  N N     . ASP F 2 26  ? 157.437 117.867 132.678 1.00 40.27  ? 24  ASP F N     1 
ATOM 3881  C CA    . ASP F 2 26  ? 156.708 116.597 132.559 1.00 40.27  ? 24  ASP F CA    1 
ATOM 3882  C C     . ASP F 2 26  ? 156.113 116.165 133.902 1.00 40.27  ? 24  ASP F C     1 
ATOM 3883  O O     . ASP F 2 26  ? 156.446 115.125 134.467 1.00 40.27  ? 24  ASP F O     1 
ATOM 3884  C CB    . ASP F 2 26  ? 157.603 115.510 131.954 1.00 40.27  ? 24  ASP F CB    1 
ATOM 3885  C CG    . ASP F 2 26  ? 156.810 114.363 131.345 1.00 40.27  ? 24  ASP F CG    1 
ATOM 3886  O OD1   . ASP F 2 26  ? 155.999 113.726 132.040 1.00 40.27  ? 24  ASP F OD1   1 
ATOM 3887  O OD2   . ASP F 2 26  ? 156.987 114.116 130.134 1.00 40.27  ? 24  ASP F OD2   1 
ATOM 3888  N N     . ASN F 2 27  ? 155.231 117.014 134.412 1.00 33.20  ? 25  ASN F N     1 
ATOM 3889  C CA    . ASN F 2 27  ? 154.489 116.740 135.627 1.00 33.20  ? 25  ASN F CA    1 
ATOM 3890  C C     . ASN F 2 27  ? 153.117 116.172 135.338 1.00 33.20  ? 25  ASN F C     1 
ATOM 3891  O O     . ASN F 2 27  ? 152.341 115.954 136.270 1.00 33.20  ? 25  ASN F O     1 
ATOM 3892  C CB    . ASN F 2 27  ? 154.364 118.007 136.457 1.00 33.20  ? 25  ASN F CB    1 
ATOM 3893  C CG    . ASN F 2 27  ? 155.691 118.552 136.862 1.00 33.20  ? 25  ASN F CG    1 
ATOM 3894  O OD1   . ASN F 2 27  ? 156.392 117.968 137.678 1.00 33.20  ? 25  ASN F OD1   1 
ATOM 3895  N ND2   . ASN F 2 27  ? 156.062 119.666 136.281 1.00 33.20  ? 25  ASN F ND2   1 
ATOM 3896  N N     . ILE F 2 28  ? 152.803 115.920 134.066 1.00 28.18  ? 26  ILE F N     1 
ATOM 3897  C CA    . ILE F 2 28  ? 151.519 115.340 133.711 1.00 28.18  ? 26  ILE F CA    1 
ATOM 3898  C C     . ILE F 2 28  ? 151.461 113.869 134.097 1.00 28.18  ? 26  ILE F C     1 
ATOM 3899  O O     . ILE F 2 28  ? 150.373 113.328 134.295 1.00 28.18  ? 26  ILE F O     1 
ATOM 3900  C CB    . ILE F 2 28  ? 151.245 115.585 132.211 1.00 28.18  ? 26  ILE F CB    1 
ATOM 3901  C CG1   . ILE F 2 28  ? 149.769 115.409 131.875 1.00 28.18  ? 26  ILE F CG1   1 
ATOM 3902  C CG2   . ILE F 2 28  ? 152.099 114.695 131.338 1.00 28.18  ? 26  ILE F CG2   1 
ATOM 3903  C CD1   . ILE F 2 28  ? 148.856 116.244 132.694 1.00 28.18  ? 26  ILE F CD1   1 
ATOM 3904  N N     . GLN F 2 29  ? 152.603 113.218 134.266 1.00 28.58  ? 27  GLN F N     1 
ATOM 3905  C CA    . GLN F 2 29  ? 152.644 111.853 134.759 1.00 28.58  ? 27  GLN F CA    1 
ATOM 3906  C C     . GLN F 2 29  ? 152.493 111.769 136.268 1.00 28.58  ? 27  GLN F C     1 
ATOM 3907  O O     . GLN F 2 29  ? 152.458 110.660 136.808 1.00 28.58  ? 27  GLN F O     1 
ATOM 3908  C CB    . GLN F 2 29  ? 153.948 111.189 134.330 1.00 28.58  ? 27  GLN F CB    1 
ATOM 3909  C CG    . GLN F 2 29  ? 154.127 111.152 132.839 1.00 28.58  ? 27  GLN F CG    1 
ATOM 3910  C CD    . GLN F 2 29  ? 153.220 110.154 132.185 1.00 28.58  ? 27  GLN F CD    1 
ATOM 3911  O OE1   . GLN F 2 29  ? 153.151 109.002 132.602 1.00 28.58  ? 27  GLN F OE1   1 
ATOM 3912  N NE2   . GLN F 2 29  ? 152.510 110.584 131.152 1.00 28.58  ? 27  GLN F NE2   1 
ATOM 3913  N N     . GLY F 2 30  ? 152.430 112.904 136.960 1.00 26.19  ? 28  GLY F N     1 
ATOM 3914  C CA    . GLY F 2 30  ? 151.993 112.933 138.337 1.00 26.19  ? 28  GLY F CA    1 
ATOM 3915  C C     . GLY F 2 30  ? 150.519 112.693 138.514 1.00 26.19  ? 28  GLY F C     1 
ATOM 3916  O O     . GLY F 2 30  ? 150.083 112.361 139.617 1.00 26.19  ? 28  GLY F O     1 
ATOM 3917  N N     . ILE F 2 31  ? 149.743 112.860 137.449 1.00 23.56  ? 29  ILE F N     1 
ATOM 3918  C CA    . ILE F 2 31  ? 148.358 112.399 137.407 1.00 23.56  ? 29  ILE F CA    1 
ATOM 3919  C C     . ILE F 2 31  ? 148.454 110.920 137.056 1.00 23.56  ? 29  ILE F C     1 
ATOM 3920  O O     . ILE F 2 31  ? 148.458 110.531 135.894 1.00 23.56  ? 29  ILE F O     1 
ATOM 3921  C CB    . ILE F 2 31  ? 147.523 113.187 136.406 1.00 23.56  ? 29  ILE F CB    1 
ATOM 3922  C CG1   . ILE F 2 31  ? 147.913 114.664 136.441 1.00 23.56  ? 29  ILE F CG1   1 
ATOM 3923  C CG2   . ILE F 2 31  ? 146.052 112.996 136.674 1.00 23.56  ? 29  ILE F CG2   1 
ATOM 3924  C CD1   . ILE F 2 31  ? 147.519 115.386 137.699 1.00 23.56  ? 29  ILE F CD1   1 
ATOM 3925  N N     . THR F 2 32  ? 148.562 110.093 138.082 1.00 23.06  ? 30  THR F N     1 
ATOM 3926  C CA    . THR F 2 32  ? 148.918 108.698 137.907 1.00 23.06  ? 30  THR F CA    1 
ATOM 3927  C C     . THR F 2 32  ? 147.715 107.927 137.391 1.00 23.06  ? 30  THR F C     1 
ATOM 3928  O O     . THR F 2 32  ? 146.589 108.421 137.384 1.00 23.06  ? 30  THR F O     1 
ATOM 3929  C CB    . THR F 2 32  ? 149.440 108.127 139.216 1.00 23.06  ? 30  THR F CB    1 
ATOM 3930  O OG1   . THR F 2 32  ? 148.382 108.095 140.172 1.00 23.06  ? 30  THR F OG1   1 
ATOM 3931  C CG2   . THR F 2 32  ? 150.538 108.990 139.755 1.00 23.06  ? 30  THR F CG2   1 
ATOM 3932  N N     . LYS F 2 33  ? 147.954 106.717 136.926 1.00 21.30  ? 31  LYS F N     1 
ATOM 3933  C CA    . LYS F 2 33  ? 146.922 105.774 136.525 1.00 21.30  ? 31  LYS F CA    1 
ATOM 3934  C C     . LYS F 2 33  ? 145.925 105.431 137.643 1.00 21.30  ? 31  LYS F C     1 
ATOM 3935  O O     . LYS F 2 33  ? 144.727 105.361 137.343 1.00 21.30  ? 31  LYS F O     1 
ATOM 3936  C CB    . LYS F 2 33  ? 147.593 104.521 135.946 1.00 21.30  ? 31  LYS F CB    1 
ATOM 3937  C CG    . LYS F 2 33  ? 146.841 103.236 136.142 1.00 21.30  ? 31  LYS F CG    1 
ATOM 3938  C CD    . LYS F 2 33  ? 147.546 102.072 135.512 1.00 21.30  ? 31  LYS F CD    1 
ATOM 3939  C CE    . LYS F 2 33  ? 146.652 100.850 135.536 1.00 21.30  ? 31  LYS F CE    1 
ATOM 3940  N NZ    . LYS F 2 33  ? 147.408 99.596  135.302 1.00 21.30  ? 31  LYS F NZ    1 
ATOM 3941  N N     . PRO F 2 34  ? 146.319 105.235 138.921 1.00 19.74  ? 32  PRO F N     1 
ATOM 3942  C CA    . PRO F 2 34  ? 145.290 105.079 139.960 1.00 19.74  ? 32  PRO F CA    1 
ATOM 3943  C C     . PRO F 2 34  ? 144.428 106.301 140.204 1.00 19.74  ? 32  PRO F C     1 
ATOM 3944  O O     . PRO F 2 34  ? 143.255 106.130 140.548 1.00 19.74  ? 32  PRO F O     1 
ATOM 3945  C CB    . PRO F 2 34  ? 146.105 104.737 141.201 1.00 19.74  ? 32  PRO F CB    1 
ATOM 3946  C CG    . PRO F 2 34  ? 147.260 104.097 140.691 1.00 19.74  ? 32  PRO F CG    1 
ATOM 3947  C CD    . PRO F 2 34  ? 147.624 104.844 139.492 1.00 19.74  ? 32  PRO F CD    1 
ATOM 3948  N N     . ALA F 2 35  ? 144.940 107.515 140.018 1.00 18.18  ? 33  ALA F N     1 
ATOM 3949  C CA    . ALA F 2 35  ? 144.108 108.701 140.191 1.00 18.18  ? 33  ALA F CA    1 
ATOM 3950  C C     . ALA F 2 35  ? 143.062 108.812 139.093 1.00 18.18  ? 33  ALA F C     1 
ATOM 3951  O O     . ALA F 2 35  ? 141.908 109.162 139.359 1.00 18.18  ? 33  ALA F O     1 
ATOM 3952  C CB    . ALA F 2 35  ? 144.981 109.948 140.223 1.00 18.18  ? 33  ALA F CB    1 
ATOM 3953  N N     . ILE F 2 36  ? 143.453 108.507 137.856 1.00 17.45  ? 34  ILE F N     1 
ATOM 3954  C CA    . ILE F 2 36  ? 142.522 108.462 136.739 1.00 17.45  ? 34  ILE F CA    1 
ATOM 3955  C C     . ILE F 2 36  ? 141.504 107.352 136.936 1.00 17.45  ? 34  ILE F C     1 
ATOM 3956  O O     . ILE F 2 36  ? 140.325 107.515 136.601 1.00 17.45  ? 34  ILE F O     1 
ATOM 3957  C CB    . ILE F 2 36  ? 143.316 108.308 135.431 1.00 17.45  ? 34  ILE F CB    1 
ATOM 3958  C CG1   . ILE F 2 36  ? 144.283 109.478 135.272 1.00 17.45  ? 34  ILE F CG1   1 
ATOM 3959  C CG2   . ILE F 2 36  ? 142.405 108.209 134.226 1.00 17.45  ? 34  ILE F CG2   1 
ATOM 3960  C CD1   . ILE F 2 36  ? 145.200 109.364 134.108 1.00 17.45  ? 34  ILE F CD1   1 
ATOM 3961  N N     . ARG F 2 37  ? 141.912 106.235 137.539 1.00 20.51  ? 35  ARG F N     1 
ATOM 3962  C CA    . ARG F 2 37  ? 140.962 105.169 137.834 1.00 20.51  ? 35  ARG F CA    1 
ATOM 3963  C C     . ARG F 2 37  ? 139.977 105.571 138.920 1.00 20.51  ? 35  ARG F C     1 
ATOM 3964  O O     . ARG F 2 37  ? 138.815 105.181 138.865 1.00 20.51  ? 35  ARG F O     1 
ATOM 3965  C CB    . ARG F 2 37  ? 141.696 103.905 138.239 1.00 20.51  ? 35  ARG F CB    1 
ATOM 3966  C CG    . ARG F 2 37  ? 142.288 103.176 137.086 1.00 20.51  ? 35  ARG F CG    1 
ATOM 3967  C CD    . ARG F 2 37  ? 143.156 102.051 137.557 1.00 20.51  ? 35  ARG F CD    1 
ATOM 3968  N NE    . ARG F 2 37  ? 142.365 100.958 138.088 1.00 20.51  ? 35  ARG F NE    1 
ATOM 3969  C CZ    . ARG F 2 37  ? 141.855 99.987  137.344 1.00 20.51  ? 35  ARG F CZ    1 
ATOM 3970  N NH1   . ARG F 2 37  ? 142.050 99.982  136.036 1.00 20.51  ? 35  ARG F NH1   1 
ATOM 3971  N NH2   . ARG F 2 37  ? 141.153 99.018  137.910 1.00 20.51  ? 35  ARG F NH2   1 
ATOM 3972  N N     . ARG F 2 38  ? 140.413 106.363 139.903 1.00 16.63  ? 36  ARG F N     1 
ATOM 3973  C CA    . ARG F 2 38  ? 139.490 106.861 140.922 1.00 16.63  ? 36  ARG F CA    1 
ATOM 3974  C C     . ARG F 2 38  ? 138.494 107.854 140.342 1.00 16.63  ? 36  ARG F C     1 
ATOM 3975  O O     . ARG F 2 38  ? 137.315 107.849 140.713 1.00 16.63  ? 36  ARG F O     1 
ATOM 3976  C CB    . ARG F 2 38  ? 140.259 107.515 142.056 1.00 16.63  ? 36  ARG F CB    1 
ATOM 3977  C CG    . ARG F 2 38  ? 140.865 106.554 143.005 1.00 16.63  ? 36  ARG F CG    1 
ATOM 3978  C CD    . ARG F 2 38  ? 141.337 107.246 144.243 1.00 16.63  ? 36  ARG F CD    1 
ATOM 3979  N NE    . ARG F 2 38  ? 142.418 108.173 143.976 1.00 16.63  ? 36  ARG F NE    1 
ATOM 3980  C CZ    . ARG F 2 38  ? 143.697 107.833 143.932 1.00 16.63  ? 36  ARG F CZ    1 
ATOM 3981  N NH1   . ARG F 2 38  ? 144.055 106.580 144.127 1.00 16.63  ? 36  ARG F NH1   1 
ATOM 3982  N NH2   . ARG F 2 38  ? 144.613 108.746 143.686 1.00 16.63  ? 36  ARG F NH2   1 
ATOM 3983  N N     . LEU F 2 39  ? 138.950 108.718 139.436 1.00 17.09  ? 37  LEU F N     1 
ATOM 3984  C CA    . LEU F 2 39  ? 138.036 109.645 138.779 1.00 17.09  ? 37  LEU F CA    1 
ATOM 3985  C C     . LEU F 2 39  ? 137.053 108.919 137.880 1.00 17.09  ? 37  LEU F C     1 
ATOM 3986  O O     . LEU F 2 39  ? 135.903 109.344 137.750 1.00 17.09  ? 37  LEU F O     1 
ATOM 3987  C CB    . LEU F 2 39  ? 138.812 110.671 137.970 1.00 17.09  ? 37  LEU F CB    1 
ATOM 3988  C CG    . LEU F 2 39  ? 139.663 111.664 138.743 1.00 17.09  ? 37  LEU F CG    1 
ATOM 3989  C CD1   . LEU F 2 39  ? 140.692 112.224 137.827 1.00 17.09  ? 37  LEU F CD1   1 
ATOM 3990  C CD2   . LEU F 2 39  ? 138.803 112.754 139.258 1.00 17.09  ? 37  LEU F CD2   1 
ATOM 3991  N N     . ALA F 2 40  ? 137.478 107.815 137.272 1.00 16.90  ? 38  ALA F N     1 
ATOM 3992  C CA    . ALA F 2 40  ? 136.548 107.016 136.491 1.00 16.90  ? 38  ALA F CA    1 
ATOM 3993  C C     . ALA F 2 40  ? 135.577 106.253 137.376 1.00 16.90  ? 38  ALA F C     1 
ATOM 3994  O O     . ALA F 2 40  ? 134.423 106.076 136.996 1.00 16.90  ? 38  ALA F O     1 
ATOM 3995  C CB    . ALA F 2 40  ? 137.312 106.063 135.591 1.00 16.90  ? 38  ALA F CB    1 
ATOM 3996  N N     . ARG F 2 41  ? 136.018 105.799 138.550 1.00 17.58  ? 39  ARG F N     1 
ATOM 3997  C CA    . ARG F 2 41  ? 135.115 105.148 139.497 1.00 17.58  ? 39  ARG F CA    1 
ATOM 3998  C C     . ARG F 2 41  ? 134.049 106.104 139.996 1.00 17.58  ? 39  ARG F C     1 
ATOM 3999  O O     . ARG F 2 41  ? 132.888 105.720 140.129 1.00 17.58  ? 39  ARG F O     1 
ATOM 4000  C CB    . ARG F 2 41  ? 135.891 104.599 140.687 1.00 17.58  ? 39  ARG F CB    1 
ATOM 4001  C CG    . ARG F 2 41  ? 136.700 103.366 140.444 1.00 17.58  ? 39  ARG F CG    1 
ATOM 4002  C CD    . ARG F 2 41  ? 135.938 102.307 139.733 1.00 17.58  ? 39  ARG F CD    1 
ATOM 4003  N NE    . ARG F 2 41  ? 136.789 101.164 139.472 1.00 17.58  ? 39  ARG F NE    1 
ATOM 4004  C CZ    . ARG F 2 41  ? 137.224 100.839 138.270 1.00 17.58  ? 39  ARG F CZ    1 
ATOM 4005  N NH1   . ARG F 2 41  ? 136.874 101.567 137.230 1.00 17.58  ? 39  ARG F NH1   1 
ATOM 4006  N NH2   . ARG F 2 41  ? 137.998 99.785  138.107 1.00 17.58  ? 39  ARG F NH2   1 
ATOM 4007  N N     . ARG F 2 42  ? 134.423 107.348 140.292 1.00 16.05  ? 40  ARG F N     1 
ATOM 4008  C CA    . ARG F 2 42  ? 133.421 108.352 140.631 1.00 16.05  ? 40  ARG F CA    1 
ATOM 4009  C C     . ARG F 2 42  ? 132.529 108.680 139.439 1.00 16.05  ? 40  ARG F C     1 
ATOM 4010  O O     . ARG F 2 42  ? 131.344 108.964 139.617 1.00 16.05  ? 40  ARG F O     1 
ATOM 4011  C CB    . ARG F 2 42  ? 134.091 109.612 141.168 1.00 16.05  ? 40  ARG F CB    1 
ATOM 4012  C CG    . ARG F 2 42  ? 133.124 110.592 141.761 1.00 16.05  ? 40  ARG F CG    1 
ATOM 4013  C CD    . ARG F 2 42  ? 133.811 111.690 142.496 1.00 16.05  ? 40  ARG F CD    1 
ATOM 4014  N NE    . ARG F 2 42  ? 134.107 111.296 143.859 1.00 16.05  ? 40  ARG F NE    1 
ATOM 4015  C CZ    . ARG F 2 42  ? 134.839 112.011 144.695 1.00 16.05  ? 40  ARG F CZ    1 
ATOM 4016  N NH1   . ARG F 2 42  ? 135.348 113.163 144.310 1.00 16.05  ? 40  ARG F NH1   1 
ATOM 4017  N NH2   . ARG F 2 42  ? 135.059 111.565 145.914 1.00 16.05  ? 40  ARG F NH2   1 
ATOM 4018  N N     . GLY F 2 43  ? 133.055 108.602 138.220 1.00 16.48  ? 41  GLY F N     1 
ATOM 4019  C CA    . GLY F 2 43  ? 132.211 108.745 137.050 1.00 16.48  ? 41  GLY F CA    1 
ATOM 4020  C C     . GLY F 2 43  ? 131.354 107.537 136.719 1.00 16.48  ? 41  GLY F C     1 
ATOM 4021  O O     . GLY F 2 43  ? 130.618 107.582 135.731 1.00 16.48  ? 41  GLY F O     1 
ATOM 4022  N N     . GLY F 2 44  ? 131.438 106.467 137.498 1.00 18.06  ? 42  GLY F N     1 
ATOM 4023  C CA    . GLY F 2 44  ? 130.625 105.294 137.288 1.00 18.06  ? 42  GLY F CA    1 
ATOM 4024  C C     . GLY F 2 44  ? 131.178 104.275 136.326 1.00 18.06  ? 42  GLY F C     1 
ATOM 4025  O O     . GLY F 2 44  ? 130.403 103.477 135.801 1.00 18.06  ? 42  GLY F O     1 
ATOM 4026  N N     . VAL F 2 45  ? 132.480 104.264 136.088 1.00 17.68  ? 43  VAL F N     1 
ATOM 4027  C CA    . VAL F 2 45  ? 133.081 103.441 135.049 1.00 17.68  ? 43  VAL F CA    1 
ATOM 4028  C C     . VAL F 2 45  ? 133.615 102.161 135.669 1.00 17.68  ? 43  VAL F C     1 
ATOM 4029  O O     . VAL F 2 45  ? 134.386 102.201 136.631 1.00 17.68  ? 43  VAL F O     1 
ATOM 4030  C CB    . VAL F 2 45  ? 134.191 104.211 134.319 1.00 17.68  ? 43  VAL F CB    1 
ATOM 4031  C CG1   . VAL F 2 45  ? 134.964 103.307 133.412 1.00 17.68  ? 43  VAL F CG1   1 
ATOM 4032  C CG2   . VAL F 2 45  ? 133.605 105.360 133.552 1.00 17.68  ? 43  VAL F CG2   1 
ATOM 4033  N N     . LYS F 2 46  ? 133.214 101.023 135.107 1.00 23.02  ? 44  LYS F N     1 
ATOM 4034  C CA    . LYS F 2 46  ? 133.547 99.717  135.653 1.00 23.02  ? 44  LYS F CA    1 
ATOM 4035  C C     . LYS F 2 46  ? 134.832 99.143  135.086 1.00 23.02  ? 44  LYS F C     1 
ATOM 4036  O O     . LYS F 2 46  ? 135.600 98.523  135.822 1.00 23.02  ? 44  LYS F O     1 
ATOM 4037  C CB    . LYS F 2 46  ? 132.400 98.751  135.384 1.00 23.02  ? 44  LYS F CB    1 
ATOM 4038  C CG    . LYS F 2 46  ? 132.417 97.485  136.190 1.00 23.02  ? 44  LYS F CG    1 
ATOM 4039  C CD    . LYS F 2 46  ? 131.317 96.563  135.716 1.00 23.02  ? 44  LYS F CD    1 
ATOM 4040  C CE    . LYS F 2 46  ? 131.300 95.283  136.503 1.00 23.02  ? 44  LYS F CE    1 
ATOM 4041  N NZ    . LYS F 2 46  ? 130.244 94.360  136.038 1.00 23.02  ? 44  LYS F NZ    1 
ATOM 4042  N N     . ARG F 2 47  ? 135.096 99.344  133.805 1.00 24.66  ? 45  ARG F N     1 
ATOM 4043  C CA    . ARG F 2 47  ? 136.226 98.718  133.144 1.00 24.66  ? 45  ARG F CA    1 
ATOM 4044  C C     . ARG F 2 47  ? 136.882 99.740  132.235 1.00 24.66  ? 45  ARG F C     1 
ATOM 4045  O O     . ARG F 2 47  ? 136.197 100.468 131.521 1.00 24.66  ? 45  ARG F O     1 
ATOM 4046  C CB    . ARG F 2 47  ? 135.754 97.500  132.368 1.00 24.66  ? 45  ARG F CB    1 
ATOM 4047  C CG    . ARG F 2 47  ? 136.810 96.529  131.973 1.00 24.66  ? 45  ARG F CG    1 
ATOM 4048  C CD    . ARG F 2 47  ? 136.159 95.326  131.356 1.00 24.66  ? 45  ARG F CD    1 
ATOM 4049  N NE    . ARG F 2 47  ? 137.001 94.748  130.330 1.00 24.66  ? 45  ARG F NE    1 
ATOM 4050  C CZ    . ARG F 2 47  ? 137.790 93.706  130.524 1.00 24.66  ? 45  ARG F CZ    1 
ATOM 4051  N NH1   . ARG F 2 47  ? 137.828 93.122  131.709 1.00 24.66  ? 45  ARG F NH1   1 
ATOM 4052  N NH2   . ARG F 2 47  ? 138.534 93.244  129.535 1.00 24.66  ? 45  ARG F NH2   1 
ATOM 4053  N N     . ILE F 2 48  ? 138.206 99.819  132.290 1.00 24.04  ? 46  ILE F N     1 
ATOM 4054  C CA    . ILE F 2 48  ? 138.966 100.912 131.694 1.00 24.04  ? 46  ILE F CA    1 
ATOM 4055  C C     . ILE F 2 48  ? 140.025 100.332 130.771 1.00 24.04  ? 46  ILE F C     1 
ATOM 4056  O O     . ILE F 2 48  ? 140.805 99.476  131.186 1.00 24.04  ? 46  ILE F O     1 
ATOM 4057  C CB    . ILE F 2 48  ? 139.634 101.784 132.772 1.00 24.04  ? 46  ILE F CB    1 
ATOM 4058  C CG1   . ILE F 2 48  ? 138.619 102.292 133.780 1.00 24.04  ? 46  ILE F CG1   1 
ATOM 4059  C CG2   . ILE F 2 48  ? 140.311 102.948 132.158 1.00 24.04  ? 46  ILE F CG2   1 
ATOM 4060  C CD1   . ILE F 2 48  ? 139.232 102.965 134.931 1.00 24.04  ? 46  ILE F CD1   1 
ATOM 4061  N N     . SER F 2 49  ? 140.075 100.814 129.536 1.00 23.93  ? 47  SER F N     1 
ATOM 4062  C CA    . SER F 2 49  ? 141.127 100.403 128.626 1.00 23.93  ? 47  SER F CA    1 
ATOM 4063  C C     . SER F 2 49  ? 142.457 101.032 129.020 1.00 23.93  ? 47  SER F C     1 
ATOM 4064  O O     . SER F 2 49  ? 142.519 101.993 129.782 1.00 23.93  ? 47  SER F O     1 
ATOM 4065  C CB    . SER F 2 49  ? 140.776 100.785 127.196 1.00 23.93  ? 47  SER F CB    1 
ATOM 4066  O OG    . SER F 2 49  ? 141.915 100.771 126.371 1.00 23.93  ? 47  SER F OG    1 
ATOM 4067  N N     . GLY F 2 50  ? 143.539 100.475 128.483 1.00 22.98  ? 48  GLY F N     1 
ATOM 4068  C CA    . GLY F 2 50  ? 144.860 100.934 128.863 1.00 22.98  ? 48  GLY F CA    1 
ATOM 4069  C C     . GLY F 2 50  ? 145.296 102.210 128.193 1.00 22.98  ? 48  GLY F C     1 
ATOM 4070  O O     . GLY F 2 50  ? 146.207 102.876 128.689 1.00 22.98  ? 48  GLY F O     1 
ATOM 4071  N N     . LEU F 2 51  ? 144.673 102.566 127.081 1.00 22.62  ? 49  LEU F N     1 
ATOM 4072  C CA    . LEU F 2 51  ? 144.966 103.798 126.369 1.00 22.62  ? 49  LEU F CA    1 
ATOM 4073  C C     . LEU F 2 51  ? 144.147 104.973 126.872 1.00 22.62  ? 49  LEU F C     1 
ATOM 4074  O O     . LEU F 2 51  ? 144.200 106.048 126.276 1.00 22.62  ? 49  LEU F O     1 
ATOM 4075  C CB    . LEU F 2 51  ? 144.716 103.610 124.877 1.00 22.62  ? 49  LEU F CB    1 
ATOM 4076  C CG    . LEU F 2 51  ? 145.239 102.340 124.227 1.00 22.62  ? 49  LEU F CG    1 
ATOM 4077  C CD1   . LEU F 2 51  ? 144.696 102.252 122.827 1.00 22.62  ? 49  LEU F CD1   1 
ATOM 4078  C CD2   . LEU F 2 51  ? 146.745 102.359 124.214 1.00 22.62  ? 49  LEU F CD2   1 
ATOM 4079  N N     . ILE F 2 52  ? 143.383 104.785 127.944 1.00 20.86  ? 50  ILE F N     1 
ATOM 4080  C CA    . ILE F 2 52  ? 142.573 105.856 128.504 1.00 20.86  ? 50  ILE F CA    1 
ATOM 4081  C C     . ILE F 2 52  ? 143.442 106.847 129.259 1.00 20.86  ? 50  ILE F C     1 
ATOM 4082  O O     . ILE F 2 52  ? 143.139 108.041 129.297 1.00 20.86  ? 50  ILE F O     1 
ATOM 4083  C CB    . ILE F 2 52  ? 141.469 105.221 129.372 1.00 20.86  ? 50  ILE F CB    1 
ATOM 4084  C CG1   . ILE F 2 52  ? 140.336 104.765 128.480 1.00 20.86  ? 50  ILE F CG1   1 
ATOM 4085  C CG2   . ILE F 2 52  ? 140.912 106.152 130.448 1.00 20.86  ? 50  ILE F CG2   1 
ATOM 4086  C CD1   . ILE F 2 52  ? 139.644 105.879 127.848 1.00 20.86  ? 50  ILE F CD1   1 
ATOM 4087  N N     . TYR F 2 53  ? 144.570 106.397 129.800 1.00 21.11  ? 51  TYR F N     1 
ATOM 4088  C CA    . TYR F 2 53  ? 145.335 107.234 130.715 1.00 21.11  ? 51  TYR F CA    1 
ATOM 4089  C C     . TYR F 2 53  ? 146.063 108.359 129.993 1.00 21.11  ? 51  TYR F C     1 
ATOM 4090  O O     . TYR F 2 53  ? 146.054 109.501 130.463 1.00 21.11  ? 51  TYR F O     1 
ATOM 4091  C CB    . TYR F 2 53  ? 146.288 106.361 131.518 1.00 21.11  ? 51  TYR F CB    1 
ATOM 4092  C CG    . TYR F 2 53  ? 145.567 105.224 132.187 1.00 21.11  ? 51  TYR F CG    1 
ATOM 4093  C CD1   . TYR F 2 53  ? 144.576 105.466 133.118 1.00 21.11  ? 51  TYR F CD1   1 
ATOM 4094  C CD2   . TYR F 2 53  ? 145.851 103.915 131.866 1.00 21.11  ? 51  TYR F CD2   1 
ATOM 4095  C CE1   . TYR F 2 53  ? 143.899 104.439 133.716 1.00 21.11  ? 51  TYR F CE1   1 
ATOM 4096  C CE2   . TYR F 2 53  ? 145.180 102.884 132.463 1.00 21.11  ? 51  TYR F CE2   1 
ATOM 4097  C CZ    . TYR F 2 53  ? 144.204 103.152 133.382 1.00 21.11  ? 51  TYR F CZ    1 
ATOM 4098  O OH    . TYR F 2 53  ? 143.537 102.114 133.973 1.00 21.11  ? 51  TYR F OH    1 
ATOM 4099  N N     . GLU F 2 54  ? 146.641 108.090 128.825 1.00 24.00  ? 52  GLU F N     1 
ATOM 4100  C CA    . GLU F 2 54  ? 147.244 109.169 128.050 1.00 24.00  ? 52  GLU F CA    1 
ATOM 4101  C C     . GLU F 2 54  ? 146.220 110.110 127.432 1.00 24.00  ? 52  GLU F C     1 
ATOM 4102  O O     . GLU F 2 54  ? 146.478 111.318 127.353 1.00 24.00  ? 52  GLU F O     1 
ATOM 4103  C CB    . GLU F 2 54  ? 148.138 108.602 126.955 1.00 24.00  ? 52  GLU F CB    1 
ATOM 4104  C CG    . GLU F 2 54  ? 149.386 107.944 127.481 1.00 24.00  ? 52  GLU F CG    1 
ATOM 4105  C CD    . GLU F 2 54  ? 150.341 108.926 128.134 1.00 24.00  ? 52  GLU F CD    1 
ATOM 4106  O OE1   . GLU F 2 54  ? 150.385 110.098 127.702 1.00 24.00  ? 52  GLU F OE1   1 
ATOM 4107  O OE2   . GLU F 2 54  ? 151.049 108.527 129.080 1.00 24.00  ? 52  GLU F OE2   1 
ATOM 4108  N N     . GLU F 2 55  ? 145.066 109.593 127.015 1.00 22.56  ? 53  GLU F N     1 
ATOM 4109  C CA    . GLU F 2 55  ? 144.004 110.445 126.497 1.00 22.56  ? 53  GLU F CA    1 
ATOM 4110  C C     . GLU F 2 55  ? 143.462 111.359 127.584 1.00 22.56  ? 53  GLU F C     1 
ATOM 4111  O O     . GLU F 2 55  ? 143.202 112.542 127.346 1.00 22.56  ? 53  GLU F O     1 
ATOM 4112  C CB    . GLU F 2 55  ? 142.897 109.575 125.909 1.00 22.56  ? 53  GLU F CB    1 
ATOM 4113  C CG    . GLU F 2 55  ? 141.817 110.336 125.194 1.00 22.56  ? 53  GLU F CG    1 
ATOM 4114  C CD    . GLU F 2 55  ? 142.118 110.537 123.721 1.00 22.56  ? 53  GLU F CD    1 
ATOM 4115  O OE1   . GLU F 2 55  ? 143.071 109.912 123.216 1.00 22.56  ? 53  GLU F OE1   1 
ATOM 4116  O OE2   . GLU F 2 55  ? 141.400 111.319 123.064 1.00 22.56  ? 53  GLU F OE2   1 
ATOM 4117  N N     . THR F 2 56  ? 143.343 110.834 128.802 1.00 20.03  ? 54  THR F N     1 
ATOM 4118  C CA    . THR F 2 56  ? 142.865 111.607 129.939 1.00 20.03  ? 54  THR F CA    1 
ATOM 4119  C C     . THR F 2 56  ? 143.876 112.660 130.358 1.00 20.03  ? 54  THR F C     1 
ATOM 4120  O O     . THR F 2 56  ? 143.497 113.779 130.718 1.00 20.03  ? 54  THR F O     1 
ATOM 4121  C CB    . THR F 2 56  ? 142.570 110.660 131.091 1.00 20.03  ? 54  THR F CB    1 
ATOM 4122  O OG1   . THR F 2 56  ? 141.736 109.607 130.612 1.00 20.03  ? 54  THR F OG1   1 
ATOM 4123  C CG2   . THR F 2 56  ? 141.873 111.368 132.219 1.00 20.03  ? 54  THR F CG2   1 
ATOM 4124  N N     . ARG F 2 57  ? 145.163 112.324 130.308 1.00 20.40  ? 55  ARG F N     1 
ATOM 4125  C CA    . ARG F 2 57  ? 146.190 113.303 130.622 1.00 20.40  ? 55  ARG F CA    1 
ATOM 4126  C C     . ARG F 2 57  ? 146.227 114.425 129.597 1.00 20.40  ? 55  ARG F C     1 
ATOM 4127  O O     . ARG F 2 57  ? 146.410 115.590 129.961 1.00 20.40  ? 55  ARG F O     1 
ATOM 4128  C CB    . ARG F 2 57  ? 147.542 112.616 130.713 1.00 20.40  ? 55  ARG F CB    1 
ATOM 4129  C CG    . ARG F 2 57  ? 147.724 111.892 131.996 1.00 20.40  ? 55  ARG F CG    1 
ATOM 4130  C CD    . ARG F 2 57  ? 149.028 111.182 132.038 1.00 20.40  ? 55  ARG F CD    1 
ATOM 4131  N NE    . ARG F 2 57  ? 149.069 110.284 133.173 1.00 20.40  ? 55  ARG F NE    1 
ATOM 4132  C CZ    . ARG F 2 57  ? 149.300 108.988 133.078 1.00 20.40  ? 55  ARG F CZ    1 
ATOM 4133  N NH1   . ARG F 2 57  ? 149.530 108.443 131.901 1.00 20.40  ? 55  ARG F NH1   1 
ATOM 4134  N NH2   . ARG F 2 57  ? 149.314 108.242 134.159 1.00 20.40  ? 55  ARG F NH2   1 
ATOM 4135  N N     . GLY F 2 58  ? 146.011 114.107 128.322 1.00 18.59  ? 56  GLY F N     1 
ATOM 4136  C CA    . GLY F 2 58  ? 145.936 115.157 127.320 1.00 18.59  ? 56  GLY F CA    1 
ATOM 4137  C C     . GLY F 2 58  ? 144.721 116.051 127.481 1.00 18.59  ? 56  GLY F C     1 
ATOM 4138  O O     . GLY F 2 58  ? 144.812 117.269 127.313 1.00 18.59  ? 56  GLY F O     1 
ATOM 4139  N N     . VAL F 2 59  ? 143.581 115.461 127.833 1.00 17.60  ? 57  VAL F N     1 
ATOM 4140  C CA    . VAL F 2 59  ? 142.351 116.226 128.037 1.00 17.60  ? 57  VAL F CA    1 
ATOM 4141  C C     . VAL F 2 59  ? 142.487 117.160 129.239 1.00 17.60  ? 57  VAL F C     1 
ATOM 4142  O O     . VAL F 2 59  ? 142.103 118.340 129.185 1.00 17.60  ? 57  VAL F O     1 
ATOM 4143  C CB    . VAL F 2 59  ? 141.168 115.256 128.194 1.00 17.60  ? 57  VAL F CB    1 
ATOM 4144  C CG1   . VAL F 2 59  ? 140.006 115.922 128.808 1.00 17.60  ? 57  VAL F CG1   1 
ATOM 4145  C CG2   . VAL F 2 59  ? 140.781 114.703 126.867 1.00 17.60  ? 57  VAL F CG2   1 
ATOM 4146  N N     . LEU F 2 60  ? 143.068 116.652 130.328 1.00 17.73  ? 58  LEU F N     1 
ATOM 4147  C CA    . LEU F 2 60  ? 143.284 117.466 131.518 1.00 17.73  ? 58  LEU F CA    1 
ATOM 4148  C C     . LEU F 2 60  ? 144.292 118.574 131.261 1.00 17.73  ? 58  LEU F C     1 
ATOM 4149  O O     . LEU F 2 60  ? 144.126 119.691 131.759 1.00 17.73  ? 58  LEU F O     1 
ATOM 4150  C CB    . LEU F 2 60  ? 143.745 116.587 132.673 1.00 17.73  ? 58  LEU F CB    1 
ATOM 4151  C CG    . LEU F 2 60  ? 144.082 117.313 133.970 1.00 17.73  ? 58  LEU F CG    1 
ATOM 4152  C CD1   . LEU F 2 60  ? 142.831 117.923 134.529 1.00 17.73  ? 58  LEU F CD1   1 
ATOM 4153  C CD2   . LEU F 2 60  ? 144.737 116.399 134.961 1.00 17.73  ? 58  LEU F CD2   1 
ATOM 4154  N N     . LYS F 2 61  ? 145.318 118.300 130.460 1.00 18.84  ? 59  LYS F N     1 
ATOM 4155  C CA    . LYS F 2 61  ? 146.296 119.333 130.151 1.00 18.84  ? 59  LYS F CA    1 
ATOM 4156  C C     . LYS F 2 61  ? 145.697 120.436 129.291 1.00 18.84  ? 59  LYS F C     1 
ATOM 4157  O O     . LYS F 2 61  ? 146.012 121.610 129.489 1.00 18.84  ? 59  LYS F O     1 
ATOM 4158  C CB    . LYS F 2 61  ? 147.504 118.715 129.467 1.00 18.84  ? 59  LYS F CB    1 
ATOM 4159  C CG    . LYS F 2 61  ? 148.716 119.598 129.492 1.00 18.84  ? 59  LYS F CG    1 
ATOM 4160  C CD    . LYS F 2 61  ? 149.873 118.961 128.773 1.00 18.84  ? 59  LYS F CD    1 
ATOM 4161  C CE    . LYS F 2 61  ? 150.966 119.973 128.539 1.00 18.84  ? 59  LYS F CE    1 
ATOM 4162  N NZ    . LYS F 2 61  ? 151.377 120.616 129.815 1.00 18.84  ? 59  LYS F NZ    1 
ATOM 4163  N N     . VAL F 2 62  ? 144.802 120.087 128.367 1.00 17.67  ? 60  VAL F N     1 
ATOM 4164  C CA    . VAL F 2 62  ? 144.141 121.098 127.541 1.00 17.67  ? 60  VAL F CA    1 
ATOM 4165  C C     . VAL F 2 62  ? 143.225 121.977 128.390 1.00 17.67  ? 60  VAL F C     1 
ATOM 4166  O O     . VAL F 2 62  ? 143.236 123.211 128.269 1.00 17.67  ? 60  VAL F O     1 
ATOM 4167  C CB    . VAL F 2 62  ? 143.382 120.417 126.389 1.00 17.67  ? 60  VAL F CB    1 
ATOM 4168  C CG1   . VAL F 2 62  ? 142.382 121.343 125.753 1.00 17.67  ? 60  VAL F CG1   1 
ATOM 4169  C CG2   . VAL F 2 62  ? 144.353 119.938 125.357 1.00 17.67  ? 60  VAL F CG2   1 
ATOM 4170  N N     . PHE F 2 63  ? 142.456 121.354 129.288 1.00 15.08  ? 61  PHE F N     1 
ATOM 4171  C CA    . PHE F 2 63  ? 141.554 122.096 130.170 1.00 15.08  ? 61  PHE F CA    1 
ATOM 4172  C C     . PHE F 2 63  ? 142.320 123.032 131.093 1.00 15.08  ? 61  PHE F C     1 
ATOM 4173  O O     . PHE F 2 63  ? 141.951 124.201 131.264 1.00 15.08  ? 61  PHE F O     1 
ATOM 4174  C CB    . PHE F 2 63  ? 140.721 121.108 130.983 1.00 15.08  ? 61  PHE F CB    1 
ATOM 4175  C CG    . PHE F 2 63  ? 139.839 121.747 132.006 1.00 15.08  ? 61  PHE F CG    1 
ATOM 4176  C CD1   . PHE F 2 63  ? 138.655 122.338 131.637 1.00 15.08  ? 61  PHE F CD1   1 
ATOM 4177  C CD2   . PHE F 2 63  ? 140.185 121.736 133.343 1.00 15.08  ? 61  PHE F CD2   1 
ATOM 4178  C CE1   . PHE F 2 63  ? 137.849 122.917 132.574 1.00 15.08  ? 61  PHE F CE1   1 
ATOM 4179  C CE2   . PHE F 2 63  ? 139.385 122.325 134.269 1.00 15.08  ? 61  PHE F CE2   1 
ATOM 4180  C CZ    . PHE F 2 63  ? 138.215 122.907 133.888 1.00 15.08  ? 61  PHE F CZ    1 
ATOM 4181  N N     . LEU F 2 64  ? 143.401 122.537 131.687 1.00 15.94  ? 62  LEU F N     1 
ATOM 4182  C CA    . LEU F 2 64  ? 144.177 123.343 132.609 1.00 15.94  ? 62  LEU F CA    1 
ATOM 4183  C C     . LEU F 2 64  ? 144.922 124.457 131.904 1.00 15.94  ? 62  LEU F C     1 
ATOM 4184  O O     . LEU F 2 64  ? 145.073 125.535 132.476 1.00 15.94  ? 62  LEU F O     1 
ATOM 4185  C CB    . LEU F 2 64  ? 145.151 122.458 133.360 1.00 15.94  ? 62  LEU F CB    1 
ATOM 4186  C CG    . LEU F 2 64  ? 144.647 121.768 134.608 1.00 15.94  ? 62  LEU F CG    1 
ATOM 4187  C CD1   . LEU F 2 64  ? 145.799 121.090 135.261 1.00 15.94  ? 62  LEU F CD1   1 
ATOM 4188  C CD2   . LEU F 2 64  ? 144.052 122.778 135.523 1.00 15.94  ? 62  LEU F CD2   1 
ATOM 4189  N N     . GLU F 2 65  ? 145.387 124.226 130.673 1.00 19.09  ? 63  GLU F N     1 
ATOM 4190  C CA    . GLU F 2 65  ? 145.988 125.298 129.887 1.00 19.09  ? 63  GLU F CA    1 
ATOM 4191  C C     . GLU F 2 65  ? 144.991 126.410 129.623 1.00 19.09  ? 63  GLU F C     1 
ATOM 4192  O O     . GLU F 2 65  ? 145.312 127.590 129.806 1.00 19.09  ? 63  GLU F O     1 
ATOM 4193  C CB    . GLU F 2 65  ? 146.505 124.753 128.564 1.00 19.09  ? 63  GLU F CB    1 
ATOM 4194  C CG    . GLU F 2 65  ? 147.888 124.186 128.610 1.00 19.09  ? 63  GLU F CG    1 
ATOM 4195  C CD    . GLU F 2 65  ? 148.202 123.360 127.381 1.00 19.09  ? 63  GLU F CD    1 
ATOM 4196  O OE1   . GLU F 2 65  ? 147.516 123.533 126.353 1.00 19.09  ? 63  GLU F OE1   1 
ATOM 4197  O OE2   . GLU F 2 65  ? 149.124 122.525 127.443 1.00 19.09  ? 63  GLU F OE2   1 
ATOM 4198  N N     . ASN F 2 66  ? 143.769 126.049 129.235 1.00 17.35  ? 64  ASN F N     1 
ATOM 4199  C CA    . ASN F 2 66  ? 142.760 127.056 128.936 1.00 17.35  ? 64  ASN F CA    1 
ATOM 4200  C C     . ASN F 2 66  ? 142.330 127.837 130.166 1.00 17.35  ? 64  ASN F C     1 
ATOM 4201  O O     . ASN F 2 66  ? 142.043 129.029 130.064 1.00 17.35  ? 64  ASN F O     1 
ATOM 4202  C CB    . ASN F 2 66  ? 141.548 126.403 128.292 1.00 17.35  ? 64  ASN F CB    1 
ATOM 4203  C CG    . ASN F 2 66  ? 141.800 126.012 126.867 1.00 17.35  ? 64  ASN F CG    1 
ATOM 4204  O OD1   . ASN F 2 66  ? 142.760 126.460 126.253 1.00 17.35  ? 64  ASN F OD1   1 
ATOM 4205  N ND2   . ASN F 2 66  ? 140.932 125.175 126.323 1.00 17.35  ? 64  ASN F ND2   1 
ATOM 4206  N N     . VAL F 2 67  ? 142.276 127.199 131.331 1.00 15.18  ? 65  VAL F N     1 
ATOM 4207  C CA    . VAL F 2 67  ? 141.851 127.927 132.524 1.00 15.18  ? 65  VAL F CA    1 
ATOM 4208  C C     . VAL F 2 67  ? 142.978 128.791 133.063 1.00 15.18  ? 65  VAL F C     1 
ATOM 4209  O O     . VAL F 2 67  ? 142.761 129.952 133.424 1.00 15.18  ? 65  VAL F O     1 
ATOM 4210  C CB    . VAL F 2 67  ? 141.317 126.947 133.583 1.00 15.18  ? 65  VAL F CB    1 
ATOM 4211  C CG1   . VAL F 2 67  ? 141.002 127.659 134.872 1.00 15.18  ? 65  VAL F CG1   1 
ATOM 4212  C CG2   . VAL F 2 67  ? 140.084 126.290 133.078 1.00 15.18  ? 65  VAL F CG2   1 
ATOM 4213  N N     . ILE F 2 68  ? 144.200 128.257 133.105 1.00 17.78  ? 66  ILE F N     1 
ATOM 4214  C CA    . ILE F 2 68  ? 145.325 128.980 133.675 1.00 17.78  ? 66  ILE F CA    1 
ATOM 4215  C C     . ILE F 2 68  ? 145.726 130.158 132.799 1.00 17.78  ? 66  ILE F C     1 
ATOM 4216  O O     . ILE F 2 68  ? 146.124 131.200 133.320 1.00 17.78  ? 66  ILE F O     1 
ATOM 4217  C CB    . ILE F 2 68  ? 146.471 127.984 133.928 1.00 17.78  ? 66  ILE F CB    1 
ATOM 4218  C CG1   . ILE F 2 68  ? 146.124 127.098 135.116 1.00 17.78  ? 66  ILE F CG1   1 
ATOM 4219  C CG2   . ILE F 2 68  ? 147.784 128.665 134.228 1.00 17.78  ? 66  ILE F CG2   1 
ATOM 4220  C CD1   . ILE F 2 68  ? 147.055 125.957 135.314 1.00 17.78  ? 66  ILE F CD1   1 
ATOM 4221  N N     . ARG F 2 69  ? 145.558 130.058 131.476 1.00 19.29  ? 67  ARG F N     1 
ATOM 4222  C CA    . ARG F 2 69  ? 145.853 131.187 130.596 1.00 19.29  ? 67  ARG F CA    1 
ATOM 4223  C C     . ARG F 2 69  ? 144.950 132.381 130.883 1.00 19.29  ? 67  ARG F C     1 
ATOM 4224  O O     . ARG F 2 69  ? 145.425 133.520 130.987 1.00 19.29  ? 67  ARG F O     1 
ATOM 4225  C CB    . ARG F 2 69  ? 145.705 130.743 129.149 1.00 19.29  ? 67  ARG F CB    1 
ATOM 4226  C CG    . ARG F 2 69  ? 146.116 131.755 128.124 1.00 19.29  ? 67  ARG F CG    1 
ATOM 4227  C CD    . ARG F 2 69  ? 145.714 131.285 126.748 1.00 19.29  ? 67  ARG F CD    1 
ATOM 4228  N NE    . ARG F 2 69  ? 146.308 129.990 126.425 1.00 19.29  ? 67  ARG F NE    1 
ATOM 4229  C CZ    . ARG F 2 69  ? 145.620 128.916 126.048 1.00 19.29  ? 67  ARG F CZ    1 
ATOM 4230  N NH1   . ARG F 2 69  ? 144.300 128.974 125.937 1.00 19.29  ? 67  ARG F NH1   1 
ATOM 4231  N NH2   . ARG F 2 69  ? 146.252 127.785 125.777 1.00 19.29  ? 67  ARG F NH2   1 
ATOM 4232  N N     . ASP F 2 70  ? 143.663 132.129 131.094 1.00 16.86  ? 68  ASP F N     1 
ATOM 4233  C CA    . ASP F 2 70  ? 142.726 133.186 131.437 1.00 16.86  ? 68  ASP F CA    1 
ATOM 4234  C C     . ASP F 2 70  ? 142.940 133.717 132.842 1.00 16.86  ? 68  ASP F C     1 
ATOM 4235  O O     . ASP F 2 70  ? 142.803 134.920 133.063 1.00 16.86  ? 68  ASP F O     1 
ATOM 4236  C CB    . ASP F 2 70  ? 141.305 132.670 131.297 1.00 16.86  ? 68  ASP F CB    1 
ATOM 4237  C CG    . ASP F 2 70  ? 140.796 132.752 129.886 1.00 16.86  ? 68  ASP F CG    1 
ATOM 4238  O OD1   . ASP F 2 70  ? 139.613 132.429 129.668 1.00 16.86  ? 68  ASP F OD1   1 
ATOM 4239  O OD2   . ASP F 2 70  ? 141.573 133.145 128.991 1.00 16.86  ? 68  ASP F OD2   1 
ATOM 4240  N N     . ALA F 2 71  ? 143.276 132.848 133.796 1.00 16.59  ? 69  ALA F N     1 
ATOM 4241  C CA    . ALA F 2 71  ? 143.529 133.297 135.160 1.00 16.59  ? 69  ALA F CA    1 
ATOM 4242  C C     . ALA F 2 71  ? 144.772 134.162 135.235 1.00 16.59  ? 69  ALA F C     1 
ATOM 4243  O O     . ALA F 2 71  ? 144.816 135.132 135.994 1.00 16.59  ? 69  ALA F O     1 
ATOM 4244  C CB    . ALA F 2 71  ? 143.666 132.098 136.088 1.00 16.59  ? 69  ALA F CB    1 
ATOM 4245  N N     . VAL F 2 72  ? 145.783 133.853 134.425 1.00 15.16  ? 70  VAL F N     1 
ATOM 4246  C CA    . VAL F 2 72  ? 146.990 134.665 134.377 1.00 15.16  ? 70  VAL F CA    1 
ATOM 4247  C C     . VAL F 2 72  ? 146.727 135.992 133.676 1.00 15.16  ? 70  VAL F C     1 
ATOM 4248  O O     . VAL F 2 72  ? 147.281 137.023 134.069 1.00 15.16  ? 70  VAL F O     1 
ATOM 4249  C CB    . VAL F 2 72  ? 148.110 133.838 133.722 1.00 15.16  ? 70  VAL F CB    1 
ATOM 4250  C CG1   . VAL F 2 72  ? 149.276 134.677 133.295 1.00 15.16  ? 70  VAL F CG1   1 
ATOM 4251  C CG2   . VAL F 2 72  ? 148.578 132.816 134.692 1.00 15.16  ? 70  VAL F CG2   1 
ATOM 4252  N N     . THR F 2 73  ? 145.853 136.007 132.666 1.00 14.36  ? 71  THR F N     1 
ATOM 4253  C CA    . THR F 2 73  ? 145.447 137.268 132.047 1.00 14.36  ? 71  THR F CA    1 
ATOM 4254  C C     . THR F 2 73  ? 144.714 138.175 133.037 1.00 14.36  ? 71  THR F C     1 
ATOM 4255  O O     . THR F 2 73  ? 145.003 139.375 133.123 1.00 14.36  ? 71  THR F O     1 
ATOM 4256  C CB    . THR F 2 73  ? 144.582 136.974 130.828 1.00 14.36  ? 71  THR F CB    1 
ATOM 4257  O OG1   . THR F 2 73  ? 145.317 136.155 129.921 1.00 14.36  ? 71  THR F OG1   1 
ATOM 4258  C CG2   . THR F 2 73  ? 144.191 138.238 130.121 1.00 14.36  ? 71  THR F CG2   1 
ATOM 4259  N N     . TYR F 2 74  ? 143.790 137.607 133.818 1.00 12.33  ? 72  TYR F N     1 
ATOM 4260  C CA    . TYR F 2 74  ? 143.127 138.344 134.893 1.00 12.33  ? 72  TYR F CA    1 
ATOM 4261  C C     . TYR F 2 74  ? 144.105 138.802 135.963 1.00 12.33  ? 72  TYR F C     1 
ATOM 4262  O O     . TYR F 2 74  ? 143.896 139.843 136.587 1.00 12.33  ? 72  TYR F O     1 
ATOM 4263  C CB    . TYR F 2 74  ? 142.058 137.474 135.551 1.00 12.33  ? 72  TYR F CB    1 
ATOM 4264  C CG    . TYR F 2 74  ? 140.739 137.427 134.844 1.00 12.33  ? 72  TYR F CG    1 
ATOM 4265  C CD1   . TYR F 2 74  ? 139.968 138.553 134.715 1.00 12.33  ? 72  TYR F CD1   1 
ATOM 4266  C CD2   . TYR F 2 74  ? 140.260 136.250 134.323 1.00 12.33  ? 72  TYR F CD2   1 
ATOM 4267  C CE1   . TYR F 2 74  ? 138.776 138.509 134.074 1.00 12.33  ? 72  TYR F CE1   1 
ATOM 4268  C CE2   . TYR F 2 74  ? 139.075 136.200 133.673 1.00 12.33  ? 72  TYR F CE2   1 
ATOM 4269  C CZ    . TYR F 2 74  ? 138.335 137.327 133.553 1.00 12.33  ? 72  TYR F CZ    1 
ATOM 4270  O OH    . TYR F 2 74  ? 137.131 137.275 132.908 1.00 12.33  ? 72  TYR F OH    1 
ATOM 4271  N N     . THR F 2 75  ? 145.155 138.024 136.209 1.00 17.44  ? 73  THR F N     1 
ATOM 4272  C CA    . THR F 2 75  ? 146.120 138.358 137.247 1.00 17.44  ? 73  THR F CA    1 
ATOM 4273  C C     . THR F 2 75  ? 147.000 139.519 136.827 1.00 17.44  ? 73  THR F C     1 
ATOM 4274  O O     . THR F 2 75  ? 147.212 140.460 137.595 1.00 17.44  ? 73  THR F O     1 
ATOM 4275  C CB    . THR F 2 75  ? 146.963 137.127 137.565 1.00 17.44  ? 73  THR F CB    1 
ATOM 4276  O OG1   . THR F 2 75  ? 146.137 136.159 138.208 1.00 17.44  ? 73  THR F OG1   1 
ATOM 4277  C CG2   . THR F 2 75  ? 148.113 137.455 138.456 1.00 17.44  ? 73  THR F CG2   1 
ATOM 4278  N N     . GLU F 2 76  ? 147.519 139.478 135.607 1.00 19.73  ? 74  GLU F N     1 
ATOM 4279  C CA    . GLU F 2 76  ? 148.413 140.537 135.176 1.00 19.73  ? 74  GLU F CA    1 
ATOM 4280  C C     . GLU F 2 76  ? 147.673 141.742 134.627 1.00 19.73  ? 74  GLU F C     1 
ATOM 4281  O O     . GLU F 2 76  ? 148.317 142.745 134.322 1.00 19.73  ? 74  GLU F O     1 
ATOM 4282  C CB    . GLU F 2 76  ? 149.413 140.021 134.145 1.00 19.73  ? 74  GLU F CB    1 
ATOM 4283  C CG    . GLU F 2 76  ? 148.832 139.609 132.822 1.00 19.73  ? 74  GLU F CG    1 
ATOM 4284  C CD    . GLU F 2 76  ? 149.816 138.806 131.994 1.00 19.73  ? 74  GLU F CD    1 
ATOM 4285  O OE1   . GLU F 2 76  ? 150.994 138.731 132.397 1.00 19.73  ? 74  GLU F OE1   1 
ATOM 4286  O OE2   . GLU F 2 76  ? 149.416 138.245 130.952 1.00 19.73  ? 74  GLU F OE2   1 
ATOM 4287  N N     . HIS F 2 77  ? 146.347 141.684 134.494 1.00 15.74  ? 75  HIS F N     1 
ATOM 4288  C CA    . HIS F 2 77  ? 145.615 142.935 134.350 1.00 15.74  ? 75  HIS F CA    1 
ATOM 4289  C C     . HIS F 2 77  ? 145.635 143.732 135.644 1.00 15.74  ? 75  HIS F C     1 
ATOM 4290  O O     . HIS F 2 77  ? 145.767 144.958 135.625 1.00 15.74  ? 75  HIS F O     1 
ATOM 4291  C CB    . HIS F 2 77  ? 144.180 142.694 133.936 1.00 15.74  ? 75  HIS F CB    1 
ATOM 4292  C CG    . HIS F 2 77  ? 143.388 143.953 133.826 1.00 15.74  ? 75  HIS F CG    1 
ATOM 4293  N ND1   . HIS F 2 77  ? 143.517 144.819 132.766 1.00 15.74  ? 75  HIS F ND1   1 
ATOM 4294  C CD2   . HIS F 2 77  ? 142.478 144.508 134.655 1.00 15.74  ? 75  HIS F CD2   1 
ATOM 4295  C CE1   . HIS F 2 77  ? 142.704 145.843 132.937 1.00 15.74  ? 75  HIS F CE1   1 
ATOM 4296  N NE2   . HIS F 2 77  ? 142.064 145.679 134.076 1.00 15.74  ? 75  HIS F NE2   1 
ATOM 4297  N N     . ALA F 2 78  ? 145.525 143.056 136.775 1.00 18.31  ? 76  ALA F N     1 
ATOM 4298  C CA    . ALA F 2 78  ? 145.537 143.692 138.080 1.00 18.31  ? 76  ALA F CA    1 
ATOM 4299  C C     . ALA F 2 78  ? 146.921 144.144 138.515 1.00 18.31  ? 76  ALA F C     1 
ATOM 4300  O O     . ALA F 2 78  ? 147.036 144.708 139.608 1.00 18.31  ? 76  ALA F O     1 
ATOM 4301  C CB    . ALA F 2 78  ? 144.969 142.736 139.118 1.00 18.31  ? 76  ALA F CB    1 
ATOM 4302  N N     . LYS F 2 79  ? 147.942 143.898 137.687 1.00 21.14  ? 77  LYS F N     1 
ATOM 4303  C CA    . LYS F 2 79  ? 149.348 144.177 137.971 1.00 21.14  ? 77  LYS F CA    1 
ATOM 4304  C C     . LYS F 2 79  ? 149.812 143.461 139.233 1.00 21.14  ? 77  LYS F C     1 
ATOM 4305  O O     . LYS F 2 79  ? 150.595 143.990 140.020 1.00 21.14  ? 77  LYS F O     1 
ATOM 4306  C CB    . LYS F 2 79  ? 149.619 145.677 138.045 1.00 21.14  ? 77  LYS F CB    1 
ATOM 4307  C CG    . LYS F 2 79  ? 149.466 146.377 136.723 1.00 21.14  ? 77  LYS F CG    1 
ATOM 4308  C CD    . LYS F 2 79  ? 149.625 147.858 136.875 1.00 21.14  ? 77  LYS F CD    1 
ATOM 4309  C CE    . LYS F 2 79  ? 148.423 148.461 137.559 1.00 21.14  ? 77  LYS F CE    1 
ATOM 4310  N NZ    . LYS F 2 79  ? 147.280 148.565 136.629 1.00 21.14  ? 77  LYS F NZ    1 
ATOM 4311  N N     . ARG F 2 80  ? 149.322 142.244 139.419 1.00 21.97  ? 78  ARG F N     1 
ATOM 4312  C CA    . ARG F 2 80  ? 149.739 141.372 140.500 1.00 21.97  ? 78  ARG F CA    1 
ATOM 4313  C C     . ARG F 2 80  ? 150.753 140.366 139.990 1.00 21.97  ? 78  ARG F C     1 
ATOM 4314  O O     . ARG F 2 80  ? 150.983 140.220 138.792 1.00 21.97  ? 78  ARG F O     1 
ATOM 4315  C CB    . ARG F 2 80  ? 148.543 140.641 141.100 1.00 21.97  ? 78  ARG F CB    1 
ATOM 4316  C CG    . ARG F 2 80  ? 147.703 141.472 142.015 1.00 21.97  ? 78  ARG F CG    1 
ATOM 4317  C CD    . ARG F 2 80  ? 146.638 140.630 142.663 1.00 21.97  ? 78  ARG F CD    1 
ATOM 4318  N NE    . ARG F 2 80  ? 145.392 140.647 141.908 1.00 21.97  ? 78  ARG F NE    1 
ATOM 4319  C CZ    . ARG F 2 80  ? 144.945 139.628 141.192 1.00 21.97  ? 78  ARG F CZ    1 
ATOM 4320  N NH1   . ARG F 2 80  ? 145.639 138.511 141.135 1.00 21.97  ? 78  ARG F NH1   1 
ATOM 4321  N NH2   . ARG F 2 80  ? 143.802 139.721 140.541 1.00 21.97  ? 78  ARG F NH2   1 
ATOM 4322  N N     . LYS F 2 81  ? 151.373 139.671 140.932 1.00 28.86  ? 79  LYS F N     1 
ATOM 4323  C CA    . LYS F 2 81  ? 152.278 138.575 140.629 1.00 28.86  ? 79  LYS F CA    1 
ATOM 4324  C C     . LYS F 2 81  ? 151.784 137.273 141.235 1.00 28.86  ? 79  LYS F C     1 
ATOM 4325  O O     . LYS F 2 81  ? 152.389 136.225 141.024 1.00 28.86  ? 79  LYS F O     1 
ATOM 4326  C CB    . LYS F 2 81  ? 153.683 138.902 141.127 1.00 28.86  ? 79  LYS F CB    1 
ATOM 4327  C CG    . LYS F 2 81  ? 154.526 139.638 140.121 1.00 28.86  ? 79  LYS F CG    1 
ATOM 4328  C CD    . LYS F 2 81  ? 155.498 140.567 140.803 1.00 28.86  ? 79  LYS F CD    1 
ATOM 4329  C CE    . LYS F 2 81  ? 154.821 141.867 141.190 1.00 28.86  ? 79  LYS F CE    1 
ATOM 4330  N NZ    . LYS F 2 81  ? 154.371 142.638 140.005 1.00 28.86  ? 79  LYS F NZ    1 
ATOM 4331  N N     . THR F 2 82  ? 150.680 137.331 141.974 1.00 26.44  ? 80  THR F N     1 
ATOM 4332  C CA    . THR F 2 82  ? 150.085 136.183 142.639 1.00 26.44  ? 80  THR F CA    1 
ATOM 4333  C C     . THR F 2 82  ? 148.751 135.895 141.980 1.00 26.44  ? 80  THR F C     1 
ATOM 4334  O O     . THR F 2 82  ? 147.917 136.793 141.856 1.00 26.44  ? 80  THR F O     1 
ATOM 4335  C CB    . THR F 2 82  ? 149.886 136.449 144.131 1.00 26.44  ? 80  THR F CB    1 
ATOM 4336  O OG1   . THR F 2 82  ? 151.135 136.806 144.725 1.00 26.44  ? 80  THR F OG1   1 
ATOM 4337  C CG2   . THR F 2 82  ? 149.353 135.238 144.833 1.00 26.44  ? 80  THR F CG2   1 
ATOM 4338  N N     . VAL F 2 83  ? 148.549 134.654 141.553 1.00 21.08  ? 81  VAL F N     1 
ATOM 4339  C CA    . VAL F 2 83  ? 147.253 134.232 141.038 1.00 21.08  ? 81  VAL F CA    1 
ATOM 4340  C C     . VAL F 2 83  ? 146.370 133.902 142.232 1.00 21.08  ? 81  VAL F C     1 
ATOM 4341  O O     . VAL F 2 83  ? 146.595 132.913 142.926 1.00 21.08  ? 81  VAL F O     1 
ATOM 4342  C CB    . VAL F 2 83  ? 147.384 133.039 140.091 1.00 21.08  ? 81  VAL F CB    1 
ATOM 4343  C CG1   . VAL F 2 83  ? 146.071 132.750 139.434 1.00 21.08  ? 81  VAL F CG1   1 
ATOM 4344  C CG2   . VAL F 2 83  ? 148.416 133.324 139.049 1.00 21.08  ? 81  VAL F CG2   1 
ATOM 4345  N N     . THR F 2 84  ? 145.374 134.738 142.481 1.00 19.54  ? 82  THR F N     1 
ATOM 4346  C CA    . THR F 2 84  ? 144.461 134.525 143.585 1.00 19.54  ? 82  THR F CA    1 
ATOM 4347  C C     . THR F 2 84  ? 143.394 133.514 143.186 1.00 19.54  ? 82  THR F C     1 
ATOM 4348  O O     . THR F 2 84  ? 143.287 133.118 142.028 1.00 19.54  ? 82  THR F O     1 
ATOM 4349  C CB    . THR F 2 84  ? 143.839 135.846 144.012 1.00 19.54  ? 82  THR F CB    1 
ATOM 4350  O OG1   . THR F 2 84  ? 143.285 136.495 142.873 1.00 19.54  ? 82  THR F OG1   1 
ATOM 4351  C CG2   . THR F 2 84  ? 144.882 136.743 144.605 1.00 19.54  ? 82  THR F CG2   1 
ATOM 4352  N N     . ALA F 2 85  ? 142.598 133.076 144.160 1.00 17.72  ? 83  ALA F N     1 
ATOM 4353  C CA    . ALA F 2 85  ? 141.518 132.145 143.861 1.00 17.72  ? 83  ALA F CA    1 
ATOM 4354  C C     . ALA F 2 85  ? 140.397 132.818 143.102 1.00 17.72  ? 83  ALA F C     1 
ATOM 4355  O O     . ALA F 2 85  ? 139.655 132.148 142.383 1.00 17.72  ? 83  ALA F O     1 
ATOM 4356  C CB    . ALA F 2 85  ? 140.965 131.533 145.140 1.00 17.72  ? 83  ALA F CB    1 
ATOM 4357  N N     . MET F 2 86  ? 140.269 134.135 143.239 1.00 18.58  ? 84  MET F N     1 
ATOM 4358  C CA    . MET F 2 86  ? 139.257 134.862 142.497 1.00 18.58  ? 84  MET F CA    1 
ATOM 4359  C C     . MET F 2 86  ? 139.562 134.897 141.015 1.00 18.58  ? 84  MET F C     1 
ATOM 4360  O O     . MET F 2 86  ? 138.637 134.848 140.212 1.00 18.58  ? 84  MET F O     1 
ATOM 4361  C CB    . MET F 2 86  ? 139.120 136.278 143.033 1.00 18.58  ? 84  MET F CB    1 
ATOM 4362  C CG    . MET F 2 86  ? 138.368 136.365 144.332 1.00 18.58  ? 84  MET F CG    1 
ATOM 4363  S SD    . MET F 2 86  ? 136.987 135.220 144.423 1.00 18.58  ? 84  MET F SD    1 
ATOM 4364  C CE    . MET F 2 86  ? 135.805 136.008 143.344 1.00 18.58  ? 84  MET F CE    1 
ATOM 4365  N N     . ASP F 2 87  ? 140.836 134.965 140.632 1.00 16.96  ? 85  ASP F N     1 
ATOM 4366  C CA    . ASP F 2 87  ? 141.194 134.935 139.219 1.00 16.96  ? 85  ASP F CA    1 
ATOM 4367  C C     . ASP F 2 87  ? 140.877 133.589 138.599 1.00 16.96  ? 85  ASP F C     1 
ATOM 4368  O O     . ASP F 2 87  ? 140.450 133.520 137.447 1.00 16.96  ? 85  ASP F O     1 
ATOM 4369  C CB    . ASP F 2 87  ? 142.670 135.251 139.049 1.00 16.96  ? 85  ASP F CB    1 
ATOM 4370  C CG    . ASP F 2 87  ? 143.029 136.610 139.560 1.00 16.96  ? 85  ASP F CG    1 
ATOM 4371  O OD1   . ASP F 2 87  ? 142.120 137.441 139.728 1.00 16.96  ? 85  ASP F OD1   1 
ATOM 4372  O OD2   . ASP F 2 87  ? 144.223 136.860 139.790 1.00 16.96  ? 85  ASP F OD2   1 
ATOM 4373  N N     . VAL F 2 88  ? 141.048 132.514 139.364 1.00 14.21  ? 86  VAL F N     1 
ATOM 4374  C CA    . VAL F 2 88  ? 140.668 131.183 138.910 1.00 14.21  ? 86  VAL F CA    1 
ATOM 4375  C C     . VAL F 2 88  ? 139.156 131.066 138.806 1.00 14.21  ? 86  VAL F C     1 
ATOM 4376  O O     . VAL F 2 88  ? 138.634 130.478 137.858 1.00 14.21  ? 86  VAL F O     1 
ATOM 4377  C CB    . VAL F 2 88  ? 141.267 130.131 139.856 1.00 14.21  ? 86  VAL F CB    1 
ATOM 4378  C CG1   . VAL F 2 88  ? 140.891 128.762 139.432 1.00 14.21  ? 86  VAL F CG1   1 
ATOM 4379  C CG2   . VAL F 2 88  ? 142.755 130.257 139.876 1.00 14.21  ? 86  VAL F CG2   1 
ATOM 4380  N N     . VAL F 2 89  ? 138.434 131.662 139.750 1.00 13.67  ? 87  VAL F N     1 
ATOM 4381  C CA    . VAL F 2 89  ? 136.977 131.620 139.726 1.00 13.67  ? 87  VAL F CA    1 
ATOM 4382  C C     . VAL F 2 89  ? 136.430 132.410 138.542 1.00 13.67  ? 87  VAL F C     1 
ATOM 4383  O O     . VAL F 2 89  ? 135.507 131.958 137.858 1.00 13.67  ? 87  VAL F O     1 
ATOM 4384  C CB    . VAL F 2 89  ? 136.433 132.112 141.079 1.00 13.67  ? 87  VAL F CB    1 
ATOM 4385  C CG1   . VAL F 2 89  ? 135.016 132.584 140.987 1.00 13.67  ? 87  VAL F CG1   1 
ATOM 4386  C CG2   . VAL F 2 89  ? 136.533 131.012 142.095 1.00 13.67  ? 87  VAL F CG2   1 
ATOM 4387  N N     . TYR F 2 90  ? 137.031 133.558 138.234 1.00 16.63  ? 88  TYR F N     1 
ATOM 4388  C CA    . TYR F 2 90  ? 136.620 134.343 137.073 1.00 16.63  ? 88  TYR F CA    1 
ATOM 4389  C C     . TYR F 2 90  ? 136.978 133.646 135.771 1.00 16.63  ? 88  TYR F C     1 
ATOM 4390  O O     . TYR F 2 90  ? 136.197 133.673 134.814 1.00 16.63  ? 88  TYR F O     1 
ATOM 4391  C CB    . TYR F 2 90  ? 137.269 135.722 137.101 1.00 16.63  ? 88  TYR F CB    1 
ATOM 4392  C CG    . TYR F 2 90  ? 136.925 136.571 138.285 1.00 16.63  ? 88  TYR F CG    1 
ATOM 4393  C CD1   . TYR F 2 90  ? 135.696 136.463 138.907 1.00 16.63  ? 88  TYR F CD1   1 
ATOM 4394  C CD2   . TYR F 2 90  ? 137.825 137.494 138.774 1.00 16.63  ? 88  TYR F CD2   1 
ATOM 4395  C CE1   . TYR F 2 90  ? 135.379 137.233 139.983 1.00 16.63  ? 88  TYR F CE1   1 
ATOM 4396  C CE2   . TYR F 2 90  ? 137.521 138.266 139.864 1.00 16.63  ? 88  TYR F CE2   1 
ATOM 4397  C CZ    . TYR F 2 90  ? 136.293 138.130 140.461 1.00 16.63  ? 88  TYR F CZ    1 
ATOM 4398  O OH    . TYR F 2 90  ? 135.981 138.908 141.544 1.00 16.63  ? 88  TYR F OH    1 
ATOM 4399  N N     . ALA F 2 91  ? 138.156 133.026 135.718 1.00 13.32  ? 89  ALA F N     1 
ATOM 4400  C CA    . ALA F 2 91  ? 138.596 132.309 134.534 1.00 13.32  ? 89  ALA F CA    1 
ATOM 4401  C C     . ALA F 2 91  ? 137.752 131.085 134.258 1.00 13.32  ? 89  ALA F C     1 
ATOM 4402  O O     . ALA F 2 91  ? 137.611 130.688 133.103 1.00 13.32  ? 89  ALA F O     1 
ATOM 4403  C CB    . ALA F 2 91  ? 140.047 131.895 134.700 1.00 13.32  ? 89  ALA F CB    1 
ATOM 4404  N N     . LEU F 2 92  ? 137.210 130.458 135.299 1.00 13.97  ? 90  LEU F N     1 
ATOM 4405  C CA    . LEU F 2 92  ? 136.274 129.360 135.099 1.00 13.97  ? 90  LEU F CA    1 
ATOM 4406  C C     . LEU F 2 92  ? 134.894 129.873 134.745 1.00 13.97  ? 90  LEU F C     1 
ATOM 4407  O O     . LEU F 2 92  ? 134.183 129.245 133.965 1.00 13.97  ? 90  LEU F O     1 
ATOM 4408  C CB    . LEU F 2 92  ? 136.192 128.507 136.352 1.00 13.97  ? 90  LEU F CB    1 
ATOM 4409  C CG    . LEU F 2 92  ? 137.387 127.630 136.647 1.00 13.97  ? 90  LEU F CG    1 
ATOM 4410  C CD1   . LEU F 2 92  ? 137.425 127.337 138.120 1.00 13.97  ? 90  LEU F CD1   1 
ATOM 4411  C CD2   . LEU F 2 92  ? 137.288 126.381 135.831 1.00 13.97  ? 90  LEU F CD2   1 
ATOM 4412  N N     . LYS F 2 93  ? 134.497 131.000 135.328 1.00 15.76  ? 91  LYS F N     1 
ATOM 4413  C CA    . LYS F 2 93  ? 133.182 131.573 135.084 1.00 15.76  ? 91  LYS F CA    1 
ATOM 4414  C C     . LYS F 2 93  ? 133.030 132.040 133.655 1.00 15.76  ? 91  LYS F C     1 
ATOM 4415  O O     . LYS F 2 93  ? 131.933 131.973 133.097 1.00 15.76  ? 91  LYS F O     1 
ATOM 4416  C CB    . LYS F 2 93  ? 132.962 132.733 136.042 1.00 15.76  ? 91  LYS F CB    1 
ATOM 4417  C CG    . LYS F 2 93  ? 131.575 133.318 136.082 1.00 15.76  ? 91  LYS F CG    1 
ATOM 4418  C CD    . LYS F 2 93  ? 131.557 134.572 136.953 1.00 15.76  ? 91  LYS F CD    1 
ATOM 4419  C CE    . LYS F 2 93  ? 132.238 134.335 138.309 1.00 15.76  ? 91  LYS F CE    1 
ATOM 4420  N NZ    . LYS F 2 93  ? 132.506 135.557 139.113 1.00 15.76  ? 91  LYS F NZ    1 
ATOM 4421  N N     . ARG F 2 94  ? 134.108 132.497 133.034 1.00 16.71  ? 92  ARG F N     1 
ATOM 4422  C CA    . ARG F 2 94  ? 134.038 132.915 131.644 1.00 16.71  ? 92  ARG F CA    1 
ATOM 4423  C C     . ARG F 2 94  ? 134.171 131.757 130.666 1.00 16.71  ? 92  ARG F C     1 
ATOM 4424  O O     . ARG F 2 94  ? 134.193 131.984 129.457 1.00 16.71  ? 92  ARG F O     1 
ATOM 4425  C CB    . ARG F 2 94  ? 135.087 133.984 131.364 1.00 16.71  ? 92  ARG F CB    1 
ATOM 4426  C CG    . ARG F 2 94  ? 136.509 133.519 131.285 1.00 16.71  ? 92  ARG F CG    1 
ATOM 4427  C CD    . ARG F 2 94  ? 137.306 134.561 130.549 1.00 16.71  ? 92  ARG F CD    1 
ATOM 4428  N NE    . ARG F 2 94  ? 136.582 134.984 129.364 1.00 16.71  ? 92  ARG F NE    1 
ATOM 4429  C CZ    . ARG F 2 94  ? 136.745 134.438 128.168 1.00 16.71  ? 92  ARG F CZ    1 
ATOM 4430  N NH1   . ARG F 2 94  ? 137.627 133.464 127.999 1.00 16.71  ? 92  ARG F NH1   1 
ATOM 4431  N NH2   . ARG F 2 94  ? 136.026 134.863 127.141 1.00 16.71  ? 92  ARG F NH2   1 
ATOM 4432  N N     . GLN F 2 95  ? 134.239 130.526 131.157 1.00 16.05  ? 93  GLN F N     1 
ATOM 4433  C CA    . GLN F 2 95  ? 134.192 129.342 130.320 1.00 16.05  ? 93  GLN F CA    1 
ATOM 4434  C C     . GLN F 2 95  ? 132.961 128.493 130.568 1.00 16.05  ? 93  GLN F C     1 
ATOM 4435  O O     . GLN F 2 95  ? 132.858 127.402 130.003 1.00 16.05  ? 93  GLN F O     1 
ATOM 4436  C CB    . GLN F 2 95  ? 135.445 128.499 130.537 1.00 16.05  ? 93  GLN F CB    1 
ATOM 4437  C CG    . GLN F 2 95  ? 136.670 129.291 130.253 1.00 16.05  ? 93  GLN F CG    1 
ATOM 4438  C CD    . GLN F 2 95  ? 137.924 128.514 130.441 1.00 16.05  ? 93  GLN F CD    1 
ATOM 4439  O OE1   . GLN F 2 95  ? 137.891 127.333 130.777 1.00 16.05  ? 93  GLN F OE1   1 
ATOM 4440  N NE2   . GLN F 2 95  ? 139.050 129.167 130.221 1.00 16.05  ? 93  GLN F NE2   1 
ATOM 4441  N N     . GLY F 2 96  ? 132.022 128.960 131.380 1.00 15.05  ? 94  GLY F N     1 
ATOM 4442  C CA    . GLY F 2 96  ? 130.863 128.166 131.706 1.00 15.05  ? 94  GLY F CA    1 
ATOM 4443  C C     . GLY F 2 96  ? 131.133 127.066 132.696 1.00 15.05  ? 94  GLY F C     1 
ATOM 4444  O O     . GLY F 2 96  ? 130.435 126.054 132.688 1.00 15.05  ? 94  GLY F O     1 
ATOM 4445  N N     . ARG F 2 97  ? 132.129 127.235 133.557 1.00 16.85  ? 95  ARG F N     1 
ATOM 4446  C CA    . ARG F 2 97  ? 132.483 126.247 134.562 1.00 16.85  ? 95  ARG F CA    1 
ATOM 4447  C C     . ARG F 2 97  ? 132.440 126.892 135.939 1.00 16.85  ? 95  ARG F C     1 
ATOM 4448  O O     . ARG F 2 97  ? 133.380 126.769 136.722 1.00 16.85  ? 95  ARG F O     1 
ATOM 4449  C CB    . ARG F 2 97  ? 133.866 125.641 134.316 1.00 16.85  ? 95  ARG F CB    1 
ATOM 4450  C CG    . ARG F 2 97  ? 134.098 124.932 132.993 1.00 16.85  ? 95  ARG F CG    1 
ATOM 4451  C CD    . ARG F 2 97  ? 133.025 123.921 132.730 1.00 16.85  ? 95  ARG F CD    1 
ATOM 4452  N NE    . ARG F 2 97  ? 132.890 122.960 133.820 1.00 16.85  ? 95  ARG F NE    1 
ATOM 4453  C CZ    . ARG F 2 97  ? 132.954 121.645 133.676 1.00 16.85  ? 95  ARG F CZ    1 
ATOM 4454  N NH1   . ARG F 2 97  ? 133.102 121.125 132.473 1.00 16.85  ? 95  ARG F NH1   1 
ATOM 4455  N NH2   . ARG F 2 97  ? 132.817 120.855 134.728 1.00 16.85  ? 95  ARG F NH2   1 
ATOM 4456  N N     . THR F 2 98  ? 131.343 127.600 136.226 1.00 14.16  ? 96  THR F N     1 
ATOM 4457  C CA    . THR F 2 98  ? 131.106 128.330 137.473 1.00 14.16  ? 96  THR F CA    1 
ATOM 4458  C C     . THR F 2 98  ? 131.312 127.474 138.716 1.00 14.16  ? 96  THR F C     1 
ATOM 4459  O O     . THR F 2 98  ? 130.751 126.391 138.839 1.00 14.16  ? 96  THR F O     1 
ATOM 4460  C CB    . THR F 2 98  ? 129.680 128.869 137.462 1.00 14.16  ? 96  THR F CB    1 
ATOM 4461  O OG1   . THR F 2 98  ? 129.504 129.728 136.334 1.00 14.16  ? 96  THR F OG1   1 
ATOM 4462  C CG2   . THR F 2 98  ? 129.365 129.625 138.718 1.00 14.16  ? 96  THR F CG2   1 
ATOM 4463  N N     . LEU F 2 99  ? 132.133 127.965 139.634 1.00 12.16  ? 97  LEU F N     1 
ATOM 4464  C CA    . LEU F 2 99  ? 132.560 127.212 140.803 1.00 12.16  ? 97  LEU F CA    1 
ATOM 4465  C C     . LEU F 2 99  ? 132.130 127.945 142.065 1.00 12.16  ? 97  LEU F C     1 
ATOM 4466  O O     . LEU F 2 99  ? 132.531 129.089 142.287 1.00 12.16  ? 97  LEU F O     1 
ATOM 4467  C CB    . LEU F 2 99  ? 134.071 127.018 140.769 1.00 12.16  ? 97  LEU F CB    1 
ATOM 4468  C CG    . LEU F 2 99  ? 134.781 126.337 141.919 1.00 12.16  ? 97  LEU F CG    1 
ATOM 4469  C CD1   . LEU F 2 99  ? 134.560 124.871 141.874 1.00 12.16  ? 97  LEU F CD1   1 
ATOM 4470  C CD2   . LEU F 2 99  ? 136.227 126.636 141.803 1.00 12.16  ? 97  LEU F CD2   1 
ATOM 4471  N N     . TYR F 2 100 ? 131.325 127.284 142.889 1.00 14.96  ? 98  TYR F N     1 
ATOM 4472  C CA    . TYR F 2 100 ? 130.853 127.837 144.150 1.00 14.96  ? 98  TYR F CA    1 
ATOM 4473  C C     . TYR F 2 100 ? 131.737 127.328 145.271 1.00 14.96  ? 98  TYR F C     1 
ATOM 4474  O O     . TYR F 2 100 ? 132.011 126.132 145.346 1.00 14.96  ? 98  TYR F O     1 
ATOM 4475  C CB    . TYR F 2 100 ? 129.416 127.432 144.448 1.00 14.96  ? 98  TYR F CB    1 
ATOM 4476  C CG    . TYR F 2 100 ? 128.337 128.072 143.626 1.00 14.96  ? 98  TYR F CG    1 
ATOM 4477  C CD1   . TYR F 2 100 ? 128.618 129.037 142.679 1.00 14.96  ? 98  TYR F CD1   1 
ATOM 4478  C CD2   . TYR F 2 100 ? 127.021 127.700 143.811 1.00 14.96  ? 98  TYR F CD2   1 
ATOM 4479  C CE1   . TYR F 2 100 ? 127.617 129.598 141.940 1.00 14.96  ? 98  TYR F CE1   1 
ATOM 4480  C CE2   . TYR F 2 100 ? 126.026 128.259 143.087 1.00 14.96  ? 98  TYR F CE2   1 
ATOM 4481  C CZ    . TYR F 2 100 ? 126.325 129.198 142.154 1.00 14.96  ? 98  TYR F CZ    1 
ATOM 4482  O OH    . TYR F 2 100 ? 125.303 129.740 141.435 1.00 14.96  ? 98  TYR F OH    1 
ATOM 4483  N N     . GLY F 2 101 ? 132.165 128.221 146.146 1.00 15.30  ? 99  GLY F N     1 
ATOM 4484  C CA    . GLY F 2 101 ? 132.890 127.773 147.310 1.00 15.30  ? 99  GLY F CA    1 
ATOM 4485  C C     . GLY F 2 101 ? 134.149 128.541 147.612 1.00 15.30  ? 99  GLY F C     1 
ATOM 4486  O O     . GLY F 2 101 ? 134.719 128.393 148.692 1.00 15.30  ? 99  GLY F O     1 
ATOM 4487  N N     . PHE F 2 102 ? 134.592 129.371 146.676 1.00 17.69  ? 100 PHE F N     1 
ATOM 4488  C CA    . PHE F 2 102 ? 135.875 130.046 146.805 1.00 17.69  ? 100 PHE F CA    1 
ATOM 4489  C C     . PHE F 2 102 ? 135.762 131.555 146.686 1.00 17.69  ? 100 PHE F C     1 
ATOM 4490  O O     . PHE F 2 102 ? 136.774 132.218 146.449 1.00 17.69  ? 100 PHE F O     1 
ATOM 4491  C CB    . PHE F 2 102 ? 136.858 129.524 145.760 1.00 17.69  ? 100 PHE F CB    1 
ATOM 4492  C CG    . PHE F 2 102 ? 137.243 128.099 145.959 1.00 17.69  ? 100 PHE F CG    1 
ATOM 4493  C CD1   . PHE F 2 102 ? 138.328 127.768 146.741 1.00 17.69  ? 100 PHE F CD1   1 
ATOM 4494  C CD2   . PHE F 2 102 ? 136.523 127.089 145.366 1.00 17.69  ? 100 PHE F CD2   1 
ATOM 4495  C CE1   . PHE F 2 102 ? 138.675 126.463 146.926 1.00 17.69  ? 100 PHE F CE1   1 
ATOM 4496  C CE2   . PHE F 2 102 ? 136.877 125.783 145.550 1.00 17.69  ? 100 PHE F CE2   1 
ATOM 4497  C CZ    . PHE F 2 102 ? 137.952 125.472 146.333 1.00 17.69  ? 100 PHE F CZ    1 
ATOM 4498  N N     . GLY F 2 103 ? 134.571 132.113 146.837 1.00 18.83  ? 101 GLY F N     1 
ATOM 4499  C CA    . GLY F 2 103 ? 134.392 133.542 146.736 1.00 18.83  ? 101 GLY F CA    1 
ATOM 4500  C C     . GLY F 2 103 ? 133.819 133.944 145.401 1.00 18.83  ? 101 GLY F C     1 
ATOM 4501  O O     . GLY F 2 103 ? 133.250 133.117 144.695 1.00 18.83  ? 101 GLY F O     1 
ATOM 4502  N N     . ALA G 3 14  ? 136.985 170.845 111.521 1.00 45.15  ? 14  ALA G N     1 
ATOM 4503  C CA    . ALA G 3 14  ? 136.632 169.665 112.300 1.00 45.15  ? 14  ALA G CA    1 
ATOM 4504  C C     . ALA G 3 14  ? 137.235 168.411 111.694 1.00 45.15  ? 14  ALA G C     1 
ATOM 4505  O O     . ALA G 3 14  ? 137.062 168.142 110.511 1.00 45.15  ? 14  ALA G O     1 
ATOM 4506  C CB    . ALA G 3 14  ? 135.126 169.527 112.403 1.00 45.15  ? 14  ALA G CB    1 
ATOM 4507  N N     . LYS G 3 15  ? 137.956 167.651 112.509 1.00 40.67  ? 15  LYS G N     1 
ATOM 4508  C CA    . LYS G 3 15  ? 138.487 166.370 112.079 1.00 40.67  ? 15  LYS G CA    1 
ATOM 4509  C C     . LYS G 3 15  ? 137.906 165.251 112.932 1.00 40.67  ? 15  LYS G C     1 
ATOM 4510  O O     . LYS G 3 15  ? 137.816 165.362 114.156 1.00 40.67  ? 15  LYS G O     1 
ATOM 4511  C CB    . LYS G 3 15  ? 140.014 166.357 112.168 1.00 40.67  ? 15  LYS G CB    1 
ATOM 4512  C CG    . LYS G 3 15  ? 140.656 165.181 111.450 1.00 40.67  ? 15  LYS G CG    1 
ATOM 4513  C CD    . LYS G 3 15  ? 142.168 165.165 111.607 1.00 40.67  ? 15  LYS G CD    1 
ATOM 4514  C CE    . LYS G 3 15  ? 142.776 163.998 110.843 1.00 40.67  ? 15  LYS G CE    1 
ATOM 4515  N NZ    . LYS G 3 15  ? 144.234 163.854 111.061 1.00 40.67  ? 15  LYS G NZ    1 
ATOM 4516  N N     . SER G 3 16  ? 137.509 164.168 112.273 1.00 35.09  ? 16  SER G N     1 
ATOM 4517  C CA    . SER G 3 16  ? 136.954 163.034 112.989 1.00 35.09  ? 16  SER G CA    1 
ATOM 4518  C C     . SER G 3 16  ? 138.048 162.294 113.745 1.00 35.09  ? 16  SER G C     1 
ATOM 4519  O O     . SER G 3 16  ? 139.216 162.277 113.356 1.00 35.09  ? 16  SER G O     1 
ATOM 4520  C CB    . SER G 3 16  ? 136.259 162.072 112.031 1.00 35.09  ? 16  SER G CB    1 
ATOM 4521  O OG    . SER G 3 16  ? 135.103 162.655 111.475 1.00 35.09  ? 16  SER G OG    1 
ATOM 4522  N N     . ARG G 3 17  ? 137.648 161.662 114.841 1.00 28.17  ? 17  ARG G N     1 
ATOM 4523  C CA    . ARG G 3 17  ? 138.549 160.778 115.556 1.00 28.17  ? 17  ARG G CA    1 
ATOM 4524  C C     . ARG G 3 17  ? 138.856 159.512 114.781 1.00 28.17  ? 17  ARG G C     1 
ATOM 4525  O O     . ARG G 3 17  ? 139.906 158.907 115.008 1.00 28.17  ? 17  ARG G O     1 
ATOM 4526  C CB    . ARG G 3 17  ? 137.957 160.415 116.904 1.00 28.17  ? 17  ARG G CB    1 
ATOM 4527  C CG    . ARG G 3 17  ? 137.687 161.592 117.780 1.00 28.17  ? 17  ARG G CG    1 
ATOM 4528  C CD    . ARG G 3 17  ? 137.484 161.138 119.188 1.00 28.17  ? 17  ARG G CD    1 
ATOM 4529  N NE    . ARG G 3 17  ? 136.103 161.298 119.594 1.00 28.17  ? 17  ARG G NE    1 
ATOM 4530  C CZ    . ARG G 3 17  ? 135.586 160.732 120.669 1.00 28.17  ? 17  ARG G CZ    1 
ATOM 4531  N NH1   . ARG G 3 17  ? 136.337 159.964 121.434 1.00 28.17  ? 17  ARG G NH1   1 
ATOM 4532  N NH2   . ARG G 3 17  ? 134.320 160.929 120.972 1.00 28.17  ? 17  ARG G NH2   1 
ATOM 4533  N N     . SER G 3 18  ? 137.969 159.102 113.878 1.00 27.81  ? 18  SER G N     1 
ATOM 4534  C CA    . SER G 3 18  ? 138.251 157.993 112.983 1.00 27.81  ? 18  SER G CA    1 
ATOM 4535  C C     . SER G 3 18  ? 139.366 158.324 112.012 1.00 27.81  ? 18  SER G C     1 
ATOM 4536  O O     . SER G 3 18  ? 140.248 157.495 111.790 1.00 27.81  ? 18  SER G O     1 
ATOM 4537  C CB    . SER G 3 18  ? 136.995 157.622 112.211 1.00 27.81  ? 18  SER G CB    1 
ATOM 4538  O OG    . SER G 3 18  ? 135.975 157.219 113.090 1.00 27.81  ? 18  SER G OG    1 
ATOM 4539  N N     . ASN G 3 19  ? 139.344 159.519 111.426 1.00 32.24  ? 19  ASN G N     1 
ATOM 4540  C CA    . ASN G 3 19  ? 140.432 159.959 110.566 1.00 32.24  ? 19  ASN G CA    1 
ATOM 4541  C C     . ASN G 3 19  ? 141.694 160.224 111.360 1.00 32.24  ? 19  ASN G C     1 
ATOM 4542  O O     . ASN G 3 19  ? 142.796 160.021 110.847 1.00 32.24  ? 19  ASN G O     1 
ATOM 4543  C CB    . ASN G 3 19  ? 140.033 161.223 109.815 1.00 32.24  ? 19  ASN G CB    1 
ATOM 4544  C CG    . ASN G 3 19  ? 139.005 160.963 108.736 1.00 32.24  ? 19  ASN G CG    1 
ATOM 4545  O OD1   . ASN G 3 19  ? 138.340 161.885 108.269 1.00 32.24  ? 19  ASN G OD1   1 
ATOM 4546  N ND2   . ASN G 3 19  ? 138.875 159.707 108.326 1.00 32.24  ? 19  ASN G ND2   1 
ATOM 4547  N N     . ARG G 3 20  ? 141.546 160.681 112.600 1.00 31.81  ? 20  ARG G N     1 
ATOM 4548  C CA    . ARG G 3 20  ? 142.692 160.913 113.463 1.00 31.81  ? 20  ARG G CA    1 
ATOM 4549  C C     . ARG G 3 20  ? 143.375 159.612 113.854 1.00 31.81  ? 20  ARG G C     1 
ATOM 4550  O O     . ARG G 3 20  ? 144.598 159.577 114.006 1.00 31.81  ? 20  ARG G O     1 
ATOM 4551  C CB    . ARG G 3 20  ? 142.236 161.680 114.696 1.00 31.81  ? 20  ARG G CB    1 
ATOM 4552  C CG    . ARG G 3 20  ? 143.317 162.052 115.665 1.00 31.81  ? 20  ARG G CG    1 
ATOM 4553  C CD    . ARG G 3 20  ? 142.829 163.132 116.574 1.00 31.81  ? 20  ARG G CD    1 
ATOM 4554  N NE    . ARG G 3 20  ? 142.086 164.128 115.821 1.00 31.81  ? 20  ARG G NE    1 
ATOM 4555  C CZ    . ARG G 3 20  ? 140.947 164.661 116.231 1.00 31.81  ? 20  ARG G CZ    1 
ATOM 4556  N NH1   . ARG G 3 20  ? 140.425 164.294 117.391 1.00 31.81  ? 20  ARG G NH1   1 
ATOM 4557  N NH2   . ARG G 3 20  ? 140.332 165.564 115.485 1.00 31.81  ? 20  ARG G NH2   1 
ATOM 4558  N N     . ALA G 3 21  ? 142.613 158.535 114.001 1.00 26.32  ? 21  ALA G N     1 
ATOM 4559  C CA    . ALA G 3 21  ? 143.159 157.238 114.365 1.00 26.32  ? 21  ALA G CA    1 
ATOM 4560  C C     . ALA G 3 21  ? 143.487 156.368 113.167 1.00 26.32  ? 21  ALA G C     1 
ATOM 4561  O O     . ALA G 3 21  ? 144.075 155.301 113.344 1.00 26.32  ? 21  ALA G O     1 
ATOM 4562  C CB    . ALA G 3 21  ? 142.177 156.494 115.263 1.00 26.32  ? 21  ALA G CB    1 
ATOM 4563  N N     . GLY G 3 22  ? 143.127 156.789 111.962 1.00 23.38  ? 22  GLY G N     1 
ATOM 4564  C CA    . GLY G 3 22  ? 143.389 155.988 110.789 1.00 23.38  ? 22  GLY G CA    1 
ATOM 4565  C C     . GLY G 3 22  ? 142.425 154.853 110.579 1.00 23.38  ? 22  GLY G C     1 
ATOM 4566  O O     . GLY G 3 22  ? 142.808 153.821 110.027 1.00 23.38  ? 22  GLY G O     1 
ATOM 4567  N N     . LEU G 3 23  ? 141.178 155.013 110.990 1.00 22.46  ? 23  LEU G N     1 
ATOM 4568  C CA    . LEU G 3 23  ? 140.202 153.940 110.995 1.00 22.46  ? 23  LEU G CA    1 
ATOM 4569  C C     . LEU G 3 23  ? 139.043 154.274 110.071 1.00 22.46  ? 23  LEU G C     1 
ATOM 4570  O O     . LEU G 3 23  ? 138.850 155.419 109.665 1.00 22.46  ? 23  LEU G O     1 
ATOM 4571  C CB    . LEU G 3 23  ? 139.698 153.691 112.411 1.00 22.46  ? 23  LEU G CB    1 
ATOM 4572  C CG    . LEU G 3 23  ? 140.750 153.221 113.393 1.00 22.46  ? 23  LEU G CG    1 
ATOM 4573  C CD1   . LEU G 3 23  ? 140.188 153.279 114.771 1.00 22.46  ? 23  LEU G CD1   1 
ATOM 4574  C CD2   . LEU G 3 23  ? 141.186 151.833 113.044 1.00 22.46  ? 23  LEU G CD2   1 
ATOM 4575  N N     . GLN G 3 24  ? 138.266 153.250 109.740 1.00 22.99  ? 24  GLN G N     1 
ATOM 4576  C CA    . GLN G 3 24  ? 137.014 153.424 109.023 1.00 22.99  ? 24  GLN G CA    1 
ATOM 4577  C C     . GLN G 3 24  ? 135.793 153.279 109.903 1.00 22.99  ? 24  GLN G C     1 
ATOM 4578  O O     . GLN G 3 24  ? 134.703 153.621 109.462 1.00 22.99  ? 24  GLN G O     1 
ATOM 4579  C CB    . GLN G 3 24  ? 136.894 152.422 107.868 1.00 22.99  ? 24  GLN G CB    1 
ATOM 4580  C CG    . GLN G 3 24  ? 138.100 152.355 106.966 1.00 22.99  ? 24  GLN G CG    1 
ATOM 4581  C CD    . GLN G 3 24  ? 138.345 153.642 106.227 1.00 22.99  ? 24  GLN G CD    1 
ATOM 4582  O OE1   . GLN G 3 24  ? 137.431 154.244 105.679 1.00 22.99  ? 24  GLN G OE1   1 
ATOM 4583  N NE2   . GLN G 3 24  ? 139.591 154.082 106.219 1.00 22.99  ? 24  GLN G NE2   1 
ATOM 4584  N N     . PHE G 3 25  ? 135.950 152.791 111.129 1.00 20.54  ? 25  PHE G N     1 
ATOM 4585  C CA    . PHE G 3 25  ? 134.828 152.591 112.029 1.00 20.54  ? 25  PHE G CA    1 
ATOM 4586  C C     . PHE G 3 25  ? 134.666 153.809 112.939 1.00 20.54  ? 25  PHE G C     1 
ATOM 4587  O O     . PHE G 3 25  ? 135.643 154.490 113.241 1.00 20.54  ? 25  PHE G O     1 
ATOM 4588  C CB    . PHE G 3 25  ? 135.052 151.316 112.836 1.00 20.54  ? 25  PHE G CB    1 
ATOM 4589  C CG    . PHE G 3 25  ? 134.436 150.104 112.208 1.00 20.54  ? 25  PHE G CG    1 
ATOM 4590  C CD1   . PHE G 3 25  ? 134.814 149.700 110.948 1.00 20.54  ? 25  PHE G CD1   1 
ATOM 4591  C CD2   . PHE G 3 25  ? 133.466 149.387 112.864 1.00 20.54  ? 25  PHE G CD2   1 
ATOM 4592  C CE1   . PHE G 3 25  ? 134.248 148.600 110.370 1.00 20.54  ? 25  PHE G CE1   1 
ATOM 4593  C CE2   . PHE G 3 25  ? 132.896 148.292 112.276 1.00 20.54  ? 25  PHE G CE2   1 
ATOM 4594  C CZ    . PHE G 3 25  ? 133.292 147.902 111.030 1.00 20.54  ? 25  PHE G CZ    1 
ATOM 4595  N N     . PRO G 3 26  ? 133.440 154.126 113.370 1.00 20.11  ? 26  PRO G N     1 
ATOM 4596  C CA    . PRO G 3 26  ? 133.191 155.429 114.011 1.00 20.11  ? 26  PRO G CA    1 
ATOM 4597  C C     . PRO G 3 26  ? 133.614 155.476 115.473 1.00 20.11  ? 26  PRO G C     1 
ATOM 4598  O O     . PRO G 3 26  ? 132.916 154.966 116.349 1.00 20.11  ? 26  PRO G O     1 
ATOM 4599  C CB    . PRO G 3 26  ? 131.679 155.603 113.865 1.00 20.11  ? 26  PRO G CB    1 
ATOM 4600  C CG    . PRO G 3 26  ? 131.155 154.247 113.774 1.00 20.11  ? 26  PRO G CG    1 
ATOM 4601  C CD    . PRO G 3 26  ? 132.179 153.411 113.113 1.00 20.11  ? 26  PRO G CD    1 
ATOM 4602  N N     . VAL G 3 27  ? 134.721 156.166 115.743 1.00 19.88  ? 27  VAL G N     1 
ATOM 4603  C CA    . VAL G 3 27  ? 135.251 156.250 117.100 1.00 19.88  ? 27  VAL G CA    1 
ATOM 4604  C C     . VAL G 3 27  ? 134.325 157.068 117.994 1.00 19.88  ? 27  VAL G C     1 
ATOM 4605  O O     . VAL G 3 27  ? 134.108 156.721 119.156 1.00 19.88  ? 27  VAL G O     1 
ATOM 4606  C CB    . VAL G 3 27  ? 136.682 156.814 117.057 1.00 19.88  ? 27  VAL G CB    1 
ATOM 4607  C CG1   . VAL G 3 27  ? 137.222 157.072 118.428 1.00 19.88  ? 27  VAL G CG1   1 
ATOM 4608  C CG2   . VAL G 3 27  ? 137.584 155.854 116.349 1.00 19.88  ? 27  VAL G CG2   1 
ATOM 4609  N N     . GLY G 3 28  ? 133.688 158.100 117.446 1.00 22.88  ? 28  GLY G N     1 
ATOM 4610  C CA    . GLY G 3 28  ? 132.776 158.903 118.244 1.00 22.88  ? 28  GLY G CA    1 
ATOM 4611  C C     . GLY G 3 28  ? 131.470 158.202 118.566 1.00 22.88  ? 28  GLY G C     1 
ATOM 4612  O O     . GLY G 3 28  ? 130.949 158.327 119.676 1.00 22.88  ? 28  GLY G O     1 
ATOM 4613  N N     . ARG G 3 29  ? 130.930 157.448 117.611 1.00 22.14  ? 29  ARG G N     1 
ATOM 4614  C CA    . ARG G 3 29  ? 129.718 156.682 117.874 1.00 22.14  ? 29  ARG G CA    1 
ATOM 4615  C C     . ARG G 3 29  ? 129.983 155.537 118.839 1.00 22.14  ? 29  ARG G C     1 
ATOM 4616  O O     . ARG G 3 29  ? 129.160 155.256 119.714 1.00 22.14  ? 29  ARG G O     1 
ATOM 4617  C CB    . ARG G 3 29  ? 129.138 156.155 116.570 1.00 22.14  ? 29  ARG G CB    1 
ATOM 4618  C CG    . ARG G 3 29  ? 127.945 155.261 116.734 1.00 22.14  ? 29  ARG G CG    1 
ATOM 4619  C CD    . ARG G 3 29  ? 127.611 154.577 115.450 1.00 22.14  ? 29  ARG G CD    1 
ATOM 4620  N NE    . ARG G 3 29  ? 127.147 155.532 114.465 1.00 22.14  ? 29  ARG G NE    1 
ATOM 4621  C CZ    . ARG G 3 29  ? 126.580 155.194 113.320 1.00 22.14  ? 29  ARG G CZ    1 
ATOM 4622  N NH1   . ARG G 3 29  ? 126.405 153.923 113.024 1.00 22.14  ? 29  ARG G NH1   1 
ATOM 4623  N NH2   . ARG G 3 29  ? 126.180 156.123 112.479 1.00 22.14  ? 29  ARG G NH2   1 
ATOM 4624  N N     . ILE G 3 30  ? 131.136 154.881 118.712 1.00 18.70  ? 30  ILE G N     1 
ATOM 4625  C CA    . ILE G 3 30  ? 131.504 153.837 119.658 1.00 18.70  ? 30  ILE G CA    1 
ATOM 4626  C C     . ILE G 3 30  ? 131.757 154.426 121.043 1.00 18.70  ? 30  ILE G C     1 
ATOM 4627  O O     . ILE G 3 30  ? 131.430 153.801 122.055 1.00 18.70  ? 30  ILE G O     1 
ATOM 4628  C CB    . ILE G 3 30  ? 132.704 153.055 119.090 1.00 18.70  ? 30  ILE G CB    1 
ATOM 4629  C CG1   . ILE G 3 30  ? 132.225 152.145 117.971 1.00 18.70  ? 30  ILE G CG1   1 
ATOM 4630  C CG2   . ILE G 3 30  ? 133.403 152.209 120.122 1.00 18.70  ? 30  ILE G CG2   1 
ATOM 4631  C CD1   . ILE G 3 30  ? 133.262 151.813 116.979 1.00 18.70  ? 30  ILE G CD1   1 
ATOM 4632  N N     . HIS G 3 31  ? 132.263 155.661 121.115 1.00 21.23  ? 31  HIS G N     1 
ATOM 4633  C CA    . HIS G 3 31  ? 132.417 156.348 122.393 1.00 21.23  ? 31  HIS G CA    1 
ATOM 4634  C C     . HIS G 3 31  ? 131.076 156.630 123.043 1.00 21.23  ? 31  HIS G C     1 
ATOM 4635  O O     . HIS G 3 31  ? 130.922 156.443 124.254 1.00 21.23  ? 31  HIS G O     1 
ATOM 4636  C CB    . HIS G 3 31  ? 133.177 157.649 122.184 1.00 21.23  ? 31  HIS G CB    1 
ATOM 4637  C CG    . HIS G 3 31  ? 133.582 158.327 123.450 1.00 21.23  ? 31  HIS G CG    1 
ATOM 4638  N ND1   . HIS G 3 31  ? 134.280 157.687 124.448 1.00 21.23  ? 31  HIS G ND1   1 
ATOM 4639  C CD2   . HIS G 3 31  ? 133.403 159.595 123.875 1.00 21.23  ? 31  HIS G CD2   1 
ATOM 4640  C CE1   . HIS G 3 31  ? 134.510 158.530 125.434 1.00 21.23  ? 31  HIS G CE1   1 
ATOM 4641  N NE2   . HIS G 3 31  ? 133.982 159.695 125.114 1.00 21.23  ? 31  HIS G NE2   1 
ATOM 4642  N N     . ARG G 3 32  ? 130.091 157.061 122.253 1.00 23.24  ? 32  ARG G N     1 
ATOM 4643  C CA    . ARG G 3 32  ? 128.756 157.285 122.795 1.00 23.24  ? 32  ARG G CA    1 
ATOM 4644  C C     . ARG G 3 32  ? 128.120 155.987 123.264 1.00 23.24  ? 32  ARG G C     1 
ATOM 4645  O O     . ARG G 3 32  ? 127.533 155.939 124.347 1.00 23.24  ? 32  ARG G O     1 
ATOM 4646  C CB    . ARG G 3 32  ? 127.861 157.959 121.759 1.00 23.24  ? 32  ARG G CB    1 
ATOM 4647  C CG    . ARG G 3 32  ? 126.397 157.928 122.144 1.00 23.24  ? 32  ARG G CG    1 
ATOM 4648  C CD    . ARG G 3 32  ? 125.501 158.664 121.213 1.00 23.24  ? 32  ARG G CD    1 
ATOM 4649  N NE    . ARG G 3 32  ? 125.517 158.113 119.869 1.00 23.24  ? 32  ARG G NE    1 
ATOM 4650  C CZ    . ARG G 3 32  ? 124.796 157.077 119.476 1.00 23.24  ? 32  ARG G CZ    1 
ATOM 4651  N NH1   . ARG G 3 32  ? 124.000 156.459 120.327 1.00 23.24  ? 32  ARG G NH1   1 
ATOM 4652  N NH2   . ARG G 3 32  ? 124.872 156.661 118.228 1.00 23.24  ? 32  ARG G NH2   1 
ATOM 4653  N N     . LEU G 3 33  ? 128.247 154.919 122.476 1.00 19.09  ? 33  LEU G N     1 
ATOM 4654  C CA    . LEU G 3 33  ? 127.666 153.634 122.845 1.00 19.09  ? 33  LEU G CA    1 
ATOM 4655  C C     . LEU G 3 33  ? 128.333 153.017 124.061 1.00 19.09  ? 33  LEU G C     1 
ATOM 4656  O O     . LEU G 3 33  ? 127.677 152.284 124.798 1.00 19.09  ? 33  LEU G O     1 
ATOM 4657  C CB    . LEU G 3 33  ? 127.757 152.654 121.683 1.00 19.09  ? 33  LEU G CB    1 
ATOM 4658  C CG    . LEU G 3 33  ? 126.895 152.911 120.460 1.00 19.09  ? 33  LEU G CG    1 
ATOM 4659  C CD1   . LEU G 3 33  ? 127.190 151.862 119.432 1.00 19.09  ? 33  LEU G CD1   1 
ATOM 4660  C CD2   . LEU G 3 33  ? 125.454 152.885 120.834 1.00 19.09  ? 33  LEU G CD2   1 
ATOM 4661  N N     . LEU G 3 34  ? 129.613 153.282 124.280 1.00 18.30  ? 34  LEU G N     1 
ATOM 4662  C CA    . LEU G 3 34  ? 130.249 152.856 125.515 1.00 18.30  ? 34  LEU G CA    1 
ATOM 4663  C C     . LEU G 3 34  ? 129.783 153.693 126.691 1.00 18.30  ? 34  LEU G C     1 
ATOM 4664  O O     . LEU G 3 34  ? 129.587 153.165 127.787 1.00 18.30  ? 34  LEU G O     1 
ATOM 4665  C CB    . LEU G 3 34  ? 131.763 152.948 125.388 1.00 18.30  ? 34  LEU G CB    1 
ATOM 4666  C CG    . LEU G 3 34  ? 132.476 151.786 124.723 1.00 18.30  ? 34  LEU G CG    1 
ATOM 4667  C CD1   . LEU G 3 34  ? 133.865 152.195 124.379 1.00 18.30  ? 34  LEU G CD1   1 
ATOM 4668  C CD2   . LEU G 3 34  ? 132.495 150.607 125.640 1.00 18.30  ? 34  LEU G CD2   1 
ATOM 4669  N N     . ARG G 3 35  ? 129.612 154.996 126.490 1.00 21.89  ? 35  ARG G N     1 
ATOM 4670  C CA    . ARG G 3 35  ? 129.172 155.877 127.561 1.00 21.89  ? 35  ARG G CA    1 
ATOM 4671  C C     . ARG G 3 35  ? 127.712 155.693 127.934 1.00 21.89  ? 35  ARG G C     1 
ATOM 4672  O O     . ARG G 3 35  ? 127.332 156.050 129.048 1.00 21.89  ? 35  ARG G O     1 
ATOM 4673  C CB    . ARG G 3 35  ? 129.404 157.332 127.171 1.00 21.89  ? 35  ARG G CB    1 
ATOM 4674  C CG    . ARG G 3 35  ? 130.786 157.859 127.466 1.00 21.89  ? 35  ARG G CG    1 
ATOM 4675  C CD    . ARG G 3 35  ? 130.805 159.370 127.409 1.00 21.89  ? 35  ARG G CD    1 
ATOM 4676  N NE    . ARG G 3 35  ? 130.942 159.882 126.050 1.00 21.89  ? 35  ARG G NE    1 
ATOM 4677  C CZ    . ARG G 3 35  ? 129.933 160.311 125.294 1.00 21.89  ? 35  ARG G CZ    1 
ATOM 4678  N NH1   . ARG G 3 35  ? 128.690 160.293 125.754 1.00 21.89  ? 35  ARG G NH1   1 
ATOM 4679  N NH2   . ARG G 3 35  ? 130.166 160.756 124.070 1.00 21.89  ? 35  ARG G NH2   1 
ATOM 4680  N N     . LYS G 3 36  ? 126.887 155.149 127.050 1.00 20.92  ? 36  LYS G N     1 
ATOM 4681  C CA    . LYS G 3 36  ? 125.467 155.009 127.328 1.00 20.92  ? 36  LYS G CA    1 
ATOM 4682  C C     . LYS G 3 36  ? 125.043 153.554 127.385 1.00 20.92  ? 36  LYS G C     1 
ATOM 4683  O O     . LYS G 3 36  ? 123.870 153.240 127.177 1.00 20.92  ? 36  LYS G O     1 
ATOM 4684  C CB    . LYS G 3 36  ? 124.636 155.729 126.280 1.00 20.92  ? 36  LYS G CB    1 
ATOM 4685  C CG    . LYS G 3 36  ? 124.850 157.204 126.287 1.00 20.92  ? 36  LYS G CG    1 
ATOM 4686  C CD    . LYS G 3 36  ? 123.661 157.941 125.742 1.00 20.92  ? 36  LYS G CD    1 
ATOM 4687  C CE    . LYS G 3 36  ? 123.903 159.424 125.849 1.00 20.92  ? 36  LYS G CE    1 
ATOM 4688  N NZ    . LYS G 3 36  ? 124.375 159.765 127.215 1.00 20.92  ? 36  LYS G NZ    1 
ATOM 4689  N N     . GLY G 3 37  ? 125.969 152.655 127.669 1.00 19.17  ? 37  GLY G N     1 
ATOM 4690  C CA    . GLY G 3 37  ? 125.645 151.254 127.609 1.00 19.17  ? 37  GLY G CA    1 
ATOM 4691  C C     . GLY G 3 37  ? 125.628 150.613 128.966 1.00 19.17  ? 37  GLY G C     1 
ATOM 4692  O O     . GLY G 3 37  ? 125.409 149.405 129.069 1.00 19.17  ? 37  GLY G O     1 
ATOM 4693  N N     . ASN G 3 38  ? 125.821 151.433 130.002 1.00 18.93  ? 38  ASN G N     1 
ATOM 4694  C CA    . ASN G 3 38  ? 125.994 151.008 131.393 1.00 18.93  ? 38  ASN G CA    1 
ATOM 4695  C C     . ASN G 3 38  ? 127.132 149.998 131.502 1.00 18.93  ? 38  ASN G C     1 
ATOM 4696  O O     . ASN G 3 38  ? 126.940 148.837 131.845 1.00 18.93  ? 38  ASN G O     1 
ATOM 4697  C CB    . ASN G 3 38  ? 124.704 150.446 132.000 1.00 18.93  ? 38  ASN G CB    1 
ATOM 4698  C CG    . ASN G 3 38  ? 123.481 151.214 131.591 1.00 18.93  ? 38  ASN G CG    1 
ATOM 4699  O OD1   . ASN G 3 38  ? 122.556 150.656 131.006 1.00 18.93  ? 38  ASN G OD1   1 
ATOM 4700  N ND2   . ASN G 3 38  ? 123.460 152.500 131.899 1.00 18.93  ? 38  ASN G ND2   1 
ATOM 4701  N N     . TYR G 3 39  ? 128.325 150.465 131.172 1.00 16.74  ? 39  TYR G N     1 
ATOM 4702  C CA    . TYR G 3 39  ? 129.513 149.637 131.186 1.00 16.74  ? 39  TYR G CA    1 
ATOM 4703  C C     . TYR G 3 39  ? 130.480 150.049 132.279 1.00 16.74  ? 39  TYR G C     1 
ATOM 4704  O O     . TYR G 3 39  ? 131.035 149.195 132.968 1.00 16.74  ? 39  TYR G O     1 
ATOM 4705  C CB    . TYR G 3 39  ? 130.200 149.697 129.822 1.00 16.74  ? 39  TYR G CB    1 
ATOM 4706  C CG    . TYR G 3 39  ? 129.471 148.957 128.743 1.00 16.74  ? 39  TYR G CG    1 
ATOM 4707  C CD1   . TYR G 3 39  ? 129.108 147.644 128.912 1.00 16.74  ? 39  TYR G CD1   1 
ATOM 4708  C CD2   . TYR G 3 39  ? 129.149 149.576 127.559 1.00 16.74  ? 39  TYR G CD2   1 
ATOM 4709  C CE1   . TYR G 3 39  ? 128.449 146.970 127.938 1.00 16.74  ? 39  TYR G CE1   1 
ATOM 4710  C CE2   . TYR G 3 39  ? 128.483 148.911 126.581 1.00 16.74  ? 39  TYR G CE2   1 
ATOM 4711  C CZ    . TYR G 3 39  ? 128.139 147.606 126.773 1.00 16.74  ? 39  TYR G CZ    1 
ATOM 4712  O OH    . TYR G 3 39  ? 127.471 146.927 125.789 1.00 16.74  ? 39  TYR G OH    1 
ATOM 4713  N N     . ALA G 3 40  ? 130.690 151.346 132.455 1.00 20.90  ? 40  ALA G N     1 
ATOM 4714  C CA    . ALA G 3 40  ? 131.422 151.866 133.589 1.00 20.90  ? 40  ALA G CA    1 
ATOM 4715  C C     . ALA G 3 40  ? 130.949 153.279 133.856 1.00 20.90  ? 40  ALA G C     1 
ATOM 4716  O O     . ALA G 3 40  ? 130.238 153.882 133.053 1.00 20.90  ? 40  ALA G O     1 
ATOM 4717  C CB    . ALA G 3 40  ? 132.929 151.846 133.361 1.00 20.90  ? 40  ALA G CB    1 
ATOM 4718  N N     . GLU G 3 41  ? 131.363 153.808 135.001 1.00 26.72  ? 41  GLU G N     1 
ATOM 4719  C CA    . GLU G 3 41  ? 130.962 155.142 135.410 1.00 26.72  ? 41  GLU G CA    1 
ATOM 4720  C C     . GLU G 3 41  ? 131.606 156.222 134.552 1.00 26.72  ? 41  GLU G C     1 
ATOM 4721  O O     . GLU G 3 41  ? 131.000 157.275 134.351 1.00 26.72  ? 41  GLU G O     1 
ATOM 4722  C CB    . GLU G 3 41  ? 131.280 155.314 136.899 1.00 26.72  ? 41  GLU G CB    1 
ATOM 4723  C CG    . GLU G 3 41  ? 130.591 156.472 137.593 1.00 26.72  ? 41  GLU G CG    1 
ATOM 4724  C CD    . GLU G 3 41  ? 131.456 157.706 137.706 1.00 26.72  ? 41  GLU G CD    1 
ATOM 4725  O OE1   . GLU G 3 41  ? 132.678 157.561 137.898 1.00 26.72  ? 41  GLU G OE1   1 
ATOM 4726  O OE2   . GLU G 3 41  ? 130.916 158.826 137.600 1.00 26.72  ? 41  GLU G OE2   1 
ATOM 4727  N N     . ARG G 3 42  ? 132.796 155.972 134.014 1.00 28.91  ? 42  ARG G N     1 
ATOM 4728  C CA    . ARG G 3 42  ? 133.413 156.851 133.037 1.00 28.91  ? 42  ARG G CA    1 
ATOM 4729  C C     . ARG G 3 42  ? 134.159 156.018 132.007 1.00 28.91  ? 42  ARG G C     1 
ATOM 4730  O O     . ARG G 3 42  ? 134.463 154.854 132.241 1.00 28.91  ? 42  ARG G O     1 
ATOM 4731  C CB    . ARG G 3 42  ? 134.337 157.855 133.711 1.00 28.91  ? 42  ARG G CB    1 
ATOM 4732  C CG    . ARG G 3 42  ? 135.050 157.306 134.891 1.00 28.91  ? 42  ARG G CG    1 
ATOM 4733  C CD    . ARG G 3 42  ? 135.942 158.311 135.555 1.00 28.91  ? 42  ARG G CD    1 
ATOM 4734  N NE    . ARG G 3 42  ? 135.220 159.506 135.948 1.00 28.91  ? 42  ARG G NE    1 
ATOM 4735  C CZ    . ARG G 3 42  ? 135.694 160.735 135.808 1.00 28.91  ? 42  ARG G CZ    1 
ATOM 4736  N NH1   . ARG G 3 42  ? 136.903 160.925 135.304 1.00 28.91  ? 42  ARG G NH1   1 
ATOM 4737  N NH2   . ARG G 3 42  ? 134.974 161.774 136.195 1.00 28.91  ? 42  ARG G NH2   1 
ATOM 4738  N N     . VAL G 3 43  ? 134.420 156.610 130.844 1.00 25.05  ? 43  VAL G N     1 
ATOM 4739  C CA    . VAL G 3 43  ? 135.018 155.912 129.710 1.00 25.05  ? 43  VAL G CA    1 
ATOM 4740  C C     . VAL G 3 43  ? 136.210 156.715 129.216 1.00 25.05  ? 43  VAL G C     1 
ATOM 4741  O O     . VAL G 3 43  ? 136.062 157.886 128.863 1.00 25.05  ? 43  VAL G O     1 
ATOM 4742  C CB    . VAL G 3 43  ? 134.005 155.705 128.568 1.00 25.05  ? 43  VAL G CB    1 
ATOM 4743  C CG1   . VAL G 3 43  ? 134.697 155.234 127.320 1.00 25.05  ? 43  VAL G CG1   1 
ATOM 4744  C CG2   . VAL G 3 43  ? 132.957 154.708 128.971 1.00 25.05  ? 43  VAL G CG2   1 
ATOM 4745  N N     . GLY G 3 44  ? 137.377 156.079 129.168 1.00 24.11  ? 44  GLY G N     1 
ATOM 4746  C CA    . GLY G 3 44  ? 138.596 156.743 128.764 1.00 24.11  ? 44  GLY G CA    1 
ATOM 4747  C C     . GLY G 3 44  ? 138.618 157.155 127.306 1.00 24.11  ? 44  GLY G C     1 
ATOM 4748  O O     . GLY G 3 44  ? 137.718 156.874 126.522 1.00 24.11  ? 44  GLY G O     1 
ATOM 4749  N N     . ALA G 3 45  ? 139.690 157.846 126.934 1.00 22.70  ? 45  ALA G N     1 
ATOM 4750  C CA    . ALA G 3 45  ? 139.781 158.427 125.602 1.00 22.70  ? 45  ALA G CA    1 
ATOM 4751  C C     . ALA G 3 45  ? 140.208 157.417 124.553 1.00 22.70  ? 45  ALA G C     1 
ATOM 4752  O O     . ALA G 3 45  ? 139.668 157.420 123.444 1.00 22.70  ? 45  ALA G O     1 
ATOM 4753  C CB    . ALA G 3 45  ? 140.763 159.593 125.604 1.00 22.70  ? 45  ALA G CB    1 
ATOM 4754  N N     . GLY G 3 46  ? 141.175 156.566 124.872 1.00 18.65  ? 46  GLY G N     1 
ATOM 4755  C CA    . GLY G 3 46  ? 141.683 155.575 123.957 1.00 18.65  ? 46  GLY G CA    1 
ATOM 4756  C C     . GLY G 3 46  ? 140.868 154.310 123.870 1.00 18.65  ? 46  GLY G C     1 
ATOM 4757  O O     . GLY G 3 46  ? 141.172 153.457 123.031 1.00 18.65  ? 46  GLY G O     1 
ATOM 4758  N N     . ALA G 3 47  ? 139.844 154.156 124.687 1.00 17.34  ? 47  ALA G N     1 
ATOM 4759  C CA    . ALA G 3 47  ? 139.047 152.939 124.664 1.00 17.34  ? 47  ALA G CA    1 
ATOM 4760  C C     . ALA G 3 47  ? 138.124 152.832 123.444 1.00 17.34  ? 47  ALA G C     1 
ATOM 4761  O O     . ALA G 3 47  ? 138.055 151.739 122.869 1.00 17.34  ? 47  ALA G O     1 
ATOM 4762  C CB    . ALA G 3 47  ? 138.267 152.796 125.970 1.00 17.34  ? 47  ALA G CB    1 
ATOM 4763  N N     . PRO G 3 48  ? 137.416 153.883 122.983 1.00 17.38  ? 48  PRO G N     1 
ATOM 4764  C CA    . PRO G 3 48  ? 136.730 153.736 121.693 1.00 17.38  ? 48  PRO G CA    1 
ATOM 4765  C C     . PRO G 3 48  ? 137.668 153.618 120.512 1.00 17.38  ? 48  PRO G C     1 
ATOM 4766  O O     . PRO G 3 48  ? 137.296 153.000 119.514 1.00 17.38  ? 48  PRO G O     1 
ATOM 4767  C CB    . PRO G 3 48  ? 135.873 155.000 121.605 1.00 17.38  ? 48  PRO G CB    1 
ATOM 4768  C CG    . PRO G 3 48  ? 136.484 155.920 122.490 1.00 17.38  ? 48  PRO G CG    1 
ATOM 4769  C CD    . PRO G 3 48  ? 136.938 155.122 123.625 1.00 17.38  ? 48  PRO G CD    1 
ATOM 4770  N N     . VAL G 3 49  ? 138.889 154.136 120.617 1.00 17.29  ? 49  VAL G N     1 
ATOM 4771  C CA    . VAL G 3 49  ? 139.869 153.992 119.548 1.00 17.29  ? 49  VAL G CA    1 
ATOM 4772  C C     . VAL G 3 49  ? 140.333 152.550 119.437 1.00 17.29  ? 49  VAL G C     1 
ATOM 4773  O O     . VAL G 3 49  ? 140.366 151.977 118.340 1.00 17.29  ? 49  VAL G O     1 
ATOM 4774  C CB    . VAL G 3 49  ? 141.043 154.948 119.795 1.00 17.29  ? 49  VAL G CB    1 
ATOM 4775  C CG1   . VAL G 3 49  ? 141.968 154.923 118.647 1.00 17.29  ? 49  VAL G CG1   1 
ATOM 4776  C CG2   . VAL G 3 49  ? 140.528 156.328 119.992 1.00 17.29  ? 49  VAL G CG2   1 
ATOM 4777  N N     . TYR G 3 50  ? 140.668 151.937 120.574 1.00 14.87  ? 50  TYR G N     1 
ATOM 4778  C CA    . TYR G 3 50  ? 141.067 150.536 120.607 1.00 14.87  ? 50  TYR G CA    1 
ATOM 4779  C C     . TYR G 3 50  ? 139.933 149.627 120.159 1.00 14.87  ? 50  TYR G C     1 
ATOM 4780  O O     . TYR G 3 50  ? 140.148 148.693 119.380 1.00 14.87  ? 50  TYR G O     1 
ATOM 4781  C CB    . TYR G 3 50  ? 141.507 150.167 122.018 1.00 14.87  ? 50  TYR G CB    1 
ATOM 4782  C CG    . TYR G 3 50  ? 142.535 149.074 122.110 1.00 14.87  ? 50  TYR G CG    1 
ATOM 4783  C CD1   . TYR G 3 50  ? 143.823 149.352 122.493 1.00 14.87  ? 50  TYR G CD1   1 
ATOM 4784  C CD2   . TYR G 3 50  ? 142.214 147.768 121.802 1.00 14.87  ? 50  TYR G CD2   1 
ATOM 4785  C CE1   . TYR G 3 50  ? 144.745 148.370 122.580 1.00 14.87  ? 50  TYR G CE1   1 
ATOM 4786  C CE2   . TYR G 3 50  ? 143.134 146.782 121.882 1.00 14.87  ? 50  TYR G CE2   1 
ATOM 4787  C CZ    . TYR G 3 50  ? 144.394 147.089 122.267 1.00 14.87  ? 50  TYR G CZ    1 
ATOM 4788  O OH    . TYR G 3 50  ? 145.324 146.099 122.349 1.00 14.87  ? 50  TYR G OH    1 
ATOM 4789  N N     . LEU G 3 51  ? 138.715 149.889 120.633 1.00 14.48  ? 51  LEU G N     1 
ATOM 4790  C CA    . LEU G 3 51  ? 137.596 149.025 120.296 1.00 14.48  ? 51  LEU G CA    1 
ATOM 4791  C C     . LEU G 3 51  ? 137.189 149.172 118.835 1.00 14.48  ? 51  LEU G C     1 
ATOM 4792  O O     . LEU G 3 51  ? 136.825 148.180 118.199 1.00 14.48  ? 51  LEU G O     1 
ATOM 4793  C CB    . LEU G 3 51  ? 136.439 149.324 121.244 1.00 14.48  ? 51  LEU G CB    1 
ATOM 4794  C CG    . LEU G 3 51  ? 135.187 148.457 121.275 1.00 14.48  ? 51  LEU G CG    1 
ATOM 4795  C CD1   . LEU G 3 51  ? 135.524 147.005 121.168 1.00 14.48  ? 51  LEU G CD1   1 
ATOM 4796  C CD2   . LEU G 3 51  ? 134.454 148.693 122.543 1.00 14.48  ? 51  LEU G CD2   1 
ATOM 4797  N N     . ALA G 3 52  ? 137.304 150.372 118.266 1.00 17.06  ? 52  ALA G N     1 
ATOM 4798  C CA    . ALA G 3 52  ? 137.026 150.548 116.849 1.00 17.06  ? 52  ALA G CA    1 
ATOM 4799  C C     . ALA G 3 52  ? 138.082 149.878 115.989 1.00 17.06  ? 52  ALA G C     1 
ATOM 4800  O O     . ALA G 3 52  ? 137.764 149.320 114.937 1.00 17.06  ? 52  ALA G O     1 
ATOM 4801  C CB    . ALA G 3 52  ? 136.934 152.030 116.517 1.00 17.06  ? 52  ALA G CB    1 
ATOM 4802  N N     . ALA G 3 53  ? 139.339 149.894 116.431 1.00 16.10  ? 53  ALA G N     1 
ATOM 4803  C CA    . ALA G 3 53  ? 140.385 149.224 115.670 1.00 16.10  ? 53  ALA G CA    1 
ATOM 4804  C C     . ALA G 3 53  ? 140.227 147.713 115.696 1.00 16.10  ? 53  ALA G C     1 
ATOM 4805  O O     . ALA G 3 53  ? 140.450 147.047 114.681 1.00 16.10  ? 53  ALA G O     1 
ATOM 4806  C CB    . ALA G 3 53  ? 141.743 149.616 116.209 1.00 16.10  ? 53  ALA G CB    1 
ATOM 4807  N N     . VAL G 3 54  ? 139.817 147.157 116.835 1.00 15.03  ? 54  VAL G N     1 
ATOM 4808  C CA    . VAL G 3 54  ? 139.603 145.715 116.930 1.00 15.03  ? 54  VAL G CA    1 
ATOM 4809  C C     . VAL G 3 54  ? 138.392 145.289 116.104 1.00 15.03  ? 54  VAL G C     1 
ATOM 4810  O O     . VAL G 3 54  ? 138.430 144.270 115.400 1.00 15.03  ? 54  VAL G O     1 
ATOM 4811  C CB    . VAL G 3 54  ? 139.476 145.309 118.408 1.00 15.03  ? 54  VAL G CB    1 
ATOM 4812  C CG1   . VAL G 3 54  ? 138.985 143.898 118.551 1.00 15.03  ? 54  VAL G CG1   1 
ATOM 4813  C CG2   . VAL G 3 54  ? 140.806 145.450 119.080 1.00 15.03  ? 54  VAL G CG2   1 
ATOM 4814  N N     . MET G 3 55  ? 137.319 146.077 116.132 1.00 17.29  ? 55  MET G N     1 
ATOM 4815  C CA    . MET G 3 55  ? 136.148 145.741 115.332 1.00 17.29  ? 55  MET G CA    1 
ATOM 4816  C C     . MET G 3 55  ? 136.410 145.875 113.840 1.00 17.29  ? 55  MET G C     1 
ATOM 4817  O O     . MET G 3 55  ? 135.910 145.065 113.054 1.00 17.29  ? 55  MET G O     1 
ATOM 4818  C CB    . MET G 3 55  ? 134.978 146.621 115.733 1.00 17.29  ? 55  MET G CB    1 
ATOM 4819  C CG    . MET G 3 55  ? 134.126 146.031 116.802 1.00 17.29  ? 55  MET G CG    1 
ATOM 4820  S SD    . MET G 3 55  ? 132.697 147.062 117.055 1.00 17.29  ? 55  MET G SD    1 
ATOM 4821  C CE    . MET G 3 55  ? 133.454 148.322 118.006 1.00 17.29  ? 55  MET G CE    1 
ATOM 4822  N N     . GLU G 3 56  ? 137.213 146.857 113.434 1.00 19.65  ? 56  GLU G N     1 
ATOM 4823  C CA    . GLU G 3 56  ? 137.562 146.990 112.029 1.00 19.65  ? 56  GLU G CA    1 
ATOM 4824  C C     . GLU G 3 56  ? 138.462 145.857 111.571 1.00 19.65  ? 56  GLU G C     1 
ATOM 4825  O O     . GLU G 3 56  ? 138.309 145.363 110.451 1.00 19.65  ? 56  GLU G O     1 
ATOM 4826  C CB    . GLU G 3 56  ? 138.230 148.332 111.787 1.00 19.65  ? 56  GLU G CB    1 
ATOM 4827  C CG    . GLU G 3 56  ? 138.501 148.607 110.344 1.00 19.65  ? 56  GLU G CG    1 
ATOM 4828  C CD    . GLU G 3 56  ? 139.076 149.970 110.124 1.00 19.65  ? 56  GLU G CD    1 
ATOM 4829  O OE1   . GLU G 3 56  ? 138.715 150.879 110.889 1.00 19.65  ? 56  GLU G OE1   1 
ATOM 4830  O OE2   . GLU G 3 56  ? 139.888 150.135 109.193 1.00 19.65  ? 56  GLU G OE2   1 
ATOM 4831  N N     . TYR G 3 57  ? 139.386 145.414 112.434 1.00 17.99  ? 57  TYR G N     1 
ATOM 4832  C CA    . TYR G 3 57  ? 140.233 144.267 112.121 1.00 17.99  ? 57  TYR G CA    1 
ATOM 4833  C C     . TYR G 3 57  ? 139.411 143.004 111.906 1.00 17.99  ? 57  TYR G C     1 
ATOM 4834  O O     . TYR G 3 57  ? 139.628 142.265 110.939 1.00 17.99  ? 57  TYR G O     1 
ATOM 4835  C CB    . TYR G 3 57  ? 141.244 144.038 113.239 1.00 17.99  ? 57  TYR G CB    1 
ATOM 4836  C CG    . TYR G 3 57  ? 141.933 142.714 113.107 1.00 17.99  ? 57  TYR G CG    1 
ATOM 4837  C CD1   . TYR G 3 57  ? 142.845 142.498 112.097 1.00 17.99  ? 57  TYR G CD1   1 
ATOM 4838  C CD2   . TYR G 3 57  ? 141.657 141.668 113.976 1.00 17.99  ? 57  TYR G CD2   1 
ATOM 4839  C CE1   . TYR G 3 57  ? 143.454 141.296 111.952 1.00 17.99  ? 57  TYR G CE1   1 
ATOM 4840  C CE2   . TYR G 3 57  ? 142.264 140.458 113.829 1.00 17.99  ? 57  TYR G CE2   1 
ATOM 4841  C CZ    . TYR G 3 57  ? 143.160 140.282 112.816 1.00 17.99  ? 57  TYR G CZ    1 
ATOM 4842  O OH    . TYR G 3 57  ? 143.780 139.076 112.667 1.00 17.99  ? 57  TYR G OH    1 
ATOM 4843  N N     . LEU G 3 58  ? 138.463 142.736 112.805 1.00 16.84  ? 58  LEU G N     1 
ATOM 4844  C CA    . LEU G 3 58  ? 137.684 141.505 112.706 1.00 16.84  ? 58  LEU G CA    1 
ATOM 4845  C C     . LEU G 3 58  ? 136.727 141.539 111.525 1.00 16.84  ? 58  LEU G C     1 
ATOM 4846  O O     . LEU G 3 58  ? 136.555 140.527 110.832 1.00 16.84  ? 58  LEU G O     1 
ATOM 4847  C CB    . LEU G 3 58  ? 136.930 141.262 114.006 1.00 16.84  ? 58  LEU G CB    1 
ATOM 4848  C CG    . LEU G 3 58  ? 137.788 140.726 115.145 1.00 16.84  ? 58  LEU G CG    1 
ATOM 4849  C CD1   . LEU G 3 58  ? 136.935 140.410 116.318 1.00 16.84  ? 58  LEU G CD1   1 
ATOM 4850  C CD2   . LEU G 3 58  ? 138.529 139.497 114.724 1.00 16.84  ? 58  LEU G CD2   1 
ATOM 4851  N N     . ALA G 3 59  ? 136.118 142.698 111.265 1.00 17.72  ? 59  ALA G N     1 
ATOM 4852  C CA    . ALA G 3 59  ? 135.260 142.844 110.100 1.00 17.72  ? 59  ALA G CA    1 
ATOM 4853  C C     . ALA G 3 59  ? 136.041 142.682 108.811 1.00 17.72  ? 59  ALA G C     1 
ATOM 4854  O O     . ALA G 3 59  ? 135.562 142.039 107.875 1.00 17.72  ? 59  ALA G O     1 
ATOM 4855  C CB    . ALA G 3 59  ? 134.567 144.199 110.128 1.00 17.72  ? 59  ALA G CB    1 
ATOM 4856  N N     . ALA G 3 60  ? 137.262 143.220 108.757 1.00 19.54  ? 60  ALA G N     1 
ATOM 4857  C CA    . ALA G 3 60  ? 138.091 143.079 107.573 1.00 19.54  ? 60  ALA G CA    1 
ATOM 4858  C C     . ALA G 3 60  ? 138.564 141.654 107.347 1.00 19.54  ? 60  ALA G C     1 
ATOM 4859  O O     . ALA G 3 60  ? 138.611 141.226 106.197 1.00 19.54  ? 60  ALA G O     1 
ATOM 4860  C CB    . ALA G 3 60  ? 139.288 144.011 107.667 1.00 19.54  ? 60  ALA G CB    1 
ATOM 4861  N N     . GLU G 3 61  ? 138.883 140.905 108.405 1.00 23.11  ? 61  GLU G N     1 
ATOM 4862  C CA    . GLU G 3 61  ? 139.288 139.509 108.234 1.00 23.11  ? 61  GLU G CA    1 
ATOM 4863  C C     . GLU G 3 61  ? 138.142 138.647 107.725 1.00 23.11  ? 61  GLU G C     1 
ATOM 4864  O O     . GLU G 3 61  ? 138.320 137.867 106.779 1.00 23.11  ? 61  GLU G O     1 
ATOM 4865  C CB    . GLU G 3 61  ? 139.818 138.941 109.547 1.00 23.11  ? 61  GLU G CB    1 
ATOM 4866  C CG    . GLU G 3 61  ? 141.262 139.296 109.831 1.00 23.11  ? 61  GLU G CG    1 
ATOM 4867  C CD    . GLU G 3 61  ? 142.263 138.280 109.300 1.00 23.11  ? 61  GLU G CD    1 
ATOM 4868  O OE1   . GLU G 3 61  ? 141.846 137.188 108.872 1.00 23.11  ? 61  GLU G OE1   1 
ATOM 4869  O OE2   . GLU G 3 61  ? 143.476 138.571 109.324 1.00 23.11  ? 61  GLU G OE2   1 
ATOM 4870  N N     . VAL G 3 62  ? 136.957 138.793 108.329 1.00 18.82  ? 62  VAL G N     1 
ATOM 4871  C CA    . VAL G 3 62  ? 135.796 138.024 107.889 1.00 18.82  ? 62  VAL G CA    1 
ATOM 4872  C C     . VAL G 3 62  ? 135.400 138.399 106.465 1.00 18.82  ? 62  VAL G C     1 
ATOM 4873  O O     . VAL G 3 62  ? 135.139 137.524 105.633 1.00 18.82  ? 62  VAL G O     1 
ATOM 4874  C CB    . VAL G 3 62  ? 134.634 138.218 108.877 1.00 18.82  ? 62  VAL G CB    1 
ATOM 4875  C CG1   . VAL G 3 62  ? 133.372 137.605 108.351 1.00 18.82  ? 62  VAL G CG1   1 
ATOM 4876  C CG2   . VAL G 3 62  ? 134.970 137.600 110.191 1.00 18.82  ? 62  VAL G CG2   1 
ATOM 4877  N N     . LEU G 3 63  ? 135.411 139.692 106.139 1.00 20.39  ? 63  LEU G N     1 
ATOM 4878  C CA    . LEU G 3 63  ? 135.028 140.131 104.806 1.00 20.39  ? 63  LEU G CA    1 
ATOM 4879  C C     . LEU G 3 63  ? 136.055 139.756 103.755 1.00 20.39  ? 63  LEU G C     1 
ATOM 4880  O O     . LEU G 3 63  ? 135.685 139.500 102.609 1.00 20.39  ? 63  LEU G O     1 
ATOM 4881  C CB    . LEU G 3 63  ? 134.813 141.636 104.798 1.00 20.39  ? 63  LEU G CB    1 
ATOM 4882  C CG    . LEU G 3 63  ? 133.422 142.108 105.171 1.00 20.39  ? 63  LEU G CG    1 
ATOM 4883  C CD1   . LEU G 3 63  ? 133.410 143.589 105.143 1.00 20.39  ? 63  LEU G CD1   1 
ATOM 4884  C CD2   . LEU G 3 63  ? 132.400 141.564 104.222 1.00 20.39  ? 63  LEU G CD2   1 
ATOM 4885  N N     . GLU G 3 64  ? 137.337 139.685 104.116 1.00 25.86  ? 64  GLU G N     1 
ATOM 4886  C CA    . GLU G 3 64  ? 138.345 139.251 103.157 1.00 25.86  ? 64  GLU G CA    1 
ATOM 4887  C C     . GLU G 3 64  ? 138.216 137.775 102.842 1.00 25.86  ? 64  GLU G C     1 
ATOM 4888  O O     . GLU G 3 64  ? 138.291 137.381 101.673 1.00 25.86  ? 64  GLU G O     1 
ATOM 4889  C CB    . GLU G 3 64  ? 139.742 139.530 103.682 1.00 25.86  ? 64  GLU G CB    1 
ATOM 4890  C CG    . GLU G 3 64  ? 140.785 139.370 102.613 1.00 25.86  ? 64  GLU G CG    1 
ATOM 4891  C CD    . GLU G 3 64  ? 142.079 140.038 102.967 1.00 25.86  ? 64  GLU G CD    1 
ATOM 4892  O OE1   . GLU G 3 64  ? 142.212 140.493 104.121 1.00 25.86  ? 64  GLU G OE1   1 
ATOM 4893  O OE2   . GLU G 3 64  ? 142.966 140.117 102.095 1.00 25.86  ? 64  GLU G OE2   1 
ATOM 4894  N N     . LEU G 3 65  ? 138.022 136.942 103.865 1.00 20.78  ? 65  LEU G N     1 
ATOM 4895  C CA    . LEU G 3 65  ? 137.851 135.518 103.607 1.00 20.78  ? 65  LEU G CA    1 
ATOM 4896  C C     . LEU G 3 65  ? 136.546 135.237 102.867 1.00 20.78  ? 65  LEU G C     1 
ATOM 4897  O O     . LEU G 3 65  ? 136.493 134.350 102.009 1.00 20.78  ? 65  LEU G O     1 
ATOM 4898  C CB    . LEU G 3 65  ? 137.924 134.744 104.916 1.00 20.78  ? 65  LEU G CB    1 
ATOM 4899  C CG    . LEU G 3 65  ? 139.236 134.822 105.691 1.00 20.78  ? 65  LEU G CG    1 
ATOM 4900  C CD1   . LEU G 3 65  ? 139.040 134.342 107.093 1.00 20.78  ? 65  LEU G CD1   1 
ATOM 4901  C CD2   . LEU G 3 65  ? 140.305 134.013 105.017 1.00 20.78  ? 65  LEU G CD2   1 
ATOM 4902  N N     . ALA G 3 66  ? 135.502 136.029 103.128 1.00 22.53  ? 66  ALA G N     1 
ATOM 4903  C CA    . ALA G 3 66  ? 134.245 135.855 102.412 1.00 22.53  ? 66  ALA G CA    1 
ATOM 4904  C C     . ALA G 3 66  ? 134.341 136.334 100.972 1.00 22.53  ? 66  ALA G C     1 
ATOM 4905  O O     . ALA G 3 66  ? 133.712 135.758 100.085 1.00 22.53  ? 66  ALA G O     1 
ATOM 4906  C CB    . ALA G 3 66  ? 133.129 136.588 103.138 1.00 22.53  ? 66  ALA G CB    1 
ATOM 4907  N N     . GLY G 3 67  ? 135.134 137.374 100.708 1.00 24.93  ? 67  GLY G N     1 
ATOM 4908  C CA    . GLY G 3 67  ? 135.346 137.800 99.337  1.00 24.93  ? 67  GLY G CA    1 
ATOM 4909  C C     . GLY G 3 67  ? 136.200 136.841 98.540  1.00 24.93  ? 67  GLY G C     1 
ATOM 4910  O O     . GLY G 3 67  ? 135.973 136.658 97.341  1.00 24.93  ? 67  GLY G O     1 
ATOM 4911  N N     . ASN G 3 68  ? 137.180 136.204 99.189  1.00 27.71  ? 68  ASN G N     1 
ATOM 4912  C CA    . ASN G 3 68  ? 137.926 135.131 98.539  1.00 27.71  ? 68  ASN G CA    1 
ATOM 4913  C C     . ASN G 3 68  ? 137.032 133.942 98.217  1.00 27.71  ? 68  ASN G C     1 
ATOM 4914  O O     . ASN G 3 68  ? 137.103 133.399 97.108  1.00 27.71  ? 68  ASN G O     1 
ATOM 4915  C CB    . ASN G 3 68  ? 139.082 134.672 99.420  1.00 27.71  ? 68  ASN G CB    1 
ATOM 4916  C CG    . ASN G 3 68  ? 140.166 135.710 99.560  1.00 27.71  ? 68  ASN G CG    1 
ATOM 4917  O OD1   . ASN G 3 68  ? 140.266 136.635 98.765  1.00 27.71  ? 68  ASN G OD1   1 
ATOM 4918  N ND2   . ASN G 3 68  ? 140.995 135.554 100.579 1.00 27.71  ? 68  ASN G ND2   1 
ATOM 4919  N N     . ALA G 3 69  ? 136.183 133.532 99.162  1.00 26.90  ? 69  ALA G N     1 
ATOM 4920  C CA    . ALA G 3 69  ? 135.244 132.446 98.910  1.00 26.90  ? 69  ALA G CA    1 
ATOM 4921  C C     . ALA G 3 69  ? 134.179 132.810 97.891  1.00 26.90  ? 69  ALA G C     1 
ATOM 4922  O O     . ALA G 3 69  ? 133.630 131.914 97.249  1.00 26.90  ? 69  ALA G O     1 
ATOM 4923  C CB    . ALA G 3 69  ? 134.577 132.015 100.211 1.00 26.90  ? 69  ALA G CB    1 
ATOM 4924  N N     . ALA G 3 70  ? 133.857 134.087 97.737  1.00 29.37  ? 70  ALA G N     1 
ATOM 4925  C CA    . ALA G 3 70  ? 132.971 134.511 96.667  1.00 29.37  ? 70  ALA G CA    1 
ATOM 4926  C C     . ALA G 3 70  ? 133.645 134.485 95.316  1.00 29.37  ? 70  ALA G C     1 
ATOM 4927  O O     . ALA G 3 70  ? 132.994 134.167 94.319  1.00 29.37  ? 70  ALA G O     1 
ATOM 4928  C CB    . ALA G 3 70  ? 132.451 135.924 96.923  1.00 29.37  ? 70  ALA G CB    1 
ATOM 4929  N N     . ARG G 3 71  ? 134.928 134.835 95.261  1.00 33.31  ? 71  ARG G N     1 
ATOM 4930  C CA    . ARG G 3 71  ? 135.665 134.767 94.009  1.00 33.31  ? 71  ARG G CA    1 
ATOM 4931  C C     . ARG G 3 71  ? 135.897 133.331 93.574  1.00 33.31  ? 71  ARG G C     1 
ATOM 4932  O O     . ARG G 3 71  ? 135.981 133.061 92.373  1.00 33.31  ? 71  ARG G O     1 
ATOM 4933  C CB    . ARG G 3 71  ? 136.995 135.492 94.155  1.00 33.31  ? 71  ARG G CB    1 
ATOM 4934  C CG    . ARG G 3 71  ? 137.599 135.938 92.859  1.00 33.31  ? 71  ARG G CG    1 
ATOM 4935  C CD    . ARG G 3 71  ? 139.090 136.030 92.988  1.00 33.31  ? 71  ARG G CD    1 
ATOM 4936  N NE    . ARG G 3 71  ? 139.485 136.995 94.004  1.00 33.31  ? 71  ARG G NE    1 
ATOM 4937  C CZ    . ARG G 3 71  ? 140.257 136.702 95.042  1.00 33.31  ? 71  ARG G CZ    1 
ATOM 4938  N NH1   . ARG G 3 71  ? 140.710 135.467 95.205  1.00 33.31  ? 71  ARG G NH1   1 
ATOM 4939  N NH2   . ARG G 3 71  ? 140.570 137.641 95.919  1.00 33.31  ? 71  ARG G NH2   1 
ATOM 4940  N N     . ASP G 3 72  ? 136.012 132.402 94.525  1.00 35.03  ? 72  ASP G N     1 
ATOM 4941  C CA    . ASP G 3 72  ? 136.198 131.000 94.166  1.00 35.03  ? 72  ASP G CA    1 
ATOM 4942  C C     . ASP G 3 72  ? 134.959 130.376 93.542  1.00 35.03  ? 72  ASP G C     1 
ATOM 4943  O O     . ASP G 3 72  ? 135.093 129.425 92.769  1.00 35.03  ? 72  ASP G O     1 
ATOM 4944  C CB    . ASP G 3 72  ? 136.608 130.187 95.386  1.00 35.03  ? 72  ASP G CB    1 
ATOM 4945  C CG    . ASP G 3 72  ? 137.961 130.593 95.917  1.00 35.03  ? 72  ASP G CG    1 
ATOM 4946  O OD1   . ASP G 3 72  ? 138.755 131.148 95.132  1.00 35.03  ? 72  ASP G OD1   1 
ATOM 4947  O OD2   . ASP G 3 72  ? 138.237 130.350 97.112  1.00 35.03  ? 72  ASP G OD2   1 
ATOM 4948  N N     . ASN G 3 73  ? 133.769 130.880 93.852  1.00 37.48  ? 73  ASN G N     1 
ATOM 4949  C CA    . ASN G 3 73  ? 132.540 130.468 93.193  1.00 37.48  ? 73  ASN G CA    1 
ATOM 4950  C C     . ASN G 3 73  ? 132.172 131.366 92.027  1.00 37.48  ? 73  ASN G C     1 
ATOM 4951  O O     . ASN G 3 73  ? 131.014 131.354 91.605  1.00 37.48  ? 73  ASN G O     1 
ATOM 4952  C CB    . ASN G 3 73  ? 131.389 130.434 94.191  1.00 37.48  ? 73  ASN G CB    1 
ATOM 4953  C CG    . ASN G 3 73  ? 131.518 129.311 95.177  1.00 37.48  ? 73  ASN G CG    1 
ATOM 4954  O OD1   . ASN G 3 73  ? 131.775 129.531 96.357  1.00 37.48  ? 73  ASN G OD1   1 
ATOM 4955  N ND2   . ASN G 3 73  ? 131.317 128.090 94.705  1.00 37.48  ? 73  ASN G ND2   1 
ATOM 4956  N N     . LYS G 3 74  ? 133.130 132.153 91.527  1.00 40.01  ? 74  LYS G N     1 
ATOM 4957  C CA    . LYS G 3 74  ? 132.988 133.012 90.348  1.00 40.01  ? 74  LYS G CA    1 
ATOM 4958  C C     . LYS G 3 74  ? 131.882 134.049 90.523  1.00 40.01  ? 74  LYS G C     1 
ATOM 4959  O O     . LYS G 3 74  ? 131.096 134.308 89.612  1.00 40.01  ? 74  LYS G O     1 
ATOM 4960  C CB    . LYS G 3 74  ? 132.768 132.182 89.082  1.00 40.01  ? 74  LYS G CB    1 
ATOM 4961  C CG    . LYS G 3 74  ? 133.841 131.146 88.814  1.00 40.01  ? 74  LYS G CG    1 
ATOM 4962  C CD    . LYS G 3 74  ? 134.000 130.877 87.325  1.00 40.01  ? 74  LYS G CD    1 
ATOM 4963  C CE    . LYS G 3 74  ? 134.175 132.159 86.524  1.00 40.01  ? 74  LYS G CE    1 
ATOM 4964  N NZ    . LYS G 3 74  ? 134.240 131.888 85.061  1.00 40.01  ? 74  LYS G NZ    1 
ATOM 4965  N N     . LYS G 3 75  ? 131.820 134.649 91.707  1.00 41.45  ? 75  LYS G N     1 
ATOM 4966  C CA    . LYS G 3 75  ? 130.815 135.656 92.002  1.00 41.45  ? 75  LYS G CA    1 
ATOM 4967  C C     . LYS G 3 75  ? 131.483 136.921 92.510  1.00 41.45  ? 75  LYS G C     1 
ATOM 4968  O O     . LYS G 3 75  ? 132.522 136.879 93.170  1.00 41.45  ? 75  LYS G O     1 
ATOM 4969  C CB    . LYS G 3 75  ? 129.796 135.157 93.024  1.00 41.45  ? 75  LYS G CB    1 
ATOM 4970  C CG    . LYS G 3 75  ? 128.977 134.004 92.518  1.00 41.45  ? 75  LYS G CG    1 
ATOM 4971  C CD    . LYS G 3 75  ? 127.639 133.927 93.189  1.00 41.45  ? 75  LYS G CD    1 
ATOM 4972  C CE    . LYS G 3 75  ? 126.723 133.017 92.410  1.00 41.45  ? 75  LYS G CE    1 
ATOM 4973  N NZ    . LYS G 3 75  ? 126.990 133.131 90.957  1.00 41.45  ? 75  LYS G NZ    1 
ATOM 4974  N N     . THR G 3 76  ? 130.871 138.059 92.186  1.00 41.37  ? 76  THR G N     1 
ATOM 4975  C CA    . THR G 3 76  ? 131.385 139.360 92.591  1.00 41.37  ? 76  THR G CA    1 
ATOM 4976  C C     . THR G 3 76  ? 130.495 140.013 93.632  1.00 41.37  ? 76  THR G C     1 
ATOM 4977  O O     . THR G 3 76  ? 130.358 141.237 93.641  1.00 41.37  ? 76  THR G O     1 
ATOM 4978  C CB    . THR G 3 76  ? 131.538 140.292 91.390  1.00 41.37  ? 76  THR G CB    1 
ATOM 4979  O OG1   . THR G 3 76  ? 130.245 140.647 90.894  1.00 41.37  ? 76  THR G OG1   1 
ATOM 4980  C CG2   . THR G 3 76  ? 132.317 139.613 90.285  1.00 41.37  ? 76  THR G CG2   1 
ATOM 4981  N N     . ARG G 3 77  ? 129.875 139.219 94.496  1.00 34.84  ? 77  ARG G N     1 
ATOM 4982  C CA    . ARG G 3 77  ? 128.983 139.730 95.523  1.00 34.84  ? 77  ARG G CA    1 
ATOM 4983  C C     . ARG G 3 77  ? 128.908 138.694 96.627  1.00 34.84  ? 77  ARG G C     1 
ATOM 4984  O O     . ARG G 3 77  ? 128.752 137.505 96.348  1.00 34.84  ? 77  ARG G O     1 
ATOM 4985  C CB    . ARG G 3 77  ? 127.598 140.017 94.959  1.00 34.84  ? 77  ARG G CB    1 
ATOM 4986  C CG    . ARG G 3 77  ? 126.726 140.801 95.872  1.00 34.84  ? 77  ARG G CG    1 
ATOM 4987  C CD    . ARG G 3 77  ? 125.363 140.980 95.289  1.00 34.84  ? 77  ARG G CD    1 
ATOM 4988  N NE    . ARG G 3 77  ? 125.332 142.044 94.298  1.00 34.84  ? 77  ARG G NE    1 
ATOM 4989  C CZ    . ARG G 3 77  ? 124.441 142.108 93.318  1.00 34.84  ? 77  ARG G CZ    1 
ATOM 4990  N NH1   . ARG G 3 77  ? 123.521 141.166 93.203  1.00 34.84  ? 77  ARG G NH1   1 
ATOM 4991  N NH2   . ARG G 3 77  ? 124.474 143.107 92.455  1.00 34.84  ? 77  ARG G NH2   1 
ATOM 4992  N N     . ILE G 3 78  ? 129.022 139.143 97.866  1.00 21.97  ? 78  ILE G N     1 
ATOM 4993  C CA    . ILE G 3 78  ? 129.061 138.255 99.017  1.00 21.97  ? 78  ILE G CA    1 
ATOM 4994  C C     . ILE G 3 78  ? 127.636 137.974 99.456  1.00 21.97  ? 78  ILE G C     1 
ATOM 4995  O O     . ILE G 3 78  ? 126.853 138.900 99.670  1.00 21.97  ? 78  ILE G O     1 
ATOM 4996  C CB    . ILE G 3 78  ? 129.883 138.869 100.156 1.00 21.97  ? 78  ILE G CB    1 
ATOM 4997  C CG1   . ILE G 3 78  ? 131.316 139.092 99.707  1.00 21.97  ? 78  ILE G CG1   1 
ATOM 4998  C CG2   . ILE G 3 78  ? 129.873 137.987 101.360 1.00 21.97  ? 78  ILE G CG2   1 
ATOM 4999  C CD1   . ILE G 3 78  ? 132.105 139.891 100.663 1.00 21.97  ? 78  ILE G CD1   1 
ATOM 5000  N N     . ILE G 3 79  ? 127.295 136.695 99.573  1.00 19.45  ? 79  ILE G N     1 
ATOM 5001  C CA    . ILE G 3 79  ? 125.997 136.233 100.057 1.00 19.45  ? 79  ILE G CA    1 
ATOM 5002  C C     . ILE G 3 79  ? 126.261 135.608 101.424 1.00 19.45  ? 79  ILE G C     1 
ATOM 5003  O O     . ILE G 3 79  ? 127.433 135.493 101.796 1.00 19.45  ? 79  ILE G O     1 
ATOM 5004  C CB    . ILE G 3 79  ? 125.358 135.271 99.042  1.00 19.45  ? 79  ILE G CB    1 
ATOM 5005  C CG1   . ILE G 3 79  ? 126.197 134.015 98.895  1.00 19.45  ? 79  ILE G CG1   1 
ATOM 5006  C CG2   . ILE G 3 79  ? 125.183 135.961 97.723  1.00 19.45  ? 79  ILE G CG2   1 
ATOM 5007  C CD1   . ILE G 3 79  ? 125.617 133.014 97.973  1.00 19.45  ? 79  ILE G CD1   1 
ATOM 5008  N N     . PRO G 3 80  ? 125.249 135.263 102.234 1.00 18.06  ? 80  PRO G N     1 
ATOM 5009  C CA    . PRO G 3 80  ? 125.529 134.621 103.530 1.00 18.06  ? 80  PRO G CA    1 
ATOM 5010  C C     . PRO G 3 80  ? 126.251 133.284 103.463 1.00 18.06  ? 80  PRO G C     1 
ATOM 5011  O O     . PRO G 3 80  ? 126.894 132.903 104.449 1.00 18.06  ? 80  PRO G O     1 
ATOM 5012  C CB    . PRO G 3 80  ? 124.133 134.445 104.120 1.00 18.06  ? 80  PRO G CB    1 
ATOM 5013  C CG    . PRO G 3 80  ? 123.389 135.522 103.593 1.00 18.06  ? 80  PRO G CG    1 
ATOM 5014  C CD    . PRO G 3 80  ? 123.869 135.784 102.226 1.00 18.06  ? 80  PRO G CD    1 
ATOM 5015  N N     . ARG G 3 81  ? 126.152 132.563 102.346 1.00 17.80  ? 81  ARG G N     1 
ATOM 5016  C CA    . ARG G 3 81  ? 126.875 131.309 102.178 1.00 17.80  ? 81  ARG G CA    1 
ATOM 5017  C C     . ARG G 3 81  ? 128.377 131.524 102.232 1.00 17.80  ? 81  ARG G C     1 
ATOM 5018  O O     . ARG G 3 81  ? 129.099 130.729 102.830 1.00 17.80  ? 81  ARG G O     1 
ATOM 5019  C CB    . ARG G 3 81  ? 126.469 130.669 100.856 1.00 17.80  ? 81  ARG G CB    1 
ATOM 5020  C CG    . ARG G 3 81  ? 127.219 129.421 100.480 1.00 17.80  ? 81  ARG G CG    1 
ATOM 5021  C CD    . ARG G 3 81  ? 127.049 128.372 101.533 1.00 17.80  ? 81  ARG G CD    1 
ATOM 5022  N NE    . ARG G 3 81  ? 127.231 127.021 101.036 1.00 17.80  ? 81  ARG G NE    1 
ATOM 5023  C CZ    . ARG G 3 81  ? 127.437 125.985 101.827 1.00 17.80  ? 81  ARG G CZ    1 
ATOM 5024  N NH1   . ARG G 3 81  ? 127.501 126.169 103.126 1.00 17.80  ? 81  ARG G NH1   1 
ATOM 5025  N NH2   . ARG G 3 81  ? 127.594 124.780 101.328 1.00 17.80  ? 81  ARG G NH2   1 
ATOM 5026  N N     . HIS G 3 82  ? 128.862 132.611 101.645 1.00 20.43  ? 82  HIS G N     1 
ATOM 5027  C CA    . HIS G 3 82  ? 130.286 132.900 101.640 1.00 20.43  ? 82  HIS G CA    1 
ATOM 5028  C C     . HIS G 3 82  ? 130.793 133.299 103.012 1.00 20.43  ? 82  HIS G C     1 
ATOM 5029  O O     . HIS G 3 82  ? 131.913 132.934 103.376 1.00 20.43  ? 82  HIS G O     1 
ATOM 5030  C CB    . HIS G 3 82  ? 130.576 133.999 100.633 1.00 20.43  ? 82  HIS G CB    1 
ATOM 5031  C CG    . HIS G 3 82  ? 130.081 133.695 99.260  1.00 20.43  ? 82  HIS G CG    1 
ATOM 5032  N ND1   . HIS G 3 82  ? 129.636 134.668 98.399  1.00 20.43  ? 82  HIS G ND1   1 
ATOM 5033  C CD2   . HIS G 3 82  ? 129.964 132.525 98.596  1.00 20.43  ? 82  HIS G CD2   1 
ATOM 5034  C CE1   . HIS G 3 82  ? 129.269 134.113 97.261  1.00 20.43  ? 82  HIS G CE1   1 
ATOM 5035  N NE2   . HIS G 3 82  ? 129.454 132.812 97.357  1.00 20.43  ? 82  HIS G NE2   1 
ATOM 5036  N N     . LEU G 3 83  ? 129.980 134.015 103.788 1.00 18.96  ? 83  LEU G N     1 
ATOM 5037  C CA    . LEU G 3 83  ? 130.322 134.314 105.173 1.00 18.96  ? 83  LEU G CA    1 
ATOM 5038  C C     . LEU G 3 83  ? 130.391 133.050 106.006 1.00 18.96  ? 83  LEU G C     1 
ATOM 5039  O O     . LEU G 3 83  ? 131.315 132.883 106.807 1.00 18.96  ? 83  LEU G O     1 
ATOM 5040  C CB    . LEU G 3 83  ? 129.300 135.273 105.766 1.00 18.96  ? 83  LEU G CB    1 
ATOM 5041  C CG    . LEU G 3 83  ? 129.372 136.694 105.244 1.00 18.96  ? 83  LEU G CG    1 
ATOM 5042  C CD1   . LEU G 3 83  ? 128.156 137.442 105.652 1.00 18.96  ? 83  LEU G CD1   1 
ATOM 5043  C CD2   . LEU G 3 83  ? 130.602 137.352 105.791 1.00 18.96  ? 83  LEU G CD2   1 
ATOM 5044  N N     . GLN G 3 84  ? 129.436 132.142 105.812 1.00 19.54  ? 84  GLN G N     1 
ATOM 5045  C CA    . GLN G 3 84  ? 129.435 130.878 106.538 1.00 19.54  ? 84  GLN G CA    1 
ATOM 5046  C C     . GLN G 3 84  ? 130.638 130.019 106.170 1.00 19.54  ? 84  GLN G C     1 
ATOM 5047  O O     . GLN G 3 84  ? 131.273 129.431 107.045 1.00 19.54  ? 84  GLN G O     1 
ATOM 5048  C CB    . GLN G 3 84  ? 128.134 130.136 106.265 1.00 19.54  ? 84  GLN G CB    1 
ATOM 5049  C CG    . GLN G 3 84  ? 128.115 128.701 106.704 1.00 19.54  ? 84  GLN G CG    1 
ATOM 5050  C CD    . GLN G 3 84  ? 127.492 128.529 108.054 1.00 19.54  ? 84  GLN G CD    1 
ATOM 5051  O OE1   . GLN G 3 84  ? 127.239 129.496 108.754 1.00 19.54  ? 84  GLN G OE1   1 
ATOM 5052  N NE2   . GLN G 3 84  ? 127.239 127.291 108.432 1.00 19.54  ? 84  GLN G NE2   1 
ATOM 5053  N N     . LEU G 3 85  ? 130.975 129.947 104.882 1.00 18.58  ? 85  LEU G N     1 
ATOM 5054  C CA    . LEU G 3 85  ? 132.139 129.175 104.455 1.00 18.58  ? 85  LEU G CA    1 
ATOM 5055  C C     . LEU G 3 85  ? 133.432 129.757 104.996 1.00 18.58  ? 85  LEU G C     1 
ATOM 5056  O O     . LEU G 3 85  ? 134.276 129.007 105.495 1.00 18.58  ? 85  LEU G O     1 
ATOM 5057  C CB    . LEU G 3 85  ? 132.219 129.113 102.935 1.00 18.58  ? 85  LEU G CB    1 
ATOM 5058  C CG    . LEU G 3 85  ? 131.192 128.308 102.153 1.00 18.58  ? 85  LEU G CG    1 
ATOM 5059  C CD1   . LEU G 3 85  ? 131.372 128.562 100.677 1.00 18.58  ? 85  LEU G CD1   1 
ATOM 5060  C CD2   . LEU G 3 85  ? 131.295 126.846 102.462 1.00 18.58  ? 85  LEU G CD2   1 
ATOM 5061  N N     . ALA G 3 86  ? 133.577 131.084 104.932 1.00 19.75  ? 86  ALA G N     1 
ATOM 5062  C CA    . ALA G 3 86  ? 134.729 131.777 105.492 1.00 19.75  ? 86  ALA G CA    1 
ATOM 5063  C C     . ALA G 3 86  ? 134.882 131.531 106.984 1.00 19.75  ? 86  ALA G C     1 
ATOM 5064  O O     . ALA G 3 86  ? 135.997 131.334 107.470 1.00 19.75  ? 86  ALA G O     1 
ATOM 5065  C CB    . ALA G 3 86  ? 134.590 133.269 105.236 1.00 19.75  ? 86  ALA G CB    1 
ATOM 5066  N N     . ILE G 3 87  ? 133.780 131.539 107.726 1.00 19.67  ? 87  ILE G N     1 
ATOM 5067  C CA    . ILE G 3 87  ? 133.877 131.412 109.172 1.00 19.67  ? 87  ILE G CA    1 
ATOM 5068  C C     . ILE G 3 87  ? 134.106 129.966 109.580 1.00 19.67  ? 87  ILE G C     1 
ATOM 5069  O O     . ILE G 3 87  ? 134.953 129.682 110.429 1.00 19.67  ? 87  ILE G O     1 
ATOM 5070  C CB    . ILE G 3 87  ? 132.623 132.021 109.822 1.00 19.67  ? 87  ILE G CB    1 
ATOM 5071  C CG1   . ILE G 3 87  ? 132.724 133.539 109.772 1.00 19.67  ? 87  ILE G CG1   1 
ATOM 5072  C CG2   . ILE G 3 87  ? 132.464 131.583 111.251 1.00 19.67  ? 87  ILE G CG2   1 
ATOM 5073  C CD1   . ILE G 3 87  ? 131.423 134.249 109.783 1.00 19.67  ? 87  ILE G CD1   1 
ATOM 5074  N N     . ARG G 3 88  ? 133.404 129.020 108.969 1.00 19.92  ? 88  ARG G N     1 
ATOM 5075  C CA    . ARG G 3 88  ? 133.517 127.637 109.396 1.00 19.92  ? 88  ARG G CA    1 
ATOM 5076  C C     . ARG G 3 88  ? 134.695 126.905 108.781 1.00 19.92  ? 88  ARG G C     1 
ATOM 5077  O O     . ARG G 3 88  ? 135.002 125.801 109.229 1.00 19.92  ? 88  ARG G O     1 
ATOM 5078  C CB    . ARG G 3 88  ? 132.238 126.869 109.082 1.00 19.92  ? 88  ARG G CB    1 
ATOM 5079  C CG    . ARG G 3 88  ? 130.986 127.506 109.597 1.00 19.92  ? 88  ARG G CG    1 
ATOM 5080  C CD    . ARG G 3 88  ? 130.783 127.267 111.049 1.00 19.92  ? 88  ARG G CD    1 
ATOM 5081  N NE    . ARG G 3 88  ? 129.745 128.145 111.565 1.00 19.92  ? 88  ARG G NE    1 
ATOM 5082  C CZ    . ARG G 3 88  ? 129.825 128.789 112.719 1.00 19.92  ? 88  ARG G CZ    1 
ATOM 5083  N NH1   . ARG G 3 88  ? 130.894 128.647 113.482 1.00 19.92  ? 88  ARG G NH1   1 
ATOM 5084  N NH2   . ARG G 3 88  ? 128.832 129.569 113.108 1.00 19.92  ? 88  ARG G NH2   1 
ATOM 5085  N N     . ASN G 3 89  ? 135.371 127.474 107.783 1.00 21.88  ? 89  ASN G N     1 
ATOM 5086  C CA    . ASN G 3 89  ? 136.596 126.886 107.264 1.00 21.88  ? 89  ASN G CA    1 
ATOM 5087  C C     . ASN G 3 89  ? 137.834 127.435 107.956 1.00 21.88  ? 89  ASN G C     1 
ATOM 5088  O O     . ASN G 3 89  ? 138.913 127.456 107.365 1.00 21.88  ? 89  ASN G O     1 
ATOM 5089  C CB    . ASN G 3 89  ? 136.699 127.113 105.760 1.00 21.88  ? 89  ASN G CB    1 
ATOM 5090  C CG    . ASN G 3 89  ? 135.864 126.146 104.966 1.00 21.88  ? 89  ASN G CG    1 
ATOM 5091  O OD1   . ASN G 3 89  ? 135.760 124.974 105.305 1.00 21.88  ? 89  ASN G OD1   1 
ATOM 5092  N ND2   . ASN G 3 89  ? 135.269 126.629 103.892 1.00 21.88  ? 89  ASN G ND2   1 
ATOM 5093  N N     . ASP G 3 90  ? 137.698 127.869 109.203 1.00 23.94  ? 90  ASP G N     1 
ATOM 5094  C CA    . ASP G 3 90  ? 138.776 128.551 109.906 1.00 23.94  ? 90  ASP G CA    1 
ATOM 5095  C C     . ASP G 3 90  ? 138.614 128.267 111.384 1.00 23.94  ? 90  ASP G C     1 
ATOM 5096  O O     . ASP G 3 90  ? 137.540 128.513 111.927 1.00 23.94  ? 90  ASP G O     1 
ATOM 5097  C CB    . ASP G 3 90  ? 138.711 130.038 109.645 1.00 23.94  ? 90  ASP G CB    1 
ATOM 5098  C CG    . ASP G 3 90  ? 140.045 130.701 109.782 1.00 23.94  ? 90  ASP G CG    1 
ATOM 5099  O OD1   . ASP G 3 90  ? 140.767 130.800 108.772 1.00 23.94  ? 90  ASP G OD1   1 
ATOM 5100  O OD2   . ASP G 3 90  ? 140.387 131.120 110.900 1.00 23.94  ? 90  ASP G OD2   1 
ATOM 5101  N N     . GLU G 3 91  ? 139.671 127.788 112.042 1.00 27.42  ? 91  GLU G N     1 
ATOM 5102  C CA    . GLU G 3 91  ? 139.517 127.294 113.407 1.00 27.42  ? 91  GLU G CA    1 
ATOM 5103  C C     . GLU G 3 91  ? 139.323 128.425 114.406 1.00 27.42  ? 91  GLU G C     1 
ATOM 5104  O O     . GLU G 3 91  ? 138.503 128.318 115.322 1.00 27.42  ? 91  GLU G O     1 
ATOM 5105  C CB    . GLU G 3 91  ? 140.712 126.441 113.811 1.00 27.42  ? 91  GLU G CB    1 
ATOM 5106  C CG    . GLU G 3 91  ? 140.444 125.709 115.107 1.00 27.42  ? 91  GLU G CG    1 
ATOM 5107  C CD    . GLU G 3 91  ? 141.659 125.056 115.704 1.00 27.42  ? 91  GLU G CD    1 
ATOM 5108  O OE1   . GLU G 3 91  ? 142.388 124.380 114.964 1.00 27.42  ? 91  GLU G OE1   1 
ATOM 5109  O OE2   . GLU G 3 91  ? 141.882 125.206 116.921 1.00 27.42  ? 91  GLU G OE2   1 
ATOM 5110  N N     . GLU G 3 92  ? 140.058 129.526 114.243 1.00 24.57  ? 92  GLU G N     1 
ATOM 5111  C CA    . GLU G 3 92  ? 139.964 130.624 115.200 1.00 24.57  ? 92  GLU G CA    1 
ATOM 5112  C C     . GLU G 3 92  ? 138.639 131.358 115.079 1.00 24.57  ? 92  GLU G C     1 
ATOM 5113  O O     . GLU G 3 92  ? 138.014 131.693 116.090 1.00 24.57  ? 92  GLU G O     1 
ATOM 5114  C CB    . GLU G 3 92  ? 141.118 131.593 115.000 1.00 24.57  ? 92  GLU G CB    1 
ATOM 5115  C CG    . GLU G 3 92  ? 142.418 131.148 115.606 1.00 24.57  ? 92  GLU G CG    1 
ATOM 5116  C CD    . GLU G 3 92  ? 143.596 131.877 115.013 1.00 24.57  ? 92  GLU G CD    1 
ATOM 5117  O OE1   . GLU G 3 92  ? 143.399 132.638 114.043 1.00 24.57  ? 92  GLU G OE1   1 
ATOM 5118  O OE2   . GLU G 3 92  ? 144.727 131.678 115.505 1.00 24.57  ? 92  GLU G OE2   1 
ATOM 5119  N N     . LEU G 3 93  ? 138.188 131.606 113.854 1.00 20.15  ? 93  LEU G N     1 
ATOM 5120  C CA    . LEU G 3 93  ? 136.882 132.213 113.667 1.00 20.15  ? 93  LEU G CA    1 
ATOM 5121  C C     . LEU G 3 93  ? 135.759 131.260 114.020 1.00 20.15  ? 93  LEU G C     1 
ATOM 5122  O O     . LEU G 3 93  ? 134.697 131.712 114.452 1.00 20.15  ? 93  LEU G O     1 
ATOM 5123  C CB    . LEU G 3 93  ? 136.725 132.692 112.232 1.00 20.15  ? 93  LEU G CB    1 
ATOM 5124  C CG    . LEU G 3 93  ? 137.452 133.968 111.837 1.00 20.15  ? 93  LEU G CG    1 
ATOM 5125  C CD1   . LEU G 3 93  ? 137.226 134.230 110.377 1.00 20.15  ? 93  LEU G CD1   1 
ATOM 5126  C CD2   . LEU G 3 93  ? 136.959 135.124 112.654 1.00 20.15  ? 93  LEU G CD2   1 
ATOM 5127  N N     . ASN G 3 94  ? 135.974 129.954 113.884 1.00 21.12  ? 94  ASN G N     1 
ATOM 5128  C CA    . ASN G 3 94  ? 134.954 128.998 114.274 1.00 21.12  ? 94  ASN G CA    1 
ATOM 5129  C C     . ASN G 3 94  ? 134.864 128.874 115.781 1.00 21.12  ? 94  ASN G C     1 
ATOM 5130  O O     . ASN G 3 94  ? 133.810 128.534 116.313 1.00 21.12  ? 94  ASN G O     1 
ATOM 5131  C CB    . ASN G 3 94  ? 135.250 127.645 113.648 1.00 21.12  ? 94  ASN G CB    1 
ATOM 5132  C CG    . ASN G 3 94  ? 134.030 126.786 113.545 1.00 21.12  ? 94  ASN G CG    1 
ATOM 5133  O OD1   . ASN G 3 94  ? 132.909 127.276 113.635 1.00 21.12  ? 94  ASN G OD1   1 
ATOM 5134  N ND2   . ASN G 3 94  ? 134.231 125.497 113.346 1.00 21.12  ? 94  ASN G ND2   1 
ATOM 5135  N N     . LYS G 3 95  ? 135.957 129.119 116.485 1.00 20.13  ? 95  LYS G N     1 
ATOM 5136  C CA    . LYS G 3 95  ? 135.905 129.157 117.934 1.00 20.13  ? 95  LYS G CA    1 
ATOM 5137  C C     . LYS G 3 95  ? 135.349 130.469 118.455 1.00 20.13  ? 95  LYS G C     1 
ATOM 5138  O O     . LYS G 3 95  ? 134.725 130.486 119.518 1.00 20.13  ? 95  LYS G O     1 
ATOM 5139  C CB    . LYS G 3 95  ? 137.288 128.924 118.520 1.00 20.13  ? 95  LYS G CB    1 
ATOM 5140  C CG    . LYS G 3 95  ? 137.240 128.477 119.951 1.00 20.13  ? 95  LYS G CG    1 
ATOM 5141  C CD    . LYS G 3 95  ? 138.605 128.420 120.584 1.00 20.13  ? 95  LYS G CD    1 
ATOM 5142  C CE    . LYS G 3 95  ? 138.509 127.766 121.941 1.00 20.13  ? 95  LYS G CE    1 
ATOM 5143  N NZ    . LYS G 3 95  ? 137.562 128.497 122.822 1.00 20.13  ? 95  LYS G NZ    1 
ATOM 5144  N N     . LEU G 3 96  ? 135.547 131.562 117.729 1.00 17.90  ? 96  LEU G N     1 
ATOM 5145  C CA    . LEU G 3 96  ? 134.915 132.820 118.095 1.00 17.90  ? 96  LEU G CA    1 
ATOM 5146  C C     . LEU G 3 96  ? 133.410 132.776 117.870 1.00 17.90  ? 96  LEU G C     1 
ATOM 5147  O O     . LEU G 3 96  ? 132.644 133.297 118.683 1.00 17.90  ? 96  LEU G O     1 
ATOM 5148  C CB    . LEU G 3 96  ? 135.543 133.956 117.298 1.00 17.90  ? 96  LEU G CB    1 
ATOM 5149  C CG    . LEU G 3 96  ? 135.108 135.382 117.583 1.00 17.90  ? 96  LEU G CG    1 
ATOM 5150  C CD1   . LEU G 3 96  ? 135.422 135.721 119.005 1.00 17.90  ? 96  LEU G CD1   1 
ATOM 5151  C CD2   . LEU G 3 96  ? 135.831 136.304 116.648 1.00 17.90  ? 96  LEU G CD2   1 
ATOM 5152  N N     . LEU G 3 97  ? 132.963 132.149 116.789 1.00 17.53  ? 97  LEU G N     1 
ATOM 5153  C CA    . LEU G 3 97  ? 131.550 132.154 116.454 1.00 17.53  ? 97  LEU G CA    1 
ATOM 5154  C C     . LEU G 3 97  ? 130.962 130.758 116.538 1.00 17.53  ? 97  LEU G C     1 
ATOM 5155  O O     . LEU G 3 97  ? 130.255 130.326 115.628 1.00 17.53  ? 97  LEU G O     1 
ATOM 5156  C CB    . LEU G 3 97  ? 131.337 132.715 115.053 1.00 17.53  ? 97  LEU G CB    1 
ATOM 5157  C CG    . LEU G 3 97  ? 131.812 134.122 114.713 1.00 17.53  ? 97  LEU G CG    1 
ATOM 5158  C CD1   . LEU G 3 97  ? 131.111 134.559 113.481 1.00 17.53  ? 97  LEU G CD1   1 
ATOM 5159  C CD2   . LEU G 3 97  ? 131.522 135.085 115.831 1.00 17.53  ? 97  LEU G CD2   1 
ATOM 5160  N N     . SER G 3 98  ? 131.267 130.036 117.612 1.00 18.21  ? 98  SER G N     1 
ATOM 5161  C CA    . SER G 3 98  ? 130.849 128.644 117.723 1.00 18.21  ? 98  SER G CA    1 
ATOM 5162  C C     . SER G 3 98  ? 129.378 128.516 118.080 1.00 18.21  ? 98  SER G C     1 
ATOM 5163  O O     . SER G 3 98  ? 128.713 127.574 117.643 1.00 18.21  ? 98  SER G O     1 
ATOM 5164  C CB    . SER G 3 98  ? 131.704 127.926 118.757 1.00 18.21  ? 98  SER G CB    1 
ATOM 5165  O OG    . SER G 3 98  ? 131.882 128.726 119.904 1.00 18.21  ? 98  SER G OG    1 
ATOM 5166  N N     . GLY G 3 99  ? 128.856 129.435 118.874 1.00 17.24  ? 99  GLY G N     1 
ATOM 5167  C CA    . GLY G 3 99  ? 127.459 129.372 119.229 1.00 17.24  ? 99  GLY G CA    1 
ATOM 5168  C C     . GLY G 3 99  ? 126.609 130.307 118.406 1.00 17.24  ? 99  GLY G C     1 
ATOM 5169  O O     . GLY G 3 99  ? 125.628 130.850 118.904 1.00 17.24  ? 99  GLY G O     1 
ATOM 5170  N N     . VAL G 3 100 ? 126.970 130.499 117.143 1.00 18.29  ? 100 VAL G N     1 
ATOM 5171  C CA    . VAL G 3 100 ? 126.308 131.456 116.272 1.00 18.29  ? 100 VAL G CA    1 
ATOM 5172  C C     . VAL G 3 100 ? 125.740 130.711 115.075 1.00 18.29  ? 100 VAL G C     1 
ATOM 5173  O O     . VAL G 3 100 ? 126.446 129.927 114.436 1.00 18.29  ? 100 VAL G O     1 
ATOM 5174  C CB    . VAL G 3 100 ? 127.268 132.568 115.815 1.00 18.29  ? 100 VAL G CB    1 
ATOM 5175  C CG1   . VAL G 3 100 ? 126.619 133.428 114.805 1.00 18.29  ? 100 VAL G CG1   1 
ATOM 5176  C CG2   . VAL G 3 100 ? 127.694 133.401 116.977 1.00 18.29  ? 100 VAL G CG2   1 
ATOM 5177  N N     . THR G 3 101 ? 124.460 130.932 114.798 1.00 20.21  ? 101 THR G N     1 
ATOM 5178  C CA    . THR G 3 101 ? 123.823 130.505 113.566 1.00 20.21  ? 101 THR G CA    1 
ATOM 5179  C C     . THR G 3 101 ? 123.784 131.677 112.600 1.00 20.21  ? 101 THR G C     1 
ATOM 5180  O O     . THR G 3 101 ? 123.265 132.740 112.934 1.00 20.21  ? 101 THR G O     1 
ATOM 5181  C CB    . THR G 3 101 ? 122.407 130.003 113.838 1.00 20.21  ? 101 THR G CB    1 
ATOM 5182  O OG1   . THR G 3 101 ? 122.463 128.753 114.531 1.00 20.21  ? 101 THR G OG1   1 
ATOM 5183  C CG2   . THR G 3 101 ? 121.642 129.823 112.548 1.00 20.21  ? 101 THR G CG2   1 
ATOM 5184  N N     . ILE G 3 102 ? 124.343 131.491 111.416 1.00 19.43  ? 102 ILE G N     1 
ATOM 5185  C CA    . ILE G 3 102 ? 124.309 132.494 110.363 1.00 19.43  ? 102 ILE G CA    1 
ATOM 5186  C C     . ILE G 3 102 ? 123.158 132.137 109.444 1.00 19.43  ? 102 ILE G C     1 
ATOM 5187  O O     . ILE G 3 102 ? 123.092 131.015 108.936 1.00 19.43  ? 102 ILE G O     1 
ATOM 5188  C CB    . ILE G 3 102 ? 125.644 132.550 109.612 1.00 19.43  ? 102 ILE G CB    1 
ATOM 5189  C CG1   . ILE G 3 102 ? 126.684 133.256 110.464 1.00 19.43  ? 102 ILE G CG1   1 
ATOM 5190  C CG2   . ILE G 3 102 ? 125.505 133.235 108.284 1.00 19.43  ? 102 ILE G CG2   1 
ATOM 5191  C CD1   . ILE G 3 102 ? 128.037 132.818 110.167 1.00 19.43  ? 102 ILE G CD1   1 
ATOM 5192  N N     . ALA G 3 103 ? 122.235 133.070 109.259 1.00 19.98  ? 103 ALA G N     1 
ATOM 5193  C CA    . ALA G 3 103 ? 121.001 132.771 108.551 1.00 19.98  ? 103 ALA G CA    1 
ATOM 5194  C C     . ALA G 3 103 ? 121.248 132.634 107.058 1.00 19.98  ? 103 ALA G C     1 
ATOM 5195  O O     . ALA G 3 103 ? 121.919 133.468 106.449 1.00 19.98  ? 103 ALA G O     1 
ATOM 5196  C CB    . ALA G 3 103 ? 119.974 133.862 108.807 1.00 19.98  ? 103 ALA G CB    1 
ATOM 5197  N N     . GLN G 3 104 ? 120.671 131.575 106.478 1.00 20.71  ? 104 GLN G N     1 
ATOM 5198  C CA    . GLN G 3 104 ? 120.868 131.163 105.086 1.00 20.71  ? 104 GLN G CA    1 
ATOM 5199  C C     . GLN G 3 104 ? 122.335 130.925 104.775 1.00 20.71  ? 104 GLN G C     1 
ATOM 5200  O O     . GLN G 3 104 ? 122.814 131.253 103.693 1.00 20.71  ? 104 GLN G O     1 
ATOM 5201  C CB    . GLN G 3 104 ? 120.267 132.155 104.094 1.00 20.71  ? 104 GLN G CB    1 
ATOM 5202  C CG    . GLN G 3 104 ? 118.850 132.534 104.378 1.00 20.71  ? 104 GLN G CG    1 
ATOM 5203  C CD    . GLN G 3 104 ? 118.502 133.845 103.747 1.00 20.71  ? 104 GLN G CD    1 
ATOM 5204  O OE1   . GLN G 3 104 ? 119.213 134.326 102.868 1.00 20.71  ? 104 GLN G OE1   1 
ATOM 5205  N NE2   . GLN G 3 104 ? 117.410 134.447 104.193 1.00 20.71  ? 104 GLN G NE2   1 
ATOM 5206  N N     . GLY G 3 105 ? 123.044 130.329 105.721 1.00 18.24  ? 105 GLY G N     1 
ATOM 5207  C CA    . GLY G 3 105 ? 124.436 130.013 105.533 1.00 18.24  ? 105 GLY G CA    1 
ATOM 5208  C C     . GLY G 3 105 ? 124.667 128.584 105.109 1.00 18.24  ? 105 GLY G C     1 
ATOM 5209  O O     . GLY G 3 105 ? 125.675 128.287 104.475 1.00 18.24  ? 105 GLY G O     1 
ATOM 5210  N N     . GLY G 3 106 ? 123.756 127.686 105.451 1.00 18.42  ? 106 GLY G N     1 
ATOM 5211  C CA    . GLY G 3 106 ? 123.971 126.286 105.170 1.00 18.42  ? 106 GLY G CA    1 
ATOM 5212  C C     . GLY G 3 106 ? 124.999 125.677 106.105 1.00 18.42  ? 106 GLY G C     1 
ATOM 5213  O O     . GLY G 3 106 ? 125.266 126.177 107.194 1.00 18.42  ? 106 GLY G O     1 
ATOM 5214  N N     . VAL G 3 107 ? 125.579 124.568 105.660 1.00 19.49  ? 107 VAL G N     1 
ATOM 5215  C CA    . VAL G 3 107 ? 126.623 123.863 106.390 1.00 19.49  ? 107 VAL G CA    1 
ATOM 5216  C C     . VAL G 3 107 ? 127.800 123.655 105.455 1.00 19.49  ? 107 VAL G C     1 
ATOM 5217  O O     . VAL G 3 107 ? 127.691 123.889 104.250 1.00 19.49  ? 107 VAL G O     1 
ATOM 5218  C CB    . VAL G 3 107 ? 126.134 122.506 106.931 1.00 19.49  ? 107 VAL G CB    1 
ATOM 5219  C CG1   . VAL G 3 107 ? 125.062 122.689 107.966 1.00 19.49  ? 107 VAL G CG1   1 
ATOM 5220  C CG2   . VAL G 3 107 ? 125.637 121.659 105.806 1.00 19.49  ? 107 VAL G CG2   1 
ATOM 5221  N N     . LEU G 3 108 ? 128.926 123.222 106.007 1.00 21.84  ? 108 LEU G N     1 
ATOM 5222  C CA    . LEU G 3 108 ? 130.040 122.803 105.169 1.00 21.84  ? 108 LEU G CA    1 
ATOM 5223  C C     . LEU G 3 108 ? 129.740 121.441 104.553 1.00 21.84  ? 108 LEU G C     1 
ATOM 5224  O O     . LEU G 3 108 ? 129.153 120.582 105.217 1.00 21.84  ? 108 LEU G O     1 
ATOM 5225  C CB    . LEU G 3 108 ? 131.334 122.710 105.977 1.00 21.84  ? 108 LEU G CB    1 
ATOM 5226  C CG    . LEU G 3 108 ? 131.890 123.958 106.648 1.00 21.84  ? 108 LEU G CG    1 
ATOM 5227  C CD1   . LEU G 3 108 ? 133.209 123.631 107.287 1.00 21.84  ? 108 LEU G CD1   1 
ATOM 5228  C CD2   . LEU G 3 108 ? 132.047 125.071 105.652 1.00 21.84  ? 108 LEU G CD2   1 
ATOM 5229  N N     . PRO G 3 109 ? 130.114 121.215 103.294 1.00 23.51  ? 109 PRO G N     1 
ATOM 5230  C CA    . PRO G 3 109 ? 130.043 119.865 102.724 1.00 23.51  ? 109 PRO G CA    1 
ATOM 5231  C C     . PRO G 3 109 ? 130.950 118.881 103.437 1.00 23.51  ? 109 PRO G C     1 
ATOM 5232  O O     . PRO G 3 109 ? 132.172 119.040 103.442 1.00 23.51  ? 109 PRO G O     1 
ATOM 5233  C CB    . PRO G 3 109 ? 130.483 120.078 101.275 1.00 23.51  ? 109 PRO G CB    1 
ATOM 5234  C CG    . PRO G 3 109 ? 130.137 121.473 100.997 1.00 23.51  ? 109 PRO G CG    1 
ATOM 5235  C CD    . PRO G 3 109 ? 130.401 122.220 102.262 1.00 23.51  ? 109 PRO G CD    1 
ATOM 5236  N N     . ASN G 3 110 ? 130.353 117.862 104.045 1.00 25.33  ? 110 ASN G N     1 
ATOM 5237  C CA    . ASN G 3 110 ? 131.076 116.921 104.891 1.00 25.33  ? 110 ASN G CA    1 
ATOM 5238  C C     . ASN G 3 110 ? 130.298 115.616 104.948 1.00 25.33  ? 110 ASN G C     1 
ATOM 5239  O O     . ASN G 3 110 ? 129.216 115.565 105.535 1.00 25.33  ? 110 ASN G O     1 
ATOM 5240  C CB    . ASN G 3 110 ? 131.273 117.497 106.288 1.00 25.33  ? 110 ASN G CB    1 
ATOM 5241  C CG    . ASN G 3 110 ? 131.724 116.462 107.287 1.00 25.33  ? 110 ASN G CG    1 
ATOM 5242  O OD1   . ASN G 3 110 ? 132.728 115.779 107.085 1.00 25.33  ? 110 ASN G OD1   1 
ATOM 5243  N ND2   . ASN G 3 110 ? 130.975 116.332 108.375 1.00 25.33  ? 110 ASN G ND2   1 
ATOM 5244  N N     . ILE G 3 111 ? 130.841 114.573 104.335 1.00 27.50  ? 111 ILE G N     1 
ATOM 5245  C CA    . ILE G 3 111 ? 130.338 113.213 104.460 1.00 27.50  ? 111 ILE G CA    1 
ATOM 5246  C C     . ILE G 3 111 ? 131.385 112.395 105.199 1.00 27.50  ? 111 ILE G C     1 
ATOM 5247  O O     . ILE G 3 111 ? 132.584 112.527 104.935 1.00 27.50  ? 111 ILE G O     1 
ATOM 5248  C CB    . ILE G 3 111 ? 130.030 112.585 103.087 1.00 27.50  ? 111 ILE G CB    1 
ATOM 5249  C CG1   . ILE G 3 111 ? 129.240 113.552 102.221 1.00 27.50  ? 111 ILE G CG1   1 
ATOM 5250  C CG2   . ILE G 3 111 ? 129.276 111.274 103.241 1.00 27.50  ? 111 ILE G CG2   1 
ATOM 5251  C CD1   . ILE G 3 111 ? 128.857 112.983 100.898 1.00 27.50  ? 111 ILE G CD1   1 
ATOM 5252  N N     . GLN G 3 112 ? 130.933 111.572 106.139 1.00 31.26  ? 112 GLN G N     1 
ATOM 5253  C CA    . GLN G 3 112 ? 131.824 110.648 106.818 1.00 31.26  ? 112 GLN G CA    1 
ATOM 5254  C C     . GLN G 3 112 ? 132.324 109.593 105.844 1.00 31.26  ? 112 GLN G C     1 
ATOM 5255  O O     . GLN G 3 112 ? 131.646 109.240 104.881 1.00 31.26  ? 112 GLN G O     1 
ATOM 5256  C CB    . GLN G 3 112 ? 131.102 109.988 107.985 1.00 31.26  ? 112 GLN G CB    1 
ATOM 5257  C CG    . GLN G 3 112 ? 130.477 110.976 108.936 1.00 31.26  ? 112 GLN G CG    1 
ATOM 5258  C CD    . GLN G 3 112 ? 131.463 111.529 109.933 1.00 31.26  ? 112 GLN G CD    1 
ATOM 5259  O OE1   . GLN G 3 112 ? 131.942 110.811 110.804 1.00 31.26  ? 112 GLN G OE1   1 
ATOM 5260  N NE2   . GLN G 3 112 ? 131.783 112.808 109.805 1.00 31.26  ? 112 GLN G NE2   1 
ATOM 5261  N N     . ALA G 3 113 ? 133.531 109.096 106.095 1.00 34.60  ? 113 ALA G N     1 
ATOM 5262  C CA    . ALA G 3 113 ? 134.161 108.167 105.170 1.00 34.60  ? 113 ALA G CA    1 
ATOM 5263  C C     . ALA G 3 113 ? 133.507 106.797 105.162 1.00 34.60  ? 113 ALA G C     1 
ATOM 5264  O O     . ALA G 3 113 ? 133.541 106.117 104.135 1.00 34.60  ? 113 ALA G O     1 
ATOM 5265  C CB    . ALA G 3 113 ? 135.642 108.015 105.507 1.00 34.60  ? 113 ALA G CB    1 
ATOM 5266  N N     . VAL G 3 114 ? 132.894 106.380 106.272 1.00 33.56  ? 114 VAL G N     1 
ATOM 5267  C CA    . VAL G 3 114 ? 132.281 105.061 106.347 1.00 33.56  ? 114 VAL G CA    1 
ATOM 5268  C C     . VAL G 3 114 ? 130.978 104.992 105.559 1.00 33.56  ? 114 VAL G C     1 
ATOM 5269  O O     . VAL G 3 114 ? 130.512 103.893 105.230 1.00 33.56  ? 114 VAL G O     1 
ATOM 5270  C CB    . VAL G 3 114 ? 132.105 104.691 107.838 1.00 33.56  ? 114 VAL G CB    1 
ATOM 5271  C CG1   . VAL G 3 114 ? 131.008 105.503 108.476 1.00 33.56  ? 114 VAL G CG1   1 
ATOM 5272  C CG2   . VAL G 3 114 ? 131.894 103.201 108.038 1.00 33.56  ? 114 VAL G CG2   1 
ATOM 5273  N N     . LEU G 3 115 ? 130.398 106.133 105.194 1.00 31.38  ? 115 LEU G N     1 
ATOM 5274  C CA    . LEU G 3 115 ? 129.157 106.145 104.437 1.00 31.38  ? 115 LEU G CA    1 
ATOM 5275  C C     . LEU G 3 115 ? 129.373 106.047 102.936 1.00 31.38  ? 115 LEU G C     1 
ATOM 5276  O O     . LEU G 3 115 ? 128.404 105.875 102.197 1.00 31.38  ? 115 LEU G O     1 
ATOM 5277  C CB    . LEU G 3 115 ? 128.365 107.412 104.747 1.00 31.38  ? 115 LEU G CB    1 
ATOM 5278  C CG    . LEU G 3 115 ? 128.177 107.797 106.212 1.00 31.38  ? 115 LEU G CG    1 
ATOM 5279  C CD1   . LEU G 3 115 ? 127.263 108.979 106.286 1.00 31.38  ? 115 LEU G CD1   1 
ATOM 5280  C CD2   . LEU G 3 115 ? 127.606 106.664 107.017 1.00 31.38  ? 115 LEU G CD2   1 
ATOM 5281  N N     . LEU G 3 116 ? 130.608 106.159 102.472 1.00 38.41  ? 116 LEU G N     1 
ATOM 5282  C CA    . LEU G 3 116 ? 130.896 106.060 101.055 1.00 38.41  ? 116 LEU G CA    1 
ATOM 5283  C C     . LEU G 3 116 ? 130.917 104.593 100.622 1.00 38.41  ? 116 LEU G C     1 
ATOM 5284  O O     . LEU G 3 116 ? 131.118 103.703 101.452 1.00 38.41  ? 116 LEU G O     1 
ATOM 5285  C CB    . LEU G 3 116 ? 132.233 106.728 100.763 1.00 38.41  ? 116 LEU G CB    1 
ATOM 5286  C CG    . LEU G 3 116 ? 132.332 108.135 101.348 1.00 38.41  ? 116 LEU G CG    1 
ATOM 5287  C CD1   . LEU G 3 116 ? 133.745 108.651 101.289 1.00 38.41  ? 116 LEU G CD1   1 
ATOM 5288  C CD2   . LEU G 3 116 ? 131.413 109.067 100.609 1.00 38.41  ? 116 LEU G CD2   1 
ATOM 5289  N N     . PRO G 3 117 ? 130.671 104.311 99.340  1.00 45.72  ? 117 PRO G N     1 
ATOM 5290  C CA    . PRO G 3 117 ? 130.805 102.934 98.846  1.00 45.72  ? 117 PRO G CA    1 
ATOM 5291  C C     . PRO G 3 117 ? 132.242 102.434 98.928  1.00 45.72  ? 117 PRO G C     1 
ATOM 5292  O O     . PRO G 3 117 ? 133.204 103.196 98.817  1.00 45.72  ? 117 PRO G O     1 
ATOM 5293  C CB    . PRO G 3 117 ? 130.326 103.031 97.394  1.00 45.72  ? 117 PRO G CB    1 
ATOM 5294  C CG    . PRO G 3 117 ? 130.346 104.478 97.076  1.00 45.72  ? 117 PRO G CG    1 
ATOM 5295  C CD    . PRO G 3 117 ? 130.040 105.176 98.334  1.00 45.72  ? 117 PRO G CD    1 
ATOM 5296  N N     . LYS G 3 118 ? 132.373 101.120 99.125  1.00 55.34  ? 118 LYS G N     1 
ATOM 5297  C CA    . LYS G 3 118 ? 133.571 100.589 99.777  1.00 55.34  ? 118 LYS G CA    1 
ATOM 5298  C C     . LYS G 3 118 ? 134.764 100.502 98.831  1.00 55.34  ? 118 LYS G C     1 
ATOM 5299  O O     . LYS G 3 118 ? 135.784 101.169 99.043  1.00 55.34  ? 118 LYS G O     1 
ATOM 5300  C CB    . LYS G 3 118 ? 133.267 99.223  100.396 1.00 55.34  ? 118 LYS G CB    1 
ATOM 5301  C CG    . LYS G 3 118 ? 132.479 99.322  101.683 1.00 55.34  ? 118 LYS G CG    1 
ATOM 5302  C CD    . LYS G 3 118 ? 133.329 99.936  102.783 1.00 55.34  ? 118 LYS G CD    1 
ATOM 5303  C CE    . LYS G 3 118 ? 132.482 100.346 103.980 1.00 55.34  ? 118 LYS G CE    1 
ATOM 5304  N NZ    . LYS G 3 118 ? 133.314 100.620 105.186 1.00 55.34  ? 118 LYS G NZ    1 
ATOM 5305  N N     . LYS G 3 119 ? 134.670 99.682  97.789  1.00 64.44  ? 119 LYS G N     1 
ATOM 5306  C CA    . LYS G 3 119 ? 135.832 99.429  96.943  1.00 64.44  ? 119 LYS G CA    1 
ATOM 5307  C C     . LYS G 3 119 ? 136.102 100.591 95.991  1.00 64.44  ? 119 LYS G C     1 
ATOM 5308  O O     . LYS G 3 119 ? 136.819 101.533 96.333  1.00 64.44  ? 119 LYS G O     1 
ATOM 5309  C CB    . LYS G 3 119 ? 135.658 98.135  96.147  1.00 64.44  ? 119 LYS G CB    1 
ATOM 5310  C CG    . LYS G 3 119 ? 136.906 97.722  95.381  1.00 64.44  ? 119 LYS G CG    1 
ATOM 5311  C CD    . LYS G 3 119 ? 136.668 96.490  94.521  1.00 64.44  ? 119 LYS G CD    1 
ATOM 5312  C CE    . LYS G 3 119 ? 136.588 95.225  95.354  1.00 64.44  ? 119 LYS G CE    1 
ATOM 5313  N NZ    . LYS G 3 119 ? 136.462 94.005  94.505  1.00 64.44  ? 119 LYS G NZ    1 
ATOM 5314  N N     . ARG H 4 30  ? 110.481 156.784 110.390 1.00 62.36  ? 28  ARG H N     1 
ATOM 5315  C CA    . ARG H 4 30  ? 111.758 157.094 109.763 1.00 62.36  ? 28  ARG H CA    1 
ATOM 5316  C C     . ARG H 4 30  ? 112.671 157.849 110.732 1.00 62.36  ? 28  ARG H C     1 
ATOM 5317  O O     . ARG H 4 30  ? 112.933 159.042 110.570 1.00 62.36  ? 28  ARG H O     1 
ATOM 5318  C CB    . ARG H 4 30  ? 111.540 157.898 108.478 1.00 62.36  ? 28  ARG H CB    1 
ATOM 5319  C CG    . ARG H 4 30  ? 110.436 158.942 108.546 1.00 62.36  ? 28  ARG H CG    1 
ATOM 5320  C CD    . ARG H 4 30  ? 110.542 159.916 107.384 1.00 62.36  ? 28  ARG H CD    1 
ATOM 5321  N NE    . ARG H 4 30  ? 111.882 160.490 107.274 1.00 62.36  ? 28  ARG H NE    1 
ATOM 5322  C CZ    . ARG H 4 30  ? 112.290 161.244 106.259 1.00 62.36  ? 28  ARG H CZ    1 
ATOM 5323  N NH1   . ARG H 4 30  ? 111.458 161.529 105.270 1.00 62.36  ? 28  ARG H NH1   1 
ATOM 5324  N NH2   . ARG H 4 30  ? 113.524 161.720 106.234 1.00 62.36  ? 28  ARG H NH2   1 
ATOM 5325  N N     . LYS H 4 31  ? 113.176 157.141 111.743 1.00 60.20  ? 29  LYS H N     1 
ATOM 5326  C CA    . LYS H 4 31  ? 113.935 157.809 112.790 1.00 60.20  ? 29  LYS H CA    1 
ATOM 5327  C C     . LYS H 4 31  ? 115.332 157.223 112.957 1.00 60.20  ? 29  LYS H C     1 
ATOM 5328  O O     . LYS H 4 31  ? 115.746 156.940 114.086 1.00 60.20  ? 29  LYS H O     1 
ATOM 5329  C CB    . LYS H 4 31  ? 113.200 157.764 114.131 1.00 60.20  ? 29  LYS H CB    1 
ATOM 5330  C CG    . LYS H 4 31  ? 111.883 158.493 114.133 1.00 60.20  ? 29  LYS H CG    1 
ATOM 5331  C CD    . LYS H 4 31  ? 112.073 159.963 113.807 1.00 60.20  ? 29  LYS H CD    1 
ATOM 5332  C CE    . LYS H 4 31  ? 112.715 160.721 114.944 1.00 60.20  ? 29  LYS H CE    1 
ATOM 5333  N NZ    . LYS H 4 31  ? 112.832 162.164 114.609 1.00 60.20  ? 29  LYS H NZ    1 
ATOM 5334  N N     . ARG H 4 32  ? 116.056 157.038 111.848 1.00 50.29  ? 30  ARG H N     1 
ATOM 5335  C CA    . ARG H 4 32  ? 117.514 156.893 111.817 1.00 50.29  ? 30  ARG H CA    1 
ATOM 5336  C C     . ARG H 4 32  ? 117.995 155.671 112.610 1.00 50.29  ? 30  ARG H C     1 
ATOM 5337  O O     . ARG H 4 32  ? 118.552 155.778 113.701 1.00 50.29  ? 30  ARG H O     1 
ATOM 5338  C CB    . ARG H 4 32  ? 118.181 158.186 112.295 1.00 50.29  ? 30  ARG H CB    1 
ATOM 5339  C CG    . ARG H 4 32  ? 117.727 159.389 111.503 1.00 50.29  ? 30  ARG H CG    1 
ATOM 5340  C CD    . ARG H 4 32  ? 118.823 160.412 111.336 1.00 50.29  ? 30  ARG H CD    1 
ATOM 5341  N NE    . ARG H 4 32  ? 118.576 161.269 110.181 1.00 50.29  ? 30  ARG H NE    1 
ATOM 5342  C CZ    . ARG H 4 32  ? 119.227 162.402 109.939 1.00 50.29  ? 30  ARG H CZ    1 
ATOM 5343  N NH1   . ARG H 4 32  ? 120.163 162.827 110.777 1.00 50.29  ? 30  ARG H NH1   1 
ATOM 5344  N NH2   . ARG H 4 32  ? 118.934 163.115 108.862 1.00 50.29  ? 30  ARG H NH2   1 
ATOM 5345  N N     . LYS H 4 33  ? 117.712 154.496 112.040 1.00 45.40  ? 31  LYS H N     1 
ATOM 5346  C CA    . LYS H 4 33  ? 117.997 153.221 112.690 1.00 45.40  ? 31  LYS H CA    1 
ATOM 5347  C C     . LYS H 4 33  ? 119.477 152.931 112.912 1.00 45.40  ? 31  LYS H C     1 
ATOM 5348  O O     . LYS H 4 33  ? 119.768 152.058 113.735 1.00 45.40  ? 31  LYS H O     1 
ATOM 5349  C CB    . LYS H 4 33  ? 117.362 152.076 111.907 1.00 45.40  ? 31  LYS H CB    1 
ATOM 5350  C CG    . LYS H 4 33  ? 115.861 152.056 112.039 1.00 45.40  ? 31  LYS H CG    1 
ATOM 5351  C CD    . LYS H 4 33  ? 115.526 151.818 113.495 1.00 45.40  ? 31  LYS H CD    1 
ATOM 5352  C CE    . LYS H 4 33  ? 114.054 151.762 113.761 1.00 45.40  ? 31  LYS H CE    1 
ATOM 5353  N NZ    . LYS H 4 33  ? 113.825 151.597 115.221 1.00 45.40  ? 31  LYS H NZ    1 
ATOM 5354  N N     . GLU H 4 34  ? 120.393 153.599 112.207 1.00 35.17  ? 32  GLU H N     1 
ATOM 5355  C CA    . GLU H 4 34  ? 121.794 153.755 112.619 1.00 35.17  ? 32  GLU H CA    1 
ATOM 5356  C C     . GLU H 4 34  ? 122.554 152.424 112.738 1.00 35.17  ? 32  GLU H C     1 
ATOM 5357  O O     . GLU H 4 34  ? 122.845 151.937 113.827 1.00 35.17  ? 32  GLU H O     1 
ATOM 5358  C CB    . GLU H 4 34  ? 121.860 154.539 113.931 1.00 35.17  ? 32  GLU H CB    1 
ATOM 5359  C CG    . GLU H 4 34  ? 123.209 155.135 114.224 1.00 35.17  ? 32  GLU H CG    1 
ATOM 5360  C CD    . GLU H 4 34  ? 123.390 155.479 115.680 1.00 35.17  ? 32  GLU H CD    1 
ATOM 5361  O OE1   . GLU H 4 34  ? 123.360 156.681 116.014 1.00 35.17  ? 32  GLU H OE1   1 
ATOM 5362  O OE2   . GLU H 4 34  ? 123.560 154.549 116.496 1.00 35.17  ? 32  GLU H OE2   1 
ATOM 5363  N N     . SER H 4 35  ? 122.825 151.815 111.586 1.00 26.10  ? 33  SER H N     1 
ATOM 5364  C CA    . SER H 4 35  ? 123.594 150.580 111.528 1.00 26.10  ? 33  SER H CA    1 
ATOM 5365  C C     . SER H 4 35  ? 125.088 150.851 111.339 1.00 26.10  ? 33  SER H C     1 
ATOM 5366  O O     . SER H 4 35  ? 125.563 151.972 111.486 1.00 26.10  ? 33  SER H O     1 
ATOM 5367  C CB    . SER H 4 35  ? 123.050 149.686 110.419 1.00 26.10  ? 33  SER H CB    1 
ATOM 5368  O OG    . SER H 4 35  ? 123.111 150.335 109.169 1.00 26.10  ? 33  SER H OG    1 
ATOM 5369  N N     . TYR H 4 36  ? 125.847 149.794 111.035 1.00 19.08  ? 34  TYR H N     1 
ATOM 5370  C CA    . TYR H 4 36  ? 127.274 149.868 110.728 1.00 19.08  ? 34  TYR H CA    1 
ATOM 5371  C C     . TYR H 4 36  ? 127.558 149.637 109.254 1.00 19.08  ? 34  TYR H C     1 
ATOM 5372  O O     . TYR H 4 36  ? 128.699 149.340 108.885 1.00 19.08  ? 34  TYR H O     1 
ATOM 5373  C CB    . TYR H 4 36  ? 128.067 148.839 111.529 1.00 19.08  ? 34  TYR H CB    1 
ATOM 5374  C CG    . TYR H 4 36  ? 128.269 149.121 112.983 1.00 19.08  ? 34  TYR H CG    1 
ATOM 5375  C CD1   . TYR H 4 36  ? 129.055 150.175 113.405 1.00 19.08  ? 34  TYR H CD1   1 
ATOM 5376  C CD2   . TYR H 4 36  ? 127.703 148.304 113.936 1.00 19.08  ? 34  TYR H CD2   1 
ATOM 5377  C CE1   . TYR H 4 36  ? 129.250 150.421 114.740 1.00 19.08  ? 34  TYR H CE1   1 
ATOM 5378  C CE2   . TYR H 4 36  ? 127.889 148.539 115.269 1.00 19.08  ? 34  TYR H CE2   1 
ATOM 5379  C CZ    . TYR H 4 36  ? 128.663 149.594 115.668 1.00 19.08  ? 34  TYR H CZ    1 
ATOM 5380  O OH    . TYR H 4 36  ? 128.848 149.818 117.009 1.00 19.08  ? 34  TYR H OH    1 
ATOM 5381  N N     . ALA H 4 37  ? 126.540 149.769 108.409 1.00 21.57  ? 35  ALA H N     1 
ATOM 5382  C CA    . ALA H 4 37  ? 126.607 149.291 107.037 1.00 21.57  ? 35  ALA H CA    1 
ATOM 5383  C C     . ALA H 4 37  ? 127.582 150.094 106.188 1.00 21.57  ? 35  ALA H C     1 
ATOM 5384  O O     . ALA H 4 37  ? 128.298 149.525 105.363 1.00 21.57  ? 35  ALA H O     1 
ATOM 5385  C CB    . ALA H 4 37  ? 125.216 149.310 106.419 1.00 21.57  ? 35  ALA H CB    1 
ATOM 5386  N N     . ILE H 4 38  ? 127.667 151.409 106.397 1.00 24.16  ? 36  ILE H N     1 
ATOM 5387  C CA    . ILE H 4 38  ? 128.566 152.199 105.561 1.00 24.16  ? 36  ILE H CA    1 
ATOM 5388  C C     . ILE H 4 38  ? 130.026 152.026 105.937 1.00 24.16  ? 36  ILE H C     1 
ATOM 5389  O O     . ILE H 4 38  ? 130.888 152.059 105.055 1.00 24.16  ? 36  ILE H O     1 
ATOM 5390  C CB    . ILE H 4 38  ? 128.189 153.689 105.570 1.00 24.16  ? 36  ILE H CB    1 
ATOM 5391  C CG1   . ILE H 4 38  ? 128.084 154.231 106.978 1.00 24.16  ? 36  ILE H CG1   1 
ATOM 5392  C CG2   . ILE H 4 38  ? 126.872 153.896 104.874 1.00 24.16  ? 36  ILE H CG2   1 
ATOM 5393  C CD1   . ILE H 4 38  ? 128.228 155.703 107.009 1.00 24.16  ? 36  ILE H CD1   1 
ATOM 5394  N N     . TYR H 4 39  ? 130.333 151.772 107.200 1.00 21.45  ? 37  TYR H N     1 
ATOM 5395  C CA    . TYR H 4 39  ? 131.699 151.479 107.603 1.00 21.45  ? 37  TYR H CA    1 
ATOM 5396  C C     . TYR H 4 39  ? 132.136 150.091 107.191 1.00 21.45  ? 37  TYR H C     1 
ATOM 5397  O O     . TYR H 4 39  ? 133.287 149.901 106.792 1.00 21.45  ? 37  TYR H O     1 
ATOM 5398  C CB    . TYR H 4 39  ? 131.838 151.630 109.110 1.00 21.45  ? 37  TYR H CB    1 
ATOM 5399  C CG    . TYR H 4 39  ? 131.113 152.829 109.621 1.00 21.45  ? 37  TYR H CG    1 
ATOM 5400  C CD1   . TYR H 4 39  ? 131.591 154.098 109.373 1.00 21.45  ? 37  TYR H CD1   1 
ATOM 5401  C CD2   . TYR H 4 39  ? 129.941 152.698 110.327 1.00 21.45  ? 37  TYR H CD2   1 
ATOM 5402  C CE1   . TYR H 4 39  ? 130.937 155.193 109.826 1.00 21.45  ? 37  TYR H CE1   1 
ATOM 5403  C CE2   . TYR H 4 39  ? 129.276 153.791 110.778 1.00 21.45  ? 37  TYR H CE2   1 
ATOM 5404  C CZ    . TYR H 4 39  ? 129.785 155.034 110.527 1.00 21.45  ? 37  TYR H CZ    1 
ATOM 5405  O OH    . TYR H 4 39  ? 129.131 156.134 110.984 1.00 21.45  ? 37  TYR H OH    1 
ATOM 5406  N N     . ILE H 4 40  ? 131.226 149.121 107.252 1.00 20.90  ? 38  ILE H N     1 
ATOM 5407  C CA    . ILE H 4 40  ? 131.532 147.789 106.752 1.00 20.90  ? 38  ILE H CA    1 
ATOM 5408  C C     . ILE H 4 40  ? 131.688 147.814 105.238 1.00 20.90  ? 38  ILE H C     1 
ATOM 5409  O O     . ILE H 4 40  ? 132.524 147.098 104.680 1.00 20.90  ? 38  ILE H O     1 
ATOM 5410  C CB    . ILE H 4 40  ? 130.451 146.809 107.246 1.00 20.90  ? 38  ILE H CB    1 
ATOM 5411  C CG1   . ILE H 4 40  ? 130.586 146.624 108.746 1.00 20.90  ? 38  ILE H CG1   1 
ATOM 5412  C CG2   . ILE H 4 40  ? 130.582 145.456 106.637 1.00 20.90  ? 38  ILE H CG2   1 
ATOM 5413  C CD1   . ILE H 4 40  ? 129.381 146.051 109.368 1.00 20.90  ? 38  ILE H CD1   1 
ATOM 5414  N N     . TYR H 4 41  ? 130.978 148.708 104.556 1.00 26.48  ? 39  TYR H N     1 
ATOM 5415  C CA    . TYR H 4 41  ? 131.170 148.836 103.118 1.00 26.48  ? 39  TYR H CA    1 
ATOM 5416  C C     . TYR H 4 41  ? 132.475 149.534 102.762 1.00 26.48  ? 39  TYR H C     1 
ATOM 5417  O O     . TYR H 4 41  ? 133.091 149.186 101.756 1.00 26.48  ? 39  TYR H O     1 
ATOM 5418  C CB    . TYR H 4 41  ? 130.001 149.577 102.500 1.00 26.48  ? 39  TYR H CB    1 
ATOM 5419  C CG    . TYR H 4 41  ? 129.865 149.318 101.038 1.00 26.48  ? 39  TYR H CG    1 
ATOM 5420  C CD1   . TYR H 4 41  ? 129.272 148.158 100.582 1.00 26.48  ? 39  TYR H CD1   1 
ATOM 5421  C CD2   . TYR H 4 41  ? 130.334 150.229 100.108 1.00 26.48  ? 39  TYR H CD2   1 
ATOM 5422  C CE1   . TYR H 4 41  ? 129.144 147.910 99.245  1.00 26.48  ? 39  TYR H CE1   1 
ATOM 5423  C CE2   . TYR H 4 41  ? 130.207 149.991 98.765  1.00 26.48  ? 39  TYR H CE2   1 
ATOM 5424  C CZ    . TYR H 4 41  ? 129.614 148.828 98.341  1.00 26.48  ? 39  TYR H CZ    1 
ATOM 5425  O OH    . TYR H 4 41  ? 129.480 148.577 97.000  1.00 26.48  ? 39  TYR H OH    1 
ATOM 5426  N N     . LYS H 4 42  ? 132.909 150.515 103.555 1.00 23.31  ? 40  LYS H N     1 
ATOM 5427  C CA    . LYS H 4 42  ? 134.225 151.111 103.341 1.00 23.31  ? 40  LYS H CA    1 
ATOM 5428  C C     . LYS H 4 42  ? 135.349 150.110 103.572 1.00 23.31  ? 40  LYS H C     1 
ATOM 5429  O O     . LYS H 4 42  ? 136.333 150.092 102.821 1.00 23.31  ? 40  LYS H O     1 
ATOM 5430  C CB    . LYS H 4 42  ? 134.423 152.298 104.269 1.00 23.31  ? 40  LYS H CB    1 
ATOM 5431  C CG    . LYS H 4 42  ? 133.625 153.517 103.938 1.00 23.31  ? 40  LYS H CG    1 
ATOM 5432  C CD    . LYS H 4 42  ? 133.844 154.559 105.009 1.00 23.31  ? 40  LYS H CD    1 
ATOM 5433  C CE    . LYS H 4 42  ? 132.704 155.542 105.071 1.00 23.31  ? 40  LYS H CE    1 
ATOM 5434  N NZ    . LYS H 4 42  ? 132.851 156.443 106.235 1.00 23.31  ? 40  LYS H NZ    1 
ATOM 5435  N N     . VAL H 4 43  ? 135.210 149.275 104.601 1.00 22.41  ? 41  VAL H N     1 
ATOM 5436  C CA    . VAL H 4 43  ? 136.183 148.224 104.877 1.00 22.41  ? 41  VAL H CA    1 
ATOM 5437  C C     . VAL H 4 43  ? 136.224 147.211 103.739 1.00 22.41  ? 41  VAL H C     1 
ATOM 5438  O O     . VAL H 4 43  ? 137.303 146.810 103.282 1.00 22.41  ? 41  VAL H O     1 
ATOM 5439  C CB    . VAL H 4 43  ? 135.844 147.568 106.226 1.00 22.41  ? 41  VAL H CB    1 
ATOM 5440  C CG1   . VAL H 4 43  ? 136.499 146.235 106.366 1.00 22.41  ? 41  VAL H CG1   1 
ATOM 5441  C CG2   . VAL H 4 43  ? 136.264 148.470 107.348 1.00 22.41  ? 41  VAL H CG2   1 
ATOM 5442  N N     . LEU H 4 44  ? 135.052 146.813 103.240 1.00 23.81  ? 42  LEU H N     1 
ATOM 5443  C CA    . LEU H 4 44  ? 134.986 145.887 102.116 1.00 23.81  ? 42  LEU H CA    1 
ATOM 5444  C C     . LEU H 4 44  ? 135.565 146.498 100.853 1.00 23.81  ? 42  LEU H C     1 
ATOM 5445  O O     . LEU H 4 44  ? 136.234 145.814 100.083 1.00 23.81  ? 42  LEU H O     1 
ATOM 5446  C CB    . LEU H 4 44  ? 133.542 145.457 101.880 1.00 23.81  ? 42  LEU H CB    1 
ATOM 5447  C CG    . LEU H 4 44  ? 133.244 144.620 100.643 1.00 23.81  ? 42  LEU H CG    1 
ATOM 5448  C CD1   . LEU H 4 44  ? 133.945 143.295 100.724 1.00 23.81  ? 42  LEU H CD1   1 
ATOM 5449  C CD2   . LEU H 4 44  ? 131.772 144.429 100.493 1.00 23.81  ? 42  LEU H CD2   1 
ATOM 5450  N N     . LYS H 4 45  ? 135.346 147.784 100.628 1.00 27.68  ? 43  LYS H N     1 
ATOM 5451  C CA    . LYS H 4 45  ? 135.868 148.372 99.410  1.00 27.68  ? 43  LYS H CA    1 
ATOM 5452  C C     . LYS H 4 45  ? 137.346 148.689 99.485  1.00 27.68  ? 43  LYS H C     1 
ATOM 5453  O O     . LYS H 4 45  ? 137.950 148.930 98.441  1.00 27.68  ? 43  LYS H O     1 
ATOM 5454  C CB    . LYS H 4 45  ? 135.086 149.624 99.051  1.00 27.68  ? 43  LYS H CB    1 
ATOM 5455  C CG    . LYS H 4 45  ? 133.776 149.296 98.394  1.00 27.68  ? 43  LYS H CG    1 
ATOM 5456  C CD    . LYS H 4 45  ? 133.978 148.403 97.189  1.00 27.68  ? 43  LYS H CD    1 
ATOM 5457  C CE    . LYS H 4 45  ? 132.661 148.035 96.579  1.00 27.68  ? 43  LYS H CE    1 
ATOM 5458  N NZ    . LYS H 4 45  ? 132.791 147.263 95.326  1.00 27.68  ? 43  LYS H NZ    1 
ATOM 5459  N N     . GLN H 4 46  ? 137.946 148.713 100.667 1.00 26.75  ? 44  GLN H N     1 
ATOM 5460  C CA    . GLN H 4 46  ? 139.398 148.786 100.690 1.00 26.75  ? 44  GLN H CA    1 
ATOM 5461  C C     . GLN H 4 46  ? 140.061 147.421 100.783 1.00 26.75  ? 44  GLN H C     1 
ATOM 5462  O O     . GLN H 4 46  ? 141.263 147.320 100.529 1.00 26.75  ? 44  GLN H O     1 
ATOM 5463  C CB    . GLN H 4 46  ? 139.887 149.672 101.836 1.00 26.75  ? 44  GLN H CB    1 
ATOM 5464  C CG    . GLN H 4 46  ? 139.945 149.012 103.169 1.00 26.75  ? 44  GLN H CG    1 
ATOM 5465  C CD    . GLN H 4 46  ? 140.354 149.974 104.251 1.00 26.75  ? 44  GLN H CD    1 
ATOM 5466  O OE1   . GLN H 4 46  ? 140.553 151.156 103.996 1.00 26.75  ? 44  GLN H OE1   1 
ATOM 5467  N NE2   . GLN H 4 46  ? 140.489 149.472 105.469 1.00 26.75  ? 44  GLN H NE2   1 
ATOM 5468  N N     . VAL H 4 47  ? 139.314 146.374 101.121 1.00 28.44  ? 45  VAL H N     1 
ATOM 5469  C CA    . VAL H 4 47  ? 139.874 145.023 101.126 1.00 28.44  ? 45  VAL H CA    1 
ATOM 5470  C C     . VAL H 4 47  ? 139.712 144.358 99.763  1.00 28.44  ? 45  VAL H C     1 
ATOM 5471  O O     . VAL H 4 47  ? 140.678 143.857 99.178  1.00 28.44  ? 45  VAL H O     1 
ATOM 5472  C CB    . VAL H 4 47  ? 139.229 144.192 102.249 1.00 28.44  ? 45  VAL H CB    1 
ATOM 5473  C CG1   . VAL H 4 47  ? 139.502 142.771 102.047 1.00 28.44  ? 45  VAL H CG1   1 
ATOM 5474  C CG2   . VAL H 4 47  ? 139.814 144.597 103.582 1.00 28.44  ? 45  VAL H CG2   1 
ATOM 5475  N N     . HIS H 4 48  ? 138.493 144.333 99.244  1.00 29.03  ? 46  HIS H N     1 
ATOM 5476  C CA    . HIS H 4 48  ? 138.161 143.790 97.933  1.00 29.03  ? 46  HIS H CA    1 
ATOM 5477  C C     . HIS H 4 48  ? 137.531 144.907 97.127  1.00 29.03  ? 46  HIS H C     1 
ATOM 5478  O O     . HIS H 4 48  ? 136.321 145.141 97.243  1.00 29.03  ? 46  HIS H O     1 
ATOM 5479  C CB    . HIS H 4 48  ? 137.183 142.623 98.058  1.00 29.03  ? 46  HIS H CB    1 
ATOM 5480  C CG    . HIS H 4 48  ? 137.820 141.324 98.407  1.00 29.03  ? 46  HIS H CG    1 
ATOM 5481  N ND1   . HIS H 4 48  ? 138.575 140.603 97.512  1.00 29.03  ? 46  HIS H ND1   1 
ATOM 5482  C CD2   . HIS H 4 48  ? 137.807 140.606 99.551  1.00 29.03  ? 46  HIS H CD2   1 
ATOM 5483  C CE1   . HIS H 4 48  ? 139.012 139.503 98.094  1.00 29.03  ? 46  HIS H CE1   1 
ATOM 5484  N NE2   . HIS H 4 48  ? 138.561 139.482 99.333  1.00 29.03  ? 46  HIS H NE2   1 
ATOM 5485  N N     . PRO H 4 49  ? 138.292 145.625 96.297  1.00 30.83  ? 47  PRO H N     1 
ATOM 5486  C CA    . PRO H 4 49  ? 137.762 146.846 95.675  1.00 30.83  ? 47  PRO H CA    1 
ATOM 5487  C C     . PRO H 4 49  ? 136.716 146.611 94.601  1.00 30.83  ? 47  PRO H C     1 
ATOM 5488  O O     . PRO H 4 49  ? 136.050 147.570 94.200  1.00 30.83  ? 47  PRO H O     1 
ATOM 5489  C CB    . PRO H 4 49  ? 139.010 147.503 95.089  1.00 30.83  ? 47  PRO H CB    1 
ATOM 5490  C CG    . PRO H 4 49  ? 140.143 146.885 95.820  1.00 30.83  ? 47  PRO H CG    1 
ATOM 5491  C CD    . PRO H 4 49  ? 139.739 145.493 96.084  1.00 30.83  ? 47  PRO H CD    1 
ATOM 5492  N N     . ASP H 4 50  ? 136.534 145.383 94.136  1.00 34.47  ? 48  ASP H N     1 
ATOM 5493  C CA    . ASP H 4 50  ? 135.567 145.092 93.093  1.00 34.47  ? 48  ASP H CA    1 
ATOM 5494  C C     . ASP H 4 50  ? 134.480 144.125 93.531  1.00 34.47  ? 48  ASP H C     1 
ATOM 5495  O O     . ASP H 4 50  ? 133.620 143.776 92.717  1.00 34.47  ? 48  ASP H O     1 
ATOM 5496  C CB    . ASP H 4 50  ? 136.288 144.534 91.865  1.00 34.47  ? 48  ASP H CB    1 
ATOM 5497  C CG    . ASP H 4 50  ? 137.264 143.436 92.222  1.00 34.47  ? 48  ASP H CG    1 
ATOM 5498  O OD1   . ASP H 4 50  ? 137.742 142.739 91.303  1.00 34.47  ? 48  ASP H OD1   1 
ATOM 5499  O OD2   . ASP H 4 50  ? 137.562 143.273 93.422  1.00 34.47  ? 48  ASP H OD2   1 
ATOM 5500  N N     . THR H 4 51  ? 134.490 143.688 94.784  1.00 30.73  ? 49  THR H N     1 
ATOM 5501  C CA    . THR H 4 51  ? 133.494 142.780 95.327  1.00 30.73  ? 49  THR H CA    1 
ATOM 5502  C C     . THR H 4 51  ? 132.473 143.590 96.112  1.00 30.73  ? 49  THR H C     1 
ATOM 5503  O O     . THR H 4 51  ? 132.844 144.474 96.885  1.00 30.73  ? 49  THR H O     1 
ATOM 5504  C CB    . THR H 4 51  ? 134.171 141.730 96.212  1.00 30.73  ? 49  THR H CB    1 
ATOM 5505  O OG1   . THR H 4 51  ? 134.886 140.802 95.391  1.00 30.73  ? 49  THR H OG1   1 
ATOM 5506  C CG2   . THR H 4 51  ? 133.198 140.964 97.064  1.00 30.73  ? 49  THR H CG2   1 
ATOM 5507  N N     . GLY H 4 52  ? 131.196 143.321 95.880  1.00 28.46  ? 50  GLY H N     1 
ATOM 5508  C CA    . GLY H 4 52  ? 130.131 143.918 96.647  1.00 28.46  ? 50  GLY H CA    1 
ATOM 5509  C C     . GLY H 4 52  ? 129.550 142.954 97.649  1.00 28.46  ? 50  GLY H C     1 
ATOM 5510  O O     . GLY H 4 52  ? 130.089 141.878 97.899  1.00 28.46  ? 50  GLY H O     1 
ATOM 5511  N N     . ILE H 4 53  ? 128.421 143.342 98.227  1.00 25.66  ? 51  ILE H N     1 
ATOM 5512  C CA    . ILE H 4 53  ? 127.807 142.567 99.293  1.00 25.66  ? 51  ILE H CA    1 
ATOM 5513  C C     . ILE H 4 53  ? 126.300 142.590 99.092  1.00 25.66  ? 51  ILE H C     1 
ATOM 5514  O O     . ILE H 4 53  ? 125.758 143.476 98.433  1.00 25.66  ? 51  ILE H O     1 
ATOM 5515  C CB    . ILE H 4 53  ? 128.233 143.106 100.679 1.00 25.66  ? 51  ILE H CB    1 
ATOM 5516  C CG1   . ILE H 4 53  ? 128.156 142.022 101.749 1.00 25.66  ? 51  ILE H CG1   1 
ATOM 5517  C CG2   . ILE H 4 53  ? 127.417 144.291 101.069 1.00 25.66  ? 51  ILE H CG2   1 
ATOM 5518  C CD1   . ILE H 4 53  ? 128.870 142.361 103.011 1.00 25.66  ? 51  ILE H CD1   1 
ATOM 5519  N N     . SER H 4 54  ? 125.629 141.577 99.617  1.00 25.33  ? 52  SER H N     1 
ATOM 5520  C CA    . SER H 4 54  ? 124.180 141.491 99.563  1.00 25.33  ? 52  SER H CA    1 
ATOM 5521  C C     . SER H 4 54  ? 123.593 142.148 100.806 1.00 25.33  ? 52  SER H C     1 
ATOM 5522  O O     . SER H 4 54  ? 124.300 142.474 101.759 1.00 25.33  ? 52  SER H O     1 
ATOM 5523  C CB    . SER H 4 54  ? 123.754 140.039 99.433  1.00 25.33  ? 52  SER H CB    1 
ATOM 5524  O OG    . SER H 4 54  ? 122.349 139.928 99.428  1.00 25.33  ? 52  SER H OG    1 
ATOM 5525  N N     . SER H 4 55  ? 122.281 142.337 100.827 1.00 24.42  ? 53  SER H N     1 
ATOM 5526  C CA    . SER H 4 55  ? 121.632 142.928 101.986 1.00 24.42  ? 53  SER H CA    1 
ATOM 5527  C C     . SER H 4 55  ? 121.578 141.999 103.184 1.00 24.42  ? 53  SER H C     1 
ATOM 5528  O O     . SER H 4 55  ? 121.776 142.460 104.311 1.00 24.42  ? 53  SER H O     1 
ATOM 5529  C CB    . SER H 4 55  ? 120.213 143.357 101.639 1.00 24.42  ? 53  SER H CB    1 
ATOM 5530  O OG    . SER H 4 55  ? 119.582 143.905 102.773 1.00 24.42  ? 53  SER H OG    1 
ATOM 5531  N N     . LYS H 4 56  ? 121.340 140.706 102.968 1.00 21.96  ? 54  LYS H N     1 
ATOM 5532  C CA    . LYS H 4 56  ? 121.360 139.745 104.060 1.00 21.96  ? 54  LYS H CA    1 
ATOM 5533  C C     . LYS H 4 56  ? 122.757 139.565 104.617 1.00 21.96  ? 54  LYS H C     1 
ATOM 5534  O O     . LYS H 4 56  ? 122.927 139.415 105.829 1.00 21.96  ? 54  LYS H O     1 
ATOM 5535  C CB    . LYS H 4 56  ? 120.810 138.407 103.591 1.00 21.96  ? 54  LYS H CB    1 
ATOM 5536  C CG    . LYS H 4 56  ? 119.329 138.415 103.273 1.00 21.96  ? 54  LYS H CG    1 
ATOM 5537  C CD    . LYS H 4 56  ? 118.507 138.557 104.533 1.00 21.96  ? 54  LYS H CD    1 
ATOM 5538  C CE    . LYS H 4 56  ? 118.703 137.360 105.449 1.00 21.96  ? 54  LYS H CE    1 
ATOM 5539  N NZ    . LYS H 4 56  ? 117.775 137.383 106.608 1.00 21.96  ? 54  LYS H NZ    1 
ATOM 5540  N N     . ALA H 4 57  ? 123.770 139.599 103.757 1.00 19.38  ? 55  ALA H N     1 
ATOM 5541  C CA    . ALA H 4 57  ? 125.142 139.511 104.233 1.00 19.38  ? 55  ALA H CA    1 
ATOM 5542  C C     . ALA H 4 57  ? 125.563 140.776 104.959 1.00 19.38  ? 55  ALA H C     1 
ATOM 5543  O O     . ALA H 4 57  ? 126.334 140.708 105.918 1.00 19.38  ? 55  ALA H O     1 
ATOM 5544  C CB    . ALA H 4 57  ? 126.076 139.229 103.071 1.00 19.38  ? 55  ALA H CB    1 
ATOM 5545  N N     . MET H 4 58  ? 125.057 141.932 104.537 1.00 21.86  ? 56  MET H N     1 
ATOM 5546  C CA    . MET H 4 58  ? 125.345 143.162 105.260 1.00 21.86  ? 56  MET H CA    1 
ATOM 5547  C C     . MET H 4 58  ? 124.660 143.171 106.617 1.00 21.86  ? 56  MET H C     1 
ATOM 5548  O O     . MET H 4 58  ? 125.219 143.672 107.595 1.00 21.86  ? 56  MET H O     1 
ATOM 5549  C CB    . MET H 4 58  ? 124.926 144.362 104.420 1.00 21.86  ? 56  MET H CB    1 
ATOM 5550  C CG    . MET H 4 58  ? 125.325 145.691 104.992 1.00 21.86  ? 56  MET H CG    1 
ATOM 5551  S SD    . MET H 4 58  ? 126.989 145.688 105.641 1.00 21.86  ? 56  MET H SD    1 
ATOM 5552  C CE    . MET H 4 58  ? 127.876 146.200 104.192 1.00 21.86  ? 56  MET H CE    1 
ATOM 5553  N N     . SER H 4 59  ? 123.472 142.577 106.706 1.00 20.17  ? 57  SER H N     1 
ATOM 5554  C CA    . SER H 4 59  ? 122.808 142.426 107.993 1.00 20.17  ? 57  SER H CA    1 
ATOM 5555  C C     . SER H 4 59  ? 123.544 141.460 108.912 1.00 20.17  ? 57  SER H C     1 
ATOM 5556  O O     . SER H 4 59  ? 123.624 141.700 110.118 1.00 20.17  ? 57  SER H O     1 
ATOM 5557  C CB    . SER H 4 59  ? 121.380 141.954 107.777 1.00 20.17  ? 57  SER H CB    1 
ATOM 5558  O OG    . SER H 4 59  ? 120.716 141.821 109.011 1.00 20.17  ? 57  SER H OG    1 
ATOM 5559  N N     . ILE H 4 60  ? 124.096 140.382 108.361 1.00 17.86  ? 58  ILE H N     1 
ATOM 5560  C CA    . ILE H 4 60  ? 124.880 139.435 109.147 1.00 17.86  ? 58  ILE H CA    1 
ATOM 5561  C C     . ILE H 4 60  ? 126.163 140.074 109.645 1.00 17.86  ? 58  ILE H C     1 
ATOM 5562  O O     . ILE H 4 60  ? 126.563 139.874 110.795 1.00 17.86  ? 58  ILE H O     1 
ATOM 5563  C CB    . ILE H 4 60  ? 125.151 138.179 108.306 1.00 17.86  ? 58  ILE H CB    1 
ATOM 5564  C CG1   . ILE H 4 60  ? 123.884 137.363 108.210 1.00 17.86  ? 58  ILE H CG1   1 
ATOM 5565  C CG2   . ILE H 4 60  ? 126.223 137.318 108.895 1.00 17.86  ? 58  ILE H CG2   1 
ATOM 5566  C CD1   . ILE H 4 60  ? 123.920 136.392 107.170 1.00 17.86  ? 58  ILE H CD1   1 
ATOM 5567  N N     . MET H 4 61  ? 126.806 140.892 108.812 1.00 17.13  ? 59  MET H N     1 
ATOM 5568  C CA    . MET H 4 61  ? 128.025 141.573 109.239 1.00 17.13  ? 59  MET H CA    1 
ATOM 5569  C C     . MET H 4 61  ? 127.741 142.657 110.264 1.00 17.13  ? 59  MET H C     1 
ATOM 5570  O O     . MET H 4 61  ? 128.555 142.887 111.163 1.00 17.13  ? 59  MET H O     1 
ATOM 5571  C CB    . MET H 4 61  ? 128.743 142.154 108.033 1.00 17.13  ? 59  MET H CB    1 
ATOM 5572  C CG    . MET H 4 61  ? 129.468 141.131 107.211 1.00 17.13  ? 59  MET H CG    1 
ATOM 5573  S SD    . MET H 4 61  ? 130.870 140.413 108.061 1.00 17.13  ? 59  MET H SD    1 
ATOM 5574  C CE    . MET H 4 61  ? 131.701 141.872 108.645 1.00 17.13  ? 59  MET H CE    1 
ATOM 5575  N N     . ASN H 4 62  ? 126.580 143.301 110.172 1.00 16.47  ? 60  ASN H N     1 
ATOM 5576  C CA    . ASN H 4 62  ? 126.168 144.268 111.181 1.00 16.47  ? 60  ASN H CA    1 
ATOM 5577  C C     . ASN H 4 62  ? 125.905 143.591 112.520 1.00 16.47  ? 60  ASN H C     1 
ATOM 5578  O O     . ASN H 4 62  ? 126.324 144.090 113.573 1.00 16.47  ? 60  ASN H O     1 
ATOM 5579  C CB    . ASN H 4 62  ? 124.933 145.006 110.677 1.00 16.47  ? 60  ASN H CB    1 
ATOM 5580  C CG    . ASN H 4 62  ? 124.554 146.164 111.535 1.00 16.47  ? 60  ASN H CG    1 
ATOM 5581  O OD1   . ASN H 4 62  ? 125.400 146.819 112.118 1.00 16.47  ? 60  ASN H OD1   1 
ATOM 5582  N ND2   . ASN H 4 62  ? 123.270 146.427 111.623 1.00 16.47  ? 60  ASN H ND2   1 
ATOM 5583  N N     . SER H 4 63  ? 125.237 142.433 112.491 1.00 16.69  ? 61  SER H N     1 
ATOM 5584  C CA    . SER H 4 63  ? 125.026 141.639 113.701 1.00 16.69  ? 61  SER H CA    1 
ATOM 5585  C C     . SER H 4 63  ? 126.341 141.166 114.300 1.00 16.69  ? 61  SER H C     1 
ATOM 5586  O O     . SER H 4 63  ? 126.497 141.150 115.520 1.00 16.69  ? 61  SER H O     1 
ATOM 5587  C CB    . SER H 4 63  ? 124.142 140.439 113.393 1.00 16.69  ? 61  SER H CB    1 
ATOM 5588  O OG    . SER H 4 63  ? 122.882 140.833 112.907 1.00 16.69  ? 61  SER H OG    1 
ATOM 5589  N N     . PHE H 4 64  ? 127.304 140.816 113.452 1.00 14.06  ? 62  PHE H N     1 
ATOM 5590  C CA    . PHE H 4 64  ? 128.609 140.364 113.912 1.00 14.06  ? 62  PHE H CA    1 
ATOM 5591  C C     . PHE H 4 64  ? 129.386 141.479 114.599 1.00 14.06  ? 62  PHE H C     1 
ATOM 5592  O O     . PHE H 4 64  ? 130.002 141.258 115.649 1.00 14.06  ? 62  PHE H O     1 
ATOM 5593  C CB    . PHE H 4 64  ? 129.386 139.809 112.721 1.00 14.06  ? 62  PHE H CB    1 
ATOM 5594  C CG    . PHE H 4 64  ? 130.817 139.495 113.011 1.00 14.06  ? 62  PHE H CG    1 
ATOM 5595  C CD1   . PHE H 4 64  ? 131.154 138.554 113.952 1.00 14.06  ? 62  PHE H CD1   1 
ATOM 5596  C CD2   . PHE H 4 64  ? 131.826 140.131 112.323 1.00 14.06  ? 62  PHE H CD2   1 
ATOM 5597  C CE1   . PHE H 4 64  ? 132.464 138.268 114.211 1.00 14.06  ? 62  PHE H CE1   1 
ATOM 5598  C CE2   . PHE H 4 64  ? 133.127 139.848 112.585 1.00 14.06  ? 62  PHE H CE2   1 
ATOM 5599  C CZ    . PHE H 4 64  ? 133.446 138.912 113.528 1.00 14.06  ? 62  PHE H CZ    1 
ATOM 5600  N N     . VAL H 4 65  ? 129.353 142.685 114.033 1.00 16.18  ? 63  VAL H N     1 
ATOM 5601  C CA    . VAL H 4 65  ? 130.091 143.804 114.611 1.00 16.18  ? 63  VAL H CA    1 
ATOM 5602  C C     . VAL H 4 65  ? 129.460 144.249 115.928 1.00 16.18  ? 63  VAL H C     1 
ATOM 5603  O O     . VAL H 4 65  ? 130.166 144.510 116.912 1.00 16.18  ? 63  VAL H O     1 
ATOM 5604  C CB    . VAL H 4 65  ? 130.183 144.941 113.580 1.00 16.18  ? 63  VAL H CB    1 
ATOM 5605  C CG1   . VAL H 4 65  ? 130.634 146.197 114.202 1.00 16.18  ? 63  VAL H CG1   1 
ATOM 5606  C CG2   . VAL H 4 65  ? 131.151 144.571 112.500 1.00 16.18  ? 63  VAL H CG2   1 
ATOM 5607  N N     . ASN H 4 66  ? 128.125 144.282 115.988 1.00 18.57  ? 64  ASN H N     1 
ATOM 5608  C CA    . ASN H 4 66  ? 127.435 144.573 117.243 1.00 18.57  ? 64  ASN H CA    1 
ATOM 5609  C C     . ASN H 4 66  ? 127.708 143.511 118.299 1.00 18.57  ? 64  ASN H C     1 
ATOM 5610  O O     . ASN H 4 66  ? 127.843 143.825 119.486 1.00 18.57  ? 64  ASN H O     1 
ATOM 5611  C CB    . ASN H 4 66  ? 125.939 144.675 116.988 1.00 18.57  ? 64  ASN H CB    1 
ATOM 5612  C CG    . ASN H 4 66  ? 125.496 146.073 116.726 1.00 18.57  ? 64  ASN H CG    1 
ATOM 5613  O OD1   . ASN H 4 66  ? 125.657 146.947 117.567 1.00 18.57  ? 64  ASN H OD1   1 
ATOM 5614  N ND2   . ASN H 4 66  ? 124.936 146.305 115.558 1.00 18.57  ? 64  ASN H ND2   1 
ATOM 5615  N N     . ASP H 4 67  ? 127.826 142.255 117.873 1.00 18.32  ? 65  ASP H N     1 
ATOM 5616  C CA    . ASP H 4 67  ? 128.084 141.146 118.778 1.00 18.32  ? 65  ASP H CA    1 
ATOM 5617  C C     . ASP H 4 67  ? 129.456 141.248 119.413 1.00 18.32  ? 65  ASP H C     1 
ATOM 5618  O O     . ASP H 4 67  ? 129.599 141.090 120.628 1.00 18.32  ? 65  ASP H O     1 
ATOM 5619  C CB    . ASP H 4 67  ? 127.962 139.846 118.003 1.00 18.32  ? 65  ASP H CB    1 
ATOM 5620  C CG    . ASP H 4 67  ? 127.698 138.666 118.881 1.00 18.32  ? 65  ASP H CG    1 
ATOM 5621  O OD1   . ASP H 4 67  ? 127.038 138.830 119.923 1.00 18.32  ? 65  ASP H OD1   1 
ATOM 5622  O OD2   . ASP H 4 67  ? 128.143 137.562 118.520 1.00 18.32  ? 65  ASP H OD2   1 
ATOM 5623  N N     . ILE H 4 68  ? 130.485 141.511 118.610 1.00 14.86  ? 66  ILE H N     1 
ATOM 5624  C CA    . ILE H 4 68  ? 131.817 141.575 119.194 1.00 14.86  ? 66  ILE H CA    1 
ATOM 5625  C C     . ILE H 4 68  ? 132.005 142.852 119.995 1.00 14.86  ? 66  ILE H C     1 
ATOM 5626  O O     . ILE H 4 68  ? 132.766 142.857 120.971 1.00 14.86  ? 66  ILE H O     1 
ATOM 5627  C CB    . ILE H 4 68  ? 132.909 141.403 118.125 1.00 14.86  ? 66  ILE H CB    1 
ATOM 5628  C CG1   . ILE H 4 68  ? 132.769 142.454 117.034 1.00 14.86  ? 66  ILE H CG1   1 
ATOM 5629  C CG2   . ILE H 4 68  ? 132.865 140.003 117.557 1.00 14.86  ? 66  ILE H CG2   1 
ATOM 5630  C CD1   . ILE H 4 68  ? 133.817 142.387 115.973 1.00 14.86  ? 66  ILE H CD1   1 
ATOM 5631  N N     . PHE H 4 69  ? 131.299 143.935 119.642 1.00 14.81  ? 67  PHE H N     1 
ATOM 5632  C CA    . PHE H 4 69  ? 131.285 145.123 120.492 1.00 14.81  ? 67  PHE H CA    1 
ATOM 5633  C C     . PHE H 4 69  ? 130.726 144.802 121.865 1.00 14.81  ? 67  PHE H C     1 
ATOM 5634  O O     . PHE H 4 69  ? 131.321 145.158 122.884 1.00 14.81  ? 67  PHE H O     1 
ATOM 5635  C CB    . PHE H 4 69  ? 130.464 146.236 119.840 1.00 14.81  ? 67  PHE H CB    1 
ATOM 5636  C CG    . PHE H 4 69  ? 130.248 147.437 120.725 1.00 14.81  ? 67  PHE H CG    1 
ATOM 5637  C CD1   . PHE H 4 69  ? 131.227 148.391 120.857 1.00 14.81  ? 67  PHE H CD1   1 
ATOM 5638  C CD2   . PHE H 4 69  ? 129.059 147.621 121.410 1.00 14.81  ? 67  PHE H CD2   1 
ATOM 5639  C CE1   . PHE H 4 69  ? 131.038 149.479 121.656 1.00 14.81  ? 67  PHE H CE1   1 
ATOM 5640  C CE2   . PHE H 4 69  ? 128.882 148.708 122.222 1.00 14.81  ? 67  PHE H CE2   1 
ATOM 5641  C CZ    . PHE H 4 69  ? 129.874 149.634 122.337 1.00 14.81  ? 67  PHE H CZ    1 
ATOM 5642  N N     . GLU H 4 70  ? 129.577 144.127 121.908 1.00 15.80  ? 68  GLU H N     1 
ATOM 5643  C CA    . GLU H 4 70  ? 128.945 143.782 123.169 1.00 15.80  ? 68  GLU H CA    1 
ATOM 5644  C C     . GLU H 4 70  ? 129.727 142.764 123.978 1.00 15.80  ? 68  GLU H C     1 
ATOM 5645  O O     . GLU H 4 70  ? 129.611 142.768 125.200 1.00 15.80  ? 68  GLU H O     1 
ATOM 5646  C CB    . GLU H 4 70  ? 127.546 143.255 122.912 1.00 15.80  ? 68  GLU H CB    1 
ATOM 5647  C CG    . GLU H 4 70  ? 126.500 144.332 122.914 1.00 15.80  ? 68  GLU H CG    1 
ATOM 5648  C CD    . GLU H 4 70  ? 125.374 144.055 121.947 1.00 15.80  ? 68  GLU H CD    1 
ATOM 5649  O OE1   . GLU H 4 70  ? 125.069 142.867 121.708 1.00 15.80  ? 68  GLU H OE1   1 
ATOM 5650  O OE2   . GLU H 4 70  ? 124.791 145.030 121.427 1.00 15.80  ? 68  GLU H OE2   1 
ATOM 5651  N N     . ARG H 4 71  ? 130.502 141.894 123.346 1.00 14.20  ? 69  ARG H N     1 
ATOM 5652  C CA    . ARG H 4 71  ? 131.322 140.971 124.119 1.00 14.20  ? 69  ARG H CA    1 
ATOM 5653  C C     . ARG H 4 71  ? 132.522 141.671 124.730 1.00 14.20  ? 69  ARG H C     1 
ATOM 5654  O O     . ARG H 4 71  ? 132.825 141.470 125.911 1.00 14.20  ? 69  ARG H O     1 
ATOM 5655  C CB    . ARG H 4 71  ? 131.806 139.824 123.252 1.00 14.20  ? 69  ARG H CB    1 
ATOM 5656  C CG    . ARG H 4 71  ? 130.757 138.910 122.739 1.00 14.20  ? 69  ARG H CG    1 
ATOM 5657  C CD    . ARG H 4 71  ? 131.437 137.816 121.981 1.00 14.20  ? 69  ARG H CD    1 
ATOM 5658  N NE    . ARG H 4 71  ? 130.516 136.996 121.217 1.00 14.20  ? 69  ARG H NE    1 
ATOM 5659  C CZ    . ARG H 4 71  ? 130.898 135.976 120.465 1.00 14.20  ? 69  ARG H CZ    1 
ATOM 5660  N NH1   . ARG H 4 71  ? 132.171 135.644 120.404 1.00 14.20  ? 69  ARG H NH1   1 
ATOM 5661  N NH2   . ARG H 4 71  ? 130.004 135.279 119.790 1.00 14.20  ? 69  ARG H NH2   1 
ATOM 5662  N N     . ILE H 4 72  ? 133.225 142.485 123.937 1.00 13.24  ? 70  ILE H N     1 
ATOM 5663  C CA    . ILE H 4 72  ? 134.428 143.144 124.438 1.00 13.24  ? 70  ILE H CA    1 
ATOM 5664  C C     . ILE H 4 72  ? 134.076 144.195 125.479 1.00 13.24  ? 70  ILE H C     1 
ATOM 5665  O O     . ILE H 4 72  ? 134.764 144.330 126.493 1.00 13.24  ? 70  ILE H O     1 
ATOM 5666  C CB    . ILE H 4 72  ? 135.234 143.726 123.266 1.00 13.24  ? 70  ILE H CB    1 
ATOM 5667  C CG1   . ILE H 4 72  ? 135.707 142.600 122.367 1.00 13.24  ? 70  ILE H CG1   1 
ATOM 5668  C CG2   . ILE H 4 72  ? 136.454 144.459 123.744 1.00 13.24  ? 70  ILE H CG2   1 
ATOM 5669  C CD1   . ILE H 4 72  ? 136.139 143.064 121.031 1.00 13.24  ? 70  ILE H CD1   1 
ATOM 5670  N N     . ALA H 4 73  ? 132.963 144.903 125.290 1.00 14.44  ? 71  ALA H N     1 
ATOM 5671  C CA    . ALA H 4 73  ? 132.567 145.926 126.245 1.00 14.44  ? 71  ALA H CA    1 
ATOM 5672  C C     . ALA H 4 73  ? 132.103 145.318 127.559 1.00 14.44  ? 71  ALA H C     1 
ATOM 5673  O O     . ALA H 4 73  ? 132.362 145.876 128.626 1.00 14.44  ? 71  ALA H O     1 
ATOM 5674  C CB    . ALA H 4 73  ? 131.478 146.796 125.635 1.00 14.44  ? 71  ALA H CB    1 
ATOM 5675  N N     . ALA H 4 74  ? 131.465 144.152 127.513 1.00 14.51  ? 72  ALA H N     1 
ATOM 5676  C CA    . ALA H 4 74  ? 131.014 143.515 128.744 1.00 14.51  ? 72  ALA H CA    1 
ATOM 5677  C C     . ALA H 4 74  ? 132.170 142.881 129.501 1.00 14.51  ? 72  ALA H C     1 
ATOM 5678  O O     . ALA H 4 74  ? 132.202 142.922 130.735 1.00 14.51  ? 72  ALA H O     1 
ATOM 5679  C CB    . ALA H 4 74  ? 129.942 142.481 128.441 1.00 14.51  ? 72  ALA H CB    1 
ATOM 5680  N N     . GLU H 4 75  ? 133.139 142.307 128.790 1.00 15.71  ? 73  GLU H N     1 
ATOM 5681  C CA    . GLU H 4 75  ? 134.316 141.792 129.479 1.00 15.71  ? 73  GLU H CA    1 
ATOM 5682  C C     . GLU H 4 75  ? 135.171 142.913 130.049 1.00 15.71  ? 73  GLU H C     1 
ATOM 5683  O O     . GLU H 4 75  ? 135.742 142.758 131.131 1.00 15.71  ? 73  GLU H O     1 
ATOM 5684  C CB    . GLU H 4 75  ? 135.130 140.918 128.538 1.00 15.71  ? 73  GLU H CB    1 
ATOM 5685  C CG    . GLU H 4 75  ? 136.224 140.107 129.206 1.00 15.71  ? 73  GLU H CG    1 
ATOM 5686  C CD    . GLU H 4 75  ? 135.707 139.162 130.275 1.00 15.71  ? 73  GLU H CD    1 
ATOM 5687  O OE1   . GLU H 4 75  ? 134.791 138.364 129.980 1.00 15.71  ? 73  GLU H OE1   1 
ATOM 5688  O OE2   . GLU H 4 75  ? 136.220 139.213 131.417 1.00 15.71  ? 73  GLU H OE2   1 
ATOM 5689  N N     . ALA H 4 76  ? 135.244 144.058 129.369 1.00 13.90  ? 74  ALA H N     1 
ATOM 5690  C CA    . ALA H 4 76  ? 135.960 145.202 129.915 1.00 13.90  ? 74  ALA H CA    1 
ATOM 5691  C C     . ALA H 4 76  ? 135.239 145.787 131.117 1.00 13.90  ? 74  ALA H C     1 
ATOM 5692  O O     . ALA H 4 76  ? 135.880 146.240 132.069 1.00 13.90  ? 74  ALA H O     1 
ATOM 5693  C CB    . ALA H 4 76  ? 136.138 146.258 128.835 1.00 13.90  ? 74  ALA H CB    1 
ATOM 5694  N N     . SER H 4 77  ? 133.905 145.778 131.088 1.00 15.20  ? 75  SER H N     1 
ATOM 5695  C CA    . SER H 4 77  ? 133.099 146.199 132.225 1.00 15.20  ? 75  SER H CA    1 
ATOM 5696  C C     . SER H 4 77  ? 133.336 145.326 133.440 1.00 15.20  ? 75  SER H C     1 
ATOM 5697  O O     . SER H 4 77  ? 133.471 145.837 134.557 1.00 15.20  ? 75  SER H O     1 
ATOM 5698  C CB    . SER H 4 77  ? 131.632 146.155 131.835 1.00 15.20  ? 75  SER H CB    1 
ATOM 5699  O OG    . SER H 4 77  ? 130.844 146.899 132.736 1.00 15.20  ? 75  SER H OG    1 
ATOM 5700  N N     . ARG H 4 78  ? 133.410 144.012 133.240 1.00 15.57  ? 76  ARG H N     1 
ATOM 5701  C CA    . ARG H 4 78  ? 133.733 143.103 134.332 1.00 15.57  ? 76  ARG H CA    1 
ATOM 5702  C C     . ARG H 4 78  ? 135.154 143.283 134.835 1.00 15.57  ? 76  ARG H C     1 
ATOM 5703  O O     . ARG H 4 78  ? 135.388 143.176 136.033 1.00 15.57  ? 76  ARG H O     1 
ATOM 5704  C CB    . ARG H 4 78  ? 133.529 141.664 133.903 1.00 15.57  ? 76  ARG H CB    1 
ATOM 5705  C CG    . ARG H 4 78  ? 132.100 141.285 133.741 1.00 15.57  ? 76  ARG H CG    1 
ATOM 5706  C CD    . ARG H 4 78  ? 131.975 139.832 133.403 1.00 15.57  ? 76  ARG H CD    1 
ATOM 5707  N NE    . ARG H 4 78  ? 130.947 139.630 132.395 1.00 15.57  ? 76  ARG H NE    1 
ATOM 5708  C CZ    . ARG H 4 78  ? 131.185 139.194 131.167 1.00 15.57  ? 76  ARG H CZ    1 
ATOM 5709  N NH1   . ARG H 4 78  ? 132.421 138.895 130.797 1.00 15.57  ? 76  ARG H NH1   1 
ATOM 5710  N NH2   . ARG H 4 78  ? 130.182 139.049 130.315 1.00 15.57  ? 76  ARG H NH2   1 
ATOM 5711  N N     . LEU H 4 79  ? 136.116 143.535 133.951 1.00 14.05  ? 77  LEU H N     1 
ATOM 5712  C CA    . LEU H 4 79  ? 137.490 143.745 134.405 1.00 14.05  ? 77  LEU H CA    1 
ATOM 5713  C C     . LEU H 4 79  ? 137.637 145.025 135.196 1.00 14.05  ? 77  LEU H C     1 
ATOM 5714  O O     . LEU H 4 79  ? 138.457 145.093 136.112 1.00 14.05  ? 77  LEU H O     1 
ATOM 5715  C CB    . LEU H 4 79  ? 138.449 143.800 133.230 1.00 14.05  ? 77  LEU H CB    1 
ATOM 5716  C CG    . LEU H 4 79  ? 138.805 142.510 132.546 1.00 14.05  ? 77  LEU H CG    1 
ATOM 5717  C CD1   . LEU H 4 79  ? 139.114 142.861 131.142 1.00 14.05  ? 77  LEU H CD1   1 
ATOM 5718  C CD2   . LEU H 4 79  ? 139.985 141.901 133.222 1.00 14.05  ? 77  LEU H CD2   1 
ATOM 5719  N N     . ALA H 4 80  ? 136.889 146.061 134.831 1.00 16.98  ? 78  ALA H N     1 
ATOM 5720  C CA    . ALA H 4 80  ? 136.889 147.274 135.631 1.00 16.98  ? 78  ALA H CA    1 
ATOM 5721  C C     . ALA H 4 80  ? 136.210 147.051 136.969 1.00 16.98  ? 78  ALA H C     1 
ATOM 5722  O O     . ALA H 4 80  ? 136.660 147.586 137.981 1.00 16.98  ? 78  ALA H O     1 
ATOM 5723  C CB    . ALA H 4 80  ? 136.206 148.403 134.871 1.00 16.98  ? 78  ALA H CB    1 
ATOM 5724  N N     . HIS H 4 81  ? 135.142 146.259 137.000 1.00 18.70  ? 79  HIS H N     1 
ATOM 5725  C CA    . HIS H 4 81  ? 134.452 145.979 138.252 1.00 18.70  ? 79  HIS H CA    1 
ATOM 5726  C C     . HIS H 4 81  ? 135.266 145.096 139.192 1.00 18.70  ? 79  HIS H C     1 
ATOM 5727  O O     . HIS H 4 81  ? 135.203 145.284 140.408 1.00 18.70  ? 79  HIS H O     1 
ATOM 5728  C CB    . HIS H 4 81  ? 133.102 145.333 137.945 1.00 18.70  ? 79  HIS H CB    1 
ATOM 5729  C CG    . HIS H 4 81  ? 132.336 144.915 139.156 1.00 18.70  ? 79  HIS H CG    1 
ATOM 5730  N ND1   . HIS H 4 81  ? 131.510 145.775 139.845 1.00 18.70  ? 79  HIS H ND1   1 
ATOM 5731  C CD2   . HIS H 4 81  ? 132.258 143.725 139.796 1.00 18.70  ? 79  HIS H CD2   1 
ATOM 5732  C CE1   . HIS H 4 81  ? 130.965 145.136 140.864 1.00 18.70  ? 79  HIS H CE1   1 
ATOM 5733  N NE2   . HIS H 4 81  ? 131.406 143.891 140.858 1.00 18.70  ? 79  HIS H NE2   1 
ATOM 5734  N N     . TYR H 4 82  ? 136.034 144.144 138.662 1.00 17.67  ? 80  TYR H N     1 
ATOM 5735  C CA    . TYR H 4 82  ? 136.788 143.227 139.507 1.00 17.67  ? 80  TYR H CA    1 
ATOM 5736  C C     . TYR H 4 82  ? 137.954 143.912 140.199 1.00 17.67  ? 80  TYR H C     1 
ATOM 5737  O O     . TYR H 4 82  ? 138.415 143.438 141.240 1.00 17.67  ? 80  TYR H O     1 
ATOM 5738  C CB    . TYR H 4 82  ? 137.337 142.063 138.690 1.00 17.67  ? 80  TYR H CB    1 
ATOM 5739  C CG    . TYR H 4 82  ? 136.325 141.119 138.095 1.00 17.67  ? 80  TYR H CG    1 
ATOM 5740  C CD1   . TYR H 4 82  ? 135.049 140.996 138.625 1.00 17.67  ? 80  TYR H CD1   1 
ATOM 5741  C CD2   . TYR H 4 82  ? 136.654 140.342 136.992 1.00 17.67  ? 80  TYR H CD2   1 
ATOM 5742  C CE1   . TYR H 4 82  ? 134.132 140.127 138.072 1.00 17.67  ? 80  TYR H CE1   1 
ATOM 5743  C CE2   . TYR H 4 82  ? 135.750 139.475 136.437 1.00 17.67  ? 80  TYR H CE2   1 
ATOM 5744  C CZ    . TYR H 4 82  ? 134.494 139.370 136.978 1.00 17.67  ? 80  TYR H CZ    1 
ATOM 5745  O OH    . TYR H 4 82  ? 133.594 138.499 136.414 1.00 17.67  ? 80  TYR H OH    1 
ATOM 5746  N N     . ASN H 4 83  ? 138.462 144.998 139.631 1.00 20.91  ? 81  ASN H N     1 
ATOM 5747  C CA    . ASN H 4 83  ? 139.627 145.688 140.157 1.00 20.91  ? 81  ASN H CA    1 
ATOM 5748  C C     . ASN H 4 83  ? 139.270 146.965 140.886 1.00 20.91  ? 81  ASN H C     1 
ATOM 5749  O O     . ASN H 4 83  ? 140.168 147.762 141.171 1.00 20.91  ? 81  ASN H O     1 
ATOM 5750  C CB    . ASN H 4 83  ? 140.603 145.995 139.033 1.00 20.91  ? 81  ASN H CB    1 
ATOM 5751  C CG    . ASN H 4 83  ? 141.111 144.757 138.370 1.00 20.91  ? 81  ASN H CG    1 
ATOM 5752  O OD1   . ASN H 4 83  ? 141.986 144.087 138.892 1.00 20.91  ? 81  ASN H OD1   1 
ATOM 5753  N ND2   . ASN H 4 83  ? 140.553 144.428 137.222 1.00 20.91  ? 81  ASN H ND2   1 
ATOM 5754  N N     . LYS H 4 84  ? 137.983 147.170 141.177 1.00 24.07  ? 82  LYS H N     1 
ATOM 5755  C CA    . LYS H 4 84  ? 137.447 148.341 141.875 1.00 24.07  ? 82  LYS H CA    1 
ATOM 5756  C C     . LYS H 4 84  ? 137.755 149.630 141.127 1.00 24.07  ? 82  LYS H C     1 
ATOM 5757  O O     . LYS H 4 84  ? 138.023 150.666 141.733 1.00 24.07  ? 82  LYS H O     1 
ATOM 5758  C CB    . LYS H 4 84  ? 137.939 148.423 143.327 1.00 24.07  ? 82  LYS H CB    1 
ATOM 5759  C CG    . LYS H 4 84  ? 137.172 147.554 144.304 1.00 24.07  ? 82  LYS H CG    1 
ATOM 5760  C CD    . LYS H 4 84  ? 137.711 146.149 144.320 1.00 24.07  ? 82  LYS H CD    1 
ATOM 5761  C CE    . LYS H 4 84  ? 136.788 145.215 145.054 1.00 24.07  ? 82  LYS H CE    1 
ATOM 5762  N NZ    . LYS H 4 84  ? 137.053 143.806 144.674 1.00 24.07  ? 82  LYS H NZ    1 
ATOM 5763  N N     . ARG H 4 85  ? 137.733 149.564 139.804 1.00 26.97  ? 83  ARG H N     1 
ATOM 5764  C CA    . ARG H 4 85  ? 137.935 150.712 138.943 1.00 26.97  ? 83  ARG H CA    1 
ATOM 5765  C C     . ARG H 4 85  ? 136.598 151.183 138.402 1.00 26.97  ? 83  ARG H C     1 
ATOM 5766  O O     . ARG H 4 85  ? 135.627 150.434 138.341 1.00 26.97  ? 83  ARG H O     1 
ATOM 5767  C CB    . ARG H 4 85  ? 138.868 150.361 137.795 1.00 26.97  ? 83  ARG H CB    1 
ATOM 5768  C CG    . ARG H 4 85  ? 140.248 149.981 138.216 1.00 26.97  ? 83  ARG H CG    1 
ATOM 5769  C CD    . ARG H 4 85  ? 141.095 151.201 138.343 1.00 26.97  ? 83  ARG H CD    1 
ATOM 5770  N NE    . ARG H 4 85  ? 142.507 150.881 138.450 1.00 26.97  ? 83  ARG H NE    1 
ATOM 5771  C CZ    . ARG H 4 85  ? 143.124 150.621 139.595 1.00 26.97  ? 83  ARG H CZ    1 
ATOM 5772  N NH1   . ARG H 4 85  ? 142.447 150.640 140.735 1.00 26.97  ? 83  ARG H NH1   1 
ATOM 5773  N NH2   . ARG H 4 85  ? 144.418 150.343 139.600 1.00 26.97  ? 83  ARG H NH2   1 
ATOM 5774  N N     . SER H 4 86  ? 136.545 152.447 138.006 1.00 28.49  ? 84  SER H N     1 
ATOM 5775  C CA    . SER H 4 86  ? 135.320 152.990 137.445 1.00 28.49  ? 84  SER H CA    1 
ATOM 5776  C C     . SER H 4 86  ? 135.505 153.508 136.031 1.00 28.49  ? 84  SER H C     1 
ATOM 5777  O O     . SER H 4 86  ? 134.572 154.083 135.477 1.00 28.49  ? 84  SER H O     1 
ATOM 5778  C CB    . SER H 4 86  ? 134.757 154.098 138.333 1.00 28.49  ? 84  SER H CB    1 
ATOM 5779  O OG    . SER H 4 86  ? 135.517 155.277 138.222 1.00 28.49  ? 84  SER H OG    1 
ATOM 5780  N N     . THR H 4 87  ? 136.662 153.296 135.425 1.00 25.64  ? 85  THR H N     1 
ATOM 5781  C CA    . THR H 4 87  ? 136.918 153.725 134.063 1.00 25.64  ? 85  THR H CA    1 
ATOM 5782  C C     . THR H 4 87  ? 137.247 152.515 133.209 1.00 25.64  ? 85  THR H C     1 
ATOM 5783  O O     . THR H 4 87  ? 138.042 151.664 133.606 1.00 25.64  ? 85  THR H O     1 
ATOM 5784  C CB    . THR H 4 87  ? 138.071 154.722 133.997 1.00 25.64  ? 85  THR H CB    1 
ATOM 5785  O OG1   . THR H 4 87  ? 137.920 155.691 135.034 1.00 25.64  ? 85  THR H OG1   1 
ATOM 5786  C CG2   . THR H 4 87  ? 138.082 155.443 132.682 1.00 25.64  ? 85  THR H CG2   1 
ATOM 5787  N N     . ILE H 4 88  ? 136.618 152.434 132.044 1.00 18.03  ? 86  ILE H N     1 
ATOM 5788  C CA    . ILE H 4 88  ? 137.041 151.515 131.002 1.00 18.03  ? 86  ILE H CA    1 
ATOM 5789  C C     . ILE H 4 88  ? 138.091 152.248 130.188 1.00 18.03  ? 86  ILE H C     1 
ATOM 5790  O O     . ILE H 4 88  ? 137.817 153.294 129.606 1.00 18.03  ? 86  ILE H O     1 
ATOM 5791  C CB    . ILE H 4 88  ? 135.879 151.061 130.121 1.00 18.03  ? 86  ILE H CB    1 
ATOM 5792  C CG1   . ILE H 4 88  ? 135.003 150.070 130.864 1.00 18.03  ? 86  ILE H CG1   1 
ATOM 5793  C CG2   . ILE H 4 88  ? 136.399 150.401 128.879 1.00 18.03  ? 86  ILE H CG2   1 
ATOM 5794  C CD1   . ILE H 4 88  ? 133.845 149.633 130.054 1.00 18.03  ? 86  ILE H CD1   1 
ATOM 5795  N N     . THR H 4 89  ? 139.293 151.720 130.173 1.00 17.32  ? 87  THR H N     1 
ATOM 5796  C CA    . THR H 4 89  ? 140.382 152.299 129.422 1.00 17.32  ? 87  THR H CA    1 
ATOM 5797  C C     . THR H 4 89  ? 140.796 151.331 128.324 1.00 17.32  ? 87  THR H C     1 
ATOM 5798  O O     . THR H 4 89  ? 140.233 150.241 128.172 1.00 17.32  ? 87  THR H O     1 
ATOM 5799  C CB    . THR H 4 89  ? 141.526 152.647 130.361 1.00 17.32  ? 87  THR H CB    1 
ATOM 5800  O OG1   . THR H 4 89  ? 141.727 151.579 131.288 1.00 17.32  ? 87  THR H OG1   1 
ATOM 5801  C CG2   . THR H 4 89  ? 141.195 153.885 131.144 1.00 17.32  ? 87  THR H CG2   1 
ATOM 5802  N N     . SER H 4 90  ? 141.796 151.722 127.543 1.00 16.23  ? 88  SER H N     1 
ATOM 5803  C CA    . SER H 4 90  ? 142.303 150.856 126.493 1.00 16.23  ? 88  SER H CA    1 
ATOM 5804  C C     . SER H 4 90  ? 143.058 149.662 127.046 1.00 16.23  ? 88  SER H C     1 
ATOM 5805  O O     . SER H 4 90  ? 143.184 148.654 126.354 1.00 16.23  ? 88  SER H O     1 
ATOM 5806  C CB    . SER H 4 90  ? 143.175 151.656 125.533 1.00 16.23  ? 88  SER H CB    1 
ATOM 5807  O OG    . SER H 4 90  ? 144.298 152.190 126.191 1.00 16.23  ? 88  SER H OG    1 
ATOM 5808  N N     . ARG H 4 91  ? 143.487 149.719 128.302 1.00 17.61  ? 89  ARG H N     1 
ATOM 5809  C CA    . ARG H 4 91  ? 144.055 148.544 128.944 1.00 17.61  ? 89  ARG H CA    1 
ATOM 5810  C C     . ARG H 4 91  ? 142.974 147.518 129.290 1.00 17.61  ? 89  ARG H C     1 
ATOM 5811  O O     . ARG H 4 91  ? 143.193 146.310 129.149 1.00 17.61  ? 89  ARG H O     1 
ATOM 5812  C CB    . ARG H 4 91  ? 144.840 148.987 130.165 1.00 17.61  ? 89  ARG H CB    1 
ATOM 5813  C CG    . ARG H 4 91  ? 145.550 147.897 130.867 1.00 17.61  ? 89  ARG H CG    1 
ATOM 5814  C CD    . ARG H 4 91  ? 146.483 148.451 131.917 1.00 17.61  ? 89  ARG H CD    1 
ATOM 5815  N NE    . ARG H 4 91  ? 146.662 147.511 133.012 1.00 17.61  ? 89  ARG H NE    1 
ATOM 5816  C CZ    . ARG H 4 91  ? 147.494 146.482 132.987 1.00 17.61  ? 89  ARG H CZ    1 
ATOM 5817  N NH1   . ARG H 4 91  ? 148.245 146.242 131.926 1.00 17.61  ? 89  ARG H NH1   1 
ATOM 5818  N NH2   . ARG H 4 91  ? 147.584 145.691 134.031 1.00 17.61  ? 89  ARG H NH2   1 
ATOM 5819  N N     . GLU H 4 92  ? 141.788 147.973 129.703 1.00 15.82  ? 90  GLU H N     1 
ATOM 5820  C CA    . GLU H 4 92  ? 140.649 147.066 129.847 1.00 15.82  ? 90  GLU H CA    1 
ATOM 5821  C C     . GLU H 4 92  ? 140.204 146.492 128.511 1.00 15.82  ? 90  GLU H C     1 
ATOM 5822  O O     . GLU H 4 92  ? 139.833 145.317 128.433 1.00 15.82  ? 90  GLU H O     1 
ATOM 5823  C CB    . GLU H 4 92  ? 139.466 147.761 130.516 1.00 15.82  ? 90  GLU H CB    1 
ATOM 5824  C CG    . GLU H 4 92  ? 139.422 147.721 132.023 1.00 15.82  ? 90  GLU H CG    1 
ATOM 5825  C CD    . GLU H 4 92  ? 140.191 148.829 132.687 1.00 15.82  ? 90  GLU H CD    1 
ATOM 5826  O OE1   . GLU H 4 92  ? 140.747 149.672 131.968 1.00 15.82  ? 90  GLU H OE1   1 
ATOM 5827  O OE2   . GLU H 4 92  ? 140.229 148.866 133.936 1.00 15.82  ? 90  GLU H OE2   1 
ATOM 5828  N N     . ILE H 4 93  ? 140.204 147.307 127.457 1.00 14.06  ? 91  ILE H N     1 
ATOM 5829  C CA    . ILE H 4 93  ? 139.816 146.805 126.141 1.00 14.06  ? 91  ILE H CA    1 
ATOM 5830  C C     . ILE H 4 93  ? 140.843 145.801 125.621 1.00 14.06  ? 91  ILE H C     1 
ATOM 5831  O O     . ILE H 4 93  ? 140.486 144.789 125.012 1.00 14.06  ? 91  ILE H O     1 
ATOM 5832  C CB    . ILE H 4 93  ? 139.602 147.979 125.169 1.00 14.06  ? 91  ILE H CB    1 
ATOM 5833  C CG1   . ILE H 4 93  ? 138.493 148.887 125.675 1.00 14.06  ? 91  ILE H CG1   1 
ATOM 5834  C CG2   . ILE H 4 93  ? 139.233 147.499 123.794 1.00 14.06  ? 91  ILE H CG2   1 
ATOM 5835  C CD1   . ILE H 4 93  ? 137.134 148.267 125.657 1.00 14.06  ? 91  ILE H CD1   1 
ATOM 5836  N N     . GLN H 4 94  ? 142.120 146.017 125.920 1.00 14.98  ? 92  GLN H N     1 
ATOM 5837  C CA    . GLN H 4 94  ? 143.156 145.090 125.485 1.00 14.98  ? 92  GLN H CA    1 
ATOM 5838  C C     . GLN H 4 94  ? 143.093 143.770 126.241 1.00 14.98  ? 92  GLN H C     1 
ATOM 5839  O O     . GLN H 4 94  ? 143.261 142.700 125.644 1.00 14.98  ? 92  GLN H O     1 
ATOM 5840  C CB    . GLN H 4 94  ? 144.514 145.744 125.660 1.00 14.98  ? 92  GLN H CB    1 
ATOM 5841  C CG    . GLN H 4 94  ? 145.663 144.848 125.389 1.00 14.98  ? 92  GLN H CG    1 
ATOM 5842  C CD    . GLN H 4 94  ? 146.942 145.592 125.323 1.00 14.98  ? 92  GLN H CD    1 
ATOM 5843  O OE1   . GLN H 4 94  ? 146.990 146.773 125.624 1.00 14.98  ? 92  GLN H OE1   1 
ATOM 5844  N NE2   . GLN H 4 94  ? 147.998 144.914 124.930 1.00 14.98  ? 92  GLN H NE2   1 
ATOM 5845  N N     . THR H 4 95  ? 142.832 143.819 127.547 1.00 13.20  ? 93  THR H N     1 
ATOM 5846  C CA    . THR H 4 95  ? 142.662 142.588 128.308 1.00 13.20  ? 93  THR H CA    1 
ATOM 5847  C C     . THR H 4 95  ? 141.413 141.829 127.887 1.00 13.20  ? 93  THR H C     1 
ATOM 5848  O O     . THR H 4 95  ? 141.442 140.599 127.805 1.00 13.20  ? 93  THR H O     1 
ATOM 5849  C CB    . THR H 4 95  ? 142.615 142.908 129.792 1.00 13.20  ? 93  THR H CB    1 
ATOM 5850  O OG1   . THR H 4 95  ? 143.741 143.719 130.123 1.00 13.20  ? 93  THR H OG1   1 
ATOM 5851  C CG2   . THR H 4 95  ? 142.675 141.657 130.608 1.00 13.20  ? 93  THR H CG2   1 
ATOM 5852  N N     . ALA H 4 96  ? 140.325 142.534 127.583 1.00 13.67  ? 94  ALA H N     1 
ATOM 5853  C CA    . ALA H 4 96  ? 139.125 141.872 127.096 1.00 13.67  ? 94  ALA H CA    1 
ATOM 5854  C C     . ALA H 4 96  ? 139.344 141.246 125.728 1.00 13.67  ? 94  ALA H C     1 
ATOM 5855  O O     . ALA H 4 96  ? 138.787 140.189 125.433 1.00 13.67  ? 94  ALA H O     1 
ATOM 5856  C CB    . ALA H 4 96  ? 137.977 142.866 127.046 1.00 13.67  ? 94  ALA H CB    1 
ATOM 5857  N N     . VAL H 4 97  ? 140.162 141.875 124.882 1.00 14.32  ? 95  VAL H N     1 
ATOM 5858  C CA    . VAL H 4 97  ? 140.475 141.300 123.578 1.00 14.32  ? 95  VAL H CA    1 
ATOM 5859  C C     . VAL H 4 97  ? 141.308 140.037 123.739 1.00 14.32  ? 95  VAL H C     1 
ATOM 5860  O O     . VAL H 4 97  ? 141.048 139.021 123.090 1.00 14.32  ? 95  VAL H O     1 
ATOM 5861  C CB    . VAL H 4 97  ? 141.168 142.356 122.696 1.00 14.32  ? 95  VAL H CB    1 
ATOM 5862  C CG1   . VAL H 4 97  ? 141.948 141.731 121.574 1.00 14.32  ? 95  VAL H CG1   1 
ATOM 5863  C CG2   . VAL H 4 97  ? 140.149 143.268 122.116 1.00 14.32  ? 95  VAL H CG2   1 
ATOM 5864  N N     . ARG H 4 98  ? 142.286 140.059 124.636 1.00 15.02  ? 96  ARG H N     1 
ATOM 5865  C CA    . ARG H 4 98  ? 143.076 138.865 124.903 1.00 15.02  ? 96  ARG H CA    1 
ATOM 5866  C C     . ARG H 4 98  ? 142.293 137.757 125.590 1.00 15.02  ? 96  ARG H C     1 
ATOM 5867  O O     . ARG H 4 98  ? 142.653 136.592 125.439 1.00 15.02  ? 96  ARG H O     1 
ATOM 5868  C CB    . ARG H 4 98  ? 144.287 139.219 125.745 1.00 15.02  ? 96  ARG H CB    1 
ATOM 5869  C CG    . ARG H 4 98  ? 145.346 139.952 124.986 1.00 15.02  ? 96  ARG H CG    1 
ATOM 5870  C CD    . ARG H 4 98  ? 146.625 139.930 125.753 1.00 15.02  ? 96  ARG H CD    1 
ATOM 5871  N NE    . ARG H 4 98  ? 146.382 140.281 127.141 1.00 15.02  ? 96  ARG H NE    1 
ATOM 5872  C CZ    . ARG H 4 98  ? 146.715 141.446 127.679 1.00 15.02  ? 96  ARG H CZ    1 
ATOM 5873  N NH1   . ARG H 4 98  ? 147.325 142.359 126.941 1.00 15.02  ? 96  ARG H NH1   1 
ATOM 5874  N NH2   . ARG H 4 98  ? 146.451 141.694 128.954 1.00 15.02  ? 96  ARG H NH2   1 
ATOM 5875  N N     . LEU H 4 99  ? 141.237 138.078 126.326 1.00 14.27  ? 97  LEU H N     1 
ATOM 5876  C CA    . LEU H 4 99  ? 140.397 137.040 126.907 1.00 14.27  ? 97  LEU H CA    1 
ATOM 5877  C C     . LEU H 4 99  ? 139.400 136.469 125.912 1.00 14.27  ? 97  LEU H C     1 
ATOM 5878  O O     . LEU H 4 99  ? 139.130 135.268 125.939 1.00 14.27  ? 97  LEU H O     1 
ATOM 5879  C CB    . LEU H 4 99  ? 139.648 137.579 128.123 1.00 14.27  ? 97  LEU H CB    1 
ATOM 5880  C CG    . LEU H 4 99  ? 140.459 137.738 129.405 1.00 14.27  ? 97  LEU H CG    1 
ATOM 5881  C CD1   . LEU H 4 99  ? 139.691 138.544 130.410 1.00 14.27  ? 97  LEU H CD1   1 
ATOM 5882  C CD2   . LEU H 4 99  ? 140.826 136.413 129.972 1.00 14.27  ? 97  LEU H CD2   1 
ATOM 5883  N N     . LEU H 4 100 ? 138.849 137.286 125.024 1.00 14.37  ? 98  LEU H N     1 
ATOM 5884  C CA    . LEU H 4 100 ? 137.776 136.806 124.165 1.00 14.37  ? 98  LEU H CA    1 
ATOM 5885  C C     . LEU H 4 100 ? 138.254 136.289 122.820 1.00 14.37  ? 98  LEU H C     1 
ATOM 5886  O O     . LEU H 4 100 ? 137.587 135.435 122.233 1.00 14.37  ? 98  LEU H O     1 
ATOM 5887  C CB    . LEU H 4 100 ? 136.752 137.909 123.935 1.00 14.37  ? 98  LEU H CB    1 
ATOM 5888  C CG    . LEU H 4 100 ? 135.923 138.264 125.154 1.00 14.37  ? 98  LEU H CG    1 
ATOM 5889  C CD1   . LEU H 4 100 ? 135.558 139.681 125.059 1.00 14.37  ? 98  LEU H CD1   1 
ATOM 5890  C CD2   . LEU H 4 100 ? 134.694 137.432 125.219 1.00 14.37  ? 98  LEU H CD2   1 
ATOM 5891  N N     . LEU H 4 101 ? 139.367 136.793 122.298 1.00 16.70  ? 99  LEU H N     1 
ATOM 5892  C CA    . LEU H 4 101 ? 139.663 136.308 120.957 1.00 16.70  ? 99  LEU H CA    1 
ATOM 5893  C C     . LEU H 4 101 ? 140.641 135.140 121.013 1.00 16.70  ? 99  LEU H C     1 
ATOM 5894  O O     . LEU H 4 101 ? 141.560 135.142 121.830 1.00 16.70  ? 99  LEU H O     1 
ATOM 5895  C CB    . LEU H 4 101 ? 140.240 137.413 120.084 1.00 16.70  ? 99  LEU H CB    1 
ATOM 5896  C CG    . LEU H 4 101 ? 139.430 138.680 119.841 1.00 16.70  ? 99  LEU H CG    1 
ATOM 5897  C CD1   . LEU H 4 101 ? 140.018 139.431 118.694 1.00 16.70  ? 99  LEU H CD1   1 
ATOM 5898  C CD2   . LEU H 4 101 ? 137.995 138.383 119.565 1.00 16.70  ? 99  LEU H CD2   1 
ATOM 5899  N N     . PRO H 4 102 ? 140.462 134.135 120.163 1.00 19.14  ? 100 PRO H N     1 
ATOM 5900  C CA    . PRO H 4 102 ? 141.305 132.943 120.249 1.00 19.14  ? 100 PRO H CA    1 
ATOM 5901  C C     . PRO H 4 102 ? 142.584 133.050 119.449 1.00 19.14  ? 100 PRO H C     1 
ATOM 5902  O O     . PRO H 4 102 ? 142.546 133.395 118.269 1.00 19.14  ? 100 PRO H O     1 
ATOM 5903  C CB    . PRO H 4 102 ? 140.406 131.841 119.676 1.00 19.14  ? 100 PRO H CB    1 
ATOM 5904  C CG    . PRO H 4 102 ? 139.067 132.475 119.465 1.00 19.14  ? 100 PRO H CG    1 
ATOM 5905  C CD    . PRO H 4 102 ? 139.327 133.908 119.263 1.00 19.14  ? 100 PRO H CD    1 
ATOM 5906  N N     . GLY H 4 103 ? 143.715 132.748 120.073 1.00 20.44  ? 101 GLY H N     1 
ATOM 5907  C CA    . GLY H 4 103 ? 144.947 132.510 119.353 1.00 20.44  ? 101 GLY H CA    1 
ATOM 5908  C C     . GLY H 4 103 ? 145.595 133.712 118.712 1.00 20.44  ? 101 GLY H C     1 
ATOM 5909  O O     . GLY H 4 103 ? 145.964 134.665 119.396 1.00 20.44  ? 101 GLY H O     1 
ATOM 5910  N N     . GLU H 4 104 ? 145.755 133.665 117.391 1.00 24.72  ? 102 GLU H N     1 
ATOM 5911  C CA    . GLU H 4 104 ? 146.394 134.734 116.641 1.00 24.72  ? 102 GLU H CA    1 
ATOM 5912  C C     . GLU H 4 104 ? 145.404 135.768 116.136 1.00 24.72  ? 102 GLU H C     1 
ATOM 5913  O O     . GLU H 4 104 ? 145.799 136.698 115.438 1.00 24.72  ? 102 GLU H O     1 
ATOM 5914  C CB    . GLU H 4 104 ? 147.203 134.173 115.478 1.00 24.72  ? 102 GLU H CB    1 
ATOM 5915  C CG    . GLU H 4 104 ? 148.591 133.729 115.873 1.00 24.72  ? 102 GLU H CG    1 
ATOM 5916  C CD    . GLU H 4 104 ? 149.613 134.019 114.803 1.00 24.72  ? 102 GLU H CD    1 
ATOM 5917  O OE1   . GLU H 4 104 ? 149.214 134.472 113.715 1.00 24.72  ? 102 GLU H OE1   1 
ATOM 5918  O OE2   . GLU H 4 104 ? 150.816 133.809 115.048 1.00 24.72  ? 102 GLU H OE2   1 
ATOM 5919  N N     . LEU H 4 105 ? 144.125 135.625 116.463 1.00 20.91  ? 103 LEU H N     1 
ATOM 5920  C CA    . LEU H 4 105 ? 143.221 136.756 116.325 1.00 20.91  ? 103 LEU H CA    1 
ATOM 5921  C C     . LEU H 4 105 ? 143.535 137.809 117.371 1.00 20.91  ? 103 LEU H C     1 
ATOM 5922  O O     . LEU H 4 105 ? 143.582 139.004 117.067 1.00 20.91  ? 103 LEU H O     1 
ATOM 5923  C CB    . LEU H 4 105 ? 141.773 136.301 116.452 1.00 20.91  ? 103 LEU H CB    1 
ATOM 5924  C CG    . LEU H 4 105 ? 141.070 135.735 115.234 1.00 20.91  ? 103 LEU H CG    1 
ATOM 5925  C CD1   . LEU H 4 105 ? 139.681 135.342 115.605 1.00 20.91  ? 103 LEU H CD1   1 
ATOM 5926  C CD2   . LEU H 4 105 ? 141.037 136.750 114.150 1.00 20.91  ? 103 LEU H CD2   1 
ATOM 5927  N N     . ALA H 4 106 ? 143.779 137.378 118.602 1.00 20.19  ? 104 ALA H N     1 
ATOM 5928  C CA    . ALA H 4 106 ? 144.093 138.266 119.704 1.00 20.19  ? 104 ALA H CA    1 
ATOM 5929  C C     . ALA H 4 106 ? 145.516 138.781 119.668 1.00 20.19  ? 104 ALA H C     1 
ATOM 5930  O O     . ALA H 4 106 ? 145.889 139.581 120.524 1.00 20.19  ? 104 ALA H O     1 
ATOM 5931  C CB    . ALA H 4 106 ? 143.862 137.550 121.027 1.00 20.19  ? 104 ALA H CB    1 
ATOM 5932  N N     . LYS H 4 107 ? 146.329 138.321 118.731 1.00 23.06  ? 105 LYS H N     1 
ATOM 5933  C CA    . LYS H 4 107 ? 147.649 138.885 118.523 1.00 23.06  ? 105 LYS H CA    1 
ATOM 5934  C C     . LYS H 4 107 ? 147.607 140.036 117.536 1.00 23.06  ? 105 LYS H C     1 
ATOM 5935  O O     . LYS H 4 107 ? 148.202 141.086 117.786 1.00 23.06  ? 105 LYS H O     1 
ATOM 5936  C CB    . LYS H 4 107 ? 148.603 137.795 118.040 1.00 23.06  ? 105 LYS H CB    1 
ATOM 5937  C CG    . LYS H 4 107 ? 149.865 138.304 117.402 1.00 23.06  ? 105 LYS H CG    1 
ATOM 5938  C CD    . LYS H 4 107 ? 150.841 137.189 117.171 1.00 23.06  ? 105 LYS H CD    1 
ATOM 5939  C CE    . LYS H 4 107 ? 152.161 137.727 116.669 1.00 23.06  ? 105 LYS H CE    1 
ATOM 5940  N NZ    . LYS H 4 107 ? 152.023 138.277 115.300 1.00 23.06  ? 105 LYS H NZ    1 
ATOM 5941  N N     . HIS H 4 108 ? 146.895 139.868 116.428 1.00 22.50  ? 106 HIS H N     1 
ATOM 5942  C CA    . HIS H 4 108 ? 146.788 140.923 115.436 1.00 22.50  ? 106 HIS H CA    1 
ATOM 5943  C C     . HIS H 4 108 ? 145.787 141.998 115.818 1.00 22.50  ? 106 HIS H C     1 
ATOM 5944  O O     . HIS H 4 108 ? 145.951 143.150 115.408 1.00 22.50  ? 106 HIS H O     1 
ATOM 5945  C CB    . HIS H 4 108 ? 146.393 140.347 114.082 1.00 22.50  ? 106 HIS H CB    1 
ATOM 5946  C CG    . HIS H 4 108 ? 147.353 139.341 113.534 1.00 22.50  ? 106 HIS H CG    1 
ATOM 5947  N ND1   . HIS H 4 108 ? 148.716 139.523 113.547 1.00 22.50  ? 106 HIS H ND1   1 
ATOM 5948  C CD2   . HIS H 4 108 ? 147.141 138.150 112.933 1.00 22.50  ? 106 HIS H CD2   1 
ATOM 5949  C CE1   . HIS H 4 108 ? 149.302 138.481 112.992 1.00 22.50  ? 106 HIS H CE1   1 
ATOM 5950  N NE2   . HIS H 4 108 ? 148.369 137.633 112.612 1.00 22.50  ? 106 HIS H NE2   1 
ATOM 5951  N N     . ALA H 4 109 ? 144.768 141.670 116.616 1.00 18.13  ? 107 ALA H N     1 
ATOM 5952  C CA    . ALA H 4 109 ? 143.815 142.689 117.040 1.00 18.13  ? 107 ALA H CA    1 
ATOM 5953  C C     . ALA H 4 109 ? 144.420 143.609 118.089 1.00 18.13  ? 107 ALA H C     1 
ATOM 5954  O O     . ALA H 4 109 ? 144.112 144.804 118.125 1.00 18.13  ? 107 ALA H O     1 
ATOM 5955  C CB    . ALA H 4 109 ? 142.550 142.026 117.566 1.00 18.13  ? 107 ALA H CB    1 
ATOM 5956  N N     . VAL H 4 110 ? 145.296 143.072 118.935 1.00 16.74  ? 108 VAL H N     1 
ATOM 5957  C CA    . VAL H 4 110 ? 146.048 143.892 119.877 1.00 16.74  ? 108 VAL H CA    1 
ATOM 5958  C C     . VAL H 4 110 ? 146.988 144.835 119.137 1.00 16.74  ? 108 VAL H C     1 
ATOM 5959  O O     . VAL H 4 110 ? 147.120 146.007 119.500 1.00 16.74  ? 108 VAL H O     1 
ATOM 5960  C CB    . VAL H 4 110 ? 146.783 142.978 120.876 1.00 16.74  ? 108 VAL H CB    1 
ATOM 5961  C CG1   . VAL H 4 110 ? 147.957 143.657 121.508 1.00 16.74  ? 108 VAL H CG1   1 
ATOM 5962  C CG2   . VAL H 4 110 ? 145.838 142.547 121.954 1.00 16.74  ? 108 VAL H CG2   1 
ATOM 5963  N N     . SER H 4 111 ? 147.606 144.361 118.054 1.00 20.14  ? 109 SER H N     1 
ATOM 5964  C CA    . SER H 4 111 ? 148.486 145.207 117.254 1.00 20.14  ? 109 SER H CA    1 
ATOM 5965  C C     . SER H 4 111 ? 147.715 146.309 116.545 1.00 20.14  ? 109 SER H C     1 
ATOM 5966  O O     . SER H 4 111 ? 148.176 147.453 116.490 1.00 20.14  ? 109 SER H O     1 
ATOM 5967  C CB    . SER H 4 111 ? 149.236 144.359 116.241 1.00 20.14  ? 109 SER H CB    1 
ATOM 5968  O OG    . SER H 4 111 ? 149.780 143.216 116.863 1.00 20.14  ? 109 SER H OG    1 
ATOM 5969  N N     . GLU H 4 112 ? 146.533 145.985 116.025 1.00 21.05  ? 110 GLU H N     1 
ATOM 5970  C CA    . GLU H 4 112 ? 145.672 146.986 115.403 1.00 21.05  ? 110 GLU H CA    1 
ATOM 5971  C C     . GLU H 4 112 ? 145.237 148.055 116.398 1.00 21.05  ? 110 GLU H C     1 
ATOM 5972  O O     . GLU H 4 112 ? 145.302 149.254 116.101 1.00 21.05  ? 110 GLU H O     1 
ATOM 5973  C CB    . GLU H 4 112 ? 144.454 146.301 114.796 1.00 21.05  ? 110 GLU H CB    1 
ATOM 5974  C CG    . GLU H 4 112 ? 144.740 145.624 113.497 1.00 21.05  ? 110 GLU H CG    1 
ATOM 5975  C CD    . GLU H 4 112 ? 144.944 146.607 112.373 1.00 21.05  ? 110 GLU H CD    1 
ATOM 5976  O OE1   . GLU H 4 112 ? 143.932 147.063 111.805 1.00 21.05  ? 110 GLU H OE1   1 
ATOM 5977  O OE2   . GLU H 4 112 ? 146.108 146.930 112.057 1.00 21.05  ? 110 GLU H OE2   1 
ATOM 5978  N N     . GLY H 4 113 ? 144.810 147.638 117.592 1.00 18.31  ? 111 GLY H N     1 
ATOM 5979  C CA    . GLY H 4 113 ? 144.359 148.597 118.583 1.00 18.31  ? 111 GLY H CA    1 
ATOM 5980  C C     . GLY H 4 113 ? 145.476 149.454 119.138 1.00 18.31  ? 111 GLY H C     1 
ATOM 5981  O O     . GLY H 4 113 ? 145.292 150.653 119.363 1.00 18.31  ? 111 GLY H O     1 
ATOM 5982  N N     . THR H 4 114 ? 146.650 148.858 119.358 1.00 18.38  ? 112 THR H N     1 
ATOM 5983  C CA    . THR H 4 114 ? 147.808 149.606 119.825 1.00 18.38  ? 112 THR H CA    1 
ATOM 5984  C C     . THR H 4 114 ? 148.262 150.622 118.789 1.00 18.38  ? 112 THR H C     1 
ATOM 5985  O O     . THR H 4 114 ? 148.595 151.759 119.137 1.00 18.38  ? 112 THR H O     1 
ATOM 5986  C CB    . THR H 4 114 ? 148.937 148.635 120.157 1.00 18.38  ? 112 THR H CB    1 
ATOM 5987  O OG1   . THR H 4 114 ? 148.503 147.738 121.181 1.00 18.38  ? 112 THR H OG1   1 
ATOM 5988  C CG2   . THR H 4 114 ? 150.146 149.359 120.655 1.00 18.38  ? 112 THR H CG2   1 
ATOM 5989  N N     . LYS H 4 115 ? 148.227 150.244 117.509 1.00 20.44  ? 113 LYS H N     1 
ATOM 5990  C CA    . LYS H 4 115 ? 148.576 151.159 116.431 1.00 20.44  ? 113 LYS H CA    1 
ATOM 5991  C C     . LYS H 4 115 ? 147.607 152.326 116.346 1.00 20.44  ? 113 LYS H C     1 
ATOM 5992  O O     . LYS H 4 115 ? 148.024 153.475 116.156 1.00 20.44  ? 113 LYS H O     1 
ATOM 5993  C CB    . LYS H 4 115 ? 148.599 150.387 115.121 1.00 20.44  ? 113 LYS H CB    1 
ATOM 5994  C CG    . LYS H 4 115 ? 148.920 151.192 113.899 1.00 20.44  ? 113 LYS H CG    1 
ATOM 5995  C CD    . LYS H 4 115 ? 148.814 150.342 112.656 1.00 20.44  ? 113 LYS H CD    1 
ATOM 5996  C CE    . LYS H 4 115 ? 149.597 149.046 112.794 1.00 20.44  ? 113 LYS H CE    1 
ATOM 5997  N NZ    . LYS H 4 115 ? 149.785 148.341 111.494 1.00 20.44  ? 113 LYS H NZ    1 
ATOM 5998  N N     . ALA H 4 116 ? 146.312 152.058 116.514 1.00 19.53  ? 114 ALA H N     1 
ATOM 5999  C CA    . ALA H 4 116 ? 145.328 153.131 116.421 1.00 19.53  ? 114 ALA H CA    1 
ATOM 6000  C C     . ALA H 4 116 ? 145.411 154.079 117.605 1.00 19.53  ? 114 ALA H C     1 
ATOM 6001  O O     . ALA H 4 116 ? 145.308 155.293 117.430 1.00 19.53  ? 114 ALA H O     1 
ATOM 6002  C CB    . ALA H 4 116 ? 143.928 152.557 116.308 1.00 19.53  ? 114 ALA H CB    1 
ATOM 6003  N N     . VAL H 4 117 ? 145.613 153.553 118.813 1.00 20.37  ? 115 VAL H N     1 
ATOM 6004  C CA    . VAL H 4 117 ? 145.731 154.414 119.988 1.00 20.37  ? 115 VAL H CA    1 
ATOM 6005  C C     . VAL H 4 117 ? 147.020 155.226 119.933 1.00 20.37  ? 115 VAL H C     1 
ATOM 6006  O O     . VAL H 4 117 ? 147.036 156.416 120.280 1.00 20.37  ? 115 VAL H O     1 
ATOM 6007  C CB    . VAL H 4 117 ? 145.623 153.560 121.264 1.00 20.37  ? 115 VAL H CB    1 
ATOM 6008  C CG1   . VAL H 4 117 ? 145.995 154.330 122.484 1.00 20.37  ? 115 VAL H CG1   1 
ATOM 6009  C CG2   . VAL H 4 117 ? 144.228 153.068 121.415 1.00 20.37  ? 115 VAL H CG2   1 
ATOM 6010  N N     . THR H 4 118 ? 148.100 154.620 119.427 1.00 22.54  ? 116 THR H N     1 
ATOM 6011  C CA    . THR H 4 118 ? 149.370 155.322 119.286 1.00 22.54  ? 116 THR H CA    1 
ATOM 6012  C C     . THR H 4 118 ? 149.275 156.464 118.287 1.00 22.54  ? 116 THR H C     1 
ATOM 6013  O O     . THR H 4 118 ? 149.689 157.586 118.591 1.00 22.54  ? 116 THR H O     1 
ATOM 6014  C CB    . THR H 4 118 ? 150.463 154.335 118.881 1.00 22.54  ? 116 THR H CB    1 
ATOM 6015  O OG1   . THR H 4 118 ? 150.843 153.556 120.018 1.00 22.54  ? 116 THR H OG1   1 
ATOM 6016  C CG2   . THR H 4 118 ? 151.679 155.042 118.362 1.00 22.54  ? 116 THR H CG2   1 
ATOM 6017  N N     . LYS H 4 119 ? 148.689 156.233 117.119 1.00 24.55  ? 117 LYS H N     1 
ATOM 6018  C CA    . LYS H 4 119 ? 148.597 157.331 116.171 1.00 24.55  ? 117 LYS H CA    1 
ATOM 6019  C C     . LYS H 4 119 ? 147.465 158.292 116.484 1.00 24.55  ? 117 LYS H C     1 
ATOM 6020  O O     . LYS H 4 119 ? 147.454 159.402 115.952 1.00 24.55  ? 117 LYS H O     1 
ATOM 6021  C CB    . LYS H 4 119 ? 148.469 156.807 114.743 1.00 24.55  ? 117 LYS H CB    1 
ATOM 6022  C CG    . LYS H 4 119 ? 147.091 156.670 114.212 1.00 24.55  ? 117 LYS H CG    1 
ATOM 6023  C CD    . LYS H 4 119 ? 147.156 156.307 112.756 1.00 24.55  ? 117 LYS H CD    1 
ATOM 6024  C CE    . LYS H 4 119 ? 147.724 157.434 111.936 1.00 24.55  ? 117 LYS H CE    1 
ATOM 6025  N NZ    . LYS H 4 119 ? 146.817 158.608 111.880 1.00 24.55  ? 117 LYS H NZ    1 
ATOM 6026  N N     . TYR H 4 120 ? 146.533 157.917 117.354 1.00 25.32  ? 118 TYR H N     1 
ATOM 6027  C CA    . TYR H 4 120 ? 145.509 158.849 117.802 1.00 25.32  ? 118 TYR H CA    1 
ATOM 6028  C C     . TYR H 4 120 ? 146.067 159.822 118.824 1.00 25.32  ? 118 TYR H C     1 
ATOM 6029  O O     . TYR H 4 120 ? 145.689 160.995 118.838 1.00 25.32  ? 118 TYR H O     1 
ATOM 6030  C CB    . TYR H 4 120 ? 144.334 158.069 118.383 1.00 25.32  ? 118 TYR H CB    1 
ATOM 6031  C CG    . TYR H 4 120 ? 143.271 158.890 119.057 1.00 25.32  ? 118 TYR H CG    1 
ATOM 6032  C CD1   . TYR H 4 120 ? 142.267 159.495 118.321 1.00 25.32  ? 118 TYR H CD1   1 
ATOM 6033  C CD2   . TYR H 4 120 ? 143.242 159.022 120.438 1.00 25.32  ? 118 TYR H CD2   1 
ATOM 6034  C CE1   . TYR H 4 120 ? 141.293 160.230 118.933 1.00 25.32  ? 118 TYR H CE1   1 
ATOM 6035  C CE2   . TYR H 4 120 ? 142.275 159.762 121.054 1.00 25.32  ? 118 TYR H CE2   1 
ATOM 6036  C CZ    . TYR H 4 120 ? 141.304 160.361 120.298 1.00 25.32  ? 118 TYR H CZ    1 
ATOM 6037  O OH    . TYR H 4 120 ? 140.332 161.095 120.920 1.00 25.32  ? 118 TYR H OH    1 
ATOM 6038  N N     . THR H 4 121 ? 146.964 159.352 119.691 1.00 27.23  ? 119 THR H N     1 
ATOM 6039  C CA    . THR H 4 121 ? 147.558 160.232 120.686 1.00 27.23  ? 119 THR H CA    1 
ATOM 6040  C C     . THR H 4 121 ? 148.555 161.214 120.070 1.00 27.23  ? 119 THR H C     1 
ATOM 6041  O O     . THR H 4 121 ? 148.877 162.228 120.695 1.00 27.23  ? 119 THR H O     1 
ATOM 6042  C CB    . THR H 4 121 ? 148.213 159.379 121.773 1.00 27.23  ? 119 THR H CB    1 
ATOM 6043  O OG1   . THR H 4 121 ? 147.382 158.246 122.034 1.00 27.23  ? 119 THR H OG1   1 
ATOM 6044  C CG2   . THR H 4 121 ? 148.334 160.142 123.070 1.00 27.23  ? 119 THR H CG2   1 
ATOM 6045  N N     . SER H 4 122 ? 149.014 160.974 118.843 1.00 29.85  ? 120 SER H N     1 
ATOM 6046  C CA    . SER H 4 122 ? 149.796 161.952 118.098 1.00 29.85  ? 120 SER H CA    1 
ATOM 6047  C C     . SER H 4 122 ? 148.927 162.964 117.357 1.00 29.85  ? 120 SER H C     1 
ATOM 6048  O O     . SER H 4 122 ? 149.459 163.780 116.595 1.00 29.85  ? 120 SER H O     1 
ATOM 6049  C CB    . SER H 4 122 ? 150.726 161.240 117.117 1.00 29.85  ? 120 SER H CB    1 
ATOM 6050  O OG    . SER H 4 122 ? 151.422 160.187 117.751 1.00 29.85  ? 120 SER H OG    1 
ATOM 6051  N N     . SER H 4 123 ? 147.609 162.921 117.566 1.00 32.90  ? 121 SER H N     1 
ATOM 6052  C CA    . SER H 4 123 ? 146.603 163.816 116.970 1.00 32.90  ? 121 SER H CA    1 
ATOM 6053  C C     . SER H 4 123 ? 146.639 163.867 115.446 1.00 32.90  ? 121 SER H C     1 
ATOM 6054  O O     . SER H 4 123 ? 146.437 162.858 114.779 1.00 32.90  ? 121 SER H O     1 
ATOM 6055  C CB    . SER H 4 123 ? 146.740 165.235 117.536 1.00 32.90  ? 121 SER H CB    1 
ATOM 6056  O OG    . SER H 4 123 ? 146.443 165.265 118.921 1.00 32.90  ? 121 SER H OG    1 
ATOM 6057  P P     . DA  I 5 1   ? 117.435 79.857  141.550 1.00 123.19 ? 1   DA  I P     1 
ATOM 6058  O OP1   . DA  I 5 1   ? 117.302 81.327  141.661 1.00 123.19 ? 1   DA  I OP1   1 
ATOM 6059  O OP2   . DA  I 5 1   ? 118.576 79.273  140.804 1.00 123.19 ? 1   DA  I OP2   1 
ATOM 6060  O "O5'" . DA  I 5 1   ? 117.410 79.205  143.012 1.00 123.19 ? 1   DA  I "O5'" 1 
ATOM 6061  C "C5'" . DA  I 5 1   ? 116.252 78.503  143.464 1.00 123.19 ? 1   DA  I "C5'" 1 
ATOM 6062  C "C4'" . DA  I 5 1   ? 116.630 77.377  144.418 1.00 123.19 ? 1   DA  I "C4'" 1 
ATOM 6063  O "O4'" . DA  I 5 1   ? 117.698 76.583  143.840 1.00 123.19 ? 1   DA  I "O4'" 1 
ATOM 6064  C "C3'" . DA  I 5 1   ? 117.126 77.824  145.790 1.00 123.19 ? 1   DA  I "C3'" 1 
ATOM 6065  O "O3'" . DA  I 5 1   ? 116.639 76.953  146.791 1.00 123.19 ? 1   DA  I "O3'" 1 
ATOM 6066  C "C2'" . DA  I 5 1   ? 118.637 77.728  145.662 1.00 123.19 ? 1   DA  I "C2'" 1 
ATOM 6067  C "C1'" . DA  I 5 1   ? 118.806 76.550  144.715 1.00 123.19 ? 1   DA  I "C1'" 1 
ATOM 6068  N N9    . DA  I 5 1   ? 120.021 76.610  143.903 1.00 123.19 ? 1   DA  I N9    1 
ATOM 6069  C C8    . DA  I 5 1   ? 120.227 77.381  142.794 1.00 123.19 ? 1   DA  I C8    1 
ATOM 6070  N N7    . DA  I 5 1   ? 121.409 77.223  142.249 1.00 123.19 ? 1   DA  I N7    1 
ATOM 6071  C C5    . DA  I 5 1   ? 122.018 76.277  143.049 1.00 123.19 ? 1   DA  I C5    1 
ATOM 6072  C C6    . DA  I 5 1   ? 123.288 75.674  143.001 1.00 123.19 ? 1   DA  I C6    1 
ATOM 6073  N N6    . DA  I 5 1   ? 124.200 75.957  142.068 1.00 123.19 ? 1   DA  I N6    1 
ATOM 6074  N N1    . DA  I 5 1   ? 123.588 74.766  143.952 1.00 123.19 ? 1   DA  I N1    1 
ATOM 6075  C C2    . DA  I 5 1   ? 122.672 74.481  144.889 1.00 123.19 ? 1   DA  I C2    1 
ATOM 6076  N N3    . DA  I 5 1   ? 121.444 74.981  145.035 1.00 123.19 ? 1   DA  I N3    1 
ATOM 6077  C C4    . DA  I 5 1   ? 121.177 75.883  144.074 1.00 123.19 ? 1   DA  I C4    1 
ATOM 6078  P P     . DT  I 5 2   ? 116.468 77.477  148.299 1.00 119.60 ? 2   DT  I P     1 
ATOM 6079  O OP1   . DT  I 5 2   ? 115.302 76.769  148.874 1.00 119.60 ? 2   DT  I OP1   1 
ATOM 6080  O OP2   . DT  I 5 2   ? 116.478 78.955  148.270 1.00 119.60 ? 2   DT  I OP2   1 
ATOM 6081  O "O5'" . DT  I 5 2   ? 117.804 76.985  149.028 1.00 119.60 ? 2   DT  I "O5'" 1 
ATOM 6082  C "C5'" . DT  I 5 2   ? 118.116 75.598  149.068 1.00 119.60 ? 2   DT  I "C5'" 1 
ATOM 6083  C "C4'" . DT  I 5 2   ? 119.487 75.341  149.680 1.00 119.60 ? 2   DT  I "C4'" 1 
ATOM 6084  O "O4'" . DT  I 5 2   ? 120.528 75.460  148.671 1.00 119.60 ? 2   DT  I "O4'" 1 
ATOM 6085  C "C3'" . DT  I 5 2   ? 119.909 76.274  150.821 1.00 119.60 ? 2   DT  I "C3'" 1 
ATOM 6086  O "O3'" . DT  I 5 2   ? 120.579 75.494  151.797 1.00 119.60 ? 2   DT  I "O3'" 1 
ATOM 6087  C "C2'" . DT  I 5 2   ? 120.886 77.220  150.120 1.00 119.60 ? 2   DT  I "C2'" 1 
ATOM 6088  C "C1'" . DT  I 5 2   ? 121.582 76.225  149.214 1.00 119.60 ? 2   DT  I "C1'" 1 
ATOM 6089  N N1    . DT  I 5 2   ? 122.392 76.805  148.085 1.00 119.60 ? 2   DT  I N1    1 
ATOM 6090  C C2    . DT  I 5 2   ? 123.666 76.335  147.879 1.00 119.60 ? 2   DT  I C2    1 
ATOM 6091  O O2    . DT  I 5 2   ? 124.186 75.497  148.588 1.00 119.60 ? 2   DT  I O2    1 
ATOM 6092  N N3    . DT  I 5 2   ? 124.317 76.895  146.816 1.00 119.60 ? 2   DT  I N3    1 
ATOM 6093  C C4    . DT  I 5 2   ? 123.834 77.845  145.947 1.00 119.60 ? 2   DT  I C4    1 
ATOM 6094  O O4    . DT  I 5 2   ? 124.500 78.288  145.019 1.00 119.60 ? 2   DT  I O4    1 
ATOM 6095  C C5    . DT  I 5 2   ? 122.493 78.290  146.204 1.00 119.60 ? 2   DT  I C5    1 
ATOM 6096  C C7    . DT  I 5 2   ? 121.879 79.330  145.317 1.00 119.60 ? 2   DT  I C7    1 
ATOM 6097  C C6    . DT  I 5 2   ? 121.835 77.753  147.247 1.00 119.60 ? 2   DT  I C6    1 
ATOM 6098  P P     . DC  I 5 3   ? 120.556 75.878  153.357 1.00 109.88 ? 3   DC  I P     1 
ATOM 6099  O OP1   . DC  I 5 3   ? 119.363 75.250  153.961 1.00 109.88 ? 3   DC  I OP1   1 
ATOM 6100  O OP2   . DC  I 5 3   ? 120.773 77.333  153.505 1.00 109.88 ? 3   DC  I OP2   1 
ATOM 6101  O "O5'" . DC  I 5 3   ? 121.850 75.130  153.912 1.00 109.88 ? 3   DC  I "O5'" 1 
ATOM 6102  C "C5'" . DC  I 5 3   ? 122.745 74.517  152.990 1.00 109.88 ? 3   DC  I "C5'" 1 
ATOM 6103  C "C4'" . DC  I 5 3   ? 124.183 74.665  153.443 1.00 109.88 ? 3   DC  I "C4'" 1 
ATOM 6104  O "O4'" . DC  I 5 3   ? 124.984 75.204  152.355 1.00 109.88 ? 3   DC  I "O4'" 1 
ATOM 6105  C "C3'" . DC  I 5 3   ? 124.396 75.623  154.601 1.00 109.88 ? 3   DC  I "C3'" 1 
ATOM 6106  O "O3'" . DC  I 5 3   ? 125.577 75.261  155.284 1.00 109.88 ? 3   DC  I "O3'" 1 
ATOM 6107  C "C2'" . DC  I 5 3   ? 124.573 76.942  153.869 1.00 109.88 ? 3   DC  I "C2'" 1 
ATOM 6108  C "C1'" . DC  I 5 3   ? 125.443 76.497  152.704 1.00 109.88 ? 3   DC  I "C1'" 1 
ATOM 6109  N N1    . DC  I 5 3   ? 125.343 77.379  151.504 1.00 109.88 ? 3   DC  I N1    1 
ATOM 6110  C C2    . DC  I 5 3   ? 126.431 77.495  150.637 1.00 109.88 ? 3   DC  I C2    1 
ATOM 6111  O O2    . DC  I 5 3   ? 127.463 76.868  150.885 1.00 109.88 ? 3   DC  I O2    1 
ATOM 6112  N N3    . DC  I 5 3   ? 126.320 78.299  149.552 1.00 109.88 ? 3   DC  I N3    1 
ATOM 6113  C C4    . DC  I 5 3   ? 125.185 78.961  149.324 1.00 109.88 ? 3   DC  I C4    1 
ATOM 6114  N N4    . DC  I 5 3   ? 125.117 79.741  148.240 1.00 109.88 ? 3   DC  I N4    1 
ATOM 6115  C C5    . DC  I 5 3   ? 124.069 78.851  150.196 1.00 109.88 ? 3   DC  I C5    1 
ATOM 6116  C C6    . DC  I 5 3   ? 124.189 78.060  151.261 1.00 109.88 ? 3   DC  I C6    1 
ATOM 6117  P P     . DG  I 5 4   ? 125.758 75.586  156.845 1.00 101.12 ? 4   DG  I P     1 
ATOM 6118  O OP1   . DG  I 5 4   ? 125.397 74.367  157.600 1.00 101.12 ? 4   DG  I OP1   1 
ATOM 6119  O OP2   . DG  I 5 4   ? 125.085 76.872  157.135 1.00 101.12 ? 4   DG  I OP2   1 
ATOM 6120  O "O5'" . DG  I 5 4   ? 127.328 75.823  156.989 1.00 101.12 ? 4   DG  I "O5'" 1 
ATOM 6121  C "C5'" . DG  I 5 4   ? 128.228 75.067  156.202 1.00 101.12 ? 4   DG  I "C5'" 1 
ATOM 6122  C "C4'" . DG  I 5 4   ? 129.382 75.924  155.705 1.00 101.12 ? 4   DG  I "C4'" 1 
ATOM 6123  O "O4'" . DG  I 5 4   ? 128.971 76.681  154.538 1.00 101.12 ? 4   DG  I "O4'" 1 
ATOM 6124  C "C3'" . DG  I 5 4   ? 129.930 76.954  156.697 1.00 101.12 ? 4   DG  I "C3'" 1 
ATOM 6125  O "O3'" . DG  I 5 4   ? 131.349 77.005  156.585 1.00 101.12 ? 4   DG  I "O3'" 1 
ATOM 6126  C "C2'" . DG  I 5 4   ? 129.297 78.254  156.204 1.00 101.12 ? 4   DG  I "C2'" 1 
ATOM 6127  C "C1'" . DG  I 5 4   ? 129.360 78.024  154.708 1.00 101.12 ? 4   DG  I "C1'" 1 
ATOM 6128  N N9    . DG  I 5 4   ? 128.469 78.863  153.919 1.00 101.12 ? 4   DG  I N9    1 
ATOM 6129  C C8    . DG  I 5 4   ? 127.169 79.186  154.195 1.00 101.12 ? 4   DG  I C8    1 
ATOM 6130  N N7    . DG  I 5 4   ? 126.612 79.931  153.282 1.00 101.12 ? 4   DG  I N7    1 
ATOM 6131  C C5    . DG  I 5 4   ? 127.618 80.117  152.345 1.00 101.12 ? 4   DG  I C5    1 
ATOM 6132  C C6    . DG  I 5 4   ? 127.614 80.844  151.134 1.00 101.12 ? 4   DG  I C6    1 
ATOM 6133  O O6    . DG  I 5 4   ? 126.688 81.494  150.632 1.00 101.12 ? 4   DG  I O6    1 
ATOM 6134  N N1    . DG  I 5 4   ? 128.841 80.771  150.487 1.00 101.12 ? 4   DG  I N1    1 
ATOM 6135  C C2    . DG  I 5 4   ? 129.932 80.081  150.955 1.00 101.12 ? 4   DG  I C2    1 
ATOM 6136  N N2    . DG  I 5 4   ? 131.036 80.117  150.200 1.00 101.12 ? 4   DG  I N2    1 
ATOM 6137  N N3    . DG  I 5 4   ? 129.945 79.398  152.083 1.00 101.12 ? 4   DG  I N3    1 
ATOM 6138  C C4    . DG  I 5 4   ? 128.760 79.460  152.722 1.00 101.12 ? 4   DG  I C4    1 
ATOM 6139  P P     . DG  I 5 5   ? 132.270 77.085  157.897 1.00 95.89  ? 5   DG  I P     1 
ATOM 6140  O OP1   . DG  I 5 5   ? 132.726 75.713  158.211 1.00 95.89  ? 5   DG  I OP1   1 
ATOM 6141  O OP2   . DG  I 5 5   ? 131.543 77.885  158.905 1.00 95.89  ? 5   DG  I OP2   1 
ATOM 6142  O "O5'" . DG  I 5 5   ? 133.533 77.950  157.436 1.00 95.89  ? 5   DG  I "O5'" 1 
ATOM 6143  C "C5'" . DG  I 5 5   ? 134.400 77.466  156.417 1.00 95.89  ? 5   DG  I "C5'" 1 
ATOM 6144  C "C4'" . DG  I 5 5   ? 134.924 78.602  155.548 1.00 95.89  ? 5   DG  I "C4'" 1 
ATOM 6145  O "O4'" . DG  I 5 5   ? 133.838 79.188  154.778 1.00 95.89  ? 5   DG  I "O4'" 1 
ATOM 6146  C "C3'" . DG  I 5 5   ? 135.576 79.761  156.296 1.00 95.89  ? 5   DG  I "C3'" 1 
ATOM 6147  O "O3'" . DG  I 5 5   ? 136.709 80.184  155.582 1.00 95.89  ? 5   DG  I "O3'" 1 
ATOM 6148  C "C2'" . DG  I 5 5   ? 134.486 80.830  156.280 1.00 95.89  ? 5   DG  I "C2'" 1 
ATOM 6149  C "C1'" . DG  I 5 5   ? 133.872 80.592  154.917 1.00 95.89  ? 5   DG  I "C1'" 1 
ATOM 6150  N N9    . DG  I 5 5   ? 132.507 81.098  154.768 1.00 95.89  ? 5   DG  I N9    1 
ATOM 6151  C C8    . DG  I 5 5   ? 131.453 80.866  155.602 1.00 95.89  ? 5   DG  I C8    1 
ATOM 6152  N N7    . DG  I 5 5   ? 130.341 81.422  155.207 1.00 95.89  ? 5   DG  I N7    1 
ATOM 6153  C C5    . DG  I 5 5   ? 130.683 82.069  154.031 1.00 95.89  ? 5   DG  I C5    1 
ATOM 6154  C C6    . DG  I 5 5   ? 129.892 82.845  153.154 1.00 95.89  ? 5   DG  I C6    1 
ATOM 6155  O O6    . DG  I 5 5   ? 128.692 83.128  153.247 1.00 95.89  ? 5   DG  I O6    1 
ATOM 6156  N N1    . DG  I 5 5   ? 130.629 83.314  152.079 1.00 95.89  ? 5   DG  I N1    1 
ATOM 6157  C C2    . DG  I 5 5   ? 131.963 83.066  151.874 1.00 95.89  ? 5   DG  I C2    1 
ATOM 6158  N N2    . DG  I 5 5   ? 132.507 83.604  150.776 1.00 95.89  ? 5   DG  I N2    1 
ATOM 6159  N N3    . DG  I 5 5   ? 132.715 82.340  152.687 1.00 95.89  ? 5   DG  I N3    1 
ATOM 6160  C C4    . DG  I 5 5   ? 132.012 81.875  153.742 1.00 95.89  ? 5   DG  I C4    1 
ATOM 6161  P P     . DA  I 5 6   ? 137.944 80.871  156.337 1.00 90.33  ? 6   DA  I P     1 
ATOM 6162  O OP1   . DA  I 5 6   ? 139.096 79.960  156.211 1.00 90.33  ? 6   DA  I OP1   1 
ATOM 6163  O OP2   . DA  I 5 6   ? 137.487 81.310  157.672 1.00 90.33  ? 6   DA  I OP2   1 
ATOM 6164  O "O5'" . DA  I 5 6   ? 138.228 82.177  155.470 1.00 90.33  ? 6   DA  I "O5'" 1 
ATOM 6165  C "C5'" . DA  I 5 6   ? 138.011 82.148  154.071 1.00 90.33  ? 6   DA  I "C5'" 1 
ATOM 6166  C "C4'" . DA  I 5 6   ? 137.614 83.519  153.555 1.00 90.33  ? 6   DA  I "C4'" 1 
ATOM 6167  O "O4'" . DA  I 5 6   ? 136.169 83.667  153.580 1.00 90.33  ? 6   DA  I "O4'" 1 
ATOM 6168  C "C3'" . DA  I 5 6   ? 138.178 84.700  154.341 1.00 90.33  ? 6   DA  I "C3'" 1 
ATOM 6169  O "O3'" . DA  I 5 6   ? 138.693 85.626  153.434 1.00 90.33  ? 6   DA  I "O3'" 1 
ATOM 6170  C "C2'" . DA  I 5 6   ? 136.953 85.253  155.070 1.00 90.33  ? 6   DA  I "C2'" 1 
ATOM 6171  C "C1'" . DA  I 5 6   ? 135.852 84.942  154.077 1.00 90.33  ? 6   DA  I "C1'" 1 
ATOM 6172  N N9    . DA  I 5 6   ? 134.522 84.878  154.669 1.00 90.33  ? 6   DA  I N9    1 
ATOM 6173  C C8    . DA  I 5 6   ? 134.167 84.221  155.802 1.00 90.33  ? 6   DA  I C8    1 
ATOM 6174  N N7    . DA  I 5 6   ? 132.896 84.319  156.097 1.00 90.33  ? 6   DA  I N7    1 
ATOM 6175  C C5    . DA  I 5 6   ? 132.380 85.097  155.085 1.00 90.33  ? 6   DA  I C5    1 
ATOM 6176  C C6    . DA  I 5 6   ? 131.086 85.571  154.822 1.00 90.33  ? 6   DA  I C6    1 
ATOM 6177  N N6    . DA  I 5 6   ? 130.038 85.306  155.602 1.00 90.33  ? 6   DA  I N6    1 
ATOM 6178  N N1    . DA  I 5 6   ? 130.906 86.333  153.727 1.00 90.33  ? 6   DA  I N1    1 
ATOM 6179  C C2    . DA  I 5 6   ? 131.958 86.599  152.948 1.00 90.33  ? 6   DA  I C2    1 
ATOM 6180  N N3    . DA  I 5 6   ? 133.221 86.208  153.093 1.00 90.33  ? 6   DA  I N3    1 
ATOM 6181  C C4    . DA  I 5 6   ? 133.365 85.453  154.192 1.00 90.33  ? 6   DA  I C4    1 
ATOM 6182  P P     . DT  I 5 7   ? 139.829 86.672  153.861 1.00 86.47  ? 7   DT  I P     1 
ATOM 6183  O OP1   . DT  I 5 7   ? 141.087 86.242  153.215 1.00 86.47  ? 7   DT  I OP1   1 
ATOM 6184  O OP2   . DT  I 5 7   ? 139.784 86.889  155.324 1.00 86.47  ? 7   DT  I OP2   1 
ATOM 6185  O "O5'" . DT  I 5 7   ? 139.341 88.002  153.147 1.00 86.47  ? 7   DT  I "O5'" 1 
ATOM 6186  C "C5'" . DT  I 5 7   ? 138.427 87.894  152.077 1.00 86.47  ? 7   DT  I "C5'" 1 
ATOM 6187  C "C4'" . DT  I 5 7   ? 137.368 88.964  152.165 1.00 86.47  ? 7   DT  I "C4'" 1 
ATOM 6188  O "O4'" . DT  I 5 7   ? 136.227 88.489  152.897 1.00 86.47  ? 7   DT  I "O4'" 1 
ATOM 6189  C "C3'" . DT  I 5 7   ? 137.814 90.235  152.866 1.00 86.47  ? 7   DT  I "C3'" 1 
ATOM 6190  O "O3'" . DT  I 5 7   ? 137.958 91.247  151.888 1.00 86.47  ? 7   DT  I "O3'" 1 
ATOM 6191  C "C2'" . DT  I 5 7   ? 136.683 90.528  153.876 1.00 86.47  ? 7   DT  I "C2'" 1 
ATOM 6192  C "C1'" . DT  I 5 7   ? 135.569 89.602  153.419 1.00 86.47  ? 7   DT  I "C1'" 1 
ATOM 6193  N N1    . DT  I 5 7   ? 134.650 89.143  154.507 1.00 86.47  ? 7   DT  I N1    1 
ATOM 6194  C C2    . DT  I 5 7   ? 133.305 89.440  154.432 1.00 86.47  ? 7   DT  I C2    1 
ATOM 6195  O O2    . DT  I 5 7   ? 132.814 90.083  153.530 1.00 86.47  ? 7   DT  I O2    1 
ATOM 6196  N N3    . DT  I 5 7   ? 132.555 88.959  155.466 1.00 86.47  ? 7   DT  I N3    1 
ATOM 6197  C C4    . DT  I 5 7   ? 132.995 88.230  156.542 1.00 86.47  ? 7   DT  I C4    1 
ATOM 6198  O O4    . DT  I 5 7   ? 132.240 87.843  157.422 1.00 86.47  ? 7   DT  I O4    1 
ATOM 6199  C C5    . DT  I 5 7   ? 134.406 87.948  156.557 1.00 86.47  ? 7   DT  I C5    1 
ATOM 6200  C C7    . DT  I 5 7   ? 135.000 87.154  157.679 1.00 86.47  ? 7   DT  I C7    1 
ATOM 6201  C C6    . DT  I 5 7   ? 135.156 88.411  155.549 1.00 86.47  ? 7   DT  I C6    1 
ATOM 6202  P P     . DG  I 5 8   ? 138.375 92.744  152.274 1.00 87.74  ? 8   DG  I P     1 
ATOM 6203  O OP1   . DG  I 5 8   ? 139.088 93.287  151.103 1.00 87.74  ? 8   DG  I OP1   1 
ATOM 6204  O OP2   . DG  I 5 8   ? 139.020 92.771  153.604 1.00 87.74  ? 8   DG  I OP2   1 
ATOM 6205  O "O5'" . DG  I 5 8   ? 136.975 93.486  152.335 1.00 87.74  ? 8   DG  I "O5'" 1 
ATOM 6206  C "C5'" . DG  I 5 8   ? 136.005 93.193  151.359 1.00 87.74  ? 8   DG  I "C5'" 1 
ATOM 6207  C "C4'" . DG  I 5 8   ? 134.712 93.909  151.656 1.00 87.74  ? 8   DG  I "C4'" 1 
ATOM 6208  O "O4'" . DG  I 5 8   ? 133.961 93.171  152.648 1.00 87.74  ? 8   DG  I "O4'" 1 
ATOM 6209  C "C3'" . DG  I 5 8   ? 134.875 95.323  152.194 1.00 87.74  ? 8   DG  I "C3'" 1 
ATOM 6210  O "O3'" . DG  I 5 8   ? 133.989 96.192  151.505 1.00 87.74  ? 8   DG  I "O3'" 1 
ATOM 6211  C "C2'" . DG  I 5 8   ? 134.524 95.184  153.676 1.00 87.74  ? 8   DG  I "C2'" 1 
ATOM 6212  C "C1'" . DG  I 5 8   ? 133.535 94.037  153.670 1.00 87.74  ? 8   DG  I "C1'" 1 
ATOM 6213  N N9    . DG  I 5 8   ? 133.500 93.276  154.920 1.00 87.74  ? 8   DG  I N9    1 
ATOM 6214  C C8    . DG  I 5 8   ? 134.558 92.700  155.564 1.00 87.74  ? 8   DG  I C8    1 
ATOM 6215  N N7    . DG  I 5 8   ? 134.223 92.067  156.650 1.00 87.74  ? 8   DG  I N7    1 
ATOM 6216  C C5    . DG  I 5 8   ? 132.853 92.236  156.730 1.00 87.74  ? 8   DG  I C5    1 
ATOM 6217  C C6    . DG  I 5 8   ? 131.936 91.774  157.696 1.00 87.74  ? 8   DG  I C6    1 
ATOM 6218  O O6    . DG  I 5 8   ? 132.158 91.098  158.708 1.00 87.74  ? 8   DG  I O6    1 
ATOM 6219  N N1    . DG  I 5 8   ? 130.638 92.167  157.399 1.00 87.74  ? 8   DG  I N1    1 
ATOM 6220  C C2    . DG  I 5 8   ? 130.282 92.928  156.316 1.00 87.74  ? 8   DG  I C2    1 
ATOM 6221  N N2    . DG  I 5 8   ? 128.981 93.205  156.180 1.00 87.74  ? 8   DG  I N2    1 
ATOM 6222  N N3    . DG  I 5 8   ? 131.131 93.348  155.398 1.00 87.74  ? 8   DG  I N3    1 
ATOM 6223  C C4    . DG  I 5 8   ? 132.394 92.973  155.671 1.00 87.74  ? 8   DG  I C4    1 
ATOM 6224  P P     . DT  I 5 9   ? 134.049 97.782  151.719 1.00 93.29  ? 9   DT  I P     1 
ATOM 6225  O OP1   . DT  I 5 9   ? 133.877 98.440  150.411 1.00 93.29  ? 9   DT  I OP1   1 
ATOM 6226  O OP2   . DT  I 5 9   ? 135.240 98.121  152.528 1.00 93.29  ? 9   DT  I OP2   1 
ATOM 6227  O "O5'" . DT  I 5 9   ? 132.716 98.071  152.532 1.00 93.29  ? 9   DT  I "O5'" 1 
ATOM 6228  C "C5'" . DT  I 5 9   ? 131.519 97.424  152.143 1.00 93.29  ? 9   DT  I "C5'" 1 
ATOM 6229  C "C4'" . DT  I 5 9   ? 130.457 97.545  153.220 1.00 93.29  ? 9   DT  I "C4'" 1 
ATOM 6230  O "O4'" . DT  I 5 9   ? 130.731 96.616  154.302 1.00 93.29  ? 9   DT  I "O4'" 1 
ATOM 6231  C "C3'" . DT  I 5 9   ? 130.335 98.923  153.871 1.00 93.29  ? 9   DT  I "C3'" 1 
ATOM 6232  O "O3'" . DT  I 5 9   ? 128.963 99.255  153.994 1.00 93.29  ? 9   DT  I "O3'" 1 
ATOM 6233  C "C2'" . DT  I 5 9   ? 130.986 98.707  155.238 1.00 93.29  ? 9   DT  I "C2'" 1 
ATOM 6234  C "C1'" . DT  I 5 9   ? 130.565 97.286  155.522 1.00 93.29  ? 9   DT  I "C1'" 1 
ATOM 6235  N N1    . DT  I 5 9   ? 131.385 96.611  156.550 1.00 93.29  ? 9   DT  I N1    1 
ATOM 6236  C C2    . DT  I 5 9   ? 130.755 95.986  157.588 1.00 93.29  ? 9   DT  I C2    1 
ATOM 6237  O O2    . DT  I 5 9   ? 129.550 95.956  157.710 1.00 93.29  ? 9   DT  I O2    1 
ATOM 6238  N N3    . DT  I 5 9   ? 131.588 95.386  158.483 1.00 93.29  ? 9   DT  I N3    1 
ATOM 6239  C C4    . DT  I 5 9   ? 132.961 95.352  158.450 1.00 93.29  ? 9   DT  I C4    1 
ATOM 6240  O O4    . DT  I 5 9   ? 133.620 94.786  159.309 1.00 93.29  ? 9   DT  I O4    1 
ATOM 6241  C C5    . DT  I 5 9   ? 133.566 96.027  157.340 1.00 93.29  ? 9   DT  I C5    1 
ATOM 6242  C C7    . DT  I 5 9   ? 135.056 96.053  157.207 1.00 93.29  ? 9   DT  I C7    1 
ATOM 6243  C C6    . DT  I 5 9   ? 132.760 96.622  156.450 1.00 93.29  ? 9   DT  I C6    1 
ATOM 6244  P P     . DA  I 5 10  ? 128.493 100.769 154.250 1.00 103.14 ? 10  DA  I P     1 
ATOM 6245  O OP1   . DA  I 5 10  ? 127.628 101.146 153.114 1.00 103.14 ? 10  DA  I OP1   1 
ATOM 6246  O OP2   . DA  I 5 10  ? 129.675 101.606 154.542 1.00 103.14 ? 10  DA  I OP2   1 
ATOM 6247  O "O5'" . DA  I 5 10  ? 127.576 100.649 155.557 1.00 103.14 ? 10  DA  I "O5'" 1 
ATOM 6248  C "C5'" . DA  I 5 10  ? 126.341 99.942  155.483 1.00 103.14 ? 10  DA  I "C5'" 1 
ATOM 6249  C "C4'" . DA  I 5 10  ? 125.836 99.522  156.859 1.00 103.14 ? 10  DA  I "C4'" 1 
ATOM 6250  O "O4'" . DA  I 5 10  ? 126.828 98.703  157.527 1.00 103.14 ? 10  DA  I "O4'" 1 
ATOM 6251  C "C3'" . DA  I 5 10  ? 125.505 100.655 157.825 1.00 103.14 ? 10  DA  I "C3'" 1 
ATOM 6252  O "O3'" . DA  I 5 10  ? 124.316 100.335 158.537 1.00 103.14 ? 10  DA  I "O3'" 1 
ATOM 6253  C "C2'" . DA  I 5 10  ? 126.722 100.687 158.747 1.00 103.14 ? 10  DA  I "C2'" 1 
ATOM 6254  C "C1'" . DA  I 5 10  ? 127.085 99.216  158.812 1.00 103.14 ? 10  DA  I "C1'" 1 
ATOM 6255  N N9    . DA  I 5 10  ? 128.486 98.975  159.105 1.00 103.14 ? 10  DA  I N9    1 
ATOM 6256  C C8    . DA  I 5 10  ? 129.552 99.361  158.356 1.00 103.14 ? 10  DA  I C8    1 
ATOM 6257  N N7    . DA  I 5 10  ? 130.704 98.991  158.848 1.00 103.14 ? 10  DA  I N7    1 
ATOM 6258  C C5    . DA  I 5 10  ? 130.367 98.310  159.996 1.00 103.14 ? 10  DA  I C5    1 
ATOM 6259  C C6    . DA  I 5 10  ? 131.139 97.667  160.972 1.00 103.14 ? 10  DA  I C6    1 
ATOM 6260  N N6    . DA  I 5 10  ? 132.471 97.612  160.930 1.00 103.14 ? 10  DA  I N6    1 
ATOM 6261  N N1    . DA  I 5 10  ? 130.490 97.076  161.996 1.00 103.14 ? 10  DA  I N1    1 
ATOM 6262  C C2    . DA  I 5 10  ? 129.156 97.142  162.036 1.00 103.14 ? 10  DA  I C2    1 
ATOM 6263  N N3    . DA  I 5 10  ? 128.325 97.711  161.170 1.00 103.14 ? 10  DA  I N3    1 
ATOM 6264  C C4    . DA  I 5 10  ? 129.002 98.284  160.166 1.00 103.14 ? 10  DA  I C4    1 
ATOM 6265  P P     . DT  I 5 11  ? 123.666 101.389 159.561 1.00 107.55 ? 11  DT  I P     1 
ATOM 6266  O OP1   . DT  I 5 11  ? 122.208 101.160 159.581 1.00 107.55 ? 11  DT  I OP1   1 
ATOM 6267  O OP2   . DT  I 5 11  ? 124.191 102.731 159.229 1.00 107.55 ? 11  DT  I OP2   1 
ATOM 6268  O "O5'" . DT  I 5 11  ? 124.255 100.956 160.982 1.00 107.55 ? 11  DT  I "O5'" 1 
ATOM 6269  C "C5'" . DT  I 5 11  ? 124.055 99.630  161.462 1.00 107.55 ? 11  DT  I "C5'" 1 
ATOM 6270  C "C4'" . DT  I 5 11  ? 124.450 99.506  162.925 1.00 107.55 ? 11  DT  I "C4'" 1 
ATOM 6271  O "O4'" . DT  I 5 11  ? 125.860 99.177  163.038 1.00 107.55 ? 11  DT  I "O4'" 1 
ATOM 6272  C "C3'" . DT  I 5 11  ? 124.246 100.763 163.764 1.00 107.55 ? 11  DT  I "C3'" 1 
ATOM 6273  O "O3'" . DT  I 5 11  ? 123.747 100.402 165.043 1.00 107.55 ? 11  DT  I "O3'" 1 
ATOM 6274  C "C2'" . DT  I 5 11  ? 125.658 101.330 163.861 1.00 107.55 ? 11  DT  I "C2'" 1 
ATOM 6275  C "C1'" . DT  I 5 11  ? 126.472 100.060 163.947 1.00 107.55 ? 11  DT  I "C1'" 1 
ATOM 6276  N N1    . DT  I 5 11  ? 127.890 100.230 163.549 1.00 107.55 ? 11  DT  I N1    1 
ATOM 6277  C C2    . DT  I 5 11  ? 128.877 99.657  164.311 1.00 107.55 ? 11  DT  I C2    1 
ATOM 6278  O O2    . DT  I 5 11  ? 128.656 99.008  165.313 1.00 107.55 ? 11  DT  I O2    1 
ATOM 6279  N N3    . DT  I 5 11  ? 130.144 99.866  163.856 1.00 107.55 ? 11  DT  I N3    1 
ATOM 6280  C C4    . DT  I 5 11  ? 130.519 100.578 162.741 1.00 107.55 ? 11  DT  I C4    1 
ATOM 6281  O O4    . DT  I 5 11  ? 131.690 100.707 162.414 1.00 107.55 ? 11  DT  I O4    1 
ATOM 6282  C C5    . DT  I 5 11  ? 129.440 101.155 161.985 1.00 107.55 ? 11  DT  I C5    1 
ATOM 6283  C C7    . DT  I 5 11  ? 129.733 101.952 160.750 1.00 107.55 ? 11  DT  I C7    1 
ATOM 6284  C C6    . DT  I 5 11  ? 128.189 100.955 162.419 1.00 107.55 ? 11  DT  I C6    1 
ATOM 6285  P P     . DA  I 5 12  ? 122.918 101.457 165.922 1.00 109.00 ? 12  DA  I P     1 
ATOM 6286  O OP1   . DA  I 5 12  ? 121.544 100.933 166.053 1.00 109.00 ? 12  DA  I OP1   1 
ATOM 6287  O OP2   . DA  I 5 12  ? 123.147 102.804 165.359 1.00 109.00 ? 12  DA  I OP2   1 
ATOM 6288  O "O5'" . DA  I 5 12  ? 123.633 101.413 167.350 1.00 109.00 ? 12  DA  I "O5'" 1 
ATOM 6289  C "C5'" . DA  I 5 12  ? 123.916 100.167 167.967 1.00 109.00 ? 12  DA  I "C5'" 1 
ATOM 6290  C "C4'" . DA  I 5 12  ? 125.129 100.269 168.881 1.00 109.00 ? 12  DA  I "C4'" 1 
ATOM 6291  O "O4'" . DA  I 5 12  ? 126.336 100.339 168.087 1.00 109.00 ? 12  DA  I "O4'" 1 
ATOM 6292  C "C3'" . DA  I 5 12  ? 125.160 101.494 169.804 1.00 109.00 ? 12  DA  I "C3'" 1 
ATOM 6293  O "O3'" . DA  I 5 12  ? 125.535 101.096 171.113 1.00 109.00 ? 12  DA  I "O3'" 1 
ATOM 6294  C "C2'" . DA  I 5 12  ? 126.221 102.385 169.166 1.00 109.00 ? 12  DA  I "C2'" 1 
ATOM 6295  C "C1'" . DA  I 5 12  ? 127.166 101.345 168.610 1.00 109.00 ? 12  DA  I "C1'" 1 
ATOM 6296  N N9    . DA  I 5 12  ? 128.020 101.837 167.542 1.00 109.00 ? 12  DA  I N9    1 
ATOM 6297  C C8    . DA  I 5 12  ? 127.632 102.491 166.413 1.00 109.00 ? 12  DA  I C8    1 
ATOM 6298  N N7    . DA  I 5 12  ? 128.624 102.802 165.616 1.00 109.00 ? 12  DA  I N7    1 
ATOM 6299  C C5    . DA  I 5 12  ? 129.739 102.315 166.273 1.00 109.00 ? 12  DA  I C5    1 
ATOM 6300  C C6    . DA  I 5 12  ? 131.106 102.326 165.956 1.00 109.00 ? 12  DA  I C6    1 
ATOM 6301  N N6    . DA  I 5 12  ? 131.594 102.870 164.843 1.00 109.00 ? 12  DA  I N6    1 
ATOM 6302  N N1    . DA  I 5 12  ? 131.956 101.750 166.829 1.00 109.00 ? 12  DA  I N1    1 
ATOM 6303  C C2    . DA  I 5 12  ? 131.463 101.209 167.945 1.00 109.00 ? 12  DA  I C2    1 
ATOM 6304  N N3    . DA  I 5 12  ? 130.198 101.137 168.348 1.00 109.00 ? 12  DA  I N3    1 
ATOM 6305  C C4    . DA  I 5 12  ? 129.382 101.715 167.459 1.00 109.00 ? 12  DA  I C4    1 
ATOM 6306  P P     . DT  I 5 13  ? 125.352 102.096 172.358 1.00 103.60 ? 13  DT  I P     1 
ATOM 6307  O OP1   . DT  I 5 13  ? 124.775 101.300 173.462 1.00 103.60 ? 13  DT  I OP1   1 
ATOM 6308  O OP2   . DT  I 5 13  ? 124.677 103.328 171.900 1.00 103.60 ? 13  DT  I OP2   1 
ATOM 6309  O "O5'" . DT  I 5 13  ? 126.846 102.470 172.770 1.00 103.60 ? 13  DT  I "O5'" 1 
ATOM 6310  C "C5'" . DT  I 5 13  ? 127.675 101.473 173.336 1.00 103.60 ? 13  DT  I "C5'" 1 
ATOM 6311  C "C4'" . DT  I 5 13  ? 129.091 101.977 173.500 1.00 103.60 ? 13  DT  I "C4'" 1 
ATOM 6312  O "O4'" . DT  I 5 13  ? 129.683 102.203 172.196 1.00 103.60 ? 13  DT  I "O4'" 1 
ATOM 6313  C "C3'" . DT  I 5 13  ? 129.223 103.302 174.262 1.00 103.60 ? 13  DT  I "C3'" 1 
ATOM 6314  O "O3'" . DT  I 5 13  ? 130.194 103.171 175.294 1.00 103.60 ? 13  DT  I "O3'" 1 
ATOM 6315  C "C2'" . DT  I 5 13  ? 129.678 104.285 173.184 1.00 103.60 ? 13  DT  I "C2'" 1 
ATOM 6316  C "C1'" . DT  I 5 13  ? 130.454 103.371 172.262 1.00 103.60 ? 13  DT  I "C1'" 1 
ATOM 6317  N N1    . DT  I 5 13  ? 130.610 103.912 170.905 1.00 103.60 ? 13  DT  I N1    1 
ATOM 6318  C C2    . DT  I 5 13  ? 131.858 103.966 170.348 1.00 103.60 ? 13  DT  I C2    1 
ATOM 6319  O O2    . DT  I 5 13  ? 132.858 103.575 170.914 1.00 103.60 ? 13  DT  I O2    1 
ATOM 6320  N N3    . DT  I 5 13  ? 131.899 104.490 169.093 1.00 103.60 ? 13  DT  I N3    1 
ATOM 6321  C C4    . DT  I 5 13  ? 130.837 104.962 168.355 1.00 103.60 ? 13  DT  I C4    1 
ATOM 6322  O O4    . DT  I 5 13  ? 130.975 105.418 167.231 1.00 103.60 ? 13  DT  I O4    1 
ATOM 6323  C C5    . DT  I 5 13  ? 129.553 104.883 169.001 1.00 103.60 ? 13  DT  I C5    1 
ATOM 6324  C C7    . DT  I 5 13  ? 128.324 105.371 168.296 1.00 103.60 ? 13  DT  I C7    1 
ATOM 6325  C C6    . DT  I 5 13  ? 129.502 104.369 170.232 1.00 103.60 ? 13  DT  I C6    1 
ATOM 6326  P P     . DA  I 5 14  ? 130.329 104.297 176.432 1.00 96.85  ? 14  DA  I P     1 
ATOM 6327  O OP1   . DA  I 5 14  ? 130.478 103.600 177.727 1.00 96.85  ? 14  DA  I OP1   1 
ATOM 6328  O OP2   . DA  I 5 14  ? 129.230 105.275 176.254 1.00 96.85  ? 14  DA  I OP2   1 
ATOM 6329  O "O5'" . DA  I 5 14  ? 131.724 105.005 176.101 1.00 96.85  ? 14  DA  I "O5'" 1 
ATOM 6330  C "C5'" . DA  I 5 14  ? 132.937 104.350 176.446 1.00 96.85  ? 14  DA  I "C5'" 1 
ATOM 6331  C "C4'" . DA  I 5 14  ? 134.138 105.007 175.785 1.00 96.85  ? 14  DA  I "C4'" 1 
ATOM 6332  O "O4'" . DA  I 5 14  ? 133.916 105.133 174.357 1.00 96.85  ? 14  DA  I "O4'" 1 
ATOM 6333  C "C3'" . DA  I 5 14  ? 134.475 106.413 176.279 1.00 96.85  ? 14  DA  I "C3'" 1 
ATOM 6334  O "O3'" . DA  I 5 14  ? 135.881 106.539 176.388 1.00 96.85  ? 14  DA  I "O3'" 1 
ATOM 6335  C "C2'" . DA  I 5 14  ? 133.929 107.297 175.163 1.00 96.85  ? 14  DA  I "C2'" 1 
ATOM 6336  C "C1'" . DA  I 5 14  ? 134.250 106.438 173.959 1.00 96.85  ? 14  DA  I "C1'" 1 
ATOM 6337  N N9    . DA  I 5 14  ? 133.482 106.764 172.767 1.00 96.85  ? 14  DA  I N9    1 
ATOM 6338  C C8    . DA  I 5 14  ? 132.126 106.768 172.641 1.00 96.85  ? 14  DA  I C8    1 
ATOM 6339  N N7    . DA  I 5 14  ? 131.709 107.088 171.444 1.00 96.85  ? 14  DA  I N7    1 
ATOM 6340  C C5    . DA  I 5 14  ? 132.873 107.303 170.736 1.00 96.85  ? 14  DA  I C5    1 
ATOM 6341  C C6    . DA  I 5 14  ? 133.113 107.673 169.405 1.00 96.85  ? 14  DA  I C6    1 
ATOM 6342  N N6    . DA  I 5 14  ? 132.141 107.897 168.525 1.00 96.85  ? 14  DA  I N6    1 
ATOM 6343  N N1    . DA  I 5 14  ? 134.392 107.805 169.012 1.00 96.85  ? 14  DA  I N1    1 
ATOM 6344  C C2    . DA  I 5 14  ? 135.368 107.578 169.896 1.00 96.85  ? 14  DA  I C2    1 
ATOM 6345  N N3    . DA  I 5 14  ? 135.264 107.224 171.176 1.00 96.85  ? 14  DA  I N3    1 
ATOM 6346  C C4    . DA  I 5 14  ? 133.977 107.103 171.533 1.00 96.85  ? 14  DA  I C4    1 
ATOM 6347  P P     . DT  I 5 15  ? 136.526 107.386 177.585 1.00 90.01  ? 15  DT  I P     1 
ATOM 6348  O OP1   . DT  I 5 15  ? 136.856 106.459 178.690 1.00 90.01  ? 15  DT  I OP1   1 
ATOM 6349  O OP2   . DT  I 5 15  ? 135.619 108.532 177.820 1.00 90.01  ? 15  DT  I OP2   1 
ATOM 6350  O "O5'" . DT  I 5 15  ? 137.901 107.933 176.973 1.00 90.01  ? 15  DT  I "O5'" 1 
ATOM 6351  C "C5'" . DT  I 5 15  ? 138.154 107.836 175.575 1.00 90.01  ? 15  DT  I "C5'" 1 
ATOM 6352  C "C4'" . DT  I 5 15  ? 138.223 109.214 174.942 1.00 90.01  ? 15  DT  I "C4'" 1 
ATOM 6353  O "O4'" . DT  I 5 15  ? 137.363 109.245 173.781 1.00 90.01  ? 15  DT  I "O4'" 1 
ATOM 6354  C "C3'" . DT  I 5 15  ? 137.721 110.348 175.838 1.00 90.01  ? 15  DT  I "C3'" 1 
ATOM 6355  O "O3'" . DT  I 5 15  ? 138.798 111.147 176.457 1.00 90.01  ? 15  DT  I "O3'" 1 
ATOM 6356  C "C2'" . DT  I 5 15  ? 136.789 111.181 174.948 1.00 90.01  ? 15  DT  I "C2'" 1 
ATOM 6357  C "C1'" . DT  I 5 15  ? 136.974 110.569 173.564 1.00 90.01  ? 15  DT  I "C1'" 1 
ATOM 6358  N N1    . DT  I 5 15  ? 135.739 110.585 172.763 1.00 90.01  ? 15  DT  I N1    1 
ATOM 6359  C C2    . DT  I 5 15  ? 135.815 110.805 171.411 1.00 90.01  ? 15  DT  I C2    1 
ATOM 6360  O O2    . DT  I 5 15  ? 136.862 110.962 170.820 1.00 90.01  ? 15  DT  I O2    1 
ATOM 6361  N N3    . DT  I 5 15  ? 134.613 110.816 170.769 1.00 90.01  ? 15  DT  I N3    1 
ATOM 6362  C C4    . DT  I 5 15  ? 133.370 110.647 171.336 1.00 90.01  ? 15  DT  I C4    1 
ATOM 6363  O O4    . DT  I 5 15  ? 132.341 110.675 170.675 1.00 90.01  ? 15  DT  I O4    1 
ATOM 6364  C C5    . DT  I 5 15  ? 133.362 110.432 172.758 1.00 90.01  ? 15  DT  I C5    1 
ATOM 6365  C C7    . DT  I 5 15  ? 132.070 110.232 173.486 1.00 90.01  ? 15  DT  I C7    1 
ATOM 6366  C C6    . DT  I 5 15  ? 134.533 110.417 173.394 1.00 90.01  ? 15  DT  I C6    1 
ATOM 6367  P P     . DC  I 5 16  ? 140.196 111.540 175.746 1.00 81.79  ? 16  DC  I P     1 
ATOM 6368  O OP1   . DC  I 5 16  ? 141.129 110.397 175.706 1.00 81.79  ? 16  DC  I OP1   1 
ATOM 6369  O OP2   . DC  I 5 16  ? 140.620 112.744 176.477 1.00 81.79  ? 16  DC  I OP2   1 
ATOM 6370  O "O5'" . DC  I 5 16  ? 139.841 112.042 174.270 1.00 81.79  ? 16  DC  I "O5'" 1 
ATOM 6371  C "C5'" . DC  I 5 16  ? 140.834 111.955 173.248 1.00 81.79  ? 16  DC  I "C5'" 1 
ATOM 6372  C "C4'" . DC  I 5 16  ? 140.728 113.090 172.237 1.00 81.79  ? 16  DC  I "C4'" 1 
ATOM 6373  O "O4'" . DC  I 5 16  ? 139.387 113.166 171.691 1.00 81.79  ? 16  DC  I "O4'" 1 
ATOM 6374  C "C3'" . DC  I 5 16  ? 141.045 114.484 172.760 1.00 81.79  ? 16  DC  I "C3'" 1 
ATOM 6375  O "O3'" . DC  I 5 16  ? 141.742 115.187 171.757 1.00 81.79  ? 16  DC  I "O3'" 1 
ATOM 6376  C "C2'" . DC  I 5 16  ? 139.656 115.076 172.980 1.00 81.79  ? 16  DC  I "C2'" 1 
ATOM 6377  C "C1'" . DC  I 5 16  ? 138.912 114.489 171.796 1.00 81.79  ? 16  DC  I "C1'" 1 
ATOM 6378  N N1    . DC  I 5 16  ? 137.441 114.414 171.965 1.00 81.79  ? 16  DC  I N1    1 
ATOM 6379  C C2    . DC  I 5 16  ? 136.620 114.451 170.838 1.00 81.79  ? 16  DC  I C2    1 
ATOM 6380  O O2    . DC  I 5 16  ? 137.135 114.580 169.728 1.00 81.79  ? 16  DC  I O2    1 
ATOM 6381  N N3    . DC  I 5 16  ? 135.285 114.353 170.998 1.00 81.79  ? 16  DC  I N3    1 
ATOM 6382  C C4    . DC  I 5 16  ? 134.770 114.214 172.214 1.00 81.79  ? 16  DC  I C4    1 
ATOM 6383  N N4    . DC  I 5 16  ? 133.442 114.120 172.326 1.00 81.79  ? 16  DC  I N4    1 
ATOM 6384  C C5    . DC  I 5 16  ? 135.594 114.166 173.375 1.00 81.79  ? 16  DC  I C5    1 
ATOM 6385  C C6    . DC  I 5 16  ? 136.911 114.267 173.203 1.00 81.79  ? 16  DC  I C6    1 
ATOM 6386  P P     . DT  I 5 17  ? 142.792 116.338 172.134 1.00 73.85  ? 17  DT  I P     1 
ATOM 6387  O OP1   . DT  I 5 17  ? 144.143 115.760 171.987 1.00 73.85  ? 17  DT  I OP1   1 
ATOM 6388  O OP2   . DT  I 5 17  ? 142.373 116.948 173.414 1.00 73.85  ? 17  DT  I OP2   1 
ATOM 6389  O "O5'" . DT  I 5 17  ? 142.589 117.415 170.975 1.00 73.85  ? 17  DT  I "O5'" 1 
ATOM 6390  C "C5'" . DT  I 5 17  ? 142.627 116.999 169.617 1.00 73.85  ? 17  DT  I "C5'" 1 
ATOM 6391  C "C4'" . DT  I 5 17  ? 141.687 117.822 168.751 1.00 73.85  ? 17  DT  I "C4'" 1 
ATOM 6392  O "O4'" . DT  I 5 17  ? 140.305 117.510 169.071 1.00 73.85  ? 17  DT  I "O4'" 1 
ATOM 6393  C "C3'" . DT  I 5 17  ? 141.812 119.336 168.892 1.00 73.85  ? 17  DT  I "C3'" 1 
ATOM 6394  O "O3'" . DT  I 5 17  ? 141.678 119.923 167.620 1.00 73.85  ? 17  DT  I "O3'" 1 
ATOM 6395  C "C2'" . DT  I 5 17  ? 140.612 119.679 169.768 1.00 73.85  ? 17  DT  I "C2'" 1 
ATOM 6396  C "C1'" . DT  I 5 17  ? 139.596 118.714 169.207 1.00 73.85  ? 17  DT  I "C1'" 1 
ATOM 6397  N N1    . DT  I 5 17  ? 138.430 118.481 170.078 1.00 73.85  ? 17  DT  I N1    1 
ATOM 6398  C C2    . DT  I 5 17  ? 137.201 118.304 169.505 1.00 73.85  ? 17  DT  I C2    1 
ATOM 6399  O O2    . DT  I 5 17  ? 137.019 118.339 168.307 1.00 73.85  ? 17  DT  I O2    1 
ATOM 6400  N N3    . DT  I 5 17  ? 136.186 118.084 170.387 1.00 73.85  ? 17  DT  I N3    1 
ATOM 6401  C C4    . DT  I 5 17  ? 136.274 118.026 171.755 1.00 73.85  ? 17  DT  I C4    1 
ATOM 6402  O O4    . DT  I 5 17  ? 135.303 117.824 172.466 1.00 73.85  ? 17  DT  I O4    1 
ATOM 6403  C C5    . DT  I 5 17  ? 137.595 118.218 172.295 1.00 73.85  ? 17  DT  I C5    1 
ATOM 6404  C C7    . DT  I 5 17  ? 137.815 118.176 173.777 1.00 73.85  ? 17  DT  I C7    1 
ATOM 6405  C C6    . DT  I 5 17  ? 138.599 118.433 171.438 1.00 73.85  ? 17  DT  I C6    1 
ATOM 6406  P P     . DG  I 5 18  ? 142.886 120.741 166.959 1.00 67.82  ? 18  DG  I P     1 
ATOM 6407  O OP1   . DG  I 5 18  ? 143.901 119.766 166.521 1.00 67.82  ? 18  DG  I OP1   1 
ATOM 6408  O OP2   . DG  I 5 18  ? 143.251 121.829 167.888 1.00 67.82  ? 18  DG  I OP2   1 
ATOM 6409  O "O5'" . DG  I 5 18  ? 142.226 121.394 165.658 1.00 67.82  ? 18  DG  I "O5'" 1 
ATOM 6410  C "C5'" . DG  I 5 18  ? 141.196 120.704 164.953 1.00 67.82  ? 18  DG  I "C5'" 1 
ATOM 6411  C "C4'" . DG  I 5 18  ? 139.923 121.540 164.826 1.00 67.82  ? 18  DG  I "C4'" 1 
ATOM 6412  O "O4'" . DG  I 5 18  ? 139.113 121.411 166.018 1.00 67.82  ? 18  DG  I "O4'" 1 
ATOM 6413  C "C3'" . DG  I 5 18  ? 140.105 123.044 164.621 1.00 67.82  ? 18  DG  I "C3'" 1 
ATOM 6414  O "O3'" . DG  I 5 18  ? 139.050 123.520 163.804 1.00 67.82  ? 18  DG  I "O3'" 1 
ATOM 6415  C "C2'" . DG  I 5 18  ? 139.928 123.572 166.038 1.00 67.82  ? 18  DG  I "C2'" 1 
ATOM 6416  C "C1'" . DG  I 5 18  ? 138.780 122.696 166.481 1.00 67.82  ? 18  DG  I "C1'" 1 
ATOM 6417  N N9    . DG  I 5 18  ? 138.602 122.618 167.912 1.00 67.82  ? 18  DG  I N9    1 
ATOM 6418  C C8    . DG  I 5 18  ? 139.531 122.856 168.879 1.00 67.82  ? 18  DG  I C8    1 
ATOM 6419  N N7    . DG  I 5 18  ? 139.077 122.681 170.085 1.00 67.82  ? 18  DG  I N7    1 
ATOM 6420  C C5    . DG  I 5 18  ? 137.764 122.305 169.896 1.00 67.82  ? 18  DG  I C5    1 
ATOM 6421  C C6    . DG  I 5 18  ? 136.764 121.986 170.833 1.00 67.82  ? 18  DG  I C6    1 
ATOM 6422  O O6    . DG  I 5 18  ? 136.839 121.960 172.061 1.00 67.82  ? 18  DG  I O6    1 
ATOM 6423  N N1    . DG  I 5 18  ? 135.569 121.656 170.214 1.00 67.82  ? 18  DG  I N1    1 
ATOM 6424  C C2    . DG  I 5 18  ? 135.365 121.639 168.865 1.00 67.82  ? 18  DG  I C2    1 
ATOM 6425  N N2    . DG  I 5 18  ? 134.143 121.313 168.459 1.00 67.82  ? 18  DG  I N2    1 
ATOM 6426  N N3    . DG  I 5 18  ? 136.290 121.939 167.977 1.00 67.82  ? 18  DG  I N3    1 
ATOM 6427  C C4    . DG  I 5 18  ? 137.461 122.259 168.563 1.00 67.82  ? 18  DG  I C4    1 
ATOM 6428  P P     . DA  I 5 19  ? 139.235 123.747 162.228 1.00 60.80  ? 19  DA  I P     1 
ATOM 6429  O OP1   . DA  I 5 19  ? 139.825 122.537 161.631 1.00 60.80  ? 19  DA  I OP1   1 
ATOM 6430  O OP2   . DA  I 5 19  ? 139.873 125.064 162.043 1.00 60.80  ? 19  DA  I OP2   1 
ATOM 6431  O "O5'" . DA  I 5 19  ? 137.735 123.869 161.706 1.00 60.80  ? 19  DA  I "O5'" 1 
ATOM 6432  C "C5'" . DA  I 5 19  ? 136.770 122.908 162.112 1.00 60.80  ? 19  DA  I "C5'" 1 
ATOM 6433  C "C4'" . DA  I 5 19  ? 135.460 123.542 162.583 1.00 60.80  ? 19  DA  I "C4'" 1 
ATOM 6434  O "O4'" . DA  I 5 19  ? 135.464 123.725 164.019 1.00 60.80  ? 19  DA  I "O4'" 1 
ATOM 6435  C "C3'" . DA  I 5 19  ? 135.094 124.900 162.015 1.00 60.80  ? 19  DA  I "C3'" 1 
ATOM 6436  O "O3'" . DA  I 5 19  ? 133.707 124.974 162.002 1.00 60.80  ? 19  DA  I "O3'" 1 
ATOM 6437  C "C2'" . DA  I 5 19  ? 135.643 125.836 163.077 1.00 60.80  ? 19  DA  I "C2'" 1 
ATOM 6438  C "C1'" . DA  I 5 19  ? 135.223 125.083 164.318 1.00 60.80  ? 19  DA  I "C1'" 1 
ATOM 6439  N N9    . DA  I 5 19  ? 135.981 125.412 165.512 1.00 60.80  ? 19  DA  I N9    1 
ATOM 6440  C C8    . DA  I 5 19  ? 137.259 125.866 165.574 1.00 60.80  ? 19  DA  I C8    1 
ATOM 6441  N N7    . DA  I 5 19  ? 137.689 126.051 166.791 1.00 60.80  ? 19  DA  I N7    1 
ATOM 6442  C C5    . DA  I 5 19  ? 136.620 125.675 167.578 1.00 60.80  ? 19  DA  I C5    1 
ATOM 6443  C C6    . DA  I 5 19  ? 136.433 125.637 168.966 1.00 60.80  ? 19  DA  I C6    1 
ATOM 6444  N N6    . DA  I 5 19  ? 137.372 125.994 169.842 1.00 60.80  ? 19  DA  I N6    1 
ATOM 6445  N N1    . DA  I 5 19  ? 135.240 125.217 169.426 1.00 60.80  ? 19  DA  I N1    1 
ATOM 6446  C C2    . DA  I 5 19  ? 134.304 124.864 168.553 1.00 60.80  ? 19  DA  I C2    1 
ATOM 6447  N N3    . DA  I 5 19  ? 134.370 124.854 167.232 1.00 60.80  ? 19  DA  I N3    1 
ATOM 6448  C C4    . DA  I 5 19  ? 135.565 125.276 166.806 1.00 60.80  ? 19  DA  I C4    1 
ATOM 6449  P P     . DC  I 5 20  ? 132.913 125.637 160.787 1.00 48.40  ? 20  DC  I P     1 
ATOM 6450  O OP1   . DC  I 5 20  ? 132.915 124.640 159.707 1.00 48.40  ? 20  DC  I OP1   1 
ATOM 6451  O OP2   . DC  I 5 20  ? 133.457 126.984 160.555 1.00 48.40  ? 20  DC  I OP2   1 
ATOM 6452  O "O5'" . DC  I 5 20  ? 131.441 125.807 161.375 1.00 48.40  ? 20  DC  I "O5'" 1 
ATOM 6453  C "C5'" . DC  I 5 20  ? 130.936 124.845 162.287 1.00 48.40  ? 20  DC  I "C5'" 1 
ATOM 6454  C "C4'" . DC  I 5 20  ? 130.274 125.491 163.498 1.00 48.40  ? 20  DC  I "C4'" 1 
ATOM 6455  O "O4'" . DC  I 5 20  ? 131.260 125.827 164.518 1.00 48.40  ? 20  DC  I "O4'" 1 
ATOM 6456  C "C3'" . DC  I 5 20  ? 129.512 126.776 163.235 1.00 48.40  ? 20  DC  I "C3'" 1 
ATOM 6457  O "O3'" . DC  I 5 20  ? 128.368 126.782 164.041 1.00 48.40  ? 20  DC  I "O3'" 1 
ATOM 6458  C "C2'" . DC  I 5 20  ? 130.501 127.830 163.712 1.00 48.40  ? 20  DC  I "C2'" 1 
ATOM 6459  C "C1'" . DC  I 5 20  ? 131.035 127.149 164.945 1.00 48.40  ? 20  DC  I "C1'" 1 
ATOM 6460  N N1    . DC  I 5 20  ? 132.315 127.706 165.441 1.00 48.40  ? 20  DC  I N1    1 
ATOM 6461  C C2    . DC  I 5 20  ? 132.562 127.790 166.820 1.00 48.40  ? 20  DC  I C2    1 
ATOM 6462  O O2    . DC  I 5 20  ? 131.700 127.418 167.617 1.00 48.40  ? 20  DC  I O2    1 
ATOM 6463  N N3    . DC  I 5 20  ? 133.742 128.289 167.242 1.00 48.40  ? 20  DC  I N3    1 
ATOM 6464  C C4    . DC  I 5 20  ? 134.647 128.681 166.361 1.00 48.40  ? 20  DC  I C4    1 
ATOM 6465  N N4    . DC  I 5 20  ? 135.799 129.165 166.821 1.00 48.40  ? 20  DC  I N4    1 
ATOM 6466  C C5    . DC  I 5 20  ? 134.417 128.601 164.964 1.00 48.40  ? 20  DC  I C5    1 
ATOM 6467  C C6    . DC  I 5 20  ? 133.250 128.111 164.554 1.00 48.40  ? 20  DC  I C6    1 
ATOM 6468  P P     . DA  I 5 21  ? 126.918 126.975 163.400 1.00 49.07  ? 21  DA  I P     1 
ATOM 6469  O OP1   . DA  I 5 21  ? 126.355 125.637 163.173 1.00 49.07  ? 21  DA  I OP1   1 
ATOM 6470  O OP2   . DA  I 5 21  ? 127.059 127.952 162.310 1.00 49.07  ? 21  DA  I OP2   1 
ATOM 6471  O "O5'" . DA  I 5 21  ? 126.080 127.663 164.561 1.00 49.07  ? 21  DA  I "O5'" 1 
ATOM 6472  C "C5'" . DA  I 5 21  ? 126.077 127.095 165.850 1.00 49.07  ? 21  DA  I "C5'" 1 
ATOM 6473  C "C4'" . DA  I 5 21  ? 126.279 128.157 166.914 1.00 49.07  ? 21  DA  I "C4'" 1 
ATOM 6474  O "O4'" . DA  I 5 21  ? 127.663 128.532 166.972 1.00 49.07  ? 21  DA  I "O4'" 1 
ATOM 6475  C "C3'" . DA  I 5 21  ? 125.495 129.446 166.702 1.00 49.07  ? 21  DA  I "C3'" 1 
ATOM 6476  O "O3'" . DA  I 5 21  ? 124.597 129.623 167.793 1.00 49.07  ? 21  DA  I "O3'" 1 
ATOM 6477  C "C2'" . DA  I 5 21  ? 126.574 130.541 166.640 1.00 49.07  ? 21  DA  I "C2'" 1 
ATOM 6478  C "C1'" . DA  I 5 21  ? 127.759 129.884 167.306 1.00 49.07  ? 21  DA  I "C1'" 1 
ATOM 6479  N N9    . DA  I 5 21  ? 129.038 130.354 166.812 1.00 49.07  ? 21  DA  I N9    1 
ATOM 6480  C C8    . DA  I 5 21  ? 129.394 130.503 165.517 1.00 49.07  ? 21  DA  I C8    1 
ATOM 6481  N N7    . DA  I 5 21  ? 130.623 130.909 165.346 1.00 49.07  ? 21  DA  I N7    1 
ATOM 6482  C C5    . DA  I 5 21  ? 131.105 131.046 166.626 1.00 49.07  ? 21  DA  I C5    1 
ATOM 6483  C C6    . DA  I 5 21  ? 132.348 131.455 167.125 1.00 49.07  ? 21  DA  I C6    1 
ATOM 6484  N N6    . DA  I 5 21  ? 133.365 131.815 166.346 1.00 49.07  ? 21  DA  I N6    1 
ATOM 6485  N N1    . DA  I 5 21  ? 132.507 131.482 168.456 1.00 49.07  ? 21  DA  I N1    1 
ATOM 6486  C C2    . DA  I 5 21  ? 131.485 131.134 169.234 1.00 49.07  ? 21  DA  I C2    1 
ATOM 6487  N N3    . DA  I 5 21  ? 130.272 130.717 168.881 1.00 49.07  ? 21  DA  I N3    1 
ATOM 6488  C C4    . DA  I 5 21  ? 130.147 130.700 167.548 1.00 49.07  ? 21  DA  I C4    1 
ATOM 6489  P P     . DC  I 5 22  ? 123.673 130.929 167.926 1.00 54.95  ? 22  DC  I P     1 
ATOM 6490  O OP1   . DC  I 5 22  ? 122.483 130.503 168.683 1.00 54.95  ? 22  DC  I OP1   1 
ATOM 6491  O OP2   . DC  I 5 22  ? 123.507 131.585 166.613 1.00 54.95  ? 22  DC  I OP2   1 
ATOM 6492  O "O5'" . DC  I 5 22  ? 124.509 131.868 168.901 1.00 54.95  ? 22  DC  I "O5'" 1 
ATOM 6493  C "C5'" . DC  I 5 22  ? 125.005 131.326 170.108 1.00 54.95  ? 22  DC  I "C5'" 1 
ATOM 6494  C "C4'" . DC  I 5 22  ? 125.923 132.299 170.812 1.00 54.95  ? 22  DC  I "C4'" 1 
ATOM 6495  O "O4'" . DC  I 5 22  ? 127.188 132.372 170.119 1.00 54.95  ? 22  DC  I "O4'" 1 
ATOM 6496  C "C3'" . DC  I 5 22  ? 125.400 133.734 170.908 1.00 54.95  ? 22  DC  I "C3'" 1 
ATOM 6497  O "O3'" . DC  I 5 22  ? 125.421 134.146 172.266 1.00 54.95  ? 22  DC  I "O3'" 1 
ATOM 6498  C "C2'" . DC  I 5 22  ? 126.389 134.533 170.059 1.00 54.95  ? 22  DC  I "C2'" 1 
ATOM 6499  C "C1'" . DC  I 5 22  ? 127.642 133.690 170.167 1.00 54.95  ? 22  DC  I "C1'" 1 
ATOM 6500  N N1    . DC  I 5 22  ? 128.588 133.905 169.056 1.00 54.95  ? 22  DC  I N1    1 
ATOM 6501  C C2    . DC  I 5 22  ? 129.906 134.264 169.330 1.00 54.95  ? 22  DC  I C2    1 
ATOM 6502  O O2    . DC  I 5 22  ? 130.260 134.393 170.500 1.00 54.95  ? 22  DC  I O2    1 
ATOM 6503  N N3    . DC  I 5 22  ? 130.754 134.466 168.303 1.00 54.95  ? 22  DC  I N3    1 
ATOM 6504  C C4    . DC  I 5 22  ? 130.329 134.320 167.054 1.00 54.95  ? 22  DC  I C4    1 
ATOM 6505  N N4    . DC  I 5 22  ? 131.203 134.526 166.067 1.00 54.95  ? 22  DC  I N4    1 
ATOM 6506  C C5    . DC  I 5 22  ? 128.988 133.955 166.755 1.00 54.95  ? 22  DC  I C5    1 
ATOM 6507  C C6    . DC  I 5 22  ? 128.161 133.761 167.777 1.00 54.95  ? 22  DC  I C6    1 
ATOM 6508  P P     . DG  I 5 23  ? 124.711 135.505 172.739 1.00 60.46  ? 23  DG  I P     1 
ATOM 6509  O OP1   . DG  I 5 23  ? 123.979 135.182 173.977 1.00 60.46  ? 23  DG  I OP1   1 
ATOM 6510  O OP2   . DG  I 5 23  ? 123.973 136.102 171.609 1.00 60.46  ? 23  DG  I OP2   1 
ATOM 6511  O "O5'" . DG  I 5 23  ? 125.939 136.453 173.118 1.00 60.46  ? 23  DG  I "O5'" 1 
ATOM 6512  C "C5'" . DG  I 5 23  ? 126.836 136.058 174.146 1.00 60.46  ? 23  DG  I "C5'" 1 
ATOM 6513  C "C4'" . DG  I 5 23  ? 127.978 137.050 174.317 1.00 60.46  ? 23  DG  I "C4'" 1 
ATOM 6514  O "O4'" . DG  I 5 23  ? 128.918 136.920 173.227 1.00 60.46  ? 23  DG  I "O4'" 1 
ATOM 6515  C "C3'" . DG  I 5 23  ? 127.583 138.522 174.366 1.00 60.46  ? 23  DG  I "C3'" 1 
ATOM 6516  O "O3'" . DG  I 5 23  ? 128.361 139.186 175.347 1.00 60.46  ? 23  DG  I "O3'" 1 
ATOM 6517  C "C2'" . DG  I 5 23  ? 127.925 139.016 172.966 1.00 60.46  ? 23  DG  I "C2'" 1 
ATOM 6518  C "C1'" . DG  I 5 23  ? 129.141 138.176 172.629 1.00 60.46  ? 23  DG  I "C1'" 1 
ATOM 6519  N N9    . DG  I 5 23  ? 129.315 137.951 171.206 1.00 60.46  ? 23  DG  I N9    1 
ATOM 6520  C C8    . DG  I 5 23  ? 128.409 137.401 170.347 1.00 60.46  ? 23  DG  I C8    1 
ATOM 6521  N N7    . DG  I 5 23  ? 128.845 137.304 169.131 1.00 60.46  ? 23  DG  I N7    1 
ATOM 6522  C C5    . DG  I 5 23  ? 130.124 137.813 169.192 1.00 60.46  ? 23  DG  I C5    1 
ATOM 6523  C C6    . DG  I 5 23  ? 131.084 137.965 168.177 1.00 60.46  ? 23  DG  I C6    1 
ATOM 6524  O O6    . DG  I 5 23  ? 130.985 137.661 166.985 1.00 60.46  ? 23  DG  I O6    1 
ATOM 6525  N N1    . DG  I 5 23  ? 132.260 138.532 168.657 1.00 60.46  ? 23  DG  I N1    1 
ATOM 6526  C C2    . DG  I 5 23  ? 132.471 138.904 169.954 1.00 60.46  ? 23  DG  I C2    1 
ATOM 6527  N N2    . DG  I 5 23  ? 133.663 139.436 170.241 1.00 60.46  ? 23  DG  I N2    1 
ATOM 6528  N N3    . DG  I 5 23  ? 131.574 138.764 170.915 1.00 60.46  ? 23  DG  I N3    1 
ATOM 6529  C C4    . DG  I 5 23  ? 130.430 138.214 170.461 1.00 60.46  ? 23  DG  I C4    1 
ATOM 6530  P P     . DT  I 5 24  ? 127.992 140.674 175.814 1.00 60.01  ? 24  DT  I P     1 
ATOM 6531  O OP1   . DT  I 5 24  ? 128.214 140.717 177.272 1.00 60.01  ? 24  DT  I OP1   1 
ATOM 6532  O OP2   . DT  I 5 24  ? 126.670 141.030 175.262 1.00 60.01  ? 24  DT  I OP2   1 
ATOM 6533  O "O5'" . DT  I 5 24  ? 129.079 141.589 175.086 1.00 60.01  ? 24  DT  I "O5'" 1 
ATOM 6534  C "C5'" . DT  I 5 24  ? 130.464 141.369 175.317 1.00 60.01  ? 24  DT  I "C5'" 1 
ATOM 6535  C "C4'" . DT  I 5 24  ? 131.321 142.351 174.535 1.00 60.01  ? 24  DT  I "C4'" 1 
ATOM 6536  O "O4'" . DT  I 5 24  ? 131.471 141.902 173.165 1.00 60.01  ? 24  DT  I "O4'" 1 
ATOM 6537  C "C3'" . DT  I 5 24  ? 130.779 143.777 174.448 1.00 60.01  ? 24  DT  I "C3'" 1 
ATOM 6538  O "O3'" . DT  I 5 24  ? 131.843 144.698 174.608 1.00 60.01  ? 24  DT  I "O3'" 1 
ATOM 6539  C "C2'" . DT  I 5 24  ? 130.207 143.838 173.034 1.00 60.01  ? 24  DT  I "C2'" 1 
ATOM 6540  C "C1'" . DT  I 5 24  ? 131.204 142.977 172.296 1.00 60.01  ? 24  DT  I "C1'" 1 
ATOM 6541  N N1    . DT  I 5 24  ? 130.695 142.426 171.026 1.00 60.01  ? 24  DT  I N1    1 
ATOM 6542  C C2    . DT  I 5 24  ? 131.514 142.413 169.934 1.00 60.01  ? 24  DT  I C2    1 
ATOM 6543  O O2    . DT  I 5 24  ? 132.650 142.850 169.949 1.00 60.01  ? 24  DT  I O2    1 
ATOM 6544  N N3    . DT  I 5 24  ? 130.962 141.874 168.816 1.00 60.01  ? 24  DT  I N3    1 
ATOM 6545  C C4    . DT  I 5 24  ? 129.697 141.355 168.687 1.00 60.01  ? 24  DT  I C4    1 
ATOM 6546  O O4    . DT  I 5 24  ? 129.284 140.889 167.638 1.00 60.01  ? 24  DT  I O4    1 
ATOM 6547  C C5    . DT  I 5 24  ? 128.889 141.396 169.865 1.00 60.01  ? 24  DT  I C5    1 
ATOM 6548  C C7    . DT  I 5 24  ? 127.493 140.858 169.827 1.00 60.01  ? 24  DT  I C7    1 
ATOM 6549  C C6    . DT  I 5 24  ? 129.419 141.922 170.970 1.00 60.01  ? 24  DT  I C6    1 
ATOM 6550  P P     . DG  I 5 25  ? 131.558 146.192 175.116 1.00 57.15  ? 25  DG  I P     1 
ATOM 6551  O OP1   . DG  I 5 25  ? 132.233 146.330 176.421 1.00 57.15  ? 25  DG  I OP1   1 
ATOM 6552  O OP2   . DG  I 5 25  ? 130.108 146.464 175.008 1.00 57.15  ? 25  DG  I OP2   1 
ATOM 6553  O "O5'" . DG  I 5 25  ? 132.297 147.109 174.037 1.00 57.15  ? 25  DG  I "O5'" 1 
ATOM 6554  C "C5'" . DG  I 5 25  ? 133.716 147.062 173.910 1.00 57.15  ? 25  DG  I "C5'" 1 
ATOM 6555  C "C4'" . DG  I 5 25  ? 134.175 147.506 172.525 1.00 57.15  ? 25  DG  I "C4'" 1 
ATOM 6556  O "O4'" . DG  I 5 25  ? 133.581 146.662 171.505 1.00 57.15  ? 25  DG  I "O4'" 1 
ATOM 6557  C "C3'" . DG  I 5 25  ? 133.829 148.939 172.130 1.00 57.15  ? 25  DG  I "C3'" 1 
ATOM 6558  O "O3'" . DG  I 5 25  ? 134.893 149.466 171.354 1.00 57.15  ? 25  DG  I "O3'" 1 
ATOM 6559  C "C2'" . DG  I 5 25  ? 132.576 148.746 171.280 1.00 57.15  ? 25  DG  I "C2'" 1 
ATOM 6560  C "C1'" . DG  I 5 25  ? 132.935 147.471 170.545 1.00 57.15  ? 25  DG  I "C1'" 1 
ATOM 6561  N N9    . DG  I 5 25  ? 131.791 146.734 170.030 1.00 57.15  ? 25  DG  I N9    1 
ATOM 6562  C C8    . DG  I 5 25  ? 130.648 146.418 170.704 1.00 57.15  ? 25  DG  I C8    1 
ATOM 6563  N N7    . DG  I 5 25  ? 129.803 145.728 169.997 1.00 57.15  ? 25  DG  I N7    1 
ATOM 6564  C C5    . DG  I 5 25  ? 130.435 145.574 168.777 1.00 57.15  ? 25  DG  I C5    1 
ATOM 6565  C C6    . DG  I 5 25  ? 130.004 144.916 167.616 1.00 57.15  ? 25  DG  I C6    1 
ATOM 6566  O O6    . DG  I 5 25  ? 128.941 144.319 167.431 1.00 57.15  ? 25  DG  I O6    1 
ATOM 6567  N N1    . DG  I 5 25  ? 130.942 144.995 166.600 1.00 57.15  ? 25  DG  I N1    1 
ATOM 6568  C C2    . DG  I 5 25  ? 132.148 145.630 166.698 1.00 57.15  ? 25  DG  I C2    1 
ATOM 6569  N N2    . DG  I 5 25  ? 132.927 145.605 165.612 1.00 57.15  ? 25  DG  I N2    1 
ATOM 6570  N N3    . DG  I 5 25  ? 132.564 146.251 167.783 1.00 57.15  ? 25  DG  I N3    1 
ATOM 6571  C C4    . DG  I 5 25  ? 131.659 146.183 168.781 1.00 57.15  ? 25  DG  I C4    1 
ATOM 6572  P P     . DC  I 5 26  ? 135.132 151.048 171.231 1.00 56.85  ? 26  DC  I P     1 
ATOM 6573  O OP1   . DC  I 5 26  ? 136.226 151.391 172.157 1.00 56.85  ? 26  DC  I OP1   1 
ATOM 6574  O OP2   . DC  I 5 26  ? 133.839 151.755 171.332 1.00 56.85  ? 26  DC  I OP2   1 
ATOM 6575  O "O5'" . DC  I 5 26  ? 135.668 151.228 169.740 1.00 56.85  ? 26  DC  I "O5'" 1 
ATOM 6576  C "C5'" . DC  I 5 26  ? 135.703 150.109 168.858 1.00 56.85  ? 26  DC  I "C5'" 1 
ATOM 6577  C "C4'" . DC  I 5 26  ? 135.196 150.473 167.471 1.00 56.85  ? 26  DC  I "C4'" 1 
ATOM 6578  O "O4'" . DC  I 5 26  ? 133.992 149.714 167.178 1.00 56.85  ? 26  DC  I "O4'" 1 
ATOM 6579  C "C3'" . DC  I 5 26  ? 134.798 151.933 167.273 1.00 56.85  ? 26  DC  I "C3'" 1 
ATOM 6580  O "O3'" . DC  I 5 26  ? 134.975 152.272 165.919 1.00 56.85  ? 26  DC  I "O3'" 1 
ATOM 6581  C "C2'" . DC  I 5 26  ? 133.314 151.879 167.592 1.00 56.85  ? 26  DC  I "C2'" 1 
ATOM 6582  C "C1'" . DC  I 5 26  ? 132.966 150.617 166.840 1.00 56.85  ? 26  DC  I "C1'" 1 
ATOM 6583  N N1    . DC  I 5 26  ? 131.671 150.021 167.200 1.00 56.85  ? 26  DC  I N1    1 
ATOM 6584  C C2    . DC  I 5 26  ? 131.024 149.206 166.281 1.00 56.85  ? 26  DC  I C2    1 
ATOM 6585  O O2    . DC  I 5 26  ? 131.557 149.001 165.190 1.00 56.85  ? 26  DC  I O2    1 
ATOM 6586  N N3    . DC  I 5 26  ? 129.839 148.659 166.615 1.00 56.85  ? 26  DC  I N3    1 
ATOM 6587  C C4    . DC  I 5 26  ? 129.307 148.908 167.805 1.00 56.85  ? 26  DC  I C4    1 
ATOM 6588  N N4    . DC  I 5 26  ? 128.136 148.346 168.097 1.00 56.85  ? 26  DC  I N4    1 
ATOM 6589  C C5    . DC  I 5 26  ? 129.951 149.741 168.754 1.00 56.85  ? 26  DC  I C5    1 
ATOM 6590  C C6    . DC  I 5 26  ? 131.120 150.274 168.410 1.00 56.85  ? 26  DC  I C6    1 
ATOM 6591  P P     . DC  I 5 27  ? 136.228 153.136 165.426 1.00 55.53  ? 27  DC  I P     1 
ATOM 6592  O OP1   . DC  I 5 27  ? 137.460 152.375 165.715 1.00 55.53  ? 27  DC  I OP1   1 
ATOM 6593  O OP2   . DC  I 5 27  ? 136.053 154.505 165.942 1.00 55.53  ? 27  DC  I OP2   1 
ATOM 6594  O "O5'" . DC  I 5 27  ? 136.038 153.166 163.844 1.00 55.53  ? 27  DC  I "O5'" 1 
ATOM 6595  C "C5'" . DC  I 5 27  ? 135.696 151.964 163.152 1.00 55.53  ? 27  DC  I "C5'" 1 
ATOM 6596  C "C4'" . DC  I 5 27  ? 134.582 152.185 162.142 1.00 55.53  ? 27  DC  I "C4'" 1 
ATOM 6597  O "O4'" . DC  I 5 27  ? 133.317 151.741 162.695 1.00 55.53  ? 27  DC  I "O4'" 1 
ATOM 6598  C "C3'" . DC  I 5 27  ? 134.349 153.628 161.700 1.00 55.53  ? 27  DC  I "C3'" 1 
ATOM 6599  O "O3'" . DC  I 5 27  ? 133.935 153.636 160.352 1.00 55.53  ? 27  DC  I "O3'" 1 
ATOM 6600  C "C2'" . DC  I 5 27  ? 133.189 154.036 162.593 1.00 55.53  ? 27  DC  I "C2'" 1 
ATOM 6601  C "C1'" . DC  I 5 27  ? 132.373 152.766 162.535 1.00 55.53  ? 27  DC  I "C1'" 1 
ATOM 6602  N N1    . DC  I 5 27  ? 131.357 152.636 163.594 1.00 55.53  ? 27  DC  I N1    1 
ATOM 6603  C C2    . DC  I 5 27  ? 130.305 151.751 163.411 1.00 55.53  ? 27  DC  I C2    1 
ATOM 6604  O O2    . DC  I 5 27  ? 130.247 151.102 162.370 1.00 55.53  ? 27  DC  I O2    1 
ATOM 6605  N N3    . DC  I 5 27  ? 129.376 151.627 164.377 1.00 55.53  ? 27  DC  I N3    1 
ATOM 6606  C C4    . DC  I 5 27  ? 129.475 152.340 165.487 1.00 55.53  ? 27  DC  I C4    1 
ATOM 6607  N N4    . DC  I 5 27  ? 128.530 152.181 166.412 1.00 55.53  ? 27  DC  I N4    1 
ATOM 6608  C C5    . DC  I 5 27  ? 130.543 153.256 165.699 1.00 55.53  ? 27  DC  I C5    1 
ATOM 6609  C C6    . DC  I 5 27  ? 131.456 153.368 164.734 1.00 55.53  ? 27  DC  I C6    1 
ATOM 6610  P P     . DT  I 5 28  ? 134.975 153.861 159.151 1.00 54.45  ? 28  DT  I P     1 
ATOM 6611  O OP1   . DT  I 5 28  ? 136.221 153.132 159.453 1.00 54.45  ? 28  DT  I OP1   1 
ATOM 6612  O OP2   . DT  I 5 28  ? 135.014 155.312 158.879 1.00 54.45  ? 28  DT  I OP2   1 
ATOM 6613  O "O5'" . DT  I 5 28  ? 134.250 153.165 157.905 1.00 54.45  ? 28  DT  I "O5'" 1 
ATOM 6614  C "C5'" . DT  I 5 28  ? 133.509 151.962 158.094 1.00 54.45  ? 28  DT  I "C5'" 1 
ATOM 6615  C "C4'" . DT  I 5 28  ? 132.087 152.057 157.539 1.00 54.45  ? 28  DT  I "C4'" 1 
ATOM 6616  O "O4'" . DT  I 5 28  ? 131.148 152.343 158.605 1.00 54.45  ? 28  DT  I "O4'" 1 
ATOM 6617  C "C3'" . DT  I 5 28  ? 131.826 153.124 156.481 1.00 54.45  ? 28  DT  I "C3'" 1 
ATOM 6618  O "O3'" . DT  I 5 28  ? 130.805 152.669 155.626 1.00 54.45  ? 28  DT  I "O3'" 1 
ATOM 6619  C "C2'" . DT  I 5 28  ? 131.299 154.268 157.328 1.00 54.45  ? 28  DT  I "C2'" 1 
ATOM 6620  C "C1'" . DT  I 5 28  ? 130.404 153.490 158.269 1.00 54.45  ? 28  DT  I "C1'" 1 
ATOM 6621  N N1    . DT  I 5 28  ? 130.070 154.188 159.516 1.00 54.45  ? 28  DT  I N1    1 
ATOM 6622  C C2    . DT  I 5 28  ? 129.023 153.735 160.257 1.00 54.45  ? 28  DT  I C2    1 
ATOM 6623  O O2    . DT  I 5 28  ? 128.337 152.793 159.928 1.00 54.45  ? 28  DT  I O2    1 
ATOM 6624  N N3    . DT  I 5 28  ? 128.797 154.425 161.401 1.00 54.45  ? 28  DT  I N3    1 
ATOM 6625  C C4    . DT  I 5 28  ? 129.502 155.499 161.877 1.00 54.45  ? 28  DT  I C4    1 
ATOM 6626  O O4    . DT  I 5 28  ? 129.219 156.049 162.927 1.00 54.45  ? 28  DT  I O4    1 
ATOM 6627  C C5    . DT  I 5 28  ? 130.599 155.924 161.055 1.00 54.45  ? 28  DT  I C5    1 
ATOM 6628  C C7    . DT  I 5 28  ? 131.445 157.085 161.469 1.00 54.45  ? 28  DT  I C7    1 
ATOM 6629  C C6    . DT  I 5 28  ? 130.828 155.254 159.927 1.00 54.45  ? 28  DT  I C6    1 
ATOM 6630  P P     . DG  I 5 29  ? 131.132 152.006 154.206 1.00 49.17  ? 29  DG  I P     1 
ATOM 6631  O OP1   . DG  I 5 29  ? 132.091 150.908 154.415 1.00 49.17  ? 29  DG  I OP1   1 
ATOM 6632  O OP2   . DG  I 5 29  ? 131.466 153.100 153.281 1.00 49.17  ? 29  DG  I OP2   1 
ATOM 6633  O "O5'" . DG  I 5 29  ? 129.723 151.401 153.754 1.00 49.17  ? 29  DG  I "O5'" 1 
ATOM 6634  C "C5'" . DG  I 5 29  ? 129.063 150.441 154.578 1.00 49.17  ? 29  DG  I "C5'" 1 
ATOM 6635  C "C4'" . DG  I 5 29  ? 127.590 150.777 154.828 1.00 49.17  ? 29  DG  I "C4'" 1 
ATOM 6636  O "O4'" . DG  I 5 29  ? 127.453 151.728 155.905 1.00 49.17  ? 29  DG  I "O4'" 1 
ATOM 6637  C "C3'" . DG  I 5 29  ? 126.795 151.368 153.672 1.00 49.17  ? 29  DG  I "C3'" 1 
ATOM 6638  O "O3'" . DG  I 5 29  ? 125.467 150.926 153.807 1.00 49.17  ? 29  DG  I "O3'" 1 
ATOM 6639  C "C2'" . DG  I 5 29  ? 126.872 152.856 153.972 1.00 49.17  ? 29  DG  I "C2'" 1 
ATOM 6640  C "C1'" . DG  I 5 29  ? 126.673 152.816 155.465 1.00 49.17  ? 29  DG  I "C1'" 1 
ATOM 6641  N N9    . DG  I 5 29  ? 127.132 153.995 156.168 1.00 49.17  ? 29  DG  I N9    1 
ATOM 6642  C C8    . DG  I 5 29  ? 128.178 154.802 155.835 1.00 49.17  ? 29  DG  I C8    1 
ATOM 6643  N N7    . DG  I 5 29  ? 128.370 155.766 156.680 1.00 49.17  ? 29  DG  I N7    1 
ATOM 6644  C C5    . DG  I 5 29  ? 127.395 155.576 157.638 1.00 49.17  ? 29  DG  I C5    1 
ATOM 6645  C C6    . DG  I 5 29  ? 127.107 156.310 158.803 1.00 49.17  ? 29  DG  I C6    1 
ATOM 6646  O O6    . DG  I 5 29  ? 127.682 157.311 159.243 1.00 49.17  ? 29  DG  I O6    1 
ATOM 6647  N N1    . DG  I 5 29  ? 126.034 155.777 159.491 1.00 49.17  ? 29  DG  I N1    1 
ATOM 6648  C C2    . DG  I 5 29  ? 125.330 154.675 159.102 1.00 49.17  ? 29  DG  I C2    1 
ATOM 6649  N N2    . DG  I 5 29  ? 124.314 154.311 159.886 1.00 49.17  ? 29  DG  I N2    1 
ATOM 6650  N N3    . DG  I 5 29  ? 125.590 153.980 158.020 1.00 49.17  ? 29  DG  I N3    1 
ATOM 6651  C C4    . DG  I 5 29  ? 126.632 154.487 157.339 1.00 49.17  ? 29  DG  I C4    1 
ATOM 6652  P P     . DG  I 5 30  ? 124.597 150.462 152.550 1.00 45.81  ? 30  DG  I P     1 
ATOM 6653  O OP1   . DG  I 5 30  ? 124.942 149.057 152.301 1.00 45.81  ? 30  DG  I OP1   1 
ATOM 6654  O OP2   . DG  I 5 30  ? 124.718 151.482 151.500 1.00 45.81  ? 30  DG  I OP2   1 
ATOM 6655  O "O5'" . DG  I 5 30  ? 123.108 150.534 153.097 1.00 45.81  ? 30  DG  I "O5'" 1 
ATOM 6656  C "C5'" . DG  I 5 30  ? 122.791 149.945 154.339 1.00 45.81  ? 30  DG  I "C5'" 1 
ATOM 6657  C "C4'" . DG  I 5 30  ? 121.784 150.767 155.133 1.00 45.81  ? 30  DG  I "C4'" 1 
ATOM 6658  O "O4'" . DG  I 5 30  ? 122.434 151.896 155.766 1.00 45.81  ? 30  DG  I "O4'" 1 
ATOM 6659  C "C3'" . DG  I 5 30  ? 120.612 151.345 154.358 1.00 45.81  ? 30  DG  I "C3'" 1 
ATOM 6660  O "O3'" . DG  I 5 30  ? 119.479 151.297 155.182 1.00 45.81  ? 30  DG  I "O3'" 1 
ATOM 6661  C "C2'" . DG  I 5 30  ? 121.052 152.788 154.129 1.00 45.81  ? 30  DG  I "C2'" 1 
ATOM 6662  C "C1'" . DG  I 5 30  ? 121.748 153.080 155.439 1.00 45.81  ? 30  DG  I "C1'" 1 
ATOM 6663  N N9    . DG  I 5 30  ? 122.729 154.146 155.375 1.00 45.81  ? 30  DG  I N9    1 
ATOM 6664  C C8    . DG  I 5 30  ? 123.679 154.328 154.422 1.00 45.81  ? 30  DG  I C8    1 
ATOM 6665  N N7    . DG  I 5 30  ? 124.444 155.352 154.642 1.00 45.81  ? 30  DG  I N7    1 
ATOM 6666  C C5    . DG  I 5 30  ? 123.965 155.883 155.824 1.00 45.81  ? 30  DG  I C5    1 
ATOM 6667  C C6    . DG  I 5 30  ? 124.399 157.004 156.562 1.00 45.81  ? 30  DG  I C6    1 
ATOM 6668  O O6    . DG  I 5 30  ? 125.324 157.783 156.308 1.00 45.81  ? 30  DG  I O6    1 
ATOM 6669  N N1    . DG  I 5 30  ? 123.641 157.190 157.701 1.00 45.81  ? 30  DG  I N1    1 
ATOM 6670  C C2    . DG  I 5 30  ? 122.596 156.393 158.082 1.00 45.81  ? 30  DG  I C2    1 
ATOM 6671  N N2    . DG  I 5 30  ? 121.977 156.725 159.216 1.00 45.81  ? 30  DG  I N2    1 
ATOM 6672  N N3    . DG  I 5 30  ? 122.187 155.341 157.405 1.00 45.81  ? 30  DG  I N3    1 
ATOM 6673  C C4    . DG  I 5 30  ? 122.916 155.146 156.291 1.00 45.81  ? 30  DG  I C4    1 
ATOM 6674  P P     . DA  I 5 31  ? 118.007 151.241 154.565 1.00 47.68  ? 31  DA  I P     1 
ATOM 6675  O OP1   . DA  I 5 31  ? 117.483 149.893 154.829 1.00 47.68  ? 31  DA  I OP1   1 
ATOM 6676  O OP2   . DA  I 5 31  ? 118.049 151.786 153.201 1.00 47.68  ? 31  DA  I OP2   1 
ATOM 6677  O "O5'" . DA  I 5 31  ? 117.194 152.276 155.452 1.00 47.68  ? 31  DA  I "O5'" 1 
ATOM 6678  C "C5'" . DA  I 5 31  ? 117.407 152.333 156.849 1.00 47.68  ? 31  DA  I "C5'" 1 
ATOM 6679  C "C4'" . DA  I 5 31  ? 116.938 153.656 157.434 1.00 47.68  ? 31  DA  I "C4'" 1 
ATOM 6680  O "O4'" . DA  I 5 31  ? 118.013 154.615 157.401 1.00 47.68  ? 31  DA  I "O4'" 1 
ATOM 6681  C "C3'" . DA  I 5 31  ? 115.754 154.325 156.740 1.00 47.68  ? 31  DA  I "C3'" 1 
ATOM 6682  O "O3'" . DA  I 5 31  ? 114.931 154.919 157.724 1.00 47.68  ? 31  DA  I "O3'" 1 
ATOM 6683  C "C2'" . DA  I 5 31  ? 116.430 155.380 155.870 1.00 47.68  ? 31  DA  I "C2'" 1 
ATOM 6684  C "C1'" . DA  I 5 31  ? 117.598 155.785 156.738 1.00 47.68  ? 31  DA  I "C1'" 1 
ATOM 6685  N N9    . DA  I 5 31  ? 118.734 156.272 155.992 1.00 47.68  ? 31  DA  I N9    1 
ATOM 6686  C C8    . DA  I 5 31  ? 119.286 155.708 154.890 1.00 47.68  ? 31  DA  I C8    1 
ATOM 6687  N N7    . DA  I 5 31  ? 120.327 156.346 154.435 1.00 47.68  ? 31  DA  I N7    1 
ATOM 6688  C C5    . DA  I 5 31  ? 120.471 157.396 155.309 1.00 47.68  ? 31  DA  I C5    1 
ATOM 6689  C C6    . DA  I 5 31  ? 121.393 158.443 155.378 1.00 47.68  ? 31  DA  I C6    1 
ATOM 6690  N N6    . DA  I 5 31  ? 122.385 158.599 154.505 1.00 47.68  ? 31  DA  I N6    1 
ATOM 6691  N N1    . DA  I 5 31  ? 121.255 159.332 156.379 1.00 47.68  ? 31  DA  I N1    1 
ATOM 6692  C C2    . DA  I 5 31  ? 120.258 159.171 157.251 1.00 47.68  ? 31  DA  I C2    1 
ATOM 6693  N N3    . DA  I 5 31  ? 119.332 158.220 157.287 1.00 47.68  ? 31  DA  I N3    1 
ATOM 6694  C C4    . DA  I 5 31  ? 119.499 157.359 156.281 1.00 47.68  ? 31  DA  I C4    1 
ATOM 6695  P P     . DG  I 5 32  ? 113.429 155.395 157.406 1.00 55.17  ? 32  DG  I P     1 
ATOM 6696  O OP1   . DG  I 5 32  ? 112.519 154.499 158.133 1.00 55.17  ? 32  DG  I OP1   1 
ATOM 6697  O OP2   . DG  I 5 32  ? 113.221 155.601 155.963 1.00 55.17  ? 32  DG  I OP2   1 
ATOM 6698  O "O5'" . DG  I 5 32  ? 113.366 156.818 158.107 1.00 55.17  ? 32  DG  I "O5'" 1 
ATOM 6699  C "C5'" . DG  I 5 32  ? 114.550 157.378 158.646 1.00 55.17  ? 32  DG  I "C5'" 1 
ATOM 6700  C "C4'" . DG  I 5 32  ? 114.431 158.879 158.783 1.00 55.17  ? 32  DG  I "C4'" 1 
ATOM 6701  O "O4'" . DG  I 5 32  ? 115.587 159.517 158.192 1.00 55.17  ? 32  DG  I "O4'" 1 
ATOM 6702  C "C3'" . DG  I 5 32  ? 113.243 159.499 158.080 1.00 55.17  ? 32  DG  I "C3'" 1 
ATOM 6703  O "O3'" . DG  I 5 32  ? 112.934 160.711 158.729 1.00 55.17  ? 32  DG  I "O3'" 1 
ATOM 6704  C "C2'" . DG  I 5 32  ? 113.804 159.742 156.688 1.00 55.17  ? 32  DG  I "C2'" 1 
ATOM 6705  C "C1'" . DG  I 5 32  ? 115.204 160.218 157.024 1.00 55.17  ? 32  DG  I "C1'" 1 
ATOM 6706  N N9    . DG  I 5 32  ? 116.180 159.929 155.996 1.00 55.17  ? 32  DG  I N9    1 
ATOM 6707  C C8    . DG  I 5 32  ? 116.221 158.833 155.183 1.00 55.17  ? 32  DG  I C8    1 
ATOM 6708  N N7    . DG  I 5 32  ? 117.230 158.831 154.369 1.00 55.17  ? 32  DG  I N7    1 
ATOM 6709  C C5    . DG  I 5 32  ? 117.903 159.999 154.670 1.00 55.17  ? 32  DG  I C5    1 
ATOM 6710  C C6    . DG  I 5 32  ? 119.074 160.535 154.111 1.00 55.17  ? 32  DG  I C6    1 
ATOM 6711  O O6    . DG  I 5 32  ? 119.770 160.068 153.212 1.00 55.17  ? 32  DG  I O6    1 
ATOM 6712  N N1    . DG  I 5 32  ? 119.417 161.738 154.696 1.00 55.17  ? 32  DG  I N1    1 
ATOM 6713  C C2    . DG  I 5 32  ? 118.713 162.347 155.697 1.00 55.17  ? 32  DG  I C2    1 
ATOM 6714  N N2    . DG  I 5 32  ? 119.191 163.513 156.140 1.00 55.17  ? 32  DG  I N2    1 
ATOM 6715  N N3    . DG  I 5 32  ? 117.612 161.852 156.231 1.00 55.17  ? 32  DG  I N3    1 
ATOM 6716  C C4    . DG  I 5 32  ? 117.270 160.681 155.670 1.00 55.17  ? 32  DG  I C4    1 
ATOM 6717  P P     . DA  I 5 33  ? 111.522 161.438 158.522 1.00 59.74  ? 33  DA  I P     1 
ATOM 6718  O OP1   . DA  I 5 33  ? 110.922 161.538 159.867 1.00 59.74  ? 33  DA  I OP1   1 
ATOM 6719  O OP2   . DA  I 5 33  ? 110.770 160.792 157.424 1.00 59.74  ? 33  DA  I OP2   1 
ATOM 6720  O "O5'" . DA  I 5 33  ? 111.950 162.895 158.040 1.00 59.74  ? 33  DA  I "O5'" 1 
ATOM 6721  C "C5'" . DA  I 5 33  ? 113.313 163.265 158.110 1.00 59.74  ? 33  DA  I "C5'" 1 
ATOM 6722  C "C4'" . DA  I 5 33  ? 113.570 164.568 157.387 1.00 59.74  ? 33  DA  I "C4'" 1 
ATOM 6723  O "O4'" . DA  I 5 33  ? 114.644 164.394 156.431 1.00 59.74  ? 33  DA  I "O4'" 1 
ATOM 6724  C "C3'" . DA  I 5 33  ? 112.403 165.125 156.592 1.00 59.74  ? 33  DA  I "C3'" 1 
ATOM 6725  O "O3'" . DA  I 5 33  ? 112.507 166.539 156.595 1.00 59.74  ? 33  DA  I "O3'" 1 
ATOM 6726  C "C2'" . DA  I 5 33  ? 112.656 164.541 155.209 1.00 59.74  ? 33  DA  I "C2'" 1 
ATOM 6727  C "C1'" . DA  I 5 33  ? 114.168 164.637 155.125 1.00 59.74  ? 33  DA  I "C1'" 1 
ATOM 6728  N N9    . DA  I 5 33  ? 114.774 163.655 154.239 1.00 59.74  ? 33  DA  I N9    1 
ATOM 6729  C C8    . DA  I 5 33  ? 114.346 162.384 154.004 1.00 59.74  ? 33  DA  I C8    1 
ATOM 6730  N N7    . DA  I 5 33  ? 115.099 161.721 153.166 1.00 59.74  ? 33  DA  I N7    1 
ATOM 6731  C C5    . DA  I 5 33  ? 116.093 162.618 152.837 1.00 59.74  ? 33  DA  I C5    1 
ATOM 6732  C C6    . DA  I 5 33  ? 117.202 162.529 151.987 1.00 59.74  ? 33  DA  I C6    1 
ATOM 6733  N N6    . DA  I 5 33  ? 117.504 161.437 151.294 1.00 59.74  ? 33  DA  I N6    1 
ATOM 6734  N N1    . DA  I 5 33  ? 117.996 163.609 151.878 1.00 59.74  ? 33  DA  I N1    1 
ATOM 6735  C C2    . DA  I 5 33  ? 117.692 164.702 152.575 1.00 59.74  ? 33  DA  I C2    1 
ATOM 6736  N N3    . DA  I 5 33  ? 116.678 164.902 153.403 1.00 59.74  ? 33  DA  I N3    1 
ATOM 6737  C C4    . DA  I 5 33  ? 115.911 163.812 153.492 1.00 59.74  ? 33  DA  I C4    1 
ATOM 6738  P P     . DC  I 5 34  ? 111.378 167.483 155.955 1.00 61.80  ? 34  DC  I P     1 
ATOM 6739  O OP1   . DC  I 5 34  ? 111.211 168.597 156.911 1.00 61.80  ? 34  DC  I OP1   1 
ATOM 6740  O OP2   . DC  I 5 34  ? 110.200 166.689 155.544 1.00 61.80  ? 34  DC  I OP2   1 
ATOM 6741  O "O5'" . DC  I 5 34  ? 112.100 168.069 154.660 1.00 61.80  ? 34  DC  I "O5'" 1 
ATOM 6742  C "C5'" . DC  I 5 34  ? 113.424 168.555 154.782 1.00 61.80  ? 34  DC  I "C5'" 1 
ATOM 6743  C "C4'" . DC  I 5 34  ? 114.002 168.938 153.437 1.00 61.80  ? 34  DC  I "C4'" 1 
ATOM 6744  O "O4'" . DC  I 5 34  ? 114.633 167.790 152.823 1.00 61.80  ? 34  DC  I "O4'" 1 
ATOM 6745  C "C3'" . DC  I 5 34  ? 112.993 169.462 152.418 1.00 61.80  ? 34  DC  I "C3'" 1 
ATOM 6746  O "O3'" . DC  I 5 34  ? 113.525 170.610 151.798 1.00 61.80  ? 34  DC  I "O3'" 1 
ATOM 6747  C "C2'" . DC  I 5 34  ? 112.874 168.305 151.432 1.00 61.80  ? 34  DC  I "C2'" 1 
ATOM 6748  C "C1'" . DC  I 5 34  ? 114.276 167.756 151.470 1.00 61.80  ? 34  DC  I "C1'" 1 
ATOM 6749  N N1    . DC  I 5 34  ? 114.380 166.368 150.993 1.00 61.80  ? 34  DC  I N1    1 
ATOM 6750  C C2    . DC  I 5 34  ? 115.409 166.024 150.125 1.00 61.80  ? 34  DC  I C2    1 
ATOM 6751  O O2    . DC  I 5 34  ? 116.206 166.897 149.781 1.00 61.80  ? 34  DC  I O2    1 
ATOM 6752  N N3    . DC  I 5 34  ? 115.495 164.755 149.687 1.00 61.80  ? 34  DC  I N3    1 
ATOM 6753  C C4    . DC  I 5 34  ? 114.606 163.856 150.088 1.00 61.80  ? 34  DC  I C4    1 
ATOM 6754  N N4    . DC  I 5 34  ? 114.731 162.611 149.637 1.00 61.80  ? 34  DC  I N4    1 
ATOM 6755  C C5    . DC  I 5 34  ? 113.549 164.188 150.976 1.00 61.80  ? 34  DC  I C5    1 
ATOM 6756  C C6    . DC  I 5 34  ? 113.476 165.443 151.401 1.00 61.80  ? 34  DC  I C6    1 
ATOM 6757  P P     . DT  I 5 35  ? 112.587 171.617 150.975 1.00 61.37  ? 35  DT  I P     1 
ATOM 6758  O OP1   . DT  I 5 35  ? 112.755 172.947 151.598 1.00 61.37  ? 35  DT  I OP1   1 
ATOM 6759  O OP2   . DT  I 5 35  ? 111.233 171.040 150.829 1.00 61.37  ? 35  DT  I OP2   1 
ATOM 6760  O "O5'" . DT  I 5 35  ? 113.284 171.656 149.544 1.00 61.37  ? 35  DT  I "O5'" 1 
ATOM 6761  C "C5'" . DT  I 5 35  ? 114.701 171.726 149.468 1.00 61.37  ? 35  DT  I "C5'" 1 
ATOM 6762  C "C4'" . DT  I 5 35  ? 115.199 171.424 148.067 1.00 61.37  ? 35  DT  I "C4'" 1 
ATOM 6763  O "O4'" . DT  I 5 35  ? 115.376 169.994 147.899 1.00 61.37  ? 35  DT  I "O4'" 1 
ATOM 6764  C "C3'" . DT  I 5 35  ? 114.276 171.869 146.931 1.00 61.37  ? 35  DT  I "C3'" 1 
ATOM 6765  O "O3'" . DT  I 5 35  ? 115.064 172.402 145.881 1.00 61.37  ? 35  DT  I "O3'" 1 
ATOM 6766  C "C2'" . DT  I 5 35  ? 113.614 170.562 146.512 1.00 61.37  ? 35  DT  I "C2'" 1 
ATOM 6767  C "C1'" . DT  I 5 35  ? 114.765 169.601 146.697 1.00 61.37  ? 35  DT  I "C1'" 1 
ATOM 6768  N N1    . DT  I 5 35  ? 114.339 168.207 146.818 1.00 61.37  ? 35  DT  I N1    1 
ATOM 6769  C C2    . DT  I 5 35  ? 115.054 167.235 146.180 1.00 61.37  ? 35  DT  I C2    1 
ATOM 6770  O O2    . DT  I 5 35  ? 116.042 167.466 145.514 1.00 61.37  ? 35  DT  I O2    1 
ATOM 6771  N N3    . DT  I 5 35  ? 114.578 165.976 146.351 1.00 61.37  ? 35  DT  I N3    1 
ATOM 6772  C C4    . DT  I 5 35  ? 113.470 165.603 147.078 1.00 61.37  ? 35  DT  I C4    1 
ATOM 6773  O O4    . DT  I 5 35  ? 113.114 164.440 147.173 1.00 61.37  ? 35  DT  I O4    1 
ATOM 6774  C C5    . DT  I 5 35  ? 112.762 166.674 147.720 1.00 61.37  ? 35  DT  I C5    1 
ATOM 6775  C C7    . DT  I 5 35  ? 111.545 166.390 148.535 1.00 61.37  ? 35  DT  I C7    1 
ATOM 6776  C C6    . DT  I 5 35  ? 113.224 167.911 147.558 1.00 61.37  ? 35  DT  I C6    1 
ATOM 6777  P P     . DA  I 5 36  ? 114.436 173.418 144.810 1.00 58.14  ? 36  DA  I P     1 
ATOM 6778  O OP1   . DA  I 5 36  ? 114.993 174.754 145.101 1.00 58.14  ? 36  DA  I OP1   1 
ATOM 6779  O OP2   . DA  I 5 36  ? 112.972 173.223 144.761 1.00 58.14  ? 36  DA  I OP2   1 
ATOM 6780  O "O5'" . DA  I 5 36  ? 115.038 172.909 143.423 1.00 58.14  ? 36  DA  I "O5'" 1 
ATOM 6781  C "C5'" . DA  I 5 36  ? 116.335 172.320 143.380 1.00 58.14  ? 36  DA  I "C5'" 1 
ATOM 6782  C "C4'" . DA  I 5 36  ? 116.480 171.362 142.203 1.00 58.14  ? 36  DA  I "C4'" 1 
ATOM 6783  O "O4'" . DA  I 5 36  ? 116.037 170.039 142.587 1.00 58.14  ? 36  DA  I "O4'" 1 
ATOM 6784  C "C3'" . DA  I 5 36  ? 115.689 171.724 140.949 1.00 58.14  ? 36  DA  I "C3'" 1 
ATOM 6785  O "O3'" . DA  I 5 36  ? 116.456 171.417 139.800 1.00 58.14  ? 36  DA  I "O3'" 1 
ATOM 6786  C "C2'" . DA  I 5 36  ? 114.460 170.824 141.051 1.00 58.14  ? 36  DA  I "C2'" 1 
ATOM 6787  C "C1'" . DA  I 5 36  ? 115.050 169.584 141.689 1.00 58.14  ? 36  DA  I "C1'" 1 
ATOM 6788  N N9    . DA  I 5 36  ? 114.082 168.811 142.444 1.00 58.14  ? 36  DA  I N9    1 
ATOM 6789  C C8    . DA  I 5 36  ? 113.094 169.294 143.243 1.00 58.14  ? 36  DA  I C8    1 
ATOM 6790  N N7    . DA  I 5 36  ? 112.376 168.364 143.812 1.00 58.14  ? 36  DA  I N7    1 
ATOM 6791  C C5    . DA  I 5 36  ? 112.934 167.192 143.350 1.00 58.14  ? 36  DA  I C5    1 
ATOM 6792  C C6    . DA  I 5 36  ? 112.626 165.849 143.581 1.00 58.14  ? 36  DA  I C6    1 
ATOM 6793  N N6    . DA  I 5 36  ? 111.635 165.458 144.375 1.00 58.14  ? 36  DA  I N6    1 
ATOM 6794  N N1    . DA  I 5 36  ? 113.382 164.915 142.965 1.00 58.14  ? 36  DA  I N1    1 
ATOM 6795  C C2    . DA  I 5 36  ? 114.374 165.315 142.170 1.00 58.14  ? 36  DA  I C2    1 
ATOM 6796  N N3    . DA  I 5 36  ? 114.757 166.552 141.879 1.00 58.14  ? 36  DA  I N3    1 
ATOM 6797  C C4    . DA  I 5 36  ? 113.987 167.449 142.509 1.00 58.14  ? 36  DA  I C4    1 
ATOM 6798  P P     . DG  I 5 37  ? 116.216 172.206 138.424 1.00 55.78  ? 37  DG  I P     1 
ATOM 6799  O OP1   . DG  I 5 37  ? 117.275 173.222 138.289 1.00 55.78  ? 37  DG  I OP1   1 
ATOM 6800  O OP2   . DG  I 5 37  ? 114.795 172.605 138.343 1.00 55.78  ? 37  DG  I OP2   1 
ATOM 6801  O "O5'" . DG  I 5 37  ? 116.463 171.096 137.312 1.00 55.78  ? 37  DG  I "O5'" 1 
ATOM 6802  C "C5'" . DG  I 5 37  ? 117.184 169.916 137.637 1.00 55.78  ? 37  DG  I "C5'" 1 
ATOM 6803  C "C4'" . DG  I 5 37  ? 116.530 168.681 137.038 1.00 55.78  ? 37  DG  I "C4'" 1 
ATOM 6804  O "O4'" . DG  I 5 37  ? 115.591 168.107 137.984 1.00 55.78  ? 37  DG  I "O4'" 1 
ATOM 6805  C "C3'" . DG  I 5 37  ? 115.727 168.906 135.755 1.00 55.78  ? 37  DG  I "C3'" 1 
ATOM 6806  O "O3'" . DG  I 5 37  ? 115.900 167.795 134.916 1.00 55.78  ? 37  DG  I "O3'" 1 
ATOM 6807  C "C2'" . DG  I 5 37  ? 114.301 168.944 136.280 1.00 55.78  ? 37  DG  I "C2'" 1 
ATOM 6808  C "C1'" . DG  I 5 37  ? 114.391 167.847 137.310 1.00 55.78  ? 37  DG  I "C1'" 1 
ATOM 6809  N N9    . DG  I 5 37  ? 113.299 167.832 138.267 1.00 55.78  ? 37  DG  I N9    1 
ATOM 6810  C C8    . DG  I 5 37  ? 112.623 168.907 138.763 1.00 55.78  ? 37  DG  I C8    1 
ATOM 6811  N N7    . DG  I 5 37  ? 111.691 168.585 139.607 1.00 55.78  ? 37  DG  I N7    1 
ATOM 6812  C C5    . DG  I 5 37  ? 111.752 167.206 139.667 1.00 55.78  ? 37  DG  I C5    1 
ATOM 6813  C C6    . DG  I 5 37  ? 110.981 166.297 140.411 1.00 55.78  ? 37  DG  I C6    1 
ATOM 6814  O O6    . DG  I 5 37  ? 110.060 166.537 141.196 1.00 55.78  ? 37  DG  I O6    1 
ATOM 6815  N N1    . DG  I 5 37  ? 111.367 164.990 140.179 1.00 55.78  ? 37  DG  I N1    1 
ATOM 6816  C C2    . DG  I 5 37  ? 112.373 164.608 139.337 1.00 55.78  ? 37  DG  I C2    1 
ATOM 6817  N N2    . DG  I 5 37  ? 112.600 163.298 139.242 1.00 55.78  ? 37  DG  I N2    1 
ATOM 6818  N N3    . DG  I 5 37  ? 113.103 165.449 138.636 1.00 55.78  ? 37  DG  I N3    1 
ATOM 6819  C C4    . DG  I 5 37  ? 112.738 166.729 138.850 1.00 55.78  ? 37  DG  I C4    1 
ATOM 6820  P P     . DG  I 5 38  ? 116.661 167.926 133.514 1.00 53.23  ? 38  DG  I P     1 
ATOM 6821  O OP1   . DG  I 5 38  ? 118.039 168.376 133.783 1.00 53.23  ? 38  DG  I OP1   1 
ATOM 6822  O OP2   . DG  I 5 38  ? 115.777 168.694 132.613 1.00 53.23  ? 38  DG  I OP2   1 
ATOM 6823  O "O5'" . DG  I 5 38  ? 116.719 166.419 132.981 1.00 53.23  ? 38  DG  I "O5'" 1 
ATOM 6824  C "C5'" . DG  I 5 38  ? 116.852 165.342 133.901 1.00 53.23  ? 38  DG  I "C5'" 1 
ATOM 6825  C "C4'" . DG  I 5 38  ? 115.753 164.295 133.739 1.00 53.23  ? 38  DG  I "C4'" 1 
ATOM 6826  O "O4'" . DG  I 5 38  ? 114.637 164.599 134.614 1.00 53.23  ? 38  DG  I "O4'" 1 
ATOM 6827  C "C3'" . DG  I 5 38  ? 115.144 164.145 132.349 1.00 53.23  ? 38  DG  I "C3'" 1 
ATOM 6828  O "O3'" . DG  I 5 38  ? 114.773 162.794 132.160 1.00 53.23  ? 38  DG  I "O3'" 1 
ATOM 6829  C "C2'" . DG  I 5 38  ? 113.896 165.004 132.473 1.00 53.23  ? 38  DG  I "C2'" 1 
ATOM 6830  C "C1'" . DG  I 5 38  ? 113.456 164.597 133.856 1.00 53.23  ? 38  DG  I "C1'" 1 
ATOM 6831  N N9    . DG  I 5 38  ? 112.510 165.502 134.479 1.00 53.23  ? 38  DG  I N9    1 
ATOM 6832  C C8    . DG  I 5 38  ? 112.403 166.849 134.289 1.00 53.23  ? 38  DG  I C8    1 
ATOM 6833  N N7    . DG  I 5 38  ? 111.463 167.401 135.002 1.00 53.23  ? 38  DG  I N7    1 
ATOM 6834  C C5    . DG  I 5 38  ? 110.911 166.345 135.699 1.00 53.23  ? 38  DG  I C5    1 
ATOM 6835  C C6    . DG  I 5 38  ? 109.852 166.321 136.626 1.00 53.23  ? 38  DG  I C6    1 
ATOM 6836  O O6    . DG  I 5 38  ? 109.167 167.256 137.041 1.00 53.23  ? 38  DG  I O6    1 
ATOM 6837  N N1    . DG  I 5 38  ? 109.615 165.042 137.098 1.00 53.23  ? 38  DG  I N1    1 
ATOM 6838  C C2    . DG  I 5 38  ? 110.308 163.929 136.726 1.00 53.23  ? 38  DG  I C2    1 
ATOM 6839  N N2    . DG  I 5 38  ? 109.924 162.779 137.290 1.00 53.23  ? 38  DG  I N2    1 
ATOM 6840  N N3    . DG  I 5 38  ? 111.303 163.936 135.862 1.00 53.23  ? 38  DG  I N3    1 
ATOM 6841  C C4    . DG  I 5 38  ? 111.547 165.173 135.391 1.00 53.23  ? 38  DG  I C4    1 
ATOM 6842  P P     . DG  I 5 39  ? 115.595 161.817 131.190 1.00 49.20  ? 39  DG  I P     1 
ATOM 6843  O OP1   . DG  I 5 39  ? 117.007 161.837 131.604 1.00 49.20  ? 39  DG  I OP1   1 
ATOM 6844  O OP2   . DG  I 5 39  ? 115.211 162.127 129.802 1.00 49.20  ? 39  DG  I OP2   1 
ATOM 6845  O "O5'" . DG  I 5 39  ? 114.992 160.378 131.519 1.00 49.20  ? 39  DG  I "O5'" 1 
ATOM 6846  C "C5'" . DG  I 5 39  ? 114.990 159.900 132.858 1.00 49.20  ? 39  DG  I "C5'" 1 
ATOM 6847  C "C4'" . DG  I 5 39  ? 113.764 159.047 133.193 1.00 49.20  ? 39  DG  I "C4'" 1 
ATOM 6848  O "O4'" . DG  I 5 39  ? 112.661 159.871 133.615 1.00 49.20  ? 39  DG  I "O4'" 1 
ATOM 6849  C "C3'" . DG  I 5 39  ? 113.203 158.152 132.113 1.00 49.20  ? 39  DG  I "C3'" 1 
ATOM 6850  O "O3'" . DG  I 5 39  ? 112.626 157.035 132.743 1.00 49.20  ? 39  DG  I "O3'" 1 
ATOM 6851  C "C2'" . DG  I 5 39  ? 112.131 159.034 131.486 1.00 49.20  ? 39  DG  I "C2'" 1 
ATOM 6852  C "C1'" . DG  I 5 39  ? 111.593 159.784 132.693 1.00 49.20  ? 39  DG  I "C1'" 1 
ATOM 6853  N N9    . DG  I 5 39  ? 111.197 161.154 132.429 1.00 49.20  ? 39  DG  I N9    1 
ATOM 6854  C C8    . DG  I 5 39  ? 111.804 162.032 131.586 1.00 49.20  ? 39  DG  I C8    1 
ATOM 6855  N N7    . DG  I 5 39  ? 111.273 163.211 131.599 1.00 49.20  ? 39  DG  I N7    1 
ATOM 6856  C C5    . DG  I 5 39  ? 110.270 163.120 132.537 1.00 49.20  ? 39  DG  I C5    1 
ATOM 6857  C C6    . DG  I 5 39  ? 109.360 164.091 132.981 1.00 49.20  ? 39  DG  I C6    1 
ATOM 6858  O O6    . DG  I 5 39  ? 109.256 165.270 132.628 1.00 49.20  ? 39  DG  I O6    1 
ATOM 6859  N N1    . DG  I 5 39  ? 108.506 163.584 133.935 1.00 49.20  ? 39  DG  I N1    1 
ATOM 6860  C C2    . DG  I 5 39  ? 108.529 162.301 134.404 1.00 49.20  ? 39  DG  I C2    1 
ATOM 6861  N N2    . DG  I 5 39  ? 107.615 161.994 135.326 1.00 49.20  ? 39  DG  I N2    1 
ATOM 6862  N N3    . DG  I 5 39  ? 109.381 161.385 134.000 1.00 49.20  ? 39  DG  I N3    1 
ATOM 6863  C C4    . DG  I 5 39  ? 110.218 161.863 133.067 1.00 49.20  ? 39  DG  I C4    1 
ATOM 6864  P P     . DA  I 5 40  ? 112.345 155.676 131.951 1.00 47.55  ? 40  DA  I P     1 
ATOM 6865  O OP1   . DA  I 5 40  ? 112.941 154.593 132.737 1.00 47.55  ? 40  DA  I OP1   1 
ATOM 6866  O OP2   . DA  I 5 40  ? 112.695 155.871 130.539 1.00 47.55  ? 40  DA  I OP2   1 
ATOM 6867  O "O5'" . DA  I 5 40  ? 110.775 155.499 132.074 1.00 47.55  ? 40  DA  I "O5'" 1 
ATOM 6868  C "C5'" . DA  I 5 40  ? 110.147 155.701 133.327 1.00 47.55  ? 40  DA  I "C5'" 1 
ATOM 6869  C "C4'" . DA  I 5 40  ? 108.701 156.135 133.168 1.00 47.55  ? 40  DA  I "C4'" 1 
ATOM 6870  O "O4'" . DA  I 5 40  ? 108.627 157.561 132.909 1.00 47.55  ? 40  DA  I "O4'" 1 
ATOM 6871  C "C3'" . DA  I 5 40  ? 107.922 155.477 132.031 1.00 47.55  ? 40  DA  I "C3'" 1 
ATOM 6872  O "O3'" . DA  I 5 40  ? 106.596 155.294 132.456 1.00 47.55  ? 40  DA  I "O3'" 1 
ATOM 6873  C "C2'" . DA  I 5 40  ? 107.962 156.558 130.963 1.00 47.55  ? 40  DA  I "C2'" 1 
ATOM 6874  C "C1'" . DA  I 5 40  ? 107.733 157.757 131.847 1.00 47.55  ? 40  DA  I "C1'" 1 
ATOM 6875  N N9    . DA  I 5 40  ? 108.001 159.034 131.215 1.00 47.55  ? 40  DA  I N9    1 
ATOM 6876  C C8    . DA  I 5 40  ? 108.945 159.297 130.285 1.00 47.55  ? 40  DA  I C8    1 
ATOM 6877  N N7    . DA  I 5 40  ? 108.974 160.543 129.896 1.00 47.55  ? 40  DA  I N7    1 
ATOM 6878  C C5    . DA  I 5 40  ? 107.957 161.135 130.612 1.00 47.55  ? 40  DA  I C5    1 
ATOM 6879  C C6    . DA  I 5 40  ? 107.469 162.447 130.649 1.00 47.55  ? 40  DA  I C6    1 
ATOM 6880  N N6    . DA  I 5 40  ? 107.972 163.432 129.914 1.00 47.55  ? 40  DA  I N6    1 
ATOM 6881  N N1    . DA  I 5 40  ? 106.445 162.711 131.476 1.00 47.55  ? 40  DA  I N1    1 
ATOM 6882  C C2    . DA  I 5 40  ? 105.943 161.721 132.213 1.00 47.55  ? 40  DA  I C2    1 
ATOM 6883  N N3    . DA  I 5 40  ? 106.322 160.449 132.266 1.00 47.55  ? 40  DA  I N3    1 
ATOM 6884  C C4    . DA  I 5 40  ? 107.345 160.221 131.432 1.00 47.55  ? 40  DA  I C4    1 
ATOM 6885  P P     . DG  I 5 41  ? 105.945 153.839 132.604 1.00 54.04  ? 41  DG  I P     1 
ATOM 6886  O OP1   . DG  I 5 41  ? 106.721 153.092 133.611 1.00 54.04  ? 41  DG  I OP1   1 
ATOM 6887  O OP2   . DG  I 5 41  ? 105.736 153.294 131.249 1.00 54.04  ? 41  DG  I OP2   1 
ATOM 6888  O "O5'" . DG  I 5 41  ? 104.508 154.165 133.211 1.00 54.04  ? 41  DG  I "O5'" 1 
ATOM 6889  C "C5'" . DG  I 5 41  ? 104.356 155.289 134.068 1.00 54.04  ? 41  DG  I "C5'" 1 
ATOM 6890  C "C4'" . DG  I 5 41  ? 103.053 156.025 133.803 1.00 54.04  ? 41  DG  I "C4'" 1 
ATOM 6891  O "O4'" . DG  I 5 41  ? 103.310 157.287 133.143 1.00 54.04  ? 41  DG  I "O4'" 1 
ATOM 6892  C "C3'" . DG  I 5 41  ? 102.042 155.302 132.936 1.00 54.04  ? 41  DG  I "C3'" 1 
ATOM 6893  O "O3'" . DG  I 5 41  ? 100.753 155.603 133.413 1.00 54.04  ? 41  DG  I "O3'" 1 
ATOM 6894  C "C2'" . DG  I 5 41  ? 102.282 155.911 131.558 1.00 54.04  ? 41  DG  I "C2'" 1 
ATOM 6895  C "C1'" . DG  I 5 41  ? 102.641 157.342 131.903 1.00 54.04  ? 41  DG  I "C1'" 1 
ATOM 6896  N N9    . DG  I 5 41  ? 103.555 157.948 130.954 1.00 54.04  ? 41  DG  I N9    1 
ATOM 6897  C C8    . DG  I 5 41  ? 104.612 157.344 130.357 1.00 54.04  ? 41  DG  I C8    1 
ATOM 6898  N N7    . DG  I 5 41  ? 105.276 158.123 129.564 1.00 54.04  ? 41  DG  I N7    1 
ATOM 6899  C C5    . DG  I 5 41  ? 104.627 159.330 129.657 1.00 54.04  ? 41  DG  I C5    1 
ATOM 6900  C C6    . DG  I 5 41  ? 104.906 160.548 129.025 1.00 54.04  ? 41  DG  I C6    1 
ATOM 6901  O O6    . DG  I 5 41  ? 105.816 160.809 128.233 1.00 54.04  ? 41  DG  I O6    1 
ATOM 6902  N N1    . DG  I 5 41  ? 104.006 161.526 129.385 1.00 54.04  ? 41  DG  I N1    1 
ATOM 6903  C C2    . DG  I 5 41  ? 102.963 161.348 130.252 1.00 54.04  ? 41  DG  I C2    1 
ATOM 6904  N N2    . DG  I 5 41  ? 102.195 162.415 130.479 1.00 54.04  ? 41  DG  I N2    1 
ATOM 6905  N N3    . DG  I 5 41  ? 102.694 160.208 130.857 1.00 54.04  ? 41  DG  I N3    1 
ATOM 6906  C C4    . DG  I 5 41  ? 103.567 159.246 130.515 1.00 54.04  ? 41  DG  I C4    1 
ATOM 6907  P P     . DT  I 5 42  ? 99.486  154.721 132.985 1.00 60.41  ? 42  DT  I P     1 
ATOM 6908  O OP1   . DT  I 5 42  ? 98.816  154.334 134.241 1.00 60.41  ? 42  DT  I OP1   1 
ATOM 6909  O OP2   . DT  I 5 42  ? 99.901  153.685 132.017 1.00 60.41  ? 42  DT  I OP2   1 
ATOM 6910  O "O5'" . DT  I 5 42  ? 98.575  155.768 132.208 1.00 60.41  ? 42  DT  I "O5'" 1 
ATOM 6911  C "C5'" . DT  I 5 42  ? 98.642  157.139 132.557 1.00 60.41  ? 42  DT  I "C5'" 1 
ATOM 6912  C "C4'" . DT  I 5 42  ? 98.037  158.004 131.472 1.00 60.41  ? 42  DT  I "C4'" 1 
ATOM 6913  O "O4'" . DT  I 5 42  ? 99.091  158.624 130.689 1.00 60.41  ? 42  DT  I "O4'" 1 
ATOM 6914  C "C3'" . DT  I 5 42  ? 97.146  157.261 130.480 1.00 60.41  ? 42  DT  I "C3'" 1 
ATOM 6915  O "O3'" . DT  I 5 42  ? 95.983  158.027 130.238 1.00 60.41  ? 42  DT  I "O3'" 1 
ATOM 6916  C "C2'" . DT  I 5 42  ? 98.025  157.167 129.240 1.00 60.41  ? 42  DT  I "C2'" 1 
ATOM 6917  C "C1'" . DT  I 5 42  ? 98.802  158.464 129.327 1.00 60.41  ? 42  DT  I "C1'" 1 
ATOM 6918  N N1    . DT  I 5 42  ? 100.075 158.440 128.562 1.00 60.41  ? 42  DT  I N1    1 
ATOM 6919  C C2    . DT  I 5 42  ? 100.475 159.561 127.892 1.00 60.41  ? 42  DT  I C2    1 
ATOM 6920  O O2    . DT  I 5 42  ? 99.845  160.596 127.893 1.00 60.41  ? 42  DT  I O2    1 
ATOM 6921  N N3    . DT  I 5 42  ? 101.645 159.431 127.212 1.00 60.41  ? 42  DT  I N3    1 
ATOM 6922  C C4    . DT  I 5 42  ? 102.440 158.312 127.134 1.00 60.41  ? 42  DT  I C4    1 
ATOM 6923  O O4    . DT  I 5 42  ? 103.478 158.291 126.494 1.00 60.41  ? 42  DT  I O4    1 
ATOM 6924  C C5    . DT  I 5 42  ? 101.963 157.171 127.855 1.00 60.41  ? 42  DT  I C5    1 
ATOM 6925  C C7    . DT  I 5 42  ? 102.743 155.895 127.840 1.00 60.41  ? 42  DT  I C7    1 
ATOM 6926  C C6    . DT  I 5 42  ? 100.816 157.287 128.525 1.00 60.41  ? 42  DT  I C6    1 
ATOM 6927  P P     . DA  I 5 43  ? 94.659  157.371 129.604 1.00 62.25  ? 43  DA  I P     1 
ATOM 6928  O OP1   . DA  I 5 43  ? 93.614  157.399 130.647 1.00 62.25  ? 43  DA  I OP1   1 
ATOM 6929  O OP2   . DA  I 5 43  ? 94.977  156.084 128.952 1.00 62.25  ? 43  DA  I OP2   1 
ATOM 6930  O "O5'" . DA  I 5 43  ? 94.273  158.422 128.475 1.00 62.25  ? 43  DA  I "O5'" 1 
ATOM 6931  C "C5'" . DA  I 5 43  ? 94.418  159.801 128.752 1.00 62.25  ? 43  DA  I "C5'" 1 
ATOM 6932  C "C4'" . DA  I 5 43  ? 94.655  160.606 127.487 1.00 62.25  ? 43  DA  I "C4'" 1 
ATOM 6933  O "O4'" . DA  I 5 43  ? 96.039  160.505 127.080 1.00 62.25  ? 43  DA  I "O4'" 1 
ATOM 6934  C "C3'" . DA  I 5 43  ? 93.825  160.195 126.278 1.00 62.25  ? 43  DA  I "C3'" 1 
ATOM 6935  O "O3'" . DA  I 5 43  ? 93.334  161.356 125.653 1.00 62.25  ? 43  DA  I "O3'" 1 
ATOM 6936  C "C2'" . DA  I 5 43  ? 94.835  159.467 125.393 1.00 62.25  ? 43  DA  I "C2'" 1 
ATOM 6937  C "C1'" . DA  I 5 43  ? 96.102  160.231 125.704 1.00 62.25  ? 43  DA  I "C1'" 1 
ATOM 6938  N N9    . DA  I 5 43  ? 97.317  159.472 125.464 1.00 62.25  ? 43  DA  I N9    1 
ATOM 6939  C C8    . DA  I 5 43  ? 97.626  158.247 125.962 1.00 62.25  ? 43  DA  I C8    1 
ATOM 6940  N N7    . DA  I 5 43  ? 98.802  157.810 125.602 1.00 62.25  ? 43  DA  I N7    1 
ATOM 6941  C C5    . DA  I 5 43  ? 99.298  158.821 124.813 1.00 62.25  ? 43  DA  I C5    1 
ATOM 6942  C C6    . DA  I 5 43  ? 100.501 158.968 124.124 1.00 62.25  ? 43  DA  I C6    1 
ATOM 6943  N N6    . DA  I 5 43  ? 101.454 158.045 124.122 1.00 62.25  ? 43  DA  I N6    1 
ATOM 6944  N N1    . DA  I 5 43  ? 100.691 160.098 123.429 1.00 62.25  ? 43  DA  I N1    1 
ATOM 6945  C C2    . DA  I 5 43  ? 99.731  161.020 123.427 1.00 62.25  ? 43  DA  I C2    1 
ATOM 6946  N N3    . DA  I 5 43  ? 98.555  160.994 124.041 1.00 62.25  ? 43  DA  I N3    1 
ATOM 6947  C C4    . DA  I 5 43  ? 98.402  159.856 124.722 1.00 62.25  ? 43  DA  I C4    1 
ATOM 6948  P P     . DA  I 5 44  ? 92.084  161.280 124.656 1.00 62.14  ? 44  DA  I P     1 
ATOM 6949  O OP1   . DA  I 5 44  ? 91.173  162.381 125.029 1.00 62.14  ? 44  DA  I OP1   1 
ATOM 6950  O OP2   . DA  I 5 44  ? 91.600  159.883 124.651 1.00 62.14  ? 44  DA  I OP2   1 
ATOM 6951  O "O5'" . DA  I 5 44  ? 92.731  161.605 123.232 1.00 62.14  ? 44  DA  I "O5'" 1 
ATOM 6952  C "C5'" . DA  I 5 44  ? 93.671  162.664 123.118 1.00 62.14  ? 44  DA  I "C5'" 1 
ATOM 6953  C "C4'" . DA  I 5 44  ? 94.401  162.606 121.792 1.00 62.14  ? 44  DA  I "C4'" 1 
ATOM 6954  O "O4'" . DA  I 5 44  ? 95.624  161.841 121.928 1.00 62.14  ? 44  DA  I "O4'" 1 
ATOM 6955  C "C3'" . DA  I 5 44  ? 93.620  161.958 120.649 1.00 62.14  ? 44  DA  I "C3'" 1 
ATOM 6956  O "O3'" . DA  I 5 44  ? 93.751  162.758 119.491 1.00 62.14  ? 44  DA  I "O3'" 1 
ATOM 6957  C "C2'" . DA  I 5 44  ? 94.319  160.612 120.477 1.00 62.14  ? 44  DA  I "C2'" 1 
ATOM 6958  C "C1'" . DA  I 5 44  ? 95.742  160.981 120.825 1.00 62.14  ? 44  DA  I "C1'" 1 
ATOM 6959  N N9    . DA  I 5 44  ? 96.562  159.842 121.207 1.00 62.14  ? 44  DA  I N9    1 
ATOM 6960  C C8    . DA  I 5 44  ? 96.224  158.842 122.063 1.00 62.14  ? 44  DA  I C8    1 
ATOM 6961  N N7    . DA  I 5 44  ? 97.158  157.944 122.216 1.00 62.14  ? 44  DA  I N7    1 
ATOM 6962  C C5    . DA  I 5 44  ? 98.177  158.387 121.403 1.00 62.14  ? 44  DA  I C5    1 
ATOM 6963  C C6    . DA  I 5 44  ? 99.447  157.877 121.127 1.00 62.14  ? 44  DA  I C6    1 
ATOM 6964  N N6    . DA  I 5 44  ? 99.912  156.757 121.674 1.00 62.14  ? 44  DA  I N6    1 
ATOM 6965  N N1    . DA  I 5 44  ? 100.230 158.562 120.274 1.00 62.14  ? 44  DA  I N1    1 
ATOM 6966  C C2    . DA  I 5 44  ? 99.765  159.683 119.735 1.00 62.14  ? 44  DA  I C2    1 
ATOM 6967  N N3    . DA  I 5 44  ? 98.583  160.264 119.922 1.00 62.14  ? 44  DA  I N3    1 
ATOM 6968  C C4    . DA  I 5 44  ? 97.831  159.556 120.776 1.00 62.14  ? 44  DA  I C4    1 
ATOM 6969  P P     . DT  I 5 45  ? 92.728  162.617 118.263 1.00 59.55  ? 45  DT  I P     1 
ATOM 6970  O OP1   . DT  I 5 45  ? 92.102  163.940 118.082 1.00 59.55  ? 45  DT  I OP1   1 
ATOM 6971  O OP2   . DT  I 5 45  ? 91.884  161.418 118.450 1.00 59.55  ? 45  DT  I OP2   1 
ATOM 6972  O "O5'" . DT  I 5 45  ? 93.691  162.361 117.022 1.00 59.55  ? 45  DT  I "O5'" 1 
ATOM 6973  C "C5'" . DT  I 5 45  ? 94.871  163.134 116.890 1.00 59.55  ? 45  DT  I "C5'" 1 
ATOM 6974  C "C4'" . DT  I 5 45  ? 95.881  162.431 116.011 1.00 59.55  ? 45  DT  I "C4'" 1 
ATOM 6975  O "O4'" . DT  I 5 45  ? 96.591  161.421 116.776 1.00 59.55  ? 45  DT  I "O4'" 1 
ATOM 6976  C "C3'" . DT  I 5 45  ? 95.287  161.705 114.802 1.00 59.55  ? 45  DT  I "C3'" 1 
ATOM 6977  O "O3'" . DT  I 5 45  ? 96.027  162.040 113.647 1.00 59.55  ? 45  DT  I "O3'" 1 
ATOM 6978  C "C2'" . DT  I 5 45  ? 95.462  160.234 115.168 1.00 59.55  ? 45  DT  I "C2'" 1 
ATOM 6979  C "C1'" . DT  I 5 45  ? 96.739  160.288 115.969 1.00 59.55  ? 45  DT  I "C1'" 1 
ATOM 6980  N N1    . DT  I 5 45  ? 96.951  159.106 116.823 1.00 59.55  ? 45  DT  I N1    1 
ATOM 6981  C C2    . DT  I 5 45  ? 98.157  158.466 116.784 1.00 59.55  ? 45  DT  I C2    1 
ATOM 6982  O O2    . DT  I 5 45  ? 99.081  158.831 116.093 1.00 59.55  ? 45  DT  I O2    1 
ATOM 6983  N N3    . DT  I 5 45  ? 98.252  157.380 117.594 1.00 59.55  ? 45  DT  I N3    1 
ATOM 6984  C C4    . DT  I 5 45  ? 97.277  156.876 118.421 1.00 59.55  ? 45  DT  I C4    1 
ATOM 6985  O O4    . DT  I 5 45  ? 97.458  155.894 119.121 1.00 59.55  ? 45  DT  I O4    1 
ATOM 6986  C C5    . DT  I 5 45  ? 96.032  157.588 118.410 1.00 59.55  ? 45  DT  I C5    1 
ATOM 6987  C C7    . DT  I 5 45  ? 94.898  157.127 119.270 1.00 59.55  ? 45  DT  I C7    1 
ATOM 6988  C C6    . DT  I 5 45  ? 95.928  158.656 117.617 1.00 59.55  ? 45  DT  I C6    1 
ATOM 6989  P P     . DC  I 5 46  ? 95.396  161.876 112.179 1.00 55.38  ? 46  DC  I P     1 
ATOM 6990  O OP1   . DC  I 5 46  ? 95.180  163.228 111.628 1.00 55.38  ? 46  DC  I OP1   1 
ATOM 6991  O OP2   . DC  I 5 46  ? 94.280  160.911 112.214 1.00 55.38  ? 46  DC  I OP2   1 
ATOM 6992  O "O5'" . DC  I 5 46  ? 96.585  161.213 111.366 1.00 55.38  ? 46  DC  I "O5'" 1 
ATOM 6993  C "C5'" . DC  I 5 46  ? 97.928  161.454 111.776 1.00 55.38  ? 46  DC  I "C5'" 1 
ATOM 6994  C "C4'" . DC  I 5 46  ? 98.838  160.287 111.434 1.00 55.38  ? 46  DC  I "C4'" 1 
ATOM 6995  O "O4'" . DC  I 5 46  ? 98.817  159.307 112.502 1.00 55.38  ? 46  DC  I "O4'" 1 
ATOM 6996  C "C3'" . DC  I 5 46  ? 98.480  159.521 110.169 1.00 55.38  ? 46  DC  I "C3'" 1 
ATOM 6997  O "O3'" . DC  I 5 46  ? 99.669  159.143 109.519 1.00 55.38  ? 46  DC  I "O3'" 1 
ATOM 6998  C "C2'" . DC  I 5 46  ? 97.757  158.300 110.730 1.00 55.38  ? 46  DC  I "C2'" 1 
ATOM 6999  C "C1'" . DC  I 5 46  ? 98.604  158.035 111.946 1.00 55.38  ? 46  DC  I "C1'" 1 
ATOM 7000  N N1    . DC  I 5 46  ? 97.980  157.179 112.976 1.00 55.38  ? 46  DC  I N1    1 
ATOM 7001  C C2    . DC  I 5 46  ? 98.734  156.167 113.561 1.00 55.38  ? 46  DC  I C2    1 
ATOM 7002  O O2    . DC  I 5 46  ? 99.891  155.992 113.177 1.00 55.38  ? 46  DC  I O2    1 
ATOM 7003  N N3    . DC  I 5 46  ? 98.175  155.400 114.519 1.00 55.38  ? 46  DC  I N3    1 
ATOM 7004  C C4    . DC  I 5 46  ? 96.926  155.624 114.903 1.00 55.38  ? 46  DC  I C4    1 
ATOM 7005  N N4    . DC  I 5 46  ? 96.422  154.842 115.856 1.00 55.38  ? 46  DC  I N4    1 
ATOM 7006  C C5    . DC  I 5 46  ? 96.136  156.662 114.326 1.00 55.38  ? 46  DC  I C5    1 
ATOM 7007  C C6    . DC  I 5 46  ? 96.701  157.409 113.374 1.00 55.38  ? 46  DC  I C6    1 
ATOM 7008  P P     . DC  I 5 47  ? 99.866  159.418 107.955 1.00 53.19  ? 47  DC  I P     1 
ATOM 7009  O OP1   . DC  I 5 47  ? 100.733 160.605 107.815 1.00 53.19  ? 47  DC  I OP1   1 
ATOM 7010  O OP2   . DC  I 5 47  ? 98.523  159.376 107.336 1.00 53.19  ? 47  DC  I OP2   1 
ATOM 7011  O "O5'" . DC  I 5 47  ? 100.675 158.142 107.446 1.00 53.19  ? 47  DC  I "O5'" 1 
ATOM 7012  C "C5'" . DC  I 5 47  ? 101.601 157.492 108.313 1.00 53.19  ? 47  DC  I "C5'" 1 
ATOM 7013  C "C4'" . DC  I 5 47  ? 101.458 155.977 108.246 1.00 53.19  ? 47  DC  I "C4'" 1 
ATOM 7014  O "O4'" . DC  I 5 47  ? 100.543 155.517 109.277 1.00 53.19  ? 47  DC  I "O4'" 1 
ATOM 7015  C "C3'" . DC  I 5 47  ? 100.907 155.407 106.933 1.00 53.19  ? 47  DC  I "C3'" 1 
ATOM 7016  O "O3'" . DC  I 5 47  ? 101.556 154.188 106.658 1.00 53.19  ? 47  DC  I "O3'" 1 
ATOM 7017  C "C2'" . DC  I 5 47  ? 99.455  155.137 107.298 1.00 53.19  ? 47  DC  I "C2'" 1 
ATOM 7018  C "C1'" . DC  I 5 47  ? 99.667  154.596 108.689 1.00 53.19  ? 47  DC  I "C1'" 1 
ATOM 7019  N N1    . DC  I 5 47  ? 98.447  154.471 109.509 1.00 53.19  ? 47  DC  I N1    1 
ATOM 7020  C C2    . DC  I 5 47  ? 98.435  153.582 110.573 1.00 53.19  ? 47  DC  I C2    1 
ATOM 7021  O O2    . DC  I 5 47  ? 99.451  152.933 110.817 1.00 53.19  ? 47  DC  I O2    1 
ATOM 7022  N N3    . DC  I 5 47  ? 97.316  153.465 111.315 1.00 53.19  ? 47  DC  I N3    1 
ATOM 7023  C C4    . DC  I 5 47  ? 96.249  154.185 111.021 1.00 53.19  ? 47  DC  I C4    1 
ATOM 7024  N N4    . DC  I 5 47  ? 95.166  154.036 111.781 1.00 53.19  ? 47  DC  I N4    1 
ATOM 7025  C C5    . DC  I 5 47  ? 96.239  155.092 109.937 1.00 53.19  ? 47  DC  I C5    1 
ATOM 7026  C C6    . DC  I 5 47  ? 97.348  155.191 109.205 1.00 53.19  ? 47  DC  I C6    1 
ATOM 7027  P P     . DC  I 5 48  ? 102.708 154.074 105.551 1.00 50.21  ? 48  DC  I P     1 
ATOM 7028  O OP1   . DC  I 5 48  ? 103.545 155.286 105.632 1.00 50.21  ? 48  DC  I OP1   1 
ATOM 7029  O OP2   . DC  I 5 48  ? 102.072 153.698 104.276 1.00 50.21  ? 48  DC  I OP2   1 
ATOM 7030  O "O5'" . DC  I 5 48  ? 103.558 152.809 106.040 1.00 50.21  ? 48  DC  I "O5'" 1 
ATOM 7031  C "C5'" . DC  I 5 48  ? 104.172 152.825 107.320 1.00 50.21  ? 48  DC  I "C5'" 1 
ATOM 7032  C "C4'" . DC  I 5 48  ? 104.023 151.498 108.065 1.00 50.21  ? 48  DC  I "C4'" 1 
ATOM 7033  O "O4'" . DC  I 5 48  ? 102.706 151.368 108.652 1.00 50.21  ? 48  DC  I "O4'" 1 
ATOM 7034  C "C3'" . DC  I 5 48  ? 104.236 150.226 107.270 1.00 50.21  ? 48  DC  I "C3'" 1 
ATOM 7035  O "O3'" . DC  I 5 48  ? 104.823 149.300 108.137 1.00 50.21  ? 48  DC  I "O3'" 1 
ATOM 7036  C "C2'" . DC  I 5 48  ? 102.803 149.819 106.935 1.00 50.21  ? 48  DC  I "C2'" 1 
ATOM 7037  C "C1'" . DC  I 5 48  ? 102.118 150.150 108.241 1.00 50.21  ? 48  DC  I "C1'" 1 
ATOM 7038  N N1    . DC  I 5 48  ? 100.660 150.403 108.168 1.00 50.21  ? 48  DC  I N1    1 
ATOM 7039  C C2    . DC  I 5 48  ? 99.832  149.919 109.176 1.00 50.21  ? 48  DC  I C2    1 
ATOM 7040  O O2    . DC  I 5 48  ? 100.303 149.208 110.061 1.00 50.21  ? 48  DC  I O2    1 
ATOM 7041  N N3    . DC  I 5 48  ? 98.519  150.208 109.139 1.00 50.21  ? 48  DC  I N3    1 
ATOM 7042  C C4    . DC  I 5 48  ? 98.031  150.967 108.172 1.00 50.21  ? 48  DC  I C4    1 
ATOM 7043  N N4    . DC  I 5 48  ? 96.725  151.223 108.193 1.00 50.21  ? 48  DC  I N4    1 
ATOM 7044  C C5    . DC  I 5 48  ? 98.856  151.492 107.144 1.00 50.21  ? 48  DC  I C5    1 
ATOM 7045  C C6    . DC  I 5 48  ? 100.157 151.203 107.192 1.00 50.21  ? 48  DC  I C6    1 
ATOM 7046  P P     . DC  I 5 49  ? 105.898 148.228 107.633 1.00 46.97  ? 49  DC  I P     1 
ATOM 7047  O OP1   . DC  I 5 49  ? 107.230 148.709 108.038 1.00 46.97  ? 49  DC  I OP1   1 
ATOM 7048  O OP2   . DC  I 5 49  ? 105.638 147.945 106.207 1.00 46.97  ? 49  DC  I OP2   1 
ATOM 7049  O "O5'" . DC  I 5 49  ? 105.532 146.950 108.519 1.00 46.97  ? 49  DC  I "O5'" 1 
ATOM 7050  C "C5'" . DC  I 5 49  ? 104.508 147.068 109.522 1.00 46.97  ? 49  DC  I "C5'" 1 
ATOM 7051  C "C4'" . DC  I 5 49  ? 103.586 145.862 109.540 1.00 46.97  ? 49  DC  I "C4'" 1 
ATOM 7052  O "O4'" . DC  I 5 49  ? 102.215 146.274 109.257 1.00 46.97  ? 49  DC  I "O4'" 1 
ATOM 7053  C "C3'" . DC  I 5 49  ? 103.891 144.793 108.507 1.00 46.97  ? 49  DC  I "C3'" 1 
ATOM 7054  O "O3'" . DC  I 5 49  ? 103.396 143.561 108.967 1.00 46.97  ? 49  DC  I "O3'" 1 
ATOM 7055  C "C2'" . DC  I 5 49  ? 103.036 145.272 107.367 1.00 46.97  ? 49  DC  I "C2'" 1 
ATOM 7056  C "C1'" . DC  I 5 49  ? 101.766 145.550 108.139 1.00 46.97  ? 49  DC  I "C1'" 1 
ATOM 7057  N N1    . DC  I 5 49  ? 100.736 146.348 107.383 1.00 46.97  ? 49  DC  I N1    1 
ATOM 7058  C C2    . DC  I 5 49  ? 99.443  146.506 107.897 1.00 46.97  ? 49  DC  I C2    1 
ATOM 7059  O O2    . DC  I 5 49  ? 99.148  146.001 108.975 1.00 46.97  ? 49  DC  I O2    1 
ATOM 7060  N N3    . DC  I 5 49  ? 98.545  147.217 107.193 1.00 46.97  ? 49  DC  I N3    1 
ATOM 7061  C C4    . DC  I 5 49  ? 98.882  147.748 106.034 1.00 46.97  ? 49  DC  I C4    1 
ATOM 7062  N N4    . DC  I 5 49  ? 97.957  148.446 105.374 1.00 46.97  ? 49  DC  I N4    1 
ATOM 7063  C C5    . DC  I 5 49  ? 100.183 147.594 105.490 1.00 46.97  ? 49  DC  I C5    1 
ATOM 7064  C C6    . DC  I 5 49  ? 101.059 146.880 106.183 1.00 46.97  ? 49  DC  I C6    1 
ATOM 7065  P P     . DT  I 5 50  ? 104.334 142.488 109.696 1.00 42.47  ? 50  DT  I P     1 
ATOM 7066  O OP1   . DT  I 5 50  ? 105.160 143.189 110.688 1.00 42.47  ? 50  DT  I OP1   1 
ATOM 7067  O OP2   . DT  I 5 50  ? 104.960 141.669 108.648 1.00 42.47  ? 50  DT  I OP2   1 
ATOM 7068  O "O5'" . DT  I 5 50  ? 103.292 141.552 110.459 1.00 42.47  ? 50  DT  I "O5'" 1 
ATOM 7069  C "C5'" . DT  I 5 50  ? 102.522 142.073 111.523 1.00 42.47  ? 50  DT  I "C5'" 1 
ATOM 7070  C "C4'" . DT  I 5 50  ? 101.099 141.545 111.488 1.00 42.47  ? 50  DT  I "C4'" 1 
ATOM 7071  O "O4'" . DT  I 5 50  ? 100.289 142.349 110.601 1.00 42.47  ? 50  DT  I "O4'" 1 
ATOM 7072  C "C3'" . DT  I 5 50  ? 100.943 140.107 111.015 1.00 42.47  ? 50  DT  I "C3'" 1 
ATOM 7073  O "O3'" . DT  I 5 50  ? 100.169 139.394 111.950 1.00 42.47  ? 50  DT  I "O3'" 1 
ATOM 7074  C "C2'" . DT  I 5 50  ? 100.227 140.248 109.675 1.00 42.47  ? 50  DT  I "C2'" 1 
ATOM 7075  C "C1'" . DT  I 5 50  ? 99.438  141.512 109.870 1.00 42.47  ? 50  DT  I "C1'" 1 
ATOM 7076  N N1    . DT  I 5 50  ? 99.087  142.208 108.601 1.00 42.47  ? 50  DT  I N1    1 
ATOM 7077  C C2    . DT  I 5 50  ? 97.811  142.701 108.421 1.00 42.47  ? 50  DT  I C2    1 
ATOM 7078  O O2    . DT  I 5 50  ? 96.926  142.588 109.242 1.00 42.47  ? 50  DT  I O2    1 
ATOM 7079  N N3    . DT  I 5 50  ? 97.615  143.335 107.231 1.00 42.47  ? 50  DT  I N3    1 
ATOM 7080  C C4    . DT  I 5 50  ? 98.526  143.522 106.231 1.00 42.47  ? 50  DT  I C4    1 
ATOM 7081  O O4    . DT  I 5 50  ? 98.250  144.103 105.194 1.00 42.47  ? 50  DT  I O4    1 
ATOM 7082  C C5    . DT  I 5 50  ? 99.834  142.990 106.481 1.00 42.47  ? 50  DT  I C5    1 
ATOM 7083  C C7    . DT  I 5 50  ? 100.901 143.128 105.443 1.00 42.47  ? 50  DT  I C7    1 
ATOM 7084  C C6    . DT  I 5 50  ? 100.052 142.374 107.643 1.00 42.47  ? 50  DT  I C6    1 
ATOM 7085  P P     . DT  I 5 51  ? 99.921  137.820 111.802 1.00 45.05  ? 51  DT  I P     1 
ATOM 7086  O OP1   . DT  I 5 51  ? 99.932  137.240 113.144 1.00 45.05  ? 51  DT  I OP1   1 
ATOM 7087  O OP2   . DT  I 5 51  ? 100.800 137.253 110.770 1.00 45.05  ? 51  DT  I OP2   1 
ATOM 7088  O "O5'" . DT  I 5 51  ? 98.423  137.745 111.319 1.00 45.05  ? 51  DT  I "O5'" 1 
ATOM 7089  C "C5'" . DT  I 5 51  ? 97.444  138.476 112.021 1.00 45.05  ? 51  DT  I "C5'" 1 
ATOM 7090  C "C4'" . DT  I 5 51  ? 96.096  138.366 111.348 1.00 45.05  ? 51  DT  I "C4'" 1 
ATOM 7091  O "O4'" . DT  I 5 51  ? 96.042  139.248 110.206 1.00 45.05  ? 51  DT  I "O4'" 1 
ATOM 7092  C "C3'" . DT  I 5 51  ? 95.751  136.979 110.834 1.00 45.05  ? 51  DT  I "C3'" 1 
ATOM 7093  O "O3'" . DT  I 5 51  ? 94.422  136.680 111.177 1.00 45.05  ? 51  DT  I "O3'" 1 
ATOM 7094  C "C2'" . DT  I 5 51  ? 95.934  137.108 109.326 1.00 45.05  ? 51  DT  I "C2'" 1 
ATOM 7095  C "C1'" . DT  I 5 51  ? 95.557  138.552 109.092 1.00 45.05  ? 51  DT  I "C1'" 1 
ATOM 7096  N N1    . DT  I 5 51  ? 96.169  139.140 107.883 1.00 45.05  ? 51  DT  I N1    1 
ATOM 7097  C C2    . DT  I 5 51  ? 95.406  139.912 107.060 1.00 45.05  ? 51  DT  I C2    1 
ATOM 7098  O O2    . DT  I 5 51  ? 94.233  140.137 107.261 1.00 45.05  ? 51  DT  I O2    1 
ATOM 7099  N N3    . DT  I 5 51  ? 96.062  140.414 105.980 1.00 45.05  ? 51  DT  I N3    1 
ATOM 7100  C C4    . DT  I 5 51  ? 97.378  140.228 105.649 1.00 45.05  ? 51  DT  I C4    1 
ATOM 7101  O O4    . DT  I 5 51  ? 97.878  140.723 104.651 1.00 45.05  ? 51  DT  I O4    1 
ATOM 7102  C C5    . DT  I 5 51  ? 98.124  139.412 106.553 1.00 45.05  ? 51  DT  I C5    1 
ATOM 7103  C C7    . DT  I 5 51  ? 99.566  139.129 106.285 1.00 45.05  ? 51  DT  I C7    1 
ATOM 7104  C C6    . DT  I 5 51  ? 97.493  138.915 107.618 1.00 45.05  ? 51  DT  I C6    1 
ATOM 7105  P P     . DG  I 5 52  ? 93.898  135.169 111.162 1.00 56.32  ? 52  DG  I P     1 
ATOM 7106  O OP1   . DG  I 5 52  ? 93.192  134.937 112.434 1.00 56.32  ? 52  DG  I OP1   1 
ATOM 7107  O OP2   . DG  I 5 52  ? 95.010  134.288 110.761 1.00 56.32  ? 52  DG  I OP2   1 
ATOM 7108  O "O5'" . DG  I 5 52  ? 92.834  135.169 109.982 1.00 56.32  ? 52  DG  I "O5'" 1 
ATOM 7109  C "C5'" . DG  I 5 52  ? 91.831  136.160 109.954 1.00 56.32  ? 52  DG  I "C5'" 1 
ATOM 7110  C "C4'" . DG  I 5 52  ? 91.269  136.303 108.562 1.00 56.32  ? 52  DG  I "C4'" 1 
ATOM 7111  O "O4'" . DG  I 5 52  ? 92.176  137.073 107.758 1.00 56.32  ? 52  DG  I "O4'" 1 
ATOM 7112  C "C3'" . DG  I 5 52  ? 91.064  134.985 107.825 1.00 56.32  ? 52  DG  I "C3'" 1 
ATOM 7113  O "O3'" . DG  I 5 52  ? 89.686  134.793 107.585 1.00 56.32  ? 52  DG  I "O3'" 1 
ATOM 7114  C "C2'" . DG  I 5 52  ? 91.856  135.145 106.520 1.00 56.32  ? 52  DG  I "C2'" 1 
ATOM 7115  C "C1'" . DG  I 5 52  ? 92.077  136.642 106.438 1.00 56.32  ? 52  DG  I "C1'" 1 
ATOM 7116  N N9    . DG  I 5 52  ? 93.305  137.004 105.752 1.00 56.32  ? 52  DG  I N9    1 
ATOM 7117  C C8    . DG  I 5 52  ? 94.578  136.697 106.133 1.00 56.32  ? 52  DG  I C8    1 
ATOM 7118  N N7    . DG  I 5 52  ? 95.484  137.154 105.323 1.00 56.32  ? 52  DG  I N7    1 
ATOM 7119  C C5    . DG  I 5 52  ? 94.762  137.804 104.344 1.00 56.32  ? 52  DG  I C5    1 
ATOM 7120  C C6    . DG  I 5 52  ? 95.205  138.493 103.202 1.00 56.32  ? 52  DG  I C6    1 
ATOM 7121  O O6    . DG  I 5 52  ? 96.359  138.673 102.817 1.00 56.32  ? 52  DG  I O6    1 
ATOM 7122  N N1    . DG  I 5 52  ? 94.146  139.007 102.474 1.00 56.32  ? 52  DG  I N1    1 
ATOM 7123  C C2    . DG  I 5 52  ? 92.827  138.864 102.808 1.00 56.32  ? 52  DG  I C2    1 
ATOM 7124  N N2    . DG  I 5 52  ? 91.937  139.421 101.986 1.00 56.32  ? 52  DG  I N2    1 
ATOM 7125  N N3    . DG  I 5 52  ? 92.402  138.221 103.878 1.00 56.32  ? 52  DG  I N3    1 
ATOM 7126  C C4    . DG  I 5 52  ? 93.421  137.720 104.595 1.00 56.32  ? 52  DG  I C4    1 
ATOM 7127  P P     . DG  I 5 53  ? 89.140  133.398 107.010 1.00 62.36  ? 53  DG  I P     1 
ATOM 7128  O OP1   . DG  I 5 53  ? 87.809  133.170 107.611 1.00 62.36  ? 53  DG  I OP1   1 
ATOM 7129  O OP2   . DG  I 5 53  ? 90.196  132.376 107.172 1.00 62.36  ? 53  DG  I OP2   1 
ATOM 7130  O "O5'" . DG  I 5 53  ? 88.935  133.705 105.459 1.00 62.36  ? 53  DG  I "O5'" 1 
ATOM 7131  C "C5'" . DG  I 5 53  ? 88.414  134.960 105.063 1.00 62.36  ? 53  DG  I "C5'" 1 
ATOM 7132  C "C4'" . DG  I 5 53  ? 88.425  135.099 103.555 1.00 62.36  ? 53  DG  I "C4'" 1 
ATOM 7133  O "O4'" . DG  I 5 53  ? 89.641  135.756 103.118 1.00 62.36  ? 53  DG  I "O4'" 1 
ATOM 7134  C "C3'" . DG  I 5 53  ? 88.351  133.785 102.785 1.00 62.36  ? 53  DG  I "C3'" 1 
ATOM 7135  O "O3'" . DG  I 5 53  ? 87.442  133.927 101.717 1.00 62.36  ? 53  DG  I "O3'" 1 
ATOM 7136  C "C2'" . DG  I 5 53  ? 89.773  133.607 102.274 1.00 62.36  ? 53  DG  I "C2'" 1 
ATOM 7137  C "C1'" . DG  I 5 53  ? 90.176  135.044 102.034 1.00 62.36  ? 53  DG  I "C1'" 1 
ATOM 7138  N N9    . DG  I 5 53  ? 91.618  135.236 102.008 1.00 62.36  ? 53  DG  I N9    1 
ATOM 7139  C C8    . DG  I 5 53  ? 92.523  134.837 102.956 1.00 62.36  ? 53  DG  I C8    1 
ATOM 7140  N N7    . DG  I 5 53  ? 93.750  135.135 102.652 1.00 62.36  ? 53  DG  I N7    1 
ATOM 7141  C C5    . DG  I 5 53  ? 93.652  135.765 101.424 1.00 62.36  ? 53  DG  I C5    1 
ATOM 7142  C C6    . DG  I 5 53  ? 94.656  136.310 100.600 1.00 62.36  ? 53  DG  I C6    1 
ATOM 7143  O O6    . DG  I 5 53  ? 95.871  136.345 100.801 1.00 62.36  ? 53  DG  I O6    1 
ATOM 7144  N N1    . DG  I 5 53  ? 94.131  136.858 99.440  1.00 62.36  ? 53  DG  I N1    1 
ATOM 7145  C C2    . DG  I 5 53  ? 92.802  136.875 99.115  1.00 62.36  ? 53  DG  I C2    1 
ATOM 7146  N N2    . DG  I 5 53  ? 92.478  137.438 97.948  1.00 62.36  ? 53  DG  I N2    1 
ATOM 7147  N N3    . DG  I 5 53  ? 91.849  136.368 99.879  1.00 62.36  ? 53  DG  I N3    1 
ATOM 7148  C C4    . DG  I 5 53  ? 92.347  135.837 101.016 1.00 62.36  ? 53  DG  I C4    1 
ATOM 7149  P P     . DC  I 5 54  ? 86.714  132.649 101.081 1.00 64.99  ? 54  DC  I P     1 
ATOM 7150  O OP1   . DC  I 5 54  ? 85.272  132.831 101.340 1.00 64.99  ? 54  DC  I OP1   1 
ATOM 7151  O OP2   . DC  I 5 54  ? 87.388  131.418 101.543 1.00 64.99  ? 54  DC  I OP2   1 
ATOM 7152  O "O5'" . DC  I 5 54  ? 87.013  132.805 99.524  1.00 64.99  ? 54  DC  I "O5'" 1 
ATOM 7153  C "C5'" . DC  I 5 54  ? 87.528  134.032 99.036  1.00 64.99  ? 54  DC  I "C5'" 1 
ATOM 7154  C "C4'" . DC  I 5 54  ? 88.072  133.872 97.630  1.00 64.99  ? 54  DC  I "C4'" 1 
ATOM 7155  O "O4'" . DC  I 5 54  ? 89.469  134.274 97.592  1.00 64.99  ? 54  DC  I "O4'" 1 
ATOM 7156  C "C3'" . DC  I 5 54  ? 88.031  132.454 97.080  1.00 64.99  ? 54  DC  I "C3'" 1 
ATOM 7157  O "O3'" . DC  I 5 54  ? 87.761  132.496 95.695  1.00 64.99  ? 54  DC  I "O3'" 1 
ATOM 7158  C "C2'" . DC  I 5 54  ? 89.441  131.955 97.353  1.00 64.99  ? 54  DC  I "C2'" 1 
ATOM 7159  C "C1'" . DC  I 5 54  ? 90.251  133.212 97.098  1.00 64.99  ? 54  DC  I "C1'" 1 
ATOM 7160  N N1    . DC  I 5 54  ? 91.555  133.220 97.800  1.00 64.99  ? 54  DC  I N1    1 
ATOM 7161  C C2    . DC  I 5 54  ? 92.689  133.692 97.141  1.00 64.99  ? 54  DC  I C2    1 
ATOM 7162  O O2    . DC  I 5 54  ? 92.577  134.103 95.987  1.00 64.99  ? 54  DC  I O2    1 
ATOM 7163  N N3    . DC  I 5 54  ? 93.870  133.685 97.786  1.00 64.99  ? 54  DC  I N3    1 
ATOM 7164  C C4    . DC  I 5 54  ? 93.939  133.230 99.029  1.00 64.99  ? 54  DC  I C4    1 
ATOM 7165  N N4    . DC  I 5 54  ? 95.126  133.242 99.631  1.00 64.99  ? 54  DC  I N4    1 
ATOM 7166  C C5    . DC  I 5 54  ? 92.798  132.737 99.715  1.00 64.99  ? 54  DC  I C5    1 
ATOM 7167  C C6    . DC  I 5 54  ? 91.636  132.753 99.069  1.00 64.99  ? 54  DC  I C6    1 
ATOM 7168  P P     . DG  I 5 55  ? 86.983  131.290 94.982  1.00 63.74  ? 55  DG  I P     1 
ATOM 7169  O OP1   . DG  I 5 55  ? 85.663  131.807 94.572  1.00 63.74  ? 55  DG  I OP1   1 
ATOM 7170  O OP2   . DG  I 5 55  ? 87.084  130.100 95.856  1.00 63.74  ? 55  DG  I OP2   1 
ATOM 7171  O "O5'" . DG  I 5 55  ? 87.846  131.010 93.674  1.00 63.74  ? 55  DG  I "O5'" 1 
ATOM 7172  C "C5'" . DG  I 5 55  ? 88.401  132.096 92.954  1.00 63.74  ? 55  DG  I "C5'" 1 
ATOM 7173  C "C4'" . DG  I 5 55  ? 89.667  131.677 92.230  1.00 63.74  ? 55  DG  I "C4'" 1 
ATOM 7174  O "O4'" . DG  I 5 55  ? 90.821  131.882 93.088  1.00 63.74  ? 55  DG  I "O4'" 1 
ATOM 7175  C "C3'" . DG  I 5 55  ? 89.716  130.207 91.802  1.00 63.74  ? 55  DG  I "C3'" 1 
ATOM 7176  O "O3'" . DG  I 5 55  ? 90.238  130.113 90.489  1.00 63.74  ? 55  DG  I "O3'" 1 
ATOM 7177  C "C2'" . DG  I 5 55  ? 90.669  129.588 92.819  1.00 63.74  ? 55  DG  I "C2'" 1 
ATOM 7178  C "C1'" . DG  I 5 55  ? 91.630  130.734 93.044  1.00 63.74  ? 55  DG  I "C1'" 1 
ATOM 7179  N N9    . DG  I 5 55  ? 92.365  130.624 94.289  1.00 63.74  ? 55  DG  I N9    1 
ATOM 7180  C C8    . DG  I 5 55  ? 91.882  130.208 95.496  1.00 63.74  ? 55  DG  I C8    1 
ATOM 7181  N N7    . DG  I 5 55  ? 92.778  130.203 96.437  1.00 63.74  ? 55  DG  I N7    1 
ATOM 7182  C C5    . DG  I 5 55  ? 93.928  130.640 95.806  1.00 63.74  ? 55  DG  I C5    1 
ATOM 7183  C C6    . DG  I 5 55  ? 95.221  130.836 96.318  1.00 63.74  ? 55  DG  I C6    1 
ATOM 7184  O O6    . DG  I 5 55  ? 95.618  130.657 97.471  1.00 63.74  ? 55  DG  I O6    1 
ATOM 7185  N N1    . DG  I 5 55  ? 96.097  131.288 95.344  1.00 63.74  ? 55  DG  I N1    1 
ATOM 7186  C C2    . DG  I 5 55  ? 95.762  131.514 94.040  1.00 63.74  ? 55  DG  I C2    1 
ATOM 7187  N N2    . DG  I 5 55  ? 96.738  131.947 93.238  1.00 63.74  ? 55  DG  I N2    1 
ATOM 7188  N N3    . DG  I 5 55  ? 94.551  131.336 93.550  1.00 63.74  ? 55  DG  I N3    1 
ATOM 7189  C C4    . DG  I 5 55  ? 93.690  130.900 94.487  1.00 63.74  ? 55  DG  I C4    1 
ATOM 7190  P P     . DG  I 5 56  ? 89.850  128.877 89.543  1.00 60.21  ? 56  DG  I P     1 
ATOM 7191  O OP1   . DG  I 5 56  ? 88.854  129.369 88.572  1.00 60.21  ? 56  DG  I OP1   1 
ATOM 7192  O OP2   . DG  I 5 56  ? 89.530  127.712 90.392  1.00 60.21  ? 56  DG  I OP2   1 
ATOM 7193  O "O5'" . DG  I 5 56  ? 91.209  128.554 88.774  1.00 60.21  ? 56  DG  I "O5'" 1 
ATOM 7194  C "C5'" . DG  I 5 56  ? 91.929  129.603 88.143  1.00 60.21  ? 56  DG  I "C5'" 1 
ATOM 7195  C "C4'" . DG  I 5 56  ? 93.434  129.364 88.193  1.00 60.21  ? 56  DG  I "C4'" 1 
ATOM 7196  O "O4'" . DG  I 5 56  ? 93.909  129.425 89.564  1.00 60.21  ? 56  DG  I "O4'" 1 
ATOM 7197  C "C3'" . DG  I 5 56  ? 93.920  128.024 87.641  1.00 60.21  ? 56  DG  I "C3'" 1 
ATOM 7198  O "O3'" . DG  I 5 56  ? 95.119  128.242 86.921  1.00 60.21  ? 56  DG  I "O3'" 1 
ATOM 7199  C "C2'" . DG  I 5 56  ? 94.172  127.216 88.913  1.00 60.21  ? 56  DG  I "C2'" 1 
ATOM 7200  C "C1'" . DG  I 5 56  ? 94.704  128.294 89.830  1.00 60.21  ? 56  DG  I "C1'" 1 
ATOM 7201  N N9    . DG  I 5 56  ? 94.592  127.990 91.248  1.00 60.21  ? 56  DG  I N9    1 
ATOM 7202  C C8    . DG  I 5 56  ? 93.477  127.571 91.919  1.00 60.21  ? 56  DG  I C8    1 
ATOM 7203  N N7    . DG  I 5 56  ? 93.674  127.406 93.196  1.00 60.21  ? 56  DG  I N7    1 
ATOM 7204  C C5    . DG  I 5 56  ? 95.004  127.746 93.381  1.00 60.21  ? 56  DG  I C5    1 
ATOM 7205  C C6    . DG  I 5 56  ? 95.785  127.759 94.552  1.00 60.21  ? 56  DG  I C6    1 
ATOM 7206  O O6    . DG  I 5 56  ? 95.447  127.467 95.701  1.00 60.21  ? 56  DG  I O6    1 
ATOM 7207  N N1    . DG  I 5 56  ? 97.084  128.169 94.299  1.00 60.21  ? 56  DG  I N1    1 
ATOM 7208  C C2    . DG  I 5 56  ? 97.570  128.515 93.068  1.00 60.21  ? 56  DG  I C2    1 
ATOM 7209  N N2    . DG  I 5 56  ? 98.859  128.884 93.014  1.00 60.21  ? 56  DG  I N2    1 
ATOM 7210  N N3    . DG  I 5 56  ? 96.849  128.505 91.963  1.00 60.21  ? 56  DG  I N3    1 
ATOM 7211  C C4    . DG  I 5 56  ? 95.580  128.111 92.193  1.00 60.21  ? 56  DG  I C4    1 
ATOM 7212  P P     . DT  I 5 57  ? 95.684  127.164 85.872  1.00 54.95  ? 57  DT  I P     1 
ATOM 7213  O OP1   . DT  I 5 57  ? 95.550  127.760 84.527  1.00 54.95  ? 57  DT  I OP1   1 
ATOM 7214  O OP2   . DT  I 5 57  ? 95.107  125.832 86.147  1.00 54.95  ? 57  DT  I OP2   1 
ATOM 7215  O "O5'" . DT  I 5 57  ? 97.231  127.090 86.242  1.00 54.95  ? 57  DT  I "O5'" 1 
ATOM 7216  C "C5'" . DT  I 5 57  ? 97.625  127.309 87.578  1.00 54.95  ? 57  DT  I "C5'" 1 
ATOM 7217  C "C4'" . DT  I 5 57  ? 99.114  127.146 87.743  1.00 54.95  ? 57  DT  I "C4'" 1 
ATOM 7218  O "O4'" . DT  I 5 57  ? 99.410  126.941 89.139  1.00 54.95  ? 57  DT  I "O4'" 1 
ATOM 7219  C "C3'" . DT  I 5 57  ? 99.698  125.923 87.087  1.00 54.95  ? 57  DT  I "C3'" 1 
ATOM 7220  O "O3'" . DT  I 5 57  ? 101.104 126.056 87.091  1.00 54.95  ? 57  DT  I "O3'" 1 
ATOM 7221  C "C2'" . DT  I 5 57  ? 99.243  124.848 88.062  1.00 54.95  ? 57  DT  I "C2'" 1 
ATOM 7222  C "C1'" . DT  I 5 57  ? 99.502  125.550 89.394  1.00 54.95  ? 57  DT  I "C1'" 1 
ATOM 7223  N N1    . DT  I 5 57  ? 98.536  125.230 90.467  1.00 54.95  ? 57  DT  I N1    1 
ATOM 7224  C C2    . DT  I 5 57  ? 98.936  125.380 91.760  1.00 54.95  ? 57  DT  I C2    1 
ATOM 7225  O O2    . DT  I 5 57  ? 100.055 125.737 92.070  1.00 54.95  ? 57  DT  I O2    1 
ATOM 7226  N N3    . DT  I 5 57  ? 97.992  125.085 92.689  1.00 54.95  ? 57  DT  I N3    1 
ATOM 7227  C C4    . DT  I 5 57  ? 96.705  124.672 92.459  1.00 54.95  ? 57  DT  I C4    1 
ATOM 7228  O O4    . DT  I 5 57  ? 95.925  124.430 93.366  1.00 54.95  ? 57  DT  I O4    1 
ATOM 7229  C C5    . DT  I 5 57  ? 96.341  124.539 91.081  1.00 54.95  ? 57  DT  I C5    1 
ATOM 7230  C C7    . DT  I 5 57  ? 94.961  124.092 90.718  1.00 54.95  ? 57  DT  I C7    1 
ATOM 7231  C C6    . DT  I 5 57  ? 97.263  124.824 90.154  1.00 54.95  ? 57  DT  I C6    1 
ATOM 7232  P P     . DT  I 5 58  ? 102.021 125.202 86.095  1.00 50.88  ? 58  DT  I P     1 
ATOM 7233  O OP1   . DT  I 5 58  ? 102.910 126.146 85.389  1.00 50.88  ? 58  DT  I OP1   1 
ATOM 7234  O OP2   . DT  I 5 58  ? 101.147 124.271 85.353  1.00 50.88  ? 58  DT  I OP2   1 
ATOM 7235  O "O5'" . DT  I 5 58  ? 102.924 124.345 87.080  1.00 50.88  ? 58  DT  I "O5'" 1 
ATOM 7236  C "C5'" . DT  I 5 58  ? 103.399 124.929 88.280  1.00 50.88  ? 58  DT  I "C5'" 1 
ATOM 7237  C "C4'" . DT  I 5 58  ? 103.622 123.869 89.327  1.00 50.88  ? 58  DT  I "C4'" 1 
ATOM 7238  O "O4'" . DT  I 5 58  ? 102.416 123.684 90.114  1.00 50.88  ? 58  DT  I "O4'" 1 
ATOM 7239  C "C3'" . DT  I 5 58  ? 103.968 122.491 88.765  1.00 50.88  ? 58  DT  I "C3'" 1 
ATOM 7240  O "O3'" . DT  I 5 58  ? 105.028 121.942 89.495  1.00 50.88  ? 58  DT  I "O3'" 1 
ATOM 7241  C "C2'" . DT  I 5 58  ? 102.687 121.705 89.004  1.00 50.88  ? 58  DT  I "C2'" 1 
ATOM 7242  C "C1'" . DT  I 5 58  ? 102.258 122.314 90.314  1.00 50.88  ? 58  DT  I "C1'" 1 
ATOM 7243  N N1    . DT  I 5 58  ? 100.870 122.007 90.702  1.00 50.88  ? 58  DT  I N1    1 
ATOM 7244  C C2    . DT  I 5 58  ? 100.510 122.110 92.017  1.00 50.88  ? 58  DT  I C2    1 
ATOM 7245  O O2    . DT  I 5 58  ? 101.268 122.484 92.881  1.00 50.88  ? 58  DT  I O2    1 
ATOM 7246  N N3    . DT  I 5 58  ? 99.215  121.777 92.281  1.00 50.88  ? 58  DT  I N3    1 
ATOM 7247  C C4    . DT  I 5 58  ? 98.277  121.341 91.384  1.00 50.88  ? 58  DT  I C4    1 
ATOM 7248  O O4    . DT  I 5 58  ? 97.136  121.063 91.715  1.00 50.88  ? 58  DT  I O4    1 
ATOM 7249  C C5    . DT  I 5 58  ? 98.727  121.236 90.024  1.00 50.88  ? 58  DT  I C5    1 
ATOM 7250  C C7    . DT  I 5 58  ? 97.787  120.774 88.957  1.00 50.88  ? 58  DT  I C7    1 
ATOM 7251  C C6    . DT  I 5 58  ? 99.988  121.561 89.753  1.00 50.88  ? 58  DT  I C6    1 
ATOM 7252  P P     . DA  I 5 59  ? 106.498 121.868 88.869  1.00 46.27  ? 59  DA  I P     1 
ATOM 7253  O OP1   . DA  I 5 59  ? 106.651 123.000 87.938  1.00 46.27  ? 59  DA  I OP1   1 
ATOM 7254  O OP2   . DA  I 5 59  ? 106.697 120.491 88.381  1.00 46.27  ? 59  DA  I OP2   1 
ATOM 7255  O "O5'" . DA  I 5 59  ? 107.445 122.094 90.132  1.00 46.27  ? 59  DA  I "O5'" 1 
ATOM 7256  C "C5'" . DA  I 5 59  ? 107.053 123.011 91.154  1.00 46.27  ? 59  DA  I "C5'" 1 
ATOM 7257  C "C4'" . DA  I 5 59  ? 106.938 122.332 92.519  1.00 46.27  ? 59  DA  I "C4'" 1 
ATOM 7258  O "O4'" . DA  I 5 59  ? 105.586 121.853 92.740  1.00 46.27  ? 59  DA  I "O4'" 1 
ATOM 7259  C "C3'" . DA  I 5 59  ? 107.848 121.135 92.762  1.00 46.27  ? 59  DA  I "C3'" 1 
ATOM 7260  O "O3'" . DA  I 5 59  ? 108.285 121.179 94.110  1.00 46.27  ? 59  DA  I "O3'" 1 
ATOM 7261  C "C2'" . DA  I 5 59  ? 106.908 119.955 92.511  1.00 46.27  ? 59  DA  I "C2'" 1 
ATOM 7262  C "C1'" . DA  I 5 59  ? 105.613 120.488 93.084  1.00 46.27  ? 59  DA  I "C1'" 1 
ATOM 7263  N N9    . DA  I 5 59  ? 104.421 119.869 92.527  1.00 46.27  ? 59  DA  I N9    1 
ATOM 7264  C C8    . DA  I 5 59  ? 104.227 119.466 91.245  1.00 46.27  ? 59  DA  I C8    1 
ATOM 7265  N N7    . DA  I 5 59  ? 103.041 118.963 91.024  1.00 46.27  ? 59  DA  I N7    1 
ATOM 7266  C C5    . DA  I 5 59  ? 102.418 119.047 92.246  1.00 46.27  ? 59  DA  I C5    1 
ATOM 7267  C C6    . DA  I 5 59  ? 101.144 118.673 92.680  1.00 46.27  ? 59  DA  I C6    1 
ATOM 7268  N N6    . DA  I 5 59  ? 100.234 118.122 91.883  1.00 46.27  ? 59  DA  I N6    1 
ATOM 7269  N N1    . DA  I 5 59  ? 100.834 118.888 93.968  1.00 46.27  ? 59  DA  I N1    1 
ATOM 7270  C C2    . DA  I 5 59  ? 101.746 119.444 94.762  1.00 46.27  ? 59  DA  I C2    1 
ATOM 7271  N N3    . DA  I 5 59  ? 102.976 119.835 94.467  1.00 46.27  ? 59  DA  I N3    1 
ATOM 7272  C C4    . DA  I 5 59  ? 103.251 119.605 93.181  1.00 46.27  ? 59  DA  I C4    1 
ATOM 7273  P P     . DA  I 5 60  ? 109.524 120.301 94.631  1.00 40.60  ? 60  DA  I P     1 
ATOM 7274  O OP1   . DA  I 5 60  ? 110.581 121.250 95.022  1.00 40.60  ? 60  DA  I OP1   1 
ATOM 7275  O OP2   . DA  I 5 60  ? 109.833 119.197 93.699  1.00 40.60  ? 60  DA  I OP2   1 
ATOM 7276  O "O5'" . DA  I 5 60  ? 108.958 119.658 95.968  1.00 40.60  ? 60  DA  I "O5'" 1 
ATOM 7277  C "C5'" . DA  I 5 60  ? 108.376 120.492 96.948  1.00 40.60  ? 60  DA  I "C5'" 1 
ATOM 7278  C "C4'" . DA  I 5 60  ? 107.287 119.764 97.707  1.00 40.60  ? 60  DA  I "C4'" 1 
ATOM 7279  O "O4'" . DA  I 5 60  ? 106.274 119.317 96.787  1.00 40.60  ? 60  DA  I "O4'" 1 
ATOM 7280  C "C3'" . DA  I 5 60  ? 107.733 118.524 98.473  1.00 40.60  ? 60  DA  I "C3'" 1 
ATOM 7281  O "O3'" . DA  I 5 60  ? 107.096 118.507 99.718  1.00 40.60  ? 60  DA  I "O3'" 1 
ATOM 7282  C "C2'" . DA  I 5 60  ? 107.244 117.389 97.586  1.00 40.60  ? 60  DA  I "C2'" 1 
ATOM 7283  C "C1'" . DA  I 5 60  ? 105.968 117.978 97.051  1.00 40.60  ? 60  DA  I "C1'" 1 
ATOM 7284  N N9    . DA  I 5 60  ? 105.522 117.375 95.816  1.00 40.60  ? 60  DA  I N9    1 
ATOM 7285  C C8    . DA  I 5 60  ? 106.236 117.239 94.673  1.00 40.60  ? 60  DA  I C8    1 
ATOM 7286  N N7    . DA  I 5 60  ? 105.573 116.675 93.703  1.00 40.60  ? 60  DA  I N7    1 
ATOM 7287  C C5    . DA  I 5 60  ? 104.333 116.431 94.252  1.00 40.60  ? 60  DA  I C5    1 
ATOM 7288  C C6    . DA  I 5 60  ? 103.172 115.843 93.738  1.00 40.60  ? 60  DA  I C6    1 
ATOM 7289  N N6    . DA  I 5 60  ? 103.075 115.381 92.494  1.00 40.60  ? 60  DA  I N6    1 
ATOM 7290  N N1    . DA  I 5 60  ? 102.110 115.747 94.550  1.00 40.60  ? 60  DA  I N1    1 
ATOM 7291  C C2    . DA  I 5 60  ? 102.210 116.202 95.796  1.00 40.60  ? 60  DA  I C2    1 
ATOM 7292  N N3    . DA  I 5 60  ? 103.246 116.779 96.388  1.00 40.60  ? 60  DA  I N3    1 
ATOM 7293  C C4    . DA  I 5 60  ? 104.285 116.859 95.553  1.00 40.60  ? 60  DA  I C4    1 
ATOM 7294  P P     . DA  I 5 61  ? 107.652 117.604 100.912 1.00 34.89  ? 61  DA  I P     1 
ATOM 7295  O OP1   . DA  I 5 61  ? 107.904 118.470 102.072 1.00 34.89  ? 61  DA  I OP1   1 
ATOM 7296  O OP2   . DA  I 5 61  ? 108.739 116.768 100.384 1.00 34.89  ? 61  DA  I OP2   1 
ATOM 7297  O "O5'" . DA  I 5 61  ? 106.421 116.665 101.258 1.00 34.89  ? 61  DA  I "O5'" 1 
ATOM 7298  C "C5'" . DA  I 5 61  ? 105.122 117.215 101.381 1.00 34.89  ? 61  DA  I "C5'" 1 
ATOM 7299  C "C4'" . DA  I 5 61  ? 104.055 116.135 101.355 1.00 34.89  ? 61  DA  I "C4'" 1 
ATOM 7300  O "O4'" . DA  I 5 61  ? 103.764 115.755 99.993  1.00 34.89  ? 61  DA  I "O4'" 1 
ATOM 7301  C "C3'" . DA  I 5 61  ? 104.397 114.848 102.078 1.00 34.89  ? 61  DA  I "C3'" 1 
ATOM 7302  O "O3'" . DA  I 5 61  ? 103.246 114.397 102.739 1.00 34.89  ? 61  DA  I "O3'" 1 
ATOM 7303  C "C2'" . DA  I 5 61  ? 104.781 113.914 100.935 1.00 34.89  ? 61  DA  I "C2'" 1 
ATOM 7304  C "C1'" . DA  I 5 61  ? 103.818 114.359 99.869  1.00 34.89  ? 61  DA  I "C1'" 1 
ATOM 7305  N N9    . DA  I 5 61  ? 104.235 114.060 98.509  1.00 34.89  ? 61  DA  I N9    1 
ATOM 7306  C C8    . DA  I 5 61  ? 105.431 114.347 97.941  1.00 34.89  ? 61  DA  I C8    1 
ATOM 7307  N N7    . DA  I 5 61  ? 105.517 113.996 96.686  1.00 34.89  ? 61  DA  I N7    1 
ATOM 7308  C C5    . DA  I 5 61  ? 104.284 113.451 96.411  1.00 34.89  ? 61  DA  I C5    1 
ATOM 7309  C C6    . DA  I 5 61  ? 103.730 112.894 95.247  1.00 34.89  ? 61  DA  I C6    1 
ATOM 7310  N N6    . DA  I 5 61  ? 104.387 112.792 94.098  1.00 34.89  ? 61  DA  I N6    1 
ATOM 7311  N N1    . DA  I 5 61  ? 102.472 112.440 95.309  1.00 34.89  ? 61  DA  I N1    1 
ATOM 7312  C C2    . DA  I 5 61  ? 101.806 112.539 96.456  1.00 34.89  ? 61  DA  I C2    1 
ATOM 7313  N N3    . DA  I 5 61  ? 102.216 113.049 97.612  1.00 34.89  ? 61  DA  I N3    1 
ATOM 7314  C C4    . DA  I 5 61  ? 103.478 113.491 97.520  1.00 34.89  ? 61  DA  I C4    1 
ATOM 7315  P P     . DA  I 5 62  ? 103.330 113.356 103.951 1.00 37.89  ? 62  DA  I P     1 
ATOM 7316  O OP1   . DA  I 5 62  ? 102.825 114.045 105.144 1.00 37.89  ? 62  DA  I OP1   1 
ATOM 7317  O OP2   . DA  I 5 62  ? 104.644 112.698 103.985 1.00 37.89  ? 62  DA  I OP2   1 
ATOM 7318  O "O5'" . DA  I 5 62  ? 102.267 112.260 103.536 1.00 37.89  ? 62  DA  I "O5'" 1 
ATOM 7319  C "C5'" . DA  I 5 62  ? 101.178 112.628 102.718 1.00 37.89  ? 62  DA  I "C5'" 1 
ATOM 7320  C "C4'" . DA  I 5 62  ? 100.586 111.420 102.033 1.00 37.89  ? 62  DA  I "C4'" 1 
ATOM 7321  O "O4'" . DA  I 5 62  ? 101.117 111.300 100.700 1.00 37.89  ? 62  DA  I "O4'" 1 
ATOM 7322  C "C3'" . DA  I 5 62  ? 100.849 110.091 102.718 1.00 37.89  ? 62  DA  I "C3'" 1 
ATOM 7323  O "O3'" . DA  I 5 62  ? 99.666  109.341 102.695 1.00 37.89  ? 62  DA  I "O3'" 1 
ATOM 7324  C "C2'" . DA  I 5 62  ? 101.939 109.461 101.854 1.00 37.89  ? 62  DA  I "C2'" 1 
ATOM 7325  C "C1'" . DA  I 5 62  ? 101.601 110.002 100.487 1.00 37.89  ? 62  DA  I "C1'" 1 
ATOM 7326  N N9    . DA  I 5 62  ? 102.736 110.124 99.598  1.00 37.89  ? 62  DA  I N9    1 
ATOM 7327  C C8    . DA  I 5 62  ? 103.935 110.695 99.876  1.00 37.89  ? 62  DA  I C8    1 
ATOM 7328  N N7    . DA  I 5 62  ? 104.764 110.704 98.868  1.00 37.89  ? 62  DA  I N7    1 
ATOM 7329  C C5    . DA  I 5 62  ? 104.052 110.108 97.859  1.00 37.89  ? 62  DA  I C5    1 
ATOM 7330  C C6    . DA  I 5 62  ? 104.368 109.818 96.529  1.00 37.89  ? 62  DA  I C6    1 
ATOM 7331  N N6    . DA  I 5 62  ? 105.541 110.110 95.977  1.00 37.89  ? 62  DA  I N6    1 
ATOM 7332  N N1    . DA  I 5 62  ? 103.425 109.219 95.779  1.00 37.89  ? 62  DA  I N1    1 
ATOM 7333  C C2    . DA  I 5 62  ? 102.247 108.931 96.334  1.00 37.89  ? 62  DA  I C2    1 
ATOM 7334  N N3    . DA  I 5 62  ? 101.835 109.160 97.574  1.00 37.89  ? 62  DA  I N3    1 
ATOM 7335  C C4    . DA  I 5 62  ? 102.794 109.755 98.289  1.00 37.89  ? 62  DA  I C4    1 
ATOM 7336  P P     . DC  I 5 63  ? 99.466  108.077 103.654 1.00 43.24  ? 63  DC  I P     1 
ATOM 7337  O OP1   . DC  I 5 63  ? 98.189  108.291 104.363 1.00 43.24  ? 63  DC  I OP1   1 
ATOM 7338  O OP2   . DC  I 5 63  ? 100.705 107.847 104.423 1.00 43.24  ? 63  DC  I OP2   1 
ATOM 7339  O "O5'" . DC  I 5 63  ? 99.288  106.883 102.615 1.00 43.24  ? 63  DC  I "O5'" 1 
ATOM 7340  C "C5'" . DC  I 5 63  ? 98.818  107.174 101.306 1.00 43.24  ? 63  DC  I "C5'" 1 
ATOM 7341  C "C4'" . DC  I 5 63  ? 99.177  106.065 100.345 1.00 43.24  ? 63  DC  I "C4'" 1 
ATOM 7342  O "O4'" . DC  I 5 63  ? 100.299 106.457 99.516  1.00 43.24  ? 63  DC  I "O4'" 1 
ATOM 7343  C "C3'" . DC  I 5 63  ? 99.582  104.758 101.004 1.00 43.24  ? 63  DC  I "C3'" 1 
ATOM 7344  O "O3'" . DC  I 5 63  ? 98.953  103.713 100.324 1.00 43.24  ? 63  DC  I "O3'" 1 
ATOM 7345  C "C2'" . DC  I 5 63  ? 101.091 104.724 100.795 1.00 43.24  ? 63  DC  I "C2'" 1 
ATOM 7346  C "C1'" . DC  I 5 63  ? 101.201 105.390 99.446  1.00 43.24  ? 63  DC  I "C1'" 1 
ATOM 7347  N N1    . DC  I 5 63  ? 102.544 105.930 99.152  1.00 43.24  ? 63  DC  I N1    1 
ATOM 7348  C C2    . DC  I 5 63  ? 103.089 105.776 97.880  1.00 43.24  ? 63  DC  I C2    1 
ATOM 7349  O O2    . DC  I 5 63  ? 102.442 105.182 97.022  1.00 43.24  ? 63  DC  I O2    1 
ATOM 7350  N N3    . DC  I 5 63  ? 104.313 106.278 97.631  1.00 43.24  ? 63  DC  I N3    1 
ATOM 7351  C C4    . DC  I 5 63  ? 104.980 106.910 98.587  1.00 43.24  ? 63  DC  I C4    1 
ATOM 7352  N N4    . DC  I 5 63  ? 106.187 107.392 98.296  1.00 43.24  ? 63  DC  I N4    1 
ATOM 7353  C C5    . DC  I 5 63  ? 104.444 107.078 99.889  1.00 43.24  ? 63  DC  I C5    1 
ATOM 7354  C C6    . DC  I 5 63  ? 103.234 106.577 100.124 1.00 43.24  ? 63  DC  I C6    1 
ATOM 7355  P P     . DG  I 5 64  ? 98.659  102.316 101.045 1.00 45.76  ? 64  DG  I P     1 
ATOM 7356  O OP1   . DG  I 5 64  ? 97.188  102.204 101.126 1.00 45.76  ? 64  DG  I OP1   1 
ATOM 7357  O OP2   . DG  I 5 64  ? 99.483  102.197 102.264 1.00 45.76  ? 64  DG  I OP2   1 
ATOM 7358  O "O5'" . DG  I 5 64  ? 99.185  101.273 99.973  1.00 45.76  ? 64  DG  I "O5'" 1 
ATOM 7359  C "C5'" . DG  I 5 64  ? 98.904  101.506 98.615  1.00 45.76  ? 64  DG  I "C5'" 1 
ATOM 7360  C "C4'" . DG  I 5 64  ? 99.968  100.905 97.728  1.00 45.76  ? 64  DG  I "C4'" 1 
ATOM 7361  O "O4'" . DG  I 5 64  ? 101.112 101.780 97.656  1.00 45.76  ? 64  DG  I "O4'" 1 
ATOM 7362  C "C3'" . DG  I 5 64  ? 100.495 99.546  98.170  1.00 45.76  ? 64  DG  I "C3'" 1 
ATOM 7363  O "O3'" . DG  I 5 64  ? 100.457 98.678  97.067  1.00 45.76  ? 64  DG  I "O3'" 1 
ATOM 7364  C "C2'" . DG  I 5 64  ? 101.931 99.846  98.607  1.00 45.76  ? 64  DG  I "C2'" 1 
ATOM 7365  C "C1'" . DG  I 5 64  ? 102.277 101.007 97.702  1.00 45.76  ? 64  DG  I "C1'" 1 
ATOM 7366  N N9    . DG  I 5 64  ? 103.352 101.853 98.196  1.00 45.76  ? 64  DG  I N9    1 
ATOM 7367  C C8    . DG  I 5 64  ? 103.435 102.444 99.427  1.00 45.76  ? 64  DG  I C8    1 
ATOM 7368  N N7    . DG  I 5 64  ? 104.505 103.164 99.584  1.00 45.76  ? 64  DG  I N7    1 
ATOM 7369  C C5    . DG  I 5 64  ? 105.166 103.051 98.376  1.00 45.76  ? 64  DG  I C5    1 
ATOM 7370  C C6    . DG  I 5 64  ? 106.384 103.615 97.956  1.00 45.76  ? 64  DG  I C6    1 
ATOM 7371  O O6    . DG  I 5 64  ? 107.140 104.351 98.589  1.00 45.76  ? 64  DG  I O6    1 
ATOM 7372  N N1    . DG  I 5 64  ? 106.701 103.247 96.657  1.00 45.76  ? 64  DG  I N1    1 
ATOM 7373  C C2    . DG  I 5 64  ? 105.936 102.439 95.865  1.00 45.76  ? 64  DG  I C2    1 
ATOM 7374  N N2    . DG  I 5 64  ? 106.404 102.192 94.639  1.00 45.76  ? 64  DG  I N2    1 
ATOM 7375  N N3    . DG  I 5 64  ? 104.789 101.902 96.248  1.00 45.76  ? 64  DG  I N3    1 
ATOM 7376  C C4    . DG  I 5 64  ? 104.468 102.252 97.510  1.00 45.76  ? 64  DG  I C4    1 
ATOM 7377  P P     . DC  I 5 65  ? 100.520 97.090  97.257  1.00 44.67  ? 65  DC  I P     1 
ATOM 7378  O OP1   . DC  I 5 65  ? 99.435  96.516  96.433  1.00 44.67  ? 65  DC  I OP1   1 
ATOM 7379  O OP2   . DC  I 5 65  ? 100.600 96.772  98.697  1.00 44.67  ? 65  DC  I OP2   1 
ATOM 7380  O "O5'" . DC  I 5 65  ? 101.906 96.719  96.579  1.00 44.67  ? 65  DC  I "O5'" 1 
ATOM 7381  C "C5'" . DC  I 5 65  ? 102.378 97.503  95.492  1.00 44.67  ? 65  DC  I "C5'" 1 
ATOM 7382  C "C4'" . DC  I 5 65  ? 103.790 97.114  95.126  1.00 44.67  ? 65  DC  I "C4'" 1 
ATOM 7383  O "O4'" . DC  I 5 65  ? 104.716 98.151  95.547  1.00 44.67  ? 65  DC  I "O4'" 1 
ATOM 7384  C "C3'" . DC  I 5 65  ? 104.275 95.831  95.778  1.00 44.67  ? 65  DC  I "C3'" 1 
ATOM 7385  O "O3'" . DC  I 5 65  ? 105.037 95.099  94.853  1.00 44.67  ? 65  DC  I "O3'" 1 
ATOM 7386  C "C2'" . DC  I 5 65  ? 105.135 96.345  96.923  1.00 44.67  ? 65  DC  I "C2'" 1 
ATOM 7387  C "C1'" . DC  I 5 65  ? 105.755 97.567  96.286  1.00 44.67  ? 65  DC  I "C1'" 1 
ATOM 7388  N N1    . DC  I 5 65  ? 106.254 98.549  97.271  1.00 44.67  ? 65  DC  I N1    1 
ATOM 7389  C C2    . DC  I 5 65  ? 107.427 99.250  97.013  1.00 44.67  ? 65  DC  I C2    1 
ATOM 7390  O O2    . DC  I 5 65  ? 108.022 99.043  95.961  1.00 44.67  ? 65  DC  I O2    1 
ATOM 7391  N N3    . DC  I 5 65  ? 107.872 100.133 97.924  1.00 44.67  ? 65  DC  I N3    1 
ATOM 7392  C C4    . DC  I 5 65  ? 107.198 100.319 99.048  1.00 44.67  ? 65  DC  I C4    1 
ATOM 7393  N N4    . DC  I 5 65  ? 107.672 101.203 99.923  1.00 44.67  ? 65  DC  I N4    1 
ATOM 7394  C C5    . DC  I 5 65  ? 106.001 99.613  99.330  1.00 44.67  ? 65  DC  I C5    1 
ATOM 7395  C C6    . DC  I 5 65  ? 105.572 98.745  98.422  1.00 44.67  ? 65  DC  I C6    1 
ATOM 7396  P P     . DG  I 5 66  ? 105.121 93.502  94.951  1.00 44.78  ? 66  DG  I P     1 
ATOM 7397  O OP1   . DG  I 5 66  ? 104.148 92.968  93.979  1.00 44.78  ? 66  DG  I OP1   1 
ATOM 7398  O OP2   . DG  I 5 66  ? 105.041 93.097  96.369  1.00 44.78  ? 66  DG  I OP2   1 
ATOM 7399  O "O5'" . DG  I 5 66  ? 106.596 93.193  94.442  1.00 44.78  ? 66  DG  I "O5'" 1 
ATOM 7400  C "C5'" . DG  I 5 66  ? 107.100 93.886  93.321  1.00 44.78  ? 66  DG  I "C5'" 1 
ATOM 7401  C "C4'" . DG  I 5 66  ? 108.588 94.150  93.457  1.00 44.78  ? 66  DG  I "C4'" 1 
ATOM 7402  O "O4'" . DG  I 5 66  ? 108.814 95.225  94.392  1.00 44.78  ? 66  DG  I "O4'" 1 
ATOM 7403  C "C3'" . DG  I 5 66  ? 109.418 92.973  93.950  1.00 44.78  ? 66  DG  I "C3'" 1 
ATOM 7404  O "O3'" . DG  I 5 66  ? 110.581 92.872  93.170  1.00 44.78  ? 66  DG  I "O3'" 1 
ATOM 7405  C "C2'" . DG  I 5 66  ? 109.738 93.345  95.396  1.00 44.78  ? 66  DG  I "C2'" 1 
ATOM 7406  C "C1'" . DG  I 5 66  ? 109.807 94.854  95.315  1.00 44.78  ? 66  DG  I "C1'" 1 
ATOM 7407  N N9    . DG  I 5 66  ? 109.502 95.519  96.565  1.00 44.78  ? 66  DG  I N9    1 
ATOM 7408  C C8    . DG  I 5 66  ? 108.413 95.302  97.355  1.00 44.78  ? 66  DG  I C8    1 
ATOM 7409  N N7    . DG  I 5 66  ? 108.374 96.060  98.403  1.00 44.78  ? 66  DG  I N7    1 
ATOM 7410  C C5    . DG  I 5 66  ? 109.512 96.831  98.301  1.00 44.78  ? 66  DG  I C5    1 
ATOM 7411  C C6    . DG  I 5 66  ? 109.999 97.829  99.155  1.00 44.78  ? 66  DG  I C6    1 
ATOM 7412  O O6    . DG  I 5 66  ? 109.500 98.238  100.203 1.00 44.78  ? 66  DG  I O6    1 
ATOM 7413  N N1    . DG  I 5 66  ? 111.188 98.375  98.690  1.00 44.78  ? 66  DG  I N1    1 
ATOM 7414  C C2    . DG  I 5 66  ? 111.823 97.998  97.539  1.00 44.78  ? 66  DG  I C2    1 
ATOM 7415  N N2    . DG  I 5 66  ? 112.964 98.636  97.251  1.00 44.78  ? 66  DG  I N2    1 
ATOM 7416  N N3    . DG  I 5 66  ? 111.373 97.054  96.724  1.00 44.78  ? 66  DG  I N3    1 
ATOM 7417  C C4    . DG  I 5 66  ? 110.215 96.518  97.170  1.00 44.78  ? 66  DG  I C4    1 
ATOM 7418  P P     . DG  I 5 67  ? 111.444 91.523  93.179  1.00 43.52  ? 67  DG  I P     1 
ATOM 7419  O OP1   . DG  I 5 67  ? 111.831 91.226  91.785  1.00 43.52  ? 67  DG  I OP1   1 
ATOM 7420  O OP2   . DG  I 5 67  ? 110.694 90.519  93.958  1.00 43.52  ? 67  DG  I OP2   1 
ATOM 7421  O "O5'" . DG  I 5 67  ? 112.755 91.934  93.990  1.00 43.52  ? 67  DG  I "O5'" 1 
ATOM 7422  C "C5'" . DG  I 5 67  ? 113.464 93.112  93.626  1.00 43.52  ? 67  DG  I "C5'" 1 
ATOM 7423  C "C4'" . DG  I 5 67  ? 114.415 93.554  94.725  1.00 43.52  ? 67  DG  I "C4'" 1 
ATOM 7424  O "O4'" . DG  I 5 67  ? 113.676 94.173  95.808  1.00 43.52  ? 67  DG  I "O4'" 1 
ATOM 7425  C "C3'" . DG  I 5 67  ? 115.239 92.445  95.372  1.00 43.52  ? 67  DG  I "C3'" 1 
ATOM 7426  O "O3'" . DG  I 5 67  ? 116.552 92.924  95.606  1.00 43.52  ? 67  DG  I "O3'" 1 
ATOM 7427  C "C2'" . DG  I 5 67  ? 114.504 92.231  96.689  1.00 43.52  ? 67  DG  I "C2'" 1 
ATOM 7428  C "C1'" . DG  I 5 67  ? 114.165 93.660  97.016  1.00 43.52  ? 67  DG  I "C1'" 1 
ATOM 7429  N N9    . DG  I 5 67  ? 113.151 93.832  98.046  1.00 43.52  ? 67  DG  I N9    1 
ATOM 7430  C C8    . DG  I 5 67  ? 112.023 93.088  98.231  1.00 43.52  ? 67  DG  I C8    1 
ATOM 7431  N N7    . DG  I 5 67  ? 111.298 93.493  99.231  1.00 43.52  ? 67  DG  I N7    1 
ATOM 7432  C C5    . DG  I 5 67  ? 111.993 94.579  99.736  1.00 43.52  ? 67  DG  I C5    1 
ATOM 7433  C C6    . DG  I 5 67  ? 111.697 95.425  100.824 1.00 43.52  ? 67  DG  I C6    1 
ATOM 7434  O O6    . DG  I 5 67  ? 110.726 95.384  101.584 1.00 43.52  ? 67  DG  I O6    1 
ATOM 7435  N N1    . DG  I 5 67  ? 112.662 96.400  100.993 1.00 43.52  ? 67  DG  I N1    1 
ATOM 7436  C C2    . DG  I 5 67  ? 113.771 96.543  100.214 1.00 43.52  ? 67  DG  I C2    1 
ATOM 7437  N N2    . DG  I 5 67  ? 114.595 97.541  100.529 1.00 43.52  ? 67  DG  I N2    1 
ATOM 7438  N N3    . DG  I 5 67  ? 114.061 95.759  99.197  1.00 43.52  ? 67  DG  I N3    1 
ATOM 7439  C C4    . DG  I 5 67  ? 113.132 94.800  99.018  1.00 43.52  ? 67  DG  I C4    1 
ATOM 7440  P P     . DG  I 5 68  ? 117.802 92.332  94.797  1.00 45.64  ? 68  DG  I P     1 
ATOM 7441  O OP1   . DG  I 5 68  ? 117.655 92.712  93.383  1.00 45.64  ? 68  DG  I OP1   1 
ATOM 7442  O OP2   . DG  I 5 68  ? 117.938 90.915  95.178  1.00 45.64  ? 68  DG  I OP2   1 
ATOM 7443  O "O5'" . DG  I 5 68  ? 119.058 93.118  95.395  1.00 45.64  ? 68  DG  I "O5'" 1 
ATOM 7444  C "C5'" . DG  I 5 68  ? 118.979 94.532  95.647  1.00 45.64  ? 68  DG  I "C5'" 1 
ATOM 7445  C "C4'" . DG  I 5 68  ? 119.470 94.914  97.047  1.00 45.64  ? 68  DG  I "C4'" 1 
ATOM 7446  O "O4'" . DG  I 5 68  ? 118.385 94.821  98.002  1.00 45.64  ? 68  DG  I "O4'" 1 
ATOM 7447  C "C3'" . DG  I 5 68  ? 120.590 94.069  97.635  1.00 45.64  ? 68  DG  I "C3'" 1 
ATOM 7448  O "O3'" . DG  I 5 68  ? 121.361 94.877  98.493  1.00 45.64  ? 68  DG  I "O3'" 1 
ATOM 7449  C "C2'" . DG  I 5 68  ? 119.808 93.054  98.455  1.00 45.64  ? 68  DG  I "C2'" 1 
ATOM 7450  C "C1'" . DG  I 5 68  ? 118.770 93.968  99.055  1.00 45.64  ? 68  DG  I "C1'" 1 
ATOM 7451  N N9    . DG  I 5 68  ? 117.585 93.297  99.539  1.00 45.64  ? 68  DG  I N9    1 
ATOM 7452  C C8    . DG  I 5 68  ? 117.040 92.138  99.074  1.00 45.64  ? 68  DG  I C8    1 
ATOM 7453  N N7    . DG  I 5 68  ? 115.950 91.796  99.696  1.00 45.64  ? 68  DG  I N7    1 
ATOM 7454  C C5    . DG  I 5 68  ? 115.768 92.799  100.629 1.00 45.64  ? 68  DG  I C5    1 
ATOM 7455  C C6    . DG  I 5 68  ? 114.760 92.972  101.595 1.00 45.64  ? 68  DG  I C6    1 
ATOM 7456  O O6    . DG  I 5 68  ? 113.786 92.254  101.828 1.00 45.64  ? 68  DG  I O6    1 
ATOM 7457  N N1    . DG  I 5 68  ? 114.957 94.121  102.341 1.00 45.64  ? 68  DG  I N1    1 
ATOM 7458  C C2    . DG  I 5 68  ? 115.994 94.995  102.175 1.00 45.64  ? 68  DG  I C2    1 
ATOM 7459  N N2    . DG  I 5 68  ? 116.017 96.050  102.996 1.00 45.64  ? 68  DG  I N2    1 
ATOM 7460  N N3    . DG  I 5 68  ? 116.945 94.845  101.273 1.00 45.64  ? 68  DG  I N3    1 
ATOM 7461  C C4    . DG  I 5 68  ? 116.767 93.728  100.540 1.00 45.64  ? 68  DG  I C4    1 
ATOM 7462  P P     . DG  I 5 69  ? 122.803 95.423  98.064  1.00 44.72  ? 69  DG  I P     1 
ATOM 7463  O OP1   . DG  I 5 69  ? 122.669 96.201  96.825  1.00 44.72  ? 69  DG  I OP1   1 
ATOM 7464  O OP2   . DG  I 5 69  ? 123.738 94.281  98.110  1.00 44.72  ? 69  DG  I OP2   1 
ATOM 7465  O "O5'" . DG  I 5 69  ? 123.174 96.429  99.245  1.00 44.72  ? 69  DG  I "O5'" 1 
ATOM 7466  C "C5'" . DG  I 5 69  ? 122.145 97.178  99.889  1.00 44.72  ? 69  DG  I "C5'" 1 
ATOM 7467  C "C4'" . DG  I 5 69  ? 122.145 96.971  101.398 1.00 44.72  ? 69  DG  I "C4'" 1 
ATOM 7468  O "O4'" . DG  I 5 69  ? 121.106 96.031  101.772 1.00 44.72  ? 69  DG  I "O4'" 1 
ATOM 7469  C "C3'" . DG  I 5 69  ? 123.432 96.418  102.006 1.00 44.72  ? 69  DG  I "C3'" 1 
ATOM 7470  O "O3'" . DG  I 5 69  ? 123.589 96.947  103.295 1.00 44.72  ? 69  DG  I "O3'" 1 
ATOM 7471  C "C2'" . DG  I 5 69  ? 123.107 94.937  102.112 1.00 44.72  ? 69  DG  I "C2'" 1 
ATOM 7472  C "C1'" . DG  I 5 69  ? 121.672 95.028  102.577 1.00 44.72  ? 69  DG  I "C1'" 1 
ATOM 7473  N N9    . DG  I 5 69  ? 120.910 93.805  102.406 1.00 44.72  ? 69  DG  I N9    1 
ATOM 7474  C C8    . DG  I 5 69  ? 121.203 92.766  101.576 1.00 44.72  ? 69  DG  I C8    1 
ATOM 7475  N N7    . DG  I 5 69  ? 120.331 91.805  101.623 1.00 44.72  ? 69  DG  I N7    1 
ATOM 7476  C C5    . DG  I 5 69  ? 119.407 92.234  102.556 1.00 44.72  ? 69  DG  I C5    1 
ATOM 7477  C C6    . DG  I 5 69  ? 118.238 91.609  103.032 1.00 44.72  ? 69  DG  I C6    1 
ATOM 7478  O O6    . DG  I 5 69  ? 117.766 90.514  102.712 1.00 44.72  ? 69  DG  I O6    1 
ATOM 7479  N N1    . DG  I 5 69  ? 117.592 92.384  103.974 1.00 44.72  ? 69  DG  I N1    1 
ATOM 7480  C C2    . DG  I 5 69  ? 118.020 93.605  104.407 1.00 44.72  ? 69  DG  I C2    1 
ATOM 7481  N N2    . DG  I 5 69  ? 117.265 94.202  105.329 1.00 44.72  ? 69  DG  I N2    1 
ATOM 7482  N N3    . DG  I 5 69  ? 119.108 94.203  103.967 1.00 44.72  ? 69  DG  I N3    1 
ATOM 7483  C C4    . DG  I 5 69  ? 119.751 93.461  103.048 1.00 44.72  ? 69  DG  I C4    1 
ATOM 7484  P P     . DG  I 5 70  ? 124.512 98.222  103.599 1.00 40.35  ? 70  DG  I P     1 
ATOM 7485  O OP1   . DG  I 5 70  ? 124.213 99.288  102.630 1.00 40.35  ? 70  DG  I OP1   1 
ATOM 7486  O OP2   . DG  I 5 70  ? 125.897 97.743  103.760 1.00 40.35  ? 70  DG  I OP2   1 
ATOM 7487  O "O5'" . DG  I 5 70  ? 123.975 98.696  105.022 1.00 40.35  ? 70  DG  I "O5'" 1 
ATOM 7488  C "C5'" . DG  I 5 70  ? 122.582 98.856  105.206 1.00 40.35  ? 70  DG  I "C5'" 1 
ATOM 7489  C "C4'" . DG  I 5 70  ? 122.081 98.236  106.502 1.00 40.35  ? 70  DG  I "C4'" 1 
ATOM 7490  O "O4'" . DG  I 5 70  ? 121.536 96.917  106.261 1.00 40.35  ? 70  DG  I "O4'" 1 
ATOM 7491  C "C3'" . DG  I 5 70  ? 123.094 98.055  107.614 1.00 40.35  ? 70  DG  I "C3'" 1 
ATOM 7492  O "O3'" . DG  I 5 70  ? 122.422 98.199  108.825 1.00 40.35  ? 70  DG  I "O3'" 1 
ATOM 7493  C "C2'" . DG  I 5 70  ? 123.497 96.605  107.431 1.00 40.35  ? 70  DG  I "C2'" 1 
ATOM 7494  C "C1'" . DG  I 5 70  ? 122.143 96.006  107.142 1.00 40.35  ? 70  DG  I "C1'" 1 
ATOM 7495  N N9    . DG  I 5 70  ? 122.203 94.717  106.484 1.00 40.35  ? 70  DG  I N9    1 
ATOM 7496  C C8    . DG  I 5 70  ? 123.161 94.284  105.620 1.00 40.35  ? 70  DG  I C8    1 
ATOM 7497  N N7    . DG  I 5 70  ? 122.945 93.092  105.170 1.00 40.35  ? 70  DG  I N7    1 
ATOM 7498  C C5    . DG  I 5 70  ? 121.773 92.706  105.785 1.00 40.35  ? 70  DG  I C5    1 
ATOM 7499  C C6    . DG  I 5 70  ? 121.056 91.502  105.687 1.00 40.35  ? 70  DG  I C6    1 
ATOM 7500  O O6    . DG  I 5 70  ? 121.322 90.506  105.011 1.00 40.35  ? 70  DG  I O6    1 
ATOM 7501  N N1    . DG  I 5 70  ? 119.919 91.517  106.477 1.00 40.35  ? 70  DG  I N1    1 
ATOM 7502  C C2    . DG  I 5 70  ? 119.526 92.565  107.264 1.00 40.35  ? 70  DG  I C2    1 
ATOM 7503  N N2    . DG  I 5 70  ? 118.400 92.395  107.963 1.00 40.35  ? 70  DG  I N2    1 
ATOM 7504  N N3    . DG  I 5 70  ? 120.191 93.700  107.359 1.00 40.35  ? 70  DG  I N3    1 
ATOM 7505  C C4    . DG  I 5 70  ? 121.302 93.697  106.593 1.00 40.35  ? 70  DG  I C4    1 
ATOM 7506  P P     . DA  I 5 71  ? 123.008 99.099  109.999 1.00 37.82  ? 71  DA  I P     1 
ATOM 7507  O OP1   . DA  I 5 71  ? 122.606 100.474 109.709 1.00 37.82  ? 71  DA  I OP1   1 
ATOM 7508  O OP2   . DA  I 5 71  ? 124.423 98.759  110.189 1.00 37.82  ? 71  DA  I OP2   1 
ATOM 7509  O "O5'" . DA  I 5 71  ? 122.175 98.618  111.253 1.00 37.82  ? 71  DA  I "O5'" 1 
ATOM 7510  C "C5'" . DA  I 5 71  ? 120.771 98.521  111.148 1.00 37.82  ? 71  DA  I "C5'" 1 
ATOM 7511  C "C4'" . DA  I 5 71  ? 120.215 97.349  111.942 1.00 37.82  ? 71  DA  I "C4'" 1 
ATOM 7512  O "O4'" . DA  I 5 71  ? 120.331 96.120  111.185 1.00 37.82  ? 71  DA  I "O4'" 1 
ATOM 7513  C "C3'" . DA  I 5 71  ? 120.873 97.078  113.279 1.00 37.82  ? 71  DA  I "C3'" 1 
ATOM 7514  O "O3'" . DA  I 5 71  ? 119.880 96.700  114.184 1.00 37.82  ? 71  DA  I "O3'" 1 
ATOM 7515  C "C2'" . DA  I 5 71  ? 121.804 95.916  112.965 1.00 37.82  ? 71  DA  I "C2'" 1 
ATOM 7516  C "C1'" . DA  I 5 71  ? 120.989 95.141  111.953 1.00 37.82  ? 71  DA  I "C1'" 1 
ATOM 7517  N N9    . DA  I 5 71  ? 121.787 94.336  111.037 1.00 37.82  ? 71  DA  I N9    1 
ATOM 7518  C C8    . DA  I 5 71  ? 122.915 94.722  110.391 1.00 37.82  ? 71  DA  I C8    1 
ATOM 7519  N N7    . DA  I 5 71  ? 123.413 93.812  109.601 1.00 37.82  ? 71  DA  I N7    1 
ATOM 7520  C C5    . DA  I 5 71  ? 122.544 92.752  109.730 1.00 37.82  ? 71  DA  I C5    1 
ATOM 7521  C C6    . DA  I 5 71  ? 122.522 91.478  109.152 1.00 37.82  ? 71  DA  I C6    1 
ATOM 7522  N N6    . DA  I 5 71  ? 123.441 91.053  108.288 1.00 37.82  ? 71  DA  I N6    1 
ATOM 7523  N N1    . DA  I 5 71  ? 121.520 90.655  109.489 1.00 37.82  ? 71  DA  I N1    1 
ATOM 7524  C C2    . DA  I 5 71  ? 120.602 91.079  110.354 1.00 37.82  ? 71  DA  I C2    1 
ATOM 7525  N N3    . DA  I 5 71  ? 120.516 92.256  110.963 1.00 37.82  ? 71  DA  I N3    1 
ATOM 7526  C C4    . DA  I 5 71  ? 121.529 93.055  110.604 1.00 37.82  ? 71  DA  I C4    1 
ATOM 7527  P P     . DC  I 5 72  ? 120.088 96.893  115.757 1.00 43.44  ? 72  DC  I P     1 
ATOM 7528  O OP1   . DC  I 5 72  ? 118.980 97.733  116.245 1.00 43.44  ? 72  DC  I OP1   1 
ATOM 7529  O OP2   . DC  I 5 72  ? 121.488 97.288  115.992 1.00 43.44  ? 72  DC  I OP2   1 
ATOM 7530  O "O5'" . DC  I 5 72  ? 119.878 95.424  116.323 1.00 43.44  ? 72  DC  I "O5'" 1 
ATOM 7531  C "C5'" . DC  I 5 72  ? 118.963 94.557  115.677 1.00 43.44  ? 72  DC  I "C5'" 1 
ATOM 7532  C "C4'" . DC  I 5 72  ? 119.343 93.110  115.897 1.00 43.44  ? 72  DC  I "C4'" 1 
ATOM 7533  O "O4'" . DC  I 5 72  ? 120.132 92.620  114.787 1.00 43.44  ? 72  DC  I "O4'" 1 
ATOM 7534  C "C3'" . DC  I 5 72  ? 120.177 92.845  117.146 1.00 43.44  ? 72  DC  I "C3'" 1 
ATOM 7535  O "O3'" . DC  I 5 72  ? 119.675 91.706  117.784 1.00 43.44  ? 72  DC  I "O3'" 1 
ATOM 7536  C "C2'" . DC  I 5 72  ? 121.559 92.579  116.573 1.00 43.44  ? 72  DC  I "C2'" 1 
ATOM 7537  C "C1'" . DC  I 5 72  ? 121.179 91.857  115.306 1.00 43.44  ? 72  DC  I "C1'" 1 
ATOM 7538  N N1    . DC  I 5 72  ? 122.261 91.787  114.321 1.00 43.44  ? 72  DC  I N1    1 
ATOM 7539  C C2    . DC  I 5 72  ? 122.456 90.621  113.604 1.00 43.44  ? 72  DC  I C2    1 
ATOM 7540  O O2    . DC  I 5 72  ? 121.702 89.670  113.800 1.00 43.44  ? 72  DC  I O2    1 
ATOM 7541  N N3    . DC  I 5 72  ? 123.464 90.567  112.710 1.00 43.44  ? 72  DC  I N3    1 
ATOM 7542  C C4    . DC  I 5 72  ? 124.252 91.619  112.537 1.00 43.44  ? 72  DC  I C4    1 
ATOM 7543  N N4    . DC  I 5 72  ? 125.237 91.528  111.646 1.00 43.44  ? 72  DC  I N4    1 
ATOM 7544  C C5    . DC  I 5 72  ? 124.065 92.812  113.264 1.00 43.44  ? 72  DC  I C5    1 
ATOM 7545  C C6    . DC  I 5 72  ? 123.072 92.845  114.145 1.00 43.44  ? 72  DC  I C6    1 
ATOM 7546  P P     . DA  I 5 73  ? 119.766 91.545  119.374 1.00 53.17  ? 73  DA  I P     1 
ATOM 7547  O OP1   . DA  I 5 73  ? 118.580 92.202  119.957 1.00 53.17  ? 73  DA  I OP1   1 
ATOM 7548  O OP2   . DA  I 5 73  ? 121.126 91.920  119.810 1.00 53.17  ? 73  DA  I OP2   1 
ATOM 7549  O "O5'" . DA  I 5 73  ? 119.621 89.975  119.569 1.00 53.17  ? 73  DA  I "O5'" 1 
ATOM 7550  C "C5'" . DA  I 5 73  ? 119.054 89.196  118.530 1.00 53.17  ? 73  DA  I "C5'" 1 
ATOM 7551  C "C4'" . DA  I 5 73  ? 119.862 87.938  118.304 1.00 53.17  ? 73  DA  I "C4'" 1 
ATOM 7552  O "O4'" . DA  I 5 73  ? 120.780 88.131  117.203 1.00 53.17  ? 73  DA  I "O4'" 1 
ATOM 7553  C "C3'" . DA  I 5 73  ? 120.705 87.493  119.496 1.00 53.17  ? 73  DA  I "C3'" 1 
ATOM 7554  O "O3'" . DA  I 5 73  ? 120.473 86.117  119.736 1.00 53.17  ? 73  DA  I "O3'" 1 
ATOM 7555  C "C2'" . DA  I 5 73  ? 122.135 87.760  119.038 1.00 53.17  ? 73  DA  I "C2'" 1 
ATOM 7556  C "C1'" . DA  I 5 73  ? 122.025 87.583  117.542 1.00 53.17  ? 73  DA  I "C1'" 1 
ATOM 7557  N N9    . DA  I 5 73  ? 123.059 88.302  116.822 1.00 53.17  ? 73  DA  I N9    1 
ATOM 7558  C C8    . DA  I 5 73  ? 123.432 89.592  117.019 1.00 53.17  ? 73  DA  I C8    1 
ATOM 7559  N N7    . DA  I 5 73  ? 124.401 89.986  116.241 1.00 53.17  ? 73  DA  I N7    1 
ATOM 7560  C C5    . DA  I 5 73  ? 124.690 88.874  115.485 1.00 53.17  ? 73  DA  I C5    1 
ATOM 7561  C C6    . DA  I 5 73  ? 125.623 88.648  114.473 1.00 53.17  ? 73  DA  I C6    1 
ATOM 7562  N N6    . DA  I 5 73  ? 126.466 89.580  114.048 1.00 53.17  ? 73  DA  I N6    1 
ATOM 7563  N N1    . DA  I 5 73  ? 125.662 87.426  113.914 1.00 53.17  ? 73  DA  I N1    1 
ATOM 7564  C C2    . DA  I 5 73  ? 124.811 86.493  114.345 1.00 53.17  ? 73  DA  I C2    1 
ATOM 7565  N N3    . DA  I 5 73  ? 123.881 86.592  115.292 1.00 53.17  ? 73  DA  I N3    1 
ATOM 7566  C C4    . DA  I 5 73  ? 123.874 87.823  115.826 1.00 53.17  ? 73  DA  I C4    1 
ATOM 7567  P P     . DG  I 5 74  ? 121.010 85.384  121.062 1.00 56.65  ? 74  DG  I P     1 
ATOM 7568  O OP1   . DG  I 5 74  ? 119.844 84.705  121.659 1.00 56.65  ? 74  DG  I OP1   1 
ATOM 7569  O OP2   . DG  I 5 74  ? 121.808 86.301  121.902 1.00 56.65  ? 74  DG  I OP2   1 
ATOM 7570  O "O5'" . DG  I 5 74  ? 121.971 84.266  120.467 1.00 56.65  ? 74  DG  I "O5'" 1 
ATOM 7571  C "C5'" . DG  I 5 74  ? 121.549 83.537  119.334 1.00 56.65  ? 74  DG  I "C5'" 1 
ATOM 7572  C "C4'" . DG  I 5 74  ? 122.692 82.752  118.736 1.00 56.65  ? 74  DG  I "C4'" 1 
ATOM 7573  O "O4'" . DG  I 5 74  ? 123.471 83.611  117.874 1.00 56.65  ? 74  DG  I "O4'" 1 
ATOM 7574  C "C3'" . DG  I 5 74  ? 123.659 82.160  119.751 1.00 56.65  ? 74  DG  I "C3'" 1 
ATOM 7575  O "O3'" . DG  I 5 74  ? 123.918 80.806  119.432 1.00 56.65  ? 74  DG  I "O3'" 1 
ATOM 7576  C "C2'" . DG  I 5 74  ? 124.906 83.025  119.610 1.00 56.65  ? 74  DG  I "C2'" 1 
ATOM 7577  C "C1'" . DG  I 5 74  ? 124.837 83.469  118.163 1.00 56.65  ? 74  DG  I "C1'" 1 
ATOM 7578  N N9    . DG  I 5 74  ? 125.471 84.756  117.943 1.00 56.65  ? 74  DG  I N9    1 
ATOM 7579  C C8    . DG  I 5 74  ? 125.165 85.931  118.567 1.00 56.65  ? 74  DG  I C8    1 
ATOM 7580  N N7    . DG  I 5 74  ? 125.891 86.929  118.175 1.00 56.65  ? 74  DG  I N7    1 
ATOM 7581  C C5    . DG  I 5 74  ? 126.732 86.381  117.229 1.00 56.65  ? 74  DG  I C5    1 
ATOM 7582  C C6    . DG  I 5 74  ? 127.740 86.987  116.467 1.00 56.65  ? 74  DG  I C6    1 
ATOM 7583  O O6    . DG  I 5 74  ? 128.091 88.166  116.475 1.00 56.65  ? 74  DG  I O6    1 
ATOM 7584  N N1    . DG  I 5 74  ? 128.365 86.083  115.623 1.00 56.65  ? 74  DG  I N1    1 
ATOM 7585  C C2    . DG  I 5 74  ? 128.052 84.757  115.530 1.00 56.65  ? 74  DG  I C2    1 
ATOM 7586  N N2    . DG  I 5 74  ? 128.769 84.038  114.662 1.00 56.65  ? 74  DG  I N2    1 
ATOM 7587  N N3    . DG  I 5 74  ? 127.103 84.170  116.245 1.00 56.65  ? 74  DG  I N3    1 
ATOM 7588  C C4    . DG  I 5 74  ? 126.487 85.044  117.071 1.00 56.65  ? 74  DG  I C4    1 
ATOM 7589  P P     . DC  I 5 75  ? 124.762 79.881  120.437 1.00 56.98  ? 75  DC  I P     1 
ATOM 7590  O OP1   . DC  I 5 75  ? 124.242 78.504  120.307 1.00 56.98  ? 75  DC  I OP1   1 
ATOM 7591  O OP2   . DC  I 5 75  ? 124.809 80.533  121.763 1.00 56.98  ? 75  DC  I OP2   1 
ATOM 7592  O "O5'" . DC  I 5 75  ? 126.232 79.922  119.833 1.00 56.98  ? 75  DC  I "O5'" 1 
ATOM 7593  C "C5'" . DC  I 5 75  ? 126.423 79.776  118.439 1.00 56.98  ? 75  DC  I "C5'" 1 
ATOM 7594  C "C4'" . DC  I 5 75  ? 127.899 79.779  118.087 1.00 56.98  ? 75  DC  I "C4'" 1 
ATOM 7595  O "O4'" . DC  I 5 75  ? 128.320 81.120  117.734 1.00 56.98  ? 75  DC  I "O4'" 1 
ATOM 7596  C "C3'" . DC  I 5 75  ? 128.835 79.322  119.198 1.00 56.98  ? 75  DC  I "C3'" 1 
ATOM 7597  O "O3'" . DC  I 5 75  ? 129.862 78.535  118.641 1.00 56.98  ? 75  DC  I "O3'" 1 
ATOM 7598  C "C2'" . DC  I 5 75  ? 129.374 80.636  119.743 1.00 56.98  ? 75  DC  I "C2'" 1 
ATOM 7599  C "C1'" . DC  I 5 75  ? 129.452 81.474  118.484 1.00 56.98  ? 75  DC  I "C1'" 1 
ATOM 7600  N N1    . DC  I 5 75  ? 129.398 82.927  118.743 1.00 56.98  ? 75  DC  I N1    1 
ATOM 7601  C C2    . DC  I 5 75  ? 130.286 83.784  118.092 1.00 56.98  ? 75  DC  I C2    1 
ATOM 7602  O O2    . DC  I 5 75  ? 131.111 83.312  117.308 1.00 56.98  ? 75  DC  I O2    1 
ATOM 7603  N N3    . DC  I 5 75  ? 130.218 85.110  118.347 1.00 56.98  ? 75  DC  I N3    1 
ATOM 7604  C C4    . DC  I 5 75  ? 129.314 85.574  119.203 1.00 56.98  ? 75  DC  I C4    1 
ATOM 7605  N N4    . DC  I 5 75  ? 129.276 86.887  119.423 1.00 56.98  ? 75  DC  I N4    1 
ATOM 7606  C C5    . DC  I 5 75  ? 128.403 84.715  119.872 1.00 56.98  ? 75  DC  I C5    1 
ATOM 7607  C C6    . DC  I 5 75  ? 128.482 83.413  119.613 1.00 56.98  ? 75  DC  I C6    1 
ATOM 7608  P P     . DG  I 5 76  ? 130.721 77.530  119.554 1.00 55.36  ? 76  DG  I P     1 
ATOM 7609  O OP1   . DG  I 5 76  ? 130.559 76.171  118.998 1.00 55.36  ? 76  DG  I OP1   1 
ATOM 7610  O OP2   . DG  I 5 76  ? 130.409 77.771  120.979 1.00 55.36  ? 76  DG  I OP2   1 
ATOM 7611  O "O5'" . DG  I 5 76  ? 132.216 77.995  119.280 1.00 55.36  ? 76  DG  I "O5'" 1 
ATOM 7612  C "C5'" . DG  I 5 76  ? 132.648 78.187  117.946 1.00 55.36  ? 76  DG  I "C5'" 1 
ATOM 7613  C "C4'" . DG  I 5 76  ? 133.851 79.112  117.875 1.00 55.36  ? 76  DG  I "C4'" 1 
ATOM 7614  O "O4'" . DG  I 5 76  ? 133.432 80.486  118.079 1.00 55.36  ? 76  DG  I "O4'" 1 
ATOM 7615  C "C3'" . DG  I 5 76  ? 134.949 78.847  118.904 1.00 55.36  ? 76  DG  I "C3'" 1 
ATOM 7616  O "O3'" . DG  I 5 76  ? 136.213 78.998  118.282 1.00 55.36  ? 76  DG  I "O3'" 1 
ATOM 7617  C "C2'" . DG  I 5 76  ? 134.707 79.946  119.934 1.00 55.36  ? 76  DG  I "C2'" 1 
ATOM 7618  C "C1'" . DG  I 5 76  ? 134.276 81.085  119.029 1.00 55.36  ? 76  DG  I "C1'" 1 
ATOM 7619  N N9    . DG  I 5 76  ? 133.535 82.147  119.700 1.00 55.36  ? 76  DG  I N9    1 
ATOM 7620  C C8    . DG  I 5 76  ? 132.450 82.005  120.514 1.00 55.36  ? 76  DG  I C8    1 
ATOM 7621  N N7    . DG  I 5 76  ? 131.982 83.132  120.956 1.00 55.36  ? 76  DG  I N7    1 
ATOM 7622  C C5    . DG  I 5 76  ? 132.815 84.086  120.401 1.00 55.36  ? 76  DG  I C5    1 
ATOM 7623  C C6    . DG  I 5 76  ? 132.800 85.485  120.526 1.00 55.36  ? 76  DG  I C6    1 
ATOM 7624  O O6    . DG  I 5 76  ? 132.021 86.184  121.176 1.00 55.36  ? 76  DG  I O6    1 
ATOM 7625  N N1    . DG  I 5 76  ? 133.820 86.078  119.802 1.00 55.36  ? 76  DG  I N1    1 
ATOM 7626  C C2    . DG  I 5 76  ? 134.738 85.404  119.053 1.00 55.36  ? 76  DG  I C2    1 
ATOM 7627  N N2    . DG  I 5 76  ? 135.654 86.143  118.421 1.00 55.36  ? 76  DG  I N2    1 
ATOM 7628  N N3    . DG  I 5 76  ? 134.764 84.092  118.927 1.00 55.36  ? 76  DG  I N3    1 
ATOM 7629  C C4    . DG  I 5 76  ? 133.773 83.499  119.625 1.00 55.36  ? 76  DG  I C4    1 
ATOM 7630  P P     . DC  I 5 77  ? 137.478 78.132  118.764 1.00 53.45  ? 77  DC  I P     1 
ATOM 7631  O OP1   . DC  I 5 77  ? 137.644 77.011  117.816 1.00 53.45  ? 77  DC  I OP1   1 
ATOM 7632  O OP2   . DC  I 5 77  ? 137.340 77.869  120.212 1.00 53.45  ? 77  DC  I OP2   1 
ATOM 7633  O "O5'" . DC  I 5 77  ? 138.707 79.133  118.568 1.00 53.45  ? 77  DC  I "O5'" 1 
ATOM 7634  C "C5'" . DC  I 5 77  ? 138.587 80.224  117.662 1.00 53.45  ? 77  DC  I "C5'" 1 
ATOM 7635  C "C4'" . DC  I 5 77  ? 139.372 81.442  118.135 1.00 53.45  ? 77  DC  I "C4'" 1 
ATOM 7636  O "O4'" . DC  I 5 77  ? 138.481 82.406  118.754 1.00 53.45  ? 77  DC  I "O4'" 1 
ATOM 7637  C "C3'" . DC  I 5 77  ? 140.460 81.181  119.166 1.00 53.45  ? 77  DC  I "C3'" 1 
ATOM 7638  O "O3'" . DC  I 5 77  ? 141.510 82.086  118.934 1.00 53.45  ? 77  DC  I "O3'" 1 
ATOM 7639  C "C2'" . DC  I 5 77  ? 139.748 81.520  120.466 1.00 53.45  ? 77  DC  I "C2'" 1 
ATOM 7640  C "C1'" . DC  I 5 77  ? 138.987 82.747  120.022 1.00 53.45  ? 77  DC  I "C1'" 1 
ATOM 7641  N N1    . DC  I 5 77  ? 137.846 83.118  120.892 1.00 53.45  ? 77  DC  I N1    1 
ATOM 7642  C C2    . DC  I 5 77  ? 137.596 84.460  121.155 1.00 53.45  ? 77  DC  I C2    1 
ATOM 7643  O O2    . DC  I 5 77  ? 138.344 85.312  120.669 1.00 53.45  ? 77  DC  I O2    1 
ATOM 7644  N N3    . DC  I 5 77  ? 136.545 84.786  121.934 1.00 53.45  ? 77  DC  I N3    1 
ATOM 7645  C C4    . DC  I 5 77  ? 135.767 83.830  122.434 1.00 53.45  ? 77  DC  I C4    1 
ATOM 7646  N N4    . DC  I 5 77  ? 134.742 84.196  123.200 1.00 53.45  ? 77  DC  I N4    1 
ATOM 7647  C C5    . DC  I 5 77  ? 136.005 82.460  122.174 1.00 53.45  ? 77  DC  I C5    1 
ATOM 7648  C C6    . DC  I 5 77  ? 137.046 82.154  121.404 1.00 53.45  ? 77  DC  I C6    1 
ATOM 7649  P P     . DG  I 5 78  ? 143.038 81.620  119.024 1.00 50.00  ? 78  DG  I P     1 
ATOM 7650  O OP1   . DG  I 5 78  ? 143.512 81.380  117.648 1.00 50.00  ? 78  DG  I OP1   1 
ATOM 7651  O OP2   . DG  I 5 78  ? 143.119 80.553  120.042 1.00 50.00  ? 78  DG  I OP2   1 
ATOM 7652  O "O5'" . DG  I 5 78  ? 143.785 82.914  119.583 1.00 50.00  ? 78  DG  I "O5'" 1 
ATOM 7653  C "C5'" . DG  I 5 78  ? 143.555 84.184  118.980 1.00 50.00  ? 78  DG  I "C5'" 1 
ATOM 7654  C "C4'" . DG  I 5 78  ? 143.528 85.308  120.009 1.00 50.00  ? 78  DG  I "C4'" 1 
ATOM 7655  O "O4'" . DG  I 5 78  ? 142.262 85.316  120.716 1.00 50.00  ? 78  DG  I "O4'" 1 
ATOM 7656  C "C3'" . DG  I 5 78  ? 144.599 85.251  121.095 1.00 50.00  ? 78  DG  I "C3'" 1 
ATOM 7657  O "O3'" . DG  I 5 78  ? 144.991 86.551  121.406 1.00 50.00  ? 78  DG  I "O3'" 1 
ATOM 7658  C "C2'" . DG  I 5 78  ? 143.825 84.661  122.267 1.00 50.00  ? 78  DG  I "C2'" 1 
ATOM 7659  C "C1'" . DG  I 5 78  ? 142.519 85.391  122.095 1.00 50.00  ? 78  DG  I "C1'" 1 
ATOM 7660  N N9    . DG  I 5 78  ? 141.410 84.797  122.805 1.00 50.00  ? 78  DG  I N9    1 
ATOM 7661  C C8    . DG  I 5 78  ? 141.142 83.470  122.954 1.00 50.00  ? 78  DG  I C8    1 
ATOM 7662  N N7    . DG  I 5 78  ? 140.055 83.234  123.628 1.00 50.00  ? 78  DG  I N7    1 
ATOM 7663  C C5    . DG  I 5 78  ? 139.581 84.492  123.950 1.00 50.00  ? 78  DG  I C5    1 
ATOM 7664  C C6    . DG  I 5 78  ? 138.438 84.873  124.675 1.00 50.00  ? 78  DG  I C6    1 
ATOM 7665  O O6    . DG  I 5 78  ? 137.588 84.150  125.198 1.00 50.00  ? 78  DG  I O6    1 
ATOM 7666  N N1    . DG  I 5 78  ? 138.324 86.252  124.768 1.00 50.00  ? 78  DG  I N1    1 
ATOM 7667  C C2    . DG  I 5 78  ? 139.203 87.146  124.227 1.00 50.00  ? 78  DG  I C2    1 
ATOM 7668  N N2    . DG  I 5 78  ? 138.933 88.440  124.420 1.00 50.00  ? 78  DG  I N2    1 
ATOM 7669  N N3    . DG  I 5 78  ? 140.276 86.800  123.543 1.00 50.00  ? 78  DG  I N3    1 
ATOM 7670  C C4    . DG  I 5 78  ? 140.401 85.462  123.448 1.00 50.00  ? 78  DG  I C4    1 
ATOM 7671  P P     . DT  I 5 79  ? 146.361 87.164  120.851 1.00 49.00  ? 79  DT  I P     1 
ATOM 7672  O OP1   . DT  I 5 79  ? 146.369 87.007  119.384 1.00 49.00  ? 79  DT  I OP1   1 
ATOM 7673  O OP2   . DT  I 5 79  ? 147.462 86.608  121.665 1.00 49.00  ? 79  DT  I OP2   1 
ATOM 7674  O "O5'" . DT  I 5 79  ? 146.208 88.716  121.196 1.00 49.00  ? 79  DT  I "O5'" 1 
ATOM 7675  C "C5'" . DT  I 5 79  ? 144.917 89.328  121.127 1.00 49.00  ? 79  DT  I "C5'" 1 
ATOM 7676  C "C4'" . DT  I 5 79  ? 144.538 90.005  122.439 1.00 49.00  ? 79  DT  I "C4'" 1 
ATOM 7677  O "O4'" . DT  I 5 79  ? 143.668 89.141  123.216 1.00 49.00  ? 79  DT  I "O4'" 1 
ATOM 7678  C "C3'" . DT  I 5 79  ? 145.701 90.360  123.373 1.00 49.00  ? 79  DT  I "C3'" 1 
ATOM 7679  O "O3'" . DT  I 5 79  ? 145.406 91.575  124.031 1.00 49.00  ? 79  DT  I "O3'" 1 
ATOM 7680  C "C2'" . DT  I 5 79  ? 145.662 89.210  124.368 1.00 49.00  ? 79  DT  I "C2'" 1 
ATOM 7681  C "C1'" . DT  I 5 79  ? 144.165 89.086  124.528 1.00 49.00  ? 79  DT  I "C1'" 1 
ATOM 7682  N N1    . DT  I 5 79  ? 143.708 87.834  125.164 1.00 49.00  ? 79  DT  I N1    1 
ATOM 7683  C C2    . DT  I 5 79  ? 142.469 87.805  125.740 1.00 49.00  ? 79  DT  I C2    1 
ATOM 7684  O O2    . DT  I 5 79  ? 141.724 88.759  125.751 1.00 49.00  ? 79  DT  I O2    1 
ATOM 7685  N N3    . DT  I 5 79  ? 142.129 86.617  126.305 1.00 49.00  ? 79  DT  I N3    1 
ATOM 7686  C C4    . DT  I 5 79  ? 142.888 85.472  126.345 1.00 49.00  ? 79  DT  I C4    1 
ATOM 7687  O O4    . DT  I 5 79  ? 142.492 84.445  126.875 1.00 49.00  ? 79  DT  I O4    1 
ATOM 7688  C C5    . DT  I 5 79  ? 144.183 85.569  125.725 1.00 49.00  ? 79  DT  I C5    1 
ATOM 7689  C C7    . DT  I 5 79  ? 145.101 84.388  125.715 1.00 49.00  ? 79  DT  I C7    1 
ATOM 7690  C C6    . DT  I 5 79  ? 144.528 86.734  125.174 1.00 49.00  ? 79  DT  I C6    1 
ATOM 7691  P P     . DA  I 5 80  ? 146.005 92.973  123.521 1.00 43.86  ? 80  DA  I P     1 
ATOM 7692  O OP1   . DA  I 5 80  ? 145.769 93.096  122.071 1.00 43.86  ? 80  DA  I OP1   1 
ATOM 7693  O OP2   . DA  I 5 80  ? 147.377 93.061  124.064 1.00 43.86  ? 80  DA  I OP2   1 
ATOM 7694  O "O5'" . DA  I 5 80  ? 145.085 94.058  124.258 1.00 43.86  ? 80  DA  I "O5'" 1 
ATOM 7695  C "C5'" . DA  I 5 80  ? 143.698 93.782  124.474 1.00 43.86  ? 80  DA  I "C5'" 1 
ATOM 7696  C "C4'" . DA  I 5 80  ? 143.286 93.933  125.939 1.00 43.86  ? 80  DA  I "C4'" 1 
ATOM 7697  O "O4'" . DA  I 5 80  ? 143.155 92.637  126.572 1.00 43.86  ? 80  DA  I "O4'" 1 
ATOM 7698  C "C3'" . DA  I 5 80  ? 144.224 94.706  126.843 1.00 43.86  ? 80  DA  I "C3'" 1 
ATOM 7699  O "O3'" . DA  I 5 80  ? 143.462 95.252  127.868 1.00 43.86  ? 80  DA  I "O3'" 1 
ATOM 7700  C "C2'" . DA  I 5 80  ? 145.072 93.588  127.411 1.00 43.86  ? 80  DA  I "C2'" 1 
ATOM 7701  C "C1'" . DA  I 5 80  ? 143.971 92.607  127.715 1.00 43.86  ? 80  DA  I "C1'" 1 
ATOM 7702  N N9    . DA  I 5 80  ? 144.430 91.252  127.912 1.00 43.86  ? 80  DA  I N9    1 
ATOM 7703  C C8    . DA  I 5 80  ? 145.612 90.721  127.516 1.00 43.86  ? 80  DA  I C8    1 
ATOM 7704  N N7    . DA  I 5 80  ? 145.748 89.461  127.816 1.00 43.86  ? 80  DA  I N7    1 
ATOM 7705  C C5    . DA  I 5 80  ? 144.577 89.152  128.462 1.00 43.86  ? 80  DA  I C5    1 
ATOM 7706  C C6    . DA  I 5 80  ? 144.102 87.969  129.030 1.00 43.86  ? 80  DA  I C6    1 
ATOM 7707  N N6    . DA  I 5 80  ? 144.795 86.833  129.035 1.00 43.86  ? 80  DA  I N6    1 
ATOM 7708  N N1    . DA  I 5 80  ? 142.878 87.993  129.596 1.00 43.86  ? 80  DA  I N1    1 
ATOM 7709  C C2    . DA  I 5 80  ? 142.188 89.135  129.592 1.00 43.86  ? 80  DA  I C2    1 
ATOM 7710  N N3    . DA  I 5 80  ? 142.535 90.307  129.079 1.00 43.86  ? 80  DA  I N3    1 
ATOM 7711  C C4    . DA  I 5 80  ? 143.750 90.244  128.525 1.00 43.86  ? 80  DA  I C4    1 
ATOM 7712  P P     . DC  I 5 81  ? 143.304 96.828  128.057 1.00 34.36  ? 81  DC  I P     1 
ATOM 7713  O OP1   . DC  I 5 81  ? 142.488 97.326  126.936 1.00 34.36  ? 81  DC  I OP1   1 
ATOM 7714  O OP2   . DC  I 5 81  ? 144.629 97.404  128.332 1.00 34.36  ? 81  DC  I OP2   1 
ATOM 7715  O "O5'" . DC  I 5 81  ? 142.456 96.927  129.398 1.00 34.36  ? 81  DC  I "O5'" 1 
ATOM 7716  C "C5'" . DC  I 5 81  ? 141.165 96.353  129.458 1.00 34.36  ? 81  DC  I "C5'" 1 
ATOM 7717  C "C4'" . DC  I 5 81  ? 140.955 95.606  130.758 1.00 34.36  ? 81  DC  I "C4'" 1 
ATOM 7718  O "O4'" . DC  I 5 81  ? 141.647 94.336  130.717 1.00 34.36  ? 81  DC  I "O4'" 1 
ATOM 7719  C "C3'" . DC  I 5 81  ? 141.454 96.315  132.013 1.00 34.36  ? 81  DC  I "C3'" 1 
ATOM 7720  O "O3'" . DC  I 5 81  ? 140.501 96.175  133.027 1.00 34.36  ? 81  DC  I "O3'" 1 
ATOM 7721  C "C2'" . DC  I 5 81  ? 142.719 95.546  132.350 1.00 34.36  ? 81  DC  I "C2'" 1 
ATOM 7722  C "C1'" . DC  I 5 81  ? 142.329 94.154  131.923 1.00 34.36  ? 81  DC  I "C1'" 1 
ATOM 7723  N N1    . DC  I 5 81  ? 143.487 93.285  131.683 1.00 34.36  ? 81  DC  I N1    1 
ATOM 7724  C C2    . DC  I 5 81  ? 143.438 91.953  132.059 1.00 34.36  ? 81  DC  I C2    1 
ATOM 7725  O O2    . DC  I 5 81  ? 142.416 91.514  132.581 1.00 34.36  ? 81  DC  I O2    1 
ATOM 7726  N N3    . DC  I 5 81  ? 144.514 91.178  131.843 1.00 34.36  ? 81  DC  I N3    1 
ATOM 7727  C C4    . DC  I 5 81  ? 145.596 91.690  131.284 1.00 34.36  ? 81  DC  I C4    1 
ATOM 7728  N N4    . DC  I 5 81  ? 146.636 90.887  131.087 1.00 34.36  ? 81  DC  I N4    1 
ATOM 7729  C C5    . DC  I 5 81  ? 145.668 93.047  130.903 1.00 34.36  ? 81  DC  I C5    1 
ATOM 7730  C C6    . DC  I 5 81  ? 144.601 93.801  131.119 1.00 34.36  ? 81  DC  I C6    1 
ATOM 7731  P P     . DG  I 5 82  ? 140.427 97.203  134.248 1.00 34.30  ? 82  DG  I P     1 
ATOM 7732  O OP1   . DG  I 5 82  ? 139.490 98.260  133.889 1.00 34.30  ? 82  DG  I OP1   1 
ATOM 7733  O OP2   . DG  I 5 82  ? 141.773 97.579  134.686 1.00 34.30  ? 82  DG  I OP2   1 
ATOM 7734  O "O5'" . DG  I 5 82  ? 139.752 96.334  135.383 1.00 34.30  ? 82  DG  I "O5'" 1 
ATOM 7735  C "C5'" . DG  I 5 82  ? 138.985 95.202  135.024 1.00 34.30  ? 82  DG  I "C5'" 1 
ATOM 7736  C "C4'" . DG  I 5 82  ? 139.087 94.098  136.057 1.00 34.30  ? 82  DG  I "C4'" 1 
ATOM 7737  O "O4'" . DG  I 5 82  ? 140.156 93.197  135.712 1.00 34.30  ? 82  DG  I "O4'" 1 
ATOM 7738  C "C3'" . DG  I 5 82  ? 139.361 94.551  137.477 1.00 34.30  ? 82  DG  I "C3'" 1 
ATOM 7739  O "O3'" . DG  I 5 82  ? 138.629 93.755  138.365 1.00 34.30  ? 82  DG  I "O3'" 1 
ATOM 7740  C "C2'" . DG  I 5 82  ? 140.849 94.315  137.631 1.00 34.30  ? 82  DG  I "C2'" 1 
ATOM 7741  C "C1'" . DG  I 5 82  ? 141.073 93.096  136.774 1.00 34.30  ? 82  DG  I "C1'" 1 
ATOM 7742  N N9    . DG  I 5 82  ? 142.401 93.031  136.192 1.00 34.30  ? 82  DG  I N9    1 
ATOM 7743  C C8    . DG  I 5 82  ? 143.046 94.019  135.511 1.00 34.30  ? 82  DG  I C8    1 
ATOM 7744  N N7    . DG  I 5 82  ? 144.213 93.671  135.072 1.00 34.30  ? 82  DG  I N7    1 
ATOM 7745  C C5    . DG  I 5 82  ? 144.348 92.366  135.481 1.00 34.30  ? 82  DG  I C5    1 
ATOM 7746  C C6    . DG  I 5 82  ? 145.409 91.469  135.294 1.00 34.30  ? 82  DG  I C6    1 
ATOM 7747  O O6    . DG  I 5 82  ? 146.474 91.661  134.710 1.00 34.30  ? 82  DG  I O6    1 
ATOM 7748  N N1    . DG  I 5 82  ? 145.147 90.236  135.865 1.00 34.30  ? 82  DG  I N1    1 
ATOM 7749  C C2    . DG  I 5 82  ? 144.007 89.916  136.539 1.00 34.30  ? 82  DG  I C2    1 
ATOM 7750  N N2    . DG  I 5 82  ? 143.928 88.677  137.024 1.00 34.30  ? 82  DG  I N2    1 
ATOM 7751  N N3    . DG  I 5 82  ? 142.999 90.749  136.717 1.00 34.30  ? 82  DG  I N3    1 
ATOM 7752  C C4    . DG  I 5 82  ? 143.239 91.952  136.163 1.00 34.30  ? 82  DG  I C4    1 
ATOM 7753  P P     . DT  I 5 83  ? 138.477 94.178  139.894 1.00 36.09  ? 83  DT  I P     1 
ATOM 7754  O OP1   . DT  I 5 83  ? 137.102 93.884  140.287 1.00 36.09  ? 83  DT  I OP1   1 
ATOM 7755  O OP2   . DT  I 5 83  ? 139.039 95.517  140.084 1.00 36.09  ? 83  DT  I OP2   1 
ATOM 7756  O "O5'" . DT  I 5 83  ? 139.413 93.162  140.653 1.00 36.09  ? 83  DT  I "O5'" 1 
ATOM 7757  C "C5'" . DT  I 5 83  ? 139.175 91.792  140.552 1.00 36.09  ? 83  DT  I "C5'" 1 
ATOM 7758  C "C4'" . DT  I 5 83  ? 140.256 91.015  141.264 1.00 36.09  ? 83  DT  I "C4'" 1 
ATOM 7759  O "O4'" . DT  I 5 83  ? 141.452 90.979  140.454 1.00 36.09  ? 83  DT  I "O4'" 1 
ATOM 7760  C "C3'" . DT  I 5 83  ? 140.671 91.577  142.612 1.00 36.09  ? 83  DT  I "C3'" 1 
ATOM 7761  O "O3'" . DT  I 5 83  ? 140.678 90.533  143.553 1.00 36.09  ? 83  DT  I "O3'" 1 
ATOM 7762  C "C2'" . DT  I 5 83  ? 142.077 92.126  142.355 1.00 36.09  ? 83  DT  I "C2'" 1 
ATOM 7763  C "C1'" . DT  I 5 83  ? 142.572 91.214  141.257 1.00 36.09  ? 83  DT  I "C1'" 1 
ATOM 7764  N N1    . DT  I 5 83  ? 143.622 91.811  140.398 1.00 36.09  ? 83  DT  I N1    1 
ATOM 7765  C C2    . DT  I 5 83  ? 144.719 91.063  140.038 1.00 36.09  ? 83  DT  I C2    1 
ATOM 7766  O O2    . DT  I 5 83  ? 144.906 89.923  140.408 1.00 36.09  ? 83  DT  I O2    1 
ATOM 7767  N N3    . DT  I 5 83  ? 145.608 91.711  139.236 1.00 36.09  ? 83  DT  I N3    1 
ATOM 7768  C C4    . DT  I 5 83  ? 145.516 92.989  138.760 1.00 36.09  ? 83  DT  I C4    1 
ATOM 7769  O O4    . DT  I 5 83  ? 146.365 93.487  138.043 1.00 36.09  ? 83  DT  I O4    1 
ATOM 7770  C C5    . DT  I 5 83  ? 144.349 93.711  139.159 1.00 36.09  ? 83  DT  I C5    1 
ATOM 7771  C C7    . DT  I 5 83  ? 144.166 95.123  138.698 1.00 36.09  ? 83  DT  I C7    1 
ATOM 7772  C C6    . DT  I 5 83  ? 143.463 93.094  139.947 1.00 36.09  ? 83  DT  I C6    1 
ATOM 7773  P P     . DG  I 5 84  ? 140.773 90.831  145.120 1.00 42.41  ? 84  DG  I P     1 
ATOM 7774  O OP1   . DG  I 5 84  ? 139.954 89.835  145.813 1.00 42.41  ? 84  DG  I OP1   1 
ATOM 7775  O OP2   . DG  I 5 84  ? 140.554 92.261  145.364 1.00 42.41  ? 84  DG  I OP2   1 
ATOM 7776  O "O5'" . DG  I 5 84  ? 142.273 90.488  145.452 1.00 42.41  ? 84  DG  I "O5'" 1 
ATOM 7777  C "C5'" . DG  I 5 84  ? 142.753 89.228  145.129 1.00 42.41  ? 84  DG  I "C5'" 1 
ATOM 7778  C "C4'" . DG  I 5 84  ? 144.252 89.164  145.271 1.00 42.41  ? 84  DG  I "C4'" 1 
ATOM 7779  O "O4'" . DG  I 5 84  ? 144.886 89.776  144.125 1.00 42.41  ? 84  DG  I "O4'" 1 
ATOM 7780  C "C3'" . DG  I 5 84  ? 144.813 89.869  146.495 1.00 42.41  ? 84  DG  I "C3'" 1 
ATOM 7781  O "O3'" . DG  I 5 84  ? 145.776 89.038  147.080 1.00 42.41  ? 84  DG  I "O3'" 1 
ATOM 7782  C "C2'" . DG  I 5 84  ? 145.452 91.113  145.899 1.00 42.41  ? 84  DG  I "C2'" 1 
ATOM 7783  C "C1'" . DG  I 5 84  ? 145.928 90.586  144.572 1.00 42.41  ? 84  DG  I "C1'" 1 
ATOM 7784  N N9    . DG  I 5 84  ? 146.167 91.634  143.598 1.00 42.41  ? 84  DG  I N9    1 
ATOM 7785  C C8    . DG  I 5 84  ? 145.385 92.727  143.358 1.00 42.41  ? 84  DG  I C8    1 
ATOM 7786  N N7    . DG  I 5 84  ? 145.853 93.506  142.433 1.00 42.41  ? 84  DG  I N7    1 
ATOM 7787  C C5    . DG  I 5 84  ? 147.022 92.890  142.042 1.00 42.41  ? 84  DG  I C5    1 
ATOM 7788  C C6    . DG  I 5 84  ? 147.959 93.274  141.075 1.00 42.41  ? 84  DG  I C6    1 
ATOM 7789  O O6    . DG  I 5 84  ? 147.936 94.264  140.347 1.00 42.41  ? 84  DG  I O6    1 
ATOM 7790  N N1    . DG  I 5 84  ? 149.010 92.375  140.989 1.00 42.41  ? 84  DG  I N1    1 
ATOM 7791  C C2    . DG  I 5 84  ? 149.137 91.247  141.745 1.00 42.41  ? 84  DG  I C2    1 
ATOM 7792  N N2    . DG  I 5 84  ? 150.219 90.499  141.522 1.00 42.41  ? 84  DG  I N2    1 
ATOM 7793  N N3    . DG  I 5 84  ? 148.259 90.872  142.657 1.00 42.41  ? 84  DG  I N3    1 
ATOM 7794  C C4    . DG  I 5 84  ? 147.230 91.740  142.750 1.00 42.41  ? 84  DG  I C4    1 
ATOM 7795  P P     . DC  I 5 85  ? 146.174 89.168  148.627 1.00 45.65  ? 85  DC  I P     1 
ATOM 7796  O OP1   . DC  I 5 85  ? 145.409 88.142  149.357 1.00 45.65  ? 85  DC  I OP1   1 
ATOM 7797  O OP2   . DC  I 5 85  ? 146.101 90.577  149.055 1.00 45.65  ? 85  DC  I OP2   1 
ATOM 7798  O "O5'" . DC  I 5 85  ? 147.704 88.751  148.607 1.00 45.65  ? 85  DC  I "O5'" 1 
ATOM 7799  C "C5'" . DC  I 5 85  ? 148.215 88.079  147.465 1.00 45.65  ? 85  DC  I "C5'" 1 
ATOM 7800  C "C4'" . DC  I 5 85  ? 149.667 88.436  147.223 1.00 45.65  ? 85  DC  I "C4'" 1 
ATOM 7801  O "O4'" . DC  I 5 85  ? 149.771 89.380  146.125 1.00 45.65  ? 85  DC  I "O4'" 1 
ATOM 7802  C "C3'" . DC  I 5 85  ? 150.369 89.079  148.407 1.00 45.65  ? 85  DC  I "C3'" 1 
ATOM 7803  O "O3'" . DC  I 5 85  ? 151.663 88.547  148.528 1.00 45.65  ? 85  DC  I "O3'" 1 
ATOM 7804  C "C2'" . DC  I 5 85  ? 150.400 90.554  148.027 1.00 45.65  ? 85  DC  I "C2'" 1 
ATOM 7805  C "C1'" . DC  I 5 85  ? 150.550 90.481  146.522 1.00 45.65  ? 85  DC  I "C1'" 1 
ATOM 7806  N N1    . DC  I 5 85  ? 150.039 91.681  145.832 1.00 45.65  ? 85  DC  I N1    1 
ATOM 7807  C C2    . DC  I 5 85  ? 150.785 92.280  144.819 1.00 45.65  ? 85  DC  I C2    1 
ATOM 7808  O O2    . DC  I 5 85  ? 151.870 91.798  144.507 1.00 45.65  ? 85  DC  I O2    1 
ATOM 7809  N N3    . DC  I 5 85  ? 150.295 93.374  144.212 1.00 45.65  ? 85  DC  I N3    1 
ATOM 7810  C C4    . DC  I 5 85  ? 149.123 93.863  144.579 1.00 45.65  ? 85  DC  I C4    1 
ATOM 7811  N N4    . DC  I 5 85  ? 148.670 94.947  143.950 1.00 45.65  ? 85  DC  I N4    1 
ATOM 7812  C C5    . DC  I 5 85  ? 148.352 93.267  145.605 1.00 45.65  ? 85  DC  I C5    1 
ATOM 7813  C C6    . DC  I 5 85  ? 148.846 92.192  146.199 1.00 45.65  ? 85  DC  I C6    1 
ATOM 7814  P P     . DG  I 5 86  ? 152.446 88.625  149.923 1.00 48.44  ? 86  DG  I P     1 
ATOM 7815  O OP1   . DG  I 5 86  ? 152.844 87.245  150.272 1.00 48.44  ? 86  DG  I OP1   1 
ATOM 7816  O OP2   . DG  I 5 86  ? 151.650 89.424  150.875 1.00 48.44  ? 86  DG  I OP2   1 
ATOM 7817  O "O5'" . DG  I 5 86  ? 153.755 89.452  149.557 1.00 48.44  ? 86  DG  I "O5'" 1 
ATOM 7818  C "C5'" . DG  I 5 86  ? 154.589 89.002  148.507 1.00 48.44  ? 86  DG  I "C5'" 1 
ATOM 7819  C "C4'" . DG  I 5 86  ? 155.438 90.130  147.952 1.00 48.44  ? 86  DG  I "C4'" 1 
ATOM 7820  O "O4'" . DG  I 5 86  ? 154.595 91.082  147.265 1.00 48.44  ? 86  DG  I "O4'" 1 
ATOM 7821  C "C3'" . DG  I 5 86  ? 156.228 90.933  148.986 1.00 48.44  ? 86  DG  I "C3'" 1 
ATOM 7822  O "O3'" . DG  I 5 86  ? 157.519 91.192  148.476 1.00 48.44  ? 86  DG  I "O3'" 1 
ATOM 7823  C "C2'" . DG  I 5 86  ? 155.416 92.218  149.106 1.00 48.44  ? 86  DG  I "C2'" 1 
ATOM 7824  C "C1'" . DG  I 5 86  ? 154.938 92.375  147.683 1.00 48.44  ? 86  DG  I "C1'" 1 
ATOM 7825  N N9    . DG  I 5 86  ? 153.775 93.227  147.534 1.00 48.44  ? 86  DG  I N9    1 
ATOM 7826  C C8    . DG  I 5 86  ? 152.629 93.218  148.280 1.00 48.44  ? 86  DG  I C8    1 
ATOM 7827  N N7    . DG  I 5 86  ? 151.756 94.099  147.891 1.00 48.44  ? 86  DG  I N7    1 
ATOM 7828  C C5    . DG  I 5 86  ? 152.370 94.724  146.821 1.00 48.44  ? 86  DG  I C5    1 
ATOM 7829  C C6    . DG  I 5 86  ? 151.917 95.764  145.991 1.00 48.44  ? 86  DG  I C6    1 
ATOM 7830  O O6    . DG  I 5 86  ? 150.843 96.367  146.028 1.00 48.44  ? 86  DG  I O6    1 
ATOM 7831  N N1    . DG  I 5 86  ? 152.858 96.097  145.031 1.00 48.44  ? 86  DG  I N1    1 
ATOM 7832  C C2    . DG  I 5 86  ? 154.077 95.498  144.891 1.00 48.44  ? 86  DG  I C2    1 
ATOM 7833  N N2    . DG  I 5 86  ? 154.857 95.949  143.903 1.00 48.44  ? 86  DG  I N2    1 
ATOM 7834  N N3    . DG  I 5 86  ? 154.507 94.524  145.659 1.00 48.44  ? 86  DG  I N3    1 
ATOM 7835  C C4    . DG  I 5 86  ? 153.607 94.192  146.595 1.00 48.44  ? 86  DG  I C4    1 
ATOM 7836  P P     . DT  I 5 87  ? 158.743 91.539  149.455 1.00 48.57  ? 87  DT  I P     1 
ATOM 7837  O OP1   . DT  I 5 87  ? 159.674 90.396  149.395 1.00 48.57  ? 87  DT  I OP1   1 
ATOM 7838  O OP2   . DT  I 5 87  ? 158.229 91.994  150.764 1.00 48.57  ? 87  DT  I OP2   1 
ATOM 7839  O "O5'" . DT  I 5 87  ? 159.434 92.785  148.740 1.00 48.57  ? 87  DT  I "O5'" 1 
ATOM 7840  C "C5'" . DT  I 5 87  ? 159.666 92.746  147.345 1.00 48.57  ? 87  DT  I "C5'" 1 
ATOM 7841  C "C4'" . DT  I 5 87  ? 159.635 94.140  146.746 1.00 48.57  ? 87  DT  I "C4'" 1 
ATOM 7842  O "O4'" . DT  I 5 87  ? 158.285 94.651  146.756 1.00 48.57  ? 87  DT  I "O4'" 1 
ATOM 7843  C "C3'" . DT  I 5 87  ? 160.490 95.183  147.466 1.00 48.57  ? 87  DT  I "C3'" 1 
ATOM 7844  O "O3'" . DT  I 5 87  ? 161.335 95.810  146.520 1.00 48.57  ? 87  DT  I "O3'" 1 
ATOM 7845  C "C2'" . DT  I 5 87  ? 159.458 96.154  148.054 1.00 48.57  ? 87  DT  I "C2'" 1 
ATOM 7846  C "C1'" . DT  I 5 87  ? 158.319 96.013  147.073 1.00 48.57  ? 87  DT  I "C1'" 1 
ATOM 7847  N N1    . DT  I 5 87  ? 156.997 96.387  147.617 1.00 48.57  ? 87  DT  I N1    1 
ATOM 7848  C C2    . DT  I 5 87  ? 156.196 97.216  146.889 1.00 48.57  ? 87  DT  I C2    1 
ATOM 7849  O O2    . DT  I 5 87  ? 156.524 97.676  145.820 1.00 48.57  ? 87  DT  I O2    1 
ATOM 7850  N N3    . DT  I 5 87  ? 154.989 97.493  147.460 1.00 48.57  ? 87  DT  I N3    1 
ATOM 7851  C C4    . DT  I 5 87  ? 154.516 97.027  148.663 1.00 48.57  ? 87  DT  I C4    1 
ATOM 7852  O O4    . DT  I 5 87  ? 153.414 97.333  149.094 1.00 48.57  ? 87  DT  I O4    1 
ATOM 7853  C C5    . DT  I 5 87  ? 155.404 96.156  149.378 1.00 48.57  ? 87  DT  I C5    1 
ATOM 7854  C C7    . DT  I 5 87  ? 154.997 95.590  150.699 1.00 48.57  ? 87  DT  I C7    1 
ATOM 7855  C C6    . DT  I 5 87  ? 156.589 95.877  148.826 1.00 48.57  ? 87  DT  I C6    1 
ATOM 7856  P P     . DT  I 5 88  ? 162.404 96.920  146.964 1.00 48.62  ? 88  DT  I P     1 
ATOM 7857  O OP1   . DT  I 5 88  ? 163.549 96.752  146.049 1.00 48.62  ? 88  DT  I OP1   1 
ATOM 7858  O OP2   . DT  I 5 88  ? 162.612 96.877  148.427 1.00 48.62  ? 88  DT  I OP2   1 
ATOM 7859  O "O5'" . DT  I 5 88  ? 161.692 98.294  146.583 1.00 48.62  ? 88  DT  I "O5'" 1 
ATOM 7860  C "C5'" . DT  I 5 88  ? 161.401 98.566  145.227 1.00 48.62  ? 88  DT  I "C5'" 1 
ATOM 7861  C "C4'" . DT  I 5 88  ? 160.697 99.898  145.057 1.00 48.62  ? 88  DT  I "C4'" 1 
ATOM 7862  O "O4'" . DT  I 5 88  ? 159.432 99.891  145.752 1.00 48.62  ? 88  DT  I "O4'" 1 
ATOM 7863  C "C3'" . DT  I 5 88  ? 161.444 101.121 145.566 1.00 48.62  ? 88  DT  I "C3'" 1 
ATOM 7864  O "O3'" . DT  I 5 88  ? 161.223 102.160 144.663 1.00 48.62  ? 88  DT  I "O3'" 1 
ATOM 7865  C "C2'" . DT  I 5 88  ? 160.757 101.401 146.899 1.00 48.62  ? 88  DT  I "C2'" 1 
ATOM 7866  C "C1'" . DT  I 5 88  ? 159.332 101.040 146.551 1.00 48.62  ? 88  DT  I "C1'" 1 
ATOM 7867  N N1    . DT  I 5 88  ? 158.489 100.699 147.701 1.00 48.62  ? 88  DT  I N1    1 
ATOM 7868  C C2    . DT  I 5 88  ? 157.203 101.135 147.722 1.00 48.62  ? 88  DT  I C2    1 
ATOM 7869  O O2    . DT  I 5 88  ? 156.728 101.825 146.851 1.00 48.62  ? 88  DT  I O2    1 
ATOM 7870  N N3    . DT  I 5 88  ? 156.484 100.750 148.807 1.00 48.62  ? 88  DT  I N3    1 
ATOM 7871  C C4    . DT  I 5 88  ? 156.918 99.973  149.847 1.00 48.62  ? 88  DT  I C4    1 
ATOM 7872  O O4    . DT  I 5 88  ? 156.196 99.676  150.783 1.00 48.62  ? 88  DT  I O4    1 
ATOM 7873  C C5    . DT  I 5 88  ? 158.280 99.535  149.761 1.00 48.62  ? 88  DT  I C5    1 
ATOM 7874  C C7    . DT  I 5 88  ? 158.864 98.689  150.843 1.00 48.62  ? 88  DT  I C7    1 
ATOM 7875  C C6    . DT  I 5 88  ? 158.993 99.911  148.701 1.00 48.62  ? 88  DT  I C6    1 
ATOM 7876  P P     . DT  I 5 89  ? 162.305 103.314 144.437 1.00 46.70  ? 89  DT  I P     1 
ATOM 7877  O OP1   . DT  I 5 89  ? 163.137 102.913 143.287 1.00 46.70  ? 89  DT  I OP1   1 
ATOM 7878  O OP2   . DT  I 5 89  ? 162.934 103.630 145.735 1.00 46.70  ? 89  DT  I OP2   1 
ATOM 7879  O "O5'" . DT  I 5 89  ? 161.400 104.550 143.999 1.00 46.70  ? 89  DT  I "O5'" 1 
ATOM 7880  C "C5'" . DT  I 5 89  ? 160.011 104.342 143.764 1.00 46.70  ? 89  DT  I "C5'" 1 
ATOM 7881  C "C4'" . DT  I 5 89  ? 159.183 105.450 144.375 1.00 46.70  ? 89  DT  I "C4'" 1 
ATOM 7882  O "O4'" . DT  I 5 89  ? 158.465 104.968 145.539 1.00 46.70  ? 89  DT  I "O4'" 1 
ATOM 7883  C "C3'" . DT  I 5 89  ? 159.975 106.653 144.848 1.00 46.70  ? 89  DT  I "C3'" 1 
ATOM 7884  O "O3'" . DT  I 5 89  ? 159.254 107.810 144.552 1.00 46.70  ? 89  DT  I "O3'" 1 
ATOM 7885  C "C2'" . DT  I 5 89  ? 160.035 106.430 146.356 1.00 46.70  ? 89  DT  I "C2'" 1 
ATOM 7886  C "C1'" . DT  I 5 89  ? 158.649 105.876 146.591 1.00 46.70  ? 89  DT  I "C1'" 1 
ATOM 7887  N N1    . DT  I 5 89  ? 158.478 105.146 147.871 1.00 46.70  ? 89  DT  I N1    1 
ATOM 7888  C C2    . DT  I 5 89  ? 157.237 105.083 148.439 1.00 46.70  ? 89  DT  I C2    1 
ATOM 7889  O O2    . DT  I 5 89  ? 156.261 105.609 147.954 1.00 46.70  ? 89  DT  I O2    1 
ATOM 7890  N N3    . DT  I 5 89  ? 157.176 104.380 149.602 1.00 46.70  ? 89  DT  I N3    1 
ATOM 7891  C C4    . DT  I 5 89  ? 158.211 103.744 150.238 1.00 46.70  ? 89  DT  I C4    1 
ATOM 7892  O O4    . DT  I 5 89  ? 158.055 103.129 151.283 1.00 46.70  ? 89  DT  I O4    1 
ATOM 7893  C C5    . DT  I 5 89  ? 159.485 103.843 149.591 1.00 46.70  ? 89  DT  I C5    1 
ATOM 7894  C C7    . DT  I 5 89  ? 160.682 103.187 150.194 1.00 46.70  ? 89  DT  I C7    1 
ATOM 7895  C C6    . DT  I 5 89  ? 159.558 104.530 148.450 1.00 46.70  ? 89  DT  I C6    1 
ATOM 7896  P P     . DA  I 5 90  ? 159.406 108.562 143.143 1.00 44.61  ? 90  DA  I P     1 
ATOM 7897  O OP1   . DA  I 5 90  ? 159.202 107.670 141.990 1.00 44.61  ? 90  DA  I OP1   1 
ATOM 7898  O OP2   . DA  I 5 90  ? 160.610 109.404 143.248 1.00 44.61  ? 90  DA  I OP2   1 
ATOM 7899  O "O5'" . DA  I 5 90  ? 158.188 109.555 143.174 1.00 44.61  ? 90  DA  I "O5'" 1 
ATOM 7900  C "C5'" . DA  I 5 90  ? 158.171 110.516 144.163 1.00 44.61  ? 90  DA  I "C5'" 1 
ATOM 7901  C "C4'" . DA  I 5 90  ? 156.835 110.594 144.852 1.00 44.61  ? 90  DA  I "C4'" 1 
ATOM 7902  O "O4'" . DA  I 5 90  ? 156.775 109.606 145.918 1.00 44.61  ? 90  DA  I "O4'" 1 
ATOM 7903  C "C3'" . DA  I 5 90  ? 156.644 111.910 145.552 1.00 44.61  ? 90  DA  I "C3'" 1 
ATOM 7904  O "O3'" . DA  I 5 90  ? 155.300 112.137 145.759 1.00 44.61  ? 90  DA  I "O3'" 1 
ATOM 7905  C "C2'" . DA  I 5 90  ? 157.366 111.638 146.852 1.00 44.61  ? 90  DA  I "C2'" 1 
ATOM 7906  C "C1'" . DA  I 5 90  ? 156.809 110.273 147.167 1.00 44.61  ? 90  DA  I "C1'" 1 
ATOM 7907  N N9    . DA  I 5 90  ? 157.619 109.508 148.108 1.00 44.61  ? 90  DA  I N9    1 
ATOM 7908  C C8    . DA  I 5 90  ? 158.961 109.304 148.056 1.00 44.61  ? 90  DA  I C8    1 
ATOM 7909  N N7    . DA  I 5 90  ? 159.424 108.572 149.037 1.00 44.61  ? 90  DA  I N7    1 
ATOM 7910  C C5    . DA  I 5 90  ? 158.307 108.285 149.790 1.00 44.61  ? 90  DA  I C5    1 
ATOM 7911  C C6    . DA  I 5 90  ? 158.120 107.545 150.971 1.00 44.61  ? 90  DA  I C6    1 
ATOM 7912  N N6    . DA  I 5 90  ? 159.111 106.938 151.617 1.00 44.61  ? 90  DA  I N6    1 
ATOM 7913  N N1    . DA  I 5 90  ? 156.874 107.454 151.464 1.00 44.61  ? 90  DA  I N1    1 
ATOM 7914  C C2    . DA  I 5 90  ? 155.889 108.063 150.813 1.00 44.61  ? 90  DA  I C2    1 
ATOM 7915  N N3    . DA  I 5 90  ? 155.940 108.776 149.695 1.00 44.61  ? 90  DA  I N3    1 
ATOM 7916  C C4    . DA  I 5 90  ? 157.188 108.854 149.234 1.00 44.61  ? 90  DA  I C4    1 
ATOM 7917  P P     . DA  I 5 91  ? 154.655 113.510 145.266 1.00 41.58  ? 91  DA  I P     1 
ATOM 7918  O OP1   . DA  I 5 91  ? 154.567 113.454 143.800 1.00 41.58  ? 91  DA  I OP1   1 
ATOM 7919  O OP2   . DA  I 5 91  ? 155.409 114.594 145.917 1.00 41.58  ? 91  DA  I OP2   1 
ATOM 7920  O "O5'" . DA  I 5 91  ? 153.191 113.462 145.875 1.00 41.58  ? 91  DA  I "O5'" 1 
ATOM 7921  C "C5'" . DA  I 5 91  ? 152.651 112.227 146.264 1.00 41.58  ? 91  DA  I "C5'" 1 
ATOM 7922  C "C4'" . DA  I 5 91  ? 151.865 112.334 147.556 1.00 41.58  ? 91  DA  I "C4'" 1 
ATOM 7923  O "O4'" . DA  I 5 91  ? 152.588 111.696 148.637 1.00 41.58  ? 91  DA  I "O4'" 1 
ATOM 7924  C "C3'" . DA  I 5 91  ? 151.552 113.727 148.049 1.00 41.58  ? 91  DA  I "C3'" 1 
ATOM 7925  O "O3'" . DA  I 5 91  ? 150.342 113.663 148.746 1.00 41.58  ? 91  DA  I "O3'" 1 
ATOM 7926  C "C2'" . DA  I 5 91  ? 152.719 113.986 148.994 1.00 41.58  ? 91  DA  I "C2'" 1 
ATOM 7927  C "C1'" . DA  I 5 91  ? 152.877 112.633 149.651 1.00 41.58  ? 91  DA  I "C1'" 1 
ATOM 7928  N N9    . DA  I 5 91  ? 154.228 112.353 150.102 1.00 41.58  ? 91  DA  I N9    1 
ATOM 7929  C C8    . DA  I 5 91  ? 155.361 112.634 149.432 1.00 41.58  ? 91  DA  I C8    1 
ATOM 7930  N N7    . DA  I 5 91  ? 156.446 112.236 150.031 1.00 41.58  ? 91  DA  I N7    1 
ATOM 7931  C C5    . DA  I 5 91  ? 155.993 111.645 151.182 1.00 41.58  ? 91  DA  I C5    1 
ATOM 7932  C C6    . DA  I 5 91  ? 156.660 111.034 152.249 1.00 41.58  ? 91  DA  I C6    1 
ATOM 7933  N N6    . DA  I 5 91  ? 157.982 110.915 152.308 1.00 41.58  ? 91  DA  I N6    1 
ATOM 7934  N N1    . DA  I 5 91  ? 155.920 110.541 153.247 1.00 41.58  ? 91  DA  I N1    1 
ATOM 7935  C C2    . DA  I 5 91  ? 154.591 110.658 153.184 1.00 41.58  ? 91  DA  I C2    1 
ATOM 7936  N N3    . DA  I 5 91  ? 153.850 111.215 152.229 1.00 41.58  ? 91  DA  I N3    1 
ATOM 7937  C C4    . DA  I 5 91  ? 154.621 111.695 151.246 1.00 41.58  ? 91  DA  I C4    1 
ATOM 7938  P P     . DG  I 5 92  ? 149.475 114.964 149.067 1.00 44.79  ? 92  DG  I P     1 
ATOM 7939  O OP1   . DG  I 5 92  ? 148.255 114.872 148.263 1.00 44.79  ? 92  DG  I OP1   1 
ATOM 7940  O OP2   . DG  I 5 92  ? 150.312 116.168 149.001 1.00 44.79  ? 92  DG  I OP2   1 
ATOM 7941  O "O5'" . DG  I 5 92  ? 149.069 114.743 150.583 1.00 44.79  ? 92  DG  I "O5'" 1 
ATOM 7942  C "C5'" . DG  I 5 92  ? 149.477 113.559 151.233 1.00 44.79  ? 92  DG  I "C5'" 1 
ATOM 7943  C "C4'" . DG  I 5 92  ? 149.655 113.769 152.720 1.00 44.79  ? 92  DG  I "C4'" 1 
ATOM 7944  O "O4'" . DG  I 5 92  ? 151.024 113.489 153.096 1.00 44.79  ? 92  DG  I "O4'" 1 
ATOM 7945  C "C3'" . DG  I 5 92  ? 149.382 115.167 153.232 1.00 44.79  ? 92  DG  I "C3'" 1 
ATOM 7946  O "O3'" . DG  I 5 92  ? 148.918 115.057 154.549 1.00 44.79  ? 92  DG  I "O3'" 1 
ATOM 7947  C "C2'" . DG  I 5 92  ? 150.773 115.786 153.193 1.00 44.79  ? 92  DG  I "C2'" 1 
ATOM 7948  C "C1'" . DG  I 5 92  ? 151.594 114.627 153.693 1.00 44.79  ? 92  DG  I "C1'" 1 
ATOM 7949  N N9    . DG  I 5 92  ? 152.982 114.677 153.297 1.00 44.79  ? 92  DG  I N9    1 
ATOM 7950  C C8    . DG  I 5 92  ? 153.487 115.168 152.135 1.00 44.79  ? 92  DG  I C8    1 
ATOM 7951  N N7    . DG  I 5 92  ? 154.776 115.057 152.041 1.00 44.79  ? 92  DG  I N7    1 
ATOM 7952  C C5    . DG  I 5 92  ? 155.144 114.454 153.223 1.00 44.79  ? 92  DG  I C5    1 
ATOM 7953  C C6    . DG  I 5 92  ? 156.413 114.087 153.690 1.00 44.79  ? 92  DG  I C6    1 
ATOM 7954  O O6    . DG  I 5 92  ? 157.502 114.222 153.127 1.00 44.79  ? 92  DG  I O6    1 
ATOM 7955  N N1    . DG  I 5 92  ? 156.346 113.502 154.940 1.00 44.79  ? 92  DG  I N1    1 
ATOM 7956  C C2    . DG  I 5 92  ? 155.196 113.300 155.651 1.00 44.79  ? 92  DG  I C2    1 
ATOM 7957  N N2    . DG  I 5 92  ? 155.325 112.721 156.846 1.00 44.79  ? 92  DG  I N2    1 
ATOM 7958  N N3    . DG  I 5 92  ? 153.999 113.641 155.222 1.00 44.79  ? 92  DG  I N3    1 
ATOM 7959  C C4    . DG  I 5 92  ? 154.050 114.209 154.004 1.00 44.79  ? 92  DG  I C4    1 
ATOM 7960  P P     . DC  I 5 93  ? 148.075 116.225 155.245 1.00 53.23  ? 93  DC  I P     1 
ATOM 7961  O OP1   . DC  I 5 93  ? 146.690 115.737 155.367 1.00 53.23  ? 93  DC  I OP1   1 
ATOM 7962  O OP2   . DC  I 5 93  ? 148.350 117.505 154.570 1.00 53.23  ? 93  DC  I OP2   1 
ATOM 7963  O "O5'" . DC  I 5 93  ? 148.711 116.292 156.698 1.00 53.23  ? 93  DC  I "O5'" 1 
ATOM 7964  C "C5'" . DC  I 5 93  ? 149.382 115.153 157.218 1.00 53.23  ? 93  DC  I "C5'" 1 
ATOM 7965  C "C4'" . DC  I 5 93  ? 150.436 115.564 158.221 1.00 53.23  ? 93  DC  I "C4'" 1 
ATOM 7966  O "O4'" . DC  I 5 93  ? 151.755 115.475 157.623 1.00 53.23  ? 93  DC  I "O4'" 1 
ATOM 7967  C "C3'" . DC  I 5 93  ? 150.298 116.993 158.723 1.00 53.23  ? 93  DC  I "C3'" 1 
ATOM 7968  O "O3'" . DC  I 5 93  ? 150.501 117.036 160.111 1.00 53.23  ? 93  DC  I "O3'" 1 
ATOM 7969  C "C2'" . DC  I 5 93  ? 151.403 117.720 157.982 1.00 53.23  ? 93  DC  I "C2'" 1 
ATOM 7970  C "C1'" . DC  I 5 93  ? 152.462 116.645 157.920 1.00 53.23  ? 93  DC  I "C1'" 1 
ATOM 7971  N N1    . DC  I 5 93  ? 153.462 116.879 156.863 1.00 53.23  ? 93  DC  I N1    1 
ATOM 7972  C C2    . DC  I 5 93  ? 154.807 116.624 157.110 1.00 53.23  ? 93  DC  I C2    1 
ATOM 7973  O O2    . DC  I 5 93  ? 155.143 116.195 158.213 1.00 53.23  ? 93  DC  I O2    1 
ATOM 7974  N N3    . DC  I 5 93  ? 155.703 116.855 156.130 1.00 53.23  ? 93  DC  I N3    1 
ATOM 7975  C C4    . DC  I 5 93  ? 155.296 117.321 154.959 1.00 53.23  ? 93  DC  I C4    1 
ATOM 7976  N N4    . DC  I 5 93  ? 156.209 117.532 154.017 1.00 53.23  ? 93  DC  I N4    1 
ATOM 7977  C C5    . DC  I 5 93  ? 153.933 117.591 154.694 1.00 53.23  ? 93  DC  I C5    1 
ATOM 7978  C C6    . DC  I 5 93  ? 153.060 117.360 155.665 1.00 53.23  ? 93  DC  I C6    1 
ATOM 7979  P P     . DG  I 5 94  ? 149.654 118.056 161.009 1.00 60.21  ? 94  DG  I P     1 
ATOM 7980  O OP1   . DG  I 5 94  ? 148.714 117.253 161.815 1.00 60.21  ? 94  DG  I OP1   1 
ATOM 7981  O OP2   . DG  I 5 94  ? 149.141 119.115 160.118 1.00 60.21  ? 94  DG  I OP2   1 
ATOM 7982  O "O5'" . DG  I 5 94  ? 150.749 118.721 161.958 1.00 60.21  ? 94  DG  I "O5'" 1 
ATOM 7983  C "C5'" . DG  I 5 94  ? 151.689 117.907 162.629 1.00 60.21  ? 94  DG  I "C5'" 1 
ATOM 7984  C "C4'" . DG  I 5 94  ? 153.044 118.580 162.661 1.00 60.21  ? 94  DG  I "C4'" 1 
ATOM 7985  O "O4'" . DG  I 5 94  ? 153.744 118.296 161.438 1.00 60.21  ? 94  DG  I "O4'" 1 
ATOM 7986  C "C3'" . DG  I 5 94  ? 152.999 120.100 162.725 1.00 60.21  ? 94  DG  I "C3'" 1 
ATOM 7987  O "O3'" . DG  I 5 94  ? 152.966 120.638 164.122 1.00 60.21  ? 94  DG  I "O3'" 1 
ATOM 7988  C "C2'" . DG  I 5 94  ? 154.220 120.552 161.921 1.00 60.21  ? 94  DG  I "C2'" 1 
ATOM 7989  C "C1'" . DG  I 5 94  ? 154.733 119.276 161.257 1.00 60.21  ? 94  DG  I "C1'" 1 
ATOM 7990  N N9    . DG  I 5 94  ? 154.962 119.470 159.839 1.00 60.21  ? 94  DG  I N9    1 
ATOM 7991  C C8    . DG  I 5 94  ? 154.023 119.773 158.897 1.00 60.21  ? 94  DG  I C8    1 
ATOM 7992  N N7    . DG  I 5 94  ? 154.514 119.928 157.710 1.00 60.21  ? 94  DG  I N7    1 
ATOM 7993  C C5    . DG  I 5 94  ? 155.870 119.743 157.880 1.00 60.21  ? 94  DG  I C5    1 
ATOM 7994  C C6    . DG  I 5 94  ? 156.906 119.795 156.940 1.00 60.21  ? 94  DG  I C6    1 
ATOM 7995  O O6    . DG  I 5 94  ? 156.823 120.020 155.734 1.00 60.21  ? 94  DG  I O6    1 
ATOM 7996  N N1    . DG  I 5 94  ? 158.139 119.549 157.518 1.00 60.21  ? 94  DG  I N1    1 
ATOM 7997  C C2    . DG  I 5 94  ? 158.343 119.286 158.844 1.00 60.21  ? 94  DG  I C2    1 
ATOM 7998  N N2    . DG  I 5 94  ? 159.605 119.081 159.220 1.00 60.21  ? 94  DG  I N2    1 
ATOM 7999  N N3    . DG  I 5 94  ? 157.375 119.235 159.744 1.00 60.21  ? 94  DG  I N3    1 
ATOM 8000  C C4    . DG  I 5 94  ? 156.167 119.469 159.187 1.00 60.21  ? 94  DG  I C4    1 
ATOM 8001  P P     . DG  I 5 95  ? 154.131 120.448 165.237 1.00 61.97  ? 95  DG  I P     1 
ATOM 8002  O OP1   . DG  I 5 95  ? 154.543 119.048 165.452 1.00 61.97  ? 95  DG  I OP1   1 
ATOM 8003  O OP2   . DG  I 5 95  ? 153.623 121.195 166.400 1.00 61.97  ? 95  DG  I OP2   1 
ATOM 8004  O "O5'" . DG  I 5 95  ? 155.389 121.293 164.739 1.00 61.97  ? 95  DG  I "O5'" 1 
ATOM 8005  C "C5'" . DG  I 5 95  ? 156.663 120.669 164.692 1.00 61.97  ? 95  DG  I "C5'" 1 
ATOM 8006  C "C4'" . DG  I 5 95  ? 157.701 121.573 164.061 1.00 61.97  ? 95  DG  I "C4'" 1 
ATOM 8007  O "O4'" . DG  I 5 95  ? 157.662 121.456 162.623 1.00 61.97  ? 95  DG  I "O4'" 1 
ATOM 8008  C "C3'" . DG  I 5 95  ? 157.538 123.057 164.372 1.00 61.97  ? 95  DG  I "C3'" 1 
ATOM 8009  O "O3'" . DG  I 5 95  ? 158.656 123.493 165.141 1.00 61.97  ? 95  DG  I "O3'" 1 
ATOM 8010  C "C2'" . DG  I 5 95  ? 157.488 123.730 162.991 1.00 61.97  ? 95  DG  I "C2'" 1 
ATOM 8011  C "C1'" . DG  I 5 95  ? 158.082 122.671 162.077 1.00 61.97  ? 95  DG  I "C1'" 1 
ATOM 8012  N N9    . DG  I 5 95  ? 157.599 122.761 160.701 1.00 61.97  ? 95  DG  I N9    1 
ATOM 8013  C C8    . DG  I 5 95  ? 156.293 122.807 160.291 1.00 61.97  ? 95  DG  I C8    1 
ATOM 8014  N N7    . DG  I 5 95  ? 156.155 122.897 159.004 1.00 61.97  ? 95  DG  I N7    1 
ATOM 8015  C C5    . DG  I 5 95  ? 157.452 122.916 158.525 1.00 61.97  ? 95  DG  I C5    1 
ATOM 8016  C C6    . DG  I 5 95  ? 157.925 123.001 157.202 1.00 61.97  ? 95  DG  I C6    1 
ATOM 8017  O O6    . DG  I 5 95  ? 157.264 123.076 156.164 1.00 61.97  ? 95  DG  I O6    1 
ATOM 8018  N N1    . DG  I 5 95  ? 159.308 122.989 157.144 1.00 61.97  ? 95  DG  I N1    1 
ATOM 8019  C C2    . DG  I 5 95  ? 160.135 122.904 158.230 1.00 61.97  ? 95  DG  I C2    1 
ATOM 8020  N N2    . DG  I 5 95  ? 161.448 122.909 157.978 1.00 61.97  ? 95  DG  I N2    1 
ATOM 8021  N N3    . DG  I 5 95  ? 159.706 122.823 159.484 1.00 61.97  ? 95  DG  I N3    1 
ATOM 8022  C C4    . DG  I 5 95  ? 158.355 122.832 159.554 1.00 61.97  ? 95  DG  I C4    1 
ATOM 8023  P P     . DT  I 5 96  ? 158.796 125.017 165.625 1.00 61.65  ? 96  DT  I P     1 
ATOM 8024  O OP1   . DT  I 5 96  ? 159.625 124.988 166.847 1.00 61.65  ? 96  DT  I OP1   1 
ATOM 8025  O OP2   . DT  I 5 96  ? 157.465 125.656 165.660 1.00 61.65  ? 96  DT  I OP2   1 
ATOM 8026  O "O5'" . DT  I 5 96  ? 159.662 125.689 164.471 1.00 61.65  ? 96  DT  I "O5'" 1 
ATOM 8027  C "C5'" . DT  I 5 96  ? 160.815 125.027 164.000 1.00 61.65  ? 96  DT  I "C5'" 1 
ATOM 8028  C "C4'" . DT  I 5 96  ? 161.458 125.814 162.886 1.00 61.65  ? 96  DT  I "C4'" 1 
ATOM 8029  O "O4'" . DT  I 5 96  ? 160.792 125.528 161.640 1.00 61.65  ? 96  DT  I "O4'" 1 
ATOM 8030  C "C3'" . DT  I 5 96  ? 161.389 127.328 163.067 1.00 61.65  ? 96  DT  I "C3'" 1 
ATOM 8031  O "O3'" . DT  I 5 96  ? 162.692 127.846 163.148 1.00 61.65  ? 96  DT  I "O3'" 1 
ATOM 8032  C "C2'" . DT  I 5 96  ? 160.644 127.831 161.820 1.00 61.65  ? 96  DT  I "C2'" 1 
ATOM 8033  C "C1'" . DT  I 5 96  ? 160.814 126.683 160.847 1.00 61.65  ? 96  DT  I "C1'" 1 
ATOM 8034  N N1    . DT  I 5 96  ? 159.728 126.590 159.868 1.00 61.65  ? 96  DT  I N1    1 
ATOM 8035  C C2    . DT  I 5 96  ? 160.025 126.610 158.535 1.00 61.65  ? 96  DT  I C2    1 
ATOM 8036  O O2    . DT  I 5 96  ? 161.153 126.701 158.106 1.00 61.65  ? 96  DT  I O2    1 
ATOM 8037  N N3    . DT  I 5 96  ? 158.945 126.522 157.712 1.00 61.65  ? 96  DT  I N3    1 
ATOM 8038  C C4    . DT  I 5 96  ? 157.620 126.420 158.087 1.00 61.65  ? 96  DT  I C4    1 
ATOM 8039  O O4    . DT  I 5 96  ? 156.713 126.344 157.274 1.00 61.65  ? 96  DT  I O4    1 
ATOM 8040  C C5    . DT  I 5 96  ? 157.385 126.404 159.503 1.00 61.65  ? 96  DT  I C5    1 
ATOM 8041  C C7    . DT  I 5 96  ? 155.990 126.299 160.031 1.00 61.65  ? 96  DT  I C7    1 
ATOM 8042  C C6    . DT  I 5 96  ? 158.438 126.491 160.315 1.00 61.65  ? 96  DT  I C6    1 
ATOM 8043  P P     . DG  I 5 97  ? 162.938 129.401 163.455 1.00 58.12  ? 97  DG  I P     1 
ATOM 8044  O OP1   . DG  I 5 97  ? 164.208 129.493 164.211 1.00 58.12  ? 97  DG  I OP1   1 
ATOM 8045  O OP2   . DG  I 5 97  ? 161.700 130.012 163.992 1.00 58.12  ? 97  DG  I OP2   1 
ATOM 8046  O "O5'" . DG  I 5 97  ? 163.195 129.999 162.011 1.00 58.12  ? 97  DG  I "O5'" 1 
ATOM 8047  C "C5'" . DG  I 5 97  ? 164.022 129.287 161.113 1.00 58.12  ? 97  DG  I "C5'" 1 
ATOM 8048  C "C4'" . DG  I 5 97  ? 164.169 130.028 159.801 1.00 58.12  ? 97  DG  I "C4'" 1 
ATOM 8049  O "O4'" . DG  I 5 97  ? 163.083 129.677 158.911 1.00 58.12  ? 97  DG  I "O4'" 1 
ATOM 8050  C "C3'" . DG  I 5 97  ? 164.160 131.547 159.904 1.00 58.12  ? 97  DG  I "C3'" 1 
ATOM 8051  O "O3'" . DG  I 5 97  ? 165.126 132.048 159.020 1.00 58.12  ? 97  DG  I "O3'" 1 
ATOM 8052  C "C2'" . DG  I 5 97  ? 162.741 131.914 159.460 1.00 58.12  ? 97  DG  I "C2'" 1 
ATOM 8053  C "C1'" . DG  I 5 97  ? 162.475 130.846 158.420 1.00 58.12  ? 97  DG  I "C1'" 1 
ATOM 8054  N N9    . DG  I 5 97  ? 161.071 130.554 158.211 1.00 58.12  ? 97  DG  I N9    1 
ATOM 8055  C C8    . DG  I 5 97  ? 160.107 130.378 159.166 1.00 58.12  ? 97  DG  I C8    1 
ATOM 8056  N N7    . DG  I 5 97  ? 158.937 130.099 158.671 1.00 58.12  ? 97  DG  I N7    1 
ATOM 8057  C C5    . DG  I 5 97  ? 159.148 130.080 157.301 1.00 58.12  ? 97  DG  I C5    1 
ATOM 8058  C C6    . DG  I 5 97  ? 158.251 129.834 156.247 1.00 58.12  ? 97  DG  I C6    1 
ATOM 8059  O O6    . DG  I 5 97  ? 157.050 129.570 156.310 1.00 58.12  ? 97  DG  I O6    1 
ATOM 8060  N N1    . DG  I 5 97  ? 158.876 129.911 155.014 1.00 58.12  ? 97  DG  I N1    1 
ATOM 8061  C C2    . DG  I 5 97  ? 160.200 130.196 154.826 1.00 58.12  ? 97  DG  I C2    1 
ATOM 8062  N N2    . DG  I 5 97  ? 160.631 130.232 153.563 1.00 58.12  ? 97  DG  I N2    1 
ATOM 8063  N N3    . DG  I 5 97  ? 161.052 130.426 155.805 1.00 58.12  ? 97  DG  I N3    1 
ATOM 8064  C C4    . DG  I 5 97  ? 160.457 130.353 157.010 1.00 58.12  ? 97  DG  I C4    1 
ATOM 8065  P P     . DC  I 5 98  ? 165.707 133.533 159.172 1.00 55.68  ? 98  DC  I P     1 
ATOM 8066  O OP1   . DC  I 5 98  ? 167.154 133.391 159.432 1.00 55.68  ? 98  DC  I OP1   1 
ATOM 8067  O OP2   . DC  I 5 98  ? 164.853 134.322 160.088 1.00 55.68  ? 98  DC  I OP2   1 
ATOM 8068  O "O5'" . DC  I 5 98  ? 165.531 134.113 157.706 1.00 55.68  ? 98  DC  I "O5'" 1 
ATOM 8069  C "C5'" . DC  I 5 98  ? 165.609 133.226 156.608 1.00 55.68  ? 98  DC  I "C5'" 1 
ATOM 8070  C "C4'" . DC  I 5 98  ? 164.910 133.800 155.399 1.00 55.68  ? 98  DC  I "C4'" 1 
ATOM 8071  O "O4'" . DC  I 5 98  ? 163.533 133.352 155.360 1.00 55.68  ? 98  DC  I "O4'" 1 
ATOM 8072  C "C3'" . DC  I 5 98  ? 164.867 135.318 155.349 1.00 55.68  ? 98  DC  I "C3'" 1 
ATOM 8073  O "O3'" . DC  I 5 98  ? 165.192 135.726 154.052 1.00 55.68  ? 98  DC  I "O3'" 1 
ATOM 8074  C "C2'" . DC  I 5 98  ? 163.410 135.635 155.694 1.00 55.68  ? 98  DC  I "C2'" 1 
ATOM 8075  C "C1'" . DC  I 5 98  ? 162.695 134.444 155.092 1.00 55.68  ? 98  DC  I "C1'" 1 
ATOM 8076  N N1    . DC  I 5 98  ? 161.376 134.159 155.699 1.00 55.68  ? 98  DC  I N1    1 
ATOM 8077  C C2    . DC  I 5 98  ? 160.308 133.791 154.890 1.00 55.68  ? 98  DC  I C2    1 
ATOM 8078  O O2    . DC  I 5 98  ? 160.471 133.724 153.674 1.00 55.68  ? 98  DC  I O2    1 
ATOM 8079  N N3    . DC  I 5 98  ? 159.118 133.517 155.466 1.00 55.68  ? 98  DC  I N3    1 
ATOM 8080  C C4    . DC  I 5 98  ? 158.981 133.599 156.780 1.00 55.68  ? 98  DC  I C4    1 
ATOM 8081  N N4    . DC  I 5 98  ? 157.785 133.322 157.306 1.00 55.68  ? 98  DC  I N4    1 
ATOM 8082  C C5    . DC  I 5 98  ? 160.058 133.969 157.620 1.00 55.68  ? 98  DC  I C5    1 
ATOM 8083  C C6    . DC  I 5 98  ? 161.226 134.233 157.042 1.00 55.68  ? 98  DC  I C6    1 
ATOM 8084  P P     . DT  I 5 99  ? 165.807 137.177 153.769 1.00 52.25  ? 99  DT  I P     1 
ATOM 8085  O OP1   . DT  I 5 99  ? 167.167 136.972 153.237 1.00 52.25  ? 99  DT  I OP1   1 
ATOM 8086  O OP2   . DT  I 5 99  ? 165.591 138.028 154.958 1.00 52.25  ? 99  DT  I OP2   1 
ATOM 8087  O "O5'" . DT  I 5 99  ? 164.886 137.711 152.588 1.00 52.25  ? 99  DT  I "O5'" 1 
ATOM 8088  C "C5'" . DT  I 5 99  ? 164.368 136.786 151.645 1.00 52.25  ? 99  DT  I "C5'" 1 
ATOM 8089  C "C4'" . DT  I 5 99  ? 163.013 137.225 151.126 1.00 52.25  ? 99  DT  I "C4'" 1 
ATOM 8090  O "O4'" . DT  I 5 99  ? 161.971 136.795 152.035 1.00 52.25  ? 99  DT  I "O4'" 1 
ATOM 8091  C "C3'" . DT  I 5 99  ? 162.827 138.734 150.965 1.00 52.25  ? 99  DT  I "C3'" 1 
ATOM 8092  O "O3'" . DT  I 5 99  ? 162.131 138.986 149.776 1.00 52.25  ? 99  DT  I "O3'" 1 
ATOM 8093  C "C2'" . DT  I 5 99  ? 161.956 139.079 152.162 1.00 52.25  ? 99  DT  I "C2'" 1 
ATOM 8094  C "C1'" . DT  I 5 99  ? 161.073 137.855 152.192 1.00 52.25  ? 99  DT  I "C1'" 1 
ATOM 8095  N N1    . DT  I 5 99  ? 160.333 137.681 153.454 1.00 52.25  ? 99  DT  I N1    1 
ATOM 8096  C C2    . DT  I 5 99  ? 159.049 137.200 153.422 1.00 52.25  ? 99  DT  I C2    1 
ATOM 8097  O O2    . DT  I 5 99  ? 158.477 136.894 152.399 1.00 52.25  ? 99  DT  I O2    1 
ATOM 8098  N N3    . DT  I 5 99  ? 158.459 137.083 154.639 1.00 52.25  ? 99  DT  I N3    1 
ATOM 8099  C C4    . DT  I 5 99  ? 159.006 137.393 155.856 1.00 52.25  ? 99  DT  I C4    1 
ATOM 8100  O O4    . DT  I 5 99  ? 158.394 137.251 156.899 1.00 52.25  ? 99  DT  I O4    1 
ATOM 8101  C C5    . DT  I 5 99  ? 160.346 137.893 155.819 1.00 52.25  ? 99  DT  I C5    1 
ATOM 8102  C C7    . DT  I 5 99  ? 161.043 138.264 157.090 1.00 52.25  ? 99  DT  I C7    1 
ATOM 8103  C C6    . DT  I 5 99  ? 160.938 138.016 154.633 1.00 52.25  ? 99  DT  I C6    1 
ATOM 8104  P P     . DA  I 5 100 ? 162.886 139.546 148.479 1.00 47.87  ? 100 DA  I P     1 
ATOM 8105  O OP1   . DA  I 5 100 ? 164.062 138.689 148.250 1.00 47.87  ? 100 DA  I OP1   1 
ATOM 8106  O OP2   . DA  I 5 100 ? 163.049 141.003 148.636 1.00 47.87  ? 100 DA  I OP2   1 
ATOM 8107  O "O5'" . DA  I 5 100 ? 161.828 139.301 147.312 1.00 47.87  ? 100 DA  I "O5'" 1 
ATOM 8108  C "C5'" . DA  I 5 100 ? 161.218 138.023 147.176 1.00 47.87  ? 100 DA  I "C5'" 1 
ATOM 8109  C "C4'" . DA  I 5 100 ? 159.710 138.110 146.932 1.00 47.87  ? 100 DA  I "C4'" 1 
ATOM 8110  O "O4'" . DA  I 5 100 ? 158.980 138.136 148.180 1.00 47.87  ? 100 DA  I "O4'" 1 
ATOM 8111  C "C3'" . DA  I 5 100 ? 159.206 139.299 146.144 1.00 47.87  ? 100 DA  I "C3'" 1 
ATOM 8112  O "O3'" . DA  I 5 100 ? 158.107 138.862 145.386 1.00 47.87  ? 100 DA  I "O3'" 1 
ATOM 8113  C "C2'" . DA  I 5 100 ? 158.771 140.262 147.249 1.00 47.87  ? 100 DA  I "C2'" 1 
ATOM 8114  C "C1'" . DA  I 5 100 ? 158.173 139.295 148.249 1.00 47.87  ? 100 DA  I "C1'" 1 
ATOM 8115  N N9    . DA  I 5 100 ? 158.217 139.739 149.630 1.00 47.87  ? 100 DA  I N9    1 
ATOM 8116  C C8    . DA  I 5 100 ? 159.252 140.359 150.254 1.00 47.87  ? 100 DA  I C8    1 
ATOM 8117  N N7    . DA  I 5 100 ? 159.042 140.586 151.523 1.00 47.87  ? 100 DA  I N7    1 
ATOM 8118  C C5    . DA  I 5 100 ? 157.791 140.057 151.749 1.00 47.87  ? 100 DA  I C5    1 
ATOM 8119  C C6    . DA  I 5 100 ? 156.998 139.981 152.897 1.00 47.87  ? 100 DA  I C6    1 
ATOM 8120  N N6    . DA  I 5 100 ? 157.380 140.460 154.076 1.00 47.87  ? 100 DA  I N6    1 
ATOM 8121  N N1    . DA  I 5 100 ? 155.793 139.396 152.790 1.00 47.87  ? 100 DA  I N1    1 
ATOM 8122  C C2    . DA  I 5 100 ? 155.417 138.914 151.606 1.00 47.87  ? 100 DA  I C2    1 
ATOM 8123  N N3    . DA  I 5 100 ? 156.081 138.927 150.455 1.00 47.87  ? 100 DA  I N3    1 
ATOM 8124  C C4    . DA  I 5 100 ? 157.271 139.521 150.598 1.00 47.87  ? 100 DA  I C4    1 
ATOM 8125  P P     . DG  I 5 101 ? 157.618 139.665 144.095 1.00 45.36  ? 101 DG  I P     1 
ATOM 8126  O OP1   . DG  I 5 101 ? 157.615 138.714 142.972 1.00 45.36  ? 101 DG  I OP1   1 
ATOM 8127  O OP2   . DG  I 5 101 ? 158.398 140.913 144.006 1.00 45.36  ? 101 DG  I OP2   1 
ATOM 8128  O "O5'" . DG  I 5 101 ? 156.108 140.018 144.449 1.00 45.36  ? 101 DG  I "O5'" 1 
ATOM 8129  C "C5'" . DG  I 5 101 ? 155.319 139.073 145.144 1.00 45.36  ? 101 DG  I "C5'" 1 
ATOM 8130  C "C4'" . DG  I 5 101 ? 154.212 139.739 145.945 1.00 45.36  ? 101 DG  I "C4'" 1 
ATOM 8131  O "O4'" . DG  I 5 101 ? 154.700 140.147 147.242 1.00 45.36  ? 101 DG  I "O4'" 1 
ATOM 8132  C "C3'" . DG  I 5 101 ? 153.596 140.993 145.339 1.00 45.36  ? 101 DG  I "C3'" 1 
ATOM 8133  O "O3'" . DG  I 5 101 ? 152.249 141.005 145.648 1.00 45.36  ? 101 DG  I "O3'" 1 
ATOM 8134  C "C2'" . DG  I 5 101 ? 154.295 142.090 146.115 1.00 45.36  ? 101 DG  I "C2'" 1 
ATOM 8135  C "C1'" . DG  I 5 101 ? 154.266 141.456 147.476 1.00 45.36  ? 101 DG  I "C1'" 1 
ATOM 8136  N N9    . DG  I 5 101 ? 155.147 142.079 148.443 1.00 45.36  ? 101 DG  I N9    1 
ATOM 8137  C C8    . DG  I 5 101 ? 156.357 142.648 148.204 1.00 45.36  ? 101 DG  I C8    1 
ATOM 8138  N N7    . DG  I 5 101 ? 156.920 143.122 149.271 1.00 45.36  ? 101 DG  I N7    1 
ATOM 8139  C C5    . DG  I 5 101 ? 156.018 142.849 150.279 1.00 45.36  ? 101 DG  I C5    1 
ATOM 8140  C C6    . DG  I 5 101 ? 156.085 143.128 151.653 1.00 45.36  ? 101 DG  I C6    1 
ATOM 8141  O O6    . DG  I 5 101 ? 156.988 143.691 152.275 1.00 45.36  ? 101 DG  I O6    1 
ATOM 8142  N N1    . DG  I 5 101 ? 154.960 142.682 152.322 1.00 45.36  ? 101 DG  I N1    1 
ATOM 8143  C C2    . DG  I 5 101 ? 153.901 142.051 151.737 1.00 45.36  ? 101 DG  I C2    1 
ATOM 8144  N N2    . DG  I 5 101 ? 152.901 141.699 152.545 1.00 45.36  ? 101 DG  I N2    1 
ATOM 8145  N N3    . DG  I 5 101 ? 153.829 141.783 150.453 1.00 45.36  ? 101 DG  I N3    1 
ATOM 8146  C C4    . DG  I 5 101 ? 154.921 142.212 149.787 1.00 45.36  ? 101 DG  I C4    1 
ATOM 8147  P P     . DA  I 5 102 ? 151.150 140.738 144.530 1.00 43.13  ? 102 DA  I P     1 
ATOM 8148  O OP1   . DA  I 5 102 ? 151.421 139.405 143.992 1.00 43.13  ? 102 DA  I OP1   1 
ATOM 8149  O OP2   . DA  I 5 102 ? 151.143 141.911 143.647 1.00 43.13  ? 102 DA  I OP2   1 
ATOM 8150  O "O5'" . DA  I 5 102 ? 149.787 140.705 145.350 1.00 43.13  ? 102 DA  I "O5'" 1 
ATOM 8151  C "C5'" . DA  I 5 102 ? 149.649 139.826 146.452 1.00 43.13  ? 102 DA  I "C5'" 1 
ATOM 8152  C "C4'" . DA  I 5 102 ? 148.909 140.464 147.628 1.00 43.13  ? 102 DA  I "C4'" 1 
ATOM 8153  O "O4'" . DA  I 5 102 ? 149.823 141.187 148.480 1.00 43.13  ? 102 DA  I "O4'" 1 
ATOM 8154  C "C3'" . DA  I 5 102 ? 147.799 141.444 147.297 1.00 43.13  ? 102 DA  I "C3'" 1 
ATOM 8155  O "O3'" . DA  I 5 102 ? 146.799 141.299 148.267 1.00 43.13  ? 102 DA  I "O3'" 1 
ATOM 8156  C "C2'" . DA  I 5 102 ? 148.502 142.792 147.434 1.00 43.13  ? 102 DA  I "C2'" 1 
ATOM 8157  C "C1'" . DA  I 5 102 ? 149.400 142.526 148.620 1.00 43.13  ? 102 DA  I "C1'" 1 
ATOM 8158  N N9    . DA  I 5 102 ? 150.597 143.332 148.655 1.00 43.13  ? 102 DA  I N9    1 
ATOM 8159  C C8    . DA  I 5 102 ? 151.432 143.586 147.619 1.00 43.13  ? 102 DA  I C8    1 
ATOM 8160  N N7    . DA  I 5 102 ? 152.470 144.303 147.941 1.00 43.13  ? 102 DA  I N7    1 
ATOM 8161  C C5    . DA  I 5 102 ? 152.314 144.520 149.292 1.00 43.13  ? 102 DA  I C5    1 
ATOM 8162  C C6    . DA  I 5 102 ? 153.087 145.214 150.231 1.00 43.13  ? 102 DA  I C6    1 
ATOM 8163  N N6    . DA  I 5 102 ? 154.216 145.841 149.921 1.00 43.13  ? 102 DA  I N6    1 
ATOM 8164  N N1    . DA  I 5 102 ? 152.650 145.250 151.501 1.00 43.13  ? 102 DA  I N1    1 
ATOM 8165  C C2    . DA  I 5 102 ? 151.514 144.622 151.808 1.00 43.13  ? 102 DA  I C2    1 
ATOM 8166  N N3    . DA  I 5 102 ? 150.704 143.932 151.008 1.00 43.13  ? 102 DA  I N3    1 
ATOM 8167  C C4    . DA  I 5 102 ? 151.168 143.922 149.752 1.00 43.13  ? 102 DA  I C4    1 
ATOM 8168  P P     . DG  I 5 103 ? 145.293 141.762 147.986 1.00 50.22  ? 103 DG  I P     1 
ATOM 8169  O OP1   . DG  I 5 103 ? 144.459 140.547 148.009 1.00 50.22  ? 103 DG  I OP1   1 
ATOM 8170  O OP2   . DG  I 5 103 ? 145.280 142.654 146.810 1.00 50.22  ? 103 DG  I OP2   1 
ATOM 8171  O "O5'" . DG  I 5 103 ? 144.948 142.649 149.262 1.00 50.22  ? 103 DG  I "O5'" 1 
ATOM 8172  C "C5'" . DG  I 5 103 ? 145.767 142.563 150.406 1.00 50.22  ? 103 DG  I "C5'" 1 
ATOM 8173  C "C4'" . DG  I 5 103 ? 145.760 143.858 151.193 1.00 50.22  ? 103 DG  I "C4'" 1 
ATOM 8174  O "O4'" . DG  I 5 103 ? 147.051 144.520 151.103 1.00 50.22  ? 103 DG  I "O4'" 1 
ATOM 8175  C "C3'" . DG  I 5 103 ? 144.748 144.900 150.753 1.00 50.22  ? 103 DG  I "C3'" 1 
ATOM 8176  O "O3'" . DG  I 5 103 ? 144.350 145.596 151.890 1.00 50.22  ? 103 DG  I "O3'" 1 
ATOM 8177  C "C2'" . DG  I 5 103 ? 145.592 145.794 149.862 1.00 50.22  ? 103 DG  I "C2'" 1 
ATOM 8178  C "C1'" . DG  I 5 103 ? 146.851 145.851 150.693 1.00 50.22  ? 103 DG  I "C1'" 1 
ATOM 8179  N N9    . DG  I 5 103 ? 148.028 146.294 149.970 1.00 50.22  ? 103 DG  I N9    1 
ATOM 8180  C C8    . DG  I 5 103 ? 148.300 146.107 148.648 1.00 50.22  ? 103 DG  I C8    1 
ATOM 8181  N N7    . DG  I 5 103 ? 149.442 146.604 148.282 1.00 50.22  ? 103 DG  I N7    1 
ATOM 8182  C C5    . DG  I 5 103 ? 149.955 147.154 149.439 1.00 50.22  ? 103 DG  I C5    1 
ATOM 8183  C C6    . DG  I 5 103 ? 151.171 147.833 149.660 1.00 50.22  ? 103 DG  I C6    1 
ATOM 8184  O O6    . DG  I 5 103 ? 152.066 148.084 148.849 1.00 50.22  ? 103 DG  I O6    1 
ATOM 8185  N N1    . DG  I 5 103 ? 151.305 148.225 150.978 1.00 50.22  ? 103 DG  I N1    1 
ATOM 8186  C C2    . DG  I 5 103 ? 150.381 147.996 151.958 1.00 50.22  ? 103 DG  I C2    1 
ATOM 8187  N N2    . DG  I 5 103 ? 150.681 148.451 153.176 1.00 50.22  ? 103 DG  I N2    1 
ATOM 8188  N N3    . DG  I 5 103 ? 149.242 147.363 151.764 1.00 50.22  ? 103 DG  I N3    1 
ATOM 8189  C C4    . DG  I 5 103 ? 149.098 146.970 150.485 1.00 50.22  ? 103 DG  I C4    1 
ATOM 8190  P P     . DC  I 5 104 ? 142.905 146.265 152.000 1.00 58.82  ? 104 DC  I P     1 
ATOM 8191  O OP1   . DC  I 5 104 ? 142.144 145.367 152.888 1.00 58.82  ? 104 DC  I OP1   1 
ATOM 8192  O OP2   . DC  I 5 104 ? 142.398 146.590 150.650 1.00 58.82  ? 104 DC  I OP2   1 
ATOM 8193  O "O5'" . DC  I 5 104 ? 143.213 147.631 152.761 1.00 58.82  ? 104 DC  I "O5'" 1 
ATOM 8194  C "C5'" . DC  I 5 104 ? 144.143 147.632 153.831 1.00 58.82  ? 104 DC  I "C5'" 1 
ATOM 8195  C "C4'" . DC  I 5 104 ? 144.901 148.942 153.894 1.00 58.82  ? 104 DC  I "C4'" 1 
ATOM 8196  O "O4'" . DC  I 5 104 ? 146.016 148.908 152.987 1.00 58.82  ? 104 DC  I "O4'" 1 
ATOM 8197  C "C3'" . DC  I 5 104 ? 144.091 150.180 153.511 1.00 58.82  ? 104 DC  I "C3'" 1 
ATOM 8198  O "O3'" . DC  I 5 104 ? 143.864 150.971 154.665 1.00 58.82  ? 104 DC  I "O3'" 1 
ATOM 8199  C "C2'" . DC  I 5 104 ? 144.971 150.910 152.490 1.00 58.82  ? 104 DC  I "C2'" 1 
ATOM 8200  C "C1'" . DC  I 5 104 ? 146.315 150.221 152.624 1.00 58.82  ? 104 DC  I "C1'" 1 
ATOM 8201  N N1    . DC  I 5 104 ? 147.082 150.196 151.358 1.00 58.82  ? 104 DC  I N1    1 
ATOM 8202  C C2    . DC  I 5 104 ? 148.325 150.815 151.295 1.00 58.82  ? 104 DC  I C2    1 
ATOM 8203  O O2    . DC  I 5 104 ? 148.764 151.369 152.297 1.00 58.82  ? 104 DC  I O2    1 
ATOM 8204  N N3    . DC  I 5 104 ? 149.008 150.788 150.133 1.00 58.82  ? 104 DC  I N3    1 
ATOM 8205  C C4    . DC  I 5 104 ? 148.492 150.183 149.069 1.00 58.82  ? 104 DC  I C4    1 
ATOM 8206  N N4    . DC  I 5 104 ? 149.204 150.181 147.943 1.00 58.82  ? 104 DC  I N4    1 
ATOM 8207  C C5    . DC  I 5 104 ? 147.224 149.549 149.112 1.00 58.82  ? 104 DC  I C5    1 
ATOM 8208  C C6    . DC  I 5 104 ? 146.562 149.575 150.267 1.00 58.82  ? 104 DC  I C6    1 
ATOM 8209  P P     . DT  I 5 105 ? 143.024 152.339 154.585 1.00 62.93  ? 105 DT  I P     1 
ATOM 8210  O OP1   . DT  I 5 105 ? 142.334 152.465 155.882 1.00 62.93  ? 105 DT  I OP1   1 
ATOM 8211  O OP2   . DT  I 5 105 ? 142.233 152.389 153.339 1.00 62.93  ? 105 DT  I OP2   1 
ATOM 8212  O "O5'" . DT  I 5 105 ? 144.149 153.465 154.508 1.00 62.93  ? 105 DT  I "O5'" 1 
ATOM 8213  C "C5'" . DT  I 5 105 ? 145.200 153.474 155.459 1.00 62.93  ? 105 DT  I "C5'" 1 
ATOM 8214  C "C4'" . DT  I 5 105 ? 146.157 154.614 155.192 1.00 62.93  ? 105 DT  I "C4'" 1 
ATOM 8215  O "O4'" . DT  I 5 105 ? 147.016 154.278 154.077 1.00 62.93  ? 105 DT  I "O4'" 1 
ATOM 8216  C "C3'" . DT  I 5 105 ? 145.493 155.943 154.839 1.00 62.93  ? 105 DT  I "C3'" 1 
ATOM 8217  O "O3'" . DT  I 5 105 ? 146.067 156.983 155.605 1.00 62.93  ? 105 DT  I "O3'" 1 
ATOM 8218  C "C2'" . DT  I 5 105 ? 145.791 156.110 153.353 1.00 62.93  ? 105 DT  I "C2'" 1 
ATOM 8219  C "C1'" . DT  I 5 105 ? 147.108 155.378 153.212 1.00 62.93  ? 105 DT  I "C1'" 1 
ATOM 8220  N N1    . DT  I 5 105 ? 147.345 154.868 151.851 1.00 62.93  ? 105 DT  I N1    1 
ATOM 8221  C C2    . DT  I 5 105 ? 148.529 155.142 151.223 1.00 62.93  ? 105 DT  I C2    1 
ATOM 8222  O O2    . DT  I 5 105 ? 149.413 155.799 151.731 1.00 62.93  ? 105 DT  I O2    1 
ATOM 8223  N N3    . DT  I 5 105 ? 148.639 154.614 149.972 1.00 62.93  ? 105 DT  I N3    1 
ATOM 8224  C C4    . DT  I 5 105 ? 147.704 153.862 149.306 1.00 62.93  ? 105 DT  I C4    1 
ATOM 8225  O O4    . DT  I 5 105 ? 147.892 153.429 148.183 1.00 62.93  ? 105 DT  I O4    1 
ATOM 8226  C C5    . DT  I 5 105 ? 146.489 153.616 150.018 1.00 62.93  ? 105 DT  I C5    1 
ATOM 8227  C C7    . DT  I 5 105 ? 145.401 152.816 149.386 1.00 62.93  ? 105 DT  I C7    1 
ATOM 8228  C C6    . DT  I 5 105 ? 146.367 154.123 151.240 1.00 62.93  ? 105 DT  I C6    1 
ATOM 8229  P P     . DG  I 5 106 ? 145.400 158.443 155.634 1.00 65.14  ? 106 DG  I P     1 
ATOM 8230  O OP1   . DG  I 5 106 ? 145.533 158.961 157.012 1.00 65.14  ? 106 DG  I OP1   1 
ATOM 8231  O OP2   . DG  I 5 106 ? 144.067 158.377 155.003 1.00 65.14  ? 106 DG  I OP2   1 
ATOM 8232  O "O5'" . DG  I 5 106 ? 146.353 159.304 154.693 1.00 65.14  ? 106 DG  I "O5'" 1 
ATOM 8233  C "C5'" . DG  I 5 106 ? 147.750 159.329 154.943 1.00 65.14  ? 106 DG  I "C5'" 1 
ATOM 8234  C "C4'" . DG  I 5 106 ? 148.480 160.115 153.870 1.00 65.14  ? 106 DG  I "C4'" 1 
ATOM 8235  O "O4'" . DG  I 5 106 ? 148.678 159.288 152.697 1.00 65.14  ? 106 DG  I "O4'" 1 
ATOM 8236  C "C3'" . DG  I 5 106 ? 147.766 161.373 153.390 1.00 65.14  ? 106 DG  I "C3'" 1 
ATOM 8237  O "O3'" . DG  I 5 106 ? 148.706 162.422 153.277 1.00 65.14  ? 106 DG  I "O3'" 1 
ATOM 8238  C "C2'" . DG  I 5 106 ? 147.204 160.965 152.027 1.00 65.14  ? 106 DG  I "C2'" 1 
ATOM 8239  C "C1'" . DG  I 5 106 ? 148.243 159.975 151.547 1.00 65.14  ? 106 DG  I "C1'" 1 
ATOM 8240  N N9    . DG  I 5 106 ? 147.715 158.996 150.612 1.00 65.14  ? 106 DG  I N9    1 
ATOM 8241  C C8    . DG  I 5 106 ? 146.558 158.282 150.735 1.00 65.14  ? 106 DG  I C8    1 
ATOM 8242  N N7    . DG  I 5 106 ? 146.344 157.468 149.748 1.00 65.14  ? 106 DG  I N7    1 
ATOM 8243  C C5    . DG  I 5 106 ? 147.433 157.655 148.918 1.00 65.14  ? 106 DG  I C5    1 
ATOM 8244  C C6    . DG  I 5 106 ? 147.746 157.048 147.694 1.00 65.14  ? 106 DG  I C6    1 
ATOM 8245  O O6    . DG  I 5 106 ? 147.105 156.192 147.078 1.00 65.14  ? 106 DG  I O6    1 
ATOM 8246  N N1    . DG  I 5 106 ? 148.940 157.523 147.179 1.00 65.14  ? 106 DG  I N1    1 
ATOM 8247  C C2    . DG  I 5 106 ? 149.724 158.469 147.776 1.00 65.14  ? 106 DG  I C2    1 
ATOM 8248  N N2    . DG  I 5 106 ? 150.843 158.812 147.133 1.00 65.14  ? 106 DG  I N2    1 
ATOM 8249  N N3    . DG  I 5 106 ? 149.437 159.047 148.924 1.00 65.14  ? 106 DG  I N3    1 
ATOM 8250  C C4    . DG  I 5 106 ? 148.282 158.592 149.436 1.00 65.14  ? 106 DG  I C4    1 
ATOM 8251  P P     . DT  I 5 107 ? 148.227 163.945 153.138 1.00 65.66  ? 107 DT  I P     1 
ATOM 8252  O OP1   . DT  I 5 107 ? 148.975 164.710 154.154 1.00 65.66  ? 107 DT  I OP1   1 
ATOM 8253  O OP2   . DT  I 5 107 ? 146.751 164.006 153.118 1.00 65.66  ? 107 DT  I OP2   1 
ATOM 8254  O "O5'" . DT  I 5 107 ? 148.750 164.355 151.690 1.00 65.66  ? 107 DT  I "O5'" 1 
ATOM 8255  C "C5'" . DT  I 5 107 ? 150.002 163.863 151.237 1.00 65.66  ? 107 DT  I "C5'" 1 
ATOM 8256  C "C4'" . DT  I 5 107 ? 150.245 164.219 149.781 1.00 65.66  ? 107 DT  I "C4'" 1 
ATOM 8257  O "O4'" . DT  I 5 107 ? 149.844 163.118 148.928 1.00 65.66  ? 107 DT  I "O4'" 1 
ATOM 8258  C "C3'" . DT  I 5 107 ? 149.502 165.447 149.267 1.00 65.66  ? 107 DT  I "C3'" 1 
ATOM 8259  O "O3'" . DT  I 5 107 ? 150.368 166.173 148.414 1.00 65.66  ? 107 DT  I "O3'" 1 
ATOM 8260  C "C2'" . DT  I 5 107 ? 148.332 164.835 148.497 1.00 65.66  ? 107 DT  I "C2'" 1 
ATOM 8261  C "C1'" . DT  I 5 107 ? 148.971 163.587 147.926 1.00 65.66  ? 107 DT  I "C1'" 1 
ATOM 8262  N N1    . DT  I 5 107 ? 148.010 162.511 147.619 1.00 65.66  ? 107 DT  I N1    1 
ATOM 8263  C C2    . DT  I 5 107 ? 148.238 161.712 146.537 1.00 65.66  ? 107 DT  I C2    1 
ATOM 8264  O O2    . DT  I 5 107 ? 149.188 161.848 145.798 1.00 65.66  ? 107 DT  I O2    1 
ATOM 8265  N N3    . DT  I 5 107 ? 147.304 160.746 146.336 1.00 65.66  ? 107 DT  I N3    1 
ATOM 8266  C C4    . DT  I 5 107 ? 146.186 160.502 147.100 1.00 65.66  ? 107 DT  I C4    1 
ATOM 8267  O O4    . DT  I 5 107 ? 145.401 159.605 146.843 1.00 65.66  ? 107 DT  I O4    1 
ATOM 8268  C C5    . DT  I 5 107 ? 146.009 161.371 148.225 1.00 65.66  ? 107 DT  I C5    1 
ATOM 8269  C C7    . DT  I 5 107 ? 144.829 161.196 149.126 1.00 65.66  ? 107 DT  I C7    1 
ATOM 8270  C C6    . DT  I 5 107 ? 146.920 162.324 148.431 1.00 65.66  ? 107 DT  I C6    1 
ATOM 8271  P P     . DC  I 5 108 ? 150.037 167.677 147.956 1.00 66.51  ? 108 DC  I P     1 
ATOM 8272  O OP1   . DC  I 5 108 ? 151.167 168.499 148.435 1.00 66.51  ? 108 DC  I OP1   1 
ATOM 8273  O OP2   . DC  I 5 108 ? 148.654 168.052 148.319 1.00 66.51  ? 108 DC  I OP2   1 
ATOM 8274  O "O5'" . DC  I 5 108 ? 150.105 167.589 146.367 1.00 66.51  ? 108 DC  I "O5'" 1 
ATOM 8275  C "C5'" . DC  I 5 108 ? 151.047 166.722 145.759 1.00 66.51  ? 108 DC  I "C5'" 1 
ATOM 8276  C "C4'" . DC  I 5 108 ? 150.617 166.331 144.357 1.00 66.51  ? 108 DC  I "C4'" 1 
ATOM 8277  O "O4'" . DC  I 5 108 ? 149.661 165.245 144.411 1.00 66.51  ? 108 DC  I "O4'" 1 
ATOM 8278  C "C3'" . DC  I 5 108 ? 149.959 167.440 143.548 1.00 66.51  ? 108 DC  I "C3'" 1 
ATOM 8279  O "O3'" . DC  I 5 108 ? 150.469 167.413 142.245 1.00 66.51  ? 108 DC  I "O3'" 1 
ATOM 8280  C "C2'" . DC  I 5 108 ? 148.475 167.065 143.573 1.00 66.51  ? 108 DC  I "C2'" 1 
ATOM 8281  C "C1'" . DC  I 5 108 ? 148.550 165.552 143.600 1.00 66.51  ? 108 DC  I "C1'" 1 
ATOM 8282  N N1    . DC  I 5 108 ? 147.365 164.902 144.192 1.00 66.51  ? 108 DC  I N1    1 
ATOM 8283  C C2    . DC  I 5 108 ? 146.921 163.695 143.674 1.00 66.51  ? 108 DC  I C2    1 
ATOM 8284  O O2    . DC  I 5 108 ? 147.516 163.203 142.718 1.00 66.51  ? 108 DC  I O2    1 
ATOM 8285  N N3    . DC  I 5 108 ? 145.846 163.101 144.230 1.00 66.51  ? 108 DC  I N3    1 
ATOM 8286  C C4    . DC  I 5 108 ? 145.234 163.669 145.260 1.00 66.51  ? 108 DC  I C4    1 
ATOM 8287  N N4    . DC  I 5 108 ? 144.180 163.046 145.778 1.00 66.51  ? 108 DC  I N4    1 
ATOM 8288  C C5    . DC  I 5 108 ? 145.678 164.898 145.810 1.00 66.51  ? 108 DC  I C5    1 
ATOM 8289  C C6    . DC  I 5 108 ? 146.740 165.473 145.251 1.00 66.51  ? 108 DC  I C6    1 
ATOM 8290  P P     . DT  I 5 109 ? 150.666 168.772 141.423 1.00 62.31  ? 109 DT  I P     1 
ATOM 8291  O OP1   . DT  I 5 109 ? 152.094 169.144 141.534 1.00 62.31  ? 109 DT  I OP1   1 
ATOM 8292  O OP2   . DT  I 5 109 ? 149.606 169.711 141.847 1.00 62.31  ? 109 DT  I OP2   1 
ATOM 8293  O "O5'" . DT  I 5 109 ? 150.360 168.329 139.924 1.00 62.31  ? 109 DT  I "O5'" 1 
ATOM 8294  C "C5'" . DT  I 5 109 ? 150.668 167.004 139.516 1.00 62.31  ? 109 DT  I "C5'" 1 
ATOM 8295  C "C4'" . DT  I 5 109 ? 149.556 166.425 138.669 1.00 62.31  ? 109 DT  I "C4'" 1 
ATOM 8296  O "O4'" . DT  I 5 109 ? 148.528 165.858 139.521 1.00 62.31  ? 109 DT  I "O4'" 1 
ATOM 8297  C "C3'" . DT  I 5 109 ? 148.841 167.435 137.765 1.00 62.31  ? 109 DT  I "C3'" 1 
ATOM 8298  O "O3'" . DT  I 5 109 ? 148.640 166.871 136.487 1.00 62.31  ? 109 DT  I "O3'" 1 
ATOM 8299  C "C2'" . DT  I 5 109 ? 147.514 167.634 138.482 1.00 62.31  ? 109 DT  I "C2'" 1 
ATOM 8300  C "C1'" . DT  I 5 109 ? 147.288 166.234 138.998 1.00 62.31  ? 109 DT  I "C1'" 1 
ATOM 8301  N N1    . DT  I 5 109 ? 146.259 166.135 140.043 1.00 62.31  ? 109 DT  I N1    1 
ATOM 8302  C C2    . DT  I 5 109 ? 145.526 164.985 140.144 1.00 62.31  ? 109 DT  I C2    1 
ATOM 8303  O O2    . DT  I 5 109 ? 145.695 164.028 139.418 1.00 62.31  ? 109 DT  I O2    1 
ATOM 8304  N N3    . DT  I 5 109 ? 144.590 164.987 141.131 1.00 62.31  ? 109 DT  I N3    1 
ATOM 8305  C C4    . DT  I 5 109 ? 144.316 166.009 142.007 1.00 62.31  ? 109 DT  I C4    1 
ATOM 8306  O O4    . DT  I 5 109 ? 143.455 165.917 142.866 1.00 62.31  ? 109 DT  I O4    1 
ATOM 8307  C C5    . DT  I 5 109 ? 145.115 167.192 141.842 1.00 62.31  ? 109 DT  I C5    1 
ATOM 8308  C C7    . DT  I 5 109 ? 144.906 168.372 142.740 1.00 62.31  ? 109 DT  I C7    1 
ATOM 8309  C C6    . DT  I 5 109 ? 146.035 167.200 140.874 1.00 62.31  ? 109 DT  I C6    1 
ATOM 8310  P P     . DA  I 5 110 ? 149.632 167.207 135.274 1.00 59.46  ? 110 DA  I P     1 
ATOM 8311  O OP1   . DA  I 5 110 ? 151.004 166.858 135.696 1.00 59.46  ? 110 DA  I OP1   1 
ATOM 8312  O OP2   . DA  I 5 110 ? 149.317 168.565 134.792 1.00 59.46  ? 110 DA  I OP2   1 
ATOM 8313  O "O5'" . DA  I 5 110 ? 149.196 166.179 134.139 1.00 59.46  ? 110 DA  I "O5'" 1 
ATOM 8314  C "C5'" . DA  I 5 110 ? 149.288 164.775 134.375 1.00 59.46  ? 110 DA  I "C5'" 1 
ATOM 8315  C "C4'" . DA  I 5 110 ? 147.938 164.073 134.215 1.00 59.46  ? 110 DA  I "C4'" 1 
ATOM 8316  O "O4'" . DA  I 5 110 ? 147.011 164.505 135.240 1.00 59.46  ? 110 DA  I "O4'" 1 
ATOM 8317  C "C3'" . DA  I 5 110 ? 147.208 164.288 132.893 1.00 59.46  ? 110 DA  I "C3'" 1 
ATOM 8318  O "O3'" . DA  I 5 110 ? 146.525 163.104 132.576 1.00 59.46  ? 110 DA  I "O3'" 1 
ATOM 8319  C "C2'" . DA  I 5 110 ? 146.224 165.387 133.256 1.00 59.46  ? 110 DA  I "C2'" 1 
ATOM 8320  C "C1'" . DA  I 5 110 ? 145.811 164.916 134.631 1.00 59.46  ? 110 DA  I "C1'" 1 
ATOM 8321  N N9    . DA  I 5 110 ? 145.227 165.935 135.478 1.00 59.46  ? 110 DA  I N9    1 
ATOM 8322  C C8    . DA  I 5 110 ? 145.589 167.242 135.564 1.00 59.46  ? 110 DA  I C8    1 
ATOM 8323  N N7    . DA  I 5 110 ? 144.906 167.921 136.447 1.00 59.46  ? 110 DA  I N7    1 
ATOM 8324  C C5    . DA  I 5 110 ? 144.053 166.988 136.989 1.00 59.46  ? 110 DA  I C5    1 
ATOM 8325  C C6    . DA  I 5 110 ? 143.074 167.075 137.982 1.00 59.46  ? 110 DA  I C6    1 
ATOM 8326  N N6    . DA  I 5 110 ? 142.793 168.204 138.628 1.00 59.46  ? 110 DA  I N6    1 
ATOM 8327  N N1    . DA  I 5 110 ? 142.389 165.955 138.288 1.00 59.46  ? 110 DA  I N1    1 
ATOM 8328  C C2    . DA  I 5 110 ? 142.675 164.827 137.637 1.00 59.46  ? 110 DA  I C2    1 
ATOM 8329  N N3    . DA  I 5 110 ? 143.579 164.625 136.689 1.00 59.46  ? 110 DA  I N3    1 
ATOM 8330  C C4    . DA  I 5 110 ? 144.239 165.758 136.409 1.00 59.46  ? 110 DA  I C4    1 
ATOM 8331  P P     . DC  I 5 111 ? 146.278 162.665 131.057 1.00 53.40  ? 111 DC  I P     1 
ATOM 8332  O OP1   . DC  I 5 111 ? 147.427 161.837 130.640 1.00 53.40  ? 111 DC  I OP1   1 
ATOM 8333  O OP2   . DC  I 5 111 ? 145.925 163.880 130.293 1.00 53.40  ? 111 DC  I OP2   1 
ATOM 8334  O "O5'" . DC  I 5 111 ? 144.980 161.733 131.158 1.00 53.40  ? 111 DC  I "O5'" 1 
ATOM 8335  C "C5'" . DC  I 5 111 ? 144.466 161.380 132.437 1.00 53.40  ? 111 DC  I "C5'" 1 
ATOM 8336  C "C4'" . DC  I 5 111 ? 142.946 161.394 132.467 1.00 53.40  ? 111 DC  I "C4'" 1 
ATOM 8337  O "O4'" . DC  I 5 111 ? 142.479 162.457 133.335 1.00 53.40  ? 111 DC  I "O4'" 1 
ATOM 8338  C "C3'" . DC  I 5 111 ? 142.252 161.635 131.137 1.00 53.40  ? 111 DC  I "C3'" 1 
ATOM 8339  O "O3'" . DC  I 5 111 ? 140.994 161.002 131.158 1.00 53.40  ? 111 DC  I "O3'" 1 
ATOM 8340  C "C2'" . DC  I 5 111 ? 142.077 163.138 131.155 1.00 53.40  ? 111 DC  I "C2'" 1 
ATOM 8341  C "C1'" . DC  I 5 111 ? 141.653 163.325 132.594 1.00 53.40  ? 111 DC  I "C1'" 1 
ATOM 8342  N N1    . DC  I 5 111 ? 141.835 164.705 133.099 1.00 53.40  ? 111 DC  I N1    1 
ATOM 8343  C C2    . DC  I 5 111 ? 141.038 165.164 134.139 1.00 53.40  ? 111 DC  I C2    1 
ATOM 8344  O O2    . DC  I 5 111 ? 140.196 164.414 134.629 1.00 53.40  ? 111 DC  I O2    1 
ATOM 8345  N N3    . DC  I 5 111 ? 141.212 166.423 134.584 1.00 53.40  ? 111 DC  I N3    1 
ATOM 8346  C C4    . DC  I 5 111 ? 142.129 167.201 134.032 1.00 53.40  ? 111 DC  I C4    1 
ATOM 8347  N N4    . DC  I 5 111 ? 142.267 168.435 134.510 1.00 53.40  ? 111 DC  I N4    1 
ATOM 8348  C C5    . DC  I 5 111 ? 142.946 166.753 132.967 1.00 53.40  ? 111 DC  I C5    1 
ATOM 8349  C C6    . DC  I 5 111 ? 142.761 165.512 132.533 1.00 53.40  ? 111 DC  I C6    1 
ATOM 8350  P P     . DG  I 5 112 ? 140.495 160.121 129.918 1.00 44.47  ? 112 DG  I P     1 
ATOM 8351  O OP1   . DG  I 5 112 ? 141.161 158.816 130.036 1.00 44.47  ? 112 DG  I OP1   1 
ATOM 8352  O OP2   . DG  I 5 112 ? 140.615 160.930 128.694 1.00 44.47  ? 112 DG  I OP2   1 
ATOM 8353  O "O5'" . DG  I 5 112 ? 138.934 159.945 130.179 1.00 44.47  ? 112 DG  I "O5'" 1 
ATOM 8354  C "C5'" . DG  I 5 112 ? 138.454 159.534 131.443 1.00 44.47  ? 112 DG  I "C5'" 1 
ATOM 8355  C "C4'" . DG  I 5 112 ? 137.268 160.374 131.885 1.00 44.47  ? 112 DG  I "C4'" 1 
ATOM 8356  O "O4'" . DG  I 5 112 ? 137.726 161.668 132.327 1.00 44.47  ? 112 DG  I "O4'" 1 
ATOM 8357  C "C3'" . DG  I 5 112 ? 136.200 160.657 130.827 1.00 44.47  ? 112 DG  I "C3'" 1 
ATOM 8358  O "O3'" . DG  I 5 112 ? 134.934 160.608 131.430 1.00 44.47  ? 112 DG  I "O3'" 1 
ATOM 8359  C "C2'" . DG  I 5 112 ? 136.530 162.076 130.403 1.00 44.47  ? 112 DG  I "C2'" 1 
ATOM 8360  C "C1'" . DG  I 5 112 ? 136.950 162.662 131.721 1.00 44.47  ? 112 DG  I "C1'" 1 
ATOM 8361  N N9    . DG  I 5 112 ? 137.755 163.859 131.593 1.00 44.47  ? 112 DG  I N9    1 
ATOM 8362  C C8    . DG  I 5 112 ? 138.772 164.078 130.715 1.00 44.47  ? 112 DG  I C8    1 
ATOM 8363  N N7    . DG  I 5 112 ? 139.317 165.247 130.839 1.00 44.47  ? 112 DG  I N7    1 
ATOM 8364  C C5    . DG  I 5 112 ? 138.606 165.841 131.859 1.00 44.47  ? 112 DG  I C5    1 
ATOM 8365  C C6    . DG  I 5 112 ? 138.739 167.115 132.434 1.00 44.47  ? 112 DG  I C6    1 
ATOM 8366  O O6    . DG  I 5 112 ? 139.543 168.004 132.147 1.00 44.47  ? 112 DG  I O6    1 
ATOM 8367  N N1    . DG  I 5 112 ? 137.810 167.323 133.441 1.00 44.47  ? 112 DG  I N1    1 
ATOM 8368  C C2    . DG  I 5 112 ? 136.877 166.410 133.839 1.00 44.47  ? 112 DG  I C2    1 
ATOM 8369  N N2    . DG  I 5 112 ? 136.064 166.779 134.837 1.00 44.47  ? 112 DG  I N2    1 
ATOM 8370  N N3    . DG  I 5 112 ? 136.752 165.209 133.316 1.00 44.47  ? 112 DG  I N3    1 
ATOM 8371  C C4    . DG  I 5 112 ? 137.644 164.998 132.332 1.00 44.47  ? 112 DG  I C4    1 
ATOM 8372  P P     . DA  I 5 113 ? 133.615 160.310 130.575 1.00 44.70  ? 113 DA  I P     1 
ATOM 8373  O OP1   . DA  I 5 113 ? 133.495 158.867 130.430 1.00 44.70  ? 113 DA  I OP1   1 
ATOM 8374  O OP2   . DA  I 5 113 ? 133.603 161.131 129.362 1.00 44.70  ? 113 DA  I OP2   1 
ATOM 8375  O "O5'" . DA  I 5 113 ? 132.445 160.812 131.522 1.00 44.70  ? 113 DA  I "O5'" 1 
ATOM 8376  C "C5'" . DA  I 5 113 ? 132.715 161.095 132.887 1.00 44.70  ? 113 DA  I "C5'" 1 
ATOM 8377  C "C4'" . DA  I 5 113 ? 131.890 162.266 133.413 1.00 44.70  ? 113 DA  I "C4'" 1 
ATOM 8378  O "O4'" . DA  I 5 113 ? 132.697 163.462 133.452 1.00 44.70  ? 113 DA  I "O4'" 1 
ATOM 8379  C "C3'" . DA  I 5 113 ? 130.648 162.635 132.625 1.00 44.70  ? 113 DA  I "C3'" 1 
ATOM 8380  O "O3'" . DA  I 5 113 ? 129.675 163.108 133.521 1.00 44.70  ? 113 DA  I "O3'" 1 
ATOM 8381  C "C2'" . DA  I 5 113 ? 131.144 163.753 131.724 1.00 44.70  ? 113 DA  I "C2'" 1 
ATOM 8382  C "C1'" . DA  I 5 113 ? 132.135 164.458 132.628 1.00 44.70  ? 113 DA  I "C1'" 1 
ATOM 8383  N N9    . DA  I 5 113 ? 133.225 165.073 131.907 1.00 44.70  ? 113 DA  I N9    1 
ATOM 8384  C C8    . DA  I 5 113 ? 133.999 164.487 130.965 1.00 44.70  ? 113 DA  I C8    1 
ATOM 8385  N N7    . DA  I 5 113 ? 134.927 165.261 130.487 1.00 44.70  ? 113 DA  I N7    1 
ATOM 8386  C C5    . DA  I 5 113 ? 134.751 166.439 131.167 1.00 44.70  ? 113 DA  I C5    1 
ATOM 8387  C C6    . DA  I 5 113 ? 135.422 167.659 131.110 1.00 44.70  ? 113 DA  I C6    1 
ATOM 8388  N N6    . DA  I 5 113 ? 136.447 167.883 130.300 1.00 44.70  ? 113 DA  I N6    1 
ATOM 8389  N N1    . DA  I 5 113 ? 135.005 168.641 131.922 1.00 44.70  ? 113 DA  I N1    1 
ATOM 8390  C C2    . DA  I 5 113 ? 133.975 168.410 132.738 1.00 44.70  ? 113 DA  I C2    1 
ATOM 8391  N N3    . DA  I 5 113 ? 133.262 167.298 132.878 1.00 44.70  ? 113 DA  I N3    1 
ATOM 8392  C C4    . DA  I 5 113 ? 133.710 166.342 132.056 1.00 44.70  ? 113 DA  I C4    1 
ATOM 8393  P P     . DC  I 5 114 ? 128.147 163.262 133.073 1.00 51.89  ? 114 DC  I P     1 
ATOM 8394  O OP1   . DC  I 5 114 ? 127.337 162.753 134.195 1.00 51.89  ? 114 DC  I OP1   1 
ATOM 8395  O OP2   . DC  I 5 114 ? 127.996 162.668 131.733 1.00 51.89  ? 114 DC  I OP2   1 
ATOM 8396  O "O5'" . DC  I 5 114 ? 127.948 164.843 132.933 1.00 51.89  ? 114 DC  I "O5'" 1 
ATOM 8397  C "C5'" . DC  I 5 114 ? 128.672 165.722 133.779 1.00 51.89  ? 114 DC  I "C5'" 1 
ATOM 8398  C "C4'" . DC  I 5 114 ? 128.576 167.158 133.297 1.00 51.89  ? 114 DC  I "C4'" 1 
ATOM 8399  O "O4'" . DC  I 5 114 ? 129.812 167.563 132.656 1.00 51.89  ? 114 DC  I "O4'" 1 
ATOM 8400  C "C3'" . DC  I 5 114 ? 127.473 167.440 132.289 1.00 51.89  ? 114 DC  I "C3'" 1 
ATOM 8401  O "O3'" . DC  I 5 114 ? 126.830 168.637 132.654 1.00 51.89  ? 114 DC  I "O3'" 1 
ATOM 8402  C "C2'" . DC  I 5 114 ? 128.240 167.602 130.978 1.00 51.89  ? 114 DC  I "C2'" 1 
ATOM 8403  C "C1'" . DC  I 5 114 ? 129.510 168.254 131.470 1.00 51.89  ? 114 DC  I "C1'" 1 
ATOM 8404  N N1    . DC  I 5 114 ? 130.658 168.109 130.542 1.00 51.89  ? 114 DC  I N1    1 
ATOM 8405  C C2    . DC  I 5 114 ? 131.481 169.204 130.254 1.00 51.89  ? 114 DC  I C2    1 
ATOM 8406  O O2    . DC  I 5 114 ? 131.243 170.294 130.769 1.00 51.89  ? 114 DC  I O2    1 
ATOM 8407  N N3    . DC  I 5 114 ? 132.519 169.031 129.410 1.00 51.89  ? 114 DC  I N3    1 
ATOM 8408  C C4    . DC  I 5 114 ? 132.747 167.843 128.874 1.00 51.89  ? 114 DC  I C4    1 
ATOM 8409  N N4    . DC  I 5 114 ? 133.784 167.711 128.046 1.00 51.89  ? 114 DC  I N4    1 
ATOM 8410  C C5    . DC  I 5 114 ? 131.923 166.725 129.157 1.00 51.89  ? 114 DC  I C5    1 
ATOM 8411  C C6    . DC  I 5 114 ? 130.905 166.903 129.987 1.00 51.89  ? 114 DC  I C6    1 
ATOM 8412  P P     . DC  I 5 115 ? 125.302 168.910 132.262 1.00 57.46  ? 115 DC  I P     1 
ATOM 8413  O OP1   . DC  I 5 115 ? 124.517 168.907 133.515 1.00 57.46  ? 115 DC  I OP1   1 
ATOM 8414  O OP2   . DC  I 5 115 ? 124.933 167.989 131.166 1.00 57.46  ? 115 DC  I OP2   1 
ATOM 8415  O "O5'" . DC  I 5 115 ? 125.347 170.393 131.675 1.00 57.46  ? 115 DC  I "O5'" 1 
ATOM 8416  C "C5'" . DC  I 5 115 ? 126.380 171.274 132.087 1.00 57.46  ? 115 DC  I "C5'" 1 
ATOM 8417  C "C4'" . DC  I 5 115 ? 126.643 172.335 131.036 1.00 57.46  ? 115 DC  I "C4'" 1 
ATOM 8418  O "O4'" . DC  I 5 115 ? 127.874 172.039 130.336 1.00 57.46  ? 115 DC  I "O4'" 1 
ATOM 8419  C "C3'" . DC  I 5 115 ? 125.563 172.474 129.962 1.00 57.46  ? 115 DC  I "C3'" 1 
ATOM 8420  O "O3'" . DC  I 5 115 ? 125.284 173.848 129.748 1.00 57.46  ? 115 DC  I "O3'" 1 
ATOM 8421  C "C2'" . DC  I 5 115 ? 126.210 171.843 128.736 1.00 57.46  ? 115 DC  I "C2'" 1 
ATOM 8422  C "C1'" . DC  I 5 115 ? 127.669 172.190 128.956 1.00 57.46  ? 115 DC  I "C1'" 1 
ATOM 8423  N N1    . DC  I 5 115 ? 128.591 171.286 128.254 1.00 57.46  ? 115 DC  I N1    1 
ATOM 8424  C C2    . DC  I 5 115 ? 129.683 171.804 127.568 1.00 57.46  ? 115 DC  I C2    1 
ATOM 8425  O O2    . DC  I 5 115 ? 129.861 173.019 127.557 1.00 57.46  ? 115 DC  I O2    1 
ATOM 8426  N N3    . DC  I 5 115 ? 130.511 170.953 126.931 1.00 57.46  ? 115 DC  I N3    1 
ATOM 8427  C C4    . DC  I 5 115 ? 130.276 169.648 126.967 1.00 57.46  ? 115 DC  I C4    1 
ATOM 8428  N N4    . DC  I 5 115 ? 131.117 168.844 126.325 1.00 57.46  ? 115 DC  I N4    1 
ATOM 8429  C C5    . DC  I 5 115 ? 129.168 169.104 127.659 1.00 57.46  ? 115 DC  I C5    1 
ATOM 8430  C C6    . DC  I 5 115 ? 128.361 169.952 128.281 1.00 57.46  ? 115 DC  I C6    1 
ATOM 8431  P P     . DA  I 5 116 ? 123.907 174.313 129.062 1.00 58.38  ? 116 DA  I P     1 
ATOM 8432  O OP1   . DA  I 5 116 ? 123.242 175.207 130.029 1.00 58.38  ? 116 DA  I OP1   1 
ATOM 8433  O OP2   . DA  I 5 116 ? 123.177 173.134 128.554 1.00 58.38  ? 116 DA  I OP2   1 
ATOM 8434  O "O5'" . DA  I 5 116 ? 124.396 175.177 127.811 1.00 58.38  ? 116 DA  I "O5'" 1 
ATOM 8435  C "C5'" . DA  I 5 116 ? 125.377 176.184 127.998 1.00 58.38  ? 116 DA  I "C5'" 1 
ATOM 8436  C "C4'" . DA  I 5 116 ? 126.088 176.521 126.698 1.00 58.38  ? 116 DA  I "C4'" 1 
ATOM 8437  O "O4'" . DA  I 5 116 ? 127.053 175.492 126.376 1.00 58.38  ? 116 DA  I "O4'" 1 
ATOM 8438  C "C3'" . DA  I 5 116 ? 125.197 176.664 125.463 1.00 58.38  ? 116 DA  I "C3'" 1 
ATOM 8439  O "O3'" . DA  I 5 116 ? 125.622 177.787 124.717 1.00 58.38  ? 116 DA  I "O3'" 1 
ATOM 8440  C "C2'" . DA  I 5 116 ? 125.463 175.371 124.703 1.00 58.38  ? 116 DA  I "C2'" 1 
ATOM 8441  C "C1'" . DA  I 5 116 ? 126.925 175.160 125.018 1.00 58.38  ? 116 DA  I "C1'" 1 
ATOM 8442  N N9    . DA  I 5 116 ? 127.368 173.792 124.843 1.00 58.38  ? 116 DA  I N9    1 
ATOM 8443  C C8    . DA  I 5 116 ? 126.773 172.671 125.331 1.00 58.38  ? 116 DA  I C8    1 
ATOM 8444  N N7    . DA  I 5 116 ? 127.401 171.568 125.024 1.00 58.38  ? 116 DA  I N7    1 
ATOM 8445  C C5    . DA  I 5 116 ? 128.482 172.003 124.287 1.00 58.38  ? 116 DA  I C5    1 
ATOM 8446  C C6    . DA  I 5 116 ? 129.535 171.322 123.668 1.00 58.38  ? 116 DA  I C6    1 
ATOM 8447  N N6    . DA  I 5 116 ? 129.666 170.003 123.703 1.00 58.38  ? 116 DA  I N6    1 
ATOM 8448  N N1    . DA  I 5 116 ? 130.453 172.052 123.007 1.00 58.38  ? 116 DA  I N1    1 
ATOM 8449  C C2    . DA  I 5 116 ? 130.320 173.377 122.974 1.00 58.38  ? 116 DA  I C2    1 
ATOM 8450  N N3    . DA  I 5 116 ? 129.368 174.127 123.521 1.00 58.38  ? 116 DA  I N3    1 
ATOM 8451  C C4    . DA  I 5 116 ? 128.477 173.370 124.169 1.00 58.38  ? 116 DA  I C4    1 
ATOM 8452  P P     . DA  I 5 117 ? 124.685 178.433 123.587 1.00 58.14  ? 117 DA  I P     1 
ATOM 8453  O OP1   . DA  I 5 117 ? 124.573 179.868 123.916 1.00 58.14  ? 117 DA  I OP1   1 
ATOM 8454  O OP2   . DA  I 5 117 ? 123.470 177.608 123.410 1.00 58.14  ? 117 DA  I OP2   1 
ATOM 8455  O "O5'" . DA  I 5 117 ? 125.557 178.304 122.261 1.00 58.14  ? 117 DA  I "O5'" 1 
ATOM 8456  C "C5'" . DA  I 5 117 ? 126.864 178.846 122.232 1.00 58.14  ? 117 DA  I "C5'" 1 
ATOM 8457  C "C4'" . DA  I 5 117 ? 127.579 178.504 120.936 1.00 58.14  ? 117 DA  I "C4'" 1 
ATOM 8458  O "O4'" . DA  I 5 117 ? 128.055 177.140 120.976 1.00 58.14  ? 117 DA  I "O4'" 1 
ATOM 8459  C "C3'" . DA  I 5 117 ? 126.747 178.636 119.665 1.00 58.14  ? 117 DA  I "C3'" 1 
ATOM 8460  O "O3'" . DA  I 5 117 ? 127.547 179.242 118.653 1.00 58.14  ? 117 DA  I "O3'" 1 
ATOM 8461  C "C2'" . DA  I 5 117 ? 126.377 177.185 119.332 1.00 58.14  ? 117 DA  I "C2'" 1 
ATOM 8462  C "C1'" . DA  I 5 117 ? 127.576 176.420 119.863 1.00 58.14  ? 117 DA  I "C1'" 1 
ATOM 8463  N N9    . DA  I 5 117 ? 127.263 175.080 120.326 1.00 58.14  ? 117 DA  I N9    1 
ATOM 8464  C C8    . DA  I 5 117 ? 126.207 174.694 121.096 1.00 58.14  ? 117 DA  I C8    1 
ATOM 8465  N N7    . DA  I 5 117 ? 126.206 173.418 121.384 1.00 58.14  ? 117 DA  I N7    1 
ATOM 8466  C C5    . DA  I 5 117 ? 127.346 172.946 120.768 1.00 58.14  ? 117 DA  I C5    1 
ATOM 8467  C C6    . DA  I 5 117 ? 127.920 171.676 120.690 1.00 58.14  ? 117 DA  I C6    1 
ATOM 8468  N N6    . DA  I 5 117 ? 127.389 170.600 121.269 1.00 58.14  ? 117 DA  I N6    1 
ATOM 8469  N N1    . DA  I 5 117 ? 129.066 171.547 119.992 1.00 58.14  ? 117 DA  I N1    1 
ATOM 8470  C C2    . DA  I 5 117 ? 129.593 172.624 119.420 1.00 58.14  ? 117 DA  I C2    1 
ATOM 8471  N N3    . DA  I 5 117 ? 129.144 173.866 119.426 1.00 58.14  ? 117 DA  I N3    1 
ATOM 8472  C C4    . DA  I 5 117 ? 128.010 173.959 120.123 1.00 58.14  ? 117 DA  I C4    1 
ATOM 8473  P P     . DT  I 5 118 ? 126.987 179.475 117.167 1.00 55.76  ? 118 DT  I P     1 
ATOM 8474  O OP1   . DT  I 5 118 ? 127.683 180.662 116.638 1.00 55.76  ? 118 DT  I OP1   1 
ATOM 8475  O OP2   . DT  I 5 118 ? 125.511 179.430 117.168 1.00 55.76  ? 118 DT  I OP2   1 
ATOM 8476  O "O5'" . DT  I 5 118 ? 127.547 178.223 116.364 1.00 55.76  ? 118 DT  I "O5'" 1 
ATOM 8477  C "C5'" . DT  I 5 118 ? 128.945 177.960 116.369 1.00 55.76  ? 118 DT  I "C5'" 1 
ATOM 8478  C "C4'" . DT  I 5 118 ? 129.310 176.834 115.416 1.00 55.76  ? 118 DT  I "C4'" 1 
ATOM 8479  O "O4'" . DT  I 5 118 ? 129.045 175.552 116.030 1.00 55.76  ? 118 DT  I "O4'" 1 
ATOM 8480  C "C3'" . DT  I 5 118 ? 128.567 176.823 114.085 1.00 55.76  ? 118 DT  I "C3'" 1 
ATOM 8481  O "O3'" . DT  I 5 118 ? 129.470 176.443 113.080 1.00 55.76  ? 118 DT  I "O3'" 1 
ATOM 8482  C "C2'" . DT  I 5 118 ? 127.496 175.752 114.303 1.00 55.76  ? 118 DT  I "C2'" 1 
ATOM 8483  C "C1'" . DT  I 5 118 ? 128.260 174.767 115.164 1.00 55.76  ? 118 DT  I "C1'" 1 
ATOM 8484  N N1    . DT  I 5 118 ? 127.415 173.896 115.998 1.00 55.76  ? 118 DT  I N1    1 
ATOM 8485  C C2    . DT  I 5 118 ? 127.859 172.640 116.291 1.00 55.76  ? 118 DT  I C2    1 
ATOM 8486  O O2    . DT  I 5 118 ? 128.908 172.195 115.873 1.00 55.76  ? 118 DT  I O2    1 
ATOM 8487  N N3    . DT  I 5 118 ? 127.027 171.909 117.080 1.00 55.76  ? 118 DT  I N3    1 
ATOM 8488  C C4    . DT  I 5 118 ? 125.822 172.311 117.607 1.00 55.76  ? 118 DT  I C4    1 
ATOM 8489  O O4    . DT  I 5 118 ? 125.145 171.584 118.314 1.00 55.76  ? 118 DT  I O4    1 
ATOM 8490  C C5    . DT  I 5 118 ? 125.421 173.645 117.272 1.00 55.76  ? 118 DT  I C5    1 
ATOM 8491  C C7    . DT  I 5 118 ? 124.131 174.186 117.790 1.00 55.76  ? 118 DT  I C7    1 
ATOM 8492  C C6    . DT  I 5 118 ? 126.227 174.370 116.494 1.00 55.76  ? 118 DT  I C6    1 
ATOM 8493  P P     . DT  I 5 119 ? 129.292 176.958 111.574 1.00 53.58  ? 119 DT  I P     1 
ATOM 8494  O OP1   . DT  I 5 119 ? 130.188 178.116 111.396 1.00 53.58  ? 119 DT  I OP1   1 
ATOM 8495  O OP2   . DT  I 5 119 ? 127.848 177.084 111.285 1.00 53.58  ? 119 DT  I OP2   1 
ATOM 8496  O "O5'" . DT  I 5 119 ? 129.861 175.742 110.722 1.00 53.58  ? 119 DT  I "O5'" 1 
ATOM 8497  C "C5'" . DT  I 5 119 ? 130.761 174.828 111.334 1.00 53.58  ? 119 DT  I "C5'" 1 
ATOM 8498  C "C4'" . DT  I 5 119 ? 130.415 173.387 110.996 1.00 53.58  ? 119 DT  I "C4'" 1 
ATOM 8499  O "O4'" . DT  I 5 119 ? 129.462 172.867 111.956 1.00 53.58  ? 119 DT  I "O4'" 1 
ATOM 8500  C "C3'" . DT  I 5 119 ? 129.781 173.165 109.621 1.00 53.58  ? 119 DT  I "C3'" 1 
ATOM 8501  O "O3'" . DT  I 5 119 ? 130.305 171.984 109.053 1.00 53.58  ? 119 DT  I "O3'" 1 
ATOM 8502  C "C2'" . DT  I 5 119 ? 128.312 172.984 109.972 1.00 53.58  ? 119 DT  I "C2'" 1 
ATOM 8503  C "C1'" . DT  I 5 119 ? 128.459 172.195 111.251 1.00 53.58  ? 119 DT  I "C1'" 1 
ATOM 8504  N N1    . DT  I 5 119 ? 127.241 172.133 112.079 1.00 53.58  ? 119 DT  I N1    1 
ATOM 8505  C C2    . DT  I 5 119 ? 127.058 171.056 112.897 1.00 53.58  ? 119 DT  I C2    1 
ATOM 8506  O O2    . DT  I 5 119 ? 127.857 170.148 112.982 1.00 53.58  ? 119 DT  I O2    1 
ATOM 8507  N N3    . DT  I 5 119 ? 125.902 171.074 113.617 1.00 53.58  ? 119 DT  I N3    1 
ATOM 8508  C C4    . DT  I 5 119 ? 124.933 172.045 113.599 1.00 53.58  ? 119 DT  I C4    1 
ATOM 8509  O O4    . DT  I 5 119 ? 123.928 171.976 114.287 1.00 53.58  ? 119 DT  I O4    1 
ATOM 8510  C C5    . DT  I 5 119 ? 125.183 173.147 112.715 1.00 53.58  ? 119 DT  I C5    1 
ATOM 8511  C C7    . DT  I 5 119 ? 124.196 174.264 112.612 1.00 53.58  ? 119 DT  I C7    1 
ATOM 8512  C C6    . DT  I 5 119 ? 126.310 173.138 112.001 1.00 53.58  ? 119 DT  I C6    1 
ATOM 8513  P P     . DG  I 5 120 ? 131.553 172.036 108.048 1.00 50.74  ? 120 DG  I P     1 
ATOM 8514  O OP1   . DG  I 5 120 ? 132.737 172.524 108.788 1.00 50.74  ? 120 DG  I OP1   1 
ATOM 8515  O OP2   . DG  I 5 120 ? 131.086 172.706 106.819 1.00 50.74  ? 120 DG  I OP2   1 
ATOM 8516  O "O5'" . DG  I 5 120 ? 131.820 170.503 107.687 1.00 50.74  ? 120 DG  I "O5'" 1 
ATOM 8517  C "C5'" . DG  I 5 120 ? 132.210 169.577 108.706 1.00 50.74  ? 120 DG  I "C5'" 1 
ATOM 8518  C "C4'" . DG  I 5 120 ? 131.376 168.296 108.676 1.00 50.74  ? 120 DG  I "C4'" 1 
ATOM 8519  O "O4'" . DG  I 5 120 ? 130.077 168.530 109.263 1.00 50.74  ? 120 DG  I "O4'" 1 
ATOM 8520  C "C3'" . DG  I 5 120 ? 131.098 167.691 107.304 1.00 50.74  ? 120 DG  I "C3'" 1 
ATOM 8521  O "O3'" . DG  I 5 120 ? 131.026 166.290 107.435 1.00 50.74  ? 120 DG  I "O3'" 1 
ATOM 8522  C "C2'" . DG  I 5 120 ? 129.714 168.246 106.996 1.00 50.74  ? 120 DG  I "C2'" 1 
ATOM 8523  C "C1'" . DG  I 5 120 ? 129.083 168.116 108.361 1.00 50.74  ? 120 DG  I "C1'" 1 
ATOM 8524  N N9    . DG  I 5 120 ? 127.923 168.953 108.566 1.00 50.74  ? 120 DG  I N9    1 
ATOM 8525  C C8    . DG  I 5 120 ? 127.651 170.149 107.976 1.00 50.74  ? 120 DG  I C8    1 
ATOM 8526  N N7    . DG  I 5 120 ? 126.532 170.675 108.377 1.00 50.74  ? 120 DG  I N7    1 
ATOM 8527  C C5    . DG  I 5 120 ? 126.046 169.771 109.297 1.00 50.74  ? 120 DG  I C5    1 
ATOM 8528  C C6    . DG  I 5 120 ? 124.870 169.800 110.066 1.00 50.74  ? 120 DG  I C6    1 
ATOM 8529  O O6    . DG  I 5 120 ? 123.991 170.664 110.100 1.00 50.74  ? 120 DG  I O6    1 
ATOM 8530  N N1    . DG  I 5 120 ? 124.760 168.682 110.866 1.00 50.74  ? 120 DG  I N1    1 
ATOM 8531  C C2    . DG  I 5 120 ? 125.670 167.670 110.921 1.00 50.74  ? 120 DG  I C2    1 
ATOM 8532  N N2    . DG  I 5 120 ? 125.389 166.666 111.748 1.00 50.74  ? 120 DG  I N2    1 
ATOM 8533  N N3    . DG  I 5 120 ? 126.772 167.632 110.210 1.00 50.74  ? 120 DG  I N3    1 
ATOM 8534  C C4    . DG  I 5 120 ? 126.893 168.710 109.424 1.00 50.74  ? 120 DG  I C4    1 
ATOM 8535  P P     . DA  I 5 121 ? 132.235 165.335 107.003 1.00 47.63  ? 121 DA  I P     1 
ATOM 8536  O OP1   . DA  I 5 121 ? 133.498 165.971 107.408 1.00 47.63  ? 121 DA  I OP1   1 
ATOM 8537  O OP2   . DA  I 5 121 ? 132.021 164.950 105.597 1.00 47.63  ? 121 DA  I OP2   1 
ATOM 8538  O "O5'" . DA  I 5 121 ? 131.995 164.036 107.899 1.00 47.63  ? 121 DA  I "O5'" 1 
ATOM 8539  C "C5'" . DA  I 5 121 ? 131.427 164.184 109.194 1.00 47.63  ? 121 DA  I "C5'" 1 
ATOM 8540  C "C4'" . DA  I 5 121 ? 130.507 163.030 109.585 1.00 47.63  ? 121 DA  I "C4'" 1 
ATOM 8541  O "O4'" . DA  I 5 121 ? 129.131 163.466 109.632 1.00 47.63  ? 121 DA  I "O4'" 1 
ATOM 8542  C "C3'" . DA  I 5 121 ? 130.487 161.813 108.699 1.00 47.63  ? 121 DA  I "C3'" 1 
ATOM 8543  O "O3'" . DA  I 5 121 ? 130.077 160.730 109.508 1.00 47.63  ? 121 DA  I "O3'" 1 
ATOM 8544  C "C2'" . DA  I 5 121 ? 129.406 162.180 107.684 1.00 47.63  ? 121 DA  I "C2'" 1 
ATOM 8545  C "C1'" . DA  I 5 121 ? 128.406 162.930 108.543 1.00 47.63  ? 121 DA  I "C1'" 1 
ATOM 8546  N N9    . DA  I 5 121 ? 127.789 164.049 107.868 1.00 47.63  ? 121 DA  I N9    1 
ATOM 8547  C C8    . DA  I 5 121 ? 128.324 164.788 106.864 1.00 47.63  ? 121 DA  I C8    1 
ATOM 8548  N N7    . DA  I 5 121 ? 127.558 165.763 106.467 1.00 47.63  ? 121 DA  I N7    1 
ATOM 8549  C C5    . DA  I 5 121 ? 126.457 165.670 107.283 1.00 47.63  ? 121 DA  I C5    1 
ATOM 8550  C C6    . DA  I 5 121 ? 125.283 166.420 107.363 1.00 47.63  ? 121 DA  I C6    1 
ATOM 8551  N N6    . DA  I 5 121 ? 125.030 167.465 106.581 1.00 47.63  ? 121 DA  I N6    1 
ATOM 8552  N N1    . DA  I 5 121 ? 124.374 166.061 108.284 1.00 47.63  ? 121 DA  I N1    1 
ATOM 8553  C C2    . DA  I 5 121 ? 124.626 165.012 109.067 1.00 47.63  ? 121 DA  I C2    1 
ATOM 8554  N N3    . DA  I 5 121 ? 125.701 164.237 109.087 1.00 47.63  ? 121 DA  I N3    1 
ATOM 8555  C C4    . DA  I 5 121 ? 126.585 164.624 108.159 1.00 47.63  ? 121 DA  I C4    1 
ATOM 8556  P P     . DG  I 5 122 ? 130.138 159.213 109.009 1.00 44.13  ? 122 DG  I P     1 
ATOM 8557  O OP1   . DG  I 5 122 ? 130.858 158.491 110.063 1.00 44.13  ? 122 DG  I OP1   1 
ATOM 8558  O OP2   . DG  I 5 122 ? 130.602 159.129 107.613 1.00 44.13  ? 122 DG  I OP2   1 
ATOM 8559  O "O5'" . DG  I 5 122 ? 128.615 158.766 109.048 1.00 44.13  ? 122 DG  I "O5'" 1 
ATOM 8560  C "C5'" . DG  I 5 122 ? 127.839 159.015 110.198 1.00 44.13  ? 122 DG  I "C5'" 1 
ATOM 8561  C "C4'" . DG  I 5 122 ? 126.344 158.950 109.906 1.00 44.13  ? 122 DG  I "C4'" 1 
ATOM 8562  O "O4'" . DG  I 5 122 ? 125.922 160.138 109.205 1.00 44.13  ? 122 DG  I "O4'" 1 
ATOM 8563  C "C3'" . DG  I 5 122 ? 125.861 157.780 109.058 1.00 44.13  ? 122 DG  I "C3'" 1 
ATOM 8564  O "O3'" . DG  I 5 122 ? 124.597 157.386 109.524 1.00 44.13  ? 122 DG  I "O3'" 1 
ATOM 8565  C "C2'" . DG  I 5 122 ? 125.742 158.413 107.683 1.00 44.13  ? 122 DG  I "C2'" 1 
ATOM 8566  C "C1'" . DG  I 5 122 ? 125.201 159.769 108.062 1.00 44.13  ? 122 DG  I "C1'" 1 
ATOM 8567  N N9    . DG  I 5 122 ? 125.400 160.794 107.057 1.00 44.13  ? 122 DG  I N9    1 
ATOM 8568  C C8    . DG  I 5 122 ? 126.476 160.943 106.238 1.00 44.13  ? 122 DG  I C8    1 
ATOM 8569  N N7    . DG  I 5 122 ? 126.388 161.972 105.453 1.00 44.13  ? 122 DG  I N7    1 
ATOM 8570  C C5    . DG  I 5 122 ? 125.173 162.540 105.777 1.00 44.13  ? 122 DG  I C5    1 
ATOM 8571  C C6    . DG  I 5 122 ? 124.537 163.680 105.257 1.00 44.13  ? 122 DG  I C6    1 
ATOM 8572  O O6    . DG  I 5 122 ? 124.936 164.443 104.375 1.00 44.13  ? 122 DG  I O6    1 
ATOM 8573  N N1    . DG  I 5 122 ? 123.318 163.909 105.865 1.00 44.13  ? 122 DG  I N1    1 
ATOM 8574  C C2    . DG  I 5 122 ? 122.780 163.132 106.847 1.00 44.13  ? 122 DG  I C2    1 
ATOM 8575  N N2    . DG  I 5 122 ? 121.588 163.504 107.313 1.00 44.13  ? 122 DG  I N2    1 
ATOM 8576  N N3    . DG  I 5 122 ? 123.367 162.068 107.347 1.00 44.13  ? 122 DG  I N3    1 
ATOM 8577  C C4    . DG  I 5 122 ? 124.557 161.831 106.765 1.00 44.13  ? 122 DG  I C4    1 
ATOM 8578  P P     . DC  I 5 123 ? 124.111 155.866 109.440 1.00 44.05  ? 123 DC  I P     1 
ATOM 8579  O OP1   . DC  I 5 123 ? 124.538 155.207 110.675 1.00 44.05  ? 123 DC  I OP1   1 
ATOM 8580  O OP2   . DC  I 5 123 ? 124.484 155.316 108.137 1.00 44.05  ? 123 DC  I OP2   1 
ATOM 8581  O "O5'" . DC  I 5 123 ? 122.529 155.984 109.437 1.00 44.05  ? 123 DC  I "O5'" 1 
ATOM 8582  C "C5'" . DC  I 5 123 ? 121.904 157.053 110.114 1.00 44.05  ? 123 DC  I "C5'" 1 
ATOM 8583  C "C4'" . DC  I 5 123 ? 120.698 157.551 109.344 1.00 44.05  ? 123 DC  I "C4'" 1 
ATOM 8584  O "O4'" . DC  I 5 123 ? 121.094 158.633 108.460 1.00 44.05  ? 123 DC  I "O4'" 1 
ATOM 8585  C "C3'" . DC  I 5 123 ? 120.027 156.503 108.465 1.00 44.05  ? 123 DC  I "C3'" 1 
ATOM 8586  O "O3'" . DC  I 5 123 ? 118.624 156.546 108.626 1.00 44.05  ? 123 DC  I "O3'" 1 
ATOM 8587  C "C2'" . DC  I 5 123 ? 120.441 156.924 107.066 1.00 44.05  ? 123 DC  I "C2'" 1 
ATOM 8588  C "C1'" . DC  I 5 123 ? 120.529 158.425 107.197 1.00 44.05  ? 123 DC  I "C1'" 1 
ATOM 8589  N N1    . DC  I 5 123 ? 121.410 159.026 106.174 1.00 44.05  ? 123 DC  I N1    1 
ATOM 8590  C C2    . DC  I 5 123 ? 121.000 160.145 105.457 1.00 44.05  ? 123 DC  I C2    1 
ATOM 8591  O O2    . DC  I 5 123 ? 119.903 160.646 105.696 1.00 44.05  ? 123 DC  I O2    1 
ATOM 8592  N N3    . DC  I 5 123 ? 121.826 160.656 104.518 1.00 44.05  ? 123 DC  I N3    1 
ATOM 8593  C C4    . DC  I 5 123 ? 122.996 160.089 104.287 1.00 44.05  ? 123 DC  I C4    1 
ATOM 8594  N N4    . DC  I 5 123 ? 123.781 160.623 103.356 1.00 44.05  ? 123 DC  I N4    1 
ATOM 8595  C C5    . DC  I 5 123 ? 123.423 158.948 104.998 1.00 44.05  ? 123 DC  I C5    1 
ATOM 8596  C C6    . DC  I 5 123 ? 122.605 158.453 105.917 1.00 44.05  ? 123 DC  I C6    1 
ATOM 8597  P P     . DG  I 5 124 ? 117.710 155.302 108.184 1.00 52.70  ? 124 DG  I P     1 
ATOM 8598  O OP1   . DG  I 5 124 ? 117.042 154.751 109.368 1.00 52.70  ? 124 DG  I OP1   1 
ATOM 8599  O OP2   . DG  I 5 124 ? 118.487 154.391 107.335 1.00 52.70  ? 124 DG  I OP2   1 
ATOM 8600  O "O5'" . DG  I 5 124 ? 116.594 155.968 107.279 1.00 52.70  ? 124 DG  I "O5'" 1 
ATOM 8601  C "C5'" . DG  I 5 124 ? 115.809 157.026 107.790 1.00 52.70  ? 124 DG  I "C5'" 1 
ATOM 8602  C "C4'" . DG  I 5 124 ? 115.141 157.799 106.670 1.00 52.70  ? 124 DG  I "C4'" 1 
ATOM 8603  O "O4'" . DG  I 5 124 ? 116.135 158.550 105.937 1.00 52.70  ? 124 DG  I "O4'" 1 
ATOM 8604  C "C3'" . DG  I 5 124 ? 114.396 156.954 105.644 1.00 52.70  ? 124 DG  I "C3'" 1 
ATOM 8605  O "O3'" . DG  I 5 124 ? 113.176 157.589 105.303 1.00 52.70  ? 124 DG  I "O3'" 1 
ATOM 8606  C "C2'" . DG  I 5 124 ? 115.349 156.916 104.459 1.00 52.70  ? 124 DG  I "C2'" 1 
ATOM 8607  C "C1'" . DG  I 5 124 ? 116.064 158.248 104.565 1.00 52.70  ? 124 DG  I "C1'" 1 
ATOM 8608  N N9    . DG  I 5 124 ? 117.418 158.182 104.059 1.00 52.70  ? 124 DG  I N9    1 
ATOM 8609  C C8    . DG  I 5 124 ? 118.359 157.260 104.397 1.00 52.70  ? 124 DG  I C8    1 
ATOM 8610  N N7    . DG  I 5 124 ? 119.493 157.430 103.799 1.00 52.70  ? 124 DG  I N7    1 
ATOM 8611  C C5    . DG  I 5 124 ? 119.286 158.531 102.999 1.00 52.70  ? 124 DG  I C5    1 
ATOM 8612  C C6    . DG  I 5 124 ? 120.163 159.172 102.118 1.00 52.70  ? 124 DG  I C6    1 
ATOM 8613  O O6    . DG  I 5 124 ? 121.331 158.881 101.866 1.00 52.70  ? 124 DG  I O6    1 
ATOM 8614  N N1    . DG  I 5 124 ? 119.564 160.251 101.498 1.00 52.70  ? 124 DG  I N1    1 
ATOM 8615  C C2    . DG  I 5 124 ? 118.276 160.659 101.707 1.00 52.70  ? 124 DG  I C2    1 
ATOM 8616  N N2    . DG  I 5 124 ? 117.869 161.724 101.016 1.00 52.70  ? 124 DG  I N2    1 
ATOM 8617  N N3    . DG  I 5 124 ? 117.439 160.064 102.535 1.00 52.70  ? 124 DG  I N3    1 
ATOM 8618  C C4    . DG  I 5 124 ? 118.012 159.009 103.145 1.00 52.70  ? 124 DG  I C4    1 
ATOM 8619  P P     . DG  I 5 125 ? 112.078 156.840 104.402 1.00 57.13  ? 125 DG  I P     1 
ATOM 8620  O OP1   . DG  I 5 125 ? 110.764 157.164 104.986 1.00 57.13  ? 125 DG  I OP1   1 
ATOM 8621  O OP2   . DG  I 5 125 ? 112.457 155.424 104.238 1.00 57.13  ? 125 DG  I OP2   1 
ATOM 8622  O "O5'" . DG  I 5 125 ? 112.228 157.536 102.976 1.00 57.13  ? 125 DG  I "O5'" 1 
ATOM 8623  C "C5'" . DG  I 5 125 ? 112.596 158.904 102.896 1.00 57.13  ? 125 DG  I "C5'" 1 
ATOM 8624  C "C4'" . DG  I 5 125 ? 112.721 159.379 101.454 1.00 57.13  ? 125 DG  I "C4'" 1 
ATOM 8625  O "O4'" . DG  I 5 125 ? 114.110 159.430 101.062 1.00 57.13  ? 125 DG  I "O4'" 1 
ATOM 8626  C "C3'" . DG  I 5 125 ? 112.029 158.533 100.397 1.00 57.13  ? 125 DG  I "C3'" 1 
ATOM 8627  O "O3'" . DG  I 5 125 ? 111.559 159.389 99.376  1.00 57.13  ? 125 DG  I "O3'" 1 
ATOM 8628  C "C2'" . DG  I 5 125 ? 113.156 157.644 99.891  1.00 57.13  ? 125 DG  I "C2'" 1 
ATOM 8629  C "C1'" . DG  I 5 125 ? 114.328 158.603 99.942  1.00 57.13  ? 125 DG  I "C1'" 1 
ATOM 8630  N N9    . DG  I 5 125 ? 115.608 157.947 100.128 1.00 57.13  ? 125 DG  I N9    1 
ATOM 8631  C C8    . DG  I 5 125 ? 115.895 156.940 101.004 1.00 57.13  ? 125 DG  I C8    1 
ATOM 8632  N N7    . DG  I 5 125 ? 117.134 156.560 100.965 1.00 57.13  ? 125 DG  I N7    1 
ATOM 8633  C C5    . DG  I 5 125 ? 117.703 157.372 100.005 1.00 57.13  ? 125 DG  I C5    1 
ATOM 8634  C C6    . DG  I 5 125 ? 119.023 157.416 99.526  1.00 57.13  ? 125 DG  I C6    1 
ATOM 8635  O O6    . DG  I 5 125 ? 119.983 156.726 99.877  1.00 57.13  ? 125 DG  I O6    1 
ATOM 8636  N N1    . DG  I 5 125 ? 119.185 158.387 98.548  1.00 57.13  ? 125 DG  I N1    1 
ATOM 8637  C C2    . DG  I 5 125 ? 118.191 159.206 98.089  1.00 57.13  ? 125 DG  I C2    1 
ATOM 8638  N N2    . DG  I 5 125 ? 118.529 160.083 97.138  1.00 57.13  ? 125 DG  I N2    1 
ATOM 8639  N N3    . DG  I 5 125 ? 116.944 159.172 98.530  1.00 57.13  ? 125 DG  I N3    1 
ATOM 8640  C C4    . DG  I 5 125 ? 116.777 158.233 99.483  1.00 57.13  ? 125 DG  I C4    1 
ATOM 8641  P P     . DC  I 5 126 ? 110.512 158.866 98.283  1.00 61.50  ? 126 DC  I P     1 
ATOM 8642  O OP1   . DC  I 5 126 ? 109.504 159.929 98.111  1.00 61.50  ? 126 DC  I OP1   1 
ATOM 8643  O OP2   . DC  I 5 126 ? 110.081 157.509 98.674  1.00 61.50  ? 126 DC  I OP2   1 
ATOM 8644  O "O5'" . DC  I 5 126 ? 111.387 158.736 96.953  1.00 61.50  ? 126 DC  I "O5'" 1 
ATOM 8645  C "C5'" . DC  I 5 126 ? 112.132 159.849 96.457  1.00 61.50  ? 126 DC  I "C5'" 1 
ATOM 8646  C "C4'" . DC  I 5 126 ? 112.925 159.425 95.241  1.00 61.50  ? 126 DC  I "C4'" 1 
ATOM 8647  O "O4'" . DC  I 5 126 ? 114.239 158.995 95.670  1.00 61.50  ? 126 DC  I "O4'" 1 
ATOM 8648  C "C3'" . DC  I 5 126 ? 112.300 158.237 94.509  1.00 61.50  ? 126 DC  I "C3'" 1 
ATOM 8649  O "O3'" . DC  I 5 126 ? 111.792 158.536 93.142  1.00 61.50  ? 126 DC  I "O3'" 1 
ATOM 8650  C "C2'" . DC  I 5 126 ? 113.350 157.136 94.547  1.00 61.50  ? 126 DC  I "C2'" 1 
ATOM 8651  C "C1'" . DC  I 5 126 ? 114.630 157.851 94.957  1.00 61.50  ? 126 DC  I "C1'" 1 
ATOM 8652  N N1    . DC  I 5 126 ? 115.467 156.999 95.834  1.00 61.50  ? 126 DC  I N1    1 
ATOM 8653  C C2    . DC  I 5 126 ? 116.846 156.892 95.617  1.00 61.50  ? 126 DC  I C2    1 
ATOM 8654  O O2    . DC  I 5 126 ? 117.368 157.543 94.711  1.00 61.50  ? 126 DC  I O2    1 
ATOM 8655  N N3    . DC  I 5 126 ? 117.569 156.084 96.424  1.00 61.50  ? 126 DC  I N3    1 
ATOM 8656  C C4    . DC  I 5 126 ? 116.963 155.399 97.389  1.00 61.50  ? 126 DC  I C4    1 
ATOM 8657  N N4    . DC  I 5 126 ? 117.709 154.614 98.163  1.00 61.50  ? 126 DC  I N4    1 
ATOM 8658  C C5    . DC  I 5 126 ? 115.568 155.488 97.612  1.00 61.50  ? 126 DC  I C5    1 
ATOM 8659  C C6    . DC  I 5 126 ? 114.867 156.283 96.815  1.00 61.50  ? 126 DC  I C6    1 
ATOM 8660  P P     . DC  I 5 127 ? 112.582 159.350 91.988  1.00 62.62  ? 127 DC  I P     1 
ATOM 8661  O OP1   . DC  I 5 127 ? 112.794 160.774 92.321  1.00 62.62  ? 127 DC  I OP1   1 
ATOM 8662  O OP2   . DC  I 5 127 ? 111.810 159.038 90.775  1.00 62.62  ? 127 DC  I OP2   1 
ATOM 8663  O "O5'" . DC  I 5 127 ? 113.976 158.609 91.761  1.00 62.62  ? 127 DC  I "O5'" 1 
ATOM 8664  C "C5'" . DC  I 5 127 ? 114.999 159.278 91.022  1.00 62.62  ? 127 DC  I "C5'" 1 
ATOM 8665  C "C4'" . DC  I 5 127 ? 115.975 158.307 90.373  1.00 62.62  ? 127 DC  I "C4'" 1 
ATOM 8666  O "O4'" . DC  I 5 127 ? 116.552 157.420 91.366  1.00 62.62  ? 127 DC  I "O4'" 1 
ATOM 8667  C "C3'" . DC  I 5 127 ? 115.401 157.395 89.289  1.00 62.62  ? 127 DC  I "C3'" 1 
ATOM 8668  O "O3'" . DC  I 5 127 ? 116.372 157.244 88.278  1.00 62.62  ? 127 DC  I "O3'" 1 
ATOM 8669  C "C2'" . DC  I 5 127 ? 115.215 156.088 90.045  1.00 62.62  ? 127 DC  I "C2'" 1 
ATOM 8670  C "C1'" . DC  I 5 127 ? 116.471 156.102 90.887  1.00 62.62  ? 127 DC  I "C1'" 1 
ATOM 8671  N N1    . DC  I 5 127 ? 116.445 155.197 92.046  1.00 62.62  ? 127 DC  I N1    1 
ATOM 8672  C C2    . DC  I 5 127 ? 117.633 154.643 92.500  1.00 62.62  ? 127 DC  I C2    1 
ATOM 8673  O O2    . DC  I 5 127 ? 118.676 154.921 91.907  1.00 62.62  ? 127 DC  I O2    1 
ATOM 8674  N N3    . DC  I 5 127 ? 117.608 153.828 93.574  1.00 62.62  ? 127 DC  I N3    1 
ATOM 8675  C C4    . DC  I 5 127 ? 116.453 153.568 94.179  1.00 62.62  ? 127 DC  I C4    1 
ATOM 8676  N N4    . DC  I 5 127 ? 116.466 152.759 95.234  1.00 62.62  ? 127 DC  I N4    1 
ATOM 8677  C C5    . DC  I 5 127 ? 115.232 154.127 93.732  1.00 62.62  ? 127 DC  I C5    1 
ATOM 8678  C C6    . DC  I 5 127 ? 115.275 154.923 92.665  1.00 62.62  ? 127 DC  I C6    1 
ATOM 8679  P P     . DT  I 5 128 ? 115.959 156.954 86.757  1.00 63.71  ? 128 DT  I P     1 
ATOM 8680  O OP1   . DT  I 5 128 ? 115.827 158.261 86.087  1.00 63.71  ? 128 DT  I OP1   1 
ATOM 8681  O OP2   . DT  I 5 128 ? 114.841 155.989 86.741  1.00 63.71  ? 128 DT  I OP2   1 
ATOM 8682  O "O5'" . DT  I 5 128 ? 117.252 156.228 86.170  1.00 63.71  ? 128 DT  I "O5'" 1 
ATOM 8683  C "C5'" . DT  I 5 128 ? 118.538 156.528 86.715  1.00 63.71  ? 128 DT  I "C5'" 1 
ATOM 8684  C "C4'" . DT  I 5 128 ? 119.458 155.315 86.695  1.00 63.71  ? 128 DT  I "C4'" 1 
ATOM 8685  O "O4'" . DT  I 5 128 ? 119.328 154.567 87.933  1.00 63.71  ? 128 DT  I "O4'" 1 
ATOM 8686  C "C3'" . DT  I 5 128 ? 119.206 154.309 85.576  1.00 63.71  ? 128 DT  I "C3'" 1 
ATOM 8687  O "O3'" . DT  I 5 128 ? 120.448 153.812 85.112  1.00 63.71  ? 128 DT  I "O3'" 1 
ATOM 8688  C "C2'" . DT  I 5 128 ? 118.417 153.222 86.292  1.00 63.71  ? 128 DT  I "C2'" 1 
ATOM 8689  C "C1'" . DT  I 5 128 ? 119.123 153.208 87.629  1.00 63.71  ? 128 DT  I "C1'" 1 
ATOM 8690  N N1    . DT  I 5 128 ? 118.340 152.591 88.733  1.00 63.71  ? 128 DT  I N1    1 
ATOM 8691  C C2    . DT  I 5 128 ? 118.998 151.866 89.701  1.00 63.71  ? 128 DT  I C2    1 
ATOM 8692  O O2    . DT  I 5 128 ? 120.197 151.684 89.698  1.00 63.71  ? 128 DT  I O2    1 
ATOM 8693  N N3    . DT  I 5 128 ? 118.192 151.357 90.675  1.00 63.71  ? 128 DT  I N3    1 
ATOM 8694  C C4    . DT  I 5 128 ? 116.832 151.496 90.784  1.00 63.71  ? 128 DT  I C4    1 
ATOM 8695  O O4    . DT  I 5 128 ? 116.195 151.000 91.701  1.00 63.71  ? 128 DT  I O4    1 
ATOM 8696  C C5    . DT  I 5 128 ? 116.203 152.266 89.744  1.00 63.71  ? 128 DT  I C5    1 
ATOM 8697  C C7    . DT  I 5 128 ? 114.719 152.475 89.765  1.00 63.71  ? 128 DT  I C7    1 
ATOM 8698  C C6    . DT  I 5 128 ? 116.978 152.772 88.778  1.00 63.71  ? 128 DT  I C6    1 
ATOM 8699  P P     . DC  I 5 129 ? 120.669 153.469 83.560  1.00 66.65  ? 129 DC  I P     1 
ATOM 8700  O OP1   . DC  I 5 129 ? 120.878 154.742 82.836  1.00 66.65  ? 129 DC  I OP1   1 
ATOM 8701  O OP2   . DC  I 5 129 ? 119.589 152.554 83.151  1.00 66.65  ? 129 DC  I OP2   1 
ATOM 8702  O "O5'" . DC  I 5 129 ? 122.035 152.637 83.552  1.00 66.65  ? 129 DC  I "O5'" 1 
ATOM 8703  C "C5'" . DC  I 5 129 ? 122.802 152.510 84.756  1.00 66.65  ? 129 DC  I "C5'" 1 
ATOM 8704  C "C4'" . DC  I 5 129 ? 123.095 151.050 85.115  1.00 66.65  ? 129 DC  I "C4'" 1 
ATOM 8705  O "O4'" . DC  I 5 129 ? 122.099 150.548 86.039  1.00 66.65  ? 129 DC  I "O4'" 1 
ATOM 8706  C "C3'" . DC  I 5 129 ? 123.121 150.048 83.966  1.00 66.65  ? 129 DC  I "C3'" 1 
ATOM 8707  O "O3'" . DC  I 5 129 ? 124.044 149.023 84.280  1.00 66.65  ? 129 DC  I "O3'" 1 
ATOM 8708  C "C2'" . DC  I 5 129 ? 121.701 149.494 84.010  1.00 66.65  ? 129 DC  I "C2'" 1 
ATOM 8709  C "C1'" . DC  I 5 129 ? 121.525 149.374 85.509  1.00 66.65  ? 129 DC  I "C1'" 1 
ATOM 8710  N N1    . DC  I 5 129 ? 120.132 149.317 85.972  1.00 66.65  ? 129 DC  I N1    1 
ATOM 8711  C C2    . DC  I 5 129 ? 119.861 148.740 87.205  1.00 66.65  ? 129 DC  I C2    1 
ATOM 8712  O O2    . DC  I 5 129 ? 120.794 148.267 87.856  1.00 66.65  ? 129 DC  I O2    1 
ATOM 8713  N N3    . DC  I 5 129 ? 118.588 148.708 87.646  1.00 66.65  ? 129 DC  I N3    1 
ATOM 8714  C C4    . DC  I 5 129 ? 117.619 149.235 86.910  1.00 66.65  ? 129 DC  I C4    1 
ATOM 8715  N N4    . DC  I 5 129 ? 116.378 149.192 87.395  1.00 66.65  ? 129 DC  I N4    1 
ATOM 8716  C C5    . DC  I 5 129 ? 117.875 149.831 85.651  1.00 66.65  ? 129 DC  I C5    1 
ATOM 8717  C C6    . DC  I 5 129 ? 119.137 149.861 85.228  1.00 66.65  ? 129 DC  I C6    1 
ATOM 8718  P P     . DG  I 5 130 ? 125.572 149.092 83.797  1.00 68.62  ? 130 DG  I P     1 
ATOM 8719  O OP1   . DG  I 5 130 ? 126.203 150.292 84.374  1.00 68.62  ? 130 DG  I OP1   1 
ATOM 8720  O OP2   . DG  I 5 130 ? 125.577 148.886 82.339  1.00 68.62  ? 130 DG  I OP2   1 
ATOM 8721  O "O5'" . DG  I 5 130 ? 126.237 147.803 84.474  1.00 68.62  ? 130 DG  I "O5'" 1 
ATOM 8722  C "C5'" . DG  I 5 130 ? 126.310 147.693 85.906  1.00 68.62  ? 130 DG  I "C5'" 1 
ATOM 8723  C "C4'" . DG  I 5 130 ? 125.919 146.299 86.415  1.00 68.62  ? 130 DG  I "C4'" 1 
ATOM 8724  O "O4'" . DG  I 5 130 ? 124.481 146.198 86.555  1.00 68.62  ? 130 DG  I "O4'" 1 
ATOM 8725  C "C3'" . DG  I 5 130 ? 126.331 145.104 85.558  1.00 68.62  ? 130 DG  I "C3'" 1 
ATOM 8726  O "O3'" . DG  I 5 130 ? 126.586 143.996 86.408  1.00 68.62  ? 130 DG  I "O3'" 1 
ATOM 8727  C "C2'" . DG  I 5 130 ? 125.064 144.854 84.749  1.00 68.62  ? 130 DG  I "C2'" 1 
ATOM 8728  C "C1'" . DG  I 5 130 ? 124.017 145.086 85.823  1.00 68.62  ? 130 DG  I "C1'" 1 
ATOM 8729  N N9    . DG  I 5 130 ? 122.700 145.417 85.322  1.00 68.62  ? 130 DG  I N9    1 
ATOM 8730  C C8    . DG  I 5 130 ? 122.393 146.009 84.129  1.00 68.62  ? 130 DG  I C8    1 
ATOM 8731  N N7    . DG  I 5 130 ? 121.119 146.214 83.968  1.00 68.62  ? 130 DG  I N7    1 
ATOM 8732  C C5    . DG  I 5 130 ? 120.551 145.740 85.136  1.00 68.62  ? 130 DG  I C5    1 
ATOM 8733  C C6    . DG  I 5 130 ? 119.200 145.696 85.538  1.00 68.62  ? 130 DG  I C6    1 
ATOM 8734  O O6    . DG  I 5 130 ? 118.203 146.086 84.928  1.00 68.62  ? 130 DG  I O6    1 
ATOM 8735  N N1    . DG  I 5 130 ? 119.059 145.132 86.798  1.00 68.62  ? 130 DG  I N1    1 
ATOM 8736  C C2    . DG  I 5 130 ? 120.090 144.669 87.569  1.00 68.62  ? 130 DG  I C2    1 
ATOM 8737  N N2    . DG  I 5 130 ? 119.758 144.152 88.755  1.00 68.62  ? 130 DG  I N2    1 
ATOM 8738  N N3    . DG  I 5 130 ? 121.358 144.705 87.203  1.00 68.62  ? 130 DG  I N3    1 
ATOM 8739  C C4    . DG  I 5 130 ? 121.513 145.253 85.981  1.00 68.62  ? 130 DG  I C4    1 
ATOM 8740  P P     . DG  I 5 131 ? 128.073 143.609 86.871  1.00 66.45  ? 131 DG  I P     1 
ATOM 8741  O OP1   . DG  I 5 131 ? 128.668 144.791 87.518  1.00 66.45  ? 131 DG  I OP1   1 
ATOM 8742  O OP2   . DG  I 5 131 ? 128.764 142.956 85.742  1.00 66.45  ? 131 DG  I OP2   1 
ATOM 8743  O "O5'" . DG  I 5 131 ? 127.839 142.487 87.984  1.00 66.45  ? 131 DG  I "O5'" 1 
ATOM 8744  C "C5'" . DG  I 5 131 ? 127.358 142.850 89.273  1.00 66.45  ? 131 DG  I "C5'" 1 
ATOM 8745  C "C4'" . DG  I 5 131 ? 126.558 141.730 89.944  1.00 66.45  ? 131 DG  I "C4'" 1 
ATOM 8746  O "O4'" . DG  I 5 131 ? 125.191 141.724 89.479  1.00 66.45  ? 131 DG  I "O4'" 1 
ATOM 8747  C "C3'" . DG  I 5 131 ? 127.063 140.314 89.767  1.00 66.45  ? 131 DG  I "C3'" 1 
ATOM 8748  O "O3'" . DG  I 5 131 ? 126.819 139.601 90.976  1.00 66.45  ? 131 DG  I "O3'" 1 
ATOM 8749  C "C2'" . DG  I 5 131 ? 126.216 139.789 88.605  1.00 66.45  ? 131 DG  I "C2'" 1 
ATOM 8750  C "C1'" . DG  I 5 131 ? 124.907 140.546 88.759  1.00 66.45  ? 131 DG  I "C1'" 1 
ATOM 8751  N N9    . DG  I 5 131 ? 124.325 140.970 87.498  1.00 66.45  ? 131 DG  I N9    1 
ATOM 8752  C C8    . DG  I 5 131 ? 124.995 141.317 86.361  1.00 66.45  ? 131 DG  I C8    1 
ATOM 8753  N N7    . DG  I 5 131 ? 124.216 141.696 85.397  1.00 66.45  ? 131 DG  I N7    1 
ATOM 8754  C C5    . DG  I 5 131 ? 122.948 141.612 85.935  1.00 66.45  ? 131 DG  I C5    1 
ATOM 8755  C C6    . DG  I 5 131 ? 121.702 141.901 85.355  1.00 66.45  ? 131 DG  I C6    1 
ATOM 8756  O O6    . DG  I 5 131 ? 121.463 142.306 84.214  1.00 66.45  ? 131 DG  I O6    1 
ATOM 8757  N N1    . DG  I 5 131 ? 120.661 141.681 86.239  1.00 66.45  ? 131 DG  I N1    1 
ATOM 8758  C C2    . DG  I 5 131 ? 120.805 141.234 87.524  1.00 66.45  ? 131 DG  I C2    1 
ATOM 8759  N N2    . DG  I 5 131 ? 119.680 141.075 88.229  1.00 66.45  ? 131 DG  I N2    1 
ATOM 8760  N N3    . DG  I 5 131 ? 121.971 140.964 88.081  1.00 66.45  ? 131 DG  I N3    1 
ATOM 8761  C C4    . DG  I 5 131 ? 122.995 141.172 87.228  1.00 66.45  ? 131 DG  I C4    1 
ATOM 8762  P P     . DC  I 5 132 ? 127.133 138.036 91.122  1.00 66.71  ? 132 DC  I P     1 
ATOM 8763  O OP1   . DC  I 5 132 ? 127.495 137.814 92.520  1.00 66.71  ? 132 DC  I OP1   1 
ATOM 8764  O OP2   . DC  I 5 132 ? 128.052 137.576 90.065  1.00 66.71  ? 132 DC  I OP2   1 
ATOM 8765  O "O5'" . DC  I 5 132 ? 125.711 137.362 90.939  1.00 66.71  ? 132 DC  I "O5'" 1 
ATOM 8766  C "C5'" . DC  I 5 132 ? 124.605 137.870 91.658  1.00 66.71  ? 132 DC  I "C5'" 1 
ATOM 8767  C "C4'" . DC  I 5 132 ? 123.295 137.267 91.176  1.00 66.71  ? 132 DC  I "C4'" 1 
ATOM 8768  O "O4'" . DC  I 5 132 ? 122.885 137.877 89.929  1.00 66.71  ? 132 DC  I "O4'" 1 
ATOM 8769  C "C3'" . DC  I 5 132 ? 123.323 135.768 90.913  1.00 66.71  ? 132 DC  I "C3'" 1 
ATOM 8770  O "O3'" . DC  I 5 132 ? 122.114 135.202 91.356  1.00 66.71  ? 132 DC  I "O3'" 1 
ATOM 8771  C "C2'" . DC  I 5 132 ? 123.423 135.708 89.399  1.00 66.71  ? 132 DC  I "C2'" 1 
ATOM 8772  C "C1'" . DC  I 5 132 ? 122.527 136.863 89.029  1.00 66.71  ? 132 DC  I "C1'" 1 
ATOM 8773  N N1    . DC  I 5 132 ? 122.728 137.354 87.648  1.00 66.71  ? 132 DC  I N1    1 
ATOM 8774  C C2    . DC  I 5 132 ? 121.629 137.713 86.875  1.00 66.71  ? 132 DC  I C2    1 
ATOM 8775  O O2    . DC  I 5 132 ? 120.504 137.621 87.357  1.00 66.71  ? 132 DC  I O2    1 
ATOM 8776  N N3    . DC  I 5 132 ? 121.832 138.159 85.619  1.00 66.71  ? 132 DC  I N3    1 
ATOM 8777  C C4    . DC  I 5 132 ? 123.064 138.244 85.138  1.00 66.71  ? 132 DC  I C4    1 
ATOM 8778  N N4    . DC  I 5 132 ? 123.223 138.689 83.889  1.00 66.71  ? 132 DC  I N4    1 
ATOM 8779  C C5    . DC  I 5 132 ? 124.196 137.879 85.911  1.00 66.71  ? 132 DC  I C5    1 
ATOM 8780  C C6    . DC  I 5 132 ? 123.981 137.436 87.145  1.00 66.71  ? 132 DC  I C6    1 
ATOM 8781  P P     . DA  I 5 133 ? 122.094 133.774 92.088  1.00 83.26  ? 133 DA  I P     1 
ATOM 8782  O OP1   . DA  I 5 133 ? 122.534 133.979 93.483  1.00 83.26  ? 133 DA  I OP1   1 
ATOM 8783  O OP2   . DA  I 5 133 ? 122.817 132.807 91.239  1.00 83.26  ? 133 DA  I OP2   1 
ATOM 8784  O "O5'" . DA  I 5 133 ? 120.543 133.394 92.083  1.00 83.26  ? 133 DA  I "O5'" 1 
ATOM 8785  C "C5'" . DA  I 5 133 ? 119.568 134.430 91.973  1.00 83.26  ? 133 DA  I "C5'" 1 
ATOM 8786  C "C4'" . DA  I 5 133 ? 118.419 134.026 91.054  1.00 83.26  ? 133 DA  I "C4'" 1 
ATOM 8787  O "O4'" . DA  I 5 133 ? 118.599 134.610 89.736  1.00 83.26  ? 133 DA  I "O4'" 1 
ATOM 8788  C "C3'" . DA  I 5 133 ? 118.251 132.530 90.836  1.00 83.26  ? 133 DA  I "C3'" 1 
ATOM 8789  O "O3'" . DA  I 5 133 ? 116.868 132.213 90.820  1.00 83.26  ? 133 DA  I "O3'" 1 
ATOM 8790  C "C2'" . DA  I 5 133 ? 118.905 132.306 89.474  1.00 83.26  ? 133 DA  I "C2'" 1 
ATOM 8791  C "C1'" . DA  I 5 133 ? 118.588 133.600 88.749  1.00 83.26  ? 133 DA  I "C1'" 1 
ATOM 8792  N N9    . DA  I 5 133 ? 119.595 133.939 87.759  1.00 83.26  ? 133 DA  I N9    1 
ATOM 8793  C C8    . DA  I 5 133 ? 120.931 133.864 87.929  1.00 83.26  ? 133 DA  I C8    1 
ATOM 8794  N N7    . DA  I 5 133 ? 121.623 134.237 86.890  1.00 83.26  ? 133 DA  I N7    1 
ATOM 8795  C C5    . DA  I 5 133 ? 120.668 134.573 85.963  1.00 83.26  ? 133 DA  I C5    1 
ATOM 8796  C C6    . DA  I 5 133 ? 120.764 135.040 84.650  1.00 83.26  ? 133 DA  I C6    1 
ATOM 8797  N N6    . DA  I 5 133 ? 121.928 135.252 84.042  1.00 83.26  ? 133 DA  I N6    1 
ATOM 8798  N N1    . DA  I 5 133 ? 119.625 135.280 83.982  1.00 83.26  ? 133 DA  I N1    1 
ATOM 8799  C C2    . DA  I 5 133 ? 118.459 135.057 84.597  1.00 83.26  ? 133 DA  I C2    1 
ATOM 8800  N N3    . DA  I 5 133 ? 118.243 134.623 85.841  1.00 83.26  ? 133 DA  I N3    1 
ATOM 8801  C C4    . DA  I 5 133 ? 119.405 134.397 86.474  1.00 83.26  ? 133 DA  I C4    1 
ATOM 8802  P P     . DC  I 5 134 ? 116.359 130.711 90.572  1.00 93.83  ? 134 DC  I P     1 
ATOM 8803  O OP1   . DC  I 5 134 ? 115.073 130.594 91.287  1.00 93.83  ? 134 DC  I OP1   1 
ATOM 8804  O OP2   . DC  I 5 134 ? 117.447 129.753 90.872  1.00 93.83  ? 134 DC  I OP2   1 
ATOM 8805  O "O5'" . DC  I 5 134 ? 116.053 130.678 89.007  1.00 93.83  ? 134 DC  I "O5'" 1 
ATOM 8806  C "C5'" . DC  I 5 134 ? 115.243 131.692 88.440  1.00 93.83  ? 134 DC  I "C5'" 1 
ATOM 8807  C "C4'" . DC  I 5 134 ? 115.068 131.491 86.946  1.00 93.83  ? 134 DC  I "C4'" 1 
ATOM 8808  O "O4'" . DC  I 5 134 ? 116.226 132.001 86.239  1.00 93.83  ? 134 DC  I "O4'" 1 
ATOM 8809  C "C3'" . DC  I 5 134 ? 114.895 130.041 86.495  1.00 93.83  ? 134 DC  I "C3'" 1 
ATOM 8810  O "O3'" . DC  I 5 134 ? 113.829 129.971 85.565  1.00 93.83  ? 134 DC  I "O3'" 1 
ATOM 8811  C "C2'" . DC  I 5 134 ? 116.236 129.724 85.837  1.00 93.83  ? 134 DC  I "C2'" 1 
ATOM 8812  C "C1'" . DC  I 5 134 ? 116.605 131.073 85.259  1.00 93.83  ? 134 DC  I "C1'" 1 
ATOM 8813  N N1    . DC  I 5 134 ? 118.045 131.229 85.002  1.00 93.83  ? 134 DC  I N1    1 
ATOM 8814  C C2    . DC  I 5 134 ? 118.475 131.645 83.746  1.00 93.83  ? 134 DC  I C2    1 
ATOM 8815  O O2    . DC  I 5 134 ? 117.634 131.863 82.875  1.00 93.83  ? 134 DC  I O2    1 
ATOM 8816  N N3    . DC  I 5 134 ? 119.799 131.779 83.518  1.00 93.83  ? 134 DC  I N3    1 
ATOM 8817  C C4    . DC  I 5 134 ? 120.668 131.521 84.494  1.00 93.83  ? 134 DC  I C4    1 
ATOM 8818  N N4    . DC  I 5 134 ? 121.966 131.671 84.231  1.00 93.83  ? 134 DC  I N4    1 
ATOM 8819  C C5    . DC  I 5 134 ? 120.246 131.101 85.784  1.00 93.83  ? 134 DC  I C5    1 
ATOM 8820  C C6    . DC  I 5 134 ? 118.934 130.969 85.991  1.00 93.83  ? 134 DC  I C6    1 
ATOM 8821  P P     . DC  I 5 135 ? 113.196 128.559 85.129  1.00 104.97 ? 135 DC  I P     1 
ATOM 8822  O OP1   . DC  I 5 135 ? 111.725 128.688 85.228  1.00 104.97 ? 135 DC  I OP1   1 
ATOM 8823  O OP2   . DC  I 5 135 ? 113.891 127.459 85.838  1.00 104.97 ? 135 DC  I OP2   1 
ATOM 8824  O "O5'" . DC  I 5 135 ? 113.580 128.452 83.589  1.00 104.97 ? 135 DC  I "O5'" 1 
ATOM 8825  C "C5'" . DC  I 5 135 ? 113.435 129.582 82.750  1.00 104.97 ? 135 DC  I "C5'" 1 
ATOM 8826  C "C4'" . DC  I 5 135 ? 113.876 129.261 81.339  1.00 104.97 ? 135 DC  I "C4'" 1 
ATOM 8827  O "O4'" . DC  I 5 135 ? 115.261 129.645 81.161  1.00 104.97 ? 135 DC  I "O4'" 1 
ATOM 8828  C "C3'" . DC  I 5 135 ? 113.784 127.790 80.967  1.00 104.97 ? 135 DC  I "C3'" 1 
ATOM 8829  O "O3'" . DC  I 5 135 ? 113.259 127.652 79.666  1.00 104.97 ? 135 DC  I "O3'" 1 
ATOM 8830  C "C2'" . DC  I 5 135 ? 115.227 127.315 81.042  1.00 104.97 ? 135 DC  I "C2'" 1 
ATOM 8831  C "C1'" . DC  I 5 135 ? 116.005 128.559 80.662  1.00 104.97 ? 135 DC  I "C1'" 1 
ATOM 8832  N N1    . DC  I 5 135 ? 117.351 128.605 81.281  1.00 104.97 ? 135 DC  I N1    1 
ATOM 8833  C C2    . DC  I 5 135 ? 118.465 128.944 80.511  1.00 104.97 ? 135 DC  I C2    1 
ATOM 8834  O O2    . DC  I 5 135 ? 118.314 129.200 79.317  1.00 104.97 ? 135 DC  I O2    1 
ATOM 8835  N N3    . DC  I 5 135 ? 119.681 128.973 81.102  1.00 104.97 ? 135 DC  I N3    1 
ATOM 8836  C C4    . DC  I 5 135 ? 119.799 128.684 82.394  1.00 104.97 ? 135 DC  I C4    1 
ATOM 8837  N N4    . DC  I 5 135 ? 121.016 128.727 82.939  1.00 104.97 ? 135 DC  I N4    1 
ATOM 8838  C C5    . DC  I 5 135 ? 118.676 128.335 83.190  1.00 104.97 ? 135 DC  I C5    1 
ATOM 8839  C C6    . DC  I 5 135 ? 117.484 128.313 82.599  1.00 104.97 ? 135 DC  I C6    1 
ATOM 8840  P P     . DG  I 5 136 ? 112.667 126.240 79.179  1.00 111.92 ? 136 DG  I P     1 
ATOM 8841  O OP1   . DG  I 5 136 ? 111.344 126.501 78.579  1.00 111.92 ? 136 DG  I OP1   1 
ATOM 8842  O OP2   . DG  I 5 136 ? 112.785 125.272 80.292  1.00 111.92 ? 136 DG  I OP2   1 
ATOM 8843  O "O5'" . DG  I 5 136 ? 113.672 125.805 78.018  1.00 111.92 ? 136 DG  I "O5'" 1 
ATOM 8844  C "C5'" . DG  I 5 136 ? 113.901 126.689 76.933  1.00 111.92 ? 136 DG  I "C5'" 1 
ATOM 8845  C "C4'" . DG  I 5 136 ? 115.164 126.314 76.185  1.00 111.92 ? 136 DG  I "C4'" 1 
ATOM 8846  O "O4'" . DG  I 5 136 ? 116.324 126.682 76.970  1.00 111.92 ? 136 DG  I "O4'" 1 
ATOM 8847  C "C3'" . DG  I 5 136 ? 115.311 124.826 75.872  1.00 111.92 ? 136 DG  I "C3'" 1 
ATOM 8848  O "O3'" . DG  I 5 136 ? 115.685 124.662 74.521  1.00 111.92 ? 136 DG  I "O3'" 1 
ATOM 8849  C "C2'" . DG  I 5 136 ? 116.421 124.372 76.819  1.00 111.92 ? 136 DG  I "C2'" 1 
ATOM 8850  C "C1'" . DG  I 5 136 ? 117.251 125.629 76.945  1.00 111.92 ? 136 DG  I "C1'" 1 
ATOM 8851  N N9    . DG  I 5 136 ? 118.023 125.669 78.172  1.00 111.92 ? 136 DG  I N9    1 
ATOM 8852  C C8    . DG  I 5 136 ? 117.567 125.407 79.432  1.00 111.92 ? 136 DG  I C8    1 
ATOM 8853  N N7    . DG  I 5 136 ? 118.481 125.512 80.348  1.00 111.92 ? 136 DG  I N7    1 
ATOM 8854  C C5    . DG  I 5 136 ? 119.621 125.852 79.645  1.00 111.92 ? 136 DG  I C5    1 
ATOM 8855  C C6    . DG  I 5 136 ? 120.919 126.097 80.105  1.00 111.92 ? 136 DG  I C6    1 
ATOM 8856  O O6    . DG  I 5 136 ? 121.332 126.056 81.267  1.00 111.92 ? 136 DG  I O6    1 
ATOM 8857  N N1    . DG  I 5 136 ? 121.781 126.410 79.067  1.00 111.92 ? 136 DG  I N1    1 
ATOM 8858  C C2    . DG  I 5 136 ? 121.427 126.484 77.748  1.00 111.92 ? 136 DG  I C2    1 
ATOM 8859  N N2    . DG  I 5 136 ? 122.396 126.802 76.884  1.00 111.92 ? 136 DG  I N2    1 
ATOM 8860  N N3    . DG  I 5 136 ? 120.206 126.260 77.301  1.00 111.92 ? 136 DG  I N3    1 
ATOM 8861  C C4    . DG  I 5 136 ? 119.357 125.951 78.304  1.00 111.92 ? 136 DG  I C4    1 
ATOM 8862  P P     . DG  I 5 137 ? 115.557 123.232 73.804  1.00 111.69 ? 137 DG  I P     1 
ATOM 8863  O OP1   . DG  I 5 137 ? 114.822 123.445 72.537  1.00 111.69 ? 137 DG  I OP1   1 
ATOM 8864  O OP2   . DG  I 5 137 ? 115.036 122.250 74.780  1.00 111.69 ? 137 DG  I OP2   1 
ATOM 8865  O "O5'" . DG  I 5 137 ? 117.070 122.854 73.464  1.00 111.69 ? 137 DG  I "O5'" 1 
ATOM 8866  C "C5'" . DG  I 5 137 ? 117.901 123.806 72.814  1.00 111.69 ? 137 DG  I "C5'" 1 
ATOM 8867  C "C4'" . DG  I 5 137 ? 119.365 123.469 73.016  1.00 111.69 ? 137 DG  I "C4'" 1 
ATOM 8868  O "O4'" . DG  I 5 137 ? 119.751 123.787 74.370  1.00 111.69 ? 137 DG  I "O4'" 1 
ATOM 8869  C "C3'" . DG  I 5 137 ? 119.709 121.994 72.809  1.00 111.69 ? 137 DG  I "C3'" 1 
ATOM 8870  O "O3'" . DG  I 5 137 ? 120.591 121.840 71.711  1.00 111.69 ? 137 DG  I "O3'" 1 
ATOM 8871  C "C2'" . DG  I 5 137 ? 120.357 121.552 74.126  1.00 111.69 ? 137 DG  I "C2'" 1 
ATOM 8872  C "C1'" . DG  I 5 137 ? 120.710 122.864 74.802  1.00 111.69 ? 137 DG  I "C1'" 1 
ATOM 8873  N N9    . DG  I 5 137 ? 120.653 122.791 76.257  1.00 111.69 ? 137 DG  I N9    1 
ATOM 8874  C C8    . DG  I 5 137 ? 119.553 122.509 77.028  1.00 111.69 ? 137 DG  I C8    1 
ATOM 8875  N N7    . DG  I 5 137 ? 119.804 122.511 78.307  1.00 111.69 ? 137 DG  I N7    1 
ATOM 8876  C C5    . DG  I 5 137 ? 121.153 122.815 78.386  1.00 111.69 ? 137 DG  I C5    1 
ATOM 8877  C C6    . DG  I 5 137 ? 121.984 122.957 79.512  1.00 111.69 ? 137 DG  I C6    1 
ATOM 8878  O O6    . DG  I 5 137 ? 121.684 122.841 80.703  1.00 111.69 ? 137 DG  I O6    1 
ATOM 8879  N N1    . DG  I 5 137 ? 123.286 123.269 79.152  1.00 111.69 ? 137 DG  I N1    1 
ATOM 8880  C C2    . DG  I 5 137 ? 123.728 123.424 77.864  1.00 111.69 ? 137 DG  I C2    1 
ATOM 8881  N N2    . DG  I 5 137 ? 125.021 123.724 77.709  1.00 111.69 ? 137 DG  I N2    1 
ATOM 8882  N N3    . DG  I 5 137 ? 122.960 123.293 76.799  1.00 111.69 ? 137 DG  I N3    1 
ATOM 8883  C C4    . DG  I 5 137 ? 121.689 122.988 77.134  1.00 111.69 ? 137 DG  I C4    1 
ATOM 8884  P P     . DG  I 5 138 ? 120.899 120.374 71.131  1.00 111.68 ? 138 DG  I P     1 
ATOM 8885  O OP1   . DG  I 5 138 ? 121.097 120.520 69.675  1.00 111.68 ? 138 DG  I OP1   1 
ATOM 8886  O OP2   . DG  I 5 138 ? 119.861 119.446 71.633  1.00 111.68 ? 138 DG  I OP2   1 
ATOM 8887  O "O5'" . DG  I 5 138 ? 122.296 119.979 71.809  1.00 111.68 ? 138 DG  I "O5'" 1 
ATOM 8888  C "C5'" . DG  I 5 138 ? 123.509 120.447 71.237  1.00 111.68 ? 138 DG  I "C5'" 1 
ATOM 8889  C "C4'" . DG  I 5 138 ? 124.601 120.564 72.279  1.00 111.68 ? 138 DG  I "C4'" 1 
ATOM 8890  O "O4'" . DG  I 5 138 ? 124.014 120.781 73.580  1.00 111.68 ? 138 DG  I "O4'" 1 
ATOM 8891  C "C3'" . DG  I 5 138 ? 125.508 119.337 72.411  1.00 111.68 ? 138 DG  I "C3'" 1 
ATOM 8892  O "O3'" . DG  I 5 138 ? 126.853 119.720 72.193  1.00 111.68 ? 138 DG  I "O3'" 1 
ATOM 8893  C "C2'" . DG  I 5 138 ? 125.285 118.851 73.851  1.00 111.68 ? 138 DG  I "C2'" 1 
ATOM 8894  C "C1'" . DG  I 5 138 ? 124.782 120.105 74.544  1.00 111.68 ? 138 DG  I "C1'" 1 
ATOM 8895  N N9    . DG  I 5 138 ? 123.931 119.840 75.697  1.00 111.68 ? 138 DG  I N9    1 
ATOM 8896  C C8    . DG  I 5 138 ? 122.624 119.423 75.681  1.00 111.68 ? 138 DG  I C8    1 
ATOM 8897  N N7    . DG  I 5 138 ? 122.109 119.282 76.867  1.00 111.68 ? 138 DG  I N7    1 
ATOM 8898  C C5    . DG  I 5 138 ? 123.142 119.626 77.725  1.00 111.68 ? 138 DG  I C5    1 
ATOM 8899  C C6    . DG  I 5 138 ? 123.178 119.659 79.132  1.00 111.68 ? 138 DG  I C6    1 
ATOM 8900  O O6    . DG  I 5 138 ? 122.276 119.382 79.927  1.00 111.68 ? 138 DG  I O6    1 
ATOM 8901  N N1    . DG  I 5 138 ? 124.416 120.063 79.604  1.00 111.68 ? 138 DG  I N1    1 
ATOM 8902  C C2    . DG  I 5 138 ? 125.485 120.395 78.815  1.00 111.68 ? 138 DG  I C2    1 
ATOM 8903  N N2    . DG  I 5 138 ? 126.603 120.762 79.455  1.00 111.68 ? 138 DG  I N2    1 
ATOM 8904  N N3    . DG  I 5 138 ? 125.466 120.367 77.495  1.00 111.68 ? 138 DG  I N3    1 
ATOM 8905  C C4    . DG  I 5 138 ? 124.266 119.976 77.020  1.00 111.68 ? 138 DG  I C4    1 
ATOM 8906  P P     . DA  I 5 139 ? 127.979 118.609 71.927  1.00 107.29 ? 139 DA  I P     1 
ATOM 8907  O OP1   . DA  I 5 139 ? 128.944 119.185 70.965  1.00 107.29 ? 139 DA  I OP1   1 
ATOM 8908  O OP2   . DA  I 5 139 ? 127.294 117.337 71.610  1.00 107.29 ? 139 DA  I OP2   1 
ATOM 8909  O "O5'" . DA  I 5 139 ? 128.687 118.441 73.351  1.00 107.29 ? 139 DA  I "O5'" 1 
ATOM 8910  C "C5'" . DA  I 5 139 ? 128.959 119.587 74.146  1.00 107.29 ? 139 DA  I "C5'" 1 
ATOM 8911  C "C4'" . DA  I 5 139 ? 129.787 119.229 75.369  1.00 107.29 ? 139 DA  I "C4'" 1 
ATOM 8912  O "O4'" . DA  I 5 139 ? 128.932 119.163 76.536  1.00 107.29 ? 139 DA  I "O4'" 1 
ATOM 8913  C "C3'" . DA  I 5 139 ? 130.518 117.893 75.294  1.00 107.29 ? 139 DA  I "C3'" 1 
ATOM 8914  O "O3'" . DA  I 5 139 ? 131.811 118.003 75.890  1.00 107.29 ? 139 DA  I "O3'" 1 
ATOM 8915  C "C2'" . DA  I 5 139 ? 129.607 116.957 76.082  1.00 107.29 ? 139 DA  I "C2'" 1 
ATOM 8916  C "C1'" . DA  I 5 139 ? 128.989 117.878 77.119  1.00 107.29 ? 139 DA  I "C1'" 1 
ATOM 8917  N N9    . DA  I 5 139 ? 127.631 117.497 77.494  1.00 107.29 ? 139 DA  I N9    1 
ATOM 8918  C C8    . DA  I 5 139 ? 126.612 117.165 76.652  1.00 107.29 ? 139 DA  I C8    1 
ATOM 8919  N N7    . DA  I 5 139 ? 125.494 116.878 77.264  1.00 107.29 ? 139 DA  I N7    1 
ATOM 8920  C C5    . DA  I 5 139 ? 125.799 117.033 78.600  1.00 107.29 ? 139 DA  I C5    1 
ATOM 8921  C C6    . DA  I 5 139 ? 125.037 116.875 79.769  1.00 107.29 ? 139 DA  I C6    1 
ATOM 8922  N N6    . DA  I 5 139 ? 123.753 116.511 79.762  1.00 107.29 ? 139 DA  I N6    1 
ATOM 8923  N N1    . DA  I 5 139 ? 125.649 117.110 80.952  1.00 107.29 ? 139 DA  I N1    1 
ATOM 8924  C C2    . DA  I 5 139 ? 126.932 117.476 80.954  1.00 107.29 ? 139 DA  I C2    1 
ATOM 8925  N N3    . DA  I 5 139 ? 127.747 117.656 79.919  1.00 107.29 ? 139 DA  I N3    1 
ATOM 8926  C C4    . DA  I 5 139 ? 127.112 117.417 78.761  1.00 107.29 ? 139 DA  I C4    1 
ATOM 8927  P P     . DT  I 5 140 ? 132.856 116.784 75.806  1.00 103.86 ? 140 DT  I P     1 
ATOM 8928  O OP1   . DT  I 5 140 ? 134.199 117.366 75.600  1.00 103.86 ? 140 DT  I OP1   1 
ATOM 8929  O OP2   . DT  I 5 140 ? 132.356 115.768 74.854  1.00 103.86 ? 140 DT  I OP2   1 
ATOM 8930  O "O5'" . DT  I 5 140 ? 132.829 116.163 77.275  1.00 103.86 ? 140 DT  I "O5'" 1 
ATOM 8931  C "C5'" . DT  I 5 140 ? 133.519 116.829 78.322  1.00 103.86 ? 140 DT  I "C5'" 1 
ATOM 8932  C "C4'" . DT  I 5 140 ? 132.959 116.452 79.682  1.00 103.86 ? 140 DT  I "C4'" 1 
ATOM 8933  O "O4'" . DT  I 5 140 ? 131.518 116.292 79.606  1.00 103.86 ? 140 DT  I "O4'" 1 
ATOM 8934  C "C3'" . DT  I 5 140 ? 133.499 115.149 80.275  1.00 103.86 ? 140 DT  I "C3'" 1 
ATOM 8935  O "O3'" . DT  I 5 140 ? 133.987 115.402 81.577  1.00 103.86 ? 140 DT  I "O3'" 1 
ATOM 8936  C "C2'" . DT  I 5 140 ? 132.273 114.227 80.298  1.00 103.86 ? 140 DT  I "C2'" 1 
ATOM 8937  C "C1'" . DT  I 5 140 ? 131.151 115.230 80.447  1.00 103.86 ? 140 DT  I "C1'" 1 
ATOM 8938  N N1    . DT  I 5 140 ? 129.792 114.746 80.044  1.00 103.86 ? 140 DT  I N1    1 
ATOM 8939  C C2    . DT  I 5 140 ? 128.821 114.617 81.005  1.00 103.86 ? 140 DT  I C2    1 
ATOM 8940  O O2    . DT  I 5 140 ? 129.018 114.854 82.182  1.00 103.86 ? 140 DT  I O2    1 
ATOM 8941  N N3    . DT  I 5 140 ? 127.604 114.201 80.538  1.00 103.86 ? 140 DT  I N3    1 
ATOM 8942  C C4    . DT  I 5 140 ? 127.268 113.907 79.237  1.00 103.86 ? 140 DT  I C4    1 
ATOM 8943  O O4    . DT  I 5 140 ? 126.145 113.537 78.912  1.00 103.86 ? 140 DT  I O4    1 
ATOM 8944  C C5    . DT  I 5 140 ? 128.323 114.067 78.279  1.00 103.86 ? 140 DT  I C5    1 
ATOM 8945  C C7    . DT  I 5 140 ? 128.060 113.769 76.833  1.00 103.86 ? 140 DT  I C7    1 
ATOM 8946  C C6    . DT  I 5 140 ? 129.523 114.482 78.719  1.00 103.86 ? 140 DT  I C6    1 
ATOM 8947  P P     . DT  I 5 141 ? 135.023 114.394 82.275  1.00 98.11  ? 141 DT  I P     1 
ATOM 8948  O OP1   . DT  I 5 141 ? 136.232 115.166 82.632  1.00 98.11  ? 141 DT  I OP1   1 
ATOM 8949  O OP2   . DT  I 5 141 ? 135.150 113.192 81.425  1.00 98.11  ? 141 DT  I OP2   1 
ATOM 8950  O "O5'" . DT  I 5 141 ? 134.280 113.981 83.628  1.00 98.11  ? 141 DT  I "O5'" 1 
ATOM 8951  C "C5'" . DT  I 5 141 ? 133.007 114.546 83.937  1.00 98.11  ? 141 DT  I "C5'" 1 
ATOM 8952  C "C4'" . DT  I 5 141 ? 132.288 113.722 84.984  1.00 98.11  ? 141 DT  I "C4'" 1 
ATOM 8953  O "O4'" . DT  I 5 141 ? 130.975 113.340 84.494  1.00 98.11  ? 141 DT  I "O4'" 1 
ATOM 8954  C "C3'" . DT  I 5 141 ? 132.968 112.418 85.360  1.00 98.11  ? 141 DT  I "C3'" 1 
ATOM 8955  O "O3'" . DT  I 5 141 ? 132.646 112.120 86.704  1.00 98.11  ? 141 DT  I "O3'" 1 
ATOM 8956  C "C2'" . DT  I 5 141 ? 132.303 111.441 84.396  1.00 98.11  ? 141 DT  I "C2'" 1 
ATOM 8957  C "C1'" . DT  I 5 141 ? 130.876 111.934 84.465  1.00 98.11  ? 141 DT  I "C1'" 1 
ATOM 8958  N N1    . DT  I 5 141 ? 130.038 111.555 83.302  1.00 98.11  ? 141 DT  I N1    1 
ATOM 8959  C C2    . DT  I 5 141 ? 128.704 111.304 83.494  1.00 98.11  ? 141 DT  I C2    1 
ATOM 8960  O O2    . DT  I 5 141 ? 128.168 111.356 84.582  1.00 98.11  ? 141 DT  I O2    1 
ATOM 8961  N N3    . DT  I 5 141 ? 128.014 110.986 82.361  1.00 98.11  ? 141 DT  I N3    1 
ATOM 8962  C C4    . DT  I 5 141 ? 128.512 110.896 81.084  1.00 98.11  ? 141 DT  I C4    1 
ATOM 8963  O O4    . DT  I 5 141 ? 127.813 110.601 80.128  1.00 98.11  ? 141 DT  I O4    1 
ATOM 8964  C C5    . DT  I 5 141 ? 129.913 111.173 80.948  1.00 98.11  ? 141 DT  I C5    1 
ATOM 8965  C C7    . DT  I 5 141 ? 130.558 111.097 79.600  1.00 98.11  ? 141 DT  I C7    1 
ATOM 8966  C C6    . DT  I 5 141 ? 130.605 111.490 82.049  1.00 98.11  ? 141 DT  I C6    1 
ATOM 8967  P P     . DC  I 5 142 ? 133.541 111.114 87.577  1.00 92.27  ? 142 DC  I P     1 
ATOM 8968  O OP1   . DC  I 5 142 ? 134.365 111.932 88.492  1.00 92.27  ? 142 DC  I OP1   1 
ATOM 8969  O OP2   . DC  I 5 142 ? 134.204 110.141 86.682  1.00 92.27  ? 142 DC  I OP2   1 
ATOM 8970  O "O5'" . DC  I 5 142 ? 132.447 110.323 88.431  1.00 92.27  ? 142 DC  I "O5'" 1 
ATOM 8971  C "C5'" . DC  I 5 142 ? 131.276 110.997 88.870  1.00 92.27  ? 142 DC  I "C5'" 1 
ATOM 8972  C "C4'" . DC  I 5 142 ? 130.087 110.050 88.959  1.00 92.27  ? 142 DC  I "C4'" 1 
ATOM 8973  O "O4'" . DC  I 5 142 ? 129.474 109.884 87.656  1.00 92.27  ? 142 DC  I "O4'" 1 
ATOM 8974  C "C3'" . DC  I 5 142 ? 130.393 108.645 89.460  1.00 92.27  ? 142 DC  I "C3'" 1 
ATOM 8975  O "O3'" . DC  I 5 142 ? 129.374 108.249 90.347  1.00 92.27  ? 142 DC  I "O3'" 1 
ATOM 8976  C "C2'" . DC  I 5 142 ? 130.364 107.817 88.180  1.00 92.27  ? 142 DC  I "C2'" 1 
ATOM 8977  C "C1'" . DC  I 5 142 ? 129.267 108.514 87.409  1.00 92.27  ? 142 DC  I "C1'" 1 
ATOM 8978  N N1    . DC  I 5 142 ? 129.320 108.307 85.936  1.00 92.27  ? 142 DC  I N1    1 
ATOM 8979  C C2    . DC  I 5 142 ? 128.148 108.009 85.229  1.00 92.27  ? 142 DC  I C2    1 
ATOM 8980  O O2    . DC  I 5 142 ? 127.085 107.885 85.838  1.00 92.27  ? 142 DC  I O2    1 
ATOM 8981  N N3    . DC  I 5 142 ? 128.218 107.851 83.889  1.00 92.27  ? 142 DC  I N3    1 
ATOM 8982  C C4    . DC  I 5 142 ? 129.381 107.987 83.261  1.00 92.27  ? 142 DC  I C4    1 
ATOM 8983  N N4    . DC  I 5 142 ? 129.398 107.824 81.936  1.00 92.27  ? 142 DC  I N4    1 
ATOM 8984  C C5    . DC  I 5 142 ? 130.579 108.296 83.958  1.00 92.27  ? 142 DC  I C5    1 
ATOM 8985  C C6    . DC  I 5 142 ? 130.502 108.447 85.281  1.00 92.27  ? 142 DC  I C6    1 
ATOM 8986  P P     . DT  I 5 143 ? 129.623 107.089 91.425  1.00 85.33  ? 143 DT  I P     1 
ATOM 8987  O OP1   . DT  I 5 143 ? 129.444 107.687 92.763  1.00 85.33  ? 143 DT  I OP1   1 
ATOM 8988  O OP2   . DT  I 5 143 ? 130.891 106.409 91.095  1.00 85.33  ? 143 DT  I OP2   1 
ATOM 8989  O "O5'" . DT  I 5 143 ? 128.413 106.083 91.162  1.00 85.33  ? 143 DT  I "O5'" 1 
ATOM 8990  C "C5'" . DT  I 5 143 ? 127.133 106.597 90.837  1.00 85.33  ? 143 DT  I "C5'" 1 
ATOM 8991  C "C4'" . DT  I 5 143 ? 126.300 105.572 90.089  1.00 85.33  ? 143 DT  I "C4'" 1 
ATOM 8992  O "O4'" . DT  I 5 143 ? 126.586 105.620 88.666  1.00 85.33  ? 143 DT  I "O4'" 1 
ATOM 8993  C "C3'" . DT  I 5 143 ? 126.515 104.119 90.503  1.00 85.33  ? 143 DT  I "C3'" 1 
ATOM 8994  O "O3'" . DT  I 5 143 ? 125.268 103.474 90.533  1.00 85.33  ? 143 DT  I "O3'" 1 
ATOM 8995  C "C2'" . DT  I 5 143 ? 127.380 103.577 89.371  1.00 85.33  ? 143 DT  I "C2'" 1 
ATOM 8996  C "C1'" . DT  I 5 143 ? 126.762 104.305 88.202  1.00 85.33  ? 143 DT  I "C1'" 1 
ATOM 8997  N N1    . DT  I 5 143 ? 127.597 104.342 86.979  1.00 85.33  ? 143 DT  I N1    1 
ATOM 8998  C C2    . DT  I 5 143 ? 126.999 104.131 85.771  1.00 85.33  ? 143 DT  I C2    1 
ATOM 8999  O O2    . DT  I 5 143 ? 125.811 103.906 85.649  1.00 85.33  ? 143 DT  I O2    1 
ATOM 9000  N N3    . DT  I 5 143 ? 127.834 104.201 84.697  1.00 85.33  ? 143 DT  I N3    1 
ATOM 9001  C C4    . DT  I 5 143 ? 129.186 104.454 84.713  1.00 85.33  ? 143 DT  I C4    1 
ATOM 9002  O O4    . DT  I 5 143 ? 129.858 104.495 83.692  1.00 85.33  ? 143 DT  I O4    1 
ATOM 9003  C C5    . DT  I 5 143 ? 129.755 104.662 86.010  1.00 85.33  ? 143 DT  I C5    1 
ATOM 9004  C C7    . DT  I 5 143 ? 131.221 104.938 86.140  1.00 85.33  ? 143 DT  I C7    1 
ATOM 9005  C C6    . DT  I 5 143 ? 128.944 104.600 87.075  1.00 85.33  ? 143 DT  I C6    1 
ATOM 9006  P P     . DC  I 5 144 ? 124.975 102.322 91.598  1.00 80.06  ? 144 DC  I P     1 
ATOM 9007  O OP1   . DC  I 5 144 ? 123.922 102.787 92.504  1.00 80.06  ? 144 DC  I OP1   1 
ATOM 9008  O OP2   . DC  I 5 144 ? 126.272 101.886 92.139  1.00 80.06  ? 144 DC  I OP2   1 
ATOM 9009  O "O5'" . DC  I 5 144 ? 124.349 101.163 90.717  1.00 80.06  ? 144 DC  I "O5'" 1 
ATOM 9010  C "C5'" . DC  I 5 144 ? 123.477 101.488 89.645  1.00 80.06  ? 144 DC  I "C5'" 1 
ATOM 9011  C "C4'" . DC  I 5 144 ? 123.455 100.386 88.598  1.00 80.06  ? 144 DC  I "C4'" 1 
ATOM 9012  O "O4'" . DC  I 5 144 ? 124.376 100.700 87.522  1.00 80.06  ? 144 DC  I "O4'" 1 
ATOM 9013  C "C3'" . DC  I 5 144 ? 123.856 99.001  89.096  1.00 80.06  ? 144 DC  I "C3'" 1 
ATOM 9014  O "O3'" . DC  I 5 144 ? 123.060 98.044  88.467  1.00 80.06  ? 144 DC  I "O3'" 1 
ATOM 9015  C "C2'" . DC  I 5 144 ? 125.300 98.884  88.637  1.00 80.06  ? 144 DC  I "C2'" 1 
ATOM 9016  C "C1'" . DC  I 5 144 ? 125.222 99.596  87.303  1.00 80.06  ? 144 DC  I "C1'" 1 
ATOM 9017  N N1    . DC  I 5 144 ? 126.528 100.091 86.812  1.00 80.06  ? 144 DC  I N1    1 
ATOM 9018  C C2    . DC  I 5 144 ? 126.733 100.223 85.445  1.00 80.06  ? 144 DC  I C2    1 
ATOM 9019  O O2    . DC  I 5 144 ? 125.815 99.930  84.679  1.00 80.06  ? 144 DC  I O2    1 
ATOM 9020  N N3    . DC  I 5 144 ? 127.925 100.673 85.001  1.00 80.06  ? 144 DC  I N3    1 
ATOM 9021  C C4    . DC  I 5 144 ? 128.882 100.979 85.871  1.00 80.06  ? 144 DC  I C4    1 
ATOM 9022  N N4    . DC  I 5 144 ? 130.047 101.422 85.392  1.00 80.06  ? 144 DC  I N4    1 
ATOM 9023  C C5    . DC  I 5 144 ? 128.691 100.848 87.273  1.00 80.06  ? 144 DC  I C5    1 
ATOM 9024  C C6    . DC  I 5 144 ? 127.512 100.400 87.695  1.00 80.06  ? 144 DC  I C6    1 
ATOM 9025  P P     . DG  I 5 145 ? 122.572 96.747  89.265  1.00 93.92  ? 145 DG  I P     1 
ATOM 9026  O OP1   . DG  I 5 145 ? 121.309 97.104  89.939  1.00 93.92  ? 145 DG  I OP1   1 
ATOM 9027  O OP2   . DG  I 5 145 ? 123.717 96.249  90.053  1.00 93.92  ? 145 DG  I OP2   1 
ATOM 9028  O "O5'" . DG  I 5 145 ? 122.245 95.712  88.099  1.00 93.92  ? 145 DG  I "O5'" 1 
ATOM 9029  C "C5'" . DG  I 5 145 ? 121.489 96.145  86.980  1.00 93.92  ? 145 DG  I "C5'" 1 
ATOM 9030  C "C4'" . DG  I 5 145 ? 122.113 95.693  85.668  1.00 93.92  ? 145 DG  I "C4'" 1 
ATOM 9031  O "O4'" . DG  I 5 145 ? 123.381 96.357  85.454  1.00 93.92  ? 145 DG  I "O4'" 1 
ATOM 9032  C "C3'" . DG  I 5 145 ? 122.401 94.202  85.556  1.00 93.92  ? 145 DG  I "C3'" 1 
ATOM 9033  O "O3'" . DG  I 5 145 ? 122.067 93.771  84.261  1.00 93.92  ? 145 DG  I "O3'" 1 
ATOM 9034  C "C2'" . DG  I 5 145 ? 123.906 94.131  85.788  1.00 93.92  ? 145 DG  I "C2'" 1 
ATOM 9035  C "C1'" . DG  I 5 145 ? 124.353 95.401  85.107  1.00 93.92  ? 145 DG  I "C1'" 1 
ATOM 9036  N N9    . DG  I 5 145 ? 125.644 95.887  85.555  1.00 93.92  ? 145 DG  I N9    1 
ATOM 9037  C C8    . DG  I 5 145 ? 126.089 95.981  86.843  1.00 93.92  ? 145 DG  I C8    1 
ATOM 9038  N N7    . DG  I 5 145 ? 127.292 96.473  86.942  1.00 93.92  ? 145 DG  I N7    1 
ATOM 9039  C C5    . DG  I 5 145 ? 127.663 96.718  85.632  1.00 93.92  ? 145 DG  I C5    1 
ATOM 9040  C C6    . DG  I 5 145 ? 128.861 97.251  85.110  1.00 93.92  ? 145 DG  I C6    1 
ATOM 9041  O O6    . DG  I 5 145 ? 129.864 97.623  85.725  1.00 93.92  ? 145 DG  I O6    1 
ATOM 9042  N N1    . DG  I 5 145 ? 128.823 97.335  83.722  1.00 93.92  ? 145 DG  I N1    1 
ATOM 9043  C C2    . DG  I 5 145 ? 127.758 96.947  82.947  1.00 93.92  ? 145 DG  I C2    1 
ATOM 9044  N N2    . DG  I 5 145 ? 127.890 97.096  81.627  1.00 93.92  ? 145 DG  I N2    1 
ATOM 9045  N N3    . DG  I 5 145 ? 126.634 96.453  83.429  1.00 93.92  ? 145 DG  I N3    1 
ATOM 9046  C C4    . DG  I 5 145 ? 126.656 96.366  84.769  1.00 93.92  ? 145 DG  I C4    1 
ATOM 9047  P P     . DA  I 5 146 ? 121.178 92.458  84.052  1.00 106.09 ? 146 DA  I P     1 
ATOM 9048  O OP1   . DA  I 5 146 ? 120.520 92.571  82.734  1.00 106.09 ? 146 DA  I OP1   1 
ATOM 9049  O OP2   . DA  I 5 146 ? 120.363 92.263  85.268  1.00 106.09 ? 146 DA  I OP2   1 
ATOM 9050  O "O5'" . DA  I 5 146 ? 122.255 91.289  83.994  1.00 106.09 ? 146 DA  I "O5'" 1 
ATOM 9051  C "C5'" . DA  I 5 146 ? 122.309 90.441  82.863  1.00 106.09 ? 146 DA  I "C5'" 1 
ATOM 9052  C "C4'" . DA  I 5 146 ? 123.306 90.958  81.843  1.00 106.09 ? 146 DA  I "C4'" 1 
ATOM 9053  O "O4'" . DA  I 5 146 ? 124.165 91.947  82.464  1.00 106.09 ? 146 DA  I "O4'" 1 
ATOM 9054  C "C3'" . DA  I 5 146 ? 124.227 89.882  81.263  1.00 106.09 ? 146 DA  I "C3'" 1 
ATOM 9055  O "O3'" . DA  I 5 146 ? 124.166 89.880  79.847  1.00 106.09 ? 146 DA  I "O3'" 1 
ATOM 9056  C "C2'" . DA  I 5 146 ? 125.613 90.271  81.763  1.00 106.09 ? 146 DA  I "C2'" 1 
ATOM 9057  C "C1'" . DA  I 5 146 ? 125.477 91.761  82.012  1.00 106.09 ? 146 DA  I "C1'" 1 
ATOM 9058  N N9    . DA  I 5 146 ? 126.394 92.227  83.038  1.00 106.09 ? 146 DA  I N9    1 
ATOM 9059  C C8    . DA  I 5 146 ? 126.293 92.031  84.384  1.00 106.09 ? 146 DA  I C8    1 
ATOM 9060  N N7    . DA  I 5 146 ? 127.284 92.543  85.068  1.00 106.09 ? 146 DA  I N7    1 
ATOM 9061  C C5    . DA  I 5 146 ? 128.095 93.098  84.100  1.00 106.09 ? 146 DA  I C5    1 
ATOM 9062  C C6    . DA  I 5 146 ? 129.309 93.793  84.169  1.00 106.09 ? 146 DA  I C6    1 
ATOM 9063  N N6    . DA  I 5 146 ? 129.942 94.056  85.315  1.00 106.09 ? 146 DA  I N6    1 
ATOM 9064  N N1    . DA  I 5 146 ? 129.851 94.212  83.010  1.00 106.09 ? 146 DA  I N1    1 
ATOM 9065  C C2    . DA  I 5 146 ? 129.221 93.952  81.864  1.00 106.09 ? 146 DA  I C2    1 
ATOM 9066  N N3    . DA  I 5 146 ? 128.079 93.308  81.675  1.00 106.09 ? 146 DA  I N3    1 
ATOM 9067  C C4    . DA  I 5 146 ? 127.564 92.905  82.843  1.00 106.09 ? 146 DA  I C4    1 
ATOM 9068  P P     . DT  I 5 147 ? 124.629 88.575  79.030  1.00 112.30 ? 147 DT  I P     1 
ATOM 9069  O OP1   . DT  I 5 147 ? 124.027 88.661  77.681  1.00 112.30 ? 147 DT  I OP1   1 
ATOM 9070  O OP2   . DT  I 5 147 ? 124.353 87.400  79.886  1.00 112.30 ? 147 DT  I OP2   1 
ATOM 9071  O "O5'" . DT  I 5 147 ? 126.224 88.719  78.923  1.00 112.30 ? 147 DT  I "O5'" 1 
ATOM 9072  C "C5'" . DT  I 5 147 ? 126.795 89.856  78.295  1.00 112.30 ? 147 DT  I "C5'" 1 
ATOM 9073  C "C4'" . DT  I 5 147 ? 128.284 89.964  78.595  1.00 112.30 ? 147 DT  I "C4'" 1 
ATOM 9074  O "O4'" . DT  I 5 147 ? 128.497 90.397  79.948  1.00 112.30 ? 147 DT  I "O4'" 1 
ATOM 9075  C "C3'" . DT  I 5 147 ? 129.083 88.667  78.466  1.00 112.30 ? 147 DT  I "C3'" 1 
ATOM 9076  O "O3'" . DT  I 5 147 ? 129.777 88.648  77.224  1.00 112.30 ? 147 DT  I "O3'" 1 
ATOM 9077  C "C2'" . DT  I 5 147 ? 130.064 88.706  79.656  1.00 112.30 ? 147 DT  I "C2'" 1 
ATOM 9078  C "C1'" . DT  I 5 147 ? 129.823 90.085  80.263  1.00 112.30 ? 147 DT  I "C1'" 1 
ATOM 9079  N N1    . DT  I 5 147 ? 129.998 90.127  81.739  1.00 112.30 ? 147 DT  I N1    1 
ATOM 9080  C C2    . DT  I 5 147 ? 131.127 90.712  82.268  1.00 112.30 ? 147 DT  I C2    1 
ATOM 9081  O O2    . DT  I 5 147 ? 132.002 91.214  81.585  1.00 112.30 ? 147 DT  I O2    1 
ATOM 9082  N N3    . DT  I 5 147 ? 131.195 90.693  83.633  1.00 112.30 ? 147 DT  I N3    1 
ATOM 9083  C C4    . DT  I 5 147 ? 130.268 90.156  84.505  1.00 112.30 ? 147 DT  I C4    1 
ATOM 9084  O O4    . DT  I 5 147 ? 130.419 90.189  85.720  1.00 112.30 ? 147 DT  I O4    1 
ATOM 9085  C C5    . DT  I 5 147 ? 129.108 89.555  83.884  1.00 112.30 ? 147 DT  I C5    1 
ATOM 9086  C C7    . DT  I 5 147 ? 128.030 88.935  84.725  1.00 112.30 ? 147 DT  I C7    1 
ATOM 9087  C C6    . DT  I 5 147 ? 129.034 89.568  82.548  1.00 112.30 ? 147 DT  I C6    1 
ATOM 9088  P P     . DA  J 6 1   ? 142.510 95.497  86.956  1.00 126.16 ? 1   DA  J P     1 
ATOM 9089  O OP1   . DA  J 6 1   ? 141.613 95.231  88.101  1.00 126.16 ? 1   DA  J OP1   1 
ATOM 9090  O OP2   . DA  J 6 1   ? 142.385 96.772  86.219  1.00 126.16 ? 1   DA  J OP2   1 
ATOM 9091  O "O5'" . DA  J 6 1   ? 142.401 94.306  85.885  1.00 126.16 ? 1   DA  J "O5'" 1 
ATOM 9092  C "C5'" . DA  J 6 1   ? 141.196 93.534  85.781  1.00 126.16 ? 1   DA  J "C5'" 1 
ATOM 9093  C "C4'" . DA  J 6 1   ? 140.501 93.777  84.450  1.00 126.16 ? 1   DA  J "C4'" 1 
ATOM 9094  O "O4'" . DA  J 6 1   ? 139.195 93.137  84.470  1.00 126.16 ? 1   DA  J "O4'" 1 
ATOM 9095  C "C3'" . DA  J 6 1   ? 140.206 95.238  84.148  1.00 126.16 ? 1   DA  J "C3'" 1 
ATOM 9096  O "O3'" . DA  J 6 1   ? 140.040 95.425  82.746  1.00 126.16 ? 1   DA  J "O3'" 1 
ATOM 9097  C "C2'" . DA  J 6 1   ? 138.892 95.410  84.881  1.00 126.16 ? 1   DA  J "C2'" 1 
ATOM 9098  C "C1'" . DA  J 6 1   ? 138.192 94.136  84.446  1.00 126.16 ? 1   DA  J "C1'" 1 
ATOM 9099  N N9    . DA  J 6 1   ? 137.094 93.734  85.319  1.00 126.16 ? 1   DA  J N9    1 
ATOM 9100  C C8    . DA  J 6 1   ? 137.014 93.894  86.673  1.00 126.16 ? 1   DA  J C8    1 
ATOM 9101  N N7    . DA  J 6 1   ? 135.901 93.435  87.195  1.00 126.16 ? 1   DA  J N7    1 
ATOM 9102  C C5    . DA  J 6 1   ? 135.201 92.943  86.108  1.00 126.16 ? 1   DA  J C5    1 
ATOM 9103  C C6    . DA  J 6 1   ? 133.940 92.323  85.988  1.00 126.16 ? 1   DA  J C6    1 
ATOM 9104  N N6    . DA  J 6 1   ? 133.137 92.087  87.028  1.00 126.16 ? 1   DA  J N6    1 
ATOM 9105  N N1    . DA  J 6 1   ? 133.538 91.951  84.753  1.00 126.16 ? 1   DA  J N1    1 
ATOM 9106  C C2    . DA  J 6 1   ? 134.345 92.186  83.713  1.00 126.16 ? 1   DA  J C2    1 
ATOM 9107  N N3    . DA  J 6 1   ? 135.545 92.765  83.701  1.00 126.16 ? 1   DA  J N3    1 
ATOM 9108  C C4    . DA  J 6 1   ? 135.918 93.120  84.942  1.00 126.16 ? 1   DA  J C4    1 
ATOM 9109  P P     . DT  J 6 2   ? 141.070 96.345  81.922  1.00 121.76 ? 2   DT  J P     1 
ATOM 9110  O OP1   . DT  J 6 2   ? 142.405 95.709  81.996  1.00 121.76 ? 2   DT  J OP1   1 
ATOM 9111  O OP2   . DT  J 6 2   ? 140.897 97.741  82.379  1.00 121.76 ? 2   DT  J OP2   1 
ATOM 9112  O "O5'" . DT  J 6 2   ? 140.540 96.261  80.415  1.00 121.76 ? 2   DT  J "O5'" 1 
ATOM 9113  C "C5'" . DT  J 6 2   ? 139.771 97.324  79.872  1.00 121.76 ? 2   DT  J "C5'" 1 
ATOM 9114  C "C4'" . DT  J 6 2   ? 138.498 96.797  79.240  1.00 121.76 ? 2   DT  J "C4'" 1 
ATOM 9115  O "O4'" . DT  J 6 2   ? 137.695 96.123  80.244  1.00 121.76 ? 2   DT  J "O4'" 1 
ATOM 9116  C "C3'" . DT  J 6 2   ? 137.596 97.860  78.616  1.00 121.76 ? 2   DT  J "C3'" 1 
ATOM 9117  O "O3'" . DT  J 6 2   ? 137.018 97.348  77.436  1.00 121.76 ? 2   DT  J "O3'" 1 
ATOM 9118  C "C2'" . DT  J 6 2   ? 136.546 98.108  79.696  1.00 121.76 ? 2   DT  J "C2'" 1 
ATOM 9119  C "C1'" . DT  J 6 2   ? 136.417 96.725  80.321  1.00 121.76 ? 2   DT  J "C1'" 1 
ATOM 9120  N N1    . DT  J 6 2   ? 135.952 96.716  81.762  1.00 121.76 ? 2   DT  J N1    1 
ATOM 9121  C C2    . DT  J 6 2   ? 136.756 97.234  82.770  1.00 121.76 ? 2   DT  J C2    1 
ATOM 9122  O O2    . DT  J 6 2   ? 137.855 97.731  82.586  1.00 121.76 ? 2   DT  J O2    1 
ATOM 9123  N N3    . DT  J 6 2   ? 136.213 97.151  84.025  1.00 121.76 ? 2   DT  J N3    1 
ATOM 9124  C C4    . DT  J 6 2   ? 135.001 96.605  84.382  1.00 121.76 ? 2   DT  J C4    1 
ATOM 9125  O O4    . DT  J 6 2   ? 134.613 96.575  85.544  1.00 121.76 ? 2   DT  J O4    1 
ATOM 9126  C C5    . DT  J 6 2   ? 134.216 96.081  83.291  1.00 121.76 ? 2   DT  J C5    1 
ATOM 9127  C C7    . DT  J 6 2   ? 132.877 95.473  83.557  1.00 121.76 ? 2   DT  J C7    1 
ATOM 9128  C C6    . DT  J 6 2   ? 134.726 96.155  82.053  1.00 121.76 ? 2   DT  J C6    1 
ATOM 9129  P P     . DC  J 6 3   ? 136.572 98.334  76.252  1.00 111.22 ? 3   DC  J P     1 
ATOM 9130  O OP1   . DC  J 6 3   ? 137.529 98.174  75.137  1.00 111.22 ? 3   DC  J OP1   1 
ATOM 9131  O OP2   . DC  J 6 3   ? 136.344 99.678  76.825  1.00 111.22 ? 3   DC  J OP2   1 
ATOM 9132  O "O5'" . DC  J 6 3   ? 135.163 97.735  75.808  1.00 111.22 ? 3   DC  J "O5'" 1 
ATOM 9133  C "C5'" . DC  J 6 3   ? 134.401 96.971  76.739  1.00 111.22 ? 3   DC  J "C5'" 1 
ATOM 9134  C "C4'" . DC  J 6 3   ? 133.030 97.577  76.909  1.00 111.22 ? 3   DC  J "C4'" 1 
ATOM 9135  O "O4'" . DC  J 6 3   ? 132.594 97.431  78.290  1.00 111.22 ? 3   DC  J "O4'" 1 
ATOM 9136  C "C3'" . DC  J 6 3   ? 132.968 99.077  76.615  1.00 111.22 ? 3   DC  J "C3'" 1 
ATOM 9137  O "O3'" . DC  J 6 3   ? 131.757 99.382  75.947  1.00 111.22 ? 3   DC  J "O3'" 1 
ATOM 9138  C "C2'" . DC  J 6 3   ? 133.001 99.684  78.011  1.00 111.22 ? 3   DC  J "C2'" 1 
ATOM 9139  C "C1'" . DC  J 6 3   ? 132.127 98.682  78.732  1.00 111.22 ? 3   DC  J "C1'" 1 
ATOM 9140  N N1    . DC  J 6 3   ? 132.191 98.750  80.216  1.00 111.22 ? 3   DC  J N1    1 
ATOM 9141  C C2    . DC  J 6 3   ? 131.107 98.285  80.958  1.00 111.22 ? 3   DC  J C2    1 
ATOM 9142  O O2    . DC  J 6 3   ? 130.135 97.819  80.356  1.00 111.22 ? 3   DC  J O2    1 
ATOM 9143  N N3    . DC  J 6 3   ? 131.155 98.350  82.307  1.00 111.22 ? 3   DC  J N3    1 
ATOM 9144  C C4    . DC  J 6 3   ? 132.228 98.863  82.906  1.00 111.22 ? 3   DC  J C4    1 
ATOM 9145  N N4    . DC  J 6 3   ? 132.236 98.906  84.240  1.00 111.22 ? 3   DC  J N4    1 
ATOM 9146  C C5    . DC  J 6 3   ? 133.346 99.349  82.165  1.00 111.22 ? 3   DC  J C5    1 
ATOM 9147  C C6    . DC  J 6 3   ? 133.284 99.275  80.833  1.00 111.22 ? 3   DC  J C6    1 
ATOM 9148  P P     . DG  J 6 4   ? 131.776 100.327 74.652  1.00 102.52 ? 4   DG  J P     1 
ATOM 9149  O OP1   . DG  J 6 4   ? 132.519 99.606  73.594  1.00 102.52 ? 4   DG  J OP1   1 
ATOM 9150  O OP2   . DG  J 6 4   ? 132.235 101.661 75.100  1.00 102.52 ? 4   DG  J OP2   1 
ATOM 9151  O "O5'" . DG  J 6 4   ? 130.238 100.448 74.234  1.00 102.52 ? 4   DG  J "O5'" 1 
ATOM 9152  C "C5'" . DG  J 6 4   ? 129.412 99.291  74.198  1.00 102.52 ? 4   DG  J "C5'" 1 
ATOM 9153  C "C4'" . DG  J 6 4   ? 128.136 99.493  75.005  1.00 102.52 ? 4   DG  J "C4'" 1 
ATOM 9154  O "O4'" . DG  J 6 4   ? 128.437 99.454  76.424  1.00 102.52 ? 4   DG  J "O4'" 1 
ATOM 9155  C "C3'" . DG  J 6 4   ? 127.400 100.812 74.769  1.00 102.52 ? 4   DG  J "C3'" 1 
ATOM 9156  O "O3'" . DG  J 6 4   ? 126.005 100.575 74.760  1.00 102.52 ? 4   DG  J "O3'" 1 
ATOM 9157  C "C2'" . DG  J 6 4   ? 127.808 101.650 75.979  1.00 102.52 ? 4   DG  J "C2'" 1 
ATOM 9158  C "C1'" . DG  J 6 4   ? 127.879 100.584 77.055  1.00 102.52 ? 4   DG  J "C1'" 1 
ATOM 9159  N N9    . DG  J 6 4   ? 128.725 100.932 78.194  1.00 102.52 ? 4   DG  J N9    1 
ATOM 9160  C C8    . DG  J 6 4   ? 129.987 101.465 78.159  1.00 102.52 ? 4   DG  J C8    1 
ATOM 9161  N N7    . DG  J 6 4   ? 130.505 101.653 79.340  1.00 102.52 ? 4   DG  J N7    1 
ATOM 9162  C C5    . DG  J 6 4   ? 129.524 101.212 80.215  1.00 102.52 ? 4   DG  J C5    1 
ATOM 9163  C C6    . DG  J 6 4   ? 129.511 101.169 81.630  1.00 102.52 ? 4   DG  J C6    1 
ATOM 9164  O O6    . DG  J 6 4   ? 130.396 101.526 82.418  1.00 102.52 ? 4   DG  J O6    1 
ATOM 9165  N N1    . DG  J 6 4   ? 128.315 100.652 82.117  1.00 102.52 ? 4   DG  J N1    1 
ATOM 9166  C C2    . DG  J 6 4   ? 127.268 100.228 81.335  1.00 102.52 ? 4   DG  J C2    1 
ATOM 9167  N N2    . DG  J 6 4   ? 126.197 99.750  81.974  1.00 102.52 ? 4   DG  J N2    1 
ATOM 9168  N N3    . DG  J 6 4   ? 127.271 100.259 80.013  1.00 102.52 ? 4   DG  J N3    1 
ATOM 9169  C C4    . DG  J 6 4   ? 128.425 100.762 79.523  1.00 102.52 ? 4   DG  J C4    1 
ATOM 9170  P P     . DA  J 6 5   ? 125.025 101.491 73.879  1.00 97.67  ? 5   DA  J P     1 
ATOM 9171  O OP1   . DA  J 6 5   ? 124.518 100.660 72.766  1.00 97.67  ? 5   DA  J OP1   1 
ATOM 9172  O OP2   . DA  J 6 5   ? 125.712 102.774 73.612  1.00 97.67  ? 5   DA  J OP2   1 
ATOM 9173  O "O5'" . DA  J 6 5   ? 123.809 101.799 74.861  1.00 97.67  ? 5   DA  J "O5'" 1 
ATOM 9174  C "C5'" . DA  J 6 5   ? 123.090 100.729 75.453  1.00 97.67  ? 5   DA  J "C5'" 1 
ATOM 9175  C "C4'" . DA  J 6 5   ? 122.448 101.161 76.760  1.00 97.67  ? 5   DA  J "C4'" 1 
ATOM 9176  O "O4'" . DA  J 6 5   ? 123.468 101.309 77.781  1.00 97.67  ? 5   DA  J "O4'" 1 
ATOM 9177  C "C3'" . DA  J 6 5   ? 121.701 102.490 76.709  1.00 97.67  ? 5   DA  J "C3'" 1 
ATOM 9178  O "O3'" . DA  J 6 5   ? 120.481 102.372 77.411  1.00 97.67  ? 5   DA  J "O3'" 1 
ATOM 9179  C "C2'" . DA  J 6 5   ? 122.659 103.457 77.401  1.00 97.67  ? 5   DA  J "C2'" 1 
ATOM 9180  C "C1'" . DA  J 6 5   ? 123.323 102.555 78.422  1.00 97.67  ? 5   DA  J "C1'" 1 
ATOM 9181  N N9    . DA  J 6 5   ? 124.649 103.004 78.835  1.00 97.67  ? 5   DA  J N9    1 
ATOM 9182  C C8    . DA  J 6 5   ? 125.656 103.421 78.024  1.00 97.67  ? 5   DA  J C8    1 
ATOM 9183  N N7    . DA  J 6 5   ? 126.750 103.748 78.659  1.00 97.67  ? 5   DA  J N7    1 
ATOM 9184  C C5    . DA  J 6 5   ? 126.440 103.531 79.984  1.00 97.67  ? 5   DA  J C5    1 
ATOM 9185  C C6    . DA  J 6 5   ? 127.180 103.690 81.171  1.00 97.67  ? 5   DA  J C6    1 
ATOM 9186  N N6    . DA  J 6 5   ? 128.441 104.135 81.196  1.00 97.67  ? 5   DA  J N6    1 
ATOM 9187  N N1    . DA  J 6 5   ? 126.574 103.382 82.334  1.00 97.67  ? 5   DA  J N1    1 
ATOM 9188  C C2    . DA  J 6 5   ? 125.310 102.941 82.306  1.00 97.67  ? 5   DA  J C2    1 
ATOM 9189  N N3    . DA  J 6 5   ? 124.517 102.748 81.253  1.00 97.67  ? 5   DA  J N3    1 
ATOM 9190  C C4    . DA  J 6 5   ? 125.148 103.065 80.113  1.00 97.67  ? 5   DA  J C4    1 
ATOM 9191  P P     . DG  J 6 6   ? 119.255 103.359 77.089  1.00 92.82  ? 6   DG  J P     1 
ATOM 9192  O OP1   . DG  J 6 6   ? 118.111 102.528 76.656  1.00 92.82  ? 6   DG  J OP1   1 
ATOM 9193  O OP2   . DG  J 6 6   ? 119.743 104.453 76.226  1.00 92.82  ? 6   DG  J OP2   1 
ATOM 9194  O "O5'" . DG  J 6 6   ? 118.912 103.995 78.509  1.00 92.82  ? 6   DG  J "O5'" 1 
ATOM 9195  C "C5'" . DG  J 6 6   ? 119.112 103.225 79.689  1.00 92.82  ? 6   DG  J "C5'" 1 
ATOM 9196  C "C4'" . DG  J 6 6   ? 119.446 104.117 80.867  1.00 92.82  ? 6   DG  J "C4'" 1 
ATOM 9197  O "O4'" . DG  J 6 6   ? 120.884 104.310 80.954  1.00 92.82  ? 6   DG  J "O4'" 1 
ATOM 9198  C "C3'" . DG  J 6 6   ? 118.833 105.516 80.810  1.00 92.82  ? 6   DG  J "C3'" 1 
ATOM 9199  O "O3'" . DG  J 6 6   ? 118.331 105.848 82.078  1.00 92.82  ? 6   DG  J "O3'" 1 
ATOM 9200  C "C2'" . DG  J 6 6   ? 120.028 106.391 80.449  1.00 92.82  ? 6   DG  J "C2'" 1 
ATOM 9201  C "C1'" . DG  J 6 6   ? 121.130 105.669 81.198  1.00 92.82  ? 6   DG  J "C1'" 1 
ATOM 9202  N N9    . DG  J 6 6   ? 122.480 106.007 80.753  1.00 92.82  ? 6   DG  J N9    1 
ATOM 9203  C C8    . DG  J 6 6   ? 122.903 106.197 79.468  1.00 92.82  ? 6   DG  J C8    1 
ATOM 9204  N N7    . DG  J 6 6   ? 124.168 106.494 79.376  1.00 92.82  ? 6   DG  J N7    1 
ATOM 9205  C C5    . DG  J 6 6   ? 124.606 106.516 80.686  1.00 92.82  ? 6   DG  J C5    1 
ATOM 9206  C C6    . DG  J 6 6   ? 125.889 106.787 81.209  1.00 92.82  ? 6   DG  J C6    1 
ATOM 9207  O O6    . DG  J 6 6   ? 126.924 107.067 80.598  1.00 92.82  ? 6   DG  J O6    1 
ATOM 9208  N N1    . DG  J 6 6   ? 125.906 106.705 82.593  1.00 92.82  ? 6   DG  J N1    1 
ATOM 9209  C C2    . DG  J 6 6   ? 124.820 106.402 83.372  1.00 92.82  ? 6   DG  J C2    1 
ATOM 9210  N N2    . DG  J 6 6   ? 125.030 106.379 84.693  1.00 92.82  ? 6   DG  J N2    1 
ATOM 9211  N N3    . DG  J 6 6   ? 123.610 106.147 82.894  1.00 92.82  ? 6   DG  J N3    1 
ATOM 9212  C C4    . DG  J 6 6   ? 123.580 106.221 81.547  1.00 92.82  ? 6   DG  J C4    1 
ATOM 9213  P P     . DA  J 6 7   ? 116.957 106.659 82.235  1.00 88.58  ? 7   DA  J P     1 
ATOM 9214  O OP1   . DA  J 6 7   ? 115.864 105.676 82.381  1.00 88.58  ? 7   DA  J OP1   1 
ATOM 9215  O OP2   . DA  J 6 7   ? 116.891 107.681 81.171  1.00 88.58  ? 7   DA  J OP2   1 
ATOM 9216  O "O5'" . DA  J 6 7   ? 117.142 107.414 83.626  1.00 88.58  ? 7   DA  J "O5'" 1 
ATOM 9217  C "C5'" . DA  J 6 7   ? 117.871 106.791 84.666  1.00 88.58  ? 7   DA  J "C5'" 1 
ATOM 9218  C "C4'" . DA  J 6 7   ? 118.917 107.732 85.232  1.00 88.58  ? 7   DA  J "C4'" 1 
ATOM 9219  O "O4'" . DA  J 6 7   ? 120.066 107.772 84.366  1.00 88.58  ? 7   DA  J "O4'" 1 
ATOM 9220  C "C3'" . DA  J 6 7   ? 118.463 109.181 85.406  1.00 88.58  ? 7   DA  J "C3'" 1 
ATOM 9221  O "O3'" . DA  J 6 7   ? 118.397 109.482 86.792  1.00 88.58  ? 7   DA  J "O3'" 1 
ATOM 9222  C "C2'" . DA  J 6 7   ? 119.540 110.008 84.682  1.00 88.58  ? 7   DA  J "C2'" 1 
ATOM 9223  C "C1'" . DA  J 6 7   ? 120.679 109.020 84.511  1.00 88.58  ? 7   DA  J "C1'" 1 
ATOM 9224  N N9    . DA  J 6 7   ? 121.494 109.266 83.328  1.00 88.58  ? 7   DA  J N9    1 
ATOM 9225  C C8    . DA  J 6 7   ? 121.069 109.306 82.036  1.00 88.58  ? 7   DA  J C8    1 
ATOM 9226  N N7    . DA  J 6 7   ? 122.023 109.540 81.172  1.00 88.58  ? 7   DA  J N7    1 
ATOM 9227  C C5    . DA  J 6 7   ? 123.150 109.668 81.954  1.00 88.58  ? 7   DA  J C5    1 
ATOM 9228  C C6    . DA  J 6 7   ? 124.493 109.930 81.640  1.00 88.58  ? 7   DA  J C6    1 
ATOM 9229  N N6    . DA  J 6 7   ? 124.932 110.111 80.397  1.00 88.58  ? 7   DA  J N6    1 
ATOM 9230  N N1    . DA  J 6 7   ? 125.372 109.999 82.656  1.00 88.58  ? 7   DA  J N1    1 
ATOM 9231  C C2    . DA  J 6 7   ? 124.928 109.817 83.902  1.00 88.58  ? 7   DA  J C2    1 
ATOM 9232  N N3    . DA  J 6 7   ? 123.689 109.564 84.316  1.00 88.58  ? 7   DA  J N3    1 
ATOM 9233  C C4    . DA  J 6 7   ? 122.843 109.501 83.284  1.00 88.58  ? 7   DA  J C4    1 
ATOM 9234  P P     . DA  J 6 8   ? 117.948 110.931 87.317  1.00 87.27  ? 8   DA  J P     1 
ATOM 9235  O OP1   . DA  J 6 8   ? 117.252 110.722 88.601  1.00 87.27  ? 8   DA  J OP1   1 
ATOM 9236  O OP2   . DA  J 6 8   ? 117.244 111.665 86.245  1.00 87.27  ? 8   DA  J OP2   1 
ATOM 9237  O "O5'" . DA  J 6 8   ? 119.337 111.649 87.613  1.00 87.27  ? 8   DA  J "O5'" 1 
ATOM 9238  C "C5'" . DA  J 6 8   ? 120.380 110.914 88.229  1.00 87.27  ? 8   DA  J "C5'" 1 
ATOM 9239  C "C4'" . DA  J 6 8   ? 121.623 111.763 88.368  1.00 87.27  ? 8   DA  J "C4'" 1 
ATOM 9240  O "O4'" . DA  J 6 8   ? 122.392 111.688 87.147  1.00 87.27  ? 8   DA  J "O4'" 1 
ATOM 9241  C "C3'" . DA  J 6 8   ? 121.340 113.234 88.624  1.00 87.27  ? 8   DA  J "C3'" 1 
ATOM 9242  O "O3'" . DA  J 6 8   ? 122.009 113.670 89.787  1.00 87.27  ? 8   DA  J "O3'" 1 
ATOM 9243  C "C2'" . DA  J 6 8   ? 121.841 113.947 87.372  1.00 87.27  ? 8   DA  J "C2'" 1 
ATOM 9244  C "C1'" . DA  J 6 8   ? 122.814 112.965 86.756  1.00 87.27  ? 8   DA  J "C1'" 1 
ATOM 9245  N N9    . DA  J 6 8   ? 122.802 113.017 85.300  1.00 87.27  ? 8   DA  J N9    1 
ATOM 9246  C C8    . DA  J 6 8   ? 121.707 112.933 84.490  1.00 87.27  ? 8   DA  J C8    1 
ATOM 9247  N N7    . DA  J 6 8   ? 121.984 113.020 83.215  1.00 87.27  ? 8   DA  J N7    1 
ATOM 9248  C C5    . DA  J 6 8   ? 123.355 113.181 83.187  1.00 87.27  ? 8   DA  J C5    1 
ATOM 9249  C C6    . DA  J 6 8   ? 124.266 113.333 82.133  1.00 87.27  ? 8   DA  J C6    1 
ATOM 9250  N N6    . DA  J 6 8   ? 123.901 113.345 80.851  1.00 87.27  ? 8   DA  J N6    1 
ATOM 9251  N N1    . DA  J 6 8   ? 125.571 113.471 82.444  1.00 87.27  ? 8   DA  J N1    1 
ATOM 9252  C C2    . DA  J 6 8   ? 125.929 113.457 83.729  1.00 87.27  ? 8   DA  J C2    1 
ATOM 9253  N N3    . DA  J 6 8   ? 125.162 113.319 84.806  1.00 87.27  ? 8   DA  J N3    1 
ATOM 9254  C C4    . DA  J 6 8   ? 123.876 113.185 84.462  1.00 87.27  ? 8   DA  J C4    1 
ATOM 9255  P P     . DT  J 6 9   ? 121.748 115.146 90.363  1.00 93.15  ? 9   DT  J P     1 
ATOM 9256  O OP1   . DT  J 6 9   ? 121.809 115.084 91.835  1.00 93.15  ? 9   DT  J OP1   1 
ATOM 9257  O OP2   . DT  J 6 9   ? 120.528 115.703 89.742  1.00 93.15  ? 9   DT  J OP2   1 
ATOM 9258  O "O5'" . DT  J 6 9   ? 123.030 115.942 89.863  1.00 93.15  ? 9   DT  J "O5'" 1 
ATOM 9259  C "C5'" . DT  J 6 9   ? 124.302 115.345 90.013  1.00 93.15  ? 9   DT  J "C5'" 1 
ATOM 9260  C "C4'" . DT  J 6 9   ? 125.338 116.051 89.167  1.00 93.15  ? 9   DT  J "C4'" 1 
ATOM 9261  O "O4'" . DT  J 6 9   ? 125.111 115.769 87.769  1.00 93.15  ? 9   DT  J "O4'" 1 
ATOM 9262  C "C3'" . DT  J 6 9   ? 125.363 117.572 89.306  1.00 93.15  ? 9   DT  J "C3'" 1 
ATOM 9263  O "O3'" . DT  J 6 9   ? 126.661 117.975 89.728  1.00 93.15  ? 9   DT  J "O3'" 1 
ATOM 9264  C "C2'" . DT  J 6 9   ? 125.025 118.082 87.896  1.00 93.15  ? 9   DT  J "C2'" 1 
ATOM 9265  C "C1'" . DT  J 6 9   ? 125.413 116.910 87.017  1.00 93.15  ? 9   DT  J "C1'" 1 
ATOM 9266  N N1    . DT  J 6 9   ? 124.638 116.844 85.762  1.00 93.15  ? 9   DT  J N1    1 
ATOM 9267  C C2    . DT  J 6 9   ? 125.299 116.840 84.562  1.00 93.15  ? 9   DT  J C2    1 
ATOM 9268  O O2    . DT  J 6 9   ? 126.511 116.893 84.466  1.00 93.15  ? 9   DT  J O2    1 
ATOM 9269  N N3    . DT  J 6 9   ? 124.483 116.769 83.469  1.00 93.15  ? 9   DT  J N3    1 
ATOM 9270  C C4    . DT  J 6 9   ? 123.109 116.706 83.457  1.00 93.15  ? 9   DT  J C4    1 
ATOM 9271  O O4    . DT  J 6 9   ? 122.464 116.649 82.421  1.00 93.15  ? 9   DT  J O4    1 
ATOM 9272  C C5    . DT  J 6 9   ? 122.485 116.714 84.747  1.00 93.15  ? 9   DT  J C5    1 
ATOM 9273  C C7    . DT  J 6 9   ? 120.992 116.647 84.857  1.00 93.15  ? 9   DT  J C7    1 
ATOM 9274  C C6    . DT  J 6 9   ? 123.270 116.787 85.824  1.00 93.15  ? 9   DT  J C6    1 
ATOM 9275  P P     . DC  J 6 10  ? 127.021 119.522 89.960  1.00 102.35 ? 10  DC  J P     1 
ATOM 9276  O OP1   . DC  J 6 10  ? 128.050 119.556 91.022  1.00 102.35 ? 10  DC  J OP1   1 
ATOM 9277  O OP2   . DC  J 6 10  ? 125.769 120.293 90.142  1.00 102.35 ? 10  DC  J OP2   1 
ATOM 9278  O "O5'" . DC  J 6 10  ? 127.719 119.941 88.583  1.00 102.35 ? 10  DC  J "O5'" 1 
ATOM 9279  C "C5'" . DC  J 6 10  ? 128.721 119.102 88.024  1.00 102.35 ? 10  DC  J "C5'" 1 
ATOM 9280  C "C4'" . DC  J 6 10  ? 129.256 119.668 86.719  1.00 102.35 ? 10  DC  J "C4'" 1 
ATOM 9281  O "O4'" . DC  J 6 10  ? 128.347 119.353 85.632  1.00 102.35 ? 10  DC  J "O4'" 1 
ATOM 9282  C "C3'" . DC  J 6 10  ? 129.449 121.183 86.689  1.00 102.35 ? 10  DC  J "C3'" 1 
ATOM 9283  O "O3'" . DC  J 6 10  ? 130.709 121.488 86.101  1.00 102.35 ? 10  DC  J "O3'" 1 
ATOM 9284  C "C2'" . DC  J 6 10  ? 128.284 121.663 85.821  1.00 102.35 ? 10  DC  J "C2'" 1 
ATOM 9285  C "C1'" . DC  J 6 10  ? 128.130 120.505 84.858  1.00 102.35 ? 10  DC  J "C1'" 1 
ATOM 9286  N N1    . DC  J 6 10  ? 126.783 120.407 84.251  1.00 102.35 ? 10  DC  J N1    1 
ATOM 9287  C C2    . DC  J 6 10  ? 126.652 120.377 82.864  1.00 102.35 ? 10  DC  J C2    1 
ATOM 9288  O O2    . DC  J 6 10  ? 127.664 120.439 82.163  1.00 102.35 ? 10  DC  J O2    1 
ATOM 9289  N N3    . DC  J 6 10  ? 125.417 120.281 82.324  1.00 102.35 ? 10  DC  J N3    1 
ATOM 9290  C C4    . DC  J 6 10  ? 124.351 120.214 83.113  1.00 102.35 ? 10  DC  J C4    1 
ATOM 9291  N N4    . DC  J 6 10  ? 123.153 120.119 82.533  1.00 102.35 ? 10  DC  J N4    1 
ATOM 9292  C C5    . DC  J 6 10  ? 124.464 120.241 84.530  1.00 102.35 ? 10  DC  J C5    1 
ATOM 9293  C C6    . DC  J 6 10  ? 125.688 120.337 85.050  1.00 102.35 ? 10  DC  J C6    1 
ATOM 9294  P P     . DC  J 6 11  ? 131.243 123.003 86.038  1.00 110.74 ? 11  DC  J P     1 
ATOM 9295  O OP1   . DC  J 6 11  ? 132.716 122.952 86.120  1.00 110.74 ? 11  DC  J OP1   1 
ATOM 9296  O OP2   . DC  J 6 11  ? 130.488 123.813 87.016  1.00 110.74 ? 11  DC  J OP2   1 
ATOM 9297  O "O5'" . DC  J 6 11  ? 130.858 123.482 84.563  1.00 110.74 ? 11  DC  J "O5'" 1 
ATOM 9298  C "C5'" . DC  J 6 11  ? 131.576 122.968 83.449  1.00 110.74 ? 11  DC  J "C5'" 1 
ATOM 9299  C "C4'" . DC  J 6 11  ? 130.955 123.411 82.136  1.00 110.74 ? 11  DC  J "C4'" 1 
ATOM 9300  O "O4'" . DC  J 6 11  ? 129.566 122.994 82.078  1.00 110.74 ? 11  DC  J "O4'" 1 
ATOM 9301  C "C3'" . DC  J 6 11  ? 130.948 124.925 81.883  1.00 110.74 ? 11  DC  J "C3'" 1 
ATOM 9302  O "O3'" . DC  J 6 11  ? 131.322 125.179 80.534  1.00 110.74 ? 11  DC  J "O3'" 1 
ATOM 9303  C "C2'" . DC  J 6 11  ? 129.488 125.287 82.123  1.00 110.74 ? 11  DC  J "C2'" 1 
ATOM 9304  C "C1'" . DC  J 6 11  ? 128.821 124.059 81.554  1.00 110.74 ? 11  DC  J "C1'" 1 
ATOM 9305  N N1    . DC  J 6 11  ? 127.401 123.904 81.936  1.00 110.74 ? 11  DC  J N1    1 
ATOM 9306  C C2    . DC  J 6 11  ? 126.437 123.804 80.936  1.00 110.74 ? 11  DC  J C2    1 
ATOM 9307  O O2    . DC  J 6 11  ? 126.796 123.854 79.758  1.00 110.74 ? 11  DC  J O2    1 
ATOM 9308  N N3    . DC  J 6 11  ? 125.141 123.671 81.287  1.00 110.74 ? 11  DC  J N3    1 
ATOM 9309  C C4    . DC  J 6 11  ? 124.800 123.629 82.573  1.00 110.74 ? 11  DC  J C4    1 
ATOM 9310  N N4    . DC  J 6 11  ? 123.506 123.493 82.873  1.00 110.74 ? 11  DC  J N4    1 
ATOM 9311  C C5    . DC  J 6 11  ? 125.773 123.729 83.610  1.00 110.74 ? 11  DC  J C5    1 
ATOM 9312  C C6    . DC  J 6 11  ? 127.049 123.865 83.246  1.00 110.74 ? 11  DC  J C6    1 
ATOM 9313  P P     . DC  J 6 12  ? 131.920 126.603 80.084  1.00 110.32 ? 12  DC  J P     1 
ATOM 9314  O OP1   . DC  J 6 12  ? 133.368 126.577 80.377  1.00 110.32 ? 12  DC  J OP1   1 
ATOM 9315  O OP2   . DC  J 6 12  ? 131.079 127.699 80.616  1.00 110.32 ? 12  DC  J OP2   1 
ATOM 9316  O "O5'" . DC  J 6 12  ? 131.716 126.600 78.501  1.00 110.32 ? 12  DC  J "O5'" 1 
ATOM 9317  C "C5'" . DC  J 6 12  ? 130.649 125.847 77.930  1.00 110.32 ? 12  DC  J "C5'" 1 
ATOM 9318  C "C4'" . DC  J 6 12  ? 129.637 126.753 77.250  1.00 110.32 ? 12  DC  J "C4'" 1 
ATOM 9319  O "O4'" . DC  J 6 12  ? 128.304 126.457 77.749  1.00 110.32 ? 12  DC  J "O4'" 1 
ATOM 9320  C "C3'" . DC  J 6 12  ? 129.850 128.252 77.474  1.00 110.32 ? 12  DC  J "C3'" 1 
ATOM 9321  O "O3'" . DC  J 6 12  ? 129.701 128.952 76.249  1.00 110.32 ? 12  DC  J "O3'" 1 
ATOM 9322  C "C2'" . DC  J 6 12  ? 128.750 128.616 78.466  1.00 110.32 ? 12  DC  J "C2'" 1 
ATOM 9323  C "C1'" . DC  J 6 12  ? 127.650 127.664 78.055  1.00 110.32 ? 12  DC  J "C1'" 1 
ATOM 9324  N N1    . DC  J 6 12  ? 126.667 127.414 79.131  1.00 110.32 ? 12  DC  J N1    1 
ATOM 9325  C C2    . DC  J 6 12  ? 125.320 127.266 78.816  1.00 110.32 ? 12  DC  J C2    1 
ATOM 9326  O O2    . DC  J 6 12  ? 124.968 127.346 77.635  1.00 110.32 ? 12  DC  J O2    1 
ATOM 9327  N N3    . DC  J 6 12  ? 124.438 127.048 79.814  1.00 110.32 ? 12  DC  J N3    1 
ATOM 9328  C C4    . DC  J 6 12  ? 124.858 126.977 81.069  1.00 110.32 ? 12  DC  J C4    1 
ATOM 9329  N N4    . DC  J 6 12  ? 123.954 126.759 82.022  1.00 110.32 ? 12  DC  J N4    1 
ATOM 9330  C C5    . DC  J 6 12  ? 126.225 127.131 81.410  1.00 110.32 ? 12  DC  J C5    1 
ATOM 9331  C C6    . DC  J 6 12  ? 127.085 127.346 80.417  1.00 110.32 ? 12  DC  J C6    1 
ATOM 9332  P P     . DG  J 6 13  ? 130.216 130.468 76.107  1.00 108.88 ? 13  DG  J P     1 
ATOM 9333  O OP1   . DG  J 6 13  ? 131.084 130.516 74.912  1.00 108.88 ? 13  DG  J OP1   1 
ATOM 9334  O OP2   . DG  J 6 13  ? 130.757 130.932 77.404  1.00 108.88 ? 13  DG  J OP2   1 
ATOM 9335  O "O5'" . DG  J 6 13  ? 128.887 131.291 75.777  1.00 108.88 ? 13  DG  J "O5'" 1 
ATOM 9336  C "C5'" . DG  J 6 13  ? 128.427 131.369 74.436  1.00 108.88 ? 13  DG  J "C5'" 1 
ATOM 9337  C "C4'" . DG  J 6 13  ? 126.911 131.342 74.372  1.00 108.88 ? 13  DG  J "C4'" 1 
ATOM 9338  O "O4'" . DG  J 6 13  ? 126.380 130.615 75.508  1.00 108.88 ? 13  DG  J "O4'" 1 
ATOM 9339  C "C3'" . DG  J 6 13  ? 126.231 132.715 74.389  1.00 108.88 ? 13  DG  J "C3'" 1 
ATOM 9340  O "O3'" . DG  J 6 13  ? 125.291 132.800 73.323  1.00 108.88 ? 13  DG  J "O3'" 1 
ATOM 9341  C "C2'" . DG  J 6 13  ? 125.537 132.754 75.749  1.00 108.88 ? 13  DG  J "C2'" 1 
ATOM 9342  C "C1'" . DG  J 6 13  ? 125.240 131.285 75.973  1.00 108.88 ? 13  DG  J "C1'" 1 
ATOM 9343  N N9    . DG  J 6 13  ? 125.032 130.933 77.373  1.00 108.88 ? 13  DG  J N9    1 
ATOM 9344  C C8    . DG  J 6 13  ? 125.989 130.833 78.349  1.00 108.88 ? 13  DG  J C8    1 
ATOM 9345  N N7    . DG  J 6 13  ? 125.508 130.497 79.511  1.00 108.88 ? 13  DG  J N7    1 
ATOM 9346  C C5    . DG  J 6 13  ? 124.144 130.369 79.291  1.00 108.88 ? 13  DG  J C5    1 
ATOM 9347  C C6    . DG  J 6 13  ? 123.113 130.018 80.183  1.00 108.88 ? 13  DG  J C6    1 
ATOM 9348  O O6    . DG  J 6 13  ? 123.203 129.751 81.382  1.00 108.88 ? 13  DG  J O6    1 
ATOM 9349  N N1    . DG  J 6 13  ? 121.874 130.001 79.559  1.00 108.88 ? 13  DG  J N1    1 
ATOM 9350  C C2    . DG  J 6 13  ? 121.660 130.282 78.236  1.00 108.88 ? 13  DG  J C2    1 
ATOM 9351  N N2    . DG  J 6 13  ? 120.393 130.216 77.807  1.00 108.88 ? 13  DG  J N2    1 
ATOM 9352  N N3    . DG  J 6 13  ? 122.623 130.608 77.386  1.00 108.88 ? 13  DG  J N3    1 
ATOM 9353  C C4    . DG  J 6 13  ? 123.836 130.629 77.982  1.00 108.88 ? 13  DG  J C4    1 
ATOM 9354  P P     . DG  J 6 14  ? 124.936 134.225 72.670  1.00 101.00 ? 14  DG  J P     1 
ATOM 9355  O OP1   . DG  J 6 14  ? 124.736 134.015 71.223  1.00 101.00 ? 14  DG  J OP1   1 
ATOM 9356  O OP2   . DG  J 6 14  ? 125.947 135.195 73.146  1.00 101.00 ? 14  DG  J OP2   1 
ATOM 9357  O "O5'" . DG  J 6 14  ? 123.526 134.607 73.316  1.00 101.00 ? 14  DG  J "O5'" 1 
ATOM 9358  C "C5'" . DG  J 6 14  ? 122.380 133.859 72.976  1.00 101.00 ? 14  DG  J "C5'" 1 
ATOM 9359  C "C4'" . DG  J 6 14  ? 121.221 134.180 73.901  1.00 101.00 ? 14  DG  J "C4'" 1 
ATOM 9360  O "O4'" . DG  J 6 14  ? 121.444 133.574 75.197  1.00 101.00 ? 14  DG  J "O4'" 1 
ATOM 9361  C "C3'" . DG  J 6 14  ? 120.978 135.670 74.160  1.00 101.00 ? 14  DG  J "C3'" 1 
ATOM 9362  O "O3'" . DG  J 6 14  ? 119.624 135.980 73.874  1.00 101.00 ? 14  DG  J "O3'" 1 
ATOM 9363  C "C2'" . DG  J 6 14  ? 121.294 135.835 75.650  1.00 101.00 ? 14  DG  J "C2'" 1 
ATOM 9364  C "C1'" . DG  J 6 14  ? 120.988 134.453 76.187  1.00 101.00 ? 14  DG  J "C1'" 1 
ATOM 9365  N N9    . DG  J 6 14  ? 121.679 134.146 77.430  1.00 101.00 ? 14  DG  J N9    1 
ATOM 9366  C C8    . DG  J 6 14  ? 123.024 134.250 77.674  1.00 101.00 ? 14  DG  J C8    1 
ATOM 9367  N N7    . DG  J 6 14  ? 123.359 133.903 78.880  1.00 101.00 ? 14  DG  J N7    1 
ATOM 9368  C C5    . DG  J 6 14  ? 122.160 133.546 79.472  1.00 101.00 ? 14  DG  J C5    1 
ATOM 9369  C C6    . DG  J 6 14  ? 121.896 133.086 80.775  1.00 101.00 ? 14  DG  J C6    1 
ATOM 9370  O O6    . DG  J 6 14  ? 122.700 132.892 81.692  1.00 101.00 ? 14  DG  J O6    1 
ATOM 9371  N N1    . DG  J 6 14  ? 120.546 132.837 80.968  1.00 101.00 ? 14  DG  J N1    1 
ATOM 9372  C C2    . DG  J 6 14  ? 119.574 133.011 80.017  1.00 101.00 ? 14  DG  J C2    1 
ATOM 9373  N N2    . DG  J 6 14  ? 118.322 132.722 80.379  1.00 101.00 ? 14  DG  J N2    1 
ATOM 9374  N N3    . DG  J 6 14  ? 119.811 133.442 78.791  1.00 101.00 ? 14  DG  J N3    1 
ATOM 9375  C C4    . DG  J 6 14  ? 121.120 133.689 78.591  1.00 101.00 ? 14  DG  J C4    1 
ATOM 9376  P P     . DT  J 6 15  ? 119.118 137.502 73.771  1.00 92.77  ? 15  DT  J P     1 
ATOM 9377  O OP1   . DT  J 6 15  ? 118.360 137.615 72.506  1.00 92.77  ? 15  DT  J OP1   1 
ATOM 9378  O OP2   . DT  J 6 15  ? 120.239 138.434 74.024  1.00 92.77  ? 15  DT  J OP2   1 
ATOM 9379  O "O5'" . DT  J 6 15  ? 118.082 137.620 74.977  1.00 92.77  ? 15  DT  J "O5'" 1 
ATOM 9380  C "C5'" . DT  J 6 15  ? 117.056 136.657 75.103  1.00 92.77  ? 15  DT  J "C5'" 1 
ATOM 9381  C "C4'" . DT  J 6 15  ? 116.415 136.708 76.475  1.00 92.77  ? 15  DT  J "C4'" 1 
ATOM 9382  O "O4'" . DT  J 6 15  ? 117.335 136.209 77.474  1.00 92.77  ? 15  DT  J "O4'" 1 
ATOM 9383  C "C3'" . DT  J 6 15  ? 115.993 138.097 76.953  1.00 92.77  ? 15  DT  J "C3'" 1 
ATOM 9384  O "O3'" . DT  J 6 15  ? 114.712 138.011 77.532  1.00 92.77  ? 15  DT  J "O3'" 1 
ATOM 9385  C "C2'" . DT  J 6 15  ? 117.047 138.429 78.006  1.00 92.77  ? 15  DT  J "C2'" 1 
ATOM 9386  C "C1'" . DT  J 6 15  ? 117.275 137.056 78.591  1.00 92.77  ? 15  DT  J "C1'" 1 
ATOM 9387  N N1    . DT  J 6 15  ? 118.526 136.908 79.365  1.00 92.77  ? 15  DT  J N1    1 
ATOM 9388  C C2    . DT  J 6 15  ? 118.464 136.361 80.620  1.00 92.77  ? 15  DT  J C2    1 
ATOM 9389  O O2    . DT  J 6 15  ? 117.424 136.003 81.136  1.00 92.77  ? 15  DT  J O2    1 
ATOM 9390  N N3    . DT  J 6 15  ? 119.666 136.248 81.255  1.00 92.77  ? 15  DT  J N3    1 
ATOM 9391  C C4    . DT  J 6 15  ? 120.898 136.615 80.763  1.00 92.77  ? 15  DT  J C4    1 
ATOM 9392  O O4    . DT  J 6 15  ? 121.925 136.474 81.404  1.00 92.77  ? 15  DT  J O4    1 
ATOM 9393  C C5    . DT  J 6 15  ? 120.893 137.177 79.440  1.00 92.77  ? 15  DT  J C5    1 
ATOM 9394  C C7    . DT  J 6 15  ? 122.177 137.615 78.810  1.00 92.77  ? 15  DT  J C7    1 
ATOM 9395  C C6    . DT  J 6 15  ? 119.720 137.292 78.808  1.00 92.77  ? 15  DT  J C6    1 
ATOM 9396  P P     . DG  J 6 16  ? 113.651 139.199 77.350  1.00 82.90  ? 16  DG  J P     1 
ATOM 9397  O OP1   . DG  J 6 16  ? 112.441 138.581 76.779  1.00 82.90  ? 16  DG  J OP1   1 
ATOM 9398  O OP2   . DG  J 6 16  ? 114.322 140.331 76.675  1.00 82.90  ? 16  DG  J OP2   1 
ATOM 9399  O "O5'" . DG  J 6 16  ? 113.303 139.622 78.848  1.00 82.90  ? 16  DG  J "O5'" 1 
ATOM 9400  C "C5'" . DG  J 6 16  ? 112.638 138.698 79.688  1.00 82.90  ? 16  DG  J "C5'" 1 
ATOM 9401  C "C4'" . DG  J 6 16  ? 113.011 138.905 81.141  1.00 82.90  ? 16  DG  J "C4'" 1 
ATOM 9402  O "O4'" . DG  J 6 16  ? 114.438 138.727 81.323  1.00 82.90  ? 16  DG  J "O4'" 1 
ATOM 9403  C "C3'" . DG  J 6 16  ? 112.684 140.282 81.714  1.00 82.90  ? 16  DG  J "C3'" 1 
ATOM 9404  O "O3'" . DG  J 6 16  ? 112.089 140.104 82.965  1.00 82.90  ? 16  DG  J "O3'" 1 
ATOM 9405  C "C2'" . DG  J 6 16  ? 114.063 140.939 81.847  1.00 82.90  ? 16  DG  J "C2'" 1 
ATOM 9406  C "C1'" . DG  J 6 16  ? 114.901 139.730 82.192  1.00 82.90  ? 16  DG  J "C1'" 1 
ATOM 9407  N N9    . DG  J 6 16  ? 116.334 139.886 81.984  1.00 82.90  ? 16  DG  J N9    1 
ATOM 9408  C C8    . DG  J 6 16  ? 116.963 140.423 80.896  1.00 82.90  ? 16  DG  J C8    1 
ATOM 9409  N N7    . DG  J 6 16  ? 118.264 140.398 80.985  1.00 82.90  ? 16  DG  J N7    1 
ATOM 9410  C C5    . DG  J 6 16  ? 118.505 139.797 82.209  1.00 82.90  ? 16  DG  J C5    1 
ATOM 9411  C C6    . DG  J 6 16  ? 119.726 139.501 82.858  1.00 82.90  ? 16  DG  J C6    1 
ATOM 9412  O O6    . DG  J 6 16  ? 120.879 139.714 82.462  1.00 82.90  ? 16  DG  J O6    1 
ATOM 9413  N N1    . DG  J 6 16  ? 119.517 138.893 84.091  1.00 82.90  ? 16  DG  J N1    1 
ATOM 9414  C C2    . DG  J 6 16  ? 118.288 138.610 84.626  1.00 82.90  ? 16  DG  J C2    1 
ATOM 9415  N N2    . DG  J 6 16  ? 118.279 138.024 85.827  1.00 82.90  ? 16  DG  J N2    1 
ATOM 9416  N N3    . DG  J 6 16  ? 117.142 138.882 84.029  1.00 82.90  ? 16  DG  J N3    1 
ATOM 9417  C C4    . DG  J 6 16  ? 117.326 139.474 82.831  1.00 82.90  ? 16  DG  J C4    1 
ATOM 9418  P P     . DC  J 6 17  ? 110.956 141.107 83.489  1.00 75.54  ? 17  DC  J P     1 
ATOM 9419  O OP1   . DC  J 6 17  ? 109.645 140.585 83.049  1.00 75.54  ? 17  DC  J OP1   1 
ATOM 9420  O OP2   . DC  J 6 17  ? 111.371 142.479 83.126  1.00 75.54  ? 17  DC  J OP2   1 
ATOM 9421  O "O5'" . DC  J 6 17  ? 111.051 140.948 85.074  1.00 75.54  ? 17  DC  J "O5'" 1 
ATOM 9422  C "C5'" . DC  J 6 17  ? 111.898 139.940 85.628  1.00 75.54  ? 17  DC  J "C5'" 1 
ATOM 9423  C "C4'" . DC  J 6 17  ? 112.709 140.495 86.776  1.00 75.54  ? 17  DC  J "C4'" 1 
ATOM 9424  O "O4'" . DC  J 6 17  ? 114.108 140.600 86.391  1.00 75.54  ? 17  DC  J "O4'" 1 
ATOM 9425  C "C3'" . DC  J 6 17  ? 112.292 141.889 87.225  1.00 75.54  ? 17  DC  J "C3'" 1 
ATOM 9426  O "O3'" . DC  J 6 17  ? 112.346 141.965 88.626  1.00 75.54  ? 17  DC  J "O3'" 1 
ATOM 9427  C "C2'" . DC  J 6 17  ? 113.358 142.774 86.587  1.00 75.54  ? 17  DC  J "C2'" 1 
ATOM 9428  C "C1'" . DC  J 6 17  ? 114.575 141.884 86.716  1.00 75.54  ? 17  DC  J "C1'" 1 
ATOM 9429  N N1    . DC  J 6 17  ? 115.685 142.236 85.792  1.00 75.54  ? 17  DC  J N1    1 
ATOM 9430  C C2    . DC  J 6 17  ? 116.966 141.725 86.023  1.00 75.54  ? 17  DC  J C2    1 
ATOM 9431  O O2    . DC  J 6 17  ? 117.165 140.999 86.997  1.00 75.54  ? 17  DC  J O2    1 
ATOM 9432  N N3    . DC  J 6 17  ? 117.966 142.054 85.181  1.00 75.54  ? 17  DC  J N3    1 
ATOM 9433  C C4    . DC  J 6 17  ? 117.728 142.847 84.146  1.00 75.54  ? 17  DC  J C4    1 
ATOM 9434  N N4    . DC  J 6 17  ? 118.749 143.138 83.339  1.00 75.54  ? 17  DC  J N4    1 
ATOM 9435  C C5    . DC  J 6 17  ? 116.431 143.375 83.889  1.00 75.54  ? 17  DC  J C5    1 
ATOM 9436  C C6    . DC  J 6 17  ? 115.452 143.050 84.732  1.00 75.54  ? 17  DC  J C6    1 
ATOM 9437  P P     . DC  J 6 18  ? 111.011 141.833 89.505  1.00 68.35  ? 18  DC  J P     1 
ATOM 9438  O OP1   . DC  J 6 18  ? 110.420 140.505 89.244  1.00 68.35  ? 18  DC  J OP1   1 
ATOM 9439  O OP2   . DC  J 6 18  ? 110.218 143.061 89.305  1.00 68.35  ? 18  DC  J OP2   1 
ATOM 9440  O "O5'" . DC  J 6 18  ? 111.561 141.841 90.999  1.00 68.35  ? 18  DC  J "O5'" 1 
ATOM 9441  C "C5'" . DC  J 6 18  ? 112.626 140.978 91.354  1.00 68.35  ? 18  DC  J "C5'" 1 
ATOM 9442  C "C4'" . DC  J 6 18  ? 113.861 141.761 91.762  1.00 68.35  ? 18  DC  J "C4'" 1 
ATOM 9443  O "O4'" . DC  J 6 18  ? 114.486 142.353 90.598  1.00 68.35  ? 18  DC  J "O4'" 1 
ATOM 9444  C "C3'" . DC  J 6 18  ? 113.620 142.917 92.733  1.00 68.35  ? 18  DC  J "C3'" 1 
ATOM 9445  O "O3'" . DC  J 6 18  ? 114.624 142.904 93.723  1.00 68.35  ? 18  DC  J "O3'" 1 
ATOM 9446  C "C2'" . DC  J 6 18  ? 113.775 144.140 91.836  1.00 68.35  ? 18  DC  J "C2'" 1 
ATOM 9447  C "C1'" . DC  J 6 18  ? 114.881 143.652 90.936  1.00 68.35  ? 18  DC  J "C1'" 1 
ATOM 9448  N N1    . DC  J 6 18  ? 115.064 144.435 89.698  1.00 68.35  ? 18  DC  J N1    1 
ATOM 9449  C C2    . DC  J 6 18  ? 116.294 144.400 89.042  1.00 68.35  ? 18  DC  J C2    1 
ATOM 9450  O O2    . DC  J 6 18  ? 117.204 143.716 89.505  1.00 68.35  ? 18  DC  J O2    1 
ATOM 9451  N N3    . DC  J 6 18  ? 116.451 145.113 87.917  1.00 68.35  ? 18  DC  J N3    1 
ATOM 9452  C C4    . DC  J 6 18  ? 115.448 145.836 87.444  1.00 68.35  ? 18  DC  J C4    1 
ATOM 9453  N N4    . DC  J 6 18  ? 115.652 146.517 86.318  1.00 68.35  ? 18  DC  J N4    1 
ATOM 9454  C C5    . DC  J 6 18  ? 114.190 145.893 88.098  1.00 68.35  ? 18  DC  J C5    1 
ATOM 9455  C C6    . DC  J 6 18  ? 114.044 145.179 89.211  1.00 68.35  ? 18  DC  J C6    1 
ATOM 9456  P P     . DG  J 6 19  ? 114.334 142.320 95.187  1.00 60.50  ? 19  DG  J P     1 
ATOM 9457  O OP1   . DG  J 6 19  ? 113.834 140.943 95.018  1.00 60.50  ? 19  DG  J OP1   1 
ATOM 9458  O OP2   . DG  J 6 19  ? 113.550 143.325 95.930  1.00 60.50  ? 19  DG  J OP2   1 
ATOM 9459  O "O5'" . DG  J 6 19  ? 115.775 142.267 95.863  1.00 60.50  ? 19  DG  J "O5'" 1 
ATOM 9460  C "C5'" . DG  J 6 19  ? 116.840 141.601 95.210  1.00 60.50  ? 19  DG  J "C5'" 1 
ATOM 9461  C "C4'" . DG  J 6 19  ? 118.075 142.489 95.079  1.00 60.50  ? 19  DG  J "C4'" 1 
ATOM 9462  O "O4'" . DG  J 6 19  ? 117.939 143.385 93.952  1.00 60.50  ? 19  DG  J "O4'" 1 
ATOM 9463  C "C3'" . DG  J 6 19  ? 118.404 143.380 96.268  1.00 60.50  ? 19  DG  J "C3'" 1 
ATOM 9464  O "O3'" . DG  J 6 19  ? 119.796 143.441 96.392  1.00 60.50  ? 19  DG  J "O3'" 1 
ATOM 9465  C "C2'" . DG  J 6 19  ? 117.852 144.728 95.831  1.00 60.50  ? 19  DG  J "C2'" 1 
ATOM 9466  C "C1'" . DG  J 6 19  ? 118.218 144.698 94.370  1.00 60.50  ? 19  DG  J "C1'" 1 
ATOM 9467  N N9    . DG  J 6 19  ? 117.441 145.601 93.543  1.00 60.50  ? 19  DG  J N9    1 
ATOM 9468  C C8    . DG  J 6 19  ? 116.140 145.978 93.720  1.00 60.50  ? 19  DG  J C8    1 
ATOM 9469  N N7    . DG  J 6 19  ? 115.711 146.787 92.799  1.00 60.50  ? 19  DG  J N7    1 
ATOM 9470  C C5    . DG  J 6 19  ? 116.798 146.942 91.958  1.00 60.50  ? 19  DG  J C5    1 
ATOM 9471  C C6    . DG  J 6 19  ? 116.936 147.702 90.788  1.00 60.50  ? 19  DG  J C6    1 
ATOM 9472  O O6    . DG  J 6 19  ? 116.098 148.415 90.232  1.00 60.50  ? 19  DG  J O6    1 
ATOM 9473  N N1    . DG  J 6 19  ? 118.203 147.580 90.248  1.00 60.50  ? 19  DG  J N1    1 
ATOM 9474  C C2    . DG  J 6 19  ? 119.205 146.820 90.773  1.00 60.50  ? 19  DG  J C2    1 
ATOM 9475  N N2    . DG  J 6 19  ? 120.363 146.826 90.119  1.00 60.50  ? 19  DG  J N2    1 
ATOM 9476  N N3    . DG  J 6 19  ? 119.088 146.108 91.867  1.00 60.50  ? 19  DG  J N3    1 
ATOM 9477  C C4    . DG  J 6 19  ? 117.862 146.215 92.404  1.00 60.50  ? 19  DG  J C4    1 
ATOM 9478  P P     . DA  J 6 20  ? 120.486 143.661 97.815  1.00 48.93  ? 20  DA  J P     1 
ATOM 9479  O OP1   . DA  J 6 20  ? 120.757 142.315 98.344  1.00 48.93  ? 20  DA  J OP1   1 
ATOM 9480  O OP2   . DA  J 6 20  ? 119.694 144.630 98.591  1.00 48.93  ? 20  DA  J OP2   1 
ATOM 9481  O "O5'" . DA  J 6 20  ? 121.858 144.369 97.451  1.00 48.93  ? 20  DA  J "O5'" 1 
ATOM 9482  C "C5'" . DA  J 6 20  ? 122.754 143.747 96.564  1.00 48.93  ? 20  DA  J "C5'" 1 
ATOM 9483  C "C4'" . DA  J 6 20  ? 123.480 144.753 95.676  1.00 48.93  ? 20  DA  J "C4'" 1 
ATOM 9484  O "O4'" . DA  J 6 20  ? 122.535 145.518 94.904  1.00 48.93  ? 20  DA  J "O4'" 1 
ATOM 9485  C "C3'" . DA  J 6 20  ? 124.356 145.777 96.373  1.00 48.93  ? 20  DA  J "C3'" 1 
ATOM 9486  O "O3'" . DA  J 6 20  ? 125.417 146.070 95.532  1.00 48.93  ? 20  DA  J "O3'" 1 
ATOM 9487  C "C2'" . DA  J 6 20  ? 123.431 146.975 96.486  1.00 48.93  ? 20  DA  J "C2'" 1 
ATOM 9488  C "C1'" . DA  J 6 20  ? 122.703 146.890 95.165  1.00 48.93  ? 20  DA  J "C1'" 1 
ATOM 9489  N N9    . DA  J 6 20  ? 121.380 147.473 95.169  1.00 48.93  ? 20  DA  J N9    1 
ATOM 9490  C C8    . DA  J 6 20  ? 120.393 147.261 96.072  1.00 48.93  ? 20  DA  J C8    1 
ATOM 9491  N N7    . DA  J 6 20  ? 119.281 147.883 95.792  1.00 48.93  ? 20  DA  J N7    1 
ATOM 9492  C C5    . DA  J 6 20  ? 119.562 148.534 94.615  1.00 48.93  ? 20  DA  J C5    1 
ATOM 9493  C C6    . DA  J 6 20  ? 118.797 149.370 93.793  1.00 48.93  ? 20  DA  J C6    1 
ATOM 9494  N N6    . DA  J 6 20  ? 117.539 149.703 94.060  1.00 48.93  ? 20  DA  J N6    1 
ATOM 9495  N N1    . DA  J 6 20  ? 119.385 149.859 92.681  1.00 48.93  ? 20  DA  J N1    1 
ATOM 9496  C C2    . DA  J 6 20  ? 120.650 149.524 92.421  1.00 48.93  ? 20  DA  J C2    1 
ATOM 9497  N N3    . DA  J 6 20  ? 121.460 148.744 93.119  1.00 48.93  ? 20  DA  J N3    1 
ATOM 9498  C C4    . DA  J 6 20  ? 120.849 148.280 94.213  1.00 48.93  ? 20  DA  J C4    1 
ATOM 9499  P P     . DG  J 6 21  ? 126.835 146.507 96.121  1.00 50.96  ? 21  DG  J P     1 
ATOM 9500  O OP1   . DG  J 6 21  ? 127.830 145.725 95.389  1.00 50.96  ? 21  DG  J OP1   1 
ATOM 9501  O OP2   . DG  J 6 21  ? 126.768 146.533 97.589  1.00 50.96  ? 21  DG  J OP2   1 
ATOM 9502  O "O5'" . DG  J 6 21  ? 127.012 147.979 95.585  1.00 50.96  ? 21  DG  J "O5'" 1 
ATOM 9503  C "C5'" . DG  J 6 21  ? 126.885 148.217 94.211  1.00 50.96  ? 21  DG  J "C5'" 1 
ATOM 9504  C "C4'" . DG  J 6 21  ? 126.554 149.660 93.962  1.00 50.96  ? 21  DG  J "C4'" 1 
ATOM 9505  O "O4'" . DG  J 6 21  ? 125.129 149.866 94.073  1.00 50.96  ? 21  DG  J "O4'" 1 
ATOM 9506  C "C3'" . DG  J 6 21  ? 127.200 150.633 94.938  1.00 50.96  ? 21  DG  J "C3'" 1 
ATOM 9507  O "O3'" . DG  J 6 21  ? 127.762 151.676 94.207  1.00 50.96  ? 21  DG  J "O3'" 1 
ATOM 9508  C "C2'" . DG  J 6 21  ? 126.017 151.116 95.773  1.00 50.96  ? 21  DG  J "C2'" 1 
ATOM 9509  C "C1'" . DG  J 6 21  ? 124.916 151.067 94.747  1.00 50.96  ? 21  DG  J "C1'" 1 
ATOM 9510  N N9    . DG  J 6 21  ? 123.582 151.060 95.318  1.00 50.96  ? 21  DG  J N9    1 
ATOM 9511  C C8    . DG  J 6 21  ? 123.184 150.453 96.471  1.00 50.96  ? 21  DG  J C8    1 
ATOM 9512  N N7    . DG  J 6 21  ? 121.924 150.620 96.736  1.00 50.96  ? 21  DG  J N7    1 
ATOM 9513  C C5    . DG  J 6 21  ? 121.461 151.392 95.692  1.00 50.96  ? 21  DG  J C5    1 
ATOM 9514  C C6    . DG  J 6 21  ? 120.172 151.894 95.439  1.00 50.96  ? 21  DG  J C6    1 
ATOM 9515  O O6    . DG  J 6 21  ? 119.145 151.745 96.109  1.00 50.96  ? 21  DG  J O6    1 
ATOM 9516  N N1    . DG  J 6 21  ? 120.131 152.635 94.271  1.00 50.96  ? 21  DG  J N1    1 
ATOM 9517  C C2    . DG  J 6 21  ? 121.202 152.863 93.455  1.00 50.96  ? 21  DG  J C2    1 
ATOM 9518  N N2    . DG  J 6 21  ? 120.977 153.602 92.372  1.00 50.96  ? 21  DG  J N2    1 
ATOM 9519  N N3    . DG  J 6 21  ? 122.414 152.399 93.679  1.00 50.96  ? 21  DG  J N3    1 
ATOM 9520  C C4    . DG  J 6 21  ? 122.470 151.674 94.813  1.00 50.96  ? 21  DG  J C4    1 
ATOM 9521  P P     . DG  J 6 22  ? 128.987 152.538 94.775  1.00 55.77  ? 22  DG  J P     1 
ATOM 9522  O OP1   . DG  J 6 22  ? 130.207 152.052 94.105  1.00 55.77  ? 22  DG  J OP1   1 
ATOM 9523  O OP2   . DG  J 6 22  ? 128.940 152.577 96.249  1.00 55.77  ? 22  DG  J OP2   1 
ATOM 9524  O "O5'" . DG  J 6 22  ? 128.639 153.987 94.222  1.00 55.77  ? 22  DG  J "O5'" 1 
ATOM 9525  C "C5'" . DG  J 6 22  ? 128.011 154.097 92.961  1.00 55.77  ? 22  DG  J "C5'" 1 
ATOM 9526  C "C4'" . DG  J 6 22  ? 126.998 155.223 92.946  1.00 55.77  ? 22  DG  J "C4'" 1 
ATOM 9527  O "O4'" . DG  J 6 22  ? 125.731 154.772 93.492  1.00 55.77  ? 22  DG  J "O4'" 1 
ATOM 9528  C "C3'" . DG  J 6 22  ? 127.390 156.463 93.745  1.00 55.77  ? 22  DG  J "C3'" 1 
ATOM 9529  O "O3'" . DG  J 6 22  ? 127.281 157.608 92.913  1.00 55.77  ? 22  DG  J "O3'" 1 
ATOM 9530  C "C2'" . DG  J 6 22  ? 126.364 156.487 94.875  1.00 55.77  ? 22  DG  J "C2'" 1 
ATOM 9531  C "C1'" . DG  J 6 22  ? 125.174 155.824 94.220  1.00 55.77  ? 22  DG  J "C1'" 1 
ATOM 9532  N N9    . DG  J 6 22  ? 124.213 155.284 95.175  1.00 55.77  ? 22  DG  J N9    1 
ATOM 9533  C C8    . DG  J 6 22  ? 124.477 154.413 96.194  1.00 55.77  ? 22  DG  J C8    1 
ATOM 9534  N N7    . DG  J 6 22  ? 123.432 154.109 96.898  1.00 55.77  ? 22  DG  J N7    1 
ATOM 9535  C C5    . DG  J 6 22  ? 122.408 154.827 96.312  1.00 55.77  ? 22  DG  J C5    1 
ATOM 9536  C C6    . DG  J 6 22  ? 121.042 154.891 96.652  1.00 55.77  ? 22  DG  J C6    1 
ATOM 9537  O O6    . DG  J 6 22  ? 120.458 154.300 97.565  1.00 55.77  ? 22  DG  J O6    1 
ATOM 9538  N N1    . DG  J 6 22  ? 120.338 155.736 95.810  1.00 55.77  ? 22  DG  J N1    1 
ATOM 9539  C C2    . DG  J 6 22  ? 120.886 156.436 94.770  1.00 55.77  ? 22  DG  J C2    1 
ATOM 9540  N N2    . DG  J 6 22  ? 120.048 157.207 94.066  1.00 55.77  ? 22  DG  J N2    1 
ATOM 9541  N N3    . DG  J 6 22  ? 122.171 156.384 94.439  1.00 55.77  ? 22  DG  J N3    1 
ATOM 9542  C C4    . DG  J 6 22  ? 122.867 155.556 95.251  1.00 55.77  ? 22  DG  J C4    1 
ATOM 9543  P P     . DC  J 6 23  ? 127.979 158.998 93.310  1.00 60.30  ? 23  DC  J P     1 
ATOM 9544  O OP1   . DC  J 6 23  ? 128.836 159.372 92.170  1.00 60.30  ? 23  DC  J OP1   1 
ATOM 9545  O OP2   . DC  J 6 23  ? 128.576 158.893 94.657  1.00 60.30  ? 23  DC  J OP2   1 
ATOM 9546  O "O5'" . DC  J 6 23  ? 126.752 160.019 93.385  1.00 60.30  ? 23  DC  J "O5'" 1 
ATOM 9547  C "C5'" . DC  J 6 23  ? 125.845 160.102 92.298  1.00 60.30  ? 23  DC  J "C5'" 1 
ATOM 9548  C "C4'" . DC  J 6 23  ? 124.562 160.811 92.695  1.00 60.30  ? 23  DC  J "C4'" 1 
ATOM 9549  O "O4'" . DC  J 6 23  ? 123.739 159.936 93.508  1.00 60.30  ? 23  DC  J "O4'" 1 
ATOM 9550  C "C3'" . DC  J 6 23  ? 124.735 162.102 93.494  1.00 60.30  ? 23  DC  J "C3'" 1 
ATOM 9551  O "O3'" . DC  J 6 23  ? 123.837 163.087 92.995  1.00 60.30  ? 23  DC  J "O3'" 1 
ATOM 9552  C "C2'" . DC  J 6 23  ? 124.361 161.680 94.910  1.00 60.30  ? 23  DC  J "C2'" 1 
ATOM 9553  C "C1'" . DC  J 6 23  ? 123.292 160.638 94.641  1.00 60.30  ? 23  DC  J "C1'" 1 
ATOM 9554  N N1    . DC  J 6 23  ? 123.128 159.669 95.745  1.00 60.30  ? 23  DC  J N1    1 
ATOM 9555  C C2    . DC  J 6 23  ? 121.874 159.479 96.320  1.00 60.30  ? 23  DC  J C2    1 
ATOM 9556  O O2    . DC  J 6 23  ? 120.919 160.127 95.896  1.00 60.30  ? 23  DC  J O2    1 
ATOM 9557  N N3    . DC  J 6 23  ? 121.745 158.590 97.326  1.00 60.30  ? 23  DC  J N3    1 
ATOM 9558  C C4    . DC  J 6 23  ? 122.806 157.914 97.753  1.00 60.30  ? 23  DC  J C4    1 
ATOM 9559  N N4    . DC  J 6 23  ? 122.636 157.044 98.749  1.00 60.30  ? 23  DC  J N4    1 
ATOM 9560  C C5    . DC  J 6 23  ? 124.091 158.100 97.181  1.00 60.30  ? 23  DC  J C5    1 
ATOM 9561  C C6    . DC  J 6 23  ? 124.204 158.978 96.189  1.00 60.30  ? 23  DC  J C6    1 
ATOM 9562  P P     . DC  J 6 24  ? 124.096 164.654 93.241  1.00 59.82  ? 24  DC  J P     1 
ATOM 9563  O OP1   . DC  J 6 24  ? 124.355 165.251 91.918  1.00 59.82  ? 24  DC  J OP1   1 
ATOM 9564  O OP2   . DC  J 6 24  ? 125.078 164.837 94.326  1.00 59.82  ? 24  DC  J OP2   1 
ATOM 9565  O "O5'" . DC  J 6 24  ? 122.690 165.180 93.778  1.00 59.82  ? 24  DC  J "O5'" 1 
ATOM 9566  C "C5'" . DC  J 6 24  ? 121.729 164.246 94.239  1.00 59.82  ? 24  DC  J "C5'" 1 
ATOM 9567  C "C4'" . DC  J 6 24  ? 120.621 164.932 95.006  1.00 59.82  ? 24  DC  J "C4'" 1 
ATOM 9568  O "O4'" . DC  J 6 24  ? 120.179 164.059 96.072  1.00 59.82  ? 24  DC  J "O4'" 1 
ATOM 9569  C "C3'" . DC  J 6 24  ? 121.025 166.210 95.712  1.00 59.82  ? 24  DC  J "C3'" 1 
ATOM 9570  O "O3'" . DC  J 6 24  ? 119.862 166.958 96.013  1.00 59.82  ? 24  DC  J "O3'" 1 
ATOM 9571  C "C2'" . DC  J 6 24  ? 121.657 165.655 96.975  1.00 59.82  ? 24  DC  J "C2'" 1 
ATOM 9572  C "C1'" . DC  J 6 24  ? 120.695 164.524 97.307  1.00 59.82  ? 24  DC  J "C1'" 1 
ATOM 9573  N N1    . DC  J 6 24  ? 121.331 163.388 98.005  1.00 59.82  ? 24  DC  J N1    1 
ATOM 9574  C C2    . DC  J 6 24  ? 120.579 162.631 98.891  1.00 59.82  ? 24  DC  J C2    1 
ATOM 9575  O O2    . DC  J 6 24  ? 119.396 162.927 99.069  1.00 59.82  ? 24  DC  J O2    1 
ATOM 9576  N N3    . DC  J 6 24  ? 121.166 161.598 99.526  1.00 59.82  ? 24  DC  J N3    1 
ATOM 9577  C C4    . DC  J 6 24  ? 122.445 161.319 99.296  1.00 59.82  ? 24  DC  J C4    1 
ATOM 9578  N N4    . DC  J 6 24  ? 122.983 160.290 99.942  1.00 59.82  ? 24  DC  J N4    1 
ATOM 9579  C C5    . DC  J 6 24  ? 123.228 162.080 98.394  1.00 59.82  ? 24  DC  J C5    1 
ATOM 9580  C C6    . DC  J 6 24  ? 122.636 163.097 97.777  1.00 59.82  ? 24  DC  J C6    1 
ATOM 9581  P P     . DG  J 6 25  ? 119.950 168.523 96.357  1.00 56.62  ? 25  DG  J P     1 
ATOM 9582  O OP1   . DG  J 6 25  ? 119.128 169.212 95.344  1.00 56.62  ? 25  DG  J OP1   1 
ATOM 9583  O OP2   . DG  J 6 25  ? 121.361 168.909 96.552  1.00 56.62  ? 25  DG  J OP2   1 
ATOM 9584  O "O5'" . DG  J 6 25  ? 119.202 168.638 97.762  1.00 56.62  ? 25  DG  J "O5'" 1 
ATOM 9585  C "C5'" . DG  J 6 25  ? 117.839 168.278 97.853  1.00 56.62  ? 25  DG  J "C5'" 1 
ATOM 9586  C "C4'" . DG  J 6 25  ? 117.436 167.943 99.280  1.00 56.62  ? 25  DG  J "C4'" 1 
ATOM 9587  O "O4'" . DG  J 6 25  ? 118.176 166.792 99.759  1.00 56.62  ? 25  DG  J "O4'" 1 
ATOM 9588  C "C3'" . DG  J 6 25  ? 117.653 169.044 100.307 1.00 56.62  ? 25  DG  J "C3'" 1 
ATOM 9589  O "O3'" . DG  J 6 25  ? 116.524 169.092 101.151 1.00 56.62  ? 25  DG  J "O3'" 1 
ATOM 9590  C "C2'" . DG  J 6 25  ? 118.907 168.576 101.057 1.00 56.62  ? 25  DG  J "C2'" 1 
ATOM 9591  C "C1'" . DG  J 6 25  ? 118.722 167.072 101.029 1.00 56.62  ? 25  DG  J "C1'" 1 
ATOM 9592  N N9    . DG  J 6 25  ? 119.951 166.305 101.145 1.00 56.62  ? 25  DG  J N9    1 
ATOM 9593  C C8    . DG  J 6 25  ? 121.127 166.529 100.485 1.00 56.62  ? 25  DG  J C8    1 
ATOM 9594  N N7    . DG  J 6 25  ? 122.047 165.651 100.757 1.00 56.62  ? 25  DG  J N7    1 
ATOM 9595  C C5    . DG  J 6 25  ? 121.431 164.779 101.641 1.00 56.62  ? 25  DG  J C5    1 
ATOM 9596  C C6    . DG  J 6 25  ? 121.934 163.631 102.276 1.00 56.62  ? 25  DG  J C6    1 
ATOM 9597  O O6    . DG  J 6 25  ? 123.058 163.138 102.181 1.00 56.62  ? 25  DG  J O6    1 
ATOM 9598  N N1    . DG  J 6 25  ? 120.984 163.037 103.091 1.00 56.62  ? 25  DG  J N1    1 
ATOM 9599  C C2    . DG  J 6 25  ? 119.712 163.495 103.272 1.00 56.62  ? 25  DG  J C2    1 
ATOM 9600  N N2    . DG  J 6 25  ? 118.935 162.789 104.099 1.00 56.62  ? 25  DG  J N2    1 
ATOM 9601  N N3    . DG  J 6 25  ? 119.227 164.572 102.682 1.00 56.62  ? 25  DG  J N3    1 
ATOM 9602  C C4    . DG  J 6 25  ? 120.141 165.162 101.881 1.00 56.62  ? 25  DG  J C4    1 
ATOM 9603  P P     . DC  J 6 26  ? 116.294 170.322 102.149 1.00 55.92  ? 26  DC  J P     1 
ATOM 9604  O OP1   . DC  J 6 26  ? 114.862 170.667 102.104 1.00 55.92  ? 26  DC  J OP1   1 
ATOM 9605  O OP2   . DC  J 6 26  ? 117.316 171.348 101.855 1.00 55.92  ? 26  DC  J OP2   1 
ATOM 9606  O "O5'" . DC  J 6 26  ? 116.593 169.693 103.583 1.00 55.92  ? 26  DC  J "O5'" 1 
ATOM 9607  C "C5'" . DC  J 6 26  ? 115.790 168.621 104.062 1.00 55.92  ? 26  DC  J "C5'" 1 
ATOM 9608  C "C4'" . DC  J 6 26  ? 116.372 168.010 105.322 1.00 55.92  ? 26  DC  J "C4'" 1 
ATOM 9609  O "O4'" . DC  J 6 26  ? 117.598 167.305 105.013 1.00 55.92  ? 26  DC  J "O4'" 1 
ATOM 9610  C "C3'" . DC  J 6 26  ? 116.729 168.999 106.427 1.00 55.92  ? 26  DC  J "C3'" 1 
ATOM 9611  O "O3'" . DC  J 6 26  ? 116.380 168.444 107.665 1.00 55.92  ? 26  DC  J "O3'" 1 
ATOM 9612  C "C2'" . DC  J 6 26  ? 118.245 169.108 106.300 1.00 55.92  ? 26  DC  J "C2'" 1 
ATOM 9613  C "C1'" . DC  J 6 26  ? 118.582 167.680 105.940 1.00 55.92  ? 26  DC  J "C1'" 1 
ATOM 9614  N N1    . DC  J 6 26  ? 119.895 167.508 105.304 1.00 55.92  ? 26  DC  J N1    1 
ATOM 9615  C C2    . DC  J 6 26  ? 120.534 166.287 105.407 1.00 55.92  ? 26  DC  J C2    1 
ATOM 9616  O O2    . DC  J 6 26  ? 120.000 165.385 106.047 1.00 55.92  ? 26  DC  J O2    1 
ATOM 9617  N N3    . DC  J 6 26  ? 121.733 166.123 104.820 1.00 55.92  ? 26  DC  J N3    1 
ATOM 9618  C C4    . DC  J 6 26  ? 122.279 167.119 104.141 1.00 55.92  ? 26  DC  J C4    1 
ATOM 9619  N N4    . DC  J 6 26  ? 123.463 166.905 103.573 1.00 55.92  ? 26  DC  J N4    1 
ATOM 9620  C C5    . DC  J 6 26  ? 121.642 168.380 104.016 1.00 55.92  ? 26  DC  J C5    1 
ATOM 9621  C C6    . DC  J 6 26  ? 120.459 168.529 104.607 1.00 55.92  ? 26  DC  J C6    1 
ATOM 9622  P P     . DT  J 6 27  ? 115.295 169.153 108.605 1.00 53.27  ? 27  DT  J P     1 
ATOM 9623  O OP1   . DT  J 6 27  ? 113.968 168.911 108.002 1.00 53.27  ? 27  DT  J OP1   1 
ATOM 9624  O OP2   . DT  J 6 27  ? 115.761 170.530 108.875 1.00 53.27  ? 27  DT  J OP2   1 
ATOM 9625  O "O5'" . DT  J 6 27  ? 115.406 168.331 109.968 1.00 53.27  ? 27  DT  J "O5'" 1 
ATOM 9626  C "C5'" . DT  J 6 27  ? 115.591 166.922 109.925 1.00 53.27  ? 27  DT  J "C5'" 1 
ATOM 9627  C "C4'" . DT  J 6 27  ? 116.793 166.498 110.750 1.00 53.27  ? 27  DT  J "C4'" 1 
ATOM 9628  O "O4'" . DT  J 6 27  ? 117.997 166.557 109.946 1.00 53.27  ? 27  DT  J "O4'" 1 
ATOM 9629  C "C3'" . DT  J 6 27  ? 117.083 167.354 111.984 1.00 53.27  ? 27  DT  J "C3'" 1 
ATOM 9630  O "O3'" . DT  J 6 27  ? 117.470 166.523 113.034 1.00 53.27  ? 27  DT  J "O3'" 1 
ATOM 9631  C "C2'" . DT  J 6 27  ? 118.267 168.190 111.525 1.00 53.27  ? 27  DT  J "C2'" 1 
ATOM 9632  C "C1'" . DT  J 6 27  ? 119.002 167.149 110.722 1.00 53.27  ? 27  DT  J "C1'" 1 
ATOM 9633  N N1    . DT  J 6 27  ? 120.038 167.683 109.835 1.00 53.27  ? 27  DT  J N1    1 
ATOM 9634  C C2    . DT  J 6 27  ? 121.031 166.850 109.409 1.00 53.27  ? 27  DT  J C2    1 
ATOM 9635  O O2    . DT  J 6 27  ? 121.100 165.682 109.728 1.00 53.27  ? 27  DT  J O2    1 
ATOM 9636  N N3    . DT  J 6 27  ? 121.947 167.429 108.591 1.00 53.27  ? 27  DT  J N3    1 
ATOM 9637  C C4    . DT  J 6 27  ? 121.968 168.734 108.168 1.00 53.27  ? 27  DT  J C4    1 
ATOM 9638  O O4    . DT  J 6 27  ? 122.834 169.168 107.429 1.00 53.27  ? 27  DT  J O4    1 
ATOM 9639  C C5    . DT  J 6 27  ? 120.900 169.554 108.654 1.00 53.27  ? 27  DT  J C5    1 
ATOM 9640  C C7    . DT  J 6 27  ? 120.822 170.993 108.259 1.00 53.27  ? 27  DT  J C7    1 
ATOM 9641  C C6    . DT  J 6 27  ? 119.999 168.997 109.459 1.00 53.27  ? 27  DT  J C6    1 
ATOM 9642  P P     . DC  J 6 28  ? 116.463 166.169 114.224 1.00 51.31  ? 28  DC  J P     1 
ATOM 9643  O OP1   . DC  J 6 28  ? 115.227 165.633 113.624 1.00 51.31  ? 28  DC  J OP1   1 
ATOM 9644  O OP2   . DC  J 6 28  ? 116.403 167.344 115.114 1.00 51.31  ? 28  DC  J OP2   1 
ATOM 9645  O "O5'" . DC  J 6 28  ? 117.221 164.993 114.989 1.00 51.31  ? 28  DC  J "O5'" 1 
ATOM 9646  C "C5'" . DC  J 6 28  ? 117.970 164.040 114.243 1.00 51.31  ? 28  DC  J "C5'" 1 
ATOM 9647  C "C4'" . DC  J 6 28  ? 119.448 164.091 114.591 1.00 51.31  ? 28  DC  J "C4'" 1 
ATOM 9648  O "O4'" . DC  J 6 28  ? 120.123 165.098 113.796 1.00 51.31  ? 28  DC  J "O4'" 1 
ATOM 9649  C "C3'" . DC  J 6 28  ? 119.775 164.426 116.045 1.00 51.31  ? 28  DC  J "C3'" 1 
ATOM 9650  O "O3'" . DC  J 6 28  ? 120.842 163.622 116.468 1.00 51.31  ? 28  DC  J "O3'" 1 
ATOM 9651  C "C2'" . DC  J 6 28  ? 120.216 165.880 115.953 1.00 51.31  ? 28  DC  J "C2'" 1 
ATOM 9652  C "C1'" . DC  J 6 28  ? 120.962 165.838 114.642 1.00 51.31  ? 28  DC  J "C1'" 1 
ATOM 9653  N N1    . DC  J 6 28  ? 121.213 167.163 114.031 1.00 51.31  ? 28  DC  J N1    1 
ATOM 9654  C C2    . DC  J 6 28  ? 122.224 167.295 113.090 1.00 51.31  ? 28  DC  J C2    1 
ATOM 9655  O O2    . DC  J 6 28  ? 122.893 166.312 112.788 1.00 51.31  ? 28  DC  J O2    1 
ATOM 9656  N N3    . DC  J 6 28  ? 122.451 168.499 112.536 1.00 51.31  ? 28  DC  J N3    1 
ATOM 9657  C C4    . DC  J 6 28  ? 121.710 169.541 112.884 1.00 51.31  ? 28  DC  J C4    1 
ATOM 9658  N N4    . DC  J 6 28  ? 121.974 170.711 112.299 1.00 51.31  ? 28  DC  J N4    1 
ATOM 9659  C C5    . DC  J 6 28  ? 120.674 169.433 113.847 1.00 51.31  ? 28  DC  J C5    1 
ATOM 9660  C C6    . DC  J 6 28  ? 120.462 168.234 114.390 1.00 51.31  ? 28  DC  J C6    1 
ATOM 9661  P P     . DA  J 6 29  ? 120.591 162.341 117.393 1.00 45.97  ? 29  DA  J P     1 
ATOM 9662  O OP1   . DA  J 6 29  ? 119.769 161.394 116.622 1.00 45.97  ? 29  DA  J OP1   1 
ATOM 9663  O OP2   . DA  J 6 29  ? 120.132 162.821 118.707 1.00 45.97  ? 29  DA  J OP2   1 
ATOM 9664  O "O5'" . DA  J 6 29  ? 122.053 161.730 117.576 1.00 45.97  ? 29  DA  J "O5'" 1 
ATOM 9665  C "C5'" . DA  J 6 29  ? 122.732 161.180 116.462 1.00 45.97  ? 29  DA  J "C5'" 1 
ATOM 9666  C "C4'" . DA  J 6 29  ? 124.133 161.751 116.304 1.00 45.97  ? 29  DA  J "C4'" 1 
ATOM 9667  O "O4'" . DA  J 6 29  ? 124.076 163.139 115.909 1.00 45.97  ? 29  DA  J "O4'" 1 
ATOM 9668  C "C3'" . DA  J 6 29  ? 125.019 161.711 117.533 1.00 45.97  ? 29  DA  J "C3'" 1 
ATOM 9669  O "O3'" . DA  J 6 29  ? 126.320 161.420 117.122 1.00 45.97  ? 29  DA  J "O3'" 1 
ATOM 9670  C "C2'" . DA  J 6 29  ? 124.933 163.139 118.049 1.00 45.97  ? 29  DA  J "C2'" 1 
ATOM 9671  C "C1'" . DA  J 6 29  ? 124.914 163.895 116.748 1.00 45.97  ? 29  DA  J "C1'" 1 
ATOM 9672  N N9    . DA  J 6 29  ? 124.350 165.229 116.853 1.00 45.97  ? 29  DA  J N9    1 
ATOM 9673  C C8    . DA  J 6 29  ? 123.323 165.623 117.646 1.00 45.97  ? 29  DA  J C8    1 
ATOM 9674  N N7    . DA  J 6 29  ? 123.018 166.883 117.521 1.00 45.97  ? 29  DA  J N7    1 
ATOM 9675  C C5    . DA  J 6 29  ? 123.901 167.344 116.573 1.00 45.97  ? 29  DA  J C5    1 
ATOM 9676  C C6    . DA  J 6 29  ? 124.094 168.604 115.995 1.00 45.97  ? 29  DA  J C6    1 
ATOM 9677  N N6    . DA  J 6 29  ? 123.363 169.672 116.311 1.00 45.97  ? 29  DA  J N6    1 
ATOM 9678  N N1    . DA  J 6 29  ? 125.068 168.731 115.079 1.00 45.97  ? 29  DA  J N1    1 
ATOM 9679  C C2    . DA  J 6 29  ? 125.800 167.665 114.770 1.00 45.97  ? 29  DA  J C2    1 
ATOM 9680  N N3    . DA  J 6 29  ? 125.705 166.431 115.236 1.00 45.97  ? 29  DA  J N3    1 
ATOM 9681  C C4    . DA  J 6 29  ? 124.728 166.339 116.147 1.00 45.97  ? 29  DA  J C4    1 
ATOM 9682  P P     . DA  J 6 30  ? 127.286 160.535 118.033 1.00 41.52  ? 30  DA  J P     1 
ATOM 9683  O OP1   . DA  J 6 30  ? 127.116 159.147 117.591 1.00 41.52  ? 30  DA  J OP1   1 
ATOM 9684  O OP2   . DA  J 6 30  ? 127.071 160.930 119.433 1.00 41.52  ? 30  DA  J OP2   1 
ATOM 9685  O "O5'" . DA  J 6 30  ? 128.737 161.038 117.637 1.00 41.52  ? 30  DA  J "O5'" 1 
ATOM 9686  C "C5'" . DA  J 6 30  ? 129.093 161.166 116.285 1.00 41.52  ? 30  DA  J "C5'" 1 
ATOM 9687  C "C4'" . DA  J 6 30  ? 129.980 162.377 116.052 1.00 41.52  ? 30  DA  J "C4'" 1 
ATOM 9688  O "O4'" . DA  J 6 30  ? 129.198 163.593 116.131 1.00 41.52  ? 30  DA  J "O4'" 1 
ATOM 9689  C "C3'" . DA  J 6 30  ? 131.136 162.560 117.025 1.00 41.52  ? 30  DA  J "C3'" 1 
ATOM 9690  O "O3'" . DA  J 6 30  ? 132.258 162.995 116.305 1.00 41.52  ? 30  DA  J "O3'" 1 
ATOM 9691  C "C2'" . DA  J 6 30  ? 130.619 163.657 117.947 1.00 41.52  ? 30  DA  J "C2'" 1 
ATOM 9692  C "C1'" . DA  J 6 30  ? 129.848 164.510 116.973 1.00 41.52  ? 30  DA  J "C1'" 1 
ATOM 9693  N N9    . DA  J 6 30  ? 128.833 165.341 117.595 1.00 41.52  ? 30  DA  J N9    1 
ATOM 9694  C C8    . DA  J 6 30  ? 127.933 164.960 118.534 1.00 41.52  ? 30  DA  J C8    1 
ATOM 9695  N N7    . DA  J 6 30  ? 127.119 165.909 118.901 1.00 41.52  ? 30  DA  J N7    1 
ATOM 9696  C C5    . DA  J 6 30  ? 127.512 166.990 118.146 1.00 41.52  ? 30  DA  J C5    1 
ATOM 9697  C C6    . DA  J 6 30  ? 127.041 168.308 118.069 1.00 41.52  ? 30  DA  J C6    1 
ATOM 9698  N N6    . DA  J 6 30  ? 126.031 168.765 118.802 1.00 41.52  ? 30  DA  J N6    1 
ATOM 9699  N N1    . DA  J 6 30  ? 127.651 169.141 117.210 1.00 41.52  ? 30  DA  J N1    1 
ATOM 9700  C C2    . DA  J 6 30  ? 128.670 168.686 116.479 1.00 41.52  ? 30  DA  J C2    1 
ATOM 9701  N N3    . DA  J 6 30  ? 129.197 167.465 116.463 1.00 41.52  ? 30  DA  J N3    1 
ATOM 9702  C C4    . DA  J 6 30  ? 128.565 166.659 117.330 1.00 41.52  ? 30  DA  J C4    1 
ATOM 9703  P P     . DT  J 6 31  ? 133.731 162.893 116.920 1.00 44.09  ? 31  DT  J P     1 
ATOM 9704  O OP1   . DT  J 6 31  ? 134.504 161.996 116.046 1.00 44.09  ? 31  DT  J OP1   1 
ATOM 9705  O OP2   . DT  J 6 31  ? 133.636 162.601 118.358 1.00 44.09  ? 31  DT  J OP2   1 
ATOM 9706  O "O5'" . DT  J 6 31  ? 134.296 164.372 116.760 1.00 44.09  ? 31  DT  J "O5'" 1 
ATOM 9707  C "C5'" . DT  J 6 31  ? 133.961 165.133 115.614 1.00 44.09  ? 31  DT  J "C5'" 1 
ATOM 9708  C "C4'" . DT  J 6 31  ? 134.165 166.613 115.860 1.00 44.09  ? 31  DT  J "C4'" 1 
ATOM 9709  O "O4'" . DT  J 6 31  ? 132.974 167.191 116.447 1.00 44.09  ? 31  DT  J "O4'" 1 
ATOM 9710  C "C3'" . DT  J 6 31  ? 135.310 166.963 116.801 1.00 44.09  ? 31  DT  J "C3'" 1 
ATOM 9711  O "O3'" . DT  J 6 31  ? 136.030 168.038 116.261 1.00 44.09  ? 31  DT  J "O3'" 1 
ATOM 9712  C "C2'" . DT  J 6 31  ? 134.588 167.373 118.075 1.00 44.09  ? 31  DT  J "C2'" 1 
ATOM 9713  C "C1'" . DT  J 6 31  ? 133.350 168.022 117.512 1.00 44.09  ? 31  DT  J "C1'" 1 
ATOM 9714  N N1    . DT  J 6 31  ? 132.212 168.108 118.473 1.00 44.09  ? 31  DT  J N1    1 
ATOM 9715  C C2    . DT  J 6 31  ? 131.506 169.281 118.581 1.00 44.09  ? 31  DT  J C2    1 
ATOM 9716  O O2    . DT  J 6 31  ? 131.763 170.274 117.938 1.00 44.09  ? 31  DT  J O2    1 
ATOM 9717  N N3    . DT  J 6 31  ? 130.481 169.249 119.476 1.00 44.09  ? 31  DT  J N3    1 
ATOM 9718  C C4    . DT  J 6 31  ? 130.099 168.198 120.260 1.00 44.09  ? 31  DT  J C4    1 
ATOM 9719  O O4    . DT  J 6 31  ? 129.162 168.269 121.041 1.00 44.09  ? 31  DT  J O4    1 
ATOM 9720  C C5    . DT  J 6 31  ? 130.870 167.001 120.101 1.00 44.09  ? 31  DT  J C5    1 
ATOM 9721  C C7    . DT  J 6 31  ? 130.535 165.791 120.911 1.00 44.09  ? 31  DT  J C7    1 
ATOM 9722  C C6    . DT  J 6 31  ? 131.876 167.010 119.221 1.00 44.09  ? 31  DT  J C6    1 
ATOM 9723  P P     . DT  J 6 32  ? 137.567 168.274 116.644 1.00 51.30  ? 32  DT  J P     1 
ATOM 9724  O OP1   . DT  J 6 32  ? 138.349 168.140 115.405 1.00 51.30  ? 32  DT  J OP1   1 
ATOM 9725  O OP2   . DT  J 6 32  ? 137.903 167.458 117.825 1.00 51.30  ? 32  DT  J OP2   1 
ATOM 9726  O "O5'" . DT  J 6 32  ? 137.596 169.797 117.093 1.00 51.30  ? 32  DT  J "O5'" 1 
ATOM 9727  C "C5'" . DT  J 6 32  ? 136.601 170.687 116.624 1.00 51.30  ? 32  DT  J "C5'" 1 
ATOM 9728  C "C4'" . DT  J 6 32  ? 136.430 171.842 117.584 1.00 51.30  ? 32  DT  J "C4'" 1 
ATOM 9729  O "O4'" . DT  J 6 32  ? 135.240 171.652 118.381 1.00 51.30  ? 32  DT  J "O4'" 1 
ATOM 9730  C "C3'" . DT  J 6 32  ? 137.576 172.027 118.569 1.00 51.30  ? 32  DT  J "C3'" 1 
ATOM 9731  O "O3'" . DT  J 6 32  ? 137.957 173.393 118.586 1.00 51.30  ? 32  DT  J "O3'" 1 
ATOM 9732  C "C2'" . DT  J 6 32  ? 136.971 171.584 119.902 1.00 51.30  ? 32  DT  J "C2'" 1 
ATOM 9733  C "C1'" . DT  J 6 32  ? 135.521 171.960 119.718 1.00 51.30  ? 32  DT  J "C1'" 1 
ATOM 9734  N N1    . DT  J 6 32  ? 134.600 171.177 120.559 1.00 51.30  ? 32  DT  J N1    1 
ATOM 9735  C C2    . DT  J 6 32  ? 133.502 171.784 121.113 1.00 51.30  ? 32  DT  J C2    1 
ATOM 9736  O O2    . DT  J 6 32  ? 133.240 172.956 120.964 1.00 51.30  ? 32  DT  J O2    1 
ATOM 9737  N N3    . DT  J 6 32  ? 132.720 170.964 121.859 1.00 51.30  ? 32  DT  J N3    1 
ATOM 9738  C C4    . DT  J 6 32  ? 132.913 169.631 122.097 1.00 51.30  ? 32  DT  J C4    1 
ATOM 9739  O O4    . DT  J 6 32  ? 132.151 168.975 122.782 1.00 51.30  ? 32  DT  J O4    1 
ATOM 9740  C C5    . DT  J 6 32  ? 134.073 169.056 121.491 1.00 51.30  ? 32  DT  J C5    1 
ATOM 9741  C C7    . DT  J 6 32  ? 134.382 167.608 121.701 1.00 51.30  ? 32  DT  J C7    1 
ATOM 9742  C C6    . DT  J 6 32  ? 134.851 169.845 120.756 1.00 51.30  ? 32  DT  J C6    1 
ATOM 9743  P P     . DG  J 6 33  ? 139.348 173.855 119.239 1.00 58.06  ? 33  DG  J P     1 
ATOM 9744  O OP1   . DG  J 6 33  ? 140.000 174.743 118.260 1.00 58.06  ? 33  DG  J OP1   1 
ATOM 9745  O OP2   . DG  J 6 33  ? 140.058 172.666 119.742 1.00 58.06  ? 33  DG  J OP2   1 
ATOM 9746  O "O5'" . DG  J 6 33  ? 138.889 174.721 120.494 1.00 58.06  ? 33  DG  J "O5'" 1 
ATOM 9747  C "C5'" . DG  J 6 33  ? 137.730 175.528 120.387 1.00 58.06  ? 33  DG  J "C5'" 1 
ATOM 9748  C "C4'" . DG  J 6 33  ? 137.283 176.034 121.742 1.00 58.06  ? 33  DG  J "C4'" 1 
ATOM 9749  O "O4'" . DG  J 6 33  ? 136.222 175.191 122.257 1.00 58.06  ? 33  DG  J "O4'" 1 
ATOM 9750  C "C3'" . DG  J 6 33  ? 138.368 176.065 122.810 1.00 58.06  ? 33  DG  J "C3'" 1 
ATOM 9751  O "O3'" . DG  J 6 33  ? 138.279 177.275 123.540 1.00 58.06  ? 33  DG  J "O3'" 1 
ATOM 9752  C "C2'" . DG  J 6 33  ? 138.032 174.862 123.681 1.00 58.06  ? 33  DG  J "C2'" 1 
ATOM 9753  C "C1'" . DG  J 6 33  ? 136.521 174.816 123.577 1.00 58.06  ? 33  DG  J "C1'" 1 
ATOM 9754  N N9    . DG  J 6 33  ? 135.978 173.486 123.806 1.00 58.06  ? 33  DG  J N9    1 
ATOM 9755  C C8    . DG  J 6 33  ? 136.507 172.303 123.377 1.00 58.06  ? 33  DG  J C8    1 
ATOM 9756  N N7    . DG  J 6 33  ? 135.811 171.270 123.730 1.00 58.06  ? 33  DG  J N7    1 
ATOM 9757  C C5    . DG  J 6 33  ? 134.754 171.803 124.442 1.00 58.06  ? 33  DG  J C5    1 
ATOM 9758  C C6    . DG  J 6 33  ? 133.670 171.162 125.061 1.00 58.06  ? 33  DG  J C6    1 
ATOM 9759  O O6    . DG  J 6 33  ? 133.435 169.959 125.124 1.00 58.06  ? 33  DG  J O6    1 
ATOM 9760  N N1    . DG  J 6 33  ? 132.825 172.060 125.678 1.00 58.06  ? 33  DG  J N1    1 
ATOM 9761  C C2    . DG  J 6 33  ? 132.995 173.411 125.684 1.00 58.06  ? 33  DG  J C2    1 
ATOM 9762  N N2    . DG  J 6 33  ? 132.070 174.126 126.333 1.00 58.06  ? 33  DG  J N2    1 
ATOM 9763  N N3    . DG  J 6 33  ? 134.007 174.029 125.100 1.00 58.06  ? 33  DG  J N3    1 
ATOM 9764  C C4    . DG  J 6 33  ? 134.843 173.162 124.499 1.00 58.06  ? 33  DG  J C4    1 
ATOM 9765  P P     . DG  J 6 34  ? 139.576 177.897 124.254 1.00 61.39  ? 34  DG  J P     1 
ATOM 9766  O OP1   . DG  J 6 34  ? 139.889 179.174 123.579 1.00 61.39  ? 34  DG  J OP1   1 
ATOM 9767  O OP2   . DG  J 6 34  ? 140.611 176.847 124.363 1.00 61.39  ? 34  DG  J OP2   1 
ATOM 9768  O "O5'" . DG  J 6 34  ? 139.075 178.184 125.736 1.00 61.39  ? 34  DG  J "O5'" 1 
ATOM 9769  C "C5'" . DG  J 6 34  ? 138.723 177.099 126.564 1.00 61.39  ? 34  DG  J "C5'" 1 
ATOM 9770  C "C4'" . DG  J 6 34  ? 137.673 177.503 127.573 1.00 61.39  ? 34  DG  J "C4'" 1 
ATOM 9771  O "O4'" . DG  J 6 34  ? 136.590 176.540 127.539 1.00 61.39  ? 34  DG  J "O4'" 1 
ATOM 9772  C "C3'" . DG  J 6 34  ? 138.157 177.476 129.005 1.00 61.39  ? 34  DG  J "C3'" 1 
ATOM 9773  O "O3'" . DG  J 6 34  ? 137.281 178.226 129.818 1.00 61.39  ? 34  DG  J "O3'" 1 
ATOM 9774  C "C2'" . DG  J 6 34  ? 138.042 176.000 129.306 1.00 61.39  ? 34  DG  J "C2'" 1 
ATOM 9775  C "C1'" . DG  J 6 34  ? 136.707 175.672 128.651 1.00 61.39  ? 34  DG  J "C1'" 1 
ATOM 9776  N N9    . DG  J 6 34  ? 136.635 174.297 128.189 1.00 61.39  ? 34  DG  J N9    1 
ATOM 9777  C C8    . DG  J 6 34  ? 137.548 173.646 127.407 1.00 61.39  ? 34  DG  J C8    1 
ATOM 9778  N N7    . DG  J 6 34  ? 137.236 172.412 127.165 1.00 61.39  ? 34  DG  J N7    1 
ATOM 9779  C C5    . DG  J 6 34  ? 136.040 172.233 127.834 1.00 61.39  ? 34  DG  J C5    1 
ATOM 9780  C C6    . DG  J 6 34  ? 135.230 171.093 127.939 1.00 61.39  ? 34  DG  J C6    1 
ATOM 9781  O O6    . DG  J 6 34  ? 135.406 169.986 127.427 1.00 61.39  ? 34  DG  J O6    1 
ATOM 9782  N N1    . DG  J 6 34  ? 134.099 171.328 128.711 1.00 61.39  ? 34  DG  J N1    1 
ATOM 9783  C C2    . DG  J 6 34  ? 133.800 172.515 129.314 1.00 61.39  ? 34  DG  J C2    1 
ATOM 9784  N N2    . DG  J 6 34  ? 132.668 172.551 130.026 1.00 61.39  ? 34  DG  J N2    1 
ATOM 9785  N N3    . DG  J 6 34  ? 134.559 173.597 129.227 1.00 61.39  ? 34  DG  J N3    1 
ATOM 9786  C C4    . DG  J 6 34  ? 135.658 173.381 128.472 1.00 61.39  ? 34  DG  J C4    1 
ATOM 9787  P P     . DT  J 6 35  ? 137.761 178.777 131.247 1.00 60.75  ? 35  DT  J P     1 
ATOM 9788  O OP1   . DT  J 6 35  ? 137.830 180.249 131.143 1.00 60.75  ? 35  DT  J OP1   1 
ATOM 9789  O OP2   . DT  J 6 35  ? 138.954 178.021 131.676 1.00 60.75  ? 35  DT  J OP2   1 
ATOM 9790  O "O5'" . DT  J 6 35  ? 136.556 178.386 132.216 1.00 60.75  ? 35  DT  J "O5'" 1 
ATOM 9791  C "C5'" . DT  J 6 35  ? 135.772 177.251 131.922 1.00 60.75  ? 35  DT  J "C5'" 1 
ATOM 9792  C "C4'" . DT  J 6 35  ? 135.227 176.617 133.182 1.00 60.75  ? 35  DT  J "C4'" 1 
ATOM 9793  O "O4'" . DT  J 6 35  ? 134.935 175.220 132.922 1.00 60.75  ? 35  DT  J "O4'" 1 
ATOM 9794  C "C3'" . DT  J 6 35  ? 136.179 176.597 134.365 1.00 60.75  ? 35  DT  J "C3'" 1 
ATOM 9795  O "O3'" . DT  J 6 35  ? 135.412 176.462 135.555 1.00 60.75  ? 35  DT  J "O3'" 1 
ATOM 9796  C "C2'" . DT  J 6 35  ? 136.974 175.340 134.071 1.00 60.75  ? 35  DT  J "C2'" 1 
ATOM 9797  C "C1'" . DT  J 6 35  ? 135.863 174.410 133.615 1.00 60.75  ? 35  DT  J "C1'" 1 
ATOM 9798  N N1    . DT  J 6 35  ? 136.317 173.336 132.710 1.00 60.75  ? 35  DT  J N1    1 
ATOM 9799  C C2    . DT  J 6 35  ? 135.548 172.218 132.570 1.00 60.75  ? 35  DT  J C2    1 
ATOM 9800  O O2    . DT  J 6 35  ? 134.495 172.060 133.153 1.00 60.75  ? 35  DT  J O2    1 
ATOM 9801  N N3    . DT  J 6 35  ? 136.054 171.284 131.719 1.00 60.75  ? 35  DT  J N3    1 
ATOM 9802  C C4    . DT  J 6 35  ? 137.232 171.362 131.014 1.00 60.75  ? 35  DT  J C4    1 
ATOM 9803  O O4    . DT  J 6 35  ? 137.608 170.475 130.266 1.00 60.75  ? 35  DT  J O4    1 
ATOM 9804  C C5    . DT  J 6 35  ? 137.990 172.560 131.207 1.00 60.75  ? 35  DT  J C5    1 
ATOM 9805  C C7    . DT  J 6 35  ? 139.288 172.750 130.490 1.00 60.75  ? 35  DT  J C7    1 
ATOM 9806  C C6    . DT  J 6 35  ? 137.504 173.478 132.035 1.00 60.75  ? 35  DT  J C6    1 
ATOM 9807  P P     . DC  J 6 36  ? 136.075 176.576 137.013 1.00 57.47  ? 36  DC  J P     1 
ATOM 9808  O OP1   . DC  J 6 36  ? 135.290 177.586 137.742 1.00 57.47  ? 36  DC  J OP1   1 
ATOM 9809  O OP2   . DC  J 6 36  ? 137.541 176.716 136.932 1.00 57.47  ? 36  DC  J OP2   1 
ATOM 9810  O "O5'" . DC  J 6 36  ? 135.733 175.169 137.670 1.00 57.47  ? 36  DC  J "O5'" 1 
ATOM 9811  C "C5'" . DC  J 6 36  ? 134.389 174.723 137.686 1.00 57.47  ? 36  DC  J "C5'" 1 
ATOM 9812  C "C4'" . DC  J 6 36  ? 134.298 173.229 137.945 1.00 57.47  ? 36  DC  J "C4'" 1 
ATOM 9813  O "O4'" . DC  J 6 36  ? 134.901 172.491 136.855 1.00 57.47  ? 36  DC  J "O4'" 1 
ATOM 9814  C "C3'" . DC  J 6 36  ? 134.983 172.743 139.211 1.00 57.47  ? 36  DC  J "C3'" 1 
ATOM 9815  O "O3'" . DC  J 6 36  ? 134.165 171.785 139.823 1.00 57.47  ? 36  DC  J "O3'" 1 
ATOM 9816  C "C2'" . DC  J 6 36  ? 136.269 172.111 138.677 1.00 57.47  ? 36  DC  J "C2'" 1 
ATOM 9817  C "C1'" . DC  J 6 36  ? 135.770 171.519 137.377 1.00 57.47  ? 36  DC  J "C1'" 1 
ATOM 9818  N N1    . DC  J 6 36  ? 136.829 171.269 136.370 1.00 57.47  ? 36  DC  J N1    1 
ATOM 9819  C C2    . DC  J 6 36  ? 136.784 170.110 135.593 1.00 57.47  ? 36  DC  J C2    1 
ATOM 9820  O O2    . DC  J 6 36  ? 135.872 169.307 135.770 1.00 57.47  ? 36  DC  J O2    1 
ATOM 9821  N N3    . DC  J 6 36  ? 137.742 169.903 134.669 1.00 57.47  ? 36  DC  J N3    1 
ATOM 9822  C C4    . DC  J 6 36  ? 138.707 170.796 134.506 1.00 57.47  ? 36  DC  J C4    1 
ATOM 9823  N N4    . DC  J 6 36  ? 139.634 170.552 133.580 1.00 57.47  ? 36  DC  J N4    1 
ATOM 9824  C C5    . DC  J 6 36  ? 138.768 171.984 135.283 1.00 57.47  ? 36  DC  J C5    1 
ATOM 9825  C C6    . DC  J 6 36  ? 137.814 172.180 136.191 1.00 57.47  ? 36  DC  J C6    1 
ATOM 9826  P P     . DG  J 6 37  ? 133.739 171.934 141.360 1.00 55.62  ? 37  DG  J P     1 
ATOM 9827  O OP1   . DG  J 6 37  ? 132.346 172.420 141.400 1.00 55.62  ? 37  DG  J OP1   1 
ATOM 9828  O OP2   . DG  J 6 37  ? 134.812 172.654 142.071 1.00 55.62  ? 37  DG  J OP2   1 
ATOM 9829  O "O5'" . DG  J 6 37  ? 133.739 170.433 141.876 1.00 55.62  ? 37  DG  J "O5'" 1 
ATOM 9830  C "C5'" . DG  J 6 37  ? 133.177 169.427 141.068 1.00 55.62  ? 37  DG  J "C5'" 1 
ATOM 9831  C "C4'" . DG  J 6 37  ? 134.066 168.206 141.035 1.00 55.62  ? 37  DG  J "C4'" 1 
ATOM 9832  O "O4'" . DG  J 6 37  ? 135.125 168.380 140.060 1.00 55.62  ? 37  DG  J "O4'" 1 
ATOM 9833  C "C3'" . DG  J 6 37  ? 134.766 167.875 142.352 1.00 55.62  ? 37  DG  J "C3'" 1 
ATOM 9834  O "O3'" . DG  J 6 37  ? 134.613 166.506 142.603 1.00 55.62  ? 37  DG  J "O3'" 1 
ATOM 9835  C "C2'" . DG  J 6 37  ? 136.226 168.222 142.063 1.00 55.62  ? 37  DG  J "C2'" 1 
ATOM 9836  C "C1'" . DG  J 6 37  ? 136.300 167.852 140.604 1.00 55.62  ? 37  DG  J "C1'" 1 
ATOM 9837  N N9    . DG  J 6 37  ? 137.443 168.404 139.901 1.00 55.62  ? 37  DG  J N9    1 
ATOM 9838  C C8    . DG  J 6 37  ? 138.124 169.546 140.200 1.00 55.62  ? 37  DG  J C8    1 
ATOM 9839  N N7    . DG  J 6 37  ? 139.113 169.782 139.391 1.00 55.62  ? 37  DG  J N7    1 
ATOM 9840  C C5    . DG  J 6 37  ? 139.085 168.725 138.503 1.00 55.62  ? 37  DG  J C5    1 
ATOM 9841  C C6    . DG  J 6 37  ? 139.909 168.444 137.399 1.00 55.62  ? 37  DG  J C6    1 
ATOM 9842  O O6    . DG  J 6 37  ? 140.869 169.090 136.979 1.00 55.62  ? 37  DG  J O6    1 
ATOM 9843  N N1    . DG  J 6 37  ? 139.543 167.272 136.770 1.00 55.62  ? 37  DG  J N1    1 
ATOM 9844  C C2    . DG  J 6 37  ? 138.504 166.475 137.147 1.00 55.62  ? 37  DG  J C2    1 
ATOM 9845  N N2    . DG  J 6 37  ? 138.304 165.379 136.417 1.00 55.62  ? 37  DG  J N2    1 
ATOM 9846  N N3    . DG  J 6 37  ? 137.715 166.728 138.172 1.00 55.62  ? 37  DG  J N3    1 
ATOM 9847  C C4    . DG  J 6 37  ? 138.066 167.868 138.804 1.00 55.62  ? 37  DG  J C4    1 
ATOM 9848  P P     . DT  J 6 38  ? 134.648 165.932 144.095 1.00 53.08  ? 38  DT  J P     1 
ATOM 9849  O OP1   . DT  J 6 38  ? 133.458 166.435 144.801 1.00 53.08  ? 38  DT  J OP1   1 
ATOM 9850  O OP2   . DT  J 6 38  ? 135.991 166.172 144.650 1.00 53.08  ? 38  DT  J OP2   1 
ATOM 9851  O "O5'" . DT  J 6 38  ? 134.480 164.369 143.869 1.00 53.08  ? 38  DT  J "O5'" 1 
ATOM 9852  C "C5'" . DT  J 6 38  ? 133.845 163.907 142.692 1.00 53.08  ? 38  DT  J "C5'" 1 
ATOM 9853  C "C4'" . DT  J 6 38  ? 134.776 163.038 141.858 1.00 53.08  ? 38  DT  J "C4'" 1 
ATOM 9854  O "O4'" . DT  J 6 38  ? 135.813 163.844 141.243 1.00 53.08  ? 38  DT  J "O4'" 1 
ATOM 9855  C "C3'" . DT  J 6 38  ? 135.507 161.928 142.611 1.00 53.08  ? 38  DT  J "C3'" 1 
ATOM 9856  O "O3'" . DT  J 6 38  ? 135.450 160.753 141.835 1.00 53.08  ? 38  DT  J "O3'" 1 
ATOM 9857  C "C2'" . DT  J 6 38  ? 136.933 162.467 142.689 1.00 53.08  ? 38  DT  J "C2'" 1 
ATOM 9858  C "C1'" . DT  J 6 38  ? 137.024 163.150 141.351 1.00 53.08  ? 38  DT  J "C1'" 1 
ATOM 9859  N N1    . DT  J 6 38  ? 138.149 164.103 141.220 1.00 53.08  ? 38  DT  J N1    1 
ATOM 9860  C C2    . DT  J 6 38  ? 138.903 164.085 140.075 1.00 53.08  ? 38  DT  J C2    1 
ATOM 9861  O O2    . DT  J 6 38  ? 138.691 163.325 139.150 1.00 53.08  ? 38  DT  J O2    1 
ATOM 9862  N N3    . DT  J 6 38  ? 139.923 164.992 140.045 1.00 53.08  ? 38  DT  J N3    1 
ATOM 9863  C C4    . DT  J 6 38  ? 140.254 165.897 141.021 1.00 53.08  ? 38  DT  J C4    1 
ATOM 9864  O O4    . DT  J 6 38  ? 141.183 166.677 140.900 1.00 53.08  ? 38  DT  J O4    1 
ATOM 9865  C C5    . DT  J 6 38  ? 139.425 165.866 142.195 1.00 53.08  ? 38  DT  J C5    1 
ATOM 9866  C C7    . DT  J 6 38  ? 139.696 166.809 143.324 1.00 53.08  ? 38  DT  J C7    1 
ATOM 9867  C C6    . DT  J 6 38  ? 138.423 164.979 142.240 1.00 53.08  ? 38  DT  J C6    1 
ATOM 9868  P P     . DA  J 6 39  ? 135.600 159.302 142.497 1.00 49.44  ? 39  DA  J P     1 
ATOM 9869  O OP1   . DA  J 6 39  ? 134.273 158.671 142.447 1.00 49.44  ? 39  DA  J OP1   1 
ATOM 9870  O OP2   . DA  J 6 39  ? 136.322 159.401 143.776 1.00 49.44  ? 39  DA  J OP2   1 
ATOM 9871  O "O5'" . DA  J 6 39  ? 136.547 158.546 141.472 1.00 49.44  ? 39  DA  J "O5'" 1 
ATOM 9872  C "C5'" . DA  J 6 39  ? 136.322 158.689 140.082 1.00 49.44  ? 39  DA  J "C5'" 1 
ATOM 9873  C "C4'" . DA  J 6 39  ? 137.535 158.295 139.250 1.00 49.44  ? 39  DA  J "C4'" 1 
ATOM 9874  O "O4'" . DA  J 6 39  ? 138.536 159.323 139.299 1.00 49.44  ? 39  DA  J "O4'" 1 
ATOM 9875  C "C3'" . DA  J 6 39  ? 138.239 157.009 139.622 1.00 49.44  ? 39  DA  J "C3'" 1 
ATOM 9876  O "O3'" . DA  J 6 39  ? 138.727 156.414 138.442 1.00 49.44  ? 39  DA  J "O3'" 1 
ATOM 9877  C "C2'" . DA  J 6 39  ? 139.381 157.489 140.508 1.00 49.44  ? 39  DA  J "C2'" 1 
ATOM 9878  C "C1'" . DA  J 6 39  ? 139.710 158.851 139.920 1.00 49.44  ? 39  DA  J "C1'" 1 
ATOM 9879  N N9    . DA  J 6 39  ? 140.069 159.849 140.905 1.00 49.44  ? 39  DA  J N9    1 
ATOM 9880  C C8    . DA  J 6 39  ? 139.454 160.069 142.091 1.00 49.44  ? 39  DA  J C8    1 
ATOM 9881  N N7    . DA  J 6 39  ? 139.958 161.059 142.767 1.00 49.44  ? 39  DA  J N7    1 
ATOM 9882  C C5    . DA  J 6 39  ? 140.959 161.538 141.957 1.00 49.44  ? 39  DA  J C5    1 
ATOM 9883  C C6    . DA  J 6 39  ? 141.865 162.587 142.111 1.00 49.44  ? 39  DA  J C6    1 
ATOM 9884  N N6    . DA  J 6 39  ? 141.894 163.369 143.187 1.00 49.44  ? 39  DA  J N6    1 
ATOM 9885  N N1    . DA  J 6 39  ? 142.749 162.804 141.120 1.00 49.44  ? 39  DA  J N1    1 
ATOM 9886  C C2    . DA  J 6 39  ? 142.716 162.017 140.047 1.00 49.44  ? 39  DA  J C2    1 
ATOM 9887  N N3    . DA  J 6 39  ? 141.903 160.998 139.792 1.00 49.44  ? 39  DA  J N3    1 
ATOM 9888  C C4    . DA  J 6 39  ? 141.038 160.813 140.799 1.00 49.44  ? 39  DA  J C4    1 
ATOM 9889  P P     . DG  J 6 40  ? 139.340 154.940 138.450 1.00 49.96  ? 40  DG  J P     1 
ATOM 9890  O OP1   . DG  J 6 40  ? 139.092 154.372 137.127 1.00 49.96  ? 40  DG  J OP1   1 
ATOM 9891  O OP2   . DG  J 6 40  ? 138.901 154.246 139.666 1.00 49.96  ? 40  DG  J OP2   1 
ATOM 9892  O "O5'" . DG  J 6 40  ? 140.899 155.180 138.540 1.00 49.96  ? 40  DG  J "O5'" 1 
ATOM 9893  C "C5'" . DG  J 6 40  ? 141.583 155.729 137.440 1.00 49.96  ? 40  DG  J "C5'" 1 
ATOM 9894  C "C4'" . DG  J 6 40  ? 142.983 156.160 137.822 1.00 49.96  ? 40  DG  J "C4'" 1 
ATOM 9895  O "O4'" . DG  J 6 40  ? 142.918 157.206 138.818 1.00 49.96  ? 40  DG  J "O4'" 1 
ATOM 9896  C "C3'" . DG  J 6 40  ? 143.875 155.072 138.431 1.00 49.96  ? 40  DG  J "C3'" 1 
ATOM 9897  O "O3'" . DG  J 6 40  ? 145.189 155.260 137.982 1.00 49.96  ? 40  DG  J "O3'" 1 
ATOM 9898  C "C2'" . DG  J 6 40  ? 143.800 155.391 139.913 1.00 49.96  ? 40  DG  J "C2'" 1 
ATOM 9899  C "C1'" . DG  J 6 40  ? 143.841 156.894 139.825 1.00 49.96  ? 40  DG  J "C1'" 1 
ATOM 9900  N N9    . DG  J 6 40  ? 143.476 157.578 141.046 1.00 49.96  ? 40  DG  J N9    1 
ATOM 9901  C C8    . DG  J 6 40  ? 142.518 157.222 141.946 1.00 49.96  ? 40  DG  J C8    1 
ATOM 9902  N N7    . DG  J 6 40  ? 142.425 158.042 142.951 1.00 49.96  ? 40  DG  J N7    1 
ATOM 9903  C C5    . DG  J 6 40  ? 143.396 158.992 142.697 1.00 49.96  ? 40  DG  J C5    1 
ATOM 9904  C C6    . DG  J 6 40  ? 143.772 160.125 143.434 1.00 49.96  ? 40  DG  J C6    1 
ATOM 9905  O O6    . DG  J 6 40  ? 143.304 160.532 144.497 1.00 49.96  ? 40  DG  J O6    1 
ATOM 9906  N N1    . DG  J 6 40  ? 144.800 160.818 142.823 1.00 49.96  ? 40  DG  J N1    1 
ATOM 9907  C C2    . DG  J 6 40  ? 145.392 160.458 141.646 1.00 49.96  ? 40  DG  J C2    1 
ATOM 9908  N N2    . DG  J 6 40  ? 146.372 161.247 141.202 1.00 49.96  ? 40  DG  J N2    1 
ATOM 9909  N N3    . DG  J 6 40  ? 145.050 159.401 140.946 1.00 49.96  ? 40  DG  J N3    1 
ATOM 9910  C C4    . DG  J 6 40  ? 144.048 158.717 141.531 1.00 49.96  ? 40  DG  J C4    1 
ATOM 9911  P P     . DA  J 6 41  ? 145.879 154.245 136.955 1.00 57.60  ? 41  DA  J P     1 
ATOM 9912  O OP1   . DA  J 6 41  ? 145.156 154.365 135.671 1.00 57.60  ? 41  DA  J OP1   1 
ATOM 9913  O OP2   . DA  J 6 41  ? 146.018 152.936 137.621 1.00 57.60  ? 41  DA  J OP2   1 
ATOM 9914  O "O5'" . DA  J 6 41  ? 147.335 154.868 136.775 1.00 57.60  ? 41  DA  J "O5'" 1 
ATOM 9915  C "C5'" . DA  J 6 41  ? 147.469 156.255 136.492 1.00 57.60  ? 41  DA  J "C5'" 1 
ATOM 9916  C "C4'" . DA  J 6 41  ? 148.648 156.866 137.229 1.00 57.60  ? 41  DA  J "C4'" 1 
ATOM 9917  O "O4'" . DA  J 6 41  ? 148.202 157.493 138.456 1.00 57.60  ? 41  DA  J "O4'" 1 
ATOM 9918  C "C3'" . DA  J 6 41  ? 149.755 155.902 137.629 1.00 57.60  ? 41  DA  J "C3'" 1 
ATOM 9919  O "O3'" . DA  J 6 41  ? 150.994 156.526 137.406 1.00 57.60  ? 41  DA  J "O3'" 1 
ATOM 9920  C "C2'" . DA  J 6 41  ? 149.505 155.687 139.117 1.00 57.60  ? 41  DA  J "C2'" 1 
ATOM 9921  C "C1'" . DA  J 6 41  ? 148.992 157.049 139.536 1.00 57.60  ? 41  DA  J "C1'" 1 
ATOM 9922  N N9    . DA  J 6 41  ? 148.135 157.008 140.705 1.00 57.60  ? 41  DA  J N9    1 
ATOM 9923  C C8    . DA  J 6 41  ? 147.124 156.135 140.929 1.00 57.60  ? 41  DA  J C8    1 
ATOM 9924  N N7    . DA  J 6 41  ? 146.488 156.334 142.047 1.00 57.60  ? 41  DA  J N7    1 
ATOM 9925  C C5    . DA  J 6 41  ? 147.120 157.421 142.596 1.00 57.60  ? 41  DA  J C5    1 
ATOM 9926  C C6    . DA  J 6 41  ? 146.912 158.119 143.784 1.00 57.60  ? 41  DA  J C6    1 
ATOM 9927  N N6    . DA  J 6 41  ? 145.963 157.796 144.657 1.00 57.60  ? 41  DA  J N6    1 
ATOM 9928  N N1    . DA  J 6 41  ? 147.720 159.159 144.051 1.00 57.60  ? 41  DA  J N1    1 
ATOM 9929  C C2    . DA  J 6 41  ? 148.675 159.481 143.174 1.00 57.60  ? 41  DA  J C2    1 
ATOM 9930  N N3    . DA  J 6 41  ? 148.964 158.894 142.013 1.00 57.60  ? 41  DA  J N3    1 
ATOM 9931  C C4    . DA  J 6 41  ? 148.139 157.860 141.783 1.00 57.60  ? 41  DA  J C4    1 
ATOM 9932  P P     . DC  J 6 42  ? 152.349 155.675 137.358 1.00 63.88  ? 42  DC  J P     1 
ATOM 9933  O OP1   . DC  J 6 42  ? 153.101 156.153 136.182 1.00 63.88  ? 42  DC  J OP1   1 
ATOM 9934  O OP2   . DC  J 6 42  ? 152.024 154.241 137.505 1.00 63.88  ? 42  DC  J OP2   1 
ATOM 9935  O "O5'" . DC  J 6 42  ? 153.115 156.140 138.671 1.00 63.88  ? 42  DC  J "O5'" 1 
ATOM 9936  C "C5'" . DC  J 6 42  ? 153.099 157.500 139.036 1.00 63.88  ? 42  DC  J "C5'" 1 
ATOM 9937  C "C4'" . DC  J 6 42  ? 153.555 157.679 140.469 1.00 63.88  ? 42  DC  J "C4'" 1 
ATOM 9938  O "O4'" . DC  J 6 42  ? 152.414 157.641 141.365 1.00 63.88  ? 42  DC  J "O4'" 1 
ATOM 9939  C "C3'" . DC  J 6 42  ? 154.531 156.618 140.979 1.00 63.88  ? 42  DC  J "C3'" 1 
ATOM 9940  O "O3'" . DC  J 6 42  ? 155.567 157.256 141.690 1.00 63.88  ? 42  DC  J "O3'" 1 
ATOM 9941  C "C2'" . DC  J 6 42  ? 153.662 155.780 141.908 1.00 63.88  ? 42  DC  J "C2'" 1 
ATOM 9942  C "C1'" . DC  J 6 42  ? 152.739 156.839 142.465 1.00 63.88  ? 42  DC  J "C1'" 1 
ATOM 9943  N N1    . DC  J 6 42  ? 151.497 156.294 143.044 1.00 63.88  ? 42  DC  J N1    1 
ATOM 9944  C C2    . DC  J 6 42  ? 151.026 156.798 144.246 1.00 63.88  ? 42  DC  J C2    1 
ATOM 9945  O O2    . DC  J 6 42  ? 151.656 157.701 144.793 1.00 63.88  ? 42  DC  J O2    1 
ATOM 9946  N N3    . DC  J 6 42  ? 149.899 156.285 144.775 1.00 63.88  ? 42  DC  J N3    1 
ATOM 9947  C C4    . DC  J 6 42  ? 149.257 155.307 144.145 1.00 63.88  ? 42  DC  J C4    1 
ATOM 9948  N N4    . DC  J 6 42  ? 148.145 154.829 144.699 1.00 63.88  ? 42  DC  J N4    1 
ATOM 9949  C C5    . DC  J 6 42  ? 149.722 154.780 142.918 1.00 63.88  ? 42  DC  J C5    1 
ATOM 9950  C C6    . DC  J 6 42  ? 150.840 155.294 142.412 1.00 63.88  ? 42  DC  J C6    1 
ATOM 9951  P P     . DA  J 6 43  ? 157.006 156.567 141.866 1.00 66.89  ? 43  DA  J P     1 
ATOM 9952  O OP1   . DA  J 6 43  ? 157.921 157.232 140.919 1.00 66.89  ? 43  DA  J OP1   1 
ATOM 9953  O OP2   . DA  J 6 43  ? 156.871 155.099 141.820 1.00 66.89  ? 43  DA  J OP2   1 
ATOM 9954  O "O5'" . DA  J 6 43  ? 157.400 156.967 143.356 1.00 66.89  ? 43  DA  J "O5'" 1 
ATOM 9955  C "C5'" . DA  J 6 43  ? 156.974 158.216 143.871 1.00 66.89  ? 43  DA  J "C5'" 1 
ATOM 9956  C "C4'" . DA  J 6 43  ? 156.858 158.182 145.383 1.00 66.89  ? 43  DA  J "C4'" 1 
ATOM 9957  O "O4'" . DA  J 6 43  ? 155.514 157.812 145.772 1.00 66.89  ? 43  DA  J "O4'" 1 
ATOM 9958  C "C3'" . DA  J 6 43  ? 157.795 157.212 146.092 1.00 66.89  ? 43  DA  J "C3'" 1 
ATOM 9959  O "O3'" . DA  J 6 43  ? 158.344 157.852 147.227 1.00 66.89  ? 43  DA  J "O3'" 1 
ATOM 9960  C "C2'" . DA  J 6 43  ? 156.876 156.055 146.481 1.00 66.89  ? 43  DA  J "C2'" 1 
ATOM 9961  C "C1'" . DA  J 6 43  ? 155.555 156.767 146.712 1.00 66.89  ? 43  DA  J "C1'" 1 
ATOM 9962  N N9    . DA  J 6 43  ? 154.394 155.920 146.482 1.00 66.89  ? 43  DA  J N9    1 
ATOM 9963  C C8    . DA  J 6 43  ? 154.163 155.121 145.404 1.00 66.89  ? 43  DA  J C8    1 
ATOM 9964  N N7    . DA  J 6 43  ? 153.029 154.480 145.456 1.00 66.89  ? 43  DA  J N7    1 
ATOM 9965  C C5    . DA  J 6 43  ? 152.474 154.891 146.647 1.00 66.89  ? 43  DA  J C5    1 
ATOM 9966  C C6    . DA  J 6 43  ? 151.268 154.577 147.280 1.00 66.89  ? 43  DA  J C6    1 
ATOM 9967  N N6    . DA  J 6 43  ? 150.379 153.734 146.765 1.00 66.89  ? 43  DA  J N6    1 
ATOM 9968  N N1    . DA  J 6 43  ? 151.007 155.160 148.462 1.00 66.89  ? 43  DA  J N1    1 
ATOM 9969  C C2    . DA  J 6 43  ? 151.901 156.005 148.974 1.00 66.89  ? 43  DA  J C2    1 
ATOM 9970  N N3    . DA  J 6 43  ? 153.071 156.382 148.468 1.00 66.89  ? 43  DA  J N3    1 
ATOM 9971  C C4    . DA  J 6 43  ? 153.297 155.781 147.292 1.00 66.89  ? 43  DA  J C4    1 
ATOM 9972  P P     . DG  J 6 44  ? 159.489 157.146 148.097 1.00 64.79  ? 44  DG  J P     1 
ATOM 9973  O OP1   . DG  J 6 44  ? 160.357 158.223 148.619 1.00 64.79  ? 44  DG  J OP1   1 
ATOM 9974  O OP2   . DG  J 6 44  ? 160.075 156.044 147.301 1.00 64.79  ? 44  DG  J OP2   1 
ATOM 9975  O "O5'" . DG  J 6 44  ? 158.689 156.521 149.327 1.00 64.79  ? 44  DG  J "O5'" 1 
ATOM 9976  C "C5'" . DG  J 6 44  ? 157.812 157.340 150.078 1.00 64.79  ? 44  DG  J "C5'" 1 
ATOM 9977  C "C4'" . DG  J 6 44  ? 157.091 156.531 151.136 1.00 64.79  ? 44  DG  J "C4'" 1 
ATOM 9978  O "O4'" . DG  J 6 44  ? 155.935 155.869 150.560 1.00 64.79  ? 44  DG  J "O4'" 1 
ATOM 9979  C "C3'" . DG  J 6 44  ? 157.923 155.430 151.791 1.00 64.79  ? 44  DG  J "C3'" 1 
ATOM 9980  O "O3'" . DG  J 6 44  ? 157.752 155.495 153.188 1.00 64.79  ? 44  DG  J "O3'" 1 
ATOM 9981  C "C2'" . DG  J 6 44  ? 157.323 154.149 151.209 1.00 64.79  ? 44  DG  J "C2'" 1 
ATOM 9982  C "C1'" . DG  J 6 44  ? 155.879 154.556 151.047 1.00 64.79  ? 44  DG  J "C1'" 1 
ATOM 9983  N N9    . DG  J 6 44  ? 155.143 153.741 150.098 1.00 64.79  ? 44  DG  J N9    1 
ATOM 9984  C C8    . DG  J 6 44  ? 155.555 153.341 148.859 1.00 64.79  ? 44  DG  J C8    1 
ATOM 9985  N N7    . DG  J 6 44  ? 154.674 152.618 148.231 1.00 64.79  ? 44  DG  J N7    1 
ATOM 9986  C C5    . DG  J 6 44  ? 153.611 152.541 149.112 1.00 64.79  ? 44  DG  J C5    1 
ATOM 9987  C C6    . DG  J 6 44  ? 152.370 151.888 148.986 1.00 64.79  ? 44  DG  J C6    1 
ATOM 9988  O O6    . DG  J 6 44  ? 151.945 151.230 148.033 1.00 64.79  ? 44  DG  J O6    1 
ATOM 9989  N N1    . DG  J 6 44  ? 151.583 152.060 150.110 1.00 64.79  ? 44  DG  J N1    1 
ATOM 9990  C C2    . DG  J 6 44  ? 151.948 152.767 151.217 1.00 64.79  ? 44  DG  J C2    1 
ATOM 9991  N N2    . DG  J 6 44  ? 151.059 152.823 152.209 1.00 64.79  ? 44  DG  J N2    1 
ATOM 9992  N N3    . DG  J 6 44  ? 153.106 153.382 151.350 1.00 64.79  ? 44  DG  J N3    1 
ATOM 9993  C C4    . DG  J 6 44  ? 153.885 153.226 150.263 1.00 64.79  ? 44  DG  J C4    1 
ATOM 9994  P P     . DC  J 6 45  ? 158.786 154.771 154.176 1.00 62.11  ? 45  DC  J P     1 
ATOM 9995  O OP1   . DC  J 6 45  ? 159.303 155.808 155.095 1.00 62.11  ? 45  DC  J OP1   1 
ATOM 9996  O OP2   . DC  J 6 45  ? 159.740 153.971 153.378 1.00 62.11  ? 45  DC  J OP2   1 
ATOM 9997  O "O5'" . DC  J 6 45  ? 157.857 153.774 155.000 1.00 62.11  ? 45  DC  J "O5'" 1 
ATOM 9998  C "C5'" . DC  J 6 45  ? 156.625 154.243 155.523 1.00 62.11  ? 45  DC  J "C5'" 1 
ATOM 9999  C "C4'" . DC  J 6 45  ? 155.728 153.086 155.908 1.00 62.11  ? 45  DC  J "C4'" 1 
ATOM 10000 O "O4'" . DC  J 6 45  ? 155.025 152.596 154.736 1.00 62.11  ? 45  DC  J "O4'" 1 
ATOM 10001 C "C3'" . DC  J 6 45  ? 156.464 151.888 156.498 1.00 62.11  ? 45  DC  J "C3'" 1 
ATOM 10002 O "O3'" . DC  J 6 45  ? 155.817 151.463 157.684 1.00 62.11  ? 45  DC  J "O3'" 1 
ATOM 10003 C "C2'" . DC  J 6 45  ? 156.368 150.837 155.395 1.00 62.11  ? 45  DC  J "C2'" 1 
ATOM 10004 C "C1'" . DC  J 6 45  ? 155.054 151.196 154.737 1.00 62.11  ? 45  DC  J "C1'" 1 
ATOM 10005 N N1    . DC  J 6 45  ? 154.944 150.715 153.334 1.00 62.11  ? 45  DC  J N1    1 
ATOM 10006 C C2    . DC  J 6 45  ? 153.732 150.204 152.875 1.00 62.11  ? 45  DC  J C2    1 
ATOM 10007 O O2    . DC  J 6 45  ? 152.767 150.169 153.638 1.00 62.11  ? 45  DC  J O2    1 
ATOM 10008 N N3    . DC  J 6 45  ? 153.649 149.767 151.605 1.00 62.11  ? 45  DC  J N3    1 
ATOM 10009 C C4    . DC  J 6 45  ? 154.712 149.827 150.812 1.00 62.11  ? 45  DC  J C4    1 
ATOM 10010 N N4    . DC  J 6 45  ? 154.576 149.393 149.560 1.00 62.11  ? 45  DC  J N4    1 
ATOM 10011 C C5    . DC  J 6 45  ? 155.957 150.339 151.259 1.00 62.11  ? 45  DC  J C5    1 
ATOM 10012 C C6    . DC  J 6 45  ? 156.026 150.765 152.515 1.00 62.11  ? 45  DC  J C6    1 
ATOM 10013 P P     . DT  J 6 46  ? 156.632 150.684 158.828 1.00 57.86  ? 46  DT  J P     1 
ATOM 10014 O OP1   . DT  J 6 46  ? 156.911 151.636 159.923 1.00 57.86  ? 46  DT  J OP1   1 
ATOM 10015 O OP2   . DT  J 6 46  ? 157.755 149.950 158.211 1.00 57.86  ? 46  DT  J OP2   1 
ATOM 10016 O "O5'" . DT  J 6 46  ? 155.577 149.615 159.345 1.00 57.86  ? 46  DT  J "O5'" 1 
ATOM 10017 C "C5'" . DT  J 6 46  ? 154.201 149.939 159.332 1.00 57.86  ? 46  DT  J "C5'" 1 
ATOM 10018 C "C4'" . DT  J 6 46  ? 153.358 148.740 158.938 1.00 57.86  ? 46  DT  J "C4'" 1 
ATOM 10019 O "O4'" . DT  J 6 46  ? 153.377 148.565 157.496 1.00 57.86  ? 46  DT  J "O4'" 1 
ATOM 10020 C "C3'" . DT  J 6 46  ? 153.805 147.407 159.531 1.00 57.86  ? 46  DT  J "C3'" 1 
ATOM 10021 O "O3'" . DT  J 6 46  ? 152.678 146.709 159.998 1.00 57.86  ? 46  DT  J "O3'" 1 
ATOM 10022 C "C2'" . DT  J 6 46  ? 154.442 146.698 158.337 1.00 57.86  ? 46  DT  J "C2'" 1 
ATOM 10023 C "C1'" . DT  J 6 46  ? 153.567 147.203 157.210 1.00 57.86  ? 46  DT  J "C1'" 1 
ATOM 10024 N N1    . DT  J 6 46  ? 154.171 147.083 155.858 1.00 57.86  ? 46  DT  J N1    1 
ATOM 10025 C C2    . DT  J 6 46  ? 153.371 146.730 154.809 1.00 57.86  ? 46  DT  J C2    1 
ATOM 10026 O O2    . DT  J 6 46  ? 152.188 146.497 154.930 1.00 57.86  ? 46  DT  J O2    1 
ATOM 10027 N N3    . DT  J 6 46  ? 154.007 146.656 153.604 1.00 57.86  ? 46  DT  J N3    1 
ATOM 10028 C C4    . DT  J 6 46  ? 155.337 146.898 153.350 1.00 57.86  ? 46  DT  J C4    1 
ATOM 10029 O O4    . DT  J 6 46  ? 155.817 146.811 152.229 1.00 57.86  ? 46  DT  J O4    1 
ATOM 10030 C C5    . DT  J 6 46  ? 156.123 147.267 154.493 1.00 57.86  ? 46  DT  J C5    1 
ATOM 10031 C C7    . DT  J 6 46  ? 157.585 147.548 154.334 1.00 57.86  ? 46  DT  J C7    1 
ATOM 10032 C C6    . DT  J 6 46  ? 155.511 147.339 155.682 1.00 57.86  ? 46  DT  J C6    1 
ATOM 10033 P P     . DC  J 6 47  ? 152.745 145.873 161.363 1.00 55.29  ? 47  DC  J P     1 
ATOM 10034 O OP1   . DC  J 6 47  ? 152.018 146.646 162.388 1.00 55.29  ? 47  DC  J OP1   1 
ATOM 10035 O OP2   . DC  J 6 47  ? 154.148 145.458 161.583 1.00 55.29  ? 47  DC  J OP2   1 
ATOM 10036 O "O5'" . DC  J 6 47  ? 151.901 144.565 161.038 1.00 55.29  ? 47  DC  J "O5'" 1 
ATOM 10037 C "C5'" . DC  J 6 47  ? 150.769 144.652 160.185 1.00 55.29  ? 47  DC  J "C5'" 1 
ATOM 10038 C "C4'" . DC  J 6 47  ? 150.751 143.519 159.176 1.00 55.29  ? 47  DC  J "C4'" 1 
ATOM 10039 O "O4'" . DC  J 6 47  ? 151.696 143.785 158.110 1.00 55.29  ? 47  DC  J "O4'" 1 
ATOM 10040 C "C3'" . DC  J 6 47  ? 151.126 142.141 159.721 1.00 55.29  ? 47  DC  J "C3'" 1 
ATOM 10041 O "O3'" . DC  J 6 47  ? 150.281 141.186 159.152 1.00 55.29  ? 47  DC  J "O3'" 1 
ATOM 10042 C "C2'" . DC  J 6 47  ? 152.541 141.965 159.200 1.00 55.29  ? 47  DC  J "C2'" 1 
ATOM 10043 C "C1'" . DC  J 6 47  ? 152.389 142.601 157.843 1.00 55.29  ? 47  DC  J "C1'" 1 
ATOM 10044 N N1    . DC  J 6 47  ? 153.661 142.928 157.162 1.00 55.29  ? 47  DC  J N1    1 
ATOM 10045 C C2    . DC  J 6 47  ? 153.701 142.969 155.773 1.00 55.29  ? 47  DC  J C2    1 
ATOM 10046 O O2    . DC  J 6 47  ? 152.677 142.730 155.131 1.00 55.29  ? 47  DC  J O2    1 
ATOM 10047 N N3    . DC  J 6 47  ? 154.860 143.270 155.161 1.00 55.29  ? 47  DC  J N3    1 
ATOM 10048 C C4    . DC  J 6 47  ? 155.940 143.520 155.877 1.00 55.29  ? 47  DC  J C4    1 
ATOM 10049 N N4    . DC  J 6 47  ? 157.062 143.814 155.225 1.00 55.29  ? 47  DC  J N4    1 
ATOM 10050 C C5    . DC  J 6 47  ? 155.923 143.478 157.293 1.00 55.29  ? 47  DC  J C5    1 
ATOM 10051 C C6    . DC  J 6 47  ? 154.773 143.178 157.888 1.00 55.29  ? 47  DC  J C6    1 
ATOM 10052 P P     . DT  J 6 48  ? 149.487 140.134 160.061 1.00 52.35  ? 48  DT  J P     1 
ATOM 10053 O OP1   . DT  J 6 48  ? 148.454 140.884 160.800 1.00 52.35  ? 48  DT  J OP1   1 
ATOM 10054 O OP2   . DT  J 6 48  ? 150.463 139.289 160.775 1.00 52.35  ? 48  DT  J OP2   1 
ATOM 10055 O "O5'" . DT  J 6 48  ? 148.751 139.224 158.984 1.00 52.35  ? 48  DT  J "O5'" 1 
ATOM 10056 C "C5'" . DT  J 6 48  ? 148.088 139.837 157.898 1.00 52.35  ? 48  DT  J "C5'" 1 
ATOM 10057 C "C4'" . DT  J 6 48  ? 148.471 139.199 156.574 1.00 52.35  ? 48  DT  J "C4'" 1 
ATOM 10058 O "O4'" . DT  J 6 48  ? 149.816 139.573 156.191 1.00 52.35  ? 48  DT  J "O4'" 1 
ATOM 10059 C "C3'" . DT  J 6 48  ? 148.437 137.679 156.533 1.00 52.35  ? 48  DT  J "C3'" 1 
ATOM 10060 O "O3'" . DT  J 6 48  ? 147.882 137.304 155.310 1.00 52.35  ? 48  DT  J "O3'" 1 
ATOM 10061 C "C2'" . DT  J 6 48  ? 149.920 137.312 156.595 1.00 52.35  ? 48  DT  J "C2'" 1 
ATOM 10062 C "C1'" . DT  J 6 48  ? 150.495 138.423 155.752 1.00 52.35  ? 48  DT  J "C1'" 1 
ATOM 10063 N N1    . DT  J 6 48  ? 151.960 138.660 155.907 1.00 52.35  ? 48  DT  J N1    1 
ATOM 10064 C C2    . DT  J 6 48  ? 152.707 138.911 154.789 1.00 52.35  ? 48  DT  J C2    1 
ATOM 10065 O O2    . DT  J 6 48  ? 152.240 138.920 153.671 1.00 52.35  ? 48  DT  J O2    1 
ATOM 10066 N N3    . DT  J 6 48  ? 154.026 139.150 155.024 1.00 52.35  ? 48  DT  J N3    1 
ATOM 10067 C C4    . DT  J 6 48  ? 154.659 139.170 156.237 1.00 52.35  ? 48  DT  J C4    1 
ATOM 10068 O O4    . DT  J 6 48  ? 155.852 139.393 156.349 1.00 52.35  ? 48  DT  J O4    1 
ATOM 10069 C C5    . DT  J 6 48  ? 153.826 138.909 157.368 1.00 52.35  ? 48  DT  J C5    1 
ATOM 10070 C C7    . DT  J 6 48  ? 154.425 138.897 158.739 1.00 52.35  ? 48  DT  J C7    1 
ATOM 10071 C C6    . DT  J 6 48  ? 152.525 138.674 157.156 1.00 52.35  ? 48  DT  J C6    1 
ATOM 10072 P P     . DA  J 6 49  ? 146.929 136.026 155.183 1.00 47.32  ? 49  DA  J P     1 
ATOM 10073 O OP1   . DA  J 6 49  ? 145.567 136.526 154.923 1.00 47.32  ? 49  DA  J OP1   1 
ATOM 10074 O OP2   . DA  J 6 49  ? 147.178 135.121 156.321 1.00 47.32  ? 49  DA  J OP2   1 
ATOM 10075 O "O5'" . DA  J 6 49  ? 147.484 135.327 153.870 1.00 47.32  ? 49  DA  J "O5'" 1 
ATOM 10076 C "C5'" . DA  J 6 49  ? 148.254 136.093 152.959 1.00 47.32  ? 49  DA  J "C5'" 1 
ATOM 10077 C "C4'" . DA  J 6 49  ? 149.380 135.281 152.354 1.00 47.32  ? 49  DA  J "C4'" 1 
ATOM 10078 O "O4'" . DA  J 6 49  ? 150.641 135.640 152.969 1.00 47.32  ? 49  DA  J "O4'" 1 
ATOM 10079 C "C3'" . DA  J 6 49  ? 149.269 133.769 152.507 1.00 47.32  ? 49  DA  J "C3'" 1 
ATOM 10080 O "O3'" . DA  J 6 49  ? 149.841 133.162 151.383 1.00 47.32  ? 49  DA  J "O3'" 1 
ATOM 10081 C "C2'" . DA  J 6 49  ? 150.155 133.523 153.707 1.00 47.32  ? 49  DA  J "C2'" 1 
ATOM 10082 C "C1'" . DA  J 6 49  ? 151.281 134.460 153.357 1.00 47.32  ? 49  DA  J "C1'" 1 
ATOM 10083 N N9    . DA  J 6 49  ? 152.188 134.736 154.454 1.00 47.32  ? 49  DA  J N9    1 
ATOM 10084 C C8    . DA  J 6 49  ? 151.949 134.565 155.780 1.00 47.32  ? 49  DA  J C8    1 
ATOM 10085 N N7    . DA  J 6 49  ? 152.960 134.881 156.538 1.00 47.32  ? 49  DA  J N7    1 
ATOM 10086 C C5    . DA  J 6 49  ? 153.930 135.274 155.643 1.00 47.32  ? 49  DA  J C5    1 
ATOM 10087 C C6    . DA  J 6 49  ? 155.247 135.726 155.810 1.00 47.32  ? 49  DA  J C6    1 
ATOM 10088 N N6    . DA  J 6 49  ? 155.824 135.866 157.000 1.00 47.32  ? 49  DA  J N6    1 
ATOM 10089 N N1    . DA  J 6 49  ? 155.951 136.034 154.704 1.00 47.32  ? 49  DA  J N1    1 
ATOM 10090 C C2    . DA  J 6 49  ? 155.372 135.894 153.515 1.00 47.32  ? 49  DA  J C2    1 
ATOM 10091 N N3    . DA  J 6 49  ? 154.142 135.481 153.237 1.00 47.32  ? 49  DA  J N3    1 
ATOM 10092 C C4    . DA  J 6 49  ? 153.471 135.183 154.356 1.00 47.32  ? 49  DA  J C4    1 
ATOM 10093 P P     . DG  J 6 50  ? 148.951 132.649 150.157 1.00 42.61  ? 50  DG  J P     1 
ATOM 10094 O OP1   . DG  J 6 50  ? 148.103 133.764 149.706 1.00 42.61  ? 50  DG  J OP1   1 
ATOM 10095 O OP2   . DG  J 6 50  ? 148.349 131.365 150.545 1.00 42.61  ? 50  DG  J OP2   1 
ATOM 10096 O "O5'" . DG  J 6 50  ? 150.037 132.355 149.029 1.00 42.61  ? 50  DG  J "O5'" 1 
ATOM 10097 C "C5'" . DG  J 6 50  ? 150.893 133.390 148.586 1.00 42.61  ? 50  DG  J "C5'" 1 
ATOM 10098 C "C4'" . DG  J 6 50  ? 152.329 132.914 148.436 1.00 42.61  ? 50  DG  J "C4'" 1 
ATOM 10099 O "O4'" . DG  J 6 50  ? 153.061 133.138 149.663 1.00 42.61  ? 50  DG  J "O4'" 1 
ATOM 10100 C "C3'" . DG  J 6 50  ? 152.528 131.439 148.109 1.00 42.61  ? 50  DG  J "C3'" 1 
ATOM 10101 O "O3'" . DG  J 6 50  ? 153.620 131.319 147.236 1.00 42.61  ? 50  DG  J "O3'" 1 
ATOM 10102 C "C2'" . DG  J 6 50  ? 152.870 130.857 149.467 1.00 42.61  ? 50  DG  J "C2'" 1 
ATOM 10103 C "C1'" . DG  J 6 50  ? 153.738 131.961 149.999 1.00 42.61  ? 50  DG  J "C1'" 1 
ATOM 10104 N N9    . DG  J 6 50  ? 153.928 131.925 151.435 1.00 42.61  ? 50  DG  J N9    1 
ATOM 10105 C C8    . DG  J 6 50  ? 153.025 131.539 152.388 1.00 42.61  ? 50  DG  J C8    1 
ATOM 10106 N N7    . DG  J 6 50  ? 153.494 131.617 153.598 1.00 42.61  ? 50  DG  J N7    1 
ATOM 10107 C C5    . DG  J 6 50  ? 154.786 132.077 153.427 1.00 42.61  ? 50  DG  J C5    1 
ATOM 10108 C C6    . DG  J 6 50  ? 155.785 132.359 154.375 1.00 42.61  ? 50  DG  J C6    1 
ATOM 10109 O O6    . DG  J 6 50  ? 155.728 132.254 155.603 1.00 42.61  ? 50  DG  J O6    1 
ATOM 10110 N N1    . DG  J 6 50  ? 156.954 132.805 153.773 1.00 42.61  ? 50  DG  J N1    1 
ATOM 10111 C C2    . DG  J 6 50  ? 157.127 132.959 152.427 1.00 42.61  ? 50  DG  J C2    1 
ATOM 10112 N N2    . DG  J 6 50  ? 158.320 133.403 152.022 1.00 42.61  ? 50  DG  J N2    1 
ATOM 10113 N N3    . DG  J 6 50  ? 156.198 132.704 151.535 1.00 42.61  ? 50  DG  J N3    1 
ATOM 10114 C C4    . DG  J 6 50  ? 155.061 132.270 152.104 1.00 42.61  ? 50  DG  J C4    1 
ATOM 10115 P P     . DC  J 6 51  ? 153.740 130.093 146.218 1.00 45.21  ? 51  DC  J P     1 
ATOM 10116 O OP1   . DC  J 6 51  ? 153.260 130.541 144.912 1.00 45.21  ? 51  DC  J OP1   1 
ATOM 10117 O OP2   . DC  J 6 51  ? 153.166 128.891 146.834 1.00 45.21  ? 51  DC  J OP2   1 
ATOM 10118 O "O5'" . DC  J 6 51  ? 155.300 129.882 146.099 1.00 45.21  ? 51  DC  J "O5'" 1 
ATOM 10119 C "C5'" . DC  J 6 51  ? 156.156 130.986 146.217 1.00 45.21  ? 51  DC  J "C5'" 1 
ATOM 10120 C "C4'" . DC  J 6 51  ? 157.418 130.609 146.964 1.00 45.21  ? 51  DC  J "C4'" 1 
ATOM 10121 O "O4'" . DC  J 6 51  ? 157.200 130.712 148.388 1.00 45.21  ? 51  DC  J "O4'" 1 
ATOM 10122 C "C3'" . DC  J 6 51  ? 157.910 129.187 146.715 1.00 45.21  ? 51  DC  J "C3'" 1 
ATOM 10123 O "O3'" . DC  J 6 51  ? 159.279 129.208 146.424 1.00 45.21  ? 51  DC  J "O3'" 1 
ATOM 10124 C "C2'" . DC  J 6 51  ? 157.631 128.481 148.035 1.00 45.21  ? 51  DC  J "C2'" 1 
ATOM 10125 C "C1'" . DC  J 6 51  ? 157.798 129.617 149.010 1.00 45.21  ? 51  DC  J "C1'" 1 
ATOM 10126 N N1    . DC  J 6 51  ? 157.144 129.385 150.306 1.00 45.21  ? 51  DC  J N1    1 
ATOM 10127 C C2    . DC  J 6 51  ? 157.837 129.670 151.470 1.00 45.21  ? 51  DC  J C2    1 
ATOM 10128 O O2    . DC  J 6 51  ? 158.976 130.120 151.385 1.00 45.21  ? 51  DC  J O2    1 
ATOM 10129 N N3    . DC  J 6 51  ? 157.240 129.451 152.659 1.00 45.21  ? 51  DC  J N3    1 
ATOM 10130 C C4    . DC  J 6 51  ? 156.007 128.965 152.703 1.00 45.21  ? 51  DC  J C4    1 
ATOM 10131 N N4    . DC  J 6 51  ? 155.462 128.764 153.903 1.00 45.21  ? 51  DC  J N4    1 
ATOM 10132 C C5    . DC  J 6 51  ? 155.281 128.661 151.520 1.00 45.21  ? 51  DC  J C5    1 
ATOM 10133 C C6    . DC  J 6 51  ? 155.885 128.884 150.354 1.00 45.21  ? 51  DC  J C6    1 
ATOM 10134 P P     . DA  J 6 52  ? 159.920 128.082 145.482 1.00 53.71  ? 52  DA  J P     1 
ATOM 10135 O OP1   . DA  J 6 52  ? 160.394 128.735 144.249 1.00 53.71  ? 52  DA  J OP1   1 
ATOM 10136 O OP2   . DA  J 6 52  ? 158.973 126.957 145.405 1.00 53.71  ? 52  DA  J OP2   1 
ATOM 10137 O "O5'" . DA  J 6 52  ? 161.174 127.586 146.315 1.00 53.71  ? 52  DA  J "O5'" 1 
ATOM 10138 C "C5'" . DA  J 6 52  ? 161.865 128.497 147.138 1.00 53.71  ? 52  DA  J "C5'" 1 
ATOM 10139 C "C4'" . DA  J 6 52  ? 162.394 127.796 148.362 1.00 53.71  ? 52  DA  J "C4'" 1 
ATOM 10140 O "O4'" . DA  J 6 52  ? 161.453 127.917 149.437 1.00 53.71  ? 52  DA  J "O4'" 1 
ATOM 10141 C "C3'" . DA  J 6 52  ? 162.629 126.304 148.180 1.00 53.71  ? 52  DA  J "C3'" 1 
ATOM 10142 O "O3'" . DA  J 6 52  ? 164.014 126.043 148.225 1.00 53.71  ? 52  DA  J "O3'" 1 
ATOM 10143 C "C2'" . DA  J 6 52  ? 161.882 125.653 149.351 1.00 53.71  ? 52  DA  J "C2'" 1 
ATOM 10144 C "C1'" . DA  J 6 52  ? 161.610 126.818 150.276 1.00 53.71  ? 52  DA  J "C1'" 1 
ATOM 10145 N N9    . DA  J 6 52  ? 160.394 126.656 151.050 1.00 53.71  ? 52  DA  J N9    1 
ATOM 10146 C C8    . DA  J 6 52  ? 159.138 126.482 150.566 1.00 53.71  ? 52  DA  J C8    1 
ATOM 10147 N N7    . DA  J 6 52  ? 158.228 126.356 151.494 1.00 53.71  ? 52  DA  J N7    1 
ATOM 10148 C C5    . DA  J 6 52  ? 158.942 126.448 152.667 1.00 53.71  ? 52  DA  J C5    1 
ATOM 10149 C C6    . DA  J 6 52  ? 158.554 126.390 154.008 1.00 53.71  ? 52  DA  J C6    1 
ATOM 10150 N N6    . DA  J 6 52  ? 157.293 126.218 154.394 1.00 53.71  ? 52  DA  J N6    1 
ATOM 10151 N N1    . DA  J 6 52  ? 159.510 126.517 154.941 1.00 53.71  ? 52  DA  J N1    1 
ATOM 10152 C C2    . DA  J 6 52  ? 160.774 126.689 154.551 1.00 53.71  ? 52  DA  J C2    1 
ATOM 10153 N N3    . DA  J 6 52  ? 161.258 126.762 153.317 1.00 53.71  ? 52  DA  J N3    1 
ATOM 10154 C C4    . DA  J 6 52  ? 160.278 126.638 152.414 1.00 53.71  ? 52  DA  J C4    1 
ATOM 10155 P P     . DC  J 6 53  ? 164.588 124.568 147.965 1.00 60.52  ? 53  DC  J P     1 
ATOM 10156 O OP1   . DC  J 6 53  ? 165.880 124.741 147.271 1.00 60.52  ? 53  DC  J OP1   1 
ATOM 10157 O OP2   . DC  J 6 53  ? 163.548 123.721 147.347 1.00 60.52  ? 53  DC  J OP2   1 
ATOM 10158 O "O5'" . DC  J 6 53  ? 164.861 124.031 149.439 1.00 60.52  ? 53  DC  J "O5'" 1 
ATOM 10159 C "C5'" . DC  J 6 53  ? 165.447 124.900 150.396 1.00 60.52  ? 53  DC  J "C5'" 1 
ATOM 10160 C "C4'" . DC  J 6 53  ? 165.488 124.250 151.762 1.00 60.52  ? 53  DC  J "C4'" 1 
ATOM 10161 O "O4'" . DC  J 6 53  ? 164.228 124.458 152.441 1.00 60.52  ? 53  DC  J "O4'" 1 
ATOM 10162 C "C3'" . DC  J 6 53  ? 165.726 122.741 151.747 1.00 60.52  ? 53  DC  J "C3'" 1 
ATOM 10163 O "O3'" . DC  J 6 53  ? 166.769 122.413 152.649 1.00 60.52  ? 53  DC  J "O3'" 1 
ATOM 10164 C "C2'" . DC  J 6 53  ? 164.391 122.164 152.202 1.00 60.52  ? 53  DC  J "C2'" 1 
ATOM 10165 C "C1'" . DC  J 6 53  ? 163.855 123.274 153.083 1.00 60.52  ? 53  DC  J "C1'" 1 
ATOM 10166 N N1    . DC  J 6 53  ? 162.388 123.255 153.201 1.00 60.52  ? 53  DC  J N1    1 
ATOM 10167 C C2    . DC  J 6 53  ? 161.791 123.169 154.459 1.00 60.52  ? 53  DC  J C2    1 
ATOM 10168 O O2    . DC  J 6 53  ? 162.507 123.111 155.460 1.00 60.52  ? 53  DC  J O2    1 
ATOM 10169 N N3    . DC  J 6 53  ? 160.445 123.139 154.538 1.00 60.52  ? 53  DC  J N3    1 
ATOM 10170 C C4    . DC  J 6 53  ? 159.715 123.198 153.430 1.00 60.52  ? 53  DC  J C4    1 
ATOM 10171 N N4    . DC  J 6 53  ? 158.391 123.166 153.551 1.00 60.52  ? 53  DC  J N4    1 
ATOM 10172 C C5    . DC  J 6 53  ? 160.305 123.280 152.143 1.00 60.52  ? 53  DC  J C5    1 
ATOM 10173 C C6    . DC  J 6 53  ? 161.632 123.309 152.078 1.00 60.52  ? 53  DC  J C6    1 
ATOM 10174 P P     . DC  J 6 54  ? 167.585 121.039 152.489 1.00 63.36  ? 54  DC  J P     1 
ATOM 10175 O OP1   . DC  J 6 54  ? 169.025 121.373 152.488 1.00 63.36  ? 54  DC  J OP1   1 
ATOM 10176 O OP2   . DC  J 6 54  ? 166.999 120.295 151.352 1.00 63.36  ? 54  DC  J OP2   1 
ATOM 10177 O "O5'" . DC  J 6 54  ? 167.233 120.233 153.823 1.00 63.36  ? 54  DC  J "O5'" 1 
ATOM 10178 C "C5'" . DC  J 6 54  ? 166.899 120.939 155.012 1.00 63.36  ? 54  DC  J "C5'" 1 
ATOM 10179 C "C4'" . DC  J 6 54  ? 166.190 120.029 155.997 1.00 63.36  ? 54  DC  J "C4'" 1 
ATOM 10180 O "O4'" . DC  J 6 54  ? 164.776 120.357 156.043 1.00 63.36  ? 54  DC  J "O4'" 1 
ATOM 10181 C "C3'" . DC  J 6 54  ? 166.268 118.538 155.661 1.00 63.36  ? 54  DC  J "C3'" 1 
ATOM 10182 O "O3'" . DC  J 6 54  ? 166.589 117.801 156.817 1.00 63.36  ? 54  DC  J "O3'" 1 
ATOM 10183 C "C2'" . DC  J 6 54  ? 164.860 118.217 155.181 1.00 63.36  ? 54  DC  J "C2'" 1 
ATOM 10184 C "C1'" . DC  J 6 54  ? 164.040 119.164 156.028 1.00 63.36  ? 54  DC  J "C1'" 1 
ATOM 10185 N N1    . DC  J 6 54  ? 162.707 119.435 155.465 1.00 63.36  ? 54  DC  J N1    1 
ATOM 10186 C C2    . DC  J 6 54  ? 161.588 119.401 156.290 1.00 63.36  ? 54  DC  J C2    1 
ATOM 10187 O O2    . DC  J 6 54  ? 161.736 119.158 157.485 1.00 63.36  ? 54  DC  J O2    1 
ATOM 10188 N N3    . DC  J 6 54  ? 160.377 119.643 155.753 1.00 63.36  ? 54  DC  J N3    1 
ATOM 10189 C C4    . DC  J 6 54  ? 160.267 119.903 154.456 1.00 63.36  ? 54  DC  J C4    1 
ATOM 10190 N N4    . DC  J 6 54  ? 159.055 120.134 153.966 1.00 63.36  ? 54  DC  J N4    1 
ATOM 10191 C C5    . DC  J 6 54  ? 161.394 119.932 153.598 1.00 63.36  ? 54  DC  J C5    1 
ATOM 10192 C C6    . DC  J 6 54  ? 162.585 119.694 154.141 1.00 63.36  ? 54  DC  J C6    1 
ATOM 10193 P P     . DG  J 6 55  ? 167.386 116.414 156.693 1.00 61.17  ? 55  DG  J P     1 
ATOM 10194 O OP1   . DG  J 6 55  ? 168.765 116.656 157.169 1.00 61.17  ? 55  DG  J OP1   1 
ATOM 10195 O OP2   . DG  J 6 55  ? 167.165 115.866 155.340 1.00 61.17  ? 55  DG  J OP2   1 
ATOM 10196 O "O5'" . DG  J 6 55  ? 166.629 115.457 157.721 1.00 61.17  ? 55  DG  J "O5'" 1 
ATOM 10197 C "C5'" . DG  J 6 55  ? 166.242 115.953 158.991 1.00 61.17  ? 55  DG  J "C5'" 1 
ATOM 10198 C "C4'" . DG  J 6 55  ? 164.983 115.262 159.486 1.00 61.17  ? 55  DG  J "C4'" 1 
ATOM 10199 O "O4'" . DG  J 6 55  ? 163.813 115.828 158.843 1.00 61.17  ? 55  DG  J "O4'" 1 
ATOM 10200 C "C3'" . DG  J 6 55  ? 164.921 113.757 159.231 1.00 61.17  ? 55  DG  J "C3'" 1 
ATOM 10201 O "O3'" . DG  J 6 55  ? 164.460 113.116 160.402 1.00 61.17  ? 55  DG  J "O3'" 1 
ATOM 10202 C "C2'" . DG  J 6 55  ? 163.906 113.639 158.088 1.00 61.17  ? 55  DG  J "C2'" 1 
ATOM 10203 C "C1'" . DG  J 6 55  ? 162.976 114.787 158.407 1.00 61.17  ? 55  DG  J "C1'" 1 
ATOM 10204 N N9    . DG  J 6 55  ? 162.220 115.267 157.264 1.00 61.17  ? 55  DG  J N9    1 
ATOM 10205 C C8    . DG  J 6 55  ? 162.698 115.538 156.011 1.00 61.17  ? 55  DG  J C8    1 
ATOM 10206 N N7    . DG  J 6 55  ? 161.788 115.976 155.195 1.00 61.17  ? 55  DG  J N7    1 
ATOM 10207 C C5    . DG  J 6 55  ? 160.635 115.998 155.959 1.00 61.17  ? 55  DG  J C5    1 
ATOM 10208 C C6    . DG  J 6 55  ? 159.332 116.381 155.613 1.00 61.17  ? 55  DG  J C6    1 
ATOM 10209 O O6    . DG  J 6 55  ? 158.922 116.791 154.526 1.00 61.17  ? 55  DG  J O6    1 
ATOM 10210 N N1    . DG  J 6 55  ? 158.459 116.253 156.679 1.00 61.17  ? 55  DG  J N1    1 
ATOM 10211 C C2    . DG  J 6 55  ? 158.806 115.812 157.924 1.00 61.17  ? 55  DG  J C2    1 
ATOM 10212 N N2    . DG  J 6 55  ? 157.828 115.757 158.831 1.00 61.17  ? 55  DG  J N2    1 
ATOM 10213 N N3    . DG  J 6 55  ? 160.027 115.453 158.263 1.00 61.17  ? 55  DG  J N3    1 
ATOM 10214 C C4    . DG  J 6 55  ? 160.886 115.570 157.232 1.00 61.17  ? 55  DG  J C4    1 
ATOM 10215 P P     . DC  J 6 56  ? 164.701 111.549 160.631 1.00 58.46  ? 56  DC  J P     1 
ATOM 10216 O OP1   . DC  J 6 56  ? 165.344 111.405 161.952 1.00 58.46  ? 56  DC  J OP1   1 
ATOM 10217 O OP2   . DC  J 6 56  ? 165.347 110.989 159.427 1.00 58.46  ? 56  DC  J OP2   1 
ATOM 10218 O "O5'" . DC  J 6 56  ? 163.221 110.968 160.737 1.00 58.46  ? 56  DC  J "O5'" 1 
ATOM 10219 C "C5'" . DC  J 6 56  ? 162.252 111.668 161.502 1.00 58.46  ? 56  DC  J "C5'" 1 
ATOM 10220 C "C4'" . DC  J 6 56  ? 160.856 111.140 161.236 1.00 58.46  ? 56  DC  J "C4'" 1 
ATOM 10221 O "O4'" . DC  J 6 56  ? 160.264 111.834 160.106 1.00 58.46  ? 56  DC  J "O4'" 1 
ATOM 10222 C "C3'" . DC  J 6 56  ? 160.771 109.651 160.913 1.00 58.46  ? 56  DC  J "C3'" 1 
ATOM 10223 O "O3'" . DC  J 6 56  ? 159.674 109.096 161.602 1.00 58.46  ? 56  DC  J "O3'" 1 
ATOM 10224 C "C2'" . DC  J 6 56  ? 160.545 109.638 159.400 1.00 58.46  ? 56  DC  J "C2'" 1 
ATOM 10225 C "C1'" . DC  J 6 56  ? 159.720 110.895 159.211 1.00 58.46  ? 56  DC  J "C1'" 1 
ATOM 10226 N N1    . DC  J 6 56  ? 159.802 111.463 157.845 1.00 58.46  ? 56  DC  J N1    1 
ATOM 10227 C C2    . DC  J 6 56  ? 158.709 112.149 157.319 1.00 58.46  ? 56  DC  J C2    1 
ATOM 10228 O O2    . DC  J 6 56  ? 157.692 112.264 157.999 1.00 58.46  ? 56  DC  J O2    1 
ATOM 10229 N N3    . DC  J 6 56  ? 158.797 112.668 156.080 1.00 58.46  ? 56  DC  J N3    1 
ATOM 10230 C C4    . DC  J 6 56  ? 159.916 112.524 155.380 1.00 58.46  ? 56  DC  J C4    1 
ATOM 10231 N N4    . DC  J 6 56  ? 159.959 113.057 154.161 1.00 58.46  ? 56  DC  J N4    1 
ATOM 10232 C C5    . DC  J 6 56  ? 161.041 111.831 155.897 1.00 58.46  ? 56  DC  J C5    1 
ATOM 10233 C C6    . DC  J 6 56  ? 160.941 111.323 157.123 1.00 58.46  ? 56  DC  J C6    1 
ATOM 10234 P P     . DT  J 6 57  ? 159.637 107.540 161.993 1.00 53.20  ? 57  DT  J P     1 
ATOM 10235 O OP1   . DT  J 6 57  ? 160.115 107.423 163.384 1.00 53.20  ? 57  DT  J OP1   1 
ATOM 10236 O OP2   . DT  J 6 57  ? 160.283 106.740 160.930 1.00 53.20  ? 57  DT  J OP2   1 
ATOM 10237 O "O5'" . DT  J 6 57  ? 158.079 107.221 161.960 1.00 53.20  ? 57  DT  J "O5'" 1 
ATOM 10238 C "C5'" . DT  J 6 57  ? 157.157 108.289 162.081 1.00 53.20  ? 57  DT  J "C5'" 1 
ATOM 10239 C "C4'" . DT  J 6 57  ? 156.014 108.150 161.088 1.00 53.20  ? 57  DT  J "C4'" 1 
ATOM 10240 O "O4'" . DT  J 6 57  ? 156.353 108.774 159.825 1.00 53.20  ? 57  DT  J "O4'" 1 
ATOM 10241 C "C3'" . DT  J 6 57  ? 155.610 106.722 160.751 1.00 53.20  ? 57  DT  J "C3'" 1 
ATOM 10242 O "O3'" . DT  J 6 57  ? 154.210 106.655 160.749 1.00 53.20  ? 57  DT  J "O3'" 1 
ATOM 10243 C "C2'" . DT  J 6 57  ? 156.180 106.528 159.344 1.00 53.20  ? 57  DT  J "C2'" 1 
ATOM 10244 C "C1'" . DT  J 6 57  ? 155.978 107.914 158.780 1.00 53.20  ? 57  DT  J "C1'" 1 
ATOM 10245 N N1    . DT  J 6 57  ? 156.816 108.241 157.605 1.00 53.20  ? 57  DT  J N1    1 
ATOM 10246 C C2    . DT  J 6 57  ? 156.319 109.093 156.656 1.00 53.20  ? 57  DT  J C2    1 
ATOM 10247 O O2    . DT  J 6 57  ? 155.206 109.572 156.711 1.00 53.20  ? 57  DT  J O2    1 
ATOM 10248 N N3    . DT  J 6 57  ? 157.167 109.364 155.630 1.00 53.20  ? 57  DT  J N3    1 
ATOM 10249 C C4    . DT  J 6 57  ? 158.445 108.881 155.465 1.00 53.20  ? 57  DT  J C4    1 
ATOM 10250 O O4    . DT  J 6 57  ? 159.137 109.181 154.506 1.00 53.20  ? 57  DT  J O4    1 
ATOM 10251 C C5    . DT  J 6 57  ? 158.909 107.998 156.495 1.00 53.20  ? 57  DT  J C5    1 
ATOM 10252 C C7    . DT  J 6 57  ? 160.285 107.411 156.416 1.00 53.20  ? 57  DT  J C7    1 
ATOM 10253 C C6    . DT  J 6 57  ? 158.082 107.725 157.510 1.00 53.20  ? 57  DT  J C6    1 
ATOM 10254 P P     . DT  J 6 58  ? 153.461 105.286 161.096 1.00 48.26  ? 58  DT  J P     1 
ATOM 10255 O OP1   . DT  J 6 58  ? 152.560 105.549 162.236 1.00 48.26  ? 58  DT  J OP1   1 
ATOM 10256 O OP2   . DT  J 6 58  ? 154.493 104.227 161.158 1.00 48.26  ? 58  DT  J OP2   1 
ATOM 10257 O "O5'" . DT  J 6 58  ? 152.555 105.048 159.814 1.00 48.26  ? 58  DT  J "O5'" 1 
ATOM 10258 C "C5'" . DT  J 6 58  ? 151.968 106.158 159.172 1.00 48.26  ? 58  DT  J "C5'" 1 
ATOM 10259 C "C4'" . DT  J 6 58  ? 151.817 105.904 157.689 1.00 48.26  ? 58  DT  J "C4'" 1 
ATOM 10260 O "O4'" . DT  J 6 58  ? 153.050 106.242 156.998 1.00 48.26  ? 58  DT  J "O4'" 1 
ATOM 10261 C "C3'" . DT  J 6 58  ? 151.514 104.452 157.307 1.00 48.26  ? 58  DT  J "C3'" 1 
ATOM 10262 O "O3'" . DT  J 6 58  ? 150.442 104.424 156.398 1.00 48.26  ? 58  DT  J "O3'" 1 
ATOM 10263 C "C2'" . DT  J 6 58  ? 152.812 104.004 156.633 1.00 48.26  ? 58  DT  J "C2'" 1 
ATOM 10264 C "C1'" . DT  J 6 58  ? 153.219 105.303 155.982 1.00 48.26  ? 58  DT  J "C1'" 1 
ATOM 10265 N N1    . DT  J 6 58  ? 154.607 105.349 155.475 1.00 48.26  ? 58  DT