data_6E7P
# 
_entry.id   6E7P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.302 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6E7P         
WWPDB D_1000235866 
EMDB  EMD-9000     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'cryo-EM structure of human TRPML1 with PI35P2' 
_pdbx_database_related.db_id          EMD-9000 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6E7P 
_pdbx_database_status.recvd_initial_deposition_date   2018-07-27 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Schmiege, P.' 1 ? 
'Li, X.'       2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            9 
_citation.language                  ? 
_citation.page_first                4192 
_citation.page_last                 4192 
_citation.title                     'Structural basis for PtdInsP2-mediated human TRPML1 regulation.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-018-06493-7 
_citation.pdbx_database_id_PubMed   30305615 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Fine, M.'     1 ?                   
primary 'Schmiege, P.' 2 0000-0001-5703-7806 
primary 'Li, X.'       3 0000-0002-0177-0803 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Mucolipin-1 65084.996 4 ? ? ? 'PIP=PI(3,5)P2' 
2 non-polymer syn 
;(1R,2S,3S,4R,5S,6R)-5-{[(R)-[(2R)-2,3-bis{[(1S)-1-hydroxyoctyl]oxy}propoxy](hydroxy)phosphoryl]oxy}-2,4,6-trihydroxycyclohexane-1,3-diyl bis[dihydrogen (phosphate)]
;
750.598   4 ? ? ? ?               
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ML1,MG-2,Mucolipidin,Transient receptor potential channel mucolipin 1,TRPML1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MTAPAGPRGSETERLLTPNPGYGTQAGPSPAPPTPPEEEDLRRRLKYFFMSPCDKFRAKGRKPCKLMLQVVKILVVTVQL
ILFGLSNQLAVTFREENTIAFRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNG
SGLALCQRYYHRGHVDPANDTFDIDPMVVTDCIQVDPPERPPPPPSDDLTLLESSSSYKNLTLKFHKLVNVTIHFRLKTI
NLQSLINNEIPDCYTFSVLITFDNKAHSGRIPISLETQAHIQECKHPSVFQHGDNSFRLLFDVVVILTCSLSFLLCARSL
LRGFLLQNEFVGFMWRQRGRVISLWERLEFVNGWYILLVTSDVLTISGTIMKIGIEAKNLASYDVCSILLGTSTLLVWVG
VIRYLTFFHNYNILIATLRVALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFAAM
QAQQGRSSLVWLFSQLYLYSFISLFIYMVLSLFIALITGAYDTIKHPGGAGAEESELQAYIAQCQDSPTSGKFRRGSGSA
CSLLCCCGRDPSEEHSLLVN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MTAPAGPRGSETERLLTPNPGYGTQAGPSPAPPTPPEEEDLRRRLKYFFMSPCDKFRAKGRKPCKLMLQVVKILVVTVQL
ILFGLSNQLAVTFREENTIAFRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNG
SGLALCQRYYHRGHVDPANDTFDIDPMVVTDCIQVDPPERPPPPPSDDLTLLESSSSYKNLTLKFHKLVNVTIHFRLKTI
NLQSLINNEIPDCYTFSVLITFDNKAHSGRIPISLETQAHIQECKHPSVFQHGDNSFRLLFDVVVILTCSLSFLLCARSL
LRGFLLQNEFVGFMWRQRGRVISLWERLEFVNGWYILLVTSDVLTISGTIMKIGIEAKNLASYDVCSILLGTSTLLVWVG
VIRYLTFFHNYNILIATLRVALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFAAM
QAQQGRSSLVWLFSQLYLYSFISLFIYMVLSLFIALITGAYDTIKHPGGAGAEESELQAYIAQCQDSPTSGKFRRGSGSA
CSLLCCCGRDPSEEHSLLVN
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   ALA n 
1 4   PRO n 
1 5   ALA n 
1 6   GLY n 
1 7   PRO n 
1 8   ARG n 
1 9   GLY n 
1 10  SER n 
1 11  GLU n 
1 12  THR n 
1 13  GLU n 
1 14  ARG n 
1 15  LEU n 
1 16  LEU n 
1 17  THR n 
1 18  PRO n 
1 19  ASN n 
1 20  PRO n 
1 21  GLY n 
1 22  TYR n 
1 23  GLY n 
1 24  THR n 
1 25  GLN n 
1 26  ALA n 
1 27  GLY n 
1 28  PRO n 
1 29  SER n 
1 30  PRO n 
1 31  ALA n 
1 32  PRO n 
1 33  PRO n 
1 34  THR n 
1 35  PRO n 
1 36  PRO n 
1 37  GLU n 
1 38  GLU n 
1 39  GLU n 
1 40  ASP n 
1 41  LEU n 
1 42  ARG n 
1 43  ARG n 
1 44  ARG n 
1 45  LEU n 
1 46  LYS n 
1 47  TYR n 
1 48  PHE n 
1 49  PHE n 
1 50  MET n 
1 51  SER n 
1 52  PRO n 
1 53  CYS n 
1 54  ASP n 
1 55  LYS n 
1 56  PHE n 
1 57  ARG n 
1 58  ALA n 
1 59  LYS n 
1 60  GLY n 
1 61  ARG n 
1 62  LYS n 
1 63  PRO n 
1 64  CYS n 
1 65  LYS n 
1 66  LEU n 
1 67  MET n 
1 68  LEU n 
1 69  GLN n 
1 70  VAL n 
1 71  VAL n 
1 72  LYS n 
1 73  ILE n 
1 74  LEU n 
1 75  VAL n 
1 76  VAL n 
1 77  THR n 
1 78  VAL n 
1 79  GLN n 
1 80  LEU n 
1 81  ILE n 
1 82  LEU n 
1 83  PHE n 
1 84  GLY n 
1 85  LEU n 
1 86  SER n 
1 87  ASN n 
1 88  GLN n 
1 89  LEU n 
1 90  ALA n 
1 91  VAL n 
1 92  THR n 
1 93  PHE n 
1 94  ARG n 
1 95  GLU n 
1 96  GLU n 
1 97  ASN n 
1 98  THR n 
1 99  ILE n 
1 100 ALA n 
1 101 PHE n 
1 102 ARG n 
1 103 HIS n 
1 104 LEU n 
1 105 PHE n 
1 106 LEU n 
1 107 LEU n 
1 108 GLY n 
1 109 TYR n 
1 110 SER n 
1 111 ASP n 
1 112 GLY n 
1 113 ALA n 
1 114 ASP n 
1 115 ASP n 
1 116 THR n 
1 117 PHE n 
1 118 ALA n 
1 119 ALA n 
1 120 TYR n 
1 121 THR n 
1 122 ARG n 
1 123 GLU n 
1 124 GLN n 
1 125 LEU n 
1 126 TYR n 
1 127 GLN n 
1 128 ALA n 
1 129 ILE n 
1 130 PHE n 
1 131 HIS n 
1 132 ALA n 
1 133 VAL n 
1 134 ASP n 
1 135 GLN n 
1 136 TYR n 
1 137 LEU n 
1 138 ALA n 
1 139 LEU n 
1 140 PRO n 
1 141 ASP n 
1 142 VAL n 
1 143 SER n 
1 144 LEU n 
1 145 GLY n 
1 146 ARG n 
1 147 TYR n 
1 148 ALA n 
1 149 TYR n 
1 150 VAL n 
1 151 ARG n 
1 152 GLY n 
1 153 GLY n 
1 154 GLY n 
1 155 ASP n 
1 156 PRO n 
1 157 TRP n 
1 158 THR n 
1 159 ASN n 
1 160 GLY n 
1 161 SER n 
1 162 GLY n 
1 163 LEU n 
1 164 ALA n 
1 165 LEU n 
1 166 CYS n 
1 167 GLN n 
1 168 ARG n 
1 169 TYR n 
1 170 TYR n 
1 171 HIS n 
1 172 ARG n 
1 173 GLY n 
1 174 HIS n 
1 175 VAL n 
1 176 ASP n 
1 177 PRO n 
1 178 ALA n 
1 179 ASN n 
1 180 ASP n 
1 181 THR n 
1 182 PHE n 
1 183 ASP n 
1 184 ILE n 
1 185 ASP n 
1 186 PRO n 
1 187 MET n 
1 188 VAL n 
1 189 VAL n 
1 190 THR n 
1 191 ASP n 
1 192 CYS n 
1 193 ILE n 
1 194 GLN n 
1 195 VAL n 
1 196 ASP n 
1 197 PRO n 
1 198 PRO n 
1 199 GLU n 
1 200 ARG n 
1 201 PRO n 
1 202 PRO n 
1 203 PRO n 
1 204 PRO n 
1 205 PRO n 
1 206 SER n 
1 207 ASP n 
1 208 ASP n 
1 209 LEU n 
1 210 THR n 
1 211 LEU n 
1 212 LEU n 
1 213 GLU n 
1 214 SER n 
1 215 SER n 
1 216 SER n 
1 217 SER n 
1 218 TYR n 
1 219 LYS n 
1 220 ASN n 
1 221 LEU n 
1 222 THR n 
1 223 LEU n 
1 224 LYS n 
1 225 PHE n 
1 226 HIS n 
1 227 LYS n 
1 228 LEU n 
1 229 VAL n 
1 230 ASN n 
1 231 VAL n 
1 232 THR n 
1 233 ILE n 
1 234 HIS n 
1 235 PHE n 
1 236 ARG n 
1 237 LEU n 
1 238 LYS n 
1 239 THR n 
1 240 ILE n 
1 241 ASN n 
1 242 LEU n 
1 243 GLN n 
1 244 SER n 
1 245 LEU n 
1 246 ILE n 
1 247 ASN n 
1 248 ASN n 
1 249 GLU n 
1 250 ILE n 
1 251 PRO n 
1 252 ASP n 
1 253 CYS n 
1 254 TYR n 
1 255 THR n 
1 256 PHE n 
1 257 SER n 
1 258 VAL n 
1 259 LEU n 
1 260 ILE n 
1 261 THR n 
1 262 PHE n 
1 263 ASP n 
1 264 ASN n 
1 265 LYS n 
1 266 ALA n 
1 267 HIS n 
1 268 SER n 
1 269 GLY n 
1 270 ARG n 
1 271 ILE n 
1 272 PRO n 
1 273 ILE n 
1 274 SER n 
1 275 LEU n 
1 276 GLU n 
1 277 THR n 
1 278 GLN n 
1 279 ALA n 
1 280 HIS n 
1 281 ILE n 
1 282 GLN n 
1 283 GLU n 
1 284 CYS n 
1 285 LYS n 
1 286 HIS n 
1 287 PRO n 
1 288 SER n 
1 289 VAL n 
1 290 PHE n 
1 291 GLN n 
1 292 HIS n 
1 293 GLY n 
1 294 ASP n 
1 295 ASN n 
1 296 SER n 
1 297 PHE n 
1 298 ARG n 
1 299 LEU n 
1 300 LEU n 
1 301 PHE n 
1 302 ASP n 
1 303 VAL n 
1 304 VAL n 
1 305 VAL n 
1 306 ILE n 
1 307 LEU n 
1 308 THR n 
1 309 CYS n 
1 310 SER n 
1 311 LEU n 
1 312 SER n 
1 313 PHE n 
1 314 LEU n 
1 315 LEU n 
1 316 CYS n 
1 317 ALA n 
1 318 ARG n 
1 319 SER n 
1 320 LEU n 
1 321 LEU n 
1 322 ARG n 
1 323 GLY n 
1 324 PHE n 
1 325 LEU n 
1 326 LEU n 
1 327 GLN n 
1 328 ASN n 
1 329 GLU n 
1 330 PHE n 
1 331 VAL n 
1 332 GLY n 
1 333 PHE n 
1 334 MET n 
1 335 TRP n 
1 336 ARG n 
1 337 GLN n 
1 338 ARG n 
1 339 GLY n 
1 340 ARG n 
1 341 VAL n 
1 342 ILE n 
1 343 SER n 
1 344 LEU n 
1 345 TRP n 
1 346 GLU n 
1 347 ARG n 
1 348 LEU n 
1 349 GLU n 
1 350 PHE n 
1 351 VAL n 
1 352 ASN n 
1 353 GLY n 
1 354 TRP n 
1 355 TYR n 
1 356 ILE n 
1 357 LEU n 
1 358 LEU n 
1 359 VAL n 
1 360 THR n 
1 361 SER n 
1 362 ASP n 
1 363 VAL n 
1 364 LEU n 
1 365 THR n 
1 366 ILE n 
1 367 SER n 
1 368 GLY n 
1 369 THR n 
1 370 ILE n 
1 371 MET n 
1 372 LYS n 
1 373 ILE n 
1 374 GLY n 
1 375 ILE n 
1 376 GLU n 
1 377 ALA n 
1 378 LYS n 
1 379 ASN n 
1 380 LEU n 
1 381 ALA n 
1 382 SER n 
1 383 TYR n 
1 384 ASP n 
1 385 VAL n 
1 386 CYS n 
1 387 SER n 
1 388 ILE n 
1 389 LEU n 
1 390 LEU n 
1 391 GLY n 
1 392 THR n 
1 393 SER n 
1 394 THR n 
1 395 LEU n 
1 396 LEU n 
1 397 VAL n 
1 398 TRP n 
1 399 VAL n 
1 400 GLY n 
1 401 VAL n 
1 402 ILE n 
1 403 ARG n 
1 404 TYR n 
1 405 LEU n 
1 406 THR n 
1 407 PHE n 
1 408 PHE n 
1 409 HIS n 
1 410 ASN n 
1 411 TYR n 
1 412 ASN n 
1 413 ILE n 
1 414 LEU n 
1 415 ILE n 
1 416 ALA n 
1 417 THR n 
1 418 LEU n 
1 419 ARG n 
1 420 VAL n 
1 421 ALA n 
1 422 LEU n 
1 423 PRO n 
1 424 SER n 
1 425 VAL n 
1 426 MET n 
1 427 ARG n 
1 428 PHE n 
1 429 CYS n 
1 430 CYS n 
1 431 CYS n 
1 432 VAL n 
1 433 ALA n 
1 434 VAL n 
1 435 ILE n 
1 436 TYR n 
1 437 LEU n 
1 438 GLY n 
1 439 TYR n 
1 440 CYS n 
1 441 PHE n 
1 442 CYS n 
1 443 GLY n 
1 444 TRP n 
1 445 ILE n 
1 446 VAL n 
1 447 LEU n 
1 448 GLY n 
1 449 PRO n 
1 450 TYR n 
1 451 HIS n 
1 452 VAL n 
1 453 LYS n 
1 454 PHE n 
1 455 ARG n 
1 456 SER n 
1 457 LEU n 
1 458 SER n 
1 459 MET n 
1 460 VAL n 
1 461 SER n 
1 462 GLU n 
1 463 CYS n 
1 464 LEU n 
1 465 PHE n 
1 466 SER n 
1 467 LEU n 
1 468 ILE n 
1 469 ASN n 
1 470 GLY n 
1 471 ASP n 
1 472 ASP n 
1 473 MET n 
1 474 PHE n 
1 475 VAL n 
1 476 THR n 
1 477 PHE n 
1 478 ALA n 
1 479 ALA n 
1 480 MET n 
1 481 GLN n 
1 482 ALA n 
1 483 GLN n 
1 484 GLN n 
1 485 GLY n 
1 486 ARG n 
1 487 SER n 
1 488 SER n 
1 489 LEU n 
1 490 VAL n 
1 491 TRP n 
1 492 LEU n 
1 493 PHE n 
1 494 SER n 
1 495 GLN n 
1 496 LEU n 
1 497 TYR n 
1 498 LEU n 
1 499 TYR n 
1 500 SER n 
1 501 PHE n 
1 502 ILE n 
1 503 SER n 
1 504 LEU n 
1 505 PHE n 
1 506 ILE n 
1 507 TYR n 
1 508 MET n 
1 509 VAL n 
1 510 LEU n 
1 511 SER n 
1 512 LEU n 
1 513 PHE n 
1 514 ILE n 
1 515 ALA n 
1 516 LEU n 
1 517 ILE n 
1 518 THR n 
1 519 GLY n 
1 520 ALA n 
1 521 TYR n 
1 522 ASP n 
1 523 THR n 
1 524 ILE n 
1 525 LYS n 
1 526 HIS n 
1 527 PRO n 
1 528 GLY n 
1 529 GLY n 
1 530 ALA n 
1 531 GLY n 
1 532 ALA n 
1 533 GLU n 
1 534 GLU n 
1 535 SER n 
1 536 GLU n 
1 537 LEU n 
1 538 GLN n 
1 539 ALA n 
1 540 TYR n 
1 541 ILE n 
1 542 ALA n 
1 543 GLN n 
1 544 CYS n 
1 545 GLN n 
1 546 ASP n 
1 547 SER n 
1 548 PRO n 
1 549 THR n 
1 550 SER n 
1 551 GLY n 
1 552 LYS n 
1 553 PHE n 
1 554 ARG n 
1 555 ARG n 
1 556 GLY n 
1 557 SER n 
1 558 GLY n 
1 559 SER n 
1 560 ALA n 
1 561 CYS n 
1 562 SER n 
1 563 LEU n 
1 564 LEU n 
1 565 CYS n 
1 566 CYS n 
1 567 CYS n 
1 568 GLY n 
1 569 ARG n 
1 570 ASP n 
1 571 PRO n 
1 572 SER n 
1 573 GLU n 
1 574 GLU n 
1 575 HIS n 
1 576 SER n 
1 577 LEU n 
1 578 LEU n 
1 579 VAL n 
1 580 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   580 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'MCOLN1, ML4, MSTP080' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MCLN1_HUMAN 
_struct_ref.pdbx_db_accession          Q9GZU1 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MTAPAGPRGSETERLLTPNPGYGTQAGPSPAPPTPPEEEDLRRRLKYFFMSPCDKFRAKGRKPCKLMLQVVKILVVTVQL
ILFGLSNQLAVTFREENTIAFRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNG
SGLALCQRYYHRGHVDPANDTFDIDPMVVTDCIQVDPPERPPPPPSDDLTLLESSSSYKNLTLKFHKLVNVTIHFRLKTI
NLQSLINNEIPDCYTFSVLITFDNKAHSGRIPISLETQAHIQECKHPSVFQHGDNSFRLLFDVVVILTCSLSFLLCARSL
LRGFLLQNEFVGFMWRQRGRVISLWERLEFVNGWYILLVTSDVLTISGTIMKIGIEAKNLASYDVCSILLGTSTLLVWVG
VIRYLTFFHNYNILIATLRVALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFAAM
QAQQGRSSLVWLFSQLYLYSFISLFIYMVLSLFIALITGAYDTIKHPGGAGAEESELQAYIAQCQDSPTSGKFRRGSGSA
CSLLCCCGRDPSEEHSLLVN
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6E7P A 1 ? 580 ? Q9GZU1 1 ? 580 ? 1 580 
2 1 6E7P B 1 ? 580 ? Q9GZU1 1 ? 580 ? 1 580 
3 1 6E7P C 1 ? 580 ? Q9GZU1 1 ? 580 ? 1 580 
4 1 6E7P D 1 ? 580 ? Q9GZU1 1 ? 580 ? 1 580 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 
HZ7 non-polymer         . 
;(1R,2S,3S,4R,5S,6R)-5-{[(R)-[(2R)-2,3-bis{[(1S)-1-hydroxyoctyl]oxy}propoxy](hydroxy)phosphoryl]oxy}-2,4,6-trihydroxycyclohexane-1,3-diyl bis[dihydrogen (phosphate)]
;
? 'C25 H53 O19 P3' 750.598 
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6E7P 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 6E7P 
_refine.pdbx_diffrn_id                           ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            3.50 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.009  ? 15897 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 1.026  ? 21580 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 11.434 ? 9304  ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.059  ? 2468  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.006  ? 2648  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     6E7P 
_struct.title                        'cryo-EM structure of human TRPML1 with PI35P2' 
_struct.pdbx_descriptor              Mucolipin-1 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6E7P 
_struct_keywords.text            'human TRPML1, MEMBRANE PROTEIN' 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LEU A 41  ? PHE A 48  ? LEU A 41  PHE A 48  1 ? 8  
HELX_P HELX_P2  AA2 SER A 51  ? PHE A 56  ? SER A 51  PHE A 56  1 ? 6  
HELX_P HELX_P3  AA3 PRO A 63  ? LEU A 106 ? PRO A 63  LEU A 106 1 ? 44 
HELX_P HELX_P4  AA4 ARG A 122 ? ALA A 138 ? ARG A 122 ALA A 138 1 ? 17 
HELX_P HELX_P5  AA5 ALA A 138 ? SER A 143 ? ALA A 138 SER A 143 1 ? 6  
HELX_P HELX_P6  AA6 LYS A 224 ? LEU A 228 ? LYS A 224 LEU A 228 5 ? 5  
HELX_P HELX_P7  AA7 PHE A 290 ? ASP A 294 ? PHE A 290 ASP A 294 5 ? 5  
HELX_P HELX_P8  AA8 ASN A 295 ? LEU A 300 ? ASN A 295 LEU A 300 1 ? 6  
HELX_P HELX_P9  AA9 PHE A 301 ? LEU A 326 ? PHE A 301 LEU A 326 1 ? 26 
HELX_P HELX_P10 AB1 GLN A 327 ? PHE A 333 ? GLN A 327 PHE A 333 1 ? 7  
HELX_P HELX_P11 AB2 ASN A 352 ? ILE A 373 ? ASN A 352 ILE A 373 1 ? 22 
HELX_P HELX_P12 AB3 ASP A 384 ? TRP A 398 ? ASP A 384 TRP A 398 1 ? 15 
HELX_P HELX_P13 AB4 VAL A 401 ? THR A 406 ? VAL A 401 THR A 406 1 ? 6  
HELX_P HELX_P14 AB5 ASN A 410 ? LEU A 447 ? ASN A 410 LEU A 447 1 ? 38 
HELX_P HELX_P15 AB6 SER A 456 ? LEU A 464 ? SER A 456 LEU A 464 1 ? 9  
HELX_P HELX_P16 AB7 LEU A 464 ? ASN A 469 ? LEU A 464 ASN A 469 1 ? 6  
HELX_P HELX_P17 AB8 MET A 473 ? GLN A 481 ? MET A 473 GLN A 481 1 ? 9  
HELX_P HELX_P18 AB9 SER A 487 ? ILE A 506 ? SER A 487 ILE A 506 1 ? 20 
HELX_P HELX_P19 AC1 VAL A 509 ? HIS A 526 ? VAL A 509 HIS A 526 1 ? 18 
HELX_P HELX_P20 AC2 LEU B 41  ? PHE B 48  ? LEU B 41  PHE B 48  1 ? 8  
HELX_P HELX_P21 AC3 SER B 51  ? PHE B 56  ? SER B 51  PHE B 56  1 ? 6  
HELX_P HELX_P22 AC4 PRO B 63  ? LEU B 106 ? PRO B 63  LEU B 106 1 ? 44 
HELX_P HELX_P23 AC5 ARG B 122 ? ALA B 138 ? ARG B 122 ALA B 138 1 ? 17 
HELX_P HELX_P24 AC6 ALA B 138 ? SER B 143 ? ALA B 138 SER B 143 1 ? 6  
HELX_P HELX_P25 AC7 LYS B 224 ? LEU B 228 ? LYS B 224 LEU B 228 5 ? 5  
HELX_P HELX_P26 AC8 PHE B 290 ? ASP B 294 ? PHE B 290 ASP B 294 5 ? 5  
HELX_P HELX_P27 AC9 ASN B 295 ? LEU B 300 ? ASN B 295 LEU B 300 1 ? 6  
HELX_P HELX_P28 AD1 PHE B 301 ? LEU B 326 ? PHE B 301 LEU B 326 1 ? 26 
HELX_P HELX_P29 AD2 GLN B 327 ? PHE B 333 ? GLN B 327 PHE B 333 1 ? 7  
HELX_P HELX_P30 AD3 ASN B 352 ? ILE B 373 ? ASN B 352 ILE B 373 1 ? 22 
HELX_P HELX_P31 AD4 ASP B 384 ? TRP B 398 ? ASP B 384 TRP B 398 1 ? 15 
HELX_P HELX_P32 AD5 VAL B 401 ? THR B 406 ? VAL B 401 THR B 406 1 ? 6  
HELX_P HELX_P33 AD6 ASN B 410 ? LEU B 447 ? ASN B 410 LEU B 447 1 ? 38 
HELX_P HELX_P34 AD7 SER B 456 ? LEU B 464 ? SER B 456 LEU B 464 1 ? 9  
HELX_P HELX_P35 AD8 LEU B 464 ? ASN B 469 ? LEU B 464 ASN B 469 1 ? 6  
HELX_P HELX_P36 AD9 MET B 473 ? GLN B 481 ? MET B 473 GLN B 481 1 ? 9  
HELX_P HELX_P37 AE1 SER B 487 ? ILE B 506 ? SER B 487 ILE B 506 1 ? 20 
HELX_P HELX_P38 AE2 VAL B 509 ? HIS B 526 ? VAL B 509 HIS B 526 1 ? 18 
HELX_P HELX_P39 AE3 LEU C 41  ? PHE C 48  ? LEU C 41  PHE C 48  1 ? 8  
HELX_P HELX_P40 AE4 SER C 51  ? PHE C 56  ? SER C 51  PHE C 56  1 ? 6  
HELX_P HELX_P41 AE5 PRO C 63  ? LEU C 106 ? PRO C 63  LEU C 106 1 ? 44 
HELX_P HELX_P42 AE6 ARG C 122 ? ALA C 138 ? ARG C 122 ALA C 138 1 ? 17 
HELX_P HELX_P43 AE7 ALA C 138 ? SER C 143 ? ALA C 138 SER C 143 1 ? 6  
HELX_P HELX_P44 AE8 LYS C 224 ? LEU C 228 ? LYS C 224 LEU C 228 5 ? 5  
HELX_P HELX_P45 AE9 PHE C 290 ? ASP C 294 ? PHE C 290 ASP C 294 5 ? 5  
HELX_P HELX_P46 AF1 ASN C 295 ? LEU C 300 ? ASN C 295 LEU C 300 1 ? 6  
HELX_P HELX_P47 AF2 PHE C 301 ? LEU C 326 ? PHE C 301 LEU C 326 1 ? 26 
HELX_P HELX_P48 AF3 GLN C 327 ? PHE C 333 ? GLN C 327 PHE C 333 1 ? 7  
HELX_P HELX_P49 AF4 ASN C 352 ? ILE C 373 ? ASN C 352 ILE C 373 1 ? 22 
HELX_P HELX_P50 AF5 ASP C 384 ? TRP C 398 ? ASP C 384 TRP C 398 1 ? 15 
HELX_P HELX_P51 AF6 VAL C 401 ? THR C 406 ? VAL C 401 THR C 406 1 ? 6  
HELX_P HELX_P52 AF7 ASN C 410 ? LEU C 447 ? ASN C 410 LEU C 447 1 ? 38 
HELX_P HELX_P53 AF8 SER C 456 ? LEU C 464 ? SER C 456 LEU C 464 1 ? 9  
HELX_P HELX_P54 AF9 LEU C 464 ? ASN C 469 ? LEU C 464 ASN C 469 1 ? 6  
HELX_P HELX_P55 AG1 MET C 473 ? GLN C 481 ? MET C 473 GLN C 481 1 ? 9  
HELX_P HELX_P56 AG2 SER C 487 ? ILE C 506 ? SER C 487 ILE C 506 1 ? 20 
HELX_P HELX_P57 AG3 VAL C 509 ? HIS C 526 ? VAL C 509 HIS C 526 1 ? 18 
HELX_P HELX_P58 AG4 LEU D 41  ? PHE D 48  ? LEU D 41  PHE D 48  1 ? 8  
HELX_P HELX_P59 AG5 SER D 51  ? PHE D 56  ? SER D 51  PHE D 56  1 ? 6  
HELX_P HELX_P60 AG6 PRO D 63  ? LEU D 106 ? PRO D 63  LEU D 106 1 ? 44 
HELX_P HELX_P61 AG7 ARG D 122 ? ALA D 138 ? ARG D 122 ALA D 138 1 ? 17 
HELX_P HELX_P62 AG8 ALA D 138 ? SER D 143 ? ALA D 138 SER D 143 1 ? 6  
HELX_P HELX_P63 AG9 LYS D 224 ? LEU D 228 ? LYS D 224 LEU D 228 5 ? 5  
HELX_P HELX_P64 AH1 PHE D 290 ? ASP D 294 ? PHE D 290 ASP D 294 5 ? 5  
HELX_P HELX_P65 AH2 ASN D 295 ? LEU D 300 ? ASN D 295 LEU D 300 1 ? 6  
HELX_P HELX_P66 AH3 PHE D 301 ? LEU D 326 ? PHE D 301 LEU D 326 1 ? 26 
HELX_P HELX_P67 AH4 GLN D 327 ? PHE D 333 ? GLN D 327 PHE D 333 1 ? 7  
HELX_P HELX_P68 AH5 ASN D 352 ? ILE D 373 ? ASN D 352 ILE D 373 1 ? 22 
HELX_P HELX_P69 AH6 ASP D 384 ? TRP D 398 ? ASP D 384 TRP D 398 1 ? 15 
HELX_P HELX_P70 AH7 VAL D 401 ? THR D 406 ? VAL D 401 THR D 406 1 ? 6  
HELX_P HELX_P71 AH8 ASN D 410 ? LEU D 447 ? ASN D 410 LEU D 447 1 ? 38 
HELX_P HELX_P72 AH9 SER D 456 ? LEU D 464 ? SER D 456 LEU D 464 1 ? 9  
HELX_P HELX_P73 AI1 LEU D 464 ? ASN D 469 ? LEU D 464 ASN D 469 1 ? 6  
HELX_P HELX_P74 AI2 MET D 473 ? GLN D 481 ? MET D 473 GLN D 481 1 ? 9  
HELX_P HELX_P75 AI3 SER D 487 ? ILE D 506 ? SER D 487 ILE D 506 1 ? 20 
HELX_P HELX_P76 AI4 VAL D 509 ? HIS D 526 ? VAL D 509 HIS D 526 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 166 SG ? ? ? 1_555 A CYS 192 SG ? ? A CYS 166 A CYS 192 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf2 disulf ? ? A CYS 253 SG ? ? ? 1_555 A CYS 284 SG ? ? A CYS 253 A CYS 284 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf3 disulf ? ? B CYS 166 SG ? ? ? 1_555 B CYS 192 SG ? ? B CYS 166 B CYS 192 1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf4 disulf ? ? B CYS 253 SG ? ? ? 1_555 B CYS 284 SG ? ? B CYS 253 B CYS 284 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf5 disulf ? ? C CYS 166 SG ? ? ? 1_555 C CYS 192 SG ? ? C CYS 166 C CYS 192 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf6 disulf ? ? C CYS 253 SG ? ? ? 1_555 C CYS 284 SG ? ? C CYS 253 C CYS 284 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf7 disulf ? ? D CYS 166 SG ? ? ? 1_555 D CYS 192 SG ? ? D CYS 166 D CYS 192 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf8 disulf ? ? D CYS 253 SG ? ? ? 1_555 D CYS 284 SG ? ? D CYS 253 D CYS 284 1_555 ? ? ? ? ? ? ? 2.025 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 6 ? 
AA3 ? 5 ? 
AA4 ? 6 ? 
AA5 ? 5 ? 
AA6 ? 6 ? 
AA7 ? 5 ? 
AA8 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA4 5 6 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA6 5 6 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA8 4 5 ? anti-parallel 
AA8 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 118 ? ALA A 119 ? ALA A 118 ALA A 119 
AA1 2 ILE A 271 ? GLU A 276 ? ILE A 271 GLU A 276 
AA1 3 THR A 255 ? ASP A 263 ? THR A 255 ASP A 263 
AA1 4 ASN A 230 ? LYS A 238 ? ASN A 230 LYS A 238 
AA1 5 ALA A 148 ? TYR A 149 ? ALA A 148 TYR A 149 
AA2 1 ALA A 118 ? ALA A 119 ? ALA A 118 ALA A 119 
AA2 2 ILE A 271 ? GLU A 276 ? ILE A 271 GLU A 276 
AA2 3 THR A 255 ? ASP A 263 ? THR A 255 ASP A 263 
AA2 4 ASN A 230 ? LYS A 238 ? ASN A 230 LYS A 238 
AA2 5 LEU A 163 ? CYS A 166 ? LEU A 163 CYS A 166 
AA2 6 CYS A 192 ? VAL A 195 ? CYS A 192 VAL A 195 
AA3 1 ALA B 118 ? ALA B 119 ? ALA B 118 ALA B 119 
AA3 2 ILE B 271 ? GLU B 276 ? ILE B 271 GLU B 276 
AA3 3 THR B 255 ? ASP B 263 ? THR B 255 ASP B 263 
AA3 4 ASN B 230 ? LYS B 238 ? ASN B 230 LYS B 238 
AA3 5 ALA B 148 ? TYR B 149 ? ALA B 148 TYR B 149 
AA4 1 ALA B 118 ? ALA B 119 ? ALA B 118 ALA B 119 
AA4 2 ILE B 271 ? GLU B 276 ? ILE B 271 GLU B 276 
AA4 3 THR B 255 ? ASP B 263 ? THR B 255 ASP B 263 
AA4 4 ASN B 230 ? LYS B 238 ? ASN B 230 LYS B 238 
AA4 5 LEU B 163 ? CYS B 166 ? LEU B 163 CYS B 166 
AA4 6 CYS B 192 ? VAL B 195 ? CYS B 192 VAL B 195 
AA5 1 ALA C 118 ? ALA C 119 ? ALA C 118 ALA C 119 
AA5 2 ILE C 271 ? GLU C 276 ? ILE C 271 GLU C 276 
AA5 3 THR C 255 ? ASP C 263 ? THR C 255 ASP C 263 
AA5 4 ASN C 230 ? LYS C 238 ? ASN C 230 LYS C 238 
AA5 5 ALA C 148 ? TYR C 149 ? ALA C 148 TYR C 149 
AA6 1 ALA C 118 ? ALA C 119 ? ALA C 118 ALA C 119 
AA6 2 ILE C 271 ? GLU C 276 ? ILE C 271 GLU C 276 
AA6 3 THR C 255 ? ASP C 263 ? THR C 255 ASP C 263 
AA6 4 ASN C 230 ? LYS C 238 ? ASN C 230 LYS C 238 
AA6 5 LEU C 163 ? CYS C 166 ? LEU C 163 CYS C 166 
AA6 6 CYS C 192 ? VAL C 195 ? CYS C 192 VAL C 195 
AA7 1 ALA D 118 ? ALA D 119 ? ALA D 118 ALA D 119 
AA7 2 ILE D 271 ? GLU D 276 ? ILE D 271 GLU D 276 
AA7 3 THR D 255 ? ASP D 263 ? THR D 255 ASP D 263 
AA7 4 ASN D 230 ? LYS D 238 ? ASN D 230 LYS D 238 
AA7 5 ALA D 148 ? TYR D 149 ? ALA D 148 TYR D 149 
AA8 1 ALA D 118 ? ALA D 119 ? ALA D 118 ALA D 119 
AA8 2 ILE D 271 ? GLU D 276 ? ILE D 271 GLU D 276 
AA8 3 THR D 255 ? ASP D 263 ? THR D 255 ASP D 263 
AA8 4 ASN D 230 ? LYS D 238 ? ASN D 230 LYS D 238 
AA8 5 LEU D 163 ? CYS D 166 ? LEU D 163 CYS D 166 
AA8 6 CYS D 192 ? VAL D 195 ? CYS D 192 VAL D 195 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A 119 ? N ALA A 119 O ILE A 271 ? O ILE A 271 
AA1 2 3 O SER A 274 ? O SER A 274 N THR A 261 ? N THR A 261 
AA1 3 4 O PHE A 256 ? O PHE A 256 N LEU A 237 ? N LEU A 237 
AA1 4 5 O LYS A 238 ? O LYS A 238 N ALA A 148 ? N ALA A 148 
AA2 1 2 N ALA A 119 ? N ALA A 119 O ILE A 271 ? O ILE A 271 
AA2 2 3 O SER A 274 ? O SER A 274 N THR A 261 ? N THR A 261 
AA2 3 4 O PHE A 256 ? O PHE A 256 N LEU A 237 ? N LEU A 237 
AA2 4 5 O THR A 232 ? O THR A 232 N CYS A 166 ? N CYS A 166 
AA2 5 6 N LEU A 163 ? N LEU A 163 O VAL A 195 ? O VAL A 195 
AA3 1 2 N ALA B 119 ? N ALA B 119 O ILE B 271 ? O ILE B 271 
AA3 2 3 O SER B 274 ? O SER B 274 N THR B 261 ? N THR B 261 
AA3 3 4 O PHE B 256 ? O PHE B 256 N LEU B 237 ? N LEU B 237 
AA3 4 5 O LYS B 238 ? O LYS B 238 N ALA B 148 ? N ALA B 148 
AA4 1 2 N ALA B 119 ? N ALA B 119 O ILE B 271 ? O ILE B 271 
AA4 2 3 O SER B 274 ? O SER B 274 N THR B 261 ? N THR B 261 
AA4 3 4 O PHE B 256 ? O PHE B 256 N LEU B 237 ? N LEU B 237 
AA4 4 5 O THR B 232 ? O THR B 232 N CYS B 166 ? N CYS B 166 
AA4 5 6 N LEU B 163 ? N LEU B 163 O VAL B 195 ? O VAL B 195 
AA5 1 2 N ALA C 119 ? N ALA C 119 O ILE C 271 ? O ILE C 271 
AA5 2 3 O SER C 274 ? O SER C 274 N THR C 261 ? N THR C 261 
AA5 3 4 O PHE C 256 ? O PHE C 256 N LEU C 237 ? N LEU C 237 
AA5 4 5 O LYS C 238 ? O LYS C 238 N ALA C 148 ? N ALA C 148 
AA6 1 2 N ALA C 119 ? N ALA C 119 O ILE C 271 ? O ILE C 271 
AA6 2 3 O SER C 274 ? O SER C 274 N THR C 261 ? N THR C 261 
AA6 3 4 O PHE C 256 ? O PHE C 256 N LEU C 237 ? N LEU C 237 
AA6 4 5 O THR C 232 ? O THR C 232 N CYS C 166 ? N CYS C 166 
AA6 5 6 N LEU C 163 ? N LEU C 163 O VAL C 195 ? O VAL C 195 
AA7 1 2 N ALA D 119 ? N ALA D 119 O ILE D 271 ? O ILE D 271 
AA7 2 3 O SER D 274 ? O SER D 274 N THR D 261 ? N THR D 261 
AA7 3 4 O PHE D 256 ? O PHE D 256 N LEU D 237 ? N LEU D 237 
AA7 4 5 O LYS D 238 ? O LYS D 238 N ALA D 148 ? N ALA D 148 
AA8 1 2 N ALA D 119 ? N ALA D 119 O ILE D 271 ? O ILE D 271 
AA8 2 3 O SER D 274 ? O SER D 274 N THR D 261 ? N THR D 261 
AA8 3 4 O PHE D 256 ? O PHE D 256 N LEU D 237 ? N LEU D 237 
AA8 4 5 O THR D 232 ? O THR D 232 N CYS D 166 ? N CYS D 166 
AA8 5 6 N LEU D 163 ? N LEU D 163 O VAL D 195 ? O VAL D 195 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A HZ7 801 ? 6 'binding site for residue HZ7 A 801' 
AC2 Software B HZ7 801 ? 6 'binding site for residue HZ7 B 801' 
AC3 Software C HZ7 801 ? 6 'binding site for residue HZ7 C 801' 
AC4 Software D HZ7 801 ? 6 'binding site for residue HZ7 D 801' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 LYS A 55  ? LYS A 55  . ? 1_555 ? 
2  AC1 6 ARG A 61  ? ARG A 61  . ? 1_555 ? 
3  AC1 6 LYS A 65  ? LYS A 65  . ? 1_555 ? 
4  AC1 6 SER A 319 ? SER A 319 . ? 1_555 ? 
5  AC1 6 ARG A 322 ? ARG A 322 . ? 1_555 ? 
6  AC1 6 TYR A 355 ? TYR A 355 . ? 1_555 ? 
7  AC2 6 LYS B 55  ? LYS B 55  . ? 1_555 ? 
8  AC2 6 ARG B 61  ? ARG B 61  . ? 1_555 ? 
9  AC2 6 LYS B 65  ? LYS B 65  . ? 1_555 ? 
10 AC2 6 SER B 319 ? SER B 319 . ? 1_555 ? 
11 AC2 6 ARG B 322 ? ARG B 322 . ? 1_555 ? 
12 AC2 6 TYR B 355 ? TYR B 355 . ? 1_555 ? 
13 AC3 6 LYS C 55  ? LYS C 55  . ? 1_555 ? 
14 AC3 6 ARG C 61  ? ARG C 61  . ? 1_555 ? 
15 AC3 6 LYS C 65  ? LYS C 65  . ? 1_555 ? 
16 AC3 6 SER C 319 ? SER C 319 . ? 1_555 ? 
17 AC3 6 ARG C 322 ? ARG C 322 . ? 1_555 ? 
18 AC3 6 TYR C 355 ? TYR C 355 . ? 1_555 ? 
19 AC4 6 LYS D 55  ? LYS D 55  . ? 1_555 ? 
20 AC4 6 ARG D 61  ? ARG D 61  . ? 1_555 ? 
21 AC4 6 LYS D 65  ? LYS D 65  . ? 1_555 ? 
22 AC4 6 SER D 319 ? SER D 319 . ? 1_555 ? 
23 AC4 6 ARG D 322 ? ARG D 322 . ? 1_555 ? 
24 AC4 6 TYR D 355 ? TYR D 355 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6E7P 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . GLU A 1 38  ? 197.356 148.999 198.915 1.00 136.33 ? 38  GLU A N   1 
ATOM   2     C CA  . GLU A 1 38  ? 197.554 150.115 198.000 1.00 136.33 ? 38  GLU A CA  1 
ATOM   3     C C   . GLU A 1 38  ? 198.422 151.200 198.629 1.00 136.33 ? 38  GLU A C   1 
ATOM   4     O O   . GLU A 1 38  ? 198.071 152.370 198.563 1.00 136.33 ? 38  GLU A O   1 
ATOM   5     C CB  . GLU A 1 38  ? 196.207 150.724 197.583 1.00 136.33 ? 38  GLU A CB  1 
ATOM   6     C CG  . GLU A 1 38  ? 195.301 149.803 196.788 1.00 136.33 ? 38  GLU A CG  1 
ATOM   7     C CD  . GLU A 1 38  ? 194.015 150.472 196.348 1.00 136.33 ? 38  GLU A CD  1 
ATOM   8     O OE1 . GLU A 1 38  ? 193.778 151.632 196.740 1.00 136.33 ? 38  GLU A OE1 1 
ATOM   9     O OE2 . GLU A 1 38  ? 193.238 149.834 195.609 1.00 136.33 ? 38  GLU A OE2 1 
ATOM   10    N N   . GLU A 1 39  ? 199.543 150.832 199.253 1.00 135.85 ? 39  GLU A N   1 
ATOM   11    C CA  . GLU A 1 39  ? 200.322 151.843 199.966 1.00 135.85 ? 39  GLU A CA  1 
ATOM   12    C C   . GLU A 1 39  ? 201.252 152.627 199.042 1.00 135.85 ? 39  GLU A C   1 
ATOM   13    O O   . GLU A 1 39  ? 201.083 153.836 198.859 1.00 135.85 ? 39  GLU A O   1 
ATOM   14    C CB  . GLU A 1 39  ? 201.130 151.202 201.099 1.00 135.85 ? 39  GLU A CB  1 
ATOM   15    C CG  . GLU A 1 39  ? 200.321 150.801 202.309 1.00 135.85 ? 39  GLU A CG  1 
ATOM   16    C CD  . GLU A 1 39  ? 201.195 150.299 203.441 1.00 135.85 ? 39  GLU A CD  1 
ATOM   17    O OE1 . GLU A 1 39  ? 202.411 150.125 203.222 1.00 135.85 ? 39  GLU A OE1 1 
ATOM   18    O OE2 . GLU A 1 39  ? 200.671 150.095 204.556 1.00 135.85 ? 39  GLU A OE2 1 
ATOM   19    N N   . ASP A 1 40  ? 202.235 151.959 198.447 1.00 126.87 ? 40  ASP A N   1 
ATOM   20    C CA  . ASP A 1 40  ? 203.313 152.659 197.762 1.00 126.87 ? 40  ASP A CA  1 
ATOM   21    C C   . ASP A 1 40  ? 203.065 152.850 196.278 1.00 126.87 ? 40  ASP A C   1 
ATOM   22    O O   . ASP A 1 40  ? 203.837 153.558 195.625 1.00 126.87 ? 40  ASP A O   1 
ATOM   23    C CB  . ASP A 1 40  ? 204.636 151.923 197.968 1.00 126.87 ? 40  ASP A CB  1 
ATOM   24    C CG  . ASP A 1 40  ? 205.192 152.118 199.354 1.00 126.87 ? 40  ASP A CG  1 
ATOM   25    O OD1 . ASP A 1 40  ? 204.928 153.186 199.941 1.00 126.87 ? 40  ASP A OD1 1 
ATOM   26    O OD2 . ASP A 1 40  ? 205.893 151.215 199.854 1.00 126.87 ? 40  ASP A OD2 1 
ATOM   27    N N   . LEU A 1 41  ? 202.016 152.254 195.729 1.00 126.66 ? 41  LEU A N   1 
ATOM   28    C CA  . LEU A 1 41  ? 201.703 152.392 194.315 1.00 126.66 ? 41  LEU A CA  1 
ATOM   29    C C   . LEU A 1 41  ? 200.656 153.470 194.077 1.00 126.66 ? 41  LEU A C   1 
ATOM   30    O O   . LEU A 1 41  ? 199.979 153.474 193.053 1.00 126.66 ? 41  LEU A O   1 
ATOM   31    C CB  . LEU A 1 41  ? 201.237 151.066 193.728 1.00 126.66 ? 41  LEU A CB  1 
ATOM   32    C CG  . LEU A 1 41  ? 202.306 149.987 193.603 1.00 126.66 ? 41  LEU A CG  1 
ATOM   33    C CD1 . LEU A 1 41  ? 201.714 148.704 193.057 1.00 126.66 ? 41  LEU A CD1 1 
ATOM   34    C CD2 . LEU A 1 41  ? 203.418 150.484 192.713 1.00 126.66 ? 41  LEU A CD2 1 
ATOM   35    N N   . ARG A 1 42  ? 200.512 154.404 195.016 1.00 128.18 ? 42  ARG A N   1 
ATOM   36    C CA  . ARG A 1 42  ? 199.503 155.443 194.841 1.00 128.18 ? 42  ARG A CA  1 
ATOM   37    C C   . ARG A 1 42  ? 199.934 156.479 193.813 1.00 128.18 ? 42  ARG A C   1 
ATOM   38    O O   . ARG A 1 42  ? 199.122 156.900 192.990 1.00 128.18 ? 42  ARG A O   1 
ATOM   39    C CB  . ARG A 1 42  ? 199.180 156.123 196.177 1.00 128.18 ? 42  ARG A CB  1 
ATOM   40    C CG  . ARG A 1 42  ? 198.408 155.249 197.158 1.00 128.18 ? 42  ARG A CG  1 
ATOM   41    C CD  . ARG A 1 42  ? 198.095 155.954 198.481 1.00 128.18 ? 42  ARG A CD  1 
ATOM   42    N NE  . ARG A 1 42  ? 197.095 157.012 198.340 1.00 128.18 ? 42  ARG A NE  1 
ATOM   43    C CZ  . ARG A 1 42  ? 196.774 157.873 199.301 1.00 128.18 ? 42  ARG A CZ  1 
ATOM   44    N NH1 . ARG A 1 42  ? 197.376 157.810 200.479 1.00 128.18 ? 42  ARG A NH1 1 
ATOM   45    N NH2 . ARG A 1 42  ? 195.852 158.801 199.085 1.00 128.18 ? 42  ARG A NH2 1 
ATOM   46    N N   . ARG A 1 43  ? 201.201 156.885 193.821 1.00 124.97 ? 43  ARG A N   1 
ATOM   47    C CA  . ARG A 1 43  ? 201.592 157.991 192.957 1.00 124.97 ? 43  ARG A CA  1 
ATOM   48    C C   . ARG A 1 43  ? 201.725 157.552 191.507 1.00 124.97 ? 43  ARG A C   1 
ATOM   49    O O   . ARG A 1 43  ? 201.254 158.245 190.599 1.00 124.97 ? 43  ARG A O   1 
ATOM   50    C CB  . ARG A 1 43  ? 202.889 158.620 193.456 1.00 124.97 ? 43  ARG A CB  1 
ATOM   51    C CG  . ARG A 1 43  ? 202.707 159.324 194.775 1.00 124.97 ? 43  ARG A CG  1 
ATOM   52    C CD  . ARG A 1 43  ? 203.965 159.998 195.241 1.00 124.97 ? 43  ARG A CD  1 
ATOM   53    N NE  . ARG A 1 43  ? 203.750 160.618 196.540 1.00 124.97 ? 43  ARG A NE  1 
ATOM   54    C CZ  . ARG A 1 43  ? 204.681 161.276 197.215 1.00 124.97 ? 43  ARG A CZ  1 
ATOM   55    N NH1 . ARG A 1 43  ? 205.898 161.411 196.710 1.00 124.97 ? 43  ARG A NH1 1 
ATOM   56    N NH2 . ARG A 1 43  ? 204.390 161.804 198.393 1.00 124.97 ? 43  ARG A NH2 1 
ATOM   57    N N   . ARG A 1 44  ? 202.342 156.400 191.269 1.00 127.54 ? 44  ARG A N   1 
ATOM   58    C CA  . ARG A 1 44  ? 202.534 155.948 189.901 1.00 127.54 ? 44  ARG A CA  1 
ATOM   59    C C   . ARG A 1 44  ? 201.245 155.462 189.252 1.00 127.54 ? 44  ARG A C   1 
ATOM   60    O O   . ARG A 1 44  ? 201.054 155.686 188.051 1.00 127.54 ? 44  ARG A O   1 
ATOM   61    C CB  . ARG A 1 44  ? 203.600 154.856 189.864 1.00 127.54 ? 44  ARG A CB  1 
ATOM   62    C CG  . ARG A 1 44  ? 204.968 155.383 190.222 1.00 127.54 ? 44  ARG A CG  1 
ATOM   63    C CD  . ARG A 1 44  ? 206.009 154.298 190.239 1.00 127.54 ? 44  ARG A CD  1 
ATOM   64    N NE  . ARG A 1 44  ? 206.240 153.733 188.917 1.00 127.54 ? 44  ARG A NE  1 
ATOM   65    C CZ  . ARG A 1 44  ? 205.908 152.495 188.572 1.00 127.54 ? 44  ARG A CZ  1 
ATOM   66    N NH1 . ARG A 1 44  ? 205.330 151.696 189.453 1.00 127.54 ? 44  ARG A NH1 1 
ATOM   67    N NH2 . ARG A 1 44  ? 206.157 152.054 187.350 1.00 127.54 ? 44  ARG A NH2 1 
ATOM   68    N N   . LEU A 1 45  ? 200.343 154.835 190.009 1.00 130.04 ? 45  LEU A N   1 
ATOM   69    C CA  . LEU A 1 45  ? 199.101 154.373 189.407 1.00 130.04 ? 45  LEU A CA  1 
ATOM   70    C C   . LEU A 1 45  ? 198.054 155.465 189.285 1.00 130.04 ? 45  LEU A C   1 
ATOM   71    O O   . LEU A 1 45  ? 196.999 155.213 188.697 1.00 130.04 ? 45  LEU A O   1 
ATOM   72    C CB  . LEU A 1 45  ? 198.508 153.208 190.190 1.00 130.04 ? 45  LEU A CB  1 
ATOM   73    C CG  . LEU A 1 45  ? 199.335 151.928 190.186 1.00 130.04 ? 45  LEU A CG  1 
ATOM   74    C CD1 . LEU A 1 45  ? 198.653 150.856 191.020 1.00 130.04 ? 45  LEU A CD1 1 
ATOM   75    C CD2 . LEU A 1 45  ? 199.567 151.457 188.769 1.00 130.04 ? 45  LEU A CD2 1 
ATOM   76    N N   . LYS A 1 46  ? 198.295 156.654 189.836 1.00 133.47 ? 46  LYS A N   1 
ATOM   77    C CA  . LYS A 1 46  ? 197.410 157.781 189.580 1.00 133.47 ? 46  LYS A CA  1 
ATOM   78    C C   . LYS A 1 46  ? 197.957 158.741 188.533 1.00 133.47 ? 46  LYS A C   1 
ATOM   79    O O   . LYS A 1 46  ? 197.180 159.524 187.975 1.00 133.47 ? 46  LYS A O   1 
ATOM   80    C CB  . LYS A 1 46  ? 197.110 158.547 190.875 1.00 133.47 ? 46  LYS A CB  1 
ATOM   81    C CG  . LYS A 1 46  ? 196.267 157.786 191.899 1.00 133.47 ? 46  LYS A CG  1 
ATOM   82    C CD  . LYS A 1 46  ? 194.822 157.607 191.478 1.00 133.47 ? 46  LYS A CD  1 
ATOM   83    C CE  . LYS A 1 46  ? 194.020 156.941 192.589 1.00 133.47 ? 46  LYS A CE  1 
ATOM   84    N NZ  . LYS A 1 46  ? 192.584 156.761 192.243 1.00 133.47 ? 46  LYS A NZ  1 
ATOM   85    N N   . TYR A 1 47  ? 199.264 158.703 188.255 1.00 137.37 ? 47  TYR A N   1 
ATOM   86    C CA  . TYR A 1 47  ? 199.791 159.413 187.094 1.00 137.37 ? 47  TYR A CA  1 
ATOM   87    C C   . TYR A 1 47  ? 199.223 158.850 185.808 1.00 137.37 ? 47  TYR A C   1 
ATOM   88    O O   . TYR A 1 47  ? 199.003 159.587 184.843 1.00 137.37 ? 47  TYR A O   1 
ATOM   89    C CB  . TYR A 1 47  ? 201.313 159.332 187.053 1.00 137.37 ? 47  TYR A CB  1 
ATOM   90    C CG  . TYR A 1 47  ? 202.016 160.279 187.979 1.00 137.37 ? 47  TYR A CG  1 
ATOM   91    C CD1 . TYR A 1 47  ? 201.370 161.400 188.478 1.00 137.37 ? 47  TYR A CD1 1 
ATOM   92    C CD2 . TYR A 1 47  ? 203.332 160.047 188.364 1.00 137.37 ? 47  TYR A CD2 1 
ATOM   93    C CE1 . TYR A 1 47  ? 202.018 162.268 189.328 1.00 137.37 ? 47  TYR A CE1 1 
ATOM   94    C CE2 . TYR A 1 47  ? 203.987 160.908 189.217 1.00 137.37 ? 47  TYR A CE2 1 
ATOM   95    C CZ  . TYR A 1 47  ? 203.325 162.015 189.694 1.00 137.37 ? 47  TYR A CZ  1 
ATOM   96    O OH  . TYR A 1 47  ? 203.976 162.866 190.548 1.00 137.37 ? 47  TYR A OH  1 
ATOM   97    N N   . PHE A 1 48  ? 198.988 157.541 185.771 1.00 131.32 ? 48  PHE A N   1 
ATOM   98    C CA  . PHE A 1 48  ? 198.417 156.946 184.579 1.00 131.32 ? 48  PHE A CA  1 
ATOM   99    C C   . PHE A 1 48  ? 196.960 157.336 184.400 1.00 131.32 ? 48  PHE A C   1 
ATOM   100   O O   . PHE A 1 48  ? 196.458 157.319 183.275 1.00 131.32 ? 48  PHE A O   1 
ATOM   101   C CB  . PHE A 1 48  ? 198.563 155.432 184.636 1.00 131.32 ? 48  PHE A CB  1 
ATOM   102   C CG  . PHE A 1 48  ? 198.198 154.755 183.364 1.00 131.32 ? 48  PHE A CG  1 
ATOM   103   C CD1 . PHE A 1 48  ? 199.051 154.805 182.278 1.00 131.32 ? 48  PHE A CD1 1 
ATOM   104   C CD2 . PHE A 1 48  ? 196.999 154.079 183.244 1.00 131.32 ? 48  PHE A CD2 1 
ATOM   105   C CE1 . PHE A 1 48  ? 198.719 154.188 181.094 1.00 131.32 ? 48  PHE A CE1 1 
ATOM   106   C CE2 . PHE A 1 48  ? 196.663 153.457 182.061 1.00 131.32 ? 48  PHE A CE2 1 
ATOM   107   C CZ  . PHE A 1 48  ? 197.525 153.513 180.984 1.00 131.32 ? 48  PHE A CZ  1 
ATOM   108   N N   . PHE A 1 49  ? 196.274 157.689 185.479 1.00 130.88 ? 49  PHE A N   1 
ATOM   109   C CA  . PHE A 1 49  ? 194.932 158.249 185.371 1.00 130.88 ? 49  PHE A CA  1 
ATOM   110   C C   . PHE A 1 49  ? 195.008 159.762 185.559 1.00 130.88 ? 49  PHE A C   1 
ATOM   111   O O   . PHE A 1 49  ? 194.699 160.312 186.614 1.00 130.88 ? 49  PHE A O   1 
ATOM   112   C CB  . PHE A 1 49  ? 193.996 157.603 186.383 1.00 130.88 ? 49  PHE A CB  1 
ATOM   113   C CG  . PHE A 1 49  ? 193.710 156.158 186.116 1.00 130.88 ? 49  PHE A CG  1 
ATOM   114   C CD1 . PHE A 1 49  ? 194.006 155.577 184.891 1.00 130.88 ? 49  PHE A CD1 1 
ATOM   115   C CD2 . PHE A 1 49  ? 193.133 155.378 187.099 1.00 130.88 ? 49  PHE A CD2 1 
ATOM   116   C CE1 . PHE A 1 49  ? 193.747 154.251 184.661 1.00 130.88 ? 49  PHE A CE1 1 
ATOM   117   C CE2 . PHE A 1 49  ? 192.865 154.048 186.873 1.00 130.88 ? 49  PHE A CE2 1 
ATOM   118   C CZ  . PHE A 1 49  ? 193.175 153.484 185.651 1.00 130.88 ? 49  PHE A CZ  1 
ATOM   119   N N   . MET A 1 50  ? 195.452 160.433 184.506 1.00 138.91 ? 50  MET A N   1 
ATOM   120   C CA  . MET A 1 50  ? 195.525 161.884 184.501 1.00 138.91 ? 50  MET A CA  1 
ATOM   121   C C   . MET A 1 50  ? 194.941 162.431 183.208 1.00 138.91 ? 50  MET A C   1 
ATOM   122   O O   . MET A 1 50  ? 194.499 161.691 182.326 1.00 138.91 ? 50  MET A O   1 
ATOM   123   C CB  . MET A 1 50  ? 196.964 162.386 184.682 1.00 138.91 ? 50  MET A CB  1 
ATOM   124   C CG  . MET A 1 50  ? 197.505 162.184 186.074 1.00 138.91 ? 50  MET A CG  1 
ATOM   125   S SD  . MET A 1 50  ? 196.470 163.009 187.285 1.00 138.91 ? 50  MET A SD  1 
ATOM   126   C CE  . MET A 1 50  ? 196.838 164.710 186.893 1.00 138.91 ? 50  MET A CE  1 
ATOM   127   N N   . SER A 1 51  ? 194.942 163.753 183.119 1.00 136.23 ? 51  SER A N   1 
ATOM   128   C CA  . SER A 1 51  ? 194.469 164.504 181.974 1.00 136.23 ? 51  SER A CA  1 
ATOM   129   C C   . SER A 1 51  ? 195.472 165.601 181.665 1.00 136.23 ? 51  SER A C   1 
ATOM   130   O O   . SER A 1 51  ? 196.038 166.199 182.583 1.00 136.23 ? 51  SER A O   1 
ATOM   131   C CB  . SER A 1 51  ? 193.099 165.132 182.254 1.00 136.23 ? 51  SER A CB  1 
ATOM   132   O OG  . SER A 1 51  ? 193.218 166.151 183.229 1.00 136.23 ? 51  SER A OG  1 
ATOM   133   N N   . PRO A 1 52  ? 195.690 165.907 180.383 1.00 135.13 ? 52  PRO A N   1 
ATOM   134   C CA  . PRO A 1 52  ? 196.644 166.964 180.018 1.00 135.13 ? 52  PRO A CA  1 
ATOM   135   C C   . PRO A 1 52  ? 196.207 168.363 180.405 1.00 135.13 ? 52  PRO A C   1 
ATOM   136   O O   . PRO A 1 52  ? 197.017 169.290 180.312 1.00 135.13 ? 52  PRO A O   1 
ATOM   137   C CB  . PRO A 1 52  ? 196.741 166.831 178.499 1.00 135.13 ? 52  PRO A CB  1 
ATOM   138   C CG  . PRO A 1 52  ? 195.468 166.229 178.109 1.00 135.13 ? 52  PRO A CG  1 
ATOM   139   C CD  . PRO A 1 52  ? 195.097 165.280 179.196 1.00 135.13 ? 52  PRO A CD  1 
ATOM   140   N N   . CYS A 1 53  ? 194.960 168.555 180.828 1.00 143.14 ? 53  CYS A N   1 
ATOM   141   C CA  . CYS A 1 53  ? 194.614 169.788 181.517 1.00 143.14 ? 53  CYS A CA  1 
ATOM   142   C C   . CYS A 1 53  ? 195.274 169.856 182.889 1.00 143.14 ? 53  CYS A C   1 
ATOM   143   O O   . CYS A 1 53  ? 195.516 170.951 183.407 1.00 143.14 ? 53  CYS A O   1 
ATOM   144   C CB  . CYS A 1 53  ? 193.098 169.902 181.645 1.00 143.14 ? 53  CYS A CB  1 
ATOM   145   S SG  . CYS A 1 53  ? 192.240 170.053 180.066 1.00 143.14 ? 53  CYS A SG  1 
ATOM   146   N N   . ASP A 1 54  ? 195.583 168.706 183.485 1.00 144.93 ? 54  ASP A N   1 
ATOM   147   C CA  . ASP A 1 54  ? 196.187 168.664 184.804 1.00 144.93 ? 54  ASP A CA  1 
ATOM   148   C C   . ASP A 1 54  ? 197.594 168.079 184.767 1.00 144.93 ? 54  ASP A C   1 
ATOM   149   O O   . ASP A 1 54  ? 198.306 168.155 185.771 1.00 144.93 ? 54  ASP A O   1 
ATOM   150   C CB  . ASP A 1 54  ? 195.300 167.848 185.755 1.00 144.93 ? 54  ASP A CB  1 
ATOM   151   C CG  . ASP A 1 54  ? 195.511 168.201 187.214 1.00 144.93 ? 54  ASP A CG  1 
ATOM   152   O OD1 . ASP A 1 54  ? 196.296 169.121 187.516 1.00 144.93 ? 54  ASP A OD1 1 
ATOM   153   O OD2 . ASP A 1 54  ? 194.877 167.555 188.072 1.00 144.93 ? 54  ASP A OD2 1 
ATOM   154   N N   . LYS A 1 55  ? 198.017 167.505 183.638 1.00 145.38 ? 55  LYS A N   1 
ATOM   155   C CA  . LYS A 1 55  ? 199.410 167.099 183.488 1.00 145.38 ? 55  LYS A CA  1 
ATOM   156   C C   . LYS A 1 55  ? 200.339 168.300 183.483 1.00 145.38 ? 55  LYS A C   1 
ATOM   157   O O   . LYS A 1 55  ? 201.496 168.188 183.901 1.00 145.38 ? 55  LYS A O   1 
ATOM   158   C CB  . LYS A 1 55  ? 199.603 166.302 182.199 1.00 145.38 ? 55  LYS A CB  1 
ATOM   159   C CG  . LYS A 1 55  ? 198.985 164.925 182.200 1.00 145.38 ? 55  LYS A CG  1 
ATOM   160   C CD  . LYS A 1 55  ? 199.231 164.221 180.876 1.00 145.38 ? 55  LYS A CD  1 
ATOM   161   C CE  . LYS A 1 55  ? 198.542 162.868 180.837 1.00 145.38 ? 55  LYS A CE  1 
ATOM   162   N NZ  . LYS A 1 55  ? 198.805 162.127 179.538 1.00 145.38 ? 55  LYS A NZ  1 
ATOM   163   N N   . PHE A 1 56  ? 199.848 169.448 183.003 1.00 149.31 ? 56  PHE A N   1 
ATOM   164   C CA  . PHE A 1 56  ? 200.606 170.694 183.020 1.00 149.31 ? 56  PHE A CA  1 
ATOM   165   C C   . PHE A 1 56  ? 200.958 171.109 184.440 1.00 149.31 ? 56  PHE A C   1 
ATOM   166   O O   . PHE A 1 56  ? 202.060 171.606 184.689 1.00 149.31 ? 56  PHE A O   1 
ATOM   167   C CB  . PHE A 1 56  ? 199.789 171.787 182.329 1.00 149.31 ? 56  PHE A CB  1 
ATOM   168   C CG  . PHE A 1 56  ? 200.522 173.077 182.126 1.00 149.31 ? 56  PHE A CG  1 
ATOM   169   C CD1 . PHE A 1 56  ? 201.437 173.215 181.092 1.00 149.31 ? 56  PHE A CD1 1 
ATOM   170   C CD2 . PHE A 1 56  ? 200.280 174.160 182.951 1.00 149.31 ? 56  PHE A CD2 1 
ATOM   171   C CE1 . PHE A 1 56  ? 202.107 174.411 180.892 1.00 149.31 ? 56  PHE A CE1 1 
ATOM   172   C CE2 . PHE A 1 56  ? 200.947 175.357 182.759 1.00 149.31 ? 56  PHE A CE2 1 
ATOM   173   C CZ  . PHE A 1 56  ? 201.862 175.482 181.726 1.00 149.31 ? 56  PHE A CZ  1 
ATOM   174   N N   . ARG A 1 57  ? 200.050 170.888 185.381 1.00 154.78 ? 57  ARG A N   1 
ATOM   175   C CA  . ARG A 1 57  ? 200.318 171.160 186.779 1.00 154.78 ? 57  ARG A CA  1 
ATOM   176   C C   . ARG A 1 57  ? 200.641 169.903 187.559 1.00 154.78 ? 57  ARG A C   1 
ATOM   177   O O   . ARG A 1 57  ? 200.722 169.959 188.789 1.00 154.78 ? 57  ARG A O   1 
ATOM   178   C CB  . ARG A 1 57  ? 199.133 171.885 187.418 1.00 154.78 ? 57  ARG A CB  1 
ATOM   179   C CG  . ARG A 1 57  ? 198.964 173.298 186.907 1.00 154.78 ? 57  ARG A CG  1 
ATOM   180   C CD  . ARG A 1 57  ? 197.824 174.055 187.565 1.00 154.78 ? 57  ARG A CD  1 
ATOM   181   N NE  . ARG A 1 57  ? 197.718 175.398 186.997 1.00 154.78 ? 57  ARG A NE  1 
ATOM   182   C CZ  . ARG A 1 57  ? 196.805 176.298 187.345 1.00 154.78 ? 57  ARG A CZ  1 
ATOM   183   N NH1 . ARG A 1 57  ? 195.904 176.011 188.274 1.00 154.78 ? 57  ARG A NH1 1 
ATOM   184   N NH2 . ARG A 1 57  ? 196.797 177.489 186.765 1.00 154.78 ? 57  ARG A NH2 1 
ATOM   185   N N   . ALA A 1 58  ? 200.832 168.771 186.886 1.00 150.98 ? 58  ALA A N   1 
ATOM   186   C CA  . ALA A 1 58  ? 201.199 167.565 187.624 1.00 150.98 ? 58  ALA A CA  1 
ATOM   187   C C   . ALA A 1 58  ? 202.688 167.572 187.944 1.00 150.98 ? 58  ALA A C   1 
ATOM   188   O O   . ALA A 1 58  ? 203.084 167.652 189.109 1.00 150.98 ? 58  ALA A O   1 
ATOM   189   C CB  . ALA A 1 58  ? 200.821 166.312 186.829 1.00 150.98 ? 58  ALA A CB  1 
ATOM   190   N N   . LYS A 1 59  ? 203.527 167.512 186.911 1.00 151.84 ? 59  LYS A N   1 
ATOM   191   C CA  . LYS A 1 59  ? 204.970 167.493 187.103 1.00 151.84 ? 59  LYS A CA  1 
ATOM   192   C C   . LYS A 1 59  ? 205.675 168.414 186.121 1.00 151.84 ? 59  LYS A C   1 
ATOM   193   O O   . LYS A 1 59  ? 206.907 168.352 186.017 1.00 151.84 ? 59  LYS A O   1 
ATOM   194   C CB  . LYS A 1 59  ? 205.540 166.064 186.974 1.00 151.84 ? 59  LYS A CB  1 
ATOM   195   C CG  . LYS A 1 59  ? 205.027 165.081 188.027 1.00 151.84 ? 59  LYS A CG  1 
ATOM   196   C CD  . LYS A 1 59  ? 205.455 165.484 189.434 1.00 151.84 ? 59  LYS A CD  1 
ATOM   197   C CE  . LYS A 1 59  ? 206.852 165.027 189.783 1.00 151.84 ? 59  LYS A CE  1 
ATOM   198   N NZ  . LYS A 1 59  ? 206.899 163.546 189.923 1.00 151.84 ? 59  LYS A NZ  1 
ATOM   199   N N   . GLY A 1 60  ? 204.941 169.266 185.407 1.00 149.17 ? 60  GLY A N   1 
ATOM   200   C CA  . GLY A 1 60  ? 205.559 170.144 184.435 1.00 149.17 ? 60  GLY A CA  1 
ATOM   201   C C   . GLY A 1 60  ? 206.062 169.390 183.224 1.00 149.17 ? 60  GLY A C   1 
ATOM   202   O O   . GLY A 1 60  ? 207.273 169.210 183.064 1.00 149.17 ? 60  GLY A O   1 
ATOM   203   N N   . ARG A 1 61  ? 205.149 168.893 182.388 1.00 139.49 ? 61  ARG A N   1 
ATOM   204   C CA  . ARG A 1 61  ? 205.535 168.002 181.307 1.00 139.49 ? 61  ARG A CA  1 
ATOM   205   C C   . ARG A 1 61  ? 205.646 168.684 179.948 1.00 139.49 ? 61  ARG A C   1 
ATOM   206   O O   . ARG A 1 61  ? 206.387 168.186 179.093 1.00 139.49 ? 61  ARG A O   1 
ATOM   207   C CB  . ARG A 1 61  ? 204.547 166.826 181.228 1.00 139.49 ? 61  ARG A CB  1 
ATOM   208   C CG  . ARG A 1 61  ? 204.963 165.660 180.340 1.00 139.49 ? 61  ARG A CG  1 
ATOM   209   C CD  . ARG A 1 61  ? 206.160 164.915 180.932 1.00 139.49 ? 61  ARG A CD  1 
ATOM   210   N NE  . ARG A 1 61  ? 207.455 165.453 180.513 1.00 139.49 ? 61  ARG A NE  1 
ATOM   211   C CZ  . ARG A 1 61  ? 208.616 165.096 181.050 1.00 139.49 ? 61  ARG A CZ  1 
ATOM   212   N NH1 . ARG A 1 61  ? 209.747 165.631 180.619 1.00 139.49 ? 61  ARG A NH1 1 
ATOM   213   N NH2 . ARG A 1 61  ? 208.645 164.199 182.021 1.00 139.49 ? 61  ARG A NH2 1 
ATOM   214   N N   . LYS A 1 62  ? 204.992 169.847 179.761 1.00 130.74 ? 62  LYS A N   1 
ATOM   215   C CA  . LYS A 1 62  ? 204.914 170.609 178.514 1.00 130.74 ? 62  LYS A CA  1 
ATOM   216   C C   . LYS A 1 62  ? 204.384 169.723 177.393 1.00 130.74 ? 62  LYS A C   1 
ATOM   217   O O   . LYS A 1 62  ? 205.152 169.284 176.530 1.00 130.74 ? 62  LYS A O   1 
ATOM   218   C CB  . LYS A 1 62  ? 206.274 171.212 178.150 1.00 130.74 ? 62  LYS A CB  1 
ATOM   219   C CG  . LYS A 1 62  ? 206.753 172.256 179.135 1.00 130.74 ? 62  LYS A CG  1 
ATOM   220   C CD  . LYS A 1 62  ? 208.129 172.766 178.776 1.00 130.74 ? 62  LYS A CD  1 
ATOM   221   C CE  . LYS A 1 62  ? 208.524 173.922 179.678 1.00 130.74 ? 62  LYS A CE  1 
ATOM   222   N NZ  . LYS A 1 62  ? 208.669 173.522 181.105 1.00 130.74 ? 62  LYS A NZ  1 
ATOM   223   N N   . PRO A 1 63  ? 203.076 169.434 177.384 1.00 132.09 ? 63  PRO A N   1 
ATOM   224   C CA  . PRO A 1 63  ? 202.555 168.302 176.604 1.00 132.09 ? 63  PRO A CA  1 
ATOM   225   C C   . PRO A 1 63  ? 202.525 168.503 175.101 1.00 132.09 ? 63  PRO A C   1 
ATOM   226   O O   . PRO A 1 63  ? 201.462 168.706 174.511 1.00 132.09 ? 63  PRO A O   1 
ATOM   227   C CB  . PRO A 1 63  ? 201.135 168.137 177.153 1.00 132.09 ? 63  PRO A CB  1 
ATOM   228   C CG  . PRO A 1 63  ? 200.759 169.502 177.597 1.00 132.09 ? 63  PRO A CG  1 
ATOM   229   C CD  . PRO A 1 63  ? 202.010 170.145 178.109 1.00 132.09 ? 63  PRO A CD  1 
ATOM   230   N N   . CYS A 1 64  ? 203.689 168.425 174.466 1.00 134.83 ? 64  CYS A N   1 
ATOM   231   C CA  . CYS A 1 64  ? 203.724 168.284 173.019 1.00 134.83 ? 64  CYS A CA  1 
ATOM   232   C C   . CYS A 1 64  ? 203.512 166.845 172.574 1.00 134.83 ? 64  CYS A C   1 
ATOM   233   O O   . CYS A 1 64  ? 203.380 166.598 171.371 1.00 134.83 ? 64  CYS A O   1 
ATOM   234   C CB  . CYS A 1 64  ? 205.047 168.813 172.458 1.00 134.83 ? 64  CYS A CB  1 
ATOM   235   S SG  . CYS A 1 64  ? 205.249 170.605 172.556 1.00 134.83 ? 64  CYS A SG  1 
ATOM   236   N N   . LYS A 1 65  ? 203.445 165.892 173.509 1.00 125.18 ? 65  LYS A N   1 
ATOM   237   C CA  . LYS A 1 65  ? 203.141 164.513 173.150 1.00 125.18 ? 65  LYS A CA  1 
ATOM   238   C C   . LYS A 1 65  ? 201.678 164.320 172.773 1.00 125.18 ? 65  LYS A C   1 
ATOM   239   O O   . LYS A 1 65  ? 201.315 163.242 172.293 1.00 125.18 ? 65  LYS A O   1 
ATOM   240   C CB  . LYS A 1 65  ? 203.522 163.573 174.296 1.00 125.18 ? 65  LYS A CB  1 
ATOM   241   C CG  . LYS A 1 65  ? 204.979 163.695 174.725 1.00 125.18 ? 65  LYS A CG  1 
ATOM   242   C CD  . LYS A 1 65  ? 205.925 163.287 173.616 1.00 125.18 ? 65  LYS A CD  1 
ATOM   243   C CE  . LYS A 1 65  ? 207.380 163.456 174.010 1.00 125.18 ? 65  LYS A CE  1 
ATOM   244   N NZ  . LYS A 1 65  ? 207.816 162.471 175.022 1.00 125.18 ? 65  LYS A NZ  1 
ATOM   245   N N   . LEU A 1 66  ? 200.836 165.329 172.992 1.00 116.38 ? 66  LEU A N   1 
ATOM   246   C CA  . LEU A 1 66  ? 199.478 165.355 172.478 1.00 116.38 ? 66  LEU A CA  1 
ATOM   247   C C   . LEU A 1 66  ? 199.311 166.286 171.287 1.00 116.38 ? 66  LEU A C   1 
ATOM   248   O O   . LEU A 1 66  ? 198.436 166.045 170.451 1.00 116.38 ? 66  LEU A O   1 
ATOM   249   C CB  . LEU A 1 66  ? 198.514 165.766 173.597 1.00 116.38 ? 66  LEU A CB  1 
ATOM   250   C CG  . LEU A 1 66  ? 197.002 165.756 173.385 1.00 116.38 ? 66  LEU A CG  1 
ATOM   251   C CD1 . LEU A 1 66  ? 196.354 165.266 174.648 1.00 116.38 ? 66  LEU A CD1 1 
ATOM   252   C CD2 . LEU A 1 66  ? 196.476 167.147 173.058 1.00 116.38 ? 66  LEU A CD2 1 
ATOM   253   N N   . MET A 1 67  ? 200.126 167.336 171.187 1.00 119.07 ? 67  MET A N   1 
ATOM   254   C CA  . MET A 1 67  ? 199.951 168.324 170.130 1.00 119.07 ? 67  MET A CA  1 
ATOM   255   C C   . MET A 1 67  ? 200.334 167.776 168.759 1.00 119.07 ? 67  MET A C   1 
ATOM   256   O O   . MET A 1 67  ? 199.810 168.253 167.747 1.00 119.07 ? 67  MET A O   1 
ATOM   257   C CB  . MET A 1 67  ? 200.763 169.575 170.480 1.00 119.07 ? 67  MET A CB  1 
ATOM   258   C CG  . MET A 1 67  ? 200.581 170.793 169.576 1.00 119.07 ? 67  MET A CG  1 
ATOM   259   S SD  . MET A 1 67  ? 201.744 170.883 168.200 1.00 119.07 ? 67  MET A SD  1 
ATOM   260   C CE  . MET A 1 67  ? 201.125 172.323 167.335 1.00 119.07 ? 67  MET A CE  1 
ATOM   261   N N   . LEU A 1 68  ? 201.207 166.766 168.708 1.00 110.65 ? 68  LEU A N   1 
ATOM   262   C CA  . LEU A 1 68  ? 201.568 166.151 167.434 1.00 110.65 ? 68  LEU A CA  1 
ATOM   263   C C   . LEU A 1 68  ? 200.381 165.429 166.817 1.00 110.65 ? 68  LEU A C   1 
ATOM   264   O O   . LEU A 1 68  ? 200.245 165.378 165.592 1.00 110.65 ? 68  LEU A O   1 
ATOM   265   C CB  . LEU A 1 68  ? 202.726 165.181 167.636 1.00 110.65 ? 68  LEU A CB  1 
ATOM   266   C CG  . LEU A 1 68  ? 203.307 164.561 166.368 1.00 110.65 ? 68  LEU A CG  1 
ATOM   267   C CD1 . LEU A 1 68  ? 203.926 165.650 165.526 1.00 110.65 ? 68  LEU A CD1 1 
ATOM   268   C CD2 . LEU A 1 68  ? 204.320 163.480 166.678 1.00 110.65 ? 68  LEU A CD2 1 
ATOM   269   N N   . GLN A 1 69  ? 199.499 164.886 167.655 1.00 109.93 ? 69  GLN A N   1 
ATOM   270   C CA  . GLN A 1 69  ? 198.274 164.255 167.184 1.00 109.93 ? 69  GLN A CA  1 
ATOM   271   C C   . GLN A 1 69  ? 197.336 165.250 166.510 1.00 109.93 ? 69  GLN A C   1 
ATOM   272   O O   . GLN A 1 69  ? 196.569 164.862 165.625 1.00 109.93 ? 69  GLN A O   1 
ATOM   273   C CB  . GLN A 1 69  ? 197.607 163.554 168.368 1.00 109.93 ? 69  GLN A CB  1 
ATOM   274   C CG  . GLN A 1 69  ? 196.309 162.815 168.106 1.00 109.93 ? 69  GLN A CG  1 
ATOM   275   C CD  . GLN A 1 69  ? 196.408 161.768 167.027 1.00 109.93 ? 69  GLN A CD  1 
ATOM   276   O OE1 . GLN A 1 69  ? 195.765 161.879 165.989 1.00 109.93 ? 69  GLN A OE1 1 
ATOM   277   N NE2 . GLN A 1 69  ? 197.227 160.752 167.257 1.00 109.93 ? 69  GLN A NE2 1 
ATOM   278   N N   . VAL A 1 70  ? 197.418 166.528 166.871 1.00 107.86 ? 70  VAL A N   1 
ATOM   279   C CA  . VAL A 1 70  ? 196.593 167.541 166.228 1.00 107.86 ? 70  VAL A CA  1 
ATOM   280   C C   . VAL A 1 70  ? 197.133 167.867 164.839 1.00 107.86 ? 70  VAL A C   1 
ATOM   281   O O   . VAL A 1 70  ? 196.380 168.300 163.960 1.00 107.86 ? 70  VAL A O   1 
ATOM   282   C CB  . VAL A 1 70  ? 196.522 168.777 167.141 1.00 107.86 ? 70  VAL A CB  1 
ATOM   283   C CG1 . VAL A 1 70  ? 195.557 169.834 166.622 1.00 107.86 ? 70  VAL A CG1 1 
ATOM   284   C CG2 . VAL A 1 70  ? 196.137 168.356 168.540 1.00 107.86 ? 70  VAL A CG2 1 
ATOM   285   N N   . VAL A 1 71  ? 198.426 167.633 164.606 1.00 107.16 ? 71  VAL A N   1 
ATOM   286   C CA  . VAL A 1 71  ? 199.023 167.911 163.302 1.00 107.16 ? 71  VAL A CA  1 
ATOM   287   C C   . VAL A 1 71  ? 198.445 166.987 162.240 1.00 107.16 ? 71  VAL A C   1 
ATOM   288   O O   . VAL A 1 71  ? 198.266 167.395 161.087 1.00 107.16 ? 71  VAL A O   1 
ATOM   289   C CB  . VAL A 1 71  ? 200.556 167.787 163.399 1.00 107.16 ? 71  VAL A CB  1 
ATOM   290   C CG1 . VAL A 1 71  ? 201.242 168.128 162.083 1.00 107.16 ? 71  VAL A CG1 1 
ATOM   291   C CG2 . VAL A 1 71  ? 201.080 168.648 164.522 1.00 107.16 ? 71  VAL A CG2 1 
ATOM   292   N N   . LYS A 1 72  ? 198.099 165.753 162.623 1.00 106.53 ? 72  LYS A N   1 
ATOM   293   C CA  . LYS A 1 72  ? 197.442 164.814 161.721 1.00 106.53 ? 72  LYS A CA  1 
ATOM   294   C C   . LYS A 1 72  ? 196.119 165.330 161.187 1.00 106.53 ? 72  LYS A C   1 
ATOM   295   O O   . LYS A 1 72  ? 195.772 165.013 160.047 1.00 106.53 ? 72  LYS A O   1 
ATOM   296   C CB  . LYS A 1 72  ? 197.134 163.500 162.421 1.00 106.53 ? 72  LYS A CB  1 
ATOM   297   C CG  . LYS A 1 72  ? 198.269 162.649 162.854 1.00 106.53 ? 72  LYS A CG  1 
ATOM   298   C CD  . LYS A 1 72  ? 197.628 161.413 163.410 1.00 106.53 ? 72  LYS A CD  1 
ATOM   299   C CE  . LYS A 1 72  ? 198.595 160.482 164.047 1.00 106.53 ? 72  LYS A CE  1 
ATOM   300   N NZ  . LYS A 1 72  ? 197.862 159.328 164.634 1.00 106.53 ? 72  LYS A NZ  1 
ATOM   301   N N   . ILE A 1 73  ? 195.377 166.089 161.998 1.00 99.39  ? 73  ILE A N   1 
ATOM   302   C CA  . ILE A 1 73  ? 194.090 166.628 161.581 1.00 99.39  ? 73  ILE A CA  1 
ATOM   303   C C   . ILE A 1 73  ? 194.268 167.555 160.396 1.00 99.39  ? 73  ILE A C   1 
ATOM   304   O O   . ILE A 1 73  ? 193.461 167.545 159.461 1.00 99.39  ? 73  ILE A O   1 
ATOM   305   C CB  . ILE A 1 73  ? 193.426 167.360 162.756 1.00 99.39  ? 73  ILE A CB  1 
ATOM   306   C CG1 . ILE A 1 73  ? 193.375 166.461 163.985 1.00 99.39  ? 73  ILE A CG1 1 
ATOM   307   C CG2 . ILE A 1 73  ? 192.026 167.807 162.392 1.00 99.39  ? 73  ILE A CG2 1 
ATOM   308   C CD1 . ILE A 1 73  ? 192.525 165.258 163.826 1.00 99.39  ? 73  ILE A CD1 1 
ATOM   309   N N   . LEU A 1 74  ? 195.348 168.324 160.380 1.00 102.13 ? 74  LEU A N   1 
ATOM   310   C CA  . LEU A 1 74  ? 195.618 169.157 159.221 1.00 102.13 ? 74  LEU A CA  1 
ATOM   311   C C   . LEU A 1 74  ? 196.240 168.378 158.079 1.00 102.13 ? 74  LEU A C   1 
ATOM   312   O O   . LEU A 1 74  ? 195.791 168.499 156.938 1.00 102.13 ? 74  LEU A O   1 
ATOM   313   C CB  . LEU A 1 74  ? 196.537 170.317 159.592 1.00 102.13 ? 74  LEU A CB  1 
ATOM   314   C CG  . LEU A 1 74  ? 195.880 171.587 160.120 1.00 102.13 ? 74  LEU A CG  1 
ATOM   315   C CD1 . LEU A 1 74  ? 195.410 171.449 161.560 1.00 102.13 ? 74  LEU A CD1 1 
ATOM   316   C CD2 . LEU A 1 74  ? 196.841 172.751 159.959 1.00 102.13 ? 74  LEU A CD2 1 
ATOM   317   N N   . VAL A 1 75  ? 197.250 167.564 158.362 1.00 103.38 ? 75  VAL A N   1 
ATOM   318   C CA  . VAL A 1 75  ? 198.102 167.066 157.293 1.00 103.38 ? 75  VAL A CA  1 
ATOM   319   C C   . VAL A 1 75  ? 197.406 165.953 156.521 1.00 103.38 ? 75  VAL A C   1 
ATOM   320   O O   . VAL A 1 75  ? 197.455 165.920 155.287 1.00 103.38 ? 75  VAL A O   1 
ATOM   321   C CB  . VAL A 1 75  ? 199.458 166.627 157.864 1.00 103.38 ? 75  VAL A CB  1 
ATOM   322   C CG1 . VAL A 1 75  ? 200.309 166.032 156.794 1.00 103.38 ? 75  VAL A CG1 1 
ATOM   323   C CG2 . VAL A 1 75  ? 200.174 167.828 158.441 1.00 103.38 ? 75  VAL A CG2 1 
ATOM   324   N N   . VAL A 1 76  ? 196.706 165.059 157.222 1.00 98.39  ? 76  VAL A N   1 
ATOM   325   C CA  . VAL A 1 76  ? 196.045 163.943 156.544 1.00 98.39  ? 76  VAL A CA  1 
ATOM   326   C C   . VAL A 1 76  ? 194.869 164.425 155.705 1.00 98.39  ? 76  VAL A C   1 
ATOM   327   O O   . VAL A 1 76  ? 194.675 163.958 154.578 1.00 98.39  ? 76  VAL A O   1 
ATOM   328   C CB  . VAL A 1 76  ? 195.615 162.885 157.572 1.00 98.39  ? 76  VAL A CB  1 
ATOM   329   C CG1 . VAL A 1 76  ? 194.874 161.756 156.919 1.00 98.39  ? 76  VAL A CG1 1 
ATOM   330   C CG2 . VAL A 1 76  ? 196.820 162.347 158.282 1.00 98.39  ? 76  VAL A CG2 1 
ATOM   331   N N   . THR A 1 77  ? 194.112 165.394 156.213 1.00 92.26  ? 77  THR A N   1 
ATOM   332   C CA  . THR A 1 77  ? 192.988 165.945 155.465 1.00 92.26  ? 77  THR A CA  1 
ATOM   333   C C   . THR A 1 77  ? 193.461 166.691 154.223 1.00 92.26  ? 77  THR A C   1 
ATOM   334   O O   . THR A 1 77  ? 192.869 166.557 153.146 1.00 92.26  ? 77  THR A O   1 
ATOM   335   C CB  . THR A 1 77  ? 192.172 166.858 156.375 1.00 92.26  ? 77  THR A CB  1 
ATOM   336   O OG1 . THR A 1 77  ? 191.726 166.106 157.502 1.00 92.26  ? 77  THR A OG1 1 
ATOM   337   C CG2 . THR A 1 77  ? 190.968 167.393 155.660 1.00 92.26  ? 77  THR A CG2 1 
ATOM   338   N N   . VAL A 1 78  ? 194.546 167.457 154.343 1.00 97.71  ? 78  VAL A N   1 
ATOM   339   C CA  . VAL A 1 78  ? 195.097 168.129 153.170 1.00 97.71  ? 78  VAL A CA  1 
ATOM   340   C C   . VAL A 1 78  ? 195.733 167.120 152.223 1.00 97.71  ? 78  VAL A C   1 
ATOM   341   O O   . VAL A 1 78  ? 195.651 167.272 150.996 1.00 97.71  ? 78  VAL A O   1 
ATOM   342   C CB  . VAL A 1 78  ? 196.073 169.232 153.616 1.00 97.71  ? 78  VAL A CB  1 
ATOM   343   C CG1 . VAL A 1 78  ? 196.812 169.845 152.445 1.00 97.71  ? 78  VAL A CG1 1 
ATOM   344   C CG2 . VAL A 1 78  ? 195.302 170.318 154.306 1.00 97.71  ? 78  VAL A CG2 1 
ATOM   345   N N   . GLN A 1 79  ? 196.322 166.051 152.763 1.00 103.99 ? 79  GLN A N   1 
ATOM   346   C CA  . GLN A 1 79  ? 196.713 164.918 151.931 1.00 103.99 ? 79  GLN A CA  1 
ATOM   347   C C   . GLN A 1 79  ? 195.514 164.300 151.235 1.00 103.99 ? 79  GLN A C   1 
ATOM   348   O O   . GLN A 1 79  ? 195.607 163.897 150.072 1.00 103.99 ? 79  GLN A O   1 
ATOM   349   C CB  . GLN A 1 79  ? 197.444 163.875 152.776 1.00 103.99 ? 79  GLN A CB  1 
ATOM   350   C CG  . GLN A 1 79  ? 197.698 162.537 152.106 1.00 103.99 ? 79  GLN A CG  1 
ATOM   351   C CD  . GLN A 1 79  ? 198.486 162.656 150.826 1.00 103.99 ? 79  GLN A CD  1 
ATOM   352   O OE1 . GLN A 1 79  ? 199.428 163.438 150.726 1.00 103.99 ? 79  GLN A OE1 1 
ATOM   353   N NE2 . GLN A 1 79  ? 198.104 161.872 149.833 1.00 103.99 ? 79  GLN A NE2 1 
ATOM   354   N N   . LEU A 1 80  ? 194.369 164.287 151.898 1.00 90.84  ? 80  LEU A N   1 
ATOM   355   C CA  . LEU A 1 80  ? 193.159 163.744 151.310 1.00 90.84  ? 80  LEU A CA  1 
ATOM   356   C C   . LEU A 1 80  ? 192.523 164.659 150.276 1.00 90.84  ? 80  LEU A C   1 
ATOM   357   O O   . LEU A 1 80  ? 192.142 164.180 149.204 1.00 90.84  ? 80  LEU A O   1 
ATOM   358   C CB  . LEU A 1 80  ? 192.167 163.414 152.423 1.00 90.84  ? 80  LEU A CB  1 
ATOM   359   C CG  . LEU A 1 80  ? 190.807 162.880 152.029 1.00 90.84  ? 80  LEU A CG  1 
ATOM   360   C CD1 . LEU A 1 80  ? 190.440 161.734 152.906 1.00 90.84  ? 80  LEU A CD1 1 
ATOM   361   C CD2 . LEU A 1 80  ? 189.762 163.968 152.213 1.00 90.84  ? 80  LEU A CD2 1 
ATOM   362   N N   . ILE A 1 81  ? 192.394 165.954 150.564 1.00 82.31  ? 81  ILE A N   1 
ATOM   363   C CA  . ILE A 1 81  ? 191.628 166.837 149.689 1.00 82.31  ? 81  ILE A CA  1 
ATOM   364   C C   . ILE A 1 81  ? 192.363 167.075 148.380 1.00 82.31  ? 81  ILE A C   1 
ATOM   365   O O   . ILE A 1 81  ? 191.770 167.012 147.298 1.00 82.31  ? 81  ILE A O   1 
ATOM   366   C CB  . ILE A 1 81  ? 191.304 168.155 150.408 1.00 82.31  ? 81  ILE A CB  1 
ATOM   367   C CG1 . ILE A 1 81  ? 190.329 167.894 151.544 1.00 82.31  ? 81  ILE A CG1 1 
ATOM   368   C CG2 . ILE A 1 81  ? 190.719 169.171 149.456 1.00 82.31  ? 81  ILE A CG2 1 
ATOM   369   C CD1 . ILE A 1 81  ? 190.078 169.094 152.392 1.00 82.31  ? 81  ILE A CD1 1 
ATOM   370   N N   . LEU A 1 82  ? 193.669 167.287 148.441 1.00 88.22  ? 82  LEU A N   1 
ATOM   371   C CA  . LEU A 1 82  ? 194.404 167.441 147.195 1.00 88.22  ? 82  LEU A CA  1 
ATOM   372   C C   . LEU A 1 82  ? 194.718 166.116 146.524 1.00 88.22  ? 82  LEU A C   1 
ATOM   373   O O   . LEU A 1 82  ? 195.360 166.113 145.473 1.00 88.22  ? 82  LEU A O   1 
ATOM   374   C CB  . LEU A 1 82  ? 195.689 168.239 147.407 1.00 88.22  ? 82  LEU A CB  1 
ATOM   375   C CG  . LEU A 1 82  ? 195.531 169.764 147.327 1.00 88.22  ? 82  LEU A CG  1 
ATOM   376   C CD1 . LEU A 1 82  ? 194.984 170.374 148.606 1.00 88.22  ? 82  LEU A CD1 1 
ATOM   377   C CD2 . LEU A 1 82  ? 196.829 170.434 146.918 1.00 88.22  ? 82  LEU A CD2 1 
ATOM   378   N N   . PHE A 1 83  ? 194.289 164.997 147.100 1.00 85.91  ? 83  PHE A N   1 
ATOM   379   C CA  . PHE A 1 83  ? 194.234 163.758 146.339 1.00 85.91  ? 83  PHE A CA  1 
ATOM   380   C C   . PHE A 1 83  ? 192.919 163.631 145.590 1.00 85.91  ? 83  PHE A C   1 
ATOM   381   O O   . PHE A 1 83  ? 192.892 163.132 144.461 1.00 85.91  ? 83  PHE A O   1 
ATOM   382   C CB  . PHE A 1 83  ? 194.435 162.559 147.260 1.00 85.91  ? 83  PHE A CB  1 
ATOM   383   C CG  . PHE A 1 83  ? 194.235 161.250 146.583 1.00 85.91  ? 83  PHE A CG  1 
ATOM   384   C CD1 . PHE A 1 83  ? 195.117 160.821 145.616 1.00 85.91  ? 83  PHE A CD1 1 
ATOM   385   C CD2 . PHE A 1 83  ? 193.173 160.439 146.925 1.00 85.91  ? 83  PHE A CD2 1 
ATOM   386   C CE1 . PHE A 1 83  ? 194.930 159.616 144.987 1.00 85.91  ? 83  PHE A CE1 1 
ATOM   387   C CE2 . PHE A 1 83  ? 192.984 159.230 146.304 1.00 85.91  ? 83  PHE A CE2 1 
ATOM   388   C CZ  . PHE A 1 83  ? 193.862 158.819 145.334 1.00 85.91  ? 83  PHE A CZ  1 
ATOM   389   N N   . GLY A 1 84  ? 191.830 164.089 146.193 1.00 85.83  ? 84  GLY A N   1 
ATOM   390   C CA  . GLY A 1 84  ? 190.523 163.956 145.591 1.00 85.83  ? 84  GLY A CA  1 
ATOM   391   C C   . GLY A 1 84  ? 190.322 164.839 144.383 1.00 85.83  ? 84  GLY A C   1 
ATOM   392   O O   . GLY A 1 84  ? 189.739 164.402 143.390 1.00 85.83  ? 84  GLY A O   1 
ATOM   393   N N   . LEU A 1 85  ? 190.815 166.074 144.441 1.00 83.63  ? 85  LEU A N   1 
ATOM   394   C CA  . LEU A 1 85  ? 190.601 167.002 143.342 1.00 83.63  ? 85  LEU A CA  1 
ATOM   395   C C   . LEU A 1 85  ? 191.391 166.635 142.097 1.00 83.63  ? 85  LEU A C   1 
ATOM   396   O O   . LEU A 1 85  ? 190.902 166.852 140.987 1.00 83.63  ? 85  LEU A O   1 
ATOM   397   C CB  . LEU A 1 85  ? 190.944 168.416 143.783 1.00 83.63  ? 85  LEU A CB  1 
ATOM   398   C CG  . LEU A 1 85  ? 189.925 168.965 144.769 1.00 83.63  ? 85  LEU A CG  1 
ATOM   399   C CD1 . LEU A 1 85  ? 190.363 170.303 145.294 1.00 83.63  ? 85  LEU A CD1 1 
ATOM   400   C CD2 . LEU A 1 85  ? 188.600 169.092 144.072 1.00 83.63  ? 85  LEU A CD2 1 
ATOM   401   N N   . SER A 1 86  ? 192.580 166.075 142.246 1.00 86.90  ? 86  SER A N   1 
ATOM   402   C CA  . SER A 1 86  ? 193.306 165.567 141.096 1.00 86.90  ? 86  SER A CA  1 
ATOM   403   C C   . SER A 1 86  ? 192.698 164.291 140.553 1.00 86.90  ? 86  SER A C   1 
ATOM   404   O O   . SER A 1 86  ? 192.883 163.985 139.373 1.00 86.90  ? 86  SER A O   1 
ATOM   405   C CB  . SER A 1 86  ? 194.767 165.315 141.460 1.00 86.90  ? 86  SER A CB  1 
ATOM   406   O OG  . SER A 1 86  ? 194.871 164.253 142.388 1.00 86.90  ? 86  SER A OG  1 
ATOM   407   N N   . ASN A 1 87  ? 191.976 163.546 141.381 1.00 85.70  ? 87  ASN A N   1 
ATOM   408   C CA  . ASN A 1 87  ? 191.323 162.324 140.948 1.00 85.70  ? 87  ASN A CA  1 
ATOM   409   C C   . ASN A 1 87  ? 189.951 162.577 140.350 1.00 85.70  ? 87  ASN A C   1 
ATOM   410   O O   . ASN A 1 87  ? 189.572 161.887 139.404 1.00 85.70  ? 87  ASN A O   1 
ATOM   411   C CB  . ASN A 1 87  ? 191.185 161.363 142.129 1.00 85.70  ? 87  ASN A CB  1 
ATOM   412   C CG  . ASN A 1 87  ? 190.883 159.947 141.703 1.00 85.70  ? 87  ASN A CG  1 
ATOM   413   O OD1 . ASN A 1 87  ? 190.867 159.625 140.521 1.00 85.70  ? 87  ASN A OD1 1 
ATOM   414   N ND2 . ASN A 1 87  ? 190.624 159.089 142.675 1.00 85.70  ? 87  ASN A ND2 1 
ATOM   415   N N   . GLN A 1 88  ? 189.207 163.552 140.879 1.00 86.83  ? 88  GLN A N   1 
ATOM   416   C CA  . GLN A 1 88  ? 187.881 163.870 140.356 1.00 86.83  ? 88  GLN A CA  1 
ATOM   417   C C   . GLN A 1 88  ? 187.947 164.361 138.922 1.00 86.83  ? 88  GLN A C   1 
ATOM   418   O O   . GLN A 1 88  ? 187.143 163.951 138.078 1.00 86.83  ? 88  GLN A O   1 
ATOM   419   C CB  . GLN A 1 88  ? 187.219 164.931 141.230 1.00 86.83  ? 88  GLN A CB  1 
ATOM   420   C CG  . GLN A 1 88  ? 185.893 165.430 140.702 1.00 86.83  ? 88  GLN A CG  1 
ATOM   421   C CD  . GLN A 1 88  ? 185.312 166.545 141.540 1.00 86.83  ? 88  GLN A CD  1 
ATOM   422   O OE1 . GLN A 1 88  ? 185.874 166.930 142.563 1.00 86.83  ? 88  GLN A OE1 1 
ATOM   423   N NE2 . GLN A 1 88  ? 184.195 167.099 141.086 1.00 86.83  ? 88  GLN A NE2 1 
ATOM   424   N N   . LEU A 1 89  ? 188.920 165.215 138.623 1.00 87.29  ? 89  LEU A N   1 
ATOM   425   C CA  . LEU A 1 89  ? 189.010 165.831 137.310 1.00 87.29  ? 89  LEU A CA  1 
ATOM   426   C C   . LEU A 1 89  ? 189.381 164.821 136.236 1.00 87.29  ? 89  LEU A C   1 
ATOM   427   O O   . LEU A 1 89  ? 189.043 165.014 135.067 1.00 87.29  ? 89  LEU A O   1 
ATOM   428   C CB  . LEU A 1 89  ? 190.022 166.973 137.364 1.00 87.29  ? 89  LEU A CB  1 
ATOM   429   C CG  . LEU A 1 89  ? 190.160 167.923 136.183 1.00 87.29  ? 89  LEU A CG  1 
ATOM   430   C CD1 . LEU A 1 89  ? 188.840 168.611 135.933 1.00 87.29  ? 89  LEU A CD1 1 
ATOM   431   C CD2 . LEU A 1 89  ? 191.229 168.948 136.488 1.00 87.29  ? 89  LEU A CD2 1 
ATOM   432   N N   . ALA A 1 90  ? 190.032 163.729 136.612 1.00 85.86  ? 90  ALA A N   1 
ATOM   433   C CA  . ALA A 1 90  ? 190.310 162.660 135.670 1.00 85.86  ? 90  ALA A CA  1 
ATOM   434   C C   . ALA A 1 90  ? 189.131 161.726 135.474 1.00 85.86  ? 90  ALA A C   1 
ATOM   435   O O   . ALA A 1 90  ? 189.068 161.039 134.451 1.00 85.86  ? 90  ALA A O   1 
ATOM   436   C CB  . ALA A 1 90  ? 191.517 161.848 136.133 1.00 85.86  ? 90  ALA A CB  1 
ATOM   437   N N   . VAL A 1 91  ? 188.205 161.668 136.426 1.00 83.76  ? 91  VAL A N   1 
ATOM   438   C CA  . VAL A 1 91  ? 187.048 160.800 136.262 1.00 83.76  ? 91  VAL A CA  1 
ATOM   439   C C   . VAL A 1 91  ? 186.068 161.410 135.275 1.00 83.76  ? 91  VAL A C   1 
ATOM   440   O O   . VAL A 1 91  ? 185.513 160.712 134.419 1.00 83.76  ? 91  VAL A O   1 
ATOM   441   C CB  . VAL A 1 91  ? 186.400 160.517 137.628 1.00 83.76  ? 91  VAL A CB  1 
ATOM   442   C CG1 . VAL A 1 91  ? 185.099 159.768 137.477 1.00 83.76  ? 91  VAL A CG1 1 
ATOM   443   C CG2 . VAL A 1 91  ? 187.331 159.693 138.462 1.00 83.76  ? 91  VAL A CG2 1 
ATOM   444   N N   . THR A 1 92  ? 185.870 162.727 135.346 1.00 84.78  ? 92  THR A N   1 
ATOM   445   C CA  . THR A 1 92  ? 184.944 163.377 134.429 1.00 84.78  ? 92  THR A CA  1 
ATOM   446   C C   . THR A 1 92  ? 185.462 163.351 133.002 1.00 84.78  ? 92  THR A C   1 
ATOM   447   O O   . THR A 1 92  ? 184.670 163.411 132.065 1.00 84.78  ? 92  THR A O   1 
ATOM   448   C CB  . THR A 1 92  ? 184.685 164.812 134.856 1.00 84.78  ? 92  THR A CB  1 
ATOM   449   O OG1 . THR A 1 92  ? 185.885 165.569 134.706 1.00 84.78  ? 92  THR A OG1 1 
ATOM   450   C CG2 . THR A 1 92  ? 184.273 164.851 136.304 1.00 84.78  ? 92  THR A CG2 1 
ATOM   451   N N   . PHE A 1 93  ? 186.772 163.245 132.811 1.00 85.18  ? 93  PHE A N   1 
ATOM   452   C CA  . PHE A 1 93  ? 187.268 162.973 131.472 1.00 85.18  ? 93  PHE A CA  1 
ATOM   453   C C   . PHE A 1 93  ? 187.027 161.525 131.079 1.00 85.18  ? 93  PHE A C   1 
ATOM   454   O O   . PHE A 1 93  ? 186.834 161.233 129.899 1.00 85.18  ? 93  PHE A O   1 
ATOM   455   C CB  . PHE A 1 93  ? 188.750 163.305 131.375 1.00 85.18  ? 93  PHE A CB  1 
ATOM   456   C CG  . PHE A 1 93  ? 189.310 163.136 130.007 1.00 85.18  ? 93  PHE A CG  1 
ATOM   457   C CD1 . PHE A 1 93  ? 189.055 164.073 129.032 1.00 85.18  ? 93  PHE A CD1 1 
ATOM   458   C CD2 . PHE A 1 93  ? 190.086 162.041 129.692 1.00 85.18  ? 93  PHE A CD2 1 
ATOM   459   C CE1 . PHE A 1 93  ? 189.567 163.922 127.772 1.00 85.18  ? 93  PHE A CE1 1 
ATOM   460   C CE2 . PHE A 1 93  ? 190.594 161.886 128.430 1.00 85.18  ? 93  PHE A CE2 1 
ATOM   461   C CZ  . PHE A 1 93  ? 190.338 162.825 127.472 1.00 85.18  ? 93  PHE A CZ  1 
ATOM   462   N N   . ARG A 1 94  ? 187.036 160.606 132.041 1.00 82.53  ? 94  ARG A N   1 
ATOM   463   C CA  . ARG A 1 94  ? 186.778 159.210 131.709 1.00 82.53  ? 94  ARG A CA  1 
ATOM   464   C C   . ARG A 1 94  ? 185.313 158.983 131.391 1.00 82.53  ? 94  ARG A C   1 
ATOM   465   O O   . ARG A 1 94  ? 184.988 158.337 130.394 1.00 82.53  ? 94  ARG A O   1 
ATOM   466   C CB  . ARG A 1 94  ? 187.206 158.294 132.853 1.00 82.53  ? 94  ARG A CB  1 
ATOM   467   C CG  . ARG A 1 94  ? 186.950 156.808 132.599 1.00 82.53  ? 94  ARG A CG  1 
ATOM   468   C CD  . ARG A 1 94  ? 187.383 155.939 133.783 1.00 82.53  ? 94  ARG A CD  1 
ATOM   469   N NE  . ARG A 1 94  ? 188.822 156.012 134.015 1.00 82.53  ? 94  ARG A NE  1 
ATOM   470   C CZ  . ARG A 1 94  ? 189.377 156.573 135.082 1.00 82.53  ? 94  ARG A CZ  1 
ATOM   471   N NH1 . ARG A 1 94  ? 188.612 157.105 136.017 1.00 82.53  ? 94  ARG A NH1 1 
ATOM   472   N NH2 . ARG A 1 94  ? 190.695 156.606 135.214 1.00 82.53  ? 94  ARG A NH2 1 
ATOM   473   N N   . GLU A 1 95  ? 184.413 159.514 132.209 1.00 83.51  ? 95  GLU A N   1 
ATOM   474   C CA  . GLU A 1 95  ? 183.001 159.213 132.063 1.00 83.51  ? 95  GLU A CA  1 
ATOM   475   C C   . GLU A 1 95  ? 182.301 160.122 131.075 1.00 83.51  ? 95  GLU A C   1 
ATOM   476   O O   . GLU A 1 95  ? 181.073 160.098 131.004 1.00 83.51  ? 95  GLU A O   1 
ATOM   477   C CB  . GLU A 1 95  ? 182.284 159.284 133.410 1.00 83.51  ? 95  GLU A CB  1 
ATOM   478   C CG  . GLU A 1 95  ? 182.155 160.675 134.000 1.00 83.51  ? 95  GLU A CG  1 
ATOM   479   C CD  . GLU A 1 95  ? 181.392 160.678 135.317 1.00 83.51  ? 95  GLU A CD  1 
ATOM   480   O OE1 . GLU A 1 95  ? 181.018 159.584 135.787 1.00 83.51  ? 95  GLU A OE1 1 
ATOM   481   O OE2 . GLU A 1 95  ? 181.151 161.771 135.874 1.00 83.51  ? 95  GLU A OE2 1 
ATOM   482   N N   . GLU A 1 96  ? 183.036 160.920 130.306 1.00 80.85  ? 96  GLU A N   1 
ATOM   483   C CA  . GLU A 1 96  ? 182.408 161.742 129.286 1.00 80.85  ? 96  GLU A CA  1 
ATOM   484   C C   . GLU A 1 96  ? 182.892 161.383 127.890 1.00 80.85  ? 96  GLU A C   1 
ATOM   485   O O   . GLU A 1 96  ? 182.206 161.678 126.913 1.00 80.85  ? 96  GLU A O   1 
ATOM   486   C CB  . GLU A 1 96  ? 182.636 163.221 129.586 1.00 80.85  ? 96  GLU A CB  1 
ATOM   487   C CG  . GLU A 1 96  ? 181.706 164.167 128.870 1.00 80.85  ? 96  GLU A CG  1 
ATOM   488   C CD  . GLU A 1 96  ? 181.861 165.596 129.332 1.00 80.85  ? 96  GLU A CD  1 
ATOM   489   O OE1 . GLU A 1 96  ? 182.759 165.862 130.155 1.00 80.85  ? 96  GLU A OE1 1 
ATOM   490   O OE2 . GLU A 1 96  ? 181.065 166.455 128.890 1.00 80.85  ? 96  GLU A OE2 1 
ATOM   491   N N   . ASN A 1 97  ? 184.029 160.707 127.764 1.00 77.37  ? 97  ASN A N   1 
ATOM   492   C CA  . ASN A 1 97  ? 184.360 160.108 126.484 1.00 77.37  ? 97  ASN A CA  1 
ATOM   493   C C   . ASN A 1 97  ? 183.545 158.867 126.185 1.00 77.37  ? 97  ASN A C   1 
ATOM   494   O O   . ASN A 1 97  ? 183.372 158.534 125.011 1.00 77.37  ? 97  ASN A O   1 
ATOM   495   C CB  . ASN A 1 97  ? 185.846 159.748 126.398 1.00 77.37  ? 97  ASN A CB  1 
ATOM   496   C CG  . ASN A 1 97  ? 186.728 160.958 126.276 1.00 77.37  ? 97  ASN A CG  1 
ATOM   497   O OD1 . ASN A 1 97  ? 187.566 161.217 127.129 1.00 77.37  ? 97  ASN A OD1 1 
ATOM   498   N ND2 . ASN A 1 97  ? 186.548 161.710 125.205 1.00 77.37  ? 97  ASN A ND2 1 
ATOM   499   N N   . THR A 1 98  ? 183.040 158.181 127.203 1.00 72.39  ? 98  THR A N   1 
ATOM   500   C CA  . THR A 1 98  ? 182.168 157.047 126.947 1.00 72.39  ? 98  THR A CA  1 
ATOM   501   C C   . THR A 1 98  ? 180.813 157.513 126.458 1.00 72.39  ? 98  THR A C   1 
ATOM   502   O O   . THR A 1 98  ? 180.239 156.917 125.540 1.00 72.39  ? 98  THR A O   1 
ATOM   503   C CB  . THR A 1 98  ? 181.993 156.238 128.209 1.00 72.39  ? 98  THR A CB  1 
ATOM   504   O OG1 . THR A 1 98  ? 181.235 157.015 129.135 1.00 72.39  ? 98  THR A OG1 1 
ATOM   505   C CG2 . THR A 1 98  ? 183.316 155.994 128.814 1.00 72.39  ? 98  THR A CG2 1 
ATOM   506   N N   . ILE A 1 99  ? 180.286 158.576 127.073 1.00 70.80  ? 99  ILE A N   1 
ATOM   507   C CA  . ILE A 1 99  ? 179.049 159.204 126.627 1.00 70.80  ? 99  ILE A CA  1 
ATOM   508   C C   . ILE A 1 99  ? 179.205 159.725 125.215 1.00 70.80  ? 99  ILE A C   1 
ATOM   509   O O   . ILE A 1 99  ? 178.258 159.694 124.422 1.00 70.80  ? 99  ILE A O   1 
ATOM   510   C CB  . ILE A 1 99  ? 178.662 160.320 127.608 1.00 70.80  ? 99  ILE A CB  1 
ATOM   511   C CG1 . ILE A 1 99  ? 178.517 159.741 129.003 1.00 70.80  ? 99  ILE A CG1 1 
ATOM   512   C CG2 . ILE A 1 99  ? 177.376 160.987 127.221 1.00 70.80  ? 99  ILE A CG2 1 
ATOM   513   C CD1 . ILE A 1 99  ? 177.478 158.667 129.109 1.00 70.80  ? 99  ILE A CD1 1 
ATOM   514   N N   . ALA A 1 100 ? 180.404 160.174 124.861 1.00 68.06  ? 100 ALA A N   1 
ATOM   515   C CA  . ALA A 1 100 ? 180.683 160.459 123.470 1.00 68.06  ? 100 ALA A CA  1 
ATOM   516   C C   . ALA A 1 100 ? 180.670 159.204 122.623 1.00 68.06  ? 100 ALA A C   1 
ATOM   517   O O   . ALA A 1 100 ? 180.160 159.239 121.502 1.00 68.06  ? 100 ALA A O   1 
ATOM   518   C CB  . ALA A 1 100 ? 182.028 161.154 123.344 1.00 68.06  ? 100 ALA A CB  1 
ATOM   519   N N   . PHE A 1 101 ? 181.182 158.097 123.137 1.00 67.58  ? 101 PHE A N   1 
ATOM   520   C CA  . PHE A 1 101 ? 181.293 156.906 122.313 1.00 67.58  ? 101 PHE A CA  1 
ATOM   521   C C   . PHE A 1 101 ? 179.962 156.235 122.066 1.00 67.58  ? 101 PHE A C   1 
ATOM   522   O O   . PHE A 1 101 ? 179.778 155.630 121.008 1.00 67.58  ? 101 PHE A O   1 
ATOM   523   C CB  . PHE A 1 101 ? 182.253 155.906 122.944 1.00 67.58  ? 101 PHE A CB  1 
ATOM   524   C CG  . PHE A 1 101 ? 183.683 156.319 122.862 1.00 67.58  ? 101 PHE A CG  1 
ATOM   525   C CD1 . PHE A 1 101 ? 184.091 157.256 121.939 1.00 67.58  ? 101 PHE A CD1 1 
ATOM   526   C CD2 . PHE A 1 101 ? 184.612 155.794 123.728 1.00 67.58  ? 101 PHE A CD2 1 
ATOM   527   C CE1 . PHE A 1 101 ? 185.397 157.646 121.874 1.00 67.58  ? 101 PHE A CE1 1 
ATOM   528   C CE2 . PHE A 1 101 ? 185.917 156.182 123.664 1.00 67.58  ? 101 PHE A CE2 1 
ATOM   529   C CZ  . PHE A 1 101 ? 186.309 157.108 122.737 1.00 67.58  ? 101 PHE A CZ  1 
ATOM   530   N N   . ARG A 1 102 ? 179.025 156.335 123.002 1.00 68.40  ? 102 ARG A N   1 
ATOM   531   C CA  . ARG A 1 102 ? 177.734 155.701 122.794 1.00 68.40  ? 102 ARG A CA  1 
ATOM   532   C C   . ARG A 1 102 ? 176.917 156.430 121.750 1.00 68.40  ? 102 ARG A C   1 
ATOM   533   O O   . ARG A 1 102 ? 176.119 155.804 121.051 1.00 68.40  ? 102 ARG A O   1 
ATOM   534   C CB  . ARG A 1 102 ? 176.963 155.636 124.099 1.00 68.40  ? 102 ARG A CB  1 
ATOM   535   C CG  . ARG A 1 102 ? 177.639 154.775 125.099 1.00 68.40  ? 102 ARG A CG  1 
ATOM   536   C CD  . ARG A 1 102 ? 176.918 154.762 126.400 1.00 68.40  ? 102 ARG A CD  1 
ATOM   537   N NE  . ARG A 1 102 ? 177.707 154.038 127.374 1.00 68.40  ? 102 ARG A NE  1 
ATOM   538   C CZ  . ARG A 1 102 ? 177.388 153.936 128.649 1.00 68.40  ? 102 ARG A CZ  1 
ATOM   539   N NH1 . ARG A 1 102 ? 176.288 154.515 129.099 1.00 68.40  ? 102 ARG A NH1 1 
ATOM   540   N NH2 . ARG A 1 102 ? 178.172 153.263 129.472 1.00 68.40  ? 102 ARG A NH2 1 
ATOM   541   N N   . HIS A 1 103 ? 177.117 157.732 121.610 1.00 64.05  ? 103 HIS A N   1 
ATOM   542   C CA  . HIS A 1 103 ? 176.464 158.483 120.552 1.00 64.05  ? 103 HIS A CA  1 
ATOM   543   C C   . HIS A 1 103 ? 177.168 158.365 119.215 1.00 64.05  ? 103 HIS A C   1 
ATOM   544   O O   . HIS A 1 103 ? 176.744 159.011 118.256 1.00 64.05  ? 103 HIS A O   1 
ATOM   545   C CB  . HIS A 1 103 ? 176.359 159.945 120.944 1.00 64.05  ? 103 HIS A CB  1 
ATOM   546   C CG  . HIS A 1 103 ? 175.335 160.202 121.992 1.00 64.05  ? 103 HIS A CG  1 
ATOM   547   N ND1 . HIS A 1 103 ? 173.991 160.242 121.709 1.00 64.05  ? 103 HIS A ND1 1 
ATOM   548   C CD2 . HIS A 1 103 ? 175.449 160.416 123.320 1.00 64.05  ? 103 HIS A CD2 1 
ATOM   549   C CE1 . HIS A 1 103 ? 173.319 160.485 122.818 1.00 64.05  ? 103 HIS A CE1 1 
ATOM   550   N NE2 . HIS A 1 103 ? 174.181 160.596 123.810 1.00 64.05  ? 103 HIS A NE2 1 
ATOM   551   N N   . LEU A 1 104 ? 178.220 157.577 119.124 1.00 60.11  ? 104 LEU A N   1 
ATOM   552   C CA  . LEU A 1 104 ? 178.888 157.346 117.862 1.00 60.11  ? 104 LEU A CA  1 
ATOM   553   C C   . LEU A 1 104 ? 178.881 155.898 117.434 1.00 60.11  ? 104 LEU A C   1 
ATOM   554   O O   . LEU A 1 104 ? 179.033 155.626 116.250 1.00 60.11  ? 104 LEU A O   1 
ATOM   555   C CB  . LEU A 1 104 ? 180.340 157.818 117.927 1.00 60.11  ? 104 LEU A CB  1 
ATOM   556   C CG  . LEU A 1 104 ? 180.527 159.317 118.081 1.00 60.11  ? 104 LEU A CG  1 
ATOM   557   C CD1 . LEU A 1 104 ? 181.989 159.654 118.214 1.00 60.11  ? 104 LEU A CD1 1 
ATOM   558   C CD2 . LEU A 1 104 ? 179.934 160.014 116.897 1.00 60.11  ? 104 LEU A CD2 1 
ATOM   559   N N   . PHE A 1 105 ? 178.705 154.964 118.356 1.00 64.39  ? 105 PHE A N   1 
ATOM   560   C CA  . PHE A 1 105 ? 178.927 153.558 118.078 1.00 64.39  ? 105 PHE A CA  1 
ATOM   561   C C   . PHE A 1 105 ? 177.700 152.695 118.294 1.00 64.39  ? 105 PHE A C   1 
ATOM   562   O O   . PHE A 1 105 ? 177.771 151.487 118.075 1.00 64.39  ? 105 PHE A O   1 
ATOM   563   C CB  . PHE A 1 105 ? 180.069 153.050 118.950 1.00 64.39  ? 105 PHE A CB  1 
ATOM   564   C CG  . PHE A 1 105 ? 181.394 153.611 118.581 1.00 64.39  ? 105 PHE A CG  1 
ATOM   565   C CD1 . PHE A 1 105 ? 181.681 153.936 117.279 1.00 64.39  ? 105 PHE A CD1 1 
ATOM   566   C CD2 . PHE A 1 105 ? 182.325 153.898 119.552 1.00 64.39  ? 105 PHE A CD2 1 
ATOM   567   C CE1 . PHE A 1 105 ? 182.898 154.470 116.946 1.00 64.39  ? 105 PHE A CE1 1 
ATOM   568   C CE2 . PHE A 1 105 ? 183.536 154.448 119.224 1.00 64.39  ? 105 PHE A CE2 1 
ATOM   569   C CZ  . PHE A 1 105 ? 183.824 154.729 117.922 1.00 64.39  ? 105 PHE A CZ  1 
ATOM   570   N N   . LEU A 1 106 ? 176.587 153.264 118.730 1.00 63.59  ? 106 LEU A N   1 
ATOM   571   C CA  . LEU A 1 106 ? 175.380 152.501 118.989 1.00 63.59  ? 106 LEU A CA  1 
ATOM   572   C C   . LEU A 1 106 ? 174.243 153.068 118.162 1.00 63.59  ? 106 LEU A C   1 
ATOM   573   O O   . LEU A 1 106 ? 173.928 154.255 118.259 1.00 63.59  ? 106 LEU A O   1 
ATOM   574   C CB  . LEU A 1 106 ? 175.017 152.544 120.455 1.00 63.59  ? 106 LEU A CB  1 
ATOM   575   C CG  . LEU A 1 106 ? 176.078 151.960 121.366 1.00 63.59  ? 106 LEU A CG  1 
ATOM   576   C CD1 . LEU A 1 106 ? 175.630 152.050 122.791 1.00 63.59  ? 106 LEU A CD1 1 
ATOM   577   C CD2 . LEU A 1 106 ? 176.340 150.547 120.979 1.00 63.59  ? 106 LEU A CD2 1 
ATOM   578   N N   . LEU A 1 107 ? 173.619 152.217 117.360 1.00 63.25  ? 107 LEU A N   1 
ATOM   579   C CA  . LEU A 1 107 ? 172.655 152.682 116.373 1.00 63.25  ? 107 LEU A CA  1 
ATOM   580   C C   . LEU A 1 107 ? 171.345 153.026 117.058 1.00 63.25  ? 107 LEU A C   1 
ATOM   581   O O   . LEU A 1 107 ? 170.629 152.138 117.522 1.00 63.25  ? 107 LEU A O   1 
ATOM   582   C CB  . LEU A 1 107 ? 172.428 151.626 115.305 1.00 63.25  ? 107 LEU A CB  1 
ATOM   583   C CG  . LEU A 1 107 ? 171.503 152.136 114.215 1.00 63.25  ? 107 LEU A CG  1 
ATOM   584   C CD1 . LEU A 1 107 ? 172.174 153.271 113.487 1.00 63.25  ? 107 LEU A CD1 1 
ATOM   585   C CD2 . LEU A 1 107 ? 171.143 151.020 113.268 1.00 63.25  ? 107 LEU A CD2 1 
ATOM   586   N N   . GLY A 1 108 ? 171.023 154.312 117.106 1.00 71.40  ? 108 GLY A N   1 
ATOM   587   C CA  . GLY A 1 108 ? 169.755 154.736 117.656 1.00 71.40  ? 108 GLY A CA  1 
ATOM   588   C C   . GLY A 1 108 ? 169.731 154.891 119.153 1.00 71.40  ? 108 GLY A C   1 
ATOM   589   O O   . GLY A 1 108 ? 168.702 154.623 119.773 1.00 71.40  ? 108 GLY A O   1 
ATOM   590   N N   . TYR A 1 109 ? 170.835 155.305 119.756 1.00 75.92  ? 109 TYR A N   1 
ATOM   591   C CA  . TYR A 1 109 ? 170.919 155.436 121.204 1.00 75.92  ? 109 TYR A CA  1 
ATOM   592   C C   . TYR A 1 109 ? 170.599 156.863 121.589 1.00 75.92  ? 109 TYR A C   1 
ATOM   593   O O   . TYR A 1 109 ? 171.405 157.767 121.381 1.00 75.92  ? 109 TYR A O   1 
ATOM   594   C CB  . TYR A 1 109 ? 172.304 155.052 121.693 1.00 75.92  ? 109 TYR A CB  1 
ATOM   595   C CG  . TYR A 1 109 ? 172.537 155.261 123.164 1.00 75.92  ? 109 TYR A CG  1 
ATOM   596   C CD1 . TYR A 1 109 ? 172.038 154.380 124.096 1.00 75.92  ? 109 TYR A CD1 1 
ATOM   597   C CD2 . TYR A 1 109 ? 173.280 156.334 123.616 1.00 75.92  ? 109 TYR A CD2 1 
ATOM   598   C CE1 . TYR A 1 109 ? 172.266 154.569 125.439 1.00 75.92  ? 109 TYR A CE1 1 
ATOM   599   C CE2 . TYR A 1 109 ? 173.508 156.529 124.950 1.00 75.92  ? 109 TYR A CE2 1 
ATOM   600   C CZ  . TYR A 1 109 ? 173.001 155.646 125.855 1.00 75.92  ? 109 TYR A CZ  1 
ATOM   601   O OH  . TYR A 1 109 ? 173.236 155.848 127.189 1.00 75.92  ? 109 TYR A OH  1 
ATOM   602   N N   . SER A 1 110 ? 169.430 157.073 122.167 1.00 85.00  ? 110 SER A N   1 
ATOM   603   C CA  . SER A 1 110 ? 169.187 158.341 122.821 1.00 85.00  ? 110 SER A CA  1 
ATOM   604   C C   . SER A 1 110 ? 169.734 158.287 124.240 1.00 85.00  ? 110 SER A C   1 
ATOM   605   O O   . SER A 1 110 ? 170.278 157.275 124.683 1.00 85.00  ? 110 SER A O   1 
ATOM   606   C CB  . SER A 1 110 ? 167.703 158.665 122.820 1.00 85.00  ? 110 SER A CB  1 
ATOM   607   O OG  . SER A 1 110 ? 166.998 157.704 123.573 1.00 85.00  ? 110 SER A OG  1 
ATOM   608   N N   . ASP A 1 111 ? 169.594 159.393 124.958 1.00 90.88  ? 111 ASP A N   1 
ATOM   609   C CA  . ASP A 1 111 ? 170.132 159.446 126.305 1.00 90.88  ? 111 ASP A CA  1 
ATOM   610   C C   . ASP A 1 111 ? 169.259 158.661 127.273 1.00 90.88  ? 111 ASP A C   1 
ATOM   611   O O   . ASP A 1 111 ? 168.132 158.272 126.967 1.00 90.88  ? 111 ASP A O   1 
ATOM   612   C CB  . ASP A 1 111 ? 170.260 160.888 126.781 1.00 90.88  ? 111 ASP A CB  1 
ATOM   613   C CG  . ASP A 1 111 ? 171.416 161.614 126.130 1.00 90.88  ? 111 ASP A CG  1 
ATOM   614   O OD1 . ASP A 1 111 ? 172.402 160.948 125.769 1.00 90.88  ? 111 ASP A OD1 1 
ATOM   615   O OD2 . ASP A 1 111 ? 171.349 162.851 125.990 1.00 90.88  ? 111 ASP A OD2 1 
ATOM   616   N N   . GLY A 1 112 ? 169.811 158.408 128.447 1.00 91.38  ? 112 GLY A N   1 
ATOM   617   C CA  . GLY A 1 112 ? 169.076 157.796 129.537 1.00 91.38  ? 112 GLY A CA  1 
ATOM   618   C C   . GLY A 1 112 ? 168.907 156.296 129.491 1.00 91.38  ? 112 GLY A C   1 
ATOM   619   O O   . GLY A 1 112 ? 169.128 155.615 130.492 1.00 91.38  ? 112 GLY A O   1 
ATOM   620   N N   . ALA A 1 113 ? 168.527 155.760 128.335 1.00 85.35  ? 113 ALA A N   1 
ATOM   621   C CA  . ALA A 1 113 ? 168.216 154.339 128.209 1.00 85.35  ? 113 ALA A CA  1 
ATOM   622   C C   . ALA A 1 113 ? 169.504 153.522 128.110 1.00 85.35  ? 113 ALA A C   1 
ATOM   623   O O   . ALA A 1 113 ? 169.861 152.984 127.063 1.00 85.35  ? 113 ALA A O   1 
ATOM   624   C CB  . ALA A 1 113 ? 167.319 154.107 127.004 1.00 85.35  ? 113 ALA A CB  1 
ATOM   625   N N   . ASP A 1 114 ? 170.211 153.428 129.235 1.00 89.48  ? 114 ASP A N   1 
ATOM   626   C CA  . ASP A 1 114 ? 171.412 152.603 129.262 1.00 89.48  ? 114 ASP A CA  1 
ATOM   627   C C   . ASP A 1 114 ? 171.056 151.129 129.253 1.00 89.48  ? 114 ASP A C   1 
ATOM   628   O O   . ASP A 1 114 ? 171.386 150.400 128.313 1.00 89.48  ? 114 ASP A O   1 
ATOM   629   C CB  . ASP A 1 114 ? 172.265 152.919 130.491 1.00 89.48  ? 114 ASP A CB  1 
ATOM   630   C CG  . ASP A 1 114 ? 173.070 154.185 130.339 1.00 89.48  ? 114 ASP A CG  1 
ATOM   631   O OD1 . ASP A 1 114 ? 173.405 154.546 129.192 1.00 89.48  ? 114 ASP A OD1 1 
ATOM   632   O OD2 . ASP A 1 114 ? 173.391 154.807 131.371 1.00 89.48  ? 114 ASP A OD2 1 
ATOM   633   N N   . ASP A 1 115 ? 170.365 150.677 130.287 1.00 86.02  ? 115 ASP A N   1 
ATOM   634   C CA  . ASP A 1 115 ? 170.158 149.257 130.503 1.00 86.02  ? 115 ASP A CA  1 
ATOM   635   C C   . ASP A 1 115 ? 168.967 148.694 129.747 1.00 86.02  ? 115 ASP A C   1 
ATOM   636   O O   . ASP A 1 115 ? 168.771 147.476 129.760 1.00 86.02  ? 115 ASP A O   1 
ATOM   637   C CB  . ASP A 1 115 ? 170.010 148.986 132.001 1.00 86.02  ? 115 ASP A CB  1 
ATOM   638   C CG  . ASP A 1 115 ? 168.941 149.849 132.654 1.00 86.02  ? 115 ASP A CG  1 
ATOM   639   O OD1 . ASP A 1 115 ? 168.348 150.710 131.969 1.00 86.02  ? 115 ASP A OD1 1 
ATOM   640   O OD2 . ASP A 1 115 ? 168.701 149.673 133.867 1.00 86.02  ? 115 ASP A OD2 1 
ATOM   641   N N   . THR A 1 116 ? 168.172 149.533 129.097 1.00 80.81  ? 116 THR A N   1 
ATOM   642   C CA  . THR A 1 116 ? 167.000 149.077 128.365 1.00 80.81  ? 116 THR A CA  1 
ATOM   643   C C   . THR A 1 116 ? 167.180 149.266 126.867 1.00 80.81  ? 116 THR A C   1 
ATOM   644   O O   . THR A 1 116 ? 166.221 149.515 126.139 1.00 80.81  ? 116 THR A O   1 
ATOM   645   C CB  . THR A 1 116 ? 165.746 149.799 128.838 1.00 80.81  ? 116 THR A CB  1 
ATOM   646   O OG1 . THR A 1 116 ? 165.860 151.191 128.541 1.00 80.81  ? 116 THR A OG1 1 
ATOM   647   C CG2 . THR A 1 116 ? 165.582 149.634 130.328 1.00 80.81  ? 116 THR A CG2 1 
ATOM   648   N N   . PHE A 1 117 ? 168.411 149.151 126.392 1.00 63.19  ? 117 PHE A N   1 
ATOM   649   C CA  . PHE A 1 117 ? 168.724 149.286 124.980 1.00 63.19  ? 117 PHE A CA  1 
ATOM   650   C C   . PHE A 1 117 ? 169.032 147.907 124.436 1.00 63.19  ? 117 PHE A C   1 
ATOM   651   O O   . PHE A 1 117 ? 170.006 147.281 124.858 1.00 63.19  ? 117 PHE A O   1 
ATOM   652   C CB  . PHE A 1 117 ? 169.911 150.214 124.772 1.00 63.19  ? 117 PHE A CB  1 
ATOM   653   C CG  . PHE A 1 117 ? 170.191 150.504 123.349 1.00 63.19  ? 117 PHE A CG  1 
ATOM   654   C CD1 . PHE A 1 117 ? 169.418 151.405 122.664 1.00 63.19  ? 117 PHE A CD1 1 
ATOM   655   C CD2 . PHE A 1 117 ? 171.220 149.876 122.692 1.00 63.19  ? 117 PHE A CD2 1 
ATOM   656   C CE1 . PHE A 1 117 ? 169.668 151.679 121.350 1.00 63.19  ? 117 PHE A CE1 1 
ATOM   657   C CE2 . PHE A 1 117 ? 171.474 150.143 121.376 1.00 63.19  ? 117 PHE A CE2 1 
ATOM   658   C CZ  . PHE A 1 117 ? 170.698 151.045 120.705 1.00 63.19  ? 117 PHE A CZ  1 
ATOM   659   N N   . ALA A 1 118 ? 168.217 147.435 123.501 1.00 61.89  ? 118 ALA A N   1 
ATOM   660   C CA  . ALA A 1 118 ? 168.321 146.063 123.044 1.00 61.89  ? 118 ALA A CA  1 
ATOM   661   C C   . ALA A 1 118 ? 167.986 145.982 121.565 1.00 61.89  ? 118 ALA A C   1 
ATOM   662   O O   . ALA A 1 118 ? 167.578 146.964 120.942 1.00 61.89  ? 118 ALA A O   1 
ATOM   663   C CB  . ALA A 1 118 ? 167.400 145.153 123.853 1.00 61.89  ? 118 ALA A CB  1 
ATOM   664   N N   . ALA A 1 119 ? 168.147 144.785 121.010 1.00 63.47  ? 119 ALA A N   1 
ATOM   665   C CA  . ALA A 1 119 ? 167.878 144.538 119.597 1.00 63.47  ? 119 ALA A CA  1 
ATOM   666   C C   . ALA A 1 119 ? 167.015 143.291 119.503 1.00 63.47  ? 119 ALA A C   1 
ATOM   667   O O   . ALA A 1 119 ? 167.392 142.243 120.022 1.00 63.47  ? 119 ALA A O   1 
ATOM   668   C CB  . ALA A 1 119 ? 169.171 144.366 118.820 1.00 63.47  ? 119 ALA A CB  1 
ATOM   669   N N   . TYR A 1 120 ? 165.872 143.396 118.839 1.00 65.06  ? 120 TYR A N   1 
ATOM   670   C CA  . TYR A 1 120 ? 164.851 142.364 118.937 1.00 65.06  ? 120 TYR A CA  1 
ATOM   671   C C   . TYR A 1 120 ? 164.685 141.535 117.678 1.00 65.06  ? 120 TYR A C   1 
ATOM   672   O O   . TYR A 1 120 ? 164.438 140.333 117.775 1.00 65.06  ? 120 TYR A O   1 
ATOM   673   C CB  . TYR A 1 120 ? 163.518 143.003 119.298 1.00 65.06  ? 120 TYR A CB  1 
ATOM   674   C CG  . TYR A 1 120 ? 163.526 143.577 120.675 1.00 65.06  ? 120 TYR A CG  1 
ATOM   675   C CD1 . TYR A 1 120 ? 163.282 142.782 121.770 1.00 65.06  ? 120 TYR A CD1 1 
ATOM   676   C CD2 . TYR A 1 120 ? 163.812 144.907 120.883 1.00 65.06  ? 120 TYR A CD2 1 
ATOM   677   C CE1 . TYR A 1 120 ? 163.298 143.298 123.027 1.00 65.06  ? 120 TYR A CE1 1 
ATOM   678   C CE2 . TYR A 1 120 ? 163.831 145.432 122.143 1.00 65.06  ? 120 TYR A CE2 1 
ATOM   679   C CZ  . TYR A 1 120 ? 163.579 144.623 123.207 1.00 65.06  ? 120 TYR A CZ  1 
ATOM   680   O OH  . TYR A 1 120 ? 163.597 145.153 124.467 1.00 65.06  ? 120 TYR A OH  1 
ATOM   681   N N   . THR A 1 121 ? 164.790 142.138 116.501 1.00 68.84  ? 121 THR A N   1 
ATOM   682   C CA  . THR A 1 121 ? 164.669 141.377 115.268 1.00 68.84  ? 121 THR A CA  1 
ATOM   683   C C   . THR A 1 121 ? 166.029 140.806 114.904 1.00 68.84  ? 121 THR A C   1 
ATOM   684   O O   . THR A 1 121 ? 167.003 140.923 115.648 1.00 68.84  ? 121 THR A O   1 
ATOM   685   C CB  . THR A 1 121 ? 164.160 142.237 114.125 1.00 68.84  ? 121 THR A CB  1 
ATOM   686   O OG1 . THR A 1 121 ? 165.179 143.169 113.761 1.00 68.84  ? 121 THR A OG1 1 
ATOM   687   C CG2 . THR A 1 121 ? 162.940 142.993 114.543 1.00 68.84  ? 121 THR A CG2 1 
ATOM   688   N N   . ARG A 1 122 ? 166.116 140.198 113.729 1.00 71.99  ? 122 ARG A N   1 
ATOM   689   C CA  . ARG A 1 122 ? 167.388 139.689 113.249 1.00 71.99  ? 122 ARG A CA  1 
ATOM   690   C C   . ARG A 1 122 ? 168.136 140.728 112.443 1.00 71.99  ? 122 ARG A C   1 
ATOM   691   O O   . ARG A 1 122 ? 169.367 140.710 112.410 1.00 71.99  ? 122 ARG A O   1 
ATOM   692   C CB  . ARG A 1 122 ? 167.158 138.423 112.425 1.00 71.99  ? 122 ARG A CB  1 
ATOM   693   C CG  . ARG A 1 122 ? 166.640 137.291 113.283 1.00 71.99  ? 122 ARG A CG  1 
ATOM   694   C CD  . ARG A 1 122 ? 166.307 136.057 112.503 1.00 71.99  ? 122 ARG A CD  1 
ATOM   695   N NE  . ARG A 1 122 ? 167.482 135.439 111.916 1.00 71.99  ? 122 ARG A NE  1 
ATOM   696   C CZ  . ARG A 1 122 ? 167.428 134.396 111.103 1.00 71.99  ? 122 ARG A CZ  1 
ATOM   697   N NH1 . ARG A 1 122 ? 166.258 133.861 110.801 1.00 71.99  ? 122 ARG A NH1 1 
ATOM   698   N NH2 . ARG A 1 122 ? 168.534 133.887 110.594 1.00 71.99  ? 122 ARG A NH2 1 
ATOM   699   N N   . GLU A 1 123 ? 167.420 141.653 111.826 1.00 73.82  ? 123 GLU A N   1 
ATOM   700   C CA  . GLU A 1 123 ? 168.039 142.725 111.072 1.00 73.82  ? 123 GLU A CA  1 
ATOM   701   C C   . GLU A 1 123 ? 168.323 143.954 111.917 1.00 73.82  ? 123 GLU A C   1 
ATOM   702   O O   . GLU A 1 123 ? 169.079 144.822 111.476 1.00 73.82  ? 123 GLU A O   1 
ATOM   703   C CB  . GLU A 1 123 ? 167.150 143.105 109.891 1.00 73.82  ? 123 GLU A CB  1 
ATOM   704   C CG  . GLU A 1 123 ? 165.879 143.814 110.287 1.00 73.82  ? 123 GLU A CG  1 
ATOM   705   C CD  . GLU A 1 123 ? 164.744 142.867 110.646 1.00 73.82  ? 123 GLU A CD  1 
ATOM   706   O OE1 . GLU A 1 123 ? 164.996 141.664 110.873 1.00 73.82  ? 123 GLU A OE1 1 
ATOM   707   O OE2 . GLU A 1 123 ? 163.588 143.332 110.718 1.00 73.82  ? 123 GLU A OE2 1 
ATOM   708   N N   . GLN A 1 124 ? 167.737 144.063 113.110 1.00 68.68  ? 124 GLN A N   1 
ATOM   709   C CA  . GLN A 1 124 ? 168.250 145.035 114.064 1.00 68.68  ? 124 GLN A CA  1 
ATOM   710   C C   . GLN A 1 124 ? 169.637 144.673 114.538 1.00 68.68  ? 124 GLN A C   1 
ATOM   711   O O   . GLN A 1 124 ? 170.412 145.564 114.887 1.00 68.68  ? 124 GLN A O   1 
ATOM   712   C CB  . GLN A 1 124 ? 167.353 145.157 115.286 1.00 68.68  ? 124 GLN A CB  1 
ATOM   713   C CG  . GLN A 1 124 ? 166.136 145.999 115.110 1.00 68.68  ? 124 GLN A CG  1 
ATOM   714   C CD  . GLN A 1 124 ? 165.314 146.047 116.372 1.00 68.68  ? 124 GLN A CD  1 
ATOM   715   O OE1 . GLN A 1 124 ? 165.586 145.326 117.328 1.00 68.68  ? 124 GLN A OE1 1 
ATOM   716   N NE2 . GLN A 1 124 ? 164.317 146.918 116.396 1.00 68.68  ? 124 GLN A NE2 1 
ATOM   717   N N   . LEU A 1 125 ? 169.960 143.390 114.571 1.00 69.70  ? 125 LEU A N   1 
ATOM   718   C CA  . LEU A 1 125 ? 171.281 142.984 114.999 1.00 69.70  ? 125 LEU A CA  1 
ATOM   719   C C   . LEU A 1 125 ? 172.315 143.180 113.908 1.00 69.70  ? 125 LEU A C   1 
ATOM   720   O O   . LEU A 1 125 ? 173.457 143.527 114.213 1.00 69.70  ? 125 LEU A O   1 
ATOM   721   C CB  . LEU A 1 125 ? 171.248 141.531 115.460 1.00 69.70  ? 125 LEU A CB  1 
ATOM   722   C CG  . LEU A 1 125 ? 172.525 141.016 116.104 1.00 69.70  ? 125 LEU A CG  1 
ATOM   723   C CD1 . LEU A 1 125 ? 172.852 141.873 117.275 1.00 69.70  ? 125 LEU A CD1 1 
ATOM   724   C CD2 . LEU A 1 125 ? 172.333 139.605 116.562 1.00 69.70  ? 125 LEU A CD2 1 
ATOM   725   N N   . TYR A 1 126 ? 171.940 143.007 112.641 1.00 72.37  ? 126 TYR A N   1 
ATOM   726   C CA  . TYR A 1 126 ? 172.884 143.304 111.572 1.00 72.37  ? 126 TYR A CA  1 
ATOM   727   C C   . TYR A 1 126 ? 173.165 144.789 111.445 1.00 72.37  ? 126 TYR A C   1 
ATOM   728   O O   . TYR A 1 126 ? 174.322 145.178 111.272 1.00 72.37  ? 126 TYR A O   1 
ATOM   729   C CB  . TYR A 1 126 ? 172.388 142.787 110.235 1.00 72.37  ? 126 TYR A CB  1 
ATOM   730   C CG  . TYR A 1 126 ? 172.558 141.319 110.039 1.00 72.37  ? 126 TYR A CG  1 
ATOM   731   C CD1 . TYR A 1 126 ? 173.805 140.785 109.776 1.00 72.37  ? 126 TYR A CD1 1 
ATOM   732   C CD2 . TYR A 1 126 ? 171.471 140.473 110.055 1.00 72.37  ? 126 TYR A CD2 1 
ATOM   733   C CE1 . TYR A 1 126 ? 173.966 139.445 109.576 1.00 72.37  ? 126 TYR A CE1 1 
ATOM   734   C CE2 . TYR A 1 126 ? 171.622 139.131 109.853 1.00 72.37  ? 126 TYR A CE2 1 
ATOM   735   C CZ  . TYR A 1 126 ? 172.867 138.623 109.615 1.00 72.37  ? 126 TYR A CZ  1 
ATOM   736   O OH  . TYR A 1 126 ? 173.015 137.281 109.412 1.00 72.37  ? 126 TYR A OH  1 
ATOM   737   N N   . GLN A 1 127 ? 172.137 145.631 111.515 1.00 69.78  ? 127 GLN A N   1 
ATOM   738   C CA  . GLN A 1 127 ? 172.379 147.059 111.377 1.00 69.78  ? 127 GLN A CA  1 
ATOM   739   C C   . GLN A 1 127 ? 173.107 147.625 112.581 1.00 69.78  ? 127 GLN A C   1 
ATOM   740   O O   . GLN A 1 127 ? 173.758 148.663 112.469 1.00 69.78  ? 127 GLN A O   1 
ATOM   741   C CB  . GLN A 1 127 ? 171.076 147.812 111.168 1.00 69.78  ? 127 GLN A CB  1 
ATOM   742   C CG  . GLN A 1 127 ? 170.431 147.571 109.838 1.00 69.78  ? 127 GLN A CG  1 
ATOM   743   C CD  . GLN A 1 127 ? 169.161 148.366 109.683 1.00 69.78  ? 127 GLN A CD  1 
ATOM   744   O OE1 . GLN A 1 127 ? 168.729 149.048 110.609 1.00 69.78  ? 127 GLN A OE1 1 
ATOM   745   N NE2 . GLN A 1 127 ? 168.554 148.290 108.508 1.00 69.78  ? 127 GLN A NE2 1 
ATOM   746   N N   . ALA A 1 128 ? 173.020 146.969 113.731 1.00 68.52  ? 128 ALA A N   1 
ATOM   747   C CA  . ALA A 1 128 ? 173.767 147.452 114.878 1.00 68.52  ? 128 ALA A CA  1 
ATOM   748   C C   . ALA A 1 128 ? 175.244 147.144 114.754 1.00 68.52  ? 128 ALA A C   1 
ATOM   749   O O   . ALA A 1 128 ? 176.075 147.945 115.188 1.00 68.52  ? 128 ALA A O   1 
ATOM   750   C CB  . ALA A 1 128 ? 173.220 146.848 116.164 1.00 68.52  ? 128 ALA A CB  1 
ATOM   751   N N   . ILE A 1 129 ? 175.588 146.003 114.162 1.00 67.47  ? 129 ILE A N   1 
ATOM   752   C CA  . ILE A 1 129 ? 176.989 145.617 114.048 1.00 67.47  ? 129 ILE A CA  1 
ATOM   753   C C   . ILE A 1 129 ? 177.682 146.452 112.985 1.00 67.47  ? 129 ILE A C   1 
ATOM   754   O O   . ILE A 1 129 ? 178.799 146.941 113.185 1.00 67.47  ? 129 ILE A O   1 
ATOM   755   C CB  . ILE A 1 129 ? 177.099 144.117 113.743 1.00 67.47  ? 129 ILE A CB  1 
ATOM   756   C CG1 . ILE A 1 129 ? 176.596 143.302 114.917 1.00 67.47  ? 129 ILE A CG1 1 
ATOM   757   C CG2 . ILE A 1 129 ? 178.512 143.730 113.475 1.00 67.47  ? 129 ILE A CG2 1 
ATOM   758   C CD1 . ILE A 1 129 ? 176.415 141.868 114.584 1.00 67.47  ? 129 ILE A CD1 1 
ATOM   759   N N   . PHE A 1 130 ? 177.011 146.652 111.855 1.00 71.72  ? 130 PHE A N   1 
ATOM   760   C CA  . PHE A 1 130 ? 177.654 147.289 110.716 1.00 71.72  ? 130 PHE A CA  1 
ATOM   761   C C   . PHE A 1 130 ? 177.868 148.766 110.975 1.00 71.72  ? 130 PHE A C   1 
ATOM   762   O O   . PHE A 1 130 ? 178.913 149.312 110.619 1.00 71.72  ? 130 PHE A O   1 
ATOM   763   C CB  . PHE A 1 130 ? 176.810 147.099 109.460 1.00 71.72  ? 130 PHE A CB  1 
ATOM   764   C CG  . PHE A 1 130 ? 176.624 145.665 109.047 1.00 71.72  ? 130 PHE A CG  1 
ATOM   765   C CD1 . PHE A 1 130 ? 177.490 144.669 109.464 1.00 71.72  ? 130 PHE A CD1 1 
ATOM   766   C CD2 . PHE A 1 130 ? 175.549 145.313 108.257 1.00 71.72  ? 130 PHE A CD2 1 
ATOM   767   C CE1 . PHE A 1 130 ? 177.287 143.362 109.093 1.00 71.72  ? 130 PHE A CE1 1 
ATOM   768   C CE2 . PHE A 1 130 ? 175.344 144.008 107.880 1.00 71.72  ? 130 PHE A CE2 1 
ATOM   769   C CZ  . PHE A 1 130 ? 176.212 143.031 108.300 1.00 71.72  ? 130 PHE A CZ  1 
ATOM   770   N N   . HIS A 1 131 ? 176.909 149.408 111.636 1.00 66.96  ? 131 HIS A N   1 
ATOM   771   C CA  . HIS A 1 131 ? 177.037 150.805 112.019 1.00 66.96  ? 131 HIS A CA  1 
ATOM   772   C C   . HIS A 1 131 ? 178.140 151.019 113.035 1.00 66.96  ? 131 HIS A C   1 
ATOM   773   O O   . HIS A 1 131 ? 178.722 152.104 113.080 1.00 66.96  ? 131 HIS A O   1 
ATOM   774   C CB  . HIS A 1 131 ? 175.712 151.295 112.584 1.00 66.96  ? 131 HIS A CB  1 
ATOM   775   C CG  . HIS A 1 131 ? 175.699 152.743 112.929 1.00 66.96  ? 131 HIS A CG  1 
ATOM   776   N ND1 . HIS A 1 131 ? 175.603 153.730 111.977 1.00 66.96  ? 131 HIS A ND1 1 
ATOM   777   C CD2 . HIS A 1 131 ? 175.765 153.374 114.122 1.00 66.96  ? 131 HIS A CD2 1 
ATOM   778   C CE1 . HIS A 1 131 ? 175.609 154.909 112.568 1.00 66.96  ? 131 HIS A CE1 1 
ATOM   779   N NE2 . HIS A 1 131 ? 175.709 154.721 113.870 1.00 66.96  ? 131 HIS A NE2 1 
ATOM   780   N N   . ALA A 1 132 ? 178.453 150.013 113.837 1.00 65.35  ? 132 ALA A N   1 
ATOM   781   C CA  . ALA A 1 132 ? 179.550 150.134 114.776 1.00 65.35  ? 132 ALA A CA  1 
ATOM   782   C C   . ALA A 1 132 ? 180.908 150.033 114.108 1.00 65.35  ? 132 ALA A C   1 
ATOM   783   O O   . ALA A 1 132 ? 181.861 150.648 114.590 1.00 65.35  ? 132 ALA A O   1 
ATOM   784   C CB  . ALA A 1 132 ? 179.438 149.067 115.861 1.00 65.35  ? 132 ALA A CB  1 
ATOM   785   N N   . VAL A 1 133 ? 181.020 149.296 113.009 1.00 68.43  ? 133 VAL A N   1 
ATOM   786   C CA  . VAL A 1 133 ? 182.275 149.178 112.283 1.00 68.43  ? 133 VAL A CA  1 
ATOM   787   C C   . VAL A 1 133 ? 182.505 150.376 111.376 1.00 68.43  ? 133 VAL A C   1 
ATOM   788   O O   . VAL A 1 133 ? 183.621 150.888 111.297 1.00 68.43  ? 133 VAL A O   1 
ATOM   789   C CB  . VAL A 1 133 ? 182.289 147.865 111.478 1.00 68.43  ? 133 VAL A CB  1 
ATOM   790   C CG1 . VAL A 1 133 ? 183.575 147.717 110.712 1.00 68.43  ? 133 VAL A CG1 1 
ATOM   791   C CG2 . VAL A 1 133 ? 182.090 146.706 112.400 1.00 68.43  ? 133 VAL A CG2 1 
ATOM   792   N N   . ASP A 1 134 ? 181.439 150.843 110.723 1.00 75.13  ? 134 ASP A N   1 
ATOM   793   C CA  . ASP A 1 134 ? 181.552 151.903 109.729 1.00 75.13  ? 134 ASP A CA  1 
ATOM   794   C C   . ASP A 1 134 ? 182.000 153.214 110.347 1.00 75.13  ? 134 ASP A C   1 
ATOM   795   O O   . ASP A 1 134 ? 182.812 153.934 109.757 1.00 75.13  ? 134 ASP A O   1 
ATOM   796   C CB  . ASP A 1 134 ? 180.217 152.096 109.025 1.00 75.13  ? 134 ASP A CB  1 
ATOM   797   C CG  . ASP A 1 134 ? 179.832 150.910 108.183 1.00 75.13  ? 134 ASP A CG  1 
ATOM   798   O OD1 . ASP A 1 134 ? 180.744 150.206 107.709 1.00 75.13  ? 134 ASP A OD1 1 
ATOM   799   O OD2 . ASP A 1 134 ? 178.620 150.671 108.006 1.00 75.13  ? 134 ASP A OD2 1 
ATOM   800   N N   . GLN A 1 135 ? 181.492 153.532 111.535 1.00 70.52  ? 135 GLN A N   1 
ATOM   801   C CA  . GLN A 1 135 ? 181.930 154.737 112.222 1.00 70.52  ? 135 GLN A CA  1 
ATOM   802   C C   . GLN A 1 135 ? 183.375 154.623 112.674 1.00 70.52  ? 135 GLN A C   1 
ATOM   803   O O   . GLN A 1 135 ? 184.080 155.632 112.755 1.00 70.52  ? 135 GLN A O   1 
ATOM   804   C CB  . GLN A 1 135 ? 181.024 155.009 113.412 1.00 70.52  ? 135 GLN A CB  1 
ATOM   805   C CG  . GLN A 1 135 ? 179.617 155.383 113.037 1.00 70.52  ? 135 GLN A CG  1 
ATOM   806   C CD  . GLN A 1 135 ? 179.522 156.739 112.392 1.00 70.52  ? 135 GLN A CD  1 
ATOM   807   O OE1 . GLN A 1 135 ? 179.272 156.852 111.199 1.00 70.52  ? 135 GLN A OE1 1 
ATOM   808   N NE2 . GLN A 1 135 ? 179.706 157.781 113.183 1.00 70.52  ? 135 GLN A NE2 1 
ATOM   809   N N   . TYR A 1 136 ? 183.834 153.408 112.961 1.00 76.06  ? 136 TYR A N   1 
ATOM   810   C CA  . TYR A 1 136 ? 185.238 153.219 113.289 1.00 76.06  ? 136 TYR A CA  1 
ATOM   811   C C   . TYR A 1 136 ? 186.120 153.441 112.073 1.00 76.06  ? 136 TYR A C   1 
ATOM   812   O O   . TYR A 1 136 ? 187.225 153.978 112.189 1.00 76.06  ? 136 TYR A O   1 
ATOM   813   C CB  . TYR A 1 136 ? 185.455 151.825 113.854 1.00 76.06  ? 136 TYR A CB  1 
ATOM   814   C CG  . TYR A 1 136 ? 186.893 151.504 114.154 1.00 76.06  ? 136 TYR A CG  1 
ATOM   815   C CD1 . TYR A 1 136 ? 187.525 152.035 115.260 1.00 76.06  ? 136 TYR A CD1 1 
ATOM   816   C CD2 . TYR A 1 136 ? 187.614 150.660 113.330 1.00 76.06  ? 136 TYR A CD2 1 
ATOM   817   C CE1 . TYR A 1 136 ? 188.826 151.735 115.531 1.00 76.06  ? 136 TYR A CE1 1 
ATOM   818   C CE2 . TYR A 1 136 ? 188.909 150.358 113.593 1.00 76.06  ? 136 TYR A CE2 1 
ATOM   819   C CZ  . TYR A 1 136 ? 189.508 150.894 114.693 1.00 76.06  ? 136 TYR A CZ  1 
ATOM   820   O OH  . TYR A 1 136 ? 190.814 150.580 114.950 1.00 76.06  ? 136 TYR A OH  1 
ATOM   821   N N   . LEU A 1 137 ? 185.651 153.040 110.897 1.00 77.79  ? 137 LEU A N   1 
ATOM   822   C CA  . LEU A 1 137 ? 186.450 153.245 109.702 1.00 77.79  ? 137 LEU A CA  1 
ATOM   823   C C   . LEU A 1 137 ? 186.435 154.684 109.241 1.00 77.79  ? 137 LEU A C   1 
ATOM   824   O O   . LEU A 1 137 ? 187.258 155.059 108.404 1.00 77.79  ? 137 LEU A O   1 
ATOM   825   C CB  . LEU A 1 137 ? 185.958 152.356 108.574 1.00 77.79  ? 137 LEU A CB  1 
ATOM   826   C CG  . LEU A 1 137 ? 186.269 150.884 108.797 1.00 77.79  ? 137 LEU A CG  1 
ATOM   827   C CD1 . LEU A 1 137 ? 185.631 150.034 107.717 1.00 77.79  ? 137 LEU A CD1 1 
ATOM   828   C CD2 . LEU A 1 137 ? 187.764 150.710 108.803 1.00 77.79  ? 137 LEU A CD2 1 
ATOM   829   N N   . ALA A 1 138 ? 185.528 155.495 109.760 1.00 77.59  ? 138 ALA A N   1 
ATOM   830   C CA  . ALA A 1 138 ? 185.375 156.868 109.311 1.00 77.59  ? 138 ALA A CA  1 
ATOM   831   C C   . ALA A 1 138 ? 185.517 157.855 110.460 1.00 77.59  ? 138 ALA A C   1 
ATOM   832   O O   . ALA A 1 138 ? 184.908 158.921 110.444 1.00 77.59  ? 138 ALA A O   1 
ATOM   833   C CB  . ALA A 1 138 ? 184.029 157.045 108.612 1.00 77.59  ? 138 ALA A CB  1 
ATOM   834   N N   . LEU A 1 139 ? 186.339 157.517 111.454 1.00 69.03  ? 139 LEU A N   1 
ATOM   835   C CA  . LEU A 1 139 ? 186.382 158.321 112.679 1.00 69.03  ? 139 LEU A CA  1 
ATOM   836   C C   . LEU A 1 139 ? 186.947 159.724 112.503 1.00 69.03  ? 139 LEU A C   1 
ATOM   837   O O   . LEU A 1 139 ? 186.309 160.668 113.005 1.00 69.03  ? 139 LEU A O   1 
ATOM   838   C CB  . LEU A 1 139 ? 187.120 157.556 113.778 1.00 69.03  ? 139 LEU A CB  1 
ATOM   839   C CG  . LEU A 1 139 ? 186.949 158.246 115.125 1.00 69.03  ? 139 LEU A CG  1 
ATOM   840   C CD1 . LEU A 1 139 ? 185.503 158.178 115.507 1.00 69.03  ? 139 LEU A CD1 1 
ATOM   841   C CD2 . LEU A 1 139 ? 187.793 157.611 116.191 1.00 69.03  ? 139 LEU A CD2 1 
ATOM   842   N N   . PRO A 1 140 ? 188.090 159.971 111.840 1.00 68.37  ? 140 PRO A N   1 
ATOM   843   C CA  . PRO A 1 140 ? 188.574 161.352 111.776 1.00 68.37  ? 140 PRO A CA  1 
ATOM   844   C C   . PRO A 1 140 ? 187.769 162.247 110.866 1.00 68.37  ? 140 PRO A C   1 
ATOM   845   O O   . PRO A 1 140 ? 187.988 163.460 110.882 1.00 68.37  ? 140 PRO A O   1 
ATOM   846   C CB  . PRO A 1 140 ? 189.997 161.203 111.254 1.00 68.37  ? 140 PRO A CB  1 
ATOM   847   C CG  . PRO A 1 140 ? 189.963 160.034 110.467 1.00 68.37  ? 140 PRO A CG  1 
ATOM   848   C CD  . PRO A 1 140 ? 189.073 159.089 111.177 1.00 68.37  ? 140 PRO A CD  1 
ATOM   849   N N   . ASP A 1 141 ? 186.847 161.713 110.082 1.00 78.32  ? 141 ASP A N   1 
ATOM   850   C CA  . ASP A 1 141 ? 186.064 162.585 109.225 1.00 78.32  ? 141 ASP A CA  1 
ATOM   851   C C   . ASP A 1 141 ? 184.788 163.070 109.884 1.00 78.32  ? 141 ASP A C   1 
ATOM   852   O O   . ASP A 1 141 ? 184.348 164.188 109.604 1.00 78.32  ? 141 ASP A O   1 
ATOM   853   C CB  . ASP A 1 141 ? 185.723 161.874 107.918 1.00 78.32  ? 141 ASP A CB  1 
ATOM   854   C CG  . ASP A 1 141 ? 186.943 161.602 107.079 1.00 78.32  ? 141 ASP A CG  1 
ATOM   855   O OD1 . ASP A 1 141 ? 187.940 162.331 107.239 1.00 78.32  ? 141 ASP A OD1 1 
ATOM   856   O OD2 . ASP A 1 141 ? 186.904 160.670 106.251 1.00 78.32  ? 141 ASP A OD2 1 
ATOM   857   N N   . VAL A 1 142 ? 184.180 162.271 110.755 1.00 75.54  ? 142 VAL A N   1 
ATOM   858   C CA  . VAL A 1 142 ? 182.873 162.611 111.294 1.00 75.54  ? 142 VAL A CA  1 
ATOM   859   C C   . VAL A 1 142 ? 182.910 163.020 112.757 1.00 75.54  ? 142 VAL A C   1 
ATOM   860   O O   . VAL A 1 142 ? 182.005 163.743 113.197 1.00 75.54  ? 142 VAL A O   1 
ATOM   861   C CB  . VAL A 1 142 ? 181.862 161.464 111.091 1.00 75.54  ? 142 VAL A CB  1 
ATOM   862   C CG1 . VAL A 1 142 ? 181.723 161.137 109.620 1.00 75.54  ? 142 VAL A CG1 1 
ATOM   863   C CG2 . VAL A 1 142 ? 182.253 160.240 111.885 1.00 75.54  ? 142 VAL A CG2 1 
ATOM   864   N N   . SER A 1 143 ? 183.911 162.609 113.521 1.00 73.66  ? 143 SER A N   1 
ATOM   865   C CA  . SER A 1 143 ? 183.934 162.880 114.947 1.00 73.66  ? 143 SER A CA  1 
ATOM   866   C C   . SER A 1 143 ? 184.898 163.999 115.269 1.00 73.66  ? 143 SER A C   1 
ATOM   867   O O   . SER A 1 143 ? 185.987 164.071 114.702 1.00 73.66  ? 143 SER A O   1 
ATOM   868   C CB  . SER A 1 143 ? 184.350 161.651 115.739 1.00 73.66  ? 143 SER A CB  1 
ATOM   869   O OG  . SER A 1 143 ? 184.517 161.993 117.102 1.00 73.66  ? 143 SER A OG  1 
ATOM   870   N N   . LEU A 1 144 ? 184.506 164.857 116.190 1.00 72.82  ? 144 LEU A N   1 
ATOM   871   C CA  . LEU A 1 144 ? 185.472 165.775 116.748 1.00 72.82  ? 144 LEU A CA  1 
ATOM   872   C C   . LEU A 1 144 ? 186.104 165.133 117.970 1.00 72.82  ? 144 LEU A C   1 
ATOM   873   O O   . LEU A 1 144 ? 185.624 164.125 118.482 1.00 72.82  ? 144 LEU A O   1 
ATOM   874   C CB  . LEU A 1 144 ? 184.806 167.104 117.066 1.00 72.82  ? 144 LEU A CB  1 
ATOM   875   C CG  . LEU A 1 144 ? 183.658 167.140 118.057 1.00 72.82  ? 144 LEU A CG  1 
ATOM   876   C CD1 . LEU A 1 144 ? 184.122 167.539 119.442 1.00 72.82  ? 144 LEU A CD1 1 
ATOM   877   C CD2 . LEU A 1 144 ? 182.608 168.082 117.543 1.00 72.82  ? 144 LEU A CD2 1 
ATOM   878   N N   . GLY A 1 145 ? 187.202 165.716 118.431 1.00 76.92  ? 145 GLY A N   1 
ATOM   879   C CA  . GLY A 1 145 ? 187.925 165.212 119.576 1.00 76.92  ? 145 GLY A CA  1 
ATOM   880   C C   . GLY A 1 145 ? 189.291 164.655 119.258 1.00 76.92  ? 145 GLY A C   1 
ATOM   881   O O   . GLY A 1 145 ? 190.145 164.615 120.152 1.00 76.92  ? 145 GLY A O   1 
ATOM   882   N N   . ARG A 1 146 ? 189.514 164.225 118.014 1.00 85.38  ? 146 ARG A N   1 
ATOM   883   C CA  . ARG A 1 146 ? 190.818 163.823 117.476 1.00 85.38  ? 146 ARG A CA  1 
ATOM   884   C C   . ARG A 1 146 ? 191.411 162.641 118.254 1.00 85.38  ? 146 ARG A C   1 
ATOM   885   O O   . ARG A 1 146 ? 192.358 162.756 119.030 1.00 85.38  ? 146 ARG A O   1 
ATOM   886   C CB  . ARG A 1 146 ? 191.766 165.026 117.410 1.00 85.38  ? 146 ARG A CB  1 
ATOM   887   C CG  . ARG A 1 146 ? 193.039 164.765 116.658 1.00 85.38  ? 146 ARG A CG  1 
ATOM   888   C CD  . ARG A 1 146 ? 193.795 166.034 116.381 1.00 85.38  ? 146 ARG A CD  1 
ATOM   889   N NE  . ARG A 1 146 ? 195.110 165.723 115.839 1.00 85.38  ? 146 ARG A NE  1 
ATOM   890   C CZ  . ARG A 1 146 ? 195.350 165.443 114.564 1.00 85.38  ? 146 ARG A CZ  1 
ATOM   891   N NH1 . ARG A 1 146 ? 194.362 165.433 113.678 1.00 85.38  ? 146 ARG A NH1 1 
ATOM   892   N NH2 . ARG A 1 146 ? 196.586 165.168 114.175 1.00 85.38  ? 146 ARG A NH2 1 
ATOM   893   N N   . TYR A 1 147 ? 190.758 161.506 118.080 1.00 81.46  ? 147 TYR A N   1 
ATOM   894   C CA  . TYR A 1 147 ? 191.319 160.247 118.521 1.00 81.46  ? 147 TYR A CA  1 
ATOM   895   C C   . TYR A 1 147 ? 192.269 159.714 117.459 1.00 81.46  ? 147 TYR A C   1 
ATOM   896   O O   . TYR A 1 147 ? 192.365 160.257 116.359 1.00 81.46  ? 147 TYR A O   1 
ATOM   897   C CB  . TYR A 1 147 ? 190.209 159.241 118.778 1.00 81.46  ? 147 TYR A CB  1 
ATOM   898   C CG  . TYR A 1 147 ? 189.239 159.741 119.799 1.00 81.46  ? 147 TYR A CG  1 
ATOM   899   C CD1 . TYR A 1 147 ? 189.532 159.668 121.144 1.00 81.46  ? 147 TYR A CD1 1 
ATOM   900   C CD2 . TYR A 1 147 ? 188.042 160.320 119.415 1.00 81.46  ? 147 TYR A CD2 1 
ATOM   901   C CE1 . TYR A 1 147 ? 188.659 160.140 122.077 1.00 81.46  ? 147 TYR A CE1 1 
ATOM   902   C CE2 . TYR A 1 147 ? 187.165 160.797 120.340 1.00 81.46  ? 147 TYR A CE2 1 
ATOM   903   C CZ  . TYR A 1 147 ? 187.478 160.702 121.668 1.00 81.46  ? 147 TYR A CZ  1 
ATOM   904   O OH  . TYR A 1 147 ? 186.601 161.175 122.605 1.00 81.46  ? 147 TYR A OH  1 
ATOM   905   N N   . ALA A 1 148 ? 192.974 158.636 117.793 1.00 79.61  ? 148 ALA A N   1 
ATOM   906   C CA  . ALA A 1 148 ? 193.824 157.961 116.821 1.00 79.61  ? 148 ALA A CA  1 
ATOM   907   C C   . ALA A 1 148 ? 193.912 156.488 117.162 1.00 79.61  ? 148 ALA A C   1 
ATOM   908   O O   . ALA A 1 148 ? 193.779 156.096 118.321 1.00 79.61  ? 148 ALA A O   1 
ATOM   909   C CB  . ALA A 1 148 ? 195.231 158.543 116.764 1.00 79.61  ? 148 ALA A CB  1 
ATOM   910   N N   . TYR A 1 149 ? 194.181 155.685 116.142 1.00 78.58  ? 149 TYR A N   1 
ATOM   911   C CA  . TYR A 1 149 ? 194.066 154.245 116.254 1.00 78.58  ? 149 TYR A CA  1 
ATOM   912   C C   . TYR A 1 149 ? 195.233 153.675 117.051 1.00 78.58  ? 149 TYR A C   1 
ATOM   913   O O   . TYR A 1 149 ? 196.203 154.364 117.365 1.00 78.58  ? 149 TYR A O   1 
ATOM   914   C CB  . TYR A 1 149 ? 194.010 153.631 114.871 1.00 78.58  ? 149 TYR A CB  1 
ATOM   915   C CG  . TYR A 1 149 ? 192.845 154.113 114.070 1.00 78.58  ? 149 TYR A CG  1 
ATOM   916   C CD1 . TYR A 1 149 ? 191.589 153.581 114.259 1.00 78.58  ? 149 TYR A CD1 1 
ATOM   917   C CD2 . TYR A 1 149 ? 193.002 155.095 113.113 1.00 78.58  ? 149 TYR A CD2 1 
ATOM   918   C CE1 . TYR A 1 149 ? 190.522 154.009 113.521 1.00 78.58  ? 149 TYR A CE1 1 
ATOM   919   C CE2 . TYR A 1 149 ? 191.942 155.530 112.367 1.00 78.58  ? 149 TYR A CE2 1 
ATOM   920   C CZ  . TYR A 1 149 ? 190.706 154.983 112.575 1.00 78.58  ? 149 TYR A CZ  1 
ATOM   921   O OH  . TYR A 1 149 ? 189.639 155.415 111.835 1.00 78.58  ? 149 TYR A OH  1 
ATOM   922   N N   . VAL A 1 150 ? 195.140 152.388 117.379 1.00 88.22  ? 150 VAL A N   1 
ATOM   923   C CA  . VAL A 1 150 ? 196.150 151.770 118.232 1.00 88.22  ? 150 VAL A CA  1 
ATOM   924   C C   . VAL A 1 150 ? 197.288 151.165 117.420 1.00 88.22  ? 150 VAL A C   1 
ATOM   925   O O   . VAL A 1 150 ? 198.453 151.373 117.767 1.00 88.22  ? 150 VAL A O   1 
ATOM   926   C CB  . VAL A 1 150 ? 195.504 150.742 119.195 1.00 88.22  ? 150 VAL A CB  1 
ATOM   927   C CG1 . VAL A 1 150 ? 194.745 149.646 118.477 1.00 88.22  ? 150 VAL A CG1 1 
ATOM   928   C CG2 . VAL A 1 150 ? 196.544 150.124 120.092 1.00 88.22  ? 150 VAL A CG2 1 
ATOM   929   N N   . ARG A 1 151 ? 196.978 150.505 116.298 1.00 99.03  ? 151 ARG A N   1 
ATOM   930   C CA  . ARG A 1 151 ? 197.886 149.607 115.581 1.00 99.03  ? 151 ARG A CA  1 
ATOM   931   C C   . ARG A 1 151 ? 198.522 148.623 116.567 1.00 99.03  ? 151 ARG A C   1 
ATOM   932   O O   . ARG A 1 151 ? 199.722 148.630 116.838 1.00 99.03  ? 151 ARG A O   1 
ATOM   933   C CB  . ARG A 1 151 ? 198.932 150.400 114.788 1.00 99.03  ? 151 ARG A CB  1 
ATOM   934   C CG  . ARG A 1 151 ? 199.739 149.585 113.811 1.00 99.03  ? 151 ARG A CG  1 
ATOM   935   C CD  . ARG A 1 151 ? 198.829 149.073 112.742 1.00 99.03  ? 151 ARG A CD  1 
ATOM   936   N NE  . ARG A 1 151 ? 198.284 150.175 111.974 1.00 99.03  ? 151 ARG A NE  1 
ATOM   937   C CZ  . ARG A 1 151 ? 197.261 150.043 111.146 1.00 99.03  ? 151 ARG A CZ  1 
ATOM   938   N NH1 . ARG A 1 151 ? 196.695 148.857 111.008 1.00 99.03  ? 151 ARG A NH1 1 
ATOM   939   N NH2 . ARG A 1 151 ? 196.804 151.083 110.463 1.00 99.03  ? 151 ARG A NH2 1 
ATOM   940   N N   . GLY A 1 152 ? 197.663 147.797 117.157 1.00 105.95 ? 152 GLY A N   1 
ATOM   941   C CA  . GLY A 1 152 ? 197.991 147.081 118.367 1.00 105.95 ? 152 GLY A CA  1 
ATOM   942   C C   . GLY A 1 152 ? 198.810 145.824 118.138 1.00 105.95 ? 152 GLY A C   1 
ATOM   943   O O   . GLY A 1 152 ? 199.174 145.468 117.017 1.00 105.95 ? 152 GLY A O   1 
ATOM   944   N N   . GLY A 1 153 ? 199.113 145.152 119.250 1.00 112.13 ? 153 GLY A N   1 
ATOM   945   C CA  . GLY A 1 153 ? 199.866 143.913 119.229 1.00 112.13 ? 153 GLY A CA  1 
ATOM   946   C C   . GLY A 1 153 ? 199.447 142.933 120.307 1.00 112.13 ? 153 GLY A C   1 
ATOM   947   O O   . GLY A 1 153 ? 200.205 142.020 120.650 1.00 112.13 ? 153 GLY A O   1 
ATOM   948   N N   . GLY A 1 154 ? 198.245 143.108 120.847 1.00 107.40 ? 154 GLY A N   1 
ATOM   949   C CA  . GLY A 1 154 ? 197.766 142.300 121.948 1.00 107.40 ? 154 GLY A CA  1 
ATOM   950   C C   . GLY A 1 154 ? 197.216 140.954 121.503 1.00 107.40 ? 154 GLY A C   1 
ATOM   951   O O   . GLY A 1 154 ? 197.417 140.490 120.380 1.00 107.40 ? 154 GLY A O   1 
ATOM   952   N N   . ASP A 1 155 ? 196.495 140.315 122.427 1.00 109.81 ? 155 ASP A N   1 
ATOM   953   C CA  . ASP A 1 155 ? 196.048 138.940 122.214 1.00 109.81 ? 155 ASP A CA  1 
ATOM   954   C C   . ASP A 1 155 ? 194.802 138.814 121.334 1.00 109.81 ? 155 ASP A C   1 
ATOM   955   O O   . ASP A 1 155 ? 194.824 137.985 120.418 1.00 109.81 ? 155 ASP A O   1 
ATOM   956   C CB  . ASP A 1 155 ? 195.829 138.224 123.552 1.00 109.81 ? 155 ASP A CB  1 
ATOM   957   C CG  . ASP A 1 155 ? 197.114 137.978 124.293 1.00 109.81 ? 155 ASP A CG  1 
ATOM   958   O OD1 . ASP A 1 155 ? 198.162 137.803 123.631 1.00 109.81 ? 155 ASP A OD1 1 
ATOM   959   O OD2 . ASP A 1 155 ? 197.082 137.968 125.544 1.00 109.81 ? 155 ASP A OD2 1 
ATOM   960   N N   . PRO A 1 156 ? 193.678 139.581 121.532 1.00 98.89  ? 156 PRO A N   1 
ATOM   961   C CA  . PRO A 1 156 ? 192.588 139.435 120.563 1.00 98.89  ? 156 PRO A CA  1 
ATOM   962   C C   . PRO A 1 156 ? 192.761 140.341 119.361 1.00 98.89  ? 156 PRO A C   1 
ATOM   963   O O   . PRO A 1 156 ? 191.788 140.938 118.901 1.00 98.89  ? 156 PRO A O   1 
ATOM   964   C CB  . PRO A 1 156 ? 191.352 139.830 121.368 1.00 98.89  ? 156 PRO A CB  1 
ATOM   965   C CG  . PRO A 1 156 ? 191.848 140.851 122.260 1.00 98.89  ? 156 PRO A CG  1 
ATOM   966   C CD  . PRO A 1 156 ? 193.241 140.455 122.642 1.00 98.89  ? 156 PRO A CD  1 
ATOM   967   N N   . TRP A 1 157 ? 193.980 140.436 118.837 1.00 101.68 ? 157 TRP A N   1 
ATOM   968   C CA  . TRP A 1 157 ? 194.262 141.184 117.620 1.00 101.68 ? 157 TRP A CA  1 
ATOM   969   C C   . TRP A 1 157 ? 195.481 140.563 116.968 1.00 101.68 ? 157 TRP A C   1 
ATOM   970   O O   . TRP A 1 157 ? 196.511 140.411 117.627 1.00 101.68 ? 157 TRP A O   1 
ATOM   971   C CB  . TRP A 1 157 ? 194.552 142.653 117.896 1.00 101.68 ? 157 TRP A CB  1 
ATOM   972   C CG  . TRP A 1 157 ? 193.441 143.455 118.429 1.00 101.68 ? 157 TRP A CG  1 
ATOM   973   C CD1 . TRP A 1 157 ? 192.442 144.040 117.723 1.00 101.68 ? 157 TRP A CD1 1 
ATOM   974   C CD2 . TRP A 1 157 ? 193.245 143.827 119.788 1.00 101.68 ? 157 TRP A CD2 1 
ATOM   975   N NE1 . TRP A 1 157 ? 191.615 144.735 118.563 1.00 101.68 ? 157 TRP A NE1 1 
ATOM   976   C CE2 . TRP A 1 157 ? 192.094 144.621 119.840 1.00 101.68 ? 157 TRP A CE2 1 
ATOM   977   C CE3 . TRP A 1 157 ? 193.929 143.557 120.969 1.00 101.68 ? 157 TRP A CE3 1 
ATOM   978   C CZ2 . TRP A 1 157 ? 191.611 145.146 121.024 1.00 101.68 ? 157 TRP A CZ2 1 
ATOM   979   C CZ3 . TRP A 1 157 ? 193.448 144.078 122.142 1.00 101.68 ? 157 TRP A CZ3 1 
ATOM   980   C CH2 . TRP A 1 157 ? 192.299 144.860 122.164 1.00 101.68 ? 157 TRP A CH2 1 
ATOM   981   N N   . THR A 1 158 ? 195.387 140.241 115.682 1.00 104.24 ? 158 THR A N   1 
ATOM   982   C CA  . THR A 1 158 ? 196.592 139.918 114.939 1.00 104.24 ? 158 THR A CA  1 
ATOM   983   C C   . THR A 1 158 ? 197.337 141.201 114.587 1.00 104.24 ? 158 THR A C   1 
ATOM   984   O O   . THR A 1 158 ? 196.861 142.313 114.825 1.00 104.24 ? 158 THR A O   1 
ATOM   985   C CB  . THR A 1 158 ? 196.269 139.129 113.675 1.00 104.24 ? 158 THR A CB  1 
ATOM   986   O OG1 . THR A 1 158 ? 195.451 139.920 112.807 1.00 104.24 ? 158 THR A OG1 1 
ATOM   987   C CG2 . THR A 1 158 ? 195.542 137.849 114.031 1.00 104.24 ? 158 THR A CG2 1 
ATOM   988   N N   . ASN A 1 159 ? 198.522 141.035 114.017 1.00 108.67 ? 159 ASN A N   1 
ATOM   989   C CA  . ASN A 1 159 ? 199.432 142.159 113.871 1.00 108.67 ? 159 ASN A CA  1 
ATOM   990   C C   . ASN A 1 159 ? 198.957 143.076 112.754 1.00 108.67 ? 159 ASN A C   1 
ATOM   991   O O   . ASN A 1 159 ? 198.650 142.626 111.649 1.00 108.67 ? 159 ASN A O   1 
ATOM   992   C CB  . ASN A 1 159 ? 200.846 141.654 113.600 1.00 108.67 ? 159 ASN A CB  1 
ATOM   993   C CG  . ASN A 1 159 ? 201.902 142.705 113.857 1.00 108.67 ? 159 ASN A CG  1 
ATOM   994   O OD1 . ASN A 1 159 ? 201.593 143.837 114.225 1.00 108.67 ? 159 ASN A OD1 1 
ATOM   995   N ND2 . ASN A 1 159 ? 203.163 142.328 113.678 1.00 108.67 ? 159 ASN A ND2 1 
ATOM   996   N N   . GLY A 1 160 ? 198.869 144.363 113.061 1.00 105.33 ? 160 GLY A N   1 
ATOM   997   C CA  . GLY A 1 160 ? 198.304 145.332 112.145 1.00 105.33 ? 160 GLY A CA  1 
ATOM   998   C C   . GLY A 1 160 ? 196.858 145.638 112.469 1.00 105.33 ? 160 GLY A C   1 
ATOM   999   O O   . GLY A 1 160 ? 196.400 146.773 112.306 1.00 105.33 ? 160 GLY A O   1 
ATOM   1000  N N   . SER A 1 161 ? 196.139 144.625 112.947 1.00 101.73 ? 161 SER A N   1 
ATOM   1001  C CA  . SER A 1 161 ? 194.711 144.728 113.197 1.00 101.73 ? 161 SER A CA  1 
ATOM   1002  C C   . SER A 1 161 ? 194.427 145.554 114.440 1.00 101.73 ? 161 SER A C   1 
ATOM   1003  O O   . SER A 1 161 ? 195.136 145.464 115.445 1.00 101.73 ? 161 SER A O   1 
ATOM   1004  C CB  . SER A 1 161 ? 194.103 143.345 113.383 1.00 101.73 ? 161 SER A CB  1 
ATOM   1005  O OG  . SER A 1 161 ? 194.595 142.763 114.577 1.00 101.73 ? 161 SER A OG  1 
ATOM   1006  N N   . GLY A 1 162 ? 193.369 146.361 114.363 1.00 96.21  ? 162 GLY A N   1 
ATOM   1007  C CA  . GLY A 1 162 ? 192.927 147.143 115.502 1.00 96.21  ? 162 GLY A CA  1 
ATOM   1008  C C   . GLY A 1 162 ? 191.524 146.815 115.966 1.00 96.21  ? 162 GLY A C   1 
ATOM   1009  O O   . GLY A 1 162 ? 191.220 146.888 117.157 1.00 96.21  ? 162 GLY A O   1 
ATOM   1010  N N   . LEU A 1 163 ? 190.664 146.434 115.038 1.00 82.49  ? 163 LEU A N   1 
ATOM   1011  C CA  . LEU A 1 163 ? 189.284 146.116 115.343 1.00 82.49  ? 163 LEU A CA  1 
ATOM   1012  C C   . LEU A 1 163 ? 189.038 144.650 115.047 1.00 82.49  ? 163 LEU A C   1 
ATOM   1013  O O   . LEU A 1 163 ? 189.515 144.134 114.035 1.00 82.49  ? 163 LEU A O   1 
ATOM   1014  C CB  . LEU A 1 163 ? 188.348 146.977 114.514 1.00 82.49  ? 163 LEU A CB  1 
ATOM   1015  C CG  . LEU A 1 163 ? 186.877 146.770 114.807 1.00 82.49  ? 163 LEU A CG  1 
ATOM   1016  C CD1 . LEU A 1 163 ? 186.658 147.246 116.178 1.00 82.49  ? 163 LEU A CD1 1 
ATOM   1017  C CD2 . LEU A 1 163 ? 186.007 147.516 113.854 1.00 82.49  ? 163 LEU A CD2 1 
ATOM   1018  N N   . ALA A 1 164 ? 188.294 143.977 115.922 1.00 83.45  ? 164 ALA A N   1 
ATOM   1019  C CA  . ALA A 1 164 ? 188.033 142.553 115.729 1.00 83.45  ? 164 ALA A CA  1 
ATOM   1020  C C   . ALA A 1 164 ? 186.644 142.227 116.260 1.00 83.45  ? 164 ALA A C   1 
ATOM   1021  O O   . ALA A 1 164 ? 186.410 142.305 117.466 1.00 83.45  ? 164 ALA A O   1 
ATOM   1022  C CB  . ALA A 1 164 ? 189.093 141.716 116.424 1.00 83.45  ? 164 ALA A CB  1 
ATOM   1023  N N   . LEU A 1 165 ? 185.743 141.843 115.373 1.00 83.30  ? 165 LEU A N   1 
ATOM   1024  C CA  . LEU A 1 165 ? 184.436 141.376 115.796 1.00 83.30  ? 165 LEU A CA  1 
ATOM   1025  C C   . LEU A 1 165 ? 184.450 139.856 115.793 1.00 83.30  ? 165 LEU A C   1 
ATOM   1026  O O   . LEU A 1 165 ? 184.810 139.234 114.791 1.00 83.30  ? 165 LEU A O   1 
ATOM   1027  C CB  . LEU A 1 165 ? 183.327 141.945 114.910 1.00 83.30  ? 165 LEU A CB  1 
ATOM   1028  C CG  . LEU A 1 165 ? 183.086 141.658 113.433 1.00 83.30  ? 165 LEU A CG  1 
ATOM   1029  C CD1 . LEU A 1 165 ? 182.100 140.523 113.271 1.00 83.30  ? 165 LEU A CD1 1 
ATOM   1030  C CD2 . LEU A 1 165 ? 182.586 142.900 112.741 1.00 83.30  ? 165 LEU A CD2 1 
ATOM   1031  N N   . CYS A 1 166 ? 184.087 139.263 116.925 1.00 86.85  ? 166 CYS A N   1 
ATOM   1032  C CA  . CYS A 1 166 ? 184.313 137.845 117.147 1.00 86.85  ? 166 CYS A CA  1 
ATOM   1033  C C   . CYS A 1 166 ? 183.028 137.198 117.624 1.00 86.85  ? 166 CYS A C   1 
ATOM   1034  O O   . CYS A 1 166 ? 182.488 137.592 118.658 1.00 86.85  ? 166 CYS A O   1 
ATOM   1035  C CB  . CYS A 1 166 ? 185.415 137.640 118.188 1.00 86.85  ? 166 CYS A CB  1 
ATOM   1036  S SG  . CYS A 1 166 ? 186.990 138.416 117.762 1.00 86.85  ? 166 CYS A SG  1 
ATOM   1037  N N   . GLN A 1 167 ? 182.545 136.205 116.892 1.00 86.06  ? 167 GLN A N   1 
ATOM   1038  C CA  . GLN A 1 167 ? 181.380 135.484 117.363 1.00 86.06  ? 167 GLN A CA  1 
ATOM   1039  C C   . GLN A 1 167 ? 181.760 134.552 118.495 1.00 86.06  ? 167 GLN A C   1 
ATOM   1040  O O   . GLN A 1 167 ? 182.931 134.355 118.805 1.00 86.06  ? 167 GLN A O   1 
ATOM   1041  C CB  . GLN A 1 167 ? 180.754 134.655 116.257 1.00 86.06  ? 167 GLN A CB  1 
ATOM   1042  C CG  . GLN A 1 167 ? 180.214 135.449 115.120 1.00 86.06  ? 167 GLN A CG  1 
ATOM   1043  C CD  . GLN A 1 167 ? 179.524 134.576 114.110 1.00 86.06  ? 167 GLN A CD  1 
ATOM   1044  O OE1 . GLN A 1 167 ? 179.417 133.365 114.291 1.00 86.06  ? 167 GLN A OE1 1 
ATOM   1045  N NE2 . GLN A 1 167 ? 179.076 135.179 113.021 1.00 86.06  ? 167 GLN A NE2 1 
ATOM   1046  N N   . ARG A 1 168 ? 180.745 133.972 119.118 1.00 87.35  ? 168 ARG A N   1 
ATOM   1047  C CA  . ARG A 1 168 ? 180.922 132.844 120.021 1.00 87.35  ? 168 ARG A CA  1 
ATOM   1048  C C   . ARG A 1 168 ? 179.720 131.944 119.828 1.00 87.35  ? 168 ARG A C   1 
ATOM   1049  O O   . ARG A 1 168 ? 178.585 132.398 119.978 1.00 87.35  ? 168 ARG A O   1 
ATOM   1050  C CB  . ARG A 1 168 ? 180.992 133.258 121.489 1.00 87.35  ? 168 ARG A CB  1 
ATOM   1051  C CG  . ARG A 1 168 ? 182.066 134.232 121.947 1.00 87.35  ? 168 ARG A CG  1 
ATOM   1052  C CD  . ARG A 1 168 ? 183.459 133.690 122.002 1.00 87.35  ? 168 ARG A CD  1 
ATOM   1053  N NE  . ARG A 1 168 ? 184.270 134.547 122.862 1.00 87.35  ? 168 ARG A NE  1 
ATOM   1054  C CZ  . ARG A 1 168 ? 184.871 135.658 122.465 1.00 87.35  ? 168 ARG A CZ  1 
ATOM   1055  N NH1 . ARG A 1 168 ? 185.583 136.368 123.323 1.00 87.35  ? 168 ARG A NH1 1 
ATOM   1056  N NH2 . ARG A 1 168 ? 184.746 136.066 121.218 1.00 87.35  ? 168 ARG A NH2 1 
ATOM   1057  N N   . TYR A 1 169 ? 179.951 130.681 119.516 1.00 91.88  ? 169 TYR A N   1 
ATOM   1058  C CA  . TYR A 1 169 ? 178.842 129.750 119.442 1.00 91.88  ? 169 TYR A CA  1 
ATOM   1059  C C   . TYR A 1 169 ? 179.325 128.368 119.831 1.00 91.88  ? 169 TYR A C   1 
ATOM   1060  O O   . TYR A 1 169 ? 180.523 128.123 119.986 1.00 91.88  ? 169 TYR A O   1 
ATOM   1061  C CB  . TYR A 1 169 ? 178.196 129.751 118.060 1.00 91.88  ? 169 TYR A CB  1 
ATOM   1062  C CG  . TYR A 1 169 ? 179.121 129.480 116.902 1.00 91.88  ? 169 TYR A CG  1 
ATOM   1063  C CD1 . TYR A 1 169 ? 179.761 130.518 116.251 1.00 91.88  ? 169 TYR A CD1 1 
ATOM   1064  C CD2 . TYR A 1 169 ? 179.309 128.199 116.424 1.00 91.88  ? 169 TYR A CD2 1 
ATOM   1065  C CE1 . TYR A 1 169 ? 180.579 130.284 115.180 1.00 91.88  ? 169 TYR A CE1 1 
ATOM   1066  C CE2 . TYR A 1 169 ? 180.135 127.951 115.358 1.00 91.88  ? 169 TYR A CE2 1 
ATOM   1067  C CZ  . TYR A 1 169 ? 180.768 128.996 114.741 1.00 91.88  ? 169 TYR A CZ  1 
ATOM   1068  O OH  . TYR A 1 169 ? 181.584 128.750 113.670 1.00 91.88  ? 169 TYR A OH  1 
ATOM   1069  N N   . TYR A 1 170 ? 178.366 127.467 119.998 1.00 100.81 ? 170 TYR A N   1 
ATOM   1070  C CA  . TYR A 1 170 ? 178.665 126.130 120.474 1.00 100.81 ? 170 TYR A CA  1 
ATOM   1071  C C   . TYR A 1 170 ? 179.361 125.320 119.386 1.00 100.81 ? 170 TYR A C   1 
ATOM   1072  O O   . TYR A 1 170 ? 179.316 125.654 118.206 1.00 100.81 ? 170 TYR A O   1 
ATOM   1073  C CB  . TYR A 1 170 ? 177.386 125.427 120.912 1.00 100.81 ? 170 TYR A CB  1 
ATOM   1074  C CG  . TYR A 1 170 ? 176.754 125.985 122.160 1.00 100.81 ? 170 TYR A CG  1 
ATOM   1075  C CD1 . TYR A 1 170 ? 177.460 126.818 123.015 1.00 100.81 ? 170 TYR A CD1 1 
ATOM   1076  C CD2 . TYR A 1 170 ? 175.449 125.662 122.493 1.00 100.81 ? 170 TYR A CD2 1 
ATOM   1077  C CE1 . TYR A 1 170 ? 176.882 127.318 124.158 1.00 100.81 ? 170 TYR A CE1 1 
ATOM   1078  C CE2 . TYR A 1 170 ? 174.863 126.157 123.634 1.00 100.81 ? 170 TYR A CE2 1 
ATOM   1079  C CZ  . TYR A 1 170 ? 175.585 126.985 124.461 1.00 100.81 ? 170 TYR A CZ  1 
ATOM   1080  O OH  . TYR A 1 170 ? 175.006 127.486 125.599 1.00 100.81 ? 170 TYR A OH  1 
ATOM   1081  N N   . HIS A 1 171 ? 180.035 124.250 119.804 1.00 115.67 ? 171 HIS A N   1 
ATOM   1082  C CA  . HIS A 1 171 ? 180.705 123.377 118.845 1.00 115.67 ? 171 HIS A CA  1 
ATOM   1083  C C   . HIS A 1 171 ? 179.701 122.650 117.973 1.00 115.67 ? 171 HIS A C   1 
ATOM   1084  O O   . HIS A 1 171 ? 179.759 122.710 116.742 1.00 115.67 ? 171 HIS A O   1 
ATOM   1085  C CB  . HIS A 1 171 ? 181.581 122.365 119.574 1.00 115.67 ? 171 HIS A CB  1 
ATOM   1086  C CG  . HIS A 1 171 ? 182.186 121.346 118.667 1.00 115.67 ? 171 HIS A CG  1 
ATOM   1087  N ND1 . HIS A 1 171 ? 181.571 120.147 118.387 1.00 115.67 ? 171 HIS A ND1 1 
ATOM   1088  C CD2 . HIS A 1 171 ? 183.331 121.360 117.948 1.00 115.67 ? 171 HIS A CD2 1 
ATOM   1089  C CE1 . HIS A 1 171 ? 182.318 119.459 117.545 1.00 115.67 ? 171 HIS A CE1 1 
ATOM   1090  N NE2 . HIS A 1 171 ? 183.393 120.172 117.265 1.00 115.67 ? 171 HIS A NE2 1 
ATOM   1091  N N   . ARG A 1 172 ? 178.788 121.931 118.603 1.00 126.29 ? 172 ARG A N   1 
ATOM   1092  C CA  . ARG A 1 172 ? 177.801 121.145 117.891 1.00 126.29 ? 172 ARG A CA  1 
ATOM   1093  C C   . ARG A 1 172 ? 176.547 121.119 118.739 1.00 126.29 ? 172 ARG A C   1 
ATOM   1094  O O   . ARG A 1 172 ? 176.587 120.693 119.895 1.00 126.29 ? 172 ARG A O   1 
ATOM   1095  C CB  . ARG A 1 172 ? 178.315 119.728 117.631 1.00 126.29 ? 172 ARG A CB  1 
ATOM   1096  C CG  . ARG A 1 172 ? 177.342 118.834 116.898 1.00 126.29 ? 172 ARG A CG  1 
ATOM   1097  C CD  . ARG A 1 172 ? 177.924 117.448 116.683 1.00 126.29 ? 172 ARG A CD  1 
ATOM   1098  N NE  . ARG A 1 172 ? 176.956 116.573 116.034 1.00 126.29 ? 172 ARG A NE  1 
ATOM   1099  C CZ  . ARG A 1 172 ? 176.067 115.836 116.689 1.00 126.29 ? 172 ARG A CZ  1 
ATOM   1100  N NH1 . ARG A 1 172 ? 176.030 115.864 118.013 1.00 126.29 ? 172 ARG A NH1 1 
ATOM   1101  N NH2 . ARG A 1 172 ? 175.216 115.069 116.021 1.00 126.29 ? 172 ARG A NH2 1 
ATOM   1102  N N   . GLY A 1 173 ? 175.449 121.582 118.166 1.00 122.09 ? 173 GLY A N   1 
ATOM   1103  C CA  . GLY A 1 173 ? 174.194 121.629 118.879 1.00 122.09 ? 173 GLY A CA  1 
ATOM   1104  C C   . GLY A 1 173 ? 173.009 121.775 117.950 1.00 122.09 ? 173 GLY A C   1 
ATOM   1105  O O   . GLY A 1 173 ? 172.988 122.653 117.082 1.00 122.09 ? 173 GLY A O   1 
ATOM   1106  N N   . HIS A 1 174 ? 172.011 120.919 118.127 1.00 123.44 ? 174 HIS A N   1 
ATOM   1107  C CA  . HIS A 1 174 ? 170.839 120.887 117.264 1.00 123.44 ? 174 HIS A CA  1 
ATOM   1108  C C   . HIS A 1 174 ? 169.616 120.954 118.161 1.00 123.44 ? 174 HIS A C   1 
ATOM   1109  O O   . HIS A 1 174 ? 169.027 119.931 118.503 1.00 123.44 ? 174 HIS A O   1 
ATOM   1110  C CB  . HIS A 1 174 ? 170.852 119.624 116.413 1.00 123.44 ? 174 HIS A CB  1 
ATOM   1111  C CG  . HIS A 1 174 ? 169.683 119.512 115.491 1.00 123.44 ? 174 HIS A CG  1 
ATOM   1112  N ND1 . HIS A 1 174 ? 169.602 120.206 114.304 1.00 123.44 ? 174 HIS A ND1 1 
ATOM   1113  C CD2 . HIS A 1 174 ? 168.528 118.818 115.601 1.00 123.44 ? 174 HIS A CD2 1 
ATOM   1114  C CE1 . HIS A 1 174 ? 168.456 119.927 113.711 1.00 123.44 ? 174 HIS A CE1 1 
ATOM   1115  N NE2 . HIS A 1 174 ? 167.784 119.089 114.479 1.00 123.44 ? 174 HIS A NE2 1 
ATOM   1116  N N   . VAL A 1 175 ? 169.232 122.158 118.540 1.00 119.42 ? 175 VAL A N   1 
ATOM   1117  C CA  . VAL A 1 175 ? 168.008 122.328 119.308 1.00 119.42 ? 175 VAL A CA  1 
ATOM   1118  C C   . VAL A 1 175 ? 166.848 122.539 118.349 1.00 119.42 ? 175 VAL A C   1 
ATOM   1119  O O   . VAL A 1 175 ? 166.962 123.249 117.341 1.00 119.42 ? 175 VAL A O   1 
ATOM   1120  C CB  . VAL A 1 175 ? 168.146 123.475 120.324 1.00 119.42 ? 175 VAL A CB  1 
ATOM   1121  C CG1 . VAL A 1 175 ? 169.129 123.075 121.395 1.00 119.42 ? 175 VAL A CG1 1 
ATOM   1122  C CG2 . VAL A 1 175 ? 168.619 124.753 119.660 1.00 119.42 ? 175 VAL A CG2 1 
ATOM   1123  N N   . ASP A 1 176 ? 165.746 121.869 118.632 1.00 118.73 ? 176 ASP A N   1 
ATOM   1124  C CA  . ASP A 1 176 ? 164.562 121.942 117.797 1.00 118.73 ? 176 ASP A CA  1 
ATOM   1125  C C   . ASP A 1 176 ? 163.347 121.574 118.636 1.00 118.73 ? 176 ASP A C   1 
ATOM   1126  O O   . ASP A 1 176 ? 163.229 120.435 119.097 1.00 118.73 ? 176 ASP A O   1 
ATOM   1127  C CB  . ASP A 1 176 ? 164.695 121.003 116.600 1.00 118.73 ? 176 ASP A CB  1 
ATOM   1128  C CG  . ASP A 1 176 ? 163.645 121.252 115.538 1.00 118.73 ? 176 ASP A CG  1 
ATOM   1129  O OD1 . ASP A 1 176 ? 162.837 122.194 115.682 1.00 118.73 ? 176 ASP A OD1 1 
ATOM   1130  O OD2 . ASP A 1 176 ? 163.618 120.484 114.555 1.00 118.73 ? 176 ASP A OD2 1 
ATOM   1131  N N   . PRO A 1 177 ? 162.437 122.504 118.875 1.00 118.42 ? 177 PRO A N   1 
ATOM   1132  C CA  . PRO A 1 177 ? 161.165 122.135 119.492 1.00 118.42 ? 177 PRO A CA  1 
ATOM   1133  C C   . PRO A 1 177 ? 160.307 121.355 118.515 1.00 118.42 ? 177 PRO A C   1 
ATOM   1134  O O   . PRO A 1 177 ? 160.475 121.455 117.298 1.00 118.42 ? 177 PRO A O   1 
ATOM   1135  C CB  . PRO A 1 177 ? 160.539 123.483 119.843 1.00 118.42 ? 177 PRO A CB  1 
ATOM   1136  C CG  . PRO A 1 177 ? 161.173 124.427 118.908 1.00 118.42 ? 177 PRO A CG  1 
ATOM   1137  C CD  . PRO A 1 177 ? 162.554 123.951 118.665 1.00 118.42 ? 177 PRO A CD  1 
ATOM   1138  N N   . ALA A 1 178 ? 159.432 120.517 119.081 1.00 127.21 ? 178 ALA A N   1 
ATOM   1139  C CA  . ALA A 1 178 ? 158.552 119.520 118.456 1.00 127.21 ? 178 ALA A CA  1 
ATOM   1140  C C   . ALA A 1 178 ? 159.306 118.348 117.827 1.00 127.21 ? 178 ALA A C   1 
ATOM   1141  O O   . ALA A 1 178 ? 158.662 117.406 117.355 1.00 127.21 ? 178 ALA A O   1 
ATOM   1142  C CB  . ALA A 1 178 ? 157.593 120.118 117.412 1.00 127.21 ? 178 ALA A CB  1 
ATOM   1143  N N   . ASN A 1 179 ? 160.648 118.370 117.798 1.00 135.24 ? 179 ASN A N   1 
ATOM   1144  C CA  . ASN A 1 179 ? 161.478 117.195 117.522 1.00 135.24 ? 179 ASN A CA  1 
ATOM   1145  C C   . ASN A 1 179 ? 162.655 117.313 118.491 1.00 135.24 ? 179 ASN A C   1 
ATOM   1146  O O   . ASN A 1 179 ? 163.722 117.817 118.142 1.00 135.24 ? 179 ASN A O   1 
ATOM   1147  C CB  . ASN A 1 179 ? 161.933 117.142 116.062 1.00 135.24 ? 179 ASN A CB  1 
ATOM   1148  C CG  . ASN A 1 179 ? 162.567 115.808 115.684 1.00 135.24 ? 179 ASN A CG  1 
ATOM   1149  O OD1 . ASN A 1 179 ? 162.666 114.896 116.502 1.00 135.24 ? 179 ASN A OD1 1 
ATOM   1150  N ND2 . ASN A 1 179 ? 163.000 115.695 114.435 1.00 135.24 ? 179 ASN A ND2 1 
ATOM   1151  N N   . ASP A 1 180 ? 162.477 116.786 119.699 1.00 138.23 ? 180 ASP A N   1 
ATOM   1152  C CA  . ASP A 1 180 ? 163.345 117.133 120.826 1.00 138.23 ? 180 ASP A CA  1 
ATOM   1153  C C   . ASP A 1 180 ? 164.541 116.193 120.960 1.00 138.23 ? 180 ASP A C   1 
ATOM   1154  O O   . ASP A 1 180 ? 164.814 115.648 122.027 1.00 138.23 ? 180 ASP A O   1 
ATOM   1155  C CB  . ASP A 1 180 ? 162.518 117.157 122.102 1.00 138.23 ? 180 ASP A CB  1 
ATOM   1156  C CG  . ASP A 1 180 ? 161.456 118.230 122.076 1.00 138.23 ? 180 ASP A CG  1 
ATOM   1157  O OD1 . ASP A 1 180 ? 161.687 119.270 121.428 1.00 138.23 ? 180 ASP A OD1 1 
ATOM   1158  O OD2 . ASP A 1 180 ? 160.383 118.024 122.676 1.00 138.23 ? 180 ASP A OD2 1 
ATOM   1159  N N   . THR A 1 181 ? 165.273 116.010 119.858 1.00 138.24 ? 181 THR A N   1 
ATOM   1160  C CA  . THR A 1 181 ? 166.544 115.286 119.853 1.00 138.24 ? 181 THR A CA  1 
ATOM   1161  C C   . THR A 1 181 ? 167.635 116.352 119.878 1.00 138.24 ? 181 THR A C   1 
ATOM   1162  O O   . THR A 1 181 ? 168.188 116.746 118.853 1.00 138.24 ? 181 THR A O   1 
ATOM   1163  C CB  . THR A 1 181 ? 166.649 114.379 118.625 1.00 138.24 ? 181 THR A CB  1 
ATOM   1164  O OG1 . THR A 1 181 ? 165.502 113.524 118.564 1.00 138.24 ? 181 THR A OG1 1 
ATOM   1165  C CG2 . THR A 1 181 ? 167.899 113.505 118.696 1.00 138.24 ? 181 THR A CG2 1 
ATOM   1166  N N   . PHE A 1 182 ? 167.920 116.854 121.069 1.00 131.67 ? 182 PHE A N   1 
ATOM   1167  C CA  . PHE A 1 182 ? 168.741 118.044 121.205 1.00 131.67 ? 182 PHE A CA  1 
ATOM   1168  C C   . PHE A 1 182 ? 170.031 117.738 121.952 1.00 131.67 ? 182 PHE A C   1 
ATOM   1169  O O   . PHE A 1 182 ? 170.023 117.059 122.983 1.00 131.67 ? 182 PHE A O   1 
ATOM   1170  C CB  . PHE A 1 182 ? 167.953 119.175 121.874 1.00 131.67 ? 182 PHE A CB  1 
ATOM   1171  C CG  . PHE A 1 182 ? 167.394 118.836 123.220 1.00 131.67 ? 182 PHE A CG  1 
ATOM   1172  C CD1 . PHE A 1 182 ? 166.147 118.250 123.338 1.00 131.67 ? 182 PHE A CD1 1 
ATOM   1173  C CD2 . PHE A 1 182 ? 168.088 119.159 124.370 1.00 131.67 ? 182 PHE A CD2 1 
ATOM   1174  C CE1 . PHE A 1 182 ? 165.626 117.952 124.572 1.00 131.67 ? 182 PHE A CE1 1 
ATOM   1175  C CE2 . PHE A 1 182 ? 167.569 118.866 125.609 1.00 131.67 ? 182 PHE A CE2 1 
ATOM   1176  C CZ  . PHE A 1 182 ? 166.336 118.263 125.711 1.00 131.67 ? 182 PHE A CZ  1 
ATOM   1177  N N   . ASP A 1 183 ? 171.139 118.238 121.404 1.00 129.89 ? 183 ASP A N   1 
ATOM   1178  C CA  . ASP A 1 183 ? 172.475 118.020 121.941 1.00 129.89 ? 183 ASP A CA  1 
ATOM   1179  C C   . ASP A 1 183 ? 173.070 119.331 122.421 1.00 129.89 ? 183 ASP A C   1 
ATOM   1180  O O   . ASP A 1 183 ? 172.986 120.352 121.731 1.00 129.89 ? 183 ASP A O   1 
ATOM   1181  C CB  . ASP A 1 183 ? 173.389 117.373 120.901 1.00 129.89 ? 183 ASP A CB  1 
ATOM   1182  C CG  . ASP A 1 183 ? 173.335 118.073 119.566 1.00 129.89 ? 183 ASP A CG  1 
ATOM   1183  O OD1 . ASP A 1 183 ? 172.433 118.905 119.371 1.00 129.89 ? 183 ASP A OD1 1 
ATOM   1184  O OD2 . ASP A 1 183 ? 174.198 117.802 118.708 1.00 129.89 ? 183 ASP A OD2 1 
ATOM   1185  N N   . ILE A 1 184 ? 173.645 119.303 123.618 1.00 127.51 ? 184 ILE A N   1 
ATOM   1186  C CA  . ILE A 1 184 ? 174.216 120.479 124.249 1.00 127.51 ? 184 ILE A CA  1 
ATOM   1187  C C   . ILE A 1 184 ? 175.538 120.045 124.853 1.00 127.51 ? 184 ILE A C   1 
ATOM   1188  O O   . ILE A 1 184 ? 175.559 119.222 125.776 1.00 127.51 ? 184 ILE A O   1 
ATOM   1189  C CB  . ILE A 1 184 ? 173.296 121.069 125.328 1.00 127.51 ? 184 ILE A CB  1 
ATOM   1190  C CG1 . ILE A 1 184 ? 171.974 121.577 124.739 1.00 127.51 ? 184 ILE A CG1 1 
ATOM   1191  C CG2 . ILE A 1 184 ? 173.997 122.195 126.062 1.00 127.51 ? 184 ILE A CG2 1 
ATOM   1192  C CD1 . ILE A 1 184 ? 170.897 121.813 125.777 1.00 127.51 ? 184 ILE A CD1 1 
ATOM   1193  N N   . ASP A 1 185 ? 176.637 120.573 124.331 1.00 122.00 ? 185 ASP A N   1 
ATOM   1194  C CA  . ASP A 1 185 ? 177.956 120.361 124.923 1.00 122.00 ? 185 ASP A CA  1 
ATOM   1195  C C   . ASP A 1 185 ? 178.742 121.656 124.898 1.00 122.00 ? 185 ASP A C   1 
ATOM   1196  O O   . ASP A 1 185 ? 178.966 122.214 123.804 1.00 122.00 ? 185 ASP A O   1 
ATOM   1197  C CB  . ASP A 1 185 ? 178.745 119.275 124.207 1.00 122.00 ? 185 ASP A CB  1 
ATOM   1198  C CG  . ASP A 1 185 ? 180.070 119.015 124.871 1.00 122.00 ? 185 ASP A CG  1 
ATOM   1199  O OD1 . ASP A 1 185 ? 180.068 118.381 125.944 1.00 122.00 ? 185 ASP A OD1 1 
ATOM   1200  O OD2 . ASP A 1 185 ? 181.106 119.472 124.341 1.00 122.00 ? 185 ASP A OD2 1 
ATOM   1201  N N   . PRO A 1 186 ? 179.187 122.150 126.039 1.00 118.34 ? 186 PRO A N   1 
ATOM   1202  C CA  . PRO A 1 186 ? 179.879 123.441 126.069 1.00 118.34 ? 186 PRO A CA  1 
ATOM   1203  C C   . PRO A 1 186 ? 181.265 123.367 125.464 1.00 118.34 ? 186 PRO A C   1 
ATOM   1204  O O   . PRO A 1 186 ? 182.197 122.854 126.083 1.00 118.34 ? 186 PRO A O   1 
ATOM   1205  C CB  . PRO A 1 186 ? 179.949 123.763 127.566 1.00 118.34 ? 186 PRO A CB  1 
ATOM   1206  C CG  . PRO A 1 186 ? 178.902 122.902 128.193 1.00 118.34 ? 186 PRO A CG  1 
ATOM   1207  C CD  . PRO A 1 186 ? 178.889 121.656 127.389 1.00 118.34 ? 186 PRO A CD  1 
ATOM   1208  N N   . MET A 1 187 ? 181.403 123.879 124.250 1.00 116.37 ? 187 MET A N   1 
ATOM   1209  C CA  . MET A 1 187 ? 182.708 123.983 123.606 1.00 116.37 ? 187 MET A CA  1 
ATOM   1210  C C   . MET A 1 187 ? 182.606 125.147 122.623 1.00 116.37 ? 187 MET A C   1 
ATOM   1211  O O   . MET A 1 187 ? 182.103 124.996 121.510 1.00 116.37 ? 187 MET A O   1 
ATOM   1212  C CB  . MET A 1 187 ? 183.105 122.689 122.917 1.00 116.37 ? 187 MET A CB  1 
ATOM   1213  C CG  . MET A 1 187 ? 184.528 122.694 122.426 1.00 116.37 ? 187 MET A CG  1 
ATOM   1214  S SD  . MET A 1 187 ? 185.680 122.856 123.803 1.00 116.37 ? 187 MET A SD  1 
ATOM   1215  C CE  . MET A 1 187 ? 187.117 123.534 122.978 1.00 116.37 ? 187 MET A CE  1 
ATOM   1216  N N   . VAL A 1 188 ? 183.079 126.283 123.042 1.00 101.03 ? 188 VAL A N   1 
ATOM   1217  C CA  . VAL A 1 188 ? 182.835 127.522 122.324 1.00 101.03 ? 188 VAL A CA  1 
ATOM   1218  C C   . VAL A 1 188 ? 184.023 127.843 121.430 1.00 101.03 ? 188 VAL A C   1 
ATOM   1219  O O   . VAL A 1 188 ? 185.178 127.580 121.781 1.00 101.03 ? 188 VAL A O   1 
ATOM   1220  C CB  . VAL A 1 188 ? 182.533 128.647 123.326 1.00 101.03 ? 188 VAL A CB  1 
ATOM   1221  C CG1 . VAL A 1 188 ? 181.236 128.343 124.023 1.00 101.03 ? 188 VAL A CG1 1 
ATOM   1222  C CG2 . VAL A 1 188 ? 183.628 128.752 124.372 1.00 101.03 ? 188 VAL A CG2 1 
ATOM   1223  N N   . VAL A 1 189 ? 183.743 128.378 120.246 1.00 93.07  ? 189 VAL A N   1 
ATOM   1224  C CA  . VAL A 1 189 ? 184.773 128.678 119.262 1.00 93.07  ? 189 VAL A CA  1 
ATOM   1225  C C   . VAL A 1 189 ? 184.738 130.169 118.981 1.00 93.07  ? 189 VAL A C   1 
ATOM   1226  O O   . VAL A 1 189 ? 183.670 130.731 118.731 1.00 93.07  ? 189 VAL A O   1 
ATOM   1227  C CB  . VAL A 1 189 ? 184.577 127.877 117.963 1.00 93.07  ? 189 VAL A CB  1 
ATOM   1228  C CG1 . VAL A 1 189 ? 185.704 128.152 116.974 1.00 93.07  ? 189 VAL A CG1 1 
ATOM   1229  C CG2 . VAL A 1 189 ? 184.492 126.407 118.261 1.00 93.07  ? 189 VAL A CG2 1 
ATOM   1230  N N   . THR A 1 190 ? 185.905 130.799 119.007 1.00 93.89  ? 190 THR A N   1 
ATOM   1231  C CA  . THR A 1 190 ? 186.038 132.242 118.838 1.00 93.89  ? 190 THR A CA  1 
ATOM   1232  C C   . THR A 1 190 ? 186.420 132.542 117.393 1.00 93.89  ? 190 THR A C   1 
ATOM   1233  O O   . THR A 1 190 ? 187.598 132.511 117.033 1.00 93.89  ? 190 THR A O   1 
ATOM   1234  C CB  . THR A 1 190 ? 187.078 132.774 119.815 1.00 93.89  ? 190 THR A CB  1 
ATOM   1235  O OG1 . THR A 1 190 ? 186.692 132.418 121.149 1.00 93.89  ? 190 THR A OG1 1 
ATOM   1236  C CG2 . THR A 1 190 ? 187.198 134.280 119.725 1.00 93.89  ? 190 THR A CG2 1 
ATOM   1237  N N   . ASP A 1 191 ? 185.426 132.838 116.557 1.00 98.00  ? 191 ASP A N   1 
ATOM   1238  C CA  . ASP A 1 191 ? 185.647 133.150 115.144 1.00 98.00  ? 191 ASP A CA  1 
ATOM   1239  C C   . ASP A 1 191 ? 185.768 134.656 114.976 1.00 98.00  ? 191 ASP A C   1 
ATOM   1240  O O   . ASP A 1 191 ? 184.762 135.360 114.867 1.00 98.00  ? 191 ASP A O   1 
ATOM   1241  C CB  . ASP A 1 191 ? 184.519 132.605 114.283 1.00 98.00  ? 191 ASP A CB  1 
ATOM   1242  C CG  . ASP A 1 191 ? 184.537 131.115 114.210 1.00 98.00  ? 191 ASP A CG  1 
ATOM   1243  O OD1 . ASP A 1 191 ? 185.631 130.541 114.363 1.00 98.00  ? 191 ASP A OD1 1 
ATOM   1244  O OD2 . ASP A 1 191 ? 183.471 130.512 113.992 1.00 98.00  ? 191 ASP A OD2 1 
ATOM   1245  N N   . CYS A 1 192 ? 186.996 135.147 114.922 1.00 98.53  ? 192 CYS A N   1 
ATOM   1246  C CA  . CYS A 1 192 ? 187.239 136.573 114.807 1.00 98.53  ? 192 CYS A CA  1 
ATOM   1247  C C   . CYS A 1 192 ? 187.378 136.984 113.352 1.00 98.53  ? 192 CYS A C   1 
ATOM   1248  O O   . CYS A 1 192 ? 187.841 136.216 112.509 1.00 98.53  ? 192 CYS A O   1 
ATOM   1249  C CB  . CYS A 1 192 ? 188.490 136.978 115.579 1.00 98.53  ? 192 CYS A CB  1 
ATOM   1250  S SG  . CYS A 1 192 ? 188.265 136.881 117.351 1.00 98.53  ? 192 CYS A SG  1 
ATOM   1251  N N   . ILE A 1 193 ? 186.953 138.204 113.067 1.00 88.87  ? 193 ILE A N   1 
ATOM   1252  C CA  . ILE A 1 193 ? 187.133 138.825 111.767 1.00 88.87  ? 193 ILE A CA  1 
ATOM   1253  C C   . ILE A 1 193 ? 188.060 140.005 111.969 1.00 88.87  ? 193 ILE A C   1 
ATOM   1254  O O   . ILE A 1 193 ? 187.856 140.813 112.879 1.00 88.87  ? 193 ILE A O   1 
ATOM   1255  C CB  . ILE A 1 193 ? 185.793 139.273 111.163 1.00 88.87  ? 193 ILE A CB  1 
ATOM   1256  C CG1 . ILE A 1 193 ? 184.806 138.115 111.164 1.00 88.87  ? 193 ILE A CG1 1 
ATOM   1257  C CG2 . ILE A 1 193 ? 185.988 139.746 109.753 1.00 88.87  ? 193 ILE A CG2 1 
ATOM   1258  C CD1 . ILE A 1 193 ? 185.269 136.921 110.386 1.00 88.87  ? 193 ILE A CD1 1 
ATOM   1259  N N   . GLN A 1 194 ? 189.085 140.098 111.146 1.00 90.94  ? 194 GLN A N   1 
ATOM   1260  C CA  . GLN A 1 194 ? 190.141 141.061 111.372 1.00 90.94  ? 194 GLN A CA  1 
ATOM   1261  C C   . GLN A 1 194 ? 189.968 142.246 110.443 1.00 90.94  ? 194 GLN A C   1 
ATOM   1262  O O   . GLN A 1 194 ? 189.716 142.076 109.248 1.00 90.94  ? 194 GLN A O   1 
ATOM   1263  C CB  . GLN A 1 194 ? 191.506 140.429 111.147 1.00 90.94  ? 194 GLN A CB  1 
ATOM   1264  C CG  . GLN A 1 194 ? 191.764 139.222 112.009 1.00 90.94  ? 194 GLN A CG  1 
ATOM   1265  C CD  . GLN A 1 194 ? 191.817 139.551 113.478 1.00 90.94  ? 194 GLN A CD  1 
ATOM   1266  O OE1 . GLN A 1 194 ? 192.345 140.587 113.873 1.00 90.94  ? 194 GLN A OE1 1 
ATOM   1267  N NE2 . GLN A 1 194 ? 191.275 138.662 114.302 1.00 90.94  ? 194 GLN A NE2 1 
ATOM   1268  N N   . VAL A 1 195 ? 190.117 143.443 110.997 1.00 85.39  ? 195 VAL A N   1 
ATOM   1269  C CA  . VAL A 1 195 ? 190.073 144.673 110.219 1.00 85.39  ? 195 VAL A CA  1 
ATOM   1270  C C   . VAL A 1 195 ? 190.971 145.703 110.892 1.00 85.39  ? 195 VAL A C   1 
ATOM   1271  O O   . VAL A 1 195 ? 190.952 145.870 112.115 1.00 85.39  ? 195 VAL A O   1 
ATOM   1272  C CB  . VAL A 1 195 ? 188.620 145.166 110.020 1.00 85.39  ? 195 VAL A CB  1 
ATOM   1273  C CG1 . VAL A 1 195 ? 187.883 145.248 111.315 1.00 85.39  ? 195 VAL A CG1 1 
ATOM   1274  C CG2 . VAL A 1 195 ? 188.587 146.512 109.336 1.00 85.39  ? 195 VAL A CG2 1 
ATOM   1275  N N   . ASP A 1 196 ? 191.808 146.328 110.095 1.00 91.15  ? 196 ASP A N   1 
ATOM   1276  C CA  . ASP A 1 196 ? 192.728 147.396 110.403 1.00 91.15  ? 196 ASP A CA  1 
ATOM   1277  C C   . ASP A 1 196 ? 192.250 148.705 109.782 1.00 91.15  ? 196 ASP A C   1 
ATOM   1278  O O   . ASP A 1 196 ? 191.615 148.693 108.724 1.00 91.15  ? 196 ASP A O   1 
ATOM   1279  C CB  . ASP A 1 196 ? 194.128 147.040 109.890 1.00 91.15  ? 196 ASP A CB  1 
ATOM   1280  C CG  . ASP A 1 196 ? 194.127 146.564 108.451 1.00 91.15  ? 196 ASP A CG  1 
ATOM   1281  O OD1 . ASP A 1 196 ? 193.042 146.367 107.875 1.00 91.15  ? 196 ASP A OD1 1 
ATOM   1282  O OD2 . ASP A 1 196 ? 195.224 146.373 107.887 1.00 91.15  ? 196 ASP A OD2 1 
ATOM   1283  N N   . PRO A 1 197 ? 192.502 149.845 110.419 1.00 92.40  ? 197 PRO A N   1 
ATOM   1284  C CA  . PRO A 1 197 ? 192.059 151.111 109.855 1.00 92.40  ? 197 PRO A CA  1 
ATOM   1285  C C   . PRO A 1 197 ? 192.897 151.477 108.648 1.00 92.40  ? 197 PRO A C   1 
ATOM   1286  O O   . PRO A 1 197 ? 194.085 151.131 108.583 1.00 92.40  ? 197 PRO A O   1 
ATOM   1287  C CB  . PRO A 1 197 ? 192.276 152.103 111.000 1.00 92.40  ? 197 PRO A CB  1 
ATOM   1288  C CG  . PRO A 1 197 ? 193.369 151.522 111.770 1.00 92.40  ? 197 PRO A CG  1 
ATOM   1289  C CD  . PRO A 1 197 ? 193.183 150.042 111.708 1.00 92.40  ? 197 PRO A CD  1 
ATOM   1290  N N   . PRO A 1 198 ? 192.314 152.152 107.667 1.00 103.80 ? 198 PRO A N   1 
ATOM   1291  C CA  . PRO A 1 198 ? 193.084 152.535 106.485 1.00 103.80 ? 198 PRO A CA  1 
ATOM   1292  C C   . PRO A 1 198 ? 194.054 153.657 106.805 1.00 103.80 ? 198 PRO A C   1 
ATOM   1293  O O   . PRO A 1 198 ? 193.852 154.454 107.721 1.00 103.80 ? 198 PRO A O   1 
ATOM   1294  C CB  . PRO A 1 198 ? 192.010 152.995 105.501 1.00 103.80 ? 198 PRO A CB  1 
ATOM   1295  C CG  . PRO A 1 198 ? 190.898 153.457 106.375 1.00 103.80 ? 198 PRO A CG  1 
ATOM   1296  C CD  . PRO A 1 198 ? 190.907 152.569 107.572 1.00 103.80 ? 198 PRO A CD  1 
ATOM   1297  N N   . GLU A 1 199 ? 195.131 153.705 106.030 1.00 125.33 ? 199 GLU A N   1 
ATOM   1298  C CA  . GLU A 1 199 ? 196.184 154.685 106.246 1.00 125.33 ? 199 GLU A CA  1 
ATOM   1299  C C   . GLU A 1 199 ? 195.859 156.033 105.618 1.00 125.33 ? 199 GLU A C   1 
ATOM   1300  O O   . GLU A 1 199 ? 195.918 157.065 106.292 1.00 125.33 ? 199 GLU A O   1 
ATOM   1301  C CB  . GLU A 1 199 ? 197.510 154.152 105.687 1.00 125.33 ? 199 GLU A CB  1 
ATOM   1302  C CG  . GLU A 1 199 ? 198.714 155.064 105.908 1.00 125.33 ? 199 GLU A CG  1 
ATOM   1303  C CD  . GLU A 1 199 ? 199.165 155.137 107.360 1.00 125.33 ? 199 GLU A CD  1 
ATOM   1304  O OE1 . GLU A 1 199 ? 198.965 154.154 108.104 1.00 125.33 ? 199 GLU A OE1 1 
ATOM   1305  O OE2 . GLU A 1 199 ? 199.727 156.181 107.756 1.00 125.33 ? 199 GLU A OE2 1 
ATOM   1306  N N   . ARG A 1 200 ? 195.495 156.039 104.338 1.00 135.95 ? 200 ARG A N   1 
ATOM   1307  C CA  . ARG A 1 200 ? 195.306 157.253 103.565 1.00 135.95 ? 200 ARG A CA  1 
ATOM   1308  C C   . ARG A 1 200 ? 193.925 157.301 102.919 1.00 135.95 ? 200 ARG A C   1 
ATOM   1309  O O   . ARG A 1 200 ? 193.327 156.256 102.647 1.00 135.95 ? 200 ARG A O   1 
ATOM   1310  C CB  . ARG A 1 200 ? 196.394 157.374 102.485 1.00 135.95 ? 200 ARG A CB  1 
ATOM   1311  C CG  . ARG A 1 200 ? 197.784 157.767 103.001 1.00 135.95 ? 200 ARG A CG  1 
ATOM   1312  C CD  . ARG A 1 200 ? 197.793 159.217 103.479 1.00 135.95 ? 200 ARG A CD  1 
ATOM   1313  N NE  . ARG A 1 200 ? 197.474 159.341 104.898 1.00 135.95 ? 200 ARG A NE  1 
ATOM   1314  C CZ  . ARG A 1 200 ? 196.999 160.443 105.462 1.00 135.95 ? 200 ARG A CZ  1 
ATOM   1315  N NH1 . ARG A 1 200 ? 196.764 161.520 104.727 1.00 135.95 ? 200 ARG A NH1 1 
ATOM   1316  N NH2 . ARG A 1 200 ? 196.735 160.459 106.760 1.00 135.95 ? 200 ARG A NH2 1 
ATOM   1317  N N   . PRO A 1 201 ? 193.375 158.510 102.684 1.00 141.60 ? 201 PRO A N   1 
ATOM   1318  C CA  . PRO A 1 201 ? 192.111 158.667 101.951 1.00 141.60 ? 201 PRO A CA  1 
ATOM   1319  C C   . PRO A 1 201 ? 192.187 158.206 100.496 1.00 141.60 ? 201 PRO A C   1 
ATOM   1320  O O   . PRO A 1 201 ? 191.176 158.271 99.794  1.00 141.60 ? 201 PRO A O   1 
ATOM   1321  C CB  . PRO A 1 201 ? 191.854 160.177 102.018 1.00 141.60 ? 201 PRO A CB  1 
ATOM   1322  C CG  . PRO A 1 201 ? 192.587 160.634 103.225 1.00 141.60 ? 201 PRO A CG  1 
ATOM   1323  C CD  . PRO A 1 201 ? 193.817 159.787 103.279 1.00 141.60 ? 201 PRO A CD  1 
ATOM   1324  N N   . SER A 1 216 ? 187.109 145.111 104.842 1.00 100.01 ? 216 SER A N   1 
ATOM   1325  C CA  . SER A 1 216 ? 187.113 144.303 103.630 1.00 100.01 ? 216 SER A CA  1 
ATOM   1326  C C   . SER A 1 216 ? 185.891 143.397 103.559 1.00 100.01 ? 216 SER A C   1 
ATOM   1327  O O   . SER A 1 216 ? 184.784 143.849 103.277 1.00 100.01 ? 216 SER A O   1 
ATOM   1328  C CB  . SER A 1 216 ? 188.390 143.462 103.547 1.00 100.01 ? 216 SER A CB  1 
ATOM   1329  O OG  . SER A 1 216 ? 188.373 142.623 102.405 1.00 100.01 ? 216 SER A OG  1 
ATOM   1330  N N   . SER A 1 217 ? 186.095 142.112 103.836 1.00 95.61  ? 217 SER A N   1 
ATOM   1331  C CA  . SER A 1 217 ? 185.062 141.103 103.666 1.00 95.61  ? 217 SER A CA  1 
ATOM   1332  C C   . SER A 1 217 ? 184.156 140.973 104.880 1.00 95.61  ? 217 SER A C   1 
ATOM   1333  O O   . SER A 1 217 ? 183.444 139.969 104.999 1.00 95.61  ? 217 SER A O   1 
ATOM   1334  C CB  . SER A 1 217 ? 185.702 139.750 103.349 1.00 95.61  ? 217 SER A CB  1 
ATOM   1335  O OG  . SER A 1 217 ? 186.428 139.802 102.134 1.00 95.61  ? 217 SER A OG  1 
ATOM   1336  N N   . TYR A 1 218 ? 184.157 141.960 105.778 1.00 87.31  ? 218 TYR A N   1 
ATOM   1337  C CA  . TYR A 1 218 ? 183.379 141.841 107.002 1.00 87.31  ? 218 TYR A CA  1 
ATOM   1338  C C   . TYR A 1 218 ? 181.886 141.958 106.753 1.00 87.31  ? 218 TYR A C   1 
ATOM   1339  O O   . TYR A 1 218 ? 181.101 141.445 107.554 1.00 87.31  ? 218 TYR A O   1 
ATOM   1340  C CB  . TYR A 1 218 ? 183.828 142.887 108.016 1.00 87.31  ? 218 TYR A CB  1 
ATOM   1341  C CG  . TYR A 1 218 ? 183.564 144.325 107.637 1.00 87.31  ? 218 TYR A CG  1 
ATOM   1342  C CD1 . TYR A 1 218 ? 184.485 145.044 106.898 1.00 87.31  ? 218 TYR A CD1 1 
ATOM   1343  C CD2 . TYR A 1 218 ? 182.416 144.980 108.068 1.00 87.31  ? 218 TYR A CD2 1 
ATOM   1344  C CE1 . TYR A 1 218 ? 184.253 146.358 106.573 1.00 87.31  ? 218 TYR A CE1 1 
ATOM   1345  C CE2 . TYR A 1 218 ? 182.177 146.283 107.740 1.00 87.31  ? 218 TYR A CE2 1 
ATOM   1346  C CZ  . TYR A 1 218 ? 183.100 146.967 106.999 1.00 87.31  ? 218 TYR A CZ  1 
ATOM   1347  O OH  . TYR A 1 218 ? 182.863 148.274 106.677 1.00 87.31  ? 218 TYR A OH  1 
ATOM   1348  N N   . LYS A 1 219 ? 181.483 142.640 105.679 1.00 84.80  ? 219 LYS A N   1 
ATOM   1349  C CA  . LYS A 1 219 ? 180.081 142.646 105.285 1.00 84.80  ? 219 LYS A CA  1 
ATOM   1350  C C   . LYS A 1 219 ? 179.607 141.249 104.922 1.00 84.80  ? 219 LYS A C   1 
ATOM   1351  O O   . LYS A 1 219 ? 178.465 140.881 105.211 1.00 84.80  ? 219 LYS A O   1 
ATOM   1352  C CB  . LYS A 1 219 ? 179.869 143.592 104.112 1.00 84.80  ? 219 LYS A CB  1 
ATOM   1353  C CG  . LYS A 1 219 ? 180.001 145.052 104.444 1.00 84.80  ? 219 LYS A CG  1 
ATOM   1354  C CD  . LYS A 1 219 ? 178.797 145.521 105.234 1.00 84.80  ? 219 LYS A CD  1 
ATOM   1355  C CE  . LYS A 1 219 ? 178.860 147.014 105.490 1.00 84.80  ? 219 LYS A CE  1 
ATOM   1356  N NZ  . LYS A 1 219 ? 178.712 147.784 104.227 1.00 84.80  ? 219 LYS A NZ  1 
ATOM   1357  N N   . ASN A 1 220 ? 180.462 140.462 104.286 1.00 88.96  ? 220 ASN A N   1 
ATOM   1358  C CA  . ASN A 1 220 ? 180.172 139.049 104.099 1.00 88.96  ? 220 ASN A CA  1 
ATOM   1359  C C   . ASN A 1 220 ? 180.282 138.381 105.461 1.00 88.96  ? 220 ASN A C   1 
ATOM   1360  O O   . ASN A 1 220 ? 181.380 138.122 105.954 1.00 88.96  ? 220 ASN A O   1 
ATOM   1361  C CB  . ASN A 1 220 ? 181.127 138.434 103.083 1.00 88.96  ? 220 ASN A CB  1 
ATOM   1362  C CG  . ASN A 1 220 ? 180.913 138.971 101.679 1.00 88.96  ? 220 ASN A CG  1 
ATOM   1363  O OD1 . ASN A 1 220 ? 181.777 139.639 101.118 1.00 88.96  ? 220 ASN A OD1 1 
ATOM   1364  N ND2 . ASN A 1 220 ? 179.758 138.670 101.102 1.00 88.96  ? 220 ASN A ND2 1 
ATOM   1365  N N   . LEU A 1 221 ? 179.135 138.125 106.087 1.00 86.90  ? 221 LEU A N   1 
ATOM   1366  C CA  . LEU A 1 221 ? 179.093 137.608 107.446 1.00 86.90  ? 221 LEU A CA  1 
ATOM   1367  C C   . LEU A 1 221 ? 177.757 136.926 107.691 1.00 86.90  ? 221 LEU A C   1 
ATOM   1368  O O   . LEU A 1 221 ? 176.709 137.468 107.341 1.00 86.90  ? 221 LEU A O   1 
ATOM   1369  C CB  . LEU A 1 221 ? 179.299 138.730 108.467 1.00 86.90  ? 221 LEU A CB  1 
ATOM   1370  C CG  . LEU A 1 221 ? 179.204 138.312 109.930 1.00 86.90  ? 221 LEU A CG  1 
ATOM   1371  C CD1 . LEU A 1 221 ? 180.252 137.276 110.230 1.00 86.90  ? 221 LEU A CD1 1 
ATOM   1372  C CD2 . LEU A 1 221 ? 179.347 139.502 110.852 1.00 86.90  ? 221 LEU A CD2 1 
ATOM   1373  N N   . THR A 1 222 ? 177.801 135.741 108.288 1.00 86.52  ? 222 THR A N   1 
ATOM   1374  C CA  . THR A 1 222 ? 176.614 135.089 108.815 1.00 86.52  ? 222 THR A CA  1 
ATOM   1375  C C   . THR A 1 222 ? 176.793 134.907 110.312 1.00 86.52  ? 222 THR A C   1 
ATOM   1376  O O   . THR A 1 222 ? 177.911 134.970 110.822 1.00 86.52  ? 222 THR A O   1 
ATOM   1377  C CB  . THR A 1 222 ? 176.373 133.743 108.158 1.00 86.52  ? 222 THR A CB  1 
ATOM   1378  O OG1 . THR A 1 222 ? 177.494 132.893 108.416 1.00 86.52  ? 222 THR A OG1 1 
ATOM   1379  C CG2 . THR A 1 222 ? 176.211 133.905 106.664 1.00 86.52  ? 222 THR A CG2 1 
ATOM   1380  N N   . LEU A 1 223 ? 175.691 134.695 111.027 1.00 82.14  ? 223 LEU A N   1 
ATOM   1381  C CA  . LEU A 1 223 ? 175.763 134.720 112.478 1.00 82.14  ? 223 LEU A CA  1 
ATOM   1382  C C   . LEU A 1 223 ? 175.360 133.435 113.178 1.00 82.14  ? 223 LEU A C   1 
ATOM   1383  O O   . LEU A 1 223 ? 175.837 133.212 114.292 1.00 82.14  ? 223 LEU A O   1 
ATOM   1384  C CB  . LEU A 1 223 ? 174.928 135.876 113.041 1.00 82.14  ? 223 LEU A CB  1 
ATOM   1385  C CG  . LEU A 1 223 ? 175.698 137.179 113.304 1.00 82.14  ? 223 LEU A CG  1 
ATOM   1386  C CD1 . LEU A 1 223 ? 176.146 137.886 112.056 1.00 82.14  ? 223 LEU A CD1 1 
ATOM   1387  C CD2 . LEU A 1 223 ? 174.862 138.116 114.127 1.00 82.14  ? 223 LEU A CD2 1 
ATOM   1388  N N   . LYS A 1 224 ? 174.520 132.598 112.568 1.00 85.87  ? 224 LYS A N   1 
ATOM   1389  C CA  . LYS A 1 224 ? 174.089 131.301 113.108 1.00 85.87  ? 224 LYS A CA  1 
ATOM   1390  C C   . LYS A 1 224 ? 173.404 131.462 114.470 1.00 85.87  ? 224 LYS A C   1 
ATOM   1391  O O   . LYS A 1 224 ? 173.913 131.047 115.511 1.00 85.87  ? 224 LYS A O   1 
ATOM   1392  C CB  . LYS A 1 224 ? 175.251 130.297 113.186 1.00 85.87  ? 224 LYS A CB  1 
ATOM   1393  C CG  . LYS A 1 224 ? 175.828 129.905 111.833 1.00 85.87  ? 224 LYS A CG  1 
ATOM   1394  C CD  . LYS A 1 224 ? 176.721 128.667 111.921 1.00 85.87  ? 224 LYS A CD  1 
ATOM   1395  C CE  . LYS A 1 224 ? 178.085 128.937 112.516 1.00 85.87  ? 224 LYS A CE  1 
ATOM   1396  N NZ  . LYS A 1 224 ? 178.965 129.719 111.614 1.00 85.87  ? 224 LYS A NZ  1 
ATOM   1397  N N   . PHE A 1 225 ? 172.226 132.092 114.419 1.00 88.99  ? 225 PHE A N   1 
ATOM   1398  C CA  . PHE A 1 225 ? 171.570 132.619 115.613 1.00 88.99  ? 225 PHE A CA  1 
ATOM   1399  C C   . PHE A 1 225 ? 171.116 131.551 116.590 1.00 88.99  ? 225 PHE A C   1 
ATOM   1400  O O   . PHE A 1 225 ? 171.163 131.789 117.800 1.00 88.99  ? 225 PHE A O   1 
ATOM   1401  C CB  . PHE A 1 225 ? 170.354 133.450 115.231 1.00 88.99  ? 225 PHE A CB  1 
ATOM   1402  C CG  . PHE A 1 225 ? 170.686 134.657 114.443 1.00 88.99  ? 225 PHE A CG  1 
ATOM   1403  C CD1 . PHE A 1 225 ? 171.226 135.767 115.058 1.00 88.99  ? 225 PHE A CD1 1 
ATOM   1404  C CD2 . PHE A 1 225 ? 170.453 134.687 113.084 1.00 88.99  ? 225 PHE A CD2 1 
ATOM   1405  C CE1 . PHE A 1 225 ? 171.533 136.882 114.331 1.00 88.99  ? 225 PHE A CE1 1 
ATOM   1406  C CE2 . PHE A 1 225 ? 170.753 135.802 112.348 1.00 88.99  ? 225 PHE A CE2 1 
ATOM   1407  C CZ  . PHE A 1 225 ? 171.301 136.905 112.973 1.00 88.99  ? 225 PHE A CZ  1 
ATOM   1408  N N   . HIS A 1 226 ? 170.701 130.384 116.110 1.00 93.14  ? 226 HIS A N   1 
ATOM   1409  C CA  . HIS A 1 226 ? 170.209 129.324 116.981 1.00 93.14  ? 226 HIS A CA  1 
ATOM   1410  C C   . HIS A 1 226 ? 171.285 128.730 117.878 1.00 93.14  ? 226 HIS A C   1 
ATOM   1411  O O   . HIS A 1 226 ? 170.955 127.982 118.800 1.00 93.14  ? 226 HIS A O   1 
ATOM   1412  C CB  . HIS A 1 226 ? 169.596 128.222 116.135 1.00 93.14  ? 226 HIS A CB  1 
ATOM   1413  C CG  . HIS A 1 226 ? 170.528 127.697 115.096 1.00 93.14  ? 226 HIS A CG  1 
ATOM   1414  N ND1 . HIS A 1 226 ? 171.519 126.785 115.380 1.00 93.14  ? 226 HIS A ND1 1 
ATOM   1415  C CD2 . HIS A 1 226 ? 170.621 127.955 113.771 1.00 93.14  ? 226 HIS A CD2 1 
ATOM   1416  C CE1 . HIS A 1 226 ? 172.187 126.506 114.276 1.00 93.14  ? 226 HIS A CE1 1 
ATOM   1417  N NE2 . HIS A 1 226 ? 171.659 127.201 113.284 1.00 93.14  ? 226 HIS A NE2 1 
ATOM   1418  N N   . LYS A 1 227 ? 172.550 129.050 117.627 1.00 96.23  ? 227 LYS A N   1 
ATOM   1419  C CA  . LYS A 1 227 ? 173.683 128.572 118.396 1.00 96.23  ? 227 LYS A CA  1 
ATOM   1420  C C   . LYS A 1 227 ? 174.467 129.723 119.017 1.00 96.23  ? 227 LYS A C   1 
ATOM   1421  O O   . LYS A 1 227 ? 175.409 129.484 119.778 1.00 96.23  ? 227 LYS A O   1 
ATOM   1422  C CB  . LYS A 1 227 ? 174.573 127.735 117.458 1.00 96.23  ? 227 LYS A CB  1 
ATOM   1423  C CG  . LYS A 1 227 ? 175.618 126.829 118.072 1.00 96.23  ? 227 LYS A CG  1 
ATOM   1424  C CD  . LYS A 1 227 ? 176.333 126.042 117.007 1.00 96.23  ? 227 LYS A CD  1 
ATOM   1425  C CE  . LYS A 1 227 ? 175.752 124.653 116.884 1.00 96.23  ? 227 LYS A CE  1 
ATOM   1426  N NZ  . LYS A 1 227 ? 174.447 124.621 116.166 1.00 96.23  ? 227 LYS A NZ  1 
ATOM   1427  N N   . LEU A 1 228 ? 174.061 130.961 118.767 1.00 85.82  ? 228 LEU A N   1 
ATOM   1428  C CA  . LEU A 1 228 ? 174.861 132.136 119.081 1.00 85.82  ? 228 LEU A CA  1 
ATOM   1429  C C   . LEU A 1 228 ? 174.889 132.435 120.574 1.00 85.82  ? 228 LEU A C   1 
ATOM   1430  O O   . LEU A 1 228 ? 173.869 132.349 121.257 1.00 85.82  ? 228 LEU A O   1 
ATOM   1431  C CB  . LEU A 1 228 ? 174.292 133.321 118.316 1.00 85.82  ? 228 LEU A CB  1 
ATOM   1432  C CG  . LEU A 1 228 ? 174.890 134.695 118.523 1.00 85.82  ? 228 LEU A CG  1 
ATOM   1433  C CD1 . LEU A 1 228 ? 176.344 134.680 118.175 1.00 85.82  ? 228 LEU A CD1 1 
ATOM   1434  C CD2 . LEU A 1 228 ? 174.143 135.657 117.642 1.00 85.82  ? 228 LEU A CD2 1 
ATOM   1435  N N   . VAL A 1 229 ? 176.064 132.806 121.080 1.00 81.08  ? 229 VAL A N   1 
ATOM   1436  C CA  . VAL A 1 229 ? 176.256 133.098 122.497 1.00 81.08  ? 229 VAL A CA  1 
ATOM   1437  C C   . VAL A 1 229 ? 176.413 134.591 122.743 1.00 81.08  ? 229 VAL A C   1 
ATOM   1438  O O   . VAL A 1 229 ? 175.605 135.197 123.439 1.00 81.08  ? 229 VAL A O   1 
ATOM   1439  C CB  . VAL A 1 229 ? 177.452 132.316 123.073 1.00 81.08  ? 229 VAL A CB  1 
ATOM   1440  C CG1 . VAL A 1 229 ? 177.600 132.639 124.536 1.00 81.08  ? 229 VAL A CG1 1 
ATOM   1441  C CG2 . VAL A 1 229 ? 177.264 130.844 122.846 1.00 81.08  ? 229 VAL A CG2 1 
ATOM   1442  N N   . ASN A 1 230 ? 177.467 135.196 122.207 1.00 78.26  ? 230 ASN A N   1 
ATOM   1443  C CA  . ASN A 1 230 ? 177.636 136.641 122.271 1.00 78.26  ? 230 ASN A CA  1 
ATOM   1444  C C   . ASN A 1 230 ? 178.601 137.077 121.192 1.00 78.26  ? 230 ASN A C   1 
ATOM   1445  O O   . ASN A 1 230 ? 179.480 136.320 120.788 1.00 78.26  ? 230 ASN A O   1 
ATOM   1446  C CB  . ASN A 1 230 ? 178.125 137.128 123.641 1.00 78.26  ? 230 ASN A CB  1 
ATOM   1447  C CG  . ASN A 1 230 ? 179.199 136.260 124.207 1.00 78.26  ? 230 ASN A CG  1 
ATOM   1448  O OD1 . ASN A 1 230 ? 179.538 135.256 123.614 1.00 78.26  ? 230 ASN A OD1 1 
ATOM   1449  N ND2 . ASN A 1 230 ? 179.746 136.636 125.360 1.00 78.26  ? 230 ASN A ND2 1 
ATOM   1450  N N   . VAL A 1 231 ? 178.413 138.300 120.724 1.00 69.43  ? 231 VAL A N   1 
ATOM   1451  C CA  . VAL A 1 231 ? 179.252 138.903 119.703 1.00 69.43  ? 231 VAL A CA  1 
ATOM   1452  C C   . VAL A 1 231 ? 179.917 140.108 120.333 1.00 69.43  ? 231 VAL A C   1 
ATOM   1453  O O   . VAL A 1 231 ? 179.234 141.021 120.805 1.00 69.43  ? 231 VAL A O   1 
ATOM   1454  C CB  . VAL A 1 231 ? 178.442 139.320 118.478 1.00 69.43  ? 231 VAL A CB  1 
ATOM   1455  C CG1 . VAL A 1 231 ? 179.334 140.007 117.510 1.00 69.43  ? 231 VAL A CG1 1 
ATOM   1456  C CG2 . VAL A 1 231 ? 177.813 138.125 117.849 1.00 69.43  ? 231 VAL A CG2 1 
ATOM   1457  N N   . THR A 1 232 ? 181.238 140.128 120.349 1.00 78.71  ? 232 THR A N   1 
ATOM   1458  C CA  . THR A 1 232 ? 181.969 141.212 120.976 1.00 78.71  ? 232 THR A CA  1 
ATOM   1459  C C   . THR A 1 232 ? 182.764 141.973 119.933 1.00 78.71  ? 232 THR A C   1 
ATOM   1460  O O   . THR A 1 232 ? 183.054 141.460 118.855 1.00 78.71  ? 232 THR A O   1 
ATOM   1461  C CB  . THR A 1 232 ? 182.921 140.693 122.047 1.00 78.71  ? 232 THR A CB  1 
ATOM   1462  O OG1 . THR A 1 232 ? 183.973 139.954 121.424 1.00 78.71  ? 232 THR A OG1 1 
ATOM   1463  C CG2 . THR A 1 232 ? 182.189 139.776 123.004 1.00 78.71  ? 232 THR A CG2 1 
ATOM   1464  N N   . ILE A 1 233 ? 183.116 143.205 120.267 1.00 74.95  ? 233 ILE A N   1 
ATOM   1465  C CA  . ILE A 1 233 ? 183.883 144.084 119.400 1.00 74.95  ? 233 ILE A CA  1 
ATOM   1466  C C   . ILE A 1 233 ? 184.915 144.796 120.258 1.00 74.95  ? 233 ILE A C   1 
ATOM   1467  O O   . ILE A 1 233 ? 184.563 145.424 121.259 1.00 74.95  ? 233 ILE A O   1 
ATOM   1468  C CB  . ILE A 1 233 ? 182.968 145.085 118.673 1.00 74.95  ? 233 ILE A CB  1 
ATOM   1469  C CG1 . ILE A 1 233 ? 182.215 144.401 117.544 1.00 74.95  ? 233 ILE A CG1 1 
ATOM   1470  C CG2 . ILE A 1 233 ? 183.731 146.236 118.140 1.00 74.95  ? 233 ILE A CG2 1 
ATOM   1471  C CD1 . ILE A 1 233 ? 181.188 145.252 116.913 1.00 74.95  ? 233 ILE A CD1 1 
ATOM   1472  N N   . HIS A 1 234 ? 186.183 144.690 119.874 1.00 84.81  ? 234 HIS A N   1 
ATOM   1473  C CA  . HIS A 1 234 ? 187.304 145.196 120.657 1.00 84.81  ? 234 HIS A CA  1 
ATOM   1474  C C   . HIS A 1 234 ? 188.078 146.198 119.815 1.00 84.81  ? 234 HIS A C   1 
ATOM   1475  O O   . HIS A 1 234 ? 188.440 145.886 118.677 1.00 84.81  ? 234 HIS A O   1 
ATOM   1476  C CB  . HIS A 1 234 ? 188.241 144.055 121.050 1.00 84.81  ? 234 HIS A CB  1 
ATOM   1477  C CG  . HIS A 1 234 ? 187.655 143.050 121.987 1.00 84.81  ? 234 HIS A CG  1 
ATOM   1478  N ND1 . HIS A 1 234 ? 187.734 143.174 123.357 1.00 84.81  ? 234 HIS A ND1 1 
ATOM   1479  C CD2 . HIS A 1 234 ? 186.988 141.895 121.754 1.00 84.81  ? 234 HIS A CD2 1 
ATOM   1480  C CE1 . HIS A 1 234 ? 187.161 142.132 123.925 1.00 84.81  ? 234 HIS A CE1 1 
ATOM   1481  N NE2 . HIS A 1 234 ? 186.682 141.350 122.973 1.00 84.81  ? 234 HIS A NE2 1 
ATOM   1482  N N   . PHE A 1 235 ? 188.360 147.375 120.371 1.00 79.76  ? 235 PHE A N   1 
ATOM   1483  C CA  . PHE A 1 235 ? 189.355 148.264 119.780 1.00 79.76  ? 235 PHE A CA  1 
ATOM   1484  C C   . PHE A 1 235 ? 189.882 149.206 120.845 1.00 79.76  ? 235 PHE A C   1 
ATOM   1485  O O   . PHE A 1 235 ? 189.371 149.258 121.962 1.00 79.76  ? 235 PHE A O   1 
ATOM   1486  C CB  . PHE A 1 235 ? 188.818 149.053 118.579 1.00 79.76  ? 235 PHE A CB  1 
ATOM   1487  C CG  . PHE A 1 235 ? 187.692 149.980 118.893 1.00 79.76  ? 235 PHE A CG  1 
ATOM   1488  C CD1 . PHE A 1 235 ? 186.392 149.525 118.898 1.00 79.76  ? 235 PHE A CD1 1 
ATOM   1489  C CD2 . PHE A 1 235 ? 187.923 151.326 119.097 1.00 79.76  ? 235 PHE A CD2 1 
ATOM   1490  C CE1 . PHE A 1 235 ? 185.354 150.375 119.154 1.00 79.76  ? 235 PHE A CE1 1 
ATOM   1491  C CE2 . PHE A 1 235 ? 186.886 152.182 119.359 1.00 79.76  ? 235 PHE A CE2 1 
ATOM   1492  C CZ  . PHE A 1 235 ? 185.604 151.702 119.385 1.00 79.76  ? 235 PHE A CZ  1 
ATOM   1493  N N   . ARG A 1 236 ? 190.929 149.935 120.483 1.00 85.35  ? 236 ARG A N   1 
ATOM   1494  C CA  . ARG A 1 236 ? 191.629 150.817 121.398 1.00 85.35  ? 236 ARG A CA  1 
ATOM   1495  C C   . ARG A 1 236 ? 191.902 152.144 120.720 1.00 85.35  ? 236 ARG A C   1 
ATOM   1496  O O   . ARG A 1 236 ? 192.063 152.212 119.502 1.00 85.35  ? 236 ARG A O   1 
ATOM   1497  C CB  . ARG A 1 236 ? 192.934 150.203 121.857 1.00 85.35  ? 236 ARG A CB  1 
ATOM   1498  C CG  . ARG A 1 236 ? 192.749 149.057 122.796 1.00 85.35  ? 236 ARG A CG  1 
ATOM   1499  C CD  . ARG A 1 236 ? 194.037 148.343 123.067 1.00 85.35  ? 236 ARG A CD  1 
ATOM   1500  N NE  . ARG A 1 236 ? 194.451 147.598 121.889 1.00 85.35  ? 236 ARG A NE  1 
ATOM   1501  C CZ  . ARG A 1 236 ? 195.557 146.877 121.826 1.00 85.35  ? 236 ARG A CZ  1 
ATOM   1502  N NH1 . ARG A 1 236 ? 196.354 146.791 122.881 1.00 85.35  ? 236 ARG A NH1 1 
ATOM   1503  N NH2 . ARG A 1 236 ? 195.850 146.226 120.719 1.00 85.35  ? 236 ARG A NH2 1 
ATOM   1504  N N   . LEU A 1 237 ? 191.956 153.202 121.518 1.00 81.16  ? 237 LEU A N   1 
ATOM   1505  C CA  . LEU A 1 237 ? 192.127 154.550 120.996 1.00 81.16  ? 237 LEU A CA  1 
ATOM   1506  C C   . LEU A 1 237 ? 192.981 155.353 121.955 1.00 81.16  ? 237 LEU A C   1 
ATOM   1507  O O   . LEU A 1 237 ? 192.623 155.495 123.125 1.00 81.16  ? 237 LEU A O   1 
ATOM   1508  C CB  . LEU A 1 237 ? 190.779 155.240 120.800 1.00 81.16  ? 237 LEU A CB  1 
ATOM   1509  C CG  . LEU A 1 237 ? 189.880 154.795 119.656 1.00 81.16  ? 237 LEU A CG  1 
ATOM   1510  C CD1 . LEU A 1 237 ? 188.553 155.489 119.735 1.00 81.16  ? 237 LEU A CD1 1 
ATOM   1511  C CD2 . LEU A 1 237 ? 190.560 155.146 118.372 1.00 81.16  ? 237 LEU A CD2 1 
ATOM   1512  N N   . LYS A 1 238 ? 194.097 155.880 121.467 1.00 89.73  ? 238 LYS A N   1 
ATOM   1513  C CA  . LYS A 1 238 ? 194.871 156.828 122.249 1.00 89.73  ? 238 LYS A CA  1 
ATOM   1514  C C   . LYS A 1 238 ? 194.332 158.234 122.048 1.00 89.73  ? 238 LYS A C   1 
ATOM   1515  O O   . LYS A 1 238 ? 193.633 158.518 121.075 1.00 89.73  ? 238 LYS A O   1 
ATOM   1516  C CB  . LYS A 1 238 ? 196.350 156.803 121.862 1.00 89.73  ? 238 LYS A CB  1 
ATOM   1517  C CG  . LYS A 1 238 ? 197.135 155.584 122.310 1.00 89.73  ? 238 LYS A CG  1 
ATOM   1518  C CD  . LYS A 1 238 ? 198.614 155.769 121.999 1.00 89.73  ? 238 LYS A CD  1 
ATOM   1519  C CE  . LYS A 1 238 ? 199.441 154.563 122.407 1.00 89.73  ? 238 LYS A CE  1 
ATOM   1520  N NZ  . LYS A 1 238 ? 199.514 154.409 123.879 1.00 89.73  ? 238 LYS A NZ  1 
ATOM   1521  N N   . THR A 1 239 ? 194.680 159.116 122.979 1.00 101.59 ? 239 THR A N   1 
ATOM   1522  C CA  . THR A 1 239 ? 194.337 160.525 122.885 1.00 101.59 ? 239 THR A CA  1 
ATOM   1523  C C   . THR A 1 239 ? 195.256 161.330 123.781 1.00 101.59 ? 239 THR A C   1 
ATOM   1524  O O   . THR A 1 239 ? 196.085 160.790 124.512 1.00 101.59 ? 239 THR A O   1 
ATOM   1525  C CB  . THR A 1 239 ? 192.900 160.807 123.299 1.00 101.59 ? 239 THR A CB  1 
ATOM   1526  O OG1 . THR A 1 239 ? 192.634 162.200 123.109 1.00 101.59 ? 239 THR A OG1 1 
ATOM   1527  C CG2 . THR A 1 239 ? 192.707 160.466 124.756 1.00 101.59 ? 239 THR A CG2 1 
ATOM   1528  N N   . ILE A 1 240 ? 195.079 162.641 123.725 1.00 105.08 ? 240 ILE A N   1 
ATOM   1529  C CA  . ILE A 1 240 ? 195.816 163.578 124.553 1.00 105.08 ? 240 ILE A CA  1 
ATOM   1530  C C   . ILE A 1 240 ? 194.792 164.347 125.363 1.00 105.08 ? 240 ILE A C   1 
ATOM   1531  O O   . ILE A 1 240 ? 193.893 164.972 124.789 1.00 105.08 ? 240 ILE A O   1 
ATOM   1532  C CB  . ILE A 1 240 ? 196.650 164.547 123.707 1.00 105.08 ? 240 ILE A CB  1 
ATOM   1533  C CG1 . ILE A 1 240 ? 197.496 163.791 122.690 1.00 105.08 ? 240 ILE A CG1 1 
ATOM   1534  C CG2 . ILE A 1 240 ? 197.528 165.384 124.592 1.00 105.08 ? 240 ILE A CG2 1 
ATOM   1535  C CD1 . ILE A 1 240 ? 198.458 162.834 123.294 1.00 105.08 ? 240 ILE A CD1 1 
ATOM   1536  N N   . ASN A 1 241 ? 194.908 164.296 126.683 1.00 104.65 ? 241 ASN A N   1 
ATOM   1537  C CA  . ASN A 1 241 ? 194.115 165.200 127.498 1.00 104.65 ? 241 ASN A CA  1 
ATOM   1538  C C   . ASN A 1 241 ? 194.634 166.609 127.285 1.00 104.65 ? 241 ASN A C   1 
ATOM   1539  O O   . ASN A 1 241 ? 195.829 166.820 127.089 1.00 104.65 ? 241 ASN A O   1 
ATOM   1540  C CB  . ASN A 1 241 ? 194.184 164.814 128.971 1.00 104.65 ? 241 ASN A CB  1 
ATOM   1541  C CG  . ASN A 1 241 ? 193.168 165.553 129.823 1.00 104.65 ? 241 ASN A CG  1 
ATOM   1542  O OD1 . ASN A 1 241 ? 192.431 166.414 129.349 1.00 104.65 ? 241 ASN A OD1 1 
ATOM   1543  N ND2 . ASN A 1 241 ? 193.115 165.199 131.095 1.00 104.65 ? 241 ASN A ND2 1 
ATOM   1544  N N   . LEU A 1 242 ? 193.731 167.572 127.286 1.00 105.57 ? 242 LEU A N   1 
ATOM   1545  C CA  . LEU A 1 242 ? 194.091 168.940 126.961 1.00 105.57 ? 242 LEU A CA  1 
ATOM   1546  C C   . LEU A 1 242 ? 193.593 169.871 128.060 1.00 105.57 ? 242 LEU A C   1 
ATOM   1547  O O   . LEU A 1 242 ? 193.128 170.986 127.825 1.00 105.57 ? 242 LEU A O   1 
ATOM   1548  C CB  . LEU A 1 242 ? 193.556 169.306 125.578 1.00 105.57 ? 242 LEU A CB  1 
ATOM   1549  C CG  . LEU A 1 242 ? 194.180 170.477 124.821 1.00 105.57 ? 242 LEU A CG  1 
ATOM   1550  C CD1 . LEU A 1 242 ? 195.635 170.183 124.622 1.00 105.57 ? 242 LEU A CD1 1 
ATOM   1551  C CD2 . LEU A 1 242 ? 193.516 170.626 123.488 1.00 105.57 ? 242 LEU A CD2 1 
ATOM   1552  N N   . GLN A 1 243 ? 193.689 169.399 129.291 1.00 110.37 ? 243 GLN A N   1 
ATOM   1553  C CA  . GLN A 1 243 ? 193.416 170.201 130.471 1.00 110.37 ? 243 GLN A CA  1 
ATOM   1554  C C   . GLN A 1 243 ? 194.720 170.508 131.194 1.00 110.37 ? 243 GLN A C   1 
ATOM   1555  O O   . GLN A 1 243 ? 194.805 170.481 132.420 1.00 110.37 ? 243 GLN A O   1 
ATOM   1556  C CB  . GLN A 1 243 ? 192.425 169.488 131.378 1.00 110.37 ? 243 GLN A CB  1 
ATOM   1557  C CG  . GLN A 1 243 ? 191.041 169.401 130.781 1.00 110.37 ? 243 GLN A CG  1 
ATOM   1558  C CD  . GLN A 1 243 ? 190.080 168.636 131.659 1.00 110.37 ? 243 GLN A CD  1 
ATOM   1559  O OE1 . GLN A 1 243 ? 190.480 168.024 132.646 1.00 110.37 ? 243 GLN A OE1 1 
ATOM   1560  N NE2 . GLN A 1 243 ? 188.799 168.691 131.323 1.00 110.37 ? 243 GLN A NE2 1 
ATOM   1561  N N   . SER A 1 244 ? 195.753 170.796 130.410 1.00 129.73 ? 244 SER A N   1 
ATOM   1562  C CA  . SER A 1 244 ? 197.099 171.042 130.897 1.00 129.73 ? 244 SER A CA  1 
ATOM   1563  C C   . SER A 1 244 ? 197.299 172.460 131.387 1.00 129.73 ? 244 SER A C   1 
ATOM   1564  O O   . SER A 1 244 ? 198.426 172.833 131.728 1.00 129.73 ? 244 SER A O   1 
ATOM   1565  C CB  . SER A 1 244 ? 198.108 170.762 129.788 1.00 129.73 ? 244 SER A CB  1 
ATOM   1566  O OG  . SER A 1 244 ? 197.982 171.717 128.749 1.00 129.73 ? 244 SER A OG  1 
ATOM   1567  N N   . LEU A 1 245 ? 196.246 173.264 131.414 1.00 134.61 ? 245 LEU A N   1 
ATOM   1568  C CA  . LEU A 1 245 ? 196.381 174.682 131.703 1.00 134.61 ? 245 LEU A CA  1 
ATOM   1569  C C   . LEU A 1 245 ? 196.276 174.989 133.186 1.00 134.61 ? 245 LEU A C   1 
ATOM   1570  O O   . LEU A 1 245 ? 197.103 175.733 133.721 1.00 134.61 ? 245 LEU A O   1 
ATOM   1571  C CB  . LEU A 1 245 ? 195.318 175.466 130.933 1.00 134.61 ? 245 LEU A CB  1 
ATOM   1572  C CG  . LEU A 1 245 ? 195.367 175.244 129.416 1.00 134.61 ? 245 LEU A CG  1 
ATOM   1573  C CD1 . LEU A 1 245 ? 194.305 176.066 128.693 1.00 134.61 ? 245 LEU A CD1 1 
ATOM   1574  C CD2 . LEU A 1 245 ? 196.750 175.512 128.858 1.00 134.61 ? 245 LEU A CD2 1 
ATOM   1575  N N   . ILE A 1 246 ? 195.282 174.413 133.863 1.00 142.58 ? 246 ILE A N   1 
ATOM   1576  C CA  . ILE A 1 246 ? 195.158 174.585 135.305 1.00 142.58 ? 246 ILE A CA  1 
ATOM   1577  C C   . ILE A 1 246 ? 196.156 173.704 136.057 1.00 142.58 ? 246 ILE A C   1 
ATOM   1578  O O   . ILE A 1 246 ? 196.462 173.975 137.225 1.00 142.58 ? 246 ILE A O   1 
ATOM   1579  C CB  . ILE A 1 246 ? 193.694 174.328 135.715 1.00 142.58 ? 246 ILE A CB  1 
ATOM   1580  C CG1 . ILE A 1 246 ? 193.383 174.892 137.110 1.00 142.58 ? 246 ILE A CG1 1 
ATOM   1581  C CG2 . ILE A 1 246 ? 193.343 172.841 135.618 1.00 142.58 ? 246 ILE A CG2 1 
ATOM   1582  C CD1 . ILE A 1 246 ? 193.439 176.397 137.198 1.00 142.58 ? 246 ILE A CD1 1 
ATOM   1583  N N   . ASN A 1 247 ? 196.693 172.666 135.412 1.00 143.55 ? 247 ASN A N   1 
ATOM   1584  C CA  . ASN A 1 247 ? 197.848 171.944 135.925 1.00 143.55 ? 247 ASN A CA  1 
ATOM   1585  C C   . ASN A 1 247 ? 199.144 172.683 135.630 1.00 143.55 ? 247 ASN A C   1 
ATOM   1586  O O   . ASN A 1 247 ? 200.147 172.450 136.315 1.00 143.55 ? 247 ASN A O   1 
ATOM   1587  C CB  . ASN A 1 247 ? 197.908 170.541 135.300 1.00 143.55 ? 247 ASN A CB  1 
ATOM   1588  C CG  . ASN A 1 247 ? 198.805 169.578 136.064 1.00 143.55 ? 247 ASN A CG  1 
ATOM   1589  O OD1 . ASN A 1 247 ? 199.333 169.898 137.123 1.00 143.55 ? 247 ASN A OD1 1 
ATOM   1590  N ND2 . ASN A 1 247 ? 198.983 168.384 135.513 1.00 143.55 ? 247 ASN A ND2 1 
ATOM   1591  N N   . ASN A 1 248 ? 199.135 173.539 134.600 1.00 150.46 ? 248 ASN A N   1 
ATOM   1592  C CA  . ASN A 1 248 ? 200.199 174.407 134.087 1.00 150.46 ? 248 ASN A CA  1 
ATOM   1593  C C   . ASN A 1 248 ? 201.332 173.612 133.429 1.00 150.46 ? 248 ASN A C   1 
ATOM   1594  O O   . ASN A 1 248 ? 202.252 174.215 132.867 1.00 150.46 ? 248 ASN A O   1 
ATOM   1595  C CB  . ASN A 1 248 ? 200.768 175.337 135.176 1.00 150.46 ? 248 ASN A CB  1 
ATOM   1596  C CG  . ASN A 1 248 ? 201.409 176.602 134.614 1.00 150.46 ? 248 ASN A CG  1 
ATOM   1597  O OD1 . ASN A 1 248 ? 201.388 176.853 133.407 1.00 150.46 ? 248 ASN A OD1 1 
ATOM   1598  N ND2 . ASN A 1 248 ? 201.981 177.408 135.499 1.00 150.46 ? 248 ASN A ND2 1 
ATOM   1599  N N   . GLU A 1 249 ? 201.296 172.278 133.460 1.00 156.02 ? 249 GLU A N   1 
ATOM   1600  C CA  . GLU A 1 249 ? 202.372 171.485 132.880 1.00 156.02 ? 249 GLU A CA  1 
ATOM   1601  C C   . GLU A 1 249 ? 201.844 170.323 132.054 1.00 156.02 ? 249 GLU A C   1 
ATOM   1602  O O   . GLU A 1 249 ? 200.635 170.212 131.826 1.00 156.02 ? 249 GLU A O   1 
ATOM   1603  C CB  . GLU A 1 249 ? 203.316 170.960 133.963 1.00 156.02 ? 249 GLU A CB  1 
ATOM   1604  C CG  . GLU A 1 249 ? 204.109 172.024 134.699 1.00 156.02 ? 249 GLU A CG  1 
ATOM   1605  C CD  . GLU A 1 249 ? 205.020 172.818 133.790 1.00 156.02 ? 249 GLU A CD  1 
ATOM   1606  O OE1 . GLU A 1 249 ? 205.555 172.248 132.813 1.00 156.02 ? 249 GLU A OE1 1 
ATOM   1607  O OE2 . GLU A 1 249 ? 205.190 174.027 134.051 1.00 156.02 ? 249 GLU A OE2 1 
ATOM   1608  N N   . ILE A 1 250 ? 202.758 169.447 131.639 1.00 154.28 ? 250 ILE A N   1 
ATOM   1609  C CA  . ILE A 1 250 ? 202.548 168.444 130.597 1.00 154.28 ? 250 ILE A CA  1 
ATOM   1610  C C   . ILE A 1 250 ? 201.503 167.417 131.017 1.00 154.28 ? 250 ILE A C   1 
ATOM   1611  O O   . ILE A 1 250 ? 201.672 166.734 132.036 1.00 154.28 ? 250 ILE A O   1 
ATOM   1612  C CB  . ILE A 1 250 ? 203.875 167.765 130.227 1.00 154.28 ? 250 ILE A CB  1 
ATOM   1613  C CG1 . ILE A 1 250 ? 204.820 168.792 129.590 1.00 154.28 ? 250 ILE A CG1 1 
ATOM   1614  C CG2 . ILE A 1 250 ? 203.636 166.574 129.308 1.00 154.28 ? 250 ILE A CG2 1 
ATOM   1615  C CD1 . ILE A 1 250 ? 206.236 168.301 129.410 1.00 154.28 ? 250 ILE A CD1 1 
ATOM   1616  N N   . PRO A 1 251 ? 200.425 167.277 130.260 1.00 137.03 ? 251 PRO A N   1 
ATOM   1617  C CA  . PRO A 1 251 ? 199.268 166.520 130.731 1.00 137.03 ? 251 PRO A CA  1 
ATOM   1618  C C   . PRO A 1 251 ? 199.480 165.024 130.559 1.00 137.03 ? 251 PRO A C   1 
ATOM   1619  O O   . PRO A 1 251 ? 200.501 164.559 130.065 1.00 137.03 ? 251 PRO A O   1 
ATOM   1620  C CB  . PRO A 1 251 ? 198.143 167.029 129.835 1.00 137.03 ? 251 PRO A CB  1 
ATOM   1621  C CG  . PRO A 1 251 ? 198.829 167.366 128.571 1.00 137.03 ? 251 PRO A CG  1 
ATOM   1622  C CD  . PRO A 1 251 ? 200.181 167.885 128.942 1.00 137.03 ? 251 PRO A CD  1 
ATOM   1623  N N   . ASP A 1 252 ? 198.473 164.277 130.986 1.00 129.78 ? 252 ASP A N   1 
ATOM   1624  C CA  . ASP A 1 252 ? 198.450 162.836 130.856 1.00 129.78 ? 252 ASP A CA  1 
ATOM   1625  C C   . ASP A 1 252 ? 198.106 162.465 129.418 1.00 129.78 ? 252 ASP A C   1 
ATOM   1626  O O   . ASP A 1 252 ? 197.667 163.299 128.628 1.00 129.78 ? 252 ASP A O   1 
ATOM   1627  C CB  . ASP A 1 252 ? 197.437 162.257 131.833 1.00 129.78 ? 252 ASP A CB  1 
ATOM   1628  C CG  . ASP A 1 252 ? 197.693 162.711 133.255 1.00 129.78 ? 252 ASP A CG  1 
ATOM   1629  O OD1 . ASP A 1 252 ? 198.858 163.029 133.571 1.00 129.78 ? 252 ASP A OD1 1 
ATOM   1630  O OD2 . ASP A 1 252 ? 196.736 162.768 134.055 1.00 129.78 ? 252 ASP A OD2 1 
ATOM   1631  N N   . CYS A 1 253 ? 198.312 161.203 129.066 1.00 121.91 ? 253 CYS A N   1 
ATOM   1632  C CA  . CYS A 1 253 ? 198.087 160.761 127.692 1.00 121.91 ? 253 CYS A CA  1 
ATOM   1633  C C   . CYS A 1 253 ? 197.451 159.377 127.726 1.00 121.91 ? 253 CYS A C   1 
ATOM   1634  O O   . CYS A 1 253 ? 198.109 158.399 128.086 1.00 121.91 ? 253 CYS A O   1 
ATOM   1635  C CB  . CYS A 1 253 ? 199.398 160.780 126.897 1.00 121.91 ? 253 CYS A CB  1 
ATOM   1636  S SG  . CYS A 1 253 ? 200.029 162.486 126.558 1.00 121.91 ? 253 CYS A SG  1 
ATOM   1637  N N   . TYR A 1 254 ? 196.178 159.295 127.337 1.00 101.82 ? 254 TYR A N   1 
ATOM   1638  C CA  . TYR A 1 254 ? 195.315 158.160 127.631 1.00 101.82 ? 254 TYR A CA  1 
ATOM   1639  C C   . TYR A 1 254 ? 195.334 157.101 126.536 1.00 101.82 ? 254 TYR A C   1 
ATOM   1640  O O   . TYR A 1 254 ? 195.917 157.270 125.466 1.00 101.82 ? 254 TYR A O   1 
ATOM   1641  C CB  . TYR A 1 254 ? 193.881 158.630 127.835 1.00 101.82 ? 254 TYR A CB  1 
ATOM   1642  C CG  . TYR A 1 254 ? 193.647 159.374 129.115 1.00 101.82 ? 254 TYR A CG  1 
ATOM   1643  C CD1 . TYR A 1 254 ? 193.301 158.701 130.269 1.00 101.82 ? 254 TYR A CD1 1 
ATOM   1644  C CD2 . TYR A 1 254 ? 193.796 160.748 129.177 1.00 101.82 ? 254 TYR A CD2 1 
ATOM   1645  C CE1 . TYR A 1 254 ? 193.082 159.377 131.436 1.00 101.82 ? 254 TYR A CE1 1 
ATOM   1646  C CE2 . TYR A 1 254 ? 193.582 161.432 130.352 1.00 101.82 ? 254 TYR A CE2 1 
ATOM   1647  C CZ  . TYR A 1 254 ? 193.232 160.735 131.478 1.00 101.82 ? 254 TYR A CZ  1 
ATOM   1648  O OH  . TYR A 1 254 ? 193.020 161.394 132.659 1.00 101.82 ? 254 TYR A OH  1 
ATOM   1649  N N   . THR A 1 255 ? 194.667 155.985 126.829 1.00 91.68  ? 255 THR A N   1 
ATOM   1650  C CA  . THR A 1 255 ? 194.461 154.901 125.871 1.00 91.68  ? 255 THR A CA  1 
ATOM   1651  C C   . THR A 1 255 ? 193.194 154.174 126.304 1.00 91.68  ? 255 THR A C   1 
ATOM   1652  O O   . THR A 1 255 ? 193.224 153.390 127.254 1.00 91.68  ? 255 THR A O   1 
ATOM   1653  C CB  . THR A 1 255 ? 195.648 153.951 125.828 1.00 91.68  ? 255 THR A CB  1 
ATOM   1654  O OG1 . THR A 1 255 ? 196.823 154.658 125.422 1.00 91.68  ? 255 THR A OG1 1 
ATOM   1655  C CG2 . THR A 1 255 ? 195.392 152.817 124.856 1.00 91.68  ? 255 THR A CG2 1 
ATOM   1656  N N   . PHE A 1 256 ? 192.092 154.434 125.618 1.00 81.40  ? 256 PHE A N   1 
ATOM   1657  C CA  . PHE A 1 256 ? 190.853 153.781 125.994 1.00 81.40  ? 256 PHE A CA  1 
ATOM   1658  C C   . PHE A 1 256 ? 190.788 152.380 125.409 1.00 81.40  ? 256 PHE A C   1 
ATOM   1659  O O   . PHE A 1 256 ? 191.484 152.050 124.452 1.00 81.40  ? 256 PHE A O   1 
ATOM   1660  C CB  . PHE A 1 256 ? 189.658 154.583 125.517 1.00 81.40  ? 256 PHE A CB  1 
ATOM   1661  C CG  . PHE A 1 256 ? 189.528 155.906 126.171 1.00 81.40  ? 256 PHE A CG  1 
ATOM   1662  C CD1 . PHE A 1 256 ? 188.991 156.013 127.431 1.00 81.40  ? 256 PHE A CD1 1 
ATOM   1663  C CD2 . PHE A 1 256 ? 189.931 157.045 125.518 1.00 81.40  ? 256 PHE A CD2 1 
ATOM   1664  C CE1 . PHE A 1 256 ? 188.869 157.233 128.027 1.00 81.40  ? 256 PHE A CE1 1 
ATOM   1665  C CE2 . PHE A 1 256 ? 189.809 158.266 126.109 1.00 81.40  ? 256 PHE A CE2 1 
ATOM   1666  C CZ  . PHE A 1 256 ? 189.278 158.362 127.362 1.00 81.40  ? 256 PHE A CZ  1 
ATOM   1667  N N   . SER A 1 257 ? 189.920 151.556 125.986 1.00 82.00  ? 257 SER A N   1 
ATOM   1668  C CA  . SER A 1 257 ? 189.735 150.185 125.516 1.00 82.00  ? 257 SER A CA  1 
ATOM   1669  C C   . SER A 1 257 ? 188.241 149.895 125.466 1.00 82.00  ? 257 SER A C   1 
ATOM   1670  O O   . SER A 1 257 ? 187.620 149.629 126.496 1.00 82.00  ? 257 SER A O   1 
ATOM   1671  C CB  . SER A 1 257 ? 190.456 149.194 126.411 1.00 82.00  ? 257 SER A CB  1 
ATOM   1672  O OG  . SER A 1 257 ? 190.249 147.875 125.943 1.00 82.00  ? 257 SER A OG  1 
ATOM   1673  N N   . VAL A 1 258 ? 187.682 149.911 124.271 1.00 76.84  ? 258 VAL A N   1 
ATOM   1674  C CA  . VAL A 1 258 ? 186.243 149.812 124.075 1.00 76.84  ? 258 VAL A CA  1 
ATOM   1675  C C   . VAL A 1 258 ? 185.860 148.349 123.912 1.00 76.84  ? 258 VAL A C   1 
ATOM   1676  O O   . VAL A 1 258 ? 186.542 147.596 123.211 1.00 76.84  ? 258 VAL A O   1 
ATOM   1677  C CB  . VAL A 1 258 ? 185.821 150.634 122.851 1.00 76.84  ? 258 VAL A CB  1 
ATOM   1678  C CG1 . VAL A 1 258 ? 184.335 150.572 122.639 1.00 76.84  ? 258 VAL A CG1 1 
ATOM   1679  C CG2 . VAL A 1 258 ? 186.286 152.054 123.004 1.00 76.84  ? 258 VAL A CG2 1 
ATOM   1680  N N   . LEU A 1 259 ? 184.783 147.938 124.570 1.00 72.26  ? 259 LEU A N   1 
ATOM   1681  C CA  . LEU A 1 259 ? 184.185 146.623 124.375 1.00 72.26  ? 259 LEU A CA  1 
ATOM   1682  C C   . LEU A 1 259 ? 182.693 146.796 124.146 1.00 72.26  ? 259 LEU A C   1 
ATOM   1683  O O   . LEU A 1 259 ? 181.944 147.067 125.086 1.00 72.26  ? 259 LEU A O   1 
ATOM   1684  C CB  . LEU A 1 259 ? 184.455 145.715 125.570 1.00 72.26  ? 259 LEU A CB  1 
ATOM   1685  C CG  . LEU A 1 259 ? 183.738 144.367 125.584 1.00 72.26  ? 259 LEU A CG  1 
ATOM   1686  C CD1 . LEU A 1 259 ? 184.052 143.564 124.362 1.00 72.26  ? 259 LEU A CD1 1 
ATOM   1687  C CD2 . LEU A 1 259 ? 184.110 143.587 126.827 1.00 72.26  ? 259 LEU A CD2 1 
ATOM   1688  N N   . ILE A 1 260 ? 182.257 146.641 122.908 1.00 72.13  ? 260 ILE A N   1 
ATOM   1689  C CA  . ILE A 1 260 ? 180.841 146.646 122.577 1.00 72.13  ? 260 ILE A CA  1 
ATOM   1690  C C   . ILE A 1 260 ? 180.352 145.212 122.625 1.00 72.13  ? 260 ILE A C   1 
ATOM   1691  O O   . ILE A 1 260 ? 180.865 144.354 121.902 1.00 72.13  ? 260 ILE A O   1 
ATOM   1692  C CB  . ILE A 1 260 ? 180.591 147.268 121.200 1.00 72.13  ? 260 ILE A CB  1 
ATOM   1693  C CG1 . ILE A 1 260 ? 180.981 148.738 121.225 1.00 72.13  ? 260 ILE A CG1 1 
ATOM   1694  C CG2 . ILE A 1 260 ? 179.148 147.106 120.807 1.00 72.13  ? 260 ILE A CG2 1 
ATOM   1695  C CD1 . ILE A 1 260 ? 181.000 149.372 119.879 1.00 72.13  ? 260 ILE A CD1 1 
ATOM   1696  N N   . THR A 1 261 ? 179.366 144.945 123.471 1.00 72.86  ? 261 THR A N   1 
ATOM   1697  C CA  . THR A 1 261 ? 178.975 143.582 123.795 1.00 72.86  ? 261 THR A CA  1 
ATOM   1698  C C   . THR A 1 261 ? 177.551 143.323 123.346 1.00 72.86  ? 261 THR A C   1 
ATOM   1699  O O   . THR A 1 261 ? 176.620 143.970 123.829 1.00 72.86  ? 261 THR A O   1 
ATOM   1700  C CB  . THR A 1 261 ? 179.086 143.331 125.293 1.00 72.86  ? 261 THR A CB  1 
ATOM   1701  O OG1 . THR A 1 261 ? 180.436 143.550 125.712 1.00 72.86  ? 261 THR A OG1 1 
ATOM   1702  C CG2 . THR A 1 261 ? 178.692 141.913 125.613 1.00 72.86  ? 261 THR A CG2 1 
ATOM   1703  N N   . PHE A 1 262 ? 177.379 142.366 122.448 1.00 68.18  ? 262 PHE A N   1 
ATOM   1704  C CA  . PHE A 1 262 ? 176.059 141.902 122.055 1.00 68.18  ? 262 PHE A CA  1 
ATOM   1705  C C   . PHE A 1 262 ? 175.756 140.599 122.782 1.00 68.18  ? 262 PHE A C   1 
ATOM   1706  O O   . PHE A 1 262 ? 175.894 139.512 122.231 1.00 68.18  ? 262 PHE A O   1 
ATOM   1707  C CB  . PHE A 1 262 ? 175.998 141.712 120.549 1.00 68.18  ? 262 PHE A CB  1 
ATOM   1708  C CG  . PHE A 1 262 ? 176.071 142.979 119.778 1.00 68.18  ? 262 PHE A CG  1 
ATOM   1709  C CD1 . PHE A 1 262 ? 174.934 143.706 119.519 1.00 68.18  ? 262 PHE A CD1 1 
ATOM   1710  C CD2 . PHE A 1 262 ? 177.278 143.453 119.327 1.00 68.18  ? 262 PHE A CD2 1 
ATOM   1711  C CE1 . PHE A 1 262 ? 174.996 144.870 118.807 1.00 68.18  ? 262 PHE A CE1 1 
ATOM   1712  C CE2 . PHE A 1 262 ? 177.349 144.621 118.619 1.00 68.18  ? 262 PHE A CE2 1 
ATOM   1713  C CZ  . PHE A 1 262 ? 176.207 145.330 118.359 1.00 68.18  ? 262 PHE A CZ  1 
ATOM   1714  N N   . ASP A 1 263 ? 175.330 140.715 124.031 1.00 75.72  ? 263 ASP A N   1 
ATOM   1715  C CA  . ASP A 1 263 ? 175.233 139.545 124.896 1.00 75.72  ? 263 ASP A CA  1 
ATOM   1716  C C   . ASP A 1 263 ? 173.916 138.813 124.714 1.00 75.72  ? 263 ASP A C   1 
ATOM   1717  O O   . ASP A 1 263 ? 172.848 139.416 124.771 1.00 75.72  ? 263 ASP A O   1 
ATOM   1718  C CB  . ASP A 1 263 ? 175.379 139.943 126.353 1.00 75.72  ? 263 ASP A CB  1 
ATOM   1719  C CG  . ASP A 1 263 ? 175.304 138.758 127.269 1.00 75.72  ? 263 ASP A CG  1 
ATOM   1720  O OD1 . ASP A 1 263 ? 176.293 138.005 127.339 1.00 75.72  ? 263 ASP A OD1 1 
ATOM   1721  O OD2 . ASP A 1 263 ? 174.249 138.563 127.905 1.00 75.72  ? 263 ASP A OD2 1 
ATOM   1722  N N   . ASN A 1 264 ? 173.993 137.500 124.527 1.00 77.80  ? 264 ASN A N   1 
ATOM   1723  C CA  . ASN A 1 264 ? 172.811 136.648 124.450 1.00 77.80  ? 264 ASN A CA  1 
ATOM   1724  C C   . ASN A 1 264 ? 173.035 135.441 125.356 1.00 77.80  ? 264 ASN A C   1 
ATOM   1725  O O   . ASN A 1 264 ? 173.359 134.351 124.895 1.00 77.80  ? 264 ASN A O   1 
ATOM   1726  C CB  . ASN A 1 264 ? 172.573 136.242 123.004 1.00 77.80  ? 264 ASN A CB  1 
ATOM   1727  C CG  . ASN A 1 264 ? 171.276 135.506 122.798 1.00 77.80  ? 264 ASN A CG  1 
ATOM   1728  O OD1 . ASN A 1 264 ? 170.491 135.304 123.722 1.00 77.80  ? 264 ASN A OD1 1 
ATOM   1729  N ND2 . ASN A 1 264 ? 171.047 135.084 121.567 1.00 77.80  ? 264 ASN A ND2 1 
ATOM   1730  N N   . LYS A 1 265 ? 172.778 135.606 126.645 1.00 78.93  ? 265 LYS A N   1 
ATOM   1731  C CA  . LYS A 1 265 ? 172.906 134.443 127.510 1.00 78.93  ? 265 LYS A CA  1 
ATOM   1732  C C   . LYS A 1 265 ? 171.592 133.709 127.667 1.00 78.93  ? 265 LYS A C   1 
ATOM   1733  O O   . LYS A 1 265 ? 171.549 132.486 127.534 1.00 78.93  ? 265 LYS A O   1 
ATOM   1734  C CB  . LYS A 1 265 ? 173.417 134.841 128.889 1.00 78.93  ? 265 LYS A CB  1 
ATOM   1735  C CG  . LYS A 1 265 ? 174.810 135.386 128.895 1.00 78.93  ? 265 LYS A CG  1 
ATOM   1736  C CD  . LYS A 1 265 ? 175.271 135.587 130.314 1.00 78.93  ? 265 LYS A CD  1 
ATOM   1737  C CE  . LYS A 1 265 ? 174.466 136.676 130.987 1.00 78.93  ? 265 LYS A CE  1 
ATOM   1738  N NZ  . LYS A 1 265 ? 174.699 138.000 130.358 1.00 78.93  ? 265 LYS A NZ  1 
ATOM   1739  N N   . ALA A 1 266 ? 170.515 134.445 127.918 1.00 80.97  ? 266 ALA A N   1 
ATOM   1740  C CA  . ALA A 1 266 ? 169.257 133.825 128.297 1.00 80.97  ? 266 ALA A CA  1 
ATOM   1741  C C   . ALA A 1 266 ? 168.563 133.122 127.143 1.00 80.97  ? 266 ALA A C   1 
ATOM   1742  O O   . ALA A 1 266 ? 167.637 132.345 127.401 1.00 80.97  ? 266 ALA A O   1 
ATOM   1743  C CB  . ALA A 1 266 ? 168.321 134.873 128.891 1.00 80.97  ? 266 ALA A CB  1 
ATOM   1744  N N   . HIS A 1 267 ? 168.989 133.377 125.902 1.00 83.38  ? 267 HIS A N   1 
ATOM   1745  C CA  . HIS A 1 267 ? 168.364 132.852 124.684 1.00 83.38  ? 267 HIS A CA  1 
ATOM   1746  C C   . HIS A 1 267 ? 166.875 133.160 124.643 1.00 83.38  ? 267 HIS A C   1 
ATOM   1747  O O   . HIS A 1 267 ? 166.049 132.331 124.262 1.00 83.38  ? 267 HIS A O   1 
ATOM   1748  C CB  . HIS A 1 267 ? 168.613 131.359 124.536 1.00 83.38  ? 267 HIS A CB  1 
ATOM   1749  C CG  . HIS A 1 267 ? 170.037 131.029 124.274 1.00 83.38  ? 267 HIS A CG  1 
ATOM   1750  N ND1 . HIS A 1 267 ? 170.608 131.161 123.028 1.00 83.38  ? 267 HIS A ND1 1 
ATOM   1751  C CD2 . HIS A 1 267 ? 171.023 130.621 125.102 1.00 83.38  ? 267 HIS A CD2 1 
ATOM   1752  C CE1 . HIS A 1 267 ? 171.880 130.821 123.096 1.00 83.38  ? 267 HIS A CE1 1 
ATOM   1753  N NE2 . HIS A 1 267 ? 172.158 130.487 124.343 1.00 83.38  ? 267 HIS A NE2 1 
ATOM   1754  N N   . SER A 1 268 ? 166.533 134.369 125.059 1.00 76.41  ? 268 SER A N   1 
ATOM   1755  C CA  . SER A 1 268 ? 165.151 134.724 125.293 1.00 76.41  ? 268 SER A CA  1 
ATOM   1756  C C   . SER A 1 268 ? 164.558 135.577 124.193 1.00 76.41  ? 268 SER A C   1 
ATOM   1757  O O   . SER A 1 268 ? 163.475 136.132 124.385 1.00 76.41  ? 268 SER A O   1 
ATOM   1758  C CB  . SER A 1 268 ? 165.026 135.452 126.630 1.00 76.41  ? 268 SER A CB  1 
ATOM   1759  O OG  . SER A 1 268 ? 165.761 136.654 126.594 1.00 76.41  ? 268 SER A OG  1 
ATOM   1760  N N   . GLY A 1 269 ? 165.215 135.691 123.050 1.00 71.65  ? 269 GLY A N   1 
ATOM   1761  C CA  . GLY A 1 269 ? 164.699 136.550 122.009 1.00 71.65  ? 269 GLY A CA  1 
ATOM   1762  C C   . GLY A 1 269 ? 164.895 138.017 122.284 1.00 71.65  ? 269 GLY A C   1 
ATOM   1763  O O   . GLY A 1 269 ? 164.113 138.837 121.804 1.00 71.65  ? 269 GLY A O   1 
ATOM   1764  N N   . ARG A 1 270 ? 165.921 138.373 123.048 1.00 65.05  ? 270 ARG A N   1 
ATOM   1765  C CA  . ARG A 1 270 ? 166.195 139.762 123.388 1.00 65.05  ? 270 ARG A CA  1 
ATOM   1766  C C   . ARG A 1 270 ? 167.675 139.906 123.676 1.00 65.05  ? 270 ARG A C   1 
ATOM   1767  O O   . ARG A 1 270 ? 168.161 139.359 124.666 1.00 65.05  ? 270 ARG A O   1 
ATOM   1768  C CB  . ARG A 1 270 ? 165.386 140.194 124.598 1.00 65.05  ? 270 ARG A CB  1 
ATOM   1769  C CG  . ARG A 1 270 ? 165.710 141.584 125.050 1.00 65.05  ? 270 ARG A CG  1 
ATOM   1770  C CD  . ARG A 1 270 ? 164.880 141.977 126.231 1.00 65.05  ? 270 ARG A CD  1 
ATOM   1771  N NE  . ARG A 1 270 ? 165.191 143.325 126.670 1.00 65.05  ? 270 ARG A NE  1 
ATOM   1772  C CZ  . ARG A 1 270 ? 166.129 143.609 127.560 1.00 65.05  ? 270 ARG A CZ  1 
ATOM   1773  N NH1 . ARG A 1 270 ? 166.842 142.635 128.101 1.00 65.05  ? 270 ARG A NH1 1 
ATOM   1774  N NH2 . ARG A 1 270 ? 166.350 144.863 127.910 1.00 65.05  ? 270 ARG A NH2 1 
ATOM   1775  N N   . ILE A 1 271 ? 168.383 140.653 122.843 1.00 58.36  ? 271 ILE A N   1 
ATOM   1776  C CA  . ILE A 1 271 ? 169.821 140.803 123.020 1.00 58.36  ? 271 ILE A CA  1 
ATOM   1777  C C   . ILE A 1 271 ? 170.141 142.192 123.551 1.00 58.36  ? 271 ILE A C   1 
ATOM   1778  O O   . ILE A 1 271 ? 169.902 143.181 122.853 1.00 58.36  ? 271 ILE A O   1 
ATOM   1779  C CB  . ILE A 1 271 ? 170.563 140.548 121.707 1.00 58.36  ? 271 ILE A CB  1 
ATOM   1780  C CG1 . ILE A 1 271 ? 170.344 139.119 121.255 1.00 58.36  ? 271 ILE A CG1 1 
ATOM   1781  C CG2 . ILE A 1 271 ? 172.027 140.786 121.879 1.00 58.36  ? 271 ILE A CG2 1 
ATOM   1782  C CD1 . ILE A 1 271 ? 170.905 138.839 119.911 1.00 58.36  ? 271 ILE A CD1 1 
ATOM   1783  N N   . PRO A 1 272 ? 170.657 142.320 124.766 1.00 60.69  ? 272 PRO A N   1 
ATOM   1784  C CA  . PRO A 1 272 ? 171.130 143.621 125.238 1.00 60.69  ? 272 PRO A CA  1 
ATOM   1785  C C   . PRO A 1 272 ? 172.384 144.064 124.510 1.00 60.69  ? 272 PRO A C   1 
ATOM   1786  O O   . PRO A 1 272 ? 173.119 143.264 123.937 1.00 60.69  ? 272 PRO A O   1 
ATOM   1787  C CB  . PRO A 1 272 ? 171.422 143.374 126.716 1.00 60.69  ? 272 PRO A CB  1 
ATOM   1788  C CG  . PRO A 1 272 ? 170.561 142.254 127.070 1.00 60.69  ? 272 PRO A CG  1 
ATOM   1789  C CD  . PRO A 1 272 ? 170.506 141.372 125.874 1.00 60.69  ? 272 PRO A CD  1 
ATOM   1790  N N   . ILE A 1 273 ? 172.619 145.370 124.535 1.00 55.17  ? 273 ILE A N   1 
ATOM   1791  C CA  . ILE A 1 273 ? 173.785 145.983 123.916 1.00 55.17  ? 273 ILE A CA  1 
ATOM   1792  C C   . ILE A 1 273 ? 174.456 146.852 124.966 1.00 55.17  ? 273 ILE A C   1 
ATOM   1793  O O   . ILE A 1 273 ? 173.775 147.587 125.686 1.00 55.17  ? 273 ILE A O   1 
ATOM   1794  C CB  . ILE A 1 273 ? 173.393 146.809 122.681 1.00 55.17  ? 273 ILE A CB  1 
ATOM   1795  C CG1 . ILE A 1 273 ? 172.817 145.911 121.602 1.00 55.17  ? 273 ILE A CG1 1 
ATOM   1796  C CG2 . ILE A 1 273 ? 174.567 147.484 122.102 1.00 55.17  ? 273 ILE A CG2 1 
ATOM   1797  C CD1 . ILE A 1 273 ? 172.241 146.662 120.451 1.00 55.17  ? 273 ILE A CD1 1 
ATOM   1798  N N   . SER A 1 274 ? 175.776 146.757 125.078 1.00 66.09  ? 274 SER A N   1 
ATOM   1799  C CA  . SER A 1 274 ? 176.505 147.408 126.152 1.00 66.09  ? 274 SER A CA  1 
ATOM   1800  C C   . SER A 1 274 ? 177.722 148.133 125.600 1.00 66.09  ? 274 SER A C   1 
ATOM   1801  O O   . SER A 1 274 ? 178.025 148.059 124.410 1.00 66.09  ? 274 SER A O   1 
ATOM   1802  C CB  . SER A 1 274 ? 176.933 146.383 127.198 1.00 66.09  ? 274 SER A CB  1 
ATOM   1803  O OG  . SER A 1 274 ? 175.800 145.744 127.749 1.00 66.09  ? 274 SER A OG  1 
ATOM   1804  N N   . LEU A 1 275 ? 178.432 148.833 126.482 1.00 72.75  ? 275 LEU A N   1 
ATOM   1805  C CA  . LEU A 1 275 ? 179.703 149.451 126.126 1.00 72.75  ? 275 LEU A CA  1 
ATOM   1806  C C   . LEU A 1 275 ? 180.528 149.644 127.390 1.00 72.75  ? 275 LEU A C   1 
ATOM   1807  O O   . LEU A 1 275 ? 179.982 149.992 128.437 1.00 72.75  ? 275 LEU A O   1 
ATOM   1808  C CB  . LEU A 1 275 ? 179.482 150.782 125.412 1.00 72.75  ? 275 LEU A CB  1 
ATOM   1809  C CG  . LEU A 1 275 ? 180.672 151.373 124.666 1.00 72.75  ? 275 LEU A CG  1 
ATOM   1810  C CD1 . LEU A 1 275 ? 180.165 152.057 123.441 1.00 72.75  ? 275 LEU A CD1 1 
ATOM   1811  C CD2 . LEU A 1 275 ? 181.439 152.372 125.495 1.00 72.75  ? 275 LEU A CD2 1 
ATOM   1812  N N   . GLU A 1 276 ? 181.838 149.425 127.290 1.00 84.54  ? 276 GLU A N   1 
ATOM   1813  C CA  . GLU A 1 276 ? 182.749 149.502 128.424 1.00 84.54  ? 276 GLU A CA  1 
ATOM   1814  C C   . GLU A 1 276 ? 184.022 150.221 128.013 1.00 84.54  ? 276 GLU A C   1 
ATOM   1815  O O   . GLU A 1 276 ? 184.427 150.169 126.852 1.00 84.54  ? 276 GLU A O   1 
ATOM   1816  C CB  . GLU A 1 276 ? 183.139 148.115 128.931 1.00 84.54  ? 276 GLU A CB  1 
ATOM   1817  C CG  . GLU A 1 276 ? 181.998 147.246 129.408 1.00 84.54  ? 276 GLU A CG  1 
ATOM   1818  C CD  . GLU A 1 276 ? 181.363 147.749 130.677 1.00 84.54  ? 276 GLU A CD  1 
ATOM   1819  O OE1 . GLU A 1 276 ? 182.084 148.320 131.524 1.00 84.54  ? 276 GLU A OE1 1 
ATOM   1820  O OE2 . GLU A 1 276 ? 180.136 147.574 130.837 1.00 84.54  ? 276 GLU A OE2 1 
ATOM   1821  N N   . THR A 1 277 ? 184.667 150.884 128.972 1.00 84.95  ? 277 THR A N   1 
ATOM   1822  C CA  . THR A 1 277 ? 185.998 151.444 128.774 1.00 84.95  ? 277 THR A CA  1 
ATOM   1823  C C   . THR A 1 277 ? 186.873 151.190 129.990 1.00 84.95  ? 277 THR A C   1 
ATOM   1824  O O   . THR A 1 277 ? 186.380 151.060 131.110 1.00 84.95  ? 277 THR A O   1 
ATOM   1825  C CB  . THR A 1 277 ? 185.992 152.944 128.553 1.00 84.95  ? 277 THR A CB  1 
ATOM   1826  O OG1 . THR A 1 277 ? 185.347 153.568 129.663 1.00 84.95  ? 277 THR A OG1 1 
ATOM   1827  C CG2 . THR A 1 277 ? 185.320 153.325 127.257 1.00 84.95  ? 277 THR A CG2 1 
ATOM   1828  N N   . GLN A 1 278 ? 188.183 151.141 129.761 1.00 91.13  ? 278 GLN A N   1 
ATOM   1829  C CA  . GLN A 1 278 ? 189.169 151.173 130.837 1.00 91.13  ? 278 GLN A CA  1 
ATOM   1830  C C   . GLN A 1 278 ? 190.263 152.135 130.406 1.00 91.13  ? 278 GLN A C   1 
ATOM   1831  O O   . GLN A 1 278 ? 191.008 151.844 129.469 1.00 91.13  ? 278 GLN A O   1 
ATOM   1832  C CB  . GLN A 1 278 ? 189.766 149.799 131.127 1.00 91.13  ? 278 GLN A CB  1 
ATOM   1833  C CG  . GLN A 1 278 ? 188.790 148.747 131.567 1.00 91.13  ? 278 GLN A CG  1 
ATOM   1834  C CD  . GLN A 1 278 ? 188.213 148.000 130.392 1.00 91.13  ? 278 GLN A CD  1 
ATOM   1835  O OE1 . GLN A 1 278 ? 188.763 148.042 129.296 1.00 91.13  ? 278 GLN A OE1 1 
ATOM   1836  N NE2 . GLN A 1 278 ? 187.108 147.301 130.612 1.00 91.13  ? 278 GLN A NE2 1 
ATOM   1837  N N   . ALA A 1 279 ? 190.366 153.272 131.081 1.00 103.31 ? 279 ALA A N   1 
ATOM   1838  C CA  . ALA A 1 279 ? 191.403 154.231 130.734 1.00 103.31 ? 279 ALA A CA  1 
ATOM   1839  C C   . ALA A 1 279 ? 192.753 153.792 131.279 1.00 103.31 ? 279 ALA A C   1 
ATOM   1840  O O   . ALA A 1 279 ? 193.102 154.112 132.418 1.00 103.31 ? 279 ALA A O   1 
ATOM   1841  C CB  . ALA A 1 279 ? 191.052 155.622 131.256 1.00 103.31 ? 279 ALA A CB  1 
ATOM   1842  N N   . HIS A 1 280 ? 193.514 153.057 130.477 1.00 109.06 ? 280 HIS A N   1 
ATOM   1843  C CA  . HIS A 1 280 ? 194.886 152.716 130.831 1.00 109.06 ? 280 HIS A CA  1 
ATOM   1844  C C   . HIS A 1 280 ? 195.783 153.922 130.590 1.00 109.06 ? 280 HIS A C   1 
ATOM   1845  O O   . HIS A 1 280 ? 196.040 154.295 129.444 1.00 109.06 ? 280 HIS A O   1 
ATOM   1846  C CB  . HIS A 1 280 ? 195.343 151.512 130.017 1.00 109.06 ? 280 HIS A CB  1 
ATOM   1847  C CG  . HIS A 1 280 ? 196.779 151.160 130.226 1.00 109.06 ? 280 HIS A CG  1 
ATOM   1848  N ND1 . HIS A 1 280 ? 197.259 150.672 131.420 1.00 109.06 ? 280 HIS A ND1 1 
ATOM   1849  C CD2 . HIS A 1 280 ? 197.837 151.201 129.383 1.00 109.06 ? 280 HIS A CD2 1 
ATOM   1850  C CE1 . HIS A 1 280 ? 198.556 150.447 131.312 1.00 109.06 ? 280 HIS A CE1 1 
ATOM   1851  N NE2 . HIS A 1 280 ? 198.932 150.763 130.086 1.00 109.06 ? 280 HIS A NE2 1 
ATOM   1852  N N   . ILE A 1 281 ? 196.267 154.534 131.663 1.00 108.48 ? 281 ILE A N   1 
ATOM   1853  C CA  . ILE A 1 281 ? 196.998 155.789 131.584 1.00 108.48 ? 281 ILE A CA  1 
ATOM   1854  C C   . ILE A 1 281 ? 198.483 155.491 131.687 1.00 108.48 ? 281 ILE A C   1 
ATOM   1855  O O   . ILE A 1 281 ? 198.897 154.644 132.488 1.00 108.48 ? 281 ILE A O   1 
ATOM   1856  C CB  . ILE A 1 281 ? 196.579 156.744 132.706 1.00 108.48 ? 281 ILE A CB  1 
ATOM   1857  C CG1 . ILE A 1 281 ? 195.077 156.802 132.815 1.00 108.48 ? 281 ILE A CG1 1 
ATOM   1858  C CG2 . ILE A 1 281 ? 197.057 158.136 132.409 1.00 108.48 ? 281 ILE A CG2 1 
ATOM   1859  C CD1 . ILE A 1 281 ? 194.621 157.505 134.065 1.00 108.48 ? 281 ILE A CD1 1 
ATOM   1860  N N   . GLN A 1 282 ? 199.281 156.170 130.868 1.00 115.19 ? 282 GLN A N   1 
ATOM   1861  C CA  . GLN A 1 282 ? 200.712 156.293 131.095 1.00 115.19 ? 282 GLN A CA  1 
ATOM   1862  C C   . GLN A 1 282 ? 201.174 157.593 130.464 1.00 115.19 ? 282 GLN A C   1 
ATOM   1863  O O   . GLN A 1 282 ? 200.441 158.235 129.715 1.00 115.19 ? 282 GLN A O   1 
ATOM   1864  C CB  . GLN A 1 282 ? 201.506 155.106 130.540 1.00 115.19 ? 282 GLN A CB  1 
ATOM   1865  C CG  . GLN A 1 282 ? 201.507 154.976 129.038 1.00 115.19 ? 282 GLN A CG  1 
ATOM   1866  C CD  . GLN A 1 282 ? 200.390 154.087 128.545 1.00 115.19 ? 282 GLN A CD  1 
ATOM   1867  O OE1 . GLN A 1 282 ? 199.446 153.808 129.273 1.00 115.19 ? 282 GLN A OE1 1 
ATOM   1868  N NE2 . GLN A 1 282 ? 200.498 153.624 127.308 1.00 115.19 ? 282 GLN A NE2 1 
ATOM   1869  N N   . GLU A 1 283 ? 202.396 157.989 130.791 1.00 129.43 ? 283 GLU A N   1 
ATOM   1870  C CA  . GLU A 1 283 ? 202.935 159.222 130.250 1.00 129.43 ? 283 GLU A CA  1 
ATOM   1871  C C   . GLU A 1 283 ? 203.317 159.036 128.794 1.00 129.43 ? 283 GLU A C   1 
ATOM   1872  O O   . GLU A 1 283 ? 203.622 157.929 128.345 1.00 129.43 ? 283 GLU A O   1 
ATOM   1873  C CB  . GLU A 1 283 ? 204.153 159.689 131.044 1.00 129.43 ? 283 GLU A CB  1 
ATOM   1874  C CG  . GLU A 1 283 ? 203.843 160.192 132.443 1.00 129.43 ? 283 GLU A CG  1 
ATOM   1875  C CD  . GLU A 1 283 ? 205.087 160.640 133.193 1.00 129.43 ? 283 GLU A CD  1 
ATOM   1876  O OE1 . GLU A 1 283 ? 206.203 160.463 132.663 1.00 129.43 ? 283 GLU A OE1 1 
ATOM   1877  O OE2 . GLU A 1 283 ? 204.950 161.164 134.319 1.00 129.43 ? 283 GLU A OE2 1 
ATOM   1878  N N   . CYS A 1 284 ? 203.298 160.136 128.060 1.00 139.89 ? 284 CYS A N   1 
ATOM   1879  C CA  . CYS A 1 284 ? 203.600 160.151 126.640 1.00 139.89 ? 284 CYS A CA  1 
ATOM   1880  C C   . CYS A 1 284 ? 204.962 160.784 126.387 1.00 139.89 ? 284 CYS A C   1 
ATOM   1881  O O   . CYS A 1 284 ? 205.525 161.466 127.246 1.00 139.89 ? 284 CYS A O   1 
ATOM   1882  C CB  . CYS A 1 284 ? 202.489 160.877 125.881 1.00 139.89 ? 284 CYS A CB  1 
ATOM   1883  S SG  . CYS A 1 284 ? 202.054 162.457 126.592 1.00 139.89 ? 284 CYS A SG  1 
ATOM   1884  N N   . LYS A 1 285 ? 205.481 160.543 125.183 1.00 144.76 ? 285 LYS A N   1 
ATOM   1885  C CA  . LYS A 1 285 ? 206.876 160.829 124.873 1.00 144.76 ? 285 LYS A CA  1 
ATOM   1886  C C   . LYS A 1 285 ? 207.136 162.328 124.748 1.00 144.76 ? 285 LYS A C   1 
ATOM   1887  O O   . LYS A 1 285 ? 206.374 163.056 124.108 1.00 144.76 ? 285 LYS A O   1 
ATOM   1888  C CB  . LYS A 1 285 ? 207.271 160.123 123.575 1.00 144.76 ? 285 LYS A CB  1 
ATOM   1889  C CG  . LYS A 1 285 ? 208.725 160.308 123.176 1.00 144.76 ? 285 LYS A CG  1 
ATOM   1890  C CD  . LYS A 1 285 ? 209.050 159.613 121.870 1.00 144.76 ? 285 LYS A CD  1 
ATOM   1891  C CE  . LYS A 1 285 ? 210.481 159.899 121.454 1.00 144.76 ? 285 LYS A CE  1 
ATOM   1892  N NZ  . LYS A 1 285 ? 210.813 159.277 120.148 1.00 144.76 ? 285 LYS A NZ  1 
ATOM   1893  N N   . HIS A 1 286 ? 208.234 162.787 125.365 1.00 154.17 ? 286 HIS A N   1 
ATOM   1894  C CA  . HIS A 1 286 ? 208.662 164.181 125.321 1.00 154.17 ? 286 HIS A CA  1 
ATOM   1895  C C   . HIS A 1 286 ? 210.135 164.301 125.702 1.00 154.17 ? 286 HIS A C   1 
ATOM   1896  O O   . HIS A 1 286 ? 210.604 163.580 126.592 1.00 154.17 ? 286 HIS A O   1 
ATOM   1897  C CB  . HIS A 1 286 ? 207.816 165.030 126.268 1.00 154.17 ? 286 HIS A CB  1 
ATOM   1898  C CG  . HIS A 1 286 ? 207.949 164.626 127.698 1.00 154.17 ? 286 HIS A CG  1 
ATOM   1899  N ND1 . HIS A 1 286 ? 208.931 165.126 128.523 1.00 154.17 ? 286 HIS A ND1 1 
ATOM   1900  C CD2 . HIS A 1 286 ? 207.252 163.735 128.440 1.00 154.17 ? 286 HIS A CD2 1 
ATOM   1901  C CE1 . HIS A 1 286 ? 208.821 164.577 129.718 1.00 154.17 ? 286 HIS A CE1 1 
ATOM   1902  N NE2 . HIS A 1 286 ? 207.809 163.729 129.695 1.00 154.17 ? 286 HIS A NE2 1 
ATOM   1903  N N   . PRO A 1 287 ? 210.900 165.159 125.036 1.00 162.66 ? 287 PRO A N   1 
ATOM   1904  C CA  . PRO A 1 287 ? 212.210 165.585 125.578 1.00 162.66 ? 287 PRO A CA  1 
ATOM   1905  C C   . PRO A 1 287 ? 212.177 166.894 126.356 1.00 162.66 ? 287 PRO A C   1 
ATOM   1906  O O   . PRO A 1 287 ? 213.253 167.400 126.691 1.00 162.66 ? 287 PRO A O   1 
ATOM   1907  C CB  . PRO A 1 287 ? 213.044 165.746 124.304 1.00 162.66 ? 287 PRO A CB  1 
ATOM   1908  C CG  . PRO A 1 287 ? 212.072 166.161 123.286 1.00 162.66 ? 287 PRO A CG  1 
ATOM   1909  C CD  . PRO A 1 287 ? 210.786 165.449 123.599 1.00 162.66 ? 287 PRO A CD  1 
ATOM   1910  N N   . SER A 1 288 ? 211.000 167.446 126.646 1.00 167.78 ? 288 SER A N   1 
ATOM   1911  C CA  . SER A 1 288 ? 210.881 168.768 127.241 1.00 167.78 ? 288 SER A CA  1 
ATOM   1912  C C   . SER A 1 288 ? 211.031 168.699 128.763 1.00 167.78 ? 288 SER A C   1 
ATOM   1913  O O   . SER A 1 288 ? 211.000 167.628 129.374 1.00 167.78 ? 288 SER A O   1 
ATOM   1914  C CB  . SER A 1 288 ? 209.548 169.406 126.842 1.00 167.78 ? 288 SER A CB  1 
ATOM   1915  O OG  . SER A 1 288 ? 209.397 170.703 127.397 1.00 167.78 ? 288 SER A OG  1 
ATOM   1916  N N   . VAL A 1 289 ? 211.183 169.872 129.382 1.00 178.87 ? 289 VAL A N   1 
ATOM   1917  C CA  . VAL A 1 289 ? 211.566 170.031 130.780 1.00 178.87 ? 289 VAL A CA  1 
ATOM   1918  C C   . VAL A 1 289 ? 210.692 171.143 131.369 1.00 178.87 ? 289 VAL A C   1 
ATOM   1919  O O   . VAL A 1 289 ? 209.716 171.563 130.740 1.00 178.87 ? 289 VAL A O   1 
ATOM   1920  C CB  . VAL A 1 289 ? 213.093 170.293 130.909 1.00 178.87 ? 289 VAL A CB  1 
ATOM   1921  C CG1 . VAL A 1 289 ? 213.501 171.711 130.474 1.00 178.87 ? 289 VAL A CG1 1 
ATOM   1922  C CG2 . VAL A 1 289 ? 213.709 169.814 132.257 1.00 178.87 ? 289 VAL A CG2 1 
ATOM   1923  N N   . PHE A 1 290 ? 210.998 171.560 132.619 1.00 174.66 ? 290 PHE A N   1 
ATOM   1924  C CA  . PHE A 1 290 ? 210.340 172.586 133.460 1.00 174.66 ? 290 PHE A CA  1 
ATOM   1925  C C   . PHE A 1 290 ? 209.029 172.119 134.077 1.00 174.66 ? 290 PHE A C   1 
ATOM   1926  O O   . PHE A 1 290 ? 208.215 172.958 134.475 1.00 174.66 ? 290 PHE A O   1 
ATOM   1927  C CB  . PHE A 1 290 ? 210.054 173.924 132.755 1.00 174.66 ? 290 PHE A CB  1 
ATOM   1928  C CG  . PHE A 1 290 ? 211.267 174.753 132.461 1.00 174.66 ? 290 PHE A CG  1 
ATOM   1929  C CD1 . PHE A 1 290 ? 211.855 175.521 133.453 1.00 174.66 ? 290 PHE A CD1 1 
ATOM   1930  C CD2 . PHE A 1 290 ? 211.786 174.809 131.179 1.00 174.66 ? 290 PHE A CD2 1 
ATOM   1931  C CE1 . PHE A 1 290 ? 212.962 176.304 133.179 1.00 174.66 ? 290 PHE A CE1 1 
ATOM   1932  C CE2 . PHE A 1 290 ? 212.893 175.587 130.897 1.00 174.66 ? 290 PHE A CE2 1 
ATOM   1933  C CZ  . PHE A 1 290 ? 213.481 176.335 131.897 1.00 174.66 ? 290 PHE A CZ  1 
ATOM   1934  N N   . GLN A 1 291 ? 208.796 170.812 134.198 1.00 167.88 ? 291 GLN A N   1 
ATOM   1935  C CA  . GLN A 1 291 ? 207.504 170.359 134.704 1.00 167.88 ? 291 GLN A CA  1 
ATOM   1936  C C   . GLN A 1 291 ? 207.438 170.420 136.226 1.00 167.88 ? 291 GLN A C   1 
ATOM   1937  O O   . GLN A 1 291 ? 206.439 170.878 136.792 1.00 167.88 ? 291 GLN A O   1 
ATOM   1938  C CB  . GLN A 1 291 ? 207.197 168.947 134.194 1.00 167.88 ? 291 GLN A CB  1 
ATOM   1939  C CG  . GLN A 1 291 ? 205.841 168.417 134.648 1.00 167.88 ? 291 GLN A CG  1 
ATOM   1940  C CD  . GLN A 1 291 ? 205.429 167.147 133.941 1.00 167.88 ? 291 GLN A CD  1 
ATOM   1941  O OE1 . GLN A 1 291 ? 206.149 166.639 133.082 1.00 167.88 ? 291 GLN A OE1 1 
ATOM   1942  N NE2 . GLN A 1 291 ? 204.261 166.625 134.300 1.00 167.88 ? 291 GLN A NE2 1 
ATOM   1943  N N   . HIS A 1 292 ? 208.502 170.004 136.906 1.00 172.86 ? 292 HIS A N   1 
ATOM   1944  C CA  . HIS A 1 292 ? 208.458 169.828 138.357 1.00 172.86 ? 292 HIS A CA  1 
ATOM   1945  C C   . HIS A 1 292 ? 208.973 171.039 139.122 1.00 172.86 ? 292 HIS A C   1 
ATOM   1946  O O   . HIS A 1 292 ? 209.597 170.889 140.177 1.00 172.86 ? 292 HIS A O   1 
ATOM   1947  C CB  . HIS A 1 292 ? 209.232 168.573 138.741 1.00 172.86 ? 292 HIS A CB  1 
ATOM   1948  C CG  . HIS A 1 292 ? 208.580 167.304 138.289 1.00 172.86 ? 292 HIS A CG  1 
ATOM   1949  N ND1 . HIS A 1 292 ? 208.831 166.733 137.061 1.00 172.86 ? 292 HIS A ND1 1 
ATOM   1950  C CD2 . HIS A 1 292 ? 207.681 166.498 138.901 1.00 172.86 ? 292 HIS A CD2 1 
ATOM   1951  C CE1 . HIS A 1 292 ? 208.118 165.628 136.937 1.00 172.86 ? 292 HIS A CE1 1 
ATOM   1952  N NE2 . HIS A 1 292 ? 207.411 165.463 138.040 1.00 172.86 ? 292 HIS A NE2 1 
ATOM   1953  N N   . GLY A 1 293 ? 208.737 172.251 138.614 1.00 173.27 ? 293 GLY A N   1 
ATOM   1954  C CA  . GLY A 1 293 ? 209.012 173.438 139.405 1.00 173.27 ? 293 GLY A CA  1 
ATOM   1955  C C   . GLY A 1 293 ? 208.061 173.591 140.574 1.00 173.27 ? 293 GLY A C   1 
ATOM   1956  O O   . GLY A 1 293 ? 208.425 174.161 141.608 1.00 173.27 ? 293 GLY A O   1 
ATOM   1957  N N   . ASP A 1 294 ? 206.836 173.087 140.429 1.00 171.05 ? 294 ASP A N   1 
ATOM   1958  C CA  . ASP A 1 294 ? 205.861 173.037 141.505 1.00 171.05 ? 294 ASP A CA  1 
ATOM   1959  C C   . ASP A 1 294 ? 205.310 171.643 141.754 1.00 171.05 ? 294 ASP A C   1 
ATOM   1960  O O   . ASP A 1 294 ? 204.674 171.428 142.791 1.00 171.05 ? 294 ASP A O   1 
ATOM   1961  C CB  . ASP A 1 294 ? 204.679 173.973 141.206 1.00 171.05 ? 294 ASP A CB  1 
ATOM   1962  C CG  . ASP A 1 294 ? 205.073 175.432 141.214 1.00 171.05 ? 294 ASP A CG  1 
ATOM   1963  O OD1 . ASP A 1 294 ? 206.018 175.794 141.945 1.00 171.05 ? 294 ASP A OD1 1 
ATOM   1964  O OD2 . ASP A 1 294 ? 204.430 176.217 140.489 1.00 171.05 ? 294 ASP A OD2 1 
ATOM   1965  N N   . ASN A 1 295 ? 205.525 170.701 140.834 1.00 167.09 ? 295 ASN A N   1 
ATOM   1966  C CA  . ASN A 1 295 ? 204.926 169.376 140.936 1.00 167.09 ? 295 ASN A CA  1 
ATOM   1967  C C   . ASN A 1 295 ? 205.601 168.527 142.002 1.00 167.09 ? 295 ASN A C   1 
ATOM   1968  O O   . ASN A 1 295 ? 204.927 167.727 142.660 1.00 167.09 ? 295 ASN A O   1 
ATOM   1969  C CB  . ASN A 1 295 ? 204.995 168.685 139.573 1.00 167.09 ? 295 ASN A CB  1 
ATOM   1970  C CG  . ASN A 1 295 ? 204.051 167.499 139.456 1.00 167.09 ? 295 ASN A CG  1 
ATOM   1971  O OD1 . ASN A 1 295 ? 203.313 167.167 140.383 1.00 167.09 ? 295 ASN A OD1 1 
ATOM   1972  N ND2 . ASN A 1 295 ? 204.067 166.858 138.294 1.00 167.09 ? 295 ASN A ND2 1 
ATOM   1973  N N   . SER A 1 296 ? 206.908 168.703 142.208 1.00 158.75 ? 296 SER A N   1 
ATOM   1974  C CA  . SER A 1 296 ? 207.590 168.001 143.290 1.00 158.75 ? 296 SER A CA  1 
ATOM   1975  C C   . SER A 1 296 ? 207.207 168.542 144.665 1.00 158.75 ? 296 SER A C   1 
ATOM   1976  O O   . SER A 1 296 ? 207.449 167.864 145.670 1.00 158.75 ? 296 SER A O   1 
ATOM   1977  C CB  . SER A 1 296 ? 209.104 168.069 143.088 1.00 158.75 ? 296 SER A CB  1 
ATOM   1978  O OG  . SER A 1 296 ? 209.569 169.401 143.187 1.00 158.75 ? 296 SER A OG  1 
ATOM   1979  N N   . PHE A 1 297 ? 206.595 169.731 144.735 1.00 157.24 ? 297 PHE A N   1 
ATOM   1980  C CA  . PHE A 1 297 ? 206.001 170.226 145.973 1.00 157.24 ? 297 PHE A CA  1 
ATOM   1981  C C   . PHE A 1 297 ? 204.691 169.529 146.326 1.00 157.24 ? 297 PHE A C   1 
ATOM   1982  O O   . PHE A 1 297 ? 204.122 169.814 147.386 1.00 157.24 ? 297 PHE A O   1 
ATOM   1983  C CB  . PHE A 1 297 ? 205.775 171.742 145.905 1.00 157.24 ? 297 PHE A CB  1 
ATOM   1984  C CG  . PHE A 1 297 ? 207.042 172.548 145.977 1.00 157.24 ? 297 PHE A CG  1 
ATOM   1985  C CD1 . PHE A 1 297 ? 207.692 172.730 147.187 1.00 157.24 ? 297 PHE A CD1 1 
ATOM   1986  C CD2 . PHE A 1 297 ? 207.570 173.140 144.841 1.00 157.24 ? 297 PHE A CD2 1 
ATOM   1987  C CE1 . PHE A 1 297 ? 208.854 173.468 147.263 1.00 157.24 ? 297 PHE A CE1 1 
ATOM   1988  C CE2 . PHE A 1 297 ? 208.733 173.885 144.908 1.00 157.24 ? 297 PHE A CE2 1 
ATOM   1989  C CZ  . PHE A 1 297 ? 209.375 174.048 146.122 1.00 157.24 ? 297 PHE A CZ  1 
ATOM   1990  N N   . ARG A 1 298 ? 204.188 168.649 145.464 1.00 145.09 ? 298 ARG A N   1 
ATOM   1991  C CA  . ARG A 1 298 ? 203.223 167.645 145.877 1.00 145.09 ? 298 ARG A CA  1 
ATOM   1992  C C   . ARG A 1 298 ? 203.889 166.304 146.133 1.00 145.09 ? 298 ARG A C   1 
ATOM   1993  O O   . ARG A 1 298 ? 203.500 165.588 147.060 1.00 145.09 ? 298 ARG A O   1 
ATOM   1994  C CB  . ARG A 1 298 ? 202.135 167.465 144.816 1.00 145.09 ? 298 ARG A CB  1 
ATOM   1995  C CG  . ARG A 1 298 ? 200.949 166.674 145.331 1.00 145.09 ? 298 ARG A CG  1 
ATOM   1996  C CD  . ARG A 1 298 ? 199.957 166.309 144.253 1.00 145.09 ? 298 ARG A CD  1 
ATOM   1997  N NE  . ARG A 1 298 ? 200.493 165.278 143.377 1.00 145.09 ? 298 ARG A NE  1 
ATOM   1998  C CZ  . ARG A 1 298 ? 199.858 164.804 142.315 1.00 145.09 ? 298 ARG A CZ  1 
ATOM   1999  N NH1 . ARG A 1 298 ? 198.654 165.260 142.005 1.00 145.09 ? 298 ARG A NH1 1 
ATOM   2000  N NH2 . ARG A 1 298 ? 200.421 163.864 141.573 1.00 145.09 ? 298 ARG A NH2 1 
ATOM   2001  N N   . LEU A 1 299 ? 204.912 165.973 145.340 1.00 142.46 ? 299 LEU A N   1 
ATOM   2002  C CA  . LEU A 1 299 ? 205.590 164.685 145.431 1.00 142.46 ? 299 LEU A CA  1 
ATOM   2003  C C   . LEU A 1 299 ? 206.352 164.523 146.731 1.00 142.46 ? 299 LEU A C   1 
ATOM   2004  O O   . LEU A 1 299 ? 206.625 163.392 147.138 1.00 142.46 ? 299 LEU A O   1 
ATOM   2005  C CB  . LEU A 1 299 ? 206.565 164.525 144.266 1.00 142.46 ? 299 LEU A CB  1 
ATOM   2006  C CG  . LEU A 1 299 ? 205.993 164.549 142.850 1.00 142.46 ? 299 LEU A CG  1 
ATOM   2007  C CD1 . LEU A 1 299 ? 207.110 164.540 141.817 1.00 142.46 ? 299 LEU A CD1 1 
ATOM   2008  C CD2 . LEU A 1 299 ? 205.048 163.382 142.643 1.00 142.46 ? 299 LEU A CD2 1 
ATOM   2009  N N   . LEU A 1 300 ? 206.726 165.622 147.367 1.00 135.08 ? 300 LEU A N   1 
ATOM   2010  C CA  . LEU A 1 300 ? 207.401 165.608 148.654 1.00 135.08 ? 300 LEU A CA  1 
ATOM   2011  C C   . LEU A 1 300 ? 206.539 166.261 149.723 1.00 135.08 ? 300 LEU A C   1 
ATOM   2012  O O   . LEU A 1 300 ? 207.045 166.914 150.635 1.00 135.08 ? 300 LEU A O   1 
ATOM   2013  C CB  . LEU A 1 300 ? 208.760 166.296 148.568 1.00 135.08 ? 300 LEU A CB  1 
ATOM   2014  C CG  . LEU A 1 300 ? 209.848 165.588 147.756 1.00 135.08 ? 300 LEU A CG  1 
ATOM   2015  C CD1 . LEU A 1 300 ? 211.077 166.467 147.607 1.00 135.08 ? 300 LEU A CD1 1 
ATOM   2016  C CD2 . LEU A 1 300 ? 210.218 164.277 148.418 1.00 135.08 ? 300 LEU A CD2 1 
ATOM   2017  N N   . PHE A 1 301 ? 205.221 166.119 149.605 1.00 130.29 ? 301 PHE A N   1 
ATOM   2018  C CA  . PHE A 1 301 ? 204.341 166.422 150.723 1.00 130.29 ? 301 PHE A CA  1 
ATOM   2019  C C   . PHE A 1 301 ? 203.904 165.187 151.474 1.00 130.29 ? 301 PHE A C   1 
ATOM   2020  O O   . PHE A 1 301 ? 203.762 165.239 152.691 1.00 130.29 ? 301 PHE A O   1 
ATOM   2021  C CB  . PHE A 1 301 ? 203.083 167.168 150.268 1.00 130.29 ? 301 PHE A CB  1 
ATOM   2022  C CG  . PHE A 1 301 ? 202.193 167.575 151.410 1.00 130.29 ? 301 PHE A CG  1 
ATOM   2023  C CD1 . PHE A 1 301 ? 202.539 168.646 152.212 1.00 130.29 ? 301 PHE A CD1 1 
ATOM   2024  C CD2 . PHE A 1 301 ? 201.036 166.874 151.703 1.00 130.29 ? 301 PHE A CD2 1 
ATOM   2025  C CE1 . PHE A 1 301 ? 201.743 169.020 153.269 1.00 130.29 ? 301 PHE A CE1 1 
ATOM   2026  C CE2 . PHE A 1 301 ? 200.243 167.242 152.764 1.00 130.29 ? 301 PHE A CE2 1 
ATOM   2027  C CZ  . PHE A 1 301 ? 200.595 168.319 153.545 1.00 130.29 ? 301 PHE A CZ  1 
ATOM   2028  N N   . ASP A 1 302 ? 203.682 164.082 150.773 1.00 135.07 ? 302 ASP A N   1 
ATOM   2029  C CA  . ASP A 1 302 ? 203.332 162.836 151.431 1.00 135.07 ? 302 ASP A CA  1 
ATOM   2030  C C   . ASP A 1 302 ? 204.449 162.307 152.316 1.00 135.07 ? 302 ASP A C   1 
ATOM   2031  O O   . ASP A 1 302 ? 204.173 161.520 153.220 1.00 135.07 ? 302 ASP A O   1 
ATOM   2032  C CB  . ASP A 1 302 ? 202.949 161.807 150.379 1.00 135.07 ? 302 ASP A CB  1 
ATOM   2033  C CG  . ASP A 1 302 ? 203.980 161.703 149.278 1.00 135.07 ? 302 ASP A CG  1 
ATOM   2034  O OD1 . ASP A 1 302 ? 204.945 162.497 149.292 1.00 135.07 ? 302 ASP A OD1 1 
ATOM   2035  O OD2 . ASP A 1 302 ? 203.823 160.839 148.388 1.00 135.07 ? 302 ASP A OD2 1 
ATOM   2036  N N   . VAL A 1 303 ? 205.695 162.732 152.088 1.00 129.66 ? 303 VAL A N   1 
ATOM   2037  C CA  . VAL A 1 303 ? 206.779 162.369 152.991 1.00 129.66 ? 303 VAL A CA  1 
ATOM   2038  C C   . VAL A 1 303 ? 206.594 163.008 154.356 1.00 129.66 ? 303 VAL A C   1 
ATOM   2039  O O   . VAL A 1 303 ? 207.081 162.471 155.354 1.00 129.66 ? 303 VAL A O   1 
ATOM   2040  C CB  . VAL A 1 303 ? 208.149 162.738 152.389 1.00 129.66 ? 303 VAL A CB  1 
ATOM   2041  C CG1 . VAL A 1 303 ? 208.397 161.953 151.115 1.00 129.66 ? 303 VAL A CG1 1 
ATOM   2042  C CG2 . VAL A 1 303 ? 208.241 164.216 152.102 1.00 129.66 ? 303 VAL A CG2 1 
ATOM   2043  N N   . VAL A 1 304 ? 205.881 164.131 154.429 1.00 129.18 ? 304 VAL A N   1 
ATOM   2044  C CA  . VAL A 1 304 ? 205.502 164.677 155.719 1.00 129.18 ? 304 VAL A CA  1 
ATOM   2045  C C   . VAL A 1 304 ? 204.441 163.797 156.359 1.00 129.18 ? 304 VAL A C   1 
ATOM   2046  O O   . VAL A 1 304 ? 204.456 163.584 157.575 1.00 129.18 ? 304 VAL A O   1 
ATOM   2047  C CB  . VAL A 1 304 ? 205.021 166.126 155.548 1.00 129.18 ? 304 VAL A CB  1 
ATOM   2048  C CG1 . VAL A 1 304 ? 204.741 166.785 156.890 1.00 129.18 ? 304 VAL A CG1 1 
ATOM   2049  C CG2 . VAL A 1 304 ? 206.015 166.920 154.719 1.00 129.18 ? 304 VAL A CG2 1 
ATOM   2050  N N   . VAL A 1 305 ? 203.525 163.255 155.553 1.00 129.45 ? 305 VAL A N   1 
ATOM   2051  C CA  . VAL A 1 305 ? 202.565 162.284 156.061 1.00 129.45 ? 305 VAL A CA  1 
ATOM   2052  C C   . VAL A 1 305 ? 203.289 161.012 156.465 1.00 129.45 ? 305 VAL A C   1 
ATOM   2053  O O   . VAL A 1 305 ? 202.925 160.368 157.457 1.00 129.45 ? 305 VAL A O   1 
ATOM   2054  C CB  . VAL A 1 305 ? 201.486 161.997 155.001 1.00 129.45 ? 305 VAL A CB  1 
ATOM   2055  C CG1 . VAL A 1 305 ? 200.402 161.089 155.546 1.00 129.45 ? 305 VAL A CG1 1 
ATOM   2056  C CG2 . VAL A 1 305 ? 200.908 163.276 154.452 1.00 129.45 ? 305 VAL A CG2 1 
ATOM   2057  N N   . ILE A 1 306 ? 204.338 160.651 155.724 1.00 130.40 ? 306 ILE A N   1 
ATOM   2058  C CA  . ILE A 1 306 ? 205.181 159.522 156.100 1.00 130.40 ? 306 ILE A CA  1 
ATOM   2059  C C   . ILE A 1 306 ? 205.893 159.801 157.420 1.00 130.40 ? 306 ILE A C   1 
ATOM   2060  O O   . ILE A 1 306 ? 206.026 158.910 158.264 1.00 130.40 ? 306 ILE A O   1 
ATOM   2061  C CB  . ILE A 1 306 ? 206.168 159.200 154.959 1.00 130.40 ? 306 ILE A CB  1 
ATOM   2062  C CG1 . ILE A 1 306 ? 205.425 158.627 153.759 1.00 130.40 ? 306 ILE A CG1 1 
ATOM   2063  C CG2 . ILE A 1 306 ? 207.240 158.200 155.379 1.00 130.40 ? 306 ILE A CG2 1 
ATOM   2064  C CD1 . ILE A 1 306 ? 206.276 158.534 152.527 1.00 130.40 ? 306 ILE A CD1 1 
ATOM   2065  N N   . LEU A 1 307 ? 206.311 161.048 157.649 1.00 126.81 ? 307 LEU A N   1 
ATOM   2066  C CA  . LEU A 1 307 ? 206.988 161.371 158.903 1.00 126.81 ? 307 LEU A CA  1 
ATOM   2067  C C   . LEU A 1 307 ? 206.023 161.375 160.081 1.00 126.81 ? 307 LEU A C   1 
ATOM   2068  O O   . LEU A 1 307 ? 206.206 160.627 161.048 1.00 126.81 ? 307 LEU A O   1 
ATOM   2069  C CB  . LEU A 1 307 ? 207.697 162.722 158.806 1.00 126.81 ? 307 LEU A CB  1 
ATOM   2070  C CG  . LEU A 1 307 ? 208.991 162.796 158.002 1.00 126.81 ? 307 LEU A CG  1 
ATOM   2071  C CD1 . LEU A 1 307 ? 209.471 164.229 157.917 1.00 126.81 ? 307 LEU A CD1 1 
ATOM   2072  C CD2 . LEU A 1 307 ? 210.044 161.916 158.638 1.00 126.81 ? 307 LEU A CD2 1 
ATOM   2073  N N   . THR A 1 308 ? 204.984 162.210 160.009 1.00 126.63 ? 308 THR A N   1 
ATOM   2074  C CA  . THR A 1 308 ? 204.215 162.556 161.200 1.00 126.63 ? 308 THR A CA  1 
ATOM   2075  C C   . THR A 1 308 ? 203.378 161.400 161.706 1.00 126.63 ? 308 THR A C   1 
ATOM   2076  O O   . THR A 1 308 ? 203.250 161.221 162.920 1.00 126.63 ? 308 THR A O   1 
ATOM   2077  C CB  . THR A 1 308 ? 203.306 163.741 160.917 1.00 126.63 ? 308 THR A CB  1 
ATOM   2078  O OG1 . THR A 1 308 ? 202.412 163.405 159.850 1.00 126.63 ? 308 THR A OG1 1 
ATOM   2079  C CG2 . THR A 1 308 ? 204.128 164.963 160.540 1.00 126.63 ? 308 THR A CG2 1 
ATOM   2080  N N   . CYS A 1 309 ? 202.807 160.612 160.805 1.00 126.16 ? 309 CYS A N   1 
ATOM   2081  C CA  . CYS A 1 309 ? 202.033 159.468 161.254 1.00 126.16 ? 309 CYS A CA  1 
ATOM   2082  C C   . CYS A 1 309 ? 202.938 158.385 161.818 1.00 126.16 ? 309 CYS A C   1 
ATOM   2083  O O   . CYS A 1 309 ? 202.560 157.692 162.766 1.00 126.16 ? 309 CYS A O   1 
ATOM   2084  C CB  . CYS A 1 309 ? 201.185 158.934 160.108 1.00 126.16 ? 309 CYS A CB  1 
ATOM   2085  S SG  . CYS A 1 309 ? 199.895 160.077 159.587 1.00 126.16 ? 309 CYS A SG  1 
ATOM   2086  N N   . SER A 1 310 ? 204.147 158.252 161.276 1.00 127.22 ? 310 SER A N   1 
ATOM   2087  C CA  . SER A 1 310 ? 205.082 157.269 161.809 1.00 127.22 ? 310 SER A CA  1 
ATOM   2088  C C   . SER A 1 310 ? 205.660 157.716 163.138 1.00 127.22 ? 310 SER A C   1 
ATOM   2089  O O   . SER A 1 310 ? 205.804 156.902 164.056 1.00 127.22 ? 310 SER A O   1 
ATOM   2090  C CB  . SER A 1 310 ? 206.213 157.023 160.823 1.00 127.22 ? 310 SER A CB  1 
ATOM   2091  O OG  . SER A 1 310 ? 206.965 158.213 160.637 1.00 127.22 ? 310 SER A OG  1 
ATOM   2092  N N   . LEU A 1 311 ? 206.018 159.000 163.253 1.00 124.94 ? 311 LEU A N   1 
ATOM   2093  C CA  . LEU A 1 311 ? 206.525 159.505 164.521 1.00 124.94 ? 311 LEU A CA  1 
ATOM   2094  C C   . LEU A 1 311 ? 205.460 159.480 165.603 1.00 124.94 ? 311 LEU A C   1 
ATOM   2095  O O   . LEU A 1 311 ? 205.798 159.352 166.782 1.00 124.94 ? 311 LEU A O   1 
ATOM   2096  C CB  . LEU A 1 311 ? 207.076 160.922 164.364 1.00 124.94 ? 311 LEU A CB  1 
ATOM   2097  C CG  . LEU A 1 311 ? 208.363 161.129 163.558 1.00 124.94 ? 311 LEU A CG  1 
ATOM   2098  C CD1 . LEU A 1 311 ? 208.697 162.609 163.450 1.00 124.94 ? 311 LEU A CD1 1 
ATOM   2099  C CD2 . LEU A 1 311 ? 209.533 160.368 164.156 1.00 124.94 ? 311 LEU A CD2 1 
ATOM   2100  N N   . SER A 1 312 ? 204.187 159.563 165.226 1.00 122.58 ? 312 SER A N   1 
ATOM   2101  C CA  . SER A 1 312 ? 203.098 159.324 166.154 1.00 122.58 ? 312 SER A CA  1 
ATOM   2102  C C   . SER A 1 312 ? 202.817 157.849 166.364 1.00 122.58 ? 312 SER A C   1 
ATOM   2103  O O   . SER A 1 312 ? 202.304 157.479 167.421 1.00 122.58 ? 312 SER A O   1 
ATOM   2104  C CB  . SER A 1 312 ? 201.823 160.004 165.668 1.00 122.58 ? 312 SER A CB  1 
ATOM   2105  O OG  . SER A 1 312 ? 200.744 159.699 166.529 1.00 122.58 ? 312 SER A OG  1 
ATOM   2106  N N   . PHE A 1 313 ? 203.135 157.002 165.390 1.00 118.97 ? 313 PHE A N   1 
ATOM   2107  C CA  . PHE A 1 313 ? 203.053 155.570 165.621 1.00 118.97 ? 313 PHE A CA  1 
ATOM   2108  C C   . PHE A 1 313 ? 204.126 155.109 166.591 1.00 118.97 ? 313 PHE A C   1 
ATOM   2109  O O   . PHE A 1 313 ? 203.926 154.128 167.312 1.00 118.97 ? 313 PHE A O   1 
ATOM   2110  C CB  . PHE A 1 313 ? 203.173 154.822 164.297 1.00 118.97 ? 313 PHE A CB  1 
ATOM   2111  C CG  . PHE A 1 313 ? 203.067 153.336 164.425 1.00 118.97 ? 313 PHE A CG  1 
ATOM   2112  C CD1 . PHE A 1 313 ? 201.852 152.738 164.695 1.00 118.97 ? 313 PHE A CD1 1 
ATOM   2113  C CD2 . PHE A 1 313 ? 204.179 152.537 164.247 1.00 118.97 ? 313 PHE A CD2 1 
ATOM   2114  C CE1 . PHE A 1 313 ? 201.754 151.371 164.804 1.00 118.97 ? 313 PHE A CE1 1 
ATOM   2115  C CE2 . PHE A 1 313 ? 204.084 151.171 164.351 1.00 118.97 ? 313 PHE A CE2 1 
ATOM   2116  C CZ  . PHE A 1 313 ? 202.869 150.588 164.631 1.00 118.97 ? 313 PHE A CZ  1 
ATOM   2117  N N   . LEU A 1 314 ? 205.257 155.809 166.631 1.00 120.81 ? 314 LEU A N   1 
ATOM   2118  C CA  . LEU A 1 314 ? 206.282 155.503 167.616 1.00 120.81 ? 314 LEU A CA  1 
ATOM   2119  C C   . LEU A 1 314 ? 205.863 155.980 168.996 1.00 120.81 ? 314 LEU A C   1 
ATOM   2120  O O   . LEU A 1 314 ? 206.117 155.302 169.995 1.00 120.81 ? 314 LEU A O   1 
ATOM   2121  C CB  . LEU A 1 314 ? 207.607 156.145 167.193 1.00 120.81 ? 314 LEU A CB  1 
ATOM   2122  C CG  . LEU A 1 314 ? 208.952 155.880 167.890 1.00 120.81 ? 314 LEU A CG  1 
ATOM   2123  C CD1 . LEU A 1 314 ? 209.219 156.762 169.117 1.00 120.81 ? 314 LEU A CD1 1 
ATOM   2124  C CD2 . LEU A 1 314 ? 209.059 154.409 168.263 1.00 120.81 ? 314 LEU A CD2 1 
ATOM   2125  N N   . LEU A 1 315 ? 205.216 157.138 169.066 1.00 120.98 ? 315 LEU A N   1 
ATOM   2126  C CA  . LEU A 1 315 ? 204.981 157.763 170.358 1.00 120.98 ? 315 LEU A CA  1 
ATOM   2127  C C   . LEU A 1 315 ? 203.832 157.094 171.090 1.00 120.98 ? 315 LEU A C   1 
ATOM   2128  O O   . LEU A 1 315 ? 203.927 156.830 172.292 1.00 120.98 ? 315 LEU A O   1 
ATOM   2129  C CB  . LEU A 1 315 ? 204.720 159.258 170.166 1.00 120.98 ? 315 LEU A CB  1 
ATOM   2130  C CG  . LEU A 1 315 ? 204.669 160.226 171.355 1.00 120.98 ? 315 LEU A CG  1 
ATOM   2131  C CD1 . LEU A 1 315 ? 203.299 160.351 172.044 1.00 120.98 ? 315 LEU A CD1 1 
ATOM   2132  C CD2 . LEU A 1 315 ? 205.731 159.824 172.365 1.00 120.98 ? 315 LEU A CD2 1 
ATOM   2133  N N   . CYS A 1 316 ? 202.731 156.834 170.391 1.00 125.62 ? 316 CYS A N   1 
ATOM   2134  C CA  . CYS A 1 316 ? 201.533 156.357 171.067 1.00 125.62 ? 316 CYS A CA  1 
ATOM   2135  C C   . CYS A 1 316 ? 201.689 154.916 171.518 1.00 125.62 ? 316 CYS A C   1 
ATOM   2136  O O   . CYS A 1 316 ? 201.120 154.514 172.539 1.00 125.62 ? 316 CYS A O   1 
ATOM   2137  C CB  . CYS A 1 316 ? 200.327 156.498 170.146 1.00 125.62 ? 316 CYS A CB  1 
ATOM   2138  S SG  . CYS A 1 316 ? 199.912 158.207 169.728 1.00 125.62 ? 316 CYS A SG  1 
ATOM   2139  N N   . ALA A 1 317 ? 202.481 154.135 170.787 1.00 132.37 ? 317 ALA A N   1 
ATOM   2140  C CA  . ALA A 1 317 ? 202.660 152.732 171.133 1.00 132.37 ? 317 ALA A CA  1 
ATOM   2141  C C   . ALA A 1 317 ? 203.584 152.566 172.325 1.00 132.37 ? 317 ALA A C   1 
ATOM   2142  O O   . ALA A 1 317 ? 203.571 151.518 172.978 1.00 132.37 ? 317 ALA A O   1 
ATOM   2143  C CB  . ALA A 1 317 ? 203.199 151.959 169.931 1.00 132.37 ? 317 ALA A CB  1 
ATOM   2144  N N   . ARG A 1 318 ? 204.399 153.579 172.617 1.00 125.97 ? 318 ARG A N   1 
ATOM   2145  C CA  . ARG A 1 318 ? 205.225 153.533 173.815 1.00 125.97 ? 318 ARG A CA  1 
ATOM   2146  C C   . ARG A 1 318 ? 204.355 153.583 175.060 1.00 125.97 ? 318 ARG A C   1 
ATOM   2147  O O   . ARG A 1 318 ? 204.685 152.977 176.085 1.00 125.97 ? 318 ARG A O   1 
ATOM   2148  C CB  . ARG A 1 318 ? 206.226 154.684 173.802 1.00 125.97 ? 318 ARG A CB  1 
ATOM   2149  C CG  . ARG A 1 318 ? 207.286 154.597 174.872 1.00 125.97 ? 318 ARG A CG  1 
ATOM   2150  C CD  . ARG A 1 318 ? 208.261 155.747 174.765 1.00 125.97 ? 318 ARG A CD  1 
ATOM   2151  N NE  . ARG A 1 318 ? 209.372 155.598 175.698 1.00 125.97 ? 318 ARG A NE  1 
ATOM   2152  C CZ  . ARG A 1 318 ? 209.371 156.050 176.945 1.00 125.97 ? 318 ARG A CZ  1 
ATOM   2153  N NH1 . ARG A 1 318 ? 210.431 155.865 177.716 1.00 125.97 ? 318 ARG A NH1 1 
ATOM   2154  N NH2 . ARG A 1 318 ? 208.312 156.686 177.421 1.00 125.97 ? 318 ARG A NH2 1 
ATOM   2155  N N   . SER A 1 319 ? 203.223 154.278 174.977 1.00 130.93 ? 319 SER A N   1 
ATOM   2156  C CA  . SER A 1 319 ? 202.257 154.239 176.061 1.00 130.93 ? 319 SER A CA  1 
ATOM   2157  C C   . SER A 1 319 ? 201.556 152.896 176.130 1.00 130.93 ? 319 SER A C   1 
ATOM   2158  O O   . SER A 1 319 ? 201.204 152.440 177.223 1.00 130.93 ? 319 SER A O   1 
ATOM   2159  C CB  . SER A 1 319 ? 201.230 155.354 175.900 1.00 130.93 ? 319 SER A CB  1 
ATOM   2160  O OG  . SER A 1 319 ? 200.291 155.323 176.959 1.00 130.93 ? 319 SER A OG  1 
ATOM   2161  N N   . LEU A 1 320 ? 201.333 152.260 174.982 1.00 131.83 ? 320 LEU A N   1 
ATOM   2162  C CA  . LEU A 1 320 ? 200.855 150.885 174.989 1.00 131.83 ? 320 LEU A CA  1 
ATOM   2163  C C   . LEU A 1 320 ? 201.895 149.966 175.603 1.00 131.83 ? 320 LEU A C   1 
ATOM   2164  O O   . LEU A 1 320 ? 201.560 149.035 176.344 1.00 131.83 ? 320 LEU A O   1 
ATOM   2165  C CB  . LEU A 1 320 ? 200.534 150.433 173.573 1.00 131.83 ? 320 LEU A CB  1 
ATOM   2166  C CG  . LEU A 1 320 ? 199.417 151.165 172.858 1.00 131.83 ? 320 LEU A CG  1 
ATOM   2167  C CD1 . LEU A 1 320 ? 199.346 150.658 171.445 1.00 131.83 ? 320 LEU A CD1 1 
ATOM   2168  C CD2 . LEU A 1 320 ? 198.122 150.919 173.582 1.00 131.83 ? 320 LEU A CD2 1 
ATOM   2169  N N   . LEU A 1 321 ? 203.172 150.227 175.309 1.00 134.29 ? 321 LEU A N   1 
ATOM   2170  C CA  . LEU A 1 321 ? 204.254 149.493 175.952 1.00 134.29 ? 321 LEU A CA  1 
ATOM   2171  C C   . LEU A 1 321 ? 204.313 149.802 177.437 1.00 134.29 ? 321 LEU A C   1 
ATOM   2172  O O   . LEU A 1 321 ? 204.737 148.962 178.234 1.00 134.29 ? 321 LEU A O   1 
ATOM   2173  C CB  . LEU A 1 321 ? 205.590 149.826 175.287 1.00 134.29 ? 321 LEU A CB  1 
ATOM   2174  C CG  . LEU A 1 321 ? 205.866 149.309 173.870 1.00 134.29 ? 321 LEU A CG  1 
ATOM   2175  C CD1 . LEU A 1 321 ? 207.156 149.894 173.320 1.00 134.29 ? 321 LEU A CD1 1 
ATOM   2176  C CD2 . LEU A 1 321 ? 205.938 147.792 173.849 1.00 134.29 ? 321 LEU A CD2 1 
ATOM   2177  N N   . ARG A 1 322 ? 203.882 150.998 177.830 1.00 138.94 ? 322 ARG A N   1 
ATOM   2178  C CA  . ARG A 1 322 ? 203.891 151.345 179.243 1.00 138.94 ? 322 ARG A CA  1 
ATOM   2179  C C   . ARG A 1 322 ? 202.725 150.704 179.974 1.00 138.94 ? 322 ARG A C   1 
ATOM   2180  O O   . ARG A 1 322 ? 202.878 150.257 181.115 1.00 138.94 ? 322 ARG A O   1 
ATOM   2181  C CB  . ARG A 1 322 ? 203.857 152.861 179.414 1.00 138.94 ? 322 ARG A CB  1 
ATOM   2182  C CG  . ARG A 1 322 ? 203.978 153.299 180.854 1.00 138.94 ? 322 ARG A CG  1 
ATOM   2183  C CD  . ARG A 1 322 ? 204.100 154.798 180.993 1.00 138.94 ? 322 ARG A CD  1 
ATOM   2184  N NE  . ARG A 1 322 ? 204.203 155.176 182.396 1.00 138.94 ? 322 ARG A NE  1 
ATOM   2185  C CZ  . ARG A 1 322 ? 205.343 155.199 183.080 1.00 138.94 ? 322 ARG A CZ  1 
ATOM   2186  N NH1 . ARG A 1 322 ? 205.342 155.555 184.355 1.00 138.94 ? 322 ARG A NH1 1 
ATOM   2187  N NH2 . ARG A 1 322 ? 206.485 154.876 182.489 1.00 138.94 ? 322 ARG A NH2 1 
ATOM   2188  N N   . GLY A 1 323 ? 201.562 150.636 179.332 1.00 138.67 ? 323 GLY A N   1 
ATOM   2189  C CA  . GLY A 1 323 ? 200.380 150.149 180.022 1.00 138.67 ? 323 GLY A CA  1 
ATOM   2190  C C   . GLY A 1 323 ? 200.417 148.656 180.274 1.00 138.67 ? 323 GLY A C   1 
ATOM   2191  O O   . GLY A 1 323 ? 199.972 148.184 181.324 1.00 138.67 ? 323 GLY A O   1 
ATOM   2192  N N   . PHE A 1 324 ? 200.944 147.894 179.319 1.00 137.96 ? 324 PHE A N   1 
ATOM   2193  C CA  . PHE A 1 324 ? 201.056 146.456 179.512 1.00 137.96 ? 324 PHE A CA  1 
ATOM   2194  C C   . PHE A 1 324 ? 202.144 146.121 180.518 1.00 137.96 ? 324 PHE A C   1 
ATOM   2195  O O   . PHE A 1 324 ? 202.016 145.148 181.268 1.00 137.96 ? 324 PHE A O   1 
ATOM   2196  C CB  . PHE A 1 324 ? 201.338 145.774 178.176 1.00 137.96 ? 324 PHE A CB  1 
ATOM   2197  C CG  . PHE A 1 324 ? 201.364 144.277 178.252 1.00 137.96 ? 324 PHE A CG  1 
ATOM   2198  C CD1 . PHE A 1 324 ? 200.183 143.558 178.341 1.00 137.96 ? 324 PHE A CD1 1 
ATOM   2199  C CD2 . PHE A 1 324 ? 202.566 143.589 178.225 1.00 137.96 ? 324 PHE A CD2 1 
ATOM   2200  C CE1 . PHE A 1 324 ? 200.199 142.186 178.406 1.00 137.96 ? 324 PHE A CE1 1 
ATOM   2201  C CE2 . PHE A 1 324 ? 202.590 142.214 178.294 1.00 137.96 ? 324 PHE A CE2 1 
ATOM   2202  C CZ  . PHE A 1 324 ? 201.405 141.512 178.384 1.00 137.96 ? 324 PHE A CZ  1 
ATOM   2203  N N   . LEU A 1 325 ? 203.213 146.917 180.545 1.00 138.62 ? 325 LEU A N   1 
ATOM   2204  C CA  . LEU A 1 325 ? 204.297 146.740 181.499 1.00 138.62 ? 325 LEU A CA  1 
ATOM   2205  C C   . LEU A 1 325 ? 203.833 146.949 182.931 1.00 138.62 ? 325 LEU A C   1 
ATOM   2206  O O   . LEU A 1 325 ? 204.286 146.234 183.828 1.00 138.62 ? 325 LEU A O   1 
ATOM   2207  C CB  . LEU A 1 325 ? 205.435 147.704 181.142 1.00 138.62 ? 325 LEU A CB  1 
ATOM   2208  C CG  . LEU A 1 325 ? 206.847 147.669 181.732 1.00 138.62 ? 325 LEU A CG  1 
ATOM   2209  C CD1 . LEU A 1 325 ? 207.852 148.145 180.695 1.00 138.62 ? 325 LEU A CD1 1 
ATOM   2210  C CD2 . LEU A 1 325 ? 206.949 148.549 182.952 1.00 138.62 ? 325 LEU A CD2 1 
ATOM   2211  N N   . LEU A 1 326 ? 202.907 147.876 183.156 1.00 141.97 ? 326 LEU A N   1 
ATOM   2212  C CA  . LEU A 1 326 ? 202.382 148.162 184.481 1.00 141.97 ? 326 LEU A CA  1 
ATOM   2213  C C   . LEU A 1 326 ? 201.237 147.245 184.872 1.00 141.97 ? 326 LEU A C   1 
ATOM   2214  O O   . LEU A 1 326 ? 200.551 147.513 185.863 1.00 141.97 ? 326 LEU A O   1 
ATOM   2215  C CB  . LEU A 1 326 ? 201.925 149.618 184.568 1.00 141.97 ? 326 LEU A CB  1 
ATOM   2216  C CG  . LEU A 1 326 ? 202.913 150.686 185.043 1.00 141.97 ? 326 LEU A CG  1 
ATOM   2217  C CD1 . LEU A 1 326 ? 203.292 150.399 186.480 1.00 141.97 ? 326 LEU A CD1 1 
ATOM   2218  C CD2 . LEU A 1 326 ? 204.155 150.806 184.159 1.00 141.97 ? 326 LEU A CD2 1 
ATOM   2219  N N   . GLN A 1 327 ? 201.002 146.181 184.117 1.00 142.93 ? 327 GLN A N   1 
ATOM   2220  C CA  . GLN A 1 327 ? 200.009 145.209 184.526 1.00 142.93 ? 327 GLN A CA  1 
ATOM   2221  C C   . GLN A 1 327 ? 200.579 144.143 185.436 1.00 142.93 ? 327 GLN A C   1 
ATOM   2222  O O   . GLN A 1 327 ? 199.841 143.614 186.271 1.00 142.93 ? 327 GLN A O   1 
ATOM   2223  C CB  . GLN A 1 327 ? 199.387 144.525 183.310 1.00 142.93 ? 327 GLN A CB  1 
ATOM   2224  C CG  . GLN A 1 327 ? 198.506 145.412 182.482 1.00 142.93 ? 327 GLN A CG  1 
ATOM   2225  C CD  . GLN A 1 327 ? 197.926 144.681 181.292 1.00 142.93 ? 327 GLN A CD  1 
ATOM   2226  O OE1 . GLN A 1 327 ? 198.266 143.528 181.024 1.00 142.93 ? 327 GLN A OE1 1 
ATOM   2227  N NE2 . GLN A 1 327 ? 197.032 145.345 180.576 1.00 142.93 ? 327 GLN A NE2 1 
ATOM   2228  N N   . ASN A 1 328 ? 201.871 143.835 185.304 1.00 151.45 ? 328 ASN A N   1 
ATOM   2229  C CA  . ASN A 1 328 ? 202.486 142.758 186.070 1.00 151.45 ? 328 ASN A CA  1 
ATOM   2230  C C   . ASN A 1 328 ? 202.524 143.072 187.558 1.00 151.45 ? 328 ASN A C   1 
ATOM   2231  O O   . ASN A 1 328 ? 202.500 142.153 188.381 1.00 151.45 ? 328 ASN A O   1 
ATOM   2232  C CB  . ASN A 1 328 ? 203.903 142.501 185.547 1.00 151.45 ? 328 ASN A CB  1 
ATOM   2233  C CG  . ASN A 1 328 ? 204.455 141.145 185.960 1.00 151.45 ? 328 ASN A CG  1 
ATOM   2234  O OD1 . ASN A 1 328 ? 203.781 140.353 186.612 1.00 151.45 ? 328 ASN A OD1 1 
ATOM   2235  N ND2 . ASN A 1 328 ? 205.693 140.873 185.572 1.00 151.45 ? 328 ASN A ND2 1 
ATOM   2236  N N   . GLU A 1 329 ? 202.525 144.344 187.919 1.00 151.59 ? 329 GLU A N   1 
ATOM   2237  C CA  . GLU A 1 329 ? 202.620 144.732 189.313 1.00 151.59 ? 329 GLU A CA  1 
ATOM   2238  C C   . GLU A 1 329 ? 201.284 144.673 190.038 1.00 151.59 ? 329 GLU A C   1 
ATOM   2239  O O   . GLU A 1 329 ? 201.254 144.341 191.228 1.00 151.59 ? 329 GLU A O   1 
ATOM   2240  C CB  . GLU A 1 329 ? 203.220 146.137 189.404 1.00 151.59 ? 329 GLU A CB  1 
ATOM   2241  C CG  . GLU A 1 329 ? 204.704 146.186 189.060 1.00 151.59 ? 329 GLU A CG  1 
ATOM   2242  C CD  . GLU A 1 329 ? 204.983 146.208 187.568 1.00 151.59 ? 329 GLU A CD  1 
ATOM   2243  O OE1 . GLU A 1 329 ? 204.020 146.266 186.776 1.00 151.59 ? 329 GLU A OE1 1 
ATOM   2244  O OE2 . GLU A 1 329 ? 206.167 146.145 187.186 1.00 151.59 ? 329 GLU A OE2 1 
ATOM   2245  N N   . PHE A 1 330 ? 200.180 144.950 189.352 1.00 148.68 ? 330 PHE A N   1 
ATOM   2246  C CA  . PHE A 1 330 ? 198.878 144.921 189.997 1.00 148.68 ? 330 PHE A CA  1 
ATOM   2247  C C   . PHE A 1 330 ? 198.351 143.505 190.178 1.00 148.68 ? 330 PHE A C   1 
ATOM   2248  O O   . PHE A 1 330 ? 197.400 143.303 190.940 1.00 148.68 ? 330 PHE A O   1 
ATOM   2249  C CB  . PHE A 1 330 ? 197.887 145.769 189.187 1.00 148.68 ? 330 PHE A CB  1 
ATOM   2250  C CG  . PHE A 1 330 ? 196.547 145.940 189.843 1.00 148.68 ? 330 PHE A CG  1 
ATOM   2251  C CD1 . PHE A 1 330 ? 196.400 146.769 190.943 1.00 148.68 ? 330 PHE A CD1 1 
ATOM   2252  C CD2 . PHE A 1 330 ? 195.439 145.258 189.370 1.00 148.68 ? 330 PHE A CD2 1 
ATOM   2253  C CE1 . PHE A 1 330 ? 195.169 146.920 191.555 1.00 148.68 ? 330 PHE A CE1 1 
ATOM   2254  C CE2 . PHE A 1 330 ? 194.208 145.405 189.978 1.00 148.68 ? 330 PHE A CE2 1 
ATOM   2255  C CZ  . PHE A 1 330 ? 194.074 146.239 191.071 1.00 148.68 ? 330 PHE A CZ  1 
ATOM   2256  N N   . VAL A 1 331 ? 198.965 142.514 189.533 1.00 154.91 ? 331 VAL A N   1 
ATOM   2257  C CA  . VAL A 1 331 ? 198.454 141.147 189.604 1.00 154.91 ? 331 VAL A CA  1 
ATOM   2258  C C   . VAL A 1 331 ? 198.676 140.553 190.990 1.00 154.91 ? 331 VAL A C   1 
ATOM   2259  O O   . VAL A 1 331 ? 197.715 140.237 191.700 1.00 154.91 ? 331 VAL A O   1 
ATOM   2260  C CB  . VAL A 1 331 ? 199.085 140.276 188.502 1.00 154.91 ? 331 VAL A CB  1 
ATOM   2261  C CG1 . VAL A 1 331 ? 198.733 138.813 188.704 1.00 154.91 ? 331 VAL A CG1 1 
ATOM   2262  C CG2 . VAL A 1 331 ? 198.586 140.725 187.147 1.00 154.91 ? 331 VAL A CG2 1 
ATOM   2263  N N   . GLY A 1 332 ? 199.932 140.417 191.408 1.00 152.96 ? 332 GLY A N   1 
ATOM   2264  C CA  . GLY A 1 332 ? 200.204 139.887 192.728 1.00 152.96 ? 332 GLY A CA  1 
ATOM   2265  C C   . GLY A 1 332 ? 199.875 140.923 193.775 1.00 152.96 ? 332 GLY A C   1 
ATOM   2266  O O   . GLY A 1 332 ? 198.988 140.721 194.610 1.00 152.96 ? 332 GLY A O   1 
ATOM   2267  N N   . PHE A 1 333 ? 200.659 142.000 193.770 1.00 154.34 ? 333 PHE A N   1 
ATOM   2268  C CA  . PHE A 1 333 ? 200.338 143.326 194.294 1.00 154.34 ? 333 PHE A CA  1 
ATOM   2269  C C   . PHE A 1 333 ? 200.281 143.436 195.817 1.00 154.34 ? 333 PHE A C   1 
ATOM   2270  O O   . PHE A 1 333 ? 200.560 144.507 196.368 1.00 154.34 ? 333 PHE A O   1 
ATOM   2271  C CB  . PHE A 1 333 ? 198.999 143.755 193.678 1.00 154.34 ? 333 PHE A CB  1 
ATOM   2272  C CG  . PHE A 1 333 ? 198.415 145.006 194.251 1.00 154.34 ? 333 PHE A CG  1 
ATOM   2273  C CD1 . PHE A 1 333 ? 198.913 146.244 193.894 1.00 154.34 ? 333 PHE A CD1 1 
ATOM   2274  C CD2 . PHE A 1 333 ? 197.344 144.941 195.137 1.00 154.34 ? 333 PHE A CD2 1 
ATOM   2275  C CE1 . PHE A 1 333 ? 198.368 147.396 194.421 1.00 154.34 ? 333 PHE A CE1 1 
ATOM   2276  C CE2 . PHE A 1 333 ? 196.800 146.085 195.668 1.00 154.34 ? 333 PHE A CE2 1 
ATOM   2277  C CZ  . PHE A 1 333 ? 197.313 147.315 195.306 1.00 154.34 ? 333 PHE A CZ  1 
ATOM   2278  N N   . MET A 1 334 ? 200.003 142.333 196.518 1.00 152.80 ? 334 MET A N   1 
ATOM   2279  C CA  . MET A 1 334 ? 200.327 142.218 197.934 1.00 152.80 ? 334 MET A CA  1 
ATOM   2280  C C   . MET A 1 334 ? 200.599 140.754 198.272 1.00 152.80 ? 334 MET A C   1 
ATOM   2281  O O   . MET A 1 334 ? 200.368 140.332 199.413 1.00 152.80 ? 334 MET A O   1 
ATOM   2282  C CB  . MET A 1 334 ? 199.208 142.830 198.814 1.00 152.80 ? 334 MET A CB  1 
ATOM   2283  C CG  . MET A 1 334 ? 199.652 143.298 200.219 1.00 152.80 ? 334 MET A CG  1 
ATOM   2284  S SD  . MET A 1 334 ? 198.374 144.082 201.221 1.00 152.80 ? 334 MET A SD  1 
ATOM   2285  C CE  . MET A 1 334 ? 198.202 145.660 200.386 1.00 152.80 ? 334 MET A CE  1 
ATOM   2286  N N   . TRP A 1 335 ? 201.046 139.967 197.276 1.00 153.44 ? 335 TRP A N   1 
ATOM   2287  C CA  . TRP A 1 335 ? 201.200 138.513 197.369 1.00 153.44 ? 335 TRP A CA  1 
ATOM   2288  C C   . TRP A 1 335 ? 199.844 137.908 197.712 1.00 153.44 ? 335 TRP A C   1 
ATOM   2289  O O   . TRP A 1 335 ? 199.600 137.570 198.875 1.00 153.44 ? 335 TRP A O   1 
ATOM   2290  C CB  . TRP A 1 335 ? 202.283 138.095 198.369 1.00 153.44 ? 335 TRP A CB  1 
ATOM   2291  C CG  . TRP A 1 335 ? 203.654 138.576 198.020 1.00 153.44 ? 335 TRP A CG  1 
ATOM   2292  C CD1 . TRP A 1 335 ? 204.048 139.177 196.859 1.00 153.44 ? 335 TRP A CD1 1 
ATOM   2293  C CD2 . TRP A 1 335 ? 204.816 138.510 198.851 1.00 153.44 ? 335 TRP A CD2 1 
ATOM   2294  N NE1 . TRP A 1 335 ? 205.385 139.485 196.916 1.00 153.44 ? 335 TRP A NE1 1 
ATOM   2295  C CE2 . TRP A 1 335 ? 205.880 139.084 198.129 1.00 153.44 ? 335 TRP A CE2 1 
ATOM   2296  C CE3 . TRP A 1 335 ? 205.061 138.016 200.136 1.00 153.44 ? 335 TRP A CE3 1 
ATOM   2297  C CZ2 . TRP A 1 335 ? 207.168 139.178 198.648 1.00 153.44 ? 335 TRP A CZ2 1 
ATOM   2298  C CZ3 . TRP A 1 335 ? 206.339 138.110 200.650 1.00 153.44 ? 335 TRP A CZ3 1 
ATOM   2299  C CH2 . TRP A 1 335 ? 207.377 138.686 199.908 1.00 153.44 ? 335 TRP A CH2 1 
ATOM   2300  N N   . ARG A 1 336 ? 198.987 137.737 196.701 1.00 143.34 ? 336 ARG A N   1 
ATOM   2301  C CA  . ARG A 1 336 ? 197.584 138.137 196.631 1.00 143.34 ? 336 ARG A CA  1 
ATOM   2302  C C   . ARG A 1 336 ? 196.848 138.315 197.945 1.00 143.34 ? 336 ARG A C   1 
ATOM   2303  O O   . ARG A 1 336 ? 196.761 137.399 198.768 1.00 143.34 ? 336 ARG A O   1 
ATOM   2304  C CB  . ARG A 1 336 ? 196.808 137.080 195.847 1.00 143.34 ? 336 ARG A CB  1 
ATOM   2305  C CG  . ARG A 1 336 ? 197.158 136.929 194.384 1.00 143.34 ? 336 ARG A CG  1 
ATOM   2306  C CD  . ARG A 1 336 ? 196.496 135.664 193.844 1.00 143.34 ? 336 ARG A CD  1 
ATOM   2307  N NE  . ARG A 1 336 ? 196.770 135.421 192.436 1.00 143.34 ? 336 ARG A NE  1 
ATOM   2308  C CZ  . ARG A 1 336 ? 196.422 134.311 191.794 1.00 143.34 ? 336 ARG A CZ  1 
ATOM   2309  N NH1 . ARG A 1 336 ? 195.806 133.335 192.441 1.00 143.34 ? 336 ARG A NH1 1 
ATOM   2310  N NH2 . ARG A 1 336 ? 196.703 134.171 190.506 1.00 143.34 ? 336 ARG A NH2 1 
ATOM   2311  N N   . GLN A 1 337 ? 196.279 139.509 198.100 1.00 156.12 ? 337 GLN A N   1 
ATOM   2312  C CA  . GLN A 1 337 ? 195.365 139.859 199.177 1.00 156.12 ? 337 GLN A CA  1 
ATOM   2313  C C   . GLN A 1 337 ? 193.925 139.576 198.770 1.00 156.12 ? 337 GLN A C   1 
ATOM   2314  O O   . GLN A 1 337 ? 193.232 138.778 199.407 1.00 156.12 ? 337 GLN A O   1 
ATOM   2315  C CB  . GLN A 1 337 ? 195.524 141.346 199.524 1.00 156.12 ? 337 GLN A CB  1 
ATOM   2316  C CG  . GLN A 1 337 ? 194.669 141.818 200.686 1.00 156.12 ? 337 GLN A CG  1 
ATOM   2317  C CD  . GLN A 1 337 ? 194.742 143.317 200.893 1.00 156.12 ? 337 GLN A CD  1 
ATOM   2318  O OE1 . GLN A 1 337 ? 195.334 144.036 200.090 1.00 156.12 ? 337 GLN A OE1 1 
ATOM   2319  N NE2 . GLN A 1 337 ? 194.143 143.795 201.975 1.00 156.12 ? 337 GLN A NE2 1 
ATOM   2320  N N   . ARG A 1 338 ? 193.470 140.226 197.702 1.00 157.96 ? 338 ARG A N   1 
ATOM   2321  C CA  . ARG A 1 338 ? 192.152 139.981 197.143 1.00 157.96 ? 338 ARG A CA  1 
ATOM   2322  C C   . ARG A 1 338 ? 192.191 138.873 196.098 1.00 157.96 ? 338 ARG A C   1 
ATOM   2323  O O   . ARG A 1 338 ? 191.334 137.985 196.108 1.00 157.96 ? 338 ARG A O   1 
ATOM   2324  C CB  . ARG A 1 338 ? 191.595 141.274 196.546 1.00 157.96 ? 338 ARG A CB  1 
ATOM   2325  C CG  . ARG A 1 338 ? 191.400 142.374 197.575 1.00 157.96 ? 338 ARG A CG  1 
ATOM   2326  C CD  . ARG A 1 338 ? 190.839 143.651 196.967 1.00 157.96 ? 338 ARG A CD  1 
ATOM   2327  N NE  . ARG A 1 338 ? 189.439 143.515 196.588 1.00 157.96 ? 338 ARG A NE  1 
ATOM   2328  C CZ  . ARG A 1 338 ? 188.754 144.418 195.892 1.00 157.96 ? 338 ARG A CZ  1 
ATOM   2329  N NH1 . ARG A 1 338 ? 187.479 144.206 195.597 1.00 157.96 ? 338 ARG A NH1 1 
ATOM   2330  N NH2 . ARG A 1 338 ? 189.341 145.530 195.485 1.00 157.96 ? 338 ARG A NH2 1 
ATOM   2331  N N   . GLY A 1 339 ? 193.170 138.909 195.195 1.00 157.92 ? 339 GLY A N   1 
ATOM   2332  C CA  . GLY A 1 339 ? 193.479 137.772 194.348 1.00 157.92 ? 339 GLY A CA  1 
ATOM   2333  C C   . GLY A 1 339 ? 192.490 137.492 193.239 1.00 157.92 ? 339 GLY A C   1 
ATOM   2334  O O   . GLY A 1 339 ? 192.809 137.635 192.053 1.00 157.92 ? 339 GLY A O   1 
ATOM   2335  N N   . ARG A 1 340 ? 191.281 137.084 193.622 1.00 173.53 ? 340 ARG A N   1 
ATOM   2336  C CA  . ARG A 1 340 ? 190.232 136.708 192.684 1.00 173.53 ? 340 ARG A CA  1 
ATOM   2337  C C   . ARG A 1 340 ? 189.452 137.909 192.167 1.00 173.53 ? 340 ARG A C   1 
ATOM   2338  O O   . ARG A 1 340 ? 188.552 137.739 191.341 1.00 173.53 ? 340 ARG A O   1 
ATOM   2339  C CB  . ARG A 1 340 ? 189.259 135.713 193.333 1.00 173.53 ? 340 ARG A CB  1 
ATOM   2340  C CG  . ARG A 1 340 ? 189.671 134.235 193.301 1.00 173.53 ? 340 ARG A CG  1 
ATOM   2341  C CD  . ARG A 1 340 ? 190.730 133.873 194.348 1.00 173.53 ? 340 ARG A CD  1 
ATOM   2342  N NE  . ARG A 1 340 ? 190.943 132.430 194.421 1.00 173.53 ? 340 ARG A NE  1 
ATOM   2343  C CZ  . ARG A 1 340 ? 191.835 131.834 195.206 1.00 173.53 ? 340 ARG A CZ  1 
ATOM   2344  N NH1 . ARG A 1 340 ? 192.610 132.553 196.006 1.00 173.53 ? 340 ARG A NH1 1 
ATOM   2345  N NH2 . ARG A 1 340 ? 191.947 130.513 195.197 1.00 173.53 ? 340 ARG A NH2 1 
ATOM   2346  N N   . VAL A 1 341 ? 189.771 139.115 192.638 1.00 170.32 ? 341 VAL A N   1 
ATOM   2347  C CA  . VAL A 1 341 ? 189.026 140.296 192.218 1.00 170.32 ? 341 VAL A CA  1 
ATOM   2348  C C   . VAL A 1 341 ? 189.438 140.713 190.809 1.00 170.32 ? 341 VAL A C   1 
ATOM   2349  O O   . VAL A 1 341 ? 188.599 141.142 190.003 1.00 170.32 ? 341 VAL A O   1 
ATOM   2350  C CB  . VAL A 1 341 ? 189.211 141.414 193.262 1.00 170.32 ? 341 VAL A CB  1 
ATOM   2351  C CG1 . VAL A 1 341 ? 188.625 142.728 192.788 1.00 170.32 ? 341 VAL A CG1 1 
ATOM   2352  C CG2 . VAL A 1 341 ? 188.534 140.995 194.551 1.00 170.32 ? 341 VAL A CG2 1 
ATOM   2353  N N   . ILE A 1 342 ? 190.719 140.552 190.474 1.00 167.93 ? 342 ILE A N   1 
ATOM   2354  C CA  . ILE A 1 342 ? 191.157 140.693 189.089 1.00 167.93 ? 342 ILE A CA  1 
ATOM   2355  C C   . ILE A 1 342 ? 190.518 139.590 188.262 1.00 167.93 ? 342 ILE A C   1 
ATOM   2356  O O   . ILE A 1 342 ? 190.685 138.400 188.552 1.00 167.93 ? 342 ILE A O   1 
ATOM   2357  C CB  . ILE A 1 342 ? 192.679 140.642 188.997 1.00 167.93 ? 342 ILE A CB  1 
ATOM   2358  C CG1 . ILE A 1 342 ? 193.291 141.832 189.721 1.00 167.93 ? 342 ILE A CG1 1 
ATOM   2359  C CG2 . ILE A 1 342 ? 193.115 140.622 187.554 1.00 167.93 ? 342 ILE A CG2 1 
ATOM   2360  C CD1 . ILE A 1 342 ? 194.763 141.692 189.905 1.00 167.93 ? 342 ILE A CD1 1 
ATOM   2361  N N   . SER A 1 343 ? 189.768 139.982 187.234 1.00 171.79 ? 343 SER A N   1 
ATOM   2362  C CA  . SER A 1 343 ? 188.887 139.028 186.574 1.00 171.79 ? 343 SER A CA  1 
ATOM   2363  C C   . SER A 1 343 ? 188.851 139.183 185.059 1.00 171.79 ? 343 SER A C   1 
ATOM   2364  O O   . SER A 1 343 ? 187.837 138.832 184.443 1.00 171.79 ? 343 SER A O   1 
ATOM   2365  C CB  . SER A 1 343 ? 187.470 139.166 187.139 1.00 171.79 ? 343 SER A CB  1 
ATOM   2366  O OG  . SER A 1 343 ? 186.945 140.457 186.878 1.00 171.79 ? 343 SER A OG  1 
ATOM   2367  N N   . LEU A 1 344 ? 189.899 139.761 184.457 1.00 164.75 ? 344 LEU A N   1 
ATOM   2368  C CA  . LEU A 1 344 ? 190.079 139.949 183.007 1.00 164.75 ? 344 LEU A CA  1 
ATOM   2369  C C   . LEU A 1 344 ? 189.050 140.899 182.383 1.00 164.75 ? 344 LEU A C   1 
ATOM   2370  O O   . LEU A 1 344 ? 189.057 141.113 181.169 1.00 164.75 ? 344 LEU A O   1 
ATOM   2371  C CB  . LEU A 1 344 ? 190.096 138.613 182.243 1.00 164.75 ? 344 LEU A CB  1 
ATOM   2372  C CG  . LEU A 1 344 ? 191.363 137.747 182.266 1.00 164.75 ? 344 LEU A CG  1 
ATOM   2373  C CD1 . LEU A 1 344 ? 191.545 136.990 183.581 1.00 164.75 ? 344 LEU A CD1 1 
ATOM   2374  C CD2 . LEU A 1 344 ? 191.365 136.781 181.095 1.00 164.75 ? 344 LEU A CD2 1 
ATOM   2375  N N   . TRP A 1 345 ? 188.161 141.473 183.183 1.00 165.81 ? 345 TRP A N   1 
ATOM   2376  C CA  . TRP A 1 345 ? 187.390 142.637 182.797 1.00 165.81 ? 345 TRP A CA  1 
ATOM   2377  C C   . TRP A 1 345 ? 187.752 143.851 183.623 1.00 165.81 ? 345 TRP A C   1 
ATOM   2378  O O   . TRP A 1 345 ? 187.646 144.974 183.120 1.00 165.81 ? 345 TRP A O   1 
ATOM   2379  C CB  . TRP A 1 345 ? 185.886 142.366 182.931 1.00 165.81 ? 345 TRP A CB  1 
ATOM   2380  C CG  . TRP A 1 345 ? 185.045 143.503 182.457 1.00 165.81 ? 345 TRP A CG  1 
ATOM   2381  C CD1 . TRP A 1 345 ? 184.450 144.458 183.227 1.00 165.81 ? 345 TRP A CD1 1 
ATOM   2382  C CD2 . TRP A 1 345 ? 184.710 143.812 181.101 1.00 165.81 ? 345 TRP A CD2 1 
ATOM   2383  N NE1 . TRP A 1 345 ? 183.764 145.346 182.434 1.00 165.81 ? 345 TRP A NE1 1 
ATOM   2384  C CE2 . TRP A 1 345 ? 183.906 144.970 181.124 1.00 165.81 ? 345 TRP A CE2 1 
ATOM   2385  C CE3 . TRP A 1 345 ? 185.009 143.222 179.870 1.00 165.81 ? 345 TRP A CE3 1 
ATOM   2386  C CZ2 . TRP A 1 345 ? 183.400 145.551 179.964 1.00 165.81 ? 345 TRP A CZ2 1 
ATOM   2387  C CZ3 . TRP A 1 345 ? 184.506 143.799 178.719 1.00 165.81 ? 345 TRP A CZ3 1 
ATOM   2388  C CH2 . TRP A 1 345 ? 183.711 144.952 178.773 1.00 165.81 ? 345 TRP A CH2 1 
ATOM   2389  N N   . GLU A 1 346 ? 188.202 143.668 184.862 1.00 162.89 ? 346 GLU A N   1 
ATOM   2390  C CA  . GLU A 1 346 ? 188.892 144.734 185.567 1.00 162.89 ? 346 GLU A CA  1 
ATOM   2391  C C   . GLU A 1 346 ? 190.313 144.934 185.065 1.00 162.89 ? 346 GLU A C   1 
ATOM   2392  O O   . GLU A 1 346 ? 190.951 145.923 185.441 1.00 162.89 ? 346 GLU A O   1 
ATOM   2393  C CB  . GLU A 1 346 ? 188.911 144.468 187.074 1.00 162.89 ? 346 GLU A CB  1 
ATOM   2394  C CG  . GLU A 1 346 ? 187.565 144.647 187.762 1.00 162.89 ? 346 GLU A CG  1 
ATOM   2395  C CD  . GLU A 1 346 ? 187.650 144.444 189.264 1.00 162.89 ? 346 GLU A CD  1 
ATOM   2396  O OE1 . GLU A 1 346 ? 188.721 144.025 189.742 1.00 162.89 ? 346 GLU A OE1 1 
ATOM   2397  O OE2 . GLU A 1 346 ? 186.654 144.716 189.968 1.00 162.89 ? 346 GLU A OE2 1 
ATOM   2398  N N   . ARG A 1 347 ? 190.828 144.026 184.238 1.00 152.52 ? 347 ARG A N   1 
ATOM   2399  C CA  . ARG A 1 347 ? 192.058 144.298 183.513 1.00 152.52 ? 347 ARG A CA  1 
ATOM   2400  C C   . ARG A 1 347 ? 191.838 145.195 182.305 1.00 152.52 ? 347 ARG A C   1 
ATOM   2401  O O   . ARG A 1 347 ? 192.804 145.777 181.800 1.00 152.52 ? 347 ARG A O   1 
ATOM   2402  C CB  . ARG A 1 347 ? 192.706 142.992 183.056 1.00 152.52 ? 347 ARG A CB  1 
ATOM   2403  C CG  . ARG A 1 347 ? 193.309 142.171 184.168 1.00 152.52 ? 347 ARG A CG  1 
ATOM   2404  C CD  . ARG A 1 347 ? 194.057 140.981 183.599 1.00 152.52 ? 347 ARG A CD  1 
ATOM   2405  N NE  . ARG A 1 347 ? 194.737 140.208 184.630 1.00 152.52 ? 347 ARG A NE  1 
ATOM   2406  C CZ  . ARG A 1 347 ? 195.467 139.126 184.389 1.00 152.52 ? 347 ARG A CZ  1 
ATOM   2407  N NH1 . ARG A 1 347 ? 196.052 138.482 185.387 1.00 152.52 ? 347 ARG A NH1 1 
ATOM   2408  N NH2 . ARG A 1 347 ? 195.622 138.691 183.148 1.00 152.52 ? 347 ARG A NH2 1 
ATOM   2409  N N   . LEU A 1 348 ? 190.593 145.332 181.849 1.00 152.71 ? 348 LEU A N   1 
ATOM   2410  C CA  . LEU A 1 348 ? 190.314 145.967 180.571 1.00 152.71 ? 348 LEU A CA  1 
ATOM   2411  C C   . LEU A 1 348 ? 190.520 147.470 180.608 1.00 152.71 ? 348 LEU A C   1 
ATOM   2412  O O   . LEU A 1 348 ? 190.834 148.061 179.571 1.00 152.71 ? 348 LEU A O   1 
ATOM   2413  C CB  . LEU A 1 348 ? 188.883 145.630 180.133 1.00 152.71 ? 348 LEU A CB  1 
ATOM   2414  C CG  . LEU A 1 348 ? 188.352 145.877 178.713 1.00 152.71 ? 348 LEU A CG  1 
ATOM   2415  C CD1 . LEU A 1 348 ? 187.809 147.286 178.467 1.00 152.71 ? 348 LEU A CD1 1 
ATOM   2416  C CD2 . LEU A 1 348 ? 189.441 145.534 177.704 1.00 152.71 ? 348 LEU A CD2 1 
ATOM   2417  N N   . GLU A 1 349 ? 190.396 148.104 181.770 1.00 150.15 ? 349 GLU A N   1 
ATOM   2418  C CA  . GLU A 1 349 ? 190.480 149.555 181.837 1.00 150.15 ? 349 GLU A CA  1 
ATOM   2419  C C   . GLU A 1 349 ? 191.914 150.054 181.961 1.00 150.15 ? 349 GLU A C   1 
ATOM   2420  O O   . GLU A 1 349 ? 192.139 151.210 182.331 1.00 150.15 ? 349 GLU A O   1 
ATOM   2421  C CB  . GLU A 1 349 ? 189.599 150.071 182.976 1.00 150.15 ? 349 GLU A CB  1 
ATOM   2422  C CG  . GLU A 1 349 ? 190.017 149.673 184.375 1.00 150.15 ? 349 GLU A CG  1 
ATOM   2423  C CD  . GLU A 1 349 ? 190.760 150.779 185.085 1.00 150.15 ? 349 GLU A CD  1 
ATOM   2424  O OE1 . GLU A 1 349 ? 190.588 151.946 184.682 1.00 150.15 ? 349 GLU A OE1 1 
ATOM   2425  O OE2 . GLU A 1 349 ? 191.504 150.487 186.043 1.00 150.15 ? 349 GLU A OE2 1 
ATOM   2426  N N   . PHE A 1 350 ? 192.895 149.222 181.623 1.00 141.48 ? 350 PHE A N   1 
ATOM   2427  C CA  . PHE A 1 350 ? 194.289 149.638 181.595 1.00 141.48 ? 350 PHE A CA  1 
ATOM   2428  C C   . PHE A 1 350 ? 194.670 150.220 180.243 1.00 141.48 ? 350 PHE A C   1 
ATOM   2429  O O   . PHE A 1 350 ? 195.104 151.370 180.155 1.00 141.48 ? 350 PHE A O   1 
ATOM   2430  C CB  . PHE A 1 350 ? 195.180 148.445 181.930 1.00 141.48 ? 350 PHE A CB  1 
ATOM   2431  C CG  . PHE A 1 350 ? 195.088 148.016 183.349 1.00 141.48 ? 350 PHE A CG  1 
ATOM   2432  C CD1 . PHE A 1 350 ? 194.694 148.911 184.324 1.00 141.48 ? 350 PHE A CD1 1 
ATOM   2433  C CD2 . PHE A 1 350 ? 195.342 146.706 183.704 1.00 141.48 ? 350 PHE A CD2 1 
ATOM   2434  C CE1 . PHE A 1 350 ? 194.593 148.520 185.631 1.00 141.48 ? 350 PHE A CE1 1 
ATOM   2435  C CE2 . PHE A 1 350 ? 195.239 146.304 185.013 1.00 141.48 ? 350 PHE A CE2 1 
ATOM   2436  C CZ  . PHE A 1 350 ? 194.863 147.214 185.978 1.00 141.48 ? 350 PHE A CZ  1 
ATOM   2437  N N   . VAL A 1 351 ? 194.512 149.436 179.183 1.00 135.17 ? 351 VAL A N   1 
ATOM   2438  C CA  . VAL A 1 351 ? 194.870 149.874 177.840 1.00 135.17 ? 351 VAL A CA  1 
ATOM   2439  C C   . VAL A 1 351 ? 193.793 150.835 177.357 1.00 135.17 ? 351 VAL A C   1 
ATOM   2440  O O   . VAL A 1 351 ? 192.616 150.478 177.292 1.00 135.17 ? 351 VAL A O   1 
ATOM   2441  C CB  . VAL A 1 351 ? 195.022 148.685 176.887 1.00 135.17 ? 351 VAL A CB  1 
ATOM   2442  C CG1 . VAL A 1 351 ? 195.300 149.174 175.475 1.00 135.17 ? 351 VAL A CG1 1 
ATOM   2443  C CG2 . VAL A 1 351 ? 196.127 147.761 177.373 1.00 135.17 ? 351 VAL A CG2 1 
ATOM   2444  N N   . ASN A 1 352 ? 194.194 152.052 177.017 1.00 120.82 ? 352 ASN A N   1 
ATOM   2445  C CA  . ASN A 1 352 ? 193.228 153.072 176.649 1.00 120.82 ? 352 ASN A CA  1 
ATOM   2446  C C   . ASN A 1 352 ? 192.720 152.835 175.238 1.00 120.82 ? 352 ASN A C   1 
ATOM   2447  O O   . ASN A 1 352 ? 193.502 152.629 174.307 1.00 120.82 ? 352 ASN A O   1 
ATOM   2448  C CB  . ASN A 1 352 ? 193.863 154.446 176.755 1.00 120.82 ? 352 ASN A CB  1 
ATOM   2449  C CG  . ASN A 1 352 ? 194.423 154.705 178.120 1.00 120.82 ? 352 ASN A CG  1 
ATOM   2450  O OD1 . ASN A 1 352 ? 195.626 154.873 178.285 1.00 120.82 ? 352 ASN A OD1 1 
ATOM   2451  N ND2 . ASN A 1 352 ? 193.557 154.709 179.119 1.00 120.82 ? 352 ASN A ND2 1 
ATOM   2452  N N   . GLY A 1 353 ? 191.398 152.879 175.084 1.00 113.28 ? 353 GLY A N   1 
ATOM   2453  C CA  . GLY A 1 353 ? 190.794 152.593 173.797 1.00 113.28 ? 353 GLY A CA  1 
ATOM   2454  C C   . GLY A 1 353 ? 191.032 153.664 172.756 1.00 113.28 ? 353 GLY A C   1 
ATOM   2455  O O   . GLY A 1 353 ? 190.896 153.399 171.559 1.00 113.28 ? 353 GLY A O   1 
ATOM   2456  N N   . TRP A 1 354 ? 191.390 154.871 173.184 1.00 106.02 ? 354 TRP A N   1 
ATOM   2457  C CA  . TRP A 1 354 ? 191.657 155.921 172.217 1.00 106.02 ? 354 TRP A CA  1 
ATOM   2458  C C   . TRP A 1 354 ? 192.990 155.708 171.527 1.00 106.02 ? 354 TRP A C   1 
ATOM   2459  O O   . TRP A 1 354 ? 193.153 156.088 170.365 1.00 106.02 ? 354 TRP A O   1 
ATOM   2460  C CB  . TRP A 1 354 ? 191.620 157.285 172.890 1.00 106.02 ? 354 TRP A CB  1 
ATOM   2461  C CG  . TRP A 1 354 ? 190.286 157.605 173.411 1.00 106.02 ? 354 TRP A CG  1 
ATOM   2462  C CD1 . TRP A 1 354 ? 189.881 157.546 174.701 1.00 106.02 ? 354 TRP A CD1 1 
ATOM   2463  C CD2 . TRP A 1 354 ? 189.146 157.988 172.649 1.00 106.02 ? 354 TRP A CD2 1 
ATOM   2464  N NE1 . TRP A 1 354 ? 188.563 157.897 174.800 1.00 106.02 ? 354 TRP A NE1 1 
ATOM   2465  C CE2 . TRP A 1 354 ? 188.087 158.170 173.547 1.00 106.02 ? 354 TRP A CE2 1 
ATOM   2466  C CE3 . TRP A 1 354 ? 188.921 158.205 171.293 1.00 106.02 ? 354 TRP A CE3 1 
ATOM   2467  C CZ2 . TRP A 1 354 ? 186.824 158.559 173.136 1.00 106.02 ? 354 TRP A CZ2 1 
ATOM   2468  C CZ3 . TRP A 1 354 ? 187.669 158.589 170.888 1.00 106.02 ? 354 TRP A CZ3 1 
ATOM   2469  C CH2 . TRP A 1 354 ? 186.634 158.764 171.805 1.00 106.02 ? 354 TRP A CH2 1 
ATOM   2470  N N   . TYR A 1 355 ? 193.950 155.092 172.212 1.00 113.09 ? 355 TYR A N   1 
ATOM   2471  C CA  . TYR A 1 355 ? 195.271 154.942 171.615 1.00 113.09 ? 355 TYR A CA  1 
ATOM   2472  C C   . TYR A 1 355 ? 195.292 153.860 170.551 1.00 113.09 ? 355 TYR A C   1 
ATOM   2473  O O   . TYR A 1 355 ? 195.940 154.025 169.512 1.00 113.09 ? 355 TYR A O   1 
ATOM   2474  C CB  . TYR A 1 355 ? 196.313 154.667 172.689 1.00 113.09 ? 355 TYR A CB  1 
ATOM   2475  C CG  . TYR A 1 355 ? 196.692 155.910 173.442 1.00 113.09 ? 355 TYR A CG  1 
ATOM   2476  C CD1 . TYR A 1 355 ? 197.588 156.814 172.901 1.00 113.09 ? 355 TYR A CD1 1 
ATOM   2477  C CD2 . TYR A 1 355 ? 196.150 156.186 174.680 1.00 113.09 ? 355 TYR A CD2 1 
ATOM   2478  C CE1 . TYR A 1 355 ? 197.940 157.952 173.574 1.00 113.09 ? 355 TYR A CE1 1 
ATOM   2479  C CE2 . TYR A 1 355 ? 196.495 157.323 175.366 1.00 113.09 ? 355 TYR A CE2 1 
ATOM   2480  C CZ  . TYR A 1 355 ? 197.393 158.202 174.806 1.00 113.09 ? 355 TYR A CZ  1 
ATOM   2481  O OH  . TYR A 1 355 ? 197.751 159.345 175.477 1.00 113.09 ? 355 TYR A OH  1 
ATOM   2482  N N   . ILE A 1 356 ? 194.564 152.762 170.772 1.00 115.03 ? 356 ILE A N   1 
ATOM   2483  C CA  . ILE A 1 356 ? 194.535 151.677 169.796 1.00 115.03 ? 356 ILE A CA  1 
ATOM   2484  C C   . ILE A 1 356 ? 193.803 152.113 168.529 1.00 115.03 ? 356 ILE A C   1 
ATOM   2485  O O   . ILE A 1 356 ? 194.083 151.614 167.435 1.00 115.03 ? 356 ILE A O   1 
ATOM   2486  C CB  . ILE A 1 356 ? 193.926 150.405 170.430 1.00 115.03 ? 356 ILE A CB  1 
ATOM   2487  C CG1 . ILE A 1 356 ? 194.206 149.171 169.573 1.00 115.03 ? 356 ILE A CG1 1 
ATOM   2488  C CG2 . ILE A 1 356 ? 192.432 150.537 170.673 1.00 115.03 ? 356 ILE A CG2 1 
ATOM   2489  C CD1 . ILE A 1 356 ? 195.674 148.805 169.484 1.00 115.03 ? 356 ILE A CD1 1 
ATOM   2490  N N   . LEU A 1 357 ? 192.908 153.088 168.642 1.00 107.28 ? 357 LEU A N   1 
ATOM   2491  C CA  . LEU A 1 357 ? 192.309 153.689 167.463 1.00 107.28 ? 357 LEU A CA  1 
ATOM   2492  C C   . LEU A 1 357 ? 193.296 154.593 166.746 1.00 107.28 ? 357 LEU A C   1 
ATOM   2493  O O   . LEU A 1 357 ? 193.289 154.664 165.514 1.00 107.28 ? 357 LEU A O   1 
ATOM   2494  C CB  . LEU A 1 357 ? 191.049 154.453 167.872 1.00 107.28 ? 357 LEU A CB  1 
ATOM   2495  C CG  . LEU A 1 357 ? 190.128 155.096 166.846 1.00 107.28 ? 357 LEU A CG  1 
ATOM   2496  C CD1 . LEU A 1 357 ? 188.698 154.944 167.291 1.00 107.28 ? 357 LEU A CD1 1 
ATOM   2497  C CD2 . LEU A 1 357 ? 190.442 156.568 166.708 1.00 107.28 ? 357 LEU A CD2 1 
ATOM   2498  N N   . LEU A 1 358 ? 194.158 155.277 167.493 1.00 109.42 ? 358 LEU A N   1 
ATOM   2499  C CA  . LEU A 1 358 ? 195.183 156.096 166.863 1.00 109.42 ? 358 LEU A CA  1 
ATOM   2500  C C   . LEU A 1 358 ? 196.299 155.248 166.273 1.00 109.42 ? 358 LEU A C   1 
ATOM   2501  O O   . LEU A 1 358 ? 196.965 155.677 165.326 1.00 109.42 ? 358 LEU A O   1 
ATOM   2502  C CB  . LEU A 1 358 ? 195.743 157.087 167.873 1.00 109.42 ? 358 LEU A CB  1 
ATOM   2503  C CG  . LEU A 1 358 ? 194.710 158.124 168.293 1.00 109.42 ? 358 LEU A CG  1 
ATOM   2504  C CD1 . LEU A 1 358 ? 195.249 159.003 169.401 1.00 109.42 ? 358 LEU A CD1 1 
ATOM   2505  C CD2 . LEU A 1 358 ? 194.285 158.949 167.093 1.00 109.42 ? 358 LEU A CD2 1 
ATOM   2506  N N   . VAL A 1 359 ? 196.528 154.055 166.822 1.00 107.36 ? 359 VAL A N   1 
ATOM   2507  C CA  . VAL A 1 359 ? 197.458 153.125 166.196 1.00 107.36 ? 359 VAL A CA  1 
ATOM   2508  C C   . VAL A 1 359 ? 196.862 152.578 164.911 1.00 107.36 ? 359 VAL A C   1 
ATOM   2509  O O   . VAL A 1 359 ? 197.572 152.391 163.916 1.00 107.36 ? 359 VAL A O   1 
ATOM   2510  C CB  . VAL A 1 359 ? 197.820 152.010 167.192 1.00 107.36 ? 359 VAL A CB  1 
ATOM   2511  C CG1 . VAL A 1 359 ? 198.625 150.910 166.544 1.00 107.36 ? 359 VAL A CG1 1 
ATOM   2512  C CG2 . VAL A 1 359 ? 198.618 152.590 168.315 1.00 107.36 ? 359 VAL A CG2 1 
ATOM   2513  N N   . THR A 1 360 ? 195.542 152.387 164.894 1.00 110.10 ? 360 THR A N   1 
ATOM   2514  C CA  . THR A 1 360 ? 194.869 151.728 163.781 1.00 110.10 ? 360 THR A CA  1 
ATOM   2515  C C   . THR A 1 360 ? 194.936 152.565 162.516 1.00 110.10 ? 360 THR A C   1 
ATOM   2516  O O   . THR A 1 360 ? 195.242 152.051 161.437 1.00 110.10 ? 360 THR A O   1 
ATOM   2517  C CB  . THR A 1 360 ? 193.412 151.462 164.148 1.00 110.10 ? 360 THR A CB  1 
ATOM   2518  O OG1 . THR A 1 360 ? 193.351 150.750 165.386 1.00 110.10 ? 360 THR A OG1 1 
ATOM   2519  C CG2 . THR A 1 360 ? 192.745 150.624 163.075 1.00 110.10 ? 360 THR A CG2 1 
ATOM   2520  N N   . SER A 1 361 ? 194.661 153.862 162.638 1.00 111.23 ? 361 SER A N   1 
ATOM   2521  C CA  . SER A 1 361 ? 194.708 154.753 161.488 1.00 111.23 ? 361 SER A CA  1 
ATOM   2522  C C   . SER A 1 361 ? 196.112 154.868 160.921 1.00 111.23 ? 361 SER A C   1 
ATOM   2523  O O   . SER A 1 361 ? 196.287 154.817 159.700 1.00 111.23 ? 361 SER A O   1 
ATOM   2524  C CB  . SER A 1 361 ? 194.196 156.131 161.885 1.00 111.23 ? 361 SER A CB  1 
ATOM   2525  O OG  . SER A 1 361 ? 195.066 156.712 162.833 1.00 111.23 ? 361 SER A OG  1 
ATOM   2526  N N   . ASP A 1 362 ? 197.117 154.989 161.790 1.00 120.31 ? 362 ASP A N   1 
ATOM   2527  C CA  . ASP A 1 362 ? 198.502 155.122 161.362 1.00 120.31 ? 362 ASP A CA  1 
ATOM   2528  C C   . ASP A 1 362 ? 199.028 153.882 160.666 1.00 120.31 ? 362 ASP A C   1 
ATOM   2529  O O   . ASP A 1 362 ? 199.939 153.996 159.841 1.00 120.31 ? 362 ASP A O   1 
ATOM   2530  C CB  . ASP A 1 362 ? 199.393 155.442 162.557 1.00 120.31 ? 362 ASP A CB  1 
ATOM   2531  C CG  . ASP A 1 362 ? 199.200 156.846 163.054 1.00 120.31 ? 362 ASP A CG  1 
ATOM   2532  O OD1 . ASP A 1 362 ? 198.861 157.718 162.229 1.00 120.31 ? 362 ASP A OD1 1 
ATOM   2533  O OD2 . ASP A 1 362 ? 199.384 157.080 164.266 1.00 120.31 ? 362 ASP A OD2 1 
ATOM   2534  N N   . VAL A 1 363 ? 198.493 152.708 160.989 1.00 116.17 ? 363 VAL A N   1 
ATOM   2535  C CA  . VAL A 1 363 ? 198.753 151.546 160.157 1.00 116.17 ? 363 VAL A CA  1 
ATOM   2536  C C   . VAL A 1 363 ? 198.169 151.764 158.774 1.00 116.17 ? 363 VAL A C   1 
ATOM   2537  O O   . VAL A 1 363 ? 198.847 151.563 157.764 1.00 116.17 ? 363 VAL A O   1 
ATOM   2538  C CB  . VAL A 1 363 ? 198.196 150.276 160.820 1.00 116.17 ? 363 VAL A CB  1 
ATOM   2539  C CG1 . VAL A 1 363 ? 198.284 149.095 159.874 1.00 116.17 ? 363 VAL A CG1 1 
ATOM   2540  C CG2 . VAL A 1 363 ? 198.960 149.985 162.083 1.00 116.17 ? 363 VAL A CG2 1 
ATOM   2541  N N   . LEU A 1 364 ? 196.927 152.238 158.706 1.00 111.93 ? 364 LEU A N   1 
ATOM   2542  C CA  . LEU A 1 364 ? 196.261 152.407 157.421 1.00 111.93 ? 364 LEU A CA  1 
ATOM   2543  C C   . LEU A 1 364 ? 196.806 153.602 156.658 1.00 111.93 ? 364 LEU A C   1 
ATOM   2544  O O   . LEU A 1 364 ? 196.906 153.560 155.429 1.00 111.93 ? 364 LEU A O   1 
ATOM   2545  C CB  . LEU A 1 364 ? 194.753 152.552 157.618 1.00 111.93 ? 364 LEU A CB  1 
ATOM   2546  C CG  . LEU A 1 364 ? 193.887 151.292 157.615 1.00 111.93 ? 364 LEU A CG  1 
ATOM   2547  C CD1 . LEU A 1 364 ? 194.102 150.421 158.819 1.00 111.93 ? 364 LEU A CD1 1 
ATOM   2548  C CD2 . LEU A 1 364 ? 192.441 151.687 157.545 1.00 111.93 ? 364 LEU A CD2 1 
ATOM   2549  N N   . THR A 1 365 ? 197.169 154.670 157.367 1.00 115.93 ? 365 THR A N   1 
ATOM   2550  C CA  . THR A 1 365 ? 197.524 155.912 156.692 1.00 115.93 ? 365 THR A CA  1 
ATOM   2551  C C   . THR A 1 365 ? 198.862 155.790 155.984 1.00 115.93 ? 365 THR A C   1 
ATOM   2552  O O   . THR A 1 365 ? 198.987 156.149 154.808 1.00 115.93 ? 365 THR A O   1 
ATOM   2553  C CB  . THR A 1 365 ? 197.558 157.066 157.688 1.00 115.93 ? 365 THR A CB  1 
ATOM   2554  O OG1 . THR A 1 365 ? 196.284 157.173 158.330 1.00 115.93 ? 365 THR A OG1 1 
ATOM   2555  C CG2 . THR A 1 365 ? 197.855 158.364 156.977 1.00 115.93 ? 365 THR A CG2 1 
ATOM   2556  N N   . ILE A 1 366 ? 199.873 155.262 156.672 1.00 117.44 ? 366 ILE A N   1 
ATOM   2557  C CA  . ILE A 1 366 ? 201.159 155.121 156.012 1.00 117.44 ? 366 ILE A CA  1 
ATOM   2558  C C   . ILE A 1 366 ? 201.149 153.932 155.058 1.00 117.44 ? 366 ILE A C   1 
ATOM   2559  O O   . ILE A 1 366 ? 201.972 153.880 154.141 1.00 117.44 ? 366 ILE A O   1 
ATOM   2560  C CB  . ILE A 1 366 ? 202.298 155.046 157.043 1.00 117.44 ? 366 ILE A CB  1 
ATOM   2561  C CG1 . ILE A 1 366 ? 203.617 155.463 156.387 1.00 117.44 ? 366 ILE A CG1 1 
ATOM   2562  C CG2 . ILE A 1 366 ? 202.417 153.655 157.628 1.00 117.44 ? 366 ILE A CG2 1 
ATOM   2563  C CD1 . ILE A 1 366 ? 204.703 155.851 157.346 1.00 117.44 ? 366 ILE A CD1 1 
ATOM   2564  N N   . SER A 1 367 ? 200.207 152.998 155.211 1.00 118.54 ? 367 SER A N   1 
ATOM   2565  C CA  . SER A 1 367 ? 199.976 152.028 154.149 1.00 118.54 ? 367 SER A CA  1 
ATOM   2566  C C   . SER A 1 367 ? 199.211 152.646 152.996 1.00 118.54 ? 367 SER A C   1 
ATOM   2567  O O   . SER A 1 367 ? 199.371 152.220 151.848 1.00 118.54 ? 367 SER A O   1 
ATOM   2568  C CB  . SER A 1 367 ? 199.209 150.819 154.675 1.00 118.54 ? 367 SER A CB  1 
ATOM   2569  O OG  . SER A 1 367 ? 198.920 149.903 153.638 1.00 118.54 ? 367 SER A OG  1 
ATOM   2570  N N   . GLY A 1 368 ? 198.375 153.640 153.283 1.00 118.87 ? 368 GLY A N   1 
ATOM   2571  C CA  . GLY A 1 368 ? 197.607 154.265 152.225 1.00 118.87 ? 368 GLY A CA  1 
ATOM   2572  C C   . GLY A 1 368 ? 198.465 155.149 151.346 1.00 118.87 ? 368 GLY A C   1 
ATOM   2573  O O   . GLY A 1 368 ? 198.504 154.976 150.127 1.00 118.87 ? 368 GLY A O   1 
ATOM   2574  N N   . THR A 1 369 ? 199.186 156.090 151.956 1.00 120.65 ? 369 THR A N   1 
ATOM   2575  C CA  . THR A 1 369 ? 199.949 157.057 151.180 1.00 120.65 ? 369 THR A CA  1 
ATOM   2576  C C   . THR A 1 369 ? 201.147 156.438 150.480 1.00 120.65 ? 369 THR A C   1 
ATOM   2577  O O   . THR A 1 369 ? 201.618 157.000 149.490 1.00 120.65 ? 369 THR A O   1 
ATOM   2578  C CB  . THR A 1 369 ? 200.418 158.203 152.069 1.00 120.65 ? 369 THR A CB  1 
ATOM   2579  O OG1 . THR A 1 369 ? 201.195 157.674 153.146 1.00 120.65 ? 369 THR A OG1 1 
ATOM   2580  C CG2 . THR A 1 369 ? 199.238 158.970 152.626 1.00 120.65 ? 369 THR A CG2 1 
ATOM   2581  N N   . ILE A 1 370 ? 201.643 155.295 150.953 1.00 117.83 ? 370 ILE A N   1 
ATOM   2582  C CA  . ILE A 1 370 ? 202.698 154.613 150.216 1.00 117.83 ? 370 ILE A CA  1 
ATOM   2583  C C   . ILE A 1 370 ? 202.133 153.945 148.969 1.00 117.83 ? 370 ILE A C   1 
ATOM   2584  O O   . ILE A 1 370 ? 202.869 153.712 148.004 1.00 117.83 ? 370 ILE A O   1 
ATOM   2585  C CB  . ILE A 1 370 ? 203.433 153.621 151.135 1.00 117.83 ? 370 ILE A CB  1 
ATOM   2586  C CG1 . ILE A 1 370 ? 204.787 153.240 150.557 1.00 117.83 ? 370 ILE A CG1 1 
ATOM   2587  C CG2 . ILE A 1 370 ? 202.645 152.349 151.343 1.00 117.83 ? 370 ILE A CG2 1 
ATOM   2588  C CD1 . ILE A 1 370 ? 205.676 152.551 151.554 1.00 117.83 ? 370 ILE A CD1 1 
ATOM   2589  N N   . MET A 1 371 ? 200.828 153.671 148.948 1.00 124.37 ? 371 MET A N   1 
ATOM   2590  C CA  . MET A 1 371 ? 200.176 153.191 147.743 1.00 124.37 ? 371 MET A CA  1 
ATOM   2591  C C   . MET A 1 371 ? 199.823 154.350 146.832 1.00 124.37 ? 371 MET A C   1 
ATOM   2592  O O   . MET A 1 371 ? 199.759 154.186 145.611 1.00 124.37 ? 371 MET A O   1 
ATOM   2593  C CB  . MET A 1 371 ? 198.921 152.408 148.123 1.00 124.37 ? 371 MET A CB  1 
ATOM   2594  C CG  . MET A 1 371 ? 198.288 151.634 147.004 1.00 124.37 ? 371 MET A CG  1 
ATOM   2595  S SD  . MET A 1 371 ? 199.308 150.248 146.520 1.00 124.37 ? 371 MET A SD  1 
ATOM   2596  C CE  . MET A 1 371 ? 199.063 149.196 147.948 1.00 124.37 ? 371 MET A CE  1 
ATOM   2597  N N   . LYS A 1 372 ? 199.621 155.531 147.417 1.00 119.75 ? 372 LYS A N   1 
ATOM   2598  C CA  . LYS A 1 372 ? 199.310 156.735 146.662 1.00 119.75 ? 372 LYS A CA  1 
ATOM   2599  C C   . LYS A 1 372 ? 200.509 157.227 145.863 1.00 119.75 ? 372 LYS A C   1 
ATOM   2600  O O   . LYS A 1 372 ? 200.331 157.978 144.899 1.00 119.75 ? 372 LYS A O   1 
ATOM   2601  C CB  . LYS A 1 372 ? 198.790 157.801 147.636 1.00 119.75 ? 372 LYS A CB  1 
ATOM   2602  C CG  . LYS A 1 372 ? 198.224 159.086 147.040 1.00 119.75 ? 372 LYS A CG  1 
ATOM   2603  C CD  . LYS A 1 372 ? 199.249 160.210 147.092 1.00 119.75 ? 372 LYS A CD  1 
ATOM   2604  C CE  . LYS A 1 372 ? 198.714 161.502 146.525 1.00 119.75 ? 372 LYS A CE  1 
ATOM   2605  N NZ  . LYS A 1 372 ? 199.752 162.562 146.587 1.00 119.75 ? 372 LYS A NZ  1 
ATOM   2606  N N   . ILE A 1 373 ? 201.721 156.792 146.220 1.00 123.64 ? 373 ILE A N   1 
ATOM   2607  C CA  . ILE A 1 373 ? 202.911 157.092 145.435 1.00 123.64 ? 373 ILE A CA  1 
ATOM   2608  C C   . ILE A 1 373 ? 202.825 156.482 144.042 1.00 123.64 ? 373 ILE A C   1 
ATOM   2609  O O   . ILE A 1 373 ? 203.355 157.049 143.080 1.00 123.64 ? 373 ILE A O   1 
ATOM   2610  C CB  . ILE A 1 373 ? 204.145 156.613 146.220 1.00 123.64 ? 373 ILE A CB  1 
ATOM   2611  C CG1 . ILE A 1 373 ? 204.220 157.356 147.546 1.00 123.64 ? 373 ILE A CG1 1 
ATOM   2612  C CG2 . ILE A 1 373 ? 205.441 156.869 145.479 1.00 123.64 ? 373 ILE A CG2 1 
ATOM   2613  C CD1 . ILE A 1 373 ? 205.246 156.796 148.492 1.00 123.64 ? 373 ILE A CD1 1 
ATOM   2614  N N   . GLY A 1 374 ? 202.076 155.394 143.885 1.00 131.07 ? 374 GLY A N   1 
ATOM   2615  C CA  . GLY A 1 374 ? 201.813 154.816 142.582 1.00 131.07 ? 374 GLY A CA  1 
ATOM   2616  C C   . GLY A 1 374 ? 200.875 155.629 141.708 1.00 131.07 ? 374 GLY A C   1 
ATOM   2617  O O   . GLY A 1 374 ? 199.793 155.165 141.337 1.00 131.07 ? 374 GLY A O   1 
ATOM   2618  N N   . ILE A 1 375 ? 201.268 156.865 141.403 1.00 136.58 ? 375 ILE A N   1 
ATOM   2619  C CA  . ILE A 1 375 ? 200.612 157.662 140.372 1.00 136.58 ? 375 ILE A CA  1 
ATOM   2620  C C   . ILE A 1 375 ? 201.606 158.298 139.406 1.00 136.58 ? 375 ILE A C   1 
ATOM   2621  O O   . ILE A 1 375 ? 201.218 158.722 138.301 1.00 136.58 ? 375 ILE A O   1 
ATOM   2622  C CB  . ILE A 1 375 ? 199.714 158.741 141.027 1.00 136.58 ? 375 ILE A CB  1 
ATOM   2623  C CG1 . ILE A 1 375 ? 198.636 159.249 140.061 1.00 136.58 ? 375 ILE A CG1 1 
ATOM   2624  C CG2 . ILE A 1 375 ? 200.550 159.896 141.560 1.00 136.58 ? 375 ILE A CG2 1 
ATOM   2625  C CD1 . ILE A 1 375 ? 197.538 160.037 140.729 1.00 136.58 ? 375 ILE A CD1 1 
ATOM   2626  N N   . GLU A 1 376 ? 202.901 158.339 139.724 1.00 144.35 ? 376 GLU A N   1 
ATOM   2627  C CA  . GLU A 1 376 ? 203.876 158.917 138.801 1.00 144.35 ? 376 GLU A CA  1 
ATOM   2628  C C   . GLU A 1 376 ? 204.213 157.938 137.683 1.00 144.35 ? 376 GLU A C   1 
ATOM   2629  O O   . GLU A 1 376 ? 203.936 158.197 136.509 1.00 144.35 ? 376 GLU A O   1 
ATOM   2630  C CB  . GLU A 1 376 ? 205.147 159.326 139.553 1.00 144.35 ? 376 GLU A CB  1 
ATOM   2631  C CG  . GLU A 1 376 ? 206.203 159.982 138.666 1.00 144.35 ? 376 GLU A CG  1 
ATOM   2632  C CD  . GLU A 1 376 ? 207.459 160.369 139.422 1.00 144.35 ? 376 GLU A CD  1 
ATOM   2633  O OE1 . GLU A 1 376 ? 207.543 160.080 140.633 1.00 144.35 ? 376 GLU A OE1 1 
ATOM   2634  O OE2 . GLU A 1 376 ? 208.365 160.966 138.806 1.00 144.35 ? 376 GLU A OE2 1 
ATOM   2635  N N   . ALA A 1 377 ? 204.795 156.795 138.039 1.00 141.64 ? 377 ALA A N   1 
ATOM   2636  C CA  . ALA A 1 377 ? 205.320 155.870 137.050 1.00 141.64 ? 377 ALA A CA  1 
ATOM   2637  C C   . ALA A 1 377 ? 204.894 154.432 137.259 1.00 141.64 ? 377 ALA A C   1 
ATOM   2638  O O   . ALA A 1 377 ? 205.197 153.594 136.404 1.00 141.64 ? 377 ALA A O   1 
ATOM   2639  C CB  . ALA A 1 377 ? 206.855 155.923 137.022 1.00 141.64 ? 377 ALA A CB  1 
ATOM   2640  N N   . LYS A 1 378 ? 204.223 154.111 138.356 1.00 139.81 ? 378 LYS A N   1 
ATOM   2641  C CA  . LYS A 1 378 ? 203.810 152.739 138.582 1.00 139.81 ? 378 LYS A CA  1 
ATOM   2642  C C   . LYS A 1 378 ? 202.585 152.441 137.736 1.00 139.81 ? 378 LYS A C   1 
ATOM   2643  O O   . LYS A 1 378 ? 201.662 153.256 137.654 1.00 139.81 ? 378 LYS A O   1 
ATOM   2644  C CB  . LYS A 1 378 ? 203.525 152.493 140.059 1.00 139.81 ? 378 LYS A CB  1 
ATOM   2645  C CG  . LYS A 1 378 ? 203.168 151.055 140.366 1.00 139.81 ? 378 LYS A CG  1 
ATOM   2646  C CD  . LYS A 1 378 ? 204.284 150.084 140.005 1.00 139.81 ? 378 LYS A CD  1 
ATOM   2647  C CE  . LYS A 1 378 ? 205.457 150.187 140.965 1.00 139.81 ? 378 LYS A CE  1 
ATOM   2648  N NZ  . LYS A 1 378 ? 206.500 149.159 140.684 1.00 139.81 ? 378 LYS A NZ  1 
ATOM   2649  N N   . ASN A 1 379 ? 202.582 151.268 137.110 1.00 142.90 ? 379 ASN A N   1 
ATOM   2650  C CA  . ASN A 1 379 ? 201.558 150.862 136.159 1.00 142.90 ? 379 ASN A CA  1 
ATOM   2651  C C   . ASN A 1 379 ? 200.267 150.392 136.821 1.00 142.90 ? 379 ASN A C   1 
ATOM   2652  O O   . ASN A 1 379 ? 199.389 149.880 136.120 1.00 142.90 ? 379 ASN A O   1 
ATOM   2653  C CB  . ASN A 1 379 ? 202.104 149.748 135.259 1.00 142.90 ? 379 ASN A CB  1 
ATOM   2654  C CG  . ASN A 1 379 ? 203.332 150.174 134.478 1.00 142.90 ? 379 ASN A CG  1 
ATOM   2655  O OD1 . ASN A 1 379 ? 204.425 149.644 134.678 1.00 142.90 ? 379 ASN A OD1 1 
ATOM   2656  N ND2 . ASN A 1 379 ? 203.159 151.138 133.584 1.00 142.90 ? 379 ASN A ND2 1 
ATOM   2657  N N   . LEU A 1 380 ? 200.129 150.530 138.135 1.00 132.26 ? 380 LEU A N   1 
ATOM   2658  C CA  . LEU A 1 380 ? 198.897 150.122 138.785 1.00 132.26 ? 380 LEU A CA  1 
ATOM   2659  C C   . LEU A 1 380 ? 197.775 151.087 138.440 1.00 132.26 ? 380 LEU A C   1 
ATOM   2660  O O   . LEU A 1 380 ? 197.983 152.298 138.341 1.00 132.26 ? 380 LEU A O   1 
ATOM   2661  C CB  . LEU A 1 380 ? 199.086 150.037 140.305 1.00 132.26 ? 380 LEU A CB  1 
ATOM   2662  C CG  . LEU A 1 380 ? 199.556 151.194 141.206 1.00 132.26 ? 380 LEU A CG  1 
ATOM   2663  C CD1 . LEU A 1 380 ? 198.456 152.163 141.628 1.00 132.26 ? 380 LEU A CD1 1 
ATOM   2664  C CD2 . LEU A 1 380 ? 200.191 150.610 142.454 1.00 132.26 ? 380 LEU A CD2 1 
ATOM   2665  N N   . ALA A 1 381 ? 196.583 150.538 138.243 1.00 121.23 ? 381 ALA A N   1 
ATOM   2666  C CA  . ALA A 1 381 ? 195.364 151.326 138.166 1.00 121.23 ? 381 ALA A CA  1 
ATOM   2667  C C   . ALA A 1 381 ? 194.499 151.105 139.399 1.00 121.23 ? 381 ALA A C   1 
ATOM   2668  O O   . ALA A 1 381 ? 193.282 151.290 139.358 1.00 121.23 ? 381 ALA A O   1 
ATOM   2669  C CB  . ALA A 1 381 ? 194.585 150.995 136.895 1.00 121.23 ? 381 ALA A CB  1 
ATOM   2670  N N   . SER A 1 382 ? 195.126 150.723 140.511 1.00 116.08 ? 382 SER A N   1 
ATOM   2671  C CA  . SER A 1 382 ? 194.414 150.286 141.712 1.00 116.08 ? 382 SER A CA  1 
ATOM   2672  C C   . SER A 1 382 ? 193.852 151.490 142.468 1.00 116.08 ? 382 SER A C   1 
ATOM   2673  O O   . SER A 1 382 ? 194.243 151.807 143.590 1.00 116.08 ? 382 SER A O   1 
ATOM   2674  C CB  . SER A 1 382 ? 195.339 149.463 142.598 1.00 116.08 ? 382 SER A CB  1 
ATOM   2675  O OG  . SER A 1 382 ? 194.696 149.088 143.802 1.00 116.08 ? 382 SER A OG  1 
ATOM   2676  N N   . TYR A 1 383 ? 192.874 152.139 141.846 1.00 102.69 ? 383 TYR A N   1 
ATOM   2677  C CA  . TYR A 1 383 ? 192.232 153.312 142.410 1.00 102.69 ? 383 TYR A CA  1 
ATOM   2678  C C   . TYR A 1 383 ? 191.112 152.977 143.376 1.00 102.69 ? 383 TYR A C   1 
ATOM   2679  O O   . TYR A 1 383 ? 190.279 153.840 143.661 1.00 102.69 ? 383 TYR A O   1 
ATOM   2680  C CB  . TYR A 1 383 ? 191.706 154.202 141.292 1.00 102.69 ? 383 TYR A CB  1 
ATOM   2681  C CG  . TYR A 1 383 ? 192.750 155.104 140.698 1.00 102.69 ? 383 TYR A CG  1 
ATOM   2682  C CD1 . TYR A 1 383 ? 193.910 155.405 141.398 1.00 102.69 ? 383 TYR A CD1 1 
ATOM   2683  C CD2 . TYR A 1 383 ? 192.575 155.664 139.445 1.00 102.69 ? 383 TYR A CD2 1 
ATOM   2684  C CE1 . TYR A 1 383 ? 194.866 156.244 140.867 1.00 102.69 ? 383 TYR A CE1 1 
ATOM   2685  C CE2 . TYR A 1 383 ? 193.528 156.500 138.903 1.00 102.69 ? 383 TYR A CE2 1 
ATOM   2686  C CZ  . TYR A 1 383 ? 194.670 156.785 139.619 1.00 102.69 ? 383 TYR A CZ  1 
ATOM   2687  O OH  . TYR A 1 383 ? 195.619 157.618 139.082 1.00 102.69 ? 383 TYR A OH  1 
ATOM   2688  N N   . ASP A 1 384 ? 191.065 151.752 143.884 1.00 102.63 ? 384 ASP A N   1 
ATOM   2689  C CA  . ASP A 1 384 ? 190.098 151.384 144.903 1.00 102.63 ? 384 ASP A CA  1 
ATOM   2690  C C   . ASP A 1 384 ? 190.771 151.061 146.226 1.00 102.63 ? 384 ASP A C   1 
ATOM   2691  O O   . ASP A 1 384 ? 190.322 151.517 147.279 1.00 102.63 ? 384 ASP A O   1 
ATOM   2692  C CB  . ASP A 1 384 ? 189.269 150.191 144.427 1.00 102.63 ? 384 ASP A CB  1 
ATOM   2693  C CG  . ASP A 1 384 ? 188.376 150.536 143.255 1.00 102.63 ? 384 ASP A CG  1 
ATOM   2694  O OD1 . ASP A 1 384 ? 187.971 151.709 143.141 1.00 102.63 ? 384 ASP A OD1 1 
ATOM   2695  O OD2 . ASP A 1 384 ? 188.075 149.635 142.447 1.00 102.63 ? 384 ASP A OD2 1 
ATOM   2696  N N   . VAL A 1 385 ? 191.856 150.291 146.180 1.00 102.88 ? 385 VAL A N   1 
ATOM   2697  C CA  . VAL A 1 385 ? 192.570 149.906 147.388 1.00 102.88 ? 385 VAL A CA  1 
ATOM   2698  C C   . VAL A 1 385 ? 193.263 151.103 148.015 1.00 102.88 ? 385 VAL A C   1 
ATOM   2699  O O   . VAL A 1 385 ? 193.235 151.270 149.236 1.00 102.88 ? 385 VAL A O   1 
ATOM   2700  C CB  . VAL A 1 385 ? 193.563 148.785 147.051 1.00 102.88 ? 385 VAL A CB  1 
ATOM   2701  C CG1 . VAL A 1 385 ? 194.336 148.365 148.269 1.00 102.88 ? 385 VAL A CG1 1 
ATOM   2702  C CG2 . VAL A 1 385 ? 192.827 147.610 146.468 1.00 102.88 ? 385 VAL A CG2 1 
ATOM   2703  N N   . CYS A 1 386 ? 193.850 151.976 147.207 1.00 108.05 ? 386 CYS A N   1 
ATOM   2704  C CA  . CYS A 1 386 ? 194.479 153.174 147.740 1.00 108.05 ? 386 CYS A CA  1 
ATOM   2705  C C   . CYS A 1 386 ? 193.473 154.200 148.229 1.00 108.05 ? 386 CYS A C   1 
ATOM   2706  O O   . CYS A 1 386 ? 193.852 155.107 148.974 1.00 108.05 ? 386 CYS A O   1 
ATOM   2707  C CB  . CYS A 1 386 ? 195.369 153.824 146.684 1.00 108.05 ? 386 CYS A CB  1 
ATOM   2708  S SG  . CYS A 1 386 ? 194.469 154.522 145.298 1.00 108.05 ? 386 CYS A SG  1 
ATOM   2709  N N   . SER A 1 387 ? 192.213 154.083 147.836 1.00 96.84  ? 387 SER A N   1 
ATOM   2710  C CA  . SER A 1 387 ? 191.193 155.048 148.201 1.00 96.84  ? 387 SER A CA  1 
ATOM   2711  C C   . SER A 1 387 ? 190.447 154.679 149.461 1.00 96.84  ? 387 SER A C   1 
ATOM   2712  O O   . SER A 1 387 ? 190.089 155.567 150.231 1.00 96.84  ? 387 SER A O   1 
ATOM   2713  C CB  . SER A 1 387 ? 190.184 155.192 147.069 1.00 96.84  ? 387 SER A CB  1 
ATOM   2714  O OG  . SER A 1 387 ? 189.481 153.977 146.912 1.00 96.84  ? 387 SER A OG  1 
ATOM   2715  N N   . ILE A 1 388 ? 190.189 153.392 149.674 1.00 90.47  ? 388 ILE A N   1 
ATOM   2716  C CA  . ILE A 1 388 ? 189.474 152.968 150.870 1.00 90.47  ? 388 ILE A CA  1 
ATOM   2717  C C   . ILE A 1 388 ? 190.338 153.172 152.104 1.00 90.47  ? 388 ILE A C   1 
ATOM   2718  O O   . ILE A 1 388 ? 189.846 153.595 153.155 1.00 90.47  ? 388 ILE A O   1 
ATOM   2719  C CB  . ILE A 1 388 ? 189.007 151.509 150.712 1.00 90.47  ? 388 ILE A CB  1 
ATOM   2720  C CG1 . ILE A 1 388 ? 187.962 151.426 149.611 1.00 90.47  ? 388 ILE A CG1 1 
ATOM   2721  C CG2 . ILE A 1 388 ? 188.409 150.962 151.982 1.00 90.47  ? 388 ILE A CG2 1 
ATOM   2722  C CD1 . ILE A 1 388 ? 187.557 150.036 149.283 1.00 90.47  ? 388 ILE A CD1 1 
ATOM   2723  N N   . LEU A 1 389 ? 191.645 152.942 151.978 1.00 94.14  ? 389 LEU A N   1 
ATOM   2724  C CA  . LEU A 1 389 ? 192.546 153.081 153.115 1.00 94.14  ? 389 LEU A CA  1 
ATOM   2725  C C   . LEU A 1 389 ? 192.673 154.525 153.570 1.00 94.14  ? 389 LEU A C   1 
ATOM   2726  O O   . LEU A 1 389 ? 192.733 154.789 154.773 1.00 94.14  ? 389 LEU A O   1 
ATOM   2727  C CB  . LEU A 1 389 ? 193.917 152.533 152.752 1.00 94.14  ? 389 LEU A CB  1 
ATOM   2728  C CG  . LEU A 1 389 ? 193.952 151.043 152.456 1.00 94.14  ? 389 LEU A CG  1 
ATOM   2729  C CD1 . LEU A 1 389 ? 195.317 150.656 151.962 1.00 94.14  ? 389 LEU A CD1 1 
ATOM   2730  C CD2 . LEU A 1 389 ? 193.595 150.264 153.692 1.00 94.14  ? 389 LEU A CD2 1 
ATOM   2731  N N   . LEU A 1 390 ? 192.694 155.465 152.632 1.00 92.42  ? 390 LEU A N   1 
ATOM   2732  C CA  . LEU A 1 390 ? 192.827 156.866 153.005 1.00 92.42  ? 390 LEU A CA  1 
ATOM   2733  C C   . LEU A 1 390 ? 191.537 157.410 153.595 1.00 92.42  ? 390 LEU A C   1 
ATOM   2734  O O   . LEU A 1 390 ? 191.569 158.206 154.539 1.00 92.42  ? 390 LEU A O   1 
ATOM   2735  C CB  . LEU A 1 390 ? 193.244 157.687 151.792 1.00 92.42  ? 390 LEU A CB  1 
ATOM   2736  C CG  . LEU A 1 390 ? 194.662 157.400 151.333 1.00 92.42  ? 390 LEU A CG  1 
ATOM   2737  C CD1 . LEU A 1 390 ? 194.943 158.083 150.024 1.00 92.42  ? 390 LEU A CD1 1 
ATOM   2738  C CD2 . LEU A 1 390 ? 195.601 157.901 152.393 1.00 92.42  ? 390 LEU A CD2 1 
ATOM   2739  N N   . GLY A 1 391 ? 190.395 156.996 153.056 1.00 87.97  ? 391 GLY A N   1 
ATOM   2740  C CA  . GLY A 1 391 ? 189.135 157.500 153.563 1.00 87.97  ? 391 GLY A CA  1 
ATOM   2741  C C   . GLY A 1 391 ? 188.793 156.941 154.927 1.00 87.97  ? 391 GLY A C   1 
ATOM   2742  O O   . GLY A 1 391 ? 188.347 157.676 155.811 1.00 87.97  ? 391 GLY A O   1 
ATOM   2743  N N   . THR A 1 392 ? 189.017 155.639 155.125 1.00 85.87  ? 392 THR A N   1 
ATOM   2744  C CA  . THR A 1 392 ? 188.721 155.005 156.403 1.00 85.87  ? 392 THR A CA  1 
ATOM   2745  C C   . THR A 1 392 ? 189.645 155.505 157.499 1.00 85.87  ? 392 THR A C   1 
ATOM   2746  O O   . THR A 1 392 ? 189.236 155.562 158.660 1.00 85.87  ? 392 THR A O   1 
ATOM   2747  C CB  . THR A 1 392 ? 188.829 153.490 156.260 1.00 85.87  ? 392 THR A CB  1 
ATOM   2748  O OG1 . THR A 1 392 ? 188.072 153.084 155.120 1.00 85.87  ? 392 THR A OG1 1 
ATOM   2749  C CG2 . THR A 1 392 ? 188.249 152.781 157.457 1.00 85.87  ? 392 THR A CG2 1 
ATOM   2750  N N   . SER A 1 393 ? 190.863 155.908 157.146 1.00 89.46  ? 393 SER A N   1 
ATOM   2751  C CA  . SER A 1 393 ? 191.719 156.589 158.108 1.00 89.46  ? 393 SER A CA  1 
ATOM   2752  C C   . SER A 1 393 ? 191.107 157.915 158.525 1.00 89.46  ? 393 SER A C   1 
ATOM   2753  O O   . SER A 1 393 ? 190.928 158.178 159.719 1.00 89.46  ? 393 SER A O   1 
ATOM   2754  C CB  . SER A 1 393 ? 193.098 156.822 157.510 1.00 89.46  ? 393 SER A CB  1 
ATOM   2755  O OG  . SER A 1 393 ? 193.033 157.818 156.510 1.00 89.46  ? 393 SER A OG  1 
ATOM   2756  N N   . THR A 1 394 ? 190.736 158.738 157.545 1.00 87.11  ? 394 THR A N   1 
ATOM   2757  C CA  . THR A 1 394 ? 190.218 160.071 157.822 1.00 87.11  ? 394 THR A CA  1 
ATOM   2758  C C   . THR A 1 394 ? 188.862 160.015 158.505 1.00 87.11  ? 394 THR A C   1 
ATOM   2759  O O   . THR A 1 394 ? 188.553 160.864 159.349 1.00 87.11  ? 394 THR A O   1 
ATOM   2760  C CB  . THR A 1 394 ? 190.139 160.838 156.512 1.00 87.11  ? 394 THR A CB  1 
ATOM   2761  O OG1 . THR A 1 394 ? 191.431 160.821 155.905 1.00 87.11  ? 394 THR A OG1 1 
ATOM   2762  C CG2 . THR A 1 394 ? 189.732 162.278 156.721 1.00 87.11  ? 394 THR A CG2 1 
ATOM   2763  N N   . LEU A 1 395 ? 188.064 158.998 158.185 1.00 80.23  ? 395 LEU A N   1 
ATOM   2764  C CA  . LEU A 1 395 ? 186.837 158.734 158.925 1.00 80.23  ? 395 LEU A CA  1 
ATOM   2765  C C   . LEU A 1 395 ? 187.123 158.411 160.383 1.00 80.23  ? 395 LEU A C   1 
ATOM   2766  O O   . LEU A 1 395 ? 186.326 158.742 161.266 1.00 80.23  ? 395 LEU A O   1 
ATOM   2767  C CB  . LEU A 1 395 ? 186.085 157.586 158.255 1.00 80.23  ? 395 LEU A CB  1 
ATOM   2768  C CG  . LEU A 1 395 ? 184.817 157.065 158.900 1.00 80.23  ? 395 LEU A CG  1 
ATOM   2769  C CD1 . LEU A 1 395 ? 183.837 158.190 159.016 1.00 80.23  ? 395 LEU A CD1 1 
ATOM   2770  C CD2 . LEU A 1 395 ? 184.237 155.939 158.075 1.00 80.23  ? 395 LEU A CD2 1 
ATOM   2771  N N   . LEU A 1 396 ? 188.269 157.807 160.652 1.00 85.36  ? 396 LEU A N   1 
ATOM   2772  C CA  . LEU A 1 396 ? 188.625 157.357 161.980 1.00 85.36  ? 396 LEU A CA  1 
ATOM   2773  C C   . LEU A 1 396 ? 189.663 158.246 162.646 1.00 85.36  ? 396 LEU A C   1 
ATOM   2774  O O   . LEU A 1 396 ? 189.855 158.144 163.858 1.00 85.36  ? 396 LEU A O   1 
ATOM   2775  C CB  . LEU A 1 396 ? 189.112 155.908 161.882 1.00 85.36  ? 396 LEU A CB  1 
ATOM   2776  C CG  . LEU A 1 396 ? 189.420 154.971 163.025 1.00 85.36  ? 396 LEU A CG  1 
ATOM   2777  C CD1 . LEU A 1 396 ? 188.986 153.596 162.608 1.00 85.36  ? 396 LEU A CD1 1 
ATOM   2778  C CD2 . LEU A 1 396 ? 190.902 154.975 163.229 1.00 85.36  ? 396 LEU A CD2 1 
ATOM   2779  N N   . VAL A 1 397 ? 190.322 159.125 161.898 1.00 85.04  ? 397 VAL A N   1 
ATOM   2780  C CA  . VAL A 1 397 ? 191.130 160.161 162.528 1.00 85.04  ? 397 VAL A CA  1 
ATOM   2781  C C   . VAL A 1 397 ? 190.244 161.225 163.150 1.00 85.04  ? 397 VAL A C   1 
ATOM   2782  O O   . VAL A 1 397 ? 190.428 161.592 164.314 1.00 85.04  ? 397 VAL A O   1 
ATOM   2783  C CB  . VAL A 1 397 ? 192.115 160.761 161.510 1.00 85.04  ? 397 VAL A CB  1 
ATOM   2784  C CG1 . VAL A 1 397 ? 192.686 162.048 162.017 1.00 85.04  ? 397 VAL A CG1 1 
ATOM   2785  C CG2 . VAL A 1 397 ? 193.258 159.803 161.272 1.00 85.04  ? 397 VAL A CG2 1 
ATOM   2786  N N   . TRP A 1 398 ? 189.256 161.712 162.397 1.00 82.10  ? 398 TRP A N   1 
ATOM   2787  C CA  . TRP A 1 398 ? 188.365 162.770 162.859 1.00 82.10  ? 398 TRP A CA  1 
ATOM   2788  C C   . TRP A 1 398 ? 187.497 162.378 164.039 1.00 82.10  ? 398 TRP A C   1 
ATOM   2789  O O   . TRP A 1 398 ? 187.126 163.259 164.810 1.00 82.10  ? 398 TRP A O   1 
ATOM   2790  C CB  . TRP A 1 398 ? 187.474 163.244 161.723 1.00 82.10  ? 398 TRP A CB  1 
ATOM   2791  C CG  . TRP A 1 398 ? 188.105 164.260 160.876 1.00 82.10  ? 398 TRP A CG  1 
ATOM   2792  C CD1 . TRP A 1 398 ? 188.856 164.052 159.773 1.00 82.10  ? 398 TRP A CD1 1 
ATOM   2793  C CD2 . TRP A 1 398 ? 188.005 165.672 161.036 1.00 82.10  ? 398 TRP A CD2 1 
ATOM   2794  N NE1 . TRP A 1 398 ? 189.258 165.250 159.241 1.00 82.10  ? 398 TRP A NE1 1 
ATOM   2795  C CE2 . TRP A 1 398 ? 188.741 166.261 160.005 1.00 82.10  ? 398 TRP A CE2 1 
ATOM   2796  C CE3 . TRP A 1 398 ? 187.368 166.497 161.963 1.00 82.10  ? 398 TRP A CE3 1 
ATOM   2797  C CZ2 . TRP A 1 398 ? 188.859 167.633 159.869 1.00 82.10  ? 398 TRP A CZ2 1 
ATOM   2798  C CZ3 . TRP A 1 398 ? 187.488 167.851 161.826 1.00 82.10  ? 398 TRP A CZ3 1 
ATOM   2799  C CH2 . TRP A 1 398 ? 188.228 168.409 160.785 1.00 82.10  ? 398 TRP A CH2 1 
ATOM   2800  N N   . VAL A 1 399 ? 187.176 161.099 164.235 1.00 86.29  ? 399 VAL A N   1 
ATOM   2801  C CA  . VAL A 1 399 ? 186.442 160.739 165.445 1.00 86.29  ? 399 VAL A CA  1 
ATOM   2802  C C   . VAL A 1 399 ? 187.317 160.793 166.683 1.00 86.29  ? 399 VAL A C   1 
ATOM   2803  O O   . VAL A 1 399 ? 186.789 160.798 167.801 1.00 86.29  ? 399 VAL A O   1 
ATOM   2804  C CB  . VAL A 1 399 ? 185.803 159.342 165.368 1.00 86.29  ? 399 VAL A CB  1 
ATOM   2805  C CG1 . VAL A 1 399 ? 184.807 159.282 164.245 1.00 86.29  ? 399 VAL A CG1 1 
ATOM   2806  C CG2 . VAL A 1 399 ? 186.852 158.295 165.183 1.00 86.29  ? 399 VAL A CG2 1 
ATOM   2807  N N   . GLY A 1 400 ? 188.638 160.865 166.523 1.00 89.94  ? 400 GLY A N   1 
ATOM   2808  C CA  . GLY A 1 400 ? 189.515 160.992 167.670 1.00 89.94  ? 400 GLY A CA  1 
ATOM   2809  C C   . GLY A 1 400 ? 189.485 162.359 168.313 1.00 89.94  ? 400 GLY A C   1 
ATOM   2810  O O   . GLY A 1 400 ? 190.020 162.539 169.408 1.00 89.94  ? 400 GLY A O   1 
ATOM   2811  N N   . VAL A 1 401 ? 188.860 163.333 167.649 1.00 89.78  ? 401 VAL A N   1 
ATOM   2812  C CA  . VAL A 1 401 ? 188.712 164.673 168.196 1.00 89.78  ? 401 VAL A CA  1 
ATOM   2813  C C   . VAL A 1 401 ? 187.789 164.676 169.404 1.00 89.78  ? 401 VAL A C   1 
ATOM   2814  O O   . VAL A 1 401 ? 187.945 165.509 170.304 1.00 89.78  ? 401 VAL A O   1 
ATOM   2815  C CB  . VAL A 1 401 ? 188.218 165.592 167.064 1.00 89.78  ? 401 VAL A CB  1 
ATOM   2816  C CG1 . VAL A 1 401 ? 187.986 167.016 167.519 1.00 89.78  ? 401 VAL A CG1 1 
ATOM   2817  C CG2 . VAL A 1 401 ? 189.226 165.583 165.951 1.00 89.78  ? 401 VAL A CG2 1 
ATOM   2818  N N   . ILE A 1 402 ? 186.881 163.700 169.483 1.00 97.59  ? 402 ILE A N   1 
ATOM   2819  C CA  . ILE A 1 402 ? 185.892 163.628 170.556 1.00 97.59  ? 402 ILE A CA  1 
ATOM   2820  C C   . ILE A 1 402 ? 186.563 163.420 171.908 1.00 97.59  ? 402 ILE A C   1 
ATOM   2821  O O   . ILE A 1 402 ? 186.036 163.849 172.943 1.00 97.59  ? 402 ILE A O   1 
ATOM   2822  C CB  . ILE A 1 402 ? 184.885 162.511 170.238 1.00 97.59  ? 402 ILE A CB  1 
ATOM   2823  C CG1 . ILE A 1 402 ? 184.297 162.735 168.859 1.00 97.59  ? 402 ILE A CG1 1 
ATOM   2824  C CG2 . ILE A 1 402 ? 183.721 162.518 171.192 1.00 97.59  ? 402 ILE A CG2 1 
ATOM   2825  C CD1 . ILE A 1 402 ? 183.508 161.573 168.374 1.00 97.59  ? 402 ILE A CD1 1 
ATOM   2826  N N   . ARG A 1 403 ? 187.753 162.806 171.910 1.00 102.54 ? 403 ARG A N   1 
ATOM   2827  C CA  . ARG A 1 403 ? 188.551 162.674 173.125 1.00 102.54 ? 403 ARG A CA  1 
ATOM   2828  C C   . ARG A 1 403 ? 188.875 164.033 173.727 1.00 102.54 ? 403 ARG A C   1 
ATOM   2829  O O   . ARG A 1 403 ? 188.828 164.210 174.950 1.00 102.54 ? 403 ARG A O   1 
ATOM   2830  C CB  . ARG A 1 403 ? 189.841 161.924 172.821 1.00 102.54 ? 403 ARG A CB  1 
ATOM   2831  C CG  . ARG A 1 403 ? 190.698 161.731 174.037 1.00 102.54 ? 403 ARG A CG  1 
ATOM   2832  C CD  . ARG A 1 403 ? 192.015 161.087 173.717 1.00 102.54 ? 403 ARG A CD  1 
ATOM   2833  N NE  . ARG A 1 403 ? 192.836 161.019 174.916 1.00 102.54 ? 403 ARG A NE  1 
ATOM   2834  C CZ  . ARG A 1 403 ? 194.064 160.525 174.954 1.00 102.54 ? 403 ARG A CZ  1 
ATOM   2835  N NH1 . ARG A 1 403 ? 194.623 160.056 173.851 1.00 102.54 ? 403 ARG A NH1 1 
ATOM   2836  N NH2 . ARG A 1 403 ? 194.731 160.501 176.097 1.00 102.54 ? 403 ARG A NH2 1 
ATOM   2837  N N   . TYR A 1 404 ? 189.140 165.022 172.877 1.00 102.08 ? 404 TYR A N   1 
ATOM   2838  C CA  . TYR A 1 404 ? 189.497 166.344 173.377 1.00 102.08 ? 404 TYR A CA  1 
ATOM   2839  C C   . TYR A 1 404 ? 188.270 167.055 173.918 1.00 102.08 ? 404 TYR A C   1 
ATOM   2840  O O   . TYR A 1 404 ? 188.380 167.957 174.752 1.00 102.08 ? 404 TYR A O   1 
ATOM   2841  C CB  . TYR A 1 404 ? 190.151 167.164 172.266 1.00 102.08 ? 404 TYR A CB  1 
ATOM   2842  C CG  . TYR A 1 404 ? 191.421 166.550 171.732 1.00 102.08 ? 404 TYR A CG  1 
ATOM   2843  C CD1 . TYR A 1 404 ? 192.184 165.689 172.511 1.00 102.08 ? 404 TYR A CD1 1 
ATOM   2844  C CD2 . TYR A 1 404 ? 191.820 166.776 170.424 1.00 102.08 ? 404 TYR A CD2 1 
ATOM   2845  C CE1 . TYR A 1 404 ? 193.312 165.099 172.019 1.00 102.08 ? 404 TYR A CE1 1 
ATOM   2846  C CE2 . TYR A 1 404 ? 192.957 166.189 169.921 1.00 102.08 ? 404 TYR A CE2 1 
ATOM   2847  C CZ  . TYR A 1 404 ? 193.695 165.350 170.729 1.00 102.08 ? 404 TYR A CZ  1 
ATOM   2848  O OH  . TYR A 1 404 ? 194.832 164.754 170.261 1.00 102.08 ? 404 TYR A OH  1 
ATOM   2849  N N   . LEU A 1 405 ? 187.088 166.651 173.465 1.00 98.57  ? 405 LEU A N   1 
ATOM   2850  C CA  . LEU A 1 405 ? 185.869 167.236 173.999 1.00 98.57  ? 405 LEU A CA  1 
ATOM   2851  C C   . LEU A 1 405 ? 185.543 166.648 175.360 1.00 98.57  ? 405 LEU A C   1 
ATOM   2852  O O   . LEU A 1 405 ? 184.929 167.316 176.195 1.00 98.57  ? 405 LEU A O   1 
ATOM   2853  C CB  . LEU A 1 405 ? 184.710 167.039 173.022 1.00 98.57  ? 405 LEU A CB  1 
ATOM   2854  C CG  . LEU A 1 405 ? 184.563 168.044 171.866 1.00 98.57  ? 405 LEU A CG  1 
ATOM   2855  C CD1 . LEU A 1 405 ? 185.583 167.858 170.762 1.00 98.57  ? 405 LEU A CD1 1 
ATOM   2856  C CD2 . LEU A 1 405 ? 183.176 167.989 171.276 1.00 98.57  ? 405 LEU A CD2 1 
ATOM   2857  N N   . THR A 1 406 ? 185.988 165.418 175.626 1.00 100.07 ? 406 THR A N   1 
ATOM   2858  C CA  . THR A 1 406 ? 185.704 164.791 176.914 1.00 100.07 ? 406 THR A CA  1 
ATOM   2859  C C   . THR A 1 406 ? 186.565 165.338 178.042 1.00 100.07 ? 406 THR A C   1 
ATOM   2860  O O   . THR A 1 406 ? 186.359 164.965 179.199 1.00 100.07 ? 406 THR A O   1 
ATOM   2861  C CB  . THR A 1 406 ? 185.898 163.286 176.832 1.00 100.07 ? 406 THR A CB  1 
ATOM   2862  O OG1 . THR A 1 406 ? 187.245 163.010 176.445 1.00 100.07 ? 406 THR A OG1 1 
ATOM   2863  C CG2 . THR A 1 406 ? 184.954 162.689 175.829 1.00 100.07 ? 406 THR A CG2 1 
ATOM   2864  N N   . PHE A 1 407 ? 187.530 166.201 177.737 1.00 106.93 ? 407 PHE A N   1 
ATOM   2865  C CA  . PHE A 1 407 ? 188.309 166.833 178.791 1.00 106.93 ? 407 PHE A CA  1 
ATOM   2866  C C   . PHE A 1 407 ? 187.511 167.910 179.502 1.00 106.93 ? 407 PHE A C   1 
ATOM   2867  O O   . PHE A 1 407 ? 187.866 168.319 180.610 1.00 106.93 ? 407 PHE A O   1 
ATOM   2868  C CB  . PHE A 1 407 ? 189.588 167.408 178.198 1.00 106.93 ? 407 PHE A CB  1 
ATOM   2869  C CG  . PHE A 1 407 ? 190.573 166.363 177.796 1.00 106.93 ? 407 PHE A CG  1 
ATOM   2870  C CD1 . PHE A 1 407 ? 190.552 165.112 178.394 1.00 106.93 ? 407 PHE A CD1 1 
ATOM   2871  C CD2 . PHE A 1 407 ? 191.484 166.604 176.788 1.00 106.93 ? 407 PHE A CD2 1 
ATOM   2872  C CE1 . PHE A 1 407 ? 191.450 164.135 178.025 1.00 106.93 ? 407 PHE A CE1 1 
ATOM   2873  C CE2 . PHE A 1 407 ? 192.378 165.629 176.405 1.00 106.93 ? 407 PHE A CE2 1 
ATOM   2874  C CZ  . PHE A 1 407 ? 192.361 164.392 177.027 1.00 106.93 ? 407 PHE A CZ  1 
ATOM   2875  N N   . PHE A 1 408 ? 186.437 168.386 178.887 1.00 106.85 ? 408 PHE A N   1 
ATOM   2876  C CA  . PHE A 1 408 ? 185.608 169.397 179.521 1.00 106.85 ? 408 PHE A CA  1 
ATOM   2877  C C   . PHE A 1 408 ? 184.482 168.733 180.305 1.00 106.85 ? 408 PHE A C   1 
ATOM   2878  O O   . PHE A 1 408 ? 184.017 167.644 179.966 1.00 106.85 ? 408 PHE A O   1 
ATOM   2879  C CB  . PHE A 1 408 ? 185.032 170.347 178.479 1.00 106.85 ? 408 PHE A CB  1 
ATOM   2880  C CG  . PHE A 1 408 ? 186.060 171.192 177.790 1.00 106.85 ? 408 PHE A CG  1 
ATOM   2881  C CD1 . PHE A 1 408 ? 187.310 171.396 178.346 1.00 106.85 ? 408 PHE A CD1 1 
ATOM   2882  C CD2 . PHE A 1 408 ? 185.775 171.769 176.565 1.00 106.85 ? 408 PHE A CD2 1 
ATOM   2883  C CE1 . PHE A 1 408 ? 188.248 172.164 177.697 1.00 106.85 ? 408 PHE A CE1 1 
ATOM   2884  C CE2 . PHE A 1 408 ? 186.709 172.540 175.909 1.00 106.85 ? 408 PHE A CE2 1 
ATOM   2885  C CZ  . PHE A 1 408 ? 187.947 172.738 176.475 1.00 106.85 ? 408 PHE A CZ  1 
ATOM   2886  N N   . HIS A 1 409 ? 184.037 169.407 181.361 1.00 99.38  ? 409 HIS A N   1 
ATOM   2887  C CA  . HIS A 1 409 ? 183.106 168.789 182.291 1.00 99.38  ? 409 HIS A CA  1 
ATOM   2888  C C   . HIS A 1 409 ? 181.689 168.731 181.756 1.00 99.38  ? 409 HIS A C   1 
ATOM   2889  O O   . HIS A 1 409 ? 180.883 167.948 182.263 1.00 99.38  ? 409 HIS A O   1 
ATOM   2890  C CB  . HIS A 1 409 ? 183.124 169.548 183.609 1.00 99.38  ? 409 HIS A CB  1 
ATOM   2891  C CG  . HIS A 1 409 ? 184.474 169.598 184.246 1.00 99.38  ? 409 HIS A CG  1 
ATOM   2892  N ND1 . HIS A 1 409 ? 185.039 168.510 184.874 1.00 99.38  ? 409 HIS A ND1 1 
ATOM   2893  C CD2 . HIS A 1 409 ? 185.377 170.601 184.343 1.00 99.38  ? 409 HIS A CD2 1 
ATOM   2894  C CE1 . HIS A 1 409 ? 186.231 168.843 185.336 1.00 99.38  ? 409 HIS A CE1 1 
ATOM   2895  N NE2 . HIS A 1 409 ? 186.459 170.107 185.028 1.00 99.38  ? 409 HIS A NE2 1 
ATOM   2896  N N   . ASN A 1 410 ? 181.368 169.540 180.755 1.00 99.96  ? 410 ASN A N   1 
ATOM   2897  C CA  . ASN A 1 410 ? 180.028 169.554 180.190 1.00 99.96  ? 410 ASN A CA  1 
ATOM   2898  C C   . ASN A 1 410 ? 179.845 168.490 179.122 1.00 99.96  ? 410 ASN A C   1 
ATOM   2899  O O   . ASN A 1 410 ? 178.852 167.758 179.141 1.00 99.96  ? 410 ASN A O   1 
ATOM   2900  C CB  . ASN A 1 410 ? 179.732 170.927 179.593 1.00 99.96  ? 410 ASN A CB  1 
ATOM   2901  C CG  . ASN A 1 410 ? 179.846 172.031 180.606 1.00 99.96  ? 410 ASN A CG  1 
ATOM   2902  O OD1 . ASN A 1 410 ? 180.718 172.889 180.509 1.00 99.96  ? 410 ASN A OD1 1 
ATOM   2903  N ND2 . ASN A 1 410 ? 178.963 172.018 181.591 1.00 99.96  ? 410 ASN A ND2 1 
ATOM   2904  N N   . TYR A 1 411 ? 180.793 168.387 178.195 1.00 99.38  ? 411 TYR A N   1 
ATOM   2905  C CA  . TYR A 1 411 ? 180.663 167.507 177.044 1.00 99.38  ? 411 TYR A CA  1 
ATOM   2906  C C   . TYR A 1 411 ? 180.838 166.042 177.406 1.00 99.38  ? 411 TYR A C   1 
ATOM   2907  O O   . TYR A 1 411 ? 180.453 165.173 176.618 1.00 99.38  ? 411 TYR A O   1 
ATOM   2908  C CB  . TYR A 1 411 ? 181.696 167.852 175.967 1.00 99.38  ? 411 TYR A CB  1 
ATOM   2909  C CG  . TYR A 1 411 ? 181.610 169.218 175.323 1.00 99.38  ? 411 TYR A CG  1 
ATOM   2910  C CD1 . TYR A 1 411 ? 180.520 170.046 175.500 1.00 99.38  ? 411 TYR A CD1 1 
ATOM   2911  C CD2 . TYR A 1 411 ? 182.635 169.662 174.504 1.00 99.38  ? 411 TYR A CD2 1 
ATOM   2912  C CE1 . TYR A 1 411 ? 180.473 171.286 174.903 1.00 99.38  ? 411 TYR A CE1 1 
ATOM   2913  C CE2 . TYR A 1 411 ? 182.587 170.896 173.895 1.00 99.38  ? 411 TYR A CE2 1 
ATOM   2914  C CZ  . TYR A 1 411 ? 181.502 171.703 174.098 1.00 99.38  ? 411 TYR A CZ  1 
ATOM   2915  O OH  . TYR A 1 411 ? 181.452 172.936 173.497 1.00 99.38  ? 411 TYR A OH  1 
ATOM   2916  N N   . ASN A 1 412 ? 181.430 165.755 178.562 1.00 97.13  ? 412 ASN A N   1 
ATOM   2917  C CA  . ASN A 1 412 ? 181.584 164.391 179.037 1.00 97.13  ? 412 ASN A CA  1 
ATOM   2918  C C   . ASN A 1 412 ? 180.245 163.739 179.328 1.00 97.13  ? 412 ASN A C   1 
ATOM   2919  O O   . ASN A 1 412 ? 180.130 162.516 179.218 1.00 97.13  ? 412 ASN A O   1 
ATOM   2920  C CB  . ASN A 1 412 ? 182.445 164.391 180.301 1.00 97.13  ? 412 ASN A CB  1 
ATOM   2921  C CG  . ASN A 1 412 ? 182.984 163.019 180.658 1.00 97.13  ? 412 ASN A CG  1 
ATOM   2922  O OD1 . ASN A 1 412 ? 182.809 162.048 179.927 1.00 97.13  ? 412 ASN A OD1 1 
ATOM   2923  N ND2 . ASN A 1 412 ? 183.642 162.937 181.805 1.00 97.13  ? 412 ASN A ND2 1 
ATOM   2924  N N   . ILE A 1 413 ? 179.234 164.534 179.673 1.00 89.18  ? 413 ILE A N   1 
ATOM   2925  C CA  . ILE A 1 413 ? 177.944 163.983 180.056 1.00 89.18  ? 413 ILE A CA  1 
ATOM   2926  C C   . ILE A 1 413 ? 177.252 163.367 178.851 1.00 89.18  ? 413 ILE A C   1 
ATOM   2927  O O   . ILE A 1 413 ? 176.692 162.269 178.929 1.00 89.18  ? 413 ILE A O   1 
ATOM   2928  C CB  . ILE A 1 413 ? 177.082 165.082 180.696 1.00 89.18  ? 413 ILE A CB  1 
ATOM   2929  C CG1 . ILE A 1 413 ? 177.864 165.803 181.789 1.00 89.18  ? 413 ILE A CG1 1 
ATOM   2930  C CG2 . ILE A 1 413 ? 175.824 164.489 181.282 1.00 89.18  ? 413 ILE A CG2 1 
ATOM   2931  C CD1 . ILE A 1 413 ? 178.311 164.920 182.929 1.00 89.18  ? 413 ILE A CD1 1 
ATOM   2932  N N   . LEU A 1 414 ? 177.313 164.046 177.712 1.00 85.39  ? 414 LEU A N   1 
ATOM   2933  C CA  . LEU A 1 414 ? 176.614 163.572 176.527 1.00 85.39  ? 414 LEU A CA  1 
ATOM   2934  C C   . LEU A 1 414 ? 177.303 162.359 175.930 1.00 85.39  ? 414 LEU A C   1 
ATOM   2935  O O   . LEU A 1 414 ? 176.640 161.448 175.431 1.00 85.39  ? 414 LEU A O   1 
ATOM   2936  C CB  . LEU A 1 414 ? 176.538 164.700 175.511 1.00 85.39  ? 414 LEU A CB  1 
ATOM   2937  C CG  . LEU A 1 414 ? 175.802 165.901 176.092 1.00 85.39  ? 414 LEU A CG  1 
ATOM   2938  C CD1 . LEU A 1 414 ? 175.990 167.111 175.230 1.00 85.39  ? 414 LEU A CD1 1 
ATOM   2939  C CD2 . LEU A 1 414 ? 174.338 165.586 176.231 1.00 85.39  ? 414 LEU A CD2 1 
ATOM   2940  N N   . ILE A 1 415 ? 178.634 162.327 175.980 1.00 89.72  ? 415 ILE A N   1 
ATOM   2941  C CA  . ILE A 1 415 ? 179.374 161.223 175.380 1.00 89.72  ? 415 ILE A CA  1 
ATOM   2942  C C   . ILE A 1 415 ? 179.267 159.973 176.239 1.00 89.72  ? 415 ILE A C   1 
ATOM   2943  O O   . ILE A 1 415 ? 179.018 158.875 175.729 1.00 89.72  ? 415 ILE A O   1 
ATOM   2944  C CB  . ILE A 1 415 ? 180.836 161.633 175.144 1.00 89.72  ? 415 ILE A CB  1 
ATOM   2945  C CG1 . ILE A 1 415 ? 180.894 162.752 174.114 1.00 89.72  ? 415 ILE A CG1 1 
ATOM   2946  C CG2 . ILE A 1 415 ? 181.665 160.458 174.689 1.00 89.72  ? 415 ILE A CG2 1 
ATOM   2947  C CD1 . ILE A 1 415 ? 180.324 162.354 172.779 1.00 89.72  ? 415 ILE A CD1 1 
ATOM   2948  N N   . ALA A 1 416 ? 179.418 160.114 177.552 1.00 87.30  ? 416 ALA A N   1 
ATOM   2949  C CA  . ALA A 1 416 ? 179.264 158.962 178.430 1.00 87.30  ? 416 ALA A CA  1 
ATOM   2950  C C   . ALA A 1 416 ? 177.822 158.496 178.535 1.00 87.30  ? 416 ALA A C   1 
ATOM   2951  O O   . ALA A 1 416 ? 177.585 157.382 179.007 1.00 87.30  ? 416 ALA A O   1 
ATOM   2952  C CB  . ALA A 1 416 ? 179.814 159.273 179.820 1.00 87.30  ? 416 ALA A CB  1 
ATOM   2953  N N   . THR A 1 417 ? 176.861 159.317 178.114 1.00 85.59  ? 417 THR A N   1 
ATOM   2954  C CA  . THR A 1 417 ? 175.500 158.835 177.945 1.00 85.59  ? 417 THR A CA  1 
ATOM   2955  C C   . THR A 1 417 ? 175.428 157.819 176.816 1.00 85.59  ? 417 THR A C   1 
ATOM   2956  O O   . THR A 1 417 ? 174.718 156.816 176.924 1.00 85.59  ? 417 THR A O   1 
ATOM   2957  C CB  . THR A 1 417 ? 174.563 160.005 177.670 1.00 85.59  ? 417 THR A CB  1 
ATOM   2958  O OG1 . THR A 1 417 ? 174.742 160.994 178.686 1.00 85.59  ? 417 THR A OG1 1 
ATOM   2959  C CG2 . THR A 1 417 ? 173.124 159.549 177.705 1.00 85.59  ? 417 THR A CG2 1 
ATOM   2960  N N   . LEU A 1 418 ? 176.170 158.054 175.735 1.00 82.11  ? 418 LEU A N   1 
ATOM   2961  C CA  . LEU A 1 418 ? 176.269 157.050 174.685 1.00 82.11  ? 418 LEU A CA  1 
ATOM   2962  C C   . LEU A 1 418 ? 176.998 155.812 175.166 1.00 82.11  ? 418 LEU A C   1 
ATOM   2963  O O   . LEU A 1 418 ? 176.645 154.699 174.769 1.00 82.11  ? 418 LEU A O   1 
ATOM   2964  C CB  . LEU A 1 418 ? 176.989 157.606 173.460 1.00 82.11  ? 418 LEU A CB  1 
ATOM   2965  C CG  . LEU A 1 418 ? 176.191 158.249 172.336 1.00 82.11  ? 418 LEU A CG  1 
ATOM   2966  C CD1 . LEU A 1 418 ? 175.252 157.224 171.750 1.00 82.11  ? 418 LEU A CD1 1 
ATOM   2967  C CD2 . LEU A 1 418 ? 175.441 159.463 172.807 1.00 82.11  ? 418 LEU A CD2 1 
ATOM   2968  N N   . ARG A 1 419 ? 178.004 155.981 176.023 1.00 85.18  ? 419 ARG A N   1 
ATOM   2969  C CA  . ARG A 1 419 ? 178.826 154.845 176.413 1.00 85.18  ? 419 ARG A CA  1 
ATOM   2970  C C   . ARG A 1 419 ? 178.071 153.914 177.349 1.00 85.18  ? 419 ARG A C   1 
ATOM   2971  O O   . ARG A 1 419 ? 178.236 152.693 177.278 1.00 85.18  ? 419 ARG A O   1 
ATOM   2972  C CB  . ARG A 1 419 ? 180.117 155.331 177.059 1.00 85.18  ? 419 ARG A CB  1 
ATOM   2973  C CG  . ARG A 1 419 ? 181.121 154.235 177.342 1.00 85.18  ? 419 ARG A CG  1 
ATOM   2974  C CD  . ARG A 1 419 ? 182.345 154.824 177.985 1.00 85.18  ? 419 ARG A CD  1 
ATOM   2975  N NE  . ARG A 1 419 ? 182.027 155.346 179.306 1.00 85.18  ? 419 ARG A NE  1 
ATOM   2976  C CZ  . ARG A 1 419 ? 182.806 156.175 179.985 1.00 85.18  ? 419 ARG A CZ  1 
ATOM   2977  N NH1 . ARG A 1 419 ? 182.436 156.598 181.183 1.00 85.18  ? 419 ARG A NH1 1 
ATOM   2978  N NH2 . ARG A 1 419 ? 183.946 156.597 179.458 1.00 85.18  ? 419 ARG A NH2 1 
ATOM   2979  N N   . VAL A 1 420 ? 177.216 154.459 178.213 1.00 83.47  ? 420 VAL A N   1 
ATOM   2980  C CA  . VAL A 1 420 ? 176.412 153.589 179.065 1.00 83.47  ? 420 VAL A CA  1 
ATOM   2981  C C   . VAL A 1 420 ? 175.192 153.041 178.352 1.00 83.47  ? 420 VAL A C   1 
ATOM   2982  O O   . VAL A 1 420 ? 174.508 152.174 178.904 1.00 83.47  ? 420 VAL A O   1 
ATOM   2983  C CB  . VAL A 1 420 ? 175.937 154.304 180.338 1.00 83.47  ? 420 VAL A CB  1 
ATOM   2984  C CG1 . VAL A 1 420 ? 177.118 154.768 181.149 1.00 83.47  ? 420 VAL A CG1 1 
ATOM   2985  C CG2 . VAL A 1 420 ? 175.055 155.460 179.978 1.00 83.47  ? 420 VAL A CG2 1 
ATOM   2986  N N   . ALA A 1 421 ? 174.895 153.519 177.145 1.00 84.39  ? 421 ALA A N   1 
ATOM   2987  C CA  . ALA A 1 421 ? 173.723 153.069 176.413 1.00 84.39  ? 421 ALA A CA  1 
ATOM   2988  C C   . ALA A 1 421 ? 174.053 152.245 175.182 1.00 84.39  ? 421 ALA A C   1 
ATOM   2989  O O   . ALA A 1 421 ? 173.168 151.551 174.672 1.00 84.39  ? 421 ALA A O   1 
ATOM   2990  C CB  . ALA A 1 421 ? 172.865 154.266 175.996 1.00 84.39  ? 421 ALA A CB  1 
ATOM   2991  N N   . LEU A 1 422 ? 175.277 152.314 174.689 1.00 88.57  ? 422 LEU A N   1 
ATOM   2992  C CA  . LEU A 1 422 ? 175.757 151.463 173.606 1.00 88.57  ? 422 LEU A CA  1 
ATOM   2993  C C   . LEU A 1 422 ? 175.667 149.964 173.908 1.00 88.57  ? 422 LEU A C   1 
ATOM   2994  O O   . LEU A 1 422 ? 175.495 149.191 172.959 1.00 88.57  ? 422 LEU A O   1 
ATOM   2995  C CB  . LEU A 1 422 ? 177.196 151.848 173.237 1.00 88.57  ? 422 LEU A CB  1 
ATOM   2996  C CG  . LEU A 1 422 ? 177.821 151.406 171.907 1.00 88.57  ? 422 LEU A CG  1 
ATOM   2997  C CD1 . LEU A 1 422 ? 178.785 152.478 171.433 1.00 88.57  ? 422 LEU A CD1 1 
ATOM   2998  C CD2 . LEU A 1 422 ? 178.560 150.080 171.988 1.00 88.57  ? 422 LEU A CD2 1 
ATOM   2999  N N   . PRO A 1 423 ? 175.796 149.474 175.171 1.00 91.50  ? 423 PRO A N   1 
ATOM   3000  C CA  . PRO A 1 423 ? 175.409 148.079 175.406 1.00 91.50  ? 423 PRO A CA  1 
ATOM   3001  C C   . PRO A 1 423 ? 173.936 147.796 175.179 1.00 91.50  ? 423 PRO A C   1 
ATOM   3002  O O   . PRO A 1 423 ? 173.606 146.842 174.470 1.00 91.50  ? 423 PRO A O   1 
ATOM   3003  C CB  . PRO A 1 423 ? 175.787 147.854 176.869 1.00 91.50  ? 423 PRO A CB  1 
ATOM   3004  C CG  . PRO A 1 423 ? 176.902 148.717 177.076 1.00 91.50  ? 423 PRO A CG  1 
ATOM   3005  C CD  . PRO A 1 423 ? 176.631 149.947 176.293 1.00 91.50  ? 423 PRO A CD  1 
ATOM   3006  N N   . SER A 1 424 ? 173.051 148.616 175.752 1.00 88.99  ? 424 SER A N   1 
ATOM   3007  C CA  . SER A 1 424 ? 171.627 148.298 175.733 1.00 88.99  ? 424 SER A CA  1 
ATOM   3008  C C   . SER A 1 424 ? 171.032 148.400 174.341 1.00 88.99  ? 424 SER A C   1 
ATOM   3009  O O   . SER A 1 424 ? 170.079 147.684 174.031 1.00 88.99  ? 424 SER A O   1 
ATOM   3010  C CB  . SER A 1 424 ? 170.870 149.213 176.684 1.00 88.99  ? 424 SER A CB  1 
ATOM   3011  O OG  . SER A 1 424 ? 171.256 148.976 178.021 1.00 88.99  ? 424 SER A OG  1 
ATOM   3012  N N   . VAL A 1 425 ? 171.580 149.263 173.489 1.00 87.37  ? 425 VAL A N   1 
ATOM   3013  C CA  . VAL A 1 425 ? 171.112 149.319 172.110 1.00 87.37  ? 425 VAL A CA  1 
ATOM   3014  C C   . VAL A 1 425 ? 171.584 148.095 171.344 1.00 87.37  ? 425 VAL A C   1 
ATOM   3015  O O   . VAL A 1 425 ? 170.814 147.469 170.608 1.00 87.37  ? 425 VAL A O   1 
ATOM   3016  C CB  . VAL A 1 425 ? 171.583 150.620 171.445 1.00 87.37  ? 425 VAL A CB  1 
ATOM   3017  C CG1 . VAL A 1 425 ? 171.200 150.644 169.989 1.00 87.37  ? 425 VAL A CG1 1 
ATOM   3018  C CG2 . VAL A 1 425 ? 170.984 151.803 172.151 1.00 87.37  ? 425 VAL A CG2 1 
ATOM   3019  N N   . MET A 1 426 ? 172.843 147.709 171.536 1.00 95.19  ? 426 MET A N   1 
ATOM   3020  C CA  . MET A 1 426 ? 173.404 146.595 170.790 1.00 95.19  ? 426 MET A CA  1 
ATOM   3021  C C   . MET A 1 426 ? 172.856 145.258 171.268 1.00 95.19  ? 426 MET A C   1 
ATOM   3022  O O   . MET A 1 426 ? 172.910 144.275 170.524 1.00 95.19  ? 426 MET A O   1 
ATOM   3023  C CB  . MET A 1 426 ? 174.925 146.631 170.901 1.00 95.19  ? 426 MET A CB  1 
ATOM   3024  C CG  . MET A 1 426 ? 175.669 145.817 169.864 1.00 95.19  ? 426 MET A CG  1 
ATOM   3025  S SD  . MET A 1 426 ? 175.411 146.477 168.210 1.00 95.19  ? 426 MET A SD  1 
ATOM   3026  C CE  . MET A 1 426 ? 176.325 148.014 168.314 1.00 95.19  ? 426 MET A CE  1 
ATOM   3027  N N   . ARG A 1 427 ? 172.317 145.199 172.483 1.00 94.16  ? 427 ARG A N   1 
ATOM   3028  C CA  . ARG A 1 427 ? 171.532 144.035 172.868 1.00 94.16  ? 427 ARG A CA  1 
ATOM   3029  C C   . ARG A 1 427 ? 170.247 143.962 172.060 1.00 94.16  ? 427 ARG A C   1 
ATOM   3030  O O   . ARG A 1 427 ? 169.934 142.929 171.460 1.00 94.16  ? 427 ARG A O   1 
ATOM   3031  C CB  . ARG A 1 427 ? 171.204 144.083 174.356 1.00 94.16  ? 427 ARG A CB  1 
ATOM   3032  C CG  . ARG A 1 427 ? 172.378 143.908 175.277 1.00 94.16  ? 427 ARG A CG  1 
ATOM   3033  C CD  . ARG A 1 427 ? 171.898 143.855 176.703 1.00 94.16  ? 427 ARG A CD  1 
ATOM   3034  N NE  . ARG A 1 427 ? 173.006 143.727 177.633 1.00 94.16  ? 427 ARG A NE  1 
ATOM   3035  C CZ  . ARG A 1 427 ? 173.614 144.758 178.203 1.00 94.16  ? 427 ARG A CZ  1 
ATOM   3036  N NH1 . ARG A 1 427 ? 173.208 145.990 177.942 1.00 94.16  ? 427 ARG A NH1 1 
ATOM   3037  N NH2 . ARG A 1 427 ? 174.619 144.558 179.040 1.00 94.16  ? 427 ARG A NH2 1 
ATOM   3038  N N   . PHE A 1 428 ? 169.498 145.063 172.023 1.00 89.17  ? 428 PHE A N   1 
ATOM   3039  C CA  . PHE A 1 428 ? 168.192 145.075 171.384 1.00 89.17  ? 428 PHE A CA  1 
ATOM   3040  C C   . PHE A 1 428 ? 168.290 145.046 169.873 1.00 89.17  ? 428 PHE A C   1 
ATOM   3041  O O   . PHE A 1 428 ? 167.358 144.579 169.212 1.00 89.17  ? 428 PHE A O   1 
ATOM   3042  C CB  . PHE A 1 428 ? 167.413 146.304 171.836 1.00 89.17  ? 428 PHE A CB  1 
ATOM   3043  C CG  . PHE A 1 428 ? 166.021 146.364 171.312 1.00 89.17  ? 428 PHE A CG  1 
ATOM   3044  C CD1 . PHE A 1 428 ? 165.079 145.439 171.706 1.00 89.17  ? 428 PHE A CD1 1 
ATOM   3045  C CD2 . PHE A 1 428 ? 165.643 147.372 170.461 1.00 89.17  ? 428 PHE A CD2 1 
ATOM   3046  C CE1 . PHE A 1 428 ? 163.789 145.505 171.222 1.00 89.17  ? 428 PHE A CE1 1 
ATOM   3047  C CE2 . PHE A 1 428 ? 164.363 147.449 169.986 1.00 89.17  ? 428 PHE A CE2 1 
ATOM   3048  C CZ  . PHE A 1 428 ? 163.435 146.513 170.365 1.00 89.17  ? 428 PHE A CZ  1 
ATOM   3049  N N   . CYS A 1 429 ? 169.406 145.516 169.317 1.00 97.05  ? 429 CYS A N   1 
ATOM   3050  C CA  . CYS A 1 429 ? 169.611 145.453 167.875 1.00 97.05  ? 429 CYS A CA  1 
ATOM   3051  C C   . CYS A 1 429 ? 169.723 144.014 167.391 1.00 97.05  ? 429 CYS A C   1 
ATOM   3052  O O   . CYS A 1 429 ? 169.401 143.721 166.235 1.00 97.05  ? 429 CYS A O   1 
ATOM   3053  C CB  . CYS A 1 429 ? 170.855 146.252 167.499 1.00 97.05  ? 429 CYS A CB  1 
ATOM   3054  S SG  . CYS A 1 429 ? 171.185 146.397 165.736 1.00 97.05  ? 429 CYS A SG  1 
ATOM   3055  N N   . CYS A 1 430 ? 170.153 143.101 168.260 1.00 99.08  ? 430 CYS A N   1 
ATOM   3056  C CA  . CYS A 1 430 ? 170.094 141.687 167.927 1.00 99.08  ? 430 CYS A CA  1 
ATOM   3057  C C   . CYS A 1 430 ? 168.676 141.146 168.021 1.00 99.08  ? 430 CYS A C   1 
ATOM   3058  O O   . CYS A 1 430 ? 168.325 140.214 167.294 1.00 99.08  ? 430 CYS A O   1 
ATOM   3059  C CB  . CYS A 1 430 ? 171.025 140.890 168.840 1.00 99.08  ? 430 CYS A CB  1 
ATOM   3060  S SG  . CYS A 1 430 ? 171.179 139.148 168.405 1.00 99.08  ? 430 CYS A SG  1 
ATOM   3061  N N   . CYS A 1 431 ? 167.843 141.723 168.889 1.00 96.02  ? 431 CYS A N   1 
ATOM   3062  C CA  . CYS A 1 431 ? 166.464 141.264 169.013 1.00 96.02  ? 431 CYS A CA  1 
ATOM   3063  C C   . CYS A 1 431 ? 165.619 141.668 167.820 1.00 96.02  ? 431 CYS A C   1 
ATOM   3064  O O   . CYS A 1 431 ? 164.589 141.046 167.553 1.00 96.02  ? 431 CYS A O   1 
ATOM   3065  C CB  . CYS A 1 431 ? 165.823 141.815 170.285 1.00 96.02  ? 431 CYS A CB  1 
ATOM   3066  S SG  . CYS A 1 431 ? 166.478 141.188 171.835 1.00 96.02  ? 431 CYS A SG  1 
ATOM   3067  N N   . VAL A 1 432 ? 166.022 142.712 167.104 1.00 89.11  ? 432 VAL A N   1 
ATOM   3068  C CA  . VAL A 1 432 ? 165.234 143.189 165.979 1.00 89.11  ? 432 VAL A CA  1 
ATOM   3069  C C   . VAL A 1 432 ? 165.701 142.518 164.701 1.00 89.11  ? 432 VAL A C   1 
ATOM   3070  O O   . VAL A 1 432 ? 164.890 142.150 163.845 1.00 89.11  ? 432 VAL A O   1 
ATOM   3071  C CB  . VAL A 1 432 ? 165.323 144.719 165.886 1.00 89.11  ? 432 VAL A CB  1 
ATOM   3072  C CG1 . VAL A 1 432 ? 164.562 145.235 164.694 1.00 89.11  ? 432 VAL A CG1 1 
ATOM   3073  C CG2 . VAL A 1 432 ? 164.775 145.318 167.138 1.00 89.11  ? 432 VAL A CG2 1 
ATOM   3074  N N   . ALA A 1 433 ? 167.013 142.303 164.585 1.00 85.24  ? 433 ALA A N   1 
ATOM   3075  C CA  . ALA A 1 433 ? 167.586 141.738 163.370 1.00 85.24  ? 433 ALA A CA  1 
ATOM   3076  C C   . ALA A 1 433 ? 167.131 140.309 163.135 1.00 85.24  ? 433 ALA A C   1 
ATOM   3077  O O   . ALA A 1 433 ? 167.108 139.846 161.992 1.00 85.24  ? 433 ALA A O   1 
ATOM   3078  C CB  . ALA A 1 433 ? 169.108 141.796 163.437 1.00 85.24  ? 433 ALA A CB  1 
ATOM   3079  N N   . VAL A 1 434 ? 166.755 139.607 164.198 1.00 82.62  ? 434 VAL A N   1 
ATOM   3080  C CA  . VAL A 1 434 ? 166.173 138.283 164.049 1.00 82.62  ? 434 VAL A CA  1 
ATOM   3081  C C   . VAL A 1 434 ? 164.820 138.368 163.361 1.00 82.62  ? 434 VAL A C   1 
ATOM   3082  O O   . VAL A 1 434 ? 164.539 137.616 162.424 1.00 82.62  ? 434 VAL A O   1 
ATOM   3083  C CB  . VAL A 1 434 ? 166.084 137.607 165.424 1.00 82.62  ? 434 VAL A CB  1 
ATOM   3084  C CG1 . VAL A 1 434 ? 165.318 136.343 165.334 1.00 82.62  ? 434 VAL A CG1 1 
ATOM   3085  C CG2 . VAL A 1 434 ? 167.471 137.313 165.927 1.00 82.62  ? 434 VAL A CG2 1 
ATOM   3086  N N   . ILE A 1 435 ? 163.978 139.311 163.784 1.00 80.09  ? 435 ILE A N   1 
ATOM   3087  C CA  . ILE A 1 435 ? 162.685 139.491 163.139 1.00 80.09  ? 435 ILE A CA  1 
ATOM   3088  C C   . ILE A 1 435 ? 162.863 140.117 161.768 1.00 80.09  ? 435 ILE A C   1 
ATOM   3089  O O   . ILE A 1 435 ? 162.103 139.824 160.838 1.00 80.09  ? 435 ILE A O   1 
ATOM   3090  C CB  . ILE A 1 435 ? 161.777 140.350 164.027 1.00 80.09  ? 435 ILE A CB  1 
ATOM   3091  C CG1 . ILE A 1 435 ? 161.721 139.774 165.427 1.00 80.09  ? 435 ILE A CG1 1 
ATOM   3092  C CG2 . ILE A 1 435 ? 160.370 140.367 163.505 1.00 80.09  ? 435 ILE A CG2 1 
ATOM   3093  C CD1 . ILE A 1 435 ? 161.085 140.706 166.409 1.00 80.09  ? 435 ILE A CD1 1 
ATOM   3094  N N   . TYR A 1 436 ? 163.874 140.969 161.613 1.00 78.29  ? 436 TYR A N   1 
ATOM   3095  C CA  . TYR A 1 436 ? 164.114 141.628 160.338 1.00 78.29  ? 436 TYR A CA  1 
ATOM   3096  C C   . TYR A 1 436 ? 164.565 140.652 159.271 1.00 78.29  ? 436 TYR A C   1 
ATOM   3097  O O   . TYR A 1 436 ? 164.200 140.814 158.106 1.00 78.29  ? 436 TYR A O   1 
ATOM   3098  C CB  . TYR A 1 436 ? 165.153 142.724 160.505 1.00 78.29  ? 436 TYR A CB  1 
ATOM   3099  C CG  . TYR A 1 436 ? 165.513 143.415 159.223 1.00 78.29  ? 436 TYR A CG  1 
ATOM   3100  C CD1 . TYR A 1 436 ? 164.651 144.318 158.639 1.00 78.29  ? 436 TYR A CD1 1 
ATOM   3101  C CD2 . TYR A 1 436 ? 166.723 143.169 158.604 1.00 78.29  ? 436 TYR A CD2 1 
ATOM   3102  C CE1 . TYR A 1 436 ? 164.981 144.953 157.472 1.00 78.29  ? 436 TYR A CE1 1 
ATOM   3103  C CE2 . TYR A 1 436 ? 167.060 143.794 157.436 1.00 78.29  ? 436 TYR A CE2 1 
ATOM   3104  C CZ  . TYR A 1 436 ? 166.187 144.686 156.875 1.00 78.29  ? 436 TYR A CZ  1 
ATOM   3105  O OH  . TYR A 1 436 ? 166.528 145.313 155.704 1.00 78.29  ? 436 TYR A OH  1 
ATOM   3106  N N   . LEU A 1 437 ? 165.343 139.634 159.635 1.00 79.93  ? 437 LEU A N   1 
ATOM   3107  C CA  . LEU A 1 437 ? 165.651 138.606 158.654 1.00 79.93  ? 437 LEU A CA  1 
ATOM   3108  C C   . LEU A 1 437 ? 164.461 137.709 158.380 1.00 79.93  ? 437 LEU A C   1 
ATOM   3109  O O   . LEU A 1 437 ? 164.451 137.020 157.362 1.00 79.93  ? 437 LEU A O   1 
ATOM   3110  C CB  . LEU A 1 437 ? 166.835 137.762 159.100 1.00 79.93  ? 437 LEU A CB  1 
ATOM   3111  C CG  . LEU A 1 437 ? 168.162 138.515 159.112 1.00 79.93  ? 437 LEU A CG  1 
ATOM   3112  C CD1 . LEU A 1 437 ? 169.276 137.652 159.676 1.00 79.93  ? 437 LEU A CD1 1 
ATOM   3113  C CD2 . LEU A 1 437 ? 168.511 139.004 157.724 1.00 79.93  ? 437 LEU A CD2 1 
ATOM   3114  N N   . GLY A 1 438 ? 163.460 137.705 159.256 1.00 80.36  ? 438 GLY A N   1 
ATOM   3115  C CA  . GLY A 1 438 ? 162.267 136.925 158.987 1.00 80.36  ? 438 GLY A CA  1 
ATOM   3116  C C   . GLY A 1 438 ? 161.477 137.467 157.813 1.00 80.36  ? 438 GLY A C   1 
ATOM   3117  O O   . GLY A 1 438 ? 161.090 136.719 156.915 1.00 80.36  ? 438 GLY A O   1 
ATOM   3118  N N   . TYR A 1 439 ? 161.245 138.776 157.797 1.00 78.73  ? 439 TYR A N   1 
ATOM   3119  C CA  . TYR A 1 439 ? 160.508 139.373 156.694 1.00 78.73  ? 439 TYR A CA  1 
ATOM   3120  C C   . TYR A 1 439 ? 161.306 139.402 155.402 1.00 78.73  ? 439 TYR A C   1 
ATOM   3121  O O   . TYR A 1 439 ? 160.706 139.413 154.325 1.00 78.73  ? 439 TYR A O   1 
ATOM   3122  C CB  . TYR A 1 439 ? 160.066 140.781 157.060 1.00 78.73  ? 439 TYR A CB  1 
ATOM   3123  C CG  . TYR A 1 439 ? 158.957 140.820 158.064 1.00 78.73  ? 439 TYR A CG  1 
ATOM   3124  C CD1 . TYR A 1 439 ? 157.643 140.661 157.669 1.00 78.73  ? 439 TYR A CD1 1 
ATOM   3125  C CD2 . TYR A 1 439 ? 159.220 141.011 159.405 1.00 78.73  ? 439 TYR A CD2 1 
ATOM   3126  C CE1 . TYR A 1 439 ? 156.622 140.698 158.576 1.00 78.73  ? 439 TYR A CE1 1 
ATOM   3127  C CE2 . TYR A 1 439 ? 158.203 141.048 160.322 1.00 78.73  ? 439 TYR A CE2 1 
ATOM   3128  C CZ  . TYR A 1 439 ? 156.909 140.892 159.899 1.00 78.73  ? 439 TYR A CZ  1 
ATOM   3129  O OH  . TYR A 1 439 ? 155.890 140.929 160.808 1.00 78.73  ? 439 TYR A OH  1 
ATOM   3130  N N   . CYS A 1 440 ? 162.633 139.415 155.477 1.00 77.02  ? 440 CYS A N   1 
ATOM   3131  C CA  . CYS A 1 440 ? 163.426 139.396 154.261 1.00 77.02  ? 440 CYS A CA  1 
ATOM   3132  C C   . CYS A 1 440 ? 163.355 138.064 153.542 1.00 77.02  ? 440 CYS A C   1 
ATOM   3133  O O   . CYS A 1 440 ? 163.370 138.048 152.314 1.00 77.02  ? 440 CYS A O   1 
ATOM   3134  C CB  . CYS A 1 440 ? 164.880 139.733 154.566 1.00 77.02  ? 440 CYS A CB  1 
ATOM   3135  S SG  . CYS A 1 440 ? 165.136 141.432 155.078 1.00 77.02  ? 440 CYS A SG  1 
ATOM   3136  N N   . PHE A 1 441 ? 163.262 136.953 154.262 1.00 78.30  ? 441 PHE A N   1 
ATOM   3137  C CA  . PHE A 1 441 ? 163.087 135.679 153.580 1.00 78.30  ? 441 PHE A CA  1 
ATOM   3138  C C   . PHE A 1 441 ? 161.652 135.434 153.173 1.00 78.30  ? 441 PHE A C   1 
ATOM   3139  O O   . PHE A 1 441 ? 161.413 134.739 152.181 1.00 78.30  ? 441 PHE A O   1 
ATOM   3140  C CB  . PHE A 1 441 ? 163.555 134.502 154.442 1.00 78.30  ? 441 PHE A CB  1 
ATOM   3141  C CG  . PHE A 1 441 ? 165.031 134.433 154.615 1.00 78.30  ? 441 PHE A CG  1 
ATOM   3142  C CD1 . PHE A 1 441 ? 165.842 134.158 153.539 1.00 78.30  ? 441 PHE A CD1 1 
ATOM   3143  C CD2 . PHE A 1 441 ? 165.603 134.567 155.858 1.00 78.30  ? 441 PHE A CD2 1 
ATOM   3144  C CE1 . PHE A 1 441 ? 167.201 134.085 153.695 1.00 78.30  ? 441 PHE A CE1 1 
ATOM   3145  C CE2 . PHE A 1 441 ? 166.961 134.494 156.018 1.00 78.30  ? 441 PHE A CE2 1 
ATOM   3146  C CZ  . PHE A 1 441 ? 167.757 134.249 154.938 1.00 78.30  ? 441 PHE A CZ  1 
ATOM   3147  N N   . CYS A 1 442 ? 160.692 135.983 153.914 1.00 81.86  ? 442 CYS A N   1 
ATOM   3148  C CA  . CYS A 1 442 ? 159.298 135.760 153.564 1.00 81.86  ? 442 CYS A CA  1 
ATOM   3149  C C   . CYS A 1 442 ? 158.890 136.591 152.361 1.00 81.86  ? 442 CYS A C   1 
ATOM   3150  O O   . CYS A 1 442 ? 158.159 136.116 151.486 1.00 81.86  ? 442 CYS A O   1 
ATOM   3151  C CB  . CYS A 1 442 ? 158.407 136.092 154.745 1.00 81.86  ? 442 CYS A CB  1 
ATOM   3152  S SG  . CYS A 1 442 ? 156.670 135.827 154.429 1.00 81.86  ? 442 CYS A SG  1 
ATOM   3153  N N   . GLY A 1 443 ? 159.338 137.840 152.304 1.00 76.88  ? 443 GLY A N   1 
ATOM   3154  C CA  . GLY A 1 443 ? 158.974 138.695 151.195 1.00 76.88  ? 443 GLY A CA  1 
ATOM   3155  C C   . GLY A 1 443 ? 159.695 138.398 149.909 1.00 76.88  ? 443 GLY A C   1 
ATOM   3156  O O   . GLY A 1 443 ? 159.234 138.822 148.849 1.00 76.88  ? 443 GLY A O   1 
ATOM   3157  N N   . TRP A 1 444 ? 160.801 137.667 149.970 1.00 73.84  ? 444 TRP A N   1 
ATOM   3158  C CA  . TRP A 1 444 ? 161.575 137.374 148.777 1.00 73.84  ? 444 TRP A CA  1 
ATOM   3159  C C   . TRP A 1 444 ? 160.970 136.258 147.947 1.00 73.84  ? 444 TRP A C   1 
ATOM   3160  O O   . TRP A 1 444 ? 161.202 136.198 146.737 1.00 73.84  ? 444 TRP A O   1 
ATOM   3161  C CB  . TRP A 1 444 ? 163.009 137.035 149.175 1.00 73.84  ? 444 TRP A CB  1 
ATOM   3162  C CG  . TRP A 1 444 ? 163.884 136.679 148.052 1.00 73.84  ? 444 TRP A CG  1 
ATOM   3163  C CD1 . TRP A 1 444 ? 164.118 137.414 146.947 1.00 73.84  ? 444 TRP A CD1 1 
ATOM   3164  C CD2 . TRP A 1 444 ? 164.683 135.508 147.935 1.00 73.84  ? 444 TRP A CD2 1 
ATOM   3165  N NE1 . TRP A 1 444 ? 164.996 136.765 146.123 1.00 73.84  ? 444 TRP A NE1 1 
ATOM   3166  C CE2 . TRP A 1 444 ? 165.361 135.588 146.716 1.00 73.84  ? 444 TRP A CE2 1 
ATOM   3167  C CE3 . TRP A 1 444 ? 164.887 134.395 148.744 1.00 73.84  ? 444 TRP A CE3 1 
ATOM   3168  C CZ2 . TRP A 1 444 ? 166.226 134.601 146.285 1.00 73.84  ? 444 TRP A CZ2 1 
ATOM   3169  C CZ3 . TRP A 1 444 ? 165.737 133.418 148.316 1.00 73.84  ? 444 TRP A CZ3 1 
ATOM   3170  C CH2 . TRP A 1 444 ? 166.399 133.524 147.101 1.00 73.84  ? 444 TRP A CH2 1 
ATOM   3171  N N   . ILE A 1 445 ? 160.174 135.385 148.552 1.00 73.18  ? 445 ILE A N   1 
ATOM   3172  C CA  . ILE A 1 445 ? 159.560 134.286 147.829 1.00 73.18  ? 445 ILE A CA  1 
ATOM   3173  C C   . ILE A 1 445 ? 158.164 134.638 147.355 1.00 73.18  ? 445 ILE A C   1 
ATOM   3174  O O   . ILE A 1 445 ? 157.822 134.392 146.199 1.00 73.18  ? 445 ILE A O   1 
ATOM   3175  C CB  . ILE A 1 445 ? 159.564 133.002 148.685 1.00 73.18  ? 445 ILE A CB  1 
ATOM   3176  C CG1 . ILE A 1 445 ? 160.911 132.321 148.574 1.00 73.18  ? 445 ILE A CG1 1 
ATOM   3177  C CG2 . ILE A 1 445 ? 158.499 132.031 148.276 1.00 73.18  ? 445 ILE A CG2 1 
ATOM   3178  C CD1 . ILE A 1 445 ? 161.854 132.740 149.595 1.00 73.18  ? 445 ILE A CD1 1 
ATOM   3179  N N   . VAL A 1 446 ? 157.367 135.255 148.221 1.00 76.44  ? 446 VAL A N   1 
ATOM   3180  C CA  . VAL A 1 446 ? 155.992 135.561 147.862 1.00 76.44  ? 446 VAL A CA  1 
ATOM   3181  C C   . VAL A 1 446 ? 155.941 136.662 146.820 1.00 76.44  ? 446 VAL A C   1 
ATOM   3182  O O   . VAL A 1 446 ? 155.330 136.505 145.759 1.00 76.44  ? 446 VAL A O   1 
ATOM   3183  C CB  . VAL A 1 446 ? 155.191 135.959 149.105 1.00 76.44  ? 446 VAL A CB  1 
ATOM   3184  C CG1 . VAL A 1 446 ? 153.786 136.237 148.690 1.00 76.44  ? 446 VAL A CG1 1 
ATOM   3185  C CG2 . VAL A 1 446 ? 155.254 134.884 150.148 1.00 76.44  ? 446 VAL A CG2 1 
ATOM   3186  N N   . LEU A 1 447 ? 156.583 137.787 147.098 1.00 76.29  ? 447 LEU A N   1 
ATOM   3187  C CA  . LEU A 1 447 ? 156.531 138.952 146.236 1.00 76.29  ? 447 LEU A CA  1 
ATOM   3188  C C   . LEU A 1 447 ? 157.661 138.968 145.227 1.00 76.29  ? 447 LEU A C   1 
ATOM   3189  O O   . LEU A 1 447 ? 157.805 139.937 144.483 1.00 76.29  ? 447 LEU A O   1 
ATOM   3190  C CB  . LEU A 1 447 ? 156.573 140.204 147.092 1.00 76.29  ? 447 LEU A CB  1 
ATOM   3191  C CG  . LEU A 1 447 ? 155.418 140.264 148.078 1.00 76.29  ? 447 LEU A CG  1 
ATOM   3192  C CD1 . LEU A 1 447 ? 155.567 141.400 149.054 1.00 76.29  ? 447 LEU A CD1 1 
ATOM   3193  C CD2 . LEU A 1 447 ? 154.150 140.413 147.302 1.00 76.29  ? 447 LEU A CD2 1 
ATOM   3194  N N   . GLY A 1 448 ? 158.466 137.921 145.200 1.00 76.46  ? 448 GLY A N   1 
ATOM   3195  C CA  . GLY A 1 448 ? 159.574 137.795 144.285 1.00 76.46  ? 448 GLY A CA  1 
ATOM   3196  C C   . GLY A 1 448 ? 159.257 137.730 142.802 1.00 76.46  ? 448 GLY A C   1 
ATOM   3197  O O   . GLY A 1 448 ? 159.830 138.490 142.019 1.00 76.46  ? 448 GLY A O   1 
ATOM   3198  N N   . PRO A 1 449 ? 158.402 136.795 142.366 1.00 76.88  ? 449 PRO A N   1 
ATOM   3199  C CA  . PRO A 1 449 ? 158.152 136.681 140.925 1.00 76.88  ? 449 PRO A CA  1 
ATOM   3200  C C   . PRO A 1 449 ? 157.412 137.851 140.326 1.00 76.88  ? 449 PRO A C   1 
ATOM   3201  O O   . PRO A 1 449 ? 157.624 138.164 139.150 1.00 76.88  ? 449 PRO A O   1 
ATOM   3202  C CB  . PRO A 1 449 ? 157.317 135.403 140.818 1.00 76.88  ? 449 PRO A CB  1 
ATOM   3203  C CG  . PRO A 1 449 ? 157.666 134.639 141.985 1.00 76.88  ? 449 PRO A CG  1 
ATOM   3204  C CD  . PRO A 1 449 ? 157.868 135.617 143.069 1.00 76.88  ? 449 PRO A CD  1 
ATOM   3205  N N   . TYR A 1 450 ? 156.555 138.510 141.079 1.00 82.36  ? 450 TYR A N   1 
ATOM   3206  C CA  . TYR A 1 450 ? 155.631 139.445 140.470 1.00 82.36  ? 450 TYR A CA  1 
ATOM   3207  C C   . TYR A 1 450 ? 156.166 140.863 140.380 1.00 82.36  ? 450 TYR A C   1 
ATOM   3208  O O   . TYR A 1 450 ? 155.543 141.695 139.718 1.00 82.36  ? 450 TYR A O   1 
ATOM   3209  C CB  . TYR A 1 450 ? 154.317 139.436 141.241 1.00 82.36  ? 450 TYR A CB  1 
ATOM   3210  C CG  . TYR A 1 450 ? 153.612 138.110 141.164 1.00 82.36  ? 450 TYR A CG  1 
ATOM   3211  C CD1 . TYR A 1 450 ? 152.874 137.762 140.047 1.00 82.36  ? 450 TYR A CD1 1 
ATOM   3212  C CD2 . TYR A 1 450 ? 153.694 137.204 142.205 1.00 82.36  ? 450 TYR A CD2 1 
ATOM   3213  C CE1 . TYR A 1 450 ? 152.232 136.552 139.970 1.00 82.36  ? 450 TYR A CE1 1 
ATOM   3214  C CE2 . TYR A 1 450 ? 153.054 135.990 142.139 1.00 82.36  ? 450 TYR A CE2 1 
ATOM   3215  C CZ  . TYR A 1 450 ? 152.326 135.669 141.019 1.00 82.36  ? 450 TYR A CZ  1 
ATOM   3216  O OH  . TYR A 1 450 ? 151.684 134.456 140.944 1.00 82.36  ? 450 TYR A OH  1 
ATOM   3217  N N   . HIS A 1 451 ? 157.290 141.178 141.012 1.00 86.67  ? 451 HIS A N   1 
ATOM   3218  C CA  . HIS A 1 451 ? 157.691 142.572 141.108 1.00 86.67  ? 451 HIS A CA  1 
ATOM   3219  C C   . HIS A 1 451 ? 159.165 142.703 140.766 1.00 86.67  ? 451 HIS A C   1 
ATOM   3220  O O   . HIS A 1 451 ? 159.814 141.755 140.318 1.00 86.67  ? 451 HIS A O   1 
ATOM   3221  C CB  . HIS A 1 451 ? 157.355 143.123 142.492 1.00 86.67  ? 451 HIS A CB  1 
ATOM   3222  C CG  . HIS A 1 451 ? 155.898 143.066 142.800 1.00 86.67  ? 451 HIS A CG  1 
ATOM   3223  N ND1 . HIS A 1 451 ? 154.979 143.879 142.177 1.00 86.67  ? 451 HIS A ND1 1 
ATOM   3224  C CD2 . HIS A 1 451 ? 155.192 142.262 143.626 1.00 86.67  ? 451 HIS A CD2 1 
ATOM   3225  C CE1 . HIS A 1 451 ? 153.769 143.591 142.622 1.00 86.67  ? 451 HIS A CE1 1 
ATOM   3226  N NE2 . HIS A 1 451 ? 153.871 142.617 143.507 1.00 86.67  ? 451 HIS A NE2 1 
ATOM   3227  N N   . VAL A 1 452 ? 159.689 143.910 140.960 1.00 81.20  ? 452 VAL A N   1 
ATOM   3228  C CA  . VAL A 1 452 ? 161.027 144.262 140.523 1.00 81.20  ? 452 VAL A CA  1 
ATOM   3229  C C   . VAL A 1 452 ? 161.931 144.592 141.701 1.00 81.20  ? 452 VAL A C   1 
ATOM   3230  O O   . VAL A 1 452 ? 163.082 144.145 141.749 1.00 81.20  ? 452 VAL A O   1 
ATOM   3231  C CB  . VAL A 1 452 ? 160.979 145.437 139.528 1.00 81.20  ? 452 VAL A CB  1 
ATOM   3232  C CG1 . VAL A 1 452 ? 162.361 145.775 139.024 1.00 81.20  ? 452 VAL A CG1 1 
ATOM   3233  C CG2 . VAL A 1 452 ? 160.064 145.110 138.366 1.00 81.20  ? 452 VAL A CG2 1 
ATOM   3234  N N   . LYS A 1 453 ? 161.417 145.342 142.677 1.00 74.13  ? 453 LYS A N   1 
ATOM   3235  C CA  . LYS A 1 453 ? 162.217 145.706 143.839 1.00 74.13  ? 453 LYS A CA  1 
ATOM   3236  C C   . LYS A 1 453 ? 162.532 144.508 144.718 1.00 74.13  ? 453 LYS A C   1 
ATOM   3237  O O   . LYS A 1 453 ? 163.540 144.515 145.425 1.00 74.13  ? 453 LYS A O   1 
ATOM   3238  C CB  . LYS A 1 453 ? 161.498 146.756 144.678 1.00 74.13  ? 453 LYS A CB  1 
ATOM   3239  C CG  . LYS A 1 453 ? 161.360 148.110 144.035 1.00 74.13  ? 453 LYS A CG  1 
ATOM   3240  C CD  . LYS A 1 453 ? 160.684 149.069 144.996 1.00 74.13  ? 453 LYS A CD  1 
ATOM   3241  C CE  . LYS A 1 453 ? 160.622 150.477 144.444 1.00 74.13  ? 453 LYS A CE  1 
ATOM   3242  N NZ  . LYS A 1 453 ? 159.733 150.580 143.254 1.00 74.13  ? 453 LYS A NZ  1 
ATOM   3243  N N   . PHE A 1 454 ? 161.706 143.471 144.685 1.00 74.14  ? 454 PHE A N   1 
ATOM   3244  C CA  . PHE A 1 454 ? 161.826 142.348 145.608 1.00 74.14  ? 454 PHE A CA  1 
ATOM   3245  C C   . PHE A 1 454 ? 162.456 141.133 144.957 1.00 74.14  ? 454 PHE A C   1 
ATOM   3246  O O   . PHE A 1 454 ? 161.999 140.014 145.174 1.00 74.14  ? 454 PHE A O   1 
ATOM   3247  C CB  . PHE A 1 454 ? 160.462 141.989 146.176 1.00 74.14  ? 454 PHE A CB  1 
ATOM   3248  C CG  . PHE A 1 454 ? 159.956 142.953 147.197 1.00 74.14  ? 454 PHE A CG  1 
ATOM   3249  C CD1 . PHE A 1 454 ? 160.814 143.784 147.874 1.00 74.14  ? 454 PHE A CD1 1 
ATOM   3250  C CD2 . PHE A 1 454 ? 158.611 143.039 147.469 1.00 74.14  ? 454 PHE A CD2 1 
ATOM   3251  C CE1 . PHE A 1 454 ? 160.333 144.662 148.812 1.00 74.14  ? 454 PHE A CE1 1 
ATOM   3252  C CE2 . PHE A 1 454 ? 158.136 143.913 148.401 1.00 74.14  ? 454 PHE A CE2 1 
ATOM   3253  C CZ  . PHE A 1 454 ? 158.997 144.727 149.072 1.00 74.14  ? 454 PHE A CZ  1 
ATOM   3254  N N   . ARG A 1 455 ? 163.486 141.309 144.135 1.00 75.76  ? 455 ARG A N   1 
ATOM   3255  C CA  . ARG A 1 455 ? 163.990 140.198 143.342 1.00 75.76  ? 455 ARG A CA  1 
ATOM   3256  C C   . ARG A 1 455 ? 165.136 139.445 144.009 1.00 75.76  ? 455 ARG A C   1 
ATOM   3257  O O   . ARG A 1 455 ? 165.106 138.215 144.060 1.00 75.76  ? 455 ARG A O   1 
ATOM   3258  C CB  . ARG A 1 455 ? 164.415 140.702 141.968 1.00 75.76  ? 455 ARG A CB  1 
ATOM   3259  C CG  . ARG A 1 455 ? 164.739 139.592 141.021 1.00 75.76  ? 455 ARG A CG  1 
ATOM   3260  C CD  . ARG A 1 455 ? 163.527 138.702 140.810 1.00 75.76  ? 455 ARG A CD  1 
ATOM   3261  N NE  . ARG A 1 455 ? 162.365 139.444 140.345 1.00 75.76  ? 455 ARG A NE  1 
ATOM   3262  C CZ  . ARG A 1 455 ? 162.134 139.757 139.076 1.00 75.76  ? 455 ARG A CZ  1 
ATOM   3263  N NH1 . ARG A 1 455 ? 162.991 139.399 138.136 1.00 75.76  ? 455 ARG A NH1 1 
ATOM   3264  N NH2 . ARG A 1 455 ? 161.046 140.435 138.745 1.00 75.76  ? 455 ARG A NH2 1 
ATOM   3265  N N   . SER A 1 456 ? 166.149 140.139 144.513 1.00 80.12  ? 456 SER A N   1 
ATOM   3266  C CA  . SER A 1 456 ? 167.220 139.479 145.245 1.00 80.12  ? 456 SER A CA  1 
ATOM   3267  C C   . SER A 1 456 ? 167.222 139.946 146.693 1.00 80.12  ? 456 SER A C   1 
ATOM   3268  O O   . SER A 1 456 ? 166.567 140.925 147.049 1.00 80.12  ? 456 SER A O   1 
ATOM   3269  C CB  . SER A 1 456 ? 168.570 139.749 144.591 1.00 80.12  ? 456 SER A CB  1 
ATOM   3270  O OG  . SER A 1 456 ? 168.934 141.102 144.748 1.00 80.12  ? 456 SER A OG  1 
ATOM   3271  N N   . LEU A 1 457 ? 167.978 139.240 147.540 1.00 76.60  ? 457 LEU A N   1 
ATOM   3272  C CA  . LEU A 1 457 ? 168.010 139.576 148.962 1.00 76.60  ? 457 LEU A CA  1 
ATOM   3273  C C   . LEU A 1 457 ? 168.694 140.908 149.209 1.00 76.60  ? 457 LEU A C   1 
ATOM   3274  O O   . LEU A 1 457 ? 168.311 141.645 150.123 1.00 76.60  ? 457 LEU A O   1 
ATOM   3275  C CB  . LEU A 1 457 ? 168.723 138.502 149.776 1.00 76.60  ? 457 LEU A CB  1 
ATOM   3276  C CG  . LEU A 1 457 ? 167.975 137.238 150.176 1.00 76.60  ? 457 LEU A CG  1 
ATOM   3277  C CD1 . LEU A 1 457 ? 167.953 136.259 149.037 1.00 76.60  ? 457 LEU A CD1 1 
ATOM   3278  C CD2 . LEU A 1 457 ? 168.592 136.613 151.408 1.00 76.60  ? 457 LEU A CD2 1 
ATOM   3279  N N   . SER A 1 458 ? 169.688 141.238 148.398 1.00 82.54  ? 458 SER A N   1 
ATOM   3280  C CA  . SER A 1 458 ? 170.375 142.509 148.525 1.00 82.54  ? 458 SER A CA  1 
ATOM   3281  C C   . SER A 1 458 ? 169.501 143.690 148.160 1.00 82.54  ? 458 SER A C   1 
ATOM   3282  O O   . SER A 1 458 ? 169.847 144.812 148.517 1.00 82.54  ? 458 SER A O   1 
ATOM   3283  C CB  . SER A 1 458 ? 171.608 142.521 147.642 1.00 82.54  ? 458 SER A CB  1 
ATOM   3284  O OG  . SER A 1 458 ? 171.211 142.483 146.288 1.00 82.54  ? 458 SER A OG  1 
ATOM   3285  N N   . MET A 1 459 ? 168.402 143.480 147.443 1.00 78.98  ? 459 MET A N   1 
ATOM   3286  C CA  . MET A 1 459 ? 167.432 144.545 147.250 1.00 78.98  ? 459 MET A CA  1 
ATOM   3287  C C   . MET A 1 459 ? 166.361 144.548 148.319 1.00 78.98  ? 459 MET A C   1 
ATOM   3288  O O   . MET A 1 459 ? 165.896 145.623 148.709 1.00 78.98  ? 459 MET A O   1 
ATOM   3289  C CB  . MET A 1 459 ? 166.754 144.429 145.890 1.00 78.98  ? 459 MET A CB  1 
ATOM   3290  C CG  . MET A 1 459 ? 167.626 144.738 144.712 1.00 78.98  ? 459 MET A CG  1 
ATOM   3291  S SD  . MET A 1 459 ? 166.682 144.600 143.187 1.00 78.98  ? 459 MET A SD  1 
ATOM   3292  C CE  . MET A 1 459 ? 167.968 144.835 141.974 1.00 78.98  ? 459 MET A CE  1 
ATOM   3293  N N   . VAL A 1 460 ? 165.952 143.371 148.791 1.00 72.36  ? 460 VAL A N   1 
ATOM   3294  C CA  . VAL A 1 460 ? 164.905 143.299 149.800 1.00 72.36  ? 460 VAL A CA  1 
ATOM   3295  C C   . VAL A 1 460 ? 165.407 143.857 151.119 1.00 72.36  ? 460 VAL A C   1 
ATOM   3296  O O   . VAL A 1 460 ? 164.690 144.581 151.815 1.00 72.36  ? 460 VAL A O   1 
ATOM   3297  C CB  . VAL A 1 460 ? 164.403 141.854 149.932 1.00 72.36  ? 460 VAL A CB  1 
ATOM   3298  C CG1 . VAL A 1 460 ? 163.432 141.714 151.065 1.00 72.36  ? 460 VAL A CG1 1 
ATOM   3299  C CG2 . VAL A 1 460 ? 163.721 141.463 148.674 1.00 72.36  ? 460 VAL A CG2 1 
ATOM   3300  N N   . SER A 1 461 ? 166.667 143.611 151.441 1.00 76.78  ? 461 SER A N   1 
ATOM   3301  C CA  . SER A 1 461 ? 167.263 144.229 152.613 1.00 76.78  ? 461 SER A CA  1 
ATOM   3302  C C   . SER A 1 461 ? 167.494 145.718 152.447 1.00 76.78  ? 461 SER A C   1 
ATOM   3303  O O   . SER A 1 461 ? 167.806 146.385 153.432 1.00 76.78  ? 461 SER A O   1 
ATOM   3304  C CB  . SER A 1 461 ? 168.587 143.565 152.951 1.00 76.78  ? 461 SER A CB  1 
ATOM   3305  O OG  . SER A 1 461 ? 169.199 144.235 154.032 1.00 76.78  ? 461 SER A OG  1 
ATOM   3306  N N   . GLU A 1 462 ? 167.380 146.248 151.235 1.00 77.45  ? 462 GLU A N   1 
ATOM   3307  C CA  . GLU A 1 462 ? 167.368 147.681 151.002 1.00 77.45  ? 462 GLU A CA  1 
ATOM   3308  C C   . GLU A 1 462 ? 165.964 148.235 150.888 1.00 77.45  ? 462 GLU A C   1 
ATOM   3309  O O   . GLU A 1 462 ? 165.689 149.313 151.416 1.00 77.45  ? 462 GLU A O   1 
ATOM   3310  C CB  . GLU A 1 462 ? 168.135 148.014 149.729 1.00 77.45  ? 462 GLU A CB  1 
ATOM   3311  C CG  . GLU A 1 462 ? 169.600 147.739 149.826 1.00 77.45  ? 462 GLU A CG  1 
ATOM   3312  C CD  . GLU A 1 462 ? 170.307 147.941 148.507 1.00 77.45  ? 462 GLU A CD  1 
ATOM   3313  O OE1 . GLU A 1 462 ? 169.620 148.191 147.499 1.00 77.45  ? 462 GLU A OE1 1 
ATOM   3314  O OE2 . GLU A 1 462 ? 171.550 147.845 148.468 1.00 77.45  ? 462 GLU A OE2 1 
ATOM   3315  N N   . CYS A 1 463 ? 165.065 147.518 150.214 1.00 72.17  ? 463 CYS A N   1 
ATOM   3316  C CA  . CYS A 1 463 ? 163.719 148.032 150.023 1.00 72.17  ? 463 CYS A CA  1 
ATOM   3317  C C   . CYS A 1 463 ? 162.909 147.968 151.301 1.00 72.17  ? 463 CYS A C   1 
ATOM   3318  O O   . CYS A 1 463 ? 161.957 148.733 151.457 1.00 72.17  ? 463 CYS A O   1 
ATOM   3319  C CB  . CYS A 1 463 ? 163.004 147.262 148.918 1.00 72.17  ? 463 CYS A CB  1 
ATOM   3320  S SG  . CYS A 1 463 ? 161.431 147.973 148.398 1.00 72.17  ? 463 CYS A SG  1 
ATOM   3321  N N   . LEU A 1 464 ? 163.259 147.078 152.221 1.00 72.40  ? 464 LEU A N   1 
ATOM   3322  C CA  . LEU A 1 464 ? 162.592 147.100 153.511 1.00 72.40  ? 464 LEU A CA  1 
ATOM   3323  C C   . LEU A 1 464 ? 163.244 148.077 154.465 1.00 72.40  ? 464 LEU A C   1 
ATOM   3324  O O   . LEU A 1 464 ? 162.547 148.725 155.246 1.00 72.40  ? 464 LEU A O   1 
ATOM   3325  C CB  . LEU A 1 464 ? 162.588 145.723 154.148 1.00 72.40  ? 464 LEU A CB  1 
ATOM   3326  C CG  . LEU A 1 464 ? 161.763 144.670 153.445 1.00 72.40  ? 464 LEU A CG  1 
ATOM   3327  C CD1 . LEU A 1 464 ? 161.976 143.371 154.150 1.00 72.40  ? 464 LEU A CD1 1 
ATOM   3328  C CD2 . LEU A 1 464 ? 160.323 145.058 153.488 1.00 72.40  ? 464 LEU A CD2 1 
ATOM   3329  N N   . PHE A 1 465 ? 164.564 148.191 154.435 1.00 71.24  ? 465 PHE A N   1 
ATOM   3330  C CA  . PHE A 1 465 ? 165.221 149.053 155.399 1.00 71.24  ? 465 PHE A CA  1 
ATOM   3331  C C   . PHE A 1 465 ? 165.032 150.517 155.062 1.00 71.24  ? 465 PHE A C   1 
ATOM   3332  O O   . PHE A 1 465 ? 164.958 151.351 155.967 1.00 71.24  ? 465 PHE A O   1 
ATOM   3333  C CB  . PHE A 1 465 ? 166.701 148.721 155.477 1.00 71.24  ? 465 PHE A CB  1 
ATOM   3334  C CG  . PHE A 1 465 ? 167.443 149.540 156.468 1.00 71.24  ? 465 PHE A CG  1 
ATOM   3335  C CD1 . PHE A 1 465 ? 167.330 149.286 157.816 1.00 71.24  ? 465 PHE A CD1 1 
ATOM   3336  C CD2 . PHE A 1 465 ? 168.252 150.569 156.052 1.00 71.24  ? 465 PHE A CD2 1 
ATOM   3337  C CE1 . PHE A 1 465 ? 168.015 150.049 158.724 1.00 71.24  ? 465 PHE A CE1 1 
ATOM   3338  C CE2 . PHE A 1 465 ? 168.921 151.322 156.952 1.00 71.24  ? 465 PHE A CE2 1 
ATOM   3339  C CZ  . PHE A 1 465 ? 168.812 151.069 158.289 1.00 71.24  ? 465 PHE A CZ  1 
ATOM   3340  N N   . SER A 1 466 ? 164.927 150.850 153.783 1.00 73.25  ? 466 SER A N   1 
ATOM   3341  C CA  . SER A 1 466 ? 164.590 152.211 153.404 1.00 73.25  ? 466 SER A CA  1 
ATOM   3342  C C   . SER A 1 466 ? 163.128 152.515 153.625 1.00 73.25  ? 466 SER A C   1 
ATOM   3343  O O   . SER A 1 466 ? 162.723 153.673 153.507 1.00 73.25  ? 466 SER A O   1 
ATOM   3344  C CB  . SER A 1 466 ? 164.932 152.463 151.941 1.00 73.25  ? 466 SER A CB  1 
ATOM   3345  O OG  . SER A 1 466 ? 164.109 151.687 151.099 1.00 73.25  ? 466 SER A OG  1 
ATOM   3346  N N   . LEU A 1 467 ? 162.333 151.506 153.934 1.00 67.27  ? 467 LEU A N   1 
ATOM   3347  C CA  . LEU A 1 467 ? 160.907 151.684 154.077 1.00 67.27  ? 467 LEU A CA  1 
ATOM   3348  C C   . LEU A 1 467 ? 160.511 152.022 155.498 1.00 67.27  ? 467 LEU A C   1 
ATOM   3349  O O   . LEU A 1 467 ? 159.590 152.811 155.685 1.00 67.27  ? 467 LEU A O   1 
ATOM   3350  C CB  . LEU A 1 467 ? 160.192 150.422 153.597 1.00 67.27  ? 467 LEU A CB  1 
ATOM   3351  C CG  . LEU A 1 467 ? 158.732 150.433 153.195 1.00 67.27  ? 467 LEU A CG  1 
ATOM   3352  C CD1 . LEU A 1 467 ? 158.561 149.461 152.064 1.00 67.27  ? 467 LEU A CD1 1 
ATOM   3353  C CD2 . LEU A 1 467 ? 157.871 150.009 154.336 1.00 67.27  ? 467 LEU A CD2 1 
ATOM   3354  N N   . ILE A 1 468 ? 161.216 151.499 156.504 1.00 70.04  ? 468 ILE A N   1 
ATOM   3355  C CA  . ILE A 1 468 ? 160.871 151.827 157.883 1.00 70.04  ? 468 ILE A CA  1 
ATOM   3356  C C   . ILE A 1 468 ? 161.288 153.237 158.261 1.00 70.04  ? 468 ILE A C   1 
ATOM   3357  O O   . ILE A 1 468 ? 160.762 153.789 159.231 1.00 70.04  ? 468 ILE A O   1 
ATOM   3358  C CB  . ILE A 1 468 ? 161.474 150.832 158.886 1.00 70.04  ? 468 ILE A CB  1 
ATOM   3359  C CG1 . ILE A 1 468 ? 162.989 150.923 158.917 1.00 70.04  ? 468 ILE A CG1 1 
ATOM   3360  C CG2 . ILE A 1 468 ? 161.094 149.432 158.524 1.00 70.04  ? 468 ILE A CG2 1 
ATOM   3361  C CD1 . ILE A 1 468 ? 163.587 150.131 160.030 1.00 70.04  ? 468 ILE A CD1 1 
ATOM   3362  N N   . ASN A 1 469 ? 162.207 153.843 157.523 1.00 70.28  ? 469 ASN A N   1 
ATOM   3363  C CA  . ASN A 1 469 ? 162.525 155.237 157.755 1.00 70.28  ? 469 ASN A CA  1 
ATOM   3364  C C   . ASN A 1 469 ? 161.541 156.155 157.061 1.00 70.28  ? 469 ASN A C   1 
ATOM   3365  O O   . ASN A 1 469 ? 161.535 157.355 157.336 1.00 70.28  ? 469 ASN A O   1 
ATOM   3366  C CB  . ASN A 1 469 ? 163.933 155.531 157.264 1.00 70.28  ? 469 ASN A CB  1 
ATOM   3367  C CG  . ASN A 1 469 ? 164.962 154.692 157.957 1.00 70.28  ? 469 ASN A CG  1 
ATOM   3368  O OD1 . ASN A 1 469 ? 164.907 154.491 159.161 1.00 70.28  ? 469 ASN A OD1 1 
ATOM   3369  N ND2 . ASN A 1 469 ? 165.898 154.168 157.191 1.00 70.28  ? 469 ASN A ND2 1 
ATOM   3370  N N   . GLY A 1 470 ? 160.717 155.619 156.170 1.00 75.19  ? 470 GLY A N   1 
ATOM   3371  C CA  . GLY A 1 470 ? 159.721 156.418 155.493 1.00 75.19  ? 470 GLY A CA  1 
ATOM   3372  C C   . GLY A 1 470 ? 160.178 156.971 154.164 1.00 75.19  ? 470 GLY A C   1 
ATOM   3373  O O   . GLY A 1 470 ? 160.140 158.184 153.951 1.00 75.19  ? 470 GLY A O   1 
ATOM   3374  N N   . ASP A 1 471 ? 160.625 156.101 153.265 1.00 76.26  ? 471 ASP A N   1 
ATOM   3375  C CA  . ASP A 1 471 ? 161.070 156.546 151.953 1.00 76.26  ? 471 ASP A CA  1 
ATOM   3376  C C   . ASP A 1 471 ? 160.787 155.455 150.938 1.00 76.26  ? 471 ASP A C   1 
ATOM   3377  O O   . ASP A 1 471 ? 161.102 154.290 151.189 1.00 76.26  ? 471 ASP A O   1 
ATOM   3378  C CB  . ASP A 1 471 ? 162.556 156.875 151.969 1.00 76.26  ? 471 ASP A CB  1 
ATOM   3379  C CG  . ASP A 1 471 ? 162.998 157.644 150.750 1.00 76.26  ? 471 ASP A CG  1 
ATOM   3380  O OD1 . ASP A 1 471 ? 162.165 157.954 149.875 1.00 76.26  ? 471 ASP A OD1 1 
ATOM   3381  O OD2 . ASP A 1 471 ? 164.198 157.947 150.671 1.00 76.26  ? 471 ASP A OD2 1 
ATOM   3382  N N   . ASP A 1 472 ? 160.260 155.861 149.782 1.00 85.36  ? 472 ASP A N   1 
ATOM   3383  C CA  . ASP A 1 472 ? 159.735 154.970 148.746 1.00 85.36  ? 472 ASP A CA  1 
ATOM   3384  C C   . ASP A 1 472 ? 158.758 153.970 149.343 1.00 85.36  ? 472 ASP A C   1 
ATOM   3385  O O   . ASP A 1 472 ? 158.947 152.757 149.294 1.00 85.36  ? 472 ASP A O   1 
ATOM   3386  C CB  . ASP A 1 472 ? 160.851 154.285 147.966 1.00 85.36  ? 472 ASP A CB  1 
ATOM   3387  C CG  . ASP A 1 472 ? 161.443 155.197 146.931 1.00 85.36  ? 472 ASP A CG  1 
ATOM   3388  O OD1 . ASP A 1 472 ? 160.689 156.049 146.422 1.00 85.36  ? 472 ASP A OD1 1 
ATOM   3389  O OD2 . ASP A 1 472 ? 162.643 155.085 146.627 1.00 85.36  ? 472 ASP A OD2 1 
ATOM   3390  N N   . MET A 1 473 ? 157.709 154.520 149.940 1.00 76.74  ? 473 MET A N   1 
ATOM   3391  C CA  . MET A 1 473 ? 156.660 153.715 150.536 1.00 76.74  ? 473 MET A CA  1 
ATOM   3392  C C   . MET A 1 473 ? 155.426 153.632 149.659 1.00 76.74  ? 473 MET A C   1 
ATOM   3393  O O   . MET A 1 473 ? 154.913 152.535 149.434 1.00 76.74  ? 473 MET A O   1 
ATOM   3394  C CB  . MET A 1 473 ? 156.276 154.280 151.896 1.00 76.74  ? 473 MET A CB  1 
ATOM   3395  C CG  . MET A 1 473 ? 155.406 153.376 152.709 1.00 76.74  ? 473 MET A CG  1 
ATOM   3396  S SD  . MET A 1 473 ? 154.989 154.186 154.245 1.00 76.74  ? 473 MET A SD  1 
ATOM   3397  C CE  . MET A 1 473 ? 156.608 154.320 154.971 1.00 76.74  ? 473 MET A CE  1 
ATOM   3398  N N   . PHE A 1 474 ? 154.940 154.763 149.147 1.00 75.40  ? 474 PHE A N   1 
ATOM   3399  C CA  . PHE A 1 474 ? 153.770 154.726 148.281 1.00 75.40  ? 474 PHE A CA  1 
ATOM   3400  C C   . PHE A 1 474 ? 154.081 154.096 146.935 1.00 75.40  ? 474 PHE A C   1 
ATOM   3401  O O   . PHE A 1 474 ? 153.193 153.502 146.319 1.00 75.40  ? 474 PHE A O   1 
ATOM   3402  C CB  . PHE A 1 474 ? 153.205 156.130 148.096 1.00 75.40  ? 474 PHE A CB  1 
ATOM   3403  C CG  . PHE A 1 474 ? 152.063 156.204 147.128 1.00 75.40  ? 474 PHE A CG  1 
ATOM   3404  C CD1 . PHE A 1 474 ? 150.824 155.702 147.458 1.00 75.40  ? 474 PHE A CD1 1 
ATOM   3405  C CD2 . PHE A 1 474 ? 152.235 156.774 145.884 1.00 75.40  ? 474 PHE A CD2 1 
ATOM   3406  C CE1 . PHE A 1 474 ? 149.784 155.762 146.567 1.00 75.40  ? 474 PHE A CE1 1 
ATOM   3407  C CE2 . PHE A 1 474 ? 151.197 156.837 144.994 1.00 75.40  ? 474 PHE A CE2 1 
ATOM   3408  C CZ  . PHE A 1 474 ? 149.972 156.330 145.337 1.00 75.40  ? 474 PHE A CZ  1 
ATOM   3409  N N   . VAL A 1 475 ? 155.329 154.183 146.477 1.00 74.67  ? 475 VAL A N   1 
ATOM   3410  C CA  . VAL A 1 475 ? 155.670 153.621 145.176 1.00 74.67  ? 475 VAL A CA  1 
ATOM   3411  C C   . VAL A 1 475 ? 155.618 152.101 145.223 1.00 74.67  ? 475 VAL A C   1 
ATOM   3412  O O   . VAL A 1 475 ? 155.219 151.455 144.248 1.00 74.67  ? 475 VAL A O   1 
ATOM   3413  C CB  . VAL A 1 475 ? 157.048 154.139 144.736 1.00 74.67  ? 475 VAL A CB  1 
ATOM   3414  C CG1 . VAL A 1 475 ? 157.389 153.670 143.336 1.00 74.67  ? 475 VAL A CG1 1 
ATOM   3415  C CG2 . VAL A 1 475 ? 157.086 155.644 144.829 1.00 74.67  ? 475 VAL A CG2 1 
ATOM   3416  N N   . THR A 1 476 ? 155.953 151.505 146.367 1.00 78.34  ? 476 THR A N   1 
ATOM   3417  C CA  . THR A 1 476 ? 155.854 150.059 146.495 1.00 78.34  ? 476 THR A CA  1 
ATOM   3418  C C   . THR A 1 476 ? 154.427 149.597 146.726 1.00 78.34  ? 476 THR A C   1 
ATOM   3419  O O   . THR A 1 476 ? 154.083 148.480 146.338 1.00 78.34  ? 476 THR A O   1 
ATOM   3420  C CB  . THR A 1 476 ? 156.727 149.568 147.633 1.00 78.34  ? 476 THR A CB  1 
ATOM   3421  O OG1 . THR A 1 476 ? 156.205 150.063 148.863 1.00 78.34  ? 476 THR A OG1 1 
ATOM   3422  C CG2 . THR A 1 476 ? 158.114 150.097 147.463 1.00 78.34  ? 476 THR A CG2 1 
ATOM   3423  N N   . PHE A 1 477 ? 153.594 150.411 147.364 1.00 80.07  ? 477 PHE A N   1 
ATOM   3424  C CA  . PHE A 1 477 ? 152.175 150.091 147.405 1.00 80.07  ? 477 PHE A CA  1 
ATOM   3425  C C   . PHE A 1 477 ? 151.514 150.231 146.048 1.00 80.07  ? 477 PHE A C   1 
ATOM   3426  O O   . PHE A 1 477 ? 150.601 149.471 145.729 1.00 80.07  ? 477 PHE A O   1 
ATOM   3427  C CB  . PHE A 1 477 ? 151.444 150.978 148.407 1.00 80.07  ? 477 PHE A CB  1 
ATOM   3428  C CG  . PHE A 1 477 ? 151.535 150.508 149.822 1.00 80.07  ? 477 PHE A CG  1 
ATOM   3429  C CD1 . PHE A 1 477 ? 150.705 149.503 150.277 1.00 80.07  ? 477 PHE A CD1 1 
ATOM   3430  C CD2 . PHE A 1 477 ? 152.418 151.087 150.701 1.00 80.07  ? 477 PHE A CD2 1 
ATOM   3431  C CE1 . PHE A 1 477 ? 150.765 149.079 151.575 1.00 80.07  ? 477 PHE A CE1 1 
ATOM   3432  C CE2 . PHE A 1 477 ? 152.486 150.664 151.998 1.00 80.07  ? 477 PHE A CE2 1 
ATOM   3433  C CZ  . PHE A 1 477 ? 151.660 149.658 152.435 1.00 80.07  ? 477 PHE A CZ  1 
ATOM   3434  N N   . ALA A 1 478 ? 151.950 151.190 145.242 1.00 81.02  ? 478 ALA A N   1 
ATOM   3435  C CA  . ALA A 1 478 ? 151.363 151.364 143.925 1.00 81.02  ? 478 ALA A CA  1 
ATOM   3436  C C   . ALA A 1 478 ? 151.767 150.268 142.958 1.00 81.02  ? 478 ALA A C   1 
ATOM   3437  O O   . ALA A 1 478 ? 151.007 149.959 142.039 1.00 81.02  ? 478 ALA A O   1 
ATOM   3438  C CB  . ALA A 1 478 ? 151.762 152.714 143.343 1.00 81.02  ? 478 ALA A CB  1 
ATOM   3439  N N   . ALA A 1 479 ? 152.939 149.673 143.142 1.00 83.07  ? 479 ALA A N   1 
ATOM   3440  C CA  . ALA A 1 479 ? 153.368 148.610 142.252 1.00 83.07  ? 479 ALA A CA  1 
ATOM   3441  C C   . ALA A 1 479 ? 152.659 147.300 142.530 1.00 83.07  ? 479 ALA A C   1 
ATOM   3442  O O   . ALA A 1 479 ? 152.651 146.423 141.664 1.00 83.07  ? 479 ALA A O   1 
ATOM   3443  C CB  . ALA A 1 479 ? 154.875 148.408 142.361 1.00 83.07  ? 479 ALA A CB  1 
ATOM   3444  N N   . MET A 1 480 ? 152.072 147.139 143.714 1.00 90.32  ? 480 MET A N   1 
ATOM   3445  C CA  . MET A 1 480 ? 151.344 145.910 143.990 1.00 90.32  ? 480 MET A CA  1 
ATOM   3446  C C   . MET A 1 480 ? 150.006 145.884 143.276 1.00 90.32  ? 480 MET A C   1 
ATOM   3447  O O   . MET A 1 480 ? 149.482 144.806 142.994 1.00 90.32  ? 480 MET A O   1 
ATOM   3448  C CB  . MET A 1 480 ? 151.104 145.738 145.485 1.00 90.32  ? 480 MET A CB  1 
ATOM   3449  C CG  . MET A 1 480 ? 152.333 145.652 146.370 1.00 90.32  ? 480 MET A CG  1 
ATOM   3450  S SD  . MET A 1 480 ? 153.513 144.342 146.008 1.00 90.32  ? 480 MET A SD  1 
ATOM   3451  C CE  . MET A 1 480 ? 154.943 145.297 145.492 1.00 90.32  ? 480 MET A CE  1 
ATOM   3452  N N   . GLN A 1 481 ? 149.434 147.049 142.974 1.00 91.53  ? 481 GLN A N   1 
ATOM   3453  C CA  . GLN A 1 481 ? 148.077 147.118 142.448 1.00 91.53  ? 481 GLN A CA  1 
ATOM   3454  C C   . GLN A 1 481 ? 148.010 146.983 140.940 1.00 91.53  ? 481 GLN A C   1 
ATOM   3455  O O   . GLN A 1 481 ? 147.013 147.389 140.334 1.00 91.53  ? 481 GLN A O   1 
ATOM   3456  C CB  . GLN A 1 481 ? 147.394 148.407 142.884 1.00 91.53  ? 481 GLN A CB  1 
ATOM   3457  C CG  . GLN A 1 481 ? 147.009 148.421 144.331 1.00 91.53  ? 481 GLN A CG  1 
ATOM   3458  C CD  . GLN A 1 481 ? 146.242 149.664 144.678 1.00 91.53  ? 481 GLN A CD  1 
ATOM   3459  O OE1 . GLN A 1 481 ? 146.051 150.535 143.833 1.00 91.53  ? 481 GLN A OE1 1 
ATOM   3460  N NE2 . GLN A 1 481 ? 145.791 149.758 145.921 1.00 91.53  ? 481 GLN A NE2 1 
ATOM   3461  N N   . ALA A 1 482 ? 149.039 146.435 140.313 1.00 99.70  ? 482 ALA A N   1 
ATOM   3462  C CA  . ALA A 1 482 ? 148.895 145.831 139.002 1.00 99.70  ? 482 ALA A CA  1 
ATOM   3463  C C   . ALA A 1 482 ? 148.526 144.364 139.111 1.00 99.70  ? 482 ALA A C   1 
ATOM   3464  O O   . ALA A 1 482 ? 148.492 143.665 138.098 1.00 99.70  ? 482 ALA A O   1 
ATOM   3465  C CB  . ALA A 1 482 ? 150.182 145.989 138.194 1.00 99.70  ? 482 ALA A CB  1 
ATOM   3466  N N   . GLN A 1 483 ? 148.257 143.892 140.327 1.00 103.11 ? 483 GLN A N   1 
ATOM   3467  C CA  . GLN A 1 483 ? 147.959 142.496 140.606 1.00 103.11 ? 483 GLN A CA  1 
ATOM   3468  C C   . GLN A 1 483 ? 146.639 142.332 141.339 1.00 103.11 ? 483 GLN A C   1 
ATOM   3469  O O   . GLN A 1 483 ? 146.431 141.315 142.002 1.00 103.11 ? 483 GLN A O   1 
ATOM   3470  C CB  . GLN A 1 483 ? 149.077 141.866 141.433 1.00 103.11 ? 483 GLN A CB  1 
ATOM   3471  C CG  . GLN A 1 483 ? 150.394 141.770 140.724 1.00 103.11 ? 483 GLN A CG  1 
ATOM   3472  C CD  . GLN A 1 483 ? 150.309 140.893 139.504 1.00 103.11 ? 483 GLN A CD  1 
ATOM   3473  O OE1 . GLN A 1 483 ? 150.396 141.374 138.376 1.00 103.11 ? 483 GLN A OE1 1 
ATOM   3474  N NE2 . GLN A 1 483 ? 150.125 139.595 139.718 1.00 103.11 ? 483 GLN A NE2 1 
ATOM   3475  N N   . GLN A 1 484 ? 145.751 143.316 141.269 1.00 104.88 ? 484 GLN A N   1 
ATOM   3476  C CA  . GLN A 1 484 ? 144.479 143.162 141.954 1.00 104.88 ? 484 GLN A CA  1 
ATOM   3477  C C   . GLN A 1 484 ? 143.536 142.263 141.169 1.00 104.88 ? 484 GLN A C   1 
ATOM   3478  O O   . GLN A 1 484 ? 142.609 141.690 141.750 1.00 104.88 ? 484 GLN A O   1 
ATOM   3479  C CB  . GLN A 1 484 ? 143.858 144.537 142.215 1.00 104.88 ? 484 GLN A CB  1 
ATOM   3480  C CG  . GLN A 1 484 ? 142.731 144.558 143.242 1.00 104.88 ? 484 GLN A CG  1 
ATOM   3481  C CD  . GLN A 1 484 ? 142.265 145.963 143.565 1.00 104.88 ? 484 GLN A CD  1 
ATOM   3482  O OE1 . GLN A 1 484 ? 142.741 146.934 142.980 1.00 104.88 ? 484 GLN A OE1 1 
ATOM   3483  N NE2 . GLN A 1 484 ? 141.336 146.079 144.505 1.00 104.88 ? 484 GLN A NE2 1 
ATOM   3484  N N   . GLY A 1 485 ? 143.776 142.104 139.870 1.00 113.69 ? 485 GLY A N   1 
ATOM   3485  C CA  . GLY A 1 485 ? 143.095 141.096 139.080 1.00 113.69 ? 485 GLY A CA  1 
ATOM   3486  C C   . GLY A 1 485 ? 143.943 139.856 138.873 1.00 113.69 ? 485 GLY A C   1 
ATOM   3487  O O   . GLY A 1 485 ? 143.464 138.728 139.024 1.00 113.69 ? 485 GLY A O   1 
ATOM   3488  N N   . ARG A 1 486 ? 145.210 140.059 138.524 1.00 107.89 ? 486 ARG A N   1 
ATOM   3489  C CA  . ARG A 1 486 ? 146.148 138.957 138.352 1.00 107.89 ? 486 ARG A CA  1 
ATOM   3490  C C   . ARG A 1 486 ? 146.520 138.394 139.715 1.00 107.89 ? 486 ARG A C   1 
ATOM   3491  O O   . ARG A 1 486 ? 147.282 139.028 140.452 1.00 107.89 ? 486 ARG A O   1 
ATOM   3492  C CB  . ARG A 1 486 ? 147.398 139.442 137.632 1.00 107.89 ? 486 ARG A CB  1 
ATOM   3493  C CG  . ARG A 1 486 ? 147.181 139.914 136.225 1.00 107.89 ? 486 ARG A CG  1 
ATOM   3494  C CD  . ARG A 1 486 ? 148.484 140.437 135.660 1.00 107.89 ? 486 ARG A CD  1 
ATOM   3495  N NE  . ARG A 1 486 ? 148.340 140.951 134.305 1.00 107.89 ? 486 ARG A NE  1 
ATOM   3496  C CZ  . ARG A 1 486 ? 149.313 141.563 133.641 1.00 107.89 ? 486 ARG A CZ  1 
ATOM   3497  N NH1 . ARG A 1 486 ? 150.493 141.742 134.216 1.00 107.89 ? 486 ARG A NH1 1 
ATOM   3498  N NH2 . ARG A 1 486 ? 149.110 142.003 132.408 1.00 107.89 ? 486 ARG A NH2 1 
ATOM   3499  N N   . SER A 1 487 ? 145.994 137.207 140.036 1.00 103.66 ? 487 SER A N   1 
ATOM   3500  C CA  . SER A 1 487 ? 146.337 136.428 141.231 1.00 103.66 ? 487 SER A CA  1 
ATOM   3501  C C   . SER A 1 487 ? 146.043 137.212 142.513 1.00 103.66 ? 487 SER A C   1 
ATOM   3502  O O   . SER A 1 487 ? 146.934 137.600 143.267 1.00 103.66 ? 487 SER A O   1 
ATOM   3503  C CB  . SER A 1 487 ? 147.797 135.965 141.190 1.00 103.66 ? 487 SER A CB  1 
ATOM   3504  O OG  . SER A 1 487 ? 148.025 135.128 140.073 1.00 103.66 ? 487 SER A OG  1 
ATOM   3505  N N   . SER A 1 488 ? 144.755 137.434 142.732 1.00 92.70  ? 488 SER A N   1 
ATOM   3506  C CA  . SER A 1 488 ? 144.218 138.192 143.857 1.00 92.70  ? 488 SER A CA  1 
ATOM   3507  C C   . SER A 1 488 ? 144.518 137.592 145.213 1.00 92.70  ? 488 SER A C   1 
ATOM   3508  O O   . SER A 1 488 ? 144.098 138.212 146.182 1.00 92.70  ? 488 SER A O   1 
ATOM   3509  C CB  . SER A 1 488 ? 142.710 138.345 143.701 1.00 92.70  ? 488 SER A CB  1 
ATOM   3510  O OG  . SER A 1 488 ? 142.162 139.009 144.820 1.00 92.70  ? 488 SER A OG  1 
ATOM   3511  N N   . LEU A 1 489 ? 145.169 136.450 145.396 1.00 87.91  ? 489 LEU A N   1 
ATOM   3512  C CA  . LEU A 1 489 ? 145.630 136.080 146.724 1.00 87.91  ? 489 LEU A CA  1 
ATOM   3513  C C   . LEU A 1 489 ? 146.922 136.792 147.084 1.00 87.91  ? 489 LEU A C   1 
ATOM   3514  O O   . LEU A 1 489 ? 147.092 137.238 148.224 1.00 87.91  ? 489 LEU A O   1 
ATOM   3515  C CB  . LEU A 1 489 ? 145.836 134.572 146.814 1.00 87.91  ? 489 LEU A CB  1 
ATOM   3516  C CG  . LEU A 1 489 ? 146.292 134.078 148.180 1.00 87.91  ? 489 LEU A CG  1 
ATOM   3517  C CD1 . LEU A 1 489 ? 145.252 134.404 149.220 1.00 87.91  ? 489 LEU A CD1 1 
ATOM   3518  C CD2 . LEU A 1 489 ? 146.543 132.600 148.125 1.00 87.91  ? 489 LEU A CD2 1 
ATOM   3519  N N   . VAL A 1 490 ? 147.823 136.927 146.112 1.00 88.17  ? 490 VAL A N   1 
ATOM   3520  C CA  . VAL A 1 490 ? 149.122 137.532 146.359 1.00 88.17  ? 490 VAL A CA  1 
ATOM   3521  C C   . VAL A 1 490 ? 148.968 139.015 146.649 1.00 88.17  ? 490 VAL A C   1 
ATOM   3522  O O   . VAL A 1 490 ? 149.759 139.594 147.404 1.00 88.17  ? 490 VAL A O   1 
ATOM   3523  C CB  . VAL A 1 490 ? 150.033 137.261 145.153 1.00 88.17  ? 490 VAL A CB  1 
ATOM   3524  C CG1 . VAL A 1 490 ? 151.437 137.763 145.390 1.00 88.17  ? 490 VAL A CG1 1 
ATOM   3525  C CG2 . VAL A 1 490 ? 150.051 135.789 144.859 1.00 88.17  ? 490 VAL A CG2 1 
ATOM   3526  N N   . TRP A 1 491 ? 147.930 139.645 146.096 1.00 88.07  ? 491 TRP A N   1 
ATOM   3527  C CA  . TRP A 1 491 ? 147.631 141.025 146.451 1.00 88.07  ? 491 TRP A CA  1 
ATOM   3528  C C   . TRP A 1 491 ? 147.228 141.137 147.908 1.00 88.07  ? 491 TRP A C   1 
ATOM   3529  O O   . TRP A 1 491 ? 147.748 141.985 148.638 1.00 88.07  ? 491 TRP A O   1 
ATOM   3530  C CB  . TRP A 1 491 ? 146.516 141.580 145.580 1.00 88.07  ? 491 TRP A CB  1 
ATOM   3531  C CG  . TRP A 1 491 ? 146.188 142.960 145.963 1.00 88.07  ? 491 TRP A CG  1 
ATOM   3532  C CD1 . TRP A 1 491 ? 146.926 144.063 145.718 1.00 88.07  ? 491 TRP A CD1 1 
ATOM   3533  C CD2 . TRP A 1 491 ? 145.069 143.387 146.737 1.00 88.07  ? 491 TRP A CD2 1 
ATOM   3534  N NE1 . TRP A 1 491 ? 146.320 145.167 146.251 1.00 88.07  ? 491 TRP A NE1 1 
ATOM   3535  C CE2 . TRP A 1 491 ? 145.177 144.774 146.890 1.00 88.07  ? 491 TRP A CE2 1 
ATOM   3536  C CE3 . TRP A 1 491 ? 143.980 142.732 147.305 1.00 88.07  ? 491 TRP A CE3 1 
ATOM   3537  C CZ2 . TRP A 1 491 ? 144.238 145.520 147.581 1.00 88.07  ? 491 TRP A CZ2 1 
ATOM   3538  C CZ3 . TRP A 1 491 ? 143.048 143.474 147.989 1.00 88.07  ? 491 TRP A CZ3 1 
ATOM   3539  C CH2 . TRP A 1 491 ? 143.182 144.852 148.123 1.00 88.07  ? 491 TRP A CH2 1 
ATOM   3540  N N   . LEU A 1 492 ? 146.309 140.279 148.350 1.00 84.37  ? 492 LEU A N   1 
ATOM   3541  C CA  . LEU A 1 492 ? 145.832 140.348 149.722 1.00 84.37  ? 492 LEU A CA  1 
ATOM   3542  C C   . LEU A 1 492 ? 146.906 139.942 150.715 1.00 84.37  ? 492 LEU A C   1 
ATOM   3543  O O   . LEU A 1 492 ? 146.865 140.387 151.863 1.00 84.37  ? 492 LEU A O   1 
ATOM   3544  C CB  . LEU A 1 492 ? 144.587 139.479 149.881 1.00 84.37  ? 492 LEU A CB  1 
ATOM   3545  C CG  . LEU A 1 492 ? 143.719 139.591 151.139 1.00 84.37  ? 492 LEU A CG  1 
ATOM   3546  C CD1 . LEU A 1 492 ? 142.272 139.381 150.756 1.00 84.37  ? 492 LEU A CD1 1 
ATOM   3547  C CD2 . LEU A 1 492 ? 144.096 138.576 152.207 1.00 84.37  ? 492 LEU A CD2 1 
ATOM   3548  N N   . PHE A 1 493 ? 147.873 139.130 150.302 1.00 81.25  ? 493 PHE A N   1 
ATOM   3549  C CA  . PHE A 1 493 ? 149.017 138.911 151.170 1.00 81.25  ? 493 PHE A CA  1 
ATOM   3550  C C   . PHE A 1 493 ? 149.898 140.143 151.233 1.00 81.25  ? 493 PHE A C   1 
ATOM   3551  O O   . PHE A 1 493 ? 150.460 140.443 152.288 1.00 81.25  ? 493 PHE A O   1 
ATOM   3552  C CB  . PHE A 1 493 ? 149.848 137.731 150.693 1.00 81.25  ? 493 PHE A CB  1 
ATOM   3553  C CG  . PHE A 1 493 ? 150.918 137.324 151.658 1.00 81.25  ? 493 PHE A CG  1 
ATOM   3554  C CD1 . PHE A 1 493 ? 150.604 136.556 152.760 1.00 81.25  ? 493 PHE A CD1 1 
ATOM   3555  C CD2 . PHE A 1 493 ? 152.224 137.721 151.479 1.00 81.25  ? 493 PHE A CD2 1 
ATOM   3556  C CE1 . PHE A 1 493 ? 151.572 136.180 153.650 1.00 81.25  ? 493 PHE A CE1 1 
ATOM   3557  C CE2 . PHE A 1 493 ? 153.198 137.343 152.361 1.00 81.25  ? 493 PHE A CE2 1 
ATOM   3558  C CZ  . PHE A 1 493 ? 152.871 136.574 153.450 1.00 81.25  ? 493 PHE A CZ  1 
ATOM   3559  N N   . SER A 1 494 ? 150.038 140.856 150.118 1.00 82.75  ? 494 SER A N   1 
ATOM   3560  C CA  . SER A 1 494 ? 150.944 141.992 150.068 1.00 82.75  ? 494 SER A CA  1 
ATOM   3561  C C   . SER A 1 494 ? 150.429 143.170 150.872 1.00 82.75  ? 494 SER A C   1 
ATOM   3562  O O   . SER A 1 494 ? 151.228 143.952 151.390 1.00 82.75  ? 494 SER A O   1 
ATOM   3563  C CB  . SER A 1 494 ? 151.166 142.413 148.626 1.00 82.75  ? 494 SER A CB  1 
ATOM   3564  O OG  . SER A 1 494 ? 149.956 142.881 148.081 1.00 82.75  ? 494 SER A OG  1 
ATOM   3565  N N   . GLN A 1 495 ? 149.112 143.318 150.988 1.00 83.73  ? 495 GLN A N   1 
ATOM   3566  C CA  . GLN A 1 495 ? 148.572 144.335 151.876 1.00 83.73  ? 495 GLN A CA  1 
ATOM   3567  C C   . GLN A 1 495 ? 148.814 143.972 153.327 1.00 83.73  ? 495 GLN A C   1 
ATOM   3568  O O   . GLN A 1 495 ? 149.078 144.848 154.152 1.00 83.73  ? 495 GLN A O   1 
ATOM   3569  C CB  . GLN A 1 495 ? 147.080 144.509 151.635 1.00 83.73  ? 495 GLN A CB  1 
ATOM   3570  C CG  . GLN A 1 495 ? 146.729 144.951 150.245 1.00 83.73  ? 495 GLN A CG  1 
ATOM   3571  C CD  . GLN A 1 495 ? 147.310 146.285 149.919 1.00 83.73  ? 495 GLN A CD  1 
ATOM   3572  O OE1 . GLN A 1 495 ? 148.225 146.395 149.109 1.00 83.73  ? 495 GLN A OE1 1 
ATOM   3573  N NE2 . GLN A 1 495 ? 146.790 147.319 150.555 1.00 83.73  ? 495 GLN A NE2 1 
ATOM   3574  N N   . LEU A 1 496 ? 148.738 142.692 153.653 1.00 77.84  ? 496 LEU A N   1 
ATOM   3575  C CA  . LEU A 1 496 ? 148.957 142.234 155.011 1.00 77.84  ? 496 LEU A CA  1 
ATOM   3576  C C   . LEU A 1 496 ? 150.432 142.103 155.346 1.00 77.84  ? 496 LEU A C   1 
ATOM   3577  O O   . LEU A 1 496 ? 150.806 142.234 156.514 1.00 77.84  ? 496 LEU A O   1 
ATOM   3578  C CB  . LEU A 1 496 ? 148.243 140.899 155.207 1.00 77.84  ? 496 LEU A CB  1 
ATOM   3579  C CG  . LEU A 1 496 ? 148.203 140.271 156.587 1.00 77.84  ? 496 LEU A CG  1 
ATOM   3580  C CD1 . LEU A 1 496 ? 147.549 141.229 157.541 1.00 77.84  ? 496 LEU A CD1 1 
ATOM   3581  C CD2 . LEU A 1 496 ? 147.416 138.992 156.511 1.00 77.84  ? 496 LEU A CD2 1 
ATOM   3582  N N   . TYR A 1 497 ? 151.275 141.868 154.345 1.00 75.99  ? 497 TYR A N   1 
ATOM   3583  C CA  . TYR A 1 497 ? 152.711 141.840 154.577 1.00 75.99  ? 497 TYR A CA  1 
ATOM   3584  C C   . TYR A 1 497 ? 153.237 143.229 154.887 1.00 75.99  ? 497 TYR A C   1 
ATOM   3585  O O   . TYR A 1 497 ? 153.961 143.423 155.865 1.00 75.99  ? 497 TYR A O   1 
ATOM   3586  C CB  . TYR A 1 497 ? 153.420 141.272 153.354 1.00 75.99  ? 497 TYR A CB  1 
ATOM   3587  C CG  . TYR A 1 497 ? 154.905 141.159 153.505 1.00 75.99  ? 497 TYR A CG  1 
ATOM   3588  C CD1 . TYR A 1 497 ? 155.466 140.105 154.191 1.00 75.99  ? 497 TYR A CD1 1 
ATOM   3589  C CD2 . TYR A 1 497 ? 155.748 142.113 152.963 1.00 75.99  ? 497 TYR A CD2 1 
ATOM   3590  C CE1 . TYR A 1 497 ? 156.819 140.000 154.327 1.00 75.99  ? 497 TYR A CE1 1 
ATOM   3591  C CE2 . TYR A 1 497 ? 157.099 142.019 153.103 1.00 75.99  ? 497 TYR A CE2 1 
ATOM   3592  C CZ  . TYR A 1 497 ? 157.628 140.961 153.783 1.00 75.99  ? 497 TYR A CZ  1 
ATOM   3593  O OH  . TYR A 1 497 ? 158.982 140.864 153.920 1.00 75.99  ? 497 TYR A OH  1 
ATOM   3594  N N   . LEU A 1 498 ? 152.882 144.208 154.058 1.00 74.96  ? 498 LEU A N   1 
ATOM   3595  C CA  . LEU A 1 498 ? 153.481 145.529 154.175 1.00 74.96  ? 498 LEU A CA  1 
ATOM   3596  C C   . LEU A 1 498 ? 152.942 146.289 155.376 1.00 74.96  ? 498 LEU A C   1 
ATOM   3597  O O   . LEU A 1 498 ? 153.725 146.868 156.129 1.00 74.96  ? 498 LEU A O   1 
ATOM   3598  C CB  . LEU A 1 498 ? 153.260 146.318 152.892 1.00 74.96  ? 498 LEU A CB  1 
ATOM   3599  C CG  . LEU A 1 498 ? 154.048 145.745 151.721 1.00 74.96  ? 498 LEU A CG  1 
ATOM   3600  C CD1 . LEU A 1 498 ? 153.665 146.395 150.419 1.00 74.96  ? 498 LEU A CD1 1 
ATOM   3601  C CD2 . LEU A 1 498 ? 155.514 145.936 151.982 1.00 74.96  ? 498 LEU A CD2 1 
ATOM   3602  N N   . TYR A 1 499 ? 151.618 146.288 155.582 1.00 72.46  ? 499 TYR A N   1 
ATOM   3603  C CA  . TYR A 1 499 ? 151.019 147.022 156.698 1.00 72.46  ? 499 TYR A CA  1 
ATOM   3604  C C   . TYR A 1 499 ? 151.475 146.511 158.051 1.00 72.46  ? 499 TYR A C   1 
ATOM   3605  O O   . TYR A 1 499 ? 151.638 147.301 158.977 1.00 72.46  ? 499 TYR A O   1 
ATOM   3606  C CB  . TYR A 1 499 ? 149.499 146.944 156.657 1.00 72.46  ? 499 TYR A CB  1 
ATOM   3607  C CG  . TYR A 1 499 ? 148.801 147.909 155.742 1.00 72.46  ? 499 TYR A CG  1 
ATOM   3608  C CD1 . TYR A 1 499 ? 149.436 149.027 155.257 1.00 72.46  ? 499 TYR A CD1 1 
ATOM   3609  C CD2 . TYR A 1 499 ? 147.482 147.706 155.392 1.00 72.46  ? 499 TYR A CD2 1 
ATOM   3610  C CE1 . TYR A 1 499 ? 148.780 149.907 154.437 1.00 72.46  ? 499 TYR A CE1 1 
ATOM   3611  C CE2 . TYR A 1 499 ? 146.823 148.579 154.572 1.00 72.46  ? 499 TYR A CE2 1 
ATOM   3612  C CZ  . TYR A 1 499 ? 147.476 149.673 154.099 1.00 72.46  ? 499 TYR A CZ  1 
ATOM   3613  O OH  . TYR A 1 499 ? 146.812 150.546 153.279 1.00 72.46  ? 499 TYR A OH  1 
ATOM   3614  N N   . SER A 1 500 ? 151.685 145.215 158.193 1.00 76.96  ? 500 SER A N   1 
ATOM   3615  C CA  . SER A 1 500 ? 152.072 144.657 159.476 1.00 76.96  ? 500 SER A CA  1 
ATOM   3616  C C   . SER A 1 500 ? 153.545 144.836 159.763 1.00 76.96  ? 500 SER A C   1 
ATOM   3617  O O   . SER A 1 500 ? 153.985 144.552 160.879 1.00 76.96  ? 500 SER A O   1 
ATOM   3618  C CB  . SER A 1 500 ? 151.727 143.176 159.532 1.00 76.96  ? 500 SER A CB  1 
ATOM   3619  O OG  . SER A 1 500 ? 152.497 142.464 158.584 1.00 76.96  ? 500 SER A OG  1 
ATOM   3620  N N   . PHE A 1 501 ? 154.316 145.286 158.783 1.00 72.83  ? 501 PHE A N   1 
ATOM   3621  C CA  . PHE A 1 501 ? 155.743 145.501 158.933 1.00 72.83  ? 501 PHE A CA  1 
ATOM   3622  C C   . PHE A 1 501 ? 156.091 146.956 159.175 1.00 72.83  ? 501 PHE A C   1 
ATOM   3623  O O   . PHE A 1 501 ? 156.850 147.261 160.093 1.00 72.83  ? 501 PHE A O   1 
ATOM   3624  C CB  . PHE A 1 501 ? 156.474 144.997 157.692 1.00 72.83  ? 501 PHE A CB  1 
ATOM   3625  C CG  . PHE A 1 501 ? 157.936 145.258 157.708 1.00 72.83  ? 501 PHE A CG  1 
ATOM   3626  C CD1 . PHE A 1 501 ? 158.765 144.551 158.550 1.00 72.83  ? 501 PHE A CD1 1 
ATOM   3627  C CD2 . PHE A 1 501 ? 158.488 146.193 156.859 1.00 72.83  ? 501 PHE A CD2 1 
ATOM   3628  C CE1 . PHE A 1 501 ? 160.113 144.783 158.559 1.00 72.83  ? 501 PHE A CE1 1 
ATOM   3629  C CE2 . PHE A 1 501 ? 159.838 146.427 156.865 1.00 72.83  ? 501 PHE A CE2 1 
ATOM   3630  C CZ  . PHE A 1 501 ? 160.651 145.723 157.716 1.00 72.83  ? 501 PHE A CZ  1 
ATOM   3631  N N   . ILE A 1 502 ? 155.551 147.862 158.366 1.00 71.79  ? 502 ILE A N   1 
ATOM   3632  C CA  . ILE A 1 502 ? 155.844 149.274 158.547 1.00 71.79  ? 502 ILE A CA  1 
ATOM   3633  C C   . ILE A 1 502 ? 155.179 149.810 159.806 1.00 71.79  ? 502 ILE A C   1 
ATOM   3634  O O   . ILE A 1 502 ? 155.725 150.692 160.475 1.00 71.79  ? 502 ILE A O   1 
ATOM   3635  C CB  . ILE A 1 502 ? 155.458 150.046 157.268 1.00 71.79  ? 502 ILE A CB  1 
ATOM   3636  C CG1 . ILE A 1 502 ? 155.799 151.512 157.391 1.00 71.79  ? 502 ILE A CG1 1 
ATOM   3637  C CG2 . ILE A 1 502 ? 154.037 149.940 156.970 1.00 71.79  ? 502 ILE A CG2 1 
ATOM   3638  C CD1 . ILE A 1 502 ? 157.213 151.724 157.591 1.00 71.79  ? 502 ILE A CD1 1 
ATOM   3639  N N   . SER A 1 503 ? 154.051 149.237 160.209 1.00 73.80  ? 503 SER A N   1 
ATOM   3640  C CA  . SER A 1 503 ? 153.418 149.613 161.459 1.00 73.80  ? 503 SER A CA  1 
ATOM   3641  C C   . SER A 1 503 ? 153.933 148.814 162.633 1.00 73.80  ? 503 SER A C   1 
ATOM   3642  O O   . SER A 1 503 ? 153.370 148.908 163.725 1.00 73.80  ? 503 SER A O   1 
ATOM   3643  C CB  . SER A 1 503 ? 151.906 149.460 161.361 1.00 73.80  ? 503 SER A CB  1 
ATOM   3644  O OG  . SER A 1 503 ? 151.304 149.697 162.615 1.00 73.80  ? 503 SER A OG  1 
ATOM   3645  N N   . LEU A 1 504 ? 154.970 148.014 162.437 1.00 73.24  ? 504 LEU A N   1 
ATOM   3646  C CA  . LEU A 1 504 ? 155.636 147.359 163.548 1.00 73.24  ? 504 LEU A CA  1 
ATOM   3647  C C   . LEU A 1 504 ? 156.913 148.057 163.960 1.00 73.24  ? 504 LEU A C   1 
ATOM   3648  O O   . LEU A 1 504 ? 157.112 148.310 165.145 1.00 73.24  ? 504 LEU A O   1 
ATOM   3649  C CB  . LEU A 1 504 ? 155.954 145.907 163.203 1.00 73.24  ? 504 LEU A CB  1 
ATOM   3650  C CG  . LEU A 1 504 ? 156.628 145.149 164.337 1.00 73.24  ? 504 LEU A CG  1 
ATOM   3651  C CD1 . LEU A 1 504 ? 155.706 145.071 165.514 1.00 73.24  ? 504 LEU A CD1 1 
ATOM   3652  C CD2 . LEU A 1 504 ? 157.018 143.767 163.897 1.00 73.24  ? 504 LEU A CD2 1 
ATOM   3653  N N   . PHE A 1 505 ? 157.769 148.407 163.010 1.00 74.40  ? 505 PHE A N   1 
ATOM   3654  C CA  . PHE A 1 505 ? 159.055 148.985 163.358 1.00 74.40  ? 505 PHE A CA  1 
ATOM   3655  C C   . PHE A 1 505 ? 158.997 150.460 163.715 1.00 74.40  ? 505 PHE A C   1 
ATOM   3656  O O   . PHE A 1 505 ? 159.879 150.934 164.437 1.00 74.40  ? 505 PHE A O   1 
ATOM   3657  C CB  . PHE A 1 505 ? 160.067 148.775 162.230 1.00 74.40  ? 505 PHE A CB  1 
ATOM   3658  C CG  . PHE A 1 505 ? 160.684 147.403 162.212 1.00 74.40  ? 505 PHE A CG  1 
ATOM   3659  C CD1 . PHE A 1 505 ? 160.447 146.503 163.227 1.00 74.40  ? 505 PHE A CD1 1 
ATOM   3660  C CD2 . PHE A 1 505 ? 161.562 147.044 161.215 1.00 74.40  ? 505 PHE A CD2 1 
ATOM   3661  C CE1 . PHE A 1 505 ? 161.034 145.260 163.221 1.00 74.40  ? 505 PHE A CE1 1 
ATOM   3662  C CE2 . PHE A 1 505 ? 162.151 145.805 161.213 1.00 74.40  ? 505 PHE A CE2 1 
ATOM   3663  C CZ  . PHE A 1 505 ? 161.886 144.913 162.215 1.00 74.40  ? 505 PHE A CZ  1 
ATOM   3664  N N   . ILE A 1 506 ? 158.001 151.204 163.252 1.00 72.14  ? 506 ILE A N   1 
ATOM   3665  C CA  . ILE A 1 506 ? 157.916 152.588 163.689 1.00 72.14  ? 506 ILE A CA  1 
ATOM   3666  C C   . ILE A 1 506 ? 157.265 152.694 165.063 1.00 72.14  ? 506 ILE A C   1 
ATOM   3667  O O   . ILE A 1 506 ? 157.718 153.469 165.909 1.00 72.14  ? 506 ILE A O   1 
ATOM   3668  C CB  . ILE A 1 506 ? 157.168 153.446 162.661 1.00 72.14  ? 506 ILE A CB  1 
ATOM   3669  C CG1 . ILE A 1 506 ? 157.880 153.415 161.325 1.00 72.14  ? 506 ILE A CG1 1 
ATOM   3670  C CG2 . ILE A 1 506 ? 157.119 154.892 163.092 1.00 72.14  ? 506 ILE A CG2 1 
ATOM   3671  C CD1 . ILE A 1 506 ? 157.131 154.161 160.278 1.00 72.14  ? 506 ILE A CD1 1 
ATOM   3672  N N   . TYR A 1 507 ? 156.254 151.888 165.336 1.00 76.11  ? 507 TYR A N   1 
ATOM   3673  C CA  . TYR A 1 507 ? 155.385 152.163 166.466 1.00 76.11  ? 507 TYR A CA  1 
ATOM   3674  C C   . TYR A 1 507 ? 155.728 151.360 167.708 1.00 76.11  ? 507 TYR A C   1 
ATOM   3675  O O   . TYR A 1 507 ? 155.269 151.708 168.798 1.00 76.11  ? 507 TYR A O   1 
ATOM   3676  C CB  . TYR A 1 507 ? 153.936 151.897 166.066 1.00 76.11  ? 507 TYR A CB  1 
ATOM   3677  C CG  . TYR A 1 507 ? 153.441 152.815 164.979 1.00 76.11  ? 507 TYR A CG  1 
ATOM   3678  C CD1 . TYR A 1 507 ? 154.009 154.061 164.778 1.00 76.11  ? 507 TYR A CD1 1 
ATOM   3679  C CD2 . TYR A 1 507 ? 152.442 152.410 164.118 1.00 76.11  ? 507 TYR A CD2 1 
ATOM   3680  C CE1 . TYR A 1 507 ? 153.569 154.884 163.777 1.00 76.11  ? 507 TYR A CE1 1 
ATOM   3681  C CE2 . TYR A 1 507 ? 152.000 153.229 163.112 1.00 76.11  ? 507 TYR A CE2 1 
ATOM   3682  C CZ  . TYR A 1 507 ? 152.571 154.462 162.948 1.00 76.11  ? 507 TYR A CZ  1 
ATOM   3683  O OH  . TYR A 1 507 ? 152.139 155.289 161.946 1.00 76.11  ? 507 TYR A OH  1 
ATOM   3684  N N   . MET A 1 508 ? 156.512 150.295 167.589 1.00 82.20  ? 508 MET A N   1 
ATOM   3685  C CA  . MET A 1 508 ? 156.930 149.544 168.759 1.00 82.20  ? 508 MET A CA  1 
ATOM   3686  C C   . MET A 1 508 ? 158.406 149.212 168.803 1.00 82.20  ? 508 MET A C   1 
ATOM   3687  O O   . MET A 1 508 ? 158.860 148.677 169.814 1.00 82.20  ? 508 MET A O   1 
ATOM   3688  C CB  . MET A 1 508 ? 156.138 148.236 168.885 1.00 82.20  ? 508 MET A CB  1 
ATOM   3689  C CG  . MET A 1 508 ? 154.728 148.425 169.399 1.00 82.20  ? 508 MET A CG  1 
ATOM   3690  S SD  . MET A 1 508 ? 153.839 146.887 169.693 1.00 82.20  ? 508 MET A SD  1 
ATOM   3691  C CE  . MET A 1 508 ? 153.355 146.461 168.029 1.00 82.20  ? 508 MET A CE  1 
ATOM   3692  N N   . VAL A 1 509 ? 159.166 149.502 167.754 1.00 78.13  ? 509 VAL A N   1 
ATOM   3693  C CA  . VAL A 1 509 ? 160.594 149.226 167.739 1.00 78.13  ? 509 VAL A CA  1 
ATOM   3694  C C   . VAL A 1 509 ? 161.412 150.507 167.745 1.00 78.13  ? 509 VAL A C   1 
ATOM   3695  O O   . VAL A 1 509 ? 162.389 150.615 168.486 1.00 78.13  ? 509 VAL A O   1 
ATOM   3696  C CB  . VAL A 1 509 ? 160.941 148.330 166.534 1.00 78.13  ? 509 VAL A CB  1 
ATOM   3697  C CG1 . VAL A 1 509 ? 162.431 148.194 166.361 1.00 78.13  ? 509 VAL A CG1 1 
ATOM   3698  C CG2 . VAL A 1 509 ? 160.334 146.972 166.751 1.00 78.13  ? 509 VAL A CG2 1 
ATOM   3699  N N   . LEU A 1 510 ? 160.998 151.498 166.954 1.00 74.83  ? 510 LEU A N   1 
ATOM   3700  C CA  . LEU A 1 510 ? 161.623 152.812 167.020 1.00 74.83  ? 510 LEU A CA  1 
ATOM   3701  C C   . LEU A 1 510 ? 161.418 153.462 168.378 1.00 74.83  ? 510 LEU A C   1 
ATOM   3702  O O   . LEU A 1 510 ? 162.286 154.203 168.847 1.00 74.83  ? 510 LEU A O   1 
ATOM   3703  C CB  . LEU A 1 510 ? 161.064 153.709 165.923 1.00 74.83  ? 510 LEU A CB  1 
ATOM   3704  C CG  . LEU A 1 510 ? 161.687 155.089 165.793 1.00 74.83  ? 510 LEU A CG  1 
ATOM   3705  C CD1 . LEU A 1 510 ? 163.140 154.927 165.434 1.00 74.83  ? 510 LEU A CD1 1 
ATOM   3706  C CD2 . LEU A 1 510 ? 160.963 155.933 164.765 1.00 74.83  ? 510 LEU A CD2 1 
ATOM   3707  N N   . SER A 1 511 ? 160.311 153.158 169.044 1.00 73.21  ? 511 SER A N   1 
ATOM   3708  C CA  . SER A 1 511 ? 160.043 153.732 170.349 1.00 73.21  ? 511 SER A CA  1 
ATOM   3709  C C   . SER A 1 511 ? 160.971 153.215 171.436 1.00 73.21  ? 511 SER A C   1 
ATOM   3710  O O   . SER A 1 511 ? 161.170 153.915 172.430 1.00 73.21  ? 511 SER A O   1 
ATOM   3711  C CB  . SER A 1 511 ? 158.602 153.460 170.743 1.00 73.21  ? 511 SER A CB  1 
ATOM   3712  O OG  . SER A 1 511 ? 157.729 154.085 169.830 1.00 73.21  ? 511 SER A OG  1 
ATOM   3713  N N   . LEU A 1 512 ? 161.537 152.016 171.282 1.00 71.93  ? 512 LEU A N   1 
ATOM   3714  C CA  . LEU A 1 512 ? 162.507 151.550 172.266 1.00 71.93  ? 512 LEU A CA  1 
ATOM   3715  C C   . LEU A 1 512 ? 163.785 152.359 172.196 1.00 71.93  ? 512 LEU A C   1 
ATOM   3716  O O   . LEU A 1 512 ? 164.329 152.757 173.231 1.00 71.93  ? 512 LEU A O   1 
ATOM   3717  C CB  . LEU A 1 512 ? 162.834 150.076 172.074 1.00 71.93  ? 512 LEU A CB  1 
ATOM   3718  C CG  . LEU A 1 512 ? 162.072 149.069 172.917 1.00 71.93  ? 512 LEU A CG  1 
ATOM   3719  C CD1 . LEU A 1 512 ? 162.317 149.371 174.378 1.00 71.93  ? 512 LEU A CD1 1 
ATOM   3720  C CD2 . LEU A 1 512 ? 160.613 149.074 172.595 1.00 71.93  ? 512 LEU A CD2 1 
ATOM   3721  N N   . PHE A 1 513 ? 164.267 152.621 170.986 1.00 73.43  ? 513 PHE A N   1 
ATOM   3722  C CA  . PHE A 1 513 ? 165.486 153.383 170.787 1.00 73.43  ? 513 PHE A CA  1 
ATOM   3723  C C   . PHE A 1 513 ? 165.381 154.808 171.299 1.00 73.43  ? 513 PHE A C   1 
ATOM   3724  O O   . PHE A 1 513 ? 166.404 155.403 171.635 1.00 73.43  ? 513 PHE A O   1 
ATOM   3725  C CB  . PHE A 1 513 ? 165.838 153.381 169.309 1.00 73.43  ? 513 PHE A CB  1 
ATOM   3726  C CG  . PHE A 1 513 ? 166.370 152.075 168.819 1.00 73.43  ? 513 PHE A CG  1 
ATOM   3727  C CD1 . PHE A 1 513 ? 166.976 151.197 169.681 1.00 73.43  ? 513 PHE A CD1 1 
ATOM   3728  C CD2 . PHE A 1 513 ? 166.232 151.711 167.497 1.00 73.43  ? 513 PHE A CD2 1 
ATOM   3729  C CE1 . PHE A 1 513 ? 167.465 150.007 169.225 1.00 73.43  ? 513 PHE A CE1 1 
ATOM   3730  C CE2 . PHE A 1 513 ? 166.710 150.510 167.046 1.00 73.43  ? 513 PHE A CE2 1 
ATOM   3731  C CZ  . PHE A 1 513 ? 167.323 149.659 167.908 1.00 73.43  ? 513 PHE A CZ  1 
ATOM   3732  N N   . ILE A 1 514 ? 164.177 155.361 171.382 1.00 67.69  ? 514 ILE A N   1 
ATOM   3733  C CA  . ILE A 1 514 ? 163.970 156.621 172.074 1.00 67.69  ? 514 ILE A CA  1 
ATOM   3734  C C   . ILE A 1 514 ? 163.853 156.404 173.576 1.00 67.69  ? 514 ILE A C   1 
ATOM   3735  O O   . ILE A 1 514 ? 164.341 157.238 174.354 1.00 67.69  ? 514 ILE A O   1 
ATOM   3736  C CB  . ILE A 1 514 ? 162.729 157.334 171.501 1.00 67.69  ? 514 ILE A CB  1 
ATOM   3737  C CG1 . ILE A 1 514 ? 162.966 157.643 170.034 1.00 67.69  ? 514 ILE A CG1 1 
ATOM   3738  C CG2 . ILE A 1 514 ? 162.448 158.632 172.189 1.00 67.69  ? 514 ILE A CG2 1 
ATOM   3739  C CD1 . ILE A 1 514 ? 161.765 158.148 169.332 1.00 67.69  ? 514 ILE A CD1 1 
ATOM   3740  N N   . ALA A 1 515 ? 163.297 155.279 174.008 1.00 70.71  ? 515 ALA A N   1 
ATOM   3741  C CA  . ALA A 1 515 ? 163.113 155.034 175.429 1.00 70.71  ? 515 ALA A CA  1 
ATOM   3742  C C   . ALA A 1 515 ? 164.385 154.608 176.137 1.00 70.71  ? 515 ALA A C   1 
ATOM   3743  O O   . ALA A 1 515 ? 164.557 154.931 177.314 1.00 70.71  ? 515 ALA A O   1 
ATOM   3744  C CB  . ALA A 1 515 ? 162.043 153.969 175.646 1.00 70.71  ? 515 ALA A CB  1 
ATOM   3745  N N   . LEU A 1 516 ? 165.274 153.879 175.464 1.00 71.57  ? 516 LEU A N   1 
ATOM   3746  C CA  . LEU A 1 516 ? 166.494 153.440 176.127 1.00 71.57  ? 516 LEU A CA  1 
ATOM   3747  C C   . LEU A 1 516 ? 167.441 154.599 176.371 1.00 71.57  ? 516 LEU A C   1 
ATOM   3748  O O   . LEU A 1 516 ? 168.122 154.641 177.399 1.00 71.57  ? 516 LEU A O   1 
ATOM   3749  C CB  . LEU A 1 516 ? 167.194 152.366 175.309 1.00 71.57  ? 516 LEU A CB  1 
ATOM   3750  C CG  . LEU A 1 516 ? 166.491 151.022 175.283 1.00 71.57  ? 516 LEU A CG  1 
ATOM   3751  C CD1 . LEU A 1 516 ? 167.238 150.078 174.382 1.00 71.57  ? 516 LEU A CD1 1 
ATOM   3752  C CD2 . LEU A 1 516 ? 166.410 150.475 176.683 1.00 71.57  ? 516 LEU A CD2 1 
ATOM   3753  N N   . ILE A 1 517 ? 167.499 155.546 175.442 1.00 71.56  ? 517 ILE A N   1 
ATOM   3754  C CA  . ILE A 1 517 ? 168.402 156.674 175.611 1.00 71.56  ? 517 ILE A CA  1 
ATOM   3755  C C   . ILE A 1 517 ? 167.873 157.621 176.678 1.00 71.56  ? 517 ILE A C   1 
ATOM   3756  O O   . ILE A 1 517 ? 168.640 158.154 177.487 1.00 71.56  ? 517 ILE A O   1 
ATOM   3757  C CB  . ILE A 1 517 ? 168.609 157.377 174.264 1.00 71.56  ? 517 ILE A CB  1 
ATOM   3758  C CG1 . ILE A 1 517 ? 169.136 156.384 173.237 1.00 71.56  ? 517 ILE A CG1 1 
ATOM   3759  C CG2 . ILE A 1 517 ? 169.583 158.493 174.402 1.00 71.56  ? 517 ILE A CG2 1 
ATOM   3760  C CD1 . ILE A 1 517 ? 170.451 155.795 173.579 1.00 71.56  ? 517 ILE A CD1 1 
ATOM   3761  N N   . THR A 1 518 ? 166.558 157.826 176.712 1.00 74.56  ? 518 THR A N   1 
ATOM   3762  C CA  . THR A 1 518 ? 165.948 158.584 177.797 1.00 74.56  ? 518 THR A CA  1 
ATOM   3763  C C   . THR A 1 518 ? 166.130 157.865 179.123 1.00 74.56  ? 518 THR A C   1 
ATOM   3764  O O   . THR A 1 518 ? 166.467 158.482 180.139 1.00 74.56  ? 518 THR A O   1 
ATOM   3765  C CB  . THR A 1 518 ? 164.468 158.801 177.503 1.00 74.56  ? 518 THR A CB  1 
ATOM   3766  O OG1 . THR A 1 518 ? 164.333 159.570 176.304 1.00 74.56  ? 518 THR A OG1 1 
ATOM   3767  C CG2 . THR A 1 518 ? 163.780 159.522 178.644 1.00 74.56  ? 518 THR A CG2 1 
ATOM   3768  N N   . GLY A 1 519 ? 165.967 156.544 179.117 1.00 79.63  ? 519 GLY A N   1 
ATOM   3769  C CA  . GLY A 1 519 ? 166.203 155.756 180.311 1.00 79.63  ? 519 GLY A CA  1 
ATOM   3770  C C   . GLY A 1 519 ? 167.650 155.714 180.748 1.00 79.63  ? 519 GLY A C   1 
ATOM   3771  O O   . GLY A 1 519 ? 167.923 155.437 181.918 1.00 79.63  ? 519 GLY A O   1 
ATOM   3772  N N   . ALA A 1 520 ? 168.581 155.979 179.841 1.00 79.26  ? 520 ALA A N   1 
ATOM   3773  C CA  . ALA A 1 520 ? 169.979 156.059 180.221 1.00 79.26  ? 520 ALA A CA  1 
ATOM   3774  C C   . ALA A 1 520 ? 170.408 157.467 180.584 1.00 79.26  ? 520 ALA A C   1 
ATOM   3775  O O   . ALA A 1 520 ? 171.377 157.626 181.330 1.00 79.26  ? 520 ALA A O   1 
ATOM   3776  C CB  . ALA A 1 520 ? 170.868 155.540 179.094 1.00 79.26  ? 520 ALA A CB  1 
ATOM   3777  N N   . TYR A 1 521 ? 169.715 158.487 180.084 1.00 78.88  ? 521 TYR A N   1 
ATOM   3778  C CA  . TYR A 1 521 ? 170.096 159.856 180.406 1.00 78.88  ? 521 TYR A CA  1 
ATOM   3779  C C   . TYR A 1 521 ? 169.697 160.222 181.823 1.00 78.88  ? 521 TYR A C   1 
ATOM   3780  O O   . TYR A 1 521 ? 170.307 161.109 182.427 1.00 78.88  ? 521 TYR A O   1 
ATOM   3781  C CB  . TYR A 1 521 ? 169.467 160.823 179.413 1.00 78.88  ? 521 TYR A CB  1 
ATOM   3782  C CG  . TYR A 1 521 ? 169.870 162.259 179.599 1.00 78.88  ? 521 TYR A CG  1 
ATOM   3783  C CD1 . TYR A 1 521 ? 171.118 162.703 179.207 1.00 78.88  ? 521 TYR A CD1 1 
ATOM   3784  C CD2 . TYR A 1 521 ? 168.996 163.172 180.153 1.00 78.88  ? 521 TYR A CD2 1 
ATOM   3785  C CE1 . TYR A 1 521 ? 171.486 164.019 179.369 1.00 78.88  ? 521 TYR A CE1 1 
ATOM   3786  C CE2 . TYR A 1 521 ? 169.353 164.488 180.315 1.00 78.88  ? 521 TYR A CE2 1 
ATOM   3787  C CZ  . TYR A 1 521 ? 170.598 164.905 179.928 1.00 78.88  ? 521 TYR A CZ  1 
ATOM   3788  O OH  . TYR A 1 521 ? 170.947 166.219 180.095 1.00 78.88  ? 521 TYR A OH  1 
ATOM   3789  N N   . ASP A 1 522 ? 168.690 159.555 182.373 1.00 87.40  ? 522 ASP A N   1 
ATOM   3790  C CA  . ASP A 1 522 ? 168.368 159.764 183.773 1.00 87.40  ? 522 ASP A CA  1 
ATOM   3791  C C   . ASP A 1 522 ? 169.400 159.152 184.705 1.00 87.40  ? 522 ASP A C   1 
ATOM   3792  O O   . ASP A 1 522 ? 169.606 159.673 185.804 1.00 87.40  ? 522 ASP A O   1 
ATOM   3793  C CB  . ASP A 1 522 ? 166.992 159.190 184.097 1.00 87.40  ? 522 ASP A CB  1 
ATOM   3794  C CG  . ASP A 1 522 ? 165.873 160.000 183.493 1.00 87.40  ? 522 ASP A CG  1 
ATOM   3795  O OD1 . ASP A 1 522 ? 166.088 161.203 183.242 1.00 87.40  ? 522 ASP A OD1 1 
ATOM   3796  O OD2 . ASP A 1 522 ? 164.772 159.445 183.292 1.00 87.40  ? 522 ASP A OD2 1 
ATOM   3797  N N   . THR A 1 523 ? 170.054 158.070 184.294 1.00 84.99  ? 523 THR A N   1 
ATOM   3798  C CA  . THR A 1 523 ? 171.005 157.416 185.179 1.00 84.99  ? 523 THR A CA  1 
ATOM   3799  C C   . THR A 1 523 ? 172.294 158.207 185.300 1.00 84.99  ? 523 THR A C   1 
ATOM   3800  O O   . THR A 1 523 ? 172.918 158.216 186.364 1.00 84.99  ? 523 THR A O   1 
ATOM   3801  C CB  . THR A 1 523 ? 171.316 156.008 184.684 1.00 84.99  ? 523 THR A CB  1 
ATOM   3802  O OG1 . THR A 1 523 ? 171.883 156.082 183.373 1.00 84.99  ? 523 THR A OG1 1 
ATOM   3803  C CG2 . THR A 1 523 ? 170.060 155.172 184.642 1.00 84.99  ? 523 THR A CG2 1 
ATOM   3804  N N   . ILE A 1 524 ? 172.709 158.876 184.229 1.00 86.59  ? 524 ILE A N   1 
ATOM   3805  C CA  . ILE A 1 524 ? 174.024 159.500 184.234 1.00 86.59  ? 524 ILE A CA  1 
ATOM   3806  C C   . ILE A 1 524 ? 173.999 160.798 185.029 1.00 86.59  ? 524 ILE A C   1 
ATOM   3807  O O   . ILE A 1 524 ? 175.007 161.194 185.626 1.00 86.59  ? 524 ILE A O   1 
ATOM   3808  C CB  . ILE A 1 524 ? 174.521 159.700 182.791 1.00 86.59  ? 524 ILE A CB  1 
ATOM   3809  C CG1 . ILE A 1 524 ? 175.981 160.117 182.774 1.00 86.59  ? 524 ILE A CG1 1 
ATOM   3810  C CG2 . ILE A 1 524 ? 173.687 160.704 182.032 1.00 86.59  ? 524 ILE A CG2 1 
ATOM   3811  C CD1 . ILE A 1 524 ? 176.568 160.069 181.424 1.00 86.59  ? 524 ILE A CD1 1 
ATOM   3812  N N   . LYS A 1 525 ? 172.844 161.455 185.106 1.00 92.85  ? 525 LYS A N   1 
ATOM   3813  C CA  . LYS A 1 525 ? 172.813 162.727 185.805 1.00 92.85  ? 525 LYS A CA  1 
ATOM   3814  C C   . LYS A 1 525 ? 172.174 162.618 187.179 1.00 92.85  ? 525 LYS A C   1 
ATOM   3815  O O   . LYS A 1 525 ? 172.080 163.627 187.884 1.00 92.85  ? 525 LYS A O   1 
ATOM   3816  C CB  . LYS A 1 525 ? 172.103 163.776 184.955 1.00 92.85  ? 525 LYS A CB  1 
ATOM   3817  C CG  . LYS A 1 525 ? 170.620 163.607 184.832 1.00 92.85  ? 525 LYS A CG  1 
ATOM   3818  C CD  . LYS A 1 525 ? 170.088 164.585 183.803 1.00 92.85  ? 525 LYS A CD  1 
ATOM   3819  C CE  . LYS A 1 525 ? 170.228 166.030 184.235 1.00 92.85  ? 525 LYS A CE  1 
ATOM   3820  N NZ  . LYS A 1 525 ? 169.326 166.362 185.360 1.00 92.85  ? 525 LYS A NZ  1 
ATOM   3821  N N   . HIS A 1 526 ? 171.735 161.429 187.577 1.00 95.09  ? 526 HIS A N   1 
ATOM   3822  C CA  . HIS A 1 526 ? 171.269 161.216 188.941 1.00 95.09  ? 526 HIS A CA  1 
ATOM   3823  C C   . HIS A 1 526 ? 171.716 159.856 189.460 1.00 95.09  ? 526 HIS A C   1 
ATOM   3824  O O   . HIS A 1 526 ? 172.770 159.735 190.081 1.00 95.09  ? 526 HIS A O   1 
ATOM   3825  C CB  . HIS A 1 526 ? 169.746 161.337 189.027 1.00 95.09  ? 526 HIS A CB  1 
ATOM   3826  C CG  . HIS A 1 526 ? 169.226 162.682 188.633 1.00 95.09  ? 526 HIS A CG  1 
ATOM   3827  N ND1 . HIS A 1 526 ? 169.492 163.823 189.358 1.00 95.09  ? 526 HIS A ND1 1 
ATOM   3828  C CD2 . HIS A 1 526 ? 168.446 163.069 187.598 1.00 95.09  ? 526 HIS A CD2 1 
ATOM   3829  C CE1 . HIS A 1 526 ? 168.910 164.856 188.779 1.00 95.09  ? 526 HIS A CE1 1 
ATOM   3830  N NE2 . HIS A 1 526 ? 168.265 164.426 187.711 1.00 95.09  ? 526 HIS A NE2 1 
ATOM   3831  N N   . GLU B 1 38  ? 149.031 123.653 198.934 1.00 137.72 ? 38  GLU B N   1 
ATOM   3832  C CA  . GLU B 1 38  ? 150.147 123.456 198.018 1.00 137.72 ? 38  GLU B CA  1 
ATOM   3833  C C   . GLU B 1 38  ? 151.233 122.589 198.647 1.00 137.72 ? 38  GLU B C   1 
ATOM   3834  O O   . GLU B 1 38  ? 152.402 122.941 198.580 1.00 137.72 ? 38  GLU B O   1 
ATOM   3835  C CB  . GLU B 1 38  ? 150.755 124.803 197.601 1.00 137.72 ? 38  GLU B CB  1 
ATOM   3836  C CG  . GLU B 1 38  ? 149.833 125.709 196.806 1.00 137.72 ? 38  GLU B CG  1 
ATOM   3837  C CD  . GLU B 1 38  ? 150.500 126.995 196.365 1.00 137.72 ? 38  GLU B CD  1 
ATOM   3838  O OE1 . GLU B 1 38  ? 151.660 127.232 196.757 1.00 137.72 ? 38  GLU B OE1 1 
ATOM   3839  O OE2 . GLU B 1 38  ? 149.862 127.772 195.627 1.00 137.72 ? 38  GLU B OE2 1 
ATOM   3840  N N   . GLU B 1 39  ? 150.866 121.467 199.271 1.00 137.18 ? 39  GLU B N   1 
ATOM   3841  C CA  . GLU B 1 39  ? 151.877 120.689 199.984 1.00 137.18 ? 39  GLU B CA  1 
ATOM   3842  C C   . GLU B 1 39  ? 152.662 119.760 199.060 1.00 137.18 ? 39  GLU B C   1 
ATOM   3843  O O   . GLU B 1 39  ? 153.871 119.930 198.876 1.00 137.18 ? 39  GLU B O   1 
ATOM   3844  C CB  . GLU B 1 39  ? 151.238 119.881 201.117 1.00 137.18 ? 39  GLU B CB  1 
ATOM   3845  C CG  . GLU B 1 39  ? 150.836 120.690 202.328 1.00 137.18 ? 39  GLU B CG  1 
ATOM   3846  C CD  . GLU B 1 39  ? 150.336 119.816 203.460 1.00 137.18 ? 39  GLU B CD  1 
ATOM   3847  O OE1 . GLU B 1 39  ? 150.162 118.599 203.240 1.00 137.18 ? 39  GLU B OE1 1 
ATOM   3848  O OE2 . GLU B 1 39  ? 150.132 120.340 204.575 1.00 137.18 ? 39  GLU B OE2 1 
ATOM   3849  N N   . ASP B 1 40  ? 151.995 118.777 198.465 1.00 128.41 ? 40  ASP B N   1 
ATOM   3850  C CA  . ASP B 1 40  ? 152.695 117.699 197.780 1.00 128.41 ? 40  ASP B CA  1 
ATOM   3851  C C   . ASP B 1 40  ? 152.885 117.947 196.296 1.00 128.41 ? 40  ASP B C   1 
ATOM   3852  O O   . ASP B 1 40  ? 153.594 117.176 195.642 1.00 128.41 ? 40  ASP B O   1 
ATOM   3853  C CB  . ASP B 1 40  ? 151.960 116.375 197.986 1.00 128.41 ? 40  ASP B CB  1 
ATOM   3854  C CG  . ASP B 1 40  ? 152.156 115.819 199.372 1.00 128.41 ? 40  ASP B CG  1 
ATOM   3855  O OD1 . ASP B 1 40  ? 153.224 116.084 199.959 1.00 128.41 ? 40  ASP B OD1 1 
ATOM   3856  O OD2 . ASP B 1 40  ? 151.254 115.118 199.873 1.00 128.41 ? 40  ASP B OD2 1 
ATOM   3857  N N   . LEU B 1 41  ? 152.288 118.995 195.747 1.00 127.91 ? 41  LEU B N   1 
ATOM   3858  C CA  . LEU B 1 41  ? 152.425 119.308 194.332 1.00 127.91 ? 41  LEU B CA  1 
ATOM   3859  C C   . LEU B 1 41  ? 153.502 120.356 194.094 1.00 127.91 ? 41  LEU B C   1 
ATOM   3860  O O   . LEU B 1 41  ? 153.505 121.033 193.071 1.00 127.91 ? 41  LEU B O   1 
ATOM   3861  C CB  . LEU B 1 41  ? 151.099 119.773 193.746 1.00 127.91 ? 41  LEU B CB  1 
ATOM   3862  C CG  . LEU B 1 41  ? 150.020 118.704 193.622 1.00 127.91 ? 41  LEU B CG  1 
ATOM   3863  C CD1 . LEU B 1 41  ? 148.737 119.294 193.076 1.00 127.91 ? 41  LEU B CD1 1 
ATOM   3864  C CD2 . LEU B 1 41  ? 150.517 117.591 192.732 1.00 127.91 ? 41  LEU B CD2 1 
ATOM   3865  N N   . ARG B 1 42  ? 154.437 120.501 195.033 1.00 128.71 ? 42  ARG B N   1 
ATOM   3866  C CA  . ARG B 1 42  ? 155.475 121.510 194.858 1.00 128.71 ? 42  ARG B CA  1 
ATOM   3867  C C   . ARG B 1 42  ? 156.510 121.080 193.829 1.00 128.71 ? 42  ARG B C   1 
ATOM   3868  O O   . ARG B 1 42  ? 156.931 121.892 193.005 1.00 128.71 ? 42  ARG B O   1 
ATOM   3869  C CB  . ARG B 1 42  ? 156.155 121.834 196.193 1.00 128.71 ? 42  ARG B CB  1 
ATOM   3870  C CG  . ARG B 1 42  ? 155.281 122.606 197.175 1.00 128.71 ? 42  ARG B CG  1 
ATOM   3871  C CD  . ARG B 1 42  ? 155.987 122.919 198.497 1.00 128.71 ? 42  ARG B CD  1 
ATOM   3872  N NE  . ARG B 1 42  ? 157.044 123.919 198.355 1.00 128.71 ? 42  ARG B NE  1 
ATOM   3873  C CZ  . ARG B 1 42  ? 157.905 124.242 199.316 1.00 128.71 ? 42  ARG B CZ  1 
ATOM   3874  N NH1 . ARG B 1 42  ? 157.842 123.640 200.494 1.00 128.71 ? 42  ARG B NH1 1 
ATOM   3875  N NH2 . ARG B 1 42  ? 158.831 125.164 199.099 1.00 128.71 ? 42  ARG B NH2 1 
ATOM   3876  N N   . ARG B 1 43  ? 156.918 119.814 193.837 1.00 126.09 ? 43  ARG B N   1 
ATOM   3877  C CA  . ARG B 1 43  ? 158.024 119.423 192.972 1.00 126.09 ? 43  ARG B CA  1 
ATOM   3878  C C   . ARG B 1 43  ? 157.584 119.290 191.522 1.00 126.09 ? 43  ARG B C   1 
ATOM   3879  O O   . ARG B 1 43  ? 158.276 119.761 190.614 1.00 126.09 ? 43  ARG B O   1 
ATOM   3880  C CB  . ARG B 1 43  ? 158.654 118.127 193.471 1.00 126.09 ? 43  ARG B CB  1 
ATOM   3881  C CG  . ARG B 1 43  ? 159.358 118.309 194.790 1.00 126.09 ? 43  ARG B CG  1 
ATOM   3882  C CD  . ARG B 1 43  ? 160.033 117.051 195.256 1.00 126.09 ? 43  ARG B CD  1 
ATOM   3883  N NE  . ARG B 1 43  ? 160.654 117.267 196.554 1.00 126.09 ? 43  ARG B NE  1 
ATOM   3884  C CZ  . ARG B 1 43  ? 161.312 116.337 197.230 1.00 126.09 ? 43  ARG B CZ  1 
ATOM   3885  N NH1 . ARG B 1 43  ? 161.448 115.119 196.724 1.00 126.09 ? 43  ARG B NH1 1 
ATOM   3886  N NH2 . ARG B 1 43  ? 161.841 116.628 198.408 1.00 126.09 ? 43  ARG B NH2 1 
ATOM   3887  N N   . ARG B 1 44  ? 156.432 118.672 191.285 1.00 127.90 ? 44  ARG B N   1 
ATOM   3888  C CA  . ARG B 1 44  ? 155.980 118.480 189.917 1.00 127.90 ? 44  ARG B CA  1 
ATOM   3889  C C   . ARG B 1 44  ? 155.492 119.768 189.268 1.00 127.90 ? 44  ARG B C   1 
ATOM   3890  O O   . ARG B 1 44  ? 155.716 119.959 188.068 1.00 127.90 ? 44  ARG B O   1 
ATOM   3891  C CB  . ARG B 1 44  ? 154.889 117.413 189.881 1.00 127.90 ? 44  ARG B CB  1 
ATOM   3892  C CG  . ARG B 1 44  ? 155.417 116.045 190.239 1.00 127.90 ? 44  ARG B CG  1 
ATOM   3893  C CD  . ARG B 1 44  ? 154.332 115.003 190.256 1.00 127.90 ? 44  ARG B CD  1 
ATOM   3894  N NE  . ARG B 1 44  ? 153.767 114.772 188.934 1.00 127.90 ? 44  ARG B NE  1 
ATOM   3895  C CZ  . ARG B 1 44  ? 152.529 115.103 188.590 1.00 127.90 ? 44  ARG B CZ  1 
ATOM   3896  N NH1 . ARG B 1 44  ? 151.729 115.680 189.471 1.00 127.90 ? 44  ARG B NH1 1 
ATOM   3897  N NH2 . ARG B 1 44  ? 152.088 114.853 187.368 1.00 127.90 ? 44  ARG B NH2 1 
ATOM   3898  N N   . LEU B 1 45  ? 154.866 120.669 190.025 1.00 130.14 ? 45  LEU B N   1 
ATOM   3899  C CA  . LEU B 1 45  ? 154.402 121.911 189.423 1.00 130.14 ? 45  LEU B CA  1 
ATOM   3900  C C   . LEU B 1 45  ? 155.494 122.959 189.301 1.00 130.14 ? 45  LEU B C   1 
ATOM   3901  O O   . LEU B 1 45  ? 155.240 124.014 188.713 1.00 130.14 ? 45  LEU B O   1 
ATOM   3902  C CB  . LEU B 1 45  ? 153.237 122.504 190.207 1.00 130.14 ? 45  LEU B CB  1 
ATOM   3903  C CG  . LEU B 1 45  ? 151.958 121.676 190.204 1.00 130.14 ? 45  LEU B CG  1 
ATOM   3904  C CD1 . LEU B 1 45  ? 150.886 122.357 191.038 1.00 130.14 ? 45  LEU B CD1 1 
ATOM   3905  C CD2 . LEU B 1 45  ? 151.486 121.443 188.787 1.00 130.14 ? 45  LEU B CD2 1 
ATOM   3906  N N   . LYS B 1 46  ? 156.683 122.719 189.852 1.00 133.76 ? 46  LYS B N   1 
ATOM   3907  C CA  . LYS B 1 46  ? 157.809 123.604 189.595 1.00 133.76 ? 46  LYS B CA  1 
ATOM   3908  C C   . LYS B 1 46  ? 158.770 123.058 188.548 1.00 133.76 ? 46  LYS B C   1 
ATOM   3909  O O   . LYS B 1 46  ? 159.551 123.835 187.989 1.00 133.76 ? 46  LYS B O   1 
ATOM   3910  C CB  . LYS B 1 46  ? 158.576 123.905 190.890 1.00 133.76 ? 46  LYS B CB  1 
ATOM   3911  C CG  . LYS B 1 46  ? 157.814 124.748 191.914 1.00 133.76 ? 46  LYS B CG  1 
ATOM   3912  C CD  . LYS B 1 46  ? 157.635 126.192 191.493 1.00 133.76 ? 46  LYS B CD  1 
ATOM   3913  C CE  . LYS B 1 46  ? 156.968 126.994 192.604 1.00 133.76 ? 46  LYS B CE  1 
ATOM   3914  N NZ  . LYS B 1 46  ? 156.787 128.430 192.258 1.00 133.76 ? 46  LYS B NZ  1 
ATOM   3915  N N   . TYR B 1 47  ? 158.732 121.751 188.270 1.00 137.29 ? 47  TYR B N   1 
ATOM   3916  C CA  . TYR B 1 47  ? 159.442 121.224 187.109 1.00 137.29 ? 47  TYR B CA  1 
ATOM   3917  C C   . TYR B 1 47  ? 158.878 121.792 185.823 1.00 137.29 ? 47  TYR B C   1 
ATOM   3918  O O   . TYR B 1 47  ? 159.614 122.013 184.857 1.00 137.29 ? 47  TYR B O   1 
ATOM   3919  C CB  . TYR B 1 47  ? 159.362 119.702 187.068 1.00 137.29 ? 47  TYR B CB  1 
ATOM   3920  C CG  . TYR B 1 47  ? 160.310 119.000 187.994 1.00 137.29 ? 47  TYR B CG  1 
ATOM   3921  C CD1 . TYR B 1 47  ? 161.431 119.647 188.492 1.00 137.29 ? 47  TYR B CD1 1 
ATOM   3922  C CD2 . TYR B 1 47  ? 160.079 117.684 188.379 1.00 137.29 ? 47  TYR B CD2 1 
ATOM   3923  C CE1 . TYR B 1 47  ? 162.300 119.000 189.342 1.00 137.29 ? 47  TYR B CE1 1 
ATOM   3924  C CE2 . TYR B 1 47  ? 160.941 117.030 189.231 1.00 137.29 ? 47  TYR B CE2 1 
ATOM   3925  C CZ  . TYR B 1 47  ? 162.047 117.693 189.708 1.00 137.29 ? 47  TYR B CZ  1 
ATOM   3926  O OH  . TYR B 1 47  ? 162.899 117.042 190.562 1.00 137.29 ? 47  TYR B OH  1 
ATOM   3927  N N   . PHE B 1 48  ? 157.569 122.026 185.786 1.00 130.76 ? 48  PHE B N   1 
ATOM   3928  C CA  . PHE B 1 48  ? 156.973 122.597 184.594 1.00 130.76 ? 48  PHE B CA  1 
ATOM   3929  C C   . PHE B 1 48  ? 157.362 124.053 184.416 1.00 130.76 ? 48  PHE B C   1 
ATOM   3930  O O   . PHE B 1 48  ? 157.344 124.556 183.290 1.00 130.76 ? 48  PHE B O   1 
ATOM   3931  C CB  . PHE B 1 48  ? 155.460 122.449 184.652 1.00 130.76 ? 48  PHE B CB  1 
ATOM   3932  C CG  . PHE B 1 48  ? 154.781 122.814 183.381 1.00 130.76 ? 48  PHE B CG  1 
ATOM   3933  C CD1 . PHE B 1 48  ? 154.832 121.961 182.295 1.00 130.76 ? 48  PHE B CD1 1 
ATOM   3934  C CD2 . PHE B 1 48  ? 154.105 124.012 183.260 1.00 130.76 ? 48  PHE B CD2 1 
ATOM   3935  C CE1 . PHE B 1 48  ? 154.214 122.292 181.110 1.00 130.76 ? 48  PHE B CE1 1 
ATOM   3936  C CE2 . PHE B 1 48  ? 153.482 124.348 182.078 1.00 130.76 ? 48  PHE B CE2 1 
ATOM   3937  C CZ  . PHE B 1 48  ? 153.538 123.485 181.001 1.00 130.76 ? 48  PHE B CZ  1 
ATOM   3938  N N   . PHE B 1 49  ? 157.715 124.740 185.494 1.00 131.18 ? 49  PHE B N   1 
ATOM   3939  C CA  . PHE B 1 49  ? 158.274 126.082 185.386 1.00 131.18 ? 49  PHE B CA  1 
ATOM   3940  C C   . PHE B 1 49  ? 159.787 126.008 185.573 1.00 131.18 ? 49  PHE B C   1 
ATOM   3941  O O   . PHE B 1 49  ? 160.337 126.317 186.627 1.00 131.18 ? 49  PHE B O   1 
ATOM   3942  C CB  . PHE B 1 49  ? 157.627 127.018 186.398 1.00 131.18 ? 49  PHE B CB  1 
ATOM   3943  C CG  . PHE B 1 49  ? 156.182 127.303 186.131 1.00 131.18 ? 49  PHE B CG  1 
ATOM   3944  C CD1 . PHE B 1 49  ? 155.601 127.007 184.907 1.00 131.18 ? 49  PHE B CD1 1 
ATOM   3945  C CD2 . PHE B 1 49  ? 155.402 127.880 187.114 1.00 131.18 ? 49  PHE B CD2 1 
ATOM   3946  C CE1 . PHE B 1 49  ? 154.274 127.264 184.677 1.00 131.18 ? 49  PHE B CE1 1 
ATOM   3947  C CE2 . PHE B 1 49  ? 154.072 128.147 186.889 1.00 131.18 ? 49  PHE B CE2 1 
ATOM   3948  C CZ  . PHE B 1 49  ? 153.508 127.836 185.667 1.00 131.18 ? 49  PHE B CZ  1 
ATOM   3949  N N   . MET B 1 50  ? 160.458 125.564 184.520 1.00 138.52 ? 50  MET B N   1 
ATOM   3950  C CA  . MET B 1 50  ? 161.909 125.492 184.514 1.00 138.52 ? 50  MET B CA  1 
ATOM   3951  C C   . MET B 1 50  ? 162.455 126.077 183.221 1.00 138.52 ? 50  MET B C   1 
ATOM   3952  O O   . MET B 1 50  ? 161.714 126.517 182.339 1.00 138.52 ? 50  MET B O   1 
ATOM   3953  C CB  . MET B 1 50  ? 162.412 124.053 184.695 1.00 138.52 ? 50  MET B CB  1 
ATOM   3954  C CG  . MET B 1 50  ? 162.211 123.512 186.088 1.00 138.52 ? 50  MET B CG  1 
ATOM   3955  S SD  . MET B 1 50  ? 163.036 124.548 187.298 1.00 138.52 ? 50  MET B SD  1 
ATOM   3956  C CE  . MET B 1 50  ? 164.737 124.181 186.905 1.00 138.52 ? 50  MET B CE  1 
ATOM   3957  N N   . SER B 1 51  ? 163.777 126.076 183.131 1.00 135.15 ? 51  SER B N   1 
ATOM   3958  C CA  . SER B 1 51  ? 164.527 126.549 181.987 1.00 135.15 ? 51  SER B CA  1 
ATOM   3959  C C   . SER B 1 51  ? 165.625 125.547 181.676 1.00 135.15 ? 51  SER B C   1 
ATOM   3960  O O   . SER B 1 51  ? 166.224 124.982 182.595 1.00 135.15 ? 51  SER B O   1 
ATOM   3961  C CB  . SER B 1 51  ? 165.155 127.920 182.265 1.00 135.15 ? 51  SER B CB  1 
ATOM   3962  O OG  . SER B 1 51  ? 166.173 127.802 183.240 1.00 135.15 ? 51  SER B OG  1 
ATOM   3963  N N   . PRO B 1 52  ? 165.930 125.329 180.394 1.00 133.80 ? 52  PRO B N   1 
ATOM   3964  C CA  . PRO B 1 52  ? 166.988 124.376 180.030 1.00 133.80 ? 52  PRO B CA  1 
ATOM   3965  C C   . PRO B 1 52  ? 168.387 124.814 180.416 1.00 133.80 ? 52  PRO B C   1 
ATOM   3966  O O   . PRO B 1 52  ? 169.314 124.005 180.322 1.00 133.80 ? 52  PRO B O   1 
ATOM   3967  C CB  . PRO B 1 52  ? 166.854 124.279 178.511 1.00 133.80 ? 52  PRO B CB  1 
ATOM   3968  C CG  . PRO B 1 52  ? 166.252 125.551 178.121 1.00 133.80 ? 52  PRO B CG  1 
ATOM   3969  C CD  . PRO B 1 52  ? 165.303 125.922 179.207 1.00 133.80 ? 52  PRO B CD  1 
ATOM   3970  N N   . CYS B 1 53  ? 168.579 126.062 180.838 1.00 140.72 ? 53  CYS B N   1 
ATOM   3971  C CA  . CYS B 1 53  ? 169.811 126.408 181.527 1.00 140.72 ? 53  CYS B CA  1 
ATOM   3972  C C   . CYS B 1 53  ? 169.880 125.749 182.899 1.00 140.72 ? 53  CYS B C   1 
ATOM   3973  O O   . CYS B 1 53  ? 170.975 125.507 183.417 1.00 140.72 ? 53  CYS B O   1 
ATOM   3974  C CB  . CYS B 1 53  ? 169.924 127.924 181.655 1.00 140.72 ? 53  CYS B CB  1 
ATOM   3975  S SG  . CYS B 1 53  ? 170.074 128.782 180.075 1.00 140.72 ? 53  CYS B SG  1 
ATOM   3976  N N   . ASP B 1 54  ? 168.731 125.439 183.496 1.00 142.76 ? 54  ASP B N   1 
ATOM   3977  C CA  . ASP B 1 54  ? 168.690 124.835 184.814 1.00 142.76 ? 54  ASP B CA  1 
ATOM   3978  C C   . ASP B 1 54  ? 168.105 123.428 184.778 1.00 142.76 ? 54  ASP B C   1 
ATOM   3979  O O   . ASP B 1 54  ? 168.182 122.715 185.782 1.00 142.76 ? 54  ASP B O   1 
ATOM   3980  C CB  . ASP B 1 54  ? 167.874 125.721 185.765 1.00 142.76 ? 54  ASP B CB  1 
ATOM   3981  C CG  . ASP B 1 54  ? 168.227 125.510 187.224 1.00 142.76 ? 54  ASP B CG  1 
ATOM   3982  O OD1 . ASP B 1 54  ? 169.148 124.726 187.526 1.00 142.76 ? 54  ASP B OD1 1 
ATOM   3983  O OD2 . ASP B 1 54  ? 167.581 126.144 188.082 1.00 142.76 ? 54  ASP B OD2 1 
ATOM   3984  N N   . LYS B 1 55  ? 167.532 123.004 183.649 1.00 143.87 ? 55  LYS B N   1 
ATOM   3985  C CA  . LYS B 1 55  ? 167.126 121.611 183.499 1.00 143.87 ? 55  LYS B CA  1 
ATOM   3986  C C   . LYS B 1 55  ? 168.328 120.682 183.494 1.00 143.87 ? 55  LYS B C   1 
ATOM   3987  O O   . LYS B 1 55  ? 168.216 119.525 183.912 1.00 143.87 ? 55  LYS B O   1 
ATOM   3988  C CB  . LYS B 1 55  ? 166.328 121.417 182.211 1.00 143.87 ? 55  LYS B CB  1 
ATOM   3989  C CG  . LYS B 1 55  ? 164.952 122.034 182.213 1.00 143.87 ? 55  LYS B CG  1 
ATOM   3990  C CD  . LYS B 1 55  ? 164.247 121.787 180.889 1.00 143.87 ? 55  LYS B CD  1 
ATOM   3991  C CE  . LYS B 1 55  ? 162.893 122.475 180.850 1.00 143.87 ? 55  LYS B CE  1 
ATOM   3992  N NZ  . LYS B 1 55  ? 162.152 122.211 179.551 1.00 143.87 ? 55  LYS B NZ  1 
ATOM   3993  N N   . PHE B 1 56  ? 169.475 121.174 183.013 1.00 146.92 ? 56  PHE B N   1 
ATOM   3994  C CA  . PHE B 1 56  ? 170.722 120.417 183.030 1.00 146.92 ? 56  PHE B CA  1 
ATOM   3995  C C   . PHE B 1 56  ? 171.138 120.066 184.450 1.00 146.92 ? 56  PHE B C   1 
ATOM   3996  O O   . PHE B 1 56  ? 171.636 118.963 184.699 1.00 146.92 ? 56  PHE B O   1 
ATOM   3997  C CB  . PHE B 1 56  ? 171.814 121.235 182.339 1.00 146.92 ? 56  PHE B CB  1 
ATOM   3998  C CG  . PHE B 1 56  ? 173.104 120.502 182.136 1.00 146.92 ? 56  PHE B CG  1 
ATOM   3999  C CD1 . PHE B 1 56  ? 173.243 119.587 181.101 1.00 146.92 ? 56  PHE B CD1 1 
ATOM   4000  C CD2 . PHE B 1 56  ? 174.187 120.746 182.959 1.00 146.92 ? 56  PHE B CD2 1 
ATOM   4001  C CE1 . PHE B 1 56  ? 174.439 118.918 180.901 1.00 146.92 ? 56  PHE B CE1 1 
ATOM   4002  C CE2 . PHE B 1 56  ? 175.385 120.079 182.767 1.00 146.92 ? 56  PHE B CE2 1 
ATOM   4003  C CZ  . PHE B 1 56  ? 175.510 119.164 181.734 1.00 146.92 ? 56  PHE B CZ  1 
ATOM   4004  N N   . ARG B 1 57  ? 170.916 120.973 185.391 1.00 151.93 ? 57  ARG B N   1 
ATOM   4005  C CA  . ARG B 1 57  ? 171.189 120.706 186.789 1.00 151.93 ? 57  ARG B CA  1 
ATOM   4006  C C   . ARG B 1 57  ? 169.933 120.381 187.570 1.00 151.93 ? 57  ARG B C   1 
ATOM   4007  O O   . ARG B 1 57  ? 169.989 120.301 188.799 1.00 151.93 ? 57  ARG B O   1 
ATOM   4008  C CB  . ARG B 1 57  ? 171.913 121.891 187.428 1.00 151.93 ? 57  ARG B CB  1 
ATOM   4009  C CG  . ARG B 1 57  ? 173.326 122.061 186.916 1.00 151.93 ? 57  ARG B CG  1 
ATOM   4010  C CD  . ARG B 1 57  ? 174.082 123.202 187.573 1.00 151.93 ? 57  ARG B CD  1 
ATOM   4011  N NE  . ARG B 1 57  ? 175.426 123.309 187.005 1.00 151.93 ? 57  ARG B NE  1 
ATOM   4012  C CZ  . ARG B 1 57  ? 176.325 124.222 187.353 1.00 151.93 ? 57  ARG B CZ  1 
ATOM   4013  N NH1 . ARG B 1 57  ? 176.037 125.123 188.281 1.00 151.93 ? 57  ARG B NH1 1 
ATOM   4014  N NH2 . ARG B 1 57  ? 177.515 124.232 186.773 1.00 151.93 ? 57  ARG B NH2 1 
ATOM   4015  N N   . ALA B 1 58  ? 168.800 120.190 186.897 1.00 149.61 ? 58  ALA B N   1 
ATOM   4016  C CA  . ALA B 1 58  ? 167.595 119.822 187.635 1.00 149.61 ? 58  ALA B CA  1 
ATOM   4017  C C   . ALA B 1 58  ? 167.604 118.334 187.956 1.00 149.61 ? 58  ALA B C   1 
ATOM   4018  O O   . ALA B 1 58  ? 167.684 117.938 189.121 1.00 149.61 ? 58  ALA B O   1 
ATOM   4019  C CB  . ALA B 1 58  ? 166.342 120.200 186.841 1.00 149.61 ? 58  ALA B CB  1 
ATOM   4020  N N   . LYS B 1 59  ? 167.544 117.494 186.923 1.00 151.81 ? 59  LYS B N   1 
ATOM   4021  C CA  . LYS B 1 59  ? 167.525 116.051 187.115 1.00 151.81 ? 59  LYS B CA  1 
ATOM   4022  C C   . LYS B 1 59  ? 168.447 115.347 186.132 1.00 151.81 ? 59  LYS B C   1 
ATOM   4023  O O   . LYS B 1 59  ? 168.386 114.114 186.028 1.00 151.81 ? 59  LYS B O   1 
ATOM   4024  C CB  . LYS B 1 59  ? 166.097 115.480 186.987 1.00 151.81 ? 59  LYS B CB  1 
ATOM   4025  C CG  . LYS B 1 59  ? 165.114 115.992 188.040 1.00 151.81 ? 59  LYS B CG  1 
ATOM   4026  C CD  . LYS B 1 59  ? 165.518 115.565 189.447 1.00 151.81 ? 59  LYS B CD  1 
ATOM   4027  C CE  . LYS B 1 59  ? 165.062 114.168 189.796 1.00 151.81 ? 59  LYS B CE  1 
ATOM   4028  N NZ  . LYS B 1 59  ? 163.581 114.120 189.937 1.00 151.81 ? 59  LYS B NZ  1 
ATOM   4029  N N   . GLY B 1 60  ? 169.298 116.082 185.418 1.00 149.03 ? 60  GLY B N   1 
ATOM   4030  C CA  . GLY B 1 60  ? 170.176 115.464 184.446 1.00 149.03 ? 60  GLY B CA  1 
ATOM   4031  C C   . GLY B 1 60  ? 169.421 114.960 183.235 1.00 149.03 ? 60  GLY B C   1 
ATOM   4032  O O   . GLY B 1 60  ? 169.242 113.749 183.076 1.00 149.03 ? 60  GLY B O   1 
ATOM   4033  N N   . ARG B 1 61  ? 168.924 115.872 182.400 1.00 139.12 ? 61  ARG B N   1 
ATOM   4034  C CA  . ARG B 1 61  ? 168.032 115.486 181.319 1.00 139.12 ? 61  ARG B CA  1 
ATOM   4035  C C   . ARG B 1 61  ? 168.715 115.375 179.960 1.00 139.12 ? 61  ARG B C   1 
ATOM   4036  O O   . ARG B 1 61  ? 168.217 114.633 179.104 1.00 139.12 ? 61  ARG B O   1 
ATOM   4037  C CB  . ARG B 1 61  ? 166.856 116.473 181.240 1.00 139.12 ? 61  ARG B CB  1 
ATOM   4038  C CG  . ARG B 1 61  ? 165.690 116.056 180.352 1.00 139.12 ? 61  ARG B CG  1 
ATOM   4039  C CD  . ARG B 1 61  ? 164.946 114.859 180.945 1.00 139.12 ? 61  ARG B CD  1 
ATOM   4040  N NE  . ARG B 1 61  ? 165.484 113.564 180.526 1.00 139.12 ? 61  ARG B NE  1 
ATOM   4041  C CZ  . ARG B 1 61  ? 165.129 112.403 181.063 1.00 139.12 ? 61  ARG B CZ  1 
ATOM   4042  N NH1 . ARG B 1 61  ? 165.664 111.272 180.632 1.00 139.12 ? 61  ARG B NH1 1 
ATOM   4043  N NH2 . ARG B 1 61  ? 164.232 112.373 182.034 1.00 139.12 ? 61  ARG B NH2 1 
ATOM   4044  N N   . LYS B 1 62  ? 169.877 116.030 179.772 1.00 129.98 ? 62  LYS B N   1 
ATOM   4045  C CA  . LYS B 1 62  ? 170.638 116.109 178.525 1.00 129.98 ? 62  LYS B CA  1 
ATOM   4046  C C   . LYS B 1 62  ? 169.751 116.638 177.404 1.00 129.98 ? 62  LYS B C   1 
ATOM   4047  O O   . LYS B 1 62  ? 169.312 115.869 176.542 1.00 129.98 ? 62  LYS B O   1 
ATOM   4048  C CB  . LYS B 1 62  ? 171.242 114.749 178.160 1.00 129.98 ? 62  LYS B CB  1 
ATOM   4049  C CG  . LYS B 1 62  ? 172.287 114.270 179.145 1.00 129.98 ? 62  LYS B CG  1 
ATOM   4050  C CD  . LYS B 1 62  ? 172.798 112.895 178.787 1.00 129.98 ? 62  LYS B CD  1 
ATOM   4051  C CE  . LYS B 1 62  ? 173.954 112.501 179.688 1.00 129.98 ? 62  LYS B CE  1 
ATOM   4052  N NZ  . LYS B 1 62  ? 173.555 112.356 181.115 1.00 129.98 ? 62  LYS B NZ  1 
ATOM   4053  N N   . PRO B 1 63  ? 169.462 117.946 177.395 1.00 131.42 ? 63  PRO B N   1 
ATOM   4054  C CA  . PRO B 1 63  ? 168.329 118.466 176.616 1.00 131.42 ? 63  PRO B CA  1 
ATOM   4055  C C   . PRO B 1 63  ? 168.530 118.495 175.112 1.00 131.42 ? 63  PRO B C   1 
ATOM   4056  O O   . PRO B 1 63  ? 168.731 119.559 174.522 1.00 131.42 ? 63  PRO B O   1 
ATOM   4057  C CB  . PRO B 1 63  ? 168.163 119.885 177.164 1.00 131.42 ? 63  PRO B CB  1 
ATOM   4058  C CG  . PRO B 1 63  ? 169.528 120.263 177.608 1.00 131.42 ? 63  PRO B CG  1 
ATOM   4059  C CD  . PRO B 1 63  ? 170.172 119.012 178.119 1.00 131.42 ? 63  PRO B CD  1 
ATOM   4060  N N   . CYS B 1 64  ? 168.451 117.331 174.477 1.00 134.12 ? 64  CYS B N   1 
ATOM   4061  C CA  . CYS B 1 64  ? 168.310 117.296 173.031 1.00 134.12 ? 64  CYS B CA  1 
ATOM   4062  C C   . CYS B 1 64  ? 166.870 117.508 172.586 1.00 134.12 ? 64  CYS B C   1 
ATOM   4063  O O   . CYS B 1 64  ? 166.623 117.639 171.384 1.00 134.12 ? 64  CYS B O   1 
ATOM   4064  C CB  . CYS B 1 64  ? 168.840 115.974 172.469 1.00 134.12 ? 64  CYS B CB  1 
ATOM   4065  S SG  . CYS B 1 64  ? 170.632 115.773 172.566 1.00 134.12 ? 64  CYS B SG  1 
ATOM   4066  N N   . LYS B 1 65  ? 165.918 117.573 173.521 1.00 124.60 ? 65  LYS B N   1 
ATOM   4067  C CA  . LYS B 1 65  ? 164.538 117.876 173.163 1.00 124.60 ? 65  LYS B CA  1 
ATOM   4068  C C   . LYS B 1 65  ? 164.344 119.340 172.786 1.00 124.60 ? 65  LYS B C   1 
ATOM   4069  O O   . LYS B 1 65  ? 163.266 119.701 172.306 1.00 124.60 ? 65  LYS B O   1 
ATOM   4070  C CB  . LYS B 1 65  ? 163.600 117.496 174.309 1.00 124.60 ? 65  LYS B CB  1 
ATOM   4071  C CG  . LYS B 1 65  ? 163.723 116.038 174.738 1.00 124.60 ? 65  LYS B CG  1 
ATOM   4072  C CD  . LYS B 1 65  ? 163.315 115.092 173.629 1.00 124.60 ? 65  LYS B CD  1 
ATOM   4073  C CE  . LYS B 1 65  ? 163.485 113.637 174.023 1.00 124.60 ? 65  LYS B CE  1 
ATOM   4074  N NZ  . LYS B 1 65  ? 162.501 113.200 175.036 1.00 124.60 ? 65  LYS B NZ  1 
ATOM   4075  N N   . LEU B 1 66  ? 165.353 120.182 173.004 1.00 115.80 ? 66  LEU B N   1 
ATOM   4076  C CA  . LEU B 1 66  ? 165.378 121.540 172.490 1.00 115.80 ? 66  LEU B CA  1 
ATOM   4077  C C   . LEU B 1 66  ? 166.309 121.707 171.299 1.00 115.80 ? 66  LEU B C   1 
ATOM   4078  O O   . LEU B 1 66  ? 166.067 122.582 170.462 1.00 115.80 ? 66  LEU B O   1 
ATOM   4079  C CB  . LEU B 1 66  ? 165.788 122.505 173.609 1.00 115.80 ? 66  LEU B CB  1 
ATOM   4080  C CG  . LEU B 1 66  ? 165.778 124.016 173.397 1.00 115.80 ? 66  LEU B CG  1 
ATOM   4081  C CD1 . LEU B 1 66  ? 165.288 124.665 174.659 1.00 115.80 ? 66  LEU B CD1 1 
ATOM   4082  C CD2 . LEU B 1 66  ? 167.168 124.543 173.069 1.00 115.80 ? 66  LEU B CD2 1 
ATOM   4083  N N   . MET B 1 67  ? 167.359 120.893 171.198 1.00 118.19 ? 67  MET B N   1 
ATOM   4084  C CA  . MET B 1 67  ? 168.346 121.069 170.141 1.00 118.19 ? 67  MET B CA  1 
ATOM   4085  C C   . MET B 1 67  ? 167.798 120.686 168.770 1.00 118.19 ? 67  MET B C   1 
ATOM   4086  O O   . MET B 1 67  ? 168.275 121.210 167.758 1.00 118.19 ? 67  MET B O   1 
ATOM   4087  C CB  . MET B 1 67  ? 169.598 120.258 170.491 1.00 118.19 ? 67  MET B CB  1 
ATOM   4088  C CG  . MET B 1 67  ? 170.815 120.441 169.586 1.00 118.19 ? 67  MET B CG  1 
ATOM   4089  S SD  . MET B 1 67  ? 170.906 119.277 168.210 1.00 118.19 ? 67  MET B SD  1 
ATOM   4090  C CE  . MET B 1 67  ? 172.345 119.897 167.344 1.00 118.19 ? 67  MET B CE  1 
ATOM   4091  N N   . LEU B 1 68  ? 166.789 119.812 168.720 1.00 109.96 ? 68  LEU B N   1 
ATOM   4092  C CA  . LEU B 1 68  ? 166.174 119.450 167.446 1.00 109.96 ? 68  LEU B CA  1 
ATOM   4093  C C   . LEU B 1 68  ? 165.450 120.637 166.829 1.00 109.96 ? 68  LEU B C   1 
ATOM   4094  O O   . LEU B 1 68  ? 165.398 120.772 165.604 1.00 109.96 ? 68  LEU B O   1 
ATOM   4095  C CB  . LEU B 1 68  ? 165.204 118.291 167.648 1.00 109.96 ? 68  LEU B CB  1 
ATOM   4096  C CG  . LEU B 1 68  ? 164.584 117.710 166.381 1.00 109.96 ? 68  LEU B CG  1 
ATOM   4097  C CD1 . LEU B 1 68  ? 165.674 117.091 165.539 1.00 109.96 ? 68  LEU B CD1 1 
ATOM   4098  C CD2 . LEU B 1 68  ? 163.504 116.697 166.691 1.00 109.96 ? 68  LEU B CD2 1 
ATOM   4099  N N   . GLN B 1 69  ? 164.907 121.518 167.667 1.00 109.56 ? 69  GLN B N   1 
ATOM   4100  C CA  . GLN B 1 69  ? 164.275 122.743 167.196 1.00 109.56 ? 69  GLN B CA  1 
ATOM   4101  C C   . GLN B 1 69  ? 165.269 123.682 166.522 1.00 109.56 ? 69  GLN B C   1 
ATOM   4102  O O   . GLN B 1 69  ? 164.880 124.448 165.637 1.00 109.56 ? 69  GLN B O   1 
ATOM   4103  C CB  . GLN B 1 69  ? 163.574 123.410 168.381 1.00 109.56 ? 69  GLN B CB  1 
ATOM   4104  C CG  . GLN B 1 69  ? 162.834 124.707 168.119 1.00 109.56 ? 69  GLN B CG  1 
ATOM   4105  C CD  . GLN B 1 69  ? 161.787 124.607 167.040 1.00 109.56 ? 69  GLN B CD  1 
ATOM   4106  O OE1 . GLN B 1 69  ? 161.896 125.250 166.002 1.00 109.56 ? 69  GLN B OE1 1 
ATOM   4107  N NE2 . GLN B 1 69  ? 160.771 123.788 167.271 1.00 109.56 ? 69  GLN B NE2 1 
ATOM   4108  N N   . VAL B 1 70  ? 166.548 123.600 166.883 1.00 107.62 ? 70  VAL B N   1 
ATOM   4109  C CA  . VAL B 1 70  ? 167.559 124.426 166.239 1.00 107.62 ? 70  VAL B CA  1 
ATOM   4110  C C   . VAL B 1 70  ? 167.886 123.886 164.850 1.00 107.62 ? 70  VAL B C   1 
ATOM   4111  O O   . VAL B 1 70  ? 168.317 124.640 163.971 1.00 107.62 ? 70  VAL B O   1 
ATOM   4112  C CB  . VAL B 1 70  ? 168.796 124.498 167.152 1.00 107.62 ? 70  VAL B CB  1 
ATOM   4113  C CG1 . VAL B 1 70  ? 169.852 125.463 166.632 1.00 107.62 ? 70  VAL B CG1 1 
ATOM   4114  C CG2 . VAL B 1 70  ? 168.375 124.883 168.551 1.00 107.62 ? 70  VAL B CG2 1 
ATOM   4115  N N   . VAL B 1 71  ? 167.652 122.593 164.617 1.00 106.97 ? 71  VAL B N   1 
ATOM   4116  C CA  . VAL B 1 71  ? 167.930 121.996 163.314 1.00 106.97 ? 71  VAL B CA  1 
ATOM   4117  C C   . VAL B 1 71  ? 167.005 122.573 162.252 1.00 106.97 ? 71  VAL B C   1 
ATOM   4118  O O   . VAL B 1 71  ? 167.412 122.752 161.098 1.00 106.97 ? 71  VAL B O   1 
ATOM   4119  C CB  . VAL B 1 71  ? 167.807 120.463 163.410 1.00 106.97 ? 71  VAL B CB  1 
ATOM   4120  C CG1 . VAL B 1 71  ? 168.148 119.777 162.094 1.00 106.97 ? 71  VAL B CG1 1 
ATOM   4121  C CG2 . VAL B 1 71  ? 168.669 119.940 164.534 1.00 106.97 ? 71  VAL B CG2 1 
ATOM   4122  N N   . LYS B 1 72  ? 165.771 122.919 162.635 1.00 106.43 ? 72  LYS B N   1 
ATOM   4123  C CA  . LYS B 1 72  ? 164.831 123.575 161.734 1.00 106.43 ? 72  LYS B CA  1 
ATOM   4124  C C   . LYS B 1 72  ? 165.346 124.898 161.199 1.00 106.43 ? 72  LYS B C   1 
ATOM   4125  O O   . LYS B 1 72  ? 165.028 125.244 160.059 1.00 106.43 ? 72  LYS B O   1 
ATOM   4126  C CB  . LYS B 1 72  ? 163.518 123.882 162.434 1.00 106.43 ? 72  LYS B CB  1 
ATOM   4127  C CG  . LYS B 1 72  ? 162.667 122.746 162.867 1.00 106.43 ? 72  LYS B CG  1 
ATOM   4128  C CD  . LYS B 1 72  ? 161.431 123.386 163.423 1.00 106.43 ? 72  LYS B CD  1 
ATOM   4129  C CE  . LYS B 1 72  ? 160.501 122.419 164.061 1.00 106.43 ? 72  LYS B CE  1 
ATOM   4130  N NZ  . LYS B 1 72  ? 159.347 123.151 164.648 1.00 106.43 ? 72  LYS B NZ  1 
ATOM   4131  N N   . ILE B 1 73  ? 166.105 125.641 162.010 1.00 98.83  ? 73  ILE B N   1 
ATOM   4132  C CA  . ILE B 1 73  ? 166.643 126.928 161.593 1.00 98.83  ? 73  ILE B CA  1 
ATOM   4133  C C   . ILE B 1 73  ? 167.569 126.750 160.407 1.00 98.83  ? 73  ILE B C   1 
ATOM   4134  O O   . ILE B 1 73  ? 167.559 127.557 159.472 1.00 98.83  ? 73  ILE B O   1 
ATOM   4135  C CB  . ILE B 1 73  ? 167.374 127.592 162.767 1.00 98.83  ? 73  ILE B CB  1 
ATOM   4136  C CG1 . ILE B 1 73  ? 166.476 127.643 163.996 1.00 98.83  ? 73  ILE B CG1 1 
ATOM   4137  C CG2 . ILE B 1 73  ? 167.821 128.993 162.403 1.00 98.83  ? 73  ILE B CG2 1 
ATOM   4138  C CD1 . ILE B 1 73  ? 165.272 128.492 163.838 1.00 98.83  ? 73  ILE B CD1 1 
ATOM   4139  N N   . LEU B 1 74  ? 168.339 125.671 160.390 1.00 101.94 ? 74  LEU B N   1 
ATOM   4140  C CA  . LEU B 1 74  ? 169.172 125.401 159.232 1.00 101.94 ? 74  LEU B CA  1 
ATOM   4141  C C   . LEU B 1 74  ? 168.393 124.779 158.089 1.00 101.94 ? 74  LEU B C   1 
ATOM   4142  O O   . LEU B 1 74  ? 168.513 125.228 156.949 1.00 101.94 ? 74  LEU B O   1 
ATOM   4143  C CB  . LEU B 1 74  ? 170.333 124.483 159.602 1.00 101.94 ? 74  LEU B CB  1 
ATOM   4144  C CG  . LEU B 1 74  ? 171.602 125.141 160.130 1.00 101.94 ? 74  LEU B CG  1 
ATOM   4145  C CD1 . LEU B 1 74  ? 171.465 125.612 161.570 1.00 101.94 ? 74  LEU B CD1 1 
ATOM   4146  C CD2 . LEU B 1 74  ? 172.767 124.181 159.968 1.00 101.94 ? 74  LEU B CD2 1 
ATOM   4147  N N   . VAL B 1 75  ? 167.580 123.769 158.373 1.00 103.40 ? 75  VAL B N   1 
ATOM   4148  C CA  . VAL B 1 75  ? 167.082 122.916 157.305 1.00 103.40 ? 75  VAL B CA  1 
ATOM   4149  C C   . VAL B 1 75  ? 165.968 123.611 156.533 1.00 103.40 ? 75  VAL B C   1 
ATOM   4150  O O   . VAL B 1 75  ? 165.935 123.561 155.299 1.00 103.40 ? 75  VAL B O   1 
ATOM   4151  C CB  . VAL B 1 75  ? 166.644 121.559 157.876 1.00 103.40 ? 75  VAL B CB  1 
ATOM   4152  C CG1 . VAL B 1 75  ? 166.049 120.708 156.806 1.00 103.40 ? 75  VAL B CG1 1 
ATOM   4153  C CG2 . VAL B 1 75  ? 167.846 120.844 158.452 1.00 103.40 ? 75  VAL B CG2 1 
ATOM   4154  N N   . VAL B 1 76  ? 165.073 124.310 157.234 1.00 98.52  ? 76  VAL B N   1 
ATOM   4155  C CA  . VAL B 1 76  ? 163.957 124.970 156.557 1.00 98.52  ? 76  VAL B CA  1 
ATOM   4156  C C   . VAL B 1 76  ? 164.438 126.146 155.718 1.00 98.52  ? 76  VAL B C   1 
ATOM   4157  O O   . VAL B 1 76  ? 163.970 126.341 154.590 1.00 98.52  ? 76  VAL B O   1 
ATOM   4158  C CB  . VAL B 1 76  ? 162.899 125.400 157.585 1.00 98.52  ? 76  VAL B CB  1 
ATOM   4159  C CG1 . VAL B 1 76  ? 161.769 126.140 156.932 1.00 98.52  ? 76  VAL B CG1 1 
ATOM   4160  C CG2 . VAL B 1 76  ? 162.362 124.195 158.295 1.00 98.52  ? 76  VAL B CG2 1 
ATOM   4161  N N   . THR B 1 77  ? 165.407 126.905 156.225 1.00 92.14  ? 77  THR B N   1 
ATOM   4162  C CA  . THR B 1 77  ? 165.956 128.029 155.477 1.00 92.14  ? 77  THR B CA  1 
ATOM   4163  C C   . THR B 1 77  ? 166.702 127.557 154.234 1.00 92.14  ? 77  THR B C   1 
ATOM   4164  O O   . THR B 1 77  ? 166.568 128.148 153.157 1.00 92.14  ? 77  THR B O   1 
ATOM   4165  C CB  . THR B 1 77  ? 166.870 128.845 156.386 1.00 92.14  ? 77  THR B CB  1 
ATOM   4166  O OG1 . THR B 1 77  ? 166.118 129.291 157.513 1.00 92.14  ? 77  THR B OG1 1 
ATOM   4167  C CG2 . THR B 1 77  ? 167.403 130.050 155.671 1.00 92.14  ? 77  THR B CG2 1 
ATOM   4168  N N   . VAL B 1 78  ? 167.469 126.471 154.354 1.00 97.77  ? 78  VAL B N   1 
ATOM   4169  C CA  . VAL B 1 78  ? 168.141 125.921 153.181 1.00 97.77  ? 78  VAL B CA  1 
ATOM   4170  C C   . VAL B 1 78  ? 167.132 125.285 152.234 1.00 97.77  ? 78  VAL B C   1 
ATOM   4171  O O   . VAL B 1 78  ? 167.284 125.366 151.008 1.00 97.77  ? 78  VAL B O   1 
ATOM   4172  C CB  . VAL B 1 78  ? 169.245 124.946 153.626 1.00 97.77  ? 78  VAL B CB  1 
ATOM   4173  C CG1 . VAL B 1 78  ? 169.858 124.208 152.455 1.00 97.77  ? 78  VAL B CG1 1 
ATOM   4174  C CG2 . VAL B 1 78  ? 170.331 125.718 154.316 1.00 97.77  ? 78  VAL B CG2 1 
ATOM   4175  N N   . GLN B 1 79  ? 166.064 124.694 152.775 1.00 104.56 ? 79  GLN B N   1 
ATOM   4176  C CA  . GLN B 1 79  ? 164.931 124.303 151.943 1.00 104.56 ? 79  GLN B CA  1 
ATOM   4177  C C   . GLN B 1 79  ? 164.311 125.501 151.247 1.00 104.56 ? 79  GLN B C   1 
ATOM   4178  O O   . GLN B 1 79  ? 163.908 125.408 150.084 1.00 104.56 ? 79  GLN B O   1 
ATOM   4179  C CB  . GLN B 1 79  ? 163.888 123.571 152.789 1.00 104.56 ? 79  GLN B CB  1 
ATOM   4180  C CG  . GLN B 1 79  ? 162.550 123.316 152.120 1.00 104.56 ? 79  GLN B CG  1 
ATOM   4181  C CD  . GLN B 1 79  ? 162.669 122.528 150.840 1.00 104.56 ? 79  GLN B CD  1 
ATOM   4182  O OE1 . GLN B 1 79  ? 163.452 121.586 150.739 1.00 104.56 ? 79  GLN B OE1 1 
ATOM   4183  N NE2 . GLN B 1 79  ? 161.885 122.910 149.847 1.00 104.56 ? 79  GLN B NE2 1 
ATOM   4184  N N   . LEU B 1 80  ? 164.298 126.646 151.910 1.00 91.57  ? 80  LEU B N   1 
ATOM   4185  C CA  . LEU B 1 80  ? 163.754 127.856 151.322 1.00 91.57  ? 80  LEU B CA  1 
ATOM   4186  C C   . LEU B 1 80  ? 164.668 128.493 150.288 1.00 91.57  ? 80  LEU B C   1 
ATOM   4187  O O   . LEU B 1 80  ? 164.189 128.873 149.216 1.00 91.57  ? 80  LEU B O   1 
ATOM   4188  C CB  . LEU B 1 80  ? 163.424 128.848 152.435 1.00 91.57  ? 80  LEU B CB  1 
ATOM   4189  C CG  . LEU B 1 80  ? 162.889 130.208 152.041 1.00 91.57  ? 80  LEU B CG  1 
ATOM   4190  C CD1 . LEU B 1 80  ? 161.743 130.574 152.919 1.00 91.57  ? 80  LEU B CD1 1 
ATOM   4191  C CD2 . LEU B 1 80  ? 163.976 131.253 152.225 1.00 91.57  ? 80  LEU B CD2 1 
ATOM   4192  N N   . ILE B 1 81  ? 165.963 128.622 150.575 1.00 83.23  ? 81  ILE B N   1 
ATOM   4193  C CA  . ILE B 1 81  ? 166.845 129.389 149.700 1.00 83.23  ? 81  ILE B CA  1 
ATOM   4194  C C   . ILE B 1 81  ? 167.083 128.654 148.391 1.00 83.23  ? 81  ILE B C   1 
ATOM   4195  O O   . ILE B 1 81  ? 167.019 129.247 147.309 1.00 83.23  ? 81  ILE B O   1 
ATOM   4196  C CB  . ILE B 1 81  ? 168.163 129.714 150.418 1.00 83.23  ? 81  ILE B CB  1 
ATOM   4197  C CG1 . ILE B 1 81  ? 167.902 130.689 151.554 1.00 83.23  ? 81  ILE B CG1 1 
ATOM   4198  C CG2 . ILE B 1 81  ? 169.178 130.300 149.466 1.00 83.23  ? 81  ILE B CG2 1 
ATOM   4199  C CD1 . ILE B 1 81  ? 169.102 130.940 152.402 1.00 83.23  ? 81  ILE B CD1 1 
ATOM   4200  N N   . LEU B 1 82  ? 167.297 127.348 148.452 1.00 88.91  ? 82  LEU B N   1 
ATOM   4201  C CA  . LEU B 1 82  ? 167.450 126.613 147.206 1.00 88.91  ? 82  LEU B CA  1 
ATOM   4202  C C   . LEU B 1 82  ? 166.126 126.298 146.536 1.00 88.91  ? 82  LEU B C   1 
ATOM   4203  O O   . LEU B 1 82  ? 166.122 125.655 145.485 1.00 88.91  ? 82  LEU B O   1 
ATOM   4204  C CB  . LEU B 1 82  ? 168.249 125.329 147.418 1.00 88.91  ? 82  LEU B CB  1 
ATOM   4205  C CG  . LEU B 1 82  ? 169.774 125.488 147.337 1.00 88.91  ? 82  LEU B CG  1 
ATOM   4206  C CD1 . LEU B 1 82  ? 170.385 126.035 148.615 1.00 88.91  ? 82  LEU B CD1 1 
ATOM   4207  C CD2 . LEU B 1 82  ? 170.445 124.190 146.928 1.00 88.91  ? 82  LEU B CD2 1 
ATOM   4208  N N   . PHE B 1 83  ? 165.006 126.726 147.112 1.00 86.05  ? 83  PHE B N   1 
ATOM   4209  C CA  . PHE B 1 83  ? 163.767 126.780 146.352 1.00 86.05  ? 83  PHE B CA  1 
ATOM   4210  C C   . PHE B 1 83  ? 163.639 128.095 145.602 1.00 86.05  ? 83  PHE B C   1 
ATOM   4211  O O   . PHE B 1 83  ? 163.139 128.122 144.473 1.00 86.05  ? 83  PHE B O   1 
ATOM   4212  C CB  . PHE B 1 83  ? 162.569 126.579 147.273 1.00 86.05  ? 83  PHE B CB  1 
ATOM   4213  C CG  . PHE B 1 83  ? 161.259 126.778 146.596 1.00 86.05  ? 83  PHE B CG  1 
ATOM   4214  C CD1 . PHE B 1 83  ? 160.830 125.896 145.630 1.00 86.05  ? 83  PHE B CD1 1 
ATOM   4215  C CD2 . PHE B 1 83  ? 160.447 127.839 146.938 1.00 86.05  ? 83  PHE B CD2 1 
ATOM   4216  C CE1 . PHE B 1 83  ? 159.625 126.081 145.001 1.00 86.05  ? 83  PHE B CE1 1 
ATOM   4217  C CE2 . PHE B 1 83  ? 159.238 128.027 146.318 1.00 86.05  ? 83  PHE B CE2 1 
ATOM   4218  C CZ  . PHE B 1 83  ? 158.827 127.149 145.349 1.00 86.05  ? 83  PHE B CZ  1 
ATOM   4219  N N   . GLY B 1 84  ? 164.096 129.184 146.205 1.00 86.03  ? 84  GLY B N   1 
ATOM   4220  C CA  . GLY B 1 84  ? 163.962 130.491 145.603 1.00 86.03  ? 84  GLY B CA  1 
ATOM   4221  C C   . GLY B 1 84  ? 164.844 130.693 144.394 1.00 86.03  ? 84  GLY B C   1 
ATOM   4222  O O   . GLY B 1 84  ? 164.406 131.275 143.402 1.00 86.03  ? 84  GLY B O   1 
ATOM   4223  N N   . LEU B 1 85  ? 166.079 130.200 144.453 1.00 83.92  ? 85  LEU B N   1 
ATOM   4224  C CA  . LEU B 1 85  ? 167.007 130.415 143.353 1.00 83.92  ? 85  LEU B CA  1 
ATOM   4225  C C   . LEU B 1 85  ? 166.640 129.625 142.108 1.00 83.92  ? 85  LEU B C   1 
ATOM   4226  O O   . LEU B 1 85  ? 166.856 130.114 140.998 1.00 83.92  ? 85  LEU B O   1 
ATOM   4227  C CB  . LEU B 1 85  ? 168.422 130.073 143.793 1.00 83.92  ? 85  LEU B CB  1 
ATOM   4228  C CG  . LEU B 1 85  ? 168.970 131.093 144.779 1.00 83.92  ? 85  LEU B CG  1 
ATOM   4229  C CD1 . LEU B 1 85  ? 170.309 130.656 145.303 1.00 83.92  ? 85  LEU B CD1 1 
ATOM   4230  C CD2 . LEU B 1 85  ? 169.096 132.418 144.081 1.00 83.92  ? 85  LEU B CD2 1 
ATOM   4231  N N   . SER B 1 86  ? 166.081 128.436 142.257 1.00 86.47  ? 86  SER B N   1 
ATOM   4232  C CA  . SER B 1 86  ? 165.574 127.709 141.107 1.00 86.47  ? 86  SER B CA  1 
ATOM   4233  C C   . SER B 1 86  ? 164.296 128.316 140.565 1.00 86.47  ? 86  SER B C   1 
ATOM   4234  O O   . SER B 1 86  ? 163.990 128.131 139.385 1.00 86.47  ? 86  SER B O   1 
ATOM   4235  C CB  . SER B 1 86  ? 165.322 126.248 141.471 1.00 86.47  ? 86  SER B CB  1 
ATOM   4236  O OG  . SER B 1 86  ? 164.260 126.143 142.401 1.00 86.47  ? 86  SER B OG  1 
ATOM   4237  N N   . ASN B 1 87  ? 163.552 129.037 141.393 1.00 85.30  ? 87  ASN B N   1 
ATOM   4238  C CA  . ASN B 1 87  ? 162.329 129.689 140.961 1.00 85.30  ? 87  ASN B CA  1 
ATOM   4239  C C   . ASN B 1 87  ? 162.581 131.062 140.362 1.00 85.30  ? 87  ASN B C   1 
ATOM   4240  O O   . ASN B 1 87  ? 161.890 131.440 139.416 1.00 85.30  ? 87  ASN B O   1 
ATOM   4241  C CB  . ASN B 1 87  ? 161.368 129.827 142.142 1.00 85.30  ? 87  ASN B CB  1 
ATOM   4242  C CG  . ASN B 1 87  ? 159.951 130.128 141.716 1.00 85.30  ? 87  ASN B CG  1 
ATOM   4243  O OD1 . ASN B 1 87  ? 159.629 130.144 140.535 1.00 85.30  ? 87  ASN B OD1 1 
ATOM   4244  N ND2 . ASN B 1 87  ? 159.094 130.387 142.688 1.00 85.30  ? 87  ASN B ND2 1 
ATOM   4245  N N   . GLN B 1 88  ? 163.555 131.806 140.891 1.00 86.35  ? 88  GLN B N   1 
ATOM   4246  C CA  . GLN B 1 88  ? 163.872 133.133 140.368 1.00 86.35  ? 88  GLN B CA  1 
ATOM   4247  C C   . GLN B 1 88  ? 164.362 133.067 138.933 1.00 86.35  ? 88  GLN B C   1 
ATOM   4248  O O   . GLN B 1 88  ? 163.951 133.870 138.090 1.00 86.35  ? 88  GLN B O   1 
ATOM   4249  C CB  . GLN B 1 88  ? 164.933 133.796 141.241 1.00 86.35  ? 88  GLN B CB  1 
ATOM   4250  C CG  . GLN B 1 88  ? 165.430 135.122 140.713 1.00 86.35  ? 88  GLN B CG  1 
ATOM   4251  C CD  . GLN B 1 88  ? 166.546 135.704 141.550 1.00 86.35  ? 88  GLN B CD  1 
ATOM   4252  O OE1 . GLN B 1 88  ? 166.931 135.142 142.573 1.00 86.35  ? 88  GLN B OE1 1 
ATOM   4253  N NE2 . GLN B 1 88  ? 167.099 136.821 141.096 1.00 86.35  ? 88  GLN B NE2 1 
ATOM   4254  N N   . LEU B 1 89  ? 165.217 132.095 138.634 1.00 87.06  ? 89  LEU B N   1 
ATOM   4255  C CA  . LEU B 1 89  ? 165.833 132.004 137.321 1.00 87.06  ? 89  LEU B CA  1 
ATOM   4256  C C   . LEU B 1 89  ? 164.822 131.633 136.248 1.00 87.06  ? 89  LEU B C   1 
ATOM   4257  O O   . LEU B 1 89  ? 165.015 131.971 135.078 1.00 87.06  ? 89  LEU B O   1 
ATOM   4258  C CB  . LEU B 1 89  ? 166.975 130.994 137.375 1.00 87.06  ? 89  LEU B CB  1 
ATOM   4259  C CG  . LEU B 1 89  ? 167.925 130.857 136.194 1.00 87.06  ? 89  LEU B CG  1 
ATOM   4260  C CD1 . LEU B 1 89  ? 168.612 132.177 135.943 1.00 87.06  ? 89  LEU B CD1 1 
ATOM   4261  C CD2 . LEU B 1 89  ? 168.951 129.788 136.498 1.00 87.06  ? 89  LEU B CD2 1 
ATOM   4262  N N   . ALA B 1 90  ? 163.731 130.981 136.624 1.00 85.32  ? 90  ALA B N   1 
ATOM   4263  C CA  . ALA B 1 90  ? 162.662 130.702 135.682 1.00 85.32  ? 90  ALA B CA  1 
ATOM   4264  C C   . ALA B 1 90  ? 161.727 131.880 135.486 1.00 85.32  ? 90  ALA B C   1 
ATOM   4265  O O   . ALA B 1 90  ? 161.040 131.943 134.464 1.00 85.32  ? 90  ALA B O   1 
ATOM   4266  C CB  . ALA B 1 90  ? 161.850 129.495 136.146 1.00 85.32  ? 90  ALA B CB  1 
ATOM   4267  N N   . VAL B 1 91  ? 161.669 132.807 136.439 1.00 83.10  ? 91  VAL B N   1 
ATOM   4268  C CA  . VAL B 1 91  ? 160.799 133.963 136.274 1.00 83.10  ? 91  VAL B CA  1 
ATOM   4269  C C   . VAL B 1 91  ? 161.409 134.944 135.287 1.00 83.10  ? 91  VAL B C   1 
ATOM   4270  O O   . VAL B 1 91  ? 160.710 135.498 134.431 1.00 83.10  ? 91  VAL B O   1 
ATOM   4271  C CB  . VAL B 1 91  ? 160.517 134.611 137.640 1.00 83.10  ? 91  VAL B CB  1 
ATOM   4272  C CG1 . VAL B 1 91  ? 159.767 135.912 137.490 1.00 83.10  ? 91  VAL B CG1 1 
ATOM   4273  C CG2 . VAL B 1 91  ? 159.694 133.680 138.476 1.00 83.10  ? 91  VAL B CG2 1 
ATOM   4274  N N   . THR B 1 92  ? 162.726 135.143 135.358 1.00 84.26  ? 92  THR B N   1 
ATOM   4275  C CA  . THR B 1 92  ? 163.374 136.068 134.440 1.00 84.26  ? 92  THR B CA  1 
ATOM   4276  C C   . THR B 1 92  ? 163.349 135.551 133.014 1.00 84.26  ? 92  THR B C   1 
ATOM   4277  O O   . THR B 1 92  ? 163.407 136.343 132.077 1.00 84.26  ? 92  THR B O   1 
ATOM   4278  C CB  . THR B 1 92  ? 164.810 136.329 134.867 1.00 84.26  ? 92  THR B CB  1 
ATOM   4279  O OG1 . THR B 1 92  ? 165.568 135.129 134.717 1.00 84.26  ? 92  THR B OG1 1 
ATOM   4280  C CG2 . THR B 1 92  ? 164.849 136.741 136.315 1.00 84.26  ? 92  THR B CG2 1 
ATOM   4281  N N   . PHE B 1 93  ? 163.243 134.240 132.823 1.00 85.24  ? 93  PHE B N   1 
ATOM   4282  C CA  . PHE B 1 93  ? 162.971 133.744 131.484 1.00 85.24  ? 93  PHE B CA  1 
ATOM   4283  C C   . PHE B 1 93  ? 161.523 133.984 131.092 1.00 85.24  ? 93  PHE B C   1 
ATOM   4284  O O   . PHE B 1 93  ? 161.230 134.177 129.912 1.00 85.24  ? 93  PHE B O   1 
ATOM   4285  C CB  . PHE B 1 93  ? 163.305 132.263 131.387 1.00 85.24  ? 93  PHE B CB  1 
ATOM   4286  C CG  . PHE B 1 93  ? 163.135 131.703 130.019 1.00 85.24  ? 93  PHE B CG  1 
ATOM   4287  C CD1 . PHE B 1 93  ? 164.071 131.958 129.044 1.00 85.24  ? 93  PHE B CD1 1 
ATOM   4288  C CD2 . PHE B 1 93  ? 162.041 130.926 129.705 1.00 85.24  ? 93  PHE B CD2 1 
ATOM   4289  C CE1 . PHE B 1 93  ? 163.920 131.446 127.784 1.00 85.24  ? 93  PHE B CE1 1 
ATOM   4290  C CE2 . PHE B 1 93  ? 161.886 130.417 128.443 1.00 85.24  ? 93  PHE B CE2 1 
ATOM   4291  C CZ  . PHE B 1 93  ? 162.824 130.674 127.484 1.00 85.24  ? 93  PHE B CZ  1 
ATOM   4292  N N   . ARG B 1 94  ? 160.604 133.974 132.054 1.00 82.56  ? 94  ARG B N   1 
ATOM   4293  C CA  . ARG B 1 94  ? 159.208 134.232 131.723 1.00 82.56  ? 94  ARG B CA  1 
ATOM   4294  C C   . ARG B 1 94  ? 158.979 135.696 131.404 1.00 82.56  ? 94  ARG B C   1 
ATOM   4295  O O   . ARG B 1 94  ? 158.333 136.021 130.408 1.00 82.56  ? 94  ARG B O   1 
ATOM   4296  C CB  . ARG B 1 94  ? 158.293 133.803 132.867 1.00 82.56  ? 94  ARG B CB  1 
ATOM   4297  C CG  . ARG B 1 94  ? 156.806 134.058 132.613 1.00 82.56  ? 94  ARG B CG  1 
ATOM   4298  C CD  . ARG B 1 94  ? 155.938 133.624 133.798 1.00 82.56  ? 94  ARG B CD  1 
ATOM   4299  N NE  . ARG B 1 94  ? 156.012 132.186 134.030 1.00 82.56  ? 94  ARG B NE  1 
ATOM   4300  C CZ  . ARG B 1 94  ? 156.574 131.631 135.096 1.00 82.56  ? 94  ARG B CZ  1 
ATOM   4301  N NH1 . ARG B 1 94  ? 157.106 132.397 136.032 1.00 82.56  ? 94  ARG B NH1 1 
ATOM   4302  N NH2 . ARG B 1 94  ? 156.608 130.313 135.228 1.00 82.56  ? 94  ARG B NH2 1 
ATOM   4303  N N   . GLU B 1 95  ? 159.511 136.597 132.222 1.00 83.70  ? 95  GLU B N   1 
ATOM   4304  C CA  . GLU B 1 95  ? 159.208 138.009 132.076 1.00 83.70  ? 95  GLU B CA  1 
ATOM   4305  C C   . GLU B 1 95  ? 160.117 138.709 131.088 1.00 83.70  ? 95  GLU B C   1 
ATOM   4306  O O   . GLU B 1 95  ? 160.091 139.937 131.016 1.00 83.70  ? 95  GLU B O   1 
ATOM   4307  C CB  . GLU B 1 95  ? 159.279 138.726 133.423 1.00 83.70  ? 95  GLU B CB  1 
ATOM   4308  C CG  . GLU B 1 95  ? 160.671 138.856 134.013 1.00 83.70  ? 95  GLU B CG  1 
ATOM   4309  C CD  . GLU B 1 95  ? 160.673 139.619 135.329 1.00 83.70  ? 95  GLU B CD  1 
ATOM   4310  O OE1 . GLU B 1 95  ? 159.579 139.992 135.800 1.00 83.70  ? 95  GLU B OE1 1 
ATOM   4311  O OE2 . GLU B 1 95  ? 161.766 139.861 135.886 1.00 83.70  ? 95  GLU B OE2 1 
ATOM   4312  N N   . GLU B 1 96  ? 160.915 137.975 130.319 1.00 80.91  ? 96  GLU B N   1 
ATOM   4313  C CA  . GLU B 1 96  ? 161.736 138.603 129.298 1.00 80.91  ? 96  GLU B CA  1 
ATOM   4314  C C   . GLU B 1 96  ? 161.376 138.119 127.903 1.00 80.91  ? 96  GLU B C   1 
ATOM   4315  O O   . GLU B 1 96  ? 161.670 138.805 126.925 1.00 80.91  ? 96  GLU B O   1 
ATOM   4316  C CB  . GLU B 1 96  ? 163.215 138.376 129.598 1.00 80.91  ? 96  GLU B CB  1 
ATOM   4317  C CG  . GLU B 1 96  ? 164.160 139.307 128.881 1.00 80.91  ? 96  GLU B CG  1 
ATOM   4318  C CD  . GLU B 1 96  ? 165.589 139.153 129.343 1.00 80.91  ? 96  GLU B CD  1 
ATOM   4319  O OE1 . GLU B 1 96  ? 165.856 138.255 130.166 1.00 80.91  ? 96  GLU B OE1 1 
ATOM   4320  O OE2 . GLU B 1 96  ? 166.447 139.950 128.900 1.00 80.91  ? 96  GLU B OE2 1 
ATOM   4321  N N   . ASN B 1 97  ? 160.701 136.981 127.777 1.00 77.04  ? 97  ASN B N   1 
ATOM   4322  C CA  . ASN B 1 97  ? 160.102 136.650 126.497 1.00 77.04  ? 97  ASN B CA  1 
ATOM   4323  C C   . ASN B 1 97  ? 158.860 137.464 126.198 1.00 77.04  ? 97  ASN B C   1 
ATOM   4324  O O   . ASN B 1 97  ? 158.526 137.636 125.025 1.00 77.04  ? 97  ASN B O   1 
ATOM   4325  C CB  . ASN B 1 97  ? 159.743 135.163 126.411 1.00 77.04  ? 97  ASN B CB  1 
ATOM   4326  C CG  . ASN B 1 97  ? 160.954 134.282 126.289 1.00 77.04  ? 97  ASN B CG  1 
ATOM   4327  O OD1 . ASN B 1 97  ? 161.213 133.444 127.141 1.00 77.04  ? 97  ASN B OD1 1 
ATOM   4328  N ND2 . ASN B 1 97  ? 161.705 134.463 125.217 1.00 77.04  ? 97  ASN B ND2 1 
ATOM   4329  N N   . THR B 1 98  ? 158.174 137.968 127.217 1.00 72.12  ? 98  THR B N   1 
ATOM   4330  C CA  . THR B 1 98  ? 157.040 138.839 126.961 1.00 72.12  ? 98  THR B CA  1 
ATOM   4331  C C   . THR B 1 98  ? 157.505 140.195 126.472 1.00 72.12  ? 98  THR B C   1 
ATOM   4332  O O   . THR B 1 98  ? 156.908 140.768 125.554 1.00 72.12  ? 98  THR B O   1 
ATOM   4333  C CB  . THR B 1 98  ? 156.231 139.014 128.223 1.00 72.12  ? 98  THR B CB  1 
ATOM   4334  O OG1 . THR B 1 98  ? 157.008 139.773 129.148 1.00 72.12  ? 98  THR B OG1 1 
ATOM   4335  C CG2 . THR B 1 98  ? 155.988 137.691 128.828 1.00 72.12  ? 98  THR B CG2 1 
ATOM   4336  N N   . ILE B 1 99  ? 158.567 140.722 127.086 1.00 70.46  ? 99  ILE B N   1 
ATOM   4337  C CA  . ILE B 1 99  ? 159.195 141.960 126.640 1.00 70.46  ? 99  ILE B CA  1 
ATOM   4338  C C   . ILE B 1 99  ? 159.715 141.805 125.227 1.00 70.46  ? 99  ILE B C   1 
ATOM   4339  O O   . ILE B 1 99  ? 159.683 142.752 124.434 1.00 70.46  ? 99  ILE B O   1 
ATOM   4340  C CB  . ILE B 1 99  ? 160.310 142.348 127.621 1.00 70.46  ? 99  ILE B CB  1 
ATOM   4341  C CG1 . ILE B 1 99  ? 159.732 142.493 129.016 1.00 70.46  ? 99  ILE B CG1 1 
ATOM   4342  C CG2 . ILE B 1 99  ? 160.976 143.635 127.233 1.00 70.46  ? 99  ILE B CG2 1 
ATOM   4343  C CD1 . ILE B 1 99  ? 158.657 143.531 129.121 1.00 70.46  ? 99  ILE B CD1 1 
ATOM   4344  N N   . ALA B 1 100 ? 160.164 140.606 124.873 1.00 68.32  ? 100 ALA B N   1 
ATOM   4345  C CA  . ALA B 1 100 ? 160.449 140.327 123.482 1.00 68.32  ? 100 ALA B CA  1 
ATOM   4346  C C   . ALA B 1 100 ? 159.194 140.339 122.636 1.00 68.32  ? 100 ALA B C   1 
ATOM   4347  O O   . ALA B 1 100 ? 159.228 140.849 121.515 1.00 68.32  ? 100 ALA B O   1 
ATOM   4348  C CB  . ALA B 1 100 ? 161.145 138.982 123.356 1.00 68.32  ? 100 ALA B CB  1 
ATOM   4349  N N   . PHE B 1 101 ? 158.087 139.826 123.150 1.00 67.70  ? 101 PHE B N   1 
ATOM   4350  C CA  . PHE B 1 101 ? 156.896 139.714 122.326 1.00 67.70  ? 101 PHE B CA  1 
ATOM   4351  C C   . PHE B 1 101 ? 156.224 141.045 122.080 1.00 67.70  ? 101 PHE B C   1 
ATOM   4352  O O   . PHE B 1 101 ? 155.619 141.228 121.022 1.00 67.70  ? 101 PHE B O   1 
ATOM   4353  C CB  . PHE B 1 101 ? 155.897 138.753 122.959 1.00 67.70  ? 101 PHE B CB  1 
ATOM   4354  C CG  . PHE B 1 101 ? 156.311 137.324 122.876 1.00 67.70  ? 101 PHE B CG  1 
ATOM   4355  C CD1 . PHE B 1 101 ? 157.248 136.916 121.953 1.00 67.70  ? 101 PHE B CD1 1 
ATOM   4356  C CD2 . PHE B 1 101 ? 155.787 136.394 123.743 1.00 67.70  ? 101 PHE B CD2 1 
ATOM   4357  C CE1 . PHE B 1 101 ? 157.638 135.611 121.888 1.00 67.70  ? 101 PHE B CE1 1 
ATOM   4358  C CE2 . PHE B 1 101 ? 156.176 135.089 123.678 1.00 67.70  ? 101 PHE B CE2 1 
ATOM   4359  C CZ  . PHE B 1 101 ? 157.102 134.698 122.751 1.00 67.70  ? 101 PHE B CZ  1 
ATOM   4360  N N   . ARG B 1 102 ? 156.324 141.981 123.016 1.00 69.18  ? 102 ARG B N   1 
ATOM   4361  C CA  . ARG B 1 102 ? 155.689 143.272 122.808 1.00 69.18  ? 102 ARG B CA  1 
ATOM   4362  C C   . ARG B 1 102 ? 156.417 144.089 121.763 1.00 69.18  ? 102 ARG B C   1 
ATOM   4363  O O   . ARG B 1 102 ? 155.790 144.887 121.065 1.00 69.18  ? 102 ARG B O   1 
ATOM   4364  C CB  . ARG B 1 102 ? 155.623 144.043 124.113 1.00 69.18  ? 102 ARG B CB  1 
ATOM   4365  C CG  . ARG B 1 102 ? 154.764 143.367 125.114 1.00 69.18  ? 102 ARG B CG  1 
ATOM   4366  C CD  . ARG B 1 102 ? 154.751 144.088 126.414 1.00 69.18  ? 102 ARG B CD  1 
ATOM   4367  N NE  . ARG B 1 102 ? 154.028 143.299 127.388 1.00 69.18  ? 102 ARG B NE  1 
ATOM   4368  C CZ  . ARG B 1 102 ? 153.926 143.617 128.664 1.00 69.18  ? 102 ARG B CZ  1 
ATOM   4369  N NH1 . ARG B 1 102 ? 154.504 144.718 129.114 1.00 69.18  ? 102 ARG B NH1 1 
ATOM   4370  N NH2 . ARG B 1 102 ? 153.253 142.834 129.487 1.00 69.18  ? 102 ARG B NH2 1 
ATOM   4371  N N   . HIS B 1 103 ? 157.719 143.891 121.623 1.00 63.89  ? 103 HIS B N   1 
ATOM   4372  C CA  . HIS B 1 103 ? 158.469 144.544 120.565 1.00 63.89  ? 103 HIS B CA  1 
ATOM   4373  C C   . HIS B 1 103 ? 158.351 143.840 119.228 1.00 63.89  ? 103 HIS B C   1 
ATOM   4374  O O   . HIS B 1 103 ? 158.997 144.264 118.269 1.00 63.89  ? 103 HIS B O   1 
ATOM   4375  C CB  . HIS B 1 103 ? 159.931 144.650 120.957 1.00 63.89  ? 103 HIS B CB  1 
ATOM   4376  C CG  . HIS B 1 103 ? 160.188 145.675 122.004 1.00 63.89  ? 103 HIS B CG  1 
ATOM   4377  N ND1 . HIS B 1 103 ? 160.227 147.018 121.721 1.00 63.89  ? 103 HIS B ND1 1 
ATOM   4378  C CD2 . HIS B 1 103 ? 160.402 145.561 123.332 1.00 63.89  ? 103 HIS B CD2 1 
ATOM   4379  C CE1 . HIS B 1 103 ? 160.470 147.690 122.830 1.00 63.89  ? 103 HIS B CE1 1 
ATOM   4380  N NE2 . HIS B 1 103 ? 160.581 146.828 123.822 1.00 63.89  ? 103 HIS B NE2 1 
ATOM   4381  N N   . LEU B 1 104 ? 157.564 142.787 119.137 1.00 59.96  ? 104 LEU B N   1 
ATOM   4382  C CA  . LEU B 1 104 ? 157.332 142.119 117.875 1.00 59.96  ? 104 LEU B CA  1 
ATOM   4383  C C   . LEU B 1 104 ? 155.884 142.125 117.448 1.00 59.96  ? 104 LEU B C   1 
ATOM   4384  O O   . LEU B 1 104 ? 155.612 141.972 116.264 1.00 59.96  ? 104 LEU B O   1 
ATOM   4385  C CB  . LEU B 1 104 ? 157.806 140.667 117.941 1.00 59.96  ? 104 LEU B CB  1 
ATOM   4386  C CG  . LEU B 1 104 ? 159.305 140.482 118.094 1.00 59.96  ? 104 LEU B CG  1 
ATOM   4387  C CD1 . LEU B 1 104 ? 159.644 139.020 118.227 1.00 59.96  ? 104 LEU B CD1 1 
ATOM   4388  C CD2 . LEU B 1 104 ? 160.001 141.074 116.910 1.00 59.96  ? 104 LEU B CD2 1 
ATOM   4389  N N   . PHE B 1 105 ? 154.951 142.300 118.371 1.00 64.53  ? 105 PHE B N   1 
ATOM   4390  C CA  . PHE B 1 105 ? 153.545 142.077 118.092 1.00 64.53  ? 105 PHE B CA  1 
ATOM   4391  C C   . PHE B 1 105 ? 152.681 143.304 118.309 1.00 64.53  ? 105 PHE B C   1 
ATOM   4392  O O   . PHE B 1 105 ? 151.473 143.232 118.091 1.00 64.53  ? 105 PHE B O   1 
ATOM   4393  C CB  . PHE B 1 105 ? 153.038 140.935 118.965 1.00 64.53  ? 105 PHE B CB  1 
ATOM   4394  C CG  . PHE B 1 105 ? 153.600 139.610 118.596 1.00 64.53  ? 105 PHE B CG  1 
ATOM   4395  C CD1 . PHE B 1 105 ? 153.924 139.324 117.294 1.00 64.53  ? 105 PHE B CD1 1 
ATOM   4396  C CD2 . PHE B 1 105 ? 153.888 138.680 119.567 1.00 64.53  ? 105 PHE B CD2 1 
ATOM   4397  C CE1 . PHE B 1 105 ? 154.459 138.106 116.961 1.00 64.53  ? 105 PHE B CE1 1 
ATOM   4398  C CE2 . PHE B 1 105 ? 154.439 137.469 119.239 1.00 64.53  ? 105 PHE B CE2 1 
ATOM   4399  C CZ  . PHE B 1 105 ? 154.719 137.181 117.937 1.00 64.53  ? 105 PHE B CZ  1 
ATOM   4400  N N   . LEU B 1 106 ? 153.250 144.417 118.744 1.00 62.97  ? 106 LEU B N   1 
ATOM   4401  C CA  . LEU B 1 106 ? 152.486 145.623 119.004 1.00 62.97  ? 106 LEU B CA  1 
ATOM   4402  C C   . LEU B 1 106 ? 153.051 146.761 118.177 1.00 62.97  ? 106 LEU B C   1 
ATOM   4403  O O   . LEU B 1 106 ? 154.238 147.076 118.273 1.00 62.97  ? 106 LEU B O   1 
ATOM   4404  C CB  . LEU B 1 106 ? 152.529 145.987 120.470 1.00 62.97  ? 106 LEU B CB  1 
ATOM   4405  C CG  . LEU B 1 106 ? 151.946 144.926 121.381 1.00 62.97  ? 106 LEU B CG  1 
ATOM   4406  C CD1 . LEU B 1 106 ? 152.036 145.374 122.806 1.00 62.97  ? 106 LEU B CD1 1 
ATOM   4407  C CD2 . LEU B 1 106 ? 150.533 144.662 120.995 1.00 62.97  ? 106 LEU B CD2 1 
ATOM   4408  N N   . LEU B 1 107 ? 152.200 147.384 117.374 1.00 63.46  ? 107 LEU B N   1 
ATOM   4409  C CA  . LEU B 1 107 ? 152.664 148.349 116.388 1.00 63.46  ? 107 LEU B CA  1 
ATOM   4410  C C   . LEU B 1 107 ? 153.007 149.659 117.072 1.00 63.46  ? 107 LEU B C   1 
ATOM   4411  O O   . LEU B 1 107 ? 152.118 150.374 117.536 1.00 63.46  ? 107 LEU B O   1 
ATOM   4412  C CB  . LEU B 1 107 ? 151.607 148.575 115.320 1.00 63.46  ? 107 LEU B CB  1 
ATOM   4413  C CG  . LEU B 1 107 ? 152.116 149.500 114.230 1.00 63.46  ? 107 LEU B CG  1 
ATOM   4414  C CD1 . LEU B 1 107 ? 153.252 148.830 113.502 1.00 63.46  ? 107 LEU B CD1 1 
ATOM   4415  C CD2 . LEU B 1 107 ? 150.999 149.859 113.283 1.00 63.46  ? 107 LEU B CD2 1 
ATOM   4416  N N   . GLY B 1 108 ? 154.293 149.982 117.120 1.00 71.03  ? 108 GLY B N   1 
ATOM   4417  C CA  . GLY B 1 108 ? 154.716 151.250 117.669 1.00 71.03  ? 108 GLY B CA  1 
ATOM   4418  C C   . GLY B 1 108 ? 154.871 151.274 119.166 1.00 71.03  ? 108 GLY B C   1 
ATOM   4419  O O   . GLY B 1 108 ? 154.603 152.303 119.787 1.00 71.03  ? 108 GLY B O   1 
ATOM   4420  N N   . TYR B 1 109 ? 155.287 150.171 119.770 1.00 75.20  ? 109 TYR B N   1 
ATOM   4421  C CA  . TYR B 1 109 ? 155.418 150.087 121.218 1.00 75.20  ? 109 TYR B CA  1 
ATOM   4422  C C   . TYR B 1 109 ? 156.845 150.407 121.602 1.00 75.20  ? 109 TYR B C   1 
ATOM   4423  O O   . TYR B 1 109 ? 157.749 149.603 121.393 1.00 75.20  ? 109 TYR B O   1 
ATOM   4424  C CB  . TYR B 1 109 ? 155.035 148.702 121.706 1.00 75.20  ? 109 TYR B CB  1 
ATOM   4425  C CG  . TYR B 1 109 ? 155.245 148.469 123.177 1.00 75.20  ? 109 TYR B CG  1 
ATOM   4426  C CD1 . TYR B 1 109 ? 154.364 148.968 124.110 1.00 75.20  ? 109 TYR B CD1 1 
ATOM   4427  C CD2 . TYR B 1 109 ? 156.319 147.727 123.629 1.00 75.20  ? 109 TYR B CD2 1 
ATOM   4428  C CE1 . TYR B 1 109 ? 154.554 148.740 125.453 1.00 75.20  ? 109 TYR B CE1 1 
ATOM   4429  C CE2 . TYR B 1 109 ? 156.515 147.500 124.963 1.00 75.20  ? 109 TYR B CE2 1 
ATOM   4430  C CZ  . TYR B 1 109 ? 155.632 148.006 125.869 1.00 75.20  ? 109 TYR B CZ  1 
ATOM   4431  O OH  . TYR B 1 109 ? 155.834 147.770 127.202 1.00 75.20  ? 109 TYR B OH  1 
ATOM   4432  N N   . SER B 1 110 ? 157.055 151.577 122.179 1.00 83.94  ? 110 SER B N   1 
ATOM   4433  C CA  . SER B 1 110 ? 158.323 151.821 122.833 1.00 83.94  ? 110 SER B CA  1 
ATOM   4434  C C   . SER B 1 110 ? 158.270 151.274 124.252 1.00 83.94  ? 110 SER B C   1 
ATOM   4435  O O   . SER B 1 110 ? 157.258 150.729 124.696 1.00 83.94  ? 110 SER B O   1 
ATOM   4436  C CB  . SER B 1 110 ? 158.646 153.306 122.832 1.00 83.94  ? 110 SER B CB  1 
ATOM   4437  O OG  . SER B 1 110 ? 157.684 154.010 123.585 1.00 83.94  ? 110 SER B OG  1 
ATOM   4438  N N   . ASP B 1 111 ? 159.376 151.415 124.970 1.00 90.55  ? 111 ASP B N   1 
ATOM   4439  C CA  . ASP B 1 111 ? 159.430 150.877 126.317 1.00 90.55  ? 111 ASP B CA  1 
ATOM   4440  C C   . ASP B 1 111 ? 158.645 151.750 127.284 1.00 90.55  ? 111 ASP B C   1 
ATOM   4441  O O   . ASP B 1 111 ? 158.255 152.877 126.979 1.00 90.55  ? 111 ASP B O   1 
ATOM   4442  C CB  . ASP B 1 111 ? 160.872 150.750 126.792 1.00 90.55  ? 111 ASP B CB  1 
ATOM   4443  C CG  . ASP B 1 111 ? 161.599 149.595 126.141 1.00 90.55  ? 111 ASP B CG  1 
ATOM   4444  O OD1 . ASP B 1 111 ? 160.934 148.608 125.781 1.00 90.55  ? 111 ASP B OD1 1 
ATOM   4445  O OD2 . ASP B 1 111 ? 162.836 149.662 126.000 1.00 90.55  ? 111 ASP B OD2 1 
ATOM   4446  N N   . GLY B 1 112 ? 158.392 151.198 128.459 1.00 91.39  ? 112 GLY B N   1 
ATOM   4447  C CA  . GLY B 1 112 ? 157.780 151.932 129.549 1.00 91.39  ? 112 GLY B CA  1 
ATOM   4448  C C   . GLY B 1 112 ? 156.281 152.100 129.504 1.00 91.39  ? 112 GLY B C   1 
ATOM   4449  O O   . GLY B 1 112 ? 155.600 151.879 130.505 1.00 91.39  ? 112 GLY B O   1 
ATOM   4450  N N   . ALA B 1 113 ? 155.744 152.480 128.348 1.00 85.13  ? 113 ALA B N   1 
ATOM   4451  C CA  . ALA B 1 113 ? 154.323 152.790 128.223 1.00 85.13  ? 113 ALA B CA  1 
ATOM   4452  C C   . ALA B 1 113 ? 153.506 151.502 128.123 1.00 85.13  ? 113 ALA B C   1 
ATOM   4453  O O   . ALA B 1 113 ? 152.968 151.143 127.077 1.00 85.13  ? 113 ALA B O   1 
ATOM   4454  C CB  . ALA B 1 113 ? 154.089 153.686 127.017 1.00 85.13  ? 113 ALA B CB  1 
ATOM   4455  N N   . ASP B 1 114 ? 153.413 150.795 129.249 1.00 88.81  ? 114 ASP B N   1 
ATOM   4456  C CA  . ASP B 1 114 ? 152.589 149.593 129.276 1.00 88.81  ? 114 ASP B CA  1 
ATOM   4457  C C   . ASP B 1 114 ? 151.114 149.948 129.268 1.00 88.81  ? 114 ASP B C   1 
ATOM   4458  O O   . ASP B 1 114 ? 150.385 149.617 128.329 1.00 88.81  ? 114 ASP B O   1 
ATOM   4459  C CB  . ASP B 1 114 ? 152.906 148.740 130.505 1.00 88.81  ? 114 ASP B CB  1 
ATOM   4460  C CG  . ASP B 1 114 ? 154.173 147.936 130.353 1.00 88.81  ? 114 ASP B CG  1 
ATOM   4461  O OD1 . ASP B 1 114 ? 154.534 147.601 129.206 1.00 88.81  ? 114 ASP B OD1 1 
ATOM   4462  O OD2 . ASP B 1 114 ? 154.796 147.615 131.385 1.00 88.81  ? 114 ASP B OD2 1 
ATOM   4463  N N   . ASP B 1 115 ? 150.662 150.638 130.302 1.00 85.30  ? 115 ASP B N   1 
ATOM   4464  C CA  . ASP B 1 115 ? 149.243 150.844 130.518 1.00 85.30  ? 115 ASP B CA  1 
ATOM   4465  C C   . ASP B 1 115 ? 148.679 152.035 129.763 1.00 85.30  ? 115 ASP B C   1 
ATOM   4466  O O   . ASP B 1 115 ? 147.461 152.230 129.776 1.00 85.30  ? 115 ASP B O   1 
ATOM   4467  C CB  . ASP B 1 115 ? 148.972 150.992 132.017 1.00 85.30  ? 115 ASP B CB  1 
ATOM   4468  C CG  . ASP B 1 115 ? 149.835 152.062 132.669 1.00 85.30  ? 115 ASP B CG  1 
ATOM   4469  O OD1 . ASP B 1 115 ? 150.695 152.656 131.984 1.00 85.30  ? 115 ASP B OD1 1 
ATOM   4470  O OD2 . ASP B 1 115 ? 149.659 152.302 133.882 1.00 85.30  ? 115 ASP B OD2 1 
ATOM   4471  N N   . THR B 1 116 ? 149.517 152.831 129.113 1.00 79.92  ? 116 THR B N   1 
ATOM   4472  C CA  . THR B 1 116 ? 149.060 154.002 128.380 1.00 79.92  ? 116 THR B CA  1 
ATOM   4473  C C   . THR B 1 116 ? 149.248 153.822 126.882 1.00 79.92  ? 116 THR B C   1 
ATOM   4474  O O   . THR B 1 116 ? 149.496 154.781 126.154 1.00 79.92  ? 116 THR B O   1 
ATOM   4475  C CB  . THR B 1 116 ? 149.780 155.256 128.853 1.00 79.92  ? 116 THR B CB  1 
ATOM   4476  O OG1 . THR B 1 116 ? 151.173 155.144 128.555 1.00 79.92  ? 116 THR B OG1 1 
ATOM   4477  C CG2 . THR B 1 116 ? 149.616 155.421 130.343 1.00 79.92  ? 116 THR B CG2 1 
ATOM   4478  N N   . PHE B 1 117 ? 149.133 152.591 126.408 1.00 62.40  ? 117 PHE B N   1 
ATOM   4479  C CA  . PHE B 1 117 ? 149.268 152.278 124.995 1.00 62.40  ? 117 PHE B CA  1 
ATOM   4480  C C   . PHE B 1 117 ? 147.889 151.969 124.452 1.00 62.40  ? 117 PHE B C   1 
ATOM   4481  O O   . PHE B 1 117 ? 147.264 150.995 124.874 1.00 62.40  ? 117 PHE B O   1 
ATOM   4482  C CB  . PHE B 1 117 ? 150.197 151.092 124.787 1.00 62.40  ? 117 PHE B CB  1 
ATOM   4483  C CG  . PHE B 1 117 ? 150.487 150.812 123.365 1.00 62.40  ? 117 PHE B CG  1 
ATOM   4484  C CD1 . PHE B 1 117 ? 151.387 151.585 122.679 1.00 62.40  ? 117 PHE B CD1 1 
ATOM   4485  C CD2 . PHE B 1 117 ? 149.859 149.782 122.707 1.00 62.40  ? 117 PHE B CD2 1 
ATOM   4486  C CE1 . PHE B 1 117 ? 151.661 151.335 121.365 1.00 62.40  ? 117 PHE B CE1 1 
ATOM   4487  C CE2 . PHE B 1 117 ? 150.125 149.528 121.391 1.00 62.40  ? 117 PHE B CE2 1 
ATOM   4488  C CZ  . PHE B 1 117 ? 151.027 150.305 120.720 1.00 62.40  ? 117 PHE B CZ  1 
ATOM   4489  N N   . ALA B 1 118 ? 147.417 152.783 123.518 1.00 61.33  ? 118 ALA B N   1 
ATOM   4490  C CA  . ALA B 1 118 ? 146.045 152.679 123.061 1.00 61.33  ? 118 ALA B CA  1 
ATOM   4491  C C   . ALA B 1 118 ? 145.963 153.013 121.582 1.00 61.33  ? 118 ALA B C   1 
ATOM   4492  O O   . ALA B 1 118 ? 146.943 153.422 120.958 1.00 61.33  ? 118 ALA B O   1 
ATOM   4493  C CB  . ALA B 1 118 ? 145.134 153.599 123.870 1.00 61.33  ? 118 ALA B CB  1 
ATOM   4494  N N   . ALA B 1 119 ? 144.765 152.851 121.027 1.00 63.30  ? 119 ALA B N   1 
ATOM   4495  C CA  . ALA B 1 119 ? 144.517 153.120 119.615 1.00 63.30  ? 119 ALA B CA  1 
ATOM   4496  C C   . ALA B 1 119 ? 143.270 153.982 119.520 1.00 63.30  ? 119 ALA B C   1 
ATOM   4497  O O   . ALA B 1 119 ? 142.222 153.605 120.040 1.00 63.30  ? 119 ALA B O   1 
ATOM   4498  C CB  . ALA B 1 119 ? 144.347 151.827 118.838 1.00 63.30  ? 119 ALA B CB  1 
ATOM   4499  N N   . TYR B 1 120 ? 143.374 155.125 118.856 1.00 64.41  ? 120 TYR B N   1 
ATOM   4500  C CA  . TYR B 1 120 ? 142.341 156.145 118.955 1.00 64.41  ? 120 TYR B CA  1 
ATOM   4501  C C   . TYR B 1 120 ? 141.512 156.311 117.696 1.00 64.41  ? 120 TYR B C   1 
ATOM   4502  O O   . TYR B 1 120 ? 140.310 156.557 117.794 1.00 64.41  ? 120 TYR B O   1 
ATOM   4503  C CB  . TYR B 1 120 ? 142.979 157.479 119.315 1.00 64.41  ? 120 TYR B CB  1 
ATOM   4504  C CG  . TYR B 1 120 ? 143.554 157.472 120.692 1.00 64.41  ? 120 TYR B CG  1 
ATOM   4505  C CD1 . TYR B 1 120 ? 142.759 157.715 121.787 1.00 64.41  ? 120 TYR B CD1 1 
ATOM   4506  C CD2 . TYR B 1 120 ? 144.884 157.186 120.900 1.00 64.41  ? 120 TYR B CD2 1 
ATOM   4507  C CE1 . TYR B 1 120 ? 143.276 157.699 123.044 1.00 64.41  ? 120 TYR B CE1 1 
ATOM   4508  C CE2 . TYR B 1 120 ? 145.410 157.168 122.159 1.00 64.41  ? 120 TYR B CE2 1 
ATOM   4509  C CZ  . TYR B 1 120 ? 144.601 157.419 123.224 1.00 64.41  ? 120 TYR B CZ  1 
ATOM   4510  O OH  . TYR B 1 120 ? 145.132 157.402 124.484 1.00 64.41  ? 120 TYR B OH  1 
ATOM   4511  N N   . THR B 1 121 ? 142.114 156.206 116.519 1.00 68.20  ? 121 THR B N   1 
ATOM   4512  C CA  . THR B 1 121 ? 141.353 156.326 115.287 1.00 68.20  ? 121 THR B CA  1 
ATOM   4513  C C   . THR B 1 121 ? 140.783 154.966 114.922 1.00 68.20  ? 121 THR B C   1 
ATOM   4514  O O   . THR B 1 121 ? 140.900 153.993 115.667 1.00 68.20  ? 121 THR B O   1 
ATOM   4515  C CB  . THR B 1 121 ? 142.211 156.836 114.142 1.00 68.20  ? 121 THR B CB  1 
ATOM   4516  O OG1 . THR B 1 121 ? 143.144 155.818 113.778 1.00 68.20  ? 121 THR B OG1 1 
ATOM   4517  C CG2 . THR B 1 121 ? 142.967 158.056 114.560 1.00 68.20  ? 121 THR B CG2 1 
ATOM   4518  N N   . ARG B 1 122 ? 140.174 154.879 113.748 1.00 71.97  ? 122 ARG B N   1 
ATOM   4519  C CA  . ARG B 1 122 ? 139.666 153.606 113.268 1.00 71.97  ? 122 ARG B CA  1 
ATOM   4520  C C   . ARG B 1 122 ? 140.705 152.859 112.462 1.00 71.97  ? 122 ARG B C   1 
ATOM   4521  O O   . ARG B 1 122 ? 140.688 151.628 112.429 1.00 71.97  ? 122 ARG B O   1 
ATOM   4522  C CB  . ARG B 1 122 ? 138.399 153.835 112.445 1.00 71.97  ? 122 ARG B CB  1 
ATOM   4523  C CG  . ARG B 1 122 ? 137.268 154.352 113.303 1.00 71.97  ? 122 ARG B CG  1 
ATOM   4524  C CD  . ARG B 1 122 ? 136.032 154.684 112.524 1.00 71.97  ? 122 ARG B CD  1 
ATOM   4525  N NE  . ARG B 1 122 ? 135.415 153.508 111.937 1.00 71.97  ? 122 ARG B NE  1 
ATOM   4526  C CZ  . ARG B 1 122 ? 134.372 153.562 111.124 1.00 71.97  ? 122 ARG B CZ  1 
ATOM   4527  N NH1 . ARG B 1 122 ? 133.836 154.731 110.822 1.00 71.97  ? 122 ARG B NH1 1 
ATOM   4528  N NH2 . ARG B 1 122 ? 133.864 152.456 110.615 1.00 71.97  ? 122 ARG B NH2 1 
ATOM   4529  N N   . GLU B 1 123 ? 141.629 153.575 111.844 1.00 73.21  ? 123 GLU B N   1 
ATOM   4530  C CA  . GLU B 1 123 ? 142.702 152.957 111.090 1.00 73.21  ? 123 GLU B CA  1 
ATOM   4531  C C   . GLU B 1 123 ? 143.930 152.674 111.935 1.00 73.21  ? 123 GLU B C   1 
ATOM   4532  O O   . GLU B 1 123 ? 144.799 151.919 111.493 1.00 73.21  ? 123 GLU B O   1 
ATOM   4533  C CB  . GLU B 1 123 ? 143.080 153.846 109.909 1.00 73.21  ? 123 GLU B CB  1 
ATOM   4534  C CG  . GLU B 1 123 ? 143.788 155.118 110.304 1.00 73.21  ? 123 GLU B CG  1 
ATOM   4535  C CD  . GLU B 1 123 ? 142.841 156.252 110.664 1.00 73.21  ? 123 GLU B CD  1 
ATOM   4536  O OE1 . GLU B 1 123 ? 141.638 155.999 110.891 1.00 73.21  ? 123 GLU B OE1 1 
ATOM   4537  O OE2 . GLU B 1 123 ? 143.305 157.409 110.735 1.00 73.21  ? 123 GLU B OE2 1 
ATOM   4538  N N   . GLN B 1 124 ? 144.040 153.260 113.128 1.00 68.71  ? 124 GLN B N   1 
ATOM   4539  C CA  . GLN B 1 124 ? 145.012 152.748 114.081 1.00 68.71  ? 124 GLN B CA  1 
ATOM   4540  C C   . GLN B 1 124 ? 144.651 151.361 114.555 1.00 68.71  ? 124 GLN B C   1 
ATOM   4541  O O   . GLN B 1 124 ? 145.544 150.586 114.904 1.00 68.71  ? 124 GLN B O   1 
ATOM   4542  C CB  . GLN B 1 124 ? 145.135 153.645 115.304 1.00 68.71  ? 124 GLN B CB  1 
ATOM   4543  C CG  . GLN B 1 124 ? 145.975 154.862 115.127 1.00 68.71  ? 124 GLN B CG  1 
ATOM   4544  C CD  . GLN B 1 124 ? 146.024 155.685 116.389 1.00 68.71  ? 124 GLN B CD  1 
ATOM   4545  O OE1 . GLN B 1 124 ? 145.303 155.412 117.345 1.00 68.71  ? 124 GLN B OE1 1 
ATOM   4546  N NE2 . GLN B 1 124 ? 146.894 156.682 116.412 1.00 68.71  ? 124 GLN B NE2 1 
ATOM   4547  N N   . LEU B 1 125 ? 143.369 151.037 114.589 1.00 69.93  ? 125 LEU B N   1 
ATOM   4548  C CA  . LEU B 1 125 ? 142.964 149.716 115.018 1.00 69.93  ? 125 LEU B CA  1 
ATOM   4549  C C   . LEU B 1 125 ? 143.160 148.682 113.927 1.00 69.93  ? 125 LEU B C   1 
ATOM   4550  O O   . LEU B 1 125 ? 143.509 147.540 114.231 1.00 69.93  ? 125 LEU B O   1 
ATOM   4551  C CB  . LEU B 1 125 ? 141.512 149.747 115.479 1.00 69.93  ? 125 LEU B CB  1 
ATOM   4552  C CG  . LEU B 1 125 ? 140.997 148.471 116.123 1.00 69.93  ? 125 LEU B CG  1 
ATOM   4553  C CD1 . LEU B 1 125 ? 141.855 148.144 117.294 1.00 69.93  ? 125 LEU B CD1 1 
ATOM   4554  C CD2 . LEU B 1 125 ? 139.586 148.662 116.581 1.00 69.93  ? 125 LEU B CD2 1 
ATOM   4555  N N   . TYR B 1 126 ? 142.987 149.056 112.659 1.00 72.72  ? 126 TYR B N   1 
ATOM   4556  C CA  . TYR B 1 126 ? 143.284 148.112 111.590 1.00 72.72  ? 126 TYR B CA  1 
ATOM   4557  C C   . TYR B 1 126 ? 144.769 147.833 111.463 1.00 72.72  ? 126 TYR B C   1 
ATOM   4558  O O   . TYR B 1 126 ? 145.159 146.676 111.290 1.00 72.72  ? 126 TYR B O   1 
ATOM   4559  C CB  . TYR B 1 126 ? 142.766 148.608 110.254 1.00 72.72  ? 126 TYR B CB  1 
ATOM   4560  C CG  . TYR B 1 126 ? 141.299 148.436 110.058 1.00 72.72  ? 126 TYR B CG  1 
ATOM   4561  C CD1 . TYR B 1 126 ? 140.765 147.189 109.795 1.00 72.72  ? 126 TYR B CD1 1 
ATOM   4562  C CD2 . TYR B 1 126 ? 140.452 149.523 110.075 1.00 72.72  ? 126 TYR B CD2 1 
ATOM   4563  C CE1 . TYR B 1 126 ? 139.425 147.028 109.596 1.00 72.72  ? 126 TYR B CE1 1 
ATOM   4564  C CE2 . TYR B 1 126 ? 139.109 149.371 109.873 1.00 72.72  ? 126 TYR B CE2 1 
ATOM   4565  C CZ  . TYR B 1 126 ? 138.602 148.126 109.635 1.00 72.72  ? 126 TYR B CZ  1 
ATOM   4566  O OH  . TYR B 1 126 ? 137.260 147.977 109.433 1.00 72.72  ? 126 TYR B OH  1 
ATOM   4567  N N   . GLN B 1 127 ? 145.611 148.861 111.532 1.00 69.84  ? 127 GLN B N   1 
ATOM   4568  C CA  . GLN B 1 127 ? 147.039 148.620 111.394 1.00 69.84  ? 127 GLN B CA  1 
ATOM   4569  C C   . GLN B 1 127 ? 147.606 147.893 112.598 1.00 69.84  ? 127 GLN B C   1 
ATOM   4570  O O   . GLN B 1 127 ? 148.644 147.242 112.485 1.00 69.84  ? 127 GLN B O   1 
ATOM   4571  C CB  . GLN B 1 127 ? 147.791 149.924 111.185 1.00 69.84  ? 127 GLN B CB  1 
ATOM   4572  C CG  . GLN B 1 127 ? 147.549 150.569 109.854 1.00 69.84  ? 127 GLN B CG  1 
ATOM   4573  C CD  . GLN B 1 127 ? 148.343 151.839 109.699 1.00 69.84  ? 127 GLN B CD  1 
ATOM   4574  O OE1 . GLN B 1 127 ? 149.025 152.272 110.625 1.00 69.84  ? 127 GLN B OE1 1 
ATOM   4575  N NE2 . GLN B 1 127 ? 148.265 152.445 108.524 1.00 69.84  ? 127 GLN B NE2 1 
ATOM   4576  N N   . ALA B 1 128 ? 146.950 147.980 113.748 1.00 68.61  ? 128 ALA B N   1 
ATOM   4577  C CA  . ALA B 1 128 ? 147.434 147.233 114.895 1.00 68.61  ? 128 ALA B CA  1 
ATOM   4578  C C   . ALA B 1 128 ? 147.126 145.755 114.771 1.00 68.61  ? 128 ALA B C   1 
ATOM   4579  O O   . ALA B 1 128 ? 147.928 144.925 115.205 1.00 68.61  ? 128 ALA B O   1 
ATOM   4580  C CB  . ALA B 1 128 ? 146.830 147.779 116.181 1.00 68.61  ? 128 ALA B CB  1 
ATOM   4581  N N   . ILE B 1 129 ? 145.985 145.410 114.180 1.00 67.72  ? 129 ILE B N   1 
ATOM   4582  C CA  . ILE B 1 129 ? 145.601 144.009 114.065 1.00 67.72  ? 129 ILE B CA  1 
ATOM   4583  C C   . ILE B 1 129 ? 146.436 143.317 113.003 1.00 67.72  ? 129 ILE B C   1 
ATOM   4584  O O   . ILE B 1 129 ? 146.926 142.200 113.202 1.00 67.72  ? 129 ILE B O   1 
ATOM   4585  C CB  . ILE B 1 129 ? 144.100 143.898 113.761 1.00 67.72  ? 129 ILE B CB  1 
ATOM   4586  C CG1 . ILE B 1 129 ? 143.286 144.401 114.936 1.00 67.72  ? 129 ILE B CG1 1 
ATOM   4587  C CG2 . ILE B 1 129 ? 143.715 142.485 113.493 1.00 67.72  ? 129 ILE B CG2 1 
ATOM   4588  C CD1 . ILE B 1 129 ? 141.852 144.581 114.603 1.00 67.72  ? 129 ILE B CD1 1 
ATOM   4589  N N   . PHE B 1 130 ? 146.635 143.988 111.873 1.00 71.95  ? 130 PHE B N   1 
ATOM   4590  C CA  . PHE B 1 130 ? 147.272 143.345 110.733 1.00 71.95  ? 130 PHE B CA  1 
ATOM   4591  C C   . PHE B 1 130 ? 148.749 143.132 110.991 1.00 71.95  ? 130 PHE B C   1 
ATOM   4592  O O   . PHE B 1 130 ? 149.296 142.087 110.635 1.00 71.95  ? 130 PHE B O   1 
ATOM   4593  C CB  . PHE B 1 130 ? 147.081 144.189 109.477 1.00 71.95  ? 130 PHE B CB  1 
ATOM   4594  C CG  . PHE B 1 130 ? 145.646 144.373 109.065 1.00 71.95  ? 130 PHE B CG  1 
ATOM   4595  C CD1 . PHE B 1 130 ? 144.651 143.507 109.483 1.00 71.95  ? 130 PHE B CD1 1 
ATOM   4596  C CD2 . PHE B 1 130 ? 145.294 145.449 108.274 1.00 71.95  ? 130 PHE B CD2 1 
ATOM   4597  C CE1 . PHE B 1 130 ? 143.344 143.709 109.112 1.00 71.95  ? 130 PHE B CE1 1 
ATOM   4598  C CE2 . PHE B 1 130 ? 143.988 145.652 107.898 1.00 71.95  ? 130 PHE B CE2 1 
ATOM   4599  C CZ  . PHE B 1 130 ? 143.012 144.783 108.319 1.00 71.95  ? 130 PHE B CZ  1 
ATOM   4600  N N   . HIS B 1 131 ? 149.391 144.091 111.653 1.00 67.26  ? 131 HIS B N   1 
ATOM   4601  C CA  . HIS B 1 131 ? 150.788 143.965 112.034 1.00 67.26  ? 131 HIS B CA  1 
ATOM   4602  C C   . HIS B 1 131 ? 151.003 142.862 113.051 1.00 67.26  ? 131 HIS B C   1 
ATOM   4603  O O   . HIS B 1 131 ? 152.088 142.281 113.096 1.00 67.26  ? 131 HIS B O   1 
ATOM   4604  C CB  . HIS B 1 131 ? 151.278 145.290 112.600 1.00 67.26  ? 131 HIS B CB  1 
ATOM   4605  C CG  . HIS B 1 131 ? 152.726 145.304 112.944 1.00 67.26  ? 131 HIS B CG  1 
ATOM   4606  N ND1 . HIS B 1 131 ? 153.712 145.401 111.991 1.00 67.26  ? 131 HIS B ND1 1 
ATOM   4607  C CD2 . HIS B 1 131 ? 153.357 145.239 114.136 1.00 67.26  ? 131 HIS B CD2 1 
ATOM   4608  C CE1 . HIS B 1 131 ? 154.891 145.395 112.582 1.00 67.26  ? 131 HIS B CE1 1 
ATOM   4609  N NE2 . HIS B 1 131 ? 154.704 145.296 113.884 1.00 67.26  ? 131 HIS B NE2 1 
ATOM   4610  N N   . ALA B 1 132 ? 149.998 142.548 113.853 1.00 66.05  ? 132 ALA B N   1 
ATOM   4611  C CA  . ALA B 1 132 ? 150.120 141.451 114.793 1.00 66.05  ? 132 ALA B CA  1 
ATOM   4612  C C   . ALA B 1 132 ? 150.019 140.093 114.125 1.00 66.05  ? 132 ALA B C   1 
ATOM   4613  O O   . ALA B 1 132 ? 150.636 139.141 114.606 1.00 66.05  ? 132 ALA B O   1 
ATOM   4614  C CB  . ALA B 1 132 ? 149.053 141.563 115.877 1.00 66.05  ? 132 ALA B CB  1 
ATOM   4615  N N   . VAL B 1 133 ? 149.282 139.980 113.026 1.00 68.65  ? 133 VAL B N   1 
ATOM   4616  C CA  . VAL B 1 133 ? 149.165 138.726 112.300 1.00 68.65  ? 133 VAL B CA  1 
ATOM   4617  C C   . VAL B 1 133 ? 150.362 138.496 111.393 1.00 68.65  ? 133 VAL B C   1 
ATOM   4618  O O   . VAL B 1 133 ? 150.875 137.380 111.313 1.00 68.65  ? 133 VAL B O   1 
ATOM   4619  C CB  . VAL B 1 133 ? 147.852 138.710 111.496 1.00 68.65  ? 133 VAL B CB  1 
ATOM   4620  C CG1 . VAL B 1 133 ? 147.705 137.424 110.730 1.00 68.65  ? 133 VAL B CG1 1 
ATOM   4621  C CG2 . VAL B 1 133 ? 146.693 138.908 112.418 1.00 68.65  ? 133 VAL B CG2 1 
ATOM   4622  N N   . ASP B 1 134 ? 150.829 139.563 110.739 1.00 75.26  ? 134 ASP B N   1 
ATOM   4623  C CA  . ASP B 1 134 ? 151.888 139.450 109.745 1.00 75.26  ? 134 ASP B CA  1 
ATOM   4624  C C   . ASP B 1 134 ? 153.200 139.004 110.363 1.00 75.26  ? 134 ASP B C   1 
ATOM   4625  O O   . ASP B 1 134 ? 153.920 138.192 109.772 1.00 75.26  ? 134 ASP B O   1 
ATOM   4626  C CB  . ASP B 1 134 ? 152.080 140.786 109.041 1.00 75.26  ? 134 ASP B CB  1 
ATOM   4627  C CG  . ASP B 1 134 ? 150.894 141.169 108.199 1.00 75.26  ? 134 ASP B CG  1 
ATOM   4628  O OD1 . ASP B 1 134 ? 150.190 140.257 107.725 1.00 75.26  ? 134 ASP B OD1 1 
ATOM   4629  O OD2 . ASP B 1 134 ? 150.654 142.381 108.022 1.00 75.26  ? 134 ASP B OD2 1 
ATOM   4630  N N   . GLN B 1 135 ? 153.518 139.511 111.550 1.00 70.59  ? 135 GLN B N   1 
ATOM   4631  C CA  . GLN B 1 135 ? 154.723 139.075 112.236 1.00 70.59  ? 135 GLN B CA  1 
ATOM   4632  C C   . GLN B 1 135 ? 154.611 137.630 112.689 1.00 70.59  ? 135 GLN B C   1 
ATOM   4633  O O   . GLN B 1 135 ? 155.621 136.925 112.770 1.00 70.59  ? 135 GLN B O   1 
ATOM   4634  C CB  . GLN B 1 135 ? 154.996 139.981 113.426 1.00 70.59  ? 135 GLN B CB  1 
ATOM   4635  C CG  . GLN B 1 135 ? 155.368 141.388 113.051 1.00 70.59  ? 135 GLN B CG  1 
ATOM   4636  C CD  . GLN B 1 135 ? 156.724 141.484 112.406 1.00 70.59  ? 135 GLN B CD  1 
ATOM   4637  O OE1 . GLN B 1 135 ? 156.836 141.734 111.213 1.00 70.59  ? 135 GLN B OE1 1 
ATOM   4638  N NE2 . GLN B 1 135 ? 157.766 141.301 113.197 1.00 70.59  ? 135 GLN B NE2 1 
ATOM   4639  N N   . TYR B 1 136 ? 153.396 137.169 112.976 1.00 75.62  ? 136 TYR B N   1 
ATOM   4640  C CA  . TYR B 1 136 ? 153.209 135.765 113.305 1.00 75.62  ? 136 TYR B CA  1 
ATOM   4641  C C   . TYR B 1 136 ? 153.430 134.884 112.089 1.00 75.62  ? 136 TYR B C   1 
ATOM   4642  O O   . TYR B 1 136 ? 153.968 133.779 112.205 1.00 75.62  ? 136 TYR B O   1 
ATOM   4643  C CB  . TYR B 1 136 ? 151.815 135.548 113.871 1.00 75.62  ? 136 TYR B CB  1 
ATOM   4644  C CG  . TYR B 1 136 ? 151.494 134.110 114.170 1.00 75.62  ? 136 TYR B CG  1 
ATOM   4645  C CD1 . TYR B 1 136 ? 152.027 133.478 115.276 1.00 75.62  ? 136 TYR B CD1 1 
ATOM   4646  C CD2 . TYR B 1 136 ? 150.651 133.388 113.347 1.00 75.62  ? 136 TYR B CD2 1 
ATOM   4647  C CE1 . TYR B 1 136 ? 151.728 132.177 115.548 1.00 75.62  ? 136 TYR B CE1 1 
ATOM   4648  C CE2 . TYR B 1 136 ? 150.350 132.093 113.610 1.00 75.62  ? 136 TYR B CE2 1 
ATOM   4649  C CZ  . TYR B 1 136 ? 150.887 131.494 114.710 1.00 75.62  ? 136 TYR B CZ  1 
ATOM   4650  O OH  . TYR B 1 136 ? 150.574 130.188 114.967 1.00 75.62  ? 136 TYR B OH  1 
ATOM   4651  N N   . LEU B 1 137 ? 153.028 135.352 110.913 1.00 77.72  ? 137 LEU B N   1 
ATOM   4652  C CA  . LEU B 1 137 ? 153.234 134.553 109.718 1.00 77.72  ? 137 LEU B CA  1 
ATOM   4653  C C   . LEU B 1 137 ? 154.672 134.569 109.256 1.00 77.72  ? 137 LEU B C   1 
ATOM   4654  O O   . LEU B 1 137 ? 155.047 133.747 108.420 1.00 77.72  ? 137 LEU B O   1 
ATOM   4655  C CB  . LEU B 1 137 ? 152.344 135.045 108.590 1.00 77.72  ? 137 LEU B CB  1 
ATOM   4656  C CG  . LEU B 1 137 ? 150.873 134.733 108.814 1.00 77.72  ? 137 LEU B CG  1 
ATOM   4657  C CD1 . LEU B 1 137 ? 150.022 135.369 107.734 1.00 77.72  ? 137 LEU B CD1 1 
ATOM   4658  C CD2 . LEU B 1 137 ? 150.699 133.237 108.820 1.00 77.72  ? 137 LEU B CD2 1 
ATOM   4659  N N   . ALA B 1 138 ? 155.483 135.477 109.774 1.00 76.89  ? 138 ALA B N   1 
ATOM   4660  C CA  . ALA B 1 138 ? 156.855 135.631 109.326 1.00 76.89  ? 138 ALA B CA  1 
ATOM   4661  C C   . ALA B 1 138 ? 157.844 135.490 110.474 1.00 76.89  ? 138 ALA B C   1 
ATOM   4662  O O   . ALA B 1 138 ? 158.909 136.099 110.457 1.00 76.89  ? 138 ALA B O   1 
ATOM   4663  C CB  . ALA B 1 138 ? 157.032 136.976 108.626 1.00 76.89  ? 138 ALA B CB  1 
ATOM   4664  N N   . LEU B 1 139 ? 157.507 134.668 111.468 1.00 68.50  ? 139 LEU B N   1 
ATOM   4665  C CA  . LEU B 1 139 ? 158.311 134.625 112.693 1.00 68.50  ? 139 LEU B CA  1 
ATOM   4666  C C   . LEU B 1 139 ? 159.714 134.061 112.517 1.00 68.50  ? 139 LEU B C   1 
ATOM   4667  O O   . LEU B 1 139 ? 160.658 134.700 113.018 1.00 68.50  ? 139 LEU B O   1 
ATOM   4668  C CB  . LEU B 1 139 ? 157.547 133.887 113.792 1.00 68.50  ? 139 LEU B CB  1 
ATOM   4669  C CG  . LEU B 1 139 ? 158.237 134.059 115.139 1.00 68.50  ? 139 LEU B CG  1 
ATOM   4670  C CD1 . LEU B 1 139 ? 158.168 135.504 115.521 1.00 68.50  ? 139 LEU B CD1 1 
ATOM   4671  C CD2 . LEU B 1 139 ? 157.603 133.214 116.205 1.00 68.50  ? 139 LEU B CD2 1 
ATOM   4672  N N   . PRO B 1 140 ? 159.961 132.918 111.853 1.00 67.89  ? 140 PRO B N   1 
ATOM   4673  C CA  . PRO B 1 140 ? 161.343 132.435 111.789 1.00 67.89  ? 140 PRO B CA  1 
ATOM   4674  C C   . PRO B 1 140 ? 162.237 133.241 110.879 1.00 67.89  ? 140 PRO B C   1 
ATOM   4675  O O   . PRO B 1 140 ? 163.450 133.022 110.894 1.00 67.89  ? 140 PRO B O   1 
ATOM   4676  C CB  . PRO B 1 140 ? 161.195 131.012 111.267 1.00 67.89  ? 140 PRO B CB  1 
ATOM   4677  C CG  . PRO B 1 140 ? 160.026 131.045 110.480 1.00 67.89  ? 140 PRO B CG  1 
ATOM   4678  C CD  . PRO B 1 140 ? 159.080 131.934 111.190 1.00 67.89  ? 140 PRO B CD  1 
ATOM   4679  N N   . ASP B 1 141 ? 161.703 134.163 110.094 1.00 77.89  ? 141 ASP B N   1 
ATOM   4680  C CA  . ASP B 1 141 ? 162.573 134.946 109.237 1.00 77.89  ? 141 ASP B CA  1 
ATOM   4681  C C   . ASP B 1 141 ? 163.057 136.223 109.896 1.00 77.89  ? 141 ASP B C   1 
ATOM   4682  O O   . ASP B 1 141 ? 164.176 136.663 109.616 1.00 77.89  ? 141 ASP B O   1 
ATOM   4683  C CB  . ASP B 1 141 ? 161.862 135.286 107.930 1.00 77.89  ? 141 ASP B CB  1 
ATOM   4684  C CG  . ASP B 1 141 ? 161.590 134.066 107.091 1.00 77.89  ? 141 ASP B CG  1 
ATOM   4685  O OD1 . ASP B 1 141 ? 162.320 133.069 107.252 1.00 77.89  ? 141 ASP B OD1 1 
ATOM   4686  O OD2 . ASP B 1 141 ? 160.658 134.104 106.264 1.00 77.89  ? 141 ASP B OD2 1 
ATOM   4687  N N   . VAL B 1 142 ? 162.258 136.830 110.767 1.00 74.86  ? 142 VAL B N   1 
ATOM   4688  C CA  . VAL B 1 142 ? 162.598 138.137 111.305 1.00 74.86  ? 142 VAL B CA  1 
ATOM   4689  C C   . VAL B 1 142 ? 163.008 138.100 112.769 1.00 74.86  ? 142 VAL B C   1 
ATOM   4690  O O   . VAL B 1 142 ? 163.730 139.006 113.208 1.00 74.86  ? 142 VAL B O   1 
ATOM   4691  C CB  . VAL B 1 142 ? 161.450 139.147 111.103 1.00 74.86  ? 142 VAL B CB  1 
ATOM   4692  C CG1 . VAL B 1 142 ? 161.122 139.285 109.632 1.00 74.86  ? 142 VAL B CG1 1 
ATOM   4693  C CG2 . VAL B 1 142 ? 160.227 138.756 111.898 1.00 74.86  ? 142 VAL B CG2 1 
ATOM   4694  N N   . SER B 1 143 ? 162.597 137.100 113.533 1.00 73.37  ? 143 SER B N   1 
ATOM   4695  C CA  . SER B 1 143 ? 162.869 137.077 114.959 1.00 73.37  ? 143 SER B CA  1 
ATOM   4696  C C   . SER B 1 143 ? 163.989 136.113 115.280 1.00 73.37  ? 143 SER B C   1 
ATOM   4697  O O   . SER B 1 143 ? 164.061 135.024 114.713 1.00 73.37  ? 143 SER B O   1 
ATOM   4698  C CB  . SER B 1 143 ? 161.640 136.660 115.751 1.00 73.37  ? 143 SER B CB  1 
ATOM   4699  O OG  . SER B 1 143 ? 161.983 136.493 117.114 1.00 73.37  ? 143 SER B OG  1 
ATOM   4700  N N   . LEU B 1 144 ? 164.847 136.506 116.201 1.00 72.26  ? 144 LEU B N   1 
ATOM   4701  C CA  . LEU B 1 144 ? 165.766 135.540 116.759 1.00 72.26  ? 144 LEU B CA  1 
ATOM   4702  C C   . LEU B 1 144 ? 165.125 134.909 117.981 1.00 72.26  ? 144 LEU B C   1 
ATOM   4703  O O   . LEU B 1 144 ? 164.116 135.388 118.493 1.00 72.26  ? 144 LEU B O   1 
ATOM   4704  C CB  . LEU B 1 144 ? 167.095 136.207 117.076 1.00 72.26  ? 144 LEU B CB  1 
ATOM   4705  C CG  . LEU B 1 144 ? 167.130 137.356 118.067 1.00 72.26  ? 144 LEU B CG  1 
ATOM   4706  C CD1 . LEU B 1 144 ? 167.530 136.892 119.452 1.00 72.26  ? 144 LEU B CD1 1 
ATOM   4707  C CD2 . LEU B 1 144 ? 168.071 138.406 117.553 1.00 72.26  ? 144 LEU B CD2 1 
ATOM   4708  N N   . GLY B 1 145 ? 165.708 133.811 118.442 1.00 76.99  ? 145 GLY B N   1 
ATOM   4709  C CA  . GLY B 1 145 ? 165.206 133.087 119.587 1.00 76.99  ? 145 GLY B CA  1 
ATOM   4710  C C   . GLY B 1 145 ? 164.649 131.721 119.270 1.00 76.99  ? 145 GLY B C   1 
ATOM   4711  O O   . GLY B 1 145 ? 164.610 130.868 120.164 1.00 76.99  ? 145 GLY B O   1 
ATOM   4712  N N   . ARG B 1 146 ? 164.219 131.497 118.025 1.00 85.16  ? 146 ARG B N   1 
ATOM   4713  C CA  . ARG B 1 146 ? 163.818 130.194 117.488 1.00 85.16  ? 146 ARG B CA  1 
ATOM   4714  C C   . ARG B 1 146 ? 162.637 129.599 118.267 1.00 85.16  ? 146 ARG B C   1 
ATOM   4715  O O   . ARG B 1 146 ? 162.753 128.653 119.043 1.00 85.16  ? 146 ARG B O   1 
ATOM   4716  C CB  . ARG B 1 146 ? 165.022 129.247 117.421 1.00 85.16  ? 146 ARG B CB  1 
ATOM   4717  C CG  . ARG B 1 146 ? 164.762 127.973 116.670 1.00 85.16  ? 146 ARG B CG  1 
ATOM   4718  C CD  . ARG B 1 146 ? 166.030 127.218 116.392 1.00 85.16  ? 146 ARG B CD  1 
ATOM   4719  N NE  . ARG B 1 146 ? 165.720 125.903 115.851 1.00 85.16  ? 146 ARG B NE  1 
ATOM   4720  C CZ  . ARG B 1 146 ? 165.440 125.662 114.576 1.00 85.16  ? 146 ARG B CZ  1 
ATOM   4721  N NH1 . ARG B 1 146 ? 165.429 126.651 113.689 1.00 85.16  ? 146 ARG B NH1 1 
ATOM   4722  N NH2 . ARG B 1 146 ? 165.166 124.426 114.187 1.00 85.16  ? 146 ARG B NH2 1 
ATOM   4723  N N   . TYR B 1 147 ? 161.501 130.252 118.092 1.00 80.80  ? 147 TYR B N   1 
ATOM   4724  C CA  . TYR B 1 147 ? 160.242 129.690 118.534 1.00 80.80  ? 147 TYR B CA  1 
ATOM   4725  C C   . TYR B 1 147 ? 159.710 128.739 117.473 1.00 80.80  ? 147 TYR B C   1 
ATOM   4726  O O   . TYR B 1 147 ? 160.253 128.644 116.373 1.00 80.80  ? 147 TYR B O   1 
ATOM   4727  C CB  . TYR B 1 147 ? 159.236 130.799 118.792 1.00 80.80  ? 147 TYR B CB  1 
ATOM   4728  C CG  . TYR B 1 147 ? 159.736 131.770 119.812 1.00 80.80  ? 147 TYR B CG  1 
ATOM   4729  C CD1 . TYR B 1 147 ? 159.664 131.477 121.157 1.00 80.80  ? 147 TYR B CD1 1 
ATOM   4730  C CD2 . TYR B 1 147 ? 160.314 132.967 119.428 1.00 80.80  ? 147 TYR B CD2 1 
ATOM   4731  C CE1 . TYR B 1 147 ? 160.135 132.350 122.090 1.00 80.80  ? 147 TYR B CE1 1 
ATOM   4732  C CE2 . TYR B 1 147 ? 160.790 133.845 120.353 1.00 80.80  ? 147 TYR B CE2 1 
ATOM   4733  C CZ  . TYR B 1 147 ? 160.696 133.532 121.681 1.00 80.80  ? 147 TYR B CZ  1 
ATOM   4734  O OH  . TYR B 1 147 ? 161.169 134.409 122.618 1.00 80.80  ? 147 TYR B OH  1 
ATOM   4735  N N   . ALA B 1 148 ? 158.633 128.033 117.807 1.00 79.56  ? 148 ALA B N   1 
ATOM   4736  C CA  . ALA B 1 148 ? 157.958 127.183 116.836 1.00 79.56  ? 148 ALA B CA  1 
ATOM   4737  C C   . ALA B 1 148 ? 156.485 127.095 117.177 1.00 79.56  ? 148 ALA B C   1 
ATOM   4738  O O   . ALA B 1 148 ? 156.093 127.227 118.336 1.00 79.56  ? 148 ALA B O   1 
ATOM   4739  C CB  . ALA B 1 148 ? 158.541 125.776 116.779 1.00 79.56  ? 148 ALA B CB  1 
ATOM   4740  N N   . TYR B 1 149 ? 155.682 126.825 116.157 1.00 77.99  ? 149 TYR B N   1 
ATOM   4741  C CA  . TYR B 1 149 ? 154.242 126.938 116.271 1.00 77.99  ? 149 TYR B CA  1 
ATOM   4742  C C   . TYR B 1 149 ? 153.673 125.772 117.067 1.00 77.99  ? 149 TYR B C   1 
ATOM   4743  O O   . TYR B 1 149 ? 154.363 124.802 117.381 1.00 77.99  ? 149 TYR B O   1 
ATOM   4744  C CB  . TYR B 1 149 ? 153.627 126.994 114.888 1.00 77.99  ? 149 TYR B CB  1 
ATOM   4745  C CG  . TYR B 1 149 ? 154.108 128.160 114.086 1.00 77.99  ? 149 TYR B CG  1 
ATOM   4746  C CD1 . TYR B 1 149 ? 153.575 129.415 114.275 1.00 77.99  ? 149 TYR B CD1 1 
ATOM   4747  C CD2 . TYR B 1 149 ? 155.090 128.002 113.129 1.00 77.99  ? 149 TYR B CD2 1 
ATOM   4748  C CE1 . TYR B 1 149 ? 154.002 130.482 113.537 1.00 77.99  ? 149 TYR B CE1 1 
ATOM   4749  C CE2 . TYR B 1 149 ? 155.524 129.063 112.383 1.00 77.99  ? 149 TYR B CE2 1 
ATOM   4750  C CZ  . TYR B 1 149 ? 154.976 130.298 112.591 1.00 77.99  ? 149 TYR B CZ  1 
ATOM   4751  O OH  . TYR B 1 149 ? 155.407 131.366 111.850 1.00 77.99  ? 149 TYR B OH  1 
ATOM   4752  N N   . VAL B 1 150 ? 152.386 125.863 117.396 1.00 87.99  ? 150 VAL B N   1 
ATOM   4753  C CA  . VAL B 1 150 ? 151.769 124.853 118.250 1.00 87.99  ? 150 VAL B CA  1 
ATOM   4754  C C   . VAL B 1 150 ? 151.165 123.714 117.437 1.00 87.99  ? 150 VAL B C   1 
ATOM   4755  O O   . VAL B 1 150 ? 151.373 122.549 117.785 1.00 87.99  ? 150 VAL B O   1 
ATOM   4756  C CB  . VAL B 1 150 ? 150.741 125.498 119.213 1.00 87.99  ? 150 VAL B CB  1 
ATOM   4757  C CG1 . VAL B 1 150 ? 149.644 126.257 118.496 1.00 87.99  ? 150 VAL B CG1 1 
ATOM   4758  C CG2 . VAL B 1 150 ? 150.124 124.458 120.110 1.00 87.99  ? 150 VAL B CG2 1 
ATOM   4759  N N   . ARG B 1 151 ? 150.504 124.024 116.316 1.00 98.27  ? 151 ARG B N   1 
ATOM   4760  C CA  . ARG B 1 151 ? 149.607 123.115 115.599 1.00 98.27  ? 151 ARG B CA  1 
ATOM   4761  C C   . ARG B 1 151 ? 148.623 122.479 116.586 1.00 98.27  ? 151 ARG B C   1 
ATOM   4762  O O   . ARG B 1 151 ? 148.631 121.279 116.857 1.00 98.27  ? 151 ARG B O   1 
ATOM   4763  C CB  . ARG B 1 151 ? 150.400 122.070 114.806 1.00 98.27  ? 151 ARG B CB  1 
ATOM   4764  C CG  . ARG B 1 151 ? 149.585 121.262 113.830 1.00 98.27  ? 151 ARG B CG  1 
ATOM   4765  C CD  . ARG B 1 151 ? 149.071 122.171 112.761 1.00 98.27  ? 151 ARG B CD  1 
ATOM   4766  N NE  . ARG B 1 151 ? 150.173 122.718 111.992 1.00 98.27  ? 151 ARG B NE  1 
ATOM   4767  C CZ  . ARG B 1 151 ? 150.040 123.740 111.164 1.00 98.27  ? 151 ARG B CZ  1 
ATOM   4768  N NH1 . ARG B 1 151 ? 148.853 124.305 111.027 1.00 98.27  ? 151 ARG B NH1 1 
ATOM   4769  N NH2 . ARG B 1 151 ? 151.080 124.197 110.481 1.00 98.27  ? 151 ARG B NH2 1 
ATOM   4770  N N   . GLY B 1 152 ? 147.797 123.338 117.176 1.00 104.92 ? 152 GLY B N   1 
ATOM   4771  C CA  . GLY B 1 152 ? 147.081 123.008 118.386 1.00 104.92 ? 152 GLY B CA  1 
ATOM   4772  C C   . GLY B 1 152 ? 145.824 122.189 118.158 1.00 104.92 ? 152 GLY B C   1 
ATOM   4773  O O   . GLY B 1 152 ? 145.469 121.824 117.037 1.00 104.92 ? 152 GLY B O   1 
ATOM   4774  N N   . GLY B 1 153 ? 145.153 121.885 119.271 1.00 110.92 ? 153 GLY B N   1 
ATOM   4775  C CA  . GLY B 1 153 ? 143.916 121.132 119.250 1.00 110.92 ? 153 GLY B CA  1 
ATOM   4776  C C   . GLY B 1 153 ? 142.935 121.550 120.329 1.00 110.92 ? 153 GLY B C   1 
ATOM   4777  O O   . GLY B 1 153 ? 142.023 120.791 120.671 1.00 110.92 ? 153 GLY B O   1 
ATOM   4778  N N   . GLY B 1 154 ? 143.110 122.752 120.868 1.00 106.34 ? 154 GLY B N   1 
ATOM   4779  C CA  . GLY B 1 154 ? 142.302 123.231 121.969 1.00 106.34 ? 154 GLY B CA  1 
ATOM   4780  C C   . GLY B 1 154 ? 140.955 123.780 121.524 1.00 106.34 ? 154 GLY B C   1 
ATOM   4781  O O   . GLY B 1 154 ? 140.491 123.578 120.402 1.00 106.34 ? 154 GLY B O   1 
ATOM   4782  N N   . ASP B 1 155 ? 140.316 124.500 122.449 1.00 108.86 ? 155 ASP B N   1 
ATOM   4783  C CA  . ASP B 1 155 ? 138.941 124.947 122.237 1.00 108.86 ? 155 ASP B CA  1 
ATOM   4784  C C   . ASP B 1 155 ? 138.813 126.192 121.357 1.00 108.86 ? 155 ASP B C   1 
ATOM   4785  O O   . ASP B 1 155 ? 137.984 126.169 120.441 1.00 108.86 ? 155 ASP B O   1 
ATOM   4786  C CB  . ASP B 1 155 ? 138.224 125.165 123.575 1.00 108.86 ? 155 ASP B CB  1 
ATOM   4787  C CG  . ASP B 1 155 ? 137.980 123.880 124.316 1.00 108.86 ? 155 ASP B CG  1 
ATOM   4788  O OD1 . ASP B 1 155 ? 137.805 122.832 123.654 1.00 108.86 ? 155 ASP B OD1 1 
ATOM   4789  O OD2 . ASP B 1 155 ? 137.970 123.912 125.567 1.00 108.86 ? 155 ASP B OD2 1 
ATOM   4790  N N   . PRO B 1 156 ? 139.579 127.316 121.554 1.00 98.62  ? 156 PRO B N   1 
ATOM   4791  C CA  . PRO B 1 156 ? 139.433 128.406 120.585 1.00 98.62  ? 156 PRO B CA  1 
ATOM   4792  C C   . PRO B 1 156 ? 140.338 128.234 119.382 1.00 98.62  ? 156 PRO B C   1 
ATOM   4793  O O   . PRO B 1 156 ? 140.935 129.207 118.922 1.00 98.62  ? 156 PRO B O   1 
ATOM   4794  C CB  . PRO B 1 156 ? 139.826 129.643 121.390 1.00 98.62  ? 156 PRO B CB  1 
ATOM   4795  C CG  . PRO B 1 156 ? 140.848 129.147 122.281 1.00 98.62  ? 156 PRO B CG  1 
ATOM   4796  C CD  . PRO B 1 156 ? 140.454 127.755 122.664 1.00 98.62  ? 156 PRO B CD  1 
ATOM   4797  N N   . TRP B 1 157 ? 140.434 127.015 118.859 1.00 101.29 ? 157 TRP B N   1 
ATOM   4798  C CA  . TRP B 1 157 ? 141.181 126.733 117.641 1.00 101.29 ? 157 TRP B CA  1 
ATOM   4799  C C   . TRP B 1 157 ? 140.562 125.514 116.989 1.00 101.29 ? 157 TRP B C   1 
ATOM   4800  O O   . TRP B 1 157 ? 140.410 124.484 117.649 1.00 101.29 ? 157 TRP B O   1 
ATOM   4801  C CB  . TRP B 1 157 ? 142.650 126.445 117.917 1.00 101.29 ? 157 TRP B CB  1 
ATOM   4802  C CG  . TRP B 1 157 ? 143.452 127.556 118.449 1.00 101.29 ? 157 TRP B CG  1 
ATOM   4803  C CD1 . TRP B 1 157 ? 144.036 128.555 117.743 1.00 101.29 ? 157 TRP B CD1 1 
ATOM   4804  C CD2 . TRP B 1 157 ? 143.825 127.752 119.808 1.00 101.29 ? 157 TRP B CD2 1 
ATOM   4805  N NE1 . TRP B 1 157 ? 144.731 129.383 118.582 1.00 101.29 ? 157 TRP B NE1 1 
ATOM   4806  C CE2 . TRP B 1 157 ? 144.618 128.905 119.860 1.00 101.29 ? 157 TRP B CE2 1 
ATOM   4807  C CE3 . TRP B 1 157 ? 143.555 127.068 120.989 1.00 101.29 ? 157 TRP B CE3 1 
ATOM   4808  C CZ2 . TRP B 1 157 ? 145.143 129.388 121.043 1.00 101.29 ? 157 TRP B CZ2 1 
ATOM   4809  C CZ3 . TRP B 1 157 ? 144.077 127.550 122.162 1.00 101.29 ? 157 TRP B CZ3 1 
ATOM   4810  C CH2 . TRP B 1 157 ? 144.858 128.700 122.183 1.00 101.29 ? 157 TRP B CH2 1 
ATOM   4811  N N   . THR B 1 158 ? 140.239 125.608 115.704 1.00 104.61 ? 158 THR B N   1 
ATOM   4812  C CA  . THR B 1 158 ? 139.917 124.402 114.961 1.00 104.61 ? 158 THR B CA  1 
ATOM   4813  C C   . THR B 1 158 ? 141.199 123.658 114.609 1.00 104.61 ? 158 THR B C   1 
ATOM   4814  O O   . THR B 1 158 ? 142.311 124.135 114.846 1.00 104.61 ? 158 THR B O   1 
ATOM   4815  C CB  . THR B 1 158 ? 139.126 124.724 113.698 1.00 104.61 ? 158 THR B CB  1 
ATOM   4816  O OG1 . THR B 1 158 ? 139.916 125.544 112.829 1.00 104.61 ? 158 THR B OG1 1 
ATOM   4817  C CG2 . THR B 1 158 ? 137.846 125.450 114.054 1.00 104.61 ? 158 THR B CG2 1 
ATOM   4818  N N   . ASN B 1 159 ? 141.034 122.473 114.039 1.00 108.91 ? 159 ASN B N   1 
ATOM   4819  C CA  . ASN B 1 159 ? 142.159 121.563 113.893 1.00 108.91 ? 159 ASN B CA  1 
ATOM   4820  C C   . ASN B 1 159 ? 143.075 122.040 112.775 1.00 108.91 ? 159 ASN B C   1 
ATOM   4821  O O   . ASN B 1 159 ? 142.624 122.346 111.670 1.00 108.91 ? 159 ASN B O   1 
ATOM   4822  C CB  . ASN B 1 159 ? 141.655 120.150 113.622 1.00 108.91 ? 159 ASN B CB  1 
ATOM   4823  C CG  . ASN B 1 159 ? 142.706 119.094 113.879 1.00 108.91 ? 159 ASN B CG  1 
ATOM   4824  O OD1 . ASN B 1 159 ? 143.838 119.404 114.246 1.00 108.91 ? 159 ASN B OD1 1 
ATOM   4825  N ND2 . ASN B 1 159 ? 142.330 117.832 113.699 1.00 108.91 ? 159 ASN B ND2 1 
ATOM   4826  N N   . GLY B 1 160 ? 144.362 122.128 113.081 1.00 105.45 ? 160 GLY B N   1 
ATOM   4827  C CA  . GLY B 1 160 ? 145.330 122.694 112.165 1.00 105.45 ? 160 GLY B CA  1 
ATOM   4828  C C   . GLY B 1 160 ? 145.635 124.140 112.489 1.00 105.45 ? 160 GLY B C   1 
ATOM   4829  O O   . GLY B 1 160 ? 146.770 124.599 112.325 1.00 105.45 ? 160 GLY B O   1 
ATOM   4830  N N   . SER B 1 161 ? 144.622 124.858 112.967 1.00 102.17 ? 161 SER B N   1 
ATOM   4831  C CA  . SER B 1 161 ? 144.724 126.287 113.217 1.00 102.17 ? 161 SER B CA  1 
ATOM   4832  C C   . SER B 1 161 ? 145.551 126.571 114.459 1.00 102.17 ? 161 SER B C   1 
ATOM   4833  O O   . SER B 1 161 ? 145.461 125.862 115.465 1.00 102.17 ? 161 SER B O   1 
ATOM   4834  C CB  . SER B 1 161 ? 143.340 126.893 113.403 1.00 102.17 ? 161 SER B CB  1 
ATOM   4835  O OG  . SER B 1 161 ? 142.760 126.401 114.597 1.00 102.17 ? 161 SER B OG  1 
ATOM   4836  N N   . GLY B 1 162 ? 146.357 127.629 114.382 1.00 96.43  ? 162 GLY B N   1 
ATOM   4837  C CA  . GLY B 1 162 ? 147.139 128.072 115.521 1.00 96.43  ? 162 GLY B CA  1 
ATOM   4838  C C   . GLY B 1 162 ? 146.810 129.475 115.985 1.00 96.43  ? 162 GLY B C   1 
ATOM   4839  O O   . GLY B 1 162 ? 146.884 129.780 117.176 1.00 96.43  ? 162 GLY B O   1 
ATOM   4840  N N   . LEU B 1 163 ? 146.428 130.335 115.057 1.00 82.91  ? 163 LEU B N   1 
ATOM   4841  C CA  . LEU B 1 163 ? 146.109 131.714 115.362 1.00 82.91  ? 163 LEU B CA  1 
ATOM   4842  C C   . LEU B 1 163 ? 144.643 131.959 115.066 1.00 82.91  ? 163 LEU B C   1 
ATOM   4843  O O   . LEU B 1 163 ? 144.126 131.482 114.055 1.00 82.91  ? 163 LEU B O   1 
ATOM   4844  C CB  . LEU B 1 163 ? 146.969 132.651 114.532 1.00 82.91  ? 163 LEU B CB  1 
ATOM   4845  C CG  . LEU B 1 163 ? 146.761 134.122 114.826 1.00 82.91  ? 163 LEU B CG  1 
ATOM   4846  C CD1 . LEU B 1 163 ? 147.238 134.342 116.196 1.00 82.91  ? 163 LEU B CD1 1 
ATOM   4847  C CD2 . LEU B 1 163 ? 147.506 134.993 113.872 1.00 82.91  ? 163 LEU B CD2 1 
ATOM   4848  N N   . ALA B 1 164 ? 143.970 132.703 115.942 1.00 83.13  ? 164 ALA B N   1 
ATOM   4849  C CA  . ALA B 1 164 ? 142.545 132.963 115.750 1.00 83.13  ? 164 ALA B CA  1 
ATOM   4850  C C   . ALA B 1 164 ? 142.218 134.352 116.280 1.00 83.13  ? 164 ALA B C   1 
ATOM   4851  O O   . ALA B 1 164 ? 142.297 134.587 117.486 1.00 83.13  ? 164 ALA B O   1 
ATOM   4852  C CB  . ALA B 1 164 ? 141.710 131.903 116.445 1.00 83.13  ? 164 ALA B CB  1 
ATOM   4853  N N   . LEU B 1 165 ? 141.834 135.253 115.393 1.00 82.83  ? 165 LEU B N   1 
ATOM   4854  C CA  . LEU B 1 165 ? 141.366 136.560 115.816 1.00 82.83  ? 165 LEU B CA  1 
ATOM   4855  C C   . LEU B 1 165 ? 139.846 136.545 115.814 1.00 82.83  ? 165 LEU B C   1 
ATOM   4856  O O   . LEU B 1 165 ? 139.224 136.184 114.813 1.00 82.83  ? 165 LEU B O   1 
ATOM   4857  C CB  . LEU B 1 165 ? 141.934 137.669 114.930 1.00 82.83  ? 165 LEU B CB  1 
ATOM   4858  C CG  . LEU B 1 165 ? 141.646 137.909 113.453 1.00 82.83  ? 165 LEU B CG  1 
ATOM   4859  C CD1 . LEU B 1 165 ? 140.510 138.895 113.291 1.00 82.83  ? 165 LEU B CD1 1 
ATOM   4860  C CD2 . LEU B 1 165 ? 142.887 138.410 112.760 1.00 82.83  ? 165 LEU B CD2 1 
ATOM   4861  N N   . CYS B 1 166 ? 139.253 136.907 116.946 1.00 86.93  ? 166 CYS B N   1 
ATOM   4862  C CA  . CYS B 1 166 ? 137.835 136.680 117.169 1.00 86.93  ? 166 CYS B CA  1 
ATOM   4863  C C   . CYS B 1 166 ? 137.187 137.965 117.646 1.00 86.93  ? 166 CYS B C   1 
ATOM   4864  O O   . CYS B 1 166 ? 137.581 138.505 118.680 1.00 86.93  ? 166 CYS B O   1 
ATOM   4865  C CB  . CYS B 1 166 ? 137.631 135.578 118.209 1.00 86.93  ? 166 CYS B CB  1 
ATOM   4866  S SG  . CYS B 1 166 ? 138.408 134.003 117.784 1.00 86.93  ? 166 CYS B SG  1 
ATOM   4867  N N   . GLN B 1 167 ? 136.194 138.447 116.914 1.00 86.52  ? 167 GLN B N   1 
ATOM   4868  C CA  . GLN B 1 167 ? 135.472 139.612 117.385 1.00 86.52  ? 167 GLN B CA  1 
ATOM   4869  C C   . GLN B 1 167 ? 134.541 139.231 118.517 1.00 86.52  ? 167 GLN B C   1 
ATOM   4870  O O   . GLN B 1 167 ? 134.344 138.060 118.828 1.00 86.52  ? 167 GLN B O   1 
ATOM   4871  C CB  . GLN B 1 167 ? 134.643 140.237 116.279 1.00 86.52  ? 167 GLN B CB  1 
ATOM   4872  C CG  . GLN B 1 167 ? 135.436 140.777 115.142 1.00 86.52  ? 167 GLN B CG  1 
ATOM   4873  C CD  . GLN B 1 167 ? 134.562 141.466 114.132 1.00 86.52  ? 167 GLN B CD  1 
ATOM   4874  O OE1 . GLN B 1 167 ? 133.350 141.573 114.314 1.00 86.52  ? 167 GLN B OE1 1 
ATOM   4875  N NE2 . GLN B 1 167 ? 135.163 141.915 113.043 1.00 86.52  ? 167 GLN B NE2 1 
ATOM   4876  N N   . ARG B 1 168 ? 133.961 140.246 119.141 1.00 87.54  ? 168 ARG B N   1 
ATOM   4877  C CA  . ARG B 1 168 ? 132.833 140.068 120.044 1.00 87.54  ? 168 ARG B CA  1 
ATOM   4878  C C   . ARG B 1 168 ? 131.932 141.269 119.852 1.00 87.54  ? 168 ARG B C   1 
ATOM   4879  O O   . ARG B 1 168 ? 132.385 142.405 120.001 1.00 87.54  ? 168 ARG B O   1 
ATOM   4880  C CB  . ARG B 1 168 ? 133.248 139.998 121.512 1.00 87.54  ? 168 ARG B CB  1 
ATOM   4881  C CG  . ARG B 1 168 ? 134.223 138.925 121.970 1.00 87.54  ? 168 ARG B CG  1 
ATOM   4882  C CD  . ARG B 1 168 ? 133.682 137.532 122.026 1.00 87.54  ? 168 ARG B CD  1 
ATOM   4883  N NE  . ARG B 1 168 ? 134.539 136.721 122.885 1.00 87.54  ? 168 ARG B NE  1 
ATOM   4884  C CZ  . ARG B 1 168 ? 135.651 136.121 122.488 1.00 87.54  ? 168 ARG B CZ  1 
ATOM   4885  N NH1 . ARG B 1 168 ? 136.362 135.410 123.345 1.00 87.54  ? 168 ARG B NH1 1 
ATOM   4886  N NH2 . ARG B 1 168 ? 136.059 136.246 121.241 1.00 87.54  ? 168 ARG B NH2 1 
ATOM   4887  N N   . TYR B 1 169 ? 130.669 141.037 119.540 1.00 91.95  ? 169 TYR B N   1 
ATOM   4888  C CA  . TYR B 1 169 ? 129.737 142.145 119.466 1.00 91.95  ? 169 TYR B CA  1 
ATOM   4889  C C   . TYR B 1 169 ? 128.356 141.662 119.856 1.00 91.95  ? 169 TYR B C   1 
ATOM   4890  O O   . TYR B 1 169 ? 128.112 140.463 120.011 1.00 91.95  ? 169 TYR B O   1 
ATOM   4891  C CB  . TYR B 1 169 ? 129.737 142.791 118.084 1.00 91.95  ? 169 TYR B CB  1 
ATOM   4892  C CG  . TYR B 1 169 ? 129.466 141.866 116.926 1.00 91.95  ? 169 TYR B CG  1 
ATOM   4893  C CD1 . TYR B 1 169 ? 130.504 141.226 116.276 1.00 91.95  ? 169 TYR B CD1 1 
ATOM   4894  C CD2 . TYR B 1 169 ? 128.185 141.677 116.449 1.00 91.95  ? 169 TYR B CD2 1 
ATOM   4895  C CE1 . TYR B 1 169 ? 130.271 140.409 115.204 1.00 91.95  ? 169 TYR B CE1 1 
ATOM   4896  C CE2 . TYR B 1 169 ? 127.937 140.851 115.383 1.00 91.95  ? 169 TYR B CE2 1 
ATOM   4897  C CZ  . TYR B 1 169 ? 128.983 140.219 114.766 1.00 91.95  ? 169 TYR B CZ  1 
ATOM   4898  O OH  . TYR B 1 169 ? 128.736 139.402 113.695 1.00 91.95  ? 169 TYR B OH  1 
ATOM   4899  N N   . TYR B 1 170 ? 127.454 142.620 120.023 1.00 100.82 ? 170 TYR B N   1 
ATOM   4900  C CA  . TYR B 1 170 ? 126.118 142.321 120.499 1.00 100.82 ? 170 TYR B CA  1 
ATOM   4901  C C   . TYR B 1 170 ? 125.308 141.623 119.412 1.00 100.82 ? 170 TYR B C   1 
ATOM   4902  O O   . TYR B 1 170 ? 125.641 141.669 118.232 1.00 100.82 ? 170 TYR B O   1 
ATOM   4903  C CB  . TYR B 1 170 ? 125.414 143.599 120.938 1.00 100.82 ? 170 TYR B CB  1 
ATOM   4904  C CG  . TYR B 1 170 ? 125.972 144.232 122.186 1.00 100.82 ? 170 TYR B CG  1 
ATOM   4905  C CD1 . TYR B 1 170 ? 126.806 143.526 123.040 1.00 100.82 ? 170 TYR B CD1 1 
ATOM   4906  C CD2 . TYR B 1 170 ? 125.648 145.535 122.518 1.00 100.82 ? 170 TYR B CD2 1 
ATOM   4907  C CE1 . TYR B 1 170 ? 127.306 144.104 124.183 1.00 100.82 ? 170 TYR B CE1 1 
ATOM   4908  C CE2 . TYR B 1 170 ? 126.144 146.123 123.659 1.00 100.82 ? 170 TYR B CE2 1 
ATOM   4909  C CZ  . TYR B 1 170 ? 126.972 145.401 124.486 1.00 100.82 ? 170 TYR B CZ  1 
ATOM   4910  O OH  . TYR B 1 170 ? 127.473 145.981 125.624 1.00 100.82 ? 170 TYR B OH  1 
ATOM   4911  N N   . HIS B 1 171 ? 124.238 140.948 119.830 1.00 115.71 ? 171 HIS B N   1 
ATOM   4912  C CA  . HIS B 1 171 ? 123.365 140.278 118.873 1.00 115.71 ? 171 HIS B CA  1 
ATOM   4913  C C   . HIS B 1 171 ? 122.637 141.281 118.000 1.00 115.71 ? 171 HIS B C   1 
ATOM   4914  O O   . HIS B 1 171 ? 122.697 141.223 116.769 1.00 115.71 ? 171 HIS B O   1 
ATOM   4915  C CB  . HIS B 1 171 ? 122.355 139.401 119.601 1.00 115.71 ? 171 HIS B CB  1 
ATOM   4916  C CG  . HIS B 1 171 ? 121.336 138.795 118.695 1.00 115.71 ? 171 HIS B CG  1 
ATOM   4917  N ND1 . HIS B 1 171 ? 120.136 139.410 118.416 1.00 115.71 ? 171 HIS B ND1 1 
ATOM   4918  C CD2 . HIS B 1 171 ? 121.350 137.651 117.976 1.00 115.71 ? 171 HIS B CD2 1 
ATOM   4919  C CE1 . HIS B 1 171 ? 119.448 138.662 117.574 1.00 115.71 ? 171 HIS B CE1 1 
ATOM   4920  N NE2 . HIS B 1 171 ? 120.161 137.587 117.294 1.00 115.71 ? 171 HIS B NE2 1 
ATOM   4921  N N   . ARG B 1 172 ? 121.918 142.194 118.630 1.00 124.99 ? 172 ARG B N   1 
ATOM   4922  C CA  . ARG B 1 172 ? 121.131 143.181 117.919 1.00 124.99 ? 172 ARG B CA  1 
ATOM   4923  C C   . ARG B 1 172 ? 121.105 144.435 118.767 1.00 124.99 ? 172 ARG B C   1 
ATOM   4924  O O   . ARG B 1 172 ? 120.679 144.394 119.923 1.00 124.99 ? 172 ARG B O   1 
ATOM   4925  C CB  . ARG B 1 172 ? 119.714 142.666 117.660 1.00 124.99 ? 172 ARG B CB  1 
ATOM   4926  C CG  . ARG B 1 172 ? 118.819 143.638 116.926 1.00 124.99 ? 172 ARG B CG  1 
ATOM   4927  C CD  . ARG B 1 172 ? 117.433 143.055 116.713 1.00 124.99 ? 172 ARG B CD  1 
ATOM   4928  N NE  . ARG B 1 172 ? 116.558 144.022 116.063 1.00 124.99 ? 172 ARG B NE  1 
ATOM   4929  C CZ  . ARG B 1 172 ? 115.820 144.911 116.718 1.00 124.99 ? 172 ARG B CZ  1 
ATOM   4930  N NH1 . ARG B 1 172 ? 115.849 144.948 118.043 1.00 124.99 ? 172 ARG B NH1 1 
ATOM   4931  N NH2 . ARG B 1 172 ? 115.053 145.761 116.051 1.00 124.99 ? 172 ARG B NH2 1 
ATOM   4932  N N   . GLY B 1 173 ? 121.567 145.533 118.194 1.00 120.93 ? 173 GLY B N   1 
ATOM   4933  C CA  . GLY B 1 173 ? 121.612 146.788 118.907 1.00 120.93 ? 173 GLY B CA  1 
ATOM   4934  C C   . GLY B 1 173 ? 121.758 147.972 117.977 1.00 120.93 ? 173 GLY B C   1 
ATOM   4935  O O   . GLY B 1 173 ? 122.635 147.994 117.109 1.00 120.93 ? 173 GLY B O   1 
ATOM   4936  N N   . HIS B 1 174 ? 120.901 148.970 118.154 1.00 120.73 ? 174 HIS B N   1 
ATOM   4937  C CA  . HIS B 1 174 ? 120.868 150.142 117.291 1.00 120.73 ? 174 HIS B CA  1 
ATOM   4938  C C   . HIS B 1 174 ? 120.935 151.365 118.188 1.00 120.73 ? 174 HIS B C   1 
ATOM   4939  O O   . HIS B 1 174 ? 119.911 151.954 118.530 1.00 120.73 ? 174 HIS B O   1 
ATOM   4940  C CB  . HIS B 1 174 ? 119.604 150.129 116.441 1.00 120.73 ? 174 HIS B CB  1 
ATOM   4941  C CG  . HIS B 1 174 ? 119.492 151.297 115.518 1.00 120.73 ? 174 HIS B CG  1 
ATOM   4942  N ND1 . HIS B 1 174 ? 120.185 151.378 114.331 1.00 120.73 ? 174 HIS B ND1 1 
ATOM   4943  C CD2 . HIS B 1 174 ? 118.796 152.451 115.628 1.00 120.73 ? 174 HIS B CD2 1 
ATOM   4944  C CE1 . HIS B 1 174 ? 119.905 152.524 113.738 1.00 120.73 ? 174 HIS B CE1 1 
ATOM   4945  N NE2 . HIS B 1 174 ? 119.067 153.195 114.506 1.00 120.73 ? 174 HIS B NE2 1 
ATOM   4946  N N   . VAL B 1 175 ? 122.139 151.750 118.567 1.00 117.35 ? 175 VAL B N   1 
ATOM   4947  C CA  . VAL B 1 175 ? 122.308 152.974 119.334 1.00 117.35 ? 175 VAL B CA  1 
ATOM   4948  C C   . VAL B 1 175 ? 122.517 154.134 118.375 1.00 117.35 ? 175 VAL B C   1 
ATOM   4949  O O   . VAL B 1 175 ? 123.227 154.020 117.367 1.00 117.35 ? 175 VAL B O   1 
ATOM   4950  C CB  . VAL B 1 175 ? 123.455 152.838 120.350 1.00 117.35 ? 175 VAL B CB  1 
ATOM   4951  C CG1 . VAL B 1 175 ? 123.056 151.854 121.421 1.00 117.35 ? 175 VAL B CG1 1 
ATOM   4952  C CG2 . VAL B 1 175 ? 124.733 152.365 119.685 1.00 117.35 ? 175 VAL B CG2 1 
ATOM   4953  N N   . ASP B 1 176 ? 121.847 155.236 118.659 1.00 117.06 ? 176 ASP B N   1 
ATOM   4954  C CA  . ASP B 1 176 ? 121.918 156.420 117.823 1.00 117.06 ? 176 ASP B CA  1 
ATOM   4955  C C   . ASP B 1 176 ? 121.550 157.634 118.662 1.00 117.06 ? 176 ASP B C   1 
ATOM   4956  O O   . ASP B 1 176 ? 120.411 157.751 119.124 1.00 117.06 ? 176 ASP B O   1 
ATOM   4957  C CB  . ASP B 1 176 ? 120.979 156.286 116.626 1.00 117.06 ? 176 ASP B CB  1 
ATOM   4958  C CG  . ASP B 1 176 ? 121.227 157.337 115.564 1.00 117.06 ? 176 ASP B CG  1 
ATOM   4959  O OD1 . ASP B 1 176 ? 122.168 158.144 115.708 1.00 117.06 ? 176 ASP B OD1 1 
ATOM   4960  O OD2 . ASP B 1 176 ? 120.459 157.362 114.581 1.00 117.06 ? 176 ASP B OD2 1 
ATOM   4961  N N   . PRO B 1 177 ? 122.480 158.545 118.900 1.00 116.63 ? 177 PRO B N   1 
ATOM   4962  C CA  . PRO B 1 177 ? 122.110 159.817 119.518 1.00 116.63 ? 177 PRO B CA  1 
ATOM   4963  C C   . PRO B 1 177 ? 121.329 160.675 118.541 1.00 116.63 ? 177 PRO B C   1 
ATOM   4964  O O   . PRO B 1 177 ? 121.428 160.506 117.323 1.00 116.63 ? 177 PRO B O   1 
ATOM   4965  C CB  . PRO B 1 177 ? 123.458 160.444 119.868 1.00 116.63 ? 177 PRO B CB  1 
ATOM   4966  C CG  . PRO B 1 177 ? 124.402 159.811 118.932 1.00 116.63 ? 177 PRO B CG  1 
ATOM   4967  C CD  . PRO B 1 177 ? 123.926 158.430 118.690 1.00 116.63 ? 177 PRO B CD  1 
ATOM   4968  N N   . ALA B 1 178 ? 120.491 161.549 119.107 1.00 125.50 ? 178 ALA B N   1 
ATOM   4969  C CA  . ALA B 1 178 ? 119.493 162.428 118.483 1.00 125.50 ? 178 ALA B CA  1 
ATOM   4970  C C   . ALA B 1 178 ? 118.320 161.673 117.854 1.00 125.50 ? 178 ALA B C   1 
ATOM   4971  O O   . ALA B 1 178 ? 117.378 162.317 117.382 1.00 125.50 ? 178 ALA B O   1 
ATOM   4972  C CB  . ALA B 1 178 ? 120.090 163.387 117.438 1.00 125.50 ? 178 ALA B CB  1 
ATOM   4973  N N   . ASN B 1 179 ? 118.344 160.331 117.825 1.00 133.56 ? 179 ASN B N   1 
ATOM   4974  C CA  . ASN B 1 179 ? 117.170 159.500 117.550 1.00 133.56 ? 179 ASN B CA  1 
ATOM   4975  C C   . ASN B 1 179 ? 117.288 158.323 118.519 1.00 133.56 ? 179 ASN B C   1 
ATOM   4976  O O   . ASN B 1 179 ? 117.793 157.257 118.170 1.00 133.56 ? 179 ASN B O   1 
ATOM   4977  C CB  . ASN B 1 179 ? 117.116 159.045 116.089 1.00 133.56 ? 179 ASN B CB  1 
ATOM   4978  C CG  . ASN B 1 179 ? 115.782 158.411 115.712 1.00 133.56 ? 179 ASN B CG  1 
ATOM   4979  O OD1 . ASN B 1 179 ? 114.871 158.311 116.531 1.00 133.56 ? 179 ASN B OD1 1 
ATOM   4980  N ND2 . ASN B 1 179 ? 115.669 157.977 114.463 1.00 133.56 ? 179 ASN B ND2 1 
ATOM   4981  N N   . ASP B 1 180 ? 116.762 158.501 119.727 1.00 136.66 ? 180 ASP B N   1 
ATOM   4982  C CA  . ASP B 1 180 ? 117.110 157.634 120.854 1.00 136.66 ? 180 ASP B CA  1 
ATOM   4983  C C   . ASP B 1 180 ? 116.171 156.437 120.988 1.00 136.66 ? 180 ASP B C   1 
ATOM   4984  O O   . ASP B 1 180 ? 115.626 156.164 122.056 1.00 136.66 ? 180 ASP B O   1 
ATOM   4985  C CB  . ASP B 1 180 ? 117.134 158.461 122.130 1.00 136.66 ? 180 ASP B CB  1 
ATOM   4986  C CG  . ASP B 1 180 ? 118.206 159.524 122.103 1.00 136.66 ? 180 ASP B CG  1 
ATOM   4987  O OD1 . ASP B 1 180 ? 119.246 159.293 121.454 1.00 136.66 ? 180 ASP B OD1 1 
ATOM   4988  O OD2 . ASP B 1 180 ? 118.000 160.597 122.703 1.00 136.66 ? 180 ASP B OD2 1 
ATOM   4989  N N   . THR B 1 181 ? 115.988 155.705 119.887 1.00 136.27 ? 181 THR B N   1 
ATOM   4990  C CA  . THR B 1 181 ? 115.265 154.433 119.882 1.00 136.27 ? 181 THR B CA  1 
ATOM   4991  C C   . THR B 1 181 ? 116.332 153.344 119.906 1.00 136.27 ? 181 THR B C   1 
ATOM   4992  O O   . THR B 1 181 ? 116.726 152.791 118.882 1.00 136.27 ? 181 THR B O   1 
ATOM   4993  C CB  . THR B 1 181 ? 114.357 154.328 118.654 1.00 136.27 ? 181 THR B CB  1 
ATOM   4994  O OG1 . THR B 1 181 ? 113.501 155.474 118.594 1.00 136.27 ? 181 THR B OG1 1 
ATOM   4995  C CG2 . THR B 1 181 ? 113.484 153.077 118.725 1.00 136.27 ? 181 THR B CG2 1 
ATOM   4996  N N   . PHE B 1 182 ? 116.835 153.059 121.098 1.00 129.93 ? 182 PHE B N   1 
ATOM   4997  C CA  . PHE B 1 182 ? 118.025 152.238 121.233 1.00 129.93 ? 182 PHE B CA  1 
ATOM   4998  C C   . PHE B 1 182 ? 117.720 150.948 121.980 1.00 129.93 ? 182 PHE B C   1 
ATOM   4999  O O   . PHE B 1 182 ? 117.041 150.956 123.012 1.00 129.93 ? 182 PHE B O   1 
ATOM   5000  C CB  . PHE B 1 182 ? 119.156 153.027 121.902 1.00 129.93 ? 182 PHE B CB  1 
ATOM   5001  C CG  . PHE B 1 182 ? 118.817 153.586 123.247 1.00 129.93 ? 182 PHE B CG  1 
ATOM   5002  C CD1 . PHE B 1 182 ? 118.230 154.833 123.366 1.00 129.93 ? 182 PHE B CD1 1 
ATOM   5003  C CD2 . PHE B 1 182 ? 119.141 152.893 124.397 1.00 129.93 ? 182 PHE B CD2 1 
ATOM   5004  C CE1 . PHE B 1 182 ? 117.932 155.354 124.600 1.00 129.93 ? 182 PHE B CE1 1 
ATOM   5005  C CE2 . PHE B 1 182 ? 118.848 153.412 125.637 1.00 129.93 ? 182 PHE B CE2 1 
ATOM   5006  C CZ  . PHE B 1 182 ? 118.244 154.644 125.738 1.00 129.93 ? 182 PHE B CZ  1 
ATOM   5007  N N   . ASP B 1 183 ? 118.221 149.841 121.432 1.00 129.12 ? 183 ASP B N   1 
ATOM   5008  C CA  . ASP B 1 183 ? 118.003 148.505 121.969 1.00 129.12 ? 183 ASP B CA  1 
ATOM   5009  C C   . ASP B 1 183 ? 119.315 147.911 122.449 1.00 129.12 ? 183 ASP B C   1 
ATOM   5010  O O   . ASP B 1 183 ? 120.336 147.995 121.759 1.00 129.12 ? 183 ASP B O   1 
ATOM   5011  C CB  . ASP B 1 183 ? 117.357 147.590 120.930 1.00 129.12 ? 183 ASP B CB  1 
ATOM   5012  C CG  . ASP B 1 183 ? 118.056 147.644 119.595 1.00 129.12 ? 183 ASP B CG  1 
ATOM   5013  O OD1 . ASP B 1 183 ? 118.888 148.547 119.399 1.00 129.12 ? 183 ASP B OD1 1 
ATOM   5014  O OD2 . ASP B 1 183 ? 117.786 146.781 118.737 1.00 129.12 ? 183 ASP B OD2 1 
ATOM   5015  N N   . ILE B 1 184 ? 119.288 147.336 123.646 1.00 125.81 ? 184 ILE B N   1 
ATOM   5016  C CA  . ILE B 1 184 ? 120.465 146.766 124.277 1.00 125.81 ? 184 ILE B CA  1 
ATOM   5017  C C   . ILE B 1 184 ? 120.032 145.443 124.881 1.00 125.81 ? 184 ILE B C   1 
ATOM   5018  O O   . ILE B 1 184 ? 119.210 145.422 125.804 1.00 125.81 ? 184 ILE B O   1 
ATOM   5019  C CB  . ILE B 1 184 ? 121.054 147.686 125.356 1.00 125.81 ? 184 ILE B CB  1 
ATOM   5020  C CG1 . ILE B 1 184 ? 121.562 149.008 124.766 1.00 125.81 ? 184 ILE B CG1 1 
ATOM   5021  C CG2 . ILE B 1 184 ? 122.181 146.986 126.088 1.00 125.81 ? 184 ILE B CG2 1 
ATOM   5022  C CD1 . ILE B 1 184 ? 121.797 150.086 125.804 1.00 125.81 ? 184 ILE B CD1 1 
ATOM   5023  N N   . ASP B 1 185 ? 120.560 144.344 124.359 1.00 120.28 ? 185 ASP B N   1 
ATOM   5024  C CA  . ASP B 1 185 ? 120.350 143.026 124.951 1.00 120.28 ? 185 ASP B CA  1 
ATOM   5025  C C   . ASP B 1 185 ? 121.646 142.241 124.926 1.00 120.28 ? 185 ASP B C   1 
ATOM   5026  O O   . ASP B 1 185 ? 122.204 142.016 123.831 1.00 120.28 ? 185 ASP B O   1 
ATOM   5027  C CB  . ASP B 1 185 ? 119.264 142.236 124.235 1.00 120.28 ? 185 ASP B CB  1 
ATOM   5028  C CG  . ASP B 1 185 ? 119.006 140.910 124.900 1.00 120.28 ? 185 ASP B CG  1 
ATOM   5029  O OD1 . ASP B 1 185 ? 118.372 140.912 125.973 1.00 120.28 ? 185 ASP B OD1 1 
ATOM   5030  O OD2 . ASP B 1 185 ? 119.463 139.875 124.370 1.00 120.28 ? 185 ASP B OD2 1 
ATOM   5031  N N   . PRO B 1 186 ? 122.141 141.796 126.066 1.00 117.15 ? 186 PRO B N   1 
ATOM   5032  C CA  . PRO B 1 186 ? 123.431 141.105 126.096 1.00 117.15 ? 186 PRO B CA  1 
ATOM   5033  C C   . PRO B 1 186 ? 123.359 139.719 125.492 1.00 117.15 ? 186 PRO B C   1 
ATOM   5034  O O   . PRO B 1 186 ? 122.846 138.787 126.110 1.00 117.15 ? 186 PRO B O   1 
ATOM   5035  C CB  . PRO B 1 186 ? 123.754 141.035 127.593 1.00 117.15 ? 186 PRO B CB  1 
ATOM   5036  C CG  . PRO B 1 186 ? 122.893 142.082 128.220 1.00 117.15 ? 186 PRO B CG  1 
ATOM   5037  C CD  . PRO B 1 186 ? 121.647 142.094 127.416 1.00 117.15 ? 186 PRO B CD  1 
ATOM   5038  N N   . MET B 1 187 ? 123.870 139.581 124.277 1.00 115.04 ? 187 MET B N   1 
ATOM   5039  C CA  . MET B 1 187 ? 123.974 138.276 123.633 1.00 115.04 ? 187 MET B CA  1 
ATOM   5040  C C   . MET B 1 187 ? 125.138 138.379 122.650 1.00 115.04 ? 187 MET B C   1 
ATOM   5041  O O   . MET B 1 187 ? 124.987 138.881 121.536 1.00 115.04 ? 187 MET B O   1 
ATOM   5042  C CB  . MET B 1 187 ? 122.681 137.878 122.945 1.00 115.04 ? 187 MET B CB  1 
ATOM   5043  C CG  . MET B 1 187 ? 122.687 136.455 122.453 1.00 115.04 ? 187 MET B CG  1 
ATOM   5044  S SD  . MET B 1 187 ? 122.850 135.303 123.830 1.00 115.04 ? 187 MET B SD  1 
ATOM   5045  C CE  . MET B 1 187 ? 123.529 133.867 123.005 1.00 115.04 ? 187 MET B CE  1 
ATOM   5046  N N   . VAL B 1 188 ? 126.275 137.906 123.068 1.00 100.02 ? 188 VAL B N   1 
ATOM   5047  C CA  . VAL B 1 188 ? 127.513 138.151 122.350 1.00 100.02 ? 188 VAL B CA  1 
ATOM   5048  C C   . VAL B 1 188 ? 127.834 136.963 121.456 1.00 100.02 ? 188 VAL B C   1 
ATOM   5049  O O   . VAL B 1 188 ? 127.572 135.809 121.807 1.00 100.02 ? 188 VAL B O   1 
ATOM   5050  C CB  . VAL B 1 188 ? 128.639 138.454 123.351 1.00 100.02 ? 188 VAL B CB  1 
ATOM   5051  C CG1 . VAL B 1 188 ? 128.333 139.751 124.048 1.00 100.02 ? 188 VAL B CG1 1 
ATOM   5052  C CG2 . VAL B 1 188 ? 128.744 137.360 124.397 1.00 100.02 ? 188 VAL B CG2 1 
ATOM   5053  N N   . VAL B 1 189 ? 128.369 137.244 120.272 1.00 91.95  ? 189 VAL B N   1 
ATOM   5054  C CA  . VAL B 1 189 ? 128.669 136.214 119.287 1.00 91.95  ? 189 VAL B CA  1 
ATOM   5055  C C   . VAL B 1 189 ? 130.160 136.249 119.006 1.00 91.95  ? 189 VAL B C   1 
ATOM   5056  O O   . VAL B 1 189 ? 130.722 137.318 118.755 1.00 91.95  ? 189 VAL B O   1 
ATOM   5057  C CB  . VAL B 1 189 ? 127.868 136.409 117.988 1.00 91.95  ? 189 VAL B CB  1 
ATOM   5058  C CG1 . VAL B 1 189 ? 128.143 135.282 116.999 1.00 91.95  ? 189 VAL B CG1 1 
ATOM   5059  C CG2 . VAL B 1 189 ? 126.398 136.493 118.287 1.00 91.95  ? 189 VAL B CG2 1 
ATOM   5060  N N   . THR B 1 190 ? 130.791 135.083 119.032 1.00 93.12  ? 190 THR B N   1 
ATOM   5061  C CA  . THR B 1 190 ? 132.234 134.951 118.863 1.00 93.12  ? 190 THR B CA  1 
ATOM   5062  C C   . THR B 1 190 ? 132.534 134.569 117.417 1.00 93.12  ? 190 THR B C   1 
ATOM   5063  O O   . THR B 1 190 ? 132.503 133.391 117.057 1.00 93.12  ? 190 THR B O   1 
ATOM   5064  C CB  . THR B 1 190 ? 132.767 133.912 119.839 1.00 93.12  ? 190 THR B CB  1 
ATOM   5065  O OG1 . THR B 1 190 ? 132.412 134.298 121.173 1.00 93.12  ? 190 THR B OG1 1 
ATOM   5066  C CG2 . THR B 1 190 ? 134.273 133.793 119.749 1.00 93.12  ? 190 THR B CG2 1 
ATOM   5067  N N   . ASP B 1 191 ? 132.828 135.564 116.581 1.00 97.62  ? 191 ASP B N   1 
ATOM   5068  C CA  . ASP B 1 191 ? 133.140 135.342 115.168 1.00 97.62  ? 191 ASP B CA  1 
ATOM   5069  C C   . ASP B 1 191 ? 134.646 135.223 114.999 1.00 97.62  ? 191 ASP B C   1 
ATOM   5070  O O   . ASP B 1 191 ? 135.350 136.229 114.890 1.00 97.62  ? 191 ASP B O   1 
ATOM   5071  C CB  . ASP B 1 191 ? 132.594 136.470 114.306 1.00 97.62  ? 191 ASP B CB  1 
ATOM   5072  C CG  . ASP B 1 191 ? 131.104 136.451 114.235 1.00 97.62  ? 191 ASP B CG  1 
ATOM   5073  O OD1 . ASP B 1 191 ? 130.531 135.357 114.388 1.00 97.62  ? 191 ASP B OD1 1 
ATOM   5074  O OD2 . ASP B 1 191 ? 130.500 137.517 114.017 1.00 97.62  ? 191 ASP B OD2 1 
ATOM   5075  N N   . CYS B 1 192 ? 135.138 133.995 114.945 1.00 98.08  ? 192 CYS B N   1 
ATOM   5076  C CA  . CYS B 1 192 ? 136.565 133.753 114.829 1.00 98.08  ? 192 CYS B CA  1 
ATOM   5077  C C   . CYS B 1 192 ? 136.975 133.614 113.374 1.00 98.08  ? 192 CYS B C   1 
ATOM   5078  O O   . CYS B 1 192 ? 136.207 133.151 112.532 1.00 98.08  ? 192 CYS B O   1 
ATOM   5079  C CB  . CYS B 1 192 ? 136.970 132.502 115.602 1.00 98.08  ? 192 CYS B CB  1 
ATOM   5080  S SG  . CYS B 1 192 ? 136.874 132.727 117.374 1.00 98.08  ? 192 CYS B SG  1 
ATOM   5081  N N   . ILE B 1 193 ? 138.195 134.040 113.089 1.00 88.94  ? 193 ILE B N   1 
ATOM   5082  C CA  . ILE B 1 193 ? 138.815 133.860 111.788 1.00 88.94  ? 193 ILE B CA  1 
ATOM   5083  C C   . ILE B 1 193 ? 139.996 132.934 111.990 1.00 88.94  ? 193 ILE B C   1 
ATOM   5084  O O   . ILE B 1 193 ? 140.804 133.138 112.899 1.00 88.94  ? 193 ILE B O   1 
ATOM   5085  C CB  . ILE B 1 193 ? 139.262 135.200 111.184 1.00 88.94  ? 193 ILE B CB  1 
ATOM   5086  C CG1 . ILE B 1 193 ? 138.103 136.187 111.186 1.00 88.94  ? 193 ILE B CG1 1 
ATOM   5087  C CG2 . ILE B 1 193 ? 139.735 135.006 109.774 1.00 88.94  ? 193 ILE B CG2 1 
ATOM   5088  C CD1 . ILE B 1 193 ? 136.909 135.722 110.408 1.00 88.94  ? 193 ILE B CD1 1 
ATOM   5089  N N   . GLN B 1 194 ? 140.089 131.909 111.167 1.00 91.73  ? 194 GLN B N   1 
ATOM   5090  C CA  . GLN B 1 194 ? 141.053 130.854 111.393 1.00 91.73  ? 194 GLN B CA  1 
ATOM   5091  C C   . GLN B 1 194 ? 142.238 131.028 110.463 1.00 91.73  ? 194 GLN B C   1 
ATOM   5092  O O   . GLN B 1 194 ? 142.067 131.279 109.269 1.00 91.73  ? 194 GLN B O   1 
ATOM   5093  C CB  . GLN B 1 194 ? 140.422 129.488 111.168 1.00 91.73  ? 194 GLN B CB  1 
ATOM   5094  C CG  . GLN B 1 194 ? 139.215 129.230 112.031 1.00 91.73  ? 194 GLN B CG  1 
ATOM   5095  C CD  . GLN B 1 194 ? 139.545 129.177 113.499 1.00 91.73  ? 194 GLN B CD  1 
ATOM   5096  O OE1 . GLN B 1 194 ? 140.581 128.650 113.894 1.00 91.73  ? 194 GLN B OE1 1 
ATOM   5097  N NE2 . GLN B 1 194 ? 138.656 129.718 114.324 1.00 91.73  ? 194 GLN B NE2 1 
ATOM   5098  N N   . VAL B 1 195 ? 143.435 130.880 111.017 1.00 85.95  ? 195 VAL B N   1 
ATOM   5099  C CA  . VAL B 1 195 ? 144.665 130.924 110.239 1.00 85.95  ? 195 VAL B CA  1 
ATOM   5100  C C   . VAL B 1 195 ? 145.696 130.027 110.911 1.00 85.95  ? 195 VAL B C   1 
ATOM   5101  O O   . VAL B 1 195 ? 145.863 130.047 112.134 1.00 85.95  ? 195 VAL B O   1 
ATOM   5102  C CB  . VAL B 1 195 ? 145.157 132.377 110.039 1.00 85.95  ? 195 VAL B CB  1 
ATOM   5103  C CG1 . VAL B 1 195 ? 145.239 133.115 111.334 1.00 85.95  ? 195 VAL B CG1 1 
ATOM   5104  C CG2 . VAL B 1 195 ? 146.502 132.411 109.355 1.00 85.95  ? 195 VAL B CG2 1 
ATOM   5105  N N   . ASP B 1 196 ? 146.321 129.190 110.114 1.00 91.72  ? 196 ASP B N   1 
ATOM   5106  C CA  . ASP B 1 196 ? 147.390 128.272 110.422 1.00 91.72  ? 196 ASP B CA  1 
ATOM   5107  C C   . ASP B 1 196 ? 148.698 128.750 109.800 1.00 91.72  ? 196 ASP B C   1 
ATOM   5108  O O   . ASP B 1 196 ? 148.685 129.385 108.742 1.00 91.72  ? 196 ASP B O   1 
ATOM   5109  C CB  . ASP B 1 196 ? 147.035 126.871 109.909 1.00 91.72  ? 196 ASP B CB  1 
ATOM   5110  C CG  . ASP B 1 196 ? 146.557 126.871 108.470 1.00 91.72  ? 196 ASP B CG  1 
ATOM   5111  O OD1 . ASP B 1 196 ? 146.360 127.956 107.895 1.00 91.72  ? 196 ASP B OD1 1 
ATOM   5112  O OD2 . ASP B 1 196 ? 146.367 125.774 107.907 1.00 91.72  ? 196 ASP B OD2 1 
ATOM   5113  N N   . PRO B 1 197 ? 149.838 128.499 110.437 1.00 93.18  ? 197 PRO B N   1 
ATOM   5114  C CA  . PRO B 1 197 ? 151.104 128.943 109.872 1.00 93.18  ? 197 PRO B CA  1 
ATOM   5115  C C   . PRO B 1 197 ? 151.470 128.105 108.666 1.00 93.18  ? 197 PRO B C   1 
ATOM   5116  O O   . PRO B 1 197 ? 151.124 126.917 108.600 1.00 93.18  ? 197 PRO B O   1 
ATOM   5117  C CB  . PRO B 1 197 ? 152.096 128.726 111.017 1.00 93.18  ? 197 PRO B CB  1 
ATOM   5118  C CG  . PRO B 1 197 ? 151.516 127.634 111.787 1.00 93.18  ? 197 PRO B CG  1 
ATOM   5119  C CD  . PRO B 1 197 ? 150.036 127.818 111.725 1.00 93.18  ? 197 PRO B CD  1 
ATOM   5120  N N   . PRO B 1 198 ? 152.145 128.688 107.684 1.00 104.35 ? 198 PRO B N   1 
ATOM   5121  C CA  . PRO B 1 198 ? 152.528 127.918 106.501 1.00 104.35 ? 198 PRO B CA  1 
ATOM   5122  C C   . PRO B 1 198 ? 153.650 126.949 106.821 1.00 104.35 ? 198 PRO B C   1 
ATOM   5123  O O   . PRO B 1 198 ? 154.447 127.152 107.737 1.00 104.35 ? 198 PRO B O   1 
ATOM   5124  C CB  . PRO B 1 198 ? 152.986 128.992 105.518 1.00 104.35 ? 198 PRO B CB  1 
ATOM   5125  C CG  . PRO B 1 198 ? 153.447 130.105 106.391 1.00 104.35 ? 198 PRO B CG  1 
ATOM   5126  C CD  . PRO B 1 198 ? 152.560 130.096 107.589 1.00 104.35 ? 198 PRO B CD  1 
ATOM   5127  N N   . GLU B 1 199 ? 153.699 125.873 106.046 1.00 126.61 ? 199 GLU B N   1 
ATOM   5128  C CA  . GLU B 1 199 ? 154.679 124.819 106.262 1.00 126.61 ? 199 GLU B CA  1 
ATOM   5129  C C   . GLU B 1 199 ? 156.027 125.146 105.633 1.00 126.61 ? 199 GLU B C   1 
ATOM   5130  O O   . GLU B 1 199 ? 157.059 125.087 106.307 1.00 126.61 ? 199 GLU B O   1 
ATOM   5131  C CB  . GLU B 1 199 ? 154.147 123.493 105.704 1.00 126.61 ? 199 GLU B CB  1 
ATOM   5132  C CG  . GLU B 1 199 ? 155.060 122.290 105.924 1.00 126.61 ? 199 GLU B CG  1 
ATOM   5133  C CD  . GLU B 1 199 ? 155.134 121.839 107.376 1.00 126.61 ? 199 GLU B CD  1 
ATOM   5134  O OE1 . GLU B 1 199 ? 154.151 122.039 108.120 1.00 126.61 ? 199 GLU B OE1 1 
ATOM   5135  O OE2 . GLU B 1 199 ? 156.178 121.279 107.772 1.00 126.61 ? 199 GLU B OE2 1 
ATOM   5136  N N   . ARG B 1 200 ? 156.032 125.509 104.353 1.00 136.80 ? 200 ARG B N   1 
ATOM   5137  C CA  . ARG B 1 200 ? 157.246 125.699 103.580 1.00 136.80 ? 200 ARG B CA  1 
ATOM   5138  C C   . ARG B 1 200 ? 157.293 127.081 102.933 1.00 136.80 ? 200 ARG B C   1 
ATOM   5139  O O   . ARG B 1 200 ? 156.247 127.677 102.663 1.00 136.80 ? 200 ARG B O   1 
ATOM   5140  C CB  . ARG B 1 200 ? 157.367 124.611 102.500 1.00 136.80 ? 200 ARG B CB  1 
ATOM   5141  C CG  . ARG B 1 200 ? 157.761 123.222 103.016 1.00 136.80 ? 200 ARG B CG  1 
ATOM   5142  C CD  . ARG B 1 200 ? 159.211 123.213 103.494 1.00 136.80 ? 200 ARG B CD  1 
ATOM   5143  N NE  . ARG B 1 200 ? 159.336 123.533 104.913 1.00 136.80 ? 200 ARG B NE  1 
ATOM   5144  C CZ  . ARG B 1 200 ? 160.438 124.009 105.476 1.00 136.80 ? 200 ARG B CZ  1 
ATOM   5145  N NH1 . ARG B 1 200 ? 161.514 124.244 104.740 1.00 136.80 ? 200 ARG B NH1 1 
ATOM   5146  N NH2 . ARG B 1 200 ? 160.454 124.273 106.774 1.00 136.80 ? 200 ARG B NH2 1 
ATOM   5147  N N   . PRO B 1 201 ? 158.501 127.631 102.699 1.00 143.45 ? 201 PRO B N   1 
ATOM   5148  C CA  . PRO B 1 201 ? 158.657 128.895 101.966 1.00 143.45 ? 201 PRO B CA  1 
ATOM   5149  C C   . PRO B 1 201 ? 158.195 128.819 100.510 1.00 143.45 ? 201 PRO B C   1 
ATOM   5150  O O   . PRO B 1 201 ? 158.259 129.829 99.808  1.00 143.45 ? 201 PRO B O   1 
ATOM   5151  C CB  . PRO B 1 201 ? 160.167 129.154 102.032 1.00 143.45 ? 201 PRO B CB  1 
ATOM   5152  C CG  . PRO B 1 201 ? 160.624 128.421 103.238 1.00 143.45 ? 201 PRO B CG  1 
ATOM   5153  C CD  . PRO B 1 201 ? 159.779 127.190 103.293 1.00 143.45 ? 201 PRO B CD  1 
ATOM   5154  N N   . SER B 1 216 ? 145.098 133.888 104.861 1.00 100.16 ? 216 SER B N   1 
ATOM   5155  C CA  . SER B 1 216 ? 144.290 133.883 103.649 1.00 100.16 ? 216 SER B CA  1 
ATOM   5156  C C   . SER B 1 216 ? 143.383 135.105 103.579 1.00 100.16 ? 216 SER B C   1 
ATOM   5157  O O   . SER B 1 216 ? 143.835 136.212 103.296 1.00 100.16 ? 216 SER B O   1 
ATOM   5158  C CB  . SER B 1 216 ? 143.450 132.606 103.567 1.00 100.16 ? 216 SER B CB  1 
ATOM   5159  O OG  . SER B 1 216 ? 142.611 132.621 102.425 1.00 100.16 ? 216 SER B OG  1 
ATOM   5160  N N   . SER B 1 217 ? 142.098 134.900 103.856 1.00 96.03  ? 217 SER B N   1 
ATOM   5161  C CA  . SER B 1 217 ? 141.088 135.932 103.687 1.00 96.03  ? 217 SER B CA  1 
ATOM   5162  C C   . SER B 1 217 ? 140.958 136.838 104.901 1.00 96.03  ? 217 SER B C   1 
ATOM   5163  O O   . SER B 1 217 ? 139.954 137.549 105.020 1.00 96.03  ? 217 SER B O   1 
ATOM   5164  C CB  . SER B 1 217 ? 139.736 135.291 103.370 1.00 96.03  ? 217 SER B CB  1 
ATOM   5165  O OG  . SER B 1 217 ? 139.788 134.565 102.155 1.00 96.03  ? 217 SER B OG  1 
ATOM   5166  N N   . TYR B 1 218 ? 141.946 136.837 105.798 1.00 87.23  ? 218 TYR B N   1 
ATOM   5167  C CA  . TYR B 1 218 ? 141.826 137.616 107.022 1.00 87.23  ? 218 TYR B CA  1 
ATOM   5168  C C   . TYR B 1 218 ? 141.943 139.109 106.773 1.00 87.23  ? 218 TYR B C   1 
ATOM   5169  O O   . TYR B 1 218 ? 141.430 139.894 107.574 1.00 87.23  ? 218 TYR B O   1 
ATOM   5170  C CB  . TYR B 1 218 ? 142.873 137.168 108.036 1.00 87.23  ? 218 TYR B CB  1 
ATOM   5171  C CG  . TYR B 1 218 ? 144.311 137.433 107.656 1.00 87.23  ? 218 TYR B CG  1 
ATOM   5172  C CD1 . TYR B 1 218 ? 145.030 136.513 106.917 1.00 87.23  ? 218 TYR B CD1 1 
ATOM   5173  C CD2 . TYR B 1 218 ? 144.965 138.582 108.087 1.00 87.23  ? 218 TYR B CD2 1 
ATOM   5174  C CE1 . TYR B 1 218 ? 146.344 136.745 106.591 1.00 87.23  ? 218 TYR B CE1 1 
ATOM   5175  C CE2 . TYR B 1 218 ? 146.268 138.821 107.758 1.00 87.23  ? 218 TYR B CE2 1 
ATOM   5176  C CZ  . TYR B 1 218 ? 146.953 137.899 107.017 1.00 87.23  ? 218 TYR B CZ  1 
ATOM   5177  O OH  . TYR B 1 218 ? 148.259 138.137 106.695 1.00 87.23  ? 218 TYR B OH  1 
ATOM   5178  N N   . LYS B 1 219 ? 142.623 139.512 105.698 1.00 85.13  ? 219 LYS B N   1 
ATOM   5179  C CA  . LYS B 1 219 ? 142.628 140.914 105.304 1.00 85.13  ? 219 LYS B CA  1 
ATOM   5180  C C   . LYS B 1 219 ? 141.231 141.387 104.941 1.00 85.13  ? 219 LYS B C   1 
ATOM   5181  O O   . LYS B 1 219 ? 140.862 142.529 105.231 1.00 85.13  ? 219 LYS B O   1 
ATOM   5182  C CB  . LYS B 1 219 ? 143.574 141.127 104.131 1.00 85.13  ? 219 LYS B CB  1 
ATOM   5183  C CG  . LYS B 1 219 ? 145.034 140.995 104.463 1.00 85.13  ? 219 LYS B CG  1 
ATOM   5184  C CD  . LYS B 1 219 ? 145.503 142.201 105.252 1.00 85.13  ? 219 LYS B CD  1 
ATOM   5185  C CE  . LYS B 1 219 ? 146.996 142.138 105.507 1.00 85.13  ? 219 LYS B CE  1 
ATOM   5186  N NZ  . LYS B 1 219 ? 147.765 142.287 104.244 1.00 85.13  ? 219 LYS B NZ  1 
ATOM   5187  N N   . ASN B 1 220 ? 140.445 140.531 104.306 1.00 89.64  ? 220 ASN B N   1 
ATOM   5188  C CA  . ASN B 1 220 ? 139.031 140.820 104.120 1.00 89.64  ? 220 ASN B CA  1 
ATOM   5189  C C   . ASN B 1 220 ? 138.364 140.711 105.482 1.00 89.64  ? 220 ASN B C   1 
ATOM   5190  O O   . ASN B 1 220 ? 138.106 139.612 105.975 1.00 89.64  ? 220 ASN B O   1 
ATOM   5191  C CB  . ASN B 1 220 ? 138.416 139.865 103.104 1.00 89.64  ? 220 ASN B CB  1 
ATOM   5192  C CG  . ASN B 1 220 ? 138.953 140.079 101.700 1.00 89.64  ? 220 ASN B CG  1 
ATOM   5193  O OD1 . ASN B 1 220 ? 139.622 139.216 101.139 1.00 89.64  ? 220 ASN B OD1 1 
ATOM   5194  N ND2 . ASN B 1 220 ? 138.650 141.234 101.123 1.00 89.64  ? 220 ASN B ND2 1 
ATOM   5195  N N   . LEU B 1 221 ? 138.107 141.857 106.108 1.00 87.12  ? 221 LEU B N   1 
ATOM   5196  C CA  . LEU B 1 221 ? 137.590 141.898 107.468 1.00 87.12  ? 221 LEU B CA  1 
ATOM   5197  C C   . LEU B 1 221 ? 136.908 143.234 107.713 1.00 87.12  ? 221 LEU B C   1 
ATOM   5198  O O   . LEU B 1 221 ? 137.449 144.282 107.362 1.00 87.12  ? 221 LEU B O   1 
ATOM   5199  C CB  . LEU B 1 221 ? 138.714 141.694 108.488 1.00 87.12  ? 221 LEU B CB  1 
ATOM   5200  C CG  . LEU B 1 221 ? 138.295 141.788 109.951 1.00 87.12  ? 221 LEU B CG  1 
ATOM   5201  C CD1 . LEU B 1 221 ? 137.261 140.740 110.251 1.00 87.12  ? 221 LEU B CD1 1 
ATOM   5202  C CD2 . LEU B 1 221 ? 139.487 141.646 110.873 1.00 87.12  ? 221 LEU B CD2 1 
ATOM   5203  N N   . THR B 1 222 ? 135.723 143.190 108.310 1.00 87.48  ? 222 THR B N   1 
ATOM   5204  C CA  . THR B 1 222 ? 135.070 144.377 108.837 1.00 87.48  ? 222 THR B CA  1 
ATOM   5205  C C   . THR B 1 222 ? 134.889 144.198 110.334 1.00 87.48  ? 222 THR B C   1 
ATOM   5206  O O   . THR B 1 222 ? 134.954 143.080 110.844 1.00 87.48  ? 222 THR B O   1 
ATOM   5207  C CB  . THR B 1 222 ? 133.724 144.616 108.181 1.00 87.48  ? 222 THR B CB  1 
ATOM   5208  O OG1 . THR B 1 222 ? 132.875 143.495 108.439 1.00 87.48  ? 222 THR B OG1 1 
ATOM   5209  C CG2 . THR B 1 222 ? 133.885 144.778 106.686 1.00 87.48  ? 222 THR B CG2 1 
ATOM   5210  N N   . LEU B 1 223 ? 134.676 145.299 111.049 1.00 82.68  ? 223 LEU B N   1 
ATOM   5211  C CA  . LEU B 1 223 ? 134.702 145.227 112.500 1.00 82.68  ? 223 LEU B CA  1 
ATOM   5212  C C   . LEU B 1 223 ? 133.418 145.629 113.201 1.00 82.68  ? 223 LEU B C   1 
ATOM   5213  O O   . LEU B 1 223 ? 133.195 145.153 114.315 1.00 82.68  ? 223 LEU B O   1 
ATOM   5214  C CB  . LEU B 1 223 ? 135.858 146.063 113.062 1.00 82.68  ? 223 LEU B CB  1 
ATOM   5215  C CG  . LEU B 1 223 ? 137.162 145.294 113.325 1.00 82.68  ? 223 LEU B CG  1 
ATOM   5216  C CD1 . LEU B 1 223 ? 137.869 144.847 112.077 1.00 82.68  ? 223 LEU B CD1 1 
ATOM   5217  C CD2 . LEU B 1 223 ? 138.098 146.131 114.147 1.00 82.68  ? 223 LEU B CD2 1 
ATOM   5218  N N   . LYS B 1 224 ? 132.579 146.469 112.591 1.00 86.11  ? 224 LYS B N   1 
ATOM   5219  C CA  . LYS B 1 224 ? 131.282 146.899 113.131 1.00 86.11  ? 224 LYS B CA  1 
ATOM   5220  C C   . LYS B 1 224 ? 131.444 147.584 114.493 1.00 86.11  ? 224 LYS B C   1 
ATOM   5221  O O   . LYS B 1 224 ? 131.030 147.075 115.534 1.00 86.11  ? 224 LYS B O   1 
ATOM   5222  C CB  . LYS B 1 224 ? 130.279 145.737 113.209 1.00 86.11  ? 224 LYS B CB  1 
ATOM   5223  C CG  . LYS B 1 224 ? 129.887 145.159 111.857 1.00 86.11  ? 224 LYS B CG  1 
ATOM   5224  C CD  . LYS B 1 224 ? 128.650 144.265 111.945 1.00 86.11  ? 224 LYS B CD  1 
ATOM   5225  C CE  . LYS B 1 224 ? 128.921 142.901 112.541 1.00 86.11  ? 224 LYS B CE  1 
ATOM   5226  N NZ  . LYS B 1 224 ? 129.704 142.022 111.639 1.00 86.11  ? 224 LYS B NZ  1 
ATOM   5227  N N   . PHE B 1 225 ? 132.072 148.763 114.442 1.00 89.00  ? 225 PHE B N   1 
ATOM   5228  C CA  . PHE B 1 225 ? 132.600 149.419 115.636 1.00 89.00  ? 225 PHE B CA  1 
ATOM   5229  C C   . PHE B 1 225 ? 131.532 149.872 116.613 1.00 89.00  ? 225 PHE B C   1 
ATOM   5230  O O   . PHE B 1 225 ? 131.770 149.826 117.823 1.00 89.00  ? 225 PHE B O   1 
ATOM   5231  C CB  . PHE B 1 225 ? 133.430 150.635 115.253 1.00 89.00  ? 225 PHE B CB  1 
ATOM   5232  C CG  . PHE B 1 225 ? 134.637 150.305 114.464 1.00 89.00  ? 225 PHE B CG  1 
ATOM   5233  C CD1 . PHE B 1 225 ? 135.747 149.766 115.079 1.00 89.00  ? 225 PHE B CD1 1 
ATOM   5234  C CD2 . PHE B 1 225 ? 134.666 150.538 113.106 1.00 89.00  ? 225 PHE B CD2 1 
ATOM   5235  C CE1 . PHE B 1 225 ? 136.862 149.459 114.352 1.00 89.00  ? 225 PHE B CE1 1 
ATOM   5236  C CE2 . PHE B 1 225 ? 135.781 150.238 112.369 1.00 89.00  ? 225 PHE B CE2 1 
ATOM   5237  C CZ  . PHE B 1 225 ? 136.885 149.691 112.993 1.00 89.00  ? 225 PHE B CZ  1 
ATOM   5238  N N   . HIS B 1 226 ? 130.364 150.287 116.134 1.00 92.72  ? 226 HIS B N   1 
ATOM   5239  C CA  . HIS B 1 226 ? 129.304 150.778 117.005 1.00 92.72  ? 226 HIS B CA  1 
ATOM   5240  C C   . HIS B 1 226 ? 128.711 149.701 117.902 1.00 92.72  ? 226 HIS B C   1 
ATOM   5241  O O   . HIS B 1 226 ? 127.963 150.031 118.824 1.00 92.72  ? 226 HIS B O   1 
ATOM   5242  C CB  . HIS B 1 226 ? 128.201 151.390 116.159 1.00 92.72  ? 226 HIS B CB  1 
ATOM   5243  C CG  . HIS B 1 226 ? 127.677 150.458 115.120 1.00 92.72  ? 226 HIS B CG  1 
ATOM   5244  N ND1 . HIS B 1 226 ? 126.765 149.466 115.404 1.00 92.72  ? 226 HIS B ND1 1 
ATOM   5245  C CD2 . HIS B 1 226 ? 127.934 150.365 113.796 1.00 92.72  ? 226 HIS B CD2 1 
ATOM   5246  C CE1 . HIS B 1 226 ? 126.487 148.798 114.301 1.00 92.72  ? 226 HIS B CE1 1 
ATOM   5247  N NE2 . HIS B 1 226 ? 127.181 149.326 113.309 1.00 92.72  ? 226 HIS B NE2 1 
ATOM   5248  N N   . LYS B 1 227 ? 129.032 148.437 117.651 1.00 96.59  ? 227 LYS B N   1 
ATOM   5249  C CA  . LYS B 1 227 ? 128.555 147.304 118.420 1.00 96.59  ? 227 LYS B CA  1 
ATOM   5250  C C   . LYS B 1 227 ? 129.707 146.520 119.041 1.00 96.59  ? 227 LYS B C   1 
ATOM   5251  O O   . LYS B 1 227 ? 129.469 145.578 119.802 1.00 96.59  ? 227 LYS B O   1 
ATOM   5252  C CB  . LYS B 1 227 ? 127.719 146.413 117.483 1.00 96.59  ? 227 LYS B CB  1 
ATOM   5253  C CG  . LYS B 1 227 ? 126.813 145.367 118.097 1.00 96.59  ? 227 LYS B CG  1 
ATOM   5254  C CD  . LYS B 1 227 ? 126.026 144.652 117.032 1.00 96.59  ? 227 LYS B CD  1 
ATOM   5255  C CE  . LYS B 1 227 ? 124.637 145.232 116.910 1.00 96.59  ? 227 LYS B CE  1 
ATOM   5256  N NZ  . LYS B 1 227 ? 124.604 146.536 116.192 1.00 96.59  ? 227 LYS B NZ  1 
ATOM   5257  N N   . LEU B 1 228 ? 130.945 146.927 118.790 1.00 86.11  ? 228 LEU B N   1 
ATOM   5258  C CA  . LEU B 1 228 ? 132.120 146.129 119.104 1.00 86.11  ? 228 LEU B CA  1 
ATOM   5259  C C   . LEU B 1 228 ? 132.420 146.101 120.597 1.00 86.11  ? 228 LEU B C   1 
ATOM   5260  O O   . LEU B 1 228 ? 132.333 147.121 121.280 1.00 86.11  ? 228 LEU B O   1 
ATOM   5261  C CB  . LEU B 1 228 ? 133.305 146.698 118.338 1.00 86.11  ? 228 LEU B CB  1 
ATOM   5262  C CG  . LEU B 1 228 ? 134.679 146.101 118.545 1.00 86.11  ? 228 LEU B CG  1 
ATOM   5263  C CD1 . LEU B 1 228 ? 134.665 144.647 118.197 1.00 86.11  ? 228 LEU B CD1 1 
ATOM   5264  C CD2 . LEU B 1 228 ? 135.640 146.848 117.663 1.00 86.11  ? 228 LEU B CD2 1 
ATOM   5265  N N   . VAL B 1 229 ? 132.792 144.925 121.103 1.00 81.16  ? 229 VAL B N   1 
ATOM   5266  C CA  . VAL B 1 229 ? 133.085 144.735 122.520 1.00 81.16  ? 229 VAL B CA  1 
ATOM   5267  C C   . VAL B 1 229 ? 134.578 144.579 122.765 1.00 81.16  ? 229 VAL B C   1 
ATOM   5268  O O   . VAL B 1 229 ? 135.183 145.387 123.461 1.00 81.16  ? 229 VAL B O   1 
ATOM   5269  C CB  . VAL B 1 229 ? 132.304 143.538 123.096 1.00 81.16  ? 229 VAL B CB  1 
ATOM   5270  C CG1 . VAL B 1 229 ? 132.628 143.390 124.559 1.00 81.16  ? 229 VAL B CG1 1 
ATOM   5271  C CG2 . VAL B 1 229 ? 130.832 143.725 122.870 1.00 81.16  ? 229 VAL B CG2 1 
ATOM   5272  N N   . ASN B 1 230 ? 135.183 143.524 122.229 1.00 79.09  ? 230 ASN B N   1 
ATOM   5273  C CA  . ASN B 1 230 ? 136.628 143.357 122.293 1.00 79.09  ? 230 ASN B CA  1 
ATOM   5274  C C   . ASN B 1 230 ? 137.064 142.392 121.214 1.00 79.09  ? 230 ASN B C   1 
ATOM   5275  O O   . ASN B 1 230 ? 136.308 141.513 120.810 1.00 79.09  ? 230 ASN B O   1 
ATOM   5276  C CB  . ASN B 1 230 ? 137.117 142.868 123.662 1.00 79.09  ? 230 ASN B CB  1 
ATOM   5277  C CG  . ASN B 1 230 ? 136.250 141.794 124.229 1.00 79.09  ? 230 ASN B CG  1 
ATOM   5278  O OD1 . ASN B 1 230 ? 135.245 141.454 123.637 1.00 79.09  ? 230 ASN B OD1 1 
ATOM   5279  N ND2 . ASN B 1 230 ? 136.626 141.247 125.382 1.00 79.09  ? 230 ASN B ND2 1 
ATOM   5280  N N   . VAL B 1 231 ? 138.287 142.581 120.745 1.00 70.04  ? 231 VAL B N   1 
ATOM   5281  C CA  . VAL B 1 231 ? 138.891 141.742 119.724 1.00 70.04  ? 231 VAL B CA  1 
ATOM   5282  C C   . VAL B 1 231 ? 140.096 141.078 120.354 1.00 70.04  ? 231 VAL B C   1 
ATOM   5283  O O   . VAL B 1 231 ? 141.009 141.762 120.825 1.00 70.04  ? 231 VAL B O   1 
ATOM   5284  C CB  . VAL B 1 231 ? 139.306 142.552 118.498 1.00 70.04  ? 231 VAL B CB  1 
ATOM   5285  C CG1 . VAL B 1 231 ? 139.994 141.661 117.530 1.00 70.04  ? 231 VAL B CG1 1 
ATOM   5286  C CG2 . VAL B 1 231 ? 138.111 143.180 117.870 1.00 70.04  ? 231 VAL B CG2 1 
ATOM   5287  N N   . THR B 1 232 ? 140.117 139.757 120.369 1.00 79.09  ? 232 THR B N   1 
ATOM   5288  C CA  . THR B 1 232 ? 141.202 139.027 120.996 1.00 79.09  ? 232 THR B CA  1 
ATOM   5289  C C   . THR B 1 232 ? 141.964 138.232 119.953 1.00 79.09  ? 232 THR B C   1 
ATOM   5290  O O   . THR B 1 232 ? 141.450 137.942 118.875 1.00 79.09  ? 232 THR B O   1 
ATOM   5291  C CB  . THR B 1 232 ? 140.685 138.075 122.068 1.00 79.09  ? 232 THR B CB  1 
ATOM   5292  O OG1 . THR B 1 232 ? 139.945 137.022 121.445 1.00 79.09  ? 232 THR B OG1 1 
ATOM   5293  C CG2 . THR B 1 232 ? 139.767 138.806 123.025 1.00 79.09  ? 232 THR B CG2 1 
ATOM   5294  N N   . ILE B 1 233 ? 143.195 137.881 120.287 1.00 75.17  ? 233 ILE B N   1 
ATOM   5295  C CA  . ILE B 1 233 ? 144.074 137.115 119.420 1.00 75.17  ? 233 ILE B CA  1 
ATOM   5296  C C   . ILE B 1 233 ? 144.788 136.084 120.277 1.00 75.17  ? 233 ILE B C   1 
ATOM   5297  O O   . ILE B 1 233 ? 145.416 136.436 121.278 1.00 75.17  ? 233 ILE B O   1 
ATOM   5298  C CB  . ILE B 1 233 ? 145.075 138.030 118.692 1.00 75.17  ? 233 ILE B CB  1 
ATOM   5299  C CG1 . ILE B 1 233 ? 144.390 138.782 117.563 1.00 75.17  ? 233 ILE B CG1 1 
ATOM   5300  C CG2 . ILE B 1 233 ? 146.226 137.268 118.159 1.00 75.17  ? 233 ILE B CG2 1 
ATOM   5301  C CD1 . ILE B 1 233 ? 145.240 139.810 116.932 1.00 75.17  ? 233 ILE B CD1 1 
ATOM   5302  N N   . HIS B 1 234 ? 144.683 134.816 119.893 1.00 84.30  ? 234 HIS B N   1 
ATOM   5303  C CA  . HIS B 1 234 ? 145.190 133.694 120.676 1.00 84.30  ? 234 HIS B CA  1 
ATOM   5304  C C   . HIS B 1 234 ? 146.191 132.921 119.834 1.00 84.30  ? 234 HIS B C   1 
ATOM   5305  O O   . HIS B 1 234 ? 145.880 132.559 118.696 1.00 84.30  ? 234 HIS B O   1 
ATOM   5306  C CB  . HIS B 1 234 ? 144.049 132.757 121.069 1.00 84.30  ? 234 HIS B CB  1 
ATOM   5307  C CG  . HIS B 1 234 ? 143.045 133.342 122.007 1.00 84.30  ? 234 HIS B CG  1 
ATOM   5308  N ND1 . HIS B 1 234 ? 143.170 133.263 123.377 1.00 84.30  ? 234 HIS B ND1 1 
ATOM   5309  C CD2 . HIS B 1 234 ? 141.889 134.009 121.775 1.00 84.30  ? 234 HIS B CD2 1 
ATOM   5310  C CE1 . HIS B 1 234 ? 142.127 133.836 123.945 1.00 84.30  ? 234 HIS B CE1 1 
ATOM   5311  N NE2 . HIS B 1 234 ? 141.344 134.314 122.994 1.00 84.30  ? 234 HIS B NE2 1 
ATOM   5312  N N   . PHE B 1 235 ? 147.370 132.640 120.390 1.00 79.39  ? 235 PHE B N   1 
ATOM   5313  C CA  . PHE B 1 235 ? 148.259 131.646 119.798 1.00 79.39  ? 235 PHE B CA  1 
ATOM   5314  C C   . PHE B 1 235 ? 149.201 131.119 120.862 1.00 79.39  ? 235 PHE B C   1 
ATOM   5315  O O   . PHE B 1 235 ? 149.254 131.631 121.980 1.00 79.39  ? 235 PHE B O   1 
ATOM   5316  C CB  . PHE B 1 235 ? 149.047 132.183 118.597 1.00 79.39  ? 235 PHE B CB  1 
ATOM   5317  C CG  . PHE B 1 235 ? 149.973 133.310 118.910 1.00 79.39  ? 235 PHE B CG  1 
ATOM   5318  C CD1 . PHE B 1 235 ? 149.518 134.610 118.915 1.00 79.39  ? 235 PHE B CD1 1 
ATOM   5319  C CD2 . PHE B 1 235 ? 151.319 133.080 119.114 1.00 79.39  ? 235 PHE B CD2 1 
ATOM   5320  C CE1 . PHE B 1 235 ? 150.367 135.648 119.171 1.00 79.39  ? 235 PHE B CE1 1 
ATOM   5321  C CE2 . PHE B 1 235 ? 152.175 134.117 119.375 1.00 79.39  ? 235 PHE B CE2 1 
ATOM   5322  C CZ  . PHE B 1 235 ? 151.694 135.399 119.401 1.00 79.39  ? 235 PHE B CZ  1 
ATOM   5323  N N   . ARG B 1 236 ? 149.931 130.073 120.501 1.00 84.97  ? 236 ARG B N   1 
ATOM   5324  C CA  . ARG B 1 236 ? 150.814 129.374 121.415 1.00 84.97  ? 236 ARG B CA  1 
ATOM   5325  C C   . ARG B 1 236 ? 152.141 129.101 120.736 1.00 84.97  ? 236 ARG B C   1 
ATOM   5326  O O   . ARG B 1 236 ? 152.208 128.941 119.519 1.00 84.97  ? 236 ARG B O   1 
ATOM   5327  C CB  . ARG B 1 236 ? 150.201 128.069 121.874 1.00 84.97  ? 236 ARG B CB  1 
ATOM   5328  C CG  . ARG B 1 236 ? 149.055 128.252 122.814 1.00 84.97  ? 236 ARG B CG  1 
ATOM   5329  C CD  . ARG B 1 236 ? 148.343 126.964 123.085 1.00 84.97  ? 236 ARG B CD  1 
ATOM   5330  N NE  . ARG B 1 236 ? 147.597 126.549 121.907 1.00 84.97  ? 236 ARG B NE  1 
ATOM   5331  C CZ  . ARG B 1 236 ? 146.877 125.442 121.845 1.00 84.97  ? 236 ARG B CZ  1 
ATOM   5332  N NH1 . ARG B 1 236 ? 146.792 124.646 122.900 1.00 84.97  ? 236 ARG B NH1 1 
ATOM   5333  N NH2 . ARG B 1 236 ? 146.226 125.150 120.738 1.00 84.97  ? 236 ARG B NH2 1 
ATOM   5334  N N   . LEU B 1 237 ? 153.200 129.048 121.534 1.00 81.07  ? 237 LEU B N   1 
ATOM   5335  C CA  . LEU B 1 237 ? 154.547 128.878 121.011 1.00 81.07  ? 237 LEU B CA  1 
ATOM   5336  C C   . LEU B 1 237 ? 155.351 128.025 121.971 1.00 81.07  ? 237 LEU B C   1 
ATOM   5337  O O   . LEU B 1 237 ? 155.493 128.383 123.141 1.00 81.07  ? 237 LEU B O   1 
ATOM   5338  C CB  . LEU B 1 237 ? 155.237 130.227 120.816 1.00 81.07  ? 237 LEU B CB  1 
ATOM   5339  C CG  . LEU B 1 237 ? 154.791 131.125 119.672 1.00 81.07  ? 237 LEU B CG  1 
ATOM   5340  C CD1 . LEU B 1 237 ? 155.484 132.453 119.750 1.00 81.07  ? 237 LEU B CD1 1 
ATOM   5341  C CD2 . LEU B 1 237 ? 155.141 130.445 118.387 1.00 81.07  ? 237 LEU B CD2 1 
ATOM   5342  N N   . LYS B 1 238 ? 155.878 126.909 121.483 1.00 89.62  ? 238 LYS B N   1 
ATOM   5343  C CA  . LYS B 1 238 ? 156.828 126.136 122.264 1.00 89.62  ? 238 LYS B CA  1 
ATOM   5344  C C   . LYS B 1 238 ? 158.233 126.676 122.063 1.00 89.62  ? 238 LYS B C   1 
ATOM   5345  O O   . LYS B 1 238 ? 158.517 127.375 121.089 1.00 89.62  ? 238 LYS B O   1 
ATOM   5346  C CB  . LYS B 1 238 ? 156.804 124.657 121.878 1.00 89.62  ? 238 LYS B CB  1 
ATOM   5347  C CG  . LYS B 1 238 ? 155.585 123.871 122.326 1.00 89.62  ? 238 LYS B CG  1 
ATOM   5348  C CD  . LYS B 1 238 ? 155.771 122.392 122.015 1.00 89.62  ? 238 LYS B CD  1 
ATOM   5349  C CE  . LYS B 1 238 ? 154.566 121.564 122.423 1.00 89.62  ? 238 LYS B CE  1 
ATOM   5350  N NZ  . LYS B 1 238 ? 154.413 121.492 123.895 1.00 89.62  ? 238 LYS B NZ  1 
ATOM   5351  N N   . THR B 1 239 ? 159.116 126.329 122.993 1.00 101.24 ? 239 THR B N   1 
ATOM   5352  C CA  . THR B 1 239 ? 160.524 126.673 122.899 1.00 101.24 ? 239 THR B CA  1 
ATOM   5353  C C   . THR B 1 239 ? 161.331 125.754 123.794 1.00 101.24 ? 239 THR B C   1 
ATOM   5354  O O   . THR B 1 239 ? 160.791 124.925 124.526 1.00 101.24 ? 239 THR B O   1 
ATOM   5355  C CB  . THR B 1 239 ? 160.806 128.110 123.312 1.00 101.24 ? 239 THR B CB  1 
ATOM   5356  O OG1 . THR B 1 239 ? 162.198 128.377 123.122 1.00 101.24 ? 239 THR B OG1 1 
ATOM   5357  C CG2 . THR B 1 239 ? 160.466 128.303 124.770 1.00 101.24 ? 239 THR B CG2 1 
ATOM   5358  N N   . ILE B 1 240 ? 162.642 125.932 123.738 1.00 105.05 ? 240 ILE B N   1 
ATOM   5359  C CA  . ILE B 1 240 ? 163.580 125.196 124.565 1.00 105.05 ? 240 ILE B CA  1 
ATOM   5360  C C   . ILE B 1 240 ? 164.348 126.221 125.375 1.00 105.05 ? 240 ILE B C   1 
ATOM   5361  O O   . ILE B 1 240 ? 164.972 127.120 124.801 1.00 105.05 ? 240 ILE B O   1 
ATOM   5362  C CB  . ILE B 1 240 ? 164.549 124.362 123.719 1.00 105.05 ? 240 ILE B CB  1 
ATOM   5363  C CG1 . ILE B 1 240 ? 163.792 123.516 122.702 1.00 105.05 ? 240 ILE B CG1 1 
ATOM   5364  C CG2 . ILE B 1 240 ? 165.386 123.486 124.604 1.00 105.05 ? 240 ILE B CG2 1 
ATOM   5365  C CD1 . ILE B 1 240 ? 162.837 122.554 123.307 1.00 105.05 ? 240 ILE B CD1 1 
ATOM   5366  N N   . ASN B 1 241 ? 164.297 126.105 126.695 1.00 104.90 ? 241 ASN B N   1 
ATOM   5367  C CA  . ASN B 1 241 ? 165.202 126.898 127.509 1.00 104.90 ? 241 ASN B CA  1 
ATOM   5368  C C   . ASN B 1 241 ? 166.611 126.381 127.297 1.00 104.90 ? 241 ASN B C   1 
ATOM   5369  O O   . ASN B 1 241 ? 166.822 125.186 127.101 1.00 104.90 ? 241 ASN B O   1 
ATOM   5370  C CB  . ASN B 1 241 ? 164.816 126.829 128.983 1.00 104.90 ? 241 ASN B CB  1 
ATOM   5371  C CG  . ASN B 1 241 ? 165.554 127.846 129.835 1.00 104.90 ? 241 ASN B CG  1 
ATOM   5372  O OD1 . ASN B 1 241 ? 166.414 128.584 129.360 1.00 104.90 ? 241 ASN B OD1 1 
ATOM   5373  N ND2 . ASN B 1 241 ? 165.201 127.898 131.107 1.00 104.90 ? 241 ASN B ND2 1 
ATOM   5374  N N   . LEU B 1 242 ? 167.573 127.284 127.297 1.00 105.92 ? 242 LEU B N   1 
ATOM   5375  C CA  . LEU B 1 242 ? 168.941 126.925 126.971 1.00 105.92 ? 242 LEU B CA  1 
ATOM   5376  C C   . LEU B 1 242 ? 169.872 127.423 128.070 1.00 105.92 ? 242 LEU B C   1 
ATOM   5377  O O   . LEU B 1 242 ? 170.987 127.889 127.834 1.00 105.92 ? 242 LEU B O   1 
ATOM   5378  C CB  . LEU B 1 242 ? 169.307 127.460 125.588 1.00 105.92 ? 242 LEU B CB  1 
ATOM   5379  C CG  . LEU B 1 242 ? 170.477 126.837 124.831 1.00 105.92 ? 242 LEU B CG  1 
ATOM   5380  C CD1 . LEU B 1 242 ? 170.185 125.381 124.632 1.00 105.92 ? 242 LEU B CD1 1 
ATOM   5381  C CD2 . LEU B 1 242 ? 170.625 127.501 123.497 1.00 105.92 ? 242 LEU B CD2 1 
ATOM   5382  N N   . GLN B 1 243 ? 169.401 127.328 129.301 1.00 111.37 ? 243 GLN B N   1 
ATOM   5383  C CA  . GLN B 1 243 ? 170.203 127.601 130.481 1.00 111.37 ? 243 GLN B CA  1 
ATOM   5384  C C   . GLN B 1 243 ? 170.511 126.298 131.204 1.00 111.37 ? 243 GLN B C   1 
ATOM   5385  O O   . GLN B 1 243 ? 170.485 126.213 132.430 1.00 111.37 ? 243 GLN B O   1 
ATOM   5386  C CB  . GLN B 1 243 ? 169.490 128.592 131.388 1.00 111.37 ? 243 GLN B CB  1 
ATOM   5387  C CG  . GLN B 1 243 ? 169.401 129.976 130.791 1.00 111.37 ? 243 GLN B CG  1 
ATOM   5388  C CD  . GLN B 1 243 ? 168.636 130.936 131.669 1.00 111.37 ? 243 GLN B CD  1 
ATOM   5389  O OE1 . GLN B 1 243 ? 168.025 130.536 132.656 1.00 111.37 ? 243 GLN B OE1 1 
ATOM   5390  N NE2 . GLN B 1 243 ? 168.690 132.218 131.332 1.00 111.37 ? 243 GLN B NE2 1 
ATOM   5391  N N   . SER B 1 244 ? 170.800 125.264 130.420 1.00 130.64 ? 244 SER B N   1 
ATOM   5392  C CA  . SER B 1 244 ? 171.046 123.919 130.907 1.00 130.64 ? 244 SER B CA  1 
ATOM   5393  C C   . SER B 1 244 ? 172.465 123.720 131.397 1.00 130.64 ? 244 SER B C   1 
ATOM   5394  O O   . SER B 1 244 ? 172.839 122.593 131.737 1.00 130.64 ? 244 SER B O   1 
ATOM   5395  C CB  . SER B 1 244 ? 170.767 122.910 129.798 1.00 130.64 ? 244 SER B CB  1 
ATOM   5396  O OG  . SER B 1 244 ? 171.721 123.036 128.759 1.00 130.64 ? 244 SER B OG  1 
ATOM   5397  N N   . LEU B 1 245 ? 173.269 124.774 131.423 1.00 136.20 ? 245 LEU B N   1 
ATOM   5398  C CA  . LEU B 1 245 ? 174.686 124.640 131.711 1.00 136.20 ? 245 LEU B CA  1 
ATOM   5399  C C   . LEU B 1 245 ? 174.994 124.745 133.194 1.00 136.20 ? 245 LEU B C   1 
ATOM   5400  O O   . LEU B 1 245 ? 175.739 123.918 133.729 1.00 136.20 ? 245 LEU B O   1 
ATOM   5401  C CB  . LEU B 1 245 ? 175.470 125.703 130.941 1.00 136.20 ? 245 LEU B CB  1 
ATOM   5402  C CG  . LEU B 1 245 ? 175.247 125.654 129.424 1.00 136.20 ? 245 LEU B CG  1 
ATOM   5403  C CD1 . LEU B 1 245 ? 176.068 126.717 128.701 1.00 136.20 ? 245 LEU B CD1 1 
ATOM   5404  C CD2 . LEU B 1 245 ? 175.516 124.270 128.866 1.00 136.20 ? 245 LEU B CD2 1 
ATOM   5405  N N   . ILE B 1 246 ? 174.417 125.739 133.871 1.00 144.47 ? 246 ILE B N   1 
ATOM   5406  C CA  . ILE B 1 246 ? 174.590 125.863 135.313 1.00 144.47 ? 246 ILE B CA  1 
ATOM   5407  C C   . ILE B 1 246 ? 173.710 124.864 136.066 1.00 144.47 ? 246 ILE B C   1 
ATOM   5408  O O   . ILE B 1 246 ? 173.982 124.559 137.233 1.00 144.47 ? 246 ILE B O   1 
ATOM   5409  C CB  . ILE B 1 246 ? 174.332 127.327 135.723 1.00 144.47 ? 246 ILE B CB  1 
ATOM   5410  C CG1 . ILE B 1 246 ? 174.896 127.639 137.117 1.00 144.47 ? 246 ILE B CG1 1 
ATOM   5411  C CG2 . ILE B 1 246 ? 172.845 127.676 135.626 1.00 144.47 ? 246 ILE B CG2 1 
ATOM   5412  C CD1 . ILE B 1 246 ? 176.402 127.583 137.205 1.00 144.47 ? 246 ILE B CD1 1 
ATOM   5413  N N   . ASN B 1 247 ? 172.672 124.327 135.421 1.00 145.81 ? 247 ASN B N   1 
ATOM   5414  C CA  . ASN B 1 247 ? 171.951 123.171 135.935 1.00 145.81 ? 247 ASN B CA  1 
ATOM   5415  C C   . ASN B 1 247 ? 172.691 121.876 135.640 1.00 145.81 ? 247 ASN B C   1 
ATOM   5416  O O   . ASN B 1 247 ? 172.459 120.873 136.325 1.00 145.81 ? 247 ASN B O   1 
ATOM   5417  C CB  . ASN B 1 247 ? 170.548 123.110 135.310 1.00 145.81 ? 247 ASN B CB  1 
ATOM   5418  C CG  . ASN B 1 247 ? 169.586 122.212 136.074 1.00 145.81 ? 247 ASN B CG  1 
ATOM   5419  O OD1 . ASN B 1 247 ? 169.907 121.685 137.133 1.00 145.81 ? 247 ASN B OD1 1 
ATOM   5420  N ND2 . ASN B 1 247 ? 168.392 122.033 135.524 1.00 145.81 ? 247 ASN B ND2 1 
ATOM   5421  N N   . ASN B 1 248 ? 173.547 121.885 134.609 1.00 151.47 ? 248 ASN B N   1 
ATOM   5422  C CA  . ASN B 1 248 ? 174.416 120.822 134.096 1.00 151.47 ? 248 ASN B CA  1 
ATOM   5423  C C   . ASN B 1 248 ? 173.621 119.688 133.438 1.00 151.47 ? 248 ASN B C   1 
ATOM   5424  O O   . ASN B 1 248 ? 174.224 118.768 132.876 1.00 151.47 ? 248 ASN B O   1 
ATOM   5425  C CB  . ASN B 1 248 ? 175.346 120.254 135.185 1.00 151.47 ? 248 ASN B CB  1 
ATOM   5426  C CG  . ASN B 1 248 ? 176.611 119.613 134.622 1.00 151.47 ? 248 ASN B CG  1 
ATOM   5427  O OD1 . ASN B 1 248 ? 176.862 119.634 133.415 1.00 151.47 ? 248 ASN B OD1 1 
ATOM   5428  N ND2 . ASN B 1 248 ? 177.418 119.041 135.507 1.00 151.47 ? 248 ASN B ND2 1 
ATOM   5429  N N   . GLU B 1 249 ? 172.287 119.723 133.470 1.00 156.90 ? 249 GLU B N   1 
ATOM   5430  C CA  . GLU B 1 249 ? 171.495 118.646 132.890 1.00 156.90 ? 249 GLU B CA  1 
ATOM   5431  C C   . GLU B 1 249 ? 170.331 119.173 132.065 1.00 156.90 ? 249 GLU B C   1 
ATOM   5432  O O   . GLU B 1 249 ? 170.220 120.382 131.837 1.00 156.90 ? 249 GLU B O   1 
ATOM   5433  C CB  . GLU B 1 249 ? 170.970 117.702 133.974 1.00 156.90 ? 249 GLU B CB  1 
ATOM   5434  C CG  . GLU B 1 249 ? 172.035 116.910 134.709 1.00 156.90 ? 249 GLU B CG  1 
ATOM   5435  C CD  . GLU B 1 249 ? 172.829 116.000 133.800 1.00 156.90 ? 249 GLU B CD  1 
ATOM   5436  O OE1 . GLU B 1 249 ? 172.259 115.464 132.823 1.00 156.90 ? 249 GLU B OE1 1 
ATOM   5437  O OE2 . GLU B 1 249 ? 174.039 115.831 134.061 1.00 156.90 ? 249 GLU B OE2 1 
ATOM   5438  N N   . ILE B 1 250 ? 169.456 118.259 131.650 1.00 155.28 ? 250 ILE B N   1 
ATOM   5439  C CA  . ILE B 1 250 ? 168.452 118.468 130.608 1.00 155.28 ? 250 ILE B CA  1 
ATOM   5440  C C   . ILE B 1 250 ? 167.425 119.512 131.028 1.00 155.28 ? 250 ILE B C   1 
ATOM   5441  O O   . ILE B 1 250 ? 166.743 119.343 132.048 1.00 155.28 ? 250 ILE B O   1 
ATOM   5442  C CB  . ILE B 1 250 ? 167.775 117.140 130.239 1.00 155.28 ? 250 ILE B CB  1 
ATOM   5443  C CG1 . ILE B 1 250 ? 168.802 116.196 129.601 1.00 155.28 ? 250 ILE B CG1 1 
ATOM   5444  C CG2 . ILE B 1 250 ? 166.582 117.378 129.320 1.00 155.28 ? 250 ILE B CG2 1 
ATOM   5445  C CD1 . ILE B 1 250 ? 168.311 114.780 129.422 1.00 155.28 ? 250 ILE B CD1 1 
ATOM   5446  N N   . PRO B 1 251 ? 167.284 120.590 130.272 1.00 138.07 ? 251 PRO B N   1 
ATOM   5447  C CA  . PRO B 1 251 ? 166.527 121.747 130.743 1.00 138.07 ? 251 PRO B CA  1 
ATOM   5448  C C   . PRO B 1 251 ? 165.030 121.534 130.571 1.00 138.07 ? 251 PRO B C   1 
ATOM   5449  O O   . PRO B 1 251 ? 164.566 120.512 130.077 1.00 138.07 ? 251 PRO B O   1 
ATOM   5450  C CB  . PRO B 1 251 ? 167.034 122.872 129.846 1.00 138.07 ? 251 PRO B CB  1 
ATOM   5451  C CG  . PRO B 1 251 ? 167.371 122.186 128.583 1.00 138.07 ? 251 PRO B CG  1 
ATOM   5452  C CD  . PRO B 1 251 ? 167.891 120.834 128.953 1.00 138.07 ? 251 PRO B CD  1 
ATOM   5453  N N   . ASP B 1 252 ? 164.283 122.540 130.998 1.00 130.07 ? 252 ASP B N   1 
ATOM   5454  C CA  . ASP B 1 252 ? 162.842 122.562 130.869 1.00 130.07 ? 252 ASP B CA  1 
ATOM   5455  C C   . ASP B 1 252 ? 162.470 122.906 129.432 1.00 130.07 ? 252 ASP B C   1 
ATOM   5456  O O   . ASP B 1 252 ? 163.303 123.345 128.641 1.00 130.07 ? 252 ASP B O   1 
ATOM   5457  C CB  . ASP B 1 252 ? 162.262 123.575 131.847 1.00 130.07 ? 252 ASP B CB  1 
ATOM   5458  C CG  . ASP B 1 252 ? 162.718 123.319 133.268 1.00 130.07 ? 252 ASP B CG  1 
ATOM   5459  O OD1 . ASP B 1 252 ? 163.036 122.155 133.584 1.00 130.07 ? 252 ASP B OD1 1 
ATOM   5460  O OD2 . ASP B 1 252 ? 162.774 124.277 134.068 1.00 130.07 ? 252 ASP B OD2 1 
ATOM   5461  N N   . CYS B 1 253 ? 161.207 122.699 129.080 1.00 121.89 ? 253 CYS B N   1 
ATOM   5462  C CA  . CYS B 1 253 ? 160.765 122.923 127.706 1.00 121.89 ? 253 CYS B CA  1 
ATOM   5463  C C   . CYS B 1 253 ? 159.380 123.559 127.740 1.00 121.89 ? 253 CYS B C   1 
ATOM   5464  O O   . CYS B 1 253 ? 158.404 122.900 128.101 1.00 121.89 ? 253 CYS B O   1 
ATOM   5465  C CB  . CYS B 1 253 ? 160.784 121.612 126.911 1.00 121.89 ? 253 CYS B CB  1 
ATOM   5466  S SG  . CYS B 1 253 ? 162.492 120.983 126.571 1.00 121.89 ? 253 CYS B SG  1 
ATOM   5467  N N   . TYR B 1 254 ? 159.298 124.831 127.351 1.00 101.96 ? 254 TYR B N   1 
ATOM   5468  C CA  . TYR B 1 254 ? 158.162 125.694 127.646 1.00 101.96 ? 254 TYR B CA  1 
ATOM   5469  C C   . TYR B 1 254 ? 157.102 125.674 126.551 1.00 101.96 ? 254 TYR B C   1 
ATOM   5470  O O   . TYR B 1 254 ? 157.272 125.091 125.481 1.00 101.96 ? 254 TYR B O   1 
ATOM   5471  C CB  . TYR B 1 254 ? 158.632 127.128 127.849 1.00 101.96 ? 254 TYR B CB  1 
ATOM   5472  C CG  . TYR B 1 254 ? 159.375 127.363 129.129 1.00 101.96 ? 254 TYR B CG  1 
ATOM   5473  C CD1 . TYR B 1 254 ? 158.703 127.708 130.283 1.00 101.96 ? 254 TYR B CD1 1 
ATOM   5474  C CD2 . TYR B 1 254 ? 160.750 127.214 129.191 1.00 101.96 ? 254 TYR B CD2 1 
ATOM   5475  C CE1 . TYR B 1 254 ? 159.379 127.928 131.450 1.00 101.96 ? 254 TYR B CE1 1 
ATOM   5476  C CE2 . TYR B 1 254 ? 161.434 127.429 130.365 1.00 101.96 ? 254 TYR B CE2 1 
ATOM   5477  C CZ  . TYR B 1 254 ? 160.737 127.778 131.491 1.00 101.96 ? 254 TYR B CZ  1 
ATOM   5478  O OH  . TYR B 1 254 ? 161.397 127.991 132.672 1.00 101.96 ? 254 TYR B OH  1 
ATOM   5479  N N   . THR B 1 255 ? 155.987 126.340 126.845 1.00 90.93  ? 255 THR B N   1 
ATOM   5480  C CA  . THR B 1 255 ? 154.902 126.545 125.886 1.00 90.93  ? 255 THR B CA  1 
ATOM   5481  C C   . THR B 1 255 ? 154.174 127.812 126.320 1.00 90.93  ? 255 THR B C   1 
ATOM   5482  O O   . THR B 1 255 ? 153.391 127.781 127.271 1.00 90.93  ? 255 THR B O   1 
ATOM   5483  C CB  . THR B 1 255 ? 153.953 125.357 125.845 1.00 90.93  ? 255 THR B CB  1 
ATOM   5484  O OG1 . THR B 1 255 ? 154.660 124.183 125.438 1.00 90.93  ? 255 THR B OG1 1 
ATOM   5485  C CG2 . THR B 1 255 ? 152.818 125.612 124.873 1.00 90.93  ? 255 THR B CG2 1 
ATOM   5486  N N   . PHE B 1 256 ? 154.433 128.914 125.634 1.00 80.87  ? 256 PHE B N   1 
ATOM   5487  C CA  . PHE B 1 256 ? 153.779 130.152 126.010 1.00 80.87  ? 256 PHE B CA  1 
ATOM   5488  C C   . PHE B 1 256 ? 152.378 130.216 125.426 1.00 80.87  ? 256 PHE B C   1 
ATOM   5489  O O   . PHE B 1 256 ? 152.048 129.520 124.468 1.00 80.87  ? 256 PHE B O   1 
ATOM   5490  C CB  . PHE B 1 256 ? 154.581 131.348 125.532 1.00 80.87  ? 256 PHE B CB  1 
ATOM   5491  C CG  . PHE B 1 256 ? 155.903 131.479 126.186 1.00 80.87  ? 256 PHE B CG  1 
ATOM   5492  C CD1 . PHE B 1 256 ? 156.011 132.015 127.445 1.00 80.87  ? 256 PHE B CD1 1 
ATOM   5493  C CD2 . PHE B 1 256 ? 157.042 131.077 125.533 1.00 80.87  ? 256 PHE B CD2 1 
ATOM   5494  C CE1 . PHE B 1 256 ? 157.231 132.138 128.041 1.00 80.87  ? 256 PHE B CE1 1 
ATOM   5495  C CE2 . PHE B 1 256 ? 158.264 131.200 126.124 1.00 80.87  ? 256 PHE B CE2 1 
ATOM   5496  C CZ  . PHE B 1 256 ? 158.359 131.731 127.376 1.00 80.87  ? 256 PHE B CZ  1 
ATOM   5497  N N   . SER B 1 257 ? 151.554 131.083 126.002 1.00 81.55  ? 257 SER B N   1 
ATOM   5498  C CA  . SER B 1 257 ? 150.183 131.267 125.533 1.00 81.55  ? 257 SER B CA  1 
ATOM   5499  C C   . SER B 1 257 ? 149.891 132.761 125.484 1.00 81.55  ? 257 SER B C   1 
ATOM   5500  O O   . SER B 1 257 ? 149.625 133.383 126.513 1.00 81.55  ? 257 SER B O   1 
ATOM   5501  C CB  . SER B 1 257 ? 149.192 130.546 126.429 1.00 81.55  ? 257 SER B CB  1 
ATOM   5502  O OG  . SER B 1 257 ? 147.873 130.752 125.961 1.00 81.55  ? 257 SER B OG  1 
ATOM   5503  N N   . VAL B 1 258 ? 149.907 133.321 124.288 1.00 76.77  ? 258 VAL B N   1 
ATOM   5504  C CA  . VAL B 1 258 ? 149.807 134.759 124.092 1.00 76.77  ? 258 VAL B CA  1 
ATOM   5505  C C   . VAL B 1 258 ? 148.343 135.141 123.929 1.00 76.77  ? 258 VAL B C   1 
ATOM   5506  O O   . VAL B 1 258 ? 147.591 134.459 123.229 1.00 76.77  ? 258 VAL B O   1 
ATOM   5507  C CB  . VAL B 1 258 ? 150.627 135.182 122.867 1.00 76.77  ? 258 VAL B CB  1 
ATOM   5508  C CG1 . VAL B 1 258 ? 150.564 136.668 122.656 1.00 76.77  ? 258 VAL B CG1 1 
ATOM   5509  C CG2 . VAL B 1 258 ? 152.048 134.717 123.021 1.00 76.77  ? 258 VAL B CG2 1 
ATOM   5510  N N   . LEU B 1 259 ? 147.932 136.218 124.588 1.00 72.83  ? 259 LEU B N   1 
ATOM   5511  C CA  . LEU B 1 259 ? 146.616 136.815 124.393 1.00 72.83  ? 259 LEU B CA  1 
ATOM   5512  C C   . LEU B 1 259 ? 146.788 138.307 124.164 1.00 72.83  ? 259 LEU B C   1 
ATOM   5513  O O   . LEU B 1 259 ? 147.059 139.057 125.104 1.00 72.83  ? 259 LEU B O   1 
ATOM   5514  C CB  . LEU B 1 259 ? 145.709 136.544 125.589 1.00 72.83  ? 259 LEU B CB  1 
ATOM   5515  C CG  . LEU B 1 259 ? 144.360 137.260 125.603 1.00 72.83  ? 259 LEU B CG  1 
ATOM   5516  C CD1 . LEU B 1 259 ? 143.557 136.946 124.382 1.00 72.83  ? 259 LEU B CD1 1 
ATOM   5517  C CD2 . LEU B 1 259 ? 143.581 136.888 126.846 1.00 72.83  ? 259 LEU B CD2 1 
ATOM   5518  N N   . ILE B 1 260 ? 146.632 138.743 122.926 1.00 72.38  ? 260 ILE B N   1 
ATOM   5519  C CA  . ILE B 1 260 ? 146.636 140.159 122.595 1.00 72.38  ? 260 ILE B CA  1 
ATOM   5520  C C   . ILE B 1 260 ? 145.202 140.647 122.643 1.00 72.38  ? 260 ILE B C   1 
ATOM   5521  O O   . ILE B 1 260 ? 144.344 140.134 121.921 1.00 72.38  ? 260 ILE B O   1 
ATOM   5522  C CB  . ILE B 1 260 ? 147.258 140.409 121.218 1.00 72.38  ? 260 ILE B CB  1 
ATOM   5523  C CG1 . ILE B 1 260 ? 148.727 140.020 121.242 1.00 72.38  ? 260 ILE B CG1 1 
ATOM   5524  C CG2 . ILE B 1 260 ? 147.094 141.852 120.825 1.00 72.38  ? 260 ILE B CG2 1 
ATOM   5525  C CD1 . ILE B 1 260 ? 149.361 140.002 119.896 1.00 72.38  ? 260 ILE B CD1 1 
ATOM   5526  N N   . THR B 1 261 ? 144.934 141.633 123.489 1.00 72.63  ? 261 THR B N   1 
ATOM   5527  C CA  . THR B 1 261 ? 143.571 142.023 123.814 1.00 72.63  ? 261 THR B CA  1 
ATOM   5528  C C   . THR B 1 261 ? 143.311 143.447 123.365 1.00 72.63  ? 261 THR B C   1 
ATOM   5529  O O   . THR B 1 261 ? 143.958 144.378 123.847 1.00 72.63  ? 261 THR B O   1 
ATOM   5530  C CB  . THR B 1 261 ? 143.321 141.911 125.312 1.00 72.63  ? 261 THR B CB  1 
ATOM   5531  O OG1 . THR B 1 261 ? 143.541 140.562 125.731 1.00 72.63  ? 261 THR B OG1 1 
ATOM   5532  C CG2 . THR B 1 261 ? 141.903 142.305 125.633 1.00 72.63  ? 261 THR B CG2 1 
ATOM   5533  N N   . PHE B 1 262 ? 142.353 143.617 122.468 1.00 68.32  ? 262 PHE B N   1 
ATOM   5534  C CA  . PHE B 1 262 ? 141.889 144.938 122.074 1.00 68.32  ? 262 PHE B CA  1 
ATOM   5535  C C   . PHE B 1 262 ? 140.585 145.240 122.802 1.00 68.32  ? 262 PHE B C   1 
ATOM   5536  O O   . PHE B 1 262 ? 139.498 145.100 122.251 1.00 68.32  ? 262 PHE B O   1 
ATOM   5537  C CB  . PHE B 1 262 ? 141.697 144.999 120.568 1.00 68.32  ? 262 PHE B CB  1 
ATOM   5538  C CG  . PHE B 1 262 ? 142.964 144.926 119.797 1.00 68.32  ? 262 PHE B CG  1 
ATOM   5539  C CD1 . PHE B 1 262 ? 143.691 146.064 119.537 1.00 68.32  ? 262 PHE B CD1 1 
ATOM   5540  C CD2 . PHE B 1 262 ? 143.439 143.719 119.345 1.00 68.32  ? 262 PHE B CD2 1 
ATOM   5541  C CE1 . PHE B 1 262 ? 144.854 146.002 118.825 1.00 68.32  ? 262 PHE B CE1 1 
ATOM   5542  C CE2 . PHE B 1 262 ? 144.607 143.649 118.638 1.00 68.32  ? 262 PHE B CE2 1 
ATOM   5543  C CZ  . PHE B 1 262 ? 145.315 144.791 118.377 1.00 68.32  ? 262 PHE B CZ  1 
ATOM   5544  N N   . ASP B 1 263 ? 140.702 145.665 124.051 1.00 75.59  ? 263 ASP B N   1 
ATOM   5545  C CA  . ASP B 1 263 ? 139.532 145.762 124.916 1.00 75.59  ? 263 ASP B CA  1 
ATOM   5546  C C   . ASP B 1 263 ? 138.799 147.078 124.734 1.00 75.59  ? 263 ASP B C   1 
ATOM   5547  O O   . ASP B 1 263 ? 139.401 148.147 124.791 1.00 75.59  ? 263 ASP B O   1 
ATOM   5548  C CB  . ASP B 1 263 ? 139.931 145.616 126.373 1.00 75.59  ? 263 ASP B CB  1 
ATOM   5549  C CG  . ASP B 1 263 ? 138.746 145.691 127.290 1.00 75.59  ? 263 ASP B CG  1 
ATOM   5550  O OD1 . ASP B 1 263 ? 137.993 144.701 127.360 1.00 75.59  ? 263 ASP B OD1 1 
ATOM   5551  O OD2 . ASP B 1 263 ? 138.550 146.746 127.925 1.00 75.59  ? 263 ASP B OD2 1 
ATOM   5552  N N   . ASN B 1 264 ? 137.486 147.001 124.547 1.00 77.59  ? 264 ASN B N   1 
ATOM   5553  C CA  . ASN B 1 264 ? 136.633 148.182 124.471 1.00 77.59  ? 264 ASN B CA  1 
ATOM   5554  C C   . ASN B 1 264 ? 135.427 147.957 125.377 1.00 77.59  ? 264 ASN B C   1 
ATOM   5555  O O   . ASN B 1 264 ? 134.337 147.632 124.917 1.00 77.59  ? 264 ASN B O   1 
ATOM   5556  C CB  . ASN B 1 264 ? 136.226 148.420 123.026 1.00 77.59  ? 264 ASN B CB  1 
ATOM   5557  C CG  . ASN B 1 264 ? 135.489 149.716 122.819 1.00 77.59  ? 264 ASN B CG  1 
ATOM   5558  O OD1 . ASN B 1 264 ? 135.287 150.501 123.744 1.00 77.59  ? 264 ASN B OD1 1 
ATOM   5559  N ND2 . ASN B 1 264 ? 135.067 149.944 121.588 1.00 77.59  ? 264 ASN B ND2 1 
ATOM   5560  N N   . LYS B 1 265 ? 135.591 148.214 126.667 1.00 79.08  ? 265 LYS B N   1 
ATOM   5561  C CA  . LYS B 1 265 ? 134.430 148.086 127.532 1.00 79.08  ? 265 LYS B CA  1 
ATOM   5562  C C   . LYS B 1 265 ? 133.695 149.399 127.689 1.00 79.08  ? 265 LYS B C   1 
ATOM   5563  O O   . LYS B 1 265 ? 132.471 149.441 127.556 1.00 79.08  ? 265 LYS B O   1 
ATOM   5564  C CB  . LYS B 1 265 ? 134.828 147.575 128.911 1.00 79.08  ? 265 LYS B CB  1 
ATOM   5565  C CG  . LYS B 1 265 ? 135.374 146.182 128.917 1.00 79.08  ? 265 LYS B CG  1 
ATOM   5566  C CD  . LYS B 1 265 ? 135.576 145.722 130.336 1.00 79.08  ? 265 LYS B CD  1 
ATOM   5567  C CE  . LYS B 1 265 ? 136.664 146.527 131.008 1.00 79.08  ? 265 LYS B CE  1 
ATOM   5568  N NZ  . LYS B 1 265 ? 137.989 146.295 130.379 1.00 79.08  ? 265 LYS B NZ  1 
ATOM   5569  N N   . ALA B 1 266 ? 134.430 150.477 127.940 1.00 81.09  ? 266 ALA B N   1 
ATOM   5570  C CA  . ALA B 1 266 ? 133.809 151.734 128.319 1.00 81.09  ? 266 ALA B CA  1 
ATOM   5571  C C   . ALA B 1 266 ? 133.105 152.428 127.165 1.00 81.09  ? 266 ALA B C   1 
ATOM   5572  O O   . ALA B 1 266 ? 132.328 153.353 127.423 1.00 81.09  ? 266 ALA B O   1 
ATOM   5573  C CB  . ALA B 1 266 ? 134.857 152.671 128.912 1.00 81.09  ? 266 ALA B CB  1 
ATOM   5574  N N   . HIS B 1 267 ? 133.359 152.001 125.923 1.00 83.81  ? 267 HIS B N   1 
ATOM   5575  C CA  . HIS B 1 267 ? 132.834 152.627 124.706 1.00 83.81  ? 267 HIS B CA  1 
ATOM   5576  C C   . HIS B 1 267 ? 133.141 154.116 124.665 1.00 83.81  ? 267 HIS B C   1 
ATOM   5577  O O   . HIS B 1 267 ? 132.311 154.941 124.284 1.00 83.81  ? 267 HIS B O   1 
ATOM   5578  C CB  . HIS B 1 267 ? 131.341 152.376 124.559 1.00 83.81  ? 267 HIS B CB  1 
ATOM   5579  C CG  . HIS B 1 267 ? 131.012 150.952 124.297 1.00 83.81  ? 267 HIS B CG  1 
ATOM   5580  N ND1 . HIS B 1 267 ? 131.144 150.381 123.051 1.00 83.81  ? 267 HIS B ND1 1 
ATOM   5581  C CD2 . HIS B 1 267 ? 130.605 149.965 125.125 1.00 83.81  ? 267 HIS B CD2 1 
ATOM   5582  C CE1 . HIS B 1 267 ? 130.804 149.109 123.119 1.00 83.81  ? 267 HIS B CE1 1 
ATOM   5583  N NE2 . HIS B 1 267 ? 130.472 148.831 124.366 1.00 83.81  ? 267 HIS B NE2 1 
ATOM   5584  N N   . SER B 1 268 ? 134.350 154.458 125.080 1.00 76.73  ? 268 SER B N   1 
ATOM   5585  C CA  . SER B 1 268 ? 134.704 155.840 125.314 1.00 76.73  ? 268 SER B CA  1 
ATOM   5586  C C   . SER B 1 268 ? 135.556 156.434 124.214 1.00 76.73  ? 268 SER B C   1 
ATOM   5587  O O   . SER B 1 268 ? 136.110 157.518 124.405 1.00 76.73  ? 268 SER B O   1 
ATOM   5588  C CB  . SER B 1 268 ? 135.433 155.966 126.650 1.00 76.73  ? 268 SER B CB  1 
ATOM   5589  O OG  . SER B 1 268 ? 136.635 155.232 126.615 1.00 76.73  ? 268 SER B OG  1 
ATOM   5590  N N   . GLY B 1 269 ? 135.670 155.777 123.070 1.00 72.12  ? 269 GLY B N   1 
ATOM   5591  C CA  . GLY B 1 269 ? 136.528 156.294 122.029 1.00 72.12  ? 269 GLY B CA  1 
ATOM   5592  C C   . GLY B 1 269 ? 137.996 156.099 122.303 1.00 72.12  ? 269 GLY B C   1 
ATOM   5593  O O   . GLY B 1 269 ? 138.814 156.881 121.823 1.00 72.12  ? 269 GLY B O   1 
ATOM   5594  N N   . ARG B 1 270 ? 138.353 155.073 123.067 1.00 64.83  ? 270 ARG B N   1 
ATOM   5595  C CA  . ARG B 1 270 ? 139.742 154.800 123.407 1.00 64.83  ? 270 ARG B CA  1 
ATOM   5596  C C   . ARG B 1 270 ? 139.887 153.320 123.695 1.00 64.83  ? 270 ARG B C   1 
ATOM   5597  O O   . ARG B 1 270 ? 139.341 152.834 124.685 1.00 64.83  ? 270 ARG B O   1 
ATOM   5598  C CB  . ARG B 1 270 ? 140.174 155.609 124.617 1.00 64.83  ? 270 ARG B CB  1 
ATOM   5599  C CG  . ARG B 1 270 ? 141.564 155.286 125.069 1.00 64.83  ? 270 ARG B CG  1 
ATOM   5600  C CD  . ARG B 1 270 ? 141.957 156.117 126.249 1.00 64.83  ? 270 ARG B CD  1 
ATOM   5601  N NE  . ARG B 1 270 ? 143.306 155.807 126.687 1.00 64.83  ? 270 ARG B NE  1 
ATOM   5602  C CZ  . ARG B 1 270 ? 143.590 154.870 127.578 1.00 64.83  ? 270 ARG B CZ  1 
ATOM   5603  N NH1 . ARG B 1 270 ? 142.617 154.155 128.119 1.00 64.83  ? 270 ARG B NH1 1 
ATOM   5604  N NH2 . ARG B 1 270 ? 144.844 154.649 127.927 1.00 64.83  ? 270 ARG B NH2 1 
ATOM   5605  N N   . ILE B 1 271 ? 140.635 152.612 122.862 1.00 58.25  ? 271 ILE B N   1 
ATOM   5606  C CA  . ILE B 1 271 ? 140.786 151.175 123.039 1.00 58.25  ? 271 ILE B CA  1 
ATOM   5607  C C   . ILE B 1 271 ? 142.175 150.856 123.570 1.00 58.25  ? 271 ILE B C   1 
ATOM   5608  O O   . ILE B 1 271 ? 143.164 151.096 122.872 1.00 58.25  ? 271 ILE B O   1 
ATOM   5609  C CB  . ILE B 1 271 ? 140.531 150.432 121.726 1.00 58.25  ? 271 ILE B CB  1 
ATOM   5610  C CG1 . ILE B 1 271 ? 139.101 150.650 121.275 1.00 58.25  ? 271 ILE B CG1 1 
ATOM   5611  C CG2 . ILE B 1 271 ? 140.769 148.968 121.898 1.00 58.25  ? 271 ILE B CG2 1 
ATOM   5612  C CD1 . ILE B 1 271 ? 138.821 150.089 119.931 1.00 58.25  ? 271 ILE B CD1 1 
ATOM   5613  N N   . PRO B 1 272 ? 142.303 150.340 124.785 1.00 60.20  ? 272 PRO B N   1 
ATOM   5614  C CA  . PRO B 1 272 ? 143.606 149.868 125.256 1.00 60.20  ? 272 PRO B CA  1 
ATOM   5615  C C   . PRO B 1 272 ? 144.048 148.615 124.528 1.00 60.20  ? 272 PRO B C   1 
ATOM   5616  O O   . PRO B 1 272 ? 143.249 147.879 123.955 1.00 60.20  ? 272 PRO B O   1 
ATOM   5617  C CB  . PRO B 1 272 ? 143.359 149.576 126.734 1.00 60.20  ? 272 PRO B CB  1 
ATOM   5618  C CG  . PRO B 1 272 ? 142.239 150.437 127.089 1.00 60.20  ? 272 PRO B CG  1 
ATOM   5619  C CD  . PRO B 1 272 ? 141.356 150.490 125.893 1.00 60.20  ? 272 PRO B CD  1 
ATOM   5620  N N   . ILE B 1 273 ? 145.354 148.380 124.553 1.00 54.43  ? 273 ILE B N   1 
ATOM   5621  C CA  . ILE B 1 273 ? 145.968 147.215 123.933 1.00 54.43  ? 273 ILE B CA  1 
ATOM   5622  C C   . ILE B 1 273 ? 146.838 146.545 124.984 1.00 54.43  ? 273 ILE B C   1 
ATOM   5623  O O   . ILE B 1 273 ? 147.573 147.225 125.702 1.00 54.43  ? 273 ILE B O   1 
ATOM   5624  C CB  . ILE B 1 273 ? 146.794 147.607 122.698 1.00 54.43  ? 273 ILE B CB  1 
ATOM   5625  C CG1 . ILE B 1 273 ? 145.895 148.183 121.619 1.00 54.43  ? 273 ILE B CG1 1 
ATOM   5626  C CG2 . ILE B 1 273 ? 147.470 146.434 122.119 1.00 54.43  ? 273 ILE B CG2 1 
ATOM   5627  C CD1 . ILE B 1 273 ? 146.645 148.759 120.468 1.00 54.43  ? 273 ILE B CD1 1 
ATOM   5628  N N   . SER B 1 274 ? 146.744 145.224 125.095 1.00 66.04  ? 274 SER B N   1 
ATOM   5629  C CA  . SER B 1 274 ? 147.396 144.496 126.169 1.00 66.04  ? 274 SER B CA  1 
ATOM   5630  C C   . SER B 1 274 ? 148.122 143.279 125.617 1.00 66.04  ? 274 SER B C   1 
ATOM   5631  O O   . SER B 1 274 ? 148.048 142.976 124.427 1.00 66.04  ? 274 SER B O   1 
ATOM   5632  C CB  . SER B 1 274 ? 146.372 144.068 127.216 1.00 66.04  ? 274 SER B CB  1 
ATOM   5633  O OG  . SER B 1 274 ? 145.732 145.200 127.767 1.00 66.04  ? 274 SER B OG  1 
ATOM   5634  N N   . LEU B 1 275 ? 148.823 142.570 126.499 1.00 73.36  ? 275 LEU B N   1 
ATOM   5635  C CA  . LEU B 1 275 ? 149.441 141.300 126.143 1.00 73.36  ? 275 LEU B CA  1 
ATOM   5636  C C   . LEU B 1 275 ? 149.635 140.474 127.407 1.00 73.36  ? 275 LEU B C   1 
ATOM   5637  O O   . LEU B 1 275 ? 149.983 141.020 128.454 1.00 73.36  ? 275 LEU B O   1 
ATOM   5638  C CB  . LEU B 1 275 ? 150.772 141.521 125.428 1.00 73.36  ? 275 LEU B CB  1 
ATOM   5639  C CG  . LEU B 1 275 ? 151.364 140.331 124.682 1.00 73.36  ? 275 LEU B CG  1 
ATOM   5640  C CD1 . LEU B 1 275 ? 152.047 140.839 123.457 1.00 73.36  ? 275 LEU B CD1 1 
ATOM   5641  C CD2 . LEU B 1 275 ? 152.364 139.565 125.510 1.00 73.36  ? 275 LEU B CD2 1 
ATOM   5642  N N   . GLU B 1 276 ? 149.418 139.164 127.307 1.00 84.45  ? 276 GLU B N   1 
ATOM   5643  C CA  . GLU B 1 276 ? 149.496 138.254 128.441 1.00 84.45  ? 276 GLU B CA  1 
ATOM   5644  C C   . GLU B 1 276 ? 150.216 136.981 128.030 1.00 84.45  ? 276 GLU B C   1 
ATOM   5645  O O   . GLU B 1 276 ? 150.163 136.576 126.869 1.00 84.45  ? 276 GLU B O   1 
ATOM   5646  C CB  . GLU B 1 276 ? 148.109 137.863 128.949 1.00 84.45  ? 276 GLU B CB  1 
ATOM   5647  C CG  . GLU B 1 276 ? 147.239 139.003 129.425 1.00 84.45  ? 276 GLU B CG  1 
ATOM   5648  C CD  . GLU B 1 276 ? 147.742 139.638 130.694 1.00 84.45  ? 276 GLU B CD  1 
ATOM   5649  O OE1 . GLU B 1 276 ? 148.314 138.918 131.541 1.00 84.45  ? 276 GLU B OE1 1 
ATOM   5650  O OE2 . GLU B 1 276 ? 147.567 140.866 130.854 1.00 84.45  ? 276 GLU B OE2 1 
ATOM   5651  N N   . THR B 1 277 ? 150.879 136.337 128.989 1.00 85.05  ? 277 THR B N   1 
ATOM   5652  C CA  . THR B 1 277 ? 151.440 135.005 128.790 1.00 85.05  ? 277 THR B CA  1 
ATOM   5653  C C   . THR B 1 277 ? 151.187 134.131 130.006 1.00 85.05  ? 277 THR B C   1 
ATOM   5654  O O   . THR B 1 277 ? 151.057 134.624 131.126 1.00 85.05  ? 277 THR B O   1 
ATOM   5655  C CB  . THR B 1 277 ? 152.940 135.013 128.569 1.00 85.05  ? 277 THR B CB  1 
ATOM   5656  O OG1 . THR B 1 277 ? 153.564 135.659 129.679 1.00 85.05  ? 277 THR B OG1 1 
ATOM   5657  C CG2 . THR B 1 277 ? 153.320 135.685 127.273 1.00 85.05  ? 277 THR B CG2 1 
ATOM   5658  N N   . GLN B 1 278 ? 151.139 132.821 129.777 1.00 91.18  ? 278 GLN B N   1 
ATOM   5659  C CA  . GLN B 1 278 ? 151.172 131.835 130.854 1.00 91.18  ? 278 GLN B CA  1 
ATOM   5660  C C   . GLN B 1 278 ? 152.135 130.742 130.423 1.00 91.18  ? 278 GLN B C   1 
ATOM   5661  O O   . GLN B 1 278 ? 151.844 129.996 129.486 1.00 91.18  ? 278 GLN B O   1 
ATOM   5662  C CB  . GLN B 1 278 ? 149.799 131.237 131.144 1.00 91.18  ? 278 GLN B CB  1 
ATOM   5663  C CG  . GLN B 1 278 ? 148.746 132.213 131.585 1.00 91.18  ? 278 GLN B CG  1 
ATOM   5664  C CD  . GLN B 1 278 ? 147.998 132.788 130.410 1.00 91.18  ? 278 GLN B CD  1 
ATOM   5665  O OE1 . GLN B 1 278 ? 148.040 132.238 129.314 1.00 91.18  ? 278 GLN B OE1 1 
ATOM   5666  N NE2 . GLN B 1 278 ? 147.299 133.893 130.630 1.00 91.18  ? 278 GLN B NE2 1 
ATOM   5667  N N   . ALA B 1 279 ? 153.272 130.639 131.098 1.00 103.40 ? 279 ALA B N   1 
ATOM   5668  C CA  . ALA B 1 279 ? 154.232 129.603 130.749 1.00 103.40 ? 279 ALA B CA  1 
ATOM   5669  C C   . ALA B 1 279 ? 153.794 128.253 131.295 1.00 103.40 ? 279 ALA B C   1 
ATOM   5670  O O   . ALA B 1 279 ? 154.114 127.904 132.435 1.00 103.40 ? 279 ALA B O   1 
ATOM   5671  C CB  . ALA B 1 279 ? 155.623 129.955 131.271 1.00 103.40 ? 279 ALA B CB  1 
ATOM   5672  N N   . HIS B 1 280 ? 153.059 127.491 130.494 1.00 108.37 ? 280 HIS B N   1 
ATOM   5673  C CA  . HIS B 1 280 ? 152.719 126.119 130.847 1.00 108.37 ? 280 HIS B CA  1 
ATOM   5674  C C   . HIS B 1 280 ? 153.926 125.222 130.607 1.00 108.37 ? 280 HIS B C   1 
ATOM   5675  O O   . HIS B 1 280 ? 154.299 124.966 129.460 1.00 108.37 ? 280 HIS B O   1 
ATOM   5676  C CB  . HIS B 1 280 ? 151.515 125.661 130.035 1.00 108.37 ? 280 HIS B CB  1 
ATOM   5677  C CG  . HIS B 1 280 ? 151.164 124.224 130.244 1.00 108.37 ? 280 HIS B CG  1 
ATOM   5678  N ND1 . HIS B 1 280 ? 150.677 123.745 131.438 1.00 108.37 ? 280 HIS B ND1 1 
ATOM   5679  C CD2 . HIS B 1 280 ? 151.206 123.167 129.401 1.00 108.37 ? 280 HIS B CD2 1 
ATOM   5680  C CE1 . HIS B 1 280 ? 150.453 122.448 131.330 1.00 108.37 ? 280 HIS B CE1 1 
ATOM   5681  N NE2 . HIS B 1 280 ? 150.769 122.072 130.104 1.00 108.37 ? 280 HIS B NE2 1 
ATOM   5682  N N   . ILE B 1 281 ? 154.538 124.739 131.680 1.00 108.41 ? 281 ILE B N   1 
ATOM   5683  C CA  . ILE B 1 281 ? 155.794 124.009 131.599 1.00 108.41 ? 281 ILE B CA  1 
ATOM   5684  C C   . ILE B 1 281 ? 155.497 122.524 131.703 1.00 108.41 ? 281 ILE B C   1 
ATOM   5685  O O   . ILE B 1 281 ? 154.651 122.110 132.505 1.00 108.41 ? 281 ILE B O   1 
ATOM   5686  C CB  . ILE B 1 281 ? 156.749 124.429 132.722 1.00 108.41 ? 281 ILE B CB  1 
ATOM   5687  C CG1 . ILE B 1 281 ? 156.806 125.931 132.830 1.00 108.41 ? 281 ILE B CG1 1 
ATOM   5688  C CG2 . ILE B 1 281 ? 158.142 123.952 132.424 1.00 108.41 ? 281 ILE B CG2 1 
ATOM   5689  C CD1 . ILE B 1 281 ? 157.509 126.388 134.080 1.00 108.41 ? 281 ILE B CD1 1 
ATOM   5690  N N   . GLN B 1 282 ? 156.177 121.726 130.884 1.00 115.31 ? 282 GLN B N   1 
ATOM   5691  C CA  . GLN B 1 282 ? 156.300 120.295 131.111 1.00 115.31 ? 282 GLN B CA  1 
ATOM   5692  C C   . GLN B 1 282 ? 157.600 119.834 130.480 1.00 115.31 ? 282 GLN B C   1 
ATOM   5693  O O   . GLN B 1 282 ? 158.242 120.568 129.730 1.00 115.31 ? 282 GLN B O   1 
ATOM   5694  C CB  . GLN B 1 282 ? 155.113 119.501 130.556 1.00 115.31 ? 282 GLN B CB  1 
ATOM   5695  C CG  . GLN B 1 282 ? 154.983 119.500 129.054 1.00 115.31 ? 282 GLN B CG  1 
ATOM   5696  C CD  . GLN B 1 282 ? 154.093 120.616 128.562 1.00 115.31 ? 282 GLN B CD  1 
ATOM   5697  O OE1 . GLN B 1 282 ? 153.813 121.559 129.290 1.00 115.31 ? 282 GLN B OE1 1 
ATOM   5698  N NE2 . GLN B 1 282 ? 153.630 120.507 127.325 1.00 115.31 ? 282 GLN B NE2 1 
ATOM   5699  N N   . GLU B 1 283 ? 157.997 118.613 130.807 1.00 130.51 ? 283 GLU B N   1 
ATOM   5700  C CA  . GLU B 1 283 ? 159.231 118.075 130.265 1.00 130.51 ? 283 GLU B CA  1 
ATOM   5701  C C   . GLU B 1 283 ? 159.044 117.692 128.809 1.00 130.51 ? 283 GLU B C   1 
ATOM   5702  O O   . GLU B 1 283 ? 157.938 117.386 128.361 1.00 130.51 ? 283 GLU B O   1 
ATOM   5703  C CB  . GLU B 1 283 ? 159.699 116.857 131.059 1.00 130.51 ? 283 GLU B CB  1 
ATOM   5704  C CG  . GLU B 1 283 ? 160.202 117.168 132.457 1.00 130.51 ? 283 GLU B CG  1 
ATOM   5705  C CD  . GLU B 1 283 ? 160.652 115.924 133.208 1.00 130.51 ? 283 GLU B CD  1 
ATOM   5706  O OE1 . GLU B 1 283 ? 160.475 114.808 132.678 1.00 130.51 ? 283 GLU B OE1 1 
ATOM   5707  O OE2 . GLU B 1 283 ? 161.176 116.061 134.333 1.00 130.51 ? 283 GLU B OE2 1 
ATOM   5708  N N   . CYS B 1 284 ? 160.144 117.712 128.075 1.00 140.61 ? 284 CYS B N   1 
ATOM   5709  C CA  . CYS B 1 284 ? 160.159 117.409 126.655 1.00 140.61 ? 284 CYS B CA  1 
ATOM   5710  C C   . CYS B 1 284 ? 160.793 116.048 126.402 1.00 140.61 ? 284 CYS B C   1 
ATOM   5711  O O   . CYS B 1 284 ? 161.475 115.486 127.260 1.00 140.61 ? 284 CYS B O   1 
ATOM   5712  C CB  . CYS B 1 284 ? 160.884 118.522 125.895 1.00 140.61 ? 284 CYS B CB  1 
ATOM   5713  S SG  . CYS B 1 284 ? 162.463 118.958 126.605 1.00 140.61 ? 284 CYS B SG  1 
ATOM   5714  N N   . LYS B 1 285 ? 160.552 115.529 125.198 1.00 144.40 ? 285 LYS B N   1 
ATOM   5715  C CA  . LYS B 1 285 ? 160.839 114.134 124.888 1.00 144.40 ? 285 LYS B CA  1 
ATOM   5716  C C   . LYS B 1 285 ? 162.338 113.875 124.762 1.00 144.40 ? 285 LYS B C   1 
ATOM   5717  O O   . LYS B 1 285 ? 163.064 114.638 124.122 1.00 144.40 ? 285 LYS B O   1 
ATOM   5718  C CB  . LYS B 1 285 ? 160.132 113.738 123.591 1.00 144.40 ? 285 LYS B CB  1 
ATOM   5719  C CG  . LYS B 1 285 ? 160.318 112.284 123.191 1.00 144.40 ? 285 LYS B CG  1 
ATOM   5720  C CD  . LYS B 1 285 ? 159.623 111.959 121.886 1.00 144.40 ? 285 LYS B CD  1 
ATOM   5721  C CE  . LYS B 1 285 ? 159.909 110.528 121.470 1.00 144.40 ? 285 LYS B CE  1 
ATOM   5722  N NZ  . LYS B 1 285 ? 159.287 110.195 120.163 1.00 144.40 ? 285 LYS B NZ  1 
ATOM   5723  N N   . HIS B 1 286 ? 162.797 112.777 125.379 1.00 153.96 ? 286 HIS B N   1 
ATOM   5724  C CA  . HIS B 1 286 ? 164.191 112.351 125.335 1.00 153.96 ? 286 HIS B CA  1 
ATOM   5725  C C   . HIS B 1 286 ? 164.313 110.877 125.716 1.00 153.96 ? 286 HIS B C   1 
ATOM   5726  O O   . HIS B 1 286 ? 163.593 110.408 126.606 1.00 153.96 ? 286 HIS B O   1 
ATOM   5727  C CB  . HIS B 1 286 ? 165.041 113.197 126.281 1.00 153.96 ? 286 HIS B CB  1 
ATOM   5728  C CG  . HIS B 1 286 ? 164.637 113.064 127.711 1.00 153.96 ? 286 HIS B CG  1 
ATOM   5729  N ND1 . HIS B 1 286 ? 165.139 112.082 128.536 1.00 153.96 ? 286 HIS B ND1 1 
ATOM   5730  C CD2 . HIS B 1 286 ? 163.746 113.760 128.453 1.00 153.96 ? 286 HIS B CD2 1 
ATOM   5731  C CE1 . HIS B 1 286 ? 164.590 112.193 129.732 1.00 153.96 ? 286 HIS B CE1 1 
ATOM   5732  N NE2 . HIS B 1 286 ? 163.741 113.204 129.708 1.00 153.96 ? 286 HIS B NE2 1 
ATOM   5733  N N   . PRO B 1 287 ? 165.171 110.113 125.049 1.00 162.59 ? 287 PRO B N   1 
ATOM   5734  C CA  . PRO B 1 287 ? 165.598 108.804 125.591 1.00 162.59 ? 287 PRO B CA  1 
ATOM   5735  C C   . PRO B 1 287 ? 166.908 108.837 126.369 1.00 162.59 ? 287 PRO B C   1 
ATOM   5736  O O   . PRO B 1 287 ? 167.415 107.762 126.704 1.00 162.59 ? 287 PRO B O   1 
ATOM   5737  C CB  . PRO B 1 287 ? 165.759 107.969 124.317 1.00 162.59 ? 287 PRO B CB  1 
ATOM   5738  C CG  . PRO B 1 287 ? 166.174 108.942 123.299 1.00 162.59 ? 287 PRO B CG  1 
ATOM   5739  C CD  . PRO B 1 287 ? 165.460 110.227 123.612 1.00 162.59 ? 287 PRO B CD  1 
ATOM   5740  N N   . SER B 1 288 ? 167.459 110.015 126.658 1.00 168.03 ? 288 SER B N   1 
ATOM   5741  C CA  . SER B 1 288 ? 168.781 110.135 127.253 1.00 168.03 ? 288 SER B CA  1 
ATOM   5742  C C   . SER B 1 288 ? 168.712 109.986 128.776 1.00 168.03 ? 288 SER B C   1 
ATOM   5743  O O   . SER B 1 288 ? 167.642 110.016 129.387 1.00 168.03 ? 288 SER B O   1 
ATOM   5744  C CB  . SER B 1 288 ? 169.418 111.468 126.854 1.00 168.03 ? 288 SER B CB  1 
ATOM   5745  O OG  . SER B 1 288 ? 170.715 111.620 127.408 1.00 168.03 ? 288 SER B OG  1 
ATOM   5746  N N   . VAL B 1 289 ? 169.886 109.834 129.393 1.00 179.76 ? 289 VAL B N   1 
ATOM   5747  C CA  . VAL B 1 289 ? 170.046 109.451 130.792 1.00 179.76 ? 289 VAL B CA  1 
ATOM   5748  C C   . VAL B 1 289 ? 171.157 110.326 131.380 1.00 179.76 ? 289 VAL B C   1 
ATOM   5749  O O   . VAL B 1 289 ? 171.576 111.302 130.750 1.00 179.76 ? 289 VAL B O   1 
ATOM   5750  C CB  . VAL B 1 289 ? 170.309 107.925 130.921 1.00 179.76 ? 289 VAL B CB  1 
ATOM   5751  C CG1 . VAL B 1 289 ? 171.727 107.518 130.485 1.00 179.76 ? 289 VAL B CG1 1 
ATOM   5752  C CG2 . VAL B 1 289 ? 169.832 107.308 132.269 1.00 179.76 ? 289 VAL B CG2 1 
ATOM   5753  N N   . PHE B 1 290 ? 171.575 110.020 132.630 1.00 175.40 ? 290 PHE B N   1 
ATOM   5754  C CA  . PHE B 1 290 ? 172.601 110.680 133.471 1.00 175.40 ? 290 PHE B CA  1 
ATOM   5755  C C   . PHE B 1 290 ? 172.133 111.990 134.087 1.00 175.40 ? 290 PHE B C   1 
ATOM   5756  O O   . PHE B 1 290 ? 172.972 112.805 134.485 1.00 175.40 ? 290 PHE B O   1 
ATOM   5757  C CB  . PHE B 1 290 ? 173.939 110.967 132.764 1.00 175.40 ? 290 PHE B CB  1 
ATOM   5758  C CG  . PHE B 1 290 ? 174.768 109.754 132.471 1.00 175.40 ? 290 PHE B CG  1 
ATOM   5759  C CD1 . PHE B 1 290 ? 175.538 109.167 133.463 1.00 175.40 ? 290 PHE B CD1 1 
ATOM   5760  C CD2 . PHE B 1 290 ? 174.824 109.234 131.189 1.00 175.40 ? 290 PHE B CD2 1 
ATOM   5761  C CE1 . PHE B 1 290 ? 176.321 108.060 133.188 1.00 175.40 ? 290 PHE B CE1 1 
ATOM   5762  C CE2 . PHE B 1 290 ? 175.603 108.128 130.906 1.00 175.40 ? 290 PHE B CE2 1 
ATOM   5763  C CZ  . PHE B 1 290 ? 176.352 107.541 131.907 1.00 175.40 ? 290 PHE B CZ  1 
ATOM   5764  N N   . GLN B 1 291 ? 170.826 112.222 134.209 1.00 168.78 ? 291 GLN B N   1 
ATOM   5765  C CA  . GLN B 1 291 ? 170.373 113.514 134.715 1.00 168.78 ? 291 GLN B CA  1 
ATOM   5766  C C   . GLN B 1 291 ? 170.434 113.580 136.237 1.00 168.78 ? 291 GLN B C   1 
ATOM   5767  O O   . GLN B 1 291 ? 170.891 114.579 136.803 1.00 168.78 ? 291 GLN B O   1 
ATOM   5768  C CB  . GLN B 1 291 ? 168.960 113.820 134.206 1.00 168.78 ? 291 GLN B CB  1 
ATOM   5769  C CG  . GLN B 1 291 ? 168.430 115.175 134.660 1.00 168.78 ? 291 GLN B CG  1 
ATOM   5770  C CD  . GLN B 1 291 ? 167.159 115.587 133.953 1.00 168.78 ? 291 GLN B CD  1 
ATOM   5771  O OE1 . GLN B 1 291 ? 166.651 114.866 133.094 1.00 168.78 ? 291 GLN B OE1 1 
ATOM   5772  N NE2 . GLN B 1 291 ? 166.636 116.754 134.312 1.00 168.78 ? 291 GLN B NE2 1 
ATOM   5773  N N   . HIS B 1 292 ? 170.019 112.516 136.917 1.00 173.85 ? 292 HIS B N   1 
ATOM   5774  C CA  . HIS B 1 292 ? 169.844 112.559 138.368 1.00 173.85 ? 292 HIS B CA  1 
ATOM   5775  C C   . HIS B 1 292 ? 171.055 112.046 139.133 1.00 173.85 ? 292 HIS B C   1 
ATOM   5776  O O   . HIS B 1 292 ? 170.906 111.422 140.188 1.00 173.85 ? 292 HIS B O   1 
ATOM   5777  C CB  . HIS B 1 292 ? 168.589 111.785 138.753 1.00 173.85 ? 292 HIS B CB  1 
ATOM   5778  C CG  . HIS B 1 292 ? 167.319 112.436 138.302 1.00 173.85 ? 292 HIS B CG  1 
ATOM   5779  N ND1 . HIS B 1 292 ? 166.748 112.184 137.073 1.00 173.85 ? 292 HIS B ND1 1 
ATOM   5780  C CD2 . HIS B 1 292 ? 166.513 113.335 138.914 1.00 173.85 ? 292 HIS B CD2 1 
ATOM   5781  C CE1 . HIS B 1 292 ? 165.643 112.896 136.950 1.00 173.85 ? 292 HIS B CE1 1 
ATOM   5782  N NE2 . HIS B 1 292 ? 165.478 113.604 138.053 1.00 173.85 ? 292 HIS B NE2 1 
ATOM   5783  N N   . GLY B 1 293 ? 172.267 112.282 138.625 1.00 173.91 ? 293 GLY B N   1 
ATOM   5784  C CA  . GLY B 1 293 ? 173.455 112.008 139.415 1.00 173.91 ? 293 GLY B CA  1 
ATOM   5785  C C   . GLY B 1 293 ? 173.608 112.960 140.584 1.00 173.91 ? 293 GLY B C   1 
ATOM   5786  O O   . GLY B 1 293 ? 174.178 112.597 141.618 1.00 173.91 ? 293 GLY B O   1 
ATOM   5787  N N   . ASP B 1 294 ? 173.102 114.184 140.439 1.00 171.84 ? 294 ASP B N   1 
ATOM   5788  C CA  . ASP B 1 294 ? 173.052 115.160 141.515 1.00 171.84 ? 294 ASP B CA  1 
ATOM   5789  C C   . ASP B 1 294 ? 171.658 115.710 141.764 1.00 171.84 ? 294 ASP B C   1 
ATOM   5790  O O   . ASP B 1 294 ? 171.443 116.345 142.802 1.00 171.84 ? 294 ASP B O   1 
ATOM   5791  C CB  . ASP B 1 294 ? 173.987 116.342 141.215 1.00 171.84 ? 294 ASP B CB  1 
ATOM   5792  C CG  . ASP B 1 294 ? 175.446 115.949 141.223 1.00 171.84 ? 294 ASP B CG  1 
ATOM   5793  O OD1 . ASP B 1 294 ? 175.810 115.004 141.954 1.00 171.84 ? 294 ASP B OD1 1 
ATOM   5794  O OD2 . ASP B 1 294 ? 176.231 116.592 140.497 1.00 171.84 ? 294 ASP B OD2 1 
ATOM   5795  N N   . ASN B 1 295 ? 170.715 115.494 140.845 1.00 167.91 ? 295 ASN B N   1 
ATOM   5796  C CA  . ASN B 1 295 ? 169.391 116.092 140.947 1.00 167.91 ? 295 ASN B CA  1 
ATOM   5797  C C   . ASN B 1 295 ? 168.542 115.417 142.014 1.00 167.91 ? 295 ASN B C   1 
ATOM   5798  O O   . ASN B 1 295 ? 167.742 116.090 142.672 1.00 167.91 ? 295 ASN B O   1 
ATOM   5799  C CB  . ASN B 1 295 ? 168.698 116.023 139.584 1.00 167.91 ? 295 ASN B CB  1 
ATOM   5800  C CG  . ASN B 1 295 ? 167.512 116.965 139.468 1.00 167.91 ? 295 ASN B CG  1 
ATOM   5801  O OD1 . ASN B 1 295 ? 167.180 117.703 140.395 1.00 167.91 ? 295 ASN B OD1 1 
ATOM   5802  N ND2 . ASN B 1 295 ? 166.871 116.949 138.307 1.00 167.91 ? 295 ASN B ND2 1 
ATOM   5803  N N   . SER B 1 296 ? 168.719 114.109 142.220 1.00 159.18 ? 296 SER B N   1 
ATOM   5804  C CA  . SER B 1 296 ? 168.018 113.427 143.302 1.00 159.18 ? 296 SER B CA  1 
ATOM   5805  C C   . SER B 1 296 ? 168.559 113.810 144.677 1.00 159.18 ? 296 SER B C   1 
ATOM   5806  O O   . SER B 1 296 ? 167.882 113.568 145.682 1.00 159.18 ? 296 SER B O   1 
ATOM   5807  C CB  . SER B 1 296 ? 168.087 111.913 143.100 1.00 159.18 ? 296 SER B CB  1 
ATOM   5808  O OG  . SER B 1 296 ? 169.419 111.449 143.199 1.00 159.18 ? 296 SER B OG  1 
ATOM   5809  N N   . PHE B 1 297 ? 169.748 114.423 144.746 1.00 158.23 ? 297 PHE B N   1 
ATOM   5810  C CA  . PHE B 1 297 ? 170.243 115.018 145.984 1.00 158.23 ? 297 PHE B CA  1 
ATOM   5811  C C   . PHE B 1 297 ? 169.545 116.327 146.337 1.00 158.23 ? 297 PHE B C   1 
ATOM   5812  O O   . PHE B 1 297 ? 169.830 116.896 147.397 1.00 158.23 ? 297 PHE B O   1 
ATOM   5813  C CB  . PHE B 1 297 ? 171.759 115.245 145.916 1.00 158.23 ? 297 PHE B CB  1 
ATOM   5814  C CG  . PHE B 1 297 ? 172.566 113.979 145.987 1.00 158.23 ? 297 PHE B CG  1 
ATOM   5815  C CD1 . PHE B 1 297 ? 172.748 113.329 147.198 1.00 158.23 ? 297 PHE B CD1 1 
ATOM   5816  C CD2 . PHE B 1 297 ? 173.157 113.451 144.851 1.00 158.23 ? 297 PHE B CD2 1 
ATOM   5817  C CE1 . PHE B 1 297 ? 173.488 112.167 147.273 1.00 158.23 ? 297 PHE B CE1 1 
ATOM   5818  C CE2 . PHE B 1 297 ? 173.903 112.288 144.918 1.00 158.23 ? 297 PHE B CE2 1 
ATOM   5819  C CZ  . PHE B 1 297 ? 174.067 111.647 146.132 1.00 158.23 ? 297 PHE B CZ  1 
ATOM   5820  N N   . ARG B 1 298 ? 168.665 116.829 145.476 1.00 145.56 ? 298 ARG B N   1 
ATOM   5821  C CA  . ARG B 1 298 ? 167.660 117.794 145.889 1.00 145.56 ? 298 ARG B CA  1 
ATOM   5822  C C   . ARG B 1 298 ? 166.319 117.127 146.146 1.00 145.56 ? 298 ARG B C   1 
ATOM   5823  O O   . ARG B 1 298 ? 165.603 117.515 147.073 1.00 145.56 ? 298 ARG B O   1 
ATOM   5824  C CB  . ARG B 1 298 ? 167.479 118.882 144.828 1.00 145.56 ? 298 ARG B CB  1 
ATOM   5825  C CG  . ARG B 1 298 ? 166.687 120.068 145.342 1.00 145.56 ? 298 ARG B CG  1 
ATOM   5826  C CD  . ARG B 1 298 ? 166.321 121.059 144.265 1.00 145.56 ? 298 ARG B CD  1 
ATOM   5827  N NE  . ARG B 1 298 ? 165.290 120.522 143.390 1.00 145.56 ? 298 ARG B NE  1 
ATOM   5828  C CZ  . ARG B 1 298 ? 164.815 121.157 142.328 1.00 145.56 ? 298 ARG B CZ  1 
ATOM   5829  N NH1 . ARG B 1 298 ? 165.270 122.361 142.017 1.00 145.56 ? 298 ARG B NH1 1 
ATOM   5830  N NH2 . ARG B 1 298 ? 163.876 120.593 141.586 1.00 145.56 ? 298 ARG B NH2 1 
ATOM   5831  N N   . LEU B 1 299 ? 165.989 116.104 145.352 1.00 142.85 ? 299 LEU B N   1 
ATOM   5832  C CA  . LEU B 1 299 ? 164.701 115.425 145.444 1.00 142.85 ? 299 LEU B CA  1 
ATOM   5833  C C   . LEU B 1 299 ? 164.540 114.663 146.744 1.00 142.85 ? 299 LEU B C   1 
ATOM   5834  O O   . LEU B 1 299 ? 163.410 114.389 147.152 1.00 142.85 ? 299 LEU B O   1 
ATOM   5835  C CB  . LEU B 1 299 ? 164.542 114.449 144.280 1.00 142.85 ? 299 LEU B CB  1 
ATOM   5836  C CG  . LEU B 1 299 ? 164.565 115.022 142.863 1.00 142.85 ? 299 LEU B CG  1 
ATOM   5837  C CD1 . LEU B 1 299 ? 164.557 113.904 141.830 1.00 142.85 ? 299 LEU B CD1 1 
ATOM   5838  C CD2 . LEU B 1 299 ? 163.397 115.966 142.656 1.00 142.85 ? 299 LEU B CD2 1 
ATOM   5839  N N   . LEU B 1 300 ? 165.641 114.289 147.379 1.00 135.41 ? 300 LEU B N   1 
ATOM   5840  C CA  . LEU B 1 300 ? 165.627 113.615 148.667 1.00 135.41 ? 300 LEU B CA  1 
ATOM   5841  C C   . LEU B 1 300 ? 166.280 114.478 149.735 1.00 135.41 ? 300 LEU B C   1 
ATOM   5842  O O   . LEU B 1 300 ? 166.934 113.972 150.647 1.00 135.41 ? 300 LEU B O   1 
ATOM   5843  C CB  . LEU B 1 300 ? 166.316 112.257 148.581 1.00 135.41 ? 300 LEU B CB  1 
ATOM   5844  C CG  . LEU B 1 300 ? 165.609 111.168 147.770 1.00 135.41 ? 300 LEU B CG  1 
ATOM   5845  C CD1 . LEU B 1 300 ? 166.488 109.939 147.620 1.00 135.41 ? 300 LEU B CD1 1 
ATOM   5846  C CD2 . LEU B 1 300 ? 164.298 110.797 148.432 1.00 135.41 ? 300 LEU B CD2 1 
ATOM   5847  N N   . PHE B 1 301 ? 166.137 115.795 149.618 1.00 130.39 ? 301 PHE B N   1 
ATOM   5848  C CA  . PHE B 1 301 ? 166.440 116.676 150.735 1.00 130.39 ? 301 PHE B CA  1 
ATOM   5849  C C   . PHE B 1 301 ? 165.204 117.112 151.486 1.00 130.39 ? 301 PHE B C   1 
ATOM   5850  O O   . PHE B 1 301 ? 165.257 117.254 152.704 1.00 130.39 ? 301 PHE B O   1 
ATOM   5851  C CB  . PHE B 1 301 ? 167.185 117.934 150.280 1.00 130.39 ? 301 PHE B CB  1 
ATOM   5852  C CG  . PHE B 1 301 ? 167.592 118.824 151.422 1.00 130.39 ? 301 PHE B CG  1 
ATOM   5853  C CD1 . PHE B 1 301 ? 168.663 118.479 152.223 1.00 130.39 ? 301 PHE B CD1 1 
ATOM   5854  C CD2 . PHE B 1 301 ? 166.889 119.981 151.715 1.00 130.39 ? 301 PHE B CD2 1 
ATOM   5855  C CE1 . PHE B 1 301 ? 169.037 119.275 153.280 1.00 130.39 ? 301 PHE B CE1 1 
ATOM   5856  C CE2 . PHE B 1 301 ? 167.258 120.775 152.775 1.00 130.39 ? 301 PHE B CE2 1 
ATOM   5857  C CZ  . PHE B 1 301 ? 168.335 120.423 153.556 1.00 130.39 ? 301 PHE B CZ  1 
ATOM   5858  N N   . ASP B 1 302 ? 164.099 117.333 150.786 1.00 135.89 ? 302 ASP B N   1 
ATOM   5859  C CA  . ASP B 1 302 ? 162.853 117.682 151.445 1.00 135.89 ? 302 ASP B CA  1 
ATOM   5860  C C   . ASP B 1 302 ? 162.325 116.565 152.330 1.00 135.89 ? 302 ASP B C   1 
ATOM   5861  O O   . ASP B 1 302 ? 161.538 116.841 153.234 1.00 135.89 ? 302 ASP B O   1 
ATOM   5862  C CB  . ASP B 1 302 ? 161.823 118.064 150.393 1.00 135.89 ? 302 ASP B CB  1 
ATOM   5863  C CG  . ASP B 1 302 ? 161.719 117.034 149.292 1.00 135.89 ? 302 ASP B CG  1 
ATOM   5864  O OD1 . ASP B 1 302 ? 162.515 116.068 149.306 1.00 135.89 ? 302 ASP B OD1 1 
ATOM   5865  O OD2 . ASP B 1 302 ? 160.856 117.190 148.403 1.00 135.89 ? 302 ASP B OD2 1 
ATOM   5866  N N   . VAL B 1 303 ? 162.751 115.319 152.102 1.00 129.96 ? 303 VAL B N   1 
ATOM   5867  C CA  . VAL B 1 303 ? 162.389 114.235 153.005 1.00 129.96 ? 303 VAL B CA  1 
ATOM   5868  C C   . VAL B 1 303 ? 163.029 114.421 154.370 1.00 129.96 ? 303 VAL B C   1 
ATOM   5869  O O   . VAL B 1 303 ? 162.493 113.934 155.368 1.00 129.96 ? 303 VAL B O   1 
ATOM   5870  C CB  . VAL B 1 303 ? 162.759 112.865 152.403 1.00 129.96 ? 303 VAL B CB  1 
ATOM   5871  C CG1 . VAL B 1 303 ? 161.974 112.616 151.130 1.00 129.96 ? 303 VAL B CG1 1 
ATOM   5872  C CG2 . VAL B 1 303 ? 164.237 112.774 152.115 1.00 129.96 ? 303 VAL B CG2 1 
ATOM   5873  N N   . VAL B 1 304 ? 164.152 115.134 154.442 1.00 129.83 ? 304 VAL B N   1 
ATOM   5874  C CA  . VAL B 1 304 ? 164.697 115.514 155.732 1.00 129.83 ? 304 VAL B CA  1 
ATOM   5875  C C   . VAL B 1 304 ? 163.817 116.574 156.372 1.00 129.83 ? 304 VAL B C   1 
ATOM   5876  O O   . VAL B 1 304 ? 163.605 116.559 157.588 1.00 129.83 ? 304 VAL B O   1 
ATOM   5877  C CB  . VAL B 1 304 ? 166.146 115.996 155.561 1.00 129.83 ? 304 VAL B CB  1 
ATOM   5878  C CG1 . VAL B 1 304 ? 166.806 116.277 156.902 1.00 129.83 ? 304 VAL B CG1 1 
ATOM   5879  C CG2 . VAL B 1 304 ? 166.941 115.003 154.731 1.00 129.83 ? 304 VAL B CG2 1 
ATOM   5880  N N   . VAL B 1 305 ? 163.274 117.490 155.567 1.00 129.62 ? 305 VAL B N   1 
ATOM   5881  C CA  . VAL B 1 305 ? 162.303 118.449 156.074 1.00 129.62 ? 305 VAL B CA  1 
ATOM   5882  C C   . VAL B 1 305 ? 161.032 117.725 156.480 1.00 129.62 ? 305 VAL B C   1 
ATOM   5883  O O   . VAL B 1 305 ? 160.387 118.088 157.472 1.00 129.62 ? 305 VAL B O   1 
ATOM   5884  C CB  . VAL B 1 305 ? 162.015 119.528 155.014 1.00 129.62 ? 305 VAL B CB  1 
ATOM   5885  C CG1 . VAL B 1 305 ? 161.106 120.612 155.560 1.00 129.62 ? 305 VAL B CG1 1 
ATOM   5886  C CG2 . VAL B 1 305 ? 163.293 120.107 154.465 1.00 129.62 ? 305 VAL B CG2 1 
ATOM   5887  N N   . ILE B 1 306 ? 160.671 116.675 155.738 1.00 130.63 ? 306 ILE B N   1 
ATOM   5888  C CA  . ILE B 1 306 ? 159.543 115.831 156.115 1.00 130.63 ? 306 ILE B CA  1 
ATOM   5889  C C   . ILE B 1 306 ? 159.823 115.120 157.435 1.00 130.63 ? 306 ILE B C   1 
ATOM   5890  O O   . ILE B 1 306 ? 158.932 114.986 158.279 1.00 130.63 ? 306 ILE B O   1 
ATOM   5891  C CB  . ILE B 1 306 ? 159.221 114.844 154.974 1.00 130.63 ? 306 ILE B CB  1 
ATOM   5892  C CG1 . ILE B 1 306 ? 158.647 115.587 153.774 1.00 130.63 ? 306 ILE B CG1 1 
ATOM   5893  C CG2 . ILE B 1 306 ? 158.221 113.771 155.395 1.00 130.63 ? 306 ILE B CG2 1 
ATOM   5894  C CD1 . ILE B 1 306 ? 158.553 114.736 152.542 1.00 130.63 ? 306 ILE B CD1 1 
ATOM   5895  N N   . LEU B 1 307 ? 161.070 114.702 157.663 1.00 127.14 ? 307 LEU B N   1 
ATOM   5896  C CA  . LEU B 1 307 ? 161.394 114.026 158.918 1.00 127.14 ? 307 LEU B CA  1 
ATOM   5897  C C   . LEU B 1 307 ? 161.398 114.991 160.095 1.00 127.14 ? 307 LEU B C   1 
ATOM   5898  O O   . LEU B 1 307 ? 160.650 114.808 161.063 1.00 127.14 ? 307 LEU B O   1 
ATOM   5899  C CB  . LEU B 1 307 ? 162.745 113.317 158.820 1.00 127.14 ? 307 LEU B CB  1 
ATOM   5900  C CG  . LEU B 1 307 ? 162.820 112.024 158.016 1.00 127.14 ? 307 LEU B CG  1 
ATOM   5901  C CD1 . LEU B 1 307 ? 164.253 111.545 157.931 1.00 127.14 ? 307 LEU B CD1 1 
ATOM   5902  C CD2 . LEU B 1 307 ? 161.941 110.970 158.653 1.00 127.14 ? 307 LEU B CD2 1 
ATOM   5903  N N   . THR B 1 308 ? 162.232 116.030 160.023 1.00 127.30 ? 308 THR B N   1 
ATOM   5904  C CA  . THR B 1 308 ? 162.577 116.800 161.214 1.00 127.30 ? 308 THR B CA  1 
ATOM   5905  C C   . THR B 1 308 ? 161.421 117.636 161.720 1.00 127.30 ? 308 THR B C   1 
ATOM   5906  O O   . THR B 1 308 ? 161.243 117.764 162.935 1.00 127.30 ? 308 THR B O   1 
ATOM   5907  C CB  . THR B 1 308 ? 163.763 117.710 160.930 1.00 127.30 ? 308 THR B CB  1 
ATOM   5908  O OG1 . THR B 1 308 ? 163.425 118.603 159.863 1.00 127.30 ? 308 THR B OG1 1 
ATOM   5909  C CG2 . THR B 1 308 ? 164.985 116.889 160.553 1.00 127.30 ? 308 THR B CG2 1 
ATOM   5910  N N   . CYS B 1 309 ? 160.633 118.207 160.820 1.00 126.58 ? 309 CYS B N   1 
ATOM   5911  C CA  . CYS B 1 309 ? 159.489 118.980 161.269 1.00 126.58 ? 309 CYS B CA  1 
ATOM   5912  C C   . CYS B 1 309 ? 158.406 118.074 161.833 1.00 126.58 ? 309 CYS B C   1 
ATOM   5913  O O   . CYS B 1 309 ? 157.713 118.451 162.782 1.00 126.58 ? 309 CYS B O   1 
ATOM   5914  C CB  . CYS B 1 309 ? 158.954 119.827 160.123 1.00 126.58 ? 309 CYS B CB  1 
ATOM   5915  S SG  . CYS B 1 309 ? 160.095 121.118 159.602 1.00 126.58 ? 309 CYS B SG  1 
ATOM   5916  N N   . SER B 1 310 ? 158.274 116.865 161.291 1.00 127.74 ? 310 SER B N   1 
ATOM   5917  C CA  . SER B 1 310 ? 157.292 115.929 161.825 1.00 127.74 ? 310 SER B CA  1 
ATOM   5918  C C   . SER B 1 310 ? 157.740 115.352 163.154 1.00 127.74 ? 310 SER B C   1 
ATOM   5919  O O   . SER B 1 310 ? 156.926 115.207 164.073 1.00 127.74 ? 310 SER B O   1 
ATOM   5920  C CB  . SER B 1 310 ? 157.046 114.798 160.839 1.00 127.74 ? 310 SER B CB  1 
ATOM   5921  O OG  . SER B 1 310 ? 158.237 114.047 160.653 1.00 127.74 ? 310 SER B OG  1 
ATOM   5922  N N   . LEU B 1 311 ? 159.023 114.994 163.269 1.00 125.86 ? 311 LEU B N   1 
ATOM   5923  C CA  . LEU B 1 311 ? 159.529 114.488 164.537 1.00 125.86 ? 311 LEU B CA  1 
ATOM   5924  C C   . LEU B 1 311 ? 159.504 115.553 165.618 1.00 125.86 ? 311 LEU B C   1 
ATOM   5925  O O   . LEU B 1 311 ? 159.378 115.215 166.798 1.00 125.86 ? 311 LEU B O   1 
ATOM   5926  C CB  . LEU B 1 311 ? 160.947 113.938 164.379 1.00 125.86 ? 311 LEU B CB  1 
ATOM   5927  C CG  . LEU B 1 311 ? 161.154 112.651 163.573 1.00 125.86 ? 311 LEU B CG  1 
ATOM   5928  C CD1 . LEU B 1 311 ? 162.635 112.318 163.465 1.00 125.86 ? 311 LEU B CD1 1 
ATOM   5929  C CD2 . LEU B 1 311 ? 160.394 111.481 164.171 1.00 125.86 ? 311 LEU B CD2 1 
ATOM   5930  N N   . SER B 1 312 ? 159.586 116.826 165.241 1.00 122.95 ? 312 SER B N   1 
ATOM   5931  C CA  . SER B 1 312 ? 159.347 117.915 166.169 1.00 122.95 ? 312 SER B CA  1 
ATOM   5932  C C   . SER B 1 312 ? 157.872 118.195 166.379 1.00 122.95 ? 312 SER B C   1 
ATOM   5933  O O   . SER B 1 312 ? 157.502 118.708 167.437 1.00 122.95 ? 312 SER B O   1 
ATOM   5934  C CB  . SER B 1 312 ? 160.026 119.190 165.683 1.00 122.95 ? 312 SER B CB  1 
ATOM   5935  O OG  . SER B 1 312 ? 159.720 120.270 166.544 1.00 122.95 ? 312 SER B OG  1 
ATOM   5936  N N   . PHE B 1 313 ? 157.025 117.876 165.405 1.00 118.94 ? 313 PHE B N   1 
ATOM   5937  C CA  . PHE B 1 313 ? 155.593 117.957 165.637 1.00 118.94 ? 313 PHE B CA  1 
ATOM   5938  C C   . PHE B 1 313 ? 155.133 116.885 166.608 1.00 118.94 ? 313 PHE B C   1 
ATOM   5939  O O   . PHE B 1 313 ? 154.152 117.084 167.329 1.00 118.94 ? 313 PHE B O   1 
ATOM   5940  C CB  . PHE B 1 313 ? 154.845 117.837 164.314 1.00 118.94 ? 313 PHE B CB  1 
ATOM   5941  C CG  . PHE B 1 313 ? 153.359 117.942 164.442 1.00 118.94 ? 313 PHE B CG  1 
ATOM   5942  C CD1 . PHE B 1 313 ? 152.759 119.156 164.713 1.00 118.94 ? 313 PHE B CD1 1 
ATOM   5943  C CD2 . PHE B 1 313 ? 152.560 116.829 164.264 1.00 118.94 ? 313 PHE B CD2 1 
ATOM   5944  C CE1 . PHE B 1 313 ? 151.393 119.253 164.822 1.00 118.94 ? 313 PHE B CE1 1 
ATOM   5945  C CE2 . PHE B 1 313 ? 151.194 116.924 164.370 1.00 118.94 ? 313 PHE B CE2 1 
ATOM   5946  C CZ  . PHE B 1 313 ? 150.611 118.138 164.649 1.00 118.94 ? 313 PHE B CZ  1 
ATOM   5947  N N   . LEU B 1 314 ? 155.833 115.754 166.647 1.00 121.23 ? 314 LEU B N   1 
ATOM   5948  C CA  . LEU B 1 314 ? 155.529 114.729 167.633 1.00 121.23 ? 314 LEU B CA  1 
ATOM   5949  C C   . LEU B 1 314 ? 156.006 115.148 169.012 1.00 121.23 ? 314 LEU B C   1 
ATOM   5950  O O   . LEU B 1 314 ? 155.329 114.894 170.012 1.00 121.23 ? 314 LEU B O   1 
ATOM   5951  C CB  . LEU B 1 314 ? 156.172 113.404 167.210 1.00 121.23 ? 314 LEU B CB  1 
ATOM   5952  C CG  . LEU B 1 314 ? 155.908 112.059 167.907 1.00 121.23 ? 314 LEU B CG  1 
ATOM   5953  C CD1 . LEU B 1 314 ? 156.791 111.792 169.134 1.00 121.23 ? 314 LEU B CD1 1 
ATOM   5954  C CD2 . LEU B 1 314 ? 154.437 111.951 168.281 1.00 121.23 ? 314 LEU B CD2 1 
ATOM   5955  N N   . LEU B 1 315 ? 157.163 115.796 169.082 1.00 121.15 ? 315 LEU B N   1 
ATOM   5956  C CA  . LEU B 1 315 ? 157.789 116.032 170.373 1.00 121.15 ? 315 LEU B CA  1 
ATOM   5957  C C   . LEU B 1 315 ? 157.119 117.180 171.106 1.00 121.15 ? 315 LEU B C   1 
ATOM   5958  O O   . LEU B 1 315 ? 156.856 117.085 172.308 1.00 121.15 ? 315 LEU B O   1 
ATOM   5959  C CB  . LEU B 1 315 ? 159.284 116.293 170.181 1.00 121.15 ? 315 LEU B CB  1 
ATOM   5960  C CG  . LEU B 1 315 ? 160.252 116.345 171.370 1.00 121.15 ? 315 LEU B CG  1 
ATOM   5961  C CD1 . LEU B 1 315 ? 160.376 117.715 172.059 1.00 121.15 ? 315 LEU B CD1 1 
ATOM   5962  C CD2 . LEU B 1 315 ? 159.851 115.283 172.380 1.00 121.15 ? 315 LEU B CD2 1 
ATOM   5963  N N   . CYS B 1 316 ? 156.858 118.281 170.407 1.00 125.14 ? 316 CYS B N   1 
ATOM   5964  C CA  . CYS B 1 316 ? 156.381 119.478 171.084 1.00 125.14 ? 316 CYS B CA  1 
ATOM   5965  C C   . CYS B 1 316 ? 154.940 119.321 171.535 1.00 125.14 ? 316 CYS B C   1 
ATOM   5966  O O   . CYS B 1 316 ? 154.538 119.890 172.556 1.00 125.14 ? 316 CYS B O   1 
ATOM   5967  C CB  . CYS B 1 316 ? 156.521 120.685 170.162 1.00 125.14 ? 316 CYS B CB  1 
ATOM   5968  S SG  . CYS B 1 316 ? 158.229 121.101 169.743 1.00 125.14 ? 316 CYS B SG  1 
ATOM   5969  N N   . ALA B 1 317 ? 154.159 118.529 170.804 1.00 130.54 ? 317 ALA B N   1 
ATOM   5970  C CA  . ALA B 1 317 ? 152.757 118.349 171.150 1.00 130.54 ? 317 ALA B CA  1 
ATOM   5971  C C   . ALA B 1 317 ? 152.591 117.425 172.343 1.00 130.54 ? 317 ALA B C   1 
ATOM   5972  O O   . ALA B 1 317 ? 151.544 117.438 172.996 1.00 130.54 ? 317 ALA B O   1 
ATOM   5973  C CB  . ALA B 1 317 ? 151.983 117.809 169.949 1.00 130.54 ? 317 ALA B CB  1 
ATOM   5974  N N   . ARG B 1 318 ? 153.605 116.611 172.635 1.00 123.95 ? 318 ARG B N   1 
ATOM   5975  C CA  . ARG B 1 318 ? 153.560 115.785 173.833 1.00 123.95 ? 318 ARG B CA  1 
ATOM   5976  C C   . ARG B 1 318 ? 153.610 116.655 175.077 1.00 123.95 ? 318 ARG B C   1 
ATOM   5977  O O   . ARG B 1 318 ? 153.005 116.325 176.103 1.00 123.95 ? 318 ARG B O   1 
ATOM   5978  C CB  . ARG B 1 318 ? 154.713 114.785 173.819 1.00 123.95 ? 318 ARG B CB  1 
ATOM   5979  C CG  . ARG B 1 318 ? 154.627 113.725 174.889 1.00 123.95 ? 318 ARG B CG  1 
ATOM   5980  C CD  . ARG B 1 318 ? 155.777 112.751 174.782 1.00 123.95 ? 318 ARG B CD  1 
ATOM   5981  N NE  . ARG B 1 318 ? 155.629 111.640 175.715 1.00 123.95 ? 318 ARG B NE  1 
ATOM   5982  C CZ  . ARG B 1 318 ? 156.082 111.641 176.962 1.00 123.95 ? 318 ARG B CZ  1 
ATOM   5983  N NH1 . ARG B 1 318 ? 155.898 110.581 177.733 1.00 123.95 ? 318 ARG B NH1 1 
ATOM   5984  N NH2 . ARG B 1 318 ? 156.717 112.700 177.438 1.00 123.95 ? 318 ARG B NH2 1 
ATOM   5985  N N   . SER B 1 319 ? 154.304 117.788 174.994 1.00 129.80 ? 319 SER B N   1 
ATOM   5986  C CA  . SER B 1 319 ? 154.266 118.754 176.078 1.00 129.80 ? 319 SER B CA  1 
ATOM   5987  C C   . SER B 1 319 ? 152.922 119.454 176.148 1.00 129.80 ? 319 SER B C   1 
ATOM   5988  O O   . SER B 1 319 ? 152.466 119.806 177.240 1.00 129.80 ? 319 SER B O   1 
ATOM   5989  C CB  . SER B 1 319 ? 155.380 119.781 175.917 1.00 129.80 ? 319 SER B CB  1 
ATOM   5990  O OG  . SER B 1 319 ? 155.348 120.720 176.976 1.00 129.80 ? 319 SER B OG  1 
ATOM   5991  N N   . LEU B 1 320 ? 152.285 119.676 175.000 1.00 129.96 ? 320 LEU B N   1 
ATOM   5992  C CA  . LEU B 1 320 ? 150.910 120.153 175.008 1.00 129.96 ? 320 LEU B CA  1 
ATOM   5993  C C   . LEU B 1 320 ? 149.992 119.112 175.622 1.00 129.96 ? 320 LEU B C   1 
ATOM   5994  O O   . LEU B 1 320 ? 149.061 119.447 176.363 1.00 129.96 ? 320 LEU B O   1 
ATOM   5995  C CB  . LEU B 1 320 ? 150.457 120.473 173.591 1.00 129.96 ? 320 LEU B CB  1 
ATOM   5996  C CG  . LEU B 1 320 ? 151.188 121.591 172.876 1.00 129.96 ? 320 LEU B CG  1 
ATOM   5997  C CD1 . LEU B 1 320 ? 150.680 121.662 171.463 1.00 129.96 ? 320 LEU B CD1 1 
ATOM   5998  C CD2 . LEU B 1 320 ? 150.941 122.886 173.600 1.00 129.96 ? 320 LEU B CD2 1 
ATOM   5999  N N   . LEU B 1 321 ? 150.254 117.836 175.328 1.00 132.69 ? 321 LEU B N   1 
ATOM   6000  C CA  . LEU B 1 321 ? 149.520 116.754 175.971 1.00 132.69 ? 321 LEU B CA  1 
ATOM   6001  C C   . LEU B 1 321 ? 149.830 116.695 177.456 1.00 132.69 ? 321 LEU B C   1 
ATOM   6002  O O   . LEU B 1 321 ? 148.991 116.270 178.253 1.00 132.69 ? 321 LEU B O   1 
ATOM   6003  C CB  . LEU B 1 321 ? 149.855 115.418 175.306 1.00 132.69 ? 321 LEU B CB  1 
ATOM   6004  C CG  . LEU B 1 321 ? 149.337 115.141 173.889 1.00 132.69 ? 321 LEU B CG  1 
ATOM   6005  C CD1 . LEU B 1 321 ? 149.923 113.851 173.339 1.00 132.69 ? 321 LEU B CD1 1 
ATOM   6006  C CD2 . LEU B 1 321 ? 147.820 115.068 173.869 1.00 132.69 ? 321 LEU B CD2 1 
ATOM   6007  N N   . ARG B 1 322 ? 151.027 117.126 177.848 1.00 137.10 ? 322 ARG B N   1 
ATOM   6008  C CA  . ARG B 1 322 ? 151.374 117.118 179.261 1.00 137.10 ? 322 ARG B CA  1 
ATOM   6009  C C   . ARG B 1 322 ? 150.732 118.283 179.993 1.00 137.10 ? 322 ARG B C   1 
ATOM   6010  O O   . ARG B 1 322 ? 150.286 118.130 181.134 1.00 137.10 ? 322 ARG B O   1 
ATOM   6011  C CB  . ARG B 1 322 ? 152.890 117.153 179.432 1.00 137.10 ? 322 ARG B CB  1 
ATOM   6012  C CG  . ARG B 1 322 ? 153.329 117.032 180.872 1.00 137.10 ? 322 ARG B CG  1 
ATOM   6013  C CD  . ARG B 1 322 ? 154.827 116.912 181.010 1.00 137.10 ? 322 ARG B CD  1 
ATOM   6014  N NE  . ARG B 1 322 ? 155.206 116.809 182.413 1.00 137.10 ? 322 ARG B NE  1 
ATOM   6015  C CZ  . ARG B 1 322 ? 155.230 115.669 183.097 1.00 137.10 ? 322 ARG B CZ  1 
ATOM   6016  N NH1 . ARG B 1 322 ? 155.587 115.671 184.372 1.00 137.10 ? 322 ARG B NH1 1 
ATOM   6017  N NH2 . ARG B 1 322 ? 154.908 114.527 182.506 1.00 137.10 ? 322 ARG B NH2 1 
ATOM   6018  N N   . GLY B 1 323 ? 150.663 119.447 179.351 1.00 137.25 ? 323 GLY B N   1 
ATOM   6019  C CA  . GLY B 1 323 ? 150.175 120.628 180.041 1.00 137.25 ? 323 GLY B CA  1 
ATOM   6020  C C   . GLY B 1 323 ? 148.683 120.591 180.293 1.00 137.25 ? 323 GLY B C   1 
ATOM   6021  O O   . GLY B 1 323 ? 148.210 121.035 181.343 1.00 137.25 ? 323 GLY B O   1 
ATOM   6022  N N   . PHE B 1 324 ? 147.921 120.062 179.338 1.00 135.85 ? 324 PHE B N   1 
ATOM   6023  C CA  . PHE B 1 324 ? 146.483 119.949 179.532 1.00 135.85 ? 324 PHE B CA  1 
ATOM   6024  C C   . PHE B 1 324 ? 146.149 118.861 180.538 1.00 135.85 ? 324 PHE B C   1 
ATOM   6025  O O   . PHE B 1 324 ? 145.176 118.989 181.288 1.00 135.85 ? 324 PHE B O   1 
ATOM   6026  C CB  . PHE B 1 324 ? 145.800 119.666 178.197 1.00 135.85 ? 324 PHE B CB  1 
ATOM   6027  C CG  . PHE B 1 324 ? 144.303 119.640 178.272 1.00 135.85 ? 324 PHE B CG  1 
ATOM   6028  C CD1 . PHE B 1 324 ? 143.584 120.820 178.362 1.00 135.85 ? 324 PHE B CD1 1 
ATOM   6029  C CD2 . PHE B 1 324 ? 143.616 118.438 178.246 1.00 135.85 ? 324 PHE B CD2 1 
ATOM   6030  C CE1 . PHE B 1 324 ? 142.212 120.803 178.428 1.00 135.85 ? 324 PHE B CE1 1 
ATOM   6031  C CE2 . PHE B 1 324 ? 142.241 118.413 178.316 1.00 135.85 ? 324 PHE B CE2 1 
ATOM   6032  C CZ  . PHE B 1 324 ? 141.539 119.597 178.406 1.00 135.85 ? 324 PHE B CZ  1 
ATOM   6033  N N   . LEU B 1 325 ? 146.946 117.793 180.565 1.00 137.31 ? 325 LEU B N   1 
ATOM   6034  C CA  . LEU B 1 325 ? 146.770 116.709 181.519 1.00 137.31 ? 325 LEU B CA  1 
ATOM   6035  C C   . LEU B 1 325 ? 146.980 117.173 182.951 1.00 137.31 ? 325 LEU B C   1 
ATOM   6036  O O   . LEU B 1 325 ? 146.265 116.720 183.849 1.00 137.31 ? 325 LEU B O   1 
ATOM   6037  C CB  . LEU B 1 325 ? 147.735 115.571 181.162 1.00 137.31 ? 325 LEU B CB  1 
ATOM   6038  C CG  . LEU B 1 325 ? 147.701 114.159 181.752 1.00 137.31 ? 325 LEU B CG  1 
ATOM   6039  C CD1 . LEU B 1 325 ? 148.178 113.155 180.715 1.00 137.31 ? 325 LEU B CD1 1 
ATOM   6040  C CD2 . LEU B 1 325 ? 148.581 114.058 182.972 1.00 137.31 ? 325 LEU B CD2 1 
ATOM   6041  N N   . LEU B 1 326 ? 147.906 118.100 183.175 1.00 140.29 ? 326 LEU B N   1 
ATOM   6042  C CA  . LEU B 1 326 ? 148.192 118.625 184.500 1.00 140.29 ? 326 LEU B CA  1 
ATOM   6043  C C   . LEU B 1 326 ? 147.274 119.770 184.892 1.00 140.29 ? 326 LEU B C   1 
ATOM   6044  O O   . LEU B 1 326 ? 147.542 120.456 185.883 1.00 140.29 ? 326 LEU B O   1 
ATOM   6045  C CB  . LEU B 1 326 ? 149.647 119.083 184.587 1.00 140.29 ? 326 LEU B CB  1 
ATOM   6046  C CG  . LEU B 1 326 ? 150.716 118.096 185.061 1.00 140.29 ? 326 LEU B CG  1 
ATOM   6047  C CD1 . LEU B 1 326 ? 150.430 117.717 186.499 1.00 140.29 ? 326 LEU B CD1 1 
ATOM   6048  C CD2 . LEU B 1 326 ? 150.837 116.854 184.178 1.00 140.29 ? 326 LEU B CD2 1 
ATOM   6049  N N   . GLN B 1 327 ? 146.210 120.004 184.137 1.00 141.61 ? 327 GLN B N   1 
ATOM   6050  C CA  . GLN B 1 327 ? 145.237 120.996 184.546 1.00 141.61 ? 327 GLN B CA  1 
ATOM   6051  C C   . GLN B 1 327 ? 144.172 120.426 185.457 1.00 141.61 ? 327 GLN B C   1 
ATOM   6052  O O   . GLN B 1 327 ? 143.643 121.164 186.292 1.00 141.61 ? 327 GLN B O   1 
ATOM   6053  C CB  . GLN B 1 327 ? 144.552 121.617 183.330 1.00 141.61 ? 327 GLN B CB  1 
ATOM   6054  C CG  . GLN B 1 327 ? 145.438 122.499 182.502 1.00 141.61 ? 327 GLN B CG  1 
ATOM   6055  C CD  . GLN B 1 327 ? 144.706 123.079 181.312 1.00 141.61 ? 327 GLN B CD  1 
ATOM   6056  O OE1 . GLN B 1 327 ? 143.554 122.737 181.045 1.00 141.61 ? 327 GLN B OE1 1 
ATOM   6057  N NE2 . GLN B 1 327 ? 145.369 123.972 180.596 1.00 141.61 ? 327 GLN B NE2 1 
ATOM   6058  N N   . ASN B 1 328 ? 143.865 119.133 185.326 1.00 150.10 ? 328 ASN B N   1 
ATOM   6059  C CA  . ASN B 1 328 ? 142.789 118.517 186.092 1.00 150.10 ? 328 ASN B CA  1 
ATOM   6060  C C   . ASN B 1 328 ? 143.103 118.480 187.580 1.00 150.10 ? 328 ASN B C   1 
ATOM   6061  O O   . ASN B 1 328 ? 142.185 118.504 188.403 1.00 150.10 ? 328 ASN B O   1 
ATOM   6062  C CB  . ASN B 1 328 ? 142.532 117.101 185.569 1.00 150.10 ? 328 ASN B CB  1 
ATOM   6063  C CG  . ASN B 1 328 ? 141.177 116.548 185.983 1.00 150.10 ? 328 ASN B CG  1 
ATOM   6064  O OD1 . ASN B 1 328 ? 140.384 117.221 186.635 1.00 150.10 ? 328 ASN B OD1 1 
ATOM   6065  N ND2 . ASN B 1 328 ? 140.906 115.309 185.595 1.00 150.10 ? 328 ASN B ND2 1 
ATOM   6066  N N   . GLU B 1 329 ? 144.375 118.480 187.940 1.00 150.95 ? 329 GLU B N   1 
ATOM   6067  C CA  . GLU B 1 329 ? 144.764 118.386 189.334 1.00 150.95 ? 329 GLU B CA  1 
ATOM   6068  C C   . GLU B 1 329 ? 144.705 119.721 190.058 1.00 150.95 ? 329 GLU B C   1 
ATOM   6069  O O   . GLU B 1 329 ? 144.373 119.751 191.249 1.00 150.95 ? 329 GLU B O   1 
ATOM   6070  C CB  . GLU B 1 329 ? 146.169 117.786 189.425 1.00 150.95 ? 329 GLU B CB  1 
ATOM   6071  C CG  . GLU B 1 329 ? 146.219 116.303 189.081 1.00 150.95 ? 329 GLU B CG  1 
ATOM   6072  C CD  . GLU B 1 329 ? 146.241 116.023 187.589 1.00 150.95 ? 329 GLU B CD  1 
ATOM   6073  O OE1 . GLU B 1 329 ? 146.298 116.986 186.796 1.00 150.95 ? 329 GLU B OE1 1 
ATOM   6074  O OE2 . GLU B 1 329 ? 146.179 114.839 187.207 1.00 150.95 ? 329 GLU B OE2 1 
ATOM   6075  N N   . PHE B 1 330 ? 144.980 120.825 189.372 1.00 148.23 ? 330 PHE B N   1 
ATOM   6076  C CA  . PHE B 1 330 ? 144.951 122.127 190.017 1.00 148.23 ? 330 PHE B CA  1 
ATOM   6077  C C   . PHE B 1 330 ? 143.534 122.654 190.199 1.00 148.23 ? 330 PHE B C   1 
ATOM   6078  O O   . PHE B 1 330 ? 143.332 123.604 190.961 1.00 148.23 ? 330 PHE B O   1 
ATOM   6079  C CB  . PHE B 1 330 ? 145.797 123.119 189.207 1.00 148.23 ? 330 PHE B CB  1 
ATOM   6080  C CG  . PHE B 1 330 ? 145.968 124.459 189.863 1.00 148.23 ? 330 PHE B CG  1 
ATOM   6081  C CD1 . PHE B 1 330 ? 146.797 124.607 190.962 1.00 148.23 ? 330 PHE B CD1 1 
ATOM   6082  C CD2 . PHE B 1 330 ? 145.284 125.567 189.390 1.00 148.23 ? 330 PHE B CD2 1 
ATOM   6083  C CE1 . PHE B 1 330 ? 146.948 125.838 191.574 1.00 148.23 ? 330 PHE B CE1 1 
ATOM   6084  C CE2 . PHE B 1 330 ? 145.431 126.798 189.998 1.00 148.23 ? 330 PHE B CE2 1 
ATOM   6085  C CZ  . PHE B 1 330 ? 146.265 126.932 191.091 1.00 148.23 ? 330 PHE B CZ  1 
ATOM   6086  N N   . VAL B 1 331 ? 142.544 122.038 189.554 1.00 154.56 ? 331 VAL B N   1 
ATOM   6087  C CA  . VAL B 1 331 ? 141.176 122.548 189.626 1.00 154.56 ? 331 VAL B CA  1 
ATOM   6088  C C   . VAL B 1 331 ? 140.583 122.327 191.012 1.00 154.56 ? 331 VAL B C   1 
ATOM   6089  O O   . VAL B 1 331 ? 140.266 123.288 191.722 1.00 154.56 ? 331 VAL B O   1 
ATOM   6090  C CB  . VAL B 1 331 ? 140.305 121.917 188.524 1.00 154.56 ? 331 VAL B CB  1 
ATOM   6091  C CG1 . VAL B 1 331 ? 138.842 122.268 188.727 1.00 154.56 ? 331 VAL B CG1 1 
ATOM   6092  C CG2 . VAL B 1 331 ? 140.753 122.416 187.169 1.00 154.56 ? 331 VAL B CG2 1 
ATOM   6093  N N   . GLY B 1 332 ? 140.448 121.071 191.430 1.00 152.90 ? 332 GLY B N   1 
ATOM   6094  C CA  . GLY B 1 332 ? 139.918 120.798 192.751 1.00 152.90 ? 332 GLY B CA  1 
ATOM   6095  C C   . GLY B 1 332 ? 140.954 121.128 193.797 1.00 152.90 ? 332 GLY B C   1 
ATOM   6096  O O   . GLY B 1 332 ? 140.752 122.015 194.633 1.00 152.90 ? 332 GLY B O   1 
ATOM   6097  N N   . PHE B 1 333 ? 142.032 120.345 193.792 1.00 154.75 ? 333 PHE B N   1 
ATOM   6098  C CA  . PHE B 1 333 ? 143.358 120.666 194.315 1.00 154.75 ? 333 PHE B CA  1 
ATOM   6099  C C   . PHE B 1 333 ? 143.469 120.724 195.838 1.00 154.75 ? 333 PHE B C   1 
ATOM   6100  O O   . PHE B 1 333 ? 144.540 120.446 196.389 1.00 154.75 ? 333 PHE B O   1 
ATOM   6101  C CB  . PHE B 1 333 ? 143.786 122.006 193.699 1.00 154.75 ? 333 PHE B CB  1 
ATOM   6102  C CG  . PHE B 1 333 ? 145.037 122.591 194.272 1.00 154.75 ? 333 PHE B CG  1 
ATOM   6103  C CD1 . PHE B 1 333 ? 146.275 122.094 193.914 1.00 154.75 ? 333 PHE B CD1 1 
ATOM   6104  C CD2 . PHE B 1 333 ? 144.971 123.662 195.157 1.00 154.75 ? 333 PHE B CD2 1 
ATOM   6105  C CE1 . PHE B 1 333 ? 147.427 122.640 194.440 1.00 154.75 ? 333 PHE B CE1 1 
ATOM   6106  C CE2 . PHE B 1 333 ? 146.115 124.207 195.687 1.00 154.75 ? 333 PHE B CE2 1 
ATOM   6107  C CZ  . PHE B 1 333 ? 147.345 123.694 195.325 1.00 154.75 ? 333 PHE B CZ  1 
ATOM   6108  N N   . MET B 1 334 ? 142.366 121.001 196.539 1.00 153.99 ? 334 MET B N   1 
ATOM   6109  C CA  . MET B 1 334 ? 142.252 120.677 197.956 1.00 153.99 ? 334 MET B CA  1 
ATOM   6110  C C   . MET B 1 334 ? 140.788 120.404 198.294 1.00 153.99 ? 334 MET B C   1 
ATOM   6111  O O   . MET B 1 334 ? 140.366 120.635 199.435 1.00 153.99 ? 334 MET B O   1 
ATOM   6112  C CB  . MET B 1 334 ? 142.863 121.797 198.835 1.00 153.99 ? 334 MET B CB  1 
ATOM   6113  C CG  . MET B 1 334 ? 143.332 121.354 200.240 1.00 153.99 ? 334 MET B CG  1 
ATOM   6114  S SD  . MET B 1 334 ? 144.116 122.632 201.241 1.00 153.99 ? 334 MET B SD  1 
ATOM   6115  C CE  . MET B 1 334 ? 145.693 122.805 200.406 1.00 153.99 ? 334 MET B CE  1 
ATOM   6116  N N   . TRP B 1 335 ? 140.001 119.957 197.298 1.00 154.73 ? 335 TRP B N   1 
ATOM   6117  C CA  . TRP B 1 335 ? 138.547 119.801 197.392 1.00 154.73 ? 335 TRP B CA  1 
ATOM   6118  C C   . TRP B 1 335 ? 137.942 121.157 197.736 1.00 154.73 ? 335 TRP B C   1 
ATOM   6119  O O   . TRP B 1 335 ? 137.603 121.401 198.898 1.00 154.73 ? 335 TRP B O   1 
ATOM   6120  C CB  . TRP B 1 335 ? 138.131 118.718 198.393 1.00 154.73 ? 335 TRP B CB  1 
ATOM   6121  C CG  . TRP B 1 335 ? 138.612 117.348 198.043 1.00 154.73 ? 335 TRP B CG  1 
ATOM   6122  C CD1 . TRP B 1 335 ? 139.213 116.954 196.882 1.00 154.73 ? 335 TRP B CD1 1 
ATOM   6123  C CD2 . TRP B 1 335 ? 138.547 116.186 198.875 1.00 154.73 ? 335 TRP B CD2 1 
ATOM   6124  N NE1 . TRP B 1 335 ? 139.522 115.617 196.939 1.00 154.73 ? 335 TRP B NE1 1 
ATOM   6125  C CE2 . TRP B 1 335 ? 139.122 115.122 198.152 1.00 154.73 ? 335 TRP B CE2 1 
ATOM   6126  C CE3 . TRP B 1 335 ? 138.054 115.941 200.160 1.00 154.73 ? 335 TRP B CE3 1 
ATOM   6127  C CZ2 . TRP B 1 335 ? 139.216 113.834 198.672 1.00 154.73 ? 335 TRP B CZ2 1 
ATOM   6128  C CZ3 . TRP B 1 335 ? 138.149 114.663 200.674 1.00 154.73 ? 335 TRP B CZ3 1 
ATOM   6129  C CH2 . TRP B 1 335 ? 138.725 113.625 199.932 1.00 154.73 ? 335 TRP B CH2 1 
ATOM   6130  N N   . ARG B 1 336 ? 137.769 122.014 196.724 1.00 144.33 ? 336 ARG B N   1 
ATOM   6131  C CA  . ARG B 1 336 ? 138.168 123.417 196.654 1.00 144.33 ? 336 ARG B CA  1 
ATOM   6132  C C   . ARG B 1 336 ? 138.346 124.154 197.967 1.00 144.33 ? 336 ARG B C   1 
ATOM   6133  O O   . ARG B 1 336 ? 137.431 124.240 198.791 1.00 144.33 ? 336 ARG B O   1 
ATOM   6134  C CB  . ARG B 1 336 ? 137.110 124.192 195.871 1.00 144.33 ? 336 ARG B CB  1 
ATOM   6135  C CG  . ARG B 1 336 ? 136.959 123.842 194.408 1.00 144.33 ? 336 ARG B CG  1 
ATOM   6136  C CD  . ARG B 1 336 ? 135.693 124.504 193.868 1.00 144.33 ? 336 ARG B CD  1 
ATOM   6137  N NE  . ARG B 1 336 ? 135.450 124.229 192.460 1.00 144.33 ? 336 ARG B NE  1 
ATOM   6138  C CZ  . ARG B 1 336 ? 134.340 124.576 191.818 1.00 144.33 ? 336 ARG B CZ  1 
ATOM   6139  N NH1 . ARG B 1 336 ? 133.363 125.191 192.465 1.00 144.33 ? 336 ARG B NH1 1 
ATOM   6140  N NH2 . ARG B 1 336 ? 134.200 124.295 190.530 1.00 144.33 ? 336 ARG B NH2 1 
ATOM   6141  N N   . GLN B 1 337 ? 139.540 124.724 198.122 1.00 156.74 ? 337 GLN B N   1 
ATOM   6142  C CA  . GLN B 1 337 ? 139.890 125.638 199.199 1.00 156.74 ? 337 GLN B CA  1 
ATOM   6143  C C   . GLN B 1 337 ? 139.606 127.077 198.792 1.00 156.74 ? 337 GLN B C   1 
ATOM   6144  O O   . GLN B 1 337 ? 138.807 127.770 199.429 1.00 156.74 ? 337 GLN B O   1 
ATOM   6145  C CB  . GLN B 1 337 ? 141.377 125.479 199.546 1.00 156.74 ? 337 GLN B CB  1 
ATOM   6146  C CG  . GLN B 1 337 ? 141.848 126.335 200.707 1.00 156.74 ? 337 GLN B CG  1 
ATOM   6147  C CD  . GLN B 1 337 ? 143.348 126.264 200.913 1.00 156.74 ? 337 GLN B CD  1 
ATOM   6148  O OE1 . GLN B 1 337 ? 144.067 125.672 200.110 1.00 156.74 ? 337 GLN B OE1 1 
ATOM   6149  N NE2 . GLN B 1 337 ? 143.826 126.863 201.996 1.00 156.74 ? 337 GLN B NE2 1 
ATOM   6150  N N   . ARG B 1 338 ? 140.255 127.533 197.723 1.00 158.63 ? 338 ARG B N   1 
ATOM   6151  C CA  . ARG B 1 338 ? 140.009 128.851 197.164 1.00 158.63 ? 338 ARG B CA  1 
ATOM   6152  C C   . ARG B 1 338 ? 138.900 128.811 196.120 1.00 158.63 ? 338 ARG B C   1 
ATOM   6153  O O   . ARG B 1 338 ? 138.011 129.668 196.130 1.00 158.63 ? 338 ARG B O   1 
ATOM   6154  C CB  . ARG B 1 338 ? 141.301 129.409 196.567 1.00 158.63 ? 338 ARG B CB  1 
ATOM   6155  C CG  . ARG B 1 338 ? 142.401 129.604 197.596 1.00 158.63 ? 338 ARG B CG  1 
ATOM   6156  C CD  . ARG B 1 338 ? 143.678 130.166 196.987 1.00 158.63 ? 338 ARG B CD  1 
ATOM   6157  N NE  . ARG B 1 338 ? 143.540 131.566 196.608 1.00 158.63 ? 338 ARG B NE  1 
ATOM   6158  C CZ  . ARG B 1 338 ? 144.442 132.251 195.912 1.00 158.63 ? 338 ARG B CZ  1 
ATOM   6159  N NH1 . ARG B 1 338 ? 144.230 133.527 195.617 1.00 158.63 ? 338 ARG B NH1 1 
ATOM   6160  N NH2 . ARG B 1 338 ? 145.555 131.665 195.504 1.00 158.63 ? 338 ARG B NH2 1 
ATOM   6161  N N   . GLY B 1 339 ? 138.937 127.832 195.217 1.00 158.18 ? 339 GLY B N   1 
ATOM   6162  C CA  . GLY B 1 339 ? 137.799 127.522 194.371 1.00 158.18 ? 339 GLY B CA  1 
ATOM   6163  C C   . GLY B 1 339 ? 137.518 128.511 193.261 1.00 158.18 ? 339 GLY B C   1 
ATOM   6164  O O   . GLY B 1 339 ? 137.661 128.192 192.076 1.00 158.18 ? 339 GLY B O   1 
ATOM   6165  N N   . ARG B 1 340 ? 137.110 129.720 193.644 1.00 173.25 ? 340 ARG B N   1 
ATOM   6166  C CA  . ARG B 1 340 ? 136.732 130.768 192.707 1.00 173.25 ? 340 ARG B CA  1 
ATOM   6167  C C   . ARG B 1 340 ? 137.933 131.549 192.189 1.00 173.25 ? 340 ARG B C   1 
ATOM   6168  O O   . ARG B 1 340 ? 137.761 132.449 191.363 1.00 173.25 ? 340 ARG B O   1 
ATOM   6169  C CB  . ARG B 1 340 ? 135.737 131.740 193.356 1.00 173.25 ? 340 ARG B CB  1 
ATOM   6170  C CG  . ARG B 1 340 ? 134.260 131.327 193.325 1.00 173.25 ? 340 ARG B CG  1 
ATOM   6171  C CD  . ARG B 1 340 ? 133.899 130.268 194.372 1.00 173.25 ? 340 ARG B CD  1 
ATOM   6172  N NE  . ARG B 1 340 ? 132.455 130.054 194.445 1.00 173.25 ? 340 ARG B NE  1 
ATOM   6173  C CZ  . ARG B 1 340 ? 131.861 129.162 195.231 1.00 173.25 ? 340 ARG B CZ  1 
ATOM   6174  N NH1 . ARG B 1 340 ? 132.580 128.387 196.030 1.00 173.25 ? 340 ARG B NH1 1 
ATOM   6175  N NH2 . ARG B 1 340 ? 130.540 129.049 195.222 1.00 173.25 ? 340 ARG B NH2 1 
ATOM   6176  N N   . VAL B 1 341 ? 139.139 131.231 192.660 1.00 170.04 ? 341 VAL B N   1 
ATOM   6177  C CA  . VAL B 1 341 ? 140.320 131.976 192.239 1.00 170.04 ? 341 VAL B CA  1 
ATOM   6178  C C   . VAL B 1 341 ? 140.736 131.565 190.830 1.00 170.04 ? 341 VAL B C   1 
ATOM   6179  O O   . VAL B 1 341 ? 141.164 132.404 190.024 1.00 170.04 ? 341 VAL B O   1 
ATOM   6180  C CB  . VAL B 1 341 ? 141.438 131.792 193.282 1.00 170.04 ? 341 VAL B CB  1 
ATOM   6181  C CG1 . VAL B 1 341 ? 142.752 132.379 192.808 1.00 170.04 ? 341 VAL B CG1 1 
ATOM   6182  C CG2 . VAL B 1 341 ? 141.019 132.469 194.571 1.00 170.04 ? 341 VAL B CG2 1 
ATOM   6183  N N   . ILE B 1 342 ? 140.576 130.283 190.495 1.00 167.81 ? 342 ILE B N   1 
ATOM   6184  C CA  . ILE B 1 342 ? 140.717 129.846 189.111 1.00 167.81 ? 342 ILE B CA  1 
ATOM   6185  C C   . ILE B 1 342 ? 139.613 130.483 188.283 1.00 167.81 ? 342 ILE B C   1 
ATOM   6186  O O   . ILE B 1 342 ? 138.423 130.316 188.574 1.00 167.81 ? 342 ILE B O   1 
ATOM   6187  C CB  . ILE B 1 342 ? 140.667 128.324 189.018 1.00 167.81 ? 342 ILE B CB  1 
ATOM   6188  C CG1 . ILE B 1 342 ? 141.858 127.712 189.742 1.00 167.81 ? 342 ILE B CG1 1 
ATOM   6189  C CG2 . ILE B 1 342 ? 140.647 127.887 187.576 1.00 167.81 ? 342 ILE B CG2 1 
ATOM   6190  C CD1 . ILE B 1 342 ? 141.719 126.240 189.926 1.00 167.81 ? 342 ILE B CD1 1 
ATOM   6191  N N   . SER B 1 343 ? 140.004 131.234 187.255 1.00 171.35 ? 343 SER B N   1 
ATOM   6192  C CA  . SER B 1 343 ? 139.049 132.114 186.596 1.00 171.35 ? 343 SER B CA  1 
ATOM   6193  C C   . SER B 1 343 ? 139.204 132.150 185.081 1.00 171.35 ? 343 SER B C   1 
ATOM   6194  O O   . SER B 1 343 ? 138.852 133.164 184.464 1.00 171.35 ? 343 SER B O   1 
ATOM   6195  C CB  . SER B 1 343 ? 139.187 133.531 187.160 1.00 171.35 ? 343 SER B CB  1 
ATOM   6196  O OG  . SER B 1 343 ? 140.477 134.057 186.899 1.00 171.35 ? 343 SER B OG  1 
ATOM   6197  N N   . LEU B 1 344 ? 139.782 131.102 184.479 1.00 164.82 ? 344 LEU B N   1 
ATOM   6198  C CA  . LEU B 1 344 ? 139.970 130.922 183.029 1.00 164.82 ? 344 LEU B CA  1 
ATOM   6199  C C   . LEU B 1 344 ? 140.918 131.952 182.404 1.00 164.82 ? 344 LEU B C   1 
ATOM   6200  O O   . LEU B 1 344 ? 141.132 131.945 181.190 1.00 164.82 ? 344 LEU B O   1 
ATOM   6201  C CB  . LEU B 1 344 ? 138.633 130.904 182.265 1.00 164.82 ? 344 LEU B CB  1 
ATOM   6202  C CG  . LEU B 1 344 ? 137.768 129.636 182.288 1.00 164.82 ? 344 LEU B CG  1 
ATOM   6203  C CD1 . LEU B 1 344 ? 137.012 129.454 183.604 1.00 164.82 ? 344 LEU B CD1 1 
ATOM   6204  C CD2 . LEU B 1 344 ? 136.801 129.633 181.118 1.00 164.82 ? 344 LEU B CD2 1 
ATOM   6205  N N   . TRP B 1 345 ? 141.492 132.841 183.204 1.00 166.03 ? 345 TRP B N   1 
ATOM   6206  C CA  . TRP B 1 345 ? 142.656 133.613 182.817 1.00 166.03 ? 345 TRP B CA  1 
ATOM   6207  C C   . TRP B 1 345 ? 143.870 133.252 183.643 1.00 166.03 ? 345 TRP B C   1 
ATOM   6208  O O   . TRP B 1 345 ? 144.992 133.359 183.139 1.00 166.03 ? 345 TRP B O   1 
ATOM   6209  C CB  . TRP B 1 345 ? 142.384 135.117 182.951 1.00 166.03 ? 345 TRP B CB  1 
ATOM   6210  C CG  . TRP B 1 345 ? 143.519 135.959 182.477 1.00 166.03 ? 345 TRP B CG  1 
ATOM   6211  C CD1 . TRP B 1 345 ? 144.475 136.555 183.247 1.00 166.03 ? 345 TRP B CD1 1 
ATOM   6212  C CD2 . TRP B 1 345 ? 143.828 136.294 181.121 1.00 166.03 ? 345 TRP B CD2 1 
ATOM   6213  N NE1 . TRP B 1 345 ? 145.361 137.241 182.453 1.00 166.03 ? 345 TRP B NE1 1 
ATOM   6214  C CE2 . TRP B 1 345 ? 144.986 137.098 181.143 1.00 166.03 ? 345 TRP B CE2 1 
ATOM   6215  C CE3 . TRP B 1 345 ? 143.238 135.994 179.889 1.00 166.03 ? 345 TRP B CE3 1 
ATOM   6216  C CZ2 . TRP B 1 345 ? 145.565 137.605 179.982 1.00 166.03 ? 345 TRP B CZ2 1 
ATOM   6217  C CZ3 . TRP B 1 345 ? 143.814 136.498 178.738 1.00 166.03 ? 345 TRP B CZ3 1 
ATOM   6218  C CH2 . TRP B 1 345 ? 144.966 137.293 178.792 1.00 166.03 ? 345 TRP B CH2 1 
ATOM   6219  N N   . GLU B 1 346 ? 143.688 132.802 184.881 1.00 163.31 ? 346 GLU B N   1 
ATOM   6220  C CA  . GLU B 1 346 ? 144.755 132.113 185.586 1.00 163.31 ? 346 GLU B CA  1 
ATOM   6221  C C   . GLU B 1 346 ? 144.956 130.692 185.085 1.00 163.31 ? 346 GLU B C   1 
ATOM   6222  O O   . GLU B 1 346 ? 145.945 130.055 185.460 1.00 163.31 ? 346 GLU B O   1 
ATOM   6223  C CB  . GLU B 1 346 ? 144.489 132.093 187.093 1.00 163.31 ? 346 GLU B CB  1 
ATOM   6224  C CG  . GLU B 1 346 ? 144.668 133.440 187.781 1.00 163.31 ? 346 GLU B CG  1 
ATOM   6225  C CD  . GLU B 1 346 ? 144.465 133.356 189.283 1.00 163.31 ? 346 GLU B CD  1 
ATOM   6226  O OE1 . GLU B 1 346 ? 144.047 132.284 189.761 1.00 163.31 ? 346 GLU B OE1 1 
ATOM   6227  O OE2 . GLU B 1 346 ? 144.737 134.352 189.987 1.00 163.31 ? 346 GLU B OE2 1 
ATOM   6228  N N   . ARG B 1 347 ? 144.048 130.177 184.258 1.00 152.01 ? 347 ARG B N   1 
ATOM   6229  C CA  . ARG B 1 347 ? 144.320 128.946 183.533 1.00 152.01 ? 347 ARG B CA  1 
ATOM   6230  C C   . ARG B 1 347 ? 145.217 129.167 182.324 1.00 152.01 ? 347 ARG B C   1 
ATOM   6231  O O   . ARG B 1 347 ? 145.799 128.201 181.819 1.00 152.01 ? 347 ARG B O   1 
ATOM   6232  C CB  . ARG B 1 347 ? 143.014 128.297 183.076 1.00 152.01 ? 347 ARG B CB  1 
ATOM   6233  C CG  . ARG B 1 347 ? 142.194 127.694 184.189 1.00 152.01 ? 347 ARG B CG  1 
ATOM   6234  C CD  . ARG B 1 347 ? 141.005 126.945 183.620 1.00 152.01 ? 347 ARG B CD  1 
ATOM   6235  N NE  . ARG B 1 347 ? 140.232 126.265 184.652 1.00 152.01 ? 347 ARG B NE  1 
ATOM   6236  C CZ  . ARG B 1 347 ? 139.151 125.533 184.411 1.00 152.01 ? 347 ARG B CZ  1 
ATOM   6237  N NH1 . ARG B 1 347 ? 138.508 124.949 185.410 1.00 152.01 ? 347 ARG B NH1 1 
ATOM   6238  N NH2 . ARG B 1 347 ? 138.716 125.378 183.170 1.00 152.01 ? 347 ARG B NH2 1 
ATOM   6239  N N   . LEU B 1 348 ? 145.352 130.412 181.868 1.00 152.76 ? 348 LEU B N   1 
ATOM   6240  C CA  . LEU B 1 348 ? 145.987 130.692 180.590 1.00 152.76 ? 348 LEU B CA  1 
ATOM   6241  C C   . LEU B 1 348 ? 147.490 130.486 180.626 1.00 152.76 ? 348 LEU B C   1 
ATOM   6242  O O   . LEU B 1 348 ? 148.081 130.173 179.589 1.00 152.76 ? 348 LEU B O   1 
ATOM   6243  C CB  . LEU B 1 348 ? 145.649 132.122 180.152 1.00 152.76 ? 348 LEU B CB  1 
ATOM   6244  C CG  . LEU B 1 348 ? 145.895 132.653 178.732 1.00 152.76 ? 348 LEU B CG  1 
ATOM   6245  C CD1 . LEU B 1 348 ? 147.303 133.197 178.485 1.00 152.76 ? 348 LEU B CD1 1 
ATOM   6246  C CD2 . LEU B 1 348 ? 145.552 131.564 177.723 1.00 152.76 ? 348 LEU B CD2 1 
ATOM   6247  N N   . GLU B 1 349 ? 148.124 130.611 181.788 1.00 150.65 ? 349 GLU B N   1 
ATOM   6248  C CA  . GLU B 1 349 ? 149.575 130.528 181.854 1.00 150.65 ? 349 GLU B CA  1 
ATOM   6249  C C   . GLU B 1 349 ? 150.075 129.094 181.979 1.00 150.65 ? 349 GLU B C   1 
ATOM   6250  O O   . GLU B 1 349 ? 151.231 128.870 182.348 1.00 150.65 ? 349 GLU B O   1 
ATOM   6251  C CB  . GLU B 1 349 ? 150.092 131.410 182.994 1.00 150.65 ? 349 GLU B CB  1 
ATOM   6252  C CG  . GLU B 1 349 ? 149.694 130.991 184.392 1.00 150.65 ? 349 GLU B CG  1 
ATOM   6253  C CD  . GLU B 1 349 ? 150.801 130.249 185.102 1.00 150.65 ? 349 GLU B CD  1 
ATOM   6254  O OE1 . GLU B 1 349 ? 151.967 130.422 184.699 1.00 150.65 ? 349 GLU B OE1 1 
ATOM   6255  O OE2 . GLU B 1 349 ? 150.510 129.505 186.061 1.00 150.65 ? 349 GLU B OE2 1 
ATOM   6256  N N   . PHE B 1 350 ? 149.244 128.113 181.641 1.00 141.48 ? 350 PHE B N   1 
ATOM   6257  C CA  . PHE B 1 350 ? 149.661 126.719 181.613 1.00 141.48 ? 350 PHE B CA  1 
ATOM   6258  C C   . PHE B 1 350 ? 150.242 126.338 180.261 1.00 141.48 ? 350 PHE B C   1 
ATOM   6259  O O   . PHE B 1 350 ? 151.393 125.905 180.172 1.00 141.48 ? 350 PHE B O   1 
ATOM   6260  C CB  . PHE B 1 350 ? 148.469 125.827 181.948 1.00 141.48 ? 350 PHE B CB  1 
ATOM   6261  C CG  . PHE B 1 350 ? 148.040 125.919 183.368 1.00 141.48 ? 350 PHE B CG  1 
ATOM   6262  C CD1 . PHE B 1 350 ? 148.935 126.313 184.343 1.00 141.48 ? 350 PHE B CD1 1 
ATOM   6263  C CD2 . PHE B 1 350 ? 146.730 125.664 183.724 1.00 141.48 ? 350 PHE B CD2 1 
ATOM   6264  C CE1 . PHE B 1 350 ? 148.545 126.414 185.650 1.00 141.48 ? 350 PHE B CE1 1 
ATOM   6265  C CE2 . PHE B 1 350 ? 146.329 125.767 185.032 1.00 141.48 ? 350 PHE B CE2 1 
ATOM   6266  C CZ  . PHE B 1 350 ? 147.239 126.144 185.997 1.00 141.48 ? 350 PHE B CZ  1 
ATOM   6267  N N   . VAL B 1 351 ? 149.458 126.496 179.201 1.00 135.36 ? 351 VAL B N   1 
ATOM   6268  C CA  . VAL B 1 351 ? 149.896 126.137 177.858 1.00 135.36 ? 351 VAL B CA  1 
ATOM   6269  C C   . VAL B 1 351 ? 150.856 127.215 177.375 1.00 135.36 ? 351 VAL B C   1 
ATOM   6270  O O   . VAL B 1 351 ? 150.498 128.393 177.310 1.00 135.36 ? 351 VAL B O   1 
ATOM   6271  C CB  . VAL B 1 351 ? 148.707 125.985 176.906 1.00 135.36 ? 351 VAL B CB  1 
ATOM   6272  C CG1 . VAL B 1 351 ? 149.195 125.707 175.493 1.00 135.36 ? 351 VAL B CG1 1 
ATOM   6273  C CG2 . VAL B 1 351 ? 147.783 124.879 177.392 1.00 135.36 ? 351 VAL B CG2 1 
ATOM   6274  N N   . ASN B 1 352 ? 152.073 126.815 177.034 1.00 120.80 ? 352 ASN B N   1 
ATOM   6275  C CA  . ASN B 1 352 ? 153.092 127.781 176.665 1.00 120.80 ? 352 ASN B CA  1 
ATOM   6276  C C   . ASN B 1 352 ? 152.855 128.289 175.255 1.00 120.80 ? 352 ASN B C   1 
ATOM   6277  O O   . ASN B 1 352 ? 152.648 127.508 174.324 1.00 120.80 ? 352 ASN B O   1 
ATOM   6278  C CB  . ASN B 1 352 ? 154.467 127.148 176.771 1.00 120.80 ? 352 ASN B CB  1 
ATOM   6279  C CG  . ASN B 1 352 ? 154.726 126.588 178.136 1.00 120.80 ? 352 ASN B CG  1 
ATOM   6280  O OD1 . ASN B 1 352 ? 154.896 125.385 178.301 1.00 120.80 ? 352 ASN B OD1 1 
ATOM   6281  N ND2 . ASN B 1 352 ? 154.730 127.454 179.135 1.00 120.80 ? 352 ASN B ND2 1 
ATOM   6282  N N   . GLY B 1 353 ? 152.897 129.612 175.100 1.00 113.30 ? 353 GLY B N   1 
ATOM   6283  C CA  . GLY B 1 353 ? 152.610 130.215 173.813 1.00 113.30 ? 353 GLY B CA  1 
ATOM   6284  C C   . GLY B 1 353 ? 153.681 129.978 172.773 1.00 113.30 ? 353 GLY B C   1 
ATOM   6285  O O   . GLY B 1 353 ? 153.416 130.114 171.575 1.00 113.30 ? 353 GLY B O   1 
ATOM   6286  N N   . TRP B 1 354 ? 154.889 129.621 173.200 1.00 105.58 ? 354 TRP B N   1 
ATOM   6287  C CA  . TRP B 1 354 ? 155.939 129.355 172.232 1.00 105.58 ? 354 TRP B CA  1 
ATOM   6288  C C   . TRP B 1 354 ? 155.726 128.021 171.543 1.00 105.58 ? 354 TRP B C   1 
ATOM   6289  O O   . TRP B 1 354 ? 156.106 127.858 170.381 1.00 105.58 ? 354 TRP B O   1 
ATOM   6290  C CB  . TRP B 1 354 ? 157.303 129.392 172.905 1.00 105.58 ? 354 TRP B CB  1 
ATOM   6291  C CG  . TRP B 1 354 ? 157.622 130.727 173.425 1.00 105.58 ? 354 TRP B CG  1 
ATOM   6292  C CD1 . TRP B 1 354 ? 157.563 131.131 174.716 1.00 105.58 ? 354 TRP B CD1 1 
ATOM   6293  C CD2 . TRP B 1 354 ? 158.004 131.867 172.663 1.00 105.58 ? 354 TRP B CD2 1 
ATOM   6294  N NE1 . TRP B 1 354 ? 157.913 132.450 174.814 1.00 105.58 ? 354 TRP B NE1 1 
ATOM   6295  C CE2 . TRP B 1 354 ? 158.185 132.926 173.561 1.00 105.58 ? 354 TRP B CE2 1 
ATOM   6296  C CE3 . TRP B 1 354 ? 158.220 132.092 171.307 1.00 105.58 ? 354 TRP B CE3 1 
ATOM   6297  C CZ2 . TRP B 1 354 ? 158.574 134.189 173.150 1.00 105.58 ? 354 TRP B CZ2 1 
ATOM   6298  C CZ3 . TRP B 1 354 ? 158.603 133.344 170.902 1.00 105.58 ? 354 TRP B CZ3 1 
ATOM   6299  C CH2 . TRP B 1 354 ? 158.778 134.379 171.819 1.00 105.58 ? 354 TRP B CH2 1 
ATOM   6300  N N   . TYR B 1 355 ? 155.111 127.060 172.228 1.00 112.45 ? 355 TYR B N   1 
ATOM   6301  C CA  . TYR B 1 355 ? 154.962 125.739 171.631 1.00 112.45 ? 355 TYR B CA  1 
ATOM   6302  C C   . TYR B 1 355 ? 153.879 125.718 170.567 1.00 112.45 ? 355 TYR B C   1 
ATOM   6303  O O   . TYR B 1 355 ? 154.044 125.070 169.529 1.00 112.45 ? 355 TYR B O   1 
ATOM   6304  C CB  . TYR B 1 355 ? 154.688 124.697 172.706 1.00 112.45 ? 355 TYR B CB  1 
ATOM   6305  C CG  . TYR B 1 355 ? 155.932 124.320 173.458 1.00 112.45 ? 355 TYR B CG  1 
ATOM   6306  C CD1 . TYR B 1 355 ? 156.836 123.424 172.917 1.00 112.45 ? 355 TYR B CD1 1 
ATOM   6307  C CD2 . TYR B 1 355 ? 156.207 124.862 174.696 1.00 112.45 ? 355 TYR B CD2 1 
ATOM   6308  C CE1 . TYR B 1 355 ? 157.975 123.073 173.589 1.00 112.45 ? 355 TYR B CE1 1 
ATOM   6309  C CE2 . TYR B 1 355 ? 157.345 124.518 175.382 1.00 112.45 ? 355 TYR B CE2 1 
ATOM   6310  C CZ  . TYR B 1 355 ? 158.224 123.620 174.821 1.00 112.45 ? 355 TYR B CZ  1 
ATOM   6311  O OH  . TYR B 1 355 ? 159.367 123.263 175.491 1.00 112.45 ? 355 TYR B OH  1 
ATOM   6312  N N   . ILE B 1 356 ? 152.780 126.445 170.789 1.00 115.26 ? 356 ILE B N   1 
ATOM   6313  C CA  . ILE B 1 356 ? 151.695 126.474 169.813 1.00 115.26 ? 356 ILE B CA  1 
ATOM   6314  C C   . ILE B 1 356 ? 152.130 127.205 168.546 1.00 115.26 ? 356 ILE B C   1 
ATOM   6315  O O   . ILE B 1 356 ? 151.632 126.925 167.452 1.00 115.26 ? 356 ILE B O   1 
ATOM   6316  C CB  . ILE B 1 356 ? 150.423 127.081 170.448 1.00 115.26 ? 356 ILE B CB  1 
ATOM   6317  C CG1 . ILE B 1 356 ? 149.189 126.800 169.592 1.00 115.26 ? 356 ILE B CG1 1 
ATOM   6318  C CG2 . ILE B 1 356 ? 150.555 128.575 170.691 1.00 115.26 ? 356 ILE B CG2 1 
ATOM   6319  C CD1 . ILE B 1 356 ? 148.824 125.332 169.502 1.00 115.26 ? 356 ILE B CD1 1 
ATOM   6320  N N   . LEU B 1 357 ? 153.105 128.101 168.659 1.00 106.80 ? 357 LEU B N   1 
ATOM   6321  C CA  . LEU B 1 357 ? 153.705 128.701 167.479 1.00 106.80 ? 357 LEU B CA  1 
ATOM   6322  C C   . LEU B 1 357 ? 154.609 127.714 166.762 1.00 106.80 ? 357 LEU B C   1 
ATOM   6323  O O   . LEU B 1 357 ? 154.680 127.721 165.530 1.00 106.80 ? 357 LEU B O   1 
ATOM   6324  C CB  . LEU B 1 357 ? 154.468 129.961 167.888 1.00 106.80 ? 357 LEU B CB  1 
ATOM   6325  C CG  . LEU B 1 357 ? 155.110 130.882 166.861 1.00 106.80 ? 357 LEU B CG  1 
ATOM   6326  C CD1 . LEU B 1 357 ? 154.958 132.313 167.306 1.00 106.80 ? 357 LEU B CD1 1 
ATOM   6327  C CD2 . LEU B 1 357 ? 156.582 130.569 166.723 1.00 106.80 ? 357 LEU B CD2 1 
ATOM   6328  N N   . LEU B 1 358 ? 155.295 126.852 167.509 1.00 109.41 ? 358 LEU B N   1 
ATOM   6329  C CA  . LEU B 1 358 ? 156.114 125.828 166.879 1.00 109.41 ? 358 LEU B CA  1 
ATOM   6330  C C   . LEU B 1 358 ? 155.267 124.711 166.289 1.00 109.41 ? 358 LEU B C   1 
ATOM   6331  O O   . LEU B 1 358 ? 155.696 124.045 165.341 1.00 109.41 ? 358 LEU B O   1 
ATOM   6332  C CB  . LEU B 1 358 ? 157.106 125.269 167.888 1.00 109.41 ? 358 LEU B CB  1 
ATOM   6333  C CG  . LEU B 1 358 ? 158.142 126.302 168.308 1.00 109.41 ? 358 LEU B CG  1 
ATOM   6334  C CD1 . LEU B 1 358 ? 159.022 125.764 169.415 1.00 109.41 ? 358 LEU B CD1 1 
ATOM   6335  C CD2 . LEU B 1 358 ? 158.966 126.728 167.108 1.00 109.41 ? 358 LEU B CD2 1 
ATOM   6336  N N   . VAL B 1 359 ? 154.074 124.482 166.838 1.00 107.32 ? 359 VAL B N   1 
ATOM   6337  C CA  . VAL B 1 359 ? 153.144 123.551 166.213 1.00 107.32 ? 359 VAL B CA  1 
ATOM   6338  C C   . VAL B 1 359 ? 152.596 124.147 164.928 1.00 107.32 ? 359 VAL B C   1 
ATOM   6339  O O   . VAL B 1 359 ? 152.409 123.436 163.933 1.00 107.32 ? 359 VAL B O   1 
ATOM   6340  C CB  . VAL B 1 359 ? 152.030 123.188 167.209 1.00 107.32 ? 359 VAL B CB  1 
ATOM   6341  C CG1 . VAL B 1 359 ? 150.930 122.383 166.562 1.00 107.32 ? 359 VAL B CG1 1 
ATOM   6342  C CG2 . VAL B 1 359 ? 152.611 122.390 168.332 1.00 107.32 ? 359 VAL B CG2 1 
ATOM   6343  N N   . THR B 1 360 ? 152.404 125.466 164.911 1.00 109.40 ? 360 THR B N   1 
ATOM   6344  C CA  . THR B 1 360 ? 151.744 126.139 163.798 1.00 109.40 ? 360 THR B CA  1 
ATOM   6345  C C   . THR B 1 360 ? 152.581 126.072 162.533 1.00 109.40 ? 360 THR B C   1 
ATOM   6346  O O   . THR B 1 360 ? 152.066 125.765 161.455 1.00 109.40 ? 360 THR B O   1 
ATOM   6347  C CB  . THR B 1 360 ? 151.477 127.595 164.165 1.00 109.40 ? 360 THR B CB  1 
ATOM   6348  O OG1 . THR B 1 360 ? 150.766 127.656 165.404 1.00 109.40 ? 360 THR B OG1 1 
ATOM   6349  C CG2 . THR B 1 360 ? 150.639 128.262 163.093 1.00 109.40 ? 360 THR B CG2 1 
ATOM   6350  N N   . SER B 1 361 ? 153.878 126.348 162.654 1.00 110.91 ? 361 SER B N   1 
ATOM   6351  C CA  . SER B 1 361 ? 154.768 126.302 161.504 1.00 110.91 ? 361 SER B CA  1 
ATOM   6352  C C   . SER B 1 361 ? 154.884 124.898 160.937 1.00 110.91 ? 361 SER B C   1 
ATOM   6353  O O   . SER B 1 361 ? 154.833 124.722 159.717 1.00 110.91 ? 361 SER B O   1 
ATOM   6354  C CB  . SER B 1 361 ? 156.146 126.814 161.900 1.00 110.91 ? 361 SER B CB  1 
ATOM   6355  O OG  . SER B 1 361 ? 156.728 125.945 162.848 1.00 110.91 ? 361 SER B OG  1 
ATOM   6356  N N   . ASP B 1 362 ? 155.006 123.893 161.806 1.00 120.38 ? 362 ASP B N   1 
ATOM   6357  C CA  . ASP B 1 362 ? 155.140 122.508 161.378 1.00 120.38 ? 362 ASP B CA  1 
ATOM   6358  C C   . ASP B 1 362 ? 153.900 121.981 160.683 1.00 120.38 ? 362 ASP B C   1 
ATOM   6359  O O   . ASP B 1 362 ? 154.014 121.070 159.858 1.00 120.38 ? 362 ASP B O   1 
ATOM   6360  C CB  . ASP B 1 362 ? 155.461 121.617 162.573 1.00 120.38 ? 362 ASP B CB  1 
ATOM   6361  C CG  . ASP B 1 362 ? 156.865 121.811 163.070 1.00 120.38 ? 362 ASP B CG  1 
ATOM   6362  O OD1 . ASP B 1 362 ? 157.736 122.151 162.244 1.00 120.38 ? 362 ASP B OD1 1 
ATOM   6363  O OD2 . ASP B 1 362 ? 157.100 121.628 164.281 1.00 120.38 ? 362 ASP B OD2 1 
ATOM   6364  N N   . VAL B 1 363 ? 152.726 122.515 161.006 1.00 116.28 ? 363 VAL B N   1 
ATOM   6365  C CA  . VAL B 1 363 ? 151.564 122.254 160.175 1.00 116.28 ? 363 VAL B CA  1 
ATOM   6366  C C   . VAL B 1 363 ? 151.780 122.838 158.791 1.00 116.28 ? 363 VAL B C   1 
ATOM   6367  O O   . VAL B 1 363 ? 151.580 122.160 157.782 1.00 116.28 ? 363 VAL B O   1 
ATOM   6368  C CB  . VAL B 1 363 ? 150.293 122.811 160.838 1.00 116.28 ? 363 VAL B CB  1 
ATOM   6369  C CG1 . VAL B 1 363 ? 149.112 122.721 159.892 1.00 116.28 ? 363 VAL B CG1 1 
ATOM   6370  C CG2 . VAL B 1 363 ? 150.003 122.047 162.101 1.00 116.28 ? 363 VAL B CG2 1 
ATOM   6371  N N   . LEU B 1 364 ? 152.253 124.081 158.723 1.00 111.83 ? 364 LEU B N   1 
ATOM   6372  C CA  . LEU B 1 364 ? 152.421 124.746 157.438 1.00 111.83 ? 364 LEU B CA  1 
ATOM   6373  C C   . LEU B 1 364 ? 153.616 124.202 156.674 1.00 111.83 ? 364 LEU B C   1 
ATOM   6374  O O   . LEU B 1 364 ? 153.574 124.102 155.446 1.00 111.83 ? 364 LEU B O   1 
ATOM   6375  C CB  . LEU B 1 364 ? 152.566 126.255 157.634 1.00 111.83 ? 364 LEU B CB  1 
ATOM   6376  C CG  . LEU B 1 364 ? 151.305 127.120 157.632 1.00 111.83 ? 364 LEU B CG  1 
ATOM   6377  C CD1 . LEU B 1 364 ? 150.434 126.904 158.837 1.00 111.83 ? 364 LEU B CD1 1 
ATOM   6378  C CD2 . LEU B 1 364 ? 151.699 128.566 157.562 1.00 111.83 ? 364 LEU B CD2 1 
ATOM   6379  N N   . THR B 1 365 ? 154.685 123.840 157.383 1.00 115.96 ? 365 THR B N   1 
ATOM   6380  C CA  . THR B 1 365 ? 155.927 123.485 156.708 1.00 115.96 ? 365 THR B CA  1 
ATOM   6381  C C   . THR B 1 365 ? 155.806 122.147 156.000 1.00 115.96 ? 365 THR B C   1 
ATOM   6382  O O   . THR B 1 365 ? 156.165 122.023 154.824 1.00 115.96 ? 365 THR B O   1 
ATOM   6383  C CB  . THR B 1 365 ? 157.081 123.453 157.703 1.00 115.96 ? 365 THR B CB  1 
ATOM   6384  O OG1 . THR B 1 365 ? 157.188 124.727 158.345 1.00 115.96 ? 365 THR B OG1 1 
ATOM   6385  C CG2 . THR B 1 365 ? 158.380 123.157 156.992 1.00 115.96 ? 365 THR B CG2 1 
ATOM   6386  N N   . ILE B 1 366 ? 155.279 121.137 156.688 1.00 118.34 ? 366 ILE B N   1 
ATOM   6387  C CA  . ILE B 1 366 ? 155.139 119.850 156.028 1.00 118.34 ? 366 ILE B CA  1 
ATOM   6388  C C   . ILE B 1 366 ? 153.950 119.860 155.075 1.00 118.34 ? 366 ILE B C   1 
ATOM   6389  O O   . ILE B 1 366 ? 153.898 119.036 154.159 1.00 118.34 ? 366 ILE B O   1 
ATOM   6390  C CB  . ILE B 1 366 ? 155.065 118.711 157.060 1.00 118.34 ? 366 ILE B CB  1 
ATOM   6391  C CG1 . ILE B 1 366 ? 155.483 117.392 156.403 1.00 118.34 ? 366 ILE B CG1 1 
ATOM   6392  C CG2 . ILE B 1 366 ? 153.674 118.592 157.645 1.00 118.34 ? 366 ILE B CG2 1 
ATOM   6393  C CD1 . ILE B 1 366 ? 155.872 116.307 157.363 1.00 118.34 ? 366 ILE B CD1 1 
ATOM   6394  N N   . SER B 1 367 ? 153.015 120.801 155.228 1.00 119.28 ? 367 SER B N   1 
ATOM   6395  C CA  . SER B 1 367 ? 152.044 121.030 154.167 1.00 119.28 ? 367 SER B CA  1 
ATOM   6396  C C   . SER B 1 367 ? 152.661 121.796 153.013 1.00 119.28 ? 367 SER B C   1 
ATOM   6397  O O   . SER B 1 367 ? 152.235 121.636 151.865 1.00 119.28 ? 367 SER B O   1 
ATOM   6398  C CB  . SER B 1 367 ? 150.835 121.797 154.693 1.00 119.28 ? 367 SER B CB  1 
ATOM   6399  O OG  . SER B 1 367 ? 149.918 122.085 153.656 1.00 119.28 ? 367 SER B OG  1 
ATOM   6400  N N   . GLY B 1 368 ? 153.655 122.633 153.300 1.00 119.93 ? 368 GLY B N   1 
ATOM   6401  C CA  . GLY B 1 368 ? 154.279 123.401 152.241 1.00 119.93 ? 368 GLY B CA  1 
ATOM   6402  C C   . GLY B 1 368 ? 155.163 122.544 151.362 1.00 119.93 ? 368 GLY B C   1 
ATOM   6403  O O   . GLY B 1 368 ? 154.989 122.504 150.144 1.00 119.93 ? 368 GLY B O   1 
ATOM   6404  N N   . THR B 1 369 ? 156.104 121.824 151.972 1.00 121.81 ? 369 THR B N   1 
ATOM   6405  C CA  . THR B 1 369 ? 157.072 121.061 151.196 1.00 121.81 ? 369 THR B CA  1 
ATOM   6406  C C   . THR B 1 369 ? 156.454 119.863 150.496 1.00 121.81 ? 369 THR B C   1 
ATOM   6407  O O   . THR B 1 369 ? 157.016 119.392 149.506 1.00 121.81 ? 369 THR B O   1 
ATOM   6408  C CB  . THR B 1 369 ? 158.219 120.593 152.084 1.00 121.81 ? 369 THR B CB  1 
ATOM   6409  O OG1 . THR B 1 369 ? 157.690 119.816 153.161 1.00 121.81 ? 369 THR B OG1 1 
ATOM   6410  C CG2 . THR B 1 369 ? 158.985 121.774 152.641 1.00 121.81 ? 369 THR B CG2 1 
ATOM   6411  N N   . ILE B 1 370 ? 155.310 119.366 150.970 1.00 119.31 ? 370 ILE B N   1 
ATOM   6412  C CA  . ILE B 1 370 ? 154.630 118.310 150.233 1.00 119.31 ? 370 ILE B CA  1 
ATOM   6413  C C   . ILE B 1 370 ? 153.960 118.875 148.986 1.00 119.31 ? 370 ILE B C   1 
ATOM   6414  O O   . ILE B 1 370 ? 153.728 118.138 148.021 1.00 119.31 ? 370 ILE B O   1 
ATOM   6415  C CB  . ILE B 1 370 ? 153.638 117.575 151.152 1.00 119.31 ? 370 ILE B CB  1 
ATOM   6416  C CG1 . ILE B 1 370 ? 153.258 116.220 150.574 1.00 119.31 ? 370 ILE B CG1 1 
ATOM   6417  C CG2 . ILE B 1 370 ? 152.366 118.362 151.360 1.00 119.31 ? 370 ILE B CG2 1 
ATOM   6418  C CD1 . ILE B 1 370 ? 152.570 115.331 151.572 1.00 119.31 ? 370 ILE B CD1 1 
ATOM   6419  N N   . MET B 1 371 ? 153.686 120.179 148.965 1.00 125.76 ? 371 MET B N   1 
ATOM   6420  C CA  . MET B 1 371 ? 153.204 120.832 147.761 1.00 125.76 ? 371 MET B CA  1 
ATOM   6421  C C   . MET B 1 371 ? 154.363 121.185 146.849 1.00 125.76 ? 371 MET B C   1 
ATOM   6422  O O   . MET B 1 371 ? 154.199 121.248 145.628 1.00 125.76 ? 371 MET B O   1 
ATOM   6423  C CB  . MET B 1 371 ? 152.421 122.085 148.140 1.00 125.76 ? 371 MET B CB  1 
ATOM   6424  C CG  . MET B 1 371 ? 151.646 122.718 147.021 1.00 125.76 ? 371 MET B CG  1 
ATOM   6425  S SD  . MET B 1 371 ? 150.260 121.697 146.539 1.00 125.76 ? 371 MET B SD  1 
ATOM   6426  C CE  . MET B 1 371 ? 149.209 121.941 147.966 1.00 125.76 ? 371 MET B CE  1 
ATOM   6427  N N   . LYS B 1 372 ? 155.544 121.388 147.433 1.00 120.66 ? 372 LYS B N   1 
ATOM   6428  C CA  . LYS B 1 372 ? 156.747 121.700 146.678 1.00 120.66 ? 372 LYS B CA  1 
ATOM   6429  C C   . LYS B 1 372 ? 157.240 120.501 145.879 1.00 120.66 ? 372 LYS B C   1 
ATOM   6430  O O   . LYS B 1 372 ? 157.991 120.679 144.914 1.00 120.66 ? 372 LYS B O   1 
ATOM   6431  C CB  . LYS B 1 372 ? 157.813 122.220 147.651 1.00 120.66 ? 372 LYS B CB  1 
ATOM   6432  C CG  . LYS B 1 372 ? 159.098 122.787 147.055 1.00 120.66 ? 372 LYS B CG  1 
ATOM   6433  C CD  . LYS B 1 372 ? 160.222 121.763 147.106 1.00 120.66 ? 372 LYS B CD  1 
ATOM   6434  C CE  . LYS B 1 372 ? 161.514 122.299 146.539 1.00 120.66 ? 372 LYS B CE  1 
ATOM   6435  N NZ  . LYS B 1 372 ? 162.575 121.262 146.600 1.00 120.66 ? 372 LYS B NZ  1 
ATOM   6436  N N   . ILE B 1 373 ? 156.806 119.289 146.236 1.00 125.07 ? 373 ILE B N   1 
ATOM   6437  C CA  . ILE B 1 373 ? 157.107 118.098 145.451 1.00 125.07 ? 373 ILE B CA  1 
ATOM   6438  C C   . ILE B 1 373 ? 156.496 118.184 144.058 1.00 125.07 ? 373 ILE B C   1 
ATOM   6439  O O   . ILE B 1 373 ? 157.063 117.654 143.096 1.00 125.07 ? 373 ILE B O   1 
ATOM   6440  C CB  . ILE B 1 373 ? 156.629 116.864 146.237 1.00 125.07 ? 373 ILE B CB  1 
ATOM   6441  C CG1 . ILE B 1 373 ? 157.372 116.789 147.562 1.00 125.07 ? 373 ILE B CG1 1 
ATOM   6442  C CG2 . ILE B 1 373 ? 156.885 115.569 145.496 1.00 125.07 ? 373 ILE B CG2 1 
ATOM   6443  C CD1 . ILE B 1 373 ? 156.813 115.763 148.508 1.00 125.07 ? 373 ILE B CD1 1 
ATOM   6444  N N   . GLY B 1 374 ? 155.407 118.932 143.902 1.00 131.69 ? 374 GLY B N   1 
ATOM   6445  C CA  . GLY B 1 374 ? 154.828 119.195 142.599 1.00 131.69 ? 374 GLY B CA  1 
ATOM   6446  C C   . GLY B 1 374 ? 155.641 120.134 141.724 1.00 131.69 ? 374 GLY B C   1 
ATOM   6447  O O   . GLY B 1 374 ? 155.176 121.215 141.354 1.00 131.69 ? 374 GLY B O   1 
ATOM   6448  N N   . ILE B 1 375 ? 156.876 119.741 141.419 1.00 136.45 ? 375 ILE B N   1 
ATOM   6449  C CA  . ILE B 1 375 ? 157.673 120.397 140.388 1.00 136.45 ? 375 ILE B CA  1 
ATOM   6450  C C   . ILE B 1 375 ? 158.309 119.404 139.422 1.00 136.45 ? 375 ILE B C   1 
ATOM   6451  O O   . ILE B 1 375 ? 158.733 119.792 138.316 1.00 136.45 ? 375 ILE B O   1 
ATOM   6452  C CB  . ILE B 1 375 ? 158.751 121.296 141.042 1.00 136.45 ? 375 ILE B CB  1 
ATOM   6453  C CG1 . ILE B 1 375 ? 159.259 122.374 140.076 1.00 136.45 ? 375 ILE B CG1 1 
ATOM   6454  C CG2 . ILE B 1 375 ? 159.907 120.461 141.575 1.00 136.45 ? 375 ILE B CG2 1 
ATOM   6455  C CD1 . ILE B 1 375 ? 160.046 123.473 140.743 1.00 136.45 ? 375 ILE B CD1 1 
ATOM   6456  N N   . GLU B 1 376 ? 158.351 118.109 139.739 1.00 143.78 ? 376 GLU B N   1 
ATOM   6457  C CA  . GLU B 1 376 ? 158.930 117.134 138.816 1.00 143.78 ? 376 GLU B CA  1 
ATOM   6458  C C   . GLU B 1 376 ? 157.950 116.797 137.699 1.00 143.78 ? 376 GLU B C   1 
ATOM   6459  O O   . GLU B 1 376 ? 158.208 117.074 136.525 1.00 143.78 ? 376 GLU B O   1 
ATOM   6460  C CB  . GLU B 1 376 ? 159.340 115.863 139.569 1.00 143.78 ? 376 GLU B CB  1 
ATOM   6461  C CG  . GLU B 1 376 ? 159.996 114.808 138.681 1.00 143.78 ? 376 GLU B CG  1 
ATOM   6462  C CD  . GLU B 1 376 ? 160.384 113.552 139.437 1.00 143.78 ? 376 GLU B CD  1 
ATOM   6463  O OE1 . GLU B 1 376 ? 160.096 113.468 140.648 1.00 143.78 ? 376 GLU B OE1 1 
ATOM   6464  O OE2 . GLU B 1 376 ? 160.982 112.646 138.821 1.00 143.78 ? 376 GLU B OE2 1 
ATOM   6465  N N   . ALA B 1 377 ? 156.808 116.213 138.056 1.00 140.39 ? 377 ALA B N   1 
ATOM   6466  C CA  . ALA B 1 377 ? 155.883 115.688 137.067 1.00 140.39 ? 377 ALA B CA  1 
ATOM   6467  C C   . ALA B 1 377 ? 154.445 116.113 137.276 1.00 140.39 ? 377 ALA B C   1 
ATOM   6468  O O   . ALA B 1 377 ? 153.607 115.809 136.422 1.00 140.39 ? 377 ALA B O   1 
ATOM   6469  C CB  . ALA B 1 377 ? 155.937 114.153 137.039 1.00 140.39 ? 377 ALA B CB  1 
ATOM   6470  N N   . LYS B 1 378 ? 154.124 116.784 138.373 1.00 137.53 ? 378 LYS B N   1 
ATOM   6471  C CA  . LYS B 1 378 ? 152.751 117.196 138.599 1.00 137.53 ? 378 LYS B CA  1 
ATOM   6472  C C   . LYS B 1 378 ? 152.452 118.421 137.754 1.00 137.53 ? 378 LYS B C   1 
ATOM   6473  O O   . LYS B 1 378 ? 153.267 119.344 137.671 1.00 137.53 ? 378 LYS B O   1 
ATOM   6474  C CB  . LYS B 1 378 ? 152.506 117.480 140.077 1.00 137.53 ? 378 LYS B CB  1 
ATOM   6475  C CG  . LYS B 1 378 ? 151.067 117.837 140.385 1.00 137.53 ? 378 LYS B CG  1 
ATOM   6476  C CD  . LYS B 1 378 ? 150.097 116.720 140.024 1.00 137.53 ? 378 LYS B CD  1 
ATOM   6477  C CE  . LYS B 1 378 ? 150.202 115.547 140.984 1.00 137.53 ? 378 LYS B CE  1 
ATOM   6478  N NZ  . LYS B 1 378 ? 149.174 114.503 140.704 1.00 137.53 ? 378 LYS B NZ  1 
ATOM   6479  N N   . ASN B 1 379 ? 151.280 118.422 137.128 1.00 140.74 ? 379 ASN B N   1 
ATOM   6480  C CA  . ASN B 1 379 ? 150.872 119.446 136.177 1.00 140.74 ? 379 ASN B CA  1 
ATOM   6481  C C   . ASN B 1 379 ? 150.401 120.737 136.839 1.00 140.74 ? 379 ASN B C   1 
ATOM   6482  O O   . ASN B 1 379 ? 149.888 121.614 136.139 1.00 140.74 ? 379 ASN B O   1 
ATOM   6483  C CB  . ASN B 1 379 ? 149.758 118.900 135.277 1.00 140.74 ? 379 ASN B CB  1 
ATOM   6484  C CG  . ASN B 1 379 ? 150.185 117.671 134.496 1.00 140.74 ? 379 ASN B CG  1 
ATOM   6485  O OD1 . ASN B 1 379 ? 149.655 116.578 134.697 1.00 140.74 ? 379 ASN B OD1 1 
ATOM   6486  N ND2 . ASN B 1 379 ? 151.148 117.845 133.602 1.00 140.74 ? 379 ASN B ND2 1 
ATOM   6487  N N   . LEU B 1 380 ? 150.540 120.875 138.153 1.00 131.11 ? 380 LEU B N   1 
ATOM   6488  C CA  . LEU B 1 380 ? 150.131 122.107 138.803 1.00 131.11 ? 380 LEU B CA  1 
ATOM   6489  C C   . LEU B 1 380 ? 151.095 123.229 138.458 1.00 131.11 ? 380 LEU B C   1 
ATOM   6490  O O   . LEU B 1 380 ? 152.306 123.022 138.359 1.00 131.11 ? 380 LEU B O   1 
ATOM   6491  C CB  . LEU B 1 380 ? 150.047 121.918 140.324 1.00 131.11 ? 380 LEU B CB  1 
ATOM   6492  C CG  . LEU B 1 380 ? 151.204 121.449 141.224 1.00 131.11 ? 380 LEU B CG  1 
ATOM   6493  C CD1 . LEU B 1 380 ? 152.173 122.550 141.645 1.00 131.11 ? 380 LEU B CD1 1 
ATOM   6494  C CD2 . LEU B 1 380 ? 150.622 120.813 142.473 1.00 131.11 ? 380 LEU B CD2 1 
ATOM   6495  N N   . ALA B 1 381 ? 150.545 124.421 138.261 1.00 120.39 ? 381 ALA B N   1 
ATOM   6496  C CA  . ALA B 1 381 ? 151.332 125.641 138.183 1.00 120.39 ? 381 ALA B CA  1 
ATOM   6497  C C   . ALA B 1 381 ? 151.111 126.505 139.416 1.00 120.39 ? 381 ALA B C   1 
ATOM   6498  O O   . ALA B 1 381 ? 151.295 127.723 139.375 1.00 120.39 ? 381 ALA B O   1 
ATOM   6499  C CB  . ALA B 1 381 ? 151.001 126.419 136.913 1.00 120.39 ? 381 ALA B CB  1 
ATOM   6500  N N   . SER B 1 382 ? 150.730 125.879 140.528 1.00 115.38 ? 382 SER B N   1 
ATOM   6501  C CA  . SER B 1 382 ? 150.293 126.590 141.730 1.00 115.38 ? 382 SER B CA  1 
ATOM   6502  C C   . SER B 1 382 ? 151.497 127.154 142.485 1.00 115.38 ? 382 SER B C   1 
ATOM   6503  O O   . SER B 1 382 ? 151.815 126.762 143.607 1.00 115.38 ? 382 SER B O   1 
ATOM   6504  C CB  . SER B 1 382 ? 149.471 125.665 142.616 1.00 115.38 ? 382 SER B CB  1 
ATOM   6505  O OG  . SER B 1 382 ? 149.096 126.308 143.820 1.00 115.38 ? 382 SER B OG  1 
ATOM   6506  N N   . TYR B 1 383 ? 152.145 128.132 141.863 1.00 101.97 ? 383 TYR B N   1 
ATOM   6507  C CA  . TYR B 1 383 ? 153.318 128.775 142.426 1.00 101.97 ? 383 TYR B CA  1 
ATOM   6508  C C   . TYR B 1 383 ? 152.983 129.894 143.392 1.00 101.97 ? 383 TYR B C   1 
ATOM   6509  O O   . TYR B 1 383 ? 153.845 130.728 143.677 1.00 101.97 ? 383 TYR B O   1 
ATOM   6510  C CB  . TYR B 1 383 ? 154.207 129.301 141.308 1.00 101.97 ? 383 TYR B CB  1 
ATOM   6511  C CG  . TYR B 1 383 ? 155.109 128.258 140.714 1.00 101.97 ? 383 TYR B CG  1 
ATOM   6512  C CD1 . TYR B 1 383 ? 155.412 127.098 141.414 1.00 101.97 ? 383 TYR B CD1 1 
ATOM   6513  C CD2 . TYR B 1 383 ? 155.669 128.433 139.461 1.00 101.97 ? 383 TYR B CD2 1 
ATOM   6514  C CE1 . TYR B 1 383 ? 156.251 126.143 140.882 1.00 101.97 ? 383 TYR B CE1 1 
ATOM   6515  C CE2 . TYR B 1 383 ? 156.506 127.480 138.919 1.00 101.97 ? 383 TYR B CE2 1 
ATOM   6516  C CZ  . TYR B 1 383 ? 156.792 126.339 139.634 1.00 101.97 ? 383 TYR B CZ  1 
ATOM   6517  O OH  . TYR B 1 383 ? 157.625 125.390 139.097 1.00 101.97 ? 383 TYR B OH  1 
ATOM   6518  N N   . ASP B 1 384 ? 151.758 129.940 143.901 1.00 102.53 ? 384 ASP B N   1 
ATOM   6519  C CA  . ASP B 1 384 ? 151.389 130.907 144.920 1.00 102.53 ? 384 ASP B CA  1 
ATOM   6520  C C   . ASP B 1 384 ? 151.068 130.234 146.243 1.00 102.53 ? 384 ASP B C   1 
ATOM   6521  O O   . ASP B 1 384 ? 151.524 130.684 147.296 1.00 102.53 ? 384 ASP B O   1 
ATOM   6522  C CB  . ASP B 1 384 ? 150.195 131.736 144.445 1.00 102.53 ? 384 ASP B CB  1 
ATOM   6523  C CG  . ASP B 1 384 ? 150.539 132.628 143.272 1.00 102.53 ? 384 ASP B CG  1 
ATOM   6524  O OD1 . ASP B 1 384 ? 151.712 133.035 143.158 1.00 102.53 ? 384 ASP B OD1 1 
ATOM   6525  O OD2 . ASP B 1 384 ? 149.638 132.929 142.464 1.00 102.53 ? 384 ASP B OD2 1 
ATOM   6526  N N   . VAL B 1 385 ? 150.299 129.149 146.197 1.00 102.77 ? 385 VAL B N   1 
ATOM   6527  C CA  . VAL B 1 385 ? 149.914 128.434 147.405 1.00 102.77 ? 385 VAL B CA  1 
ATOM   6528  C C   . VAL B 1 385 ? 151.112 127.742 148.032 1.00 102.77 ? 385 VAL B C   1 
ATOM   6529  O O   . VAL B 1 385 ? 151.280 127.771 149.254 1.00 102.77 ? 385 VAL B O   1 
ATOM   6530  C CB  . VAL B 1 385 ? 148.794 127.441 147.070 1.00 102.77 ? 385 VAL B CB  1 
ATOM   6531  C CG1 . VAL B 1 385 ? 148.375 126.668 148.287 1.00 102.77 ? 385 VAL B CG1 1 
ATOM   6532  C CG2 . VAL B 1 385 ? 147.618 128.176 146.487 1.00 102.77 ? 385 VAL B CG2 1 
ATOM   6533  N N   . CYS B 1 386 ? 151.985 127.156 147.224 1.00 107.46 ? 386 CYS B N   1 
ATOM   6534  C CA  . CYS B 1 386 ? 153.184 126.528 147.756 1.00 107.46 ? 386 CYS B CA  1 
ATOM   6535  C C   . CYS B 1 386 ? 154.209 127.534 148.245 1.00 107.46 ? 386 CYS B C   1 
ATOM   6536  O O   . CYS B 1 386 ? 155.116 127.156 148.989 1.00 107.46 ? 386 CYS B O   1 
ATOM   6537  C CB  . CYS B 1 386 ? 153.834 125.638 146.701 1.00 107.46 ? 386 CYS B CB  1 
ATOM   6538  S SG  . CYS B 1 386 ? 154.530 126.539 145.314 1.00 107.46 ? 386 CYS B SG  1 
ATOM   6539  N N   . SER B 1 387 ? 154.091 128.795 147.852 1.00 96.41  ? 387 SER B N   1 
ATOM   6540  C CA  . SER B 1 387 ? 155.056 129.815 148.216 1.00 96.41  ? 387 SER B CA  1 
ATOM   6541  C C   . SER B 1 387 ? 154.687 130.561 149.476 1.00 96.41  ? 387 SER B C   1 
ATOM   6542  O O   . SER B 1 387 ? 155.574 130.920 150.246 1.00 96.41  ? 387 SER B O   1 
ATOM   6543  C CB  . SER B 1 387 ? 155.198 130.825 147.085 1.00 96.41  ? 387 SER B CB  1 
ATOM   6544  O OG  . SER B 1 387 ? 153.983 131.526 146.928 1.00 96.41  ? 387 SER B OG  1 
ATOM   6545  N N   . ILE B 1 388 ? 153.399 130.819 149.690 1.00 90.76  ? 388 ILE B N   1 
ATOM   6546  C CA  . ILE B 1 388 ? 152.975 131.533 150.886 1.00 90.76  ? 388 ILE B CA  1 
ATOM   6547  C C   . ILE B 1 388 ? 153.180 130.670 152.120 1.00 90.76  ? 388 ILE B C   1 
ATOM   6548  O O   . ILE B 1 388 ? 153.604 131.162 153.170 1.00 90.76  ? 388 ILE B O   1 
ATOM   6549  C CB  . ILE B 1 388 ? 151.516 131.999 150.728 1.00 90.76  ? 388 ILE B CB  1 
ATOM   6550  C CG1 . ILE B 1 388 ? 151.432 133.044 149.628 1.00 90.76  ? 388 ILE B CG1 1 
ATOM   6551  C CG2 . ILE B 1 388 ? 150.969 132.597 151.999 1.00 90.76  ? 388 ILE B CG2 1 
ATOM   6552  C CD1 . ILE B 1 388 ? 150.041 133.448 149.300 1.00 90.76  ? 388 ILE B CD1 1 
ATOM   6553  N N   . LEU B 1 389 ? 152.951 129.362 151.994 1.00 94.20  ? 389 LEU B N   1 
ATOM   6554  C CA  . LEU B 1 389 ? 153.092 128.461 153.131 1.00 94.20  ? 389 LEU B CA  1 
ATOM   6555  C C   . LEU B 1 389 ? 154.535 128.335 153.586 1.00 94.20  ? 389 LEU B C   1 
ATOM   6556  O O   . LEU B 1 389 ? 154.800 128.276 154.788 1.00 94.20  ? 389 LEU B O   1 
ATOM   6557  C CB  . LEU B 1 389 ? 152.545 127.090 152.769 1.00 94.20  ? 389 LEU B CB  1 
ATOM   6558  C CG  . LEU B 1 389 ? 151.054 127.054 152.474 1.00 94.20  ? 389 LEU B CG  1 
ATOM   6559  C CD1 . LEU B 1 389 ? 150.668 125.688 151.979 1.00 94.20  ? 389 LEU B CD1 1 
ATOM   6560  C CD2 . LEU B 1 389 ? 150.276 127.410 153.710 1.00 94.20  ? 389 LEU B CD2 1 
ATOM   6561  N N   . LEU B 1 390 ? 155.476 128.316 152.648 1.00 91.83  ? 390 LEU B N   1 
ATOM   6562  C CA  . LEU B 1 390 ? 156.877 128.184 153.020 1.00 91.83  ? 390 LEU B CA  1 
ATOM   6563  C C   . LEU B 1 390 ? 157.420 129.474 153.610 1.00 91.83  ? 390 LEU B C   1 
ATOM   6564  O O   . LEU B 1 390 ? 158.216 129.443 154.553 1.00 91.83  ? 390 LEU B O   1 
ATOM   6565  C CB  . LEU B 1 390 ? 157.697 127.767 151.807 1.00 91.83  ? 390 LEU B CB  1 
ATOM   6566  C CG  . LEU B 1 390 ? 157.411 126.348 151.348 1.00 91.83  ? 390 LEU B CG  1 
ATOM   6567  C CD1 . LEU B 1 390 ? 158.094 126.068 150.039 1.00 91.83  ? 390 LEU B CD1 1 
ATOM   6568  C CD2 . LEU B 1 390 ? 157.914 125.409 152.408 1.00 91.83  ? 390 LEU B CD2 1 
ATOM   6569  N N   . GLY B 1 391 ? 157.005 130.615 153.070 1.00 87.59  ? 391 GLY B N   1 
ATOM   6570  C CA  . GLY B 1 391 ? 157.508 131.876 153.577 1.00 87.59  ? 391 GLY B CA  1 
ATOM   6571  C C   . GLY B 1 391 ? 156.949 132.217 154.942 1.00 87.59  ? 391 GLY B C   1 
ATOM   6572  O O   . GLY B 1 391 ? 157.685 132.664 155.825 1.00 87.59  ? 391 GLY B O   1 
ATOM   6573  N N   . THR B 1 392 ? 155.648 131.992 155.140 1.00 85.35  ? 392 THR B N   1 
ATOM   6574  C CA  . THR B 1 392 ? 155.014 132.288 156.418 1.00 85.35  ? 392 THR B CA  1 
ATOM   6575  C C   . THR B 1 392 ? 155.515 131.365 157.514 1.00 85.35  ? 392 THR B C   1 
ATOM   6576  O O   . THR B 1 392 ? 155.572 131.774 158.675 1.00 85.35  ? 392 THR B O   1 
ATOM   6577  C CB  . THR B 1 392 ? 153.499 132.179 156.276 1.00 85.35  ? 392 THR B CB  1 
ATOM   6578  O OG1 . THR B 1 392 ? 153.092 132.936 155.136 1.00 85.35  ? 392 THR B OG1 1 
ATOM   6579  C CG2 . THR B 1 392 ? 152.790 132.759 157.474 1.00 85.35  ? 392 THR B CG2 1 
ATOM   6580  N N   . SER B 1 393 ? 155.919 130.147 157.162 1.00 88.90  ? 393 SER B N   1 
ATOM   6581  C CA  . SER B 1 393 ? 156.601 129.292 158.123 1.00 88.90  ? 393 SER B CA  1 
ATOM   6582  C C   . SER B 1 393 ? 157.926 129.904 158.540 1.00 88.90  ? 393 SER B C   1 
ATOM   6583  O O   . SER B 1 393 ? 158.189 130.083 159.733 1.00 88.90  ? 393 SER B O   1 
ATOM   6584  C CB  . SER B 1 393 ? 156.835 127.912 157.525 1.00 88.90  ? 393 SER B CB  1 
ATOM   6585  O OG  . SER B 1 393 ? 157.830 127.978 156.525 1.00 88.90  ? 393 SER B OG  1 
ATOM   6586  N N   . THR B 1 394 ? 158.749 130.276 157.560 1.00 86.78  ? 394 THR B N   1 
ATOM   6587  C CA  . THR B 1 394 ? 160.082 130.795 157.835 1.00 86.78  ? 394 THR B CA  1 
ATOM   6588  C C   . THR B 1 394 ? 160.025 132.151 158.518 1.00 86.78  ? 394 THR B C   1 
ATOM   6589  O O   . THR B 1 394 ? 160.874 132.460 159.362 1.00 86.78  ? 394 THR B O   1 
ATOM   6590  C CB  . THR B 1 394 ? 160.848 130.874 156.526 1.00 86.78  ? 394 THR B CB  1 
ATOM   6591  O OG1 . THR B 1 394 ? 160.831 129.582 155.919 1.00 86.78  ? 394 THR B OG1 1 
ATOM   6592  C CG2 . THR B 1 394 ? 162.288 131.282 156.733 1.00 86.78  ? 394 THR B CG2 1 
ATOM   6593  N N   . LEU B 1 395 ? 159.007 132.948 158.198 1.00 79.80  ? 395 LEU B N   1 
ATOM   6594  C CA  . LEU B 1 395 ? 158.743 134.175 158.939 1.00 79.80  ? 395 LEU B CA  1 
ATOM   6595  C C   . LEU B 1 395 ? 158.420 133.889 160.396 1.00 79.80  ? 395 LEU B C   1 
ATOM   6596  O O   . LEU B 1 395 ? 158.751 134.687 161.280 1.00 79.80  ? 395 LEU B O   1 
ATOM   6597  C CB  . LEU B 1 395 ? 157.594 134.926 158.269 1.00 79.80  ? 395 LEU B CB  1 
ATOM   6598  C CG  . LEU B 1 395 ? 157.072 136.194 158.914 1.00 79.80  ? 395 LEU B CG  1 
ATOM   6599  C CD1 . LEU B 1 395 ? 158.196 137.175 159.030 1.00 79.80  ? 395 LEU B CD1 1 
ATOM   6600  C CD2 . LEU B 1 395 ? 155.945 136.773 158.089 1.00 79.80  ? 395 LEU B CD2 1 
ATOM   6601  N N   . LEU B 1 396 ? 157.817 132.742 160.667 1.00 84.79  ? 396 LEU B N   1 
ATOM   6602  C CA  . LEU B 1 396 ? 157.368 132.386 161.994 1.00 84.79  ? 396 LEU B CA  1 
ATOM   6603  C C   . LEU B 1 396 ? 158.258 131.349 162.660 1.00 84.79  ? 396 LEU B C   1 
ATOM   6604  O O   . LEU B 1 396 ? 158.157 131.158 163.872 1.00 84.79  ? 396 LEU B O   1 
ATOM   6605  C CB  . LEU B 1 396 ? 155.919 131.899 161.897 1.00 84.79  ? 396 LEU B CB  1 
ATOM   6606  C CG  . LEU B 1 396 ? 154.983 131.590 163.041 1.00 84.79  ? 396 LEU B CG  1 
ATOM   6607  C CD1 . LEU B 1 396 ? 153.607 132.023 162.624 1.00 84.79  ? 396 LEU B CD1 1 
ATOM   6608  C CD2 . LEU B 1 396 ? 154.989 130.108 163.244 1.00 84.79  ? 396 LEU B CD2 1 
ATOM   6609  N N   . VAL B 1 397 ? 159.137 130.691 161.911 1.00 84.89  ? 397 VAL B N   1 
ATOM   6610  C CA  . VAL B 1 397 ? 160.174 129.883 162.541 1.00 84.89  ? 397 VAL B CA  1 
ATOM   6611  C C   . VAL B 1 397 ? 161.237 130.771 163.163 1.00 84.89  ? 397 VAL B C   1 
ATOM   6612  O O   . VAL B 1 397 ? 161.606 130.587 164.327 1.00 84.89  ? 397 VAL B O   1 
ATOM   6613  C CB  . VAL B 1 397 ? 160.774 128.899 161.523 1.00 84.89  ? 397 VAL B CB  1 
ATOM   6614  C CG1 . VAL B 1 397 ? 162.062 128.329 162.030 1.00 84.89  ? 397 VAL B CG1 1 
ATOM   6615  C CG2 . VAL B 1 397 ? 159.817 127.755 161.286 1.00 84.89  ? 397 VAL B CG2 1 
ATOM   6616  N N   . TRP B 1 398 ? 161.724 131.758 162.410 1.00 82.42  ? 398 TRP B N   1 
ATOM   6617  C CA  . TRP B 1 398 ? 162.781 132.650 162.871 1.00 82.42  ? 398 TRP B CA  1 
ATOM   6618  C C   . TRP B 1 398 ? 162.389 133.518 164.052 1.00 82.42  ? 398 TRP B C   1 
ATOM   6619  O O   . TRP B 1 398 ? 163.270 133.890 164.822 1.00 82.42  ? 398 TRP B O   1 
ATOM   6620  C CB  . TRP B 1 398 ? 163.254 133.542 161.735 1.00 82.42  ? 398 TRP B CB  1 
ATOM   6621  C CG  . TRP B 1 398 ? 164.271 132.911 160.888 1.00 82.42  ? 398 TRP B CG  1 
ATOM   6622  C CD1 . TRP B 1 398 ? 164.062 132.160 159.785 1.00 82.42  ? 398 TRP B CD1 1 
ATOM   6623  C CD2 . TRP B 1 398 ? 165.682 133.012 161.047 1.00 82.42  ? 398 TRP B CD2 1 
ATOM   6624  N NE1 . TRP B 1 398 ? 165.260 131.759 159.252 1.00 82.42  ? 398 TRP B NE1 1 
ATOM   6625  C CE2 . TRP B 1 398 ? 166.272 132.276 160.015 1.00 82.42  ? 398 TRP B CE2 1 
ATOM   6626  C CE3 . TRP B 1 398 ? 166.508 133.649 161.973 1.00 82.42  ? 398 TRP B CE3 1 
ATOM   6627  C CZ2 . TRP B 1 398 ? 167.644 132.160 159.880 1.00 82.42  ? 398 TRP B CZ2 1 
ATOM   6628  C CZ3 . TRP B 1 398 ? 167.861 133.531 161.836 1.00 82.42  ? 398 TRP B CZ3 1 
ATOM   6629  C CH2 . TRP B 1 398 ? 168.420 132.791 160.795 1.00 82.42  ? 398 TRP B CH2 1 
ATOM   6630  N N   . VAL B 1 399 ? 161.110 133.838 164.248 1.00 86.35  ? 399 VAL B N   1 
ATOM   6631  C CA  . VAL B 1 399 ? 160.750 134.572 165.458 1.00 86.35  ? 399 VAL B CA  1 
ATOM   6632  C C   . VAL B 1 399 ? 160.805 133.697 166.696 1.00 86.35  ? 399 VAL B C   1 
ATOM   6633  O O   . VAL B 1 399 ? 160.810 134.226 167.813 1.00 86.35  ? 399 VAL B O   1 
ATOM   6634  C CB  . VAL B 1 399 ? 159.352 135.210 165.381 1.00 86.35  ? 399 VAL B CB  1 
ATOM   6635  C CG1 . VAL B 1 399 ? 159.292 136.206 164.258 1.00 86.35  ? 399 VAL B CG1 1 
ATOM   6636  C CG2 . VAL B 1 399 ? 158.306 134.160 165.196 1.00 86.35  ? 399 VAL B CG2 1 
ATOM   6637  N N   . GLY B 1 400 ? 160.878 132.376 166.536 1.00 90.32  ? 400 GLY B N   1 
ATOM   6638  C CA  . GLY B 1 400 ? 161.006 131.500 167.683 1.00 90.32  ? 400 GLY B CA  1 
ATOM   6639  C C   . GLY B 1 400 ? 162.373 131.531 168.325 1.00 90.32  ? 400 GLY B C   1 
ATOM   6640  O O   . GLY B 1 400 ? 162.554 130.996 169.420 1.00 90.32  ? 400 GLY B O   1 
ATOM   6641  N N   . VAL B 1 401 ? 163.346 132.157 167.661 1.00 90.09  ? 401 VAL B N   1 
ATOM   6642  C CA  . VAL B 1 401 ? 164.686 132.306 168.207 1.00 90.09  ? 401 VAL B CA  1 
ATOM   6643  C C   . VAL B 1 401 ? 164.689 133.228 169.415 1.00 90.09  ? 401 VAL B C   1 
ATOM   6644  O O   . VAL B 1 401 ? 165.523 133.073 170.315 1.00 90.09  ? 401 VAL B O   1 
ATOM   6645  C CB  . VAL B 1 401 ? 165.605 132.800 167.075 1.00 90.09  ? 401 VAL B CB  1 
ATOM   6646  C CG1 . VAL B 1 401 ? 167.029 133.032 167.530 1.00 90.09  ? 401 VAL B CG1 1 
ATOM   6647  C CG2 . VAL B 1 401 ? 165.596 131.791 165.962 1.00 90.09  ? 401 VAL B CG2 1 
ATOM   6648  N N   . ILE B 1 402 ? 163.713 134.136 169.495 1.00 97.53  ? 402 ILE B N   1 
ATOM   6649  C CA  . ILE B 1 402 ? 163.641 135.124 170.568 1.00 97.53  ? 402 ILE B CA  1 
ATOM   6650  C C   . ILE B 1 402 ? 163.434 134.453 171.920 1.00 97.53  ? 402 ILE B C   1 
ATOM   6651  O O   . ILE B 1 402 ? 163.863 134.981 172.955 1.00 97.53  ? 402 ILE B O   1 
ATOM   6652  C CB  . ILE B 1 402 ? 162.522 136.131 170.250 1.00 97.53  ? 402 ILE B CB  1 
ATOM   6653  C CG1 . ILE B 1 402 ? 162.746 136.719 168.871 1.00 97.53  ? 402 ILE B CG1 1 
ATOM   6654  C CG2 . ILE B 1 402 ? 162.529 137.295 171.204 1.00 97.53  ? 402 ILE B CG2 1 
ATOM   6655  C CD1 . ILE B 1 402 ? 161.583 137.507 168.386 1.00 97.53  ? 402 ILE B CD1 1 
ATOM   6656  N N   . ARG B 1 403 ? 162.821 133.263 171.922 1.00 102.89 ? 403 ARG B N   1 
ATOM   6657  C CA  . ARG B 1 403 ? 162.690 132.465 173.137 1.00 102.89 ? 403 ARG B CA  1 
ATOM   6658  C C   . ARG B 1 403 ? 164.049 132.142 173.739 1.00 102.89 ? 403 ARG B C   1 
ATOM   6659  O O   . ARG B 1 403 ? 164.227 132.190 174.961 1.00 102.89 ? 403 ARG B O   1 
ATOM   6660  C CB  . ARG B 1 403 ? 161.940 131.174 172.834 1.00 102.89 ? 403 ARG B CB  1 
ATOM   6661  C CG  . ARG B 1 403 ? 161.749 130.318 174.050 1.00 102.89 ? 403 ARG B CG  1 
ATOM   6662  C CD  . ARG B 1 403 ? 161.105 129.000 173.730 1.00 102.89 ? 403 ARG B CD  1 
ATOM   6663  N NE  . ARG B 1 403 ? 161.038 128.179 174.930 1.00 102.89 ? 403 ARG B NE  1 
ATOM   6664  C CZ  . ARG B 1 403 ? 160.545 126.951 174.968 1.00 102.89 ? 403 ARG B CZ  1 
ATOM   6665  N NH1 . ARG B 1 403 ? 160.076 126.391 173.865 1.00 102.89 ? 403 ARG B NH1 1 
ATOM   6666  N NH2 . ARG B 1 403 ? 160.522 126.285 176.111 1.00 102.89 ? 403 ARG B NH2 1 
ATOM   6667  N N   . TYR B 1 404 ? 165.038 131.878 172.888 1.00 101.89 ? 404 TYR B N   1 
ATOM   6668  C CA  . TYR B 1 404 ? 166.360 131.522 173.388 1.00 101.89 ? 404 TYR B CA  1 
ATOM   6669  C C   . TYR B 1 404 ? 167.071 132.750 173.928 1.00 101.89 ? 404 TYR B C   1 
ATOM   6670  O O   . TYR B 1 404 ? 167.973 132.640 174.762 1.00 101.89 ? 404 TYR B O   1 
ATOM   6671  C CB  . TYR B 1 404 ? 167.180 130.868 172.277 1.00 101.89 ? 404 TYR B CB  1 
ATOM   6672  C CG  . TYR B 1 404 ? 166.567 129.598 171.743 1.00 101.89 ? 404 TYR B CG  1 
ATOM   6673  C CD1 . TYR B 1 404 ? 165.706 128.834 172.523 1.00 101.89 ? 404 TYR B CD1 1 
ATOM   6674  C CD2 . TYR B 1 404 ? 166.793 129.199 170.435 1.00 101.89 ? 404 TYR B CD2 1 
ATOM   6675  C CE1 . TYR B 1 404 ? 165.118 127.706 172.031 1.00 101.89 ? 404 TYR B CE1 1 
ATOM   6676  C CE2 . TYR B 1 404 ? 166.206 128.062 169.932 1.00 101.89 ? 404 TYR B CE2 1 
ATOM   6677  C CZ  . TYR B 1 404 ? 165.368 127.323 170.741 1.00 101.89 ? 404 TYR B CZ  1 
ATOM   6678  O OH  . TYR B 1 404 ? 164.773 126.186 170.273 1.00 101.89 ? 404 TYR B OH  1 
ATOM   6679  N N   . LEU B 1 405 ? 166.665 133.931 173.475 1.00 98.28  ? 405 LEU B N   1 
ATOM   6680  C CA  . LEU B 1 405 ? 167.249 135.150 174.009 1.00 98.28  ? 405 LEU B CA  1 
ATOM   6681  C C   . LEU B 1 405 ? 166.663 135.477 175.370 1.00 98.28  ? 405 LEU B C   1 
ATOM   6682  O O   . LEU B 1 405 ? 167.330 136.091 176.205 1.00 98.28  ? 405 LEU B O   1 
ATOM   6683  C CB  . LEU B 1 405 ? 167.052 136.310 173.032 1.00 98.28  ? 405 LEU B CB  1 
ATOM   6684  C CG  . LEU B 1 405 ? 168.057 136.456 171.876 1.00 98.28  ? 405 LEU B CG  1 
ATOM   6685  C CD1 . LEU B 1 405 ? 167.871 135.437 170.772 1.00 98.28  ? 405 LEU B CD1 1 
ATOM   6686  C CD2 . LEU B 1 405 ? 168.000 137.844 171.286 1.00 98.28  ? 405 LEU B CD2 1 
ATOM   6687  N N   . THR B 1 406 ? 165.432 135.030 175.637 1.00 99.95  ? 406 THR B N   1 
ATOM   6688  C CA  . THR B 1 406 ? 164.806 135.314 176.925 1.00 99.95  ? 406 THR B CA  1 
ATOM   6689  C C   . THR B 1 406 ? 165.354 134.454 178.053 1.00 99.95  ? 406 THR B C   1 
ATOM   6690  O O   . THR B 1 406 ? 164.982 134.660 179.210 1.00 99.95  ? 406 THR B O   1 
ATOM   6691  C CB  . THR B 1 406 ? 163.301 135.119 176.844 1.00 99.95  ? 406 THR B CB  1 
ATOM   6692  O OG1 . THR B 1 406 ? 163.026 133.771 176.457 1.00 99.95  ? 406 THR B OG1 1 
ATOM   6693  C CG2 . THR B 1 406 ? 162.703 136.063 175.840 1.00 99.95  ? 406 THR B CG2 1 
ATOM   6694  N N   . PHE B 1 407 ? 166.218 133.490 177.748 1.00 107.33 ? 407 PHE B N   1 
ATOM   6695  C CA  . PHE B 1 407 ? 166.851 132.711 178.801 1.00 107.33 ? 407 PHE B CA  1 
ATOM   6696  C C   . PHE B 1 407 ? 167.928 133.510 179.512 1.00 107.33 ? 407 PHE B C   1 
ATOM   6697  O O   . PHE B 1 407 ? 168.336 133.155 180.620 1.00 107.33 ? 407 PHE B O   1 
ATOM   6698  C CB  . PHE B 1 407 ? 167.426 131.432 178.209 1.00 107.33 ? 407 PHE B CB  1 
ATOM   6699  C CG  . PHE B 1 407 ? 166.381 130.447 177.807 1.00 107.33 ? 407 PHE B CG  1 
ATOM   6700  C CD1 . PHE B 1 407 ? 165.131 130.466 178.406 1.00 107.33 ? 407 PHE B CD1 1 
ATOM   6701  C CD2 . PHE B 1 407 ? 166.623 129.536 176.799 1.00 107.33 ? 407 PHE B CD2 1 
ATOM   6702  C CE1 . PHE B 1 407 ? 164.155 129.568 178.037 1.00 107.33 ? 407 PHE B CE1 1 
ATOM   6703  C CE2 . PHE B 1 407 ? 165.649 128.641 176.417 1.00 107.33 ? 407 PHE B CE2 1 
ATOM   6704  C CZ  . PHE B 1 407 ? 164.411 128.657 177.039 1.00 107.33 ? 407 PHE B CZ  1 
ATOM   6705  N N   . PHE B 1 408 ? 168.403 134.584 178.897 1.00 106.99 ? 408 PHE B N   1 
ATOM   6706  C CA  . PHE B 1 408 ? 169.413 135.414 179.530 1.00 106.99 ? 408 PHE B CA  1 
ATOM   6707  C C   . PHE B 1 408 ? 168.749 136.539 180.314 1.00 106.99 ? 408 PHE B C   1 
ATOM   6708  O O   . PHE B 1 408 ? 167.659 137.004 179.975 1.00 106.99 ? 408 PHE B O   1 
ATOM   6709  C CB  . PHE B 1 408 ? 170.363 135.990 178.488 1.00 106.99 ? 408 PHE B CB  1 
ATOM   6710  C CG  . PHE B 1 408 ? 171.207 134.963 177.799 1.00 106.99 ? 408 PHE B CG  1 
ATOM   6711  C CD1 . PHE B 1 408 ? 171.412 133.713 178.354 1.00 106.99 ? 408 PHE B CD1 1 
ATOM   6712  C CD2 . PHE B 1 408 ? 171.784 135.248 176.574 1.00 106.99 ? 408 PHE B CD2 1 
ATOM   6713  C CE1 . PHE B 1 408 ? 172.181 132.776 177.705 1.00 106.99 ? 408 PHE B CE1 1 
ATOM   6714  C CE2 . PHE B 1 408 ? 172.555 134.315 175.917 1.00 106.99 ? 408 PHE B CE2 1 
ATOM   6715  C CZ  . PHE B 1 408 ? 172.754 133.077 176.483 1.00 106.99 ? 408 PHE B CZ  1 
ATOM   6716  N N   . HIS B 1 409 ? 169.423 136.985 181.370 1.00 100.63 ? 409 HIS B N   1 
ATOM   6717  C CA  . HIS B 1 409 ? 168.804 137.916 182.300 1.00 100.63 ? 409 HIS B CA  1 
ATOM   6718  C C   . HIS B 1 409 ? 168.745 139.333 181.766 1.00 100.63 ? 409 HIS B C   1 
ATOM   6719  O O   . HIS B 1 409 ? 167.962 140.138 182.273 1.00 100.63 ? 409 HIS B O   1 
ATOM   6720  C CB  . HIS B 1 409 ? 169.564 137.899 183.617 1.00 100.63 ? 409 HIS B CB  1 
ATOM   6721  C CG  . HIS B 1 409 ? 169.615 136.549 184.255 1.00 100.63 ? 409 HIS B CG  1 
ATOM   6722  N ND1 . HIS B 1 409 ? 168.528 135.982 184.883 1.00 100.63 ? 409 HIS B ND1 1 
ATOM   6723  C CD2 . HIS B 1 409 ? 170.619 135.646 184.352 1.00 100.63 ? 409 HIS B CD2 1 
ATOM   6724  C CE1 . HIS B 1 409 ? 168.862 134.791 185.345 1.00 100.63 ? 409 HIS B CE1 1 
ATOM   6725  N NE2 . HIS B 1 409 ? 170.126 134.564 185.037 1.00 100.63 ? 409 HIS B NE2 1 
ATOM   6726  N N   . ASN B 1 410 ? 169.553 139.654 180.764 1.00 101.30 ? 410 ASN B N   1 
ATOM   6727  C CA  . ASN B 1 410 ? 169.567 140.994 180.199 1.00 101.30 ? 410 ASN B CA  1 
ATOM   6728  C C   . ASN B 1 410 ? 168.502 141.176 179.131 1.00 101.30 ? 410 ASN B C   1 
ATOM   6729  O O   . ASN B 1 410 ? 167.769 142.168 179.151 1.00 101.30 ? 410 ASN B O   1 
ATOM   6730  C CB  . ASN B 1 410 ? 170.938 141.291 179.601 1.00 101.30 ? 410 ASN B CB  1 
ATOM   6731  C CG  . ASN B 1 410 ? 172.043 141.178 180.614 1.00 101.30 ? 410 ASN B CG  1 
ATOM   6732  O OD1 . ASN B 1 410 ? 172.902 140.306 180.516 1.00 101.30 ? 410 ASN B OD1 1 
ATOM   6733  N ND2 . ASN B 1 410 ? 172.030 142.061 181.599 1.00 101.30 ? 410 ASN B ND2 1 
ATOM   6734  N N   . TYR B 1 411 ? 168.399 140.228 178.204 1.00 100.43 ? 411 TYR B N   1 
ATOM   6735  C CA  . TYR B 1 411 ? 167.518 140.357 177.053 1.00 100.43 ? 411 TYR B CA  1 
ATOM   6736  C C   . TYR B 1 411 ? 166.053 140.181 177.416 1.00 100.43 ? 411 TYR B C   1 
ATOM   6737  O O   . TYR B 1 411 ? 165.184 140.565 176.629 1.00 100.43 ? 411 TYR B O   1 
ATOM   6738  C CB  . TYR B 1 411 ? 167.864 139.325 175.977 1.00 100.43 ? 411 TYR B CB  1 
ATOM   6739  C CG  . TYR B 1 411 ? 169.229 139.411 175.332 1.00 100.43 ? 411 TYR B CG  1 
ATOM   6740  C CD1 . TYR B 1 411 ? 170.057 140.502 175.508 1.00 100.43 ? 411 TYR B CD1 1 
ATOM   6741  C CD2 . TYR B 1 411 ? 169.674 138.386 174.513 1.00 100.43 ? 411 TYR B CD2 1 
ATOM   6742  C CE1 . TYR B 1 411 ? 171.297 140.550 174.911 1.00 100.43 ? 411 TYR B CE1 1 
ATOM   6743  C CE2 . TYR B 1 411 ? 170.908 138.435 173.903 1.00 100.43 ? 411 TYR B CE2 1 
ATOM   6744  C CZ  . TYR B 1 411 ? 171.713 139.521 174.106 1.00 100.43 ? 411 TYR B CZ  1 
ATOM   6745  O OH  . TYR B 1 411 ? 172.946 139.572 173.504 1.00 100.43 ? 411 TYR B OH  1 
ATOM   6746  N N   . ASN B 1 412 ? 165.767 139.589 178.572 1.00 98.24  ? 412 ASN B N   1 
ATOM   6747  C CA  . ASN B 1 412 ? 164.404 139.434 179.048 1.00 98.24  ? 412 ASN B CA  1 
ATOM   6748  C C   . ASN B 1 412 ? 163.751 140.772 179.339 1.00 98.24  ? 412 ASN B C   1 
ATOM   6749  O O   . ASN B 1 412 ? 162.528 140.887 179.230 1.00 98.24  ? 412 ASN B O   1 
ATOM   6750  C CB  . ASN B 1 412 ? 164.405 138.573 180.312 1.00 98.24  ? 412 ASN B CB  1 
ATOM   6751  C CG  . ASN B 1 412 ? 163.034 138.033 180.669 1.00 98.24  ? 412 ASN B CG  1 
ATOM   6752  O OD1 . ASN B 1 412 ? 162.062 138.208 179.939 1.00 98.24  ? 412 ASN B OD1 1 
ATOM   6753  N ND2 . ASN B 1 412 ? 162.952 137.375 181.816 1.00 98.24  ? 412 ASN B ND2 1 
ATOM   6754  N N   . ILE B 1 413 ? 164.545 141.784 179.684 1.00 89.98  ? 413 ILE B N   1 
ATOM   6755  C CA  . ILE B 1 413 ? 163.994 143.074 180.067 1.00 89.98  ? 413 ILE B CA  1 
ATOM   6756  C C   . ILE B 1 413 ? 163.376 143.765 178.862 1.00 89.98  ? 413 ILE B C   1 
ATOM   6757  O O   . ILE B 1 413 ? 162.279 144.325 178.940 1.00 89.98  ? 413 ILE B O   1 
ATOM   6758  C CB  . ILE B 1 413 ? 165.092 143.937 180.706 1.00 89.98  ? 413 ILE B CB  1 
ATOM   6759  C CG1 . ILE B 1 413 ? 165.814 143.155 181.799 1.00 89.98  ? 413 ILE B CG1 1 
ATOM   6760  C CG2 . ILE B 1 413 ? 164.499 145.195 181.292 1.00 89.98  ? 413 ILE B CG2 1 
ATOM   6761  C CD1 . ILE B 1 413 ? 164.932 142.708 182.940 1.00 89.98  ? 413 ILE B CD1 1 
ATOM   6762  N N   . LEU B 1 414 ? 164.055 143.705 177.722 1.00 86.47  ? 414 LEU B N   1 
ATOM   6763  C CA  . LEU B 1 414 ? 163.580 144.404 176.538 1.00 86.47  ? 414 LEU B CA  1 
ATOM   6764  C C   . LEU B 1 414 ? 162.368 143.713 175.941 1.00 86.47  ? 414 LEU B C   1 
ATOM   6765  O O   . LEU B 1 414 ? 161.456 144.375 175.443 1.00 86.47  ? 414 LEU B O   1 
ATOM   6766  C CB  . LEU B 1 414 ? 164.708 144.480 175.521 1.00 86.47  ? 414 LEU B CB  1 
ATOM   6767  C CG  . LEU B 1 414 ? 165.908 145.217 176.102 1.00 86.47  ? 414 LEU B CG  1 
ATOM   6768  C CD1 . LEU B 1 414 ? 167.118 145.030 175.239 1.00 86.47  ? 414 LEU B CD1 1 
ATOM   6769  C CD2 . LEU B 1 414 ? 165.593 146.681 176.241 1.00 86.47  ? 414 LEU B CD2 1 
ATOM   6770  N N   . ILE B 1 415 ? 162.337 142.383 175.991 1.00 90.49  ? 415 ILE B N   1 
ATOM   6771  C CA  . ILE B 1 415 ? 161.233 141.641 175.392 1.00 90.49  ? 415 ILE B CA  1 
ATOM   6772  C C   . ILE B 1 415 ? 159.984 141.748 176.251 1.00 90.49  ? 415 ILE B C   1 
ATOM   6773  O O   . ILE B 1 415 ? 158.885 141.996 175.742 1.00 90.49  ? 415 ILE B O   1 
ATOM   6774  C CB  . ILE B 1 415 ? 161.644 140.180 175.156 1.00 90.49  ? 415 ILE B CB  1 
ATOM   6775  C CG1 . ILE B 1 415 ? 162.762 140.122 174.125 1.00 90.49  ? 415 ILE B CG1 1 
ATOM   6776  C CG2 . ILE B 1 415 ? 160.470 139.350 174.702 1.00 90.49  ? 415 ILE B CG2 1 
ATOM   6777  C CD1 . ILE B 1 415 ? 162.363 140.692 172.790 1.00 90.49  ? 415 ILE B CD1 1 
ATOM   6778  N N   . ALA B 1 416 ? 160.124 141.596 177.564 1.00 87.83  ? 416 ALA B N   1 
ATOM   6779  C CA  . ALA B 1 416 ? 158.974 141.750 178.442 1.00 87.83  ? 416 ALA B CA  1 
ATOM   6780  C C   . ALA B 1 416 ? 158.506 143.192 178.547 1.00 87.83  ? 416 ALA B C   1 
ATOM   6781  O O   . ALA B 1 416 ? 157.392 143.428 179.020 1.00 87.83  ? 416 ALA B O   1 
ATOM   6782  C CB  . ALA B 1 416 ? 159.284 141.201 179.833 1.00 87.83  ? 416 ALA B CB  1 
ATOM   6783  N N   . THR B 1 417 ? 159.326 144.153 178.126 1.00 85.71  ? 417 THR B N   1 
ATOM   6784  C CA  . THR B 1 417 ? 158.843 145.514 177.958 1.00 85.71  ? 417 THR B CA  1 
ATOM   6785  C C   . THR B 1 417 ? 157.827 145.586 176.829 1.00 85.71  ? 417 THR B C   1 
ATOM   6786  O O   . THR B 1 417 ? 156.823 146.294 176.937 1.00 85.71  ? 417 THR B O   1 
ATOM   6787  C CB  . THR B 1 417 ? 160.012 146.452 177.682 1.00 85.71  ? 417 THR B CB  1 
ATOM   6788  O OG1 . THR B 1 417 ? 161.002 146.273 178.697 1.00 85.71  ? 417 THR B OG1 1 
ATOM   6789  C CG2 . THR B 1 417 ? 159.556 147.891 177.717 1.00 85.71  ? 417 THR B CG2 1 
ATOM   6790  N N   . LEU B 1 418 ? 158.062 144.843 175.747 1.00 81.73  ? 418 LEU B N   1 
ATOM   6791  C CA  . LEU B 1 418 ? 157.058 144.744 174.698 1.00 81.73  ? 418 LEU B CA  1 
ATOM   6792  C C   . LEU B 1 418 ? 155.820 144.013 175.180 1.00 81.73  ? 418 LEU B C   1 
ATOM   6793  O O   . LEU B 1 418 ? 154.707 144.366 174.783 1.00 81.73  ? 418 LEU B O   1 
ATOM   6794  C CB  . LEU B 1 418 ? 157.613 144.024 173.473 1.00 81.73  ? 418 LEU B CB  1 
ATOM   6795  C CG  . LEU B 1 418 ? 158.256 144.822 172.349 1.00 81.73  ? 418 LEU B CG  1 
ATOM   6796  C CD1 . LEU B 1 418 ? 157.230 145.760 171.763 1.00 81.73  ? 418 LEU B CD1 1 
ATOM   6797  C CD2 . LEU B 1 418 ? 159.469 145.573 172.819 1.00 81.73  ? 418 LEU B CD2 1 
ATOM   6798  N N   . ARG B 1 419 ? 155.990 143.008 176.037 1.00 85.00  ? 419 ARG B N   1 
ATOM   6799  C CA  . ARG B 1 419 ? 154.855 142.186 176.428 1.00 85.00  ? 419 ARG B CA  1 
ATOM   6800  C C   . ARG B 1 419 ? 153.924 142.939 177.364 1.00 85.00  ? 419 ARG B C   1 
ATOM   6801  O O   . ARG B 1 419 ? 152.703 142.774 177.293 1.00 85.00  ? 419 ARG B O   1 
ATOM   6802  C CB  . ARG B 1 419 ? 155.342 140.895 177.073 1.00 85.00  ? 419 ARG B CB  1 
ATOM   6803  C CG  . ARG B 1 419 ? 154.247 139.889 177.357 1.00 85.00  ? 419 ARG B CG  1 
ATOM   6804  C CD  . ARG B 1 419 ? 154.837 138.666 178.000 1.00 85.00  ? 419 ARG B CD  1 
ATOM   6805  N NE  . ARG B 1 419 ? 155.359 138.985 179.320 1.00 85.00  ? 419 ARG B NE  1 
ATOM   6806  C CZ  . ARG B 1 419 ? 156.189 138.206 179.999 1.00 85.00  ? 419 ARG B CZ  1 
ATOM   6807  N NH1 . ARG B 1 419 ? 156.613 138.577 181.197 1.00 85.00  ? 419 ARG B NH1 1 
ATOM   6808  N NH2 . ARG B 1 419 ? 156.612 137.067 179.472 1.00 85.00  ? 419 ARG B NH2 1 
ATOM   6809  N N   . VAL B 1 420 ? 154.469 143.795 178.228 1.00 83.12  ? 420 VAL B N   1 
ATOM   6810  C CA  . VAL B 1 420 ? 153.598 144.598 179.079 1.00 83.12  ? 420 VAL B CA  1 
ATOM   6811  C C   . VAL B 1 420 ? 153.049 145.818 178.367 1.00 83.12  ? 420 VAL B C   1 
ATOM   6812  O O   . VAL B 1 420 ? 152.182 146.501 178.919 1.00 83.12  ? 420 VAL B O   1 
ATOM   6813  C CB  . VAL B 1 420 ? 154.314 145.074 180.353 1.00 83.12  ? 420 VAL B CB  1 
ATOM   6814  C CG1 . VAL B 1 420 ? 154.779 143.894 181.163 1.00 83.12  ? 420 VAL B CG1 1 
ATOM   6815  C CG2 . VAL B 1 420 ? 155.469 145.957 179.992 1.00 83.12  ? 420 VAL B CG2 1 
ATOM   6816  N N   . ALA B 1 421 ? 153.527 146.116 177.159 1.00 84.27  ? 421 ALA B N   1 
ATOM   6817  C CA  . ALA B 1 421 ? 153.076 147.287 176.427 1.00 84.27  ? 421 ALA B CA  1 
ATOM   6818  C C   . ALA B 1 421 ? 152.251 146.957 175.197 1.00 84.27  ? 421 ALA B C   1 
ATOM   6819  O O   . ALA B 1 421 ? 151.556 147.840 174.687 1.00 84.27  ? 421 ALA B O   1 
ATOM   6820  C CB  . ALA B 1 421 ? 154.271 148.145 176.010 1.00 84.27  ? 421 ALA B CB  1 
ATOM   6821  N N   . LEU B 1 422 ? 152.320 145.732 174.704 1.00 88.16  ? 422 LEU B N   1 
ATOM   6822  C CA  . LEU B 1 422 ? 151.469 145.251 173.621 1.00 88.16  ? 422 LEU B CA  1 
ATOM   6823  C C   . LEU B 1 422 ? 149.970 145.341 173.924 1.00 88.16  ? 422 LEU B C   1 
ATOM   6824  O O   . LEU B 1 422 ? 149.198 145.512 172.976 1.00 88.16  ? 422 LEU B O   1 
ATOM   6825  C CB  . LEU B 1 422 ? 151.855 143.813 173.252 1.00 88.16  ? 422 LEU B CB  1 
ATOM   6826  C CG  . LEU B 1 422 ? 151.413 143.188 171.923 1.00 88.16  ? 422 LEU B CG  1 
ATOM   6827  C CD1 . LEU B 1 422 ? 152.485 142.224 171.448 1.00 88.16  ? 422 LEU B CD1 1 
ATOM   6828  C CD2 . LEU B 1 422 ? 150.088 142.448 172.004 1.00 88.16  ? 422 LEU B CD2 1 
ATOM   6829  N N   . PRO B 1 423 ? 149.481 145.211 175.187 1.00 91.77  ? 423 PRO B N   1 
ATOM   6830  C CA  . PRO B 1 423 ? 148.086 145.598 175.422 1.00 91.77  ? 423 PRO B CA  1 
ATOM   6831  C C   . PRO B 1 423 ? 147.802 147.070 175.195 1.00 91.77  ? 423 PRO B C   1 
ATOM   6832  O O   . PRO B 1 423 ? 146.847 147.399 174.487 1.00 91.77  ? 423 PRO B O   1 
ATOM   6833  C CB  . PRO B 1 423 ? 147.862 145.219 176.886 1.00 91.77  ? 423 PRO B CB  1 
ATOM   6834  C CG  . PRO B 1 423 ? 148.726 144.105 177.092 1.00 91.77  ? 423 PRO B CG  1 
ATOM   6835  C CD  . PRO B 1 423 ? 149.955 144.376 176.310 1.00 91.77  ? 423 PRO B CD  1 
ATOM   6836  N N   . SER B 1 424 ? 148.621 147.956 175.769 1.00 89.43  ? 424 SER B N   1 
ATOM   6837  C CA  . SER B 1 424 ? 148.303 149.379 175.749 1.00 89.43  ? 424 SER B CA  1 
ATOM   6838  C C   . SER B 1 424 ? 148.404 149.974 174.357 1.00 89.43  ? 424 SER B C   1 
ATOM   6839  O O   . SER B 1 424 ? 147.687 150.927 174.047 1.00 89.43  ? 424 SER B O   1 
ATOM   6840  C CB  . SER B 1 424 ? 149.217 150.138 176.699 1.00 89.43  ? 424 SER B CB  1 
ATOM   6841  O OG  . SER B 1 424 ? 148.981 149.751 178.037 1.00 89.43  ? 424 SER B OG  1 
ATOM   6842  N N   . VAL B 1 425 ? 149.267 149.427 173.505 1.00 87.71  ? 425 VAL B N   1 
ATOM   6843  C CA  . VAL B 1 425 ? 149.322 149.895 172.126 1.00 87.71  ? 425 VAL B CA  1 
ATOM   6844  C C   . VAL B 1 425 ? 148.098 149.422 171.361 1.00 87.71  ? 425 VAL B C   1 
ATOM   6845  O O   . VAL B 1 425 ? 147.471 150.192 170.624 1.00 87.71  ? 425 VAL B O   1 
ATOM   6846  C CB  . VAL B 1 425 ? 150.623 149.424 171.461 1.00 87.71  ? 425 VAL B CB  1 
ATOM   6847  C CG1 . VAL B 1 425 ? 150.645 149.808 170.004 1.00 87.71  ? 425 VAL B CG1 1 
ATOM   6848  C CG2 . VAL B 1 425 ? 151.806 150.025 172.166 1.00 87.71  ? 425 VAL B CG2 1 
ATOM   6849  N N   . MET B 1 426 ? 147.713 148.163 171.553 1.00 95.85  ? 426 MET B N   1 
ATOM   6850  C CA  . MET B 1 426 ? 146.599 147.600 170.807 1.00 95.85  ? 426 MET B CA  1 
ATOM   6851  C C   . MET B 1 426 ? 145.262 148.148 171.285 1.00 95.85  ? 426 MET B C   1 
ATOM   6852  O O   . MET B 1 426 ? 144.279 148.093 170.542 1.00 95.85  ? 426 MET B O   1 
ATOM   6853  C CB  . MET B 1 426 ? 146.636 146.079 170.918 1.00 95.85  ? 426 MET B CB  1 
ATOM   6854  C CG  . MET B 1 426 ? 145.822 145.335 169.882 1.00 95.85  ? 426 MET B CG  1 
ATOM   6855  S SD  . MET B 1 426 ? 146.482 145.593 168.227 1.00 95.85  ? 426 MET B SD  1 
ATOM   6856  C CE  . MET B 1 426 ? 148.019 144.681 168.331 1.00 95.85  ? 426 MET B CE  1 
ATOM   6857  N N   . ARG B 1 427 ? 145.202 148.687 172.500 1.00 94.44  ? 427 ARG B N   1 
ATOM   6858  C CA  . ARG B 1 427 ? 144.038 149.471 172.886 1.00 94.44  ? 427 ARG B CA  1 
ATOM   6859  C C   . ARG B 1 427 ? 143.964 150.756 172.077 1.00 94.44  ? 427 ARG B C   1 
ATOM   6860  O O   . ARG B 1 427 ? 142.930 151.068 171.478 1.00 94.44  ? 427 ARG B O   1 
ATOM   6861  C CB  . ARG B 1 427 ? 144.087 149.799 174.374 1.00 94.44  ? 427 ARG B CB  1 
ATOM   6862  C CG  . ARG B 1 427 ? 143.913 148.625 175.295 1.00 94.44  ? 427 ARG B CG  1 
ATOM   6863  C CD  . ARG B 1 427 ? 143.860 149.106 176.721 1.00 94.44  ? 427 ARG B CD  1 
ATOM   6864  N NE  . ARG B 1 427 ? 143.733 147.997 177.651 1.00 94.44  ? 427 ARG B NE  1 
ATOM   6865  C CZ  . ARG B 1 427 ? 144.765 147.390 178.221 1.00 94.44  ? 427 ARG B CZ  1 
ATOM   6866  N NH1 . ARG B 1 427 ? 145.996 147.797 177.959 1.00 94.44  ? 427 ARG B NH1 1 
ATOM   6867  N NH2 . ARG B 1 427 ? 144.566 146.385 179.058 1.00 94.44  ? 427 ARG B NH2 1 
ATOM   6868  N N   . PHE B 1 428 ? 145.064 151.506 172.041 1.00 89.58  ? 428 PHE B N   1 
ATOM   6869  C CA  . PHE B 1 428 ? 145.075 152.812 171.402 1.00 89.58  ? 428 PHE B CA  1 
ATOM   6870  C C   . PHE B 1 428 ? 145.046 152.714 169.891 1.00 89.58  ? 428 PHE B C   1 
ATOM   6871  O O   . PHE B 1 428 ? 144.578 153.645 169.229 1.00 89.58  ? 428 PHE B O   1 
ATOM   6872  C CB  . PHE B 1 428 ? 146.304 153.591 171.853 1.00 89.58  ? 428 PHE B CB  1 
ATOM   6873  C CG  . PHE B 1 428 ? 146.363 154.983 171.328 1.00 89.58  ? 428 PHE B CG  1 
ATOM   6874  C CD1 . PHE B 1 428 ? 145.437 155.925 171.723 1.00 89.58  ? 428 PHE B CD1 1 
ATOM   6875  C CD2 . PHE B 1 428 ? 147.370 155.362 170.477 1.00 89.58  ? 428 PHE B CD2 1 
ATOM   6876  C CE1 . PHE B 1 428 ? 145.502 157.215 171.239 1.00 89.58  ? 428 PHE B CE1 1 
ATOM   6877  C CE2 . PHE B 1 428 ? 147.446 156.642 170.002 1.00 89.58  ? 428 PHE B CE2 1 
ATOM   6878  C CZ  . PHE B 1 428 ? 146.510 157.570 170.381 1.00 89.58  ? 428 PHE B CZ  1 
ATOM   6879  N N   . CYS B 1 429 ? 145.517 151.598 169.334 1.00 97.80  ? 429 CYS B N   1 
ATOM   6880  C CA  . CYS B 1 429 ? 145.453 151.393 167.893 1.00 97.80  ? 429 CYS B CA  1 
ATOM   6881  C C   . CYS B 1 429 ? 144.014 151.279 167.408 1.00 97.80  ? 429 CYS B C   1 
ATOM   6882  O O   . CYS B 1 429 ? 143.720 151.601 166.253 1.00 97.80  ? 429 CYS B O   1 
ATOM   6883  C CB  . CYS B 1 429 ? 146.252 150.149 167.516 1.00 97.80  ? 429 CYS B CB  1 
ATOM   6884  S SG  . CYS B 1 429 ? 146.398 149.819 165.753 1.00 97.80  ? 429 CYS B SG  1 
ATOM   6885  N N   . CYS B 1 430 ? 143.102 150.849 168.278 1.00 99.51  ? 430 CYS B N   1 
ATOM   6886  C CA  . CYS B 1 430 ? 141.687 150.906 167.946 1.00 99.51  ? 430 CYS B CA  1 
ATOM   6887  C C   . CYS B 1 430 ? 141.146 152.325 168.040 1.00 99.51  ? 430 CYS B C   1 
ATOM   6888  O O   . CYS B 1 430 ? 140.213 152.675 167.313 1.00 99.51  ? 430 CYS B O   1 
ATOM   6889  C CB  . CYS B 1 430 ? 140.891 149.975 168.859 1.00 99.51  ? 430 CYS B CB  1 
ATOM   6890  S SG  . CYS B 1 430 ? 139.149 149.821 168.425 1.00 99.51  ? 430 CYS B SG  1 
ATOM   6891  N N   . CYS B 1 431 ? 141.722 153.158 168.907 1.00 96.48  ? 431 CYS B N   1 
ATOM   6892  C CA  . CYS B 1 431 ? 141.262 154.536 169.032 1.00 96.48  ? 431 CYS B CA  1 
ATOM   6893  C C   . CYS B 1 431 ? 141.666 155.382 167.838 1.00 96.48  ? 431 CYS B C   1 
ATOM   6894  O O   . CYS B 1 431 ? 141.042 156.412 167.571 1.00 96.48  ? 431 CYS B O   1 
ATOM   6895  C CB  . CYS B 1 431 ? 141.813 155.178 170.303 1.00 96.48  ? 431 CYS B CB  1 
ATOM   6896  S SG  . CYS B 1 431 ? 141.188 154.523 171.853 1.00 96.48  ? 431 CYS B SG  1 
ATOM   6897  N N   . VAL B 1 432 ? 142.709 154.980 167.122 1.00 89.96  ? 432 VAL B N   1 
ATOM   6898  C CA  . VAL B 1 432 ? 143.185 155.768 165.996 1.00 89.96  ? 432 VAL B CA  1 
ATOM   6899  C C   . VAL B 1 432 ? 142.514 155.300 164.719 1.00 89.96  ? 432 VAL B C   1 
ATOM   6900  O O   . VAL B 1 432 ? 142.145 156.111 163.863 1.00 89.96  ? 432 VAL B O   1 
ATOM   6901  C CB  . VAL B 1 432 ? 144.715 155.680 165.903 1.00 89.96  ? 432 VAL B CB  1 
ATOM   6902  C CG1 . VAL B 1 432 ? 145.231 156.441 164.710 1.00 89.96  ? 432 VAL B CG1 1 
ATOM   6903  C CG2 . VAL B 1 432 ? 145.314 156.229 167.154 1.00 89.96  ? 432 VAL B CG2 1 
ATOM   6904  N N   . ALA B 1 433 ? 142.300 153.988 164.603 1.00 85.70  ? 433 ALA B N   1 
ATOM   6905  C CA  . ALA B 1 433 ? 141.735 153.414 163.388 1.00 85.70  ? 433 ALA B CA  1 
ATOM   6906  C C   . ALA B 1 433 ? 140.306 153.869 163.154 1.00 85.70  ? 433 ALA B C   1 
ATOM   6907  O O   . ALA B 1 433 ? 139.842 153.891 162.011 1.00 85.70  ? 433 ALA B O   1 
ATOM   6908  C CB  . ALA B 1 433 ? 141.794 151.893 163.456 1.00 85.70  ? 433 ALA B CB  1 
ATOM   6909  N N   . VAL B 1 434 ? 139.603 154.244 164.217 1.00 83.22  ? 434 VAL B N   1 
ATOM   6910  C CA  . VAL B 1 434 ? 138.279 154.825 164.068 1.00 83.22  ? 434 VAL B CA  1 
ATOM   6911  C C   . VAL B 1 434 ? 138.363 156.178 163.381 1.00 83.22  ? 434 VAL B C   1 
ATOM   6912  O O   . VAL B 1 434 ? 137.610 156.458 162.444 1.00 83.22  ? 434 VAL B O   1 
ATOM   6913  C CB  . VAL B 1 434 ? 137.604 154.914 165.444 1.00 83.22  ? 434 VAL B CB  1 
ATOM   6914  C CG1 . VAL B 1 434 ? 136.339 155.679 165.354 1.00 83.22  ? 434 VAL B CG1 1 
ATOM   6915  C CG2 . VAL B 1 434 ? 137.311 153.527 165.948 1.00 83.22  ? 434 VAL B CG2 1 
ATOM   6916  N N   . ILE B 1 435 ? 139.305 157.021 163.803 1.00 81.20  ? 435 ILE B N   1 
ATOM   6917  C CA  . ILE B 1 435 ? 139.484 158.314 163.158 1.00 81.20  ? 435 ILE B CA  1 
ATOM   6918  C C   . ILE B 1 435 ? 140.110 158.137 161.786 1.00 81.20  ? 435 ILE B C   1 
ATOM   6919  O O   . ILE B 1 435 ? 139.816 158.896 160.857 1.00 81.20  ? 435 ILE B O   1 
ATOM   6920  C CB  . ILE B 1 435 ? 140.343 159.223 164.045 1.00 81.20  ? 435 ILE B CB  1 
ATOM   6921  C CG1 . ILE B 1 435 ? 139.768 159.279 165.445 1.00 81.20  ? 435 ILE B CG1 1 
ATOM   6922  C CG2 . ILE B 1 435 ? 140.359 160.630 163.523 1.00 81.20  ? 435 ILE B CG2 1 
ATOM   6923  C CD1 . ILE B 1 435 ? 140.699 159.915 166.427 1.00 81.20  ? 435 ILE B CD1 1 
ATOM   6924  N N   . TYR B 1 436 ? 140.962 157.125 161.631 1.00 78.80  ? 436 TYR B N   1 
ATOM   6925  C CA  . TYR B 1 436 ? 141.621 156.886 160.356 1.00 78.80  ? 436 TYR B CA  1 
ATOM   6926  C C   . TYR B 1 436 ? 140.645 156.434 159.290 1.00 78.80  ? 436 TYR B C   1 
ATOM   6927  O O   . TYR B 1 436 ? 140.806 156.799 158.124 1.00 78.80  ? 436 TYR B O   1 
ATOM   6928  C CB  . TYR B 1 436 ? 142.718 155.848 160.522 1.00 78.80  ? 436 TYR B CB  1 
ATOM   6929  C CG  . TYR B 1 436 ? 143.408 155.489 159.241 1.00 78.80  ? 436 TYR B CG  1 
ATOM   6930  C CD1 . TYR B 1 436 ? 144.311 156.351 158.656 1.00 78.80  ? 436 TYR B CD1 1 
ATOM   6931  C CD2 . TYR B 1 436 ? 143.163 154.278 158.622 1.00 78.80  ? 436 TYR B CD2 1 
ATOM   6932  C CE1 . TYR B 1 436 ? 144.946 156.021 157.489 1.00 78.80  ? 436 TYR B CE1 1 
ATOM   6933  C CE2 . TYR B 1 436 ? 143.788 153.941 157.454 1.00 78.80  ? 436 TYR B CE2 1 
ATOM   6934  C CZ  . TYR B 1 436 ? 144.679 154.815 156.892 1.00 78.80  ? 436 TYR B CZ  1 
ATOM   6935  O OH  . TYR B 1 436 ? 145.306 154.474 155.721 1.00 78.80  ? 436 TYR B OH  1 
ATOM   6936  N N   . LEU B 1 437 ? 139.628 155.656 159.654 1.00 80.30  ? 437 LEU B N   1 
ATOM   6937  C CA  . LEU B 1 437 ? 138.600 155.347 158.673 1.00 80.30  ? 437 LEU B CA  1 
ATOM   6938  C C   . LEU B 1 437 ? 137.701 156.536 158.399 1.00 80.30  ? 437 LEU B C   1 
ATOM   6939  O O   . LEU B 1 437 ? 137.012 156.545 157.382 1.00 80.30  ? 437 LEU B O   1 
ATOM   6940  C CB  . LEU B 1 437 ? 137.756 154.163 159.120 1.00 80.30  ? 437 LEU B CB  1 
ATOM   6941  C CG  . LEU B 1 437 ? 138.510 152.836 159.132 1.00 80.30  ? 437 LEU B CG  1 
ATOM   6942  C CD1 . LEU B 1 437 ? 137.648 151.721 159.696 1.00 80.30  ? 437 LEU B CD1 1 
ATOM   6943  C CD2 . LEU B 1 437 ? 138.999 152.487 157.744 1.00 80.30  ? 437 LEU B CD2 1 
ATOM   6944  N N   . GLY B 1 438 ? 137.697 157.537 159.276 1.00 80.37  ? 438 GLY B N   1 
ATOM   6945  C CA  . GLY B 1 438 ? 136.917 158.730 159.007 1.00 80.37  ? 438 GLY B CA  1 
ATOM   6946  C C   . GLY B 1 438 ? 137.457 159.520 157.833 1.00 80.37  ? 438 GLY B C   1 
ATOM   6947  O O   . GLY B 1 438 ? 136.708 159.906 156.935 1.00 80.37  ? 438 GLY B O   1 
ATOM   6948  N N   . TYR B 1 439 ? 138.766 159.753 157.816 1.00 78.63  ? 439 TYR B N   1 
ATOM   6949  C CA  . TYR B 1 439 ? 139.362 160.490 156.712 1.00 78.63  ? 439 TYR B CA  1 
ATOM   6950  C C   . TYR B 1 439 ? 139.391 159.692 155.421 1.00 78.63  ? 439 TYR B C   1 
ATOM   6951  O O   . TYR B 1 439 ? 139.401 160.292 154.344 1.00 78.63  ? 439 TYR B O   1 
ATOM   6952  C CB  . TYR B 1 439 ? 140.770 160.933 157.078 1.00 78.63  ? 439 TYR B CB  1 
ATOM   6953  C CG  . TYR B 1 439 ? 140.808 162.042 158.082 1.00 78.63  ? 439 TYR B CG  1 
ATOM   6954  C CD1 . TYR B 1 439 ? 140.648 163.356 157.687 1.00 78.63  ? 439 TYR B CD1 1 
ATOM   6955  C CD2 . TYR B 1 439 ? 141.000 161.780 159.423 1.00 78.63  ? 439 TYR B CD2 1 
ATOM   6956  C CE1 . TYR B 1 439 ? 140.685 164.377 158.594 1.00 78.63  ? 439 TYR B CE1 1 
ATOM   6957  C CE2 . TYR B 1 439 ? 141.037 162.797 160.340 1.00 78.63  ? 439 TYR B CE2 1 
ATOM   6958  C CZ  . TYR B 1 439 ? 140.880 164.090 159.916 1.00 78.63  ? 439 TYR B CZ  1 
ATOM   6959  O OH  . TYR B 1 439 ? 140.916 165.110 160.826 1.00 78.63  ? 439 TYR B OH  1 
ATOM   6960  N N   . CYS B 1 440 ? 139.405 158.365 155.495 1.00 77.24  ? 440 CYS B N   1 
ATOM   6961  C CA  . CYS B 1 440 ? 139.386 157.572 154.280 1.00 77.24  ? 440 CYS B CA  1 
ATOM   6962  C C   . CYS B 1 440 ? 138.054 157.642 153.562 1.00 77.24  ? 440 CYS B C   1 
ATOM   6963  O O   . CYS B 1 440 ? 138.037 157.627 152.334 1.00 77.24  ? 440 CYS B O   1 
ATOM   6964  C CB  . CYS B 1 440 ? 139.724 156.118 154.585 1.00 77.24  ? 440 CYS B CB  1 
ATOM   6965  S SG  . CYS B 1 440 ? 141.424 155.863 155.096 1.00 77.24  ? 440 CYS B SG  1 
ATOM   6966  N N   . PHE B 1 441 ? 136.943 157.735 154.281 1.00 78.41  ? 441 PHE B N   1 
ATOM   6967  C CA  . PHE B 1 441 ? 135.668 157.908 153.601 1.00 78.41  ? 441 PHE B CA  1 
ATOM   6968  C C   . PHE B 1 441 ? 135.422 159.343 153.193 1.00 78.41  ? 441 PHE B C   1 
ATOM   6969  O O   . PHE B 1 441 ? 134.727 159.581 152.201 1.00 78.41  ? 441 PHE B O   1 
ATOM   6970  C CB  . PHE B 1 441 ? 134.493 157.439 154.463 1.00 78.41  ? 441 PHE B CB  1 
ATOM   6971  C CG  . PHE B 1 441 ? 134.424 155.963 154.636 1.00 78.41  ? 441 PHE B CG  1 
ATOM   6972  C CD1 . PHE B 1 441 ? 134.149 155.152 153.560 1.00 78.41  ? 441 PHE B CD1 1 
ATOM   6973  C CD2 . PHE B 1 441 ? 134.559 155.392 155.879 1.00 78.41  ? 441 PHE B CD2 1 
ATOM   6974  C CE1 . PHE B 1 441 ? 134.078 153.793 153.716 1.00 78.41  ? 441 PHE B CE1 1 
ATOM   6975  C CE2 . PHE B 1 441 ? 134.488 154.033 156.039 1.00 78.41  ? 441 PHE B CE2 1 
ATOM   6976  C CZ  . PHE B 1 441 ? 134.242 153.237 154.960 1.00 78.41  ? 441 PHE B CZ  1 
ATOM   6977  N N   . CYS B 1 442 ? 135.971 160.303 153.934 1.00 81.87  ? 442 CYS B N   1 
ATOM   6978  C CA  . CYS B 1 442 ? 135.747 161.697 153.584 1.00 81.87  ? 442 CYS B CA  1 
ATOM   6979  C C   . CYS B 1 442 ? 136.578 162.106 152.380 1.00 81.87  ? 442 CYS B C   1 
ATOM   6980  O O   . CYS B 1 442 ? 136.101 162.836 151.506 1.00 81.87  ? 442 CYS B O   1 
ATOM   6981  C CB  . CYS B 1 442 ? 136.079 162.588 154.765 1.00 81.87  ? 442 CYS B CB  1 
ATOM   6982  S SG  . CYS B 1 442 ? 135.813 164.325 154.448 1.00 81.87  ? 442 CYS B SG  1 
ATOM   6983  N N   . GLY B 1 443 ? 137.827 161.659 152.323 1.00 77.01  ? 443 GLY B N   1 
ATOM   6984  C CA  . GLY B 1 443 ? 138.681 162.023 151.214 1.00 77.01  ? 443 GLY B CA  1 
ATOM   6985  C C   . GLY B 1 443 ? 138.384 161.302 149.928 1.00 77.01  ? 443 GLY B C   1 
ATOM   6986  O O   . GLY B 1 443 ? 138.807 161.763 148.868 1.00 77.01  ? 443 GLY B O   1 
ATOM   6987  N N   . TRP B 1 444 ? 137.654 160.196 149.989 1.00 73.77  ? 444 TRP B N   1 
ATOM   6988  C CA  . TRP B 1 444 ? 137.361 159.421 148.796 1.00 73.77  ? 444 TRP B CA  1 
ATOM   6989  C C   . TRP B 1 444 ? 136.244 160.025 147.967 1.00 73.77  ? 444 TRP B C   1 
ATOM   6990  O O   . TRP B 1 444 ? 136.184 159.793 146.757 1.00 73.77  ? 444 TRP B O   1 
ATOM   6991  C CB  . TRP B 1 444 ? 137.023 157.986 149.195 1.00 73.77  ? 444 TRP B CB  1 
ATOM   6992  C CG  . TRP B 1 444 ? 136.667 157.111 148.072 1.00 73.77  ? 444 TRP B CG  1 
ATOM   6993  C CD1 . TRP B 1 444 ? 137.402 156.878 146.966 1.00 73.77  ? 444 TRP B CD1 1 
ATOM   6994  C CD2 . TRP B 1 444 ? 135.496 156.312 147.956 1.00 73.77  ? 444 TRP B CD2 1 
ATOM   6995  N NE1 . TRP B 1 444 ? 136.753 156.000 146.143 1.00 73.77  ? 444 TRP B NE1 1 
ATOM   6996  C CE2 . TRP B 1 444 ? 135.577 155.633 146.737 1.00 73.77  ? 444 TRP B CE2 1 
ATOM   6997  C CE3 . TRP B 1 444 ? 134.384 156.106 148.765 1.00 73.77  ? 444 TRP B CE3 1 
ATOM   6998  C CZ2 . TRP B 1 444 ? 134.590 154.768 146.307 1.00 73.77  ? 444 TRP B CZ2 1 
ATOM   6999  C CZ3 . TRP B 1 444 ? 133.408 155.256 148.337 1.00 73.77  ? 444 TRP B CZ3 1 
ATOM   7000  C CH2 . TRP B 1 444 ? 133.513 154.594 147.123 1.00 73.77  ? 444 TRP B CH2 1 
ATOM   7001  N N   . ILE B 1 445 ? 135.371 160.820 148.572 1.00 73.95  ? 445 ILE B N   1 
ATOM   7002  C CA  . ILE B 1 445 ? 134.270 161.433 147.850 1.00 73.95  ? 445 ILE B CA  1 
ATOM   7003  C C   . ILE B 1 445 ? 134.622 162.830 147.376 1.00 73.95  ? 445 ILE B C   1 
ATOM   7004  O O   . ILE B 1 445 ? 134.375 163.172 146.220 1.00 73.95  ? 445 ILE B O   1 
ATOM   7005  C CB  . ILE B 1 445 ? 132.987 161.429 148.706 1.00 73.95  ? 445 ILE B CB  1 
ATOM   7006  C CG1 . ILE B 1 445 ? 132.307 160.081 148.596 1.00 73.95  ? 445 ILE B CG1 1 
ATOM   7007  C CG2 . ILE B 1 445 ? 132.015 162.493 148.298 1.00 73.95  ? 445 ILE B CG2 1 
ATOM   7008  C CD1 . ILE B 1 445 ? 132.728 159.139 149.616 1.00 73.95  ? 445 ILE B CD1 1 
ATOM   7009  N N   . VAL B 1 446 ? 135.239 163.628 148.241 1.00 76.81  ? 446 VAL B N   1 
ATOM   7010  C CA  . VAL B 1 446 ? 135.543 165.003 147.882 1.00 76.81  ? 446 VAL B CA  1 
ATOM   7011  C C   . VAL B 1 446 ? 136.644 165.055 146.839 1.00 76.81  ? 446 VAL B C   1 
ATOM   7012  O O   . VAL B 1 446 ? 136.486 165.665 145.779 1.00 76.81  ? 446 VAL B O   1 
ATOM   7013  C CB  . VAL B 1 446 ? 135.941 165.804 149.124 1.00 76.81  ? 446 VAL B CB  1 
ATOM   7014  C CG1 . VAL B 1 446 ? 136.218 167.209 148.709 1.00 76.81  ? 446 VAL B CG1 1 
ATOM   7015  C CG2 . VAL B 1 446 ? 134.867 165.740 150.168 1.00 76.81  ? 446 VAL B CG2 1 
ATOM   7016  N N   . LEU B 1 447 ? 137.770 164.413 147.117 1.00 77.26  ? 447 LEU B N   1 
ATOM   7017  C CA  . LEU B 1 447 ? 138.934 164.466 146.255 1.00 77.26  ? 447 LEU B CA  1 
ATOM   7018  C C   . LEU B 1 447 ? 138.950 163.336 145.246 1.00 77.26  ? 447 LEU B C   1 
ATOM   7019  O O   . LEU B 1 447 ? 139.919 163.192 144.501 1.00 77.26  ? 447 LEU B O   1 
ATOM   7020  C CB  . LEU B 1 447 ? 140.187 164.425 147.110 1.00 77.26  ? 447 LEU B CB  1 
ATOM   7021  C CG  . LEU B 1 447 ? 140.246 165.580 148.096 1.00 77.26  ? 447 LEU B CG  1 
ATOM   7022  C CD1 . LEU B 1 447 ? 141.383 165.432 149.071 1.00 77.26  ? 447 LEU B CD1 1 
ATOM   7023  C CD2 . LEU B 1 447 ? 140.394 166.848 147.320 1.00 77.26  ? 447 LEU B CD2 1 
ATOM   7024  N N   . GLY B 1 448 ? 137.905 162.530 145.219 1.00 77.53  ? 448 GLY B N   1 
ATOM   7025  C CA  . GLY B 1 448 ? 137.778 161.421 144.305 1.00 77.53  ? 448 GLY B CA  1 
ATOM   7026  C C   . GLY B 1 448 ? 137.713 161.739 142.821 1.00 77.53  ? 448 GLY B C   1 
ATOM   7027  O O   . GLY B 1 448 ? 138.473 161.166 142.038 1.00 77.53  ? 448 GLY B O   1 
ATOM   7028  N N   . PRO B 1 449 ? 136.777 162.593 142.385 1.00 78.03  ? 449 PRO B N   1 
ATOM   7029  C CA  . PRO B 1 449 ? 136.662 162.842 140.944 1.00 78.03  ? 449 PRO B CA  1 
ATOM   7030  C C   . PRO B 1 449 ? 137.832 163.584 140.345 1.00 78.03  ? 449 PRO B C   1 
ATOM   7031  O O   . PRO B 1 449 ? 138.144 163.371 139.169 1.00 78.03  ? 449 PRO B O   1 
ATOM   7032  C CB  . PRO B 1 449 ? 135.383 163.677 140.838 1.00 78.03  ? 449 PRO B CB  1 
ATOM   7033  C CG  . PRO B 1 449 ? 134.620 163.328 142.005 1.00 78.03  ? 449 PRO B CG  1 
ATOM   7034  C CD  . PRO B 1 449 ? 135.599 163.126 143.089 1.00 78.03  ? 449 PRO B CD  1 
ATOM   7035  N N   . TYR B 1 450 ? 138.490 164.441 141.097 1.00 83.20  ? 450 TYR B N   1 
ATOM   7036  C CA  . TYR B 1 450 ? 139.424 165.365 140.488 1.00 83.20  ? 450 TYR B CA  1 
ATOM   7037  C C   . TYR B 1 450 ? 140.843 164.831 140.397 1.00 83.20  ? 450 TYR B C   1 
ATOM   7038  O O   . TYR B 1 450 ? 141.674 165.455 139.735 1.00 83.20  ? 450 TYR B O   1 
ATOM   7039  C CB  . TYR B 1 450 ? 139.415 166.679 141.259 1.00 83.20  ? 450 TYR B CB  1 
ATOM   7040  C CG  . TYR B 1 450 ? 138.089 167.383 141.183 1.00 83.20  ? 450 TYR B CG  1 
ATOM   7041  C CD1 . TYR B 1 450 ? 137.739 168.121 140.066 1.00 83.20  ? 450 TYR B CD1 1 
ATOM   7042  C CD2 . TYR B 1 450 ? 137.182 167.302 142.224 1.00 83.20  ? 450 TYR B CD2 1 
ATOM   7043  C CE1 . TYR B 1 450 ? 136.529 168.762 139.989 1.00 83.20  ? 450 TYR B CE1 1 
ATOM   7044  C CE2 . TYR B 1 450 ? 135.968 167.940 142.159 1.00 83.20  ? 450 TYR B CE2 1 
ATOM   7045  C CZ  . TYR B 1 450 ? 135.646 168.668 141.038 1.00 83.20  ? 450 TYR B CZ  1 
ATOM   7046  O OH  . TYR B 1 450 ? 134.433 169.309 140.964 1.00 83.20  ? 450 TYR B OH  1 
ATOM   7047  N N   . HIS B 1 451 ? 141.159 163.708 141.030 1.00 87.28  ? 451 HIS B N   1 
ATOM   7048  C CA  . HIS B 1 451 ? 142.553 163.308 141.125 1.00 87.28  ? 451 HIS B CA  1 
ATOM   7049  C C   . HIS B 1 451 ? 142.685 161.834 140.784 1.00 87.28  ? 451 HIS B C   1 
ATOM   7050  O O   . HIS B 1 451 ? 141.737 161.185 140.336 1.00 87.28  ? 451 HIS B O   1 
ATOM   7051  C CB  . HIS B 1 451 ? 143.104 163.644 142.509 1.00 87.28  ? 451 HIS B CB  1 
ATOM   7052  C CG  . HIS B 1 451 ? 143.046 165.102 142.816 1.00 87.28  ? 451 HIS B CG  1 
ATOM   7053  N ND1 . HIS B 1 451 ? 143.858 166.021 142.193 1.00 87.28  ? 451 HIS B ND1 1 
ATOM   7054  C CD2 . HIS B 1 451 ? 142.242 165.807 143.643 1.00 87.28  ? 451 HIS B CD2 1 
ATOM   7055  C CE1 . HIS B 1 451 ? 143.570 167.230 142.638 1.00 87.28  ? 451 HIS B CE1 1 
ATOM   7056  N NE2 . HIS B 1 451 ? 142.596 167.128 143.524 1.00 87.28  ? 451 HIS B NE2 1 
ATOM   7057  N N   . VAL B 1 452 ? 143.892 161.310 140.976 1.00 81.86  ? 452 VAL B N   1 
ATOM   7058  C CA  . VAL B 1 452 ? 144.245 159.973 140.540 1.00 81.86  ? 452 VAL B CA  1 
ATOM   7059  C C   . VAL B 1 452 ? 144.576 159.070 141.717 1.00 81.86  ? 452 VAL B C   1 
ATOM   7060  O O   . VAL B 1 452 ? 144.130 157.918 141.766 1.00 81.86  ? 452 VAL B O   1 
ATOM   7061  C CB  . VAL B 1 452 ? 145.420 160.021 139.544 1.00 81.86  ? 452 VAL B CB  1 
ATOM   7062  C CG1 . VAL B 1 452 ? 145.759 158.640 139.041 1.00 81.86  ? 452 VAL B CG1 1 
ATOM   7063  C CG2 . VAL B 1 452 ? 145.091 160.936 138.382 1.00 81.86  ? 452 VAL B CG2 1 
ATOM   7064  N N   . LYS B 1 453 ? 145.326 159.584 142.694 1.00 74.31  ? 453 LYS B N   1 
ATOM   7065  C CA  . LYS B 1 453 ? 145.691 158.785 143.856 1.00 74.31  ? 453 LYS B CA  1 
ATOM   7066  C C   . LYS B 1 453 ? 144.494 158.468 144.735 1.00 74.31  ? 453 LYS B C   1 
ATOM   7067  O O   . LYS B 1 453 ? 144.502 157.460 145.442 1.00 74.31  ? 453 LYS B O   1 
ATOM   7068  C CB  . LYS B 1 453 ? 146.741 159.505 144.693 1.00 74.31  ? 453 LYS B CB  1 
ATOM   7069  C CG  . LYS B 1 453 ? 148.095 159.643 144.050 1.00 74.31  ? 453 LYS B CG  1 
ATOM   7070  C CD  . LYS B 1 453 ? 149.054 160.319 145.011 1.00 74.31  ? 453 LYS B CD  1 
ATOM   7071  C CE  . LYS B 1 453 ? 150.461 160.382 144.458 1.00 74.31  ? 453 LYS B CE  1 
ATOM   7072  N NZ  . LYS B 1 453 ? 150.563 161.272 143.268 1.00 74.31  ? 453 LYS B NZ  1 
ATOM   7073  N N   . PHE B 1 454 ? 143.456 159.294 144.702 1.00 74.53  ? 454 PHE B N   1 
ATOM   7074  C CA  . PHE B 1 454 ? 142.333 159.174 145.625 1.00 74.53  ? 454 PHE B CA  1 
ATOM   7075  C C   . PHE B 1 454 ? 141.119 158.542 144.975 1.00 74.53  ? 454 PHE B C   1 
ATOM   7076  O O   . PHE B 1 454 ? 139.999 158.998 145.193 1.00 74.53  ? 454 PHE B O   1 
ATOM   7077  C CB  . PHE B 1 454 ? 141.974 160.537 146.194 1.00 74.53  ? 454 PHE B CB  1 
ATOM   7078  C CG  . PHE B 1 454 ? 142.938 161.044 147.215 1.00 74.53  ? 454 PHE B CG  1 
ATOM   7079  C CD1 . PHE B 1 454 ? 143.770 160.186 147.891 1.00 74.53  ? 454 PHE B CD1 1 
ATOM   7080  C CD2 . PHE B 1 454 ? 143.023 162.388 147.486 1.00 74.53  ? 454 PHE B CD2 1 
ATOM   7081  C CE1 . PHE B 1 454 ? 144.648 160.668 148.828 1.00 74.53  ? 454 PHE B CE1 1 
ATOM   7082  C CE2 . PHE B 1 454 ? 143.898 162.864 148.418 1.00 74.53  ? 454 PHE B CE2 1 
ATOM   7083  C CZ  . PHE B 1 454 ? 144.712 162.005 149.088 1.00 74.53  ? 454 PHE B CZ  1 
ATOM   7084  N N   . ARG B 1 455 ? 141.295 157.512 144.154 1.00 76.02  ? 455 ARG B N   1 
ATOM   7085  C CA  . ARG B 1 455 ? 140.184 157.007 143.361 1.00 76.02  ? 455 ARG B CA  1 
ATOM   7086  C C   . ARG B 1 455 ? 139.432 155.861 144.028 1.00 76.02  ? 455 ARG B C   1 
ATOM   7087  O O   . ARG B 1 455 ? 138.202 155.890 144.080 1.00 76.02  ? 455 ARG B O   1 
ATOM   7088  C CB  . ARG B 1 455 ? 140.688 156.583 141.987 1.00 76.02  ? 455 ARG B CB  1 
ATOM   7089  C CG  . ARG B 1 455 ? 139.578 156.258 141.040 1.00 76.02  ? 455 ARG B CG  1 
ATOM   7090  C CD  . ARG B 1 455 ? 138.687 157.469 140.829 1.00 76.02  ? 455 ARG B CD  1 
ATOM   7091  N NE  . ARG B 1 455 ? 139.428 158.632 140.364 1.00 76.02  ? 455 ARG B NE  1 
ATOM   7092  C CZ  . ARG B 1 455 ? 139.741 158.863 139.095 1.00 76.02  ? 455 ARG B CZ  1 
ATOM   7093  N NH1 . ARG B 1 455 ? 139.382 158.005 138.155 1.00 76.02  ? 455 ARG B NH1 1 
ATOM   7094  N NH2 . ARG B 1 455 ? 140.417 159.951 138.763 1.00 76.02  ? 455 ARG B NH2 1 
ATOM   7095  N N   . SER B 1 456 ? 140.127 154.848 144.532 1.00 79.71  ? 456 SER B N   1 
ATOM   7096  C CA  . SER B 1 456 ? 139.469 153.777 145.264 1.00 79.71  ? 456 SER B CA  1 
ATOM   7097  C C   . SER B 1 456 ? 139.936 153.776 146.712 1.00 79.71  ? 456 SER B C   1 
ATOM   7098  O O   . SER B 1 456 ? 140.915 154.432 147.067 1.00 79.71  ? 456 SER B O   1 
ATOM   7099  C CB  . SER B 1 456 ? 139.739 152.428 144.611 1.00 79.71  ? 456 SER B CB  1 
ATOM   7100  O OG  . SER B 1 456 ? 141.092 152.064 144.767 1.00 79.71  ? 456 SER B OG  1 
ATOM   7101  N N   . LEU B 1 457 ? 139.231 153.019 147.560 1.00 77.02  ? 457 LEU B N   1 
ATOM   7102  C CA  . LEU B 1 457 ? 139.567 152.987 148.981 1.00 77.02  ? 457 LEU B CA  1 
ATOM   7103  C C   . LEU B 1 457 ? 140.900 152.305 149.228 1.00 77.02  ? 457 LEU B C   1 
ATOM   7104  O O   . LEU B 1 457 ? 141.637 152.688 150.141 1.00 77.02  ? 457 LEU B O   1 
ATOM   7105  C CB  . LEU B 1 457 ? 138.494 152.274 149.795 1.00 77.02  ? 457 LEU B CB  1 
ATOM   7106  C CG  . LEU B 1 457 ? 137.230 153.021 150.196 1.00 77.02  ? 457 LEU B CG  1 
ATOM   7107  C CD1 . LEU B 1 457 ? 136.250 153.042 149.058 1.00 77.02  ? 457 LEU B CD1 1 
ATOM   7108  C CD2 . LEU B 1 457 ? 136.605 152.404 151.429 1.00 77.02  ? 457 LEU B CD2 1 
ATOM   7109  N N   . SER B 1 458 ? 141.230 151.311 148.417 1.00 82.73  ? 458 SER B N   1 
ATOM   7110  C CA  . SER B 1 458 ? 142.501 150.625 148.543 1.00 82.73  ? 458 SER B CA  1 
ATOM   7111  C C   . SER B 1 458 ? 143.682 151.500 148.178 1.00 82.73  ? 458 SER B C   1 
ATOM   7112  O O   . SER B 1 458 ? 144.805 151.154 148.535 1.00 82.73  ? 458 SER B O   1 
ATOM   7113  C CB  . SER B 1 458 ? 142.515 149.392 147.660 1.00 82.73  ? 458 SER B CB  1 
ATOM   7114  O OG  . SER B 1 458 ? 142.475 149.789 146.307 1.00 82.73  ? 458 SER B OG  1 
ATOM   7115  N N   . MET B 1 459 ? 143.471 152.598 147.460 1.00 78.81  ? 459 MET B N   1 
ATOM   7116  C CA  . MET B 1 459 ? 144.535 153.568 147.268 1.00 78.81  ? 459 MET B CA  1 
ATOM   7117  C C   . MET B 1 459 ? 144.538 154.640 148.337 1.00 78.81  ? 459 MET B C   1 
ATOM   7118  O O   . MET B 1 459 ? 145.612 155.106 148.725 1.00 78.81  ? 459 MET B O   1 
ATOM   7119  C CB  . MET B 1 459 ? 144.418 154.246 145.908 1.00 78.81  ? 459 MET B CB  1 
ATOM   7120  C CG  . MET B 1 459 ? 144.727 153.375 144.729 1.00 78.81  ? 459 MET B CG  1 
ATOM   7121  S SD  . MET B 1 459 ? 144.588 154.318 143.204 1.00 78.81  ? 459 MET B SD  1 
ATOM   7122  C CE  . MET B 1 459 ? 144.824 153.033 141.991 1.00 78.81  ? 459 MET B CE  1 
ATOM   7123  N N   . VAL B 1 460 ? 143.361 155.048 148.808 1.00 72.60  ? 460 VAL B N   1 
ATOM   7124  C CA  . VAL B 1 460 ? 143.288 156.095 149.818 1.00 72.60  ? 460 VAL B CA  1 
ATOM   7125  C C   . VAL B 1 460 ? 143.847 155.594 151.136 1.00 72.60  ? 460 VAL B C   1 
ATOM   7126  O O   . VAL B 1 460 ? 144.571 156.311 151.832 1.00 72.60  ? 460 VAL B O   1 
ATOM   7127  C CB  . VAL B 1 460 ? 141.843 156.596 149.950 1.00 72.60  ? 460 VAL B CB  1 
ATOM   7128  C CG1 . VAL B 1 460 ? 141.703 157.567 151.083 1.00 72.60  ? 460 VAL B CG1 1 
ATOM   7129  C CG2 . VAL B 1 460 ? 141.451 157.278 148.692 1.00 72.60  ? 460 VAL B CG2 1 
ATOM   7130  N N   . SER B 1 461 ? 143.602 154.333 151.458 1.00 76.96  ? 461 SER B N   1 
ATOM   7131  C CA  . SER B 1 461 ? 144.221 153.739 152.630 1.00 76.96  ? 461 SER B CA  1 
ATOM   7132  C C   . SER B 1 461 ? 145.711 153.509 152.464 1.00 76.96  ? 461 SER B C   1 
ATOM   7133  O O   . SER B 1 461 ? 146.378 153.196 153.449 1.00 76.96  ? 461 SER B O   1 
ATOM   7134  C CB  . SER B 1 461 ? 143.558 152.414 152.968 1.00 76.96  ? 461 SER B CB  1 
ATOM   7135  O OG  . SER B 1 461 ? 144.229 151.802 154.050 1.00 76.96  ? 461 SER B OG  1 
ATOM   7136  N N   . GLU B 1 462 ? 146.240 153.622 151.251 1.00 76.96  ? 462 GLU B N   1 
ATOM   7137  C CA  . GLU B 1 462 ? 147.673 153.635 151.019 1.00 76.96  ? 462 GLU B CA  1 
ATOM   7138  C C   . GLU B 1 462 ? 148.226 155.040 150.903 1.00 76.96  ? 462 GLU B C   1 
ATOM   7139  O O   . GLU B 1 462 ? 149.303 155.316 151.431 1.00 76.96  ? 462 GLU B O   1 
ATOM   7140  C CB  . GLU B 1 462 ? 148.006 152.869 149.745 1.00 76.96  ? 462 GLU B CB  1 
ATOM   7141  C CG  . GLU B 1 462 ? 147.732 151.404 149.843 1.00 76.96  ? 462 GLU B CG  1 
ATOM   7142  C CD  . GLU B 1 462 ? 147.934 150.696 148.523 1.00 76.96  ? 462 GLU B CD  1 
ATOM   7143  O OE1 . GLU B 1 462 ? 148.183 151.383 147.515 1.00 76.96  ? 462 GLU B OE1 1 
ATOM   7144  O OE2 . GLU B 1 462 ? 147.839 149.454 148.485 1.00 76.96  ? 462 GLU B OE2 1 
ATOM   7145  N N   . CYS B 1 463 ? 147.508 155.938 150.230 1.00 71.90  ? 463 CYS B N   1 
ATOM   7146  C CA  . CYS B 1 463 ? 148.021 157.285 150.038 1.00 71.90  ? 463 CYS B CA  1 
ATOM   7147  C C   . CYS B 1 463 ? 147.957 158.095 151.316 1.00 71.90  ? 463 CYS B C   1 
ATOM   7148  O O   . CYS B 1 463 ? 148.721 159.047 151.472 1.00 71.90  ? 463 CYS B O   1 
ATOM   7149  C CB  . CYS B 1 463 ? 147.250 157.999 148.934 1.00 71.90  ? 463 CYS B CB  1 
ATOM   7150  S SG  . CYS B 1 463 ? 147.960 159.573 148.413 1.00 71.90  ? 463 CYS B SG  1 
ATOM   7151  N N   . LEU B 1 464 ? 147.067 157.744 152.237 1.00 71.84  ? 464 LEU B N   1 
ATOM   7152  C CA  . LEU B 1 464 ? 147.090 158.411 153.527 1.00 71.84  ? 464 LEU B CA  1 
ATOM   7153  C C   . LEU B 1 464 ? 148.068 157.760 154.481 1.00 71.84  ? 464 LEU B C   1 
ATOM   7154  O O   . LEU B 1 464 ? 148.715 158.457 155.261 1.00 71.84  ? 464 LEU B O   1 
ATOM   7155  C CB  . LEU B 1 464 ? 145.712 158.414 154.164 1.00 71.84  ? 464 LEU B CB  1 
ATOM   7156  C CG  . LEU B 1 464 ? 144.659 159.239 153.462 1.00 71.84  ? 464 LEU B CG  1 
ATOM   7157  C CD1 . LEU B 1 464 ? 143.360 159.025 154.167 1.00 71.84  ? 464 LEU B CD1 1 
ATOM   7158  C CD2 . LEU B 1 464 ? 145.046 160.679 153.505 1.00 71.84  ? 464 LEU B CD2 1 
ATOM   7159  N N   . PHE B 1 465 ? 148.182 156.440 154.450 1.00 71.10  ? 465 PHE B N   1 
ATOM   7160  C CA  . PHE B 1 465 ? 149.045 155.784 155.415 1.00 71.10  ? 465 PHE B CA  1 
ATOM   7161  C C   . PHE B 1 465 ? 150.509 155.974 155.077 1.00 71.10  ? 465 PHE B C   1 
ATOM   7162  O O   . PHE B 1 465 ? 151.343 156.049 155.982 1.00 71.10  ? 465 PHE B O   1 
ATOM   7163  C CB  . PHE B 1 465 ? 148.714 154.303 155.492 1.00 71.10  ? 465 PHE B CB  1 
ATOM   7164  C CG  . PHE B 1 465 ? 149.534 153.562 156.483 1.00 71.10  ? 465 PHE B CG  1 
ATOM   7165  C CD1 . PHE B 1 465 ? 149.280 153.676 157.832 1.00 71.10  ? 465 PHE B CD1 1 
ATOM   7166  C CD2 . PHE B 1 465 ? 150.563 152.754 156.067 1.00 71.10  ? 465 PHE B CD2 1 
ATOM   7167  C CE1 . PHE B 1 465 ? 150.044 152.991 158.740 1.00 71.10  ? 465 PHE B CE1 1 
ATOM   7168  C CE2 . PHE B 1 465 ? 151.317 152.086 156.967 1.00 71.10  ? 465 PHE B CE2 1 
ATOM   7169  C CZ  . PHE B 1 465 ? 151.065 152.195 158.304 1.00 71.10  ? 465 PHE B CZ  1 
ATOM   7170  N N   . SER B 1 466 ? 150.841 156.079 153.798 1.00 72.82  ? 466 SER B N   1 
ATOM   7171  C CA  . SER B 1 466 ? 152.202 156.417 153.418 1.00 72.82  ? 466 SER B CA  1 
ATOM   7172  C C   . SER B 1 466 ? 152.505 157.879 153.638 1.00 72.82  ? 466 SER B C   1 
ATOM   7173  O O   . SER B 1 466 ? 153.662 158.285 153.520 1.00 72.82  ? 466 SER B O   1 
ATOM   7174  C CB  . SER B 1 466 ? 152.453 156.075 151.955 1.00 72.82  ? 466 SER B CB  1 
ATOM   7175  O OG  . SER B 1 466 ? 151.676 156.898 151.113 1.00 72.82  ? 466 SER B OG  1 
ATOM   7176  N N   . LEU B 1 467 ? 151.495 158.673 153.948 1.00 66.85  ? 467 LEU B N   1 
ATOM   7177  C CA  . LEU B 1 467 ? 151.672 160.099 154.091 1.00 66.85  ? 467 LEU B CA  1 
ATOM   7178  C C   . LEU B 1 467 ? 152.011 160.495 155.512 1.00 66.85  ? 467 LEU B C   1 
ATOM   7179  O O   . LEU B 1 467 ? 152.799 161.418 155.698 1.00 66.85  ? 467 LEU B O   1 
ATOM   7180  C CB  . LEU B 1 467 ? 150.409 160.813 153.611 1.00 66.85  ? 467 LEU B CB  1 
ATOM   7181  C CG  . LEU B 1 467 ? 150.419 162.273 153.209 1.00 66.85  ? 467 LEU B CG  1 
ATOM   7182  C CD1 . LEU B 1 467 ? 149.447 162.444 152.078 1.00 66.85  ? 467 LEU B CD1 1 
ATOM   7183  C CD2 . LEU B 1 467 ? 149.996 163.135 154.350 1.00 66.85  ? 467 LEU B CD2 1 
ATOM   7184  N N   . ILE B 1 468 ? 151.489 159.790 156.518 1.00 69.91  ? 468 ILE B N   1 
ATOM   7185  C CA  . ILE B 1 468 ? 151.816 160.136 157.897 1.00 69.91  ? 468 ILE B CA  1 
ATOM   7186  C C   . ILE B 1 468 ? 153.227 159.720 158.275 1.00 69.91  ? 468 ILE B C   1 
ATOM   7187  O O   . ILE B 1 468 ? 153.780 160.246 159.244 1.00 69.91  ? 468 ILE B O   1 
ATOM   7188  C CB  . ILE B 1 468 ? 150.823 159.532 158.901 1.00 69.91  ? 468 ILE B CB  1 
ATOM   7189  C CG1 . ILE B 1 468 ? 150.915 158.018 158.932 1.00 69.91  ? 468 ILE B CG1 1 
ATOM   7190  C CG2 . ILE B 1 468 ? 149.422 159.911 158.539 1.00 69.91  ? 468 ILE B CG2 1 
ATOM   7191  C CD1 . ILE B 1 468 ? 150.123 157.419 160.044 1.00 69.91  ? 468 ILE B CD1 1 
ATOM   7192  N N   . ASN B 1 469 ? 153.834 158.801 157.536 1.00 70.28  ? 469 ASN B N   1 
ATOM   7193  C CA  . ASN B 1 469 ? 155.228 158.484 157.767 1.00 70.28  ? 469 ASN B CA  1 
ATOM   7194  C C   . ASN B 1 469 ? 156.145 159.469 157.073 1.00 70.28  ? 469 ASN B C   1 
ATOM   7195  O O   . ASN B 1 469 ? 157.345 159.476 157.347 1.00 70.28  ? 469 ASN B O   1 
ATOM   7196  C CB  . ASN B 1 469 ? 155.522 157.077 157.276 1.00 70.28  ? 469 ASN B CB  1 
ATOM   7197  C CG  . ASN B 1 469 ? 154.685 156.047 157.970 1.00 70.28  ? 469 ASN B CG  1 
ATOM   7198  O OD1 . ASN B 1 469 ? 154.484 156.102 159.175 1.00 70.28  ? 469 ASN B OD1 1 
ATOM   7199  N ND2 . ASN B 1 469 ? 154.162 155.111 157.204 1.00 70.28  ? 469 ASN B ND2 1 
ATOM   7200  N N   . GLY B 1 470 ? 155.608 160.292 156.182 1.00 75.08  ? 470 GLY B N   1 
ATOM   7201  C CA  . GLY B 1 470 ? 156.406 161.289 155.505 1.00 75.08  ? 470 GLY B CA  1 
ATOM   7202  C C   . GLY B 1 470 ? 156.959 160.833 154.176 1.00 75.08  ? 470 GLY B C   1 
ATOM   7203  O O   . GLY B 1 470 ? 158.172 160.871 153.962 1.00 75.08  ? 470 GLY B O   1 
ATOM   7204  N N   . ASP B 1 471 ? 156.089 160.385 153.277 1.00 76.01  ? 471 ASP B N   1 
ATOM   7205  C CA  . ASP B 1 471 ? 156.534 159.940 151.965 1.00 76.01  ? 471 ASP B CA  1 
ATOM   7206  C C   . ASP B 1 471 ? 155.442 160.222 150.950 1.00 76.01  ? 471 ASP B C   1 
ATOM   7207  O O   . ASP B 1 471 ? 154.277 159.906 151.202 1.00 76.01  ? 471 ASP B O   1 
ATOM   7208  C CB  . ASP B 1 471 ? 156.864 158.454 151.981 1.00 76.01  ? 471 ASP B CB  1 
ATOM   7209  C CG  . ASP B 1 471 ? 157.633 158.013 150.762 1.00 76.01  ? 471 ASP B CG  1 
ATOM   7210  O OD1 . ASP B 1 471 ? 157.942 158.845 149.887 1.00 76.01  ? 471 ASP B OD1 1 
ATOM   7211  O OD2 . ASP B 1 471 ? 157.936 156.813 150.683 1.00 76.01  ? 471 ASP B OD2 1 
ATOM   7212  N N   . ASP B 1 472 ? 155.847 160.749 149.794 1.00 84.94  ? 472 ASP B N   1 
ATOM   7213  C CA  . ASP B 1 472 ? 154.956 161.274 148.758 1.00 84.94  ? 472 ASP B CA  1 
ATOM   7214  C C   . ASP B 1 472 ? 153.955 162.250 149.356 1.00 84.94  ? 472 ASP B C   1 
ATOM   7215  O O   . ASP B 1 472 ? 152.742 162.060 149.308 1.00 84.94  ? 472 ASP B O   1 
ATOM   7216  C CB  . ASP B 1 472 ? 154.271 160.156 147.979 1.00 84.94  ? 472 ASP B CB  1 
ATOM   7217  C CG  . ASP B 1 472 ? 155.182 159.565 146.943 1.00 84.94  ? 472 ASP B CG  1 
ATOM   7218  O OD1 . ASP B 1 472 ? 156.034 160.320 146.434 1.00 84.94  ? 472 ASP B OD1 1 
ATOM   7219  O OD2 . ASP B 1 472 ? 155.071 158.365 146.640 1.00 84.94  ? 472 ASP B OD2 1 
ATOM   7220  N N   . MET B 1 473 ? 154.504 163.299 149.953 1.00 76.50  ? 473 MET B N   1 
ATOM   7221  C CA  . MET B 1 473 ? 153.699 164.348 150.548 1.00 76.50  ? 473 MET B CA  1 
ATOM   7222  C C   . MET B 1 473 ? 153.614 165.582 149.672 1.00 76.50  ? 473 MET B C   1 
ATOM   7223  O O   . MET B 1 473 ? 152.518 166.093 149.447 1.00 76.50  ? 473 MET B O   1 
ATOM   7224  C CB  . MET B 1 473 ? 154.264 164.733 151.908 1.00 76.50  ? 473 MET B CB  1 
ATOM   7225  C CG  . MET B 1 473 ? 153.359 165.602 152.721 1.00 76.50  ? 473 MET B CG  1 
ATOM   7226  S SD  . MET B 1 473 ? 154.170 166.019 154.257 1.00 76.50  ? 473 MET B SD  1 
ATOM   7227  C CE  . MET B 1 473 ? 154.305 164.401 154.983 1.00 76.50  ? 473 MET B CE  1 
ATOM   7228  N N   . PHE B 1 474 ? 154.745 166.068 149.159 1.00 74.62  ? 474 PHE B N   1 
ATOM   7229  C CA  . PHE B 1 474 ? 154.707 167.239 148.293 1.00 74.62  ? 474 PHE B CA  1 
ATOM   7230  C C   . PHE B 1 474 ? 154.076 166.926 146.947 1.00 74.62  ? 474 PHE B C   1 
ATOM   7231  O O   . PHE B 1 474 ? 153.481 167.814 146.331 1.00 74.62  ? 474 PHE B O   1 
ATOM   7232  C CB  . PHE B 1 474 ? 156.110 167.804 148.108 1.00 74.62  ? 474 PHE B CB  1 
ATOM   7233  C CG  . PHE B 1 474 ? 156.184 168.946 147.139 1.00 74.62  ? 474 PHE B CG  1 
ATOM   7234  C CD1 . PHE B 1 474 ? 155.681 170.185 147.469 1.00 74.62  ? 474 PHE B CD1 1 
ATOM   7235  C CD2 . PHE B 1 474 ? 156.753 168.775 145.895 1.00 74.62  ? 474 PHE B CD2 1 
ATOM   7236  C CE1 . PHE B 1 474 ? 155.740 171.225 146.578 1.00 74.62  ? 474 PHE B CE1 1 
ATOM   7237  C CE2 . PHE B 1 474 ? 156.815 169.813 145.005 1.00 74.62  ? 474 PHE B CE2 1 
ATOM   7238  C CZ  . PHE B 1 474 ? 156.307 171.037 145.348 1.00 74.62  ? 474 PHE B CZ  1 
ATOM   7239  N N   . VAL B 1 475 ? 154.164 165.679 146.489 1.00 74.16  ? 475 VAL B N   1 
ATOM   7240  C CA  . VAL B 1 475 ? 153.602 165.337 145.188 1.00 74.16  ? 475 VAL B CA  1 
ATOM   7241  C C   . VAL B 1 475 ? 152.082 165.388 145.236 1.00 74.16  ? 475 VAL B C   1 
ATOM   7242  O O   . VAL B 1 475 ? 151.436 165.787 144.262 1.00 74.16  ? 475 VAL B O   1 
ATOM   7243  C CB  . VAL B 1 475 ? 154.120 163.959 144.748 1.00 74.16  ? 475 VAL B CB  1 
ATOM   7244  C CG1 . VAL B 1 475 ? 153.652 163.617 143.349 1.00 74.16  ? 475 VAL B CG1 1 
ATOM   7245  C CG2 . VAL B 1 475 ? 155.626 163.922 144.841 1.00 74.16  ? 475 VAL B CG2 1 
ATOM   7246  N N   . THR B 1 476 ? 151.487 165.053 146.380 1.00 78.59  ? 476 THR B N   1 
ATOM   7247  C CA  . THR B 1 476 ? 150.041 165.150 146.509 1.00 78.59  ? 476 THR B CA  1 
ATOM   7248  C C   . THR B 1 476 ? 149.578 166.577 146.740 1.00 78.59  ? 476 THR B C   1 
ATOM   7249  O O   . THR B 1 476 ? 148.460 166.920 146.352 1.00 78.59  ? 476 THR B O   1 
ATOM   7250  C CB  . THR B 1 476 ? 149.551 164.278 147.647 1.00 78.59  ? 476 THR B CB  1 
ATOM   7251  O OG1 . THR B 1 476 ? 150.046 164.800 148.877 1.00 78.59  ? 476 THR B OG1 1 
ATOM   7252  C CG2 . THR B 1 476 ? 150.081 162.891 147.477 1.00 78.59  ? 476 THR B CG2 1 
ATOM   7253  N N   . PHE B 1 477 ? 150.392 167.411 147.377 1.00 80.43  ? 477 PHE B N   1 
ATOM   7254  C CA  . PHE B 1 477 ? 150.070 168.829 147.419 1.00 80.43  ? 477 PHE B CA  1 
ATOM   7255  C C   . PHE B 1 477 ? 150.210 169.490 146.061 1.00 80.43  ? 477 PHE B C   1 
ATOM   7256  O O   . PHE B 1 477 ? 149.449 170.404 145.743 1.00 80.43  ? 477 PHE B O   1 
ATOM   7257  C CB  . PHE B 1 477 ? 150.957 169.561 148.420 1.00 80.43  ? 477 PHE B CB  1 
ATOM   7258  C CG  . PHE B 1 477 ? 150.488 169.470 149.835 1.00 80.43  ? 477 PHE B CG  1 
ATOM   7259  C CD1 . PHE B 1 477 ? 149.482 170.300 150.291 1.00 80.43  ? 477 PHE B CD1 1 
ATOM   7260  C CD2 . PHE B 1 477 ? 151.068 168.587 150.714 1.00 80.43  ? 477 PHE B CD2 1 
ATOM   7261  C CE1 . PHE B 1 477 ? 149.060 170.240 151.588 1.00 80.43  ? 477 PHE B CE1 1 
ATOM   7262  C CE2 . PHE B 1 477 ? 150.645 168.519 152.011 1.00 80.43  ? 477 PHE B CE2 1 
ATOM   7263  C CZ  . PHE B 1 477 ? 149.639 169.345 152.449 1.00 80.43  ? 477 PHE B CZ  1 
ATOM   7264  N N   . ALA B 1 478 ? 151.169 169.055 145.255 1.00 81.16  ? 478 ALA B N   1 
ATOM   7265  C CA  . ALA B 1 478 ? 151.341 169.642 143.938 1.00 81.16  ? 478 ALA B CA  1 
ATOM   7266  C C   . ALA B 1 478 ? 150.245 169.237 142.972 1.00 81.16  ? 478 ALA B C   1 
ATOM   7267  O O   . ALA B 1 478 ? 149.935 169.997 142.052 1.00 81.16  ? 478 ALA B O   1 
ATOM   7268  C CB  . ALA B 1 478 ? 152.692 169.245 143.355 1.00 81.16  ? 478 ALA B CB  1 
ATOM   7269  N N   . ALA B 1 479 ? 149.651 168.065 143.156 1.00 83.63  ? 479 ALA B N   1 
ATOM   7270  C CA  . ALA B 1 479 ? 148.589 167.635 142.266 1.00 83.63  ? 479 ALA B CA  1 
ATOM   7271  C C   . ALA B 1 479 ? 147.278 168.343 142.545 1.00 83.63  ? 479 ALA B C   1 
ATOM   7272  O O   . ALA B 1 479 ? 146.401 168.351 141.679 1.00 83.63  ? 479 ALA B O   1 
ATOM   7273  C CB  . ALA B 1 479 ? 148.387 166.128 142.375 1.00 83.63  ? 479 ALA B CB  1 
ATOM   7274  N N   . MET B 1 480 ? 147.117 168.930 143.729 1.00 90.73  ? 480 MET B N   1 
ATOM   7275  C CA  . MET B 1 480 ? 145.887 169.657 144.005 1.00 90.73  ? 480 MET B CA  1 
ATOM   7276  C C   . MET B 1 480 ? 145.861 170.996 143.291 1.00 90.73  ? 480 MET B C   1 
ATOM   7277  O O   . MET B 1 480 ? 144.782 171.519 143.009 1.00 90.73  ? 480 MET B O   1 
ATOM   7278  C CB  . MET B 1 480 ? 145.716 169.898 145.500 1.00 90.73  ? 480 MET B CB  1 
ATOM   7279  C CG  . MET B 1 480 ? 145.632 168.668 146.385 1.00 90.73  ? 480 MET B CG  1 
ATOM   7280  S SD  . MET B 1 480 ? 144.322 167.487 146.024 1.00 90.73  ? 480 MET B SD  1 
ATOM   7281  C CE  . MET B 1 480 ? 145.278 166.058 145.507 1.00 90.73  ? 480 MET B CE  1 
ATOM   7282  N N   . GLN B 1 481 ? 147.025 171.568 142.989 1.00 91.54  ? 481 GLN B N   1 
ATOM   7283  C CA  . GLN B 1 481 ? 147.093 172.925 142.462 1.00 91.54  ? 481 GLN B CA  1 
ATOM   7284  C C   . GLN B 1 481 ? 146.957 172.992 140.954 1.00 91.54  ? 481 GLN B C   1 
ATOM   7285  O O   . GLN B 1 481 ? 147.362 173.989 140.348 1.00 91.54  ? 481 GLN B O   1 
ATOM   7286  C CB  . GLN B 1 481 ? 148.381 173.610 142.897 1.00 91.54  ? 481 GLN B CB  1 
ATOM   7287  C CG  . GLN B 1 481 ? 148.396 173.994 144.344 1.00 91.54  ? 481 GLN B CG  1 
ATOM   7288  C CD  . GLN B 1 481 ? 149.638 174.762 144.691 1.00 91.54  ? 481 GLN B CD  1 
ATOM   7289  O OE1 . GLN B 1 481 ? 150.509 174.953 143.845 1.00 91.54  ? 481 GLN B OE1 1 
ATOM   7290  N NE2 . GLN B 1 481 ? 149.733 175.213 145.934 1.00 91.54  ? 481 GLN B NE2 1 
ATOM   7291  N N   . ALA B 1 482 ? 146.410 171.962 140.328 1.00 99.42  ? 482 ALA B N   1 
ATOM   7292  C CA  . ALA B 1 482 ? 145.805 172.106 139.017 1.00 99.42  ? 482 ALA B CA  1 
ATOM   7293  C C   . ALA B 1 482 ? 144.338 172.474 139.127 1.00 99.42  ? 482 ALA B C   1 
ATOM   7294  O O   . ALA B 1 482 ? 143.638 172.507 138.114 1.00 99.42  ? 482 ALA B O   1 
ATOM   7295  C CB  . ALA B 1 482 ? 145.964 170.819 138.209 1.00 99.42  ? 482 ALA B CB  1 
ATOM   7296  N N   . GLN B 1 483 ? 143.866 172.743 140.342 1.00 102.67 ? 483 GLN B N   1 
ATOM   7297  C CA  . GLN B 1 483 ? 142.470 173.040 140.622 1.00 102.67 ? 483 GLN B CA  1 
ATOM   7298  C C   . GLN B 1 483 ? 142.305 174.360 141.355 1.00 102.67 ? 483 GLN B C   1 
ATOM   7299  O O   . GLN B 1 483 ? 141.288 174.567 142.019 1.00 102.67 ? 483 GLN B O   1 
ATOM   7300  C CB  . GLN B 1 483 ? 141.841 171.921 141.449 1.00 102.67 ? 483 GLN B CB  1 
ATOM   7301  C CG  . GLN B 1 483 ? 141.746 170.604 140.740 1.00 102.67 ? 483 GLN B CG  1 
ATOM   7302  C CD  . GLN B 1 483 ? 140.868 170.688 139.521 1.00 102.67 ? 483 GLN B CD  1 
ATOM   7303  O OE1 . GLN B 1 483 ? 141.348 170.601 138.393 1.00 102.67 ? 483 GLN B OE1 1 
ATOM   7304  N NE2 . GLN B 1 483 ? 139.570 170.872 139.735 1.00 102.67 ? 483 GLN B NE2 1 
ATOM   7305  N N   . GLN B 1 484 ? 143.289 175.249 141.284 1.00 103.51 ? 484 GLN B N   1 
ATOM   7306  C CA  . GLN B 1 484 ? 143.134 176.521 141.970 1.00 103.51 ? 484 GLN B CA  1 
ATOM   7307  C C   . GLN B 1 484 ? 142.234 177.462 141.185 1.00 103.51 ? 484 GLN B C   1 
ATOM   7308  O O   . GLN B 1 484 ? 141.661 178.390 141.766 1.00 103.51 ? 484 GLN B O   1 
ATOM   7309  C CB  . GLN B 1 484 ? 144.508 177.142 142.229 1.00 103.51 ? 484 GLN B CB  1 
ATOM   7310  C CG  . GLN B 1 484 ? 144.529 178.269 143.257 1.00 103.51 ? 484 GLN B CG  1 
ATOM   7311  C CD  . GLN B 1 484 ? 145.934 178.736 143.579 1.00 103.51 ? 484 GLN B CD  1 
ATOM   7312  O OE1 . GLN B 1 484 ? 146.905 178.261 142.994 1.00 103.51 ? 484 GLN B OE1 1 
ATOM   7313  N NE2 . GLN B 1 484 ? 146.050 179.666 144.519 1.00 103.51 ? 484 GLN B NE2 1 
ATOM   7314  N N   . GLY B 1 485 ? 142.075 177.223 139.886 1.00 112.32 ? 485 GLY B N   1 
ATOM   7315  C CA  . GLY B 1 485 ? 141.066 177.903 139.097 1.00 112.32 ? 485 GLY B CA  1 
ATOM   7316  C C   . GLY B 1 485 ? 139.826 177.054 138.890 1.00 112.32 ? 485 GLY B C   1 
ATOM   7317  O O   . GLY B 1 485 ? 138.698 177.532 139.041 1.00 112.32 ? 485 GLY B O   1 
ATOM   7318  N N   . ARG B 1 486 ? 140.030 175.787 138.541 1.00 107.48 ? 486 ARG B N   1 
ATOM   7319  C CA  . ARG B 1 486 ? 138.928 174.848 138.370 1.00 107.48 ? 486 ARG B CA  1 
ATOM   7320  C C   . ARG B 1 486 ? 138.367 174.476 139.733 1.00 107.48 ? 486 ARG B C   1 
ATOM   7321  O O   . ARG B 1 486 ? 139.001 173.714 140.470 1.00 107.48 ? 486 ARG B O   1 
ATOM   7322  C CB  . ARG B 1 486 ? 139.414 173.598 137.649 1.00 107.48 ? 486 ARG B CB  1 
ATOM   7323  C CG  . ARG B 1 486 ? 139.886 173.816 136.242 1.00 107.48 ? 486 ARG B CG  1 
ATOM   7324  C CD  . ARG B 1 486 ? 140.409 172.513 135.677 1.00 107.48 ? 486 ARG B CD  1 
ATOM   7325  N NE  . ARG B 1 486 ? 140.923 172.657 134.322 1.00 107.48 ? 486 ARG B NE  1 
ATOM   7326  C CZ  . ARG B 1 486 ? 141.535 171.684 133.658 1.00 107.48 ? 486 ARG B CZ  1 
ATOM   7327  N NH1 . ARG B 1 486 ? 141.716 170.505 134.233 1.00 107.48 ? 486 ARG B NH1 1 
ATOM   7328  N NH2 . ARG B 1 486 ? 141.975 171.888 132.425 1.00 107.48 ? 486 ARG B NH2 1 
ATOM   7329  N N   . SER B 1 487 ? 137.179 175.001 140.054 1.00 103.21 ? 487 SER B N   1 
ATOM   7330  C CA  . SER B 1 487 ? 136.401 174.658 141.249 1.00 103.21 ? 487 SER B CA  1 
ATOM   7331  C C   . SER B 1 487 ? 137.186 174.953 142.531 1.00 103.21 ? 487 SER B C   1 
ATOM   7332  O O   . SER B 1 487 ? 137.574 174.061 143.285 1.00 103.21 ? 487 SER B O   1 
ATOM   7333  C CB  . SER B 1 487 ? 135.939 173.197 141.209 1.00 103.21 ? 487 SER B CB  1 
ATOM   7334  O OG  . SER B 1 487 ? 135.102 172.968 140.092 1.00 103.21 ? 487 SER B OG  1 
ATOM   7335  N N   . SER B 1 488 ? 137.407 176.240 142.750 1.00 92.49  ? 488 SER B N   1 
ATOM   7336  C CA  . SER B 1 488 ? 138.165 176.778 143.875 1.00 92.49  ? 488 SER B CA  1 
ATOM   7337  C C   . SER B 1 488 ? 137.566 176.478 145.230 1.00 92.49  ? 488 SER B C   1 
ATOM   7338  O O   . SER B 1 488 ? 138.185 176.899 146.200 1.00 92.49  ? 488 SER B O   1 
ATOM   7339  C CB  . SER B 1 488 ? 138.316 178.286 143.718 1.00 92.49  ? 488 SER B CB  1 
ATOM   7340  O OG  . SER B 1 488 ? 138.980 178.835 144.837 1.00 92.49  ? 488 SER B OG  1 
ATOM   7341  N N   . LEU B 1 489 ? 136.423 175.826 145.414 1.00 87.82  ? 489 LEU B N   1 
ATOM   7342  C CA  . LEU B 1 489 ? 136.055 175.364 146.743 1.00 87.82  ? 489 LEU B CA  1 
ATOM   7343  C C   . LEU B 1 489 ? 136.768 174.073 147.102 1.00 87.82  ? 489 LEU B C   1 
ATOM   7344  O O   . LEU B 1 489 ? 137.214 173.904 148.242 1.00 87.82  ? 489 LEU B O   1 
ATOM   7345  C CB  . LEU B 1 489 ? 134.547 175.157 146.833 1.00 87.82  ? 489 LEU B CB  1 
ATOM   7346  C CG  . LEU B 1 489 ? 134.053 174.702 148.199 1.00 87.82  ? 489 LEU B CG  1 
ATOM   7347  C CD1 . LEU B 1 489 ? 134.379 175.742 149.239 1.00 87.82  ? 489 LEU B CD1 1 
ATOM   7348  C CD2 . LEU B 1 489 ? 132.575 174.449 148.145 1.00 87.82  ? 489 LEU B CD2 1 
ATOM   7349  N N   . VAL B 1 490 ? 136.902 173.172 146.130 1.00 88.18  ? 490 VAL B N   1 
ATOM   7350  C CA  . VAL B 1 490 ? 137.509 171.874 146.377 1.00 88.18  ? 490 VAL B CA  1 
ATOM   7351  C C   . VAL B 1 490 ? 138.992 172.029 146.667 1.00 88.18  ? 490 VAL B C   1 
ATOM   7352  O O   . VAL B 1 490 ? 139.572 171.239 147.421 1.00 88.18  ? 490 VAL B O   1 
ATOM   7353  C CB  . VAL B 1 490 ? 137.238 170.962 145.171 1.00 88.18  ? 490 VAL B CB  1 
ATOM   7354  C CG1 . VAL B 1 490 ? 137.741 169.558 145.408 1.00 88.18  ? 490 VAL B CG1 1 
ATOM   7355  C CG2 . VAL B 1 490 ? 135.766 170.943 144.878 1.00 88.18  ? 490 VAL B CG2 1 
ATOM   7356  N N   . TRP B 1 491 ? 139.621 173.067 146.113 1.00 87.92  ? 491 TRP B N   1 
ATOM   7357  C CA  . TRP B 1 491 ? 141.001 173.368 146.467 1.00 87.92  ? 491 TRP B CA  1 
ATOM   7358  C C   . TRP B 1 491 ? 141.113 173.770 147.924 1.00 87.92  ? 491 TRP B C   1 
ATOM   7359  O O   . TRP B 1 491 ? 141.962 173.251 148.654 1.00 87.92  ? 491 TRP B O   1 
ATOM   7360  C CB  . TRP B 1 491 ? 141.555 174.482 145.597 1.00 87.92  ? 491 TRP B CB  1 
ATOM   7361  C CG  . TRP B 1 491 ? 142.934 174.812 145.979 1.00 87.92  ? 491 TRP B CG  1 
ATOM   7362  C CD1 . TRP B 1 491 ? 144.038 174.075 145.733 1.00 87.92  ? 491 TRP B CD1 1 
ATOM   7363  C CD2 . TRP B 1 491 ? 143.361 175.931 146.753 1.00 87.92  ? 491 TRP B CD2 1 
ATOM   7364  N NE1 . TRP B 1 491 ? 145.142 174.682 146.266 1.00 87.92  ? 491 TRP B NE1 1 
ATOM   7365  C CE2 . TRP B 1 491 ? 144.749 175.824 146.905 1.00 87.92  ? 491 TRP B CE2 1 
ATOM   7366  C CE3 . TRP B 1 491 ? 142.705 177.020 147.320 1.00 87.92  ? 491 TRP B CE3 1 
ATOM   7367  C CZ2 . TRP B 1 491 ? 145.494 176.763 147.596 1.00 87.92  ? 491 TRP B CZ2 1 
ATOM   7368  C CZ3 . TRP B 1 491 ? 143.447 177.952 148.004 1.00 87.92  ? 491 TRP B CZ3 1 
ATOM   7369  C CH2 . TRP B 1 491 ? 144.825 177.819 148.137 1.00 87.92  ? 491 TRP B CH2 1 
ATOM   7370  N N   . LEU B 1 492 ? 140.255 174.689 148.367 1.00 84.18  ? 492 LEU B N   1 
ATOM   7371  C CA  . LEU B 1 492 ? 140.324 175.166 149.739 1.00 84.18  ? 492 LEU B CA  1 
ATOM   7372  C C   . LEU B 1 492 ? 139.920 174.092 150.732 1.00 84.18  ? 492 LEU B C   1 
ATOM   7373  O O   . LEU B 1 492 ? 140.365 174.134 151.880 1.00 84.18  ? 492 LEU B O   1 
ATOM   7374  C CB  . LEU B 1 492 ? 139.454 176.411 149.898 1.00 84.18  ? 492 LEU B CB  1 
ATOM   7375  C CG  . LEU B 1 492 ? 139.566 177.278 151.156 1.00 84.18  ? 492 LEU B CG  1 
ATOM   7376  C CD1 . LEU B 1 492 ? 139.355 178.726 150.773 1.00 84.18  ? 492 LEU B CD1 1 
ATOM   7377  C CD2 . LEU B 1 492 ? 138.552 176.901 152.224 1.00 84.18  ? 492 LEU B CD2 1 
ATOM   7378  N N   . PHE B 1 493 ? 139.107 173.124 150.320 1.00 81.33  ? 493 PHE B N   1 
ATOM   7379  C CA  . PHE B 1 493 ? 138.890 171.980 151.188 1.00 81.33  ? 493 PHE B CA  1 
ATOM   7380  C C   . PHE B 1 493 ? 140.122 171.100 151.250 1.00 81.33  ? 493 PHE B C   1 
ATOM   7381  O O   . PHE B 1 493 ? 140.423 170.538 152.305 1.00 81.33  ? 493 PHE B O   1 
ATOM   7382  C CB  . PHE B 1 493 ? 137.710 171.148 150.711 1.00 81.33  ? 493 PHE B CB  1 
ATOM   7383  C CG  . PHE B 1 493 ? 137.305 170.078 151.676 1.00 81.33  ? 493 PHE B CG  1 
ATOM   7384  C CD1 . PHE B 1 493 ? 136.537 170.392 152.778 1.00 81.33  ? 493 PHE B CD1 1 
ATOM   7385  C CD2 . PHE B 1 493 ? 137.702 168.772 151.497 1.00 81.33  ? 493 PHE B CD2 1 
ATOM   7386  C CE1 . PHE B 1 493 ? 136.161 169.423 153.669 1.00 81.33  ? 493 PHE B CE1 1 
ATOM   7387  C CE2 . PHE B 1 493 ? 137.325 167.799 152.380 1.00 81.33  ? 493 PHE B CE2 1 
ATOM   7388  C CZ  . PHE B 1 493 ? 136.557 168.125 153.469 1.00 81.33  ? 493 PHE B CZ  1 
ATOM   7389  N N   . SER B 1 494 ? 140.835 170.961 150.135 1.00 82.32  ? 494 SER B N   1 
ATOM   7390  C CA  . SER B 1 494 ? 141.972 170.056 150.085 1.00 82.32  ? 494 SER B CA  1 
ATOM   7391  C C   . SER B 1 494 ? 143.150 170.572 150.888 1.00 82.32  ? 494 SER B C   1 
ATOM   7392  O O   . SER B 1 494 ? 143.932 169.773 151.406 1.00 82.32  ? 494 SER B O   1 
ATOM   7393  C CB  . SER B 1 494 ? 142.392 169.833 148.642 1.00 82.32  ? 494 SER B CB  1 
ATOM   7394  O OG  . SER B 1 494 ? 142.859 171.044 148.097 1.00 82.32  ? 494 SER B OG  1 
ATOM   7395  N N   . GLN B 1 495 ? 143.296 171.889 151.003 1.00 83.38  ? 495 GLN B N   1 
ATOM   7396  C CA  . GLN B 1 495 ? 144.314 172.429 151.891 1.00 83.38  ? 495 GLN B CA  1 
ATOM   7397  C C   . GLN B 1 495 ? 143.951 172.187 153.343 1.00 83.38  ? 495 GLN B C   1 
ATOM   7398  O O   . GLN B 1 495 ? 144.828 171.923 154.167 1.00 83.38  ? 495 GLN B O   1 
ATOM   7399  C CB  . GLN B 1 495 ? 144.487 173.921 151.650 1.00 83.38  ? 495 GLN B CB  1 
ATOM   7400  C CG  . GLN B 1 495 ? 144.928 174.273 150.260 1.00 83.38  ? 495 GLN B CG  1 
ATOM   7401  C CD  . GLN B 1 495 ? 146.262 173.692 149.933 1.00 83.38  ? 495 GLN B CD  1 
ATOM   7402  O OE1 . GLN B 1 495 ? 146.372 172.777 149.124 1.00 83.38  ? 495 GLN B OE1 1 
ATOM   7403  N NE2 . GLN B 1 495 ? 147.296 174.213 150.569 1.00 83.38  ? 495 GLN B NE2 1 
ATOM   7404  N N   . LEU B 1 496 ? 142.672 172.262 153.669 1.00 77.77  ? 496 LEU B N   1 
ATOM   7405  C CA  . LEU B 1 496 ? 142.214 172.043 155.028 1.00 77.77  ? 496 LEU B CA  1 
ATOM   7406  C C   . LEU B 1 496 ? 142.084 170.568 155.363 1.00 77.77  ? 496 LEU B C   1 
ATOM   7407  O O   . LEU B 1 496 ? 142.216 170.194 156.530 1.00 77.77  ? 496 LEU B O   1 
ATOM   7408  C CB  . LEU B 1 496 ? 140.879 172.756 155.223 1.00 77.77  ? 496 LEU B CB  1 
ATOM   7409  C CG  . LEU B 1 496 ? 140.252 172.796 156.604 1.00 77.77  ? 496 LEU B CG  1 
ATOM   7410  C CD1 . LEU B 1 496 ? 141.210 173.450 157.557 1.00 77.77  ? 496 LEU B CD1 1 
ATOM   7411  C CD2 . LEU B 1 496 ? 138.971 173.582 156.529 1.00 77.77  ? 496 LEU B CD2 1 
ATOM   7412  N N   . TYR B 1 497 ? 141.850 169.725 154.362 1.00 75.85  ? 497 TYR B N   1 
ATOM   7413  C CA  . TYR B 1 497 ? 141.822 168.289 154.593 1.00 75.85  ? 497 TYR B CA  1 
ATOM   7414  C C   . TYR B 1 497 ? 143.212 167.764 154.903 1.00 75.85  ? 497 TYR B C   1 
ATOM   7415  O O   . TYR B 1 497 ? 143.408 167.040 155.881 1.00 75.85  ? 497 TYR B O   1 
ATOM   7416  C CB  . TYR B 1 497 ? 141.255 167.579 153.372 1.00 75.85  ? 497 TYR B CB  1 
ATOM   7417  C CG  . TYR B 1 497 ? 141.143 166.094 153.523 1.00 75.85  ? 497 TYR B CG  1 
ATOM   7418  C CD1 . TYR B 1 497 ? 140.089 165.533 154.208 1.00 75.85  ? 497 TYR B CD1 1 
ATOM   7419  C CD2 . TYR B 1 497 ? 142.097 165.252 152.981 1.00 75.85  ? 497 TYR B CD2 1 
ATOM   7420  C CE1 . TYR B 1 497 ? 139.985 164.180 154.345 1.00 75.85  ? 497 TYR B CE1 1 
ATOM   7421  C CE2 . TYR B 1 497 ? 142.005 163.900 153.120 1.00 75.85  ? 497 TYR B CE2 1 
ATOM   7422  C CZ  . TYR B 1 497 ? 140.947 163.371 153.801 1.00 75.85  ? 497 TYR B CZ  1 
ATOM   7423  O OH  . TYR B 1 497 ? 140.851 162.017 153.938 1.00 75.85  ? 497 TYR B OH  1 
ATOM   7424  N N   . LEU B 1 498 ? 144.191 168.120 154.074 1.00 74.81  ? 498 LEU B N   1 
ATOM   7425  C CA  . LEU B 1 498 ? 145.512 167.521 154.191 1.00 74.81  ? 498 LEU B CA  1 
ATOM   7426  C C   . LEU B 1 498 ? 146.273 168.061 155.391 1.00 74.81  ? 498 LEU B C   1 
ATOM   7427  O O   . LEU B 1 498 ? 146.852 167.278 156.144 1.00 74.81  ? 498 LEU B O   1 
ATOM   7428  C CB  . LEU B 1 498 ? 146.300 167.743 152.907 1.00 74.81  ? 498 LEU B CB  1 
ATOM   7429  C CG  . LEU B 1 498 ? 145.728 166.955 151.736 1.00 74.81  ? 498 LEU B CG  1 
ATOM   7430  C CD1 . LEU B 1 498 ? 146.377 167.337 150.434 1.00 74.81  ? 498 LEU B CD1 1 
ATOM   7431  C CD2 . LEU B 1 498 ? 145.920 165.488 151.998 1.00 74.81  ? 498 LEU B CD2 1 
ATOM   7432  N N   . TYR B 1 499 ? 146.270 169.385 155.597 1.00 73.15  ? 499 TYR B N   1 
ATOM   7433  C CA  . TYR B 1 499 ? 147.004 169.984 156.712 1.00 73.15  ? 499 TYR B CA  1 
ATOM   7434  C C   . TYR B 1 499 ? 146.495 169.528 158.066 1.00 73.15  ? 499 TYR B C   1 
ATOM   7435  O O   . TYR B 1 499 ? 147.285 169.366 158.992 1.00 73.15  ? 499 TYR B O   1 
ATOM   7436  C CB  . TYR B 1 499 ? 146.925 171.504 156.671 1.00 73.15  ? 499 TYR B CB  1 
ATOM   7437  C CG  . TYR B 1 499 ? 147.889 172.203 155.757 1.00 73.15  ? 499 TYR B CG  1 
ATOM   7438  C CD1 . TYR B 1 499 ? 149.008 171.569 155.271 1.00 73.15  ? 499 TYR B CD1 1 
ATOM   7439  C CD2 . TYR B 1 499 ? 147.686 173.522 155.406 1.00 73.15  ? 499 TYR B CD2 1 
ATOM   7440  C CE1 . TYR B 1 499 ? 149.887 172.226 154.451 1.00 73.15  ? 499 TYR B CE1 1 
ATOM   7441  C CE2 . TYR B 1 499 ? 148.557 174.182 154.585 1.00 73.15  ? 499 TYR B CE2 1 
ATOM   7442  C CZ  . TYR B 1 499 ? 149.652 173.529 154.113 1.00 73.15  ? 499 TYR B CZ  1 
ATOM   7443  O OH  . TYR B 1 499 ? 150.524 174.193 153.291 1.00 73.15  ? 499 TYR B OH  1 
ATOM   7444  N N   . SER B 1 500 ? 145.198 169.318 158.209 1.00 77.85  ? 500 SER B N   1 
ATOM   7445  C CA  . SER B 1 500 ? 144.642 168.930 159.492 1.00 77.85  ? 500 SER B CA  1 
ATOM   7446  C C   . SER B 1 500 ? 144.822 167.457 159.779 1.00 77.85  ? 500 SER B C   1 
ATOM   7447  O O   . SER B 1 500 ? 144.539 167.017 160.895 1.00 77.85  ? 500 SER B O   1 
ATOM   7448  C CB  . SER B 1 500 ? 143.160 169.274 159.548 1.00 77.85  ? 500 SER B CB  1 
ATOM   7449  O OG  . SER B 1 500 ? 142.449 168.504 158.601 1.00 77.85  ? 500 SER B OG  1 
ATOM   7450  N N   . PHE B 1 501 ? 145.272 166.687 158.798 1.00 73.42  ? 501 PHE B N   1 
ATOM   7451  C CA  . PHE B 1 501 ? 145.487 165.260 158.949 1.00 73.42  ? 501 PHE B CA  1 
ATOM   7452  C C   . PHE B 1 501 ? 146.943 164.912 159.191 1.00 73.42  ? 501 PHE B C   1 
ATOM   7453  O O   . PHE B 1 501 ? 147.249 164.154 160.108 1.00 73.42  ? 501 PHE B O   1 
ATOM   7454  C CB  . PHE B 1 501 ? 144.983 164.529 157.708 1.00 73.42  ? 501 PHE B CB  1 
ATOM   7455  C CG  . PHE B 1 501 ? 145.246 163.066 157.724 1.00 73.42  ? 501 PHE B CG  1 
ATOM   7456  C CD1 . PHE B 1 501 ? 144.540 162.237 158.567 1.00 73.42  ? 501 PHE B CD1 1 
ATOM   7457  C CD2 . PHE B 1 501 ? 146.181 162.515 156.875 1.00 73.42  ? 501 PHE B CD2 1 
ATOM   7458  C CE1 . PHE B 1 501 ? 144.772 160.890 158.575 1.00 73.42  ? 501 PHE B CE1 1 
ATOM   7459  C CE2 . PHE B 1 501 ? 146.416 161.165 156.880 1.00 73.42  ? 501 PHE B CE2 1 
ATOM   7460  C CZ  . PHE B 1 501 ? 145.713 160.351 157.732 1.00 73.42  ? 501 PHE B CZ  1 
ATOM   7461  N N   . ILE B 1 502 ? 147.849 165.454 158.381 1.00 72.74  ? 502 ILE B N   1 
ATOM   7462  C CA  . ILE B 1 502 ? 149.261 165.162 158.561 1.00 72.74  ? 502 ILE B CA  1 
ATOM   7463  C C   . ILE B 1 502 ? 149.796 165.827 159.820 1.00 72.74  ? 502 ILE B C   1 
ATOM   7464  O O   . ILE B 1 502 ? 150.680 165.282 160.489 1.00 72.74  ? 502 ILE B O   1 
ATOM   7465  C CB  . ILE B 1 502 ? 150.031 165.547 157.282 1.00 72.74  ? 502 ILE B CB  1 
ATOM   7466  C CG1 . ILE B 1 502 ? 151.499 165.208 157.404 1.00 72.74  ? 502 ILE B CG1 1 
ATOM   7467  C CG2 . ILE B 1 502 ? 149.925 166.969 156.984 1.00 72.74  ? 502 ILE B CG2 1 
ATOM   7468  C CD1 . ILE B 1 502 ? 151.711 163.794 157.605 1.00 72.74  ? 502 ILE B CD1 1 
ATOM   7469  N N   . SER B 1 503 ? 149.222 166.954 160.223 1.00 74.61  ? 503 SER B N   1 
ATOM   7470  C CA  . SER B 1 503 ? 149.599 167.588 161.473 1.00 74.61  ? 503 SER B CA  1 
ATOM   7471  C C   . SER B 1 503 ? 148.801 167.072 162.648 1.00 74.61  ? 503 SER B C   1 
ATOM   7472  O O   . SER B 1 503 ? 148.895 167.635 163.739 1.00 74.61  ? 503 SER B O   1 
ATOM   7473  C CB  . SER B 1 503 ? 149.444 169.099 161.374 1.00 74.61  ? 503 SER B CB  1 
ATOM   7474  O OG  . SER B 1 503 ? 149.682 169.702 162.628 1.00 74.61  ? 503 SER B OG  1 
ATOM   7475  N N   . LEU B 1 504 ? 148.002 166.035 162.452 1.00 74.67  ? 504 LEU B N   1 
ATOM   7476  C CA  . LEU B 1 504 ? 147.347 165.368 163.563 1.00 74.67  ? 504 LEU B CA  1 
ATOM   7477  C C   . LEU B 1 504 ? 148.047 164.092 163.975 1.00 74.67  ? 504 LEU B C   1 
ATOM   7478  O O   . LEU B 1 504 ? 148.300 163.893 165.160 1.00 74.67  ? 504 LEU B O   1 
ATOM   7479  C CB  . LEU B 1 504 ? 145.895 165.050 163.219 1.00 74.67  ? 504 LEU B CB  1 
ATOM   7480  C CG  . LEU B 1 504 ? 145.138 164.375 164.353 1.00 74.67  ? 504 LEU B CG  1 
ATOM   7481  C CD1 . LEU B 1 504 ? 145.060 165.297 165.530 1.00 74.67  ? 504 LEU B CD1 1 
ATOM   7482  C CD2 . LEU B 1 504 ? 143.757 163.984 163.913 1.00 74.67  ? 504 LEU B CD2 1 
ATOM   7483  N N   . PHE B 1 505 ? 148.397 163.236 163.025 1.00 75.43  ? 505 PHE B N   1 
ATOM   7484  C CA  . PHE B 1 505 ? 148.975 161.951 163.372 1.00 75.43  ? 505 PHE B CA  1 
ATOM   7485  C C   . PHE B 1 505 ? 150.451 162.010 163.729 1.00 75.43  ? 505 PHE B C   1 
ATOM   7486  O O   . PHE B 1 505 ? 150.926 161.128 164.452 1.00 75.43  ? 505 PHE B O   1 
ATOM   7487  C CB  . PHE B 1 505 ? 148.766 160.939 162.245 1.00 75.43  ? 505 PHE B CB  1 
ATOM   7488  C CG  . PHE B 1 505 ? 147.394 160.320 162.227 1.00 75.43  ? 505 PHE B CG  1 
ATOM   7489  C CD1 . PHE B 1 505 ? 146.494 160.557 163.243 1.00 75.43  ? 505 PHE B CD1 1 
ATOM   7490  C CD2 . PHE B 1 505 ? 147.035 159.442 161.230 1.00 75.43  ? 505 PHE B CD2 1 
ATOM   7491  C CE1 . PHE B 1 505 ? 145.252 159.969 163.237 1.00 75.43  ? 505 PHE B CE1 1 
ATOM   7492  C CE2 . PHE B 1 505 ? 145.797 158.852 161.229 1.00 75.43  ? 505 PHE B CE2 1 
ATOM   7493  C CZ  . PHE B 1 505 ? 144.905 159.117 162.231 1.00 75.43  ? 505 PHE B CZ  1 
ATOM   7494  N N   . ILE B 1 506 ? 151.194 163.006 163.266 1.00 72.57  ? 506 ILE B N   1 
ATOM   7495  C CA  . ILE B 1 506 ? 152.578 163.092 163.702 1.00 72.57  ? 506 ILE B CA  1 
ATOM   7496  C C   . ILE B 1 506 ? 152.684 163.743 165.076 1.00 72.57  ? 506 ILE B C   1 
ATOM   7497  O O   . ILE B 1 506 ? 153.459 163.291 165.921 1.00 72.57  ? 506 ILE B O   1 
ATOM   7498  C CB  . ILE B 1 506 ? 153.435 163.840 162.673 1.00 72.57  ? 506 ILE B CB  1 
ATOM   7499  C CG1 . ILE B 1 506 ? 153.404 163.129 161.338 1.00 72.57  ? 506 ILE B CG1 1 
ATOM   7500  C CG2 . ILE B 1 506 ? 154.882 163.891 163.104 1.00 72.57  ? 506 ILE B CG2 1 
ATOM   7501  C CD1 . ILE B 1 506 ? 154.150 163.878 160.290 1.00 72.57  ? 506 ILE B CD1 1 
ATOM   7502  N N   . TYR B 1 507 ? 151.878 164.754 165.349 1.00 76.82  ? 507 TYR B N   1 
ATOM   7503  C CA  . TYR B 1 507 ? 152.153 165.623 166.479 1.00 76.82  ? 507 TYR B CA  1 
ATOM   7504  C C   . TYR B 1 507 ? 151.350 165.280 167.722 1.00 76.82  ? 507 TYR B C   1 
ATOM   7505  O O   . TYR B 1 507 ? 151.698 165.739 168.811 1.00 76.82  ? 507 TYR B O   1 
ATOM   7506  C CB  . TYR B 1 507 ? 151.886 167.072 166.079 1.00 76.82  ? 507 TYR B CB  1 
ATOM   7507  C CG  . TYR B 1 507 ? 152.803 167.567 164.992 1.00 76.82  ? 507 TYR B CG  1 
ATOM   7508  C CD1 . TYR B 1 507 ? 154.049 167.000 164.790 1.00 76.82  ? 507 TYR B CD1 1 
ATOM   7509  C CD2 . TYR B 1 507 ? 152.396 168.567 164.131 1.00 76.82  ? 507 TYR B CD2 1 
ATOM   7510  C CE1 . TYR B 1 507 ? 154.871 167.440 163.789 1.00 76.82  ? 507 TYR B CE1 1 
ATOM   7511  C CE2 . TYR B 1 507 ? 153.214 169.009 163.124 1.00 76.82  ? 507 TYR B CE2 1 
ATOM   7512  C CZ  . TYR B 1 507 ? 154.448 168.439 162.959 1.00 76.82  ? 507 TYR B CZ  1 
ATOM   7513  O OH  . TYR B 1 507 ? 155.274 168.871 161.957 1.00 76.82  ? 507 TYR B OH  1 
ATOM   7514  N N   . MET B 1 508 ? 150.286 164.495 167.603 1.00 83.23  ? 508 MET B N   1 
ATOM   7515  C CA  . MET B 1 508 ? 149.536 164.077 168.774 1.00 83.23  ? 508 MET B CA  1 
ATOM   7516  C C   . MET B 1 508 ? 149.205 162.600 168.817 1.00 83.23  ? 508 MET B C   1 
ATOM   7517  O O   . MET B 1 508 ? 148.670 162.146 169.829 1.00 83.23  ? 508 MET B O   1 
ATOM   7518  C CB  . MET B 1 508 ? 148.226 164.868 168.900 1.00 83.23  ? 508 MET B CB  1 
ATOM   7519  C CG  . MET B 1 508 ? 148.415 166.278 169.413 1.00 83.23  ? 508 MET B CG  1 
ATOM   7520  S SD  . MET B 1 508 ? 146.877 167.166 169.708 1.00 83.23  ? 508 MET B SD  1 
ATOM   7521  C CE  . MET B 1 508 ? 146.450 167.649 168.044 1.00 83.23  ? 508 MET B CE  1 
ATOM   7522  N N   . VAL B 1 509 ? 149.495 161.840 167.769 1.00 78.40  ? 509 VAL B N   1 
ATOM   7523  C CA  . VAL B 1 509 ? 149.220 160.413 167.754 1.00 78.40  ? 509 VAL B CA  1 
ATOM   7524  C C   . VAL B 1 509 ? 150.501 159.595 167.759 1.00 78.40  ? 509 VAL B C   1 
ATOM   7525  O O   . VAL B 1 509 ? 150.611 158.619 168.501 1.00 78.40  ? 509 VAL B O   1 
ATOM   7526  C CB  . VAL B 1 509 ? 148.324 160.065 166.549 1.00 78.40  ? 509 VAL B CB  1 
ATOM   7527  C CG1 . VAL B 1 509 ? 148.188 158.575 166.377 1.00 78.40  ? 509 VAL B CG1 1 
ATOM   7528  C CG2 . VAL B 1 509 ? 146.965 160.671 166.767 1.00 78.40  ? 509 VAL B CG2 1 
ATOM   7529  N N   . LEU B 1 510 ? 151.491 160.009 166.968 1.00 75.42  ? 510 LEU B N   1 
ATOM   7530  C CA  . LEU B 1 510 ? 152.806 159.385 167.033 1.00 75.42  ? 510 LEU B CA  1 
ATOM   7531  C C   . LEU B 1 510 ? 153.456 159.591 168.392 1.00 75.42  ? 510 LEU B C   1 
ATOM   7532  O O   . LEU B 1 510 ? 154.198 158.724 168.860 1.00 75.42  ? 510 LEU B O   1 
ATOM   7533  C CB  . LEU B 1 510 ? 153.702 159.945 165.936 1.00 75.42  ? 510 LEU B CB  1 
ATOM   7534  C CG  . LEU B 1 510 ? 155.083 159.323 165.806 1.00 75.42  ? 510 LEU B CG  1 
ATOM   7535  C CD1 . LEU B 1 510 ? 154.922 157.870 165.447 1.00 75.42  ? 510 LEU B CD1 1 
ATOM   7536  C CD2 . LEU B 1 510 ? 155.925 160.048 164.777 1.00 75.42  ? 510 LEU B CD2 1 
ATOM   7537  N N   . SER B 1 511 ? 153.152 160.699 169.057 1.00 74.10  ? 511 SER B N   1 
ATOM   7538  C CA  . SER B 1 511 ? 153.726 160.967 170.362 1.00 74.10  ? 511 SER B CA  1 
ATOM   7539  C C   . SER B 1 511 ? 153.210 160.039 171.449 1.00 74.10  ? 511 SER B C   1 
ATOM   7540  O O   . SER B 1 511 ? 153.911 159.840 172.443 1.00 74.10  ? 511 SER B O   1 
ATOM   7541  C CB  . SER B 1 511 ? 153.453 162.408 170.756 1.00 74.10  ? 511 SER B CB  1 
ATOM   7542  O OG  . SER B 1 511 ? 154.077 163.280 169.843 1.00 74.10  ? 511 SER B OG  1 
ATOM   7543  N N   . LEU B 1 512 ? 152.012 159.471 171.295 1.00 72.77  ? 512 LEU B N   1 
ATOM   7544  C CA  . LEU B 1 512 ? 151.547 158.501 172.280 1.00 72.77  ? 512 LEU B CA  1 
ATOM   7545  C C   . LEU B 1 512 ? 152.356 157.224 172.210 1.00 72.77  ? 512 LEU B C   1 
ATOM   7546  O O   . LEU B 1 512 ? 152.755 156.680 173.245 1.00 72.77  ? 512 LEU B O   1 
ATOM   7547  C CB  . LEU B 1 512 ? 150.073 158.173 172.088 1.00 72.77  ? 512 LEU B CB  1 
ATOM   7548  C CG  . LEU B 1 512 ? 149.065 158.934 172.932 1.00 72.77  ? 512 LEU B CG  1 
ATOM   7549  C CD1 . LEU B 1 512 ? 149.368 158.690 174.393 1.00 72.77  ? 512 LEU B CD1 1 
ATOM   7550  C CD2 . LEU B 1 512 ? 149.069 160.394 172.610 1.00 72.77  ? 512 LEU B CD2 1 
ATOM   7551  N N   . PHE B 1 513 ? 152.618 156.742 170.999 1.00 74.50  ? 513 PHE B N   1 
ATOM   7552  C CA  . PHE B 1 513 ? 153.382 155.523 170.801 1.00 74.50  ? 513 PHE B CA  1 
ATOM   7553  C C   . PHE B 1 513 ? 154.807 155.630 171.312 1.00 74.50  ? 513 PHE B C   1 
ATOM   7554  O O   . PHE B 1 513 ? 155.402 154.607 171.648 1.00 74.50  ? 513 PHE B O   1 
ATOM   7555  C CB  . PHE B 1 513 ? 153.378 155.171 169.322 1.00 74.50  ? 513 PHE B CB  1 
ATOM   7556  C CG  . PHE B 1 513 ? 152.073 154.639 168.833 1.00 74.50  ? 513 PHE B CG  1 
ATOM   7557  C CD1 . PHE B 1 513 ? 151.196 154.032 169.696 1.00 74.50  ? 513 PHE B CD1 1 
ATOM   7558  C CD2 . PHE B 1 513 ? 151.709 154.776 167.511 1.00 74.50  ? 513 PHE B CD2 1 
ATOM   7559  C CE1 . PHE B 1 513 ? 150.006 153.542 169.241 1.00 74.50  ? 513 PHE B CE1 1 
ATOM   7560  C CE2 . PHE B 1 513 ? 150.507 154.297 167.061 1.00 74.50  ? 513 PHE B CE2 1 
ATOM   7561  C CZ  . PHE B 1 513 ? 149.657 153.684 167.924 1.00 74.50  ? 513 PHE B CZ  1 
ATOM   7562  N N   . ILE B 1 514 ? 155.358 156.834 171.395 1.00 68.41  ? 514 ILE B N   1 
ATOM   7563  C CA  . ILE B 1 514 ? 156.619 157.042 172.086 1.00 68.41  ? 514 ILE B CA  1 
ATOM   7564  C C   . ILE B 1 514 ? 156.402 157.159 173.588 1.00 68.41  ? 514 ILE B C   1 
ATOM   7565  O O   . ILE B 1 514 ? 157.236 156.671 174.366 1.00 68.41  ? 514 ILE B O   1 
ATOM   7566  C CB  . ILE B 1 514 ? 157.331 158.284 171.513 1.00 68.41  ? 514 ILE B CB  1 
ATOM   7567  C CG1 . ILE B 1 514 ? 157.639 158.046 170.046 1.00 68.41  ? 514 ILE B CG1 1 
ATOM   7568  C CG2 . ILE B 1 514 ? 158.628 158.565 172.200 1.00 68.41  ? 514 ILE B CG2 1 
ATOM   7569  C CD1 . ILE B 1 514 ? 158.143 159.248 169.343 1.00 68.41  ? 514 ILE B CD1 1 
ATOM   7570  N N   . ALA B 1 515 ? 155.277 157.714 174.021 1.00 71.78  ? 515 ALA B N   1 
ATOM   7571  C CA  . ALA B 1 515 ? 155.033 157.898 175.442 1.00 71.78  ? 515 ALA B CA  1 
ATOM   7572  C C   . ALA B 1 515 ? 154.607 156.625 176.150 1.00 71.78  ? 515 ALA B C   1 
ATOM   7573  O O   . ALA B 1 515 ? 154.931 156.454 177.327 1.00 71.78  ? 515 ALA B O   1 
ATOM   7574  C CB  . ALA B 1 515 ? 153.967 158.967 175.659 1.00 71.78  ? 515 ALA B CB  1 
ATOM   7575  N N   . LEU B 1 516 ? 153.879 155.737 175.477 1.00 72.41  ? 516 LEU B N   1 
ATOM   7576  C CA  . LEU B 1 516 ? 153.441 154.516 176.140 1.00 72.41  ? 516 LEU B CA  1 
ATOM   7577  C C   . LEU B 1 516 ? 154.601 153.570 176.384 1.00 72.41  ? 516 LEU B C   1 
ATOM   7578  O O   . LEU B 1 516 ? 154.644 152.889 177.412 1.00 72.41  ? 516 LEU B O   1 
ATOM   7579  C CB  . LEU B 1 516 ? 152.367 153.815 175.323 1.00 72.41  ? 516 LEU B CB  1 
ATOM   7580  C CG  . LEU B 1 516 ? 151.023 154.518 175.298 1.00 72.41  ? 516 LEU B CG  1 
ATOM   7581  C CD1 . LEU B 1 516 ? 150.079 153.770 174.398 1.00 72.41  ? 516 LEU B CD1 1 
ATOM   7582  C CD2 . LEU B 1 516 ? 150.476 154.598 176.697 1.00 72.41  ? 516 LEU B CD2 1 
ATOM   7583  N N   . ILE B 1 517 ? 155.548 153.513 175.455 1.00 71.74  ? 517 ILE B N   1 
ATOM   7584  C CA  . ILE B 1 517 ? 156.676 152.611 175.623 1.00 71.74  ? 517 ILE B CA  1 
ATOM   7585  C C   . ILE B 1 517 ? 157.623 153.140 176.690 1.00 71.74  ? 517 ILE B C   1 
ATOM   7586  O O   . ILE B 1 517 ? 158.157 152.374 177.499 1.00 71.74  ? 517 ILE B O   1 
ATOM   7587  C CB  . ILE B 1 517 ? 157.379 152.403 174.276 1.00 71.74  ? 517 ILE B CB  1 
ATOM   7588  C CG1 . ILE B 1 517 ? 156.386 151.876 173.250 1.00 71.74  ? 517 ILE B CG1 1 
ATOM   7589  C CG2 . ILE B 1 517 ? 158.496 151.431 174.414 1.00 71.74  ? 517 ILE B CG2 1 
ATOM   7590  C CD1 . ILE B 1 517 ? 155.798 150.561 173.592 1.00 71.74  ? 517 ILE B CD1 1 
ATOM   7591  N N   . THR B 1 518 ? 157.827 154.455 176.724 1.00 75.49  ? 518 THR B N   1 
ATOM   7592  C CA  . THR B 1 518 ? 158.585 155.066 177.809 1.00 75.49  ? 518 THR B CA  1 
ATOM   7593  C C   . THR B 1 518 ? 157.867 154.883 179.135 1.00 75.49  ? 518 THR B C   1 
ATOM   7594  O O   . THR B 1 518 ? 158.484 154.547 180.150 1.00 75.49  ? 518 THR B O   1 
ATOM   7595  C CB  . THR B 1 518 ? 158.801 156.546 177.514 1.00 75.49  ? 518 THR B CB  1 
ATOM   7596  O OG1 . THR B 1 518 ? 159.569 156.681 176.315 1.00 75.49  ? 518 THR B OG1 1 
ATOM   7597  C CG2 . THR B 1 518 ? 159.522 157.235 178.655 1.00 75.49  ? 518 THR B CG2 1 
ATOM   7598  N N   . GLY B 1 519 ? 156.546 155.046 179.129 1.00 80.74  ? 519 GLY B N   1 
ATOM   7599  C CA  . GLY B 1 519 ? 155.759 154.809 180.324 1.00 80.74  ? 519 GLY B CA  1 
ATOM   7600  C C   . GLY B 1 519 ? 155.718 153.362 180.761 1.00 80.74  ? 519 GLY B C   1 
ATOM   7601  O O   . GLY B 1 519 ? 155.441 153.089 181.931 1.00 80.74  ? 519 GLY B O   1 
ATOM   7602  N N   . ALA B 1 520 ? 155.983 152.431 179.854 1.00 80.13  ? 520 ALA B N   1 
ATOM   7603  C CA  . ALA B 1 520 ? 156.065 151.034 180.234 1.00 80.13  ? 520 ALA B CA  1 
ATOM   7604  C C   . ALA B 1 520 ? 157.472 150.605 180.596 1.00 80.13  ? 520 ALA B C   1 
ATOM   7605  O O   . ALA B 1 520 ? 157.632 149.637 181.342 1.00 80.13  ? 520 ALA B O   1 
ATOM   7606  C CB  . ALA B 1 520 ? 155.545 150.144 179.107 1.00 80.13  ? 520 ALA B CB  1 
ATOM   7607  N N   . TYR B 1 521 ? 158.492 151.299 180.096 1.00 79.83  ? 521 TYR B N   1 
ATOM   7608  C CA  . TYR B 1 521 ? 159.861 150.919 180.417 1.00 79.83  ? 521 TYR B CA  1 
ATOM   7609  C C   . TYR B 1 521 ? 160.227 151.318 181.834 1.00 79.83  ? 521 TYR B C   1 
ATOM   7610  O O   . TYR B 1 521 ? 161.115 150.710 182.438 1.00 79.83  ? 521 TYR B O   1 
ATOM   7611  C CB  . TYR B 1 521 ? 160.828 151.549 179.424 1.00 79.83  ? 521 TYR B CB  1 
ATOM   7612  C CG  . TYR B 1 521 ? 162.263 151.147 179.609 1.00 79.83  ? 521 TYR B CG  1 
ATOM   7613  C CD1 . TYR B 1 521 ? 162.709 149.899 179.218 1.00 79.83  ? 521 TYR B CD1 1 
ATOM   7614  C CD2 . TYR B 1 521 ? 163.176 152.021 180.163 1.00 79.83  ? 521 TYR B CD2 1 
ATOM   7615  C CE1 . TYR B 1 521 ? 164.025 149.532 179.379 1.00 79.83  ? 521 TYR B CE1 1 
ATOM   7616  C CE2 . TYR B 1 521 ? 164.493 151.665 180.325 1.00 79.83  ? 521 TYR B CE2 1 
ATOM   7617  C CZ  . TYR B 1 521 ? 164.910 150.421 179.937 1.00 79.83  ? 521 TYR B CZ  1 
ATOM   7618  O OH  . TYR B 1 521 ? 166.225 150.073 180.104 1.00 79.83  ? 521 TYR B OH  1 
ATOM   7619  N N   . ASP B 1 522 ? 159.560 152.325 182.385 1.00 88.02  ? 522 ASP B N   1 
ATOM   7620  C CA  . ASP B 1 522 ? 159.769 152.647 183.785 1.00 88.02  ? 522 ASP B CA  1 
ATOM   7621  C C   . ASP B 1 522 ? 159.159 151.615 184.716 1.00 88.02  ? 522 ASP B C   1 
ATOM   7622  O O   . ASP B 1 522 ? 159.681 151.410 185.815 1.00 88.02  ? 522 ASP B O   1 
ATOM   7623  C CB  . ASP B 1 522 ? 159.195 154.023 184.109 1.00 88.02  ? 522 ASP B CB  1 
ATOM   7624  C CG  . ASP B 1 522 ? 160.003 155.143 183.504 1.00 88.02  ? 522 ASP B CG  1 
ATOM   7625  O OD1 . ASP B 1 522 ? 161.206 154.928 183.253 1.00 88.02  ? 522 ASP B OD1 1 
ATOM   7626  O OD2 . ASP B 1 522 ? 159.448 156.243 183.303 1.00 88.02  ? 522 ASP B OD2 1 
ATOM   7627  N N   . THR B 1 523 ? 158.076 150.960 184.306 1.00 86.09  ? 523 THR B N   1 
ATOM   7628  C CA  . THR B 1 523 ? 157.423 150.009 185.192 1.00 86.09  ? 523 THR B CA  1 
ATOM   7629  C C   . THR B 1 523 ? 158.216 148.720 185.313 1.00 86.09  ? 523 THR B C   1 
ATOM   7630  O O   . THR B 1 523 ? 158.225 148.097 186.377 1.00 86.09  ? 523 THR B O   1 
ATOM   7631  C CB  . THR B 1 523 ? 156.016 149.697 184.697 1.00 86.09  ? 523 THR B CB  1 
ATOM   7632  O OG1 . THR B 1 523 ? 156.090 149.130 183.386 1.00 86.09  ? 523 THR B OG1 1 
ATOM   7633  C CG2 . THR B 1 523 ? 155.179 150.953 184.655 1.00 86.09  ? 523 THR B CG2 1 
ATOM   7634  N N   . ILE B 1 524 ? 158.884 148.306 184.241 1.00 87.21  ? 524 ILE B N   1 
ATOM   7635  C CA  . ILE B 1 524 ? 159.510 146.992 184.246 1.00 87.21  ? 524 ILE B CA  1 
ATOM   7636  C C   . ILE B 1 524 ? 160.808 147.017 185.040 1.00 87.21  ? 524 ILE B C   1 
ATOM   7637  O O   . ILE B 1 524 ? 161.204 146.010 185.637 1.00 87.21  ? 524 ILE B O   1 
ATOM   7638  C CB  . ILE B 1 524 ? 159.709 146.494 182.803 1.00 87.21  ? 524 ILE B CB  1 
ATOM   7639  C CG1 . ILE B 1 524 ? 160.128 145.034 182.786 1.00 87.21  ? 524 ILE B CG1 1 
ATOM   7640  C CG2 . ILE B 1 524 ? 160.712 147.329 182.043 1.00 87.21  ? 524 ILE B CG2 1 
ATOM   7641  C CD1 . ILE B 1 524 ? 160.079 144.448 181.436 1.00 87.21  ? 524 ILE B CD1 1 
ATOM   7642  N N   . LYS B 1 525 ? 161.465 148.172 185.117 1.00 93.25  ? 525 LYS B N   1 
ATOM   7643  C CA  . LYS B 1 525 ? 162.736 148.204 185.816 1.00 93.25  ? 525 LYS B CA  1 
ATOM   7644  C C   . LYS B 1 525 ? 162.627 148.843 187.190 1.00 93.25  ? 525 LYS B C   1 
ATOM   7645  O O   . LYS B 1 525 ? 163.637 148.938 187.894 1.00 93.25  ? 525 LYS B O   1 
ATOM   7646  C CB  . LYS B 1 525 ? 163.784 148.915 184.965 1.00 93.25  ? 525 LYS B CB  1 
ATOM   7647  C CG  . LYS B 1 525 ? 163.614 150.398 184.842 1.00 93.25  ? 525 LYS B CG  1 
ATOM   7648  C CD  . LYS B 1 525 ? 164.591 150.930 183.812 1.00 93.25  ? 525 LYS B CD  1 
ATOM   7649  C CE  . LYS B 1 525 ? 166.037 150.792 184.244 1.00 93.25  ? 525 LYS B CE  1 
ATOM   7650  N NZ  . LYS B 1 525 ? 166.368 151.694 185.369 1.00 93.25  ? 525 LYS B NZ  1 
ATOM   7651  N N   . HIS B 1 526 ? 161.438 149.282 187.588 1.00 96.19  ? 526 HIS B N   1 
ATOM   7652  C CA  . HIS B 1 526 ? 161.226 149.748 188.952 1.00 96.19  ? 526 HIS B CA  1 
ATOM   7653  C C   . HIS B 1 526 ? 159.866 149.300 189.472 1.00 96.19  ? 526 HIS B C   1 
ATOM   7654  O O   . HIS B 1 526 ? 159.747 148.246 190.093 1.00 96.19  ? 526 HIS B O   1 
ATOM   7655  C CB  . HIS B 1 526 ? 161.345 151.271 189.038 1.00 96.19  ? 526 HIS B CB  1 
ATOM   7656  C CG  . HIS B 1 526 ? 162.690 151.792 188.643 1.00 96.19  ? 526 HIS B CG  1 
ATOM   7657  N ND1 . HIS B 1 526 ? 163.831 151.526 189.368 1.00 96.19  ? 526 HIS B ND1 1 
ATOM   7658  C CD2 . HIS B 1 526 ? 163.076 152.572 187.608 1.00 96.19  ? 526 HIS B CD2 1 
ATOM   7659  C CE1 . HIS B 1 526 ? 164.864 152.109 188.788 1.00 96.19  ? 526 HIS B CE1 1 
ATOM   7660  N NE2 . HIS B 1 526 ? 164.433 152.754 187.720 1.00 96.19  ? 526 HIS B NE2 1 
ATOM   7661  N N   . GLU C 1 38  ? 123.633 172.038 198.931 1.00 140.24 ? 38  GLU C N   1 
ATOM   7662  C CA  . GLU C 1 38  ? 123.436 170.922 198.016 1.00 140.24 ? 38  GLU C CA  1 
ATOM   7663  C C   . GLU C 1 38  ? 122.568 169.837 198.646 1.00 140.24 ? 38  GLU C C   1 
ATOM   7664  O O   . GLU C 1 38  ? 122.920 168.667 198.580 1.00 140.24 ? 38  GLU C O   1 
ATOM   7665  C CB  . GLU C 1 38  ? 124.783 170.313 197.600 1.00 140.24 ? 38  GLU C CB  1 
ATOM   7666  C CG  . GLU C 1 38  ? 125.689 171.234 196.804 1.00 140.24 ? 38  GLU C CG  1 
ATOM   7667  C CD  . GLU C 1 38  ? 126.975 170.565 196.364 1.00 140.24 ? 38  GLU C CD  1 
ATOM   7668  O OE1 . GLU C 1 38  ? 127.212 169.405 196.758 1.00 140.24 ? 38  GLU C OE1 1 
ATOM   7669  O OE2 . GLU C 1 38  ? 127.752 171.202 195.625 1.00 140.24 ? 38  GLU C OE2 1 
ATOM   7670  N N   . GLU C 1 39  ? 121.447 170.205 199.270 1.00 138.62 ? 39  GLU C N   1 
ATOM   7671  C CA  . GLU C 1 39  ? 120.668 169.195 199.983 1.00 138.62 ? 39  GLU C CA  1 
ATOM   7672  C C   . GLU C 1 39  ? 119.738 168.410 199.060 1.00 138.62 ? 39  GLU C C   1 
ATOM   7673  O O   . GLU C 1 39  ? 119.908 167.201 198.877 1.00 138.62 ? 39  GLU C O   1 
ATOM   7674  C CB  . GLU C 1 39  ? 119.860 169.836 201.116 1.00 138.62 ? 39  GLU C CB  1 
ATOM   7675  C CG  . GLU C 1 39  ? 120.669 170.239 202.326 1.00 138.62 ? 39  GLU C CG  1 
ATOM   7676  C CD  . GLU C 1 39  ? 119.795 170.741 203.458 1.00 138.62 ? 39  GLU C CD  1 
ATOM   7677  O OE1 . GLU C 1 39  ? 118.579 170.915 203.238 1.00 138.62 ? 39  GLU C OE1 1 
ATOM   7678  O OE2 . GLU C 1 39  ? 120.319 170.945 204.572 1.00 138.62 ? 39  GLU C OE2 1 
ATOM   7679  N N   . ASP C 1 40  ? 118.756 169.077 198.464 1.00 129.76 ? 40  ASP C N   1 
ATOM   7680  C CA  . ASP C 1 40  ? 117.678 168.377 197.780 1.00 129.76 ? 40  ASP C CA  1 
ATOM   7681  C C   . ASP C 1 40  ? 117.926 168.185 196.296 1.00 129.76 ? 40  ASP C C   1 
ATOM   7682  O O   . ASP C 1 40  ? 117.154 167.476 195.643 1.00 129.76 ? 40  ASP C O   1 
ATOM   7683  C CB  . ASP C 1 40  ? 116.354 169.113 197.985 1.00 129.76 ? 40  ASP C CB  1 
ATOM   7684  C CG  . ASP C 1 40  ? 115.798 168.918 199.371 1.00 129.76 ? 40  ASP C CG  1 
ATOM   7685  O OD1 . ASP C 1 40  ? 116.062 167.851 199.959 1.00 129.76 ? 40  ASP C OD1 1 
ATOM   7686  O OD2 . ASP C 1 40  ? 115.097 169.821 199.871 1.00 129.76 ? 40  ASP C OD2 1 
ATOM   7687  N N   . LEU C 1 41  ? 118.974 168.781 195.746 1.00 128.56 ? 41  LEU C N   1 
ATOM   7688  C CA  . LEU C 1 41  ? 119.287 168.642 194.332 1.00 128.56 ? 41  LEU C CA  1 
ATOM   7689  C C   . LEU C 1 41  ? 120.335 167.565 194.095 1.00 128.56 ? 41  LEU C C   1 
ATOM   7690  O O   . LEU C 1 41  ? 121.012 167.560 193.072 1.00 128.56 ? 41  LEU C O   1 
ATOM   7691  C CB  . LEU C 1 41  ? 119.753 169.968 193.745 1.00 128.56 ? 41  LEU C CB  1 
ATOM   7692  C CG  . LEU C 1 41  ? 118.685 171.047 193.619 1.00 128.56 ? 41  LEU C CG  1 
ATOM   7693  C CD1 . LEU C 1 41  ? 119.276 172.329 193.072 1.00 128.56 ? 41  LEU C CD1 1 
ATOM   7694  C CD2 . LEU C 1 41  ? 117.572 170.550 192.729 1.00 128.56 ? 41  LEU C CD2 1 
ATOM   7695  N N   . ARG C 1 42  ? 120.479 166.631 195.035 1.00 129.65 ? 42  ARG C N   1 
ATOM   7696  C CA  . ARG C 1 42  ? 121.488 165.592 194.861 1.00 129.65 ? 42  ARG C CA  1 
ATOM   7697  C C   . ARG C 1 42  ? 121.057 164.556 193.833 1.00 129.65 ? 42  ARG C C   1 
ATOM   7698  O O   . ARG C 1 42  ? 121.869 164.134 193.010 1.00 129.65 ? 42  ARG C O   1 
ATOM   7699  C CB  . ARG C 1 42  ? 121.811 164.913 196.197 1.00 129.65 ? 42  ARG C CB  1 
ATOM   7700  C CG  . ARG C 1 42  ? 122.583 165.788 197.178 1.00 129.65 ? 42  ARG C CG  1 
ATOM   7701  C CD  . ARG C 1 42  ? 122.896 165.083 198.501 1.00 129.65 ? 42  ARG C CD  1 
ATOM   7702  N NE  . ARG C 1 42  ? 123.896 164.025 198.360 1.00 129.65 ? 42  ARG C NE  1 
ATOM   7703  C CZ  . ARG C 1 42  ? 124.217 163.165 199.322 1.00 129.65 ? 42  ARG C CZ  1 
ATOM   7704  N NH1 . ARG C 1 42  ? 123.615 163.229 200.500 1.00 129.65 ? 42  ARG C NH1 1 
ATOM   7705  N NH2 . ARG C 1 42  ? 125.139 162.237 199.106 1.00 129.65 ? 42  ARG C NH2 1 
ATOM   7706  N N   . ARG C 1 43  ? 119.791 164.149 193.841 1.00 126.08 ? 43  ARG C N   1 
ATOM   7707  C CA  . ARG C 1 43  ? 119.400 163.042 192.977 1.00 126.08 ? 43  ARG C CA  1 
ATOM   7708  C C   . ARG C 1 43  ? 119.267 163.480 191.527 1.00 126.08 ? 43  ARG C C   1 
ATOM   7709  O O   . ARG C 1 43  ? 119.737 162.788 190.620 1.00 126.08 ? 43  ARG C O   1 
ATOM   7710  C CB  . ARG C 1 43  ? 118.103 162.414 193.477 1.00 126.08 ? 43  ARG C CB  1 
ATOM   7711  C CG  . ARG C 1 43  ? 118.284 161.711 194.797 1.00 126.08 ? 43  ARG C CG  1 
ATOM   7712  C CD  . ARG C 1 43  ? 117.026 161.037 195.263 1.00 126.08 ? 43  ARG C CD  1 
ATOM   7713  N NE  . ARG C 1 43  ? 117.242 160.417 196.562 1.00 126.08 ? 43  ARG C NE  1 
ATOM   7714  C CZ  . ARG C 1 43  ? 116.311 159.760 197.238 1.00 126.08 ? 43  ARG C CZ  1 
ATOM   7715  N NH1 . ARG C 1 43  ? 115.093 159.624 196.732 1.00 126.08 ? 43  ARG C NH1 1 
ATOM   7716  N NH2 . ARG C 1 43  ? 116.602 159.232 198.416 1.00 126.08 ? 43  ARG C NH2 1 
ATOM   7717  N N   . ARG C 1 44  ? 118.649 164.633 191.289 1.00 127.82 ? 44  ARG C N   1 
ATOM   7718  C CA  . ARG C 1 44  ? 118.458 165.084 189.921 1.00 127.82 ? 44  ARG C CA  1 
ATOM   7719  C C   . ARG C 1 44  ? 119.746 165.570 189.271 1.00 127.82 ? 44  ARG C C   1 
ATOM   7720  O O   . ARG C 1 44  ? 119.937 165.345 188.071 1.00 127.82 ? 44  ARG C O   1 
ATOM   7721  C CB  . ARG C 1 44  ? 117.392 166.175 189.883 1.00 127.82 ? 44  ARG C CB  1 
ATOM   7722  C CG  . ARG C 1 44  ? 116.024 165.648 190.242 1.00 127.82 ? 44  ARG C CG  1 
ATOM   7723  C CD  . ARG C 1 44  ? 114.982 166.734 190.257 1.00 127.82 ? 44  ARG C CD  1 
ATOM   7724  N NE  . ARG C 1 44  ? 114.751 167.298 188.935 1.00 127.82 ? 44  ARG C NE  1 
ATOM   7725  C CZ  . ARG C 1 44  ? 115.083 168.535 188.589 1.00 127.82 ? 44  ARG C CZ  1 
ATOM   7726  N NH1 . ARG C 1 44  ? 115.660 169.335 189.470 1.00 127.82 ? 44  ARG C NH1 1 
ATOM   7727  N NH2 . ARG C 1 44  ? 114.834 168.976 187.367 1.00 127.82 ? 44  ARG C NH2 1 
ATOM   7728  N N   . LEU C 1 45  ? 120.648 166.197 190.028 1.00 130.19 ? 45  LEU C N   1 
ATOM   7729  C CA  . LEU C 1 45  ? 121.890 166.659 189.425 1.00 130.19 ? 45  LEU C CA  1 
ATOM   7730  C C   . LEU C 1 45  ? 122.937 165.567 189.305 1.00 130.19 ? 45  LEU C C   1 
ATOM   7731  O O   . LEU C 1 45  ? 123.992 165.819 188.716 1.00 130.19 ? 45  LEU C O   1 
ATOM   7732  C CB  . LEU C 1 45  ? 122.483 167.824 190.208 1.00 130.19 ? 45  LEU C CB  1 
ATOM   7733  C CG  . LEU C 1 45  ? 121.656 169.104 190.204 1.00 130.19 ? 45  LEU C CG  1 
ATOM   7734  C CD1 . LEU C 1 45  ? 122.337 170.177 191.037 1.00 130.19 ? 45  LEU C CD1 1 
ATOM   7735  C CD2 . LEU C 1 45  ? 121.423 169.575 188.786 1.00 130.19 ? 45  LEU C CD2 1 
ATOM   7736  N N   . LYS C 1 46  ? 122.696 164.378 189.856 1.00 133.38 ? 46  LYS C N   1 
ATOM   7737  C CA  . LYS C 1 46  ? 123.581 163.251 189.601 1.00 133.38 ? 46  LYS C CA  1 
ATOM   7738  C C   . LYS C 1 46  ? 123.035 162.290 188.554 1.00 133.38 ? 46  LYS C C   1 
ATOM   7739  O O   . LYS C 1 46  ? 123.812 161.508 187.997 1.00 133.38 ? 46  LYS C O   1 
ATOM   7740  C CB  . LYS C 1 46  ? 123.881 162.486 190.896 1.00 133.38 ? 46  LYS C CB  1 
ATOM   7741  C CG  . LYS C 1 46  ? 124.725 163.248 191.920 1.00 133.38 ? 46  LYS C CG  1 
ATOM   7742  C CD  . LYS C 1 46  ? 126.169 163.426 191.499 1.00 133.38 ? 46  LYS C CD  1 
ATOM   7743  C CE  . LYS C 1 46  ? 126.971 164.093 192.610 1.00 133.38 ? 46  LYS C CE  1 
ATOM   7744  N NZ  . LYS C 1 46  ? 128.407 164.274 192.264 1.00 133.38 ? 46  LYS C NZ  1 
ATOM   7745  N N   . TYR C 1 47  ? 121.727 162.328 188.277 1.00 136.63 ? 47  TYR C N   1 
ATOM   7746  C CA  . TYR C 1 47  ? 121.201 161.617 187.116 1.00 136.63 ? 47  TYR C CA  1 
ATOM   7747  C C   . TYR C 1 47  ? 121.769 162.180 185.829 1.00 136.63 ? 47  TYR C C   1 
ATOM   7748  O O   . TYR C 1 47  ? 121.990 161.442 184.864 1.00 136.63 ? 47  TYR C O   1 
ATOM   7749  C CB  . TYR C 1 47  ? 119.679 161.698 187.074 1.00 136.63 ? 47  TYR C CB  1 
ATOM   7750  C CG  . TYR C 1 47  ? 118.976 160.751 188.001 1.00 136.63 ? 47  TYR C CG  1 
ATOM   7751  C CD1 . TYR C 1 47  ? 119.622 159.631 188.501 1.00 136.63 ? 47  TYR C CD1 1 
ATOM   7752  C CD2 . TYR C 1 47  ? 117.660 160.983 188.386 1.00 136.63 ? 47  TYR C CD2 1 
ATOM   7753  C CE1 . TYR C 1 47  ? 118.974 158.763 189.351 1.00 136.63 ? 47  TYR C CE1 1 
ATOM   7754  C CE2 . TYR C 1 47  ? 117.005 160.123 189.239 1.00 136.63 ? 47  TYR C CE2 1 
ATOM   7755  C CZ  . TYR C 1 47  ? 117.668 159.017 189.717 1.00 136.63 ? 47  TYR C CZ  1 
ATOM   7756  O OH  . TYR C 1 47  ? 117.016 158.166 190.572 1.00 136.63 ? 47  TYR C OH  1 
ATOM   7757  N N   . PHE C 1 48  ? 122.004 163.488 185.791 1.00 129.94 ? 48  PHE C N   1 
ATOM   7758  C CA  . PHE C 1 48  ? 122.575 164.083 184.599 1.00 129.94 ? 48  PHE C CA  1 
ATOM   7759  C C   . PHE C 1 48  ? 124.031 163.693 184.421 1.00 129.94 ? 48  PHE C C   1 
ATOM   7760  O O   . PHE C 1 48  ? 124.534 163.709 183.295 1.00 129.94 ? 48  PHE C O   1 
ATOM   7761  C CB  . PHE C 1 48  ? 122.428 165.597 184.655 1.00 129.94 ? 48  PHE C CB  1 
ATOM   7762  C CG  . PHE C 1 48  ? 122.794 166.274 183.383 1.00 129.94 ? 48  PHE C CG  1 
ATOM   7763  C CD1 . PHE C 1 48  ? 121.941 166.222 182.297 1.00 129.94 ? 48  PHE C CD1 1 
ATOM   7764  C CD2 . PHE C 1 48  ? 123.992 166.949 183.262 1.00 129.94 ? 48  PHE C CD2 1 
ATOM   7765  C CE1 . PHE C 1 48  ? 122.272 166.839 181.112 1.00 129.94 ? 48  PHE C CE1 1 
ATOM   7766  C CE2 . PHE C 1 48  ? 124.328 167.571 182.080 1.00 129.94 ? 48  PHE C CE2 1 
ATOM   7767  C CZ  . PHE C 1 48  ? 123.466 167.515 181.002 1.00 129.94 ? 48  PHE C CZ  1 
ATOM   7768  N N   . PHE C 1 49  ? 124.718 163.341 185.500 1.00 130.40 ? 49  PHE C N   1 
ATOM   7769  C CA  . PHE C 1 49  ? 126.059 162.781 185.392 1.00 130.40 ? 49  PHE C CA  1 
ATOM   7770  C C   . PHE C 1 49  ? 125.985 161.269 185.581 1.00 130.40 ? 49  PHE C C   1 
ATOM   7771  O O   . PHE C 1 49  ? 126.293 160.719 186.636 1.00 130.40 ? 49  PHE C O   1 
ATOM   7772  C CB  . PHE C 1 49  ? 126.995 163.428 186.404 1.00 130.40 ? 49  PHE C CB  1 
ATOM   7773  C CG  . PHE C 1 49  ? 127.282 164.873 186.136 1.00 130.40 ? 49  PHE C CG  1 
ATOM   7774  C CD1 . PHE C 1 49  ? 126.986 165.453 184.911 1.00 130.40 ? 49  PHE C CD1 1 
ATOM   7775  C CD2 . PHE C 1 49  ? 127.859 165.653 187.118 1.00 130.40 ? 49  PHE C CD2 1 
ATOM   7776  C CE1 . PHE C 1 49  ? 127.244 166.779 184.680 1.00 130.40 ? 49  PHE C CE1 1 
ATOM   7777  C CE2 . PHE C 1 49  ? 128.126 166.983 186.891 1.00 130.40 ? 49  PHE C CE2 1 
ATOM   7778  C CZ  . PHE C 1 49  ? 127.816 167.546 185.670 1.00 130.40 ? 49  PHE C CZ  1 
ATOM   7779  N N   . MET C 1 50  ? 125.540 160.596 184.528 1.00 138.11 ? 50  MET C N   1 
ATOM   7780  C CA  . MET C 1 50  ? 125.467 159.146 184.524 1.00 138.11 ? 50  MET C CA  1 
ATOM   7781  C C   . MET C 1 50  ? 126.052 158.598 183.232 1.00 138.11 ? 50  MET C C   1 
ATOM   7782  O O   . MET C 1 50  ? 126.493 159.337 182.349 1.00 138.11 ? 50  MET C O   1 
ATOM   7783  C CB  . MET C 1 50  ? 124.028 158.643 184.706 1.00 138.11 ? 50  MET C CB  1 
ATOM   7784  C CG  . MET C 1 50  ? 123.487 158.846 186.098 1.00 138.11 ? 50  MET C CG  1 
ATOM   7785  S SD  . MET C 1 50  ? 124.522 158.022 187.309 1.00 138.11 ? 50  MET C SD  1 
ATOM   7786  C CE  . MET C 1 50  ? 124.155 156.320 186.918 1.00 138.11 ? 50  MET C CE  1 
ATOM   7787  N N   . SER C 1 51  ? 126.050 157.276 183.143 1.00 135.90 ? 51  SER C N   1 
ATOM   7788  C CA  . SER C 1 51  ? 126.524 156.524 181.999 1.00 135.90 ? 51  SER C CA  1 
ATOM   7789  C C   . SER C 1 51  ? 125.521 155.427 181.690 1.00 135.90 ? 51  SER C C   1 
ATOM   7790  O O   . SER C 1 51  ? 124.955 154.829 182.609 1.00 135.90 ? 51  SER C O   1 
ATOM   7791  C CB  . SER C 1 51  ? 127.894 155.896 182.279 1.00 135.90 ? 51  SER C CB  1 
ATOM   7792  O OG  . SER C 1 51  ? 127.775 154.878 183.255 1.00 135.90 ? 51  SER C OG  1 
ATOM   7793  N N   . PRO C 1 52  ? 125.303 155.121 180.408 1.00 135.58 ? 52  PRO C N   1 
ATOM   7794  C CA  . PRO C 1 52  ? 124.350 154.062 180.045 1.00 135.58 ? 52  PRO C CA  1 
ATOM   7795  C C   . PRO C 1 52  ? 124.787 152.664 180.432 1.00 135.58 ? 52  PRO C C   1 
ATOM   7796  O O   . PRO C 1 52  ? 123.977 151.737 180.339 1.00 135.58 ? 52  PRO C O   1 
ATOM   7797  C CB  . PRO C 1 52  ? 124.253 154.195 178.525 1.00 135.58 ? 52  PRO C CB  1 
ATOM   7798  C CG  . PRO C 1 52  ? 125.525 154.796 178.135 1.00 135.58 ? 52  PRO C CG  1 
ATOM   7799  C CD  . PRO C 1 52  ? 125.897 155.746 179.221 1.00 135.58 ? 52  PRO C CD  1 
ATOM   7800  N N   . CYS C 1 53  ? 126.034 152.472 180.855 1.00 141.85 ? 53  CYS C N   1 
ATOM   7801  C CA  . CYS C 1 53  ? 126.380 151.240 181.545 1.00 141.85 ? 53  CYS C CA  1 
ATOM   7802  C C   . CYS C 1 53  ? 125.720 151.172 182.917 1.00 141.85 ? 53  CYS C C   1 
ATOM   7803  O O   . CYS C 1 53  ? 125.478 150.078 183.436 1.00 141.85 ? 53  CYS C O   1 
ATOM   7804  C CB  . CYS C 1 53  ? 127.896 151.127 181.673 1.00 141.85 ? 53  CYS C CB  1 
ATOM   7805  S SG  . CYS C 1 53  ? 128.754 150.974 180.094 1.00 141.85 ? 53  CYS C SG  1 
ATOM   7806  N N   . ASP C 1 54  ? 125.411 152.323 183.512 1.00 144.10 ? 54  ASP C N   1 
ATOM   7807  C CA  . ASP C 1 54  ? 124.807 152.365 184.831 1.00 144.10 ? 54  ASP C CA  1 
ATOM   7808  C C   . ASP C 1 54  ? 123.400 152.951 184.794 1.00 144.10 ? 54  ASP C C   1 
ATOM   7809  O O   . ASP C 1 54  ? 122.687 152.875 185.798 1.00 144.10 ? 54  ASP C O   1 
ATOM   7810  C CB  . ASP C 1 54  ? 125.694 153.182 185.781 1.00 144.10 ? 54  ASP C CB  1 
ATOM   7811  C CG  . ASP C 1 54  ? 125.482 152.830 187.241 1.00 144.10 ? 54  ASP C CG  1 
ATOM   7812  O OD1 . ASP C 1 54  ? 124.697 151.910 187.543 1.00 144.10 ? 54  ASP C OD1 1 
ATOM   7813  O OD2 . ASP C 1 54  ? 126.116 153.477 188.098 1.00 144.10 ? 54  ASP C OD2 1 
ATOM   7814  N N   . LYS C 1 55  ? 122.977 153.523 183.664 1.00 144.64 ? 55  LYS C N   1 
ATOM   7815  C CA  . LYS C 1 55  ? 121.584 153.929 183.514 1.00 144.64 ? 55  LYS C CA  1 
ATOM   7816  C C   . LYS C 1 55  ? 120.654 152.728 183.510 1.00 144.64 ? 55  LYS C C   1 
ATOM   7817  O O   . LYS C 1 55  ? 119.497 152.841 183.928 1.00 144.64 ? 55  LYS C O   1 
ATOM   7818  C CB  . LYS C 1 55  ? 121.390 154.726 182.225 1.00 144.64 ? 55  LYS C CB  1 
ATOM   7819  C CG  . LYS C 1 55  ? 122.008 156.102 182.225 1.00 144.64 ? 55  LYS C CG  1 
ATOM   7820  C CD  . LYS C 1 55  ? 121.762 156.806 180.901 1.00 144.64 ? 55  LYS C CD  1 
ATOM   7821  C CE  . LYS C 1 55  ? 122.451 158.159 180.861 1.00 144.64 ? 55  LYS C CE  1 
ATOM   7822  N NZ  . LYS C 1 55  ? 122.188 158.899 179.561 1.00 144.64 ? 55  LYS C NZ  1 
ATOM   7823  N N   . PHE C 1 56  ? 121.146 151.580 183.030 1.00 147.90 ? 56  PHE C N   1 
ATOM   7824  C CA  . PHE C 1 56  ? 120.387 150.333 183.048 1.00 147.90 ? 56  PHE C CA  1 
ATOM   7825  C C   . PHE C 1 56  ? 120.036 149.920 184.468 1.00 147.90 ? 56  PHE C C   1 
ATOM   7826  O O   . PHE C 1 56  ? 118.934 149.423 184.717 1.00 147.90 ? 56  PHE C O   1 
ATOM   7827  C CB  . PHE C 1 56  ? 121.206 149.241 182.358 1.00 147.90 ? 56  PHE C CB  1 
ATOM   7828  C CG  . PHE C 1 56  ? 120.472 147.951 182.156 1.00 147.90 ? 56  PHE C CG  1 
ATOM   7829  C CD1 . PHE C 1 56  ? 119.557 147.811 181.122 1.00 147.90 ? 56  PHE C CD1 1 
ATOM   7830  C CD2 . PHE C 1 56  ? 120.715 146.868 182.981 1.00 147.90 ? 56  PHE C CD2 1 
ATOM   7831  C CE1 . PHE C 1 56  ? 118.887 146.615 180.922 1.00 147.90 ? 56  PHE C CE1 1 
ATOM   7832  C CE2 . PHE C 1 56  ? 120.047 145.671 182.790 1.00 147.90 ? 56  PHE C CE2 1 
ATOM   7833  C CZ  . PHE C 1 56  ? 119.132 145.545 181.757 1.00 147.90 ? 56  PHE C CZ  1 
ATOM   7834  N N   . ARG C 1 57  ? 120.944 150.142 185.409 1.00 152.17 ? 57  ARG C N   1 
ATOM   7835  C CA  . ARG C 1 57  ? 120.676 149.870 186.808 1.00 152.17 ? 57  ARG C CA  1 
ATOM   7836  C C   . ARG C 1 57  ? 120.352 151.127 187.587 1.00 152.17 ? 57  ARG C C   1 
ATOM   7837  O O   . ARG C 1 57  ? 120.271 151.073 188.816 1.00 152.17 ? 57  ARG C O   1 
ATOM   7838  C CB  . ARG C 1 57  ? 121.861 149.146 187.447 1.00 152.17 ? 57  ARG C CB  1 
ATOM   7839  C CG  . ARG C 1 57  ? 122.030 147.733 186.936 1.00 152.17 ? 57  ARG C CG  1 
ATOM   7840  C CD  . ARG C 1 57  ? 123.170 146.976 187.595 1.00 152.17 ? 57  ARG C CD  1 
ATOM   7841  N NE  . ARG C 1 57  ? 123.276 145.632 187.028 1.00 152.17 ? 57  ARG C NE  1 
ATOM   7842  C CZ  . ARG C 1 57  ? 124.190 144.733 187.377 1.00 152.17 ? 57  ARG C CZ  1 
ATOM   7843  N NH1 . ARG C 1 57  ? 125.090 145.021 188.305 1.00 152.17 ? 57  ARG C NH1 1 
ATOM   7844  N NH2 . ARG C 1 57  ? 124.198 143.542 186.798 1.00 152.17 ? 57  ARG C NH2 1 
ATOM   7845  N N   . ALA C 1 58  ? 120.161 152.259 186.913 1.00 149.41 ? 58  ALA C N   1 
ATOM   7846  C CA  . ALA C 1 58  ? 119.794 153.466 187.650 1.00 149.41 ? 58  ALA C CA  1 
ATOM   7847  C C   . ALA C 1 58  ? 118.306 153.458 187.970 1.00 149.41 ? 58  ALA C C   1 
ATOM   7848  O O   . ALA C 1 58  ? 117.909 153.379 189.135 1.00 149.41 ? 58  ALA C O   1 
ATOM   7849  C CB  . ALA C 1 58  ? 120.172 154.718 186.854 1.00 149.41 ? 58  ALA C CB  1 
ATOM   7850  N N   . LYS C 1 59  ? 117.466 153.518 186.937 1.00 150.93 ? 59  LYS C N   1 
ATOM   7851  C CA  . LYS C 1 59  ? 116.023 153.537 187.129 1.00 150.93 ? 59  LYS C CA  1 
ATOM   7852  C C   . LYS C 1 59  ? 115.318 152.615 186.147 1.00 150.93 ? 59  LYS C C   1 
ATOM   7853  O O   . LYS C 1 59  ? 114.086 152.677 186.043 1.00 150.93 ? 59  LYS C O   1 
ATOM   7854  C CB  . LYS C 1 59  ? 115.453 154.965 187.000 1.00 150.93 ? 59  LYS C CB  1 
ATOM   7855  C CG  . LYS C 1 59  ? 115.965 155.949 188.052 1.00 150.93 ? 59  LYS C CG  1 
ATOM   7856  C CD  . LYS C 1 59  ? 115.538 155.546 189.459 1.00 150.93 ? 59  LYS C CD  1 
ATOM   7857  C CE  . LYS C 1 59  ? 114.141 156.004 189.808 1.00 150.93 ? 59  LYS C CE  1 
ATOM   7858  N NZ  . LYS C 1 59  ? 114.094 157.485 189.947 1.00 150.93 ? 59  LYS C NZ  1 
ATOM   7859  N N   . GLY C 1 60  ? 116.053 151.762 185.434 1.00 147.99 ? 60  GLY C N   1 
ATOM   7860  C CA  . GLY C 1 60  ? 115.435 150.884 184.463 1.00 147.99 ? 60  GLY C CA  1 
ATOM   7861  C C   . GLY C 1 60  ? 114.931 151.638 183.251 1.00 147.99 ? 60  GLY C C   1 
ATOM   7862  O O   . GLY C 1 60  ? 113.721 151.817 183.091 1.00 147.99 ? 60  GLY C O   1 
ATOM   7863  N N   . ARG C 1 61  ? 115.844 152.134 182.415 1.00 137.97 ? 61  ARG C N   1 
ATOM   7864  C CA  . ARG C 1 61  ? 115.458 153.024 181.334 1.00 137.97 ? 61  ARG C CA  1 
ATOM   7865  C C   . ARG C 1 61  ? 115.348 152.341 179.975 1.00 137.97 ? 61  ARG C C   1 
ATOM   7866  O O   . ARG C 1 61  ? 114.606 152.838 179.119 1.00 137.97 ? 61  ARG C O   1 
ATOM   7867  C CB  . ARG C 1 61  ? 116.447 154.200 181.254 1.00 137.97 ? 61  ARG C CB  1 
ATOM   7868  C CG  . ARG C 1 61  ? 116.030 155.366 180.365 1.00 137.97 ? 61  ARG C CG  1 
ATOM   7869  C CD  . ARG C 1 61  ? 114.833 156.111 180.956 1.00 137.97 ? 61  ARG C CD  1 
ATOM   7870  N NE  . ARG C 1 61  ? 113.539 155.573 180.538 1.00 137.97 ? 61  ARG C NE  1 
ATOM   7871  C CZ  . ARG C 1 61  ? 112.377 155.930 181.074 1.00 137.97 ? 61  ARG C CZ  1 
ATOM   7872  N NH1 . ARG C 1 61  ? 111.246 155.394 180.644 1.00 137.97 ? 61  ARG C NH1 1 
ATOM   7873  N NH2 . ARG C 1 61  ? 112.348 156.827 182.045 1.00 137.97 ? 61  ARG C NH2 1 
ATOM   7874  N N   . LYS C 1 62  ? 116.001 151.178 179.789 1.00 128.86 ? 62  LYS C N   1 
ATOM   7875  C CA  . LYS C 1 62  ? 116.080 150.415 178.542 1.00 128.86 ? 62  LYS C CA  1 
ATOM   7876  C C   . LYS C 1 62  ? 116.610 151.301 177.420 1.00 128.86 ? 62  LYS C C   1 
ATOM   7877  O O   . LYS C 1 62  ? 115.842 151.740 176.558 1.00 128.86 ? 62  LYS C O   1 
ATOM   7878  C CB  . LYS C 1 62  ? 114.721 149.812 178.178 1.00 128.86 ? 62  LYS C CB  1 
ATOM   7879  C CG  . LYS C 1 62  ? 114.241 148.768 179.164 1.00 128.86 ? 62  LYS C CG  1 
ATOM   7880  C CD  . LYS C 1 62  ? 112.866 148.258 178.806 1.00 128.86 ? 62  LYS C CD  1 
ATOM   7881  C CE  . LYS C 1 62  ? 112.471 147.103 179.708 1.00 128.86 ? 62  LYS C CE  1 
ATOM   7882  N NZ  . LYS C 1 62  ? 112.326 147.504 181.134 1.00 128.86 ? 62  LYS C NZ  1 
ATOM   7883  N N   . PRO C 1 63  ? 117.918 151.590 177.412 1.00 130.52 ? 63  PRO C N   1 
ATOM   7884  C CA  . PRO C 1 63  ? 118.439 152.722 176.631 1.00 130.52 ? 63  PRO C CA  1 
ATOM   7885  C C   . PRO C 1 63  ? 118.469 152.520 175.128 1.00 130.52 ? 63  PRO C C   1 
ATOM   7886  O O   . PRO C 1 63  ? 119.532 152.317 174.538 1.00 130.52 ? 63  PRO C O   1 
ATOM   7887  C CB  . PRO C 1 63  ? 119.859 152.887 177.179 1.00 130.52 ? 63  PRO C CB  1 
ATOM   7888  C CG  . PRO C 1 63  ? 120.235 151.523 177.625 1.00 130.52 ? 63  PRO C CG  1 
ATOM   7889  C CD  . PRO C 1 63  ? 118.984 150.880 178.137 1.00 130.52 ? 63  PRO C CD  1 
ATOM   7890  N N   . CYS C 1 64  ? 117.305 152.598 174.493 1.00 134.43 ? 64  CYS C N   1 
ATOM   7891  C CA  . CYS C 1 64  ? 117.270 152.737 173.046 1.00 134.43 ? 64  CYS C CA  1 
ATOM   7892  C C   . CYS C 1 64  ? 117.482 154.177 172.600 1.00 134.43 ? 64  CYS C C   1 
ATOM   7893  O O   . CYS C 1 64  ? 117.614 154.423 171.397 1.00 134.43 ? 64  CYS C O   1 
ATOM   7894  C CB  . CYS C 1 64  ? 115.947 152.208 172.484 1.00 134.43 ? 64  CYS C CB  1 
ATOM   7895  S SG  . CYS C 1 64  ? 115.745 150.416 172.584 1.00 134.43 ? 64  CYS C SG  1 
ATOM   7896  N N   . LYS C 1 65  ? 117.548 155.130 173.534 1.00 124.43 ? 65  LYS C N   1 
ATOM   7897  C CA  . LYS C 1 65  ? 117.852 156.509 173.174 1.00 124.43 ? 65  LYS C CA  1 
ATOM   7898  C C   . LYS C 1 65  ? 119.316 156.702 172.798 1.00 124.43 ? 65  LYS C C   1 
ATOM   7899  O O   . LYS C 1 65  ? 119.678 157.780 172.317 1.00 124.43 ? 65  LYS C O   1 
ATOM   7900  C CB  . LYS C 1 65  ? 117.472 157.449 174.320 1.00 124.43 ? 65  LYS C CB  1 
ATOM   7901  C CG  . LYS C 1 65  ? 116.014 157.327 174.749 1.00 124.43 ? 65  LYS C CG  1 
ATOM   7902  C CD  . LYS C 1 65  ? 115.069 157.735 173.639 1.00 124.43 ? 65  LYS C CD  1 
ATOM   7903  C CE  . LYS C 1 65  ? 113.613 157.565 174.033 1.00 124.43 ? 65  LYS C CE  1 
ATOM   7904  N NZ  . LYS C 1 65  ? 113.177 158.551 175.045 1.00 124.43 ? 65  LYS C NZ  1 
ATOM   7905  N N   . LEU C 1 66  ? 120.158 155.693 173.017 1.00 116.48 ? 66  LEU C N   1 
ATOM   7906  C CA  . LEU C 1 66  ? 121.516 155.667 172.503 1.00 116.48 ? 66  LEU C CA  1 
ATOM   7907  C C   . LEU C 1 66  ? 121.683 154.735 171.313 1.00 116.48 ? 66  LEU C C   1 
ATOM   7908  O O   . LEU C 1 66  ? 122.558 154.976 170.476 1.00 116.48 ? 66  LEU C O   1 
ATOM   7909  C CB  . LEU C 1 66  ? 122.480 155.257 173.622 1.00 116.48 ? 66  LEU C CB  1 
ATOM   7910  C CG  . LEU C 1 66  ? 123.991 155.267 173.410 1.00 116.48 ? 66  LEU C CG  1 
ATOM   7911  C CD1 . LEU C 1 66  ? 124.640 155.758 174.673 1.00 116.48 ? 66  LEU C CD1 1 
ATOM   7912  C CD2 . LEU C 1 66  ? 124.518 153.876 173.084 1.00 116.48 ? 66  LEU C CD2 1 
ATOM   7913  N N   . MET C 1 67  ? 120.868 153.685 171.213 1.00 119.15 ? 67  MET C N   1 
ATOM   7914  C CA  . MET C 1 67  ? 121.043 152.696 170.157 1.00 119.15 ? 67  MET C CA  1 
ATOM   7915  C C   . MET C 1 67  ? 120.660 153.244 168.786 1.00 119.15 ? 67  MET C C   1 
ATOM   7916  O O   . MET C 1 67  ? 121.184 152.766 167.773 1.00 119.15 ? 67  MET C O   1 
ATOM   7917  C CB  . MET C 1 67  ? 120.231 151.445 170.508 1.00 119.15 ? 67  MET C CB  1 
ATOM   7918  C CG  . MET C 1 67  ? 120.414 150.227 169.604 1.00 119.15 ? 67  MET C CG  1 
ATOM   7919  S SD  . MET C 1 67  ? 119.250 150.136 168.228 1.00 119.15 ? 67  MET C SD  1 
ATOM   7920  C CE  . MET C 1 67  ? 119.869 148.696 167.364 1.00 119.15 ? 67  MET C CE  1 
ATOM   7921  N N   . LEU C 1 68  ? 119.787 154.253 168.734 1.00 111.05 ? 68  LEU C N   1 
ATOM   7922  C CA  . LEU C 1 68  ? 119.426 154.867 167.460 1.00 111.05 ? 68  LEU C CA  1 
ATOM   7923  C C   . LEU C 1 68  ? 120.613 155.590 166.842 1.00 111.05 ? 68  LEU C C   1 
ATOM   7924  O O   . LEU C 1 68  ? 120.749 155.640 165.617 1.00 111.05 ? 68  LEU C O   1 
ATOM   7925  C CB  . LEU C 1 68  ? 118.267 155.837 167.661 1.00 111.05 ? 68  LEU C CB  1 
ATOM   7926  C CG  . LEU C 1 68  ? 117.687 156.457 166.393 1.00 111.05 ? 68  LEU C CG  1 
ATOM   7927  C CD1 . LEU C 1 68  ? 117.068 155.367 165.552 1.00 111.05 ? 68  LEU C CD1 1 
ATOM   7928  C CD2 . LEU C 1 68  ? 116.674 157.538 166.702 1.00 111.05 ? 68  LEU C CD2 1 
ATOM   7929  N N   . GLN C 1 69  ? 121.495 156.133 167.680 1.00 110.67 ? 69  GLN C N   1 
ATOM   7930  C CA  . GLN C 1 69  ? 122.720 156.764 167.208 1.00 110.67 ? 69  GLN C CA  1 
ATOM   7931  C C   . GLN C 1 69  ? 123.658 155.769 166.536 1.00 110.67 ? 69  GLN C C   1 
ATOM   7932  O O   . GLN C 1 69  ? 124.424 156.157 165.650 1.00 110.67 ? 69  GLN C O   1 
ATOM   7933  C CB  . GLN C 1 69  ? 123.387 157.466 168.392 1.00 110.67 ? 69  GLN C CB  1 
ATOM   7934  C CG  . GLN C 1 69  ? 124.684 158.205 168.130 1.00 110.67 ? 69  GLN C CG  1 
ATOM   7935  C CD  . GLN C 1 69  ? 124.585 159.251 167.050 1.00 110.67 ? 69  GLN C CD  1 
ATOM   7936  O OE1 . GLN C 1 69  ? 125.228 159.140 166.012 1.00 110.67 ? 69  GLN C OE1 1 
ATOM   7937  N NE2 . GLN C 1 69  ? 123.766 160.267 167.280 1.00 110.67 ? 69  GLN C NE2 1 
ATOM   7938  N N   . VAL C 1 70  ? 123.576 154.491 166.897 1.00 108.77 ? 70  VAL C N   1 
ATOM   7939  C CA  . VAL C 1 70  ? 124.402 153.478 166.254 1.00 108.77 ? 70  VAL C CA  1 
ATOM   7940  C C   . VAL C 1 70  ? 123.861 153.150 164.866 1.00 108.77 ? 70  VAL C C   1 
ATOM   7941  O O   . VAL C 1 70  ? 124.615 152.718 163.987 1.00 108.77 ? 70  VAL C O   1 
ATOM   7942  C CB  . VAL C 1 70  ? 124.472 152.242 167.169 1.00 108.77 ? 70  VAL C CB  1 
ATOM   7943  C CG1 . VAL C 1 70  ? 125.437 151.185 166.650 1.00 108.77 ? 70  VAL C CG1 1 
ATOM   7944  C CG2 . VAL C 1 70  ? 124.857 152.664 168.567 1.00 108.77 ? 70  VAL C CG2 1 
ATOM   7945  N N   . VAL C 1 71  ? 122.568 153.385 164.632 1.00 107.94 ? 71  VAL C N   1 
ATOM   7946  C CA  . VAL C 1 71  ? 121.971 153.106 163.329 1.00 107.94 ? 71  VAL C CA  1 
ATOM   7947  C C   . VAL C 1 71  ? 122.549 154.029 162.266 1.00 107.94 ? 71  VAL C C   1 
ATOM   7948  O O   . VAL C 1 71  ? 122.728 153.621 161.113 1.00 107.94 ? 71  VAL C O   1 
ATOM   7949  C CB  . VAL C 1 71  ? 120.438 153.230 163.425 1.00 107.94 ? 71  VAL C CB  1 
ATOM   7950  C CG1 . VAL C 1 71  ? 119.752 152.888 162.110 1.00 107.94 ? 71  VAL C CG1 1 
ATOM   7951  C CG2 . VAL C 1 71  ? 119.914 152.369 164.549 1.00 107.94 ? 71  VAL C CG2 1 
ATOM   7952  N N   . LYS C 1 72  ? 122.895 155.264 162.648 1.00 107.22 ? 72  LYS C N   1 
ATOM   7953  C CA  . LYS C 1 72  ? 123.552 156.202 161.746 1.00 107.22 ? 72  LYS C CA  1 
ATOM   7954  C C   . LYS C 1 72  ? 124.875 155.686 161.212 1.00 107.22 ? 72  LYS C C   1 
ATOM   7955  O O   . LYS C 1 72  ? 125.222 156.003 160.072 1.00 107.22 ? 72  LYS C O   1 
ATOM   7956  C CB  . LYS C 1 72  ? 123.860 157.516 162.446 1.00 107.22 ? 72  LYS C CB  1 
ATOM   7957  C CG  . LYS C 1 72  ? 122.725 158.368 162.878 1.00 107.22 ? 72  LYS C CG  1 
ATOM   7958  C CD  . LYS C 1 72  ? 123.365 159.604 163.433 1.00 107.22 ? 72  LYS C CD  1 
ATOM   7959  C CE  . LYS C 1 72  ? 122.399 160.536 164.069 1.00 107.22 ? 72  LYS C CE  1 
ATOM   7960  N NZ  . LYS C 1 72  ? 123.131 161.689 164.656 1.00 107.22 ? 72  LYS C NZ  1 
ATOM   7961  N N   . ILE C 1 73  ? 125.617 154.927 162.024 1.00 99.78  ? 73  ILE C N   1 
ATOM   7962  C CA  . ILE C 1 73  ? 126.904 154.388 161.608 1.00 99.78  ? 73  ILE C CA  1 
ATOM   7963  C C   . ILE C 1 73  ? 126.726 153.461 160.423 1.00 99.78  ? 73  ILE C C   1 
ATOM   7964  O O   . ILE C 1 73  ? 127.534 153.470 159.488 1.00 99.78  ? 73  ILE C O   1 
ATOM   7965  C CB  . ILE C 1 73  ? 127.568 153.657 162.783 1.00 99.78  ? 73  ILE C CB  1 
ATOM   7966  C CG1 . ILE C 1 73  ? 127.619 154.557 164.011 1.00 99.78  ? 73  ILE C CG1 1 
ATOM   7967  C CG2 . ILE C 1 73  ? 128.968 153.210 162.419 1.00 99.78  ? 73  ILE C CG2 1 
ATOM   7968  C CD1 . ILE C 1 73  ? 128.469 155.760 163.852 1.00 99.78  ? 73  ILE C CD1 1 
ATOM   7969  N N   . LEU C 1 74  ? 125.647 152.691 160.407 1.00 102.62 ? 74  LEU C N   1 
ATOM   7970  C CA  . LEU C 1 74  ? 125.377 151.858 159.249 1.00 102.62 ? 74  LEU C CA  1 
ATOM   7971  C C   . LEU C 1 74  ? 124.755 152.636 158.106 1.00 102.62 ? 74  LEU C C   1 
ATOM   7972  O O   . LEU C 1 74  ? 125.204 152.515 156.965 1.00 102.62 ? 74  LEU C O   1 
ATOM   7973  C CB  . LEU C 1 74  ? 124.458 150.698 159.620 1.00 102.62 ? 74  LEU C CB  1 
ATOM   7974  C CG  . LEU C 1 74  ? 125.115 149.428 160.149 1.00 102.62 ? 74  LEU C CG  1 
ATOM   7975  C CD1 . LEU C 1 74  ? 125.585 149.567 161.589 1.00 102.62 ? 74  LEU C CD1 1 
ATOM   7976  C CD2 . LEU C 1 74  ? 124.154 148.264 159.988 1.00 102.62 ? 74  LEU C CD2 1 
ATOM   7977  N N   . VAL C 1 75  ? 123.745 153.450 158.389 1.00 103.96 ? 75  VAL C N   1 
ATOM   7978  C CA  . VAL C 1 75  ? 122.893 153.948 157.319 1.00 103.96 ? 75  VAL C CA  1 
ATOM   7979  C C   . VAL C 1 75  ? 123.589 155.060 156.547 1.00 103.96 ? 75  VAL C C   1 
ATOM   7980  O O   . VAL C 1 75  ? 123.539 155.092 155.313 1.00 103.96 ? 75  VAL C O   1 
ATOM   7981  C CB  . VAL C 1 75  ? 121.536 154.386 157.890 1.00 103.96 ? 75  VAL C CB  1 
ATOM   7982  C CG1 . VAL C 1 75  ? 120.686 154.981 156.820 1.00 103.96 ? 75  VAL C CG1 1 
ATOM   7983  C CG2 . VAL C 1 75  ? 120.821 153.186 158.468 1.00 103.96 ? 75  VAL C CG2 1 
ATOM   7984  N N   . VAL C 1 76  ? 124.288 155.955 157.247 1.00 98.67  ? 76  VAL C N   1 
ATOM   7985  C CA  . VAL C 1 76  ? 124.949 157.070 156.569 1.00 98.67  ? 76  VAL C CA  1 
ATOM   7986  C C   . VAL C 1 76  ? 126.125 156.588 155.730 1.00 98.67  ? 76  VAL C C   1 
ATOM   7987  O O   . VAL C 1 76  ? 126.319 157.055 154.602 1.00 98.67  ? 76  VAL C O   1 
ATOM   7988  C CB  . VAL C 1 76  ? 125.379 158.129 157.596 1.00 98.67  ? 76  VAL C CB  1 
ATOM   7989  C CG1 . VAL C 1 76  ? 126.120 159.258 156.942 1.00 98.67  ? 76  VAL C CG1 1 
ATOM   7990  C CG2 . VAL C 1 76  ? 124.174 158.667 158.306 1.00 98.67  ? 76  VAL C CG2 1 
ATOM   7991  N N   . THR C 1 77  ? 126.883 155.619 156.238 1.00 92.79  ? 77  THR C N   1 
ATOM   7992  C CA  . THR C 1 77  ? 128.007 155.068 155.491 1.00 92.79  ? 77  THR C CA  1 
ATOM   7993  C C   . THR C 1 77  ? 127.534 154.321 154.249 1.00 92.79  ? 77  THR C C   1 
ATOM   7994  O O   . THR C 1 77  ? 128.126 154.454 153.172 1.00 92.79  ? 77  THR C O   1 
ATOM   7995  C CB  . THR C 1 77  ? 128.822 154.155 156.401 1.00 92.79  ? 77  THR C CB  1 
ATOM   7996  O OG1 . THR C 1 77  ? 129.268 154.908 157.528 1.00 92.79  ? 77  THR C OG1 1 
ATOM   7997  C CG2 . THR C 1 77  ? 130.027 153.621 155.687 1.00 92.79  ? 77  THR C CG2 1 
ATOM   7998  N N   . VAL C 1 78  ? 126.448 153.555 154.369 1.00 98.21  ? 78  VAL C N   1 
ATOM   7999  C CA  . VAL C 1 78  ? 125.898 152.882 153.197 1.00 98.21  ? 78  VAL C CA  1 
ATOM   8000  C C   . VAL C 1 78  ? 125.262 153.891 152.249 1.00 98.21  ? 78  VAL C C   1 
ATOM   8001  O O   . VAL C 1 78  ? 125.344 153.738 151.023 1.00 98.21  ? 78  VAL C O   1 
ATOM   8002  C CB  . VAL C 1 78  ? 124.922 151.780 153.643 1.00 98.21  ? 78  VAL C CB  1 
ATOM   8003  C CG1 . VAL C 1 78  ? 124.184 151.166 152.473 1.00 98.21  ? 78  VAL C CG1 1 
ATOM   8004  C CG2 . VAL C 1 78  ? 125.693 150.694 154.334 1.00 98.21  ? 78  VAL C CG2 1 
ATOM   8005  N N   . GLN C 1 79  ? 124.672 154.959 152.789 1.00 104.71 ? 79  GLN C N   1 
ATOM   8006  C CA  . GLN C 1 79  ? 124.281 156.092 151.956 1.00 104.71 ? 79  GLN C CA  1 
ATOM   8007  C C   . GLN C 1 79  ? 125.481 156.710 151.260 1.00 104.71 ? 79  GLN C C   1 
ATOM   8008  O O   . GLN C 1 79  ? 125.388 157.112 150.096 1.00 104.71 ? 79  GLN C O   1 
ATOM   8009  C CB  . GLN C 1 79  ? 123.550 157.136 152.800 1.00 104.71 ? 79  GLN C CB  1 
ATOM   8010  C CG  . GLN C 1 79  ? 123.296 158.473 152.130 1.00 104.71 ? 79  GLN C CG  1 
ATOM   8011  C CD  . GLN C 1 79  ? 122.508 158.354 150.850 1.00 104.71 ? 79  GLN C CD  1 
ATOM   8012  O OE1 . GLN C 1 79  ? 121.566 157.571 150.750 1.00 104.71 ? 79  GLN C OE1 1 
ATOM   8013  N NE2 . GLN C 1 79  ? 122.890 159.137 149.856 1.00 104.71 ? 79  GLN C NE2 1 
ATOM   8014  N N   . LEU C 1 80  ? 126.626 156.724 151.923 1.00 91.61  ? 80  LEU C N   1 
ATOM   8015  C CA  . LEU C 1 80  ? 127.836 157.267 151.334 1.00 91.61  ? 80  LEU C CA  1 
ATOM   8016  C C   . LEU C 1 80  ? 128.472 156.351 150.301 1.00 91.61  ? 80  LEU C C   1 
ATOM   8017  O O   . LEU C 1 80  ? 128.852 156.829 149.229 1.00 91.61  ? 80  LEU C O   1 
ATOM   8018  C CB  . LEU C 1 80  ? 128.828 157.597 152.447 1.00 91.61  ? 80  LEU C CB  1 
ATOM   8019  C CG  . LEU C 1 80  ? 130.187 158.131 152.053 1.00 91.61  ? 80  LEU C CG  1 
ATOM   8020  C CD1 . LEU C 1 80  ? 130.554 159.278 152.930 1.00 91.61  ? 80  LEU C CD1 1 
ATOM   8021  C CD2 . LEU C 1 80  ? 131.232 157.044 152.238 1.00 91.61  ? 80  LEU C CD2 1 
ATOM   8022  N N   . ILE C 1 81  ? 128.601 155.056 150.590 1.00 83.26  ? 81  ILE C N   1 
ATOM   8023  C CA  . ILE C 1 81  ? 129.367 154.173 149.716 1.00 83.26  ? 81  ILE C CA  1 
ATOM   8024  C C   . ILE C 1 81  ? 128.632 153.934 148.406 1.00 83.26  ? 81  ILE C C   1 
ATOM   8025  O O   . ILE C 1 81  ? 129.225 153.996 147.324 1.00 83.26  ? 81  ILE C O   1 
ATOM   8026  C CB  . ILE C 1 81  ? 129.691 152.856 150.435 1.00 83.26  ? 81  ILE C CB  1 
ATOM   8027  C CG1 . ILE C 1 81  ? 130.666 153.117 151.571 1.00 83.26  ? 81  ILE C CG1 1 
ATOM   8028  C CG2 . ILE C 1 81  ? 130.276 151.839 149.483 1.00 83.26  ? 81  ILE C CG2 1 
ATOM   8029  C CD1 . ILE C 1 81  ? 130.917 151.918 152.419 1.00 83.26  ? 81  ILE C CD1 1 
ATOM   8030  N N   . LEU C 1 82  ? 127.326 153.721 148.468 1.00 89.01  ? 82  LEU C N   1 
ATOM   8031  C CA  . LEU C 1 82  ? 126.591 153.567 147.222 1.00 89.01  ? 82  LEU C CA  1 
ATOM   8032  C C   . LEU C 1 82  ? 126.277 154.891 146.550 1.00 89.01  ? 82  LEU C C   1 
ATOM   8033  O O   . LEU C 1 82  ? 125.635 154.894 145.499 1.00 89.01  ? 82  LEU C O   1 
ATOM   8034  C CB  . LEU C 1 82  ? 125.306 152.769 147.434 1.00 89.01  ? 82  LEU C CB  1 
ATOM   8035  C CG  . LEU C 1 82  ? 125.465 151.244 147.355 1.00 89.01  ? 82  LEU C CG  1 
ATOM   8036  C CD1 . LEU C 1 82  ? 126.012 150.634 148.634 1.00 89.01  ? 82  LEU C CD1 1 
ATOM   8037  C CD2 . LEU C 1 82  ? 124.167 150.573 146.946 1.00 89.01  ? 82  LEU C CD2 1 
ATOM   8038  N N   . PHE C 1 83  ? 126.706 156.011 147.125 1.00 86.24  ? 83  PHE C N   1 
ATOM   8039  C CA  . PHE C 1 83  ? 126.760 157.250 146.364 1.00 86.24  ? 83  PHE C CA  1 
ATOM   8040  C C   . PHE C 1 83  ? 128.075 157.376 145.614 1.00 86.24  ? 83  PHE C C   1 
ATOM   8041  O O   . PHE C 1 83  ? 128.103 157.874 144.485 1.00 86.24  ? 83  PHE C O   1 
ATOM   8042  C CB  . PHE C 1 83  ? 126.560 158.449 147.284 1.00 86.24  ? 83  PHE C CB  1 
ATOM   8043  C CG  . PHE C 1 83  ? 126.760 159.758 146.606 1.00 86.24  ? 83  PHE C CG  1 
ATOM   8044  C CD1 . PHE C 1 83  ? 125.878 160.186 145.639 1.00 86.24  ? 83  PHE C CD1 1 
ATOM   8045  C CD2 . PHE C 1 83  ? 127.821 160.569 146.947 1.00 86.24  ? 83  PHE C CD2 1 
ATOM   8046  C CE1 . PHE C 1 83  ? 126.064 161.391 145.009 1.00 86.24  ? 83  PHE C CE1 1 
ATOM   8047  C CE2 . PHE C 1 83  ? 128.010 161.777 146.326 1.00 86.24  ? 83  PHE C CE2 1 
ATOM   8048  C CZ  . PHE C 1 83  ? 127.132 162.188 145.356 1.00 86.24  ? 83  PHE C CZ  1 
ATOM   8049  N N   . GLY C 1 84  ? 129.164 156.919 146.218 1.00 85.97  ? 84  GLY C N   1 
ATOM   8050  C CA  . GLY C 1 84  ? 130.472 157.051 145.616 1.00 85.97  ? 84  GLY C CA  1 
ATOM   8051  C C   . GLY C 1 84  ? 130.673 156.168 144.408 1.00 85.97  ? 84  GLY C C   1 
ATOM   8052  O O   . GLY C 1 84  ? 131.256 156.605 143.415 1.00 85.97  ? 84  GLY C O   1 
ATOM   8053  N N   . LEU C 1 85  ? 130.180 154.933 144.467 1.00 84.01  ? 85  LEU C N   1 
ATOM   8054  C CA  . LEU C 1 85  ? 130.394 154.004 143.368 1.00 84.01  ? 85  LEU C CA  1 
ATOM   8055  C C   . LEU C 1 85  ? 129.605 154.371 142.124 1.00 84.01  ? 85  LEU C C   1 
ATOM   8056  O O   . LEU C 1 85  ? 130.093 154.153 141.013 1.00 84.01  ? 85  LEU C O   1 
ATOM   8057  C CB  . LEU C 1 85  ? 130.051 152.590 143.810 1.00 84.01  ? 85  LEU C CB  1 
ATOM   8058  C CG  . LEU C 1 85  ? 131.070 152.042 144.797 1.00 84.01  ? 85  LEU C CG  1 
ATOM   8059  C CD1 . LEU C 1 85  ? 130.633 150.704 145.322 1.00 84.01  ? 85  LEU C CD1 1 
ATOM   8060  C CD2 . LEU C 1 85  ? 132.396 151.915 144.099 1.00 84.01  ? 85  LEU C CD2 1 
ATOM   8061  N N   . SER C 1 86  ? 128.415 154.931 142.272 1.00 86.22  ? 86  SER C N   1 
ATOM   8062  C CA  . SER C 1 86  ? 127.689 155.437 141.121 1.00 86.22  ? 86  SER C CA  1 
ATOM   8063  C C   . SER C 1 86  ? 128.297 156.714 140.577 1.00 86.22  ? 86  SER C C   1 
ATOM   8064  O O   . SER C 1 86  ? 128.112 157.018 139.398 1.00 86.22  ? 86  SER C O   1 
ATOM   8065  C CB  . SER C 1 86  ? 126.228 155.689 141.485 1.00 86.22  ? 86  SER C CB  1 
ATOM   8066  O OG  . SER C 1 86  ? 126.124 156.752 142.413 1.00 86.22  ? 86  SER C OG  1 
ATOM   8067  N N   . ASN C 1 87  ? 129.019 157.459 141.405 1.00 85.42  ? 87  ASN C N   1 
ATOM   8068  C CA  . ASN C 1 87  ? 129.671 158.680 140.972 1.00 85.42  ? 87  ASN C CA  1 
ATOM   8069  C C   . ASN C 1 87  ? 131.043 158.427 140.374 1.00 85.42  ? 87  ASN C C   1 
ATOM   8070  O O   . ASN C 1 87  ? 131.422 159.117 139.427 1.00 85.42  ? 87  ASN C O   1 
ATOM   8071  C CB  . ASN C 1 87  ? 129.809 159.642 142.152 1.00 85.42  ? 87  ASN C CB  1 
ATOM   8072  C CG  . ASN C 1 87  ? 130.111 161.059 141.725 1.00 85.42  ? 87  ASN C CG  1 
ATOM   8073  O OD1 . ASN C 1 87  ? 130.127 161.380 140.543 1.00 85.42  ? 87  ASN C OD1 1 
ATOM   8074  N ND2 . ASN C 1 87  ? 130.370 161.917 142.697 1.00 85.42  ? 87  ASN C ND2 1 
ATOM   8075  N N   . GLN C 1 88  ? 131.788 157.453 140.903 1.00 86.50  ? 88  GLN C N   1 
ATOM   8076  C CA  . GLN C 1 88  ? 133.114 157.135 140.381 1.00 86.50  ? 88  GLN C CA  1 
ATOM   8077  C C   . GLN C 1 88  ? 133.048 156.643 138.947 1.00 86.50  ? 88  GLN C C   1 
ATOM   8078  O O   . GLN C 1 88  ? 133.852 157.053 138.103 1.00 86.50  ? 88  GLN C O   1 
ATOM   8079  C CB  . GLN C 1 88  ? 133.776 156.074 141.255 1.00 86.50  ? 88  GLN C CB  1 
ATOM   8080  C CG  . GLN C 1 88  ? 135.102 155.576 140.728 1.00 86.50  ? 88  GLN C CG  1 
ATOM   8081  C CD  . GLN C 1 88  ? 135.684 154.461 141.566 1.00 86.50  ? 88  GLN C CD  1 
ATOM   8082  O OE1 . GLN C 1 88  ? 135.121 154.077 142.589 1.00 86.50  ? 88  GLN C OE1 1 
ATOM   8083  N NE2 . GLN C 1 88  ? 136.800 153.907 141.113 1.00 86.50  ? 88  GLN C NE2 1 
ATOM   8084  N N   . LEU C 1 89  ? 132.075 155.788 138.649 1.00 86.20  ? 89  LEU C N   1 
ATOM   8085  C CA  . LEU C 1 89  ? 131.985 155.172 137.336 1.00 86.20  ? 89  LEU C CA  1 
ATOM   8086  C C   . LEU C 1 89  ? 131.615 156.181 136.262 1.00 86.20  ? 89  LEU C C   1 
ATOM   8087  O O   . LEU C 1 89  ? 131.952 155.988 135.092 1.00 86.20  ? 89  LEU C O   1 
ATOM   8088  C CB  . LEU C 1 89  ? 130.973 154.030 137.390 1.00 86.20  ? 89  LEU C CB  1 
ATOM   8089  C CG  . LEU C 1 89  ? 130.836 153.079 136.211 1.00 86.20  ? 89  LEU C CG  1 
ATOM   8090  C CD1 . LEU C 1 89  ? 132.156 152.391 135.960 1.00 86.20  ? 89  LEU C CD1 1 
ATOM   8091  C CD2 . LEU C 1 89  ? 129.766 152.054 136.515 1.00 86.20  ? 89  LEU C CD2 1 
ATOM   8092  N N   . ALA C 1 90  ? 130.963 157.273 136.637 1.00 85.01  ? 90  ALA C N   1 
ATOM   8093  C CA  . ALA C 1 90  ? 130.684 158.342 135.694 1.00 85.01  ? 90  ALA C CA  1 
ATOM   8094  C C   . ALA C 1 90  ? 131.863 159.276 135.497 1.00 85.01  ? 90  ALA C C   1 
ATOM   8095  O O   . ALA C 1 90  ? 131.927 159.962 134.474 1.00 85.01  ? 90  ALA C O   1 
ATOM   8096  C CB  . ALA C 1 90  ? 129.478 159.154 136.156 1.00 85.01  ? 90  ALA C CB  1 
ATOM   8097  N N   . VAL C 1 91  ? 132.790 159.334 136.450 1.00 83.38  ? 91  VAL C N   1 
ATOM   8098  C CA  . VAL C 1 91  ? 133.947 160.203 136.285 1.00 83.38  ? 91  VAL C CA  1 
ATOM   8099  C C   . VAL C 1 91  ? 134.927 159.592 135.298 1.00 83.38  ? 91  VAL C C   1 
ATOM   8100  O O   . VAL C 1 91  ? 135.481 160.290 134.442 1.00 83.38  ? 91  VAL C O   1 
ATOM   8101  C CB  . VAL C 1 91  ? 134.594 160.487 137.650 1.00 83.38  ? 91  VAL C CB  1 
ATOM   8102  C CG1 . VAL C 1 91  ? 135.896 161.236 137.499 1.00 83.38  ? 91  VAL C CG1 1 
ATOM   8103  C CG2 . VAL C 1 91  ? 133.664 161.311 138.485 1.00 83.38  ? 91  VAL C CG2 1 
ATOM   8104  N N   . THR C 1 92  ? 135.125 158.275 135.370 1.00 84.18  ? 92  THR C N   1 
ATOM   8105  C CA  . THR C 1 92  ? 136.051 157.625 134.453 1.00 84.18  ? 92  THR C CA  1 
ATOM   8106  C C   . THR C 1 92  ? 135.533 157.650 133.027 1.00 84.18  ? 92  THR C C   1 
ATOM   8107  O O   . THR C 1 92  ? 136.325 157.590 132.090 1.00 84.18  ? 92  THR C O   1 
ATOM   8108  C CB  . THR C 1 92  ? 136.310 156.190 134.881 1.00 84.18  ? 92  THR C CB  1 
ATOM   8109  O OG1 . THR C 1 92  ? 135.110 155.433 134.732 1.00 84.18  ? 92  THR C OG1 1 
ATOM   8110  C CG2 . THR C 1 92  ? 136.722 156.152 136.329 1.00 84.18  ? 92  THR C CG2 1 
ATOM   8111  N N   . PHE C 1 93  ? 134.223 157.756 132.836 1.00 85.07  ? 93  PHE C N   1 
ATOM   8112  C CA  . PHE C 1 93  ? 133.727 158.026 131.496 1.00 85.07  ? 93  PHE C CA  1 
ATOM   8113  C C   . PHE C 1 93  ? 133.968 159.474 131.103 1.00 85.07  ? 93  PHE C C   1 
ATOM   8114  O O   . PHE C 1 93  ? 134.161 159.766 129.922 1.00 85.07  ? 93  PHE C O   1 
ATOM   8115  C CB  . PHE C 1 93  ? 132.245 157.694 131.400 1.00 85.07  ? 93  PHE C CB  1 
ATOM   8116  C CG  . PHE C 1 93  ? 131.686 157.862 130.031 1.00 85.07  ? 93  PHE C CG  1 
ATOM   8117  C CD1 . PHE C 1 93  ? 131.940 156.925 129.057 1.00 85.07  ? 93  PHE C CD1 1 
ATOM   8118  C CD2 . PHE C 1 93  ? 130.909 158.957 129.716 1.00 85.07  ? 93  PHE C CD2 1 
ATOM   8119  C CE1 . PHE C 1 93  ? 131.429 157.075 127.796 1.00 85.07  ? 93  PHE C CE1 1 
ATOM   8120  C CE2 . PHE C 1 93  ? 130.401 159.111 128.454 1.00 85.07  ? 93  PHE C CE2 1 
ATOM   8121  C CZ  . PHE C 1 93  ? 130.658 158.172 127.496 1.00 85.07  ? 93  PHE C CZ  1 
ATOM   8122  N N   . ARG C 1 94  ? 133.958 160.394 132.064 1.00 81.98  ? 94  ARG C N   1 
ATOM   8123  C CA  . ARG C 1 94  ? 134.217 161.790 131.732 1.00 81.98  ? 94  ARG C CA  1 
ATOM   8124  C C   . ARG C 1 94  ? 135.681 162.017 131.413 1.00 81.98  ? 94  ARG C C   1 
ATOM   8125  O O   . ARG C 1 94  ? 136.007 162.663 130.416 1.00 81.98  ? 94  ARG C O   1 
ATOM   8126  C CB  . ARG C 1 94  ? 133.788 162.706 132.875 1.00 81.98  ? 94  ARG C CB  1 
ATOM   8127  C CG  . ARG C 1 94  ? 134.044 164.193 132.619 1.00 81.98  ? 94  ARG C CG  1 
ATOM   8128  C CD  . ARG C 1 94  ? 133.611 165.062 133.803 1.00 81.98  ? 94  ARG C CD  1 
ATOM   8129  N NE  . ARG C 1 94  ? 132.172 164.989 134.035 1.00 81.98  ? 94  ARG C NE  1 
ATOM   8130  C CZ  . ARG C 1 94  ? 131.617 164.428 135.102 1.00 81.98  ? 94  ARG C CZ  1 
ATOM   8131  N NH1 . ARG C 1 94  ? 132.382 163.897 136.038 1.00 81.98  ? 94  ARG C NH1 1 
ATOM   8132  N NH2 . ARG C 1 94  ? 130.299 164.395 135.234 1.00 81.98  ? 94  ARG C NH2 1 
ATOM   8133  N N   . GLU C 1 95  ? 136.582 161.486 132.232 1.00 83.88  ? 95  GLU C N   1 
ATOM   8134  C CA  . GLU C 1 95  ? 137.994 161.788 132.085 1.00 83.88  ? 95  GLU C CA  1 
ATOM   8135  C C   . GLU C 1 95  ? 138.694 160.878 131.098 1.00 83.88  ? 95  GLU C C   1 
ATOM   8136  O O   . GLU C 1 95  ? 139.922 160.903 131.027 1.00 83.88  ? 95  GLU C O   1 
ATOM   8137  C CB  . GLU C 1 95  ? 138.710 161.718 133.432 1.00 83.88  ? 95  GLU C CB  1 
ATOM   8138  C CG  . GLU C 1 95  ? 138.840 160.327 134.024 1.00 83.88  ? 95  GLU C CG  1 
ATOM   8139  C CD  . GLU C 1 95  ? 139.602 160.325 135.340 1.00 83.88  ? 95  GLU C CD  1 
ATOM   8140  O OE1 . GLU C 1 95  ? 139.976 161.420 135.810 1.00 83.88  ? 95  GLU C OE1 1 
ATOM   8141  O OE2 . GLU C 1 95  ? 139.844 159.232 135.898 1.00 83.88  ? 95  GLU C OE2 1 
ATOM   8142  N N   . GLU C 1 96  ? 137.959 160.080 130.330 1.00 80.85  ? 96  GLU C N   1 
ATOM   8143  C CA  . GLU C 1 96  ? 138.587 159.257 129.310 1.00 80.85  ? 96  GLU C CA  1 
ATOM   8144  C C   . GLU C 1 96  ? 138.103 159.616 127.914 1.00 80.85  ? 96  GLU C C   1 
ATOM   8145  O O   . GLU C 1 96  ? 138.790 159.320 126.936 1.00 80.85  ? 96  GLU C O   1 
ATOM   8146  C CB  . GLU C 1 96  ? 138.359 157.779 129.611 1.00 80.85  ? 96  GLU C CB  1 
ATOM   8147  C CG  . GLU C 1 96  ? 139.289 156.832 128.896 1.00 80.85  ? 96  GLU C CG  1 
ATOM   8148  C CD  . GLU C 1 96  ? 139.135 155.403 129.358 1.00 80.85  ? 96  GLU C CD  1 
ATOM   8149  O OE1 . GLU C 1 96  ? 138.236 155.138 130.182 1.00 80.85  ? 96  GLU C OE1 1 
ATOM   8150  O OE2 . GLU C 1 96  ? 139.931 154.545 128.917 1.00 80.85  ? 96  GLU C OE2 1 
ATOM   8151  N N   . ASN C 1 97  ? 136.965 160.291 127.788 1.00 77.37  ? 97  ASN C N   1 
ATOM   8152  C CA  . ASN C 1 97  ? 136.635 160.889 126.507 1.00 77.37  ? 97  ASN C CA  1 
ATOM   8153  C C   . ASN C 1 97  ? 137.449 162.131 126.207 1.00 77.37  ? 97  ASN C C   1 
ATOM   8154  O O   . ASN C 1 97  ? 137.622 162.463 125.033 1.00 77.37  ? 97  ASN C O   1 
ATOM   8155  C CB  . ASN C 1 97  ? 135.149 161.249 126.421 1.00 77.37  ? 97  ASN C CB  1 
ATOM   8156  C CG  . ASN C 1 97  ? 134.267 160.039 126.299 1.00 77.37  ? 97  ASN C CG  1 
ATOM   8157  O OD1 . ASN C 1 97  ? 133.429 159.781 127.152 1.00 77.37  ? 97  ASN C OD1 1 
ATOM   8158  N ND2 . ASN C 1 97  ? 134.447 159.286 125.228 1.00 77.37  ? 97  ASN C ND2 1 
ATOM   8159  N N   . THR C 1 98  ? 137.955 162.817 127.225 1.00 72.40  ? 98  THR C N   1 
ATOM   8160  C CA  . THR C 1 98  ? 138.826 163.951 126.968 1.00 72.40  ? 98  THR C CA  1 
ATOM   8161  C C   . THR C 1 98  ? 140.182 163.484 126.480 1.00 72.40  ? 98  THR C C   1 
ATOM   8162  O O   . THR C 1 98  ? 140.755 164.080 125.562 1.00 72.40  ? 98  THR C O   1 
ATOM   8163  C CB  . THR C 1 98  ? 139.001 164.761 128.230 1.00 72.40  ? 98  THR C CB  1 
ATOM   8164  O OG1 . THR C 1 98  ? 139.759 163.984 129.156 1.00 72.40  ? 98  THR C OG1 1 
ATOM   8165  C CG2 . THR C 1 98  ? 137.678 165.005 128.834 1.00 72.40  ? 98  THR C CG2 1 
ATOM   8166  N N   . ILE C 1 99  ? 140.708 162.422 127.095 1.00 70.77  ? 99  ILE C N   1 
ATOM   8167  C CA  . ILE C 1 99  ? 141.946 161.794 126.650 1.00 70.77  ? 99  ILE C CA  1 
ATOM   8168  C C   . ILE C 1 99  ? 141.790 161.272 125.238 1.00 70.77  ? 99  ILE C C   1 
ATOM   8169  O O   . ILE C 1 99  ? 142.737 161.303 124.445 1.00 70.77  ? 99  ILE C O   1 
ATOM   8170  C CB  . ILE C 1 99  ? 142.333 160.679 127.632 1.00 70.77  ? 99  ILE C CB  1 
ATOM   8171  C CG1 . ILE C 1 99  ? 142.478 161.259 129.026 1.00 70.77  ? 99  ILE C CG1 1 
ATOM   8172  C CG2 . ILE C 1 99  ? 143.620 160.012 127.245 1.00 70.77  ? 99  ILE C CG2 1 
ATOM   8173  C CD1 . ILE C 1 99  ? 143.517 162.333 129.131 1.00 70.77  ? 99  ILE C CD1 1 
ATOM   8174  N N   . ALA C 1 100 ? 140.591 160.823 124.884 1.00 68.27  ? 100 ALA C N   1 
ATOM   8175  C CA  . ALA C 1 100 ? 140.313 160.537 123.493 1.00 68.27  ? 100 ALA C CA  1 
ATOM   8176  C C   . ALA C 1 100 ? 140.325 161.791 122.645 1.00 68.27  ? 100 ALA C C   1 
ATOM   8177  O O   . ALA C 1 100 ? 140.835 161.756 121.525 1.00 68.27  ? 100 ALA C O   1 
ATOM   8178  C CB  . ALA C 1 100 ? 138.967 159.842 123.368 1.00 68.27  ? 100 ALA C CB  1 
ATOM   8179  N N   . PHE C 1 101 ? 139.813 162.899 123.159 1.00 67.79  ? 101 PHE C N   1 
ATOM   8180  C CA  . PHE C 1 101 ? 139.702 164.089 122.334 1.00 67.79  ? 101 PHE C CA  1 
ATOM   8181  C C   . PHE C 1 101 ? 141.033 164.760 122.087 1.00 67.79  ? 101 PHE C C   1 
ATOM   8182  O O   . PHE C 1 101 ? 141.216 165.365 121.028 1.00 67.79  ? 101 PHE C O   1 
ATOM   8183  C CB  . PHE C 1 101 ? 138.741 165.090 122.965 1.00 67.79  ? 101 PHE C CB  1 
ATOM   8184  C CG  . PHE C 1 101 ? 137.312 164.677 122.883 1.00 67.79  ? 101 PHE C CG  1 
ATOM   8185  C CD1 . PHE C 1 101 ? 136.903 163.738 121.960 1.00 67.79  ? 101 PHE C CD1 1 
ATOM   8186  C CD2 . PHE C 1 101 ? 136.382 165.202 123.748 1.00 67.79  ? 101 PHE C CD2 1 
ATOM   8187  C CE1 . PHE C 1 101 ? 135.598 163.349 121.895 1.00 67.79  ? 101 PHE C CE1 1 
ATOM   8188  C CE2 . PHE C 1 101 ? 135.077 164.813 123.684 1.00 67.79  ? 101 PHE C CE2 1 
ATOM   8189  C CZ  . PHE C 1 101 ? 134.685 163.887 122.758 1.00 67.79  ? 101 PHE C CZ  1 
ATOM   8190  N N   . ARG C 1 102 ? 141.969 164.661 123.023 1.00 68.81  ? 102 ARG C N   1 
ATOM   8191  C CA  . ARG C 1 102 ? 143.260 165.295 122.814 1.00 68.81  ? 102 ARG C CA  1 
ATOM   8192  C C   . ARG C 1 102 ? 144.077 164.566 121.771 1.00 68.81  ? 102 ARG C C   1 
ATOM   8193  O O   . ARG C 1 102 ? 144.875 165.192 121.072 1.00 68.81  ? 102 ARG C O   1 
ATOM   8194  C CB  . ARG C 1 102 ? 144.031 165.361 124.120 1.00 68.81  ? 102 ARG C CB  1 
ATOM   8195  C CG  . ARG C 1 102 ? 143.355 166.222 125.119 1.00 68.81  ? 102 ARG C CG  1 
ATOM   8196  C CD  . ARG C 1 102 ? 144.076 166.236 126.420 1.00 68.81  ? 102 ARG C CD  1 
ATOM   8197  N NE  . ARG C 1 102 ? 143.287 166.961 127.393 1.00 68.81  ? 102 ARG C NE  1 
ATOM   8198  C CZ  . ARG C 1 102 ? 143.606 167.063 128.669 1.00 68.81  ? 102 ARG C CZ  1 
ATOM   8199  N NH1 . ARG C 1 102 ? 144.705 166.485 129.119 1.00 68.81  ? 102 ARG C NH1 1 
ATOM   8200  N NH2 . ARG C 1 102 ? 142.822 167.737 129.491 1.00 68.81  ? 102 ARG C NH2 1 
ATOM   8201  N N   . HIS C 1 103 ? 143.878 163.264 121.631 1.00 64.20  ? 103 HIS C N   1 
ATOM   8202  C CA  . HIS C 1 103 ? 144.531 162.512 120.575 1.00 64.20  ? 103 HIS C CA  1 
ATOM   8203  C C   . HIS C 1 103 ? 143.827 162.629 119.237 1.00 64.20  ? 103 HIS C C   1 
ATOM   8204  O O   . HIS C 1 103 ? 144.251 161.982 118.279 1.00 64.20  ? 103 HIS C O   1 
ATOM   8205  C CB  . HIS C 1 103 ? 144.636 161.050 120.968 1.00 64.20  ? 103 HIS C CB  1 
ATOM   8206  C CG  . HIS C 1 103 ? 145.661 160.794 122.015 1.00 64.20  ? 103 HIS C CG  1 
ATOM   8207  N ND1 . HIS C 1 103 ? 147.004 160.754 121.732 1.00 64.20  ? 103 HIS C ND1 1 
ATOM   8208  C CD2 . HIS C 1 103 ? 145.546 160.581 123.344 1.00 64.20  ? 103 HIS C CD2 1 
ATOM   8209  C CE1 . HIS C 1 103 ? 147.676 160.512 122.842 1.00 64.20  ? 103 HIS C CE1 1 
ATOM   8210  N NE2 . HIS C 1 103 ? 146.814 160.402 123.834 1.00 64.20  ? 103 HIS C NE2 1 
ATOM   8211  N N   . LEU C 1 104 ? 142.775 163.417 119.146 1.00 59.66  ? 104 LEU C N   1 
ATOM   8212  C CA  . LEU C 1 104 ? 142.107 163.648 117.883 1.00 59.66  ? 104 LEU C CA  1 
ATOM   8213  C C   . LEU C 1 104 ? 142.114 165.095 117.455 1.00 59.66  ? 104 LEU C C   1 
ATOM   8214  O O   . LEU C 1 104 ? 141.962 165.366 116.270 1.00 59.66  ? 104 LEU C O   1 
ATOM   8215  C CB  . LEU C 1 104 ? 140.655 163.174 117.949 1.00 59.66  ? 104 LEU C CB  1 
ATOM   8216  C CG  . LEU C 1 104 ? 140.468 161.676 118.104 1.00 59.66  ? 104 LEU C CG  1 
ATOM   8217  C CD1 . LEU C 1 104 ? 139.006 161.338 118.237 1.00 59.66  ? 104 LEU C CD1 1 
ATOM   8218  C CD2 . LEU C 1 104 ? 141.061 160.978 116.920 1.00 59.66  ? 104 LEU C CD2 1 
ATOM   8219  N N   . PHE C 1 105 ? 142.289 166.029 118.377 1.00 64.39  ? 105 PHE C N   1 
ATOM   8220  C CA  . PHE C 1 105 ? 142.067 167.435 118.097 1.00 64.39  ? 105 PHE C CA  1 
ATOM   8221  C C   . PHE C 1 105 ? 143.294 168.299 118.313 1.00 64.39  ? 105 PHE C C   1 
ATOM   8222  O O   . PHE C 1 105 ? 143.223 169.507 118.093 1.00 64.39  ? 105 PHE C O   1 
ATOM   8223  C CB  . PHE C 1 105 ? 140.925 167.943 118.969 1.00 64.39  ? 105 PHE C CB  1 
ATOM   8224  C CG  . PHE C 1 105 ? 139.600 167.382 118.600 1.00 64.39  ? 105 PHE C CG  1 
ATOM   8225  C CD1 . PHE C 1 105 ? 139.314 167.057 117.298 1.00 64.39  ? 105 PHE C CD1 1 
ATOM   8226  C CD2 . PHE C 1 105 ? 138.669 167.096 119.572 1.00 64.39  ? 105 PHE C CD2 1 
ATOM   8227  C CE1 . PHE C 1 105 ? 138.096 166.522 116.965 1.00 64.39  ? 105 PHE C CE1 1 
ATOM   8228  C CE2 . PHE C 1 105 ? 137.458 166.545 119.244 1.00 64.39  ? 105 PHE C CE2 1 
ATOM   8229  C CZ  . PHE C 1 105 ? 137.170 166.263 117.942 1.00 64.39  ? 105 PHE C CZ  1 
ATOM   8230  N N   . LEU C 1 106 ? 144.407 167.730 118.749 1.00 63.13  ? 106 LEU C N   1 
ATOM   8231  C CA  . LEU C 1 106 ? 145.614 168.493 119.008 1.00 63.13  ? 106 LEU C CA  1 
ATOM   8232  C C   . LEU C 1 106 ? 146.751 167.926 118.181 1.00 63.13  ? 106 LEU C C   1 
ATOM   8233  O O   . LEU C 1 106 ? 147.066 166.740 118.279 1.00 63.13  ? 106 LEU C O   1 
ATOM   8234  C CB  . LEU C 1 106 ? 145.977 168.452 120.474 1.00 63.13  ? 106 LEU C CB  1 
ATOM   8235  C CG  . LEU C 1 106 ? 144.916 169.036 121.384 1.00 63.13  ? 106 LEU C CG  1 
ATOM   8236  C CD1 . LEU C 1 106 ? 145.364 168.947 122.809 1.00 63.13  ? 106 LEU C CD1 1 
ATOM   8237  C CD2 . LEU C 1 106 ? 144.653 170.449 120.997 1.00 63.13  ? 106 LEU C CD2 1 
ATOM   8238  N N   . LEU C 1 107 ? 147.375 168.776 117.378 1.00 62.71  ? 107 LEU C N   1 
ATOM   8239  C CA  . LEU C 1 107 ? 148.339 168.311 116.392 1.00 62.71  ? 107 LEU C CA  1 
ATOM   8240  C C   . LEU C 1 107 ? 149.649 167.968 117.077 1.00 62.71  ? 107 LEU C C   1 
ATOM   8241  O O   . LEU C 1 107 ? 150.365 168.857 117.540 1.00 62.71  ? 107 LEU C O   1 
ATOM   8242  C CB  . LEU C 1 107 ? 148.566 169.367 115.324 1.00 62.71  ? 107 LEU C CB  1 
ATOM   8243  C CG  . LEU C 1 107 ? 149.491 168.857 114.234 1.00 62.71  ? 107 LEU C CG  1 
ATOM   8244  C CD1 . LEU C 1 107 ? 148.821 167.720 113.507 1.00 62.71  ? 107 LEU C CD1 1 
ATOM   8245  C CD2 . LEU C 1 107 ? 149.851 169.972 113.286 1.00 62.71  ? 107 LEU C CD2 1 
ATOM   8246  N N   . GLY C 1 108 ? 149.972 166.682 117.126 1.00 71.07  ? 108 GLY C N   1 
ATOM   8247  C CA  . GLY C 1 108 ? 151.240 166.259 117.676 1.00 71.07  ? 108 GLY C CA  1 
ATOM   8248  C C   . GLY C 1 108 ? 151.263 166.105 119.173 1.00 71.07  ? 108 GLY C C   1 
ATOM   8249  O O   . GLY C 1 108 ? 152.292 166.373 119.794 1.00 71.07  ? 108 GLY C O   1 
ATOM   8250  N N   . TYR C 1 109 ? 150.160 165.690 119.777 1.00 75.43  ? 109 TYR C N   1 
ATOM   8251  C CA  . TYR C 1 109 ? 150.076 165.560 121.225 1.00 75.43  ? 109 TYR C CA  1 
ATOM   8252  C C   . TYR C 1 109 ? 150.395 164.134 121.611 1.00 75.43  ? 109 TYR C C   1 
ATOM   8253  O O   . TYR C 1 109 ? 149.590 163.230 121.403 1.00 75.43  ? 109 TYR C O   1 
ATOM   8254  C CB  . TYR C 1 109 ? 148.690 165.945 121.713 1.00 75.43  ? 109 TYR C CB  1 
ATOM   8255  C CG  . TYR C 1 109 ? 148.457 165.736 123.184 1.00 75.43  ? 109 TYR C CG  1 
ATOM   8256  C CD1 . TYR C 1 109 ? 148.956 166.618 124.116 1.00 75.43  ? 109 TYR C CD1 1 
ATOM   8257  C CD2 . TYR C 1 109 ? 147.715 164.664 123.637 1.00 75.43  ? 109 TYR C CD2 1 
ATOM   8258  C CE1 . TYR C 1 109 ? 148.728 166.430 125.459 1.00 75.43  ? 109 TYR C CE1 1 
ATOM   8259  C CE2 . TYR C 1 109 ? 147.487 164.469 124.971 1.00 75.43  ? 109 TYR C CE2 1 
ATOM   8260  C CZ  . TYR C 1 109 ? 147.993 165.352 125.876 1.00 75.43  ? 109 TYR C CZ  1 
ATOM   8261  O OH  . TYR C 1 109 ? 147.758 165.152 127.210 1.00 75.43  ? 109 TYR C OH  1 
ATOM   8262  N N   . SER C 1 110 ? 151.565 163.924 122.188 1.00 83.80  ? 110 SER C N   1 
ATOM   8263  C CA  . SER C 1 110 ? 151.808 162.657 122.843 1.00 83.80  ? 110 SER C CA  1 
ATOM   8264  C C   . SER C 1 110 ? 151.261 162.711 124.262 1.00 83.80  ? 110 SER C C   1 
ATOM   8265  O O   . SER C 1 110 ? 150.716 163.724 124.705 1.00 83.80  ? 110 SER C O   1 
ATOM   8266  C CB  . SER C 1 110 ? 153.292 162.333 122.843 1.00 83.80  ? 110 SER C CB  1 
ATOM   8267  O OG  . SER C 1 110 ? 153.997 163.295 123.595 1.00 83.80  ? 110 SER C OG  1 
ATOM   8268  N N   . ASP C 1 111 ? 151.401 161.606 124.981 1.00 90.42  ? 111 ASP C N   1 
ATOM   8269  C CA  . ASP C 1 111 ? 150.863 161.553 126.328 1.00 90.42  ? 111 ASP C CA  1 
ATOM   8270  C C   . ASP C 1 111 ? 151.736 162.339 127.295 1.00 90.42  ? 111 ASP C C   1 
ATOM   8271  O O   . ASP C 1 111 ? 152.863 162.728 126.989 1.00 90.42  ? 111 ASP C O   1 
ATOM   8272  C CB  . ASP C 1 111 ? 150.735 160.111 126.805 1.00 90.42  ? 111 ASP C CB  1 
ATOM   8273  C CG  . ASP C 1 111 ? 149.579 159.385 126.154 1.00 90.42  ? 111 ASP C CG  1 
ATOM   8274  O OD1 . ASP C 1 111 ? 148.593 160.051 125.793 1.00 90.42  ? 111 ASP C OD1 1 
ATOM   8275  O OD2 . ASP C 1 111 ? 149.646 158.148 126.015 1.00 90.42  ? 111 ASP C OD2 1 
ATOM   8276  N N   . GLY C 1 112 ? 151.184 162.593 128.470 1.00 91.97  ? 112 GLY C N   1 
ATOM   8277  C CA  . GLY C 1 112 ? 151.918 163.206 129.559 1.00 91.97  ? 112 GLY C CA  1 
ATOM   8278  C C   . GLY C 1 112 ? 152.087 164.705 129.512 1.00 91.97  ? 112 GLY C C   1 
ATOM   8279  O O   . GLY C 1 112 ? 151.866 165.387 130.513 1.00 91.97  ? 112 GLY C O   1 
ATOM   8280  N N   . ALA C 1 113 ? 152.468 165.241 128.356 1.00 85.51  ? 113 ALA C N   1 
ATOM   8281  C CA  . ALA C 1 113 ? 152.778 166.662 128.229 1.00 85.51  ? 113 ALA C CA  1 
ATOM   8282  C C   . ALA C 1 113 ? 151.490 167.478 128.129 1.00 85.51  ? 113 ALA C C   1 
ATOM   8283  O O   . ALA C 1 113 ? 151.132 168.016 127.082 1.00 85.51  ? 113 ALA C O   1 
ATOM   8284  C CB  . ALA C 1 113 ? 153.675 166.893 127.024 1.00 85.51  ? 113 ALA C CB  1 
ATOM   8285  N N   . ASP C 1 114 ? 150.783 167.574 129.254 1.00 89.36  ? 114 ASP C N   1 
ATOM   8286  C CA  . ASP C 1 114 ? 149.582 168.398 129.281 1.00 89.36  ? 114 ASP C CA  1 
ATOM   8287  C C   . ASP C 1 114 ? 149.938 169.872 129.271 1.00 89.36  ? 114 ASP C C   1 
ATOM   8288  O O   . ASP C 1 114 ? 149.607 170.601 128.331 1.00 89.36  ? 114 ASP C O   1 
ATOM   8289  C CB  . ASP C 1 114 ? 148.729 168.083 130.510 1.00 89.36  ? 114 ASP C CB  1 
ATOM   8290  C CG  . ASP C 1 114 ? 147.924 166.816 130.358 1.00 89.36  ? 114 ASP C CG  1 
ATOM   8291  O OD1 . ASP C 1 114 ? 147.589 166.454 129.212 1.00 89.36  ? 114 ASP C OD1 1 
ATOM   8292  O OD2 . ASP C 1 114 ? 147.603 166.194 131.392 1.00 89.36  ? 114 ASP C OD2 1 
ATOM   8293  N N   . ASP C 1 115 ? 150.628 170.325 130.305 1.00 86.22  ? 115 ASP C N   1 
ATOM   8294  C CA  . ASP C 1 115 ? 150.835 171.745 130.520 1.00 86.22  ? 115 ASP C CA  1 
ATOM   8295  C C   . ASP C 1 115 ? 152.026 172.308 129.764 1.00 86.22  ? 115 ASP C C   1 
ATOM   8296  O O   . ASP C 1 115 ? 152.222 173.525 129.776 1.00 86.22  ? 115 ASP C O   1 
ATOM   8297  C CB  . ASP C 1 115 ? 150.982 172.017 132.018 1.00 86.22  ? 115 ASP C CB  1 
ATOM   8298  C CG  . ASP C 1 115 ? 152.052 171.154 132.671 1.00 86.22  ? 115 ASP C CG  1 
ATOM   8299  O OD1 . ASP C 1 115 ? 152.645 170.293 131.987 1.00 86.22  ? 115 ASP C OD1 1 
ATOM   8300  O OD2 . ASP C 1 115 ? 152.292 171.331 133.884 1.00 86.22  ? 115 ASP C OD2 1 
ATOM   8301  N N   . THR C 1 116 ? 152.821 171.468 129.115 1.00 80.41  ? 116 THR C N   1 
ATOM   8302  C CA  . THR C 1 116 ? 153.993 171.924 128.382 1.00 80.41  ? 116 THR C CA  1 
ATOM   8303  C C   . THR C 1 116 ? 153.814 171.734 126.884 1.00 80.41  ? 116 THR C C   1 
ATOM   8304  O O   . THR C 1 116 ? 154.772 171.485 126.156 1.00 80.41  ? 116 THR C O   1 
ATOM   8305  C CB  . THR C 1 116 ? 155.247 171.203 128.855 1.00 80.41  ? 116 THR C CB  1 
ATOM   8306  O OG1 . THR C 1 116 ? 155.134 169.810 128.559 1.00 80.41  ? 116 THR C OG1 1 
ATOM   8307  C CG2 . THR C 1 116 ? 155.411 171.369 130.346 1.00 80.41  ? 116 THR C CG2 1 
ATOM   8308  N N   . PHE C 1 117 ? 152.582 171.849 126.410 1.00 62.92  ? 117 PHE C N   1 
ATOM   8309  C CA  . PHE C 1 117 ? 152.269 171.713 124.997 1.00 62.92  ? 117 PHE C CA  1 
ATOM   8310  C C   . PHE C 1 117 ? 151.961 173.092 124.452 1.00 62.92  ? 117 PHE C C   1 
ATOM   8311  O O   . PHE C 1 117 ? 150.987 173.717 124.874 1.00 62.92  ? 117 PHE C O   1 
ATOM   8312  C CB  . PHE C 1 117 ? 151.083 170.785 124.790 1.00 62.92  ? 117 PHE C CB  1 
ATOM   8313  C CG  . PHE C 1 117 ? 150.802 170.494 123.367 1.00 62.92  ? 117 PHE C CG  1 
ATOM   8314  C CD1 . PHE C 1 117 ? 151.576 169.593 122.682 1.00 62.92  ? 117 PHE C CD1 1 
ATOM   8315  C CD2 . PHE C 1 117 ? 149.774 171.121 122.709 1.00 62.92  ? 117 PHE C CD2 1 
ATOM   8316  C CE1 . PHE C 1 117 ? 151.326 169.317 121.369 1.00 62.92  ? 117 PHE C CE1 1 
ATOM   8317  C CE2 . PHE C 1 117 ? 149.519 170.854 121.393 1.00 62.92  ? 117 PHE C CE2 1 
ATOM   8318  C CZ  . PHE C 1 117 ? 150.296 169.951 120.723 1.00 62.92  ? 117 PHE C CZ  1 
ATOM   8319  N N   . ALA C 1 118 ? 152.776 173.563 123.518 1.00 61.44  ? 118 ALA C N   1 
ATOM   8320  C CA  . ALA C 1 118 ? 152.672 174.934 123.059 1.00 61.44  ? 118 ALA C CA  1 
ATOM   8321  C C   . ALA C 1 118 ? 153.007 175.015 121.580 1.00 61.44  ? 118 ALA C C   1 
ATOM   8322  O O   . ALA C 1 118 ? 153.415 174.033 120.958 1.00 61.44  ? 118 ALA C O   1 
ATOM   8323  C CB  . ALA C 1 118 ? 153.592 175.845 123.868 1.00 61.44  ? 118 ALA C CB  1 
ATOM   8324  N N   . ALA C 1 119 ? 152.846 176.212 121.024 1.00 63.78  ? 119 ALA C N   1 
ATOM   8325  C CA  . ALA C 1 119 ? 153.115 176.458 119.612 1.00 63.78  ? 119 ALA C CA  1 
ATOM   8326  C C   . ALA C 1 119 ? 153.978 177.705 119.516 1.00 63.78  ? 119 ALA C C   1 
ATOM   8327  O O   . ALA C 1 119 ? 153.600 178.753 120.035 1.00 63.78  ? 119 ALA C O   1 
ATOM   8328  C CB  . ALA C 1 119 ? 151.822 176.629 118.834 1.00 63.78  ? 119 ALA C CB  1 
ATOM   8329  N N   . TYR C 1 120 ? 155.121 177.600 118.853 1.00 65.43  ? 120 TYR C N   1 
ATOM   8330  C CA  . TYR C 1 120 ? 156.141 178.632 118.950 1.00 65.43  ? 120 TYR C CA  1 
ATOM   8331  C C   . TYR C 1 120 ? 156.308 179.460 117.691 1.00 65.43  ? 120 TYR C C   1 
ATOM   8332  O O   . TYR C 1 120 ? 156.554 180.662 117.787 1.00 65.43  ? 120 TYR C O   1 
ATOM   8333  C CB  . TYR C 1 120 ? 157.474 177.994 119.312 1.00 65.43  ? 120 TYR C CB  1 
ATOM   8334  C CG  . TYR C 1 120 ? 157.467 177.420 120.689 1.00 65.43  ? 120 TYR C CG  1 
ATOM   8335  C CD1 . TYR C 1 120 ? 157.711 178.216 121.783 1.00 65.43  ? 120 TYR C CD1 1 
ATOM   8336  C CD2 . TYR C 1 120 ? 157.181 176.090 120.898 1.00 65.43  ? 120 TYR C CD2 1 
ATOM   8337  C CE1 . TYR C 1 120 ? 157.694 177.700 123.041 1.00 65.43  ? 120 TYR C CE1 1 
ATOM   8338  C CE2 . TYR C 1 120 ? 157.162 175.566 122.158 1.00 65.43  ? 120 TYR C CE2 1 
ATOM   8339  C CZ  . TYR C 1 120 ? 157.414 176.376 123.222 1.00 65.43  ? 120 TYR C CZ  1 
ATOM   8340  O OH  . TYR C 1 120 ? 157.396 175.846 124.482 1.00 65.43  ? 120 TYR C OH  1 
ATOM   8341  N N   . THR C 1 121 ? 156.202 178.857 116.514 1.00 69.26  ? 121 THR C N   1 
ATOM   8342  C CA  . THR C 1 121 ? 156.324 179.617 115.281 1.00 69.26  ? 121 THR C CA  1 
ATOM   8343  C C   . THR C 1 121 ? 154.964 180.187 114.916 1.00 69.26  ? 121 THR C C   1 
ATOM   8344  O O   . THR C 1 121 ? 153.990 180.071 115.661 1.00 69.26  ? 121 THR C O   1 
ATOM   8345  C CB  . THR C 1 121 ? 156.833 178.757 114.138 1.00 69.26  ? 121 THR C CB  1 
ATOM   8346  O OG1 . THR C 1 121 ? 155.814 177.824 113.774 1.00 69.26  ? 121 THR C OG1 1 
ATOM   8347  C CG2 . THR C 1 121 ? 158.053 178.001 114.557 1.00 69.26  ? 121 THR C CG2 1 
ATOM   8348  N N   . ARG C 1 122 ? 154.877 180.795 113.741 1.00 72.08  ? 122 ARG C N   1 
ATOM   8349  C CA  . ARG C 1 122 ? 153.605 181.303 113.260 1.00 72.08  ? 122 ARG C CA  1 
ATOM   8350  C C   . ARG C 1 122 ? 152.857 180.264 112.455 1.00 72.08  ? 122 ARG C C   1 
ATOM   8351  O O   . ARG C 1 122 ? 151.626 180.282 112.422 1.00 72.08  ? 122 ARG C O   1 
ATOM   8352  C CB  . ARG C 1 122 ? 153.834 182.569 112.436 1.00 72.08  ? 122 ARG C CB  1 
ATOM   8353  C CG  . ARG C 1 122 ? 154.352 183.701 113.294 1.00 72.08  ? 122 ARG C CG  1 
ATOM   8354  C CD  . ARG C 1 122 ? 154.685 184.935 112.513 1.00 72.08  ? 122 ARG C CD  1 
ATOM   8355  N NE  . ARG C 1 122 ? 153.509 185.552 111.926 1.00 72.08  ? 122 ARG C NE  1 
ATOM   8356  C CZ  . ARG C 1 122 ? 153.564 186.595 111.111 1.00 72.08  ? 122 ARG C CZ  1 
ATOM   8357  N NH1 . ARG C 1 122 ? 154.733 187.130 110.809 1.00 72.08  ? 122 ARG C NH1 1 
ATOM   8358  N NH2 . ARG C 1 122 ? 152.458 187.103 110.602 1.00 72.08  ? 122 ARG C NH2 1 
ATOM   8359  N N   . GLU C 1 123 ? 153.573 179.338 111.838 1.00 74.31  ? 123 GLU C N   1 
ATOM   8360  C CA  . GLU C 1 123 ? 152.954 178.266 111.085 1.00 74.31  ? 123 GLU C CA  1 
ATOM   8361  C C   . GLU C 1 123 ? 152.670 177.038 111.932 1.00 74.31  ? 123 GLU C C   1 
ATOM   8362  O O   . GLU C 1 123 ? 151.914 176.169 111.490 1.00 74.31  ? 123 GLU C O   1 
ATOM   8363  C CB  . GLU C 1 123 ? 153.843 177.886 109.905 1.00 74.31  ? 123 GLU C CB  1 
ATOM   8364  C CG  . GLU C 1 123 ? 155.114 177.177 110.301 1.00 74.31  ? 123 GLU C CG  1 
ATOM   8365  C CD  . GLU C 1 123 ? 156.249 178.124 110.660 1.00 74.31  ? 123 GLU C CD  1 
ATOM   8366  O OE1 . GLU C 1 123 ? 155.997 179.327 110.886 1.00 74.31  ? 123 GLU C OE1 1 
ATOM   8367  O OE2 . GLU C 1 123 ? 157.405 177.659 110.732 1.00 74.31  ? 123 GLU C OE2 1 
ATOM   8368  N N   . GLN C 1 124 ? 153.256 176.929 113.125 1.00 69.44  ? 124 GLN C N   1 
ATOM   8369  C CA  . GLN C 1 124 ? 152.743 175.958 114.079 1.00 69.44  ? 124 GLN C CA  1 
ATOM   8370  C C   . GLN C 1 124 ? 151.356 176.320 114.552 1.00 69.44  ? 124 GLN C C   1 
ATOM   8371  O O   . GLN C 1 124 ? 150.581 175.429 114.902 1.00 69.44  ? 124 GLN C O   1 
ATOM   8372  C CB  . GLN C 1 124 ? 153.640 175.836 115.301 1.00 69.44  ? 124 GLN C CB  1 
ATOM   8373  C CG  . GLN C 1 124 ? 154.857 174.995 115.126 1.00 69.44  ? 124 GLN C CG  1 
ATOM   8374  C CD  . GLN C 1 124 ? 155.679 174.947 116.388 1.00 69.44  ? 124 GLN C CD  1 
ATOM   8375  O OE1 . GLN C 1 124 ? 155.407 175.669 117.343 1.00 69.44  ? 124 GLN C OE1 1 
ATOM   8376  N NE2 . GLN C 1 124 ? 156.676 174.076 116.412 1.00 69.44  ? 124 GLN C NE2 1 
ATOM   8377  N N   . LEU C 1 125 ? 151.033 177.603 114.585 1.00 70.42  ? 125 LEU C N   1 
ATOM   8378  C CA  . LEU C 1 125 ? 149.712 178.009 115.013 1.00 70.42  ? 125 LEU C CA  1 
ATOM   8379  C C   . LEU C 1 125 ? 148.678 177.812 113.922 1.00 70.42  ? 125 LEU C C   1 
ATOM   8380  O O   . LEU C 1 125 ? 147.536 177.464 114.226 1.00 70.42  ? 125 LEU C O   1 
ATOM   8381  C CB  . LEU C 1 125 ? 149.744 179.461 115.472 1.00 70.42  ? 125 LEU C CB  1 
ATOM   8382  C CG  . LEU C 1 125 ? 148.468 179.977 116.116 1.00 70.42  ? 125 LEU C CG  1 
ATOM   8383  C CD1 . LEU C 1 125 ? 148.140 179.121 117.288 1.00 70.42  ? 125 LEU C CD1 1 
ATOM   8384  C CD2 . LEU C 1 125 ? 148.659 181.389 116.573 1.00 70.42  ? 125 LEU C CD2 1 
ATOM   8385  N N   . TYR C 1 126 ? 149.053 177.984 112.654 1.00 73.06  ? 126 TYR C N   1 
ATOM   8386  C CA  . TYR C 1 126 ? 148.109 177.687 111.585 1.00 73.06  ? 126 TYR C CA  1 
ATOM   8387  C C   . TYR C 1 126 ? 147.829 176.201 111.460 1.00 73.06  ? 126 TYR C C   1 
ATOM   8388  O O   . TYR C 1 126 ? 146.671 175.812 111.287 1.00 73.06  ? 126 TYR C O   1 
ATOM   8389  C CB  . TYR C 1 126 ? 148.605 178.202 110.249 1.00 73.06  ? 126 TYR C CB  1 
ATOM   8390  C CG  . TYR C 1 126 ? 148.434 179.670 110.052 1.00 73.06  ? 126 TYR C CG  1 
ATOM   8391  C CD1 . TYR C 1 126 ? 147.187 180.204 109.788 1.00 73.06  ? 126 TYR C CD1 1 
ATOM   8392  C CD2 . TYR C 1 126 ? 149.521 180.517 110.067 1.00 73.06  ? 126 TYR C CD2 1 
ATOM   8393  C CE1 . TYR C 1 126 ? 147.027 181.544 109.588 1.00 73.06  ? 126 TYR C CE1 1 
ATOM   8394  C CE2 . TYR C 1 126 ? 149.370 181.859 109.864 1.00 73.06  ? 126 TYR C CE2 1 
ATOM   8395  C CZ  . TYR C 1 126 ? 148.126 182.366 109.626 1.00 73.06  ? 126 TYR C CZ  1 
ATOM   8396  O OH  . TYR C 1 126 ? 147.977 183.709 109.422 1.00 73.06  ? 126 TYR C OH  1 
ATOM   8397  N N   . GLN C 1 127 ? 148.857 175.359 111.530 1.00 69.51  ? 127 GLN C N   1 
ATOM   8398  C CA  . GLN C 1 127 ? 148.614 173.931 111.393 1.00 69.51  ? 127 GLN C CA  1 
ATOM   8399  C C   . GLN C 1 127 ? 147.887 173.366 112.597 1.00 69.51  ? 127 GLN C C   1 
ATOM   8400  O O   . GLN C 1 127 ? 147.235 172.328 112.485 1.00 69.51  ? 127 GLN C O   1 
ATOM   8401  C CB  . GLN C 1 127 ? 149.918 173.178 111.185 1.00 69.51  ? 127 GLN C CB  1 
ATOM   8402  C CG  . GLN C 1 127 ? 150.563 173.419 109.854 1.00 69.51  ? 127 GLN C CG  1 
ATOM   8403  C CD  . GLN C 1 127 ? 151.833 172.623 109.699 1.00 69.51  ? 127 GLN C CD  1 
ATOM   8404  O OE1 . GLN C 1 127 ? 152.265 171.942 110.626 1.00 69.51  ? 127 GLN C OE1 1 
ATOM   8405  N NE2 . GLN C 1 127 ? 152.440 172.700 108.525 1.00 69.51  ? 127 GLN C NE2 1 
ATOM   8406  N N   . ALA C 1 128 ? 147.974 174.023 113.746 1.00 68.32  ? 128 ALA C N   1 
ATOM   8407  C CA  . ALA C 1 128 ? 147.227 173.540 114.894 1.00 68.32  ? 128 ALA C CA  1 
ATOM   8408  C C   . ALA C 1 128 ? 145.749 173.848 114.770 1.00 68.32  ? 128 ALA C C   1 
ATOM   8409  O O   . ALA C 1 128 ? 144.919 173.047 115.204 1.00 68.32  ? 128 ALA C O   1 
ATOM   8410  C CB  . ALA C 1 128 ? 147.773 174.145 116.180 1.00 68.32  ? 128 ALA C CB  1 
ATOM   8411  N N   . ILE C 1 129 ? 145.405 174.989 114.177 1.00 68.17  ? 129 ILE C N   1 
ATOM   8412  C CA  . ILE C 1 129 ? 144.004 175.374 114.062 1.00 68.17  ? 129 ILE C CA  1 
ATOM   8413  C C   . ILE C 1 129 ? 143.312 174.539 113.000 1.00 68.17  ? 129 ILE C C   1 
ATOM   8414  O O   . ILE C 1 129 ? 142.194 174.049 113.200 1.00 68.17  ? 129 ILE C O   1 
ATOM   8415  C CB  . ILE C 1 129 ? 143.894 176.874 113.756 1.00 68.17  ? 129 ILE C CB  1 
ATOM   8416  C CG1 . ILE C 1 129 ? 144.397 177.690 114.930 1.00 68.17  ? 129 ILE C CG1 1 
ATOM   8417  C CG2 . ILE C 1 129 ? 142.481 177.260 113.488 1.00 68.17  ? 129 ILE C CG2 1 
ATOM   8418  C CD1 . ILE C 1 129 ? 144.578 179.124 114.596 1.00 68.17  ? 129 ILE C CD1 1 
ATOM   8419  N N   . PHE C 1 130 ? 143.982 174.337 111.871 1.00 72.28  ? 130 PHE C N   1 
ATOM   8420  C CA  . PHE C 1 130 ? 143.340 173.700 110.732 1.00 72.28  ? 130 PHE C CA  1 
ATOM   8421  C C   . PHE C 1 130 ? 143.126 172.223 110.991 1.00 72.28  ? 130 PHE C C   1 
ATOM   8422  O O   . PHE C 1 130 ? 142.081 171.677 110.636 1.00 72.28  ? 130 PHE C O   1 
ATOM   8423  C CB  . PHE C 1 130 ? 144.184 173.890 109.475 1.00 72.28  ? 130 PHE C CB  1 
ATOM   8424  C CG  . PHE C 1 130 ? 144.369 175.324 109.062 1.00 72.28  ? 130 PHE C CG  1 
ATOM   8425  C CD1 . PHE C 1 130 ? 143.503 176.320 109.478 1.00 72.28  ? 130 PHE C CD1 1 
ATOM   8426  C CD2 . PHE C 1 130 ? 145.445 175.675 108.271 1.00 72.28  ? 130 PHE C CD2 1 
ATOM   8427  C CE1 . PHE C 1 130 ? 143.706 177.627 109.107 1.00 72.28  ? 130 PHE C CE1 1 
ATOM   8428  C CE2 . PHE C 1 130 ? 145.649 176.980 107.894 1.00 72.28  ? 130 PHE C CE2 1 
ATOM   8429  C CZ  . PHE C 1 130 ? 144.781 177.957 108.313 1.00 72.28  ? 130 PHE C CZ  1 
ATOM   8430  N N   . HIS C 1 131 ? 144.085 171.582 111.653 1.00 67.12  ? 131 HIS C N   1 
ATOM   8431  C CA  . HIS C 1 131 ? 143.957 170.185 112.036 1.00 67.12  ? 131 HIS C CA  1 
ATOM   8432  C C   . HIS C 1 131 ? 142.854 169.971 113.053 1.00 67.12  ? 131 HIS C C   1 
ATOM   8433  O O   . HIS C 1 131 ? 142.272 168.887 113.099 1.00 67.12  ? 131 HIS C O   1 
ATOM   8434  C CB  . HIS C 1 131 ? 145.282 169.695 112.603 1.00 67.12  ? 131 HIS C CB  1 
ATOM   8435  C CG  . HIS C 1 131 ? 145.296 168.248 112.948 1.00 67.12  ? 131 HIS C CG  1 
ATOM   8436  N ND1 . HIS C 1 131 ? 145.391 167.261 111.996 1.00 67.12  ? 131 HIS C ND1 1 
ATOM   8437  C CD2 . HIS C 1 131 ? 145.229 167.617 114.141 1.00 67.12  ? 131 HIS C CD2 1 
ATOM   8438  C CE1 . HIS C 1 131 ? 145.386 166.082 112.589 1.00 67.12  ? 131 HIS C CE1 1 
ATOM   8439  N NE2 . HIS C 1 131 ? 145.286 166.271 113.890 1.00 67.12  ? 131 HIS C NE2 1 
ATOM   8440  N N   . ALA C 1 132 ? 142.541 170.978 113.854 1.00 65.50  ? 132 ALA C N   1 
ATOM   8441  C CA  . ALA C 1 132 ? 141.444 170.857 114.794 1.00 65.50  ? 132 ALA C CA  1 
ATOM   8442  C C   . ALA C 1 132 ? 140.086 170.958 114.125 1.00 65.50  ? 132 ALA C C   1 
ATOM   8443  O O   . ALA C 1 132 ? 139.133 170.343 114.607 1.00 65.50  ? 132 ALA C O   1 
ATOM   8444  C CB  . ALA C 1 132 ? 141.555 171.925 115.877 1.00 65.50  ? 132 ALA C CB  1 
ATOM   8445  N N   . VAL C 1 133 ? 139.973 171.694 113.026 1.00 68.23  ? 133 VAL C N   1 
ATOM   8446  C CA  . VAL C 1 133 ? 138.719 171.811 112.299 1.00 68.23  ? 133 VAL C CA  1 
ATOM   8447  C C   . VAL C 1 133 ? 138.489 170.613 111.393 1.00 68.23  ? 133 VAL C C   1 
ATOM   8448  O O   . VAL C 1 133 ? 137.373 170.101 111.314 1.00 68.23  ? 133 VAL C O   1 
ATOM   8449  C CB  . VAL C 1 133 ? 138.704 173.124 111.494 1.00 68.23  ? 133 VAL C CB  1 
ATOM   8450  C CG1 . VAL C 1 133 ? 137.419 173.271 110.728 1.00 68.23  ? 133 VAL C CG1 1 
ATOM   8451  C CG2 . VAL C 1 133 ? 138.903 174.283 112.415 1.00 68.23  ? 133 VAL C CG2 1 
ATOM   8452  N N   . ASP C 1 134 ? 139.556 170.145 110.741 1.00 75.16  ? 134 ASP C N   1 
ATOM   8453  C CA  . ASP C 1 134 ? 139.442 169.085 109.747 1.00 75.16  ? 134 ASP C CA  1 
ATOM   8454  C C   . ASP C 1 134 ? 138.995 167.774 110.366 1.00 75.16  ? 134 ASP C C   1 
ATOM   8455  O O   . ASP C 1 134 ? 138.183 167.054 109.776 1.00 75.16  ? 134 ASP C O   1 
ATOM   8456  C CB  . ASP C 1 134 ? 140.778 168.892 109.043 1.00 75.16  ? 134 ASP C CB  1 
ATOM   8457  C CG  . ASP C 1 134 ? 141.162 170.077 108.201 1.00 75.16  ? 134 ASP C CG  1 
ATOM   8458  O OD1 . ASP C 1 134 ? 140.251 170.781 107.726 1.00 75.16  ? 134 ASP C OD1 1 
ATOM   8459  O OD2 . ASP C 1 134 ? 142.375 170.316 108.023 1.00 75.16  ? 134 ASP C OD2 1 
ATOM   8460  N N   . GLN C 1 135 ? 139.502 167.457 111.554 1.00 70.05  ? 135 GLN C N   1 
ATOM   8461  C CA  . GLN C 1 135 ? 139.065 166.253 112.242 1.00 70.05  ? 135 GLN C CA  1 
ATOM   8462  C C   . GLN C 1 135 ? 137.620 166.367 112.694 1.00 70.05  ? 135 GLN C C   1 
ATOM   8463  O O   . GLN C 1 135 ? 136.915 165.357 112.775 1.00 70.05  ? 135 GLN C O   1 
ATOM   8464  C CB  . GLN C 1 135 ? 139.971 165.981 113.432 1.00 70.05  ? 135 GLN C CB  1 
ATOM   8465  C CG  . GLN C 1 135 ? 141.378 165.607 113.057 1.00 70.05  ? 135 GLN C CG  1 
ATOM   8466  C CD  . GLN C 1 135 ? 141.473 164.251 112.413 1.00 70.05  ? 135 GLN C CD  1 
ATOM   8467  O OE1 . GLN C 1 135 ? 141.723 164.138 111.220 1.00 70.05  ? 135 GLN C OE1 1 
ATOM   8468  N NE2 . GLN C 1 135 ? 141.289 163.209 113.205 1.00 70.05  ? 135 GLN C NE2 1 
ATOM   8469  N N   . TYR C 1 136 ? 137.160 167.581 112.980 1.00 75.41  ? 136 TYR C N   1 
ATOM   8470  C CA  . TYR C 1 136 ? 135.756 167.770 113.308 1.00 75.41  ? 136 TYR C CA  1 
ATOM   8471  C C   . TYR C 1 136 ? 134.875 167.548 112.092 1.00 75.41  ? 136 TYR C C   1 
ATOM   8472  O O   . TYR C 1 136 ? 133.770 167.011 112.208 1.00 75.41  ? 136 TYR C O   1 
ATOM   8473  C CB  . TYR C 1 136 ? 135.539 169.165 113.872 1.00 75.41  ? 136 TYR C CB  1 
ATOM   8474  C CG  . TYR C 1 136 ? 134.101 169.486 114.171 1.00 75.41  ? 136 TYR C CG  1 
ATOM   8475  C CD1 . TYR C 1 136 ? 133.469 168.955 115.278 1.00 75.41  ? 136 TYR C CD1 1 
ATOM   8476  C CD2 . TYR C 1 136 ? 133.380 170.329 113.347 1.00 75.41  ? 136 TYR C CD2 1 
ATOM   8477  C CE1 . TYR C 1 136 ? 132.169 169.255 115.549 1.00 75.41  ? 136 TYR C CE1 1 
ATOM   8478  C CE2 . TYR C 1 136 ? 132.085 170.631 113.610 1.00 75.41  ? 136 TYR C CE2 1 
ATOM   8479  C CZ  . TYR C 1 136 ? 131.486 170.096 114.710 1.00 75.41  ? 136 TYR C CZ  1 
ATOM   8480  O OH  . TYR C 1 136 ? 130.180 170.410 114.967 1.00 75.41  ? 136 TYR C OH  1 
ATOM   8481  N N   . LEU C 1 137 ? 135.343 167.948 110.916 1.00 77.04  ? 137 LEU C N   1 
ATOM   8482  C CA  . LEU C 1 137 ? 134.545 167.742 109.720 1.00 77.04  ? 137 LEU C CA  1 
ATOM   8483  C C   . LEU C 1 137 ? 134.560 166.303 109.260 1.00 77.04  ? 137 LEU C C   1 
ATOM   8484  O O   . LEU C 1 137 ? 133.737 165.928 108.424 1.00 77.04  ? 137 LEU C O   1 
ATOM   8485  C CB  . LEU C 1 137 ? 135.037 168.631 108.592 1.00 77.04  ? 137 LEU C CB  1 
ATOM   8486  C CG  . LEU C 1 137 ? 134.725 170.102 108.814 1.00 77.04  ? 137 LEU C CG  1 
ATOM   8487  C CD1 . LEU C 1 137 ? 135.363 170.952 107.734 1.00 77.04  ? 137 LEU C CD1 1 
ATOM   8488  C CD2 . LEU C 1 137 ? 133.230 170.277 108.820 1.00 77.04  ? 137 LEU C CD2 1 
ATOM   8489  N N   . ALA C 1 138 ? 135.467 165.492 109.780 1.00 76.63  ? 138 ALA C N   1 
ATOM   8490  C CA  . ALA C 1 138 ? 135.621 164.120 109.332 1.00 76.63  ? 138 ALA C CA  1 
ATOM   8491  C C   . ALA C 1 138 ? 135.479 163.132 110.482 1.00 76.63  ? 138 ALA C C   1 
ATOM   8492  O O   . ALA C 1 138 ? 136.087 162.067 110.466 1.00 76.63  ? 138 ALA C O   1 
ATOM   8493  C CB  . ALA C 1 138 ? 136.966 163.942 108.633 1.00 76.63  ? 138 ALA C CB  1 
ATOM   8494  N N   . LEU C 1 139 ? 134.656 163.471 111.475 1.00 68.60  ? 139 LEU C N   1 
ATOM   8495  C CA  . LEU C 1 139 ? 134.613 162.668 112.701 1.00 68.60  ? 139 LEU C CA  1 
ATOM   8496  C C   . LEU C 1 139 ? 134.049 161.265 112.526 1.00 68.60  ? 139 LEU C C   1 
ATOM   8497  O O   . LEU C 1 139 ? 134.687 160.321 113.028 1.00 68.60  ? 139 LEU C O   1 
ATOM   8498  C CB  . LEU C 1 139 ? 133.875 163.434 113.799 1.00 68.60  ? 139 LEU C CB  1 
ATOM   8499  C CG  . LEU C 1 139 ? 134.046 162.745 115.147 1.00 68.60  ? 139 LEU C CG  1 
ATOM   8500  C CD1 . LEU C 1 139 ? 135.492 162.813 115.529 1.00 68.60  ? 139 LEU C CD1 1 
ATOM   8501  C CD2 . LEU C 1 139 ? 133.202 163.380 116.212 1.00 68.60  ? 139 LEU C CD2 1 
ATOM   8502  N N   . PRO C 1 140 ? 132.905 161.017 111.862 1.00 68.56  ? 140 PRO C N   1 
ATOM   8503  C CA  . PRO C 1 140 ? 132.422 159.636 111.799 1.00 68.56  ? 140 PRO C CA  1 
ATOM   8504  C C   . PRO C 1 140 ? 133.227 158.741 110.890 1.00 68.56  ? 140 PRO C C   1 
ATOM   8505  O O   . PRO C 1 140 ? 133.008 157.528 110.906 1.00 68.56  ? 140 PRO C O   1 
ATOM   8506  C CB  . PRO C 1 140 ? 130.999 159.784 111.277 1.00 68.56  ? 140 PRO C CB  1 
ATOM   8507  C CG  . PRO C 1 140 ? 131.033 160.953 110.489 1.00 68.56  ? 140 PRO C CG  1 
ATOM   8508  C CD  . PRO C 1 140 ? 131.922 161.899 111.199 1.00 68.56  ? 140 PRO C CD  1 
ATOM   8509  N N   . ASP C 1 141 ? 134.149 159.274 110.105 1.00 78.71  ? 141 ASP C N   1 
ATOM   8510  C CA  . ASP C 1 141 ? 134.932 158.402 109.249 1.00 78.71  ? 141 ASP C CA  1 
ATOM   8511  C C   . ASP C 1 141 ? 136.209 157.918 109.909 1.00 78.71  ? 141 ASP C C   1 
ATOM   8512  O O   . ASP C 1 141 ? 136.649 156.799 109.630 1.00 78.71  ? 141 ASP C O   1 
ATOM   8513  C CB  . ASP C 1 141 ? 135.273 159.112 107.942 1.00 78.71  ? 141 ASP C CB  1 
ATOM   8514  C CG  . ASP C 1 141 ? 134.053 159.383 107.102 1.00 78.71  ? 141 ASP C CG  1 
ATOM   8515  O OD1 . ASP C 1 141 ? 133.056 158.655 107.263 1.00 78.71  ? 141 ASP C OD1 1 
ATOM   8516  O OD2 . ASP C 1 141 ? 134.092 160.315 106.274 1.00 78.71  ? 141 ASP C OD2 1 
ATOM   8517  N N   . VAL C 1 142 ? 136.816 158.718 110.779 1.00 75.14  ? 142 VAL C N   1 
ATOM   8518  C CA  . VAL C 1 142 ? 138.123 158.378 111.318 1.00 75.14  ? 142 VAL C CA  1 
ATOM   8519  C C   . VAL C 1 142 ? 138.086 157.969 112.782 1.00 75.14  ? 142 VAL C C   1 
ATOM   8520  O O   . VAL C 1 142 ? 138.991 157.247 113.222 1.00 75.14  ? 142 VAL C O   1 
ATOM   8521  C CB  . VAL C 1 142 ? 139.134 159.525 111.115 1.00 75.14  ? 142 VAL C CB  1 
ATOM   8522  C CG1 . VAL C 1 142 ? 139.273 159.851 109.643 1.00 75.14  ? 142 VAL C CG1 1 
ATOM   8523  C CG2 . VAL C 1 142 ? 138.743 160.749 111.908 1.00 75.14  ? 142 VAL C CG2 1 
ATOM   8524  N N   . SER C 1 143 ? 137.085 158.381 113.545 1.00 73.25  ? 143 SER C N   1 
ATOM   8525  C CA  . SER C 1 143 ? 137.062 158.111 114.972 1.00 73.25  ? 143 SER C CA  1 
ATOM   8526  C C   . SER C 1 143 ? 136.098 156.992 115.294 1.00 73.25  ? 143 SER C C   1 
ATOM   8527  O O   . SER C 1 143 ? 135.009 156.920 114.727 1.00 73.25  ? 143 SER C O   1 
ATOM   8528  C CB  . SER C 1 143 ? 136.646 159.340 115.763 1.00 73.25  ? 143 SER C CB  1 
ATOM   8529  O OG  . SER C 1 143 ? 136.479 158.999 117.126 1.00 73.25  ? 143 SER C OG  1 
ATOM   8530  N N   . LEU C 1 144 ? 136.490 156.134 116.215 1.00 72.14  ? 144 LEU C N   1 
ATOM   8531  C CA  . LEU C 1 144 ? 135.524 155.216 116.774 1.00 72.14  ? 144 LEU C CA  1 
ATOM   8532  C C   . LEU C 1 144 ? 134.892 155.859 117.995 1.00 72.14  ? 144 LEU C C   1 
ATOM   8533  O O   . LEU C 1 144 ? 135.372 156.868 118.507 1.00 72.14  ? 144 LEU C O   1 
ATOM   8534  C CB  . LEU C 1 144 ? 136.190 153.888 117.093 1.00 72.14  ? 144 LEU C CB  1 
ATOM   8535  C CG  . LEU C 1 144 ? 137.339 153.853 118.084 1.00 72.14  ? 144 LEU C CG  1 
ATOM   8536  C CD1 . LEU C 1 144 ? 136.874 153.454 119.469 1.00 72.14  ? 144 LEU C CD1 1 
ATOM   8537  C CD2 . LEU C 1 144 ? 138.388 152.911 117.571 1.00 72.14  ? 144 LEU C CD2 1 
ATOM   8538  N N   . GLY C 1 145 ? 133.794 155.277 118.457 1.00 76.55  ? 145 GLY C N   1 
ATOM   8539  C CA  . GLY C 1 145 ? 133.071 155.780 119.602 1.00 76.55  ? 145 GLY C CA  1 
ATOM   8540  C C   . GLY C 1 145 ? 131.705 156.338 119.283 1.00 76.55  ? 145 GLY C C   1 
ATOM   8541  O O   . GLY C 1 145 ? 130.851 156.378 120.177 1.00 76.55  ? 145 GLY C O   1 
ATOM   8542  N N   . ARG C 1 146 ? 131.482 156.766 118.039 1.00 84.32  ? 146 ARG C N   1 
ATOM   8543  C CA  . ARG C 1 146 ? 130.178 157.168 117.501 1.00 84.32  ? 146 ARG C CA  1 
ATOM   8544  C C   . ARG C 1 146 ? 129.584 158.350 118.278 1.00 84.32  ? 146 ARG C C   1 
ATOM   8545  O O   . ARG C 1 146 ? 128.638 158.236 119.054 1.00 84.32  ? 146 ARG C O   1 
ATOM   8546  C CB  . ARG C 1 146 ? 129.230 155.964 117.435 1.00 84.32  ? 146 ARG C CB  1 
ATOM   8547  C CG  . ARG C 1 146 ? 127.957 156.225 116.683 1.00 84.32  ? 146 ARG C CG  1 
ATOM   8548  C CD  . ARG C 1 146 ? 127.201 154.956 116.407 1.00 84.32  ? 146 ARG C CD  1 
ATOM   8549  N NE  . ARG C 1 146 ? 125.887 155.266 115.865 1.00 84.32  ? 146 ARG C NE  1 
ATOM   8550  C CZ  . ARG C 1 146 ? 125.646 155.546 114.589 1.00 84.32  ? 146 ARG C CZ  1 
ATOM   8551  N NH1 . ARG C 1 146 ? 126.635 155.555 113.703 1.00 84.32  ? 146 ARG C NH1 1 
ATOM   8552  N NH2 . ARG C 1 146 ? 124.410 155.820 114.200 1.00 84.32  ? 146 ARG C NH2 1 
ATOM   8553  N N   . TYR C 1 147 ? 130.238 159.485 118.103 1.00 80.14  ? 147 TYR C N   1 
ATOM   8554  C CA  . TYR C 1 147 ? 129.676 160.745 118.543 1.00 80.14  ? 147 TYR C CA  1 
ATOM   8555  C C   . TYR C 1 147 ? 128.726 161.276 117.481 1.00 80.14  ? 147 TYR C C   1 
ATOM   8556  O O   . TYR C 1 147 ? 128.631 160.733 116.382 1.00 80.14  ? 147 TYR C O   1 
ATOM   8557  C CB  . TYR C 1 147 ? 130.786 161.751 118.800 1.00 80.14  ? 147 TYR C CB  1 
ATOM   8558  C CG  . TYR C 1 147 ? 131.756 161.252 119.821 1.00 80.14  ? 147 TYR C CG  1 
ATOM   8559  C CD1 . TYR C 1 147 ? 131.463 161.325 121.166 1.00 80.14  ? 147 TYR C CD1 1 
ATOM   8560  C CD2 . TYR C 1 147 ? 132.953 160.673 119.438 1.00 80.14  ? 147 TYR C CD2 1 
ATOM   8561  C CE1 . TYR C 1 147 ? 132.336 160.855 122.099 1.00 80.14  ? 147 TYR C CE1 1 
ATOM   8562  C CE2 . TYR C 1 147 ? 133.830 160.197 120.363 1.00 80.14  ? 147 TYR C CE2 1 
ATOM   8563  C CZ  . TYR C 1 147 ? 133.517 160.292 121.691 1.00 80.14  ? 147 TYR C CZ  1 
ATOM   8564  O OH  . TYR C 1 147 ? 134.394 159.819 122.628 1.00 80.14  ? 147 TYR C OH  1 
ATOM   8565  N N   . ALA C 1 148 ? 128.021 162.355 117.814 1.00 79.07  ? 148 ALA C N   1 
ATOM   8566  C CA  . ALA C 1 148 ? 127.171 163.029 116.842 1.00 79.07  ? 148 ALA C CA  1 
ATOM   8567  C C   . ALA C 1 148 ? 127.083 164.502 117.182 1.00 79.07  ? 148 ALA C C   1 
ATOM   8568  O O   . ALA C 1 148 ? 127.216 164.895 118.341 1.00 79.07  ? 148 ALA C O   1 
ATOM   8569  C CB  . ALA C 1 148 ? 125.764 162.447 116.786 1.00 79.07  ? 148 ALA C CB  1 
ATOM   8570  N N   . TYR C 1 149 ? 126.814 165.304 116.161 1.00 77.78  ? 149 TYR C N   1 
ATOM   8571  C CA  . TYR C 1 149 ? 126.928 166.745 116.273 1.00 77.78  ? 149 TYR C CA  1 
ATOM   8572  C C   . TYR C 1 149 ? 125.762 167.315 117.070 1.00 77.78  ? 149 TYR C C   1 
ATOM   8573  O O   . TYR C 1 149 ? 124.792 166.626 117.383 1.00 77.78  ? 149 TYR C O   1 
ATOM   8574  C CB  . TYR C 1 149 ? 126.984 167.358 114.890 1.00 77.78  ? 149 TYR C CB  1 
ATOM   8575  C CG  . TYR C 1 149 ? 128.150 166.876 114.088 1.00 77.78  ? 149 TYR C CG  1 
ATOM   8576  C CD1 . TYR C 1 149 ? 129.405 167.408 114.278 1.00 77.78  ? 149 TYR C CD1 1 
ATOM   8577  C CD2 . TYR C 1 149 ? 127.992 165.893 113.133 1.00 77.78  ? 149 TYR C CD2 1 
ATOM   8578  C CE1 . TYR C 1 149 ? 130.472 166.980 113.540 1.00 77.78  ? 149 TYR C CE1 1 
ATOM   8579  C CE2 . TYR C 1 149 ? 129.053 165.458 112.387 1.00 77.78  ? 149 TYR C CE2 1 
ATOM   8580  C CZ  . TYR C 1 149 ? 130.288 166.005 112.595 1.00 77.78  ? 149 TYR C CZ  1 
ATOM   8581  O OH  . TYR C 1 149 ? 131.356 165.573 111.855 1.00 77.78  ? 149 TYR C OH  1 
ATOM   8582  N N   . VAL C 1 150 ? 125.854 168.602 117.397 1.00 87.33  ? 150 VAL C N   1 
ATOM   8583  C CA  . VAL C 1 150 ? 124.844 169.221 118.250 1.00 87.33  ? 150 VAL C CA  1 
ATOM   8584  C C   . VAL C 1 150 ? 123.706 169.825 117.436 1.00 87.33  ? 150 VAL C C   1 
ATOM   8585  O O   . VAL C 1 150 ? 122.541 169.617 117.784 1.00 87.33  ? 150 VAL C O   1 
ATOM   8586  C CB  . VAL C 1 150 ? 125.490 170.249 119.212 1.00 87.33  ? 150 VAL C CB  1 
ATOM   8587  C CG1 . VAL C 1 150 ? 126.249 171.345 118.494 1.00 87.33  ? 150 VAL C CG1 1 
ATOM   8588  C CG2 . VAL C 1 150 ? 124.449 170.867 120.108 1.00 87.33  ? 150 VAL C CG2 1 
ATOM   8589  N N   . ARG C 1 151 ? 124.016 170.484 116.315 1.00 96.89  ? 151 ARG C N   1 
ATOM   8590  C CA  . ARG C 1 151 ? 123.107 171.381 115.597 1.00 96.89  ? 151 ARG C CA  1 
ATOM   8591  C C   . ARG C 1 151 ? 122.472 172.367 116.583 1.00 96.89  ? 151 ARG C C   1 
ATOM   8592  O O   . ARG C 1 151 ? 121.272 172.359 116.853 1.00 96.89  ? 151 ARG C O   1 
ATOM   8593  C CB  . ARG C 1 151 ? 122.062 170.588 114.804 1.00 96.89  ? 151 ARG C CB  1 
ATOM   8594  C CG  . ARG C 1 151 ? 121.255 171.402 113.827 1.00 96.89  ? 151 ARG C CG  1 
ATOM   8595  C CD  . ARG C 1 151 ? 122.165 171.914 112.758 1.00 96.89  ? 151 ARG C CD  1 
ATOM   8596  N NE  . ARG C 1 151 ? 122.710 170.812 111.990 1.00 96.89  ? 151 ARG C NE  1 
ATOM   8597  C CZ  . ARG C 1 151 ? 123.733 170.944 111.162 1.00 96.89  ? 151 ARG C CZ  1 
ATOM   8598  N NH1 . ARG C 1 151 ? 124.299 172.130 111.024 1.00 96.89  ? 151 ARG C NH1 1 
ATOM   8599  N NH2 . ARG C 1 151 ? 124.190 169.903 110.480 1.00 96.89  ? 151 ARG C NH2 1 
ATOM   8600  N N   . GLY C 1 152 ? 123.331 173.193 117.172 1.00 104.29 ? 152 GLY C N   1 
ATOM   8601  C CA  . GLY C 1 152 ? 123.002 173.910 118.381 1.00 104.29 ? 152 GLY C CA  1 
ATOM   8602  C C   . GLY C 1 152 ? 122.183 175.167 118.152 1.00 104.29 ? 152 GLY C C   1 
ATOM   8603  O O   . GLY C 1 152 ? 121.819 175.521 117.030 1.00 104.29 ? 152 GLY C O   1 
ATOM   8604  N N   . GLY C 1 153 ? 121.880 175.839 119.264 1.00 111.18 ? 153 GLY C N   1 
ATOM   8605  C CA  . GLY C 1 153 ? 121.127 177.077 119.242 1.00 111.18 ? 153 GLY C CA  1 
ATOM   8606  C C   . GLY C 1 153 ? 121.546 178.058 120.319 1.00 111.18 ? 153 GLY C C   1 
ATOM   8607  O O   . GLY C 1 153 ? 120.787 178.971 120.661 1.00 111.18 ? 153 GLY C O   1 
ATOM   8608  N N   . GLY C 1 154 ? 122.748 177.884 120.859 1.00 106.28 ? 154 GLY C N   1 
ATOM   8609  C CA  . GLY C 1 154 ? 123.227 178.693 121.960 1.00 106.28 ? 154 GLY C CA  1 
ATOM   8610  C C   . GLY C 1 154 ? 123.776 180.039 121.514 1.00 106.28 ? 154 GLY C C   1 
ATOM   8611  O O   . GLY C 1 154 ? 123.575 180.501 120.391 1.00 106.28 ? 154 GLY C O   1 
ATOM   8612  N N   . ASP C 1 155 ? 124.497 180.678 122.438 1.00 108.26 ? 155 ASP C N   1 
ATOM   8613  C CA  . ASP C 1 155 ? 124.944 182.053 122.224 1.00 108.26 ? 155 ASP C CA  1 
ATOM   8614  C C   . ASP C 1 155 ? 126.190 182.179 121.344 1.00 108.26 ? 155 ASP C C   1 
ATOM   8615  O O   . ASP C 1 155 ? 126.168 183.007 120.428 1.00 108.26 ? 155 ASP C O   1 
ATOM   8616  C CB  . ASP C 1 155 ? 125.162 182.770 123.562 1.00 108.26 ? 155 ASP C CB  1 
ATOM   8617  C CG  . ASP C 1 155 ? 123.877 183.016 124.302 1.00 108.26 ? 155 ASP C CG  1 
ATOM   8618  O OD1 . ASP C 1 155 ? 122.830 183.191 123.640 1.00 108.26 ? 155 ASP C OD1 1 
ATOM   8619  O OD2 . ASP C 1 155 ? 123.910 183.027 125.553 1.00 108.26 ? 155 ASP C OD2 1 
ATOM   8620  N N   . PRO C 1 156 ? 127.313 181.412 121.542 1.00 97.94  ? 156 PRO C N   1 
ATOM   8621  C CA  . PRO C 1 156 ? 128.404 181.557 120.573 1.00 97.94  ? 156 PRO C CA  1 
ATOM   8622  C C   . PRO C 1 156 ? 128.231 180.651 119.372 1.00 97.94  ? 156 PRO C C   1 
ATOM   8623  O O   . PRO C 1 156 ? 129.204 180.053 118.912 1.00 97.94  ? 156 PRO C O   1 
ATOM   8624  C CB  . PRO C 1 156 ? 129.640 181.164 121.379 1.00 97.94  ? 156 PRO C CB  1 
ATOM   8625  C CG  . PRO C 1 156 ? 129.144 180.143 122.271 1.00 97.94  ? 156 PRO C CG  1 
ATOM   8626  C CD  . PRO C 1 156 ? 127.751 180.539 122.653 1.00 97.94  ? 156 PRO C CD  1 
ATOM   8627  N N   . TRP C 1 157 ? 127.012 180.556 118.848 1.00 100.61 ? 157 TRP C N   1 
ATOM   8628  C CA  . TRP C 1 157 ? 126.730 179.807 117.631 1.00 100.61 ? 157 TRP C CA  1 
ATOM   8629  C C   . TRP C 1 157 ? 125.511 180.427 116.978 1.00 100.61 ? 157 TRP C C   1 
ATOM   8630  O O   . TRP C 1 157 ? 124.481 180.579 117.638 1.00 100.61 ? 157 TRP C O   1 
ATOM   8631  C CB  . TRP C 1 157 ? 126.441 178.338 117.908 1.00 100.61 ? 157 TRP C CB  1 
ATOM   8632  C CG  . TRP C 1 157 ? 127.552 177.536 118.442 1.00 100.61 ? 157 TRP C CG  1 
ATOM   8633  C CD1 . TRP C 1 157 ? 128.551 176.951 117.736 1.00 100.61 ? 157 TRP C CD1 1 
ATOM   8634  C CD2 . TRP C 1 157 ? 127.747 177.165 119.800 1.00 100.61 ? 157 TRP C CD2 1 
ATOM   8635  N NE1 . TRP C 1 157 ? 129.378 176.257 118.576 1.00 100.61 ? 157 TRP C NE1 1 
ATOM   8636  C CE2 . TRP C 1 157 ? 128.899 176.371 119.853 1.00 100.61 ? 157 TRP C CE2 1 
ATOM   8637  C CE3 . TRP C 1 157 ? 127.064 177.436 120.981 1.00 100.61 ? 157 TRP C CE3 1 
ATOM   8638  C CZ2 . TRP C 1 157 ? 129.382 175.847 121.037 1.00 100.61 ? 157 TRP C CZ2 1 
ATOM   8639  C CZ3 . TRP C 1 157 ? 127.545 176.915 122.155 1.00 100.61 ? 157 TRP C CZ3 1 
ATOM   8640  C CH2 . TRP C 1 157 ? 128.694 176.134 122.177 1.00 100.61 ? 157 TRP C CH2 1 
ATOM   8641  N N   . THR C 1 158 ? 125.606 180.748 115.692 1.00 103.36 ? 158 THR C N   1 
ATOM   8642  C CA  . THR C 1 158 ? 124.400 181.070 114.949 1.00 103.36 ? 158 THR C CA  1 
ATOM   8643  C C   . THR C 1 158 ? 123.656 179.788 114.598 1.00 103.36 ? 158 THR C C   1 
ATOM   8644  O O   . THR C 1 158 ? 124.131 178.675 114.837 1.00 103.36 ? 158 THR C O   1 
ATOM   8645  C CB  . THR C 1 158 ? 124.723 181.859 113.685 1.00 103.36 ? 158 THR C CB  1 
ATOM   8646  O OG1 . THR C 1 158 ? 125.542 181.068 112.817 1.00 103.36 ? 158 THR C OG1 1 
ATOM   8647  C CG2 . THR C 1 158 ? 125.450 183.139 114.040 1.00 103.36 ? 158 THR C CG2 1 
ATOM   8648  N N   . ASN C 1 159 ? 122.470 179.953 114.028 1.00 107.49 ? 159 ASN C N   1 
ATOM   8649  C CA  . ASN C 1 159 ? 121.560 178.828 113.883 1.00 107.49 ? 159 ASN C CA  1 
ATOM   8650  C C   . ASN C 1 159 ? 122.036 177.911 112.766 1.00 107.49 ? 159 ASN C C   1 
ATOM   8651  O O   . ASN C 1 159 ? 122.343 178.361 111.661 1.00 107.49 ? 159 ASN C O   1 
ATOM   8652  C CB  . ASN C 1 159 ? 120.147 179.333 113.612 1.00 107.49 ? 159 ASN C CB  1 
ATOM   8653  C CG  . ASN C 1 159 ? 119.091 178.282 113.869 1.00 107.49 ? 159 ASN C CG  1 
ATOM   8654  O OD1 . ASN C 1 159 ? 119.399 177.150 114.237 1.00 107.49 ? 159 ASN C OD1 1 
ATOM   8655  N ND2 . ASN C 1 159 ? 117.829 178.659 113.689 1.00 107.49 ? 159 ASN C ND2 1 
ATOM   8656  N N   . GLY C 1 160 ? 122.124 176.624 113.074 1.00 104.17 ? 160 GLY C N   1 
ATOM   8657  C CA  . GLY C 1 160 ? 122.689 175.655 112.159 1.00 104.17 ? 160 GLY C CA  1 
ATOM   8658  C C   . GLY C 1 160 ? 124.135 175.349 112.483 1.00 104.17 ? 160 GLY C C   1 
ATOM   8659  O O   . GLY C 1 160 ? 124.593 174.215 112.321 1.00 104.17 ? 160 GLY C O   1 
ATOM   8660  N N   . SER C 1 161 ? 124.854 176.362 112.960 1.00 100.76 ? 161 SER C N   1 
ATOM   8661  C CA  . SER C 1 161 ? 126.282 176.260 113.210 1.00 100.76 ? 161 SER C CA  1 
ATOM   8662  C C   . SER C 1 161 ? 126.566 175.434 114.453 1.00 100.76 ? 161 SER C C   1 
ATOM   8663  O O   . SER C 1 161 ? 125.857 175.525 115.459 1.00 100.76 ? 161 SER C O   1 
ATOM   8664  C CB  . SER C 1 161 ? 126.889 177.643 113.395 1.00 100.76 ? 161 SER C CB  1 
ATOM   8665  O OG  . SER C 1 161 ? 126.398 178.225 114.589 1.00 100.76 ? 161 SER C OG  1 
ATOM   8666  N N   . GLY C 1 162 ? 127.624 174.628 114.377 1.00 95.45  ? 162 GLY C N   1 
ATOM   8667  C CA  . GLY C 1 162 ? 128.066 173.846 115.517 1.00 95.45  ? 162 GLY C CA  1 
ATOM   8668  C C   . GLY C 1 162 ? 129.469 174.175 115.981 1.00 95.45  ? 162 GLY C C   1 
ATOM   8669  O O   . GLY C 1 162 ? 129.773 174.102 117.172 1.00 95.45  ? 162 GLY C O   1 
ATOM   8670  N N   . LEU C 1 163 ? 130.329 174.555 115.052 1.00 82.17  ? 163 LEU C N   1 
ATOM   8671  C CA  . LEU C 1 163 ? 131.709 174.874 115.358 1.00 82.17  ? 163 LEU C CA  1 
ATOM   8672  C C   . LEU C 1 163 ? 131.955 176.339 115.060 1.00 82.17  ? 163 LEU C C   1 
ATOM   8673  O O   . LEU C 1 163 ? 131.478 176.856 114.048 1.00 82.17  ? 163 LEU C O   1 
ATOM   8674  C CB  . LEU C 1 163 ? 132.645 174.013 114.529 1.00 82.17  ? 163 LEU C CB  1 
ATOM   8675  C CG  . LEU C 1 163 ? 134.116 174.220 114.822 1.00 82.17  ? 163 LEU C CG  1 
ATOM   8676  C CD1 . LEU C 1 163 ? 134.335 173.745 116.193 1.00 82.17  ? 163 LEU C CD1 1 
ATOM   8677  C CD2 . LEU C 1 163 ? 134.987 173.474 113.869 1.00 82.17  ? 163 LEU C CD2 1 
ATOM   8678  N N   . ALA C 1 164 ? 132.699 177.013 115.935 1.00 82.52  ? 164 ALA C N   1 
ATOM   8679  C CA  . ALA C 1 164 ? 132.959 178.437 115.742 1.00 82.52  ? 164 ALA C CA  1 
ATOM   8680  C C   . ALA C 1 164 ? 134.348 178.764 116.272 1.00 82.52  ? 164 ALA C C   1 
ATOM   8681  O O   . ALA C 1 164 ? 134.583 178.687 117.478 1.00 82.52  ? 164 ALA C O   1 
ATOM   8682  C CB  . ALA C 1 164 ? 131.900 179.274 116.436 1.00 82.52  ? 164 ALA C CB  1 
ATOM   8683  N N   . LEU C 1 165 ? 135.250 179.147 115.385 1.00 82.31  ? 165 LEU C N   1 
ATOM   8684  C CA  . LEU C 1 165 ? 136.557 179.615 115.807 1.00 82.31  ? 165 LEU C CA  1 
ATOM   8685  C C   . LEU C 1 165 ? 136.543 181.135 115.804 1.00 82.31  ? 165 LEU C C   1 
ATOM   8686  O O   . LEU C 1 165 ? 136.183 181.757 114.802 1.00 82.31  ? 165 LEU C O   1 
ATOM   8687  C CB  . LEU C 1 165 ? 137.666 179.045 114.922 1.00 82.31  ? 165 LEU C CB  1 
ATOM   8688  C CG  . LEU C 1 165 ? 137.906 179.332 113.445 1.00 82.31  ? 165 LEU C CG  1 
ATOM   8689  C CD1 . LEU C 1 165 ? 138.893 180.467 113.282 1.00 82.31  ? 165 LEU C CD1 1 
ATOM   8690  C CD2 . LEU C 1 165 ? 138.407 178.090 112.753 1.00 82.31  ? 165 LEU C CD2 1 
ATOM   8691  N N   . CYS C 1 166 ? 136.905 181.729 116.935 1.00 86.45  ? 166 CYS C N   1 
ATOM   8692  C CA  . CYS C 1 166 ? 136.678 183.147 117.157 1.00 86.45  ? 166 CYS C CA  1 
ATOM   8693  C C   . CYS C 1 166 ? 137.964 183.795 117.634 1.00 86.45  ? 166 CYS C C   1 
ATOM   8694  O O   . CYS C 1 166 ? 138.504 183.401 118.668 1.00 86.45  ? 166 CYS C O   1 
ATOM   8695  C CB  . CYS C 1 166 ? 135.577 183.352 118.197 1.00 86.45  ? 166 CYS C CB  1 
ATOM   8696  S SG  . CYS C 1 166 ? 134.002 182.576 117.772 1.00 86.45  ? 166 CYS C SG  1 
ATOM   8697  N N   . GLN C 1 167 ? 138.447 184.787 116.900 1.00 85.88  ? 167 GLN C N   1 
ATOM   8698  C CA  . GLN C 1 167 ? 139.612 185.509 117.371 1.00 85.88  ? 167 GLN C CA  1 
ATOM   8699  C C   . GLN C 1 167 ? 139.231 186.441 118.503 1.00 85.88  ? 167 GLN C C   1 
ATOM   8700  O O   . GLN C 1 167 ? 138.060 186.639 118.813 1.00 85.88  ? 167 GLN C O   1 
ATOM   8701  C CB  . GLN C 1 167 ? 140.238 186.337 116.265 1.00 85.88  ? 167 GLN C CB  1 
ATOM   8702  C CG  . GLN C 1 167 ? 140.778 185.542 115.128 1.00 85.88  ? 167 GLN C CG  1 
ATOM   8703  C CD  . GLN C 1 167 ? 141.467 186.415 114.118 1.00 85.88  ? 167 GLN C CD  1 
ATOM   8704  O OE1 . GLN C 1 167 ? 141.575 187.626 114.299 1.00 85.88  ? 167 GLN C OE1 1 
ATOM   8705  N NE2 . GLN C 1 167 ? 141.916 185.812 113.029 1.00 85.88  ? 167 GLN C NE2 1 
ATOM   8706  N N   . ARG C 1 168 ? 140.246 187.021 119.126 1.00 86.80  ? 168 ARG C N   1 
ATOM   8707  C CA  . ARG C 1 168 ? 140.069 188.150 120.028 1.00 86.80  ? 168 ARG C CA  1 
ATOM   8708  C C   . ARG C 1 168 ? 141.271 189.050 119.835 1.00 86.80  ? 168 ARG C C   1 
ATOM   8709  O O   . ARG C 1 168 ? 142.406 188.596 119.985 1.00 86.80  ? 168 ARG C O   1 
ATOM   8710  C CB  . ARG C 1 168 ? 139.999 187.737 121.496 1.00 86.80  ? 168 ARG C CB  1 
ATOM   8711  C CG  . ARG C 1 168 ? 138.926 186.763 121.955 1.00 86.80  ? 168 ARG C CG  1 
ATOM   8712  C CD  . ARG C 1 168 ? 137.532 187.305 122.010 1.00 86.80  ? 168 ARG C CD  1 
ATOM   8713  N NE  . ARG C 1 168 ? 136.721 186.448 122.869 1.00 86.80  ? 168 ARG C NE  1 
ATOM   8714  C CZ  . ARG C 1 168 ? 136.121 185.337 122.474 1.00 86.80  ? 168 ARG C CZ  1 
ATOM   8715  N NH1 . ARG C 1 168 ? 135.409 184.627 123.332 1.00 86.80  ? 168 ARG C NH1 1 
ATOM   8716  N NH2 . ARG C 1 168 ? 136.245 184.928 121.227 1.00 86.80  ? 168 ARG C NH2 1 
ATOM   8717  N N   . TYR C 1 169 ? 141.040 190.313 119.522 1.00 92.08  ? 169 TYR C N   1 
ATOM   8718  C CA  . TYR C 1 169 ? 142.148 191.245 119.447 1.00 92.08  ? 169 TYR C CA  1 
ATOM   8719  C C   . TYR C 1 169 ? 141.665 192.626 119.836 1.00 92.08  ? 169 TYR C C   1 
ATOM   8720  O O   . TYR C 1 169 ? 140.467 192.871 119.991 1.00 92.08  ? 169 TYR C O   1 
ATOM   8721  C CB  . TYR C 1 169 ? 142.794 191.242 118.065 1.00 92.08  ? 169 TYR C CB  1 
ATOM   8722  C CG  . TYR C 1 169 ? 141.869 191.513 116.907 1.00 92.08  ? 169 TYR C CG  1 
ATOM   8723  C CD1 . TYR C 1 169 ? 141.229 190.474 116.257 1.00 92.08  ? 169 TYR C CD1 1 
ATOM   8724  C CD2 . TYR C 1 169 ? 141.681 192.794 116.428 1.00 92.08  ? 169 TYR C CD2 1 
ATOM   8725  C CE1 . TYR C 1 169 ? 140.412 190.708 115.185 1.00 92.08  ? 169 TYR C CE1 1 
ATOM   8726  C CE2 . TYR C 1 169 ? 140.856 193.041 115.362 1.00 92.08  ? 169 TYR C CE2 1 
ATOM   8727  C CZ  . TYR C 1 169 ? 140.223 191.995 114.746 1.00 92.08  ? 169 TYR C CZ  1 
ATOM   8728  O OH  . TYR C 1 169 ? 139.406 192.241 113.675 1.00 92.08  ? 169 TYR C OH  1 
ATOM   8729  N N   . TYR C 1 170 ? 142.624 193.528 120.002 1.00 100.53 ? 170 TYR C N   1 
ATOM   8730  C CA  . TYR C 1 170 ? 142.325 194.865 120.477 1.00 100.53 ? 170 TYR C CA  1 
ATOM   8731  C C   . TYR C 1 170 ? 141.629 195.674 119.389 1.00 100.53 ? 170 TYR C C   1 
ATOM   8732  O O   . TYR C 1 170 ? 141.674 195.339 118.209 1.00 100.53 ? 170 TYR C O   1 
ATOM   8733  C CB  . TYR C 1 170 ? 143.604 195.568 120.915 1.00 100.53 ? 170 TYR C CB  1 
ATOM   8734  C CG  . TYR C 1 170 ? 144.236 195.011 122.163 1.00 100.53 ? 170 TYR C CG  1 
ATOM   8735  C CD1 . TYR C 1 170 ? 143.530 194.178 123.018 1.00 100.53 ? 170 TYR C CD1 1 
ATOM   8736  C CD2 . TYR C 1 170 ? 145.540 195.334 122.496 1.00 100.53 ? 170 TYR C CD2 1 
ATOM   8737  C CE1 . TYR C 1 170 ? 144.108 193.679 124.162 1.00 100.53 ? 170 TYR C CE1 1 
ATOM   8738  C CE2 . TYR C 1 170 ? 146.127 194.840 123.637 1.00 100.53 ? 170 TYR C CE2 1 
ATOM   8739  C CZ  . TYR C 1 170 ? 145.405 194.012 124.464 1.00 100.53 ? 170 TYR C CZ  1 
ATOM   8740  O OH  . TYR C 1 170 ? 145.984 193.512 125.603 1.00 100.53 ? 170 TYR C OH  1 
ATOM   8741  N N   . HIS C 1 171 ? 140.954 196.744 119.806 1.00 115.29 ? 171 HIS C N   1 
ATOM   8742  C CA  . HIS C 1 171 ? 140.285 197.616 118.847 1.00 115.29 ? 171 HIS C CA  1 
ATOM   8743  C C   . HIS C 1 171 ? 141.288 198.344 117.974 1.00 115.29 ? 171 HIS C C   1 
ATOM   8744  O O   . HIS C 1 171 ? 141.230 198.282 116.743 1.00 115.29 ? 171 HIS C O   1 
ATOM   8745  C CB  . HIS C 1 171 ? 139.408 198.628 119.575 1.00 115.29 ? 171 HIS C CB  1 
ATOM   8746  C CG  . HIS C 1 171 ? 138.803 199.647 118.667 1.00 115.29 ? 171 HIS C CG  1 
ATOM   8747  N ND1 . HIS C 1 171 ? 139.418 200.846 118.387 1.00 115.29 ? 171 HIS C ND1 1 
ATOM   8748  C CD2 . HIS C 1 171 ? 137.658 199.632 117.948 1.00 115.29 ? 171 HIS C CD2 1 
ATOM   8749  C CE1 . HIS C 1 171 ? 138.671 201.534 117.544 1.00 115.29 ? 171 HIS C CE1 1 
ATOM   8750  N NE2 . HIS C 1 171 ? 137.596 200.820 117.264 1.00 115.29 ? 171 HIS C NE2 1 
ATOM   8751  N N   . ARG C 1 172 ? 142.201 199.063 118.604 1.00 125.24 ? 172 ARG C N   1 
ATOM   8752  C CA  . ARG C 1 172 ? 143.189 199.848 117.892 1.00 125.24 ? 172 ARG C CA  1 
ATOM   8753  C C   . ARG C 1 172 ? 144.443 199.875 118.739 1.00 125.24 ? 172 ARG C C   1 
ATOM   8754  O O   . ARG C 1 172 ? 144.402 200.301 119.895 1.00 125.24 ? 172 ARG C O   1 
ATOM   8755  C CB  . ARG C 1 172 ? 142.674 201.265 117.631 1.00 125.24 ? 172 ARG C CB  1 
ATOM   8756  C CG  . ARG C 1 172 ? 143.647 202.159 116.897 1.00 125.24 ? 172 ARG C CG  1 
ATOM   8757  C CD  . ARG C 1 172 ? 143.065 203.545 116.682 1.00 125.24 ? 172 ARG C CD  1 
ATOM   8758  N NE  . ARG C 1 172 ? 144.033 204.419 116.031 1.00 125.24 ? 172 ARG C NE  1 
ATOM   8759  C CZ  . ARG C 1 172 ? 144.922 205.157 116.686 1.00 125.24 ? 172 ARG C CZ  1 
ATOM   8760  N NH1 . ARG C 1 172 ? 144.959 205.129 118.011 1.00 125.24 ? 172 ARG C NH1 1 
ATOM   8761  N NH2 . ARG C 1 172 ? 145.773 205.923 116.018 1.00 125.24 ? 172 ARG C NH2 1 
ATOM   8762  N N   . GLY C 1 173 ? 145.541 199.411 118.167 1.00 121.28 ? 173 GLY C N   1 
ATOM   8763  C CA  . GLY C 1 173 ? 146.795 199.366 118.880 1.00 121.28 ? 173 GLY C CA  1 
ATOM   8764  C C   . GLY C 1 173 ? 147.980 199.219 117.951 1.00 121.28 ? 173 GLY C C   1 
ATOM   8765  O O   . GLY C 1 173 ? 148.001 198.341 117.084 1.00 121.28 ? 173 GLY C O   1 
ATOM   8766  N N   . HIS C 1 174 ? 148.978 200.075 118.127 1.00 123.08 ? 174 HIS C N   1 
ATOM   8767  C CA  . HIS C 1 174 ? 150.150 200.107 117.265 1.00 123.08 ? 174 HIS C CA  1 
ATOM   8768  C C   . HIS C 1 174 ? 151.373 200.040 118.161 1.00 123.08 ? 174 HIS C C   1 
ATOM   8769  O O   . HIS C 1 174 ? 151.962 201.064 118.503 1.00 123.08 ? 174 HIS C O   1 
ATOM   8770  C CB  . HIS C 1 174 ? 150.138 201.370 116.413 1.00 123.08 ? 174 HIS C CB  1 
ATOM   8771  C CG  . HIS C 1 174 ? 151.306 201.481 115.491 1.00 123.08 ? 174 HIS C CG  1 
ATOM   8772  N ND1 . HIS C 1 174 ? 151.387 200.786 114.304 1.00 123.08 ? 174 HIS C ND1 1 
ATOM   8773  C CD2 . HIS C 1 174 ? 152.461 202.176 115.600 1.00 123.08 ? 174 HIS C CD2 1 
ATOM   8774  C CE1 . HIS C 1 174 ? 152.534 201.065 113.711 1.00 123.08 ? 174 HIS C CE1 1 
ATOM   8775  N NE2 . HIS C 1 174 ? 153.205 201.904 114.478 1.00 123.08 ? 174 HIS C NE2 1 
ATOM   8776  N N   . VAL C 1 175 ? 151.757 198.837 118.541 1.00 119.85 ? 175 VAL C N   1 
ATOM   8777  C CA  . VAL C 1 175 ? 152.981 198.667 119.309 1.00 119.85 ? 175 VAL C CA  1 
ATOM   8778  C C   . VAL C 1 175 ? 154.141 198.456 118.351 1.00 119.85 ? 175 VAL C C   1 
ATOM   8779  O O   . VAL C 1 175 ? 154.027 197.746 117.343 1.00 119.85 ? 175 VAL C O   1 
ATOM   8780  C CB  . VAL C 1 175 ? 152.844 197.522 120.326 1.00 119.85 ? 175 VAL C CB  1 
ATOM   8781  C CG1 . VAL C 1 175 ? 151.860 197.922 121.397 1.00 119.85 ? 175 VAL C CG1 1 
ATOM   8782  C CG2 . VAL C 1 175 ? 152.371 196.243 119.663 1.00 119.85 ? 175 VAL C CG2 1 
ATOM   8783  N N   . ASP C 1 176 ? 155.244 199.126 118.634 1.00 119.78 ? 176 ASP C N   1 
ATOM   8784  C CA  . ASP C 1 176 ? 156.427 199.054 117.798 1.00 119.78 ? 176 ASP C CA  1 
ATOM   8785  C C   . ASP C 1 176 ? 157.642 199.422 118.638 1.00 119.78 ? 176 ASP C C   1 
ATOM   8786  O O   . ASP C 1 176 ? 157.760 200.562 119.098 1.00 119.78 ? 176 ASP C O   1 
ATOM   8787  C CB  . ASP C 1 176 ? 156.295 199.992 116.601 1.00 119.78 ? 176 ASP C CB  1 
ATOM   8788  C CG  . ASP C 1 176 ? 157.345 199.742 115.539 1.00 119.78 ? 176 ASP C CG  1 
ATOM   8789  O OD1 . ASP C 1 176 ? 158.152 198.800 115.684 1.00 119.78 ? 176 ASP C OD1 1 
ATOM   8790  O OD2 . ASP C 1 176 ? 157.371 200.509 114.555 1.00 119.78 ? 176 ASP C OD2 1 
ATOM   8791  N N   . PRO C 1 177 ? 158.552 198.492 118.877 1.00 118.59 ? 177 PRO C N   1 
ATOM   8792  C CA  . PRO C 1 177 ? 159.824 198.861 119.494 1.00 118.59 ? 177 PRO C CA  1 
ATOM   8793  C C   . PRO C 1 177 ? 160.682 199.641 118.516 1.00 118.59 ? 177 PRO C C   1 
ATOM   8794  O O   . PRO C 1 177 ? 160.514 199.541 117.299 1.00 118.59 ? 177 PRO C O   1 
ATOM   8795  C CB  . PRO C 1 177 ? 160.451 197.514 119.846 1.00 118.59 ? 177 PRO C CB  1 
ATOM   8796  C CG  . PRO C 1 177 ? 159.817 196.569 118.911 1.00 118.59 ? 177 PRO C CG  1 
ATOM   8797  C CD  . PRO C 1 177 ? 158.436 197.046 118.667 1.00 118.59 ? 177 PRO C CD  1 
ATOM   8798  N N   . ALA C 1 178 ? 161.557 200.480 119.081 1.00 127.33 ? 178 ALA C N   1 
ATOM   8799  C CA  . ALA C 1 178 ? 162.437 201.476 118.457 1.00 127.33 ? 178 ALA C CA  1 
ATOM   8800  C C   . ALA C 1 178 ? 161.683 202.649 117.827 1.00 127.33 ? 178 ALA C C   1 
ATOM   8801  O O   . ALA C 1 178 ? 162.327 203.590 117.354 1.00 127.33 ? 178 ALA C O   1 
ATOM   8802  C CB  . ALA C 1 178 ? 163.396 200.878 117.412 1.00 127.33 ? 178 ALA C CB  1 
ATOM   8803  N N   . ASN C 1 179 ? 160.341 202.626 117.798 1.00 135.58 ? 179 ASN C N   1 
ATOM   8804  C CA  . ASN C 1 179 ? 159.510 203.800 117.521 1.00 135.58 ? 179 ASN C CA  1 
ATOM   8805  C C   . ASN C 1 179 ? 158.333 203.683 118.490 1.00 135.58 ? 179 ASN C C   1 
ATOM   8806  O O   . ASN C 1 179 ? 157.266 203.179 118.141 1.00 135.58 ? 179 ASN C O   1 
ATOM   8807  C CB  . ASN C 1 179 ? 159.055 203.852 116.060 1.00 135.58 ? 179 ASN C CB  1 
ATOM   8808  C CG  . ASN C 1 179 ? 158.422 205.187 115.682 1.00 135.58 ? 179 ASN C CG  1 
ATOM   8809  O OD1 . ASN C 1 179 ? 158.322 206.099 116.499 1.00 135.58 ? 179 ASN C OD1 1 
ATOM   8810  N ND2 . ASN C 1 179 ? 157.988 205.299 114.433 1.00 135.58 ? 179 ASN C ND2 1 
ATOM   8811  N N   . ASP C 1 180 ? 158.511 204.211 119.698 1.00 137.94 ? 180 ASP C N   1 
ATOM   8812  C CA  . ASP C 1 180 ? 157.643 203.864 120.825 1.00 137.94 ? 180 ASP C CA  1 
ATOM   8813  C C   . ASP C 1 180 ? 156.447 204.804 120.958 1.00 137.94 ? 180 ASP C C   1 
ATOM   8814  O O   . ASP C 1 180 ? 156.174 205.350 122.025 1.00 137.94 ? 180 ASP C O   1 
ATOM   8815  C CB  . ASP C 1 180 ? 158.470 203.841 122.101 1.00 137.94 ? 180 ASP C CB  1 
ATOM   8816  C CG  . ASP C 1 180 ? 159.533 202.769 122.075 1.00 137.94 ? 180 ASP C CG  1 
ATOM   8817  O OD1 . ASP C 1 180 ? 159.301 201.728 121.428 1.00 137.94 ? 180 ASP C OD1 1 
ATOM   8818  O OD2 . ASP C 1 180 ? 160.606 202.975 122.676 1.00 137.94 ? 180 ASP C OD2 1 
ATOM   8819  N N   . THR C 1 181 ? 155.715 204.986 119.856 1.00 137.87 ? 181 THR C N   1 
ATOM   8820  C CA  . THR C 1 181 ? 154.444 205.710 119.850 1.00 137.87 ? 181 THR C CA  1 
ATOM   8821  C C   . THR C 1 181 ? 153.354 204.644 119.876 1.00 137.87 ? 181 THR C C   1 
ATOM   8822  O O   . THR C 1 181 ? 152.801 204.249 118.852 1.00 137.87 ? 181 THR C O   1 
ATOM   8823  C CB  . THR C 1 181 ? 154.339 206.617 118.622 1.00 137.87 ? 181 THR C CB  1 
ATOM   8824  O OG1 . THR C 1 181 ? 155.486 207.472 118.560 1.00 137.87 ? 181 THR C OG1 1 
ATOM   8825  C CG2 . THR C 1 181 ? 153.089 207.490 118.692 1.00 137.87 ? 181 THR C CG2 1 
ATOM   8826  N N   . PHE C 1 182 ? 153.068 204.142 121.068 1.00 130.77 ? 182 PHE C N   1 
ATOM   8827  C CA  . PHE C 1 182 ? 152.247 202.953 121.204 1.00 130.77 ? 182 PHE C CA  1 
ATOM   8828  C C   . PHE C 1 182 ? 150.958 203.259 121.951 1.00 130.77 ? 182 PHE C C   1 
ATOM   8829  O O   . PHE C 1 182 ? 150.966 203.939 122.981 1.00 130.77 ? 182 PHE C O   1 
ATOM   8830  C CB  . PHE C 1 182 ? 153.035 201.822 121.874 1.00 130.77 ? 182 PHE C CB  1 
ATOM   8831  C CG  . PHE C 1 182 ? 153.594 202.162 123.219 1.00 130.77 ? 182 PHE C CG  1 
ATOM   8832  C CD1 . PHE C 1 182 ? 154.842 202.748 123.337 1.00 130.77 ? 182 PHE C CD1 1 
ATOM   8833  C CD2 . PHE C 1 182 ? 152.901 201.839 124.369 1.00 130.77 ? 182 PHE C CD2 1 
ATOM   8834  C CE1 . PHE C 1 182 ? 155.362 203.047 124.571 1.00 130.77 ? 182 PHE C CE1 1 
ATOM   8835  C CE2 . PHE C 1 182 ? 153.420 202.133 125.609 1.00 130.77 ? 182 PHE C CE2 1 
ATOM   8836  C CZ  . PHE C 1 182 ? 154.652 202.737 125.710 1.00 130.77 ? 182 PHE C CZ  1 
ATOM   8837  N N   . ASP C 1 183 ? 149.850 202.758 121.403 1.00 129.61 ? 183 ASP C N   1 
ATOM   8838  C CA  . ASP C 1 183 ? 148.514 202.977 121.940 1.00 129.61 ? 183 ASP C CA  1 
ATOM   8839  C C   . ASP C 1 183 ? 147.919 201.666 122.421 1.00 129.61 ? 183 ASP C C   1 
ATOM   8840  O O   . ASP C 1 183 ? 148.003 200.644 121.731 1.00 129.61 ? 183 ASP C O   1 
ATOM   8841  C CB  . ASP C 1 183 ? 147.600 203.623 120.900 1.00 129.61 ? 183 ASP C CB  1 
ATOM   8842  C CG  . ASP C 1 183 ? 147.654 202.922 119.565 1.00 129.61 ? 183 ASP C CG  1 
ATOM   8843  O OD1 . ASP C 1 183 ? 148.556 202.090 119.370 1.00 129.61 ? 183 ASP C OD1 1 
ATOM   8844  O OD2 . ASP C 1 183 ? 146.791 203.192 118.707 1.00 129.61 ? 183 ASP C OD2 1 
ATOM   8845  N N   . ILE C 1 184 ? 147.344 201.695 123.617 1.00 126.47 ? 184 ILE C N   1 
ATOM   8846  C CA  . ILE C 1 184 ? 146.773 200.519 124.250 1.00 126.47 ? 184 ILE C CA  1 
ATOM   8847  C C   . ILE C 1 184 ? 145.451 200.953 124.853 1.00 126.47 ? 184 ILE C C   1 
ATOM   8848  O O   . ILE C 1 184 ? 145.430 201.776 125.775 1.00 126.47 ? 184 ILE C O   1 
ATOM   8849  C CB  . ILE C 1 184 ? 147.693 199.930 125.329 1.00 126.47 ? 184 ILE C CB  1 
ATOM   8850  C CG1 . ILE C 1 184 ? 149.015 199.421 124.740 1.00 126.47 ? 184 ILE C CG1 1 
ATOM   8851  C CG2 . ILE C 1 184 ? 146.992 198.804 126.063 1.00 126.47 ? 184 ILE C CG2 1 
ATOM   8852  C CD1 . ILE C 1 184 ? 150.092 199.187 125.778 1.00 126.47 ? 184 ILE C CD1 1 
ATOM   8853  N N   . ASP C 1 185 ? 144.352 200.425 124.331 1.00 121.37 ? 185 ASP C N   1 
ATOM   8854  C CA  . ASP C 1 185 ? 143.033 200.636 124.923 1.00 121.37 ? 185 ASP C CA  1 
ATOM   8855  C C   . ASP C 1 185 ? 142.247 199.341 124.899 1.00 121.37 ? 185 ASP C C   1 
ATOM   8856  O O   . ASP C 1 185 ? 142.023 198.782 123.804 1.00 121.37 ? 185 ASP C O   1 
ATOM   8857  C CB  . ASP C 1 185 ? 142.244 201.722 124.206 1.00 121.37 ? 185 ASP C CB  1 
ATOM   8858  C CG  . ASP C 1 185 ? 140.918 201.982 124.870 1.00 121.37 ? 185 ASP C CG  1 
ATOM   8859  O OD1 . ASP C 1 185 ? 140.920 202.616 125.943 1.00 121.37 ? 185 ASP C OD1 1 
ATOM   8860  O OD2 . ASP C 1 185 ? 139.883 201.525 124.340 1.00 121.37 ? 185 ASP C OD2 1 
ATOM   8861  N N   . PRO C 1 186 ? 141.802 198.848 126.040 1.00 118.03 ? 186 PRO C N   1 
ATOM   8862  C CA  . PRO C 1 186 ? 141.110 197.557 126.071 1.00 118.03 ? 186 PRO C CA  1 
ATOM   8863  C C   . PRO C 1 186 ? 139.725 197.630 125.466 1.00 118.03 ? 186 PRO C C   1 
ATOM   8864  O O   . PRO C 1 186 ? 138.793 198.144 126.084 1.00 118.03 ? 186 PRO C O   1 
ATOM   8865  C CB  . PRO C 1 186 ? 141.040 197.236 127.568 1.00 118.03 ? 186 PRO C CB  1 
ATOM   8866  C CG  . PRO C 1 186 ? 142.087 198.097 128.194 1.00 118.03 ? 186 PRO C CG  1 
ATOM   8867  C CD  . PRO C 1 186 ? 142.100 199.343 127.389 1.00 118.03 ? 186 PRO C CD  1 
ATOM   8868  N N   . MET C 1 187 ? 139.587 197.118 124.252 1.00 116.07 ? 187 MET C N   1 
ATOM   8869  C CA  . MET C 1 187 ? 138.281 197.013 123.608 1.00 116.07 ? 187 MET C CA  1 
ATOM   8870  C C   . MET C 1 187 ? 138.384 195.849 122.626 1.00 116.07 ? 187 MET C C   1 
ATOM   8871  O O   . MET C 1 187 ? 138.887 195.999 121.512 1.00 116.07 ? 187 MET C O   1 
ATOM   8872  C CB  . MET C 1 187 ? 137.885 198.306 122.918 1.00 116.07 ? 187 MET C CB  1 
ATOM   8873  C CG  . MET C 1 187 ? 136.461 198.301 122.426 1.00 116.07 ? 187 MET C CG  1 
ATOM   8874  S SD  . MET C 1 187 ? 135.309 198.140 123.804 1.00 116.07 ? 187 MET C SD  1 
ATOM   8875  C CE  . MET C 1 187 ? 133.872 197.461 122.979 1.00 116.07 ? 187 MET C CE  1 
ATOM   8876  N N   . VAL C 1 188 ? 137.911 194.712 123.045 1.00 100.95 ? 188 VAL C N   1 
ATOM   8877  C CA  . VAL C 1 188 ? 138.155 193.473 122.328 1.00 100.95 ? 188 VAL C CA  1 
ATOM   8878  C C   . VAL C 1 188 ? 136.967 193.152 121.434 1.00 100.95 ? 188 VAL C C   1 
ATOM   8879  O O   . VAL C 1 188 ? 135.812 193.415 121.785 1.00 100.95 ? 188 VAL C O   1 
ATOM   8880  C CB  . VAL C 1 188 ? 138.457 192.349 123.331 1.00 100.95 ? 188 VAL C CB  1 
ATOM   8881  C CG1 . VAL C 1 188 ? 139.754 192.654 124.028 1.00 100.95 ? 188 VAL C CG1 1 
ATOM   8882  C CG2 . VAL C 1 188 ? 137.362 192.244 124.376 1.00 100.95 ? 188 VAL C CG2 1 
ATOM   8883  N N   . VAL C 1 189 ? 137.248 192.616 120.250 1.00 92.85  ? 189 VAL C N   1 
ATOM   8884  C CA  . VAL C 1 189 ? 136.217 192.315 119.266 1.00 92.85  ? 189 VAL C CA  1 
ATOM   8885  C C   . VAL C 1 189 ? 136.252 190.824 118.986 1.00 92.85  ? 189 VAL C C   1 
ATOM   8886  O O   . VAL C 1 189 ? 137.321 190.262 118.736 1.00 92.85  ? 189 VAL C O   1 
ATOM   8887  C CB  . VAL C 1 189 ? 136.413 193.115 117.967 1.00 92.85  ? 189 VAL C CB  1 
ATOM   8888  C CG1 . VAL C 1 189 ? 135.286 192.839 116.978 1.00 92.85  ? 189 VAL C CG1 1 
ATOM   8889  C CG2 . VAL C 1 189 ? 136.498 194.585 118.264 1.00 92.85  ? 189 VAL C CG2 1 
ATOM   8890  N N   . THR C 1 190 ? 135.085 190.194 119.013 1.00 94.21  ? 190 THR C N   1 
ATOM   8891  C CA  . THR C 1 190 ? 134.953 188.750 118.845 1.00 94.21  ? 190 THR C CA  1 
ATOM   8892  C C   . THR C 1 190 ? 134.571 188.450 117.400 1.00 94.21  ? 190 THR C C   1 
ATOM   8893  O O   . THR C 1 190 ? 133.393 188.480 117.039 1.00 94.21  ? 190 THR C O   1 
ATOM   8894  C CB  . THR C 1 190 ? 133.913 188.219 119.822 1.00 94.21  ? 190 THR C CB  1 
ATOM   8895  O OG1 . THR C 1 190 ? 134.299 188.576 121.155 1.00 94.21  ? 190 THR C OG1 1 
ATOM   8896  C CG2 . THR C 1 190 ? 133.793 186.713 119.733 1.00 94.21  ? 190 THR C CG2 1 
ATOM   8897  N N   . ASP C 1 191 ? 135.565 188.154 116.564 1.00 98.19  ? 191 ASP C N   1 
ATOM   8898  C CA  . ASP C 1 191 ? 135.344 187.841 115.151 1.00 98.19  ? 191 ASP C CA  1 
ATOM   8899  C C   . ASP C 1 191 ? 135.224 186.334 114.984 1.00 98.19  ? 191 ASP C C   1 
ATOM   8900  O O   . ASP C 1 191 ? 136.229 185.630 114.876 1.00 98.19  ? 191 ASP C O   1 
ATOM   8901  C CB  . ASP C 1 191 ? 136.472 188.385 114.289 1.00 98.19  ? 191 ASP C CB  1 
ATOM   8902  C CG  . ASP C 1 191 ? 136.454 189.875 114.216 1.00 98.19  ? 191 ASP C CG  1 
ATOM   8903  O OD1 . ASP C 1 191 ? 135.360 190.449 114.369 1.00 98.19  ? 191 ASP C OD1 1 
ATOM   8904  O OD2 . ASP C 1 191 ? 137.520 190.478 113.998 1.00 98.19  ? 191 ASP C OD2 1 
ATOM   8905  N N   . CYS C 1 192 ? 133.996 185.843 114.930 1.00 98.29  ? 192 CYS C N   1 
ATOM   8906  C CA  . CYS C 1 192 ? 133.753 184.417 114.815 1.00 98.29  ? 192 CYS C CA  1 
ATOM   8907  C C   . CYS C 1 192 ? 133.614 184.005 113.361 1.00 98.29  ? 192 CYS C C   1 
ATOM   8908  O O   . CYS C 1 192 ? 133.151 184.773 112.518 1.00 98.29  ? 192 CYS C O   1 
ATOM   8909  C CB  . CYS C 1 192 ? 132.501 184.013 115.588 1.00 98.29  ? 192 CYS C CB  1 
ATOM   8910  S SG  . CYS C 1 192 ? 132.726 184.111 117.360 1.00 98.29  ? 192 CYS C SG  1 
ATOM   8911  N N   . ILE C 1 193 ? 134.039 182.785 113.077 1.00 88.72  ? 193 ILE C N   1 
ATOM   8912  C CA  . ILE C 1 193 ? 133.859 182.163 111.777 1.00 88.72  ? 193 ILE C CA  1 
ATOM   8913  C C   . ILE C 1 193 ? 132.933 180.983 111.980 1.00 88.72  ? 193 ILE C C   1 
ATOM   8914  O O   . ILE C 1 193 ? 133.136 180.176 112.890 1.00 88.72  ? 193 ILE C O   1 
ATOM   8915  C CB  . ILE C 1 193 ? 135.199 181.715 111.173 1.00 88.72  ? 193 ILE C CB  1 
ATOM   8916  C CG1 . ILE C 1 193 ? 136.186 182.874 111.174 1.00 88.72  ? 193 ILE C CG1 1 
ATOM   8917  C CG2 . ILE C 1 193 ? 135.005 181.241 109.763 1.00 88.72  ? 193 ILE C CG2 1 
ATOM   8918  C CD1 . ILE C 1 193 ? 135.723 184.067 110.395 1.00 88.72  ? 193 ILE C CD1 1 
ATOM   8919  N N   . GLN C 1 194 ? 131.908 180.890 111.157 1.00 90.98  ? 194 GLN C N   1 
ATOM   8920  C CA  . GLN C 1 194 ? 130.852 179.926 111.384 1.00 90.98  ? 194 GLN C CA  1 
ATOM   8921  C C   . GLN C 1 194 ? 131.025 178.741 110.455 1.00 90.98  ? 194 GLN C C   1 
ATOM   8922  O O   . GLN C 1 194 ? 131.277 178.911 109.260 1.00 90.98  ? 194 GLN C O   1 
ATOM   8923  C CB  . GLN C 1 194 ? 129.486 180.559 111.158 1.00 90.98  ? 194 GLN C CB  1 
ATOM   8924  C CG  . GLN C 1 194 ? 129.229 181.766 112.019 1.00 90.98  ? 194 GLN C CG  1 
ATOM   8925  C CD  . GLN C 1 194 ? 129.175 181.438 113.488 1.00 90.98  ? 194 GLN C CD  1 
ATOM   8926  O OE1 . GLN C 1 194 ? 128.648 180.402 113.884 1.00 90.98  ? 194 GLN C OE1 1 
ATOM   8927  N NE2 . GLN C 1 194 ? 129.717 182.327 114.311 1.00 90.98  ? 194 GLN C NE2 1 
ATOM   8928  N N   . VAL C 1 195 ? 130.876 177.545 111.010 1.00 85.02  ? 195 VAL C N   1 
ATOM   8929  C CA  . VAL C 1 195 ? 130.920 176.314 110.233 1.00 85.02  ? 195 VAL C CA  1 
ATOM   8930  C C   . VAL C 1 195 ? 130.022 175.284 110.906 1.00 85.02  ? 195 VAL C C   1 
ATOM   8931  O O   . VAL C 1 195 ? 130.042 175.117 112.129 1.00 85.02  ? 195 VAL C O   1 
ATOM   8932  C CB  . VAL C 1 195 ? 132.373 175.821 110.034 1.00 85.02  ? 195 VAL C CB  1 
ATOM   8933  C CG1 . VAL C 1 195 ? 133.111 175.740 111.329 1.00 85.02  ? 195 VAL C CG1 1 
ATOM   8934  C CG2 . VAL C 1 195 ? 132.406 174.475 109.351 1.00 85.02  ? 195 VAL C CG2 1 
ATOM   8935  N N   . ASP C 1 196 ? 129.185 174.658 110.109 1.00 90.58  ? 196 ASP C N   1 
ATOM   8936  C CA  . ASP C 1 196 ? 128.266 173.590 110.418 1.00 90.58  ? 196 ASP C CA  1 
ATOM   8937  C C   . ASP C 1 196 ? 128.744 172.281 109.797 1.00 90.58  ? 196 ASP C C   1 
ATOM   8938  O O   . ASP C 1 196 ? 129.379 172.292 108.740 1.00 90.58  ? 196 ASP C O   1 
ATOM   8939  C CB  . ASP C 1 196 ? 126.866 173.946 109.904 1.00 90.58  ? 196 ASP C CB  1 
ATOM   8940  C CG  . ASP C 1 196 ? 126.866 174.422 108.465 1.00 90.58  ? 196 ASP C CG  1 
ATOM   8941  O OD1 . ASP C 1 196 ? 127.952 174.618 107.890 1.00 90.58  ? 196 ASP C OD1 1 
ATOM   8942  O OD2 . ASP C 1 196 ? 125.770 174.612 107.901 1.00 90.58  ? 196 ASP C OD2 1 
ATOM   8943  N N   . PRO C 1 197 ? 128.492 171.142 110.436 1.00 92.29  ? 197 PRO C N   1 
ATOM   8944  C CA  . PRO C 1 197 ? 128.936 169.876 109.872 1.00 92.29  ? 197 PRO C CA  1 
ATOM   8945  C C   . PRO C 1 197 ? 128.097 169.508 108.666 1.00 92.29  ? 197 PRO C C   1 
ATOM   8946  O O   . PRO C 1 197 ? 126.910 169.855 108.600 1.00 92.29  ? 197 PRO C O   1 
ATOM   8947  C CB  . PRO C 1 197 ? 128.718 168.884 111.017 1.00 92.29  ? 197 PRO C CB  1 
ATOM   8948  C CG  . PRO C 1 197 ? 127.626 169.466 111.787 1.00 92.29  ? 197 PRO C CG  1 
ATOM   8949  C CD  . PRO C 1 197 ? 127.811 170.945 111.724 1.00 92.29  ? 197 PRO C CD  1 
ATOM   8950  N N   . PRO C 1 198 ? 128.680 168.833 107.685 1.00 103.72 ? 198 PRO C N   1 
ATOM   8951  C CA  . PRO C 1 198 ? 127.911 168.449 106.503 1.00 103.72 ? 198 PRO C CA  1 
ATOM   8952  C C   . PRO C 1 198 ? 126.941 167.328 106.824 1.00 103.72 ? 198 PRO C C   1 
ATOM   8953  O O   . PRO C 1 198 ? 127.143 166.531 107.740 1.00 103.72 ? 198 PRO C O   1 
ATOM   8954  C CB  . PRO C 1 198 ? 128.985 167.989 105.520 1.00 103.72 ? 198 PRO C CB  1 
ATOM   8955  C CG  . PRO C 1 198 ? 130.097 167.528 106.393 1.00 103.72 ? 198 PRO C CG  1 
ATOM   8956  C CD  . PRO C 1 198 ? 130.088 168.416 107.591 1.00 103.72 ? 198 PRO C CD  1 
ATOM   8957  N N   . GLU C 1 199 ? 125.864 167.279 106.048 1.00 127.12 ? 199 GLU C N   1 
ATOM   8958  C CA  . GLU C 1 199 ? 124.811 166.299 106.265 1.00 127.12 ? 199 GLU C CA  1 
ATOM   8959  C C   . GLU C 1 199 ? 125.137 164.950 105.638 1.00 127.12 ? 199 GLU C C   1 
ATOM   8960  O O   . GLU C 1 199 ? 125.077 163.919 106.313 1.00 127.12 ? 199 GLU C O   1 
ATOM   8961  C CB  . GLU C 1 199 ? 123.485 166.831 105.706 1.00 127.12 ? 199 GLU C CB  1 
ATOM   8962  C CG  . GLU C 1 199 ? 122.281 165.919 105.927 1.00 127.12 ? 199 GLU C CG  1 
ATOM   8963  C CD  . GLU C 1 199 ? 121.830 165.847 107.379 1.00 127.12 ? 199 GLU C CD  1 
ATOM   8964  O OE1 . GLU C 1 199 ? 122.030 166.830 108.122 1.00 127.12 ? 199 GLU C OE1 1 
ATOM   8965  O OE2 . GLU C 1 199 ? 121.269 164.803 107.776 1.00 127.12 ? 199 GLU C OE2 1 
ATOM   8966  N N   . ARG C 1 200 ? 125.500 164.944 104.358 1.00 138.69 ? 200 ARG C N   1 
ATOM   8967  C CA  . ARG C 1 200 ? 125.689 163.729 103.585 1.00 138.69 ? 200 ARG C CA  1 
ATOM   8968  C C   . ARG C 1 200 ? 127.071 163.681 102.939 1.00 138.69 ? 200 ARG C C   1 
ATOM   8969  O O   . ARG C 1 200 ? 127.668 164.726 102.668 1.00 138.69 ? 200 ARG C O   1 
ATOM   8970  C CB  . ARG C 1 200 ? 124.602 163.607 102.506 1.00 138.69 ? 200 ARG C CB  1 
ATOM   8971  C CG  . ARG C 1 200 ? 123.212 163.215 103.022 1.00 138.69 ? 200 ARG C CG  1 
ATOM   8972  C CD  . ARG C 1 200 ? 123.202 161.765 103.501 1.00 138.69 ? 200 ARG C CD  1 
ATOM   8973  N NE  . ARG C 1 200 ? 123.522 161.642 104.920 1.00 138.69 ? 200 ARG C NE  1 
ATOM   8974  C CZ  . ARG C 1 200 ? 123.997 160.540 105.485 1.00 138.69 ? 200 ARG C CZ  1 
ATOM   8975  N NH1 . ARG C 1 200 ? 124.232 159.463 104.750 1.00 138.69 ? 200 ARG C NH1 1 
ATOM   8976  N NH2 . ARG C 1 200 ? 124.261 160.525 106.782 1.00 138.69 ? 200 ARG C NH2 1 
ATOM   8977  N N   . PRO C 1 201 ? 127.621 162.472 102.706 1.00 145.46 ? 201 PRO C N   1 
ATOM   8978  C CA  . PRO C 1 201 ? 128.885 162.315 101.973 1.00 145.46 ? 201 PRO C CA  1 
ATOM   8979  C C   . PRO C 1 201 ? 128.809 162.775 100.517 1.00 145.46 ? 201 PRO C C   1 
ATOM   8980  O O   . PRO C 1 201 ? 129.819 162.710 99.816  1.00 145.46 ? 201 PRO C O   1 
ATOM   8981  C CB  . PRO C 1 201 ? 129.143 160.805 102.041 1.00 145.46 ? 201 PRO C CB  1 
ATOM   8982  C CG  . PRO C 1 201 ? 128.409 160.349 103.247 1.00 145.46 ? 201 PRO C CG  1 
ATOM   8983  C CD  . PRO C 1 201 ? 127.179 161.195 103.302 1.00 145.46 ? 201 PRO C CD  1 
ATOM   8984  N N   . SER C 1 216 ? 133.884 175.873 104.856 1.00 99.70  ? 216 SER C N   1 
ATOM   8985  C CA  . SER C 1 216 ? 133.880 176.681 103.643 1.00 99.70  ? 216 SER C CA  1 
ATOM   8986  C C   . SER C 1 216 ? 135.103 177.586 103.572 1.00 99.70  ? 216 SER C C   1 
ATOM   8987  O O   . SER C 1 216 ? 136.210 177.134 103.290 1.00 99.70  ? 216 SER C O   1 
ATOM   8988  C CB  . SER C 1 216 ? 132.603 177.521 103.560 1.00 99.70  ? 216 SER C CB  1 
ATOM   8989  O OG  . SER C 1 216 ? 132.620 178.359 102.417 1.00 99.70  ? 216 SER C OG  1 
ATOM   8990  N N   . SER C 1 217 ? 134.898 178.872 103.848 1.00 95.74  ? 217 SER C N   1 
ATOM   8991  C CA  . SER C 1 217 ? 135.931 179.881 103.678 1.00 95.74  ? 217 SER C CA  1 
ATOM   8992  C C   . SER C 1 217 ? 136.837 180.012 104.892 1.00 95.74  ? 217 SER C C   1 
ATOM   8993  O O   . SER C 1 217 ? 137.549 181.016 105.010 1.00 95.74  ? 217 SER C O   1 
ATOM   8994  C CB  . SER C 1 217 ? 135.291 181.233 103.360 1.00 95.74  ? 217 SER C CB  1 
ATOM   8995  O OG  . SER C 1 217 ? 134.565 181.181 102.145 1.00 95.74  ? 217 SER C OG  1 
ATOM   8996  N N   . TYR C 1 218 ? 136.836 179.025 105.790 1.00 87.19  ? 218 TYR C N   1 
ATOM   8997  C CA  . TYR C 1 218 ? 137.614 179.145 107.014 1.00 87.19  ? 218 TYR C CA  1 
ATOM   8998  C C   . TYR C 1 218 ? 139.107 179.028 106.765 1.00 87.19  ? 218 TYR C C   1 
ATOM   8999  O O   . TYR C 1 218 ? 139.892 179.541 107.566 1.00 87.19  ? 218 TYR C O   1 
ATOM   9000  C CB  . TYR C 1 218 ? 137.166 178.100 108.029 1.00 87.19  ? 218 TYR C CB  1 
ATOM   9001  C CG  . TYR C 1 218 ? 137.430 176.661 107.650 1.00 87.19  ? 218 TYR C CG  1 
ATOM   9002  C CD1 . TYR C 1 218 ? 136.509 175.942 106.912 1.00 87.19  ? 218 TYR C CD1 1 
ATOM   9003  C CD2 . TYR C 1 218 ? 138.578 176.007 108.082 1.00 87.19  ? 218 TYR C CD2 1 
ATOM   9004  C CE1 . TYR C 1 218 ? 136.741 174.628 106.587 1.00 87.19  ? 218 TYR C CE1 1 
ATOM   9005  C CE2 . TYR C 1 218 ? 138.816 174.704 107.754 1.00 87.19  ? 218 TYR C CE2 1 
ATOM   9006  C CZ  . TYR C 1 218 ? 137.894 174.019 107.015 1.00 87.19  ? 218 TYR C CZ  1 
ATOM   9007  O OH  . TYR C 1 218 ? 138.132 172.712 106.693 1.00 87.19  ? 218 TYR C OH  1 
ATOM   9008  N N   . LYS C 1 219 ? 139.510 178.346 105.692 1.00 84.71  ? 219 LYS C N   1 
ATOM   9009  C CA  . LYS C 1 219 ? 140.912 178.340 105.298 1.00 84.71  ? 219 LYS C CA  1 
ATOM   9010  C C   . LYS C 1 219 ? 141.386 179.736 104.934 1.00 84.71  ? 219 LYS C C   1 
ATOM   9011  O O   . LYS C 1 219 ? 142.528 180.105 105.223 1.00 84.71  ? 219 LYS C O   1 
ATOM   9012  C CB  . LYS C 1 219 ? 141.125 177.393 104.125 1.00 84.71  ? 219 LYS C CB  1 
ATOM   9013  C CG  . LYS C 1 219 ? 140.992 175.933 104.458 1.00 84.71  ? 219 LYS C CG  1 
ATOM   9014  C CD  . LYS C 1 219 ? 142.197 175.464 105.249 1.00 84.71  ? 219 LYS C CD  1 
ATOM   9015  C CE  . LYS C 1 219 ? 142.134 173.972 105.505 1.00 84.71  ? 219 LYS C CE  1 
ATOM   9016  N NZ  . LYS C 1 219 ? 142.282 173.201 104.243 1.00 84.71  ? 219 LYS C NZ  1 
ATOM   9017  N N   . ASN C 1 220 ? 140.531 180.523 104.298 1.00 89.36  ? 220 ASN C N   1 
ATOM   9018  C CA  . ASN C 1 220 ? 140.820 181.936 104.110 1.00 89.36  ? 220 ASN C CA  1 
ATOM   9019  C C   . ASN C 1 220 ? 140.711 182.605 105.471 1.00 89.36  ? 220 ASN C C   1 
ATOM   9020  O O   . ASN C 1 220 ? 139.613 182.863 105.964 1.00 89.36  ? 220 ASN C O   1 
ATOM   9021  C CB  . ASN C 1 220 ? 139.866 182.550 103.093 1.00 89.36  ? 220 ASN C CB  1 
ATOM   9022  C CG  . ASN C 1 220 ? 140.080 182.012 101.690 1.00 89.36  ? 220 ASN C CG  1 
ATOM   9023  O OD1 . ASN C 1 220 ? 139.216 181.343 101.129 1.00 89.36  ? 220 ASN C OD1 1 
ATOM   9024  N ND2 . ASN C 1 220 ? 141.234 182.314 101.112 1.00 89.36  ? 220 ASN C ND2 1 
ATOM   9025  N N   . LEU C 1 221 ? 141.857 182.861 106.097 1.00 87.37  ? 221 LEU C N   1 
ATOM   9026  C CA  . LEU C 1 221 ? 141.899 183.379 107.456 1.00 87.37  ? 221 LEU C CA  1 
ATOM   9027  C C   . LEU C 1 221 ? 143.235 184.061 107.701 1.00 87.37  ? 221 LEU C C   1 
ATOM   9028  O O   . LEU C 1 221 ? 144.283 183.519 107.351 1.00 87.37  ? 221 LEU C O   1 
ATOM   9029  C CB  . LEU C 1 221 ? 141.694 182.257 108.478 1.00 87.37  ? 221 LEU C CB  1 
ATOM   9030  C CG  . LEU C 1 221 ? 141.788 182.677 109.940 1.00 87.37  ? 221 LEU C CG  1 
ATOM   9031  C CD1 . LEU C 1 221 ? 140.740 183.712 110.240 1.00 87.37  ? 221 LEU C CD1 1 
ATOM   9032  C CD2 . LEU C 1 221 ? 141.645 181.487 110.863 1.00 87.37  ? 221 LEU C CD2 1 
ATOM   9033  N N   . THR C 1 222 ? 143.191 185.247 108.297 1.00 87.02  ? 222 THR C N   1 
ATOM   9034  C CA  . THR C 1 222 ? 144.378 185.899 108.823 1.00 87.02  ? 222 THR C CA  1 
ATOM   9035  C C   . THR C 1 222 ? 144.199 186.082 110.320 1.00 87.02  ? 222 THR C C   1 
ATOM   9036  O O   . THR C 1 222 ? 143.081 186.019 110.830 1.00 87.02  ? 222 THR C O   1 
ATOM   9037  C CB  . THR C 1 222 ? 144.619 187.245 108.166 1.00 87.02  ? 222 THR C CB  1 
ATOM   9038  O OG1 . THR C 1 222 ? 143.498 188.094 108.423 1.00 87.02  ? 222 THR C OG1 1 
ATOM   9039  C CG2 . THR C 1 222 ? 144.780 187.082 106.672 1.00 87.02  ? 222 THR C CG2 1 
ATOM   9040  N N   . LEU C 1 223 ? 145.301 186.295 111.035 1.00 83.09  ? 223 LEU C N   1 
ATOM   9041  C CA  . LEU C 1 223 ? 145.228 186.271 112.486 1.00 83.09  ? 223 LEU C CA  1 
ATOM   9042  C C   . LEU C 1 223 ? 145.631 187.556 113.186 1.00 83.09  ? 223 LEU C C   1 
ATOM   9043  O O   . LEU C 1 223 ? 145.154 187.780 114.300 1.00 83.09  ? 223 LEU C O   1 
ATOM   9044  C CB  . LEU C 1 223 ? 146.064 185.115 113.050 1.00 83.09  ? 223 LEU C CB  1 
ATOM   9045  C CG  . LEU C 1 223 ? 145.294 183.812 113.314 1.00 83.09  ? 223 LEU C CG  1 
ATOM   9046  C CD1 . LEU C 1 223 ? 144.846 183.104 112.067 1.00 83.09  ? 223 LEU C CD1 1 
ATOM   9047  C CD2 . LEU C 1 223 ? 146.130 182.876 114.137 1.00 83.09  ? 223 LEU C CD2 1 
ATOM   9048  N N   . LYS C 1 224 ? 146.472 188.393 112.575 1.00 86.48  ? 224 LYS C N   1 
ATOM   9049  C CA  . LYS C 1 224 ? 146.902 189.691 113.114 1.00 86.48  ? 224 LYS C CA  1 
ATOM   9050  C C   . LYS C 1 224 ? 147.587 189.530 114.477 1.00 86.48  ? 224 LYS C C   1 
ATOM   9051  O O   . LYS C 1 224 ? 147.078 189.945 115.517 1.00 86.48  ? 224 LYS C O   1 
ATOM   9052  C CB  . LYS C 1 224 ? 145.740 190.694 113.191 1.00 86.48  ? 224 LYS C CB  1 
ATOM   9053  C CG  . LYS C 1 224 ? 145.163 191.086 111.838 1.00 86.48  ? 224 LYS C CG  1 
ATOM   9054  C CD  . LYS C 1 224 ? 144.269 192.323 111.926 1.00 86.48  ? 224 LYS C CD  1 
ATOM   9055  C CE  . LYS C 1 224 ? 142.906 192.053 112.521 1.00 86.48  ? 224 LYS C CE  1 
ATOM   9056  N NZ  . LYS C 1 224 ? 142.026 191.270 111.619 1.00 86.48  ? 224 LYS C NZ  1 
ATOM   9057  N N   . PHE C 1 225 ? 148.765 188.900 114.426 1.00 89.02  ? 225 PHE C N   1 
ATOM   9058  C CA  . PHE C 1 225 ? 149.421 188.374 115.620 1.00 89.02  ? 225 PHE C CA  1 
ATOM   9059  C C   . PHE C 1 225 ? 149.875 189.442 116.597 1.00 89.02  ? 225 PHE C C   1 
ATOM   9060  O O   . PHE C 1 225 ? 149.828 189.206 117.807 1.00 89.02  ? 225 PHE C O   1 
ATOM   9061  C CB  . PHE C 1 225 ? 150.637 187.543 115.239 1.00 89.02  ? 225 PHE C CB  1 
ATOM   9062  C CG  . PHE C 1 225 ? 150.306 186.335 114.451 1.00 89.02  ? 225 PHE C CG  1 
ATOM   9063  C CD1 . PHE C 1 225 ? 149.766 185.226 115.067 1.00 89.02  ? 225 PHE C CD1 1 
ATOM   9064  C CD2 . PHE C 1 225 ? 150.539 186.304 113.093 1.00 89.02  ? 225 PHE C CD2 1 
ATOM   9065  C CE1 . PHE C 1 225 ? 149.459 184.110 114.341 1.00 89.02  ? 225 PHE C CE1 1 
ATOM   9066  C CE2 . PHE C 1 225 ? 150.239 185.189 112.357 1.00 89.02  ? 225 PHE C CE2 1 
ATOM   9067  C CZ  . PHE C 1 225 ? 149.691 184.086 112.983 1.00 89.02  ? 225 PHE C CZ  1 
ATOM   9068  N N   . HIS C 1 226 ? 150.290 190.609 116.117 1.00 93.51  ? 226 HIS C N   1 
ATOM   9069  C CA  . HIS C 1 226 ? 150.781 191.670 116.987 1.00 93.51  ? 226 HIS C CA  1 
ATOM   9070  C C   . HIS C 1 226 ? 149.705 192.264 117.883 1.00 93.51  ? 226 HIS C C   1 
ATOM   9071  O O   . HIS C 1 226 ? 150.035 193.013 118.805 1.00 93.51  ? 226 HIS C O   1 
ATOM   9072  C CB  . HIS C 1 226 ? 151.394 192.772 116.139 1.00 93.51  ? 226 HIS C CB  1 
ATOM   9073  C CG  . HIS C 1 226 ? 150.462 193.296 115.100 1.00 93.51  ? 226 HIS C CG  1 
ATOM   9074  N ND1 . HIS C 1 226 ? 149.472 194.208 115.384 1.00 93.51  ? 226 HIS C ND1 1 
ATOM   9075  C CD2 . HIS C 1 226 ? 150.370 193.037 113.776 1.00 93.51  ? 226 HIS C CD2 1 
ATOM   9076  C CE1 . HIS C 1 226 ? 148.804 194.486 114.279 1.00 93.51  ? 226 HIS C CE1 1 
ATOM   9077  N NE2 . HIS C 1 226 ? 149.331 193.791 113.289 1.00 93.51  ? 226 HIS C NE2 1 
ATOM   9078  N N   . LYS C 1 227 ? 148.441 191.944 117.632 1.00 97.03  ? 227 LYS C N   1 
ATOM   9079  C CA  . LYS C 1 227 ? 147.307 192.423 118.401 1.00 97.03  ? 227 LYS C CA  1 
ATOM   9080  C C   . LYS C 1 227 ? 146.523 191.271 119.022 1.00 97.03  ? 227 LYS C C   1 
ATOM   9081  O O   . LYS C 1 227 ? 145.581 191.511 119.783 1.00 97.03  ? 227 LYS C O   1 
ATOM   9082  C CB  . LYS C 1 227 ? 146.417 193.258 117.462 1.00 97.03  ? 227 LYS C CB  1 
ATOM   9083  C CG  . LYS C 1 227 ? 145.372 194.165 118.075 1.00 97.03  ? 227 LYS C CG  1 
ATOM   9084  C CD  . LYS C 1 227 ? 144.657 194.951 117.010 1.00 97.03  ? 227 LYS C CD  1 
ATOM   9085  C CE  . LYS C 1 227 ? 145.238 196.340 116.887 1.00 97.03  ? 227 LYS C CE  1 
ATOM   9086  N NZ  . LYS C 1 227 ? 146.542 196.372 116.169 1.00 97.03  ? 227 LYS C NZ  1 
ATOM   9087  N N   . LEU C 1 228 ? 146.930 190.033 118.773 1.00 85.57  ? 228 LEU C N   1 
ATOM   9088  C CA  . LEU C 1 228 ? 146.130 188.859 119.088 1.00 85.57  ? 228 LEU C CA  1 
ATOM   9089  C C   . LEU C 1 228 ? 146.102 188.560 120.581 1.00 85.57  ? 228 LEU C C   1 
ATOM   9090  O O   . LEU C 1 228 ? 147.122 188.647 121.264 1.00 85.57  ? 228 LEU C O   1 
ATOM   9091  C CB  . LEU C 1 228 ? 146.699 187.673 118.324 1.00 85.57  ? 228 LEU C CB  1 
ATOM   9092  C CG  . LEU C 1 228 ? 146.101 186.300 118.531 1.00 85.57  ? 228 LEU C CG  1 
ATOM   9093  C CD1 . LEU C 1 228 ? 144.647 186.314 118.183 1.00 85.57  ? 228 LEU C CD1 1 
ATOM   9094  C CD2 . LEU C 1 228 ? 146.848 185.337 117.651 1.00 85.57  ? 228 LEU C CD2 1 
ATOM   9095  N N   . VAL C 1 229 ? 144.926 188.190 121.087 1.00 80.51  ? 229 VAL C N   1 
ATOM   9096  C CA  . VAL C 1 229 ? 144.735 187.898 122.505 1.00 80.51  ? 229 VAL C CA  1 
ATOM   9097  C C   . VAL C 1 229 ? 144.578 186.405 122.751 1.00 80.51  ? 229 VAL C C   1 
ATOM   9098  O O   . VAL C 1 229 ? 145.386 185.800 123.448 1.00 80.51  ? 229 VAL C O   1 
ATOM   9099  C CB  . VAL C 1 229 ? 143.539 188.681 123.080 1.00 80.51  ? 229 VAL C CB  1 
ATOM   9100  C CG1 . VAL C 1 229 ? 143.391 188.358 124.543 1.00 80.51  ? 229 VAL C CG1 1 
ATOM   9101  C CG2 . VAL C 1 229 ? 143.726 190.152 122.852 1.00 80.51  ? 229 VAL C CG2 1 
ATOM   9102  N N   . ASN C 1 230 ? 143.524 185.800 122.216 1.00 77.71  ? 230 ASN C N   1 
ATOM   9103  C CA  . ASN C 1 230 ? 143.355 184.355 122.281 1.00 77.71  ? 230 ASN C CA  1 
ATOM   9104  C C   . ASN C 1 230 ? 142.391 183.919 121.202 1.00 77.71  ? 230 ASN C C   1 
ATOM   9105  O O   . ASN C 1 230 ? 141.512 184.675 120.798 1.00 77.71  ? 230 ASN C O   1 
ATOM   9106  C CB  . ASN C 1 230 ? 142.867 183.868 123.651 1.00 77.71  ? 230 ASN C CB  1 
ATOM   9107  C CG  . ASN C 1 230 ? 141.792 184.736 124.216 1.00 77.71  ? 230 ASN C CG  1 
ATOM   9108  O OD1 . ASN C 1 230 ? 141.453 185.740 123.623 1.00 77.71  ? 230 ASN C OD1 1 
ATOM   9109  N ND2 . ASN C 1 230 ? 141.246 184.362 125.369 1.00 77.71  ? 230 ASN C ND2 1 
ATOM   9110  N N   . VAL C 1 231 ? 142.579 182.695 120.735 1.00 68.51  ? 231 VAL C N   1 
ATOM   9111  C CA  . VAL C 1 231 ? 141.740 182.091 119.714 1.00 68.51  ? 231 VAL C CA  1 
ATOM   9112  C C   . VAL C 1 231 ? 141.075 180.887 120.344 1.00 68.51  ? 231 VAL C C   1 
ATOM   9113  O O   . VAL C 1 231 ? 141.759 179.974 120.817 1.00 68.51  ? 231 VAL C O   1 
ATOM   9114  C CB  . VAL C 1 231 ? 142.550 181.674 118.489 1.00 68.51  ? 231 VAL C CB  1 
ATOM   9115  C CG1 . VAL C 1 231 ? 141.658 180.985 117.521 1.00 68.51  ? 231 VAL C CG1 1 
ATOM   9116  C CG2 . VAL C 1 231 ? 143.179 182.868 117.859 1.00 68.51  ? 231 VAL C CG2 1 
ATOM   9117  N N   . THR C 1 232 ? 139.754 180.867 120.360 1.00 78.20  ? 232 THR C N   1 
ATOM   9118  C CA  . THR C 1 232 ? 139.023 179.783 120.988 1.00 78.20  ? 232 THR C CA  1 
ATOM   9119  C C   . THR C 1 232 ? 138.228 179.020 119.945 1.00 78.20  ? 232 THR C C   1 
ATOM   9120  O O   . THR C 1 232 ? 137.938 179.533 118.867 1.00 78.20  ? 232 THR C O   1 
ATOM   9121  C CB  . THR C 1 232 ? 138.071 180.302 122.059 1.00 78.20  ? 232 THR C CB  1 
ATOM   9122  O OG1 . THR C 1 232 ? 137.019 181.041 121.435 1.00 78.20  ? 232 THR C OG1 1 
ATOM   9123  C CG2 . THR C 1 232 ? 138.803 181.219 123.015 1.00 78.20  ? 232 THR C CG2 1 
ATOM   9124  N N   . ILE C 1 233 ? 137.876 177.789 120.280 1.00 74.78  ? 233 ILE C N   1 
ATOM   9125  C CA  . ILE C 1 233 ? 137.110 176.910 119.414 1.00 74.78  ? 233 ILE C CA  1 
ATOM   9126  C C   . ILE C 1 233 ? 136.078 176.197 120.271 1.00 74.78  ? 233 ILE C C   1 
ATOM   9127  O O   . ILE C 1 233 ? 136.430 175.570 121.274 1.00 74.78  ? 233 ILE C O   1 
ATOM   9128  C CB  . ILE C 1 233 ? 138.025 175.908 118.687 1.00 74.78  ? 233 ILE C CB  1 
ATOM   9129  C CG1 . ILE C 1 233 ? 138.777 176.592 117.558 1.00 74.78  ? 233 ILE C CG1 1 
ATOM   9130  C CG2 . ILE C 1 233 ? 137.262 174.757 118.155 1.00 74.78  ? 233 ILE C CG2 1 
ATOM   9131  C CD1 . ILE C 1 233 ? 139.805 175.740 116.927 1.00 74.78  ? 233 ILE C CD1 1 
ATOM   9132  N N   . HIS C 1 234 ? 134.810 176.303 119.888 1.00 84.09  ? 234 HIS C N   1 
ATOM   9133  C CA  . HIS C 1 234 ? 133.689 175.797 120.671 1.00 84.09  ? 234 HIS C CA  1 
ATOM   9134  C C   . HIS C 1 234 ? 132.915 174.795 119.830 1.00 84.09  ? 234 HIS C C   1 
ATOM   9135  O O   . HIS C 1 234 ? 132.553 175.106 118.691 1.00 84.09  ? 234 HIS C O   1 
ATOM   9136  C CB  . HIS C 1 234 ? 132.752 176.939 121.063 1.00 84.09  ? 234 HIS C CB  1 
ATOM   9137  C CG  . HIS C 1 234 ? 133.337 177.944 122.000 1.00 84.09  ? 234 HIS C CG  1 
ATOM   9138  N ND1 . HIS C 1 234 ? 133.258 177.821 123.370 1.00 84.09  ? 234 HIS C ND1 1 
ATOM   9139  C CD2 . HIS C 1 234 ? 134.004 179.099 121.766 1.00 84.09  ? 234 HIS C CD2 1 
ATOM   9140  C CE1 . HIS C 1 234 ? 133.832 178.863 123.937 1.00 84.09  ? 234 HIS C CE1 1 
ATOM   9141  N NE2 . HIS C 1 234 ? 134.310 179.645 122.985 1.00 84.09  ? 234 HIS C NE2 1 
ATOM   9142  N N   . PHE C 1 235 ? 132.633 173.618 120.387 1.00 79.15  ? 235 PHE C N   1 
ATOM   9143  C CA  . PHE C 1 235 ? 131.638 172.729 119.795 1.00 79.15  ? 235 PHE C CA  1 
ATOM   9144  C C   . PHE C 1 235 ? 131.111 171.787 120.861 1.00 79.15  ? 235 PHE C C   1 
ATOM   9145  O O   . PHE C 1 235 ? 131.622 171.735 121.978 1.00 79.15  ? 235 PHE C O   1 
ATOM   9146  C CB  . PHE C 1 235 ? 132.175 171.939 118.595 1.00 79.15  ? 235 PHE C CB  1 
ATOM   9147  C CG  . PHE C 1 235 ? 133.302 171.012 118.909 1.00 79.15  ? 235 PHE C CG  1 
ATOM   9148  C CD1 . PHE C 1 235 ? 134.602 171.467 118.914 1.00 79.15  ? 235 PHE C CD1 1 
ATOM   9149  C CD2 . PHE C 1 235 ? 133.071 169.667 119.115 1.00 79.15  ? 235 PHE C CD2 1 
ATOM   9150  C CE1 . PHE C 1 235 ? 135.640 170.617 119.171 1.00 79.15  ? 235 PHE C CE1 1 
ATOM   9151  C CE2 . PHE C 1 235 ? 134.108 168.811 119.377 1.00 79.15  ? 235 PHE C CE2 1 
ATOM   9152  C CZ  . PHE C 1 235 ? 135.390 169.291 119.403 1.00 79.15  ? 235 PHE C CZ  1 
ATOM   9153  N N   . ARG C 1 236 ? 130.065 171.058 120.500 1.00 84.32  ? 236 ARG C N   1 
ATOM   9154  C CA  . ARG C 1 236 ? 129.365 170.176 121.415 1.00 84.32  ? 236 ARG C CA  1 
ATOM   9155  C C   . ARG C 1 236 ? 129.092 168.849 120.737 1.00 84.32  ? 236 ARG C C   1 
ATOM   9156  O O   . ARG C 1 236 ? 128.931 168.780 119.520 1.00 84.32  ? 236 ARG C O   1 
ATOM   9157  C CB  . ARG C 1 236 ? 128.060 170.790 121.873 1.00 84.32  ? 236 ARG C CB  1 
ATOM   9158  C CG  . ARG C 1 236 ? 128.244 171.937 122.812 1.00 84.32  ? 236 ARG C CG  1 
ATOM   9159  C CD  . ARG C 1 236 ? 126.956 172.650 123.082 1.00 84.32  ? 236 ARG C CD  1 
ATOM   9160  N NE  . ARG C 1 236 ? 126.542 173.395 121.904 1.00 84.32  ? 236 ARG C NE  1 
ATOM   9161  C CZ  . ARG C 1 236 ? 125.436 174.116 121.840 1.00 84.32  ? 236 ARG C CZ  1 
ATOM   9162  N NH1 . ARG C 1 236 ? 124.639 174.202 122.895 1.00 84.32  ? 236 ARG C NH1 1 
ATOM   9163  N NH2 . ARG C 1 236 ? 125.143 174.766 120.733 1.00 84.32  ? 236 ARG C NH2 1 
ATOM   9164  N N   . LEU C 1 237 ? 129.038 167.791 121.536 1.00 80.70  ? 237 LEU C N   1 
ATOM   9165  C CA  . LEU C 1 237 ? 128.867 166.443 121.015 1.00 80.70  ? 237 LEU C CA  1 
ATOM   9166  C C   . LEU C 1 237 ? 128.013 165.640 121.975 1.00 80.70  ? 237 LEU C C   1 
ATOM   9167  O O   . LEU C 1 237 ? 128.371 165.499 123.145 1.00 80.70  ? 237 LEU C O   1 
ATOM   9168  C CB  . LEU C 1 237 ? 130.215 165.753 120.820 1.00 80.70  ? 237 LEU C CB  1 
ATOM   9169  C CG  . LEU C 1 237 ? 131.114 166.197 119.676 1.00 80.70  ? 237 LEU C CG  1 
ATOM   9170  C CD1 . LEU C 1 237 ? 132.442 165.503 119.755 1.00 80.70  ? 237 LEU C CD1 1 
ATOM   9171  C CD2 . LEU C 1 237 ? 130.434 165.846 118.392 1.00 80.70  ? 237 LEU C CD2 1 
ATOM   9172  N N   . LYS C 1 238 ? 126.897 165.113 121.487 1.00 89.10  ? 238 LYS C N   1 
ATOM   9173  C CA  . LYS C 1 238 ? 126.124 164.165 122.269 1.00 89.10  ? 238 LYS C CA  1 
ATOM   9174  C C   . LYS C 1 238 ? 126.663 162.760 122.069 1.00 89.10  ? 238 LYS C C   1 
ATOM   9175  O O   . LYS C 1 238 ? 127.362 162.475 121.096 1.00 89.10  ? 238 LYS C O   1 
ATOM   9176  C CB  . LYS C 1 238 ? 124.645 164.190 121.883 1.00 89.10  ? 238 LYS C CB  1 
ATOM   9177  C CG  . LYS C 1 238 ? 123.860 165.409 122.330 1.00 89.10  ? 238 LYS C CG  1 
ATOM   9178  C CD  . LYS C 1 238 ? 122.380 165.224 122.018 1.00 89.10  ? 238 LYS C CD  1 
ATOM   9179  C CE  . LYS C 1 238 ? 121.553 166.429 122.426 1.00 89.10  ? 238 LYS C CE  1 
ATOM   9180  N NZ  . LYS C 1 238 ? 121.480 166.584 123.898 1.00 89.10  ? 238 LYS C NZ  1 
ATOM   9181  N N   . THR C 1 239 ? 126.315 161.878 123.000 1.00 101.20 ? 239 THR C N   1 
ATOM   9182  C CA  . THR C 1 239 ? 126.659 160.469 122.908 1.00 101.20 ? 239 THR C CA  1 
ATOM   9183  C C   . THR C 1 239 ? 125.739 159.664 123.804 1.00 101.20 ? 239 THR C C   1 
ATOM   9184  O O   . THR C 1 239 ? 124.910 160.205 124.535 1.00 101.20 ? 239 THR C O   1 
ATOM   9185  C CB  . THR C 1 239 ? 128.095 160.187 123.321 1.00 101.20 ? 239 THR C CB  1 
ATOM   9186  O OG1 . THR C 1 239 ? 128.362 158.794 123.133 1.00 101.20 ? 239 THR C OG1 1 
ATOM   9187  C CG2 . THR C 1 239 ? 128.289 160.529 124.779 1.00 101.20 ? 239 THR C CG2 1 
ATOM   9188  N N   . ILE C 1 240 ? 125.917 158.353 123.749 1.00 104.92 ? 240 ILE C N   1 
ATOM   9189  C CA  . ILE C 1 240 ? 125.180 157.416 124.577 1.00 104.92 ? 240 ILE C CA  1 
ATOM   9190  C C   . ILE C 1 240 ? 126.204 156.648 125.387 1.00 104.92 ? 240 ILE C C   1 
ATOM   9191  O O   . ILE C 1 240 ? 127.103 156.023 124.814 1.00 104.92 ? 240 ILE C O   1 
ATOM   9192  C CB  . ILE C 1 240 ? 124.345 156.447 123.732 1.00 104.92 ? 240 ILE C CB  1 
ATOM   9193  C CG1 . ILE C 1 240 ? 123.500 157.202 122.714 1.00 104.92 ? 240 ILE C CG1 1 
ATOM   9194  C CG2 . ILE C 1 240 ? 123.468 155.611 124.617 1.00 104.92 ? 240 ILE C CG2 1 
ATOM   9195  C CD1 . ILE C 1 240 ? 122.538 158.159 123.317 1.00 104.92 ? 240 ILE C CD1 1 
ATOM   9196  N N   . ASN C 1 241 ? 126.088 156.700 126.707 1.00 104.93 ? 241 ASN C N   1 
ATOM   9197  C CA  . ASN C 1 241 ? 126.881 155.796 127.523 1.00 104.93 ? 241 ASN C CA  1 
ATOM   9198  C C   . ASN C 1 241 ? 126.362 154.387 127.311 1.00 104.93 ? 241 ASN C C   1 
ATOM   9199  O O   . ASN C 1 241 ? 125.167 154.176 127.115 1.00 104.93 ? 241 ASN C O   1 
ATOM   9200  C CB  . ASN C 1 241 ? 126.812 156.183 128.996 1.00 104.93 ? 241 ASN C CB  1 
ATOM   9201  C CG  . ASN C 1 241 ? 127.828 155.445 129.849 1.00 104.93 ? 241 ASN C CG  1 
ATOM   9202  O OD1 . ASN C 1 241 ? 128.565 154.584 129.375 1.00 104.93 ? 241 ASN C OD1 1 
ATOM   9203  N ND2 . ASN C 1 241 ? 127.880 155.799 131.121 1.00 104.93 ? 241 ASN C ND2 1 
ATOM   9204  N N   . LEU C 1 242 ? 127.265 153.424 127.313 1.00 105.57 ? 242 LEU C N   1 
ATOM   9205  C CA  . LEU C 1 242 ? 126.905 152.056 126.988 1.00 105.57 ? 242 LEU C CA  1 
ATOM   9206  C C   . LEU C 1 242 ? 127.403 151.126 128.088 1.00 105.57 ? 242 LEU C C   1 
ATOM   9207  O O   . LEU C 1 242 ? 127.868 150.011 127.853 1.00 105.57 ? 242 LEU C O   1 
ATOM   9208  C CB  . LEU C 1 242 ? 127.440 151.689 125.606 1.00 105.57 ? 242 LEU C CB  1 
ATOM   9209  C CG  . LEU C 1 242 ? 126.816 150.518 124.850 1.00 105.57 ? 242 LEU C CG  1 
ATOM   9210  C CD1 . LEU C 1 242 ? 125.361 150.811 124.650 1.00 105.57 ? 242 LEU C CD1 1 
ATOM   9211  C CD2 . LEU C 1 242 ? 127.481 150.368 123.516 1.00 105.57 ? 242 LEU C CD2 1 
ATOM   9212  N N   . GLN C 1 243 ? 127.308 151.598 129.319 1.00 110.73 ? 243 GLN C N   1 
ATOM   9213  C CA  . GLN C 1 243 ? 127.580 150.797 130.499 1.00 110.73 ? 243 GLN C CA  1 
ATOM   9214  C C   . GLN C 1 243 ? 126.277 150.490 131.222 1.00 110.73 ? 243 GLN C C   1 
ATOM   9215  O O   . GLN C 1 243 ? 126.191 150.518 132.449 1.00 110.73 ? 243 GLN C O   1 
ATOM   9216  C CB  . GLN C 1 243 ? 128.571 151.511 131.406 1.00 110.73 ? 243 GLN C CB  1 
ATOM   9217  C CG  . GLN C 1 243 ? 129.955 151.598 130.809 1.00 110.73 ? 243 GLN C CG  1 
ATOM   9218  C CD  . GLN C 1 243 ? 130.916 152.363 131.686 1.00 110.73 ? 243 GLN C CD  1 
ATOM   9219  O OE1 . GLN C 1 243 ? 130.516 152.976 132.673 1.00 110.73 ? 243 GLN C OE1 1 
ATOM   9220  N NE2 . GLN C 1 243 ? 132.197 152.308 131.350 1.00 110.73 ? 243 GLN C NE2 1 
ATOM   9221  N N   . SER C 1 244 ? 125.243 150.202 130.439 1.00 130.58 ? 244 SER C N   1 
ATOM   9222  C CA  . SER C 1 244 ? 123.897 149.956 130.926 1.00 130.58 ? 244 SER C CA  1 
ATOM   9223  C C   . SER C 1 244 ? 123.697 148.538 131.417 1.00 130.58 ? 244 SER C C   1 
ATOM   9224  O O   . SER C 1 244 ? 122.571 148.165 131.758 1.00 130.58 ? 244 SER C O   1 
ATOM   9225  C CB  . SER C 1 244 ? 122.889 150.235 129.817 1.00 130.58 ? 244 SER C CB  1 
ATOM   9226  O OG  . SER C 1 244 ? 123.014 149.280 128.778 1.00 130.58 ? 244 SER C OG  1 
ATOM   9227  N N   . LEU C 1 245 ? 124.751 147.734 131.444 1.00 135.64 ? 245 LEU C N   1 
ATOM   9228  C CA  . LEU C 1 245 ? 124.616 146.317 131.734 1.00 135.64 ? 245 LEU C CA  1 
ATOM   9229  C C   . LEU C 1 245 ? 124.721 146.011 133.217 1.00 135.64 ? 245 LEU C C   1 
ATOM   9230  O O   . LEU C 1 245 ? 123.894 145.266 133.753 1.00 135.64 ? 245 LEU C O   1 
ATOM   9231  C CB  . LEU C 1 245 ? 125.679 145.532 130.964 1.00 135.64 ? 245 LEU C CB  1 
ATOM   9232  C CG  . LEU C 1 245 ? 125.630 145.753 129.447 1.00 135.64 ? 245 LEU C CG  1 
ATOM   9233  C CD1 . LEU C 1 245 ? 126.693 144.931 128.725 1.00 135.64 ? 245 LEU C CD1 1 
ATOM   9234  C CD2 . LEU C 1 245 ? 124.247 145.484 128.889 1.00 135.64 ? 245 LEU C CD2 1 
ATOM   9235  N N   . ILE C 1 246 ? 125.715 146.587 133.894 1.00 144.22 ? 246 ILE C N   1 
ATOM   9236  C CA  . ILE C 1 246 ? 125.839 146.416 135.336 1.00 144.22 ? 246 ILE C CA  1 
ATOM   9237  C C   . ILE C 1 246 ? 124.841 147.297 136.087 1.00 144.22 ? 246 ILE C C   1 
ATOM   9238  O O   . ILE C 1 246 ? 124.535 147.027 137.255 1.00 144.22 ? 246 ILE C O   1 
ATOM   9239  C CB  . ILE C 1 246 ? 127.303 146.673 135.746 1.00 144.22 ? 246 ILE C CB  1 
ATOM   9240  C CG1 . ILE C 1 246 ? 127.614 146.111 137.141 1.00 144.22 ? 246 ILE C CG1 1 
ATOM   9241  C CG2 . ILE C 1 246 ? 127.653 148.160 135.648 1.00 144.22 ? 246 ILE C CG2 1 
ATOM   9242  C CD1 . ILE C 1 246 ? 127.558 144.605 137.230 1.00 144.22 ? 246 ILE C CD1 1 
ATOM   9243  N N   . ASN C 1 247 ? 124.304 148.334 135.442 1.00 145.02 ? 247 ASN C N   1 
ATOM   9244  C CA  . ASN C 1 247 ? 123.149 149.057 135.954 1.00 145.02 ? 247 ASN C CA  1 
ATOM   9245  C C   . ASN C 1 247 ? 121.853 148.317 135.660 1.00 145.02 ? 247 ASN C C   1 
ATOM   9246  O O   . ASN C 1 247 ? 120.850 148.550 136.345 1.00 145.02 ? 247 ASN C O   1 
ATOM   9247  C CB  . ASN C 1 247 ? 123.088 150.459 135.329 1.00 145.02 ? 247 ASN C CB  1 
ATOM   9248  C CG  . ASN C 1 247 ? 122.191 151.422 136.091 1.00 145.02 ? 247 ASN C CG  1 
ATOM   9249  O OD1 . ASN C 1 247 ? 121.663 151.103 137.151 1.00 145.02 ? 247 ASN C OD1 1 
ATOM   9250  N ND2 . ASN C 1 247 ? 122.013 152.616 135.540 1.00 145.02 ? 247 ASN C ND2 1 
ATOM   9251  N N   . ASN C 1 248 ? 121.861 147.461 134.630 1.00 151.83 ? 248 ASN C N   1 
ATOM   9252  C CA  . ASN C 1 248 ? 120.798 146.592 134.118 1.00 151.83 ? 248 ASN C CA  1 
ATOM   9253  C C   . ASN C 1 248 ? 119.665 147.387 133.459 1.00 151.83 ? 248 ASN C C   1 
ATOM   9254  O O   . ASN C 1 248 ? 118.745 146.784 132.897 1.00 151.83 ? 248 ASN C O   1 
ATOM   9255  C CB  . ASN C 1 248 ? 120.229 145.663 135.207 1.00 151.83 ? 248 ASN C CB  1 
ATOM   9256  C CG  . ASN C 1 248 ? 119.588 144.397 134.646 1.00 151.83 ? 248 ASN C CG  1 
ATOM   9257  O OD1 . ASN C 1 248 ? 119.609 144.145 133.439 1.00 151.83 ? 248 ASN C OD1 1 
ATOM   9258  N ND2 . ASN C 1 248 ? 119.016 143.592 135.531 1.00 151.83 ? 248 ASN C ND2 1 
ATOM   9259  N N   . GLU C 1 249 ? 119.700 148.721 133.489 1.00 156.84 ? 249 GLU C N   1 
ATOM   9260  C CA  . GLU C 1 249 ? 118.624 149.513 132.909 1.00 156.84 ? 249 GLU C CA  1 
ATOM   9261  C C   . GLU C 1 249 ? 119.152 150.675 132.082 1.00 156.84 ? 249 GLU C C   1 
ATOM   9262  O O   . GLU C 1 249 ? 120.361 150.786 131.854 1.00 156.84 ? 249 GLU C O   1 
ATOM   9263  C CB  . GLU C 1 249 ? 117.680 150.039 133.991 1.00 156.84 ? 249 GLU C CB  1 
ATOM   9264  C CG  . GLU C 1 249 ? 116.887 148.975 134.728 1.00 156.84 ? 249 GLU C CG  1 
ATOM   9265  C CD  . GLU C 1 249 ? 115.977 148.181 133.819 1.00 156.84 ? 249 GLU C CD  1 
ATOM   9266  O OE1 . GLU C 1 249 ? 115.441 148.750 132.842 1.00 156.84 ? 249 GLU C OE1 1 
ATOM   9267  O OE2 . GLU C 1 249 ? 115.807 146.971 134.081 1.00 156.84 ? 249 GLU C OE2 1 
ATOM   9268  N N   . ILE C 1 250 ? 118.238 151.550 131.667 1.00 154.85 ? 250 ILE C N   1 
ATOM   9269  C CA  . ILE C 1 250 ? 118.448 152.553 130.624 1.00 154.85 ? 250 ILE C CA  1 
ATOM   9270  C C   . ILE C 1 250 ? 119.493 153.581 131.043 1.00 154.85 ? 250 ILE C C   1 
ATOM   9271  O O   . ILE C 1 250 ? 119.324 154.264 132.061 1.00 154.85 ? 250 ILE C O   1 
ATOM   9272  C CB  . ILE C 1 250 ? 117.121 153.231 130.254 1.00 154.85 ? 250 ILE C CB  1 
ATOM   9273  C CG1 . ILE C 1 250 ? 116.176 152.204 129.617 1.00 154.85 ? 250 ILE C CG1 1 
ATOM   9274  C CG2 . ILE C 1 250 ? 117.359 154.422 129.333 1.00 154.85 ? 250 ILE C CG2 1 
ATOM   9275  C CD1 . ILE C 1 250 ? 114.760 152.695 129.437 1.00 154.85 ? 250 ILE C CD1 1 
ATOM   9276  N N   . PRO C 1 251 ? 120.571 153.720 130.286 1.00 138.29 ? 251 PRO C N   1 
ATOM   9277  C CA  . PRO C 1 251 ? 121.728 154.477 130.757 1.00 138.29 ? 251 PRO C CA  1 
ATOM   9278  C C   . PRO C 1 251 ? 121.516 155.973 130.584 1.00 138.29 ? 251 PRO C C   1 
ATOM   9279  O O   . PRO C 1 251 ? 120.494 156.438 130.089 1.00 138.29 ? 251 PRO C O   1 
ATOM   9280  C CB  . PRO C 1 251 ? 122.853 153.968 129.861 1.00 138.29 ? 251 PRO C CB  1 
ATOM   9281  C CG  . PRO C 1 251 ? 122.166 153.630 128.598 1.00 138.29 ? 251 PRO C CG  1 
ATOM   9282  C CD  . PRO C 1 251 ? 120.815 153.111 128.968 1.00 138.29 ? 251 PRO C CD  1 
ATOM   9283  N N   . ASP C 1 252 ? 122.523 156.721 131.010 1.00 129.96 ? 252 ASP C N   1 
ATOM   9284  C CA  . ASP C 1 252 ? 122.545 158.162 130.880 1.00 129.96 ? 252 ASP C CA  1 
ATOM   9285  C C   . ASP C 1 252 ? 122.889 158.532 129.442 1.00 129.96 ? 252 ASP C C   1 
ATOM   9286  O O   . ASP C 1 252 ? 123.329 157.698 128.652 1.00 129.96 ? 252 ASP C O   1 
ATOM   9287  C CB  . ASP C 1 252 ? 123.558 158.742 131.857 1.00 129.96 ? 252 ASP C CB  1 
ATOM   9288  C CG  . ASP C 1 252 ? 123.302 158.288 133.279 1.00 129.96 ? 252 ASP C CG  1 
ATOM   9289  O OD1 . ASP C 1 252 ? 122.137 157.970 133.595 1.00 129.96 ? 252 ASP C OD1 1 
ATOM   9290  O OD2 . ASP C 1 252 ? 124.259 158.232 134.078 1.00 129.96 ? 252 ASP C OD2 1 
ATOM   9291  N N   . CYS C 1 253 ? 122.683 159.794 129.089 1.00 121.86 ? 253 CYS C N   1 
ATOM   9292  C CA  . CYS C 1 253 ? 122.908 160.235 127.714 1.00 121.86 ? 253 CYS C CA  1 
ATOM   9293  C C   . CYS C 1 253 ? 123.544 161.619 127.747 1.00 121.86 ? 253 CYS C C   1 
ATOM   9294  O O   . CYS C 1 253 ? 122.886 162.597 128.107 1.00 121.86 ? 253 CYS C O   1 
ATOM   9295  C CB  . CYS C 1 253 ? 121.597 160.216 126.919 1.00 121.86 ? 253 CYS C CB  1 
ATOM   9296  S SG  . CYS C 1 253 ? 120.967 158.508 126.581 1.00 121.86 ? 253 CYS C SG  1 
ATOM   9297  N N   . TYR C 1 254 ? 124.816 161.701 127.359 1.00 102.05 ? 254 TYR C N   1 
ATOM   9298  C CA  . TYR C 1 254 ? 125.680 162.837 127.652 1.00 102.05 ? 254 TYR C CA  1 
ATOM   9299  C C   . TYR C 1 254 ? 125.661 163.895 126.556 1.00 102.05 ? 254 TYR C C   1 
ATOM   9300  O O   . TYR C 1 254 ? 125.078 163.725 125.487 1.00 102.05 ? 254 TYR C O   1 
ATOM   9301  C CB  . TYR C 1 254 ? 127.114 162.366 127.856 1.00 102.05 ? 254 TYR C CB  1 
ATOM   9302  C CG  . TYR C 1 254 ? 127.348 161.624 129.137 1.00 102.05 ? 254 TYR C CG  1 
ATOM   9303  C CD1 . TYR C 1 254 ? 127.694 162.297 130.290 1.00 102.05 ? 254 TYR C CD1 1 
ATOM   9304  C CD2 . TYR C 1 254 ? 127.199 160.249 129.200 1.00 102.05 ? 254 TYR C CD2 1 
ATOM   9305  C CE1 . TYR C 1 254 ? 127.913 161.622 131.458 1.00 102.05 ? 254 TYR C CE1 1 
ATOM   9306  C CE2 . TYR C 1 254 ? 127.413 159.566 130.375 1.00 102.05 ? 254 TYR C CE2 1 
ATOM   9307  C CZ  . TYR C 1 254 ? 127.763 160.264 131.501 1.00 102.05 ? 254 TYR C CZ  1 
ATOM   9308  O OH  . TYR C 1 254 ? 127.974 159.605 132.682 1.00 102.05 ? 254 TYR C OH  1 
ATOM   9309  N N   . THR C 1 255 ? 126.327 165.011 126.849 1.00 91.19  ? 255 THR C N   1 
ATOM   9310  C CA  . THR C 1 255 ? 126.533 166.094 125.890 1.00 91.19  ? 255 THR C CA  1 
ATOM   9311  C C   . THR C 1 255 ? 127.800 166.822 126.323 1.00 91.19  ? 255 THR C C   1 
ATOM   9312  O O   . THR C 1 255 ? 127.769 167.606 127.273 1.00 91.19  ? 255 THR C O   1 
ATOM   9313  C CB  . THR C 1 255 ? 125.346 167.044 125.847 1.00 91.19  ? 255 THR C CB  1 
ATOM   9314  O OG1 . THR C 1 255 ? 124.171 166.337 125.441 1.00 91.19  ? 255 THR C OG1 1 
ATOM   9315  C CG2 . THR C 1 255 ? 125.602 168.178 124.874 1.00 91.19  ? 255 THR C CG2 1 
ATOM   9316  N N   . PHE C 1 256 ? 128.902 166.561 125.637 1.00 81.09  ? 256 PHE C N   1 
ATOM   9317  C CA  . PHE C 1 256 ? 130.141 167.215 126.013 1.00 81.09  ? 256 PHE C CA  1 
ATOM   9318  C C   . PHE C 1 256 ? 130.206 168.615 125.427 1.00 81.09  ? 256 PHE C C   1 
ATOM   9319  O O   . PHE C 1 256 ? 129.510 168.945 124.469 1.00 81.09  ? 256 PHE C O   1 
ATOM   9320  C CB  . PHE C 1 256 ? 131.336 166.413 125.536 1.00 81.09  ? 256 PHE C CB  1 
ATOM   9321  C CG  . PHE C 1 256 ? 131.466 165.091 126.191 1.00 81.09  ? 256 PHE C CG  1 
ATOM   9322  C CD1 . PHE C 1 256 ? 132.003 164.984 127.451 1.00 81.09  ? 256 PHE C CD1 1 
ATOM   9323  C CD2 . PHE C 1 256 ? 131.064 163.951 125.539 1.00 81.09  ? 256 PHE C CD2 1 
ATOM   9324  C CE1 . PHE C 1 256 ? 132.125 163.764 128.048 1.00 81.09  ? 256 PHE C CE1 1 
ATOM   9325  C CE2 . PHE C 1 256 ? 131.186 162.730 126.131 1.00 81.09  ? 256 PHE C CE2 1 
ATOM   9326  C CZ  . PHE C 1 256 ? 131.717 162.635 127.384 1.00 81.09  ? 256 PHE C CZ  1 
ATOM   9327  N N   . SER C 1 257 ? 131.073 169.440 126.003 1.00 81.79  ? 257 SER C N   1 
ATOM   9328  C CA  . SER C 1 257 ? 131.258 170.811 125.532 1.00 81.79  ? 257 SER C CA  1 
ATOM   9329  C C   . SER C 1 257 ? 132.752 171.101 125.483 1.00 81.79  ? 257 SER C C   1 
ATOM   9330  O O   . SER C 1 257 ? 133.373 171.368 126.512 1.00 81.79  ? 257 SER C O   1 
ATOM   9331  C CB  . SER C 1 257 ? 130.538 171.803 126.427 1.00 81.79  ? 257 SER C CB  1 
ATOM   9332  O OG  . SER C 1 257 ? 130.744 173.121 125.958 1.00 81.79  ? 257 SER C OG  1 
ATOM   9333  N N   . VAL C 1 258 ? 133.312 171.084 124.287 1.00 77.33  ? 258 VAL C N   1 
ATOM   9334  C CA  . VAL C 1 258 ? 134.750 171.183 124.092 1.00 77.33  ? 258 VAL C CA  1 
ATOM   9335  C C   . VAL C 1 258 ? 135.133 172.646 123.927 1.00 77.33  ? 258 VAL C C   1 
ATOM   9336  O O   . VAL C 1 258 ? 134.451 173.399 123.226 1.00 77.33  ? 258 VAL C O   1 
ATOM   9337  C CB  . VAL C 1 258 ? 135.173 170.361 122.868 1.00 77.33  ? 258 VAL C CB  1 
ATOM   9338  C CG1 . VAL C 1 258 ? 136.659 170.423 122.656 1.00 77.33  ? 258 VAL C CG1 1 
ATOM   9339  C CG2 . VAL C 1 258 ? 134.708 168.941 123.022 1.00 77.33  ? 258 VAL C CG2 1 
ATOM   9340  N N   . LEU C 1 259 ? 136.210 173.058 124.586 1.00 72.85  ? 259 LEU C N   1 
ATOM   9341  C CA  . LEU C 1 259 ? 136.808 174.374 124.390 1.00 72.85  ? 259 LEU C CA  1 
ATOM   9342  C C   . LEU C 1 259 ? 138.300 174.201 124.161 1.00 72.85  ? 259 LEU C C   1 
ATOM   9343  O O   . LEU C 1 259 ? 139.049 173.930 125.101 1.00 72.85  ? 259 LEU C O   1 
ATOM   9344  C CB  . LEU C 1 259 ? 136.538 175.281 125.585 1.00 72.85  ? 259 LEU C CB  1 
ATOM   9345  C CG  . LEU C 1 259 ? 137.254 176.630 125.598 1.00 72.85  ? 259 LEU C CG  1 
ATOM   9346  C CD1 . LEU C 1 259 ? 136.940 177.432 124.375 1.00 72.85  ? 259 LEU C CD1 1 
ATOM   9347  C CD2 . LEU C 1 259 ? 136.883 177.411 126.840 1.00 72.85  ? 259 LEU C CD2 1 
ATOM   9348  N N   . ILE C 1 260 ? 138.736 174.355 122.923 1.00 72.45  ? 260 ILE C N   1 
ATOM   9349  C CA  . ILE C 1 260 ? 140.152 174.350 122.592 1.00 72.45  ? 260 ILE C CA  1 
ATOM   9350  C C   . ILE C 1 260 ? 140.641 175.784 122.639 1.00 72.45  ? 260 ILE C C   1 
ATOM   9351  O O   . ILE C 1 260 ? 140.128 176.641 121.916 1.00 72.45  ? 260 ILE C O   1 
ATOM   9352  C CB  . ILE C 1 260 ? 140.402 173.726 121.215 1.00 72.45  ? 260 ILE C CB  1 
ATOM   9353  C CG1 . ILE C 1 260 ? 140.012 172.257 121.242 1.00 72.45  ? 260 ILE C CG1 1 
ATOM   9354  C CG2 . ILE C 1 260 ? 141.845 173.889 120.823 1.00 72.45  ? 260 ILE C CG2 1 
ATOM   9355  C CD1 . ILE C 1 260 ? 139.994 171.622 119.896 1.00 72.45  ? 260 ILE C CD1 1 
ATOM   9356  N N   . THR C 1 261 ? 141.627 176.052 123.485 1.00 72.75  ? 261 THR C N   1 
ATOM   9357  C CA  . THR C 1 261 ? 142.018 177.414 123.808 1.00 72.75  ? 261 THR C CA  1 
ATOM   9358  C C   . THR C 1 261 ? 143.442 177.673 123.360 1.00 72.75  ? 261 THR C C   1 
ATOM   9359  O O   . THR C 1 261 ? 144.372 177.027 123.842 1.00 72.75  ? 261 THR C O   1 
ATOM   9360  C CB  . THR C 1 261 ? 141.906 177.666 125.306 1.00 72.75  ? 261 THR C CB  1 
ATOM   9361  O OG1 . THR C 1 261 ? 140.557 177.448 125.725 1.00 72.75  ? 261 THR C OG1 1 
ATOM   9362  C CG2 . THR C 1 261 ? 142.300 179.084 125.626 1.00 72.75  ? 261 THR C CG2 1 
ATOM   9363  N N   . PHE C 1 262 ? 143.613 178.630 122.461 1.00 68.07  ? 262 PHE C N   1 
ATOM   9364  C CA  . PHE C 1 262 ? 144.934 179.094 122.068 1.00 68.07  ? 262 PHE C CA  1 
ATOM   9365  C C   . PHE C 1 262 ? 145.236 180.398 122.794 1.00 68.07  ? 262 PHE C C   1 
ATOM   9366  O O   . PHE C 1 262 ? 145.098 181.484 122.242 1.00 68.07  ? 262 PHE C O   1 
ATOM   9367  C CB  . PHE C 1 262 ? 144.995 179.284 120.561 1.00 68.07  ? 262 PHE C CB  1 
ATOM   9368  C CG  . PHE C 1 262 ? 144.921 178.016 119.791 1.00 68.07  ? 262 PHE C CG  1 
ATOM   9369  C CD1 . PHE C 1 262 ? 146.059 177.289 119.533 1.00 68.07  ? 262 PHE C CD1 1 
ATOM   9370  C CD2 . PHE C 1 262 ? 143.714 177.542 119.340 1.00 68.07  ? 262 PHE C CD2 1 
ATOM   9371  C CE1 . PHE C 1 262 ? 145.997 176.125 118.822 1.00 68.07  ? 262 PHE C CE1 1 
ATOM   9372  C CE2 . PHE C 1 262 ? 143.643 176.373 118.633 1.00 68.07  ? 262 PHE C CE2 1 
ATOM   9373  C CZ  . PHE C 1 262 ? 144.786 175.664 118.374 1.00 68.07  ? 262 PHE C CZ  1 
ATOM   9374  N N   . ASP C 1 263 ? 145.662 180.282 124.043 1.00 75.24  ? 263 ASP C N   1 
ATOM   9375  C CA  . ASP C 1 263 ? 145.758 181.453 124.907 1.00 75.24  ? 263 ASP C CA  1 
ATOM   9376  C C   . ASP C 1 263 ? 147.075 182.185 124.724 1.00 75.24  ? 263 ASP C C   1 
ATOM   9377  O O   . ASP C 1 263 ? 148.144 181.582 124.782 1.00 75.24  ? 263 ASP C O   1 
ATOM   9378  C CB  . ASP C 1 263 ? 145.613 181.056 126.364 1.00 75.24  ? 263 ASP C CB  1 
ATOM   9379  C CG  . ASP C 1 263 ? 145.688 182.241 127.280 1.00 75.24  ? 263 ASP C CG  1 
ATOM   9380  O OD1 . ASP C 1 263 ? 144.699 182.994 127.350 1.00 75.24  ? 263 ASP C OD1 1 
ATOM   9381  O OD2 . ASP C 1 263 ? 146.743 182.437 127.915 1.00 75.24  ? 263 ASP C OD2 1 
ATOM   9382  N N   . ASN C 1 264 ? 146.999 183.498 124.537 1.00 77.23  ? 264 ASN C N   1 
ATOM   9383  C CA  . ASN C 1 264 ? 148.181 184.350 124.460 1.00 77.23  ? 264 ASN C CA  1 
ATOM   9384  C C   . ASN C 1 264 ? 147.956 185.557 125.365 1.00 77.23  ? 264 ASN C C   1 
ATOM   9385  O O   . ASN C 1 264 ? 147.632 186.647 124.903 1.00 77.23  ? 264 ASN C O   1 
ATOM   9386  C CB  . ASN C 1 264 ? 148.419 184.755 123.014 1.00 77.23  ? 264 ASN C CB  1 
ATOM   9387  C CG  . ASN C 1 264 ? 149.715 185.491 122.807 1.00 77.23  ? 264 ASN C CG  1 
ATOM   9388  O OD1 . ASN C 1 264 ? 150.501 185.694 123.731 1.00 77.23  ? 264 ASN C OD1 1 
ATOM   9389  N ND2 . ASN C 1 264 ? 149.944 185.912 121.575 1.00 77.23  ? 264 ASN C ND2 1 
ATOM   9390  N N   . LYS C 1 265 ? 148.213 185.394 126.654 1.00 78.37  ? 265 LYS C N   1 
ATOM   9391  C CA  . LYS C 1 265 ? 148.085 186.557 127.519 1.00 78.37  ? 265 LYS C CA  1 
ATOM   9392  C C   . LYS C 1 265 ? 149.399 187.291 127.675 1.00 78.37  ? 265 LYS C C   1 
ATOM   9393  O O   . LYS C 1 265 ? 149.442 188.514 127.541 1.00 78.37  ? 265 LYS C O   1 
ATOM   9394  C CB  . LYS C 1 265 ? 147.574 186.160 128.898 1.00 78.37  ? 265 LYS C CB  1 
ATOM   9395  C CG  . LYS C 1 265 ? 146.180 185.614 128.904 1.00 78.37  ? 265 LYS C CG  1 
ATOM   9396  C CD  . LYS C 1 265 ? 145.720 185.414 130.323 1.00 78.37  ? 265 LYS C CD  1 
ATOM   9397  C CE  . LYS C 1 265 ? 146.525 184.326 130.997 1.00 78.37  ? 265 LYS C CE  1 
ATOM   9398  N NZ  . LYS C 1 265 ? 146.292 183.001 130.368 1.00 78.37  ? 265 LYS C NZ  1 
ATOM   9399  N N   . ALA C 1 266 ? 150.476 186.556 127.927 1.00 80.55  ? 266 ALA C N   1 
ATOM   9400  C CA  . ALA C 1 266 ? 151.733 187.175 128.305 1.00 80.55  ? 266 ALA C CA  1 
ATOM   9401  C C   . ALA C 1 266 ? 152.428 187.878 127.151 1.00 80.55  ? 266 ALA C C   1 
ATOM   9402  O O   . ALA C 1 266 ? 153.353 188.655 127.408 1.00 80.55  ? 266 ALA C O   1 
ATOM   9403  C CB  . ALA C 1 266 ? 152.670 186.128 128.900 1.00 80.55  ? 266 ALA C CB  1 
ATOM   9404  N N   . HIS C 1 267 ? 152.001 187.623 125.909 1.00 83.28  ? 267 HIS C N   1 
ATOM   9405  C CA  . HIS C 1 267 ? 152.627 188.147 124.692 1.00 83.28  ? 267 HIS C CA  1 
ATOM   9406  C C   . HIS C 1 267 ? 154.116 187.839 124.651 1.00 83.28  ? 267 HIS C C   1 
ATOM   9407  O O   . HIS C 1 267 ? 154.942 188.668 124.270 1.00 83.28  ? 267 HIS C O   1 
ATOM   9408  C CB  . HIS C 1 267 ? 152.378 189.640 124.543 1.00 83.28  ? 267 HIS C CB  1 
ATOM   9409  C CG  . HIS C 1 267 ? 150.953 189.969 124.280 1.00 83.28  ? 267 HIS C CG  1 
ATOM   9410  N ND1 . HIS C 1 267 ? 150.383 189.836 123.035 1.00 83.28  ? 267 HIS C ND1 1 
ATOM   9411  C CD2 . HIS C 1 267 ? 149.967 190.377 125.108 1.00 83.28  ? 267 HIS C CD2 1 
ATOM   9412  C CE1 . HIS C 1 267 ? 149.110 190.177 123.102 1.00 83.28  ? 267 HIS C CE1 1 
ATOM   9413  N NE2 . HIS C 1 267 ? 148.833 190.511 124.349 1.00 83.28  ? 267 HIS C NE2 1 
ATOM   9414  N N   . SER C 1 268 ? 154.458 186.630 125.068 1.00 76.95  ? 268 SER C N   1 
ATOM   9415  C CA  . SER C 1 268 ? 155.840 186.276 125.302 1.00 76.95  ? 268 SER C CA  1 
ATOM   9416  C C   . SER C 1 268 ? 156.433 185.422 124.203 1.00 76.95  ? 268 SER C C   1 
ATOM   9417  O O   . SER C 1 268 ? 157.516 184.868 124.395 1.00 76.95  ? 268 SER C O   1 
ATOM   9418  C CB  . SER C 1 268 ? 155.965 185.548 126.639 1.00 76.95  ? 268 SER C CB  1 
ATOM   9419  O OG  . SER C 1 268 ? 155.230 184.346 126.604 1.00 76.95  ? 268 SER C OG  1 
ATOM   9420  N N   . GLY C 1 269 ? 155.776 185.308 123.059 1.00 71.90  ? 269 GLY C N   1 
ATOM   9421  C CA  . GLY C 1 269 ? 156.293 184.448 122.019 1.00 71.90  ? 269 GLY C CA  1 
ATOM   9422  C C   . GLY C 1 269 ? 156.097 182.981 122.294 1.00 71.90  ? 269 GLY C C   1 
ATOM   9423  O O   . GLY C 1 269 ? 156.879 182.161 121.815 1.00 71.90  ? 269 GLY C O   1 
ATOM   9424  N N   . ARG C 1 270 ? 155.071 182.625 123.059 1.00 64.89  ? 270 ARG C N   1 
ATOM   9425  C CA  . ARG C 1 270 ? 154.797 181.237 123.400 1.00 64.89  ? 270 ARG C CA  1 
ATOM   9426  C C   . ARG C 1 270 ? 153.317 181.093 123.688 1.00 64.89  ? 270 ARG C C   1 
ATOM   9427  O O   . ARG C 1 270 ? 152.830 181.640 124.677 1.00 64.89  ? 270 ARG C O   1 
ATOM   9428  C CB  . ARG C 1 270 ? 155.606 180.805 124.610 1.00 64.89  ? 270 ARG C CB  1 
ATOM   9429  C CG  . ARG C 1 270 ? 155.282 179.415 125.063 1.00 64.89  ? 270 ARG C CG  1 
ATOM   9430  C CD  . ARG C 1 270 ? 156.112 179.024 126.244 1.00 64.89  ? 270 ARG C CD  1 
ATOM   9431  N NE  . ARG C 1 270 ? 155.801 177.675 126.684 1.00 64.89  ? 270 ARG C NE  1 
ATOM   9432  C CZ  . ARG C 1 270 ? 154.864 177.392 127.574 1.00 64.89  ? 270 ARG C CZ  1 
ATOM   9433  N NH1 . ARG C 1 270 ? 154.150 178.366 128.114 1.00 64.89  ? 270 ARG C NH1 1 
ATOM   9434  N NH2 . ARG C 1 270 ? 154.642 176.138 127.925 1.00 64.89  ? 270 ARG C NH2 1 
ATOM   9435  N N   . ILE C 1 271 ? 152.609 180.344 122.855 1.00 58.19  ? 271 ILE C N   1 
ATOM   9436  C CA  . ILE C 1 271 ? 151.171 180.194 123.032 1.00 58.19  ? 271 ILE C CA  1 
ATOM   9437  C C   . ILE C 1 271 ? 150.851 178.806 123.564 1.00 58.19  ? 271 ILE C C   1 
ATOM   9438  O O   . ILE C 1 271 ? 151.091 177.816 122.867 1.00 58.19  ? 271 ILE C O   1 
ATOM   9439  C CB  . ILE C 1 271 ? 150.429 180.448 121.719 1.00 58.19  ? 271 ILE C CB  1 
ATOM   9440  C CG1 . ILE C 1 271 ? 150.648 181.878 121.266 1.00 58.19  ? 271 ILE C CG1 1 
ATOM   9441  C CG2 . ILE C 1 271 ? 148.965 180.211 121.891 1.00 58.19  ? 271 ILE C CG2 1 
ATOM   9442  C CD1 . ILE C 1 271 ? 150.087 182.156 119.922 1.00 58.19  ? 271 ILE C CD1 1 
ATOM   9443  N N   . PRO C 1 272 ? 150.336 178.679 124.779 1.00 59.93  ? 272 PRO C N   1 
ATOM   9444  C CA  . PRO C 1 272 ? 149.863 177.377 125.251 1.00 59.93  ? 272 PRO C CA  1 
ATOM   9445  C C   . PRO C 1 272 ? 148.609 176.934 124.524 1.00 59.93  ? 272 PRO C C   1 
ATOM   9446  O O   . PRO C 1 272 ? 147.873 177.733 123.950 1.00 59.93  ? 272 PRO C O   1 
ATOM   9447  C CB  . PRO C 1 272 ? 149.570 177.625 126.730 1.00 59.93  ? 272 PRO C CB  1 
ATOM   9448  C CG  . PRO C 1 272 ? 150.431 178.746 127.083 1.00 59.93  ? 272 PRO C CG  1 
ATOM   9449  C CD  . PRO C 1 272 ? 150.486 179.627 125.886 1.00 59.93  ? 272 PRO C CD  1 
ATOM   9450  N N   . ILE C 1 273 ? 148.373 175.628 124.550 1.00 54.48  ? 273 ILE C N   1 
ATOM   9451  C CA  . ILE C 1 273 ? 147.208 175.015 123.931 1.00 54.48  ? 273 ILE C CA  1 
ATOM   9452  C C   . ILE C 1 273 ? 146.537 174.146 124.982 1.00 54.48  ? 273 ILE C C   1 
ATOM   9453  O O   . ILE C 1 273 ? 147.218 173.412 125.701 1.00 54.48  ? 273 ILE C O   1 
ATOM   9454  C CB  . ILE C 1 273 ? 147.600 174.188 122.697 1.00 54.48  ? 273 ILE C CB  1 
ATOM   9455  C CG1 . ILE C 1 273 ? 148.176 175.085 121.617 1.00 54.48  ? 273 ILE C CG1 1 
ATOM   9456  C CG2 . ILE C 1 273 ? 146.427 173.512 122.118 1.00 54.48  ? 273 ILE C CG2 1 
ATOM   9457  C CD1 . ILE C 1 273 ? 148.752 174.333 120.467 1.00 54.48  ? 273 ILE C CD1 1 
ATOM   9458  N N   . SER C 1 274 ? 145.217 174.241 125.094 1.00 65.85  ? 274 SER C N   1 
ATOM   9459  C CA  . SER C 1 274 ? 144.488 173.590 126.168 1.00 65.85  ? 274 SER C CA  1 
ATOM   9460  C C   . SER C 1 274 ? 143.271 172.865 125.616 1.00 65.85  ? 274 SER C C   1 
ATOM   9461  O O   . SER C 1 274 ? 142.969 172.938 124.427 1.00 65.85  ? 274 SER C O   1 
ATOM   9462  C CB  . SER C 1 274 ? 144.060 174.616 127.213 1.00 65.85  ? 274 SER C CB  1 
ATOM   9463  O OG  . SER C 1 274 ? 145.193 175.256 127.764 1.00 65.85  ? 274 SER C OG  1 
ATOM   9464  N N   . LEU C 1 275 ? 142.561 172.165 126.499 1.00 73.05  ? 275 LEU C N   1 
ATOM   9465  C CA  . LEU C 1 275 ? 141.291 171.547 126.143 1.00 73.05  ? 275 LEU C CA  1 
ATOM   9466  C C   . LEU C 1 275 ? 140.465 171.355 127.407 1.00 73.05  ? 275 LEU C C   1 
ATOM   9467  O O   . LEU C 1 275 ? 141.011 171.008 128.454 1.00 73.05  ? 275 LEU C O   1 
ATOM   9468  C CB  . LEU C 1 275 ? 141.511 170.215 125.429 1.00 73.05  ? 275 LEU C CB  1 
ATOM   9469  C CG  . LEU C 1 275 ? 140.322 169.624 124.684 1.00 73.05  ? 275 LEU C CG  1 
ATOM   9470  C CD1 . LEU C 1 275 ? 140.829 168.939 123.460 1.00 73.05  ? 275 LEU C CD1 1 
ATOM   9471  C CD2 . LEU C 1 275 ? 139.555 168.625 125.513 1.00 73.05  ? 275 LEU C CD2 1 
ATOM   9472  N N   . GLU C 1 276 ? 139.155 171.573 127.307 1.00 84.95  ? 276 GLU C N   1 
ATOM   9473  C CA  . GLU C 1 276 ? 138.245 171.497 128.441 1.00 84.95  ? 276 GLU C CA  1 
ATOM   9474  C C   . GLU C 1 276 ? 136.971 170.777 128.030 1.00 84.95  ? 276 GLU C C   1 
ATOM   9475  O O   . GLU C 1 276 ? 136.567 170.829 126.869 1.00 84.95  ? 276 GLU C O   1 
ATOM   9476  C CB  . GLU C 1 276 ? 137.854 172.884 128.947 1.00 84.95  ? 276 GLU C CB  1 
ATOM   9477  C CG  . GLU C 1 276 ? 138.995 173.754 129.423 1.00 84.95  ? 276 GLU C CG  1 
ATOM   9478  C CD  . GLU C 1 276 ? 139.629 173.251 130.692 1.00 84.95  ? 276 GLU C CD  1 
ATOM   9479  O OE1 . GLU C 1 276 ? 138.909 172.681 131.540 1.00 84.95  ? 276 GLU C OE1 1 
ATOM   9480  O OE2 . GLU C 1 276 ? 140.857 173.426 130.852 1.00 84.95  ? 276 GLU C OE2 1 
ATOM   9481  N N   . THR C 1 277 ? 136.327 170.115 128.989 1.00 85.11  ? 277 THR C N   1 
ATOM   9482  C CA  . THR C 1 277 ? 134.995 169.555 128.792 1.00 85.11  ? 277 THR C CA  1 
ATOM   9483  C C   . THR C 1 277 ? 134.121 169.809 130.007 1.00 85.11  ? 277 THR C C   1 
ATOM   9484  O O   . THR C 1 277 ? 134.614 169.940 131.127 1.00 85.11  ? 277 THR C O   1 
ATOM   9485  C CB  . THR C 1 277 ? 135.002 168.054 128.572 1.00 85.11  ? 277 THR C CB  1 
ATOM   9486  O OG1 . THR C 1 277 ? 135.647 167.431 129.682 1.00 85.11  ? 277 THR C OG1 1 
ATOM   9487  C CG2 . THR C 1 277 ? 135.674 167.673 127.276 1.00 85.11  ? 277 THR C CG2 1 
ATOM   9488  N N   . GLN C 1 278 ? 132.811 169.858 129.778 1.00 91.13  ? 278 GLN C N   1 
ATOM   9489  C CA  . GLN C 1 278 ? 131.824 169.826 130.854 1.00 91.13  ? 278 GLN C CA  1 
ATOM   9490  C C   . GLN C 1 278 ? 130.731 168.864 130.424 1.00 91.13  ? 278 GLN C C   1 
ATOM   9491  O O   . GLN C 1 278 ? 129.985 169.154 129.487 1.00 91.13  ? 278 GLN C O   1 
ATOM   9492  C CB  . GLN C 1 278 ? 131.227 171.200 131.143 1.00 91.13  ? 278 GLN C CB  1 
ATOM   9493  C CG  . GLN C 1 278 ? 132.203 172.253 131.583 1.00 91.13  ? 278 GLN C CG  1 
ATOM   9494  C CD  . GLN C 1 278 ? 132.780 172.999 130.408 1.00 91.13  ? 278 GLN C CD  1 
ATOM   9495  O OE1 . GLN C 1 278 ? 132.230 172.956 129.312 1.00 91.13  ? 278 GLN C OE1 1 
ATOM   9496  N NE2 . GLN C 1 278 ? 133.884 173.698 130.627 1.00 91.13  ? 278 GLN C NE2 1 
ATOM   9497  N N   . ALA C 1 279 ? 130.627 167.728 131.100 1.00 103.20 ? 279 ALA C N   1 
ATOM   9498  C CA  . ALA C 1 279 ? 129.591 166.768 130.753 1.00 103.20 ? 279 ALA C CA  1 
ATOM   9499  C C   . ALA C 1 279 ? 128.241 167.207 131.298 1.00 103.20 ? 279 ALA C C   1 
ATOM   9500  O O   . ALA C 1 279 ? 127.892 166.888 132.437 1.00 103.20 ? 279 ALA C O   1 
ATOM   9501  C CB  . ALA C 1 279 ? 129.942 165.377 131.276 1.00 103.20 ? 279 ALA C CB  1 
ATOM   9502  N N   . HIS C 1 280 ? 127.480 167.941 130.495 1.00 108.47 ? 280 HIS C N   1 
ATOM   9503  C CA  . HIS C 1 280 ? 126.108 168.283 130.848 1.00 108.47 ? 280 HIS C CA  1 
ATOM   9504  C C   . HIS C 1 280 ? 125.210 167.076 130.609 1.00 108.47 ? 280 HIS C C   1 
ATOM   9505  O O   . HIS C 1 280 ? 124.954 166.702 129.463 1.00 108.47 ? 280 HIS C O   1 
ATOM   9506  C CB  . HIS C 1 280 ? 125.650 169.486 130.035 1.00 108.47 ? 280 HIS C CB  1 
ATOM   9507  C CG  . HIS C 1 280 ? 124.214 169.838 130.243 1.00 108.47 ? 280 HIS C CG  1 
ATOM   9508  N ND1 . HIS C 1 280 ? 123.734 170.327 131.437 1.00 108.47 ? 280 HIS C ND1 1 
ATOM   9509  C CD2 . HIS C 1 280 ? 123.157 169.796 129.400 1.00 108.47 ? 280 HIS C CD2 1 
ATOM   9510  C CE1 . HIS C 1 280 ? 122.437 170.551 131.328 1.00 108.47 ? 280 HIS C CE1 1 
ATOM   9511  N NE2 . HIS C 1 280 ? 122.062 170.234 130.103 1.00 108.47 ? 280 HIS C NE2 1 
ATOM   9512  N N   . ILE C 1 281 ? 124.726 166.465 131.682 1.00 108.32 ? 281 ILE C N   1 
ATOM   9513  C CA  . ILE C 1 281 ? 123.996 165.209 131.603 1.00 108.32 ? 281 ILE C CA  1 
ATOM   9514  C C   . ILE C 1 281 ? 122.511 165.507 131.707 1.00 108.32 ? 281 ILE C C   1 
ATOM   9515  O O   . ILE C 1 281 ? 122.097 166.355 132.507 1.00 108.32 ? 281 ILE C O   1 
ATOM   9516  C CB  . ILE C 1 281 ? 124.415 164.255 132.726 1.00 108.32 ? 281 ILE C CB  1 
ATOM   9517  C CG1 . ILE C 1 281 ? 125.918 164.197 132.836 1.00 108.32 ? 281 ILE C CG1 1 
ATOM   9518  C CG2 . ILE C 1 281 ? 123.938 162.863 132.430 1.00 108.32 ? 281 ILE C CG2 1 
ATOM   9519  C CD1 . ILE C 1 281 ? 126.373 163.495 134.086 1.00 108.32 ? 281 ILE C CD1 1 
ATOM   9520  N N   . GLN C 1 282 ? 121.713 164.827 130.887 1.00 115.34 ? 282 GLN C N   1 
ATOM   9521  C CA  . GLN C 1 282 ? 120.282 164.705 131.115 1.00 115.34 ? 282 GLN C CA  1 
ATOM   9522  C C   . GLN C 1 282 ? 119.820 163.404 130.485 1.00 115.34 ? 282 GLN C C   1 
ATOM   9523  O O   . GLN C 1 282 ? 120.554 162.762 129.735 1.00 115.34 ? 282 GLN C O   1 
ATOM   9524  C CB  . GLN C 1 282 ? 119.488 165.891 130.559 1.00 115.34 ? 282 GLN C CB  1 
ATOM   9525  C CG  . GLN C 1 282 ? 119.487 166.020 129.057 1.00 115.34 ? 282 GLN C CG  1 
ATOM   9526  C CD  . GLN C 1 282 ? 120.604 166.909 128.564 1.00 115.34 ? 282 GLN C CD  1 
ATOM   9527  O OE1 . GLN C 1 282 ? 121.548 167.189 129.291 1.00 115.34 ? 282 GLN C OE1 1 
ATOM   9528  N NE2 . GLN C 1 282 ? 120.496 167.371 127.326 1.00 115.34 ? 282 GLN C NE2 1 
ATOM   9529  N N   . GLU C 1 283 ? 118.598 163.009 130.812 1.00 129.45 ? 283 GLU C N   1 
ATOM   9530  C CA  . GLU C 1 283 ? 118.060 161.774 130.272 1.00 129.45 ? 283 GLU C CA  1 
ATOM   9531  C C   . GLU C 1 283 ? 117.677 161.960 128.816 1.00 129.45 ? 283 GLU C C   1 
ATOM   9532  O O   . GLU C 1 283 ? 117.372 163.066 128.366 1.00 129.45 ? 283 GLU C O   1 
ATOM   9533  C CB  . GLU C 1 283 ? 116.842 161.308 131.066 1.00 129.45 ? 283 GLU C CB  1 
ATOM   9534  C CG  . GLU C 1 283 ? 117.152 160.806 132.464 1.00 129.45 ? 283 GLU C CG  1 
ATOM   9535  C CD  . GLU C 1 283 ? 115.908 160.358 133.216 1.00 129.45 ? 283 GLU C CD  1 
ATOM   9536  O OE1 . GLU C 1 283 ? 114.792 160.535 132.685 1.00 129.45 ? 283 GLU C OE1 1 
ATOM   9537  O OE2 . GLU C 1 283 ? 116.045 159.835 134.341 1.00 129.45 ? 283 GLU C OE2 1 
ATOM   9538  N N   . CYS C 1 284 ? 117.697 160.859 128.082 1.00 140.67 ? 284 CYS C N   1 
ATOM   9539  C CA  . CYS C 1 284 ? 117.395 160.843 126.662 1.00 140.67 ? 284 CYS C CA  1 
ATOM   9540  C C   . CYS C 1 284 ? 116.033 160.210 126.409 1.00 140.67 ? 284 CYS C C   1 
ATOM   9541  O O   . CYS C 1 284 ? 115.470 159.529 127.268 1.00 140.67 ? 284 CYS C O   1 
ATOM   9542  C CB  . CYS C 1 284 ? 118.506 160.117 125.903 1.00 140.67 ? 284 CYS C CB  1 
ATOM   9543  S SG  . CYS C 1 284 ? 118.941 158.538 126.615 1.00 140.67 ? 284 CYS C SG  1 
ATOM   9544  N N   . LYS C 1 285 ? 115.515 160.450 125.205 1.00 144.38 ? 285 LYS C N   1 
ATOM   9545  C CA  . LYS C 1 285 ? 114.119 160.163 124.895 1.00 144.38 ? 285 LYS C CA  1 
ATOM   9546  C C   . LYS C 1 285 ? 113.859 158.664 124.771 1.00 144.38 ? 285 LYS C C   1 
ATOM   9547  O O   . LYS C 1 285 ? 114.622 157.937 124.132 1.00 144.38 ? 285 LYS C O   1 
ATOM   9548  C CB  . LYS C 1 285 ? 113.724 160.869 123.597 1.00 144.38 ? 285 LYS C CB  1 
ATOM   9549  C CG  . LYS C 1 285 ? 112.270 160.684 123.197 1.00 144.38 ? 285 LYS C CG  1 
ATOM   9550  C CD  . LYS C 1 285 ? 111.945 161.378 121.892 1.00 144.38 ? 285 LYS C CD  1 
ATOM   9551  C CE  . LYS C 1 285 ? 110.514 161.091 121.476 1.00 144.38 ? 285 LYS C CE  1 
ATOM   9552  N NZ  . LYS C 1 285 ? 110.182 161.713 120.169 1.00 144.38 ? 285 LYS C NZ  1 
ATOM   9553  N N   . HIS C 1 286 ? 112.761 158.206 125.388 1.00 153.98 ? 286 HIS C N   1 
ATOM   9554  C CA  . HIS C 1 286 ? 112.334 156.812 125.345 1.00 153.98 ? 286 HIS C CA  1 
ATOM   9555  C C   . HIS C 1 286 ? 110.860 156.692 125.726 1.00 153.98 ? 286 HIS C C   1 
ATOM   9556  O O   . HIS C 1 286 ? 110.391 157.413 126.616 1.00 153.98 ? 286 HIS C O   1 
ATOM   9557  C CB  . HIS C 1 286 ? 113.180 155.963 126.293 1.00 153.98 ? 286 HIS C CB  1 
ATOM   9558  C CG  . HIS C 1 286 ? 113.047 156.369 127.722 1.00 153.98 ? 286 HIS C CG  1 
ATOM   9559  N ND1 . HIS C 1 286 ? 112.065 155.868 128.547 1.00 153.98 ? 286 HIS C ND1 1 
ATOM   9560  C CD2 . HIS C 1 286 ? 113.743 157.260 128.463 1.00 153.98 ? 286 HIS C CD2 1 
ATOM   9561  C CE1 . HIS C 1 286 ? 112.175 156.418 129.742 1.00 153.98 ? 286 HIS C CE1 1 
ATOM   9562  N NE2 . HIS C 1 286 ? 113.187 157.266 129.718 1.00 153.98 ? 286 HIS C NE2 1 
ATOM   9563  N N   . PRO C 1 287 ? 110.096 155.833 125.060 1.00 162.26 ? 287 PRO C N   1 
ATOM   9564  C CA  . PRO C 1 287 ? 108.786 155.408 125.602 1.00 162.26 ? 287 PRO C CA  1 
ATOM   9565  C C   . PRO C 1 287 ? 108.819 154.099 126.382 1.00 162.26 ? 287 PRO C C   1 
ATOM   9566  O O   . PRO C 1 287 ? 107.743 153.593 126.717 1.00 162.26 ? 287 PRO C O   1 
ATOM   9567  C CB  . PRO C 1 287 ? 107.952 155.246 124.329 1.00 162.26 ? 287 PRO C CB  1 
ATOM   9568  C CG  . PRO C 1 287 ? 108.924 154.830 123.311 1.00 162.26 ? 287 PRO C CG  1 
ATOM   9569  C CD  . PRO C 1 287 ? 110.210 155.543 123.624 1.00 162.26 ? 287 PRO C CD  1 
ATOM   9570  N N   . SER C 1 288 ? 109.996 153.547 126.672 1.00 167.73 ? 288 SER C N   1 
ATOM   9571  C CA  . SER C 1 288 ? 110.116 152.226 127.267 1.00 167.73 ? 288 SER C CA  1 
ATOM   9572  C C   . SER C 1 288 ? 109.966 152.296 128.790 1.00 167.73 ? 288 SER C C   1 
ATOM   9573  O O   . SER C 1 288 ? 109.996 153.367 129.400 1.00 167.73 ? 288 SER C O   1 
ATOM   9574  C CB  . SER C 1 288 ? 111.448 151.588 126.869 1.00 167.73 ? 288 SER C CB  1 
ATOM   9575  O OG  . SER C 1 288 ? 111.600 150.291 127.425 1.00 167.73 ? 288 SER C OG  1 
ATOM   9576  N N   . VAL C 1 289 ? 109.813 151.123 129.409 1.00 179.04 ? 289 VAL C N   1 
ATOM   9577  C CA  . VAL C 1 289 ? 109.430 150.965 130.808 1.00 179.04 ? 289 VAL C CA  1 
ATOM   9578  C C   . VAL C 1 289 ? 110.304 149.853 131.397 1.00 179.04 ? 289 VAL C C   1 
ATOM   9579  O O   . VAL C 1 289 ? 111.280 149.433 130.768 1.00 179.04 ? 289 VAL C O   1 
ATOM   9580  C CB  . VAL C 1 289 ? 107.903 150.703 130.937 1.00 179.04 ? 289 VAL C CB  1 
ATOM   9581  C CG1 . VAL C 1 289 ? 107.496 149.284 130.503 1.00 179.04 ? 289 VAL C CG1 1 
ATOM   9582  C CG2 . VAL C 1 289 ? 107.287 151.182 132.285 1.00 179.04 ? 289 VAL C CG2 1 
ATOM   9583  N N   . PHE C 1 290 ? 109.998 149.437 132.647 1.00 174.16 ? 290 PHE C N   1 
ATOM   9584  C CA  . PHE C 1 290 ? 110.657 148.411 133.489 1.00 174.16 ? 290 PHE C CA  1 
ATOM   9585  C C   . PHE C 1 290 ? 111.967 148.879 134.105 1.00 174.16 ? 290 PHE C C   1 
ATOM   9586  O O   . PHE C 1 290 ? 112.782 148.040 134.504 1.00 174.16 ? 290 PHE C O   1 
ATOM   9587  C CB  . PHE C 1 290 ? 110.943 147.073 132.784 1.00 174.16 ? 290 PHE C CB  1 
ATOM   9588  C CG  . PHE C 1 290 ? 109.730 146.244 132.491 1.00 174.16 ? 290 PHE C CG  1 
ATOM   9589  C CD1 . PHE C 1 290 ? 109.143 145.476 133.484 1.00 174.16 ? 290 PHE C CD1 1 
ATOM   9590  C CD2 . PHE C 1 290 ? 109.211 146.187 131.209 1.00 174.16 ? 290 PHE C CD2 1 
ATOM   9591  C CE1 . PHE C 1 290 ? 108.035 144.692 133.210 1.00 174.16 ? 290 PHE C CE1 1 
ATOM   9592  C CE2 . PHE C 1 290 ? 108.104 145.409 130.927 1.00 174.16 ? 290 PHE C CE2 1 
ATOM   9593  C CZ  . PHE C 1 290 ? 107.517 144.661 131.928 1.00 174.16 ? 290 PHE C CZ  1 
ATOM   9594  N N   . GLN C 1 291 ? 112.200 150.186 134.226 1.00 168.15 ? 291 GLN C N   1 
ATOM   9595  C CA  . GLN C 1 291 ? 113.492 150.639 134.732 1.00 168.15 ? 291 GLN C CA  1 
ATOM   9596  C C   . GLN C 1 291 ? 113.558 150.580 136.254 1.00 168.15 ? 291 GLN C C   1 
ATOM   9597  O O   . GLN C 1 291 ? 114.557 150.122 136.820 1.00 168.15 ? 291 GLN C O   1 
ATOM   9598  C CB  . GLN C 1 291 ? 113.799 152.051 134.221 1.00 168.15 ? 291 GLN C CB  1 
ATOM   9599  C CG  . GLN C 1 291 ? 115.155 152.581 134.675 1.00 168.15 ? 291 GLN C CG  1 
ATOM   9600  C CD  . GLN C 1 291 ? 115.567 153.851 133.967 1.00 168.15 ? 291 GLN C CD  1 
ATOM   9601  O OE1 . GLN C 1 291 ? 114.847 154.359 133.107 1.00 168.15 ? 291 GLN C OE1 1 
ATOM   9602  N NE2 . GLN C 1 291 ? 116.734 154.373 134.325 1.00 168.15 ? 291 GLN C NE2 1 
ATOM   9603  N N   . HIS C 1 292 ? 112.494 150.996 136.933 1.00 173.17 ? 292 HIS C N   1 
ATOM   9604  C CA  . HIS C 1 292 ? 112.537 151.172 138.384 1.00 173.17 ? 292 HIS C CA  1 
ATOM   9605  C C   . HIS C 1 292 ? 112.023 149.962 139.150 1.00 173.17 ? 292 HIS C C   1 
ATOM   9606  O O   . HIS C 1 292 ? 111.399 150.112 140.205 1.00 173.17 ? 292 HIS C O   1 
ATOM   9607  C CB  . HIS C 1 292 ? 111.764 152.428 138.768 1.00 173.17 ? 292 HIS C CB  1 
ATOM   9608  C CG  . HIS C 1 292 ? 112.415 153.697 138.315 1.00 173.17 ? 292 HIS C CG  1 
ATOM   9609  N ND1 . HIS C 1 292 ? 112.164 154.267 137.086 1.00 173.17 ? 292 HIS C ND1 1 
ATOM   9610  C CD2 . HIS C 1 292 ? 113.315 154.503 138.927 1.00 173.17 ? 292 HIS C CD2 1 
ATOM   9611  C CE1 . HIS C 1 292 ? 112.877 155.372 136.962 1.00 173.17 ? 292 HIS C CE1 1 
ATOM   9612  N NE2 . HIS C 1 292 ? 113.585 155.537 138.064 1.00 173.17 ? 292 HIS C NE2 1 
ATOM   9613  N N   . GLY C 1 293 ? 112.259 148.750 138.643 1.00 173.70 ? 293 GLY C N   1 
ATOM   9614  C CA  . GLY C 1 293 ? 111.984 147.563 139.435 1.00 173.70 ? 293 GLY C CA  1 
ATOM   9615  C C   . GLY C 1 293 ? 112.935 147.410 140.604 1.00 173.70 ? 293 GLY C C   1 
ATOM   9616  O O   . GLY C 1 293 ? 112.572 146.842 141.638 1.00 173.70 ? 293 GLY C O   1 
ATOM   9617  N N   . ASP C 1 294 ? 114.160 147.915 140.458 1.00 171.97 ? 294 ASP C N   1 
ATOM   9618  C CA  . ASP C 1 294 ? 115.136 147.966 141.534 1.00 171.97 ? 294 ASP C CA  1 
ATOM   9619  C C   . ASP C 1 294 ? 115.686 149.360 141.783 1.00 171.97 ? 294 ASP C C   1 
ATOM   9620  O O   . ASP C 1 294 ? 116.322 149.576 142.820 1.00 171.97 ? 294 ASP C O   1 
ATOM   9621  C CB  . ASP C 1 294 ? 116.317 147.030 141.236 1.00 171.97 ? 294 ASP C CB  1 
ATOM   9622  C CG  . ASP C 1 294 ? 115.924 145.571 141.245 1.00 171.97 ? 294 ASP C CG  1 
ATOM   9623  O OD1 . ASP C 1 294 ? 114.979 145.209 141.976 1.00 171.97 ? 294 ASP C OD1 1 
ATOM   9624  O OD2 . ASP C 1 294 ? 116.566 144.785 140.520 1.00 171.97 ? 294 ASP C OD2 1 
ATOM   9625  N N   . ASN C 1 295 ? 115.471 150.302 140.862 1.00 167.57 ? 295 ASN C N   1 
ATOM   9626  C CA  . ASN C 1 295 ? 116.070 151.626 140.963 1.00 167.57 ? 295 ASN C CA  1 
ATOM   9627  C C   . ASN C 1 295 ? 115.395 152.476 142.029 1.00 167.57 ? 295 ASN C C   1 
ATOM   9628  O O   . ASN C 1 295 ? 116.069 153.276 142.686 1.00 167.57 ? 295 ASN C O   1 
ATOM   9629  C CB  . ASN C 1 295 ? 116.001 152.317 139.600 1.00 167.57 ? 295 ASN C CB  1 
ATOM   9630  C CG  . ASN C 1 295 ? 116.944 153.503 139.482 1.00 167.57 ? 295 ASN C CG  1 
ATOM   9631  O OD1 . ASN C 1 295 ? 117.682 153.835 140.409 1.00 167.57 ? 295 ASN C OD1 1 
ATOM   9632  N ND2 . ASN C 1 295 ? 116.929 154.143 138.320 1.00 167.57 ? 295 ASN C ND2 1 
ATOM   9633  N N   . SER C 1 296 ? 114.087 152.300 142.235 1.00 158.98 ? 296 SER C N   1 
ATOM   9634  C CA  . SER C 1 296 ? 113.406 153.002 143.316 1.00 158.98 ? 296 SER C CA  1 
ATOM   9635  C C   . SER C 1 296 ? 113.788 152.462 144.692 1.00 158.98 ? 296 SER C C   1 
ATOM   9636  O O   . SER C 1 296 ? 113.546 153.141 145.696 1.00 158.98 ? 296 SER C O   1 
ATOM   9637  C CB  . SER C 1 296 ? 111.892 152.934 143.115 1.00 158.98 ? 296 SER C CB  1 
ATOM   9638  O OG  . SER C 1 296 ? 111.426 151.603 143.214 1.00 158.98 ? 296 SER C OG  1 
ATOM   9639  N N   . PHE C 1 297 ? 114.401 151.274 144.762 1.00 157.61 ? 297 PHE C N   1 
ATOM   9640  C CA  . PHE C 1 297 ? 114.995 150.779 146.001 1.00 157.61 ? 297 PHE C CA  1 
ATOM   9641  C C   . PHE C 1 297 ? 116.304 151.477 146.353 1.00 157.61 ? 297 PHE C C   1 
ATOM   9642  O O   . PHE C 1 297 ? 116.873 151.193 147.414 1.00 157.61 ? 297 PHE C O   1 
ATOM   9643  C CB  . PHE C 1 297 ? 115.221 149.264 145.934 1.00 157.61 ? 297 PHE C CB  1 
ATOM   9644  C CG  . PHE C 1 297 ? 113.954 148.457 146.006 1.00 157.61 ? 297 PHE C CG  1 
ATOM   9645  C CD1 . PHE C 1 297 ? 113.304 148.276 147.217 1.00 157.61 ? 297 PHE C CD1 1 
ATOM   9646  C CD2 . PHE C 1 297 ? 113.426 147.865 144.871 1.00 157.61 ? 297 PHE C CD2 1 
ATOM   9647  C CE1 . PHE C 1 297 ? 112.142 147.537 147.292 1.00 157.61 ? 297 PHE C CE1 1 
ATOM   9648  C CE2 . PHE C 1 297 ? 112.263 147.119 144.938 1.00 157.61 ? 297 PHE C CE2 1 
ATOM   9649  C CZ  . PHE C 1 297 ? 111.622 146.957 146.152 1.00 157.61 ? 297 PHE C CZ  1 
ATOM   9650  N N   . ARG C 1 298 ? 116.807 152.356 145.491 1.00 145.48 ? 298 ARG C N   1 
ATOM   9651  C CA  . ARG C 1 298 ? 117.772 153.361 145.903 1.00 145.48 ? 298 ARG C CA  1 
ATOM   9652  C C   . ARG C 1 298 ? 117.106 154.702 146.159 1.00 145.48 ? 298 ARG C C   1 
ATOM   9653  O O   . ARG C 1 298 ? 117.495 155.419 147.085 1.00 145.48 ? 298 ARG C O   1 
ATOM   9654  C CB  . ARG C 1 298 ? 118.861 153.540 144.842 1.00 145.48 ? 298 ARG C CB  1 
ATOM   9655  C CG  . ARG C 1 298 ? 120.046 154.332 145.356 1.00 145.48 ? 298 ARG C CG  1 
ATOM   9656  C CD  . ARG C 1 298 ? 121.038 154.696 144.279 1.00 145.48 ? 298 ARG C CD  1 
ATOM   9657  N NE  . ARG C 1 298 ? 120.502 155.727 143.402 1.00 145.48 ? 298 ARG C NE  1 
ATOM   9658  C CZ  . ARG C 1 298 ? 121.137 156.201 142.340 1.00 145.48 ? 298 ARG C CZ  1 
ATOM   9659  N NH1 . ARG C 1 298 ? 122.341 155.745 142.030 1.00 145.48 ? 298 ARG C NH1 1 
ATOM   9660  N NH2 . ARG C 1 298 ? 120.574 157.139 141.597 1.00 145.48 ? 298 ARG C NH2 1 
ATOM   9661  N N   . LEU C 1 299 ? 116.083 155.033 145.365 1.00 142.08 ? 299 LEU C N   1 
ATOM   9662  C CA  . LEU C 1 299 ? 115.405 156.320 145.455 1.00 142.08 ? 299 LEU C CA  1 
ATOM   9663  C C   . LEU C 1 299 ? 114.642 156.483 146.755 1.00 142.08 ? 299 LEU C C   1 
ATOM   9664  O O   . LEU C 1 299 ? 114.369 157.614 147.162 1.00 142.08 ? 299 LEU C O   1 
ATOM   9665  C CB  . LEU C 1 299 ? 114.429 156.479 144.291 1.00 142.08 ? 299 LEU C CB  1 
ATOM   9666  C CG  . LEU C 1 299 ? 115.002 156.455 142.874 1.00 142.08 ? 299 LEU C CG  1 
ATOM   9667  C CD1 . LEU C 1 299 ? 113.885 156.462 141.841 1.00 142.08 ? 299 LEU C CD1 1 
ATOM   9668  C CD2 . LEU C 1 299 ? 115.947 157.621 142.666 1.00 142.08 ? 299 LEU C CD2 1 
ATOM   9669  N N   . LEU C 1 300 ? 114.268 155.384 147.391 1.00 134.62 ? 300 LEU C N   1 
ATOM   9670  C CA  . LEU C 1 300 ? 113.594 155.399 148.679 1.00 134.62 ? 300 LEU C CA  1 
ATOM   9671  C C   . LEU C 1 300 ? 114.456 154.747 149.748 1.00 134.62 ? 300 LEU C C   1 
ATOM   9672  O O   . LEU C 1 300 ? 113.950 154.094 150.660 1.00 134.62 ? 300 LEU C O   1 
ATOM   9673  C CB  . LEU C 1 300 ? 112.235 154.710 148.593 1.00 134.62 ? 300 LEU C CB  1 
ATOM   9674  C CG  . LEU C 1 300 ? 111.147 155.418 147.781 1.00 134.62 ? 300 LEU C CG  1 
ATOM   9675  C CD1 . LEU C 1 300 ? 109.918 154.539 147.632 1.00 134.62 ? 300 LEU C CD1 1 
ATOM   9676  C CD2 . LEU C 1 300 ? 110.777 156.729 148.442 1.00 134.62 ? 300 LEU C CD2 1 
ATOM   9677  N N   . PHE C 1 301 ? 115.774 154.889 149.631 1.00 129.64 ? 301 PHE C N   1 
ATOM   9678  C CA  . PHE C 1 301 ? 116.654 154.586 150.748 1.00 129.64 ? 301 PHE C CA  1 
ATOM   9679  C C   . PHE C 1 301 ? 117.091 155.822 151.499 1.00 129.64 ? 301 PHE C C   1 
ATOM   9680  O O   . PHE C 1 301 ? 117.232 155.771 152.716 1.00 129.64 ? 301 PHE C O   1 
ATOM   9681  C CB  . PHE C 1 301 ? 117.912 153.840 150.294 1.00 129.64 ? 301 PHE C CB  1 
ATOM   9682  C CG  . PHE C 1 301 ? 118.802 153.434 151.436 1.00 129.64 ? 301 PHE C CG  1 
ATOM   9683  C CD1 . PHE C 1 301 ? 118.456 152.364 152.238 1.00 129.64 ? 301 PHE C CD1 1 
ATOM   9684  C CD2 . PHE C 1 301 ? 119.959 154.136 151.729 1.00 129.64 ? 301 PHE C CD2 1 
ATOM   9685  C CE1 . PHE C 1 301 ? 119.252 151.990 153.297 1.00 129.64 ? 301 PHE C CE1 1 
ATOM   9686  C CE2 . PHE C 1 301 ? 120.752 153.768 152.790 1.00 129.64 ? 301 PHE C CE2 1 
ATOM   9687  C CZ  . PHE C 1 301 ? 120.400 152.692 153.572 1.00 129.64 ? 301 PHE C CZ  1 
ATOM   9688  N N   . ASP C 1 302 ? 117.312 156.927 150.797 1.00 135.11 ? 302 ASP C N   1 
ATOM   9689  C CA  . ASP C 1 302 ? 117.662 158.173 151.455 1.00 135.11 ? 302 ASP C CA  1 
ATOM   9690  C C   . ASP C 1 302 ? 116.545 158.703 152.339 1.00 135.11 ? 302 ASP C C   1 
ATOM   9691  O O   . ASP C 1 302 ? 116.821 159.490 153.242 1.00 135.11 ? 302 ASP C O   1 
ATOM   9692  C CB  . ASP C 1 302 ? 118.045 159.202 150.402 1.00 135.11 ? 302 ASP C CB  1 
ATOM   9693  C CG  . ASP C 1 302 ? 117.014 159.305 149.301 1.00 135.11 ? 302 ASP C CG  1 
ATOM   9694  O OD1 . ASP C 1 302 ? 116.049 158.511 149.315 1.00 135.11 ? 302 ASP C OD1 1 
ATOM   9695  O OD2 . ASP C 1 302 ? 117.171 160.168 148.411 1.00 135.11 ? 302 ASP C OD2 1 
ATOM   9696  N N   . VAL C 1 303 ? 115.299 158.277 152.112 1.00 129.37 ? 303 VAL C N   1 
ATOM   9697  C CA  . VAL C 1 303 ? 114.215 158.640 153.014 1.00 129.37 ? 303 VAL C CA  1 
ATOM   9698  C C   . VAL C 1 303 ? 114.400 158.002 154.380 1.00 129.37 ? 303 VAL C C   1 
ATOM   9699  O O   . VAL C 1 303 ? 113.913 158.539 155.377 1.00 129.37 ? 303 VAL C O   1 
ATOM   9700  C CB  . VAL C 1 303 ? 112.845 158.271 152.412 1.00 129.37 ? 303 VAL C CB  1 
ATOM   9701  C CG1 . VAL C 1 303 ? 112.597 159.055 151.138 1.00 129.37 ? 303 VAL C CG1 1 
ATOM   9702  C CG2 . VAL C 1 303 ? 112.754 156.792 152.126 1.00 129.37 ? 303 VAL C CG2 1 
ATOM   9703  N N   . VAL C 1 304 ? 115.113 156.879 154.453 1.00 129.07 ? 304 VAL C N   1 
ATOM   9704  C CA  . VAL C 1 304 ? 115.492 156.334 155.744 1.00 129.07 ? 304 VAL C CA  1 
ATOM   9705  C C   . VAL C 1 304 ? 116.553 157.215 156.383 1.00 129.07 ? 304 VAL C C   1 
ATOM   9706  O O   . VAL C 1 304 ? 116.538 157.428 157.599 1.00 129.07 ? 304 VAL C O   1 
ATOM   9707  C CB  . VAL C 1 304 ? 115.974 154.885 155.574 1.00 129.07 ? 304 VAL C CB  1 
ATOM   9708  C CG1 . VAL C 1 304 ? 116.254 154.227 156.915 1.00 129.07 ? 304 VAL C CG1 1 
ATOM   9709  C CG2 . VAL C 1 304 ? 114.980 154.090 154.744 1.00 129.07 ? 304 VAL C CG2 1 
ATOM   9710  N N   . VAL C 1 305 ? 117.469 157.756 155.577 1.00 129.77 ? 305 VAL C N   1 
ATOM   9711  C CA  . VAL C 1 305 ? 118.429 158.728 156.084 1.00 129.77 ? 305 VAL C CA  1 
ATOM   9712  C C   . VAL C 1 305 ? 117.705 159.999 156.488 1.00 129.77 ? 305 VAL C C   1 
ATOM   9713  O O   . VAL C 1 305 ? 118.068 160.644 157.479 1.00 129.77 ? 305 VAL C O   1 
ATOM   9714  C CB  . VAL C 1 305 ? 119.508 159.014 155.024 1.00 129.77 ? 305 VAL C CB  1 
ATOM   9715  C CG1 . VAL C 1 305 ? 120.592 159.923 155.569 1.00 129.77 ? 305 VAL C CG1 1 
ATOM   9716  C CG2 . VAL C 1 305 ? 120.086 157.735 154.476 1.00 129.77 ? 305 VAL C CG2 1 
ATOM   9717  N N   . ILE C 1 306 ? 116.656 160.360 155.746 1.00 130.47 ? 306 ILE C N   1 
ATOM   9718  C CA  . ILE C 1 306 ? 115.812 161.489 156.121 1.00 130.47 ? 306 ILE C CA  1 
ATOM   9719  C C   . ILE C 1 306 ? 115.100 161.211 157.442 1.00 130.47 ? 306 ILE C C   1 
ATOM   9720  O O   . ILE C 1 306 ? 114.967 162.103 158.285 1.00 130.47 ? 306 ILE C O   1 
ATOM   9721  C CB  . ILE C 1 306 ? 114.825 161.810 154.980 1.00 130.47 ? 306 ILE C CB  1 
ATOM   9722  C CG1 . ILE C 1 306 ? 115.569 162.383 153.780 1.00 130.47 ? 306 ILE C CG1 1 
ATOM   9723  C CG2 . ILE C 1 306 ? 113.753 162.811 155.399 1.00 130.47 ? 306 ILE C CG2 1 
ATOM   9724  C CD1 . ILE C 1 306 ? 114.718 162.476 152.547 1.00 130.47 ? 306 ILE C CD1 1 
ATOM   9725  N N   . LEU C 1 307 ? 114.682 159.964 157.671 1.00 126.91 ? 307 LEU C N   1 
ATOM   9726  C CA  . LEU C 1 307 ? 114.006 159.642 158.925 1.00 126.91 ? 307 LEU C CA  1 
ATOM   9727  C C   . LEU C 1 307 ? 114.971 159.638 160.103 1.00 126.91 ? 307 LEU C C   1 
ATOM   9728  O O   . LEU C 1 307 ? 114.788 160.387 161.070 1.00 126.91 ? 307 LEU C O   1 
ATOM   9729  C CB  . LEU C 1 307 ? 113.296 158.290 158.829 1.00 126.91 ? 307 LEU C CB  1 
ATOM   9730  C CG  . LEU C 1 307 ? 112.003 158.216 158.025 1.00 126.91 ? 307 LEU C CG  1 
ATOM   9731  C CD1 . LEU C 1 307 ? 111.523 156.783 157.941 1.00 126.91 ? 307 LEU C CD1 1 
ATOM   9732  C CD2 . LEU C 1 307 ? 110.949 159.096 158.661 1.00 126.91 ? 307 LEU C CD2 1 
ATOM   9733  N N   . THR C 1 308 ? 116.009 158.803 160.032 1.00 126.79 ? 308 THR C N   1 
ATOM   9734  C CA  . THR C 1 308 ? 116.778 158.459 161.223 1.00 126.79 ? 308 THR C CA  1 
ATOM   9735  C C   . THR C 1 308 ? 117.615 159.615 161.729 1.00 126.79 ? 308 THR C C   1 
ATOM   9736  O O   . THR C 1 308 ? 117.743 159.794 162.943 1.00 126.79 ? 308 THR C O   1 
ATOM   9737  C CB  . THR C 1 308 ? 117.688 157.273 160.941 1.00 126.79 ? 308 THR C CB  1 
ATOM   9738  O OG1 . THR C 1 308 ? 118.582 157.609 159.874 1.00 126.79 ? 308 THR C OG1 1 
ATOM   9739  C CG2 . THR C 1 308 ? 116.866 156.051 160.565 1.00 126.79 ? 308 THR C CG2 1 
ATOM   9740  N N   . CYS C 1 309 ? 118.187 160.402 160.828 1.00 125.93 ? 309 CYS C N   1 
ATOM   9741  C CA  . CYS C 1 309 ? 118.960 161.547 161.276 1.00 125.93 ? 309 CYS C CA  1 
ATOM   9742  C C   . CYS C 1 309 ? 118.055 162.631 161.839 1.00 125.93 ? 309 CYS C C   1 
ATOM   9743  O O   . CYS C 1 309 ? 118.433 163.324 162.787 1.00 125.93 ? 309 CYS C O   1 
ATOM   9744  C CB  . CYS C 1 309 ? 119.808 162.080 160.129 1.00 125.93 ? 309 CYS C CB  1 
ATOM   9745  S SG  . CYS C 1 309 ? 121.098 160.937 159.609 1.00 125.93 ? 309 CYS C SG  1 
ATOM   9746  N N   . SER C 1 310 ? 116.846 162.763 161.296 1.00 127.33 ? 310 SER C N   1 
ATOM   9747  C CA  . SER C 1 310 ? 115.910 163.746 161.829 1.00 127.33 ? 310 SER C CA  1 
ATOM   9748  C C   . SER C 1 310 ? 115.333 163.299 163.158 1.00 127.33 ? 310 SER C C   1 
ATOM   9749  O O   . SER C 1 310 ? 115.189 164.114 164.076 1.00 127.33 ? 310 SER C O   1 
ATOM   9750  C CB  . SER C 1 310 ? 114.780 163.991 160.843 1.00 127.33 ? 310 SER C CB  1 
ATOM   9751  O OG  . SER C 1 310 ? 114.029 162.801 160.658 1.00 127.33 ? 310 SER C OG  1 
ATOM   9752  N N   . LEU C 1 311 ? 114.975 162.016 163.275 1.00 125.15 ? 311 LEU C N   1 
ATOM   9753  C CA  . LEU C 1 311 ? 114.468 161.512 164.543 1.00 125.15 ? 311 LEU C CA  1 
ATOM   9754  C C   . LEU C 1 311 ? 115.533 161.537 165.624 1.00 125.15 ? 311 LEU C C   1 
ATOM   9755  O O   . LEU C 1 311 ? 115.195 161.665 166.804 1.00 125.15 ? 311 LEU C O   1 
ATOM   9756  C CB  . LEU C 1 311 ? 113.917 160.094 164.386 1.00 125.15 ? 311 LEU C CB  1 
ATOM   9757  C CG  . LEU C 1 311 ? 112.630 159.887 163.580 1.00 125.15 ? 311 LEU C CG  1 
ATOM   9758  C CD1 . LEU C 1 311 ? 112.296 158.406 163.473 1.00 125.15 ? 311 LEU C CD1 1 
ATOM   9759  C CD2 . LEU C 1 311 ? 111.460 160.648 164.178 1.00 125.15 ? 311 LEU C CD2 1 
ATOM   9760  N N   . SER C 1 312 ? 116.806 161.454 165.247 1.00 122.26 ? 312 SER C N   1 
ATOM   9761  C CA  . SER C 1 312 ? 117.895 161.694 166.176 1.00 122.26 ? 312 SER C CA  1 
ATOM   9762  C C   . SER C 1 312 ? 118.175 163.169 166.384 1.00 122.26 ? 312 SER C C   1 
ATOM   9763  O O   . SER C 1 312 ? 118.689 163.540 167.442 1.00 122.26 ? 312 SER C O   1 
ATOM   9764  C CB  . SER C 1 312 ? 119.170 161.014 165.690 1.00 122.26 ? 312 SER C CB  1 
ATOM   9765  O OG  . SER C 1 312 ? 120.249 161.319 166.551 1.00 122.26 ? 312 SER C OG  1 
ATOM   9766  N N   . PHE C 1 313 ? 117.858 164.015 165.410 1.00 118.92 ? 313 PHE C N   1 
ATOM   9767  C CA  . PHE C 1 313 ? 117.939 165.448 165.640 1.00 118.92 ? 313 PHE C CA  1 
ATOM   9768  C C   . PHE C 1 313 ? 116.866 165.909 166.610 1.00 118.92 ? 313 PHE C C   1 
ATOM   9769  O O   . PHE C 1 313 ? 117.066 166.891 167.330 1.00 118.92 ? 313 PHE C O   1 
ATOM   9770  C CB  . PHE C 1 313 ? 117.820 166.194 164.316 1.00 118.92 ? 313 PHE C CB  1 
ATOM   9771  C CG  . PHE C 1 313 ? 117.925 167.680 164.442 1.00 118.92 ? 313 PHE C CG  1 
ATOM   9772  C CD1 . PHE C 1 313 ? 119.140 168.279 164.713 1.00 118.92 ? 313 PHE C CD1 1 
ATOM   9773  C CD2 . PHE C 1 313 ? 116.813 168.479 164.264 1.00 118.92 ? 313 PHE C CD2 1 
ATOM   9774  C CE1 . PHE C 1 313 ? 119.238 169.646 164.821 1.00 118.92 ? 313 PHE C CE1 1 
ATOM   9775  C CE2 . PHE C 1 313 ? 116.908 169.845 164.368 1.00 118.92 ? 313 PHE C CE2 1 
ATOM   9776  C CZ  . PHE C 1 313 ? 118.122 170.428 164.647 1.00 118.92 ? 313 PHE C CZ  1 
ATOM   9777  N N   . LEU C 1 314 ? 115.736 165.209 166.650 1.00 121.31 ? 314 LEU C N   1 
ATOM   9778  C CA  . LEU C 1 314 ? 114.711 165.515 167.635 1.00 121.31 ? 314 LEU C CA  1 
ATOM   9779  C C   . LEU C 1 314 ? 115.129 165.039 169.015 1.00 121.31 ? 314 LEU C C   1 
ATOM   9780  O O   . LEU C 1 314 ? 114.875 165.717 170.014 1.00 121.31 ? 314 LEU C O   1 
ATOM   9781  C CB  . LEU C 1 314 ? 113.386 164.872 167.213 1.00 121.31 ? 314 LEU C CB  1 
ATOM   9782  C CG  . LEU C 1 314 ? 112.040 165.138 167.909 1.00 121.31 ? 314 LEU C CG  1 
ATOM   9783  C CD1 . LEU C 1 314 ? 111.773 164.256 169.136 1.00 121.31 ? 314 LEU C CD1 1 
ATOM   9784  C CD2 . LEU C 1 314 ? 111.933 166.609 168.282 1.00 121.31 ? 314 LEU C CD2 1 
ATOM   9785  N N   . LEU C 1 315 ? 115.777 163.881 169.086 1.00 120.81 ? 315 LEU C N   1 
ATOM   9786  C CA  . LEU C 1 315 ? 116.012 163.257 170.378 1.00 120.81 ? 315 LEU C CA  1 
ATOM   9787  C C   . LEU C 1 315 ? 117.160 163.927 171.110 1.00 120.81 ? 315 LEU C C   1 
ATOM   9788  O O   . LEU C 1 315 ? 117.065 164.191 172.312 1.00 120.81 ? 315 LEU C O   1 
ATOM   9789  C CB  . LEU C 1 315 ? 116.272 161.762 170.187 1.00 120.81 ? 315 LEU C CB  1 
ATOM   9790  C CG  . LEU C 1 315 ? 116.324 160.794 171.377 1.00 120.81 ? 315 LEU C CG  1 
ATOM   9791  C CD1 . LEU C 1 315 ? 117.694 160.670 172.066 1.00 120.81 ? 315 LEU C CD1 1 
ATOM   9792  C CD2 . LEU C 1 315 ? 115.261 161.197 172.387 1.00 120.81 ? 315 LEU C CD2 1 
ATOM   9793  N N   . CYS C 1 316 ? 118.261 164.187 170.411 1.00 126.30 ? 316 CYS C N   1 
ATOM   9794  C CA  . CYS C 1 316 ? 119.459 164.664 171.087 1.00 126.30 ? 316 CYS C CA  1 
ATOM   9795  C C   . CYS C 1 316 ? 119.303 166.105 171.537 1.00 126.30 ? 316 CYS C C   1 
ATOM   9796  O O   . CYS C 1 316 ? 119.872 166.508 172.558 1.00 126.30 ? 316 CYS C O   1 
ATOM   9797  C CB  . CYS C 1 316 ? 120.665 164.522 170.166 1.00 126.30 ? 316 CYS C CB  1 
ATOM   9798  S SG  . CYS C 1 316 ? 121.081 162.813 169.749 1.00 126.30 ? 316 CYS C SG  1 
ATOM   9799  N N   . ALA C 1 317 ? 118.511 166.886 170.806 1.00 131.71 ? 317 ALA C N   1 
ATOM   9800  C CA  . ALA C 1 317 ? 118.331 168.289 171.150 1.00 131.71 ? 317 ALA C CA  1 
ATOM   9801  C C   . ALA C 1 317 ? 117.407 168.456 172.342 1.00 131.71 ? 317 ALA C C   1 
ATOM   9802  O O   . ALA C 1 317 ? 117.421 169.503 172.995 1.00 131.71 ? 317 ALA C O   1 
ATOM   9803  C CB  . ALA C 1 317 ? 117.792 169.061 169.949 1.00 131.71 ? 317 ALA C CB  1 
ATOM   9804  N N   . ARG C 1 318 ? 116.592 167.442 172.635 1.00 124.75 ? 318 ARG C N   1 
ATOM   9805  C CA  . ARG C 1 318 ? 115.767 167.489 173.833 1.00 124.75 ? 318 ARG C CA  1 
ATOM   9806  C C   . ARG C 1 318 ? 116.637 167.440 175.078 1.00 124.75 ? 318 ARG C C   1 
ATOM   9807  O O   . ARG C 1 318 ? 116.307 168.046 176.102 1.00 124.75 ? 318 ARG C O   1 
ATOM   9808  C CB  . ARG C 1 318 ? 114.766 166.337 173.820 1.00 124.75 ? 318 ARG C CB  1 
ATOM   9809  C CG  . ARG C 1 318 ? 113.706 166.425 174.890 1.00 124.75 ? 318 ARG C CG  1 
ATOM   9810  C CD  . ARG C 1 318 ? 112.731 165.275 174.784 1.00 124.75 ? 318 ARG C CD  1 
ATOM   9811  N NE  . ARG C 1 318 ? 111.620 165.425 175.716 1.00 124.75 ? 318 ARG C NE  1 
ATOM   9812  C CZ  . ARG C 1 318 ? 111.621 164.973 176.964 1.00 124.75 ? 318 ARG C CZ  1 
ATOM   9813  N NH1 . ARG C 1 318 ? 110.561 165.158 177.735 1.00 124.75 ? 318 ARG C NH1 1 
ATOM   9814  N NH2 . ARG C 1 318 ? 112.680 164.338 177.441 1.00 124.75 ? 318 ARG C NH2 1 
ATOM   9815  N N   . SER C 1 319 ? 117.769 166.745 174.995 1.00 130.22 ? 319 SER C N   1 
ATOM   9816  C CA  . SER C 1 319 ? 118.735 166.784 176.080 1.00 130.22 ? 319 SER C CA  1 
ATOM   9817  C C   . SER C 1 319 ? 119.435 168.127 176.148 1.00 130.22 ? 319 SER C C   1 
ATOM   9818  O O   . SER C 1 319 ? 119.787 168.584 177.240 1.00 130.22 ? 319 SER C O   1 
ATOM   9819  C CB  . SER C 1 319 ? 119.762 165.669 175.919 1.00 130.22 ? 319 SER C CB  1 
ATOM   9820  O OG  . SER C 1 319 ? 120.701 165.701 176.979 1.00 130.22 ? 319 SER C OG  1 
ATOM   9821  N N   . LEU C 1 320 ? 119.658 168.763 174.999 1.00 131.03 ? 320 LEU C N   1 
ATOM   9822  C CA  . LEU C 1 320 ? 120.136 170.138 175.006 1.00 131.03 ? 320 LEU C CA  1 
ATOM   9823  C C   . LEU C 1 320 ? 119.096 171.057 175.619 1.00 131.03 ? 320 LEU C C   1 
ATOM   9824  O O   . LEU C 1 320 ? 119.431 171.989 176.359 1.00 131.03 ? 320 LEU C O   1 
ATOM   9825  C CB  . LEU C 1 320 ? 120.457 170.590 173.589 1.00 131.03 ? 320 LEU C CB  1 
ATOM   9826  C CG  . LEU C 1 320 ? 121.574 169.857 172.875 1.00 131.03 ? 320 LEU C CG  1 
ATOM   9827  C CD1 . LEU C 1 320 ? 121.645 170.364 171.461 1.00 131.03 ? 320 LEU C CD1 1 
ATOM   9828  C CD2 . LEU C 1 320 ? 122.870 170.104 173.599 1.00 131.03 ? 320 LEU C CD2 1 
ATOM   9829  N N   . LEU C 1 321 ? 117.819 170.796 175.325 1.00 133.49 ? 321 LEU C N   1 
ATOM   9830  C CA  . LEU C 1 321 ? 116.737 171.530 175.967 1.00 133.49 ? 321 LEU C CA  1 
ATOM   9831  C C   . LEU C 1 321 ? 116.678 171.222 177.453 1.00 133.49 ? 321 LEU C C   1 
ATOM   9832  O O   . LEU C 1 321 ? 116.254 172.062 178.249 1.00 133.49 ? 321 LEU C O   1 
ATOM   9833  C CB  . LEU C 1 321 ? 115.401 171.196 175.303 1.00 133.49 ? 321 LEU C CB  1 
ATOM   9834  C CG  . LEU C 1 321 ? 115.125 171.713 173.885 1.00 133.49 ? 321 LEU C CG  1 
ATOM   9835  C CD1 . LEU C 1 321 ? 113.835 171.127 173.335 1.00 133.49 ? 321 LEU C CD1 1 
ATOM   9836  C CD2 . LEU C 1 321 ? 115.053 173.230 173.863 1.00 133.49 ? 321 LEU C CD2 1 
ATOM   9837  N N   . ARG C 1 322 ? 117.109 170.026 177.846 1.00 137.66 ? 322 ARG C N   1 
ATOM   9838  C CA  . ARG C 1 322 ? 117.100 169.680 179.259 1.00 137.66 ? 322 ARG C CA  1 
ATOM   9839  C C   . ARG C 1 322 ? 118.265 170.321 179.991 1.00 137.66 ? 322 ARG C C   1 
ATOM   9840  O O   . ARG C 1 322 ? 118.113 170.769 181.132 1.00 137.66 ? 322 ARG C O   1 
ATOM   9841  C CB  . ARG C 1 322 ? 117.135 168.164 179.432 1.00 137.66 ? 322 ARG C CB  1 
ATOM   9842  C CG  . ARG C 1 322 ? 117.013 167.727 180.872 1.00 137.66 ? 322 ARG C CG  1 
ATOM   9843  C CD  . ARG C 1 322 ? 116.892 166.228 181.012 1.00 137.66 ? 322 ARG C CD  1 
ATOM   9844  N NE  . ARG C 1 322 ? 116.788 165.851 182.415 1.00 137.66 ? 322 ARG C NE  1 
ATOM   9845  C CZ  . ARG C 1 322 ? 115.649 165.829 183.099 1.00 137.66 ? 322 ARG C CZ  1 
ATOM   9846  N NH1 . ARG C 1 322 ? 115.650 165.473 184.374 1.00 137.66 ? 322 ARG C NH1 1 
ATOM   9847  N NH2 . ARG C 1 322 ? 114.506 166.151 182.507 1.00 137.66 ? 322 ARG C NH2 1 
ATOM   9848  N N   . GLY C 1 323 ? 119.429 170.390 179.349 1.00 137.69 ? 323 GLY C N   1 
ATOM   9849  C CA  . GLY C 1 323 ? 120.611 170.877 180.038 1.00 137.69 ? 323 GLY C CA  1 
ATOM   9850  C C   . GLY C 1 323 ? 120.574 172.370 180.290 1.00 137.69 ? 323 GLY C C   1 
ATOM   9851  O O   . GLY C 1 323 ? 121.018 172.843 181.339 1.00 137.69 ? 323 GLY C O   1 
ATOM   9852  N N   . PHE C 1 324 ? 120.046 173.132 179.334 1.00 136.47 ? 324 PHE C N   1 
ATOM   9853  C CA  . PHE C 1 324 ? 119.934 174.570 179.526 1.00 136.47 ? 324 PHE C CA  1 
ATOM   9854  C C   . PHE C 1 324 ? 118.846 174.905 180.532 1.00 136.47 ? 324 PHE C C   1 
ATOM   9855  O O   . PHE C 1 324 ? 118.974 175.879 181.281 1.00 136.47 ? 324 PHE C O   1 
ATOM   9856  C CB  . PHE C 1 324 ? 119.652 175.251 178.190 1.00 136.47 ? 324 PHE C CB  1 
ATOM   9857  C CG  . PHE C 1 324 ? 119.626 176.748 178.264 1.00 136.47 ? 324 PHE C CG  1 
ATOM   9858  C CD1 . PHE C 1 324 ? 120.807 177.467 178.354 1.00 136.47 ? 324 PHE C CD1 1 
ATOM   9859  C CD2 . PHE C 1 324 ? 118.424 177.436 178.237 1.00 136.47 ? 324 PHE C CD2 1 
ATOM   9860  C CE1 . PHE C 1 324 ? 120.791 178.839 178.418 1.00 136.47 ? 324 PHE C CE1 1 
ATOM   9861  C CE2 . PHE C 1 324 ? 118.400 178.811 178.306 1.00 136.47 ? 324 PHE C CE2 1 
ATOM   9862  C CZ  . PHE C 1 324 ? 119.585 179.513 178.396 1.00 136.47 ? 324 PHE C CZ  1 
ATOM   9863  N N   . LEU C 1 325 ? 117.777 174.109 180.559 1.00 137.85 ? 325 LEU C N   1 
ATOM   9864  C CA  . LEU C 1 325 ? 116.693 174.287 181.513 1.00 137.85 ? 325 LEU C CA  1 
ATOM   9865  C C   . LEU C 1 325 ? 117.157 174.078 182.945 1.00 137.85 ? 325 LEU C C   1 
ATOM   9866  O O   . LEU C 1 325 ? 116.704 174.794 183.842 1.00 137.85 ? 325 LEU C O   1 
ATOM   9867  C CB  . LEU C 1 325 ? 115.555 173.322 181.156 1.00 137.85 ? 325 LEU C CB  1 
ATOM   9868  C CG  . LEU C 1 325 ? 114.143 173.357 181.746 1.00 137.85 ? 325 LEU C CG  1 
ATOM   9869  C CD1 . LEU C 1 325 ? 113.138 172.880 180.709 1.00 137.85 ? 325 LEU C CD1 1 
ATOM   9870  C CD2 . LEU C 1 325 ? 114.041 172.478 182.967 1.00 137.85 ? 325 LEU C CD2 1 
ATOM   9871  N N   . LEU C 1 326 ? 118.083 173.151 183.170 1.00 140.68 ? 326 LEU C N   1 
ATOM   9872  C CA  . LEU C 1 326 ? 118.608 172.866 184.496 1.00 140.68 ? 326 LEU C CA  1 
ATOM   9873  C C   . LEU C 1 326 ? 119.753 173.784 184.887 1.00 140.68 ? 326 LEU C C   1 
ATOM   9874  O O   . LEU C 1 326 ? 120.440 173.517 185.878 1.00 140.68 ? 326 LEU C O   1 
ATOM   9875  C CB  . LEU C 1 326 ? 119.065 171.411 184.584 1.00 140.68 ? 326 LEU C CB  1 
ATOM   9876  C CG  . LEU C 1 326 ? 118.078 170.343 185.059 1.00 140.68 ? 326 LEU C CG  1 
ATOM   9877  C CD1 . LEU C 1 326 ? 117.698 170.630 186.497 1.00 140.68 ? 326 LEU C CD1 1 
ATOM   9878  C CD2 . LEU C 1 326 ? 116.836 170.222 184.176 1.00 140.68 ? 326 LEU C CD2 1 
ATOM   9879  N N   . GLN C 1 327 ? 119.988 174.847 184.131 1.00 142.65 ? 327 GLN C N   1 
ATOM   9880  C CA  . GLN C 1 327 ? 120.980 175.820 184.539 1.00 142.65 ? 327 GLN C CA  1 
ATOM   9881  C C   . GLN C 1 327 ? 120.411 176.886 185.449 1.00 142.65 ? 327 GLN C C   1 
ATOM   9882  O O   . GLN C 1 327 ? 121.149 177.416 186.284 1.00 142.65 ? 327 GLN C O   1 
ATOM   9883  C CB  . GLN C 1 327 ? 121.603 176.503 183.323 1.00 142.65 ? 327 GLN C CB  1 
ATOM   9884  C CG  . GLN C 1 327 ? 122.484 175.616 182.496 1.00 142.65 ? 327 GLN C CG  1 
ATOM   9885  C CD  . GLN C 1 327 ? 123.064 176.346 181.305 1.00 142.65 ? 327 GLN C CD  1 
ATOM   9886  O OE1 . GLN C 1 327 ? 122.723 177.499 181.037 1.00 142.65 ? 327 GLN C OE1 1 
ATOM   9887  N NE2 . GLN C 1 327 ? 123.958 175.682 180.590 1.00 142.65 ? 327 GLN C NE2 1 
ATOM   9888  N N   . ASN C 1 328 ? 119.118 177.194 185.317 1.00 151.55 ? 328 ASN C N   1 
ATOM   9889  C CA  . ASN C 1 328 ? 118.503 178.271 186.082 1.00 151.55 ? 328 ASN C CA  1 
ATOM   9890  C C   . ASN C 1 328 ? 118.465 177.958 187.570 1.00 151.55 ? 328 ASN C C   1 
ATOM   9891  O O   . ASN C 1 328 ? 118.490 178.877 188.392 1.00 151.55 ? 328 ASN C O   1 
ATOM   9892  C CB  . ASN C 1 328 ? 117.087 178.528 185.559 1.00 151.55 ? 328 ASN C CB  1 
ATOM   9893  C CG  . ASN C 1 328 ? 116.534 179.884 185.971 1.00 151.55 ? 328 ASN C CG  1 
ATOM   9894  O OD1 . ASN C 1 328 ? 117.208 180.677 186.622 1.00 151.55 ? 328 ASN C OD1 1 
ATOM   9895  N ND2 . ASN C 1 328 ? 115.296 180.155 185.583 1.00 151.55 ? 328 ASN C ND2 1 
ATOM   9896  N N   . GLU C 1 329 ? 118.464 176.687 187.932 1.00 151.85 ? 329 GLU C N   1 
ATOM   9897  C CA  . GLU C 1 329 ? 118.370 176.299 189.326 1.00 151.85 ? 329 GLU C CA  1 
ATOM   9898  C C   . GLU C 1 329 ? 119.706 176.358 190.051 1.00 151.85 ? 329 GLU C C   1 
ATOM   9899  O O   . GLU C 1 329 ? 119.735 176.692 191.241 1.00 151.85 ? 329 GLU C O   1 
ATOM   9900  C CB  . GLU C 1 329 ? 117.770 174.895 189.418 1.00 151.85 ? 329 GLU C CB  1 
ATOM   9901  C CG  . GLU C 1 329 ? 116.286 174.845 189.074 1.00 151.85 ? 329 GLU C CG  1 
ATOM   9902  C CD  . GLU C 1 329 ? 116.007 174.821 187.582 1.00 151.85 ? 329 GLU C CD  1 
ATOM   9903  O OE1 . GLU C 1 329 ? 116.970 174.763 186.790 1.00 151.85 ? 329 GLU C OE1 1 
ATOM   9904  O OE2 . GLU C 1 329 ? 114.823 174.884 187.200 1.00 151.85 ? 329 GLU C OE2 1 
ATOM   9905  N N   . PHE C 1 330 ? 120.809 176.082 189.365 1.00 149.84 ? 330 PHE C N   1 
ATOM   9906  C CA  . PHE C 1 330 ? 122.111 176.111 190.010 1.00 149.84 ? 330 PHE C CA  1 
ATOM   9907  C C   . PHE C 1 330 ? 122.638 177.528 190.190 1.00 149.84 ? 330 PHE C C   1 
ATOM   9908  O O   . PHE C 1 330 ? 123.589 177.730 190.952 1.00 149.84 ? 330 PHE C O   1 
ATOM   9909  C CB  . PHE C 1 330 ? 123.102 175.263 189.201 1.00 149.84 ? 330 PHE C CB  1 
ATOM   9910  C CG  . PHE C 1 330 ? 124.443 175.093 189.857 1.00 149.84 ? 330 PHE C CG  1 
ATOM   9911  C CD1 . PHE C 1 330 ? 124.590 174.264 190.957 1.00 149.84 ? 330 PHE C CD1 1 
ATOM   9912  C CD2 . PHE C 1 330 ? 125.551 175.775 189.384 1.00 149.84 ? 330 PHE C CD2 1 
ATOM   9913  C CE1 . PHE C 1 330 ? 125.821 174.113 191.570 1.00 149.84 ? 330 PHE C CE1 1 
ATOM   9914  C CE2 . PHE C 1 330 ? 126.781 175.628 189.992 1.00 149.84 ? 330 PHE C CE2 1 
ATOM   9915  C CZ  . PHE C 1 330 ? 126.915 174.795 191.086 1.00 149.84 ? 330 PHE C CZ  1 
ATOM   9916  N N   . VAL C 1 331 ? 122.024 178.518 189.545 1.00 156.42 ? 331 VAL C N   1 
ATOM   9917  C CA  . VAL C 1 331 ? 122.535 179.885 189.615 1.00 156.42 ? 331 VAL C CA  1 
ATOM   9918  C C   . VAL C 1 331 ? 122.313 180.480 191.001 1.00 156.42 ? 331 VAL C C   1 
ATOM   9919  O O   . VAL C 1 331 ? 123.274 180.796 191.711 1.00 156.42 ? 331 VAL C O   1 
ATOM   9920  C CB  . VAL C 1 331 ? 121.904 180.755 188.513 1.00 156.42 ? 331 VAL C CB  1 
ATOM   9921  C CG1 . VAL C 1 331 ? 122.256 182.218 188.714 1.00 156.42 ? 331 VAL C CG1 1 
ATOM   9922  C CG2 . VAL C 1 331 ? 122.403 180.306 187.157 1.00 156.42 ? 331 VAL C CG2 1 
ATOM   9923  N N   . GLY C 1 332 ? 121.057 180.616 191.418 1.00 155.39 ? 332 GLY C N   1 
ATOM   9924  C CA  . GLY C 1 332 ? 120.784 181.147 192.739 1.00 155.39 ? 332 GLY C CA  1 
ATOM   9925  C C   . GLY C 1 332 ? 121.114 180.112 193.785 1.00 155.39 ? 332 GLY C C   1 
ATOM   9926  O O   . GLY C 1 332 ? 122.000 180.314 194.621 1.00 155.39 ? 332 GLY C O   1 
ATOM   9927  N N   . PHE C 1 333 ? 120.330 179.034 193.781 1.00 156.69 ? 333 PHE C N   1 
ATOM   9928  C CA  . PHE C 1 333 ? 120.651 177.709 194.306 1.00 156.69 ? 333 PHE C CA  1 
ATOM   9929  C C   . PHE C 1 333 ? 120.708 177.599 195.829 1.00 156.69 ? 333 PHE C C   1 
ATOM   9930  O O   . PHE C 1 333 ? 120.429 176.529 196.381 1.00 156.69 ? 333 PHE C O   1 
ATOM   9931  C CB  . PHE C 1 333 ? 121.990 177.280 193.691 1.00 156.69 ? 333 PHE C CB  1 
ATOM   9932  C CG  . PHE C 1 333 ? 122.574 176.029 194.265 1.00 156.69 ? 333 PHE C CG  1 
ATOM   9933  C CD1 . PHE C 1 333 ? 122.077 174.791 193.908 1.00 156.69 ? 333 PHE C CD1 1 
ATOM   9934  C CD2 . PHE C 1 333 ? 123.646 176.095 195.150 1.00 156.69 ? 333 PHE C CD2 1 
ATOM   9935  C CE1 . PHE C 1 333 ? 122.622 173.639 194.435 1.00 156.69 ? 333 PHE C CE1 1 
ATOM   9936  C CE2 . PHE C 1 333 ? 124.190 174.951 195.682 1.00 156.69 ? 333 PHE C CE2 1 
ATOM   9937  C CZ  . PHE C 1 333 ? 123.676 173.721 195.320 1.00 156.69 ? 333 PHE C CZ  1 
ATOM   9938  N N   . MET C 1 334 ? 120.986 178.703 196.529 1.00 155.24 ? 334 MET C N   1 
ATOM   9939  C CA  . MET C 1 334 ? 120.662 178.819 197.946 1.00 155.24 ? 334 MET C CA  1 
ATOM   9940  C C   . MET C 1 334 ? 120.389 180.283 198.283 1.00 155.24 ? 334 MET C C   1 
ATOM   9941  O O   . MET C 1 334 ? 120.620 180.706 199.423 1.00 155.24 ? 334 MET C O   1 
ATOM   9942  C CB  . MET C 1 334 ? 121.781 178.207 198.826 1.00 155.24 ? 334 MET C CB  1 
ATOM   9943  C CG  . MET C 1 334 ? 121.337 177.740 200.231 1.00 155.24 ? 334 MET C CG  1 
ATOM   9944  S SD  . MET C 1 334 ? 122.614 176.956 201.233 1.00 155.24 ? 334 MET C SD  1 
ATOM   9945  C CE  . MET C 1 334 ? 122.787 175.378 200.400 1.00 155.24 ? 334 MET C CE  1 
ATOM   9946  N N   . TRP C 1 335 ? 119.942 181.069 197.286 1.00 156.58 ? 335 TRP C N   1 
ATOM   9947  C CA  . TRP C 1 335 ? 119.788 182.523 197.378 1.00 156.58 ? 335 TRP C CA  1 
ATOM   9948  C C   . TRP C 1 335 ? 121.144 183.128 197.721 1.00 156.58 ? 335 TRP C C   1 
ATOM   9949  O O   . TRP C 1 335 ? 121.388 183.468 198.883 1.00 156.58 ? 335 TRP C O   1 
ATOM   9950  C CB  . TRP C 1 335 ? 118.705 182.941 198.378 1.00 156.58 ? 335 TRP C CB  1 
ATOM   9951  C CG  . TRP C 1 335 ? 117.335 182.460 198.029 1.00 156.58 ? 335 TRP C CG  1 
ATOM   9952  C CD1 . TRP C 1 335 ? 116.940 181.858 196.869 1.00 156.58 ? 335 TRP C CD1 1 
ATOM   9953  C CD2 . TRP C 1 335 ? 116.172 182.527 198.860 1.00 156.58 ? 335 TRP C CD2 1 
ATOM   9954  N NE1 . TRP C 1 335 ? 115.603 181.550 196.925 1.00 156.58 ? 335 TRP C NE1 1 
ATOM   9955  C CE2 . TRP C 1 335 ? 115.108 181.952 198.138 1.00 156.58 ? 335 TRP C CE2 1 
ATOM   9956  C CE3 . TRP C 1 335 ? 115.927 183.021 200.145 1.00 156.58 ? 335 TRP C CE3 1 
ATOM   9957  C CZ2 . TRP C 1 335 ? 113.820 181.858 198.658 1.00 156.58 ? 335 TRP C CZ2 1 
ATOM   9958  C CZ3 . TRP C 1 335 ? 114.649 182.927 200.659 1.00 156.58 ? 335 TRP C CZ3 1 
ATOM   9959  C CH2 . TRP C 1 335 ? 113.611 182.351 199.917 1.00 156.58 ? 335 TRP C CH2 1 
ATOM   9960  N N   . ARG C 1 336 ? 122.001 183.299 196.710 1.00 146.00 ? 336 ARG C N   1 
ATOM   9961  C CA  . ARG C 1 336 ? 123.404 182.899 196.640 1.00 146.00 ? 336 ARG C CA  1 
ATOM   9962  C C   . ARG C 1 336 ? 124.141 182.723 197.954 1.00 146.00 ? 336 ARG C C   1 
ATOM   9963  O O   . ARG C 1 336 ? 124.227 183.638 198.777 1.00 146.00 ? 336 ARG C O   1 
ATOM   9964  C CB  . ARG C 1 336 ? 124.180 183.956 195.856 1.00 146.00 ? 336 ARG C CB  1 
ATOM   9965  C CG  . ARG C 1 336 ? 123.830 184.106 194.393 1.00 146.00 ? 336 ARG C CG  1 
ATOM   9966  C CD  . ARG C 1 336 ? 124.492 185.371 193.852 1.00 146.00 ? 336 ARG C CD  1 
ATOM   9967  N NE  . ARG C 1 336 ? 124.218 185.613 192.443 1.00 146.00 ? 336 ARG C NE  1 
ATOM   9968  C CZ  . ARG C 1 336 ? 124.566 186.722 191.801 1.00 146.00 ? 336 ARG C CZ  1 
ATOM   9969  N NH1 . ARG C 1 336 ? 125.181 187.699 192.447 1.00 146.00 ? 336 ARG C NH1 1 
ATOM   9970  N NH2 . ARG C 1 336 ? 124.285 186.861 190.513 1.00 146.00 ? 336 ARG C NH2 1 
ATOM   9971  N N   . GLN C 1 337 ? 124.710 181.528 198.110 1.00 158.40 ? 337 GLN C N   1 
ATOM   9972  C CA  . GLN C 1 337 ? 125.623 181.179 199.188 1.00 158.40 ? 337 GLN C CA  1 
ATOM   9973  C C   . GLN C 1 337 ? 127.063 181.462 198.780 1.00 158.40 ? 337 GLN C C   1 
ATOM   9974  O O   . GLN C 1 337 ? 127.756 182.261 199.417 1.00 158.40 ? 337 GLN C O   1 
ATOM   9975  C CB  . GLN C 1 337 ? 125.464 179.693 199.535 1.00 158.40 ? 337 GLN C CB  1 
ATOM   9976  C CG  . GLN C 1 337 ? 126.320 179.222 200.697 1.00 158.40 ? 337 GLN C CG  1 
ATOM   9977  C CD  . GLN C 1 337 ? 126.247 177.722 200.905 1.00 158.40 ? 337 GLN C CD  1 
ATOM   9978  O OE1 . GLN C 1 337 ? 125.655 177.003 200.103 1.00 158.40 ? 337 GLN C OE1 1 
ATOM   9979  N NE2 . GLN C 1 337 ? 126.846 177.245 201.988 1.00 158.40 ? 337 GLN C NE2 1 
ATOM   9980  N N   . ARG C 1 338 ? 127.518 180.811 197.712 1.00 160.15 ? 338 ARG C N   1 
ATOM   9981  C CA  . ARG C 1 338 ? 128.837 181.056 197.153 1.00 160.15 ? 338 ARG C CA  1 
ATOM   9982  C C   . ARG C 1 338 ? 128.797 182.164 196.108 1.00 160.15 ? 338 ARG C C   1 
ATOM   9983  O O   . ARG C 1 338 ? 129.654 183.052 196.117 1.00 160.15 ? 338 ARG C O   1 
ATOM   9984  C CB  . ARG C 1 338 ? 129.394 179.763 196.557 1.00 160.15 ? 338 ARG C CB  1 
ATOM   9985  C CG  . ARG C 1 338 ? 129.589 178.664 197.588 1.00 160.15 ? 338 ARG C CG  1 
ATOM   9986  C CD  . ARG C 1 338 ? 130.150 177.386 196.980 1.00 160.15 ? 338 ARG C CD  1 
ATOM   9987  N NE  . ARG C 1 338 ? 131.550 177.523 196.601 1.00 160.15 ? 338 ARG C NE  1 
ATOM   9988  C CZ  . ARG C 1 338 ? 132.235 176.620 195.906 1.00 160.15 ? 338 ARG C CZ  1 
ATOM   9989  N NH1 . ARG C 1 338 ? 133.511 176.831 195.611 1.00 160.15 ? 338 ARG C NH1 1 
ATOM   9990  N NH2 . ARG C 1 338 ? 131.648 175.507 195.499 1.00 160.15 ? 338 ARG C NH2 1 
ATOM   9991  N N   . GLY C 1 339 ? 127.819 182.127 195.205 1.00 159.81 ? 339 GLY C N   1 
ATOM   9992  C CA  . GLY C 1 339 ? 127.509 183.264 194.357 1.00 159.81 ? 339 GLY C CA  1 
ATOM   9993  C C   . GLY C 1 339 ? 128.499 183.543 193.248 1.00 159.81 ? 339 GLY C C   1 
ATOM   9994  O O   . GLY C 1 339 ? 128.180 183.400 192.063 1.00 159.81 ? 339 GLY C O   1 
ATOM   9995  N N   . ARG C 1 340 ? 129.708 183.952 193.631 1.00 174.35 ? 340 ARG C N   1 
ATOM   9996  C CA  . ARG C 1 340 ? 130.756 184.327 192.693 1.00 174.35 ? 340 ARG C CA  1 
ATOM   9997  C C   . ARG C 1 340 ? 131.536 183.126 192.177 1.00 174.35 ? 340 ARG C C   1 
ATOM   9998  O O   . ARG C 1 340 ? 132.437 183.296 191.350 1.00 174.35 ? 340 ARG C O   1 
ATOM   9999  C CB  . ARG C 1 340 ? 131.729 185.322 193.341 1.00 174.35 ? 340 ARG C CB  1 
ATOM   10000 C CG  . ARG C 1 340 ? 131.317 186.800 193.309 1.00 174.35 ? 340 ARG C CG  1 
ATOM   10001 C CD  . ARG C 1 340 ? 130.258 187.163 194.355 1.00 174.35 ? 340 ARG C CD  1 
ATOM   10002 N NE  . ARG C 1 340 ? 130.045 188.606 194.427 1.00 174.35 ? 340 ARG C NE  1 
ATOM   10003 C CZ  . ARG C 1 340 ? 129.152 189.202 195.212 1.00 174.35 ? 340 ARG C CZ  1 
ATOM   10004 N NH1 . ARG C 1 340 ? 128.377 188.484 196.012 1.00 174.35 ? 340 ARG C NH1 1 
ATOM   10005 N NH2 . ARG C 1 340 ? 129.040 190.524 195.202 1.00 174.35 ? 340 ARG C NH2 1 
ATOM   10006 N N   . VAL C 1 341 ? 131.217 181.920 192.648 1.00 171.75 ? 341 VAL C N   1 
ATOM   10007 C CA  . VAL C 1 341 ? 131.962 180.739 192.229 1.00 171.75 ? 341 VAL C CA  1 
ATOM   10008 C C   . VAL C 1 341 ? 131.551 180.321 190.820 1.00 171.75 ? 341 VAL C C   1 
ATOM   10009 O O   . VAL C 1 341 ? 132.390 179.892 190.015 1.00 171.75 ? 341 VAL C O   1 
ATOM   10010 C CB  . VAL C 1 341 ? 131.778 179.622 193.273 1.00 171.75 ? 341 VAL C CB  1 
ATOM   10011 C CG1 . VAL C 1 341 ? 132.364 178.307 192.801 1.00 171.75 ? 341 VAL C CG1 1 
ATOM   10012 C CG2 . VAL C 1 341 ? 132.454 180.042 194.562 1.00 171.75 ? 341 VAL C CG2 1 
ATOM   10013 N N   . ILE C 1 342 ? 130.270 180.482 190.485 1.00 169.26 ? 342 ILE C N   1 
ATOM   10014 C CA  . ILE C 1 342 ? 129.832 180.340 189.100 1.00 169.26 ? 342 ILE C CA  1 
ATOM   10015 C C   . ILE C 1 342 ? 130.470 181.442 188.272 1.00 169.26 ? 342 ILE C C   1 
ATOM   10016 O O   . ILE C 1 342 ? 130.304 182.633 188.562 1.00 169.26 ? 342 ILE C O   1 
ATOM   10017 C CB  . ILE C 1 342 ? 128.310 180.391 189.008 1.00 169.26 ? 342 ILE C CB  1 
ATOM   10018 C CG1 . ILE C 1 342 ? 127.698 179.201 189.733 1.00 169.26 ? 342 ILE C CG1 1 
ATOM   10019 C CG2 . ILE C 1 342 ? 127.874 180.410 187.565 1.00 169.26 ? 342 ILE C CG2 1 
ATOM   10020 C CD1 . ILE C 1 342 ? 126.226 179.340 189.916 1.00 169.26 ? 342 ILE C CD1 1 
ATOM   10021 N N   . SER C 1 343 ? 131.221 181.050 187.244 1.00 172.63 ? 343 SER C N   1 
ATOM   10022 C CA  . SER C 1 343 ? 132.102 182.004 186.585 1.00 172.63 ? 343 SER C CA  1 
ATOM   10023 C C   . SER C 1 343 ? 132.138 181.848 185.069 1.00 172.63 ? 343 SER C C   1 
ATOM   10024 O O   . SER C 1 343 ? 133.152 182.198 184.453 1.00 172.63 ? 343 SER C O   1 
ATOM   10025 C CB  . SER C 1 343 ? 133.518 181.866 187.149 1.00 172.63 ? 343 SER C CB  1 
ATOM   10026 O OG  . SER C 1 343 ? 134.044 180.575 186.889 1.00 172.63 ? 343 SER C OG  1 
ATOM   10027 N N   . LEU C 1 344 ? 131.090 181.269 184.468 1.00 166.15 ? 344 LEU C N   1 
ATOM   10028 C CA  . LEU C 1 344 ? 130.910 181.080 183.018 1.00 166.15 ? 344 LEU C CA  1 
ATOM   10029 C C   . LEU C 1 344 ? 131.939 180.130 182.394 1.00 166.15 ? 344 LEU C C   1 
ATOM   10030 O O   . LEU C 1 344 ? 131.932 179.916 181.180 1.00 166.15 ? 344 LEU C O   1 
ATOM   10031 C CB  . LEU C 1 344 ? 130.893 182.416 182.253 1.00 166.15 ? 344 LEU C CB  1 
ATOM   10032 C CG  . LEU C 1 344 ? 129.625 183.282 182.275 1.00 166.15 ? 344 LEU C CG  1 
ATOM   10033 C CD1 . LEU C 1 344 ? 129.444 184.039 183.590 1.00 166.15 ? 344 LEU C CD1 1 
ATOM   10034 C CD2 . LEU C 1 344 ? 129.623 184.247 181.104 1.00 166.15 ? 344 LEU C CD2 1 
ATOM   10035 N N   . TRP C 1 345 ? 132.828 179.557 183.195 1.00 165.69 ? 345 TRP C N   1 
ATOM   10036 C CA  . TRP C 1 345 ? 133.599 178.393 182.809 1.00 165.69 ? 345 TRP C CA  1 
ATOM   10037 C C   . TRP C 1 345 ? 133.238 177.179 183.636 1.00 165.69 ? 345 TRP C C   1 
ATOM   10038 O O   . TRP C 1 345 ? 133.344 176.056 183.134 1.00 165.69 ? 345 TRP C O   1 
ATOM   10039 C CB  . TRP C 1 345 ? 135.104 178.664 182.943 1.00 165.69 ? 345 TRP C CB  1 
ATOM   10040 C CG  . TRP C 1 345 ? 135.945 177.527 182.470 1.00 165.69 ? 345 TRP C CG  1 
ATOM   10041 C CD1 . TRP C 1 345 ? 136.540 176.572 183.241 1.00 165.69 ? 345 TRP C CD1 1 
ATOM   10042 C CD2 . TRP C 1 345 ? 136.280 177.217 181.114 1.00 165.69 ? 345 TRP C CD2 1 
ATOM   10043 N NE1 . TRP C 1 345 ? 137.226 175.685 182.448 1.00 165.69 ? 345 TRP C NE1 1 
ATOM   10044 C CE2 . TRP C 1 345 ? 137.084 176.059 181.138 1.00 165.69 ? 345 TRP C CE2 1 
ATOM   10045 C CE3 . TRP C 1 345 ? 135.981 177.806 179.883 1.00 165.69 ? 345 TRP C CE3 1 
ATOM   10046 C CZ2 . TRP C 1 345 ? 137.590 175.478 179.978 1.00 165.69 ? 345 TRP C CZ2 1 
ATOM   10047 C CZ3 . TRP C 1 345 ? 136.484 177.229 178.732 1.00 165.69 ? 345 TRP C CZ3 1 
ATOM   10048 C CH2 . TRP C 1 345 ? 137.279 176.076 178.787 1.00 165.69 ? 345 TRP C CH2 1 
ATOM   10049 N N   . GLU C 1 346 ? 132.787 177.363 184.875 1.00 163.06 ? 346 GLU C N   1 
ATOM   10050 C CA  . GLU C 1 346 ? 132.098 176.297 185.581 1.00 163.06 ? 346 GLU C CA  1 
ATOM   10051 C C   . GLU C 1 346 ? 130.677 176.096 185.079 1.00 163.06 ? 346 GLU C C   1 
ATOM   10052 O O   . GLU C 1 346 ? 130.039 175.108 185.455 1.00 163.06 ? 346 GLU C O   1 
ATOM   10053 C CB  . GLU C 1 346 ? 132.078 176.564 187.087 1.00 163.06 ? 346 GLU C CB  1 
ATOM   10054 C CG  . GLU C 1 346 ? 133.424 176.385 187.776 1.00 163.06 ? 346 GLU C CG  1 
ATOM   10055 C CD  . GLU C 1 346 ? 133.340 176.589 189.277 1.00 163.06 ? 346 GLU C CD  1 
ATOM   10056 O OE1 . GLU C 1 346 ? 132.268 177.009 189.755 1.00 163.06 ? 346 GLU C OE1 1 
ATOM   10057 O OE2 . GLU C 1 346 ? 134.336 176.318 189.982 1.00 163.06 ? 346 GLU C OE2 1 
ATOM   10058 N N   . ARG C 1 347 ? 130.162 177.004 184.251 1.00 151.86 ? 347 ARG C N   1 
ATOM   10059 C CA  . ARG C 1 347 ? 128.932 176.731 183.526 1.00 151.86 ? 347 ARG C CA  1 
ATOM   10060 C C   . ARG C 1 347 ? 129.152 175.834 182.319 1.00 151.86 ? 347 ARG C C   1 
ATOM   10061 O O   . ARG C 1 347 ? 128.186 175.252 181.814 1.00 151.86 ? 347 ARG C O   1 
ATOM   10062 C CB  . ARG C 1 347 ? 128.283 178.037 183.068 1.00 151.86 ? 347 ARG C CB  1 
ATOM   10063 C CG  . ARG C 1 347 ? 127.680 178.859 184.180 1.00 151.86 ? 347 ARG C CG  1 
ATOM   10064 C CD  . ARG C 1 347 ? 126.932 180.048 183.610 1.00 151.86 ? 347 ARG C CD  1 
ATOM   10065 N NE  . ARG C 1 347 ? 126.252 180.822 184.641 1.00 151.86 ? 347 ARG C NE  1 
ATOM   10066 C CZ  . ARG C 1 347 ? 125.521 181.904 184.399 1.00 151.86 ? 347 ARG C CZ  1 
ATOM   10067 N NH1 . ARG C 1 347 ? 124.937 182.548 185.397 1.00 151.86 ? 347 ARG C NH1 1 
ATOM   10068 N NH2 . ARG C 1 347 ? 125.367 182.337 183.157 1.00 151.86 ? 347 ARG C NH2 1 
ATOM   10069 N N   . LEU C 1 348 ? 130.397 175.697 181.863 1.00 152.64 ? 348 LEU C N   1 
ATOM   10070 C CA  . LEU C 1 348 ? 130.676 175.061 180.585 1.00 152.64 ? 348 LEU C CA  1 
ATOM   10071 C C   . LEU C 1 348 ? 130.470 173.558 180.623 1.00 152.64 ? 348 LEU C C   1 
ATOM   10072 O O   . LEU C 1 348 ? 130.157 172.966 179.587 1.00 152.64 ? 348 LEU C O   1 
ATOM   10073 C CB  . LEU C 1 348 ? 132.107 175.398 180.147 1.00 152.64 ? 348 LEU C CB  1 
ATOM   10074 C CG  . LEU C 1 348 ? 132.638 175.150 178.727 1.00 152.64 ? 348 LEU C CG  1 
ATOM   10075 C CD1 . LEU C 1 348 ? 133.182 173.741 178.482 1.00 152.64 ? 348 LEU C CD1 1 
ATOM   10076 C CD2 . LEU C 1 348 ? 131.549 175.493 177.718 1.00 152.64 ? 348 LEU C CD2 1 
ATOM   10077 N N   . GLU C 1 349 ? 130.594 172.925 181.785 1.00 149.56 ? 349 GLU C N   1 
ATOM   10078 C CA  . GLU C 1 349 ? 130.511 171.474 181.853 1.00 149.56 ? 349 GLU C CA  1 
ATOM   10079 C C   . GLU C 1 349 ? 129.077 170.975 181.978 1.00 149.56 ? 349 GLU C C   1 
ATOM   10080 O O   . GLU C 1 349 ? 128.852 169.819 182.349 1.00 149.56 ? 349 GLU C O   1 
ATOM   10081 C CB  . GLU C 1 349 ? 131.392 170.958 182.993 1.00 149.56 ? 349 GLU C CB  1 
ATOM   10082 C CG  . GLU C 1 349 ? 130.973 171.358 184.391 1.00 149.56 ? 349 GLU C CG  1 
ATOM   10083 C CD  . GLU C 1 349 ? 130.231 170.252 185.102 1.00 149.56 ? 349 GLU C CD  1 
ATOM   10084 O OE1 . GLU C 1 349 ? 130.403 169.085 184.700 1.00 149.56 ? 349 GLU C OE1 1 
ATOM   10085 O OE2 . GLU C 1 349 ? 129.487 170.544 186.060 1.00 149.56 ? 349 GLU C OE2 1 
ATOM   10086 N N   . PHE C 1 350 ? 128.096 171.806 181.639 1.00 140.61 ? 350 PHE C N   1 
ATOM   10087 C CA  . PHE C 1 350 ? 126.702 171.390 181.612 1.00 140.61 ? 350 PHE C CA  1 
ATOM   10088 C C   . PHE C 1 350 ? 126.321 170.808 180.259 1.00 140.61 ? 350 PHE C C   1 
ATOM   10089 O O   . PHE C 1 350 ? 125.887 169.657 180.172 1.00 140.61 ? 350 PHE C O   1 
ATOM   10090 C CB  . PHE C 1 350 ? 125.810 172.583 181.945 1.00 140.61 ? 350 PHE C CB  1 
ATOM   10091 C CG  . PHE C 1 350 ? 125.902 173.013 183.364 1.00 140.61 ? 350 PHE C CG  1 
ATOM   10092 C CD1 . PHE C 1 350 ? 126.296 172.119 184.340 1.00 140.61 ? 350 PHE C CD1 1 
ATOM   10093 C CD2 . PHE C 1 350 ? 125.648 174.323 183.719 1.00 140.61 ? 350 PHE C CD2 1 
ATOM   10094 C CE1 . PHE C 1 350 ? 126.397 172.510 185.647 1.00 140.61 ? 350 PHE C CE1 1 
ATOM   10095 C CE2 . PHE C 1 350 ? 125.751 174.725 185.027 1.00 140.61 ? 350 PHE C CE2 1 
ATOM   10096 C CZ  . PHE C 1 350 ? 126.127 173.817 185.993 1.00 140.61 ? 350 PHE C CZ  1 
ATOM   10097 N N   . VAL C 1 351 ? 126.479 171.590 179.199 1.00 135.33 ? 351 VAL C N   1 
ATOM   10098 C CA  . VAL C 1 351 ? 126.120 171.151 177.856 1.00 135.33 ? 351 VAL C CA  1 
ATOM   10099 C C   . VAL C 1 351 ? 127.198 170.191 177.374 1.00 135.33 ? 351 VAL C C   1 
ATOM   10100 O O   . VAL C 1 351 ? 128.375 170.548 177.309 1.00 135.33 ? 351 VAL C O   1 
ATOM   10101 C CB  . VAL C 1 351 ? 125.969 172.340 176.903 1.00 135.33 ? 351 VAL C CB  1 
ATOM   10102 C CG1 . VAL C 1 351 ? 125.691 171.851 175.491 1.00 135.33 ? 351 VAL C CG1 1 
ATOM   10103 C CG2 . VAL C 1 351 ? 124.863 173.264 177.388 1.00 135.33 ? 351 VAL C CG2 1 
ATOM   10104 N N   . ASN C 1 352 ? 126.797 168.973 177.034 1.00 121.01 ? 352 ASN C N   1 
ATOM   10105 C CA  . ASN C 1 352 ? 127.763 167.953 176.667 1.00 121.01 ? 352 ASN C CA  1 
ATOM   10106 C C   . ASN C 1 352 ? 128.271 168.189 175.256 1.00 121.01 ? 352 ASN C C   1 
ATOM   10107 O O   . ASN C 1 352 ? 127.490 168.395 174.325 1.00 121.01 ? 352 ASN C O   1 
ATOM   10108 C CB  . ASN C 1 352 ? 127.128 166.579 176.774 1.00 121.01 ? 352 ASN C CB  1 
ATOM   10109 C CG  . ASN C 1 352 ? 126.569 166.321 178.139 1.00 121.01 ? 352 ASN C CG  1 
ATOM   10110 O OD1 . ASN C 1 352 ? 125.365 166.153 178.304 1.00 121.01 ? 352 ASN C OD1 1 
ATOM   10111 N ND2 . ASN C 1 352 ? 127.435 166.318 179.138 1.00 121.01 ? 352 ASN C ND2 1 
ATOM   10112 N N   . GLY C 1 353 ? 129.594 168.146 175.102 1.00 113.16 ? 353 GLY C N   1 
ATOM   10113 C CA  . GLY C 1 353 ? 130.197 168.431 173.815 1.00 113.16 ? 353 GLY C CA  1 
ATOM   10114 C C   . GLY C 1 353 ? 129.960 167.359 172.775 1.00 113.16 ? 353 GLY C C   1 
ATOM   10115 O O   . GLY C 1 353 ? 130.096 167.624 171.578 1.00 113.16 ? 353 GLY C O   1 
ATOM   10116 N N   . TRP C 1 354 ? 129.602 166.152 173.204 1.00 106.20 ? 354 TRP C N   1 
ATOM   10117 C CA  . TRP C 1 354 ? 129.336 165.102 172.237 1.00 106.20 ? 354 TRP C CA  1 
ATOM   10118 C C   . TRP C 1 354 ? 128.002 165.314 171.547 1.00 106.20 ? 354 TRP C C   1 
ATOM   10119 O O   . TRP C 1 354 ? 127.839 164.933 170.385 1.00 106.20 ? 354 TRP C O   1 
ATOM   10120 C CB  . TRP C 1 354 ? 129.372 163.738 172.911 1.00 106.20 ? 354 TRP C CB  1 
ATOM   10121 C CG  . TRP C 1 354 ? 130.707 163.419 173.432 1.00 106.20 ? 354 TRP C CG  1 
ATOM   10122 C CD1 . TRP C 1 354 ? 131.111 163.478 174.722 1.00 106.20 ? 354 TRP C CD1 1 
ATOM   10123 C CD2 . TRP C 1 354 ? 131.847 163.036 172.670 1.00 106.20 ? 354 TRP C CD2 1 
ATOM   10124 N NE1 . TRP C 1 354 ? 132.430 163.128 174.821 1.00 106.20 ? 354 TRP C NE1 1 
ATOM   10125 C CE2 . TRP C 1 354 ? 132.905 162.854 173.569 1.00 106.20 ? 354 TRP C CE2 1 
ATOM   10126 C CE3 . TRP C 1 354 ? 132.072 162.817 171.315 1.00 106.20 ? 354 TRP C CE3 1 
ATOM   10127 C CZ2 . TRP C 1 354 ? 134.169 162.465 173.158 1.00 106.20 ? 354 TRP C CZ2 1 
ATOM   10128 C CZ3 . TRP C 1 354 ? 133.324 162.434 170.910 1.00 106.20 ? 354 TRP C CZ3 1 
ATOM   10129 C CH2 . TRP C 1 354 ? 134.358 162.259 171.827 1.00 106.20 ? 354 TRP C CH2 1 
ATOM   10130 N N   . TYR C 1 355 ? 127.042 165.931 172.232 1.00 113.18 ? 355 TYR C N   1 
ATOM   10131 C CA  . TYR C 1 355 ? 125.721 166.080 171.634 1.00 113.18 ? 355 TYR C CA  1 
ATOM   10132 C C   . TYR C 1 355 ? 125.700 167.162 170.569 1.00 113.18 ? 355 TYR C C   1 
ATOM   10133 O O   . TYR C 1 355 ? 125.052 166.996 169.531 1.00 113.18 ? 355 TYR C O   1 
ATOM   10134 C CB  . TYR C 1 355 ? 124.679 166.355 172.708 1.00 113.18 ? 355 TYR C CB  1 
ATOM   10135 C CG  . TYR C 1 355 ? 124.300 165.113 173.462 1.00 113.18 ? 355 TYR C CG  1 
ATOM   10136 C CD1 . TYR C 1 355 ? 123.404 164.208 172.921 1.00 113.18 ? 355 TYR C CD1 1 
ATOM   10137 C CD2 . TYR C 1 355 ? 124.842 164.838 174.700 1.00 113.18 ? 355 TYR C CD2 1 
ATOM   10138 C CE1 . TYR C 1 355 ? 123.052 163.070 173.595 1.00 113.18 ? 355 TYR C CE1 1 
ATOM   10139 C CE2 . TYR C 1 355 ? 124.497 163.701 175.387 1.00 113.18 ? 355 TYR C CE2 1 
ATOM   10140 C CZ  . TYR C 1 355 ? 123.599 162.821 174.827 1.00 113.18 ? 355 TYR C CZ  1 
ATOM   10141 O OH  . TYR C 1 355 ? 123.241 161.679 175.499 1.00 113.18 ? 355 TYR C OH  1 
ATOM   10142 N N   . ILE C 1 356 ? 126.428 168.260 170.790 1.00 115.37 ? 356 ILE C N   1 
ATOM   10143 C CA  . ILE C 1 356 ? 126.457 169.344 169.813 1.00 115.37 ? 356 ILE C CA  1 
ATOM   10144 C C   . ILE C 1 356 ? 127.188 168.908 168.546 1.00 115.37 ? 356 ILE C C   1 
ATOM   10145 O O   . ILE C 1 356 ? 126.909 169.405 167.453 1.00 115.37 ? 356 ILE C O   1 
ATOM   10146 C CB  . ILE C 1 356 ? 127.065 170.616 170.447 1.00 115.37 ? 356 ILE C CB  1 
ATOM   10147 C CG1 . ILE C 1 356 ? 126.785 171.850 169.589 1.00 115.37 ? 356 ILE C CG1 1 
ATOM   10148 C CG2 . ILE C 1 356 ? 128.559 170.485 170.690 1.00 115.37 ? 356 ILE C CG2 1 
ATOM   10149 C CD1 . ILE C 1 356 ? 125.317 172.215 169.500 1.00 115.37 ? 356 ILE C CD1 1 
ATOM   10150 N N   . LEU C 1 357 ? 128.084 167.933 168.661 1.00 107.21 ? 357 LEU C N   1 
ATOM   10151 C CA  . LEU C 1 357 ? 128.683 167.331 167.482 1.00 107.21 ? 357 LEU C CA  1 
ATOM   10152 C C   . LEU C 1 357 ? 127.696 166.427 166.765 1.00 107.21 ? 357 LEU C C   1 
ATOM   10153 O O   . LEU C 1 357 ? 127.703 166.355 165.533 1.00 107.21 ? 357 LEU C O   1 
ATOM   10154 C CB  . LEU C 1 357 ? 129.944 166.568 167.892 1.00 107.21 ? 357 LEU C CB  1 
ATOM   10155 C CG  . LEU C 1 357 ? 130.864 165.924 166.865 1.00 107.21 ? 357 LEU C CG  1 
ATOM   10156 C CD1 . LEU C 1 357 ? 132.294 166.076 167.310 1.00 107.21 ? 357 LEU C CD1 1 
ATOM   10157 C CD2 . LEU C 1 357 ? 130.550 164.452 166.728 1.00 107.21 ? 357 LEU C CD2 1 
ATOM   10158 N N   . LEU C 1 358 ? 126.834 165.743 167.513 1.00 110.20 ? 358 LEU C N   1 
ATOM   10159 C CA  . LEU C 1 358 ? 125.810 164.923 166.883 1.00 110.20 ? 358 LEU C CA  1 
ATOM   10160 C C   . LEU C 1 358 ? 124.693 165.770 166.292 1.00 110.20 ? 358 LEU C C   1 
ATOM   10161 O O   . LEU C 1 358 ? 124.027 165.341 165.345 1.00 110.20 ? 358 LEU C O   1 
ATOM   10162 C CB  . LEU C 1 358 ? 125.249 163.932 167.893 1.00 110.20 ? 358 LEU C CB  1 
ATOM   10163 C CG  . LEU C 1 358 ? 126.282 162.896 168.315 1.00 110.20 ? 358 LEU C CG  1 
ATOM   10164 C CD1 . LEU C 1 358 ? 125.743 162.017 169.422 1.00 110.20 ? 358 LEU C CD1 1 
ATOM   10165 C CD2 . LEU C 1 358 ? 126.708 162.071 167.115 1.00 110.20 ? 358 LEU C CD2 1 
ATOM   10166 N N   . VAL C 1 359 ? 124.464 166.964 166.840 1.00 108.11 ? 359 VAL C N   1 
ATOM   10167 C CA  . VAL C 1 359 ? 123.534 167.894 166.214 1.00 108.11 ? 359 VAL C CA  1 
ATOM   10168 C C   . VAL C 1 359 ? 124.130 168.440 164.929 1.00 108.11 ? 359 VAL C C   1 
ATOM   10169 O O   . VAL C 1 359 ? 123.420 168.626 163.933 1.00 108.11 ? 359 VAL C O   1 
ATOM   10170 C CB  . VAL C 1 359 ? 123.172 169.009 167.209 1.00 108.11 ? 359 VAL C CB  1 
ATOM   10171 C CG1 . VAL C 1 359 ? 122.367 170.108 166.561 1.00 108.11 ? 359 VAL C CG1 1 
ATOM   10172 C CG2 . VAL C 1 359 ? 122.373 168.430 168.333 1.00 108.11 ? 359 VAL C CG2 1 
ATOM   10173 N N   . THR C 1 360 ? 125.450 168.632 164.912 1.00 110.62 ? 360 THR C N   1 
ATOM   10174 C CA  . THR C 1 360 ? 126.123 169.289 163.798 1.00 110.62 ? 360 THR C CA  1 
ATOM   10175 C C   . THR C 1 360 ? 126.056 168.452 162.534 1.00 110.62 ? 360 THR C C   1 
ATOM   10176 O O   . THR C 1 360 ? 125.750 168.965 161.455 1.00 110.62 ? 360 THR C O   1 
ATOM   10177 C CB  . THR C 1 360 ? 127.579 169.556 164.165 1.00 110.62 ? 360 THR C CB  1 
ATOM   10178 O OG1 . THR C 1 360 ? 127.640 170.268 165.403 1.00 110.62 ? 360 THR C OG1 1 
ATOM   10179 C CG2 . THR C 1 360 ? 128.247 170.393 163.092 1.00 110.62 ? 360 THR C CG2 1 
ATOM   10180 N N   . SER C 1 361 ? 126.331 167.155 162.656 1.00 111.48 ? 361 SER C N   1 
ATOM   10181 C CA  . SER C 1 361 ? 126.285 166.264 161.507 1.00 111.48 ? 361 SER C CA  1 
ATOM   10182 C C   . SER C 1 361 ? 124.880 166.147 160.940 1.00 111.48 ? 361 SER C C   1 
ATOM   10183 O O   . SER C 1 361 ? 124.705 166.198 159.720 1.00 111.48 ? 361 SER C O   1 
ATOM   10184 C CB  . SER C 1 361 ? 126.796 164.886 161.905 1.00 111.48 ? 361 SER C CB  1 
ATOM   10185 O OG  . SER C 1 361 ? 125.927 164.304 162.853 1.00 111.48 ? 361 SER C OG  1 
ATOM   10186 N N   . ASP C 1 362 ? 123.876 166.027 161.809 1.00 120.71 ? 362 ASP C N   1 
ATOM   10187 C CA  . ASP C 1 362 ? 122.491 165.894 161.381 1.00 120.71 ? 362 ASP C CA  1 
ATOM   10188 C C   . ASP C 1 362 ? 121.964 167.133 160.684 1.00 120.71 ? 362 ASP C C   1 
ATOM   10189 O O   . ASP C 1 362 ? 121.053 167.019 159.860 1.00 120.71 ? 362 ASP C O   1 
ATOM   10190 C CB  . ASP C 1 362 ? 121.599 165.575 162.576 1.00 120.71 ? 362 ASP C CB  1 
ATOM   10191 C CG  . ASP C 1 362 ? 121.792 164.170 163.075 1.00 120.71 ? 362 ASP C CG  1 
ATOM   10192 O OD1 . ASP C 1 362 ? 122.132 163.298 162.250 1.00 120.71 ? 362 ASP C OD1 1 
ATOM   10193 O OD2 . ASP C 1 362 ? 121.609 163.937 164.286 1.00 120.71 ? 362 ASP C OD2 1 
ATOM   10194 N N   . VAL C 1 363 ? 122.499 168.307 161.007 1.00 116.53 ? 363 VAL C N   1 
ATOM   10195 C CA  . VAL C 1 363 ? 122.239 169.469 160.174 1.00 116.53 ? 363 VAL C CA  1 
ATOM   10196 C C   . VAL C 1 363 ? 122.823 169.251 158.791 1.00 116.53 ? 363 VAL C C   1 
ATOM   10197 O O   . VAL C 1 363 ? 122.145 169.450 157.782 1.00 116.53 ? 363 VAL C O   1 
ATOM   10198 C CB  . VAL C 1 363 ? 122.796 170.739 160.836 1.00 116.53 ? 363 VAL C CB  1 
ATOM   10199 C CG1 . VAL C 1 363 ? 122.707 171.919 159.889 1.00 116.53 ? 363 VAL C CG1 1 
ATOM   10200 C CG2 . VAL C 1 363 ? 122.032 171.031 162.099 1.00 116.53 ? 363 VAL C CG2 1 
ATOM   10201 N N   . LEU C 1 364 ? 124.065 168.776 158.724 1.00 112.48 ? 364 LEU C N   1 
ATOM   10202 C CA  . LEU C 1 364 ? 124.731 168.607 157.438 1.00 112.48 ? 364 LEU C CA  1 
ATOM   10203 C C   . LEU C 1 364 ? 124.186 167.411 156.676 1.00 112.48 ? 364 LEU C C   1 
ATOM   10204 O O   . LEU C 1 364 ? 124.086 167.453 155.447 1.00 112.48 ? 364 LEU C O   1 
ATOM   10205 C CB  . LEU C 1 364 ? 126.240 168.462 157.635 1.00 112.48 ? 364 LEU C CB  1 
ATOM   10206 C CG  . LEU C 1 364 ? 127.105 169.722 157.632 1.00 112.48 ? 364 LEU C CG  1 
ATOM   10207 C CD1 . LEU C 1 364 ? 126.889 170.594 158.836 1.00 112.48 ? 364 LEU C CD1 1 
ATOM   10208 C CD2 . LEU C 1 364 ? 128.551 169.327 157.562 1.00 112.48 ? 364 LEU C CD2 1 
ATOM   10209 N N   . THR C 1 365 ? 123.824 166.344 157.386 1.00 116.58 ? 365 THR C N   1 
ATOM   10210 C CA  . THR C 1 365 ? 123.468 165.101 156.712 1.00 116.58 ? 365 THR C CA  1 
ATOM   10211 C C   . THR C 1 365 ? 122.131 165.222 156.003 1.00 116.58 ? 365 THR C C   1 
ATOM   10212 O O   . THR C 1 365 ? 122.006 164.863 154.827 1.00 116.58 ? 365 THR C O   1 
ATOM   10213 C CB  . THR C 1 365 ? 123.435 163.948 157.708 1.00 116.58 ? 365 THR C CB  1 
ATOM   10214 O OG1 . THR C 1 365 ? 124.709 163.841 158.350 1.00 116.58 ? 365 THR C OG1 1 
ATOM   10215 C CG2 . THR C 1 365 ? 123.139 162.649 156.998 1.00 116.58 ? 365 THR C CG2 1 
ATOM   10216 N N   . ILE C 1 366 ? 121.120 165.750 156.691 1.00 119.08 ? 366 ILE C N   1 
ATOM   10217 C CA  . ILE C 1 366 ? 119.834 165.891 156.031 1.00 119.08 ? 366 ILE C CA  1 
ATOM   10218 C C   . ILE C 1 366 ? 119.844 167.079 155.077 1.00 119.08 ? 366 ILE C C   1 
ATOM   10219 O O   . ILE C 1 366 ? 119.020 167.131 154.160 1.00 119.08 ? 366 ILE C O   1 
ATOM   10220 C CB  . ILE C 1 366 ? 118.695 165.966 157.062 1.00 119.08 ? 366 ILE C CB  1 
ATOM   10221 C CG1 . ILE C 1 366 ? 117.375 165.548 156.406 1.00 119.08 ? 366 ILE C CG1 1 
ATOM   10222 C CG2 . ILE C 1 366 ? 118.576 167.357 157.646 1.00 119.08 ? 366 ILE C CG2 1 
ATOM   10223 C CD1 . ILE C 1 366 ? 116.290 165.161 157.366 1.00 119.08 ? 366 ILE C CD1 1 
ATOM   10224 N N   . SER C 1 367 ? 120.786 168.013 155.228 1.00 120.45 ? 367 SER C N   1 
ATOM   10225 C CA  . SER C 1 367 ? 121.016 168.983 154.166 1.00 120.45 ? 367 SER C CA  1 
ATOM   10226 C C   . SER C 1 367 ? 121.782 168.365 153.014 1.00 120.45 ? 367 SER C C   1 
ATOM   10227 O O   . SER C 1 367 ? 121.622 168.790 151.865 1.00 120.45 ? 367 SER C O   1 
ATOM   10228 C CB  . SER C 1 367 ? 121.783 170.192 154.692 1.00 120.45 ? 367 SER C CB  1 
ATOM   10229 O OG  . SER C 1 367 ? 122.072 171.108 153.654 1.00 120.45 ? 367 SER C OG  1 
ATOM   10230 N N   . GLY C 1 368 ? 122.618 167.371 153.302 1.00 120.83 ? 368 GLY C N   1 
ATOM   10231 C CA  . GLY C 1 368 ? 123.385 166.745 152.244 1.00 120.83 ? 368 GLY C CA  1 
ATOM   10232 C C   . GLY C 1 368 ? 122.528 165.861 151.365 1.00 120.83 ? 368 GLY C C   1 
ATOM   10233 O O   . GLY C 1 368 ? 122.489 166.033 150.147 1.00 120.83 ? 368 GLY C O   1 
ATOM   10234 N N   . THR C 1 369 ? 121.808 164.920 151.976 1.00 123.13 ? 369 THR C N   1 
ATOM   10235 C CA  . THR C 1 369 ? 121.044 163.952 151.200 1.00 123.13 ? 369 THR C CA  1 
ATOM   10236 C C   . THR C 1 369 ? 119.846 164.570 150.500 1.00 123.13 ? 369 THR C C   1 
ATOM   10237 O O   . THR C 1 369 ? 119.375 164.008 149.510 1.00 123.13 ? 369 THR C O   1 
ATOM   10238 C CB  . THR C 1 369 ? 120.575 162.807 152.090 1.00 123.13 ? 369 THR C CB  1 
ATOM   10239 O OG1 . THR C 1 369 ? 119.798 163.337 153.166 1.00 123.13 ? 369 THR C OG1 1 
ATOM   10240 C CG2 . THR C 1 369 ? 121.756 162.041 152.648 1.00 123.13 ? 369 THR C CG2 1 
ATOM   10241 N N   . ILE C 1 370 ? 119.350 165.714 150.972 1.00 120.22 ? 370 ILE C N   1 
ATOM   10242 C CA  . ILE C 1 370 ? 118.295 166.395 150.235 1.00 120.22 ? 370 ILE C CA  1 
ATOM   10243 C C   . ILE C 1 370 ? 118.860 167.063 148.988 1.00 120.22 ? 370 ILE C C   1 
ATOM   10244 O O   . ILE C 1 370 ? 118.124 167.295 148.022 1.00 120.22 ? 370 ILE C O   1 
ATOM   10245 C CB  . ILE C 1 370 ? 117.560 167.388 151.153 1.00 120.22 ? 370 ILE C CB  1 
ATOM   10246 C CG1 . ILE C 1 370 ? 116.206 167.768 150.574 1.00 120.22 ? 370 ILE C CG1 1 
ATOM   10247 C CG2 . ILE C 1 370 ? 118.348 168.660 151.360 1.00 120.22 ? 370 ILE C CG2 1 
ATOM   10248 C CD1 . ILE C 1 370 ? 115.316 168.457 151.572 1.00 120.22 ? 370 ILE C CD1 1 
ATOM   10249 N N   . MET C 1 371 ? 120.165 167.337 148.966 1.00 127.36 ? 371 MET C N   1 
ATOM   10250 C CA  . MET C 1 371 ? 120.817 167.817 147.761 1.00 127.36 ? 371 MET C CA  1 
ATOM   10251 C C   . MET C 1 371 ? 121.170 166.657 146.851 1.00 127.36 ? 371 MET C C   1 
ATOM   10252 O O   . MET C 1 371 ? 121.234 166.820 145.630 1.00 127.36 ? 371 MET C O   1 
ATOM   10253 C CB  . MET C 1 371 ? 122.071 168.600 148.141 1.00 127.36 ? 371 MET C CB  1 
ATOM   10254 C CG  . MET C 1 371 ? 122.705 169.373 147.021 1.00 127.36 ? 371 MET C CG  1 
ATOM   10255 S SD  . MET C 1 371 ? 121.684 170.759 146.537 1.00 127.36 ? 371 MET C SD  1 
ATOM   10256 C CE  . MET C 1 371 ? 121.929 171.812 147.963 1.00 127.36 ? 371 MET C CE  1 
ATOM   10257 N N   . LYS C 1 372 ? 121.372 165.476 147.437 1.00 122.32 ? 372 LYS C N   1 
ATOM   10258 C CA  . LYS C 1 372 ? 121.684 164.272 146.682 1.00 122.32 ? 372 LYS C CA  1 
ATOM   10259 C C   . LYS C 1 372 ? 120.485 163.779 145.883 1.00 122.32 ? 372 LYS C C   1 
ATOM   10260 O O   . LYS C 1 372 ? 120.663 163.027 144.920 1.00 122.32 ? 372 LYS C O   1 
ATOM   10261 C CB  . LYS C 1 372 ? 122.203 163.207 147.657 1.00 122.32 ? 372 LYS C CB  1 
ATOM   10262 C CG  . LYS C 1 372 ? 122.770 161.921 147.062 1.00 122.32 ? 372 LYS C CG  1 
ATOM   10263 C CD  . LYS C 1 372 ? 121.745 160.797 147.114 1.00 122.32 ? 372 LYS C CD  1 
ATOM   10264 C CE  . LYS C 1 372 ? 122.281 159.505 146.548 1.00 122.32 ? 372 LYS C CE  1 
ATOM   10265 N NZ  . LYS C 1 372 ? 121.242 158.444 146.610 1.00 122.32 ? 372 LYS C NZ  1 
ATOM   10266 N N   . ILE C 1 373 ? 119.273 164.214 146.240 1.00 125.91 ? 373 ILE C N   1 
ATOM   10267 C CA  . ILE C 1 373 ? 118.082 163.913 145.455 1.00 125.91 ? 373 ILE C CA  1 
ATOM   10268 C C   . ILE C 1 373 ? 118.169 164.523 144.062 1.00 125.91 ? 373 ILE C C   1 
ATOM   10269 O O   . ILE C 1 373 ? 117.638 163.955 143.100 1.00 125.91 ? 373 ILE C O   1 
ATOM   10270 C CB  . ILE C 1 373 ? 116.848 164.392 146.240 1.00 125.91 ? 373 ILE C CB  1 
ATOM   10271 C CG1 . ILE C 1 373 ? 116.773 163.651 147.567 1.00 125.91 ? 373 ILE C CG1 1 
ATOM   10272 C CG2 . ILE C 1 373 ? 115.553 164.136 145.499 1.00 125.91 ? 373 ILE C CG2 1 
ATOM   10273 C CD1 . ILE C 1 373 ? 115.747 164.211 148.512 1.00 125.91 ? 373 ILE C CD1 1 
ATOM   10274 N N   . GLY C 1 374 ? 118.917 165.611 143.905 1.00 132.98 ? 374 GLY C N   1 
ATOM   10275 C CA  . GLY C 1 374 ? 119.180 166.188 142.601 1.00 132.98 ? 374 GLY C CA  1 
ATOM   10276 C C   . GLY C 1 374 ? 120.119 165.375 141.727 1.00 132.98 ? 374 GLY C C   1 
ATOM   10277 O O   . GLY C 1 374 ? 121.200 165.839 141.357 1.00 132.98 ? 374 GLY C O   1 
ATOM   10278 N N   . ILE C 1 375 ? 119.726 164.139 141.423 1.00 138.29 ? 375 ILE C N   1 
ATOM   10279 C CA  . ILE C 1 375 ? 120.381 163.341 140.393 1.00 138.29 ? 375 ILE C CA  1 
ATOM   10280 C C   . ILE C 1 375 ? 119.388 162.704 139.427 1.00 138.29 ? 375 ILE C C   1 
ATOM   10281 O O   . ILE C 1 375 ? 119.776 162.279 138.322 1.00 138.29 ? 375 ILE C O   1 
ATOM   10282 C CB  . ILE C 1 375 ? 121.280 162.263 141.048 1.00 138.29 ? 375 ILE C CB  1 
ATOM   10283 C CG1 . ILE C 1 375 ? 122.358 161.754 140.083 1.00 138.29 ? 375 ILE C CG1 1 
ATOM   10284 C CG2 . ILE C 1 375 ? 120.444 161.108 141.582 1.00 138.29 ? 375 ILE C CG2 1 
ATOM   10285 C CD1 . ILE C 1 375 ? 123.456 160.966 140.751 1.00 138.29 ? 375 ILE C CD1 1 
ATOM   10286 N N   . GLU C 1 376 ? 118.093 162.663 139.744 1.00 143.97 ? 376 GLU C N   1 
ATOM   10287 C CA  . GLU C 1 376 ? 117.118 162.084 138.822 1.00 143.97 ? 376 GLU C CA  1 
ATOM   10288 C C   . GLU C 1 376 ? 116.781 163.063 137.704 1.00 143.97 ? 376 GLU C C   1 
ATOM   10289 O O   . GLU C 1 376 ? 117.058 162.804 136.530 1.00 143.97 ? 376 GLU C O   1 
ATOM   10290 C CB  . GLU C 1 376 ? 115.847 161.675 139.575 1.00 143.97 ? 376 GLU C CB  1 
ATOM   10291 C CG  . GLU C 1 376 ? 114.792 161.019 138.687 1.00 143.97 ? 376 GLU C CG  1 
ATOM   10292 C CD  . GLU C 1 376 ? 113.535 160.632 139.444 1.00 143.97 ? 376 GLU C CD  1 
ATOM   10293 O OE1 . GLU C 1 376 ? 113.451 160.922 140.654 1.00 143.97 ? 376 GLU C OE1 1 
ATOM   10294 O OE2 . GLU C 1 376 ? 112.629 160.035 138.828 1.00 143.97 ? 376 GLU C OE2 1 
ATOM   10295 N N   . ALA C 1 377 ? 116.198 164.206 138.059 1.00 141.07 ? 377 ALA C N   1 
ATOM   10296 C CA  . ALA C 1 377 ? 115.674 165.130 137.069 1.00 141.07 ? 377 ALA C CA  1 
ATOM   10297 C C   . ALA C 1 377 ? 116.100 166.568 137.278 1.00 141.07 ? 377 ALA C C   1 
ATOM   10298 O O   . ALA C 1 377 ? 115.796 167.406 136.422 1.00 141.07 ? 377 ALA C O   1 
ATOM   10299 C CB  . ALA C 1 377 ? 114.138 165.077 137.042 1.00 141.07 ? 377 ALA C CB  1 
ATOM   10300 N N   . LYS C 1 378 ? 116.771 166.890 138.374 1.00 139.51 ? 378 LYS C N   1 
ATOM   10301 C CA  . LYS C 1 378 ? 117.183 168.263 138.599 1.00 139.51 ? 378 LYS C CA  1 
ATOM   10302 C C   . LYS C 1 378 ? 118.408 168.560 137.754 1.00 139.51 ? 378 LYS C C   1 
ATOM   10303 O O   . LYS C 1 378 ? 119.332 167.745 137.672 1.00 139.51 ? 378 LYS C O   1 
ATOM   10304 C CB  . LYS C 1 378 ? 117.468 168.510 140.076 1.00 139.51 ? 378 LYS C CB  1 
ATOM   10305 C CG  . LYS C 1 378 ? 117.825 169.948 140.383 1.00 139.51 ? 378 LYS C CG  1 
ATOM   10306 C CD  . LYS C 1 378 ? 116.709 170.918 140.021 1.00 139.51 ? 378 LYS C CD  1 
ATOM   10307 C CE  . LYS C 1 378 ? 115.536 170.816 140.981 1.00 139.51 ? 378 LYS C CE  1 
ATOM   10308 N NZ  . LYS C 1 378 ? 114.492 171.843 140.699 1.00 139.51 ? 378 LYS C NZ  1 
ATOM   10309 N N   . ASN C 1 379 ? 118.411 169.732 137.127 1.00 143.00 ? 379 ASN C N   1 
ATOM   10310 C CA  . ASN C 1 379 ? 119.435 170.138 136.175 1.00 143.00 ? 379 ASN C CA  1 
ATOM   10311 C C   . ASN C 1 379 ? 120.726 170.609 136.837 1.00 143.00 ? 379 ASN C C   1 
ATOM   10312 O O   . ASN C 1 379 ? 121.604 171.121 136.136 1.00 143.00 ? 379 ASN C O   1 
ATOM   10313 C CB  . ASN C 1 379 ? 118.889 171.252 135.274 1.00 143.00 ? 379 ASN C CB  1 
ATOM   10314 C CG  . ASN C 1 379 ? 117.661 170.825 134.494 1.00 143.00 ? 379 ASN C CG  1 
ATOM   10315 O OD1 . ASN C 1 379 ? 116.568 171.355 134.693 1.00 143.00 ? 379 ASN C OD1 1 
ATOM   10316 N ND2 . ASN C 1 379 ? 117.834 169.861 133.600 1.00 143.00 ? 379 ASN C ND2 1 
ATOM   10317 N N   . LEU C 1 380 ? 120.864 170.471 138.151 1.00 132.21 ? 380 LEU C N   1 
ATOM   10318 C CA  . LEU C 1 380 ? 122.095 170.881 138.801 1.00 132.21 ? 380 LEU C CA  1 
ATOM   10319 C C   . LEU C 1 380 ? 123.218 169.916 138.457 1.00 132.21 ? 380 LEU C C   1 
ATOM   10320 O O   . LEU C 1 380 ? 123.010 168.704 138.359 1.00 132.21 ? 380 LEU C O   1 
ATOM   10321 C CB  . LEU C 1 380 ? 121.907 170.966 140.321 1.00 132.21 ? 380 LEU C CB  1 
ATOM   10322 C CG  . LEU C 1 380 ? 121.437 169.810 141.223 1.00 132.21 ? 380 LEU C CG  1 
ATOM   10323 C CD1 . LEU C 1 380 ? 122.537 168.841 141.645 1.00 132.21 ? 380 LEU C CD1 1 
ATOM   10324 C CD2 . LEU C 1 380 ? 120.801 170.394 142.471 1.00 132.21 ? 380 LEU C CD2 1 
ATOM   10325 N N   . ALA C 1 381 ? 124.409 170.464 138.260 1.00 121.12 ? 381 ALA C N   1 
ATOM   10326 C CA  . ALA C 1 381 ? 125.629 169.677 138.183 1.00 121.12 ? 381 ALA C CA  1 
ATOM   10327 C C   . ALA C 1 381 ? 126.493 169.899 139.416 1.00 121.12 ? 381 ALA C C   1 
ATOM   10328 O O   . ALA C 1 381 ? 127.711 169.714 139.375 1.00 121.12 ? 381 ALA C O   1 
ATOM   10329 C CB  . ALA C 1 381 ? 126.408 170.007 136.912 1.00 121.12 ? 381 ALA C CB  1 
ATOM   10330 N N   . SER C 1 382 ? 125.867 170.281 140.528 1.00 116.63 ? 382 SER C N   1 
ATOM   10331 C CA  . SER C 1 382 ? 126.579 170.719 141.729 1.00 116.63 ? 382 SER C CA  1 
ATOM   10332 C C   . SER C 1 382 ? 127.141 169.516 142.485 1.00 116.63 ? 382 SER C C   1 
ATOM   10333 O O   . SER C 1 382 ? 126.750 169.199 143.608 1.00 116.63 ? 382 SER C O   1 
ATOM   10334 C CB  . SER C 1 382 ? 125.654 171.542 142.614 1.00 116.63 ? 382 SER C CB  1 
ATOM   10335 O OG  . SER C 1 382 ? 126.296 171.918 143.818 1.00 116.63 ? 382 SER C OG  1 
ATOM   10336 N N   . TYR C 1 383 ? 128.119 168.866 141.864 1.00 103.91 ? 383 TYR C N   1 
ATOM   10337 C CA  . TYR C 1 383 ? 128.761 167.693 142.428 1.00 103.91 ? 383 TYR C CA  1 
ATOM   10338 C C   . TYR C 1 383 ? 129.881 168.029 143.394 1.00 103.91 ? 383 TYR C C   1 
ATOM   10339 O O   . TYR C 1 383 ? 130.714 167.166 143.680 1.00 103.91 ? 383 TYR C O   1 
ATOM   10340 C CB  . TYR C 1 383 ? 129.288 166.803 141.311 1.00 103.91 ? 383 TYR C CB  1 
ATOM   10341 C CG  . TYR C 1 383 ? 128.244 165.901 140.718 1.00 103.91 ? 383 TYR C CG  1 
ATOM   10342 C CD1 . TYR C 1 383 ? 127.083 165.599 141.417 1.00 103.91 ? 383 TYR C CD1 1 
ATOM   10343 C CD2 . TYR C 1 383 ? 128.418 165.340 139.465 1.00 103.91 ? 383 TYR C CD2 1 
ATOM   10344 C CE1 . TYR C 1 383 ? 126.128 164.760 140.887 1.00 103.91 ? 383 TYR C CE1 1 
ATOM   10345 C CE2 . TYR C 1 383 ? 127.466 164.503 138.924 1.00 103.91 ? 383 TYR C CE2 1 
ATOM   10346 C CZ  . TYR C 1 383 ? 126.324 164.218 139.639 1.00 103.91 ? 383 TYR C CZ  1 
ATOM   10347 O OH  . TYR C 1 383 ? 125.375 163.384 139.102 1.00 103.91 ? 383 TYR C OH  1 
ATOM   10348 N N   . ASP C 1 384 ? 129.927 169.254 143.901 1.00 103.88 ? 384 ASP C N   1 
ATOM   10349 C CA  . ASP C 1 384 ? 130.894 169.623 144.920 1.00 103.88 ? 384 ASP C CA  1 
ATOM   10350 C C   . ASP C 1 384 ? 130.221 169.946 146.243 1.00 103.88 ? 384 ASP C C   1 
ATOM   10351 O O   . ASP C 1 384 ? 130.671 169.491 147.297 1.00 103.88 ? 384 ASP C O   1 
ATOM   10352 C CB  . ASP C 1 384 ? 131.724 170.816 144.444 1.00 103.88 ? 384 ASP C CB  1 
ATOM   10353 C CG  . ASP C 1 384 ? 132.616 170.471 143.272 1.00 103.88 ? 384 ASP C CG  1 
ATOM   10354 O OD1 . ASP C 1 384 ? 133.022 169.298 143.159 1.00 103.88 ? 384 ASP C OD1 1 
ATOM   10355 O OD2 . ASP C 1 384 ? 132.917 171.371 142.463 1.00 103.88 ? 384 ASP C OD2 1 
ATOM   10356 N N   . VAL C 1 385 ? 129.136 170.716 146.196 1.00 104.00 ? 385 VAL C N   1 
ATOM   10357 C CA  . VAL C 1 385 ? 128.422 171.102 147.404 1.00 104.00 ? 385 VAL C CA  1 
ATOM   10358 C C   . VAL C 1 385 ? 127.729 169.905 148.032 1.00 104.00 ? 385 VAL C C   1 
ATOM   10359 O O   . VAL C 1 385 ? 127.758 169.739 149.254 1.00 104.00 ? 385 VAL C O   1 
ATOM   10360 C CB  . VAL C 1 385 ? 127.429 172.223 147.067 1.00 104.00 ? 385 VAL C CB  1 
ATOM   10361 C CG1 . VAL C 1 385 ? 126.656 172.643 148.284 1.00 104.00 ? 385 VAL C CG1 1 
ATOM   10362 C CG2 . VAL C 1 385 ? 128.165 173.397 146.483 1.00 104.00 ? 385 VAL C CG2 1 
ATOM   10363 N N   . CYS C 1 386 ? 127.142 169.032 147.225 1.00 109.04 ? 386 CYS C N   1 
ATOM   10364 C CA  . CYS C 1 386 ? 126.514 167.834 147.758 1.00 109.04 ? 386 CYS C CA  1 
ATOM   10365 C C   . CYS C 1 386 ? 127.519 166.809 148.248 1.00 109.04 ? 386 CYS C C   1 
ATOM   10366 O O   . CYS C 1 386 ? 127.141 165.902 148.993 1.00 109.04 ? 386 CYS C O   1 
ATOM   10367 C CB  . CYS C 1 386 ? 125.624 167.183 146.703 1.00 109.04 ? 386 CYS C CB  1 
ATOM   10368 S SG  . CYS C 1 386 ? 126.524 166.485 145.317 1.00 109.04 ? 386 CYS C SG  1 
ATOM   10369 N N   . SER C 1 387 ? 128.780 166.926 147.855 1.00 97.74  ? 387 SER C N   1 
ATOM   10370 C CA  . SER C 1 387 ? 129.800 165.961 148.220 1.00 97.74  ? 387 SER C CA  1 
ATOM   10371 C C   . SER C 1 387 ? 130.546 166.330 149.480 1.00 97.74  ? 387 SER C C   1 
ATOM   10372 O O   . SER C 1 387 ? 130.904 165.444 150.250 1.00 97.74  ? 387 SER C O   1 
ATOM   10373 C CB  . SER C 1 387 ? 130.810 165.817 147.089 1.00 97.74  ? 387 SER C CB  1 
ATOM   10374 O OG  . SER C 1 387 ? 131.512 167.032 146.931 1.00 97.74  ? 387 SER C OG  1 
ATOM   10375 N N   . ILE C 1 388 ? 130.804 167.618 149.693 1.00 91.84  ? 388 ILE C N   1 
ATOM   10376 C CA  . ILE C 1 388 ? 131.519 168.043 150.888 1.00 91.84  ? 388 ILE C CA  1 
ATOM   10377 C C   . ILE C 1 388 ? 130.655 167.839 152.122 1.00 91.84  ? 388 ILE C C   1 
ATOM   10378 O O   . ILE C 1 388 ? 131.147 167.417 153.173 1.00 91.84  ? 388 ILE C O   1 
ATOM   10379 C CB  . ILE C 1 388 ? 131.985 169.501 150.729 1.00 91.84  ? 388 ILE C CB  1 
ATOM   10380 C CG1 . ILE C 1 388 ? 133.031 169.584 149.629 1.00 91.84  ? 388 ILE C CG1 1 
ATOM   10381 C CG2 . ILE C 1 388 ? 132.583 170.050 151.999 1.00 91.84  ? 388 ILE C CG2 1 
ATOM   10382 C CD1 . ILE C 1 388 ? 133.436 170.975 149.300 1.00 91.84  ? 388 ILE C CD1 1 
ATOM   10383 N N   . LEU C 1 389 ? 129.348 168.069 151.996 1.00 95.39  ? 389 LEU C N   1 
ATOM   10384 C CA  . LEU C 1 389 ? 128.447 167.930 153.133 1.00 95.39  ? 389 LEU C CA  1 
ATOM   10385 C C   . LEU C 1 389 ? 128.319 166.487 153.589 1.00 95.39  ? 389 LEU C C   1 
ATOM   10386 O O   . LEU C 1 389 ? 128.260 166.224 154.792 1.00 95.39  ? 389 LEU C O   1 
ATOM   10387 C CB  . LEU C 1 389 ? 127.075 168.478 152.770 1.00 95.39  ? 389 LEU C CB  1 
ATOM   10388 C CG  . LEU C 1 389 ? 127.040 169.968 152.473 1.00 95.39  ? 389 LEU C CG  1 
ATOM   10389 C CD1 . LEU C 1 389 ? 125.675 170.355 151.978 1.00 95.39  ? 389 LEU C CD1 1 
ATOM   10390 C CD2 . LEU C 1 389 ? 127.397 170.748 153.709 1.00 95.39  ? 389 LEU C CD2 1 
ATOM   10391 N N   . LEU C 1 390 ? 128.299 165.546 152.652 1.00 93.05  ? 390 LEU C N   1 
ATOM   10392 C CA  . LEU C 1 390 ? 128.167 164.145 153.025 1.00 93.05  ? 390 LEU C CA  1 
ATOM   10393 C C   . LEU C 1 390 ? 129.456 163.602 153.616 1.00 93.05  ? 390 LEU C C   1 
ATOM   10394 O O   . LEU C 1 390 ? 129.425 162.807 154.560 1.00 93.05  ? 390 LEU C O   1 
ATOM   10395 C CB  . LEU C 1 390 ? 127.750 163.324 151.813 1.00 93.05  ? 390 LEU C CB  1 
ATOM   10396 C CG  . LEU C 1 390 ? 126.331 163.611 151.353 1.00 93.05  ? 390 LEU C CG  1 
ATOM   10397 C CD1 . LEU C 1 390 ? 126.050 162.926 150.046 1.00 93.05  ? 390 LEU C CD1 1 
ATOM   10398 C CD2 . LEU C 1 390 ? 125.392 163.109 152.414 1.00 93.05  ? 390 LEU C CD2 1 
ATOM   10399 N N   . GLY C 1 391 ? 130.598 164.016 153.076 1.00 88.11  ? 391 GLY C N   1 
ATOM   10400 C CA  . GLY C 1 391 ? 131.858 163.512 153.584 1.00 88.11  ? 391 GLY C CA  1 
ATOM   10401 C C   . GLY C 1 391 ? 132.200 164.073 154.948 1.00 88.11  ? 391 GLY C C   1 
ATOM   10402 O O   . GLY C 1 391 ? 132.647 163.338 155.832 1.00 88.11  ? 391 GLY C O   1 
ATOM   10403 N N   . THR C 1 392 ? 131.975 165.374 155.145 1.00 86.16  ? 392 THR C N   1 
ATOM   10404 C CA  . THR C 1 392 ? 132.272 166.009 156.423 1.00 86.16  ? 392 THR C CA  1 
ATOM   10405 C C   . THR C 1 392 ? 131.348 165.509 157.519 1.00 86.16  ? 392 THR C C   1 
ATOM   10406 O O   . THR C 1 392 ? 131.757 165.454 158.680 1.00 86.16  ? 392 THR C O   1 
ATOM   10407 C CB  . THR C 1 392 ? 132.163 167.524 156.279 1.00 86.16  ? 392 THR C CB  1 
ATOM   10408 O OG1 . THR C 1 392 ? 132.920 167.930 155.138 1.00 86.16  ? 392 THR C OG1 1 
ATOM   10409 C CG2 . THR C 1 392 ? 132.744 168.234 157.476 1.00 86.16  ? 392 THR C CG2 1 
ATOM   10410 N N   . SER C 1 393 ? 130.130 165.106 157.166 1.00 89.50  ? 393 SER C N   1 
ATOM   10411 C CA  . SER C 1 393 ? 129.274 164.426 158.128 1.00 89.50  ? 393 SER C CA  1 
ATOM   10412 C C   . SER C 1 393 ? 129.886 163.100 158.547 1.00 89.50  ? 393 SER C C   1 
ATOM   10413 O O   . SER C 1 393 ? 130.065 162.838 159.740 1.00 89.50  ? 393 SER C O   1 
ATOM   10414 C CB  . SER C 1 393 ? 127.894 164.192 157.531 1.00 89.50  ? 393 SER C CB  1 
ATOM   10415 O OG  . SER C 1 393 ? 127.960 163.196 156.531 1.00 89.50  ? 393 SER C OG  1 
ATOM   10416 N N   . THR C 1 394 ? 130.257 162.276 157.567 1.00 87.08  ? 394 THR C N   1 
ATOM   10417 C CA  . THR C 1 394 ? 130.776 160.943 157.844 1.00 87.08  ? 394 THR C CA  1 
ATOM   10418 C C   . THR C 1 394 ? 132.132 161.000 158.527 1.00 87.08  ? 394 THR C C   1 
ATOM   10419 O O   . THR C 1 394 ? 132.440 160.152 159.372 1.00 87.08  ? 394 THR C O   1 
ATOM   10420 C CB  . THR C 1 394 ? 130.855 160.176 156.535 1.00 87.08  ? 394 THR C CB  1 
ATOM   10421 O OG1 . THR C 1 394 ? 129.563 160.193 155.928 1.00 87.08  ? 394 THR C OG1 1 
ATOM   10422 C CG2 . THR C 1 394 ? 131.261 158.736 156.745 1.00 87.08  ? 394 THR C CG2 1 
ATOM   10423 N N   . LEU C 1 395 ? 132.929 162.018 158.207 1.00 80.02  ? 395 LEU C N   1 
ATOM   10424 C CA  . LEU C 1 395 ? 134.156 162.282 158.947 1.00 80.02  ? 395 LEU C CA  1 
ATOM   10425 C C   . LEU C 1 395 ? 133.871 162.606 160.404 1.00 80.02  ? 395 LEU C C   1 
ATOM   10426 O O   . LEU C 1 395 ? 134.667 162.275 161.288 1.00 80.02  ? 395 LEU C O   1 
ATOM   10427 C CB  . LEU C 1 395 ? 134.908 163.430 158.276 1.00 80.02  ? 395 LEU C CB  1 
ATOM   10428 C CG  . LEU C 1 395 ? 136.176 163.951 158.921 1.00 80.02  ? 395 LEU C CG  1 
ATOM   10429 C CD1 . LEU C 1 395 ? 137.156 162.827 159.038 1.00 80.02  ? 395 LEU C CD1 1 
ATOM   10430 C CD2 . LEU C 1 395 ? 136.756 165.077 158.095 1.00 80.02  ? 395 LEU C CD2 1 
ATOM   10431 N N   . LEU C 1 396 ? 132.724 163.210 160.674 1.00 85.39  ? 396 LEU C N   1 
ATOM   10432 C CA  . LEU C 1 396 ? 132.367 163.661 162.001 1.00 85.39  ? 396 LEU C CA  1 
ATOM   10433 C C   . LEU C 1 396 ? 131.330 162.772 162.668 1.00 85.39  ? 396 LEU C C   1 
ATOM   10434 O O   . LEU C 1 396 ? 131.138 162.875 163.880 1.00 85.39  ? 396 LEU C O   1 
ATOM   10435 C CB  . LEU C 1 396 ? 131.881 165.110 161.903 1.00 85.39  ? 396 LEU C CB  1 
ATOM   10436 C CG  . LEU C 1 396 ? 131.572 166.047 163.045 1.00 85.39  ? 396 LEU C CG  1 
ATOM   10437 C CD1 . LEU C 1 396 ? 132.006 167.422 162.627 1.00 85.39  ? 396 LEU C CD1 1 
ATOM   10438 C CD2 . LEU C 1 396 ? 130.090 166.042 163.248 1.00 85.39  ? 396 LEU C CD2 1 
ATOM   10439 N N   . VAL C 1 397 ? 130.671 161.892 161.919 1.00 85.62  ? 397 VAL C N   1 
ATOM   10440 C CA  . VAL C 1 397 ? 129.863 160.857 162.550 1.00 85.62  ? 397 VAL C CA  1 
ATOM   10441 C C   . VAL C 1 397 ? 130.750 159.793 163.173 1.00 85.62  ? 397 VAL C C   1 
ATOM   10442 O O   . VAL C 1 397 ? 130.566 159.426 164.338 1.00 85.62  ? 397 VAL C O   1 
ATOM   10443 C CB  . VAL C 1 397 ? 128.879 160.256 161.533 1.00 85.62  ? 397 VAL C CB  1 
ATOM   10444 C CG1 . VAL C 1 397 ? 128.308 158.968 162.041 1.00 85.62  ? 397 VAL C CG1 1 
ATOM   10445 C CG2 . VAL C 1 397 ? 127.735 161.214 161.295 1.00 85.62  ? 397 VAL C CG2 1 
ATOM   10446 N N   . TRP C 1 398 ? 131.737 159.305 162.421 1.00 82.93  ? 398 TRP C N   1 
ATOM   10447 C CA  . TRP C 1 398 ? 132.629 158.248 162.883 1.00 82.93  ? 398 TRP C CA  1 
ATOM   10448 C C   . TRP C 1 398 ? 133.496 158.641 164.063 1.00 82.93  ? 398 TRP C C   1 
ATOM   10449 O O   . TRP C 1 398 ? 133.868 157.760 164.835 1.00 82.93  ? 398 TRP C O   1 
ATOM   10450 C CB  . TRP C 1 398 ? 133.520 157.774 161.747 1.00 82.93  ? 398 TRP C CB  1 
ATOM   10451 C CG  . TRP C 1 398 ? 132.889 156.757 160.901 1.00 82.93  ? 398 TRP C CG  1 
ATOM   10452 C CD1 . TRP C 1 398 ? 132.138 156.964 159.798 1.00 82.93  ? 398 TRP C CD1 1 
ATOM   10453 C CD2 . TRP C 1 398 ? 132.989 155.345 161.062 1.00 82.93  ? 398 TRP C CD2 1 
ATOM   10454 N NE1 . TRP C 1 398 ? 131.736 155.766 159.266 1.00 82.93  ? 398 TRP C NE1 1 
ATOM   10455 C CE2 . TRP C 1 398 ? 132.253 154.755 160.031 1.00 82.93  ? 398 TRP C CE2 1 
ATOM   10456 C CE3 . TRP C 1 398 ? 133.626 154.520 161.989 1.00 82.93  ? 398 TRP C CE3 1 
ATOM   10457 C CZ2 . TRP C 1 398 ? 132.136 153.383 159.896 1.00 82.93  ? 398 TRP C CZ2 1 
ATOM   10458 C CZ3 . TRP C 1 398 ? 133.507 153.167 161.853 1.00 82.93  ? 398 TRP C CZ3 1 
ATOM   10459 C CH2 . TRP C 1 398 ? 132.767 152.608 160.813 1.00 82.93  ? 398 TRP C CH2 1 
ATOM   10460 N N   . VAL C 1 399 ? 133.817 159.920 164.258 1.00 86.76  ? 399 VAL C N   1 
ATOM   10461 C CA  . VAL C 1 399 ? 134.551 160.281 165.469 1.00 86.76  ? 399 VAL C CA  1 
ATOM   10462 C C   . VAL C 1 399 ? 133.676 160.227 166.706 1.00 86.76  ? 399 VAL C C   1 
ATOM   10463 O O   . VAL C 1 399 ? 134.204 160.223 167.824 1.00 86.76  ? 399 VAL C O   1 
ATOM   10464 C CB  . VAL C 1 399 ? 135.190 161.678 165.390 1.00 86.76  ? 399 VAL C CB  1 
ATOM   10465 C CG1 . VAL C 1 399 ? 136.186 161.737 164.267 1.00 86.76  ? 399 VAL C CG1 1 
ATOM   10466 C CG2 . VAL C 1 399 ? 134.141 162.724 165.204 1.00 86.76  ? 399 VAL C CG2 1 
ATOM   10467 N N   . GLY C 1 400 ? 132.355 160.155 166.546 1.00 91.28  ? 400 GLY C N   1 
ATOM   10468 C CA  . GLY C 1 400 ? 131.479 160.029 167.693 1.00 91.28  ? 400 GLY C CA  1 
ATOM   10469 C C   . GLY C 1 400 ? 131.508 158.662 168.337 1.00 91.28  ? 400 GLY C C   1 
ATOM   10470 O O   . GLY C 1 400 ? 130.973 158.483 169.432 1.00 91.28  ? 400 GLY C O   1 
ATOM   10471 N N   . VAL C 1 401 ? 132.134 157.688 167.674 1.00 90.70  ? 401 VAL C N   1 
ATOM   10472 C CA  . VAL C 1 401 ? 132.282 156.348 168.221 1.00 90.70  ? 401 VAL C CA  1 
ATOM   10473 C C   . VAL C 1 401 ? 133.204 156.346 169.429 1.00 90.70  ? 401 VAL C C   1 
ATOM   10474 O O   . VAL C 1 401 ? 133.048 155.513 170.330 1.00 90.70  ? 401 VAL C O   1 
ATOM   10475 C CB  . VAL C 1 401 ? 132.776 155.428 167.090 1.00 90.70  ? 401 VAL C CB  1 
ATOM   10476 C CG1 . VAL C 1 401 ? 133.008 154.004 167.546 1.00 90.70  ? 401 VAL C CG1 1 
ATOM   10477 C CG2 . VAL C 1 401 ? 131.768 155.436 165.976 1.00 90.70  ? 401 VAL C CG2 1 
ATOM   10478 N N   . ILE C 1 402 ? 134.113 157.322 169.508 1.00 98.34  ? 402 ILE C N   1 
ATOM   10479 C CA  . ILE C 1 402 ? 135.101 157.395 170.581 1.00 98.34  ? 402 ILE C CA  1 
ATOM   10480 C C   . ILE C 1 402 ? 134.430 157.604 171.933 1.00 98.34  ? 402 ILE C C   1 
ATOM   10481 O O   . ILE C 1 402 ? 134.957 157.175 172.968 1.00 98.34  ? 402 ILE C O   1 
ATOM   10482 C CB  . ILE C 1 402 ? 136.109 158.512 170.262 1.00 98.34  ? 402 ILE C CB  1 
ATOM   10483 C CG1 . ILE C 1 402 ? 136.696 158.287 168.883 1.00 98.34  ? 402 ILE C CG1 1 
ATOM   10484 C CG2 . ILE C 1 402 ? 137.272 158.506 171.216 1.00 98.34  ? 402 ILE C CG2 1 
ATOM   10485 C CD1 . ILE C 1 402 ? 137.485 159.449 168.398 1.00 98.34  ? 402 ILE C CD1 1 
ATOM   10486 N N   . ARG C 1 403 ? 133.240 158.217 171.935 1.00 103.42 ? 403 ARG C N   1 
ATOM   10487 C CA  . ARG C 1 403 ? 132.442 158.350 173.149 1.00 103.42 ? 403 ARG C CA  1 
ATOM   10488 C C   . ARG C 1 403 ? 132.118 156.991 173.752 1.00 103.42 ? 403 ARG C C   1 
ATOM   10489 O O   . ARG C 1 403 ? 132.165 156.815 174.975 1.00 103.42 ? 403 ARG C O   1 
ATOM   10490 C CB  . ARG C 1 403 ? 131.152 159.100 172.844 1.00 103.42 ? 403 ARG C CB  1 
ATOM   10491 C CG  . ARG C 1 403 ? 130.295 159.293 174.060 1.00 103.42 ? 403 ARG C CG  1 
ATOM   10492 C CD  . ARG C 1 403 ? 128.978 159.937 173.740 1.00 103.42 ? 403 ARG C CD  1 
ATOM   10493 N NE  . ARG C 1 403 ? 128.156 160.005 174.939 1.00 103.42 ? 403 ARG C NE  1 
ATOM   10494 C CZ  . ARG C 1 403 ? 126.929 160.499 174.977 1.00 103.42 ? 403 ARG C CZ  1 
ATOM   10495 N NH1 . ARG C 1 403 ? 126.369 160.967 173.873 1.00 103.42 ? 403 ARG C NH1 1 
ATOM   10496 N NH2 . ARG C 1 403 ? 126.262 160.523 176.120 1.00 103.42 ? 403 ARG C NH2 1 
ATOM   10497 N N   . TYR C 1 404 ? 131.854 156.002 172.902 1.00 102.88 ? 404 TYR C N   1 
ATOM   10498 C CA  . TYR C 1 404 ? 131.497 154.680 173.403 1.00 102.88 ? 404 TYR C CA  1 
ATOM   10499 C C   . TYR C 1 404 ? 132.724 153.969 173.944 1.00 102.88 ? 404 TYR C C   1 
ATOM   10500 O O   . TYR C 1 404 ? 132.614 153.068 174.779 1.00 102.88 ? 404 TYR C O   1 
ATOM   10501 C CB  . TYR C 1 404 ? 130.843 153.859 172.293 1.00 102.88 ? 404 TYR C CB  1 
ATOM   10502 C CG  . TYR C 1 404 ? 129.572 154.472 171.759 1.00 102.88 ? 404 TYR C CG  1 
ATOM   10503 C CD1 . TYR C 1 404 ? 128.809 155.335 172.537 1.00 102.88 ? 404 TYR C CD1 1 
ATOM   10504 C CD2 . TYR C 1 404 ? 129.174 154.246 170.450 1.00 102.88 ? 404 TYR C CD2 1 
ATOM   10505 C CE1 . TYR C 1 404 ? 127.682 155.923 172.045 1.00 102.88 ? 404 TYR C CE1 1 
ATOM   10506 C CE2 . TYR C 1 404 ? 128.037 154.833 169.947 1.00 102.88 ? 404 TYR C CE2 1 
ATOM   10507 C CZ  . TYR C 1 404 ? 127.299 155.672 170.755 1.00 102.88 ? 404 TYR C CZ  1 
ATOM   10508 O OH  . TYR C 1 404 ? 126.162 156.267 170.286 1.00 102.88 ? 404 TYR C OH  1 
ATOM   10509 N N   . LEU C 1 405 ? 133.906 154.374 173.491 1.00 98.74  ? 405 LEU C N   1 
ATOM   10510 C CA  . LEU C 1 405 ? 135.124 153.789 174.026 1.00 98.74  ? 405 LEU C CA  1 
ATOM   10511 C C   . LEU C 1 405 ? 135.451 154.377 175.387 1.00 98.74  ? 405 LEU C C   1 
ATOM   10512 O O   . LEU C 1 405 ? 136.065 153.710 176.222 1.00 98.74  ? 405 LEU C O   1 
ATOM   10513 C CB  . LEU C 1 405 ? 136.284 153.985 173.049 1.00 98.74  ? 405 LEU C CB  1 
ATOM   10514 C CG  . LEU C 1 405 ? 136.431 152.980 171.893 1.00 98.74  ? 405 LEU C CG  1 
ATOM   10515 C CD1 . LEU C 1 405 ? 135.411 153.165 170.790 1.00 98.74  ? 405 LEU C CD1 1 
ATOM   10516 C CD2 . LEU C 1 405 ? 137.819 153.034 171.304 1.00 98.74  ? 405 LEU C CD2 1 
ATOM   10517 N N   . THR C 1 406 ? 135.005 155.608 175.652 1.00 100.41 ? 406 THR C N   1 
ATOM   10518 C CA  . THR C 1 406 ? 135.289 156.235 176.939 1.00 100.41 ? 406 THR C CA  1 
ATOM   10519 C C   . THR C 1 406 ? 134.428 155.690 178.067 1.00 100.41 ? 406 THR C C   1 
ATOM   10520 O O   . THR C 1 406 ? 134.634 156.063 179.225 1.00 100.41 ? 406 THR C O   1 
ATOM   10521 C CB  . THR C 1 406 ? 135.095 157.741 176.857 1.00 100.41 ? 406 THR C CB  1 
ATOM   10522 O OG1 . THR C 1 406 ? 133.748 158.016 176.469 1.00 100.41 ? 406 THR C OG1 1 
ATOM   10523 C CG2 . THR C 1 406 ? 136.039 158.337 175.853 1.00 100.41 ? 406 THR C CG2 1 
ATOM   10524 N N   . PHE C 1 407 ? 133.464 154.826 177.764 1.00 107.58 ? 407 PHE C N   1 
ATOM   10525 C CA  . PHE C 1 407 ? 132.685 154.194 178.817 1.00 107.58 ? 407 PHE C CA  1 
ATOM   10526 C C   . PHE C 1 407 ? 133.483 153.117 179.529 1.00 107.58 ? 407 PHE C C   1 
ATOM   10527 O O   . PHE C 1 407 ? 133.128 152.710 180.638 1.00 107.58 ? 407 PHE C O   1 
ATOM   10528 C CB  . PHE C 1 407 ? 131.406 153.619 178.225 1.00 107.58 ? 407 PHE C CB  1 
ATOM   10529 C CG  . PHE C 1 407 ? 130.421 154.664 177.822 1.00 107.58 ? 407 PHE C CG  1 
ATOM   10530 C CD1 . PHE C 1 407 ? 130.441 155.915 178.420 1.00 107.58 ? 407 PHE C CD1 1 
ATOM   10531 C CD2 . PHE C 1 407 ? 129.510 154.421 176.814 1.00 107.58 ? 407 PHE C CD2 1 
ATOM   10532 C CE1 . PHE C 1 407 ? 129.543 156.891 178.050 1.00 107.58 ? 407 PHE C CE1 1 
ATOM   10533 C CE2 . PHE C 1 407 ? 128.615 155.396 176.431 1.00 107.58 ? 407 PHE C CE2 1 
ATOM   10534 C CZ  . PHE C 1 407 ? 128.632 156.634 177.052 1.00 107.58 ? 407 PHE C CZ  1 
ATOM   10535 N N   . PHE C 1 408 ? 134.557 152.641 178.914 1.00 107.10 ? 408 PHE C N   1 
ATOM   10536 C CA  . PHE C 1 408 ? 135.386 151.631 179.549 1.00 107.10 ? 408 PHE C CA  1 
ATOM   10537 C C   . PHE C 1 408 ? 136.512 152.296 180.333 1.00 107.10 ? 408 PHE C C   1 
ATOM   10538 O O   . PHE C 1 408 ? 136.977 153.385 179.993 1.00 107.10 ? 408 PHE C O   1 
ATOM   10539 C CB  . PHE C 1 408 ? 135.962 150.680 178.508 1.00 107.10 ? 408 PHE C CB  1 
ATOM   10540 C CG  . PHE C 1 408 ? 134.934 149.836 177.820 1.00 107.10 ? 408 PHE C CG  1 
ATOM   10541 C CD1 . PHE C 1 408 ? 133.684 149.632 178.375 1.00 107.10 ? 408 PHE C CD1 1 
ATOM   10542 C CD2 . PHE C 1 408 ? 135.219 149.258 176.595 1.00 107.10 ? 408 PHE C CD2 1 
ATOM   10543 C CE1 . PHE C 1 408 ? 132.747 148.863 177.727 1.00 107.10 ? 408 PHE C CE1 1 
ATOM   10544 C CE2 . PHE C 1 408 ? 134.286 148.486 175.939 1.00 107.10 ? 408 PHE C CE2 1 
ATOM   10545 C CZ  . PHE C 1 408 ? 133.048 148.288 176.505 1.00 107.10 ? 408 PHE C CZ  1 
ATOM   10546 N N   . HIS C 1 409 ? 136.957 151.622 181.389 1.00 100.31 ? 409 HIS C N   1 
ATOM   10547 C CA  . HIS C 1 409 ? 137.888 152.241 182.319 1.00 100.31 ? 409 HIS C CA  1 
ATOM   10548 C C   . HIS C 1 409 ? 139.305 152.299 181.784 1.00 100.31 ? 409 HIS C C   1 
ATOM   10549 O O   . HIS C 1 409 ? 140.111 153.083 182.291 1.00 100.31 ? 409 HIS C O   1 
ATOM   10550 C CB  . HIS C 1 409 ? 137.870 151.483 183.637 1.00 100.31 ? 409 HIS C CB  1 
ATOM   10551 C CG  . HIS C 1 409 ? 136.520 151.434 184.274 1.00 100.31 ? 409 HIS C CG  1 
ATOM   10552 N ND1 . HIS C 1 409 ? 135.954 152.521 184.901 1.00 100.31 ? 409 HIS C ND1 1 
ATOM   10553 C CD2 . HIS C 1 409 ? 135.617 150.430 184.372 1.00 100.31 ? 409 HIS C CD2 1 
ATOM   10554 C CE1 . HIS C 1 409 ? 134.763 152.188 185.364 1.00 100.31 ? 409 HIS C CE1 1 
ATOM   10555 N NE2 . HIS C 1 409 ? 134.535 150.924 185.057 1.00 100.31 ? 409 HIS C NE2 1 
ATOM   10556 N N   . ASN C 1 410 ? 139.626 151.490 180.784 1.00 101.47 ? 410 ASN C N   1 
ATOM   10557 C CA  . ASN C 1 410 ? 140.966 151.475 180.219 1.00 101.47 ? 410 ASN C CA  1 
ATOM   10558 C C   . ASN C 1 410 ? 141.149 152.539 179.150 1.00 101.47 ? 410 ASN C C   1 
ATOM   10559 O O   . ASN C 1 410 ? 142.142 153.271 179.169 1.00 101.47 ? 410 ASN C O   1 
ATOM   10560 C CB  . ASN C 1 410 ? 141.262 150.102 179.622 1.00 101.47 ? 410 ASN C CB  1 
ATOM   10561 C CG  . ASN C 1 410 ? 141.148 148.999 180.636 1.00 101.47 ? 410 ASN C CG  1 
ATOM   10562 O OD1 . ASN C 1 410 ? 140.276 148.140 180.539 1.00 101.47 ? 410 ASN C OD1 1 
ATOM   10563 N ND2 . ASN C 1 410 ? 142.031 149.012 181.621 1.00 101.47 ? 410 ASN C ND2 1 
ATOM   10564 N N   . TYR C 1 411 ? 140.201 152.641 178.223 1.00 100.58 ? 411 TYR C N   1 
ATOM   10565 C CA  . TYR C 1 411 ? 140.331 153.521 177.071 1.00 100.58 ? 411 TYR C CA  1 
ATOM   10566 C C   . TYR C 1 411 ? 140.155 154.986 177.432 1.00 100.58 ? 411 TYR C C   1 
ATOM   10567 O O   . TYR C 1 411 ? 140.540 155.855 176.644 1.00 100.58 ? 411 TYR C O   1 
ATOM   10568 C CB  . TYR C 1 411 ? 139.298 153.175 175.995 1.00 100.58 ? 411 TYR C CB  1 
ATOM   10569 C CG  . TYR C 1 411 ? 139.384 151.809 175.351 1.00 100.58 ? 411 TYR C CG  1 
ATOM   10570 C CD1 . TYR C 1 411 ? 140.474 150.981 175.528 1.00 100.58 ? 411 TYR C CD1 1 
ATOM   10571 C CD2 . TYR C 1 411 ? 138.359 151.363 174.532 1.00 100.58 ? 411 TYR C CD2 1 
ATOM   10572 C CE1 . TYR C 1 411 ? 140.522 149.740 174.933 1.00 100.58 ? 411 TYR C CE1 1 
ATOM   10573 C CE2 . TYR C 1 411 ? 138.407 150.129 173.924 1.00 100.58 ? 411 TYR C CE2 1 
ATOM   10574 C CZ  . TYR C 1 411 ? 139.492 149.323 174.128 1.00 100.58 ? 411 TYR C CZ  1 
ATOM   10575 O OH  . TYR C 1 411 ? 139.543 148.090 173.527 1.00 100.58 ? 411 TYR C OH  1 
ATOM   10576 N N   . ASN C 1 412 ? 139.563 155.274 178.588 1.00 98.30  ? 412 ASN C N   1 
ATOM   10577 C CA  . ASN C 1 412 ? 139.409 156.638 179.062 1.00 98.30  ? 412 ASN C CA  1 
ATOM   10578 C C   . ASN C 1 412 ? 140.748 157.290 179.353 1.00 98.30  ? 412 ASN C C   1 
ATOM   10579 O O   . ASN C 1 412 ? 140.863 158.513 179.243 1.00 98.30  ? 412 ASN C O   1 
ATOM   10580 C CB  . ASN C 1 412 ? 138.548 156.639 180.326 1.00 98.30  ? 412 ASN C CB  1 
ATOM   10581 C CG  . ASN C 1 412 ? 138.009 158.010 180.682 1.00 98.30  ? 412 ASN C CG  1 
ATOM   10582 O OD1 . ASN C 1 412 ? 138.184 158.981 179.951 1.00 98.30  ? 412 ASN C OD1 1 
ATOM   10583 N ND2 . ASN C 1 412 ? 137.351 158.093 181.829 1.00 98.30  ? 412 ASN C ND2 1 
ATOM   10584 N N   . ILE C 1 413 ? 141.759 156.495 179.699 1.00 90.29  ? 413 ILE C N   1 
ATOM   10585 C CA  . ILE C 1 413 ? 143.049 157.047 180.082 1.00 90.29  ? 413 ILE C CA  1 
ATOM   10586 C C   . ILE C 1 413 ? 143.741 157.662 178.876 1.00 90.29  ? 413 ILE C C   1 
ATOM   10587 O O   . ILE C 1 413 ? 144.301 158.760 178.953 1.00 90.29  ? 413 ILE C O   1 
ATOM   10588 C CB  . ILE C 1 413 ? 143.911 155.949 180.722 1.00 90.29  ? 413 ILE C CB  1 
ATOM   10589 C CG1 . ILE C 1 413 ? 143.129 155.228 181.816 1.00 90.29  ? 413 ILE C CG1 1 
ATOM   10590 C CG2 . ILE C 1 413 ? 145.169 156.542 181.308 1.00 90.29  ? 413 ILE C CG2 1 
ATOM   10591 C CD1 . ILE C 1 413 ? 142.682 156.112 182.955 1.00 90.29  ? 413 ILE C CD1 1 
ATOM   10592 N N   . LEU C 1 414 ? 143.681 156.983 177.737 1.00 86.70  ? 414 LEU C N   1 
ATOM   10593 C CA  . LEU C 1 414 ? 144.379 157.456 176.552 1.00 86.70  ? 414 LEU C CA  1 
ATOM   10594 C C   . LEU C 1 414 ? 143.690 158.668 175.954 1.00 86.70  ? 414 LEU C C   1 
ATOM   10595 O O   . LEU C 1 414 ? 144.353 159.580 175.455 1.00 86.70  ? 414 LEU C O   1 
ATOM   10596 C CB  . LEU C 1 414 ? 144.456 156.327 175.537 1.00 86.70  ? 414 LEU C CB  1 
ATOM   10597 C CG  . LEU C 1 414 ? 145.191 155.127 176.119 1.00 86.70  ? 414 LEU C CG  1 
ATOM   10598 C CD1 . LEU C 1 414 ? 145.004 153.916 175.257 1.00 86.70  ? 414 LEU C CD1 1 
ATOM   10599 C CD2 . LEU C 1 414 ? 146.655 155.442 176.257 1.00 86.70  ? 414 LEU C CD2 1 
ATOM   10600 N N   . ILE C 1 415 ? 142.359 158.700 176.004 1.00 91.02  ? 415 ILE C N   1 
ATOM   10601 C CA  . ILE C 1 415 ? 141.619 159.804 175.404 1.00 91.02  ? 415 ILE C CA  1 
ATOM   10602 C C   . ILE C 1 415 ? 141.725 161.054 176.262 1.00 91.02  ? 415 ILE C C   1 
ATOM   10603 O O   . ILE C 1 415 ? 141.975 162.152 175.751 1.00 91.02  ? 415 ILE C O   1 
ATOM   10604 C CB  . ILE C 1 415 ? 140.157 159.393 175.167 1.00 91.02  ? 415 ILE C CB  1 
ATOM   10605 C CG1 . ILE C 1 415 ? 140.099 158.274 174.138 1.00 91.02  ? 415 ILE C CG1 1 
ATOM   10606 C CG2 . ILE C 1 415 ? 139.328 160.568 174.713 1.00 91.02  ? 415 ILE C CG2 1 
ATOM   10607 C CD1 . ILE C 1 415 ? 140.670 158.671 172.803 1.00 91.02  ? 415 ILE C CD1 1 
ATOM   10608 N N   . ALA C 1 416 ? 141.574 160.914 177.575 1.00 88.63  ? 416 ALA C N   1 
ATOM   10609 C CA  . ALA C 1 416 ? 141.728 162.066 178.452 1.00 88.63  ? 416 ALA C CA  1 
ATOM   10610 C C   . ALA C 1 416 ? 143.170 162.533 178.557 1.00 88.63  ? 416 ALA C C   1 
ATOM   10611 O O   . ALA C 1 416 ? 143.407 163.648 179.029 1.00 88.63  ? 416 ALA C O   1 
ATOM   10612 C CB  . ALA C 1 416 ? 141.178 161.757 179.843 1.00 88.63  ? 416 ALA C CB  1 
ATOM   10613 N N   . THR C 1 417 ? 144.131 161.712 178.136 1.00 86.67  ? 417 THR C N   1 
ATOM   10614 C CA  . THR C 1 417 ? 145.492 162.194 177.968 1.00 86.67  ? 417 THR C CA  1 
ATOM   10615 C C   . THR C 1 417 ? 145.564 163.209 176.838 1.00 86.67  ? 417 THR C C   1 
ATOM   10616 O O   . THR C 1 417 ? 146.274 164.213 176.945 1.00 86.67  ? 417 THR C O   1 
ATOM   10617 C CB  . THR C 1 417 ? 146.429 161.024 177.694 1.00 86.67  ? 417 THR C CB  1 
ATOM   10618 O OG1 . THR C 1 417 ? 146.250 160.035 178.709 1.00 86.67  ? 417 THR C OG1 1 
ATOM   10619 C CG2 . THR C 1 417 ? 147.869 161.480 177.728 1.00 86.67  ? 417 THR C CG2 1 
ATOM   10620 N N   . LEU C 1 418 ? 144.822 162.973 175.757 1.00 82.69  ? 418 LEU C N   1 
ATOM   10621 C CA  . LEU C 1 418 ? 144.724 163.976 174.706 1.00 82.69  ? 418 LEU C CA  1 
ATOM   10622 C C   . LEU C 1 418 ? 143.994 165.215 175.187 1.00 82.69  ? 418 LEU C C   1 
ATOM   10623 O O   . LEU C 1 418 ? 144.347 166.328 174.789 1.00 82.69  ? 418 LEU C O   1 
ATOM   10624 C CB  . LEU C 1 418 ? 144.004 163.420 173.482 1.00 82.69  ? 418 LEU C CB  1 
ATOM   10625 C CG  . LEU C 1 418 ? 144.801 162.776 172.358 1.00 82.69  ? 418 LEU C CG  1 
ATOM   10626 C CD1 . LEU C 1 418 ? 145.740 163.801 171.771 1.00 82.69  ? 418 LEU C CD1 1 
ATOM   10627 C CD2 . LEU C 1 418 ? 145.551 161.563 172.829 1.00 82.69  ? 418 LEU C CD2 1 
ATOM   10628 N N   . ARG C 1 419 ? 142.988 165.047 176.043 1.00 85.89  ? 419 ARG C N   1 
ATOM   10629 C CA  . ARG C 1 419 ? 142.166 166.183 176.433 1.00 85.89  ? 419 ARG C CA  1 
ATOM   10630 C C   . ARG C 1 419 ? 142.920 167.114 177.368 1.00 85.89  ? 419 ARG C C   1 
ATOM   10631 O O   . ARG C 1 419 ? 142.755 168.335 177.297 1.00 85.89  ? 419 ARG C O   1 
ATOM   10632 C CB  . ARG C 1 419 ? 140.875 165.696 177.079 1.00 85.89  ? 419 ARG C CB  1 
ATOM   10633 C CG  . ARG C 1 419 ? 139.870 166.793 177.361 1.00 85.89  ? 419 ARG C CG  1 
ATOM   10634 C CD  . ARG C 1 419 ? 138.646 166.204 178.005 1.00 85.89  ? 419 ARG C CD  1 
ATOM   10635 N NE  . ARG C 1 419 ? 138.965 165.683 179.326 1.00 85.89  ? 419 ARG C NE  1 
ATOM   10636 C CZ  . ARG C 1 419 ? 138.185 164.854 180.006 1.00 85.89  ? 419 ARG C CZ  1 
ATOM   10637 N NH1 . ARG C 1 419 ? 138.556 164.431 181.203 1.00 85.89  ? 419 ARG C NH1 1 
ATOM   10638 N NH2 . ARG C 1 419 ? 137.046 164.431 179.478 1.00 85.89  ? 419 ARG C NH2 1 
ATOM   10639 N N   . VAL C 1 420 ? 143.776 166.569 178.233 1.00 83.83  ? 420 VAL C N   1 
ATOM   10640 C CA  . VAL C 1 420 ? 144.579 167.441 179.084 1.00 83.83  ? 420 VAL C CA  1 
ATOM   10641 C C   . VAL C 1 420 ? 145.799 167.988 178.371 1.00 83.83  ? 420 VAL C C   1 
ATOM   10642 O O   . VAL C 1 420 ? 146.483 168.855 178.923 1.00 83.83  ? 420 VAL C O   1 
ATOM   10643 C CB  . VAL C 1 420 ? 145.055 166.726 180.358 1.00 83.83  ? 420 VAL C CB  1 
ATOM   10644 C CG1 . VAL C 1 420 ? 143.874 166.262 181.169 1.00 83.83  ? 420 VAL C CG1 1 
ATOM   10645 C CG2 . VAL C 1 420 ? 145.937 165.570 179.999 1.00 83.83  ? 420 VAL C CG2 1 
ATOM   10646 N N   . ALA C 1 421 ? 146.097 167.509 177.164 1.00 84.61  ? 421 ALA C N   1 
ATOM   10647 C CA  . ALA C 1 421 ? 147.268 167.959 176.432 1.00 84.61  ? 421 ALA C CA  1 
ATOM   10648 C C   . ALA C 1 421 ? 146.939 168.783 175.201 1.00 84.61  ? 421 ALA C C   1 
ATOM   10649 O O   . ALA C 1 421 ? 147.823 169.476 174.690 1.00 84.61  ? 421 ALA C O   1 
ATOM   10650 C CB  . ALA C 1 421 ? 148.126 166.762 176.016 1.00 84.61  ? 421 ALA C CB  1 
ATOM   10651 N N   . LEU C 1 422 ? 145.714 168.713 174.708 1.00 88.72  ? 422 LEU C N   1 
ATOM   10652 C CA  . LEU C 1 422 ? 145.234 169.564 173.624 1.00 88.72  ? 422 LEU C CA  1 
ATOM   10653 C C   . LEU C 1 422 ? 145.324 171.063 173.925 1.00 88.72  ? 422 LEU C C   1 
ATOM   10654 O O   . LEU C 1 422 ? 145.496 171.835 172.976 1.00 88.72  ? 422 LEU C O   1 
ATOM   10655 C CB  . LEU C 1 422 ? 143.796 169.178 173.255 1.00 88.72  ? 422 LEU C CB  1 
ATOM   10656 C CG  . LEU C 1 422 ? 143.171 169.619 171.925 1.00 88.72  ? 422 LEU C CG  1 
ATOM   10657 C CD1 . LEU C 1 422 ? 142.206 168.547 171.451 1.00 88.72  ? 422 LEU C CD1 1 
ATOM   10658 C CD2 . LEU C 1 422 ? 142.432 170.945 172.005 1.00 88.72  ? 422 LEU C CD2 1 
ATOM   10659 N N   . PRO C 1 423 ? 145.195 171.553 175.188 1.00 91.76  ? 423 PRO C N   1 
ATOM   10660 C CA  . PRO C 1 423 ? 145.582 172.949 175.422 1.00 91.76  ? 423 PRO C CA  1 
ATOM   10661 C C   . PRO C 1 423 ? 147.055 173.231 175.195 1.00 91.76  ? 423 PRO C C   1 
ATOM   10662 O O   . PRO C 1 423 ? 147.384 174.186 174.486 1.00 91.76  ? 423 PRO C O   1 
ATOM   10663 C CB  . PRO C 1 423 ? 145.203 173.174 176.885 1.00 91.76  ? 423 PRO C CB  1 
ATOM   10664 C CG  . PRO C 1 423 ? 144.089 172.311 177.092 1.00 91.76  ? 423 PRO C CG  1 
ATOM   10665 C CD  . PRO C 1 423 ? 144.359 171.081 176.311 1.00 91.76  ? 423 PRO C CD  1 
ATOM   10666 N N   . SER C 1 424 ? 147.940 172.412 175.769 1.00 89.28  ? 424 SER C N   1 
ATOM   10667 C CA  . SER C 1 424 ? 149.364 172.730 175.750 1.00 89.28  ? 424 SER C CA  1 
ATOM   10668 C C   . SER C 1 424 ? 149.958 172.627 174.357 1.00 89.28  ? 424 SER C C   1 
ATOM   10669 O O   . SER C 1 424 ? 150.912 173.343 174.047 1.00 89.28  ? 424 SER C O   1 
ATOM   10670 C CB  . SER C 1 424 ? 150.121 171.816 176.701 1.00 89.28  ? 424 SER C CB  1 
ATOM   10671 O OG  . SER C 1 424 ? 149.735 172.054 178.038 1.00 89.28  ? 424 SER C OG  1 
ATOM   10672 N N   . VAL C 1 425 ? 149.411 171.764 173.506 1.00 87.76  ? 425 VAL C N   1 
ATOM   10673 C CA  . VAL C 1 425 ? 149.879 171.707 172.128 1.00 87.76  ? 425 VAL C CA  1 
ATOM   10674 C C   . VAL C 1 425 ? 149.407 172.931 171.361 1.00 87.76  ? 425 VAL C C   1 
ATOM   10675 O O   . VAL C 1 425 ? 150.177 173.556 170.624 1.00 87.76  ? 425 VAL C O   1 
ATOM   10676 C CB  . VAL C 1 425 ? 149.408 170.405 171.463 1.00 87.76  ? 425 VAL C CB  1 
ATOM   10677 C CG1 . VAL C 1 425 ? 149.792 170.381 170.006 1.00 87.76  ? 425 VAL C CG1 1 
ATOM   10678 C CG2 . VAL C 1 425 ? 150.008 169.223 172.170 1.00 87.76  ? 425 VAL C CG2 1 
ATOM   10679 N N   . MET C 1 426 ? 148.148 173.316 171.552 1.00 95.96  ? 426 MET C N   1 
ATOM   10680 C CA  . MET C 1 426 ? 147.586 174.430 170.805 1.00 95.96  ? 426 MET C CA  1 
ATOM   10681 C C   . MET C 1 426 ? 148.135 175.767 171.282 1.00 95.96  ? 426 MET C C   1 
ATOM   10682 O O   . MET C 1 426 ? 148.081 176.749 170.538 1.00 95.96  ? 426 MET C O   1 
ATOM   10683 C CB  . MET C 1 426 ? 146.065 174.394 170.916 1.00 95.96  ? 426 MET C CB  1 
ATOM   10684 C CG  . MET C 1 426 ? 145.322 175.207 169.879 1.00 95.96  ? 426 MET C CG  1 
ATOM   10685 S SD  . MET C 1 426 ? 145.579 174.546 168.225 1.00 95.96  ? 426 MET C SD  1 
ATOM   10686 C CE  . MET C 1 426 ? 144.666 173.009 168.330 1.00 95.96  ? 426 MET C CE  1 
ATOM   10687 N N   . ARG C 1 427 ? 148.674 175.827 172.497 1.00 95.09  ? 427 ARG C N   1 
ATOM   10688 C CA  . ARG C 1 427 ? 149.458 176.991 172.882 1.00 95.09  ? 427 ARG C CA  1 
ATOM   10689 C C   . ARG C 1 427 ? 150.743 177.064 172.074 1.00 95.09  ? 427 ARG C C   1 
ATOM   10690 O O   . ARG C 1 427 ? 151.056 178.097 171.473 1.00 95.09  ? 427 ARG C O   1 
ATOM   10691 C CB  . ARG C 1 427 ? 149.786 176.944 174.370 1.00 95.09  ? 427 ARG C CB  1 
ATOM   10692 C CG  . ARG C 1 427 ? 148.612 177.120 175.291 1.00 95.09  ? 427 ARG C CG  1 
ATOM   10693 C CD  . ARG C 1 427 ? 149.092 177.174 176.717 1.00 95.09  ? 427 ARG C CD  1 
ATOM   10694 N NE  . ARG C 1 427 ? 147.984 177.302 177.647 1.00 95.09  ? 427 ARG C NE  1 
ATOM   10695 C CZ  . ARG C 1 427 ? 147.376 176.271 178.218 1.00 95.09  ? 427 ARG C CZ  1 
ATOM   10696 N NH1 . ARG C 1 427 ? 147.782 175.040 177.957 1.00 95.09  ? 427 ARG C NH1 1 
ATOM   10697 N NH2 . ARG C 1 427 ? 146.371 176.472 179.054 1.00 95.09  ? 427 ARG C NH2 1 
ATOM   10698 N N   . PHE C 1 428 ? 151.493 175.964 172.038 1.00 90.07  ? 428 PHE C N   1 
ATOM   10699 C CA  . PHE C 1 428 ? 152.799 175.951 171.399 1.00 90.07  ? 428 PHE C CA  1 
ATOM   10700 C C   . PHE C 1 428 ? 152.701 175.979 169.888 1.00 90.07  ? 428 PHE C C   1 
ATOM   10701 O O   . PHE C 1 428 ? 153.632 176.446 169.227 1.00 90.07  ? 428 PHE C O   1 
ATOM   10702 C CB  . PHE C 1 428 ? 153.578 174.723 171.852 1.00 90.07  ? 428 PHE C CB  1 
ATOM   10703 C CG  . PHE C 1 428 ? 154.969 174.662 171.327 1.00 90.07  ? 428 PHE C CG  1 
ATOM   10704 C CD1 . PHE C 1 428 ? 155.912 175.588 171.721 1.00 90.07  ? 428 PHE C CD1 1 
ATOM   10705 C CD2 . PHE C 1 428 ? 155.348 173.654 170.477 1.00 90.07  ? 428 PHE C CD2 1 
ATOM   10706 C CE1 . PHE C 1 428 ? 157.202 175.522 171.238 1.00 90.07  ? 428 PHE C CE1 1 
ATOM   10707 C CE2 . PHE C 1 428 ? 156.628 173.577 170.003 1.00 90.07  ? 428 PHE C CE2 1 
ATOM   10708 C CZ  . PHE C 1 428 ? 157.556 174.513 170.380 1.00 90.07  ? 428 PHE C CZ  1 
ATOM   10709 N N   . CYS C 1 429 ? 151.585 175.509 169.331 1.00 98.15  ? 429 CYS C N   1 
ATOM   10710 C CA  . CYS C 1 429 ? 151.380 175.571 167.890 1.00 98.15  ? 429 CYS C CA  1 
ATOM   10711 C C   . CYS C 1 429 ? 151.267 177.009 167.405 1.00 98.15  ? 429 CYS C C   1 
ATOM   10712 O O   . CYS C 1 429 ? 151.589 177.302 166.249 1.00 98.15  ? 429 CYS C O   1 
ATOM   10713 C CB  . CYS C 1 429 ? 150.136 174.772 167.514 1.00 98.15  ? 429 CYS C CB  1 
ATOM   10714 S SG  . CYS C 1 429 ? 149.806 174.625 165.752 1.00 98.15  ? 429 CYS C SG  1 
ATOM   10715 N N   . CYS C 1 430 ? 150.838 177.923 168.274 1.00 99.38  ? 430 CYS C N   1 
ATOM   10716 C CA  . CYS C 1 430 ? 150.896 179.337 167.940 1.00 99.38  ? 430 CYS C CA  1 
ATOM   10717 C C   . CYS C 1 430 ? 152.314 179.878 168.033 1.00 99.38  ? 430 CYS C C   1 
ATOM   10718 O O   . CYS C 1 430 ? 152.665 180.810 167.306 1.00 99.38  ? 430 CYS C O   1 
ATOM   10719 C CB  . CYS C 1 430 ? 149.965 180.134 168.852 1.00 99.38  ? 430 CYS C CB  1 
ATOM   10720 S SG  . CYS C 1 430 ? 149.811 181.876 168.416 1.00 99.38  ? 430 CYS C SG  1 
ATOM   10721 N N   . CYS C 1 431 ? 153.147 179.302 168.902 1.00 96.49  ? 431 CYS C N   1 
ATOM   10722 C CA  . CYS C 1 431 ? 154.526 179.761 169.026 1.00 96.49  ? 431 CYS C CA  1 
ATOM   10723 C C   . CYS C 1 431 ? 155.371 179.356 167.833 1.00 96.49  ? 431 CYS C C   1 
ATOM   10724 O O   . CYS C 1 431 ? 156.401 179.978 167.565 1.00 96.49  ? 431 CYS C O   1 
ATOM   10725 C CB  . CYS C 1 431 ? 155.167 179.211 170.298 1.00 96.49  ? 431 CYS C CB  1 
ATOM   10726 S SG  . CYS C 1 431 ? 154.511 179.838 171.847 1.00 96.49  ? 431 CYS C SG  1 
ATOM   10727 N N   . VAL C 1 432 ? 154.968 178.312 167.118 1.00 89.83  ? 432 VAL C N   1 
ATOM   10728 C CA  . VAL C 1 432 ? 155.757 177.834 165.993 1.00 89.83  ? 432 VAL C CA  1 
ATOM   10729 C C   . VAL C 1 432 ? 155.289 178.505 164.715 1.00 89.83  ? 432 VAL C C   1 
ATOM   10730 O O   . VAL C 1 432 ? 156.101 178.872 163.858 1.00 89.83  ? 432 VAL C O   1 
ATOM   10731 C CB  . VAL C 1 432 ? 155.668 176.305 165.900 1.00 89.83  ? 432 VAL C CB  1 
ATOM   10732 C CG1 . VAL C 1 432 ? 156.429 175.787 164.709 1.00 89.83  ? 432 VAL C CG1 1 
ATOM   10733 C CG2 . VAL C 1 432 ? 156.216 175.706 167.153 1.00 89.83  ? 432 VAL C CG2 1 
ATOM   10734 N N   . ALA C 1 433 ? 153.978 178.719 164.598 1.00 85.76  ? 433 ALA C N   1 
ATOM   10735 C CA  . ALA C 1 433 ? 153.404 179.283 163.383 1.00 85.76  ? 433 ALA C CA  1 
ATOM   10736 C C   . ALA C 1 433 ? 153.859 180.712 163.147 1.00 85.76  ? 433 ALA C C   1 
ATOM   10737 O O   . ALA C 1 433 ? 153.882 181.175 162.004 1.00 85.76  ? 433 ALA C O   1 
ATOM   10738 C CB  . ALA C 1 433 ? 151.883 179.226 163.450 1.00 85.76  ? 433 ALA C CB  1 
ATOM   10739 N N   . VAL C 1 434 ? 154.235 181.416 164.210 1.00 83.25  ? 434 VAL C N   1 
ATOM   10740 C CA  . VAL C 1 434 ? 154.817 182.740 164.059 1.00 83.25  ? 434 VAL C CA  1 
ATOM   10741 C C   . VAL C 1 434 ? 156.170 182.654 163.372 1.00 83.25  ? 434 VAL C C   1 
ATOM   10742 O O   . VAL C 1 434 ? 156.451 183.406 162.434 1.00 83.25  ? 434 VAL C O   1 
ATOM   10743 C CB  . VAL C 1 434 ? 154.905 183.416 165.434 1.00 83.25  ? 434 VAL C CB  1 
ATOM   10744 C CG1 . VAL C 1 434 ? 155.671 184.680 165.344 1.00 83.25  ? 434 VAL C CG1 1 
ATOM   10745 C CG2 . VAL C 1 434 ? 153.519 183.710 165.938 1.00 83.25  ? 434 VAL C CG2 1 
ATOM   10746 N N   . ILE C 1 435 ? 157.012 181.711 163.796 1.00 80.61  ? 435 ILE C N   1 
ATOM   10747 C CA  . ILE C 1 435 ? 158.305 181.532 163.150 1.00 80.61  ? 435 ILE C CA  1 
ATOM   10748 C C   . ILE C 1 435 ? 158.128 180.904 161.780 1.00 80.61  ? 435 ILE C C   1 
ATOM   10749 O O   . ILE C 1 435 ? 158.887 181.197 160.850 1.00 80.61  ? 435 ILE C O   1 
ATOM   10750 C CB  . ILE C 1 435 ? 159.213 180.672 164.039 1.00 80.61  ? 435 ILE C CB  1 
ATOM   10751 C CG1 . ILE C 1 435 ? 159.269 181.249 165.439 1.00 80.61  ? 435 ILE C CG1 1 
ATOM   10752 C CG2 . ILE C 1 435 ? 160.621 180.656 163.517 1.00 80.61  ? 435 ILE C CG2 1 
ATOM   10753 C CD1 . ILE C 1 435 ? 159.905 180.318 166.422 1.00 80.61  ? 435 ILE C CD1 1 
ATOM   10754 N N   . TYR C 1 436 ? 157.116 180.052 161.625 1.00 78.12  ? 436 TYR C N   1 
ATOM   10755 C CA  . TYR C 1 436 ? 156.876 179.393 160.351 1.00 78.12  ? 436 TYR C CA  1 
ATOM   10756 C C   . TYR C 1 436 ? 156.425 180.367 159.283 1.00 78.12  ? 436 TYR C C   1 
ATOM   10757 O O   . TYR C 1 436 ? 156.790 180.205 158.118 1.00 78.12  ? 436 TYR C O   1 
ATOM   10758 C CB  . TYR C 1 436 ? 155.837 178.296 160.518 1.00 78.12  ? 436 TYR C CB  1 
ATOM   10759 C CG  . TYR C 1 436 ? 155.478 177.605 159.237 1.00 78.12  ? 436 TYR C CG  1 
ATOM   10760 C CD1 . TYR C 1 436 ? 156.340 176.701 158.654 1.00 78.12  ? 436 TYR C CD1 1 
ATOM   10761 C CD2 . TYR C 1 436 ? 154.267 177.850 158.618 1.00 78.12  ? 436 TYR C CD2 1 
ATOM   10762 C CE1 . TYR C 1 436 ? 156.010 176.065 157.487 1.00 78.12  ? 436 TYR C CE1 1 
ATOM   10763 C CE2 . TYR C 1 436 ? 153.931 177.224 157.450 1.00 78.12  ? 436 TYR C CE2 1 
ATOM   10764 C CZ  . TYR C 1 436 ? 154.804 176.332 156.890 1.00 78.12  ? 436 TYR C CZ  1 
ATOM   10765 O OH  . TYR C 1 436 ? 154.463 175.705 155.719 1.00 78.12  ? 436 TYR C OH  1 
ATOM   10766 N N   . LEU C 1 437 ? 155.647 181.385 159.647 1.00 79.49  ? 437 LEU C N   1 
ATOM   10767 C CA  . LEU C 1 437 ? 155.339 182.413 158.665 1.00 79.49  ? 437 LEU C CA  1 
ATOM   10768 C C   . LEU C 1 437 ? 156.528 183.311 158.390 1.00 79.49  ? 437 LEU C C   1 
ATOM   10769 O O   . LEU C 1 437 ? 156.538 183.998 157.372 1.00 79.49  ? 437 LEU C O   1 
ATOM   10770 C CB  . LEU C 1 437 ? 154.155 183.257 159.110 1.00 79.49  ? 437 LEU C CB  1 
ATOM   10771 C CG  . LEU C 1 437 ? 152.828 182.504 159.123 1.00 79.49  ? 437 LEU C CG  1 
ATOM   10772 C CD1 . LEU C 1 437 ? 151.714 183.367 159.687 1.00 79.49  ? 437 LEU C CD1 1 
ATOM   10773 C CD2 . LEU C 1 437 ? 152.479 182.014 157.736 1.00 79.49  ? 437 LEU C CD2 1 
ATOM   10774 N N   . GLY C 1 438 ? 157.530 183.315 159.267 1.00 80.28  ? 438 GLY C N   1 
ATOM   10775 C CA  . GLY C 1 438 ? 158.723 184.095 158.998 1.00 80.28  ? 438 GLY C CA  1 
ATOM   10776 C C   . GLY C 1 438 ? 159.513 183.552 157.824 1.00 80.28  ? 438 GLY C C   1 
ATOM   10777 O O   . GLY C 1 438 ? 159.900 184.300 156.925 1.00 80.28  ? 438 GLY C O   1 
ATOM   10778 N N   . TYR C 1 439 ? 159.746 182.243 157.808 1.00 78.50  ? 439 TYR C N   1 
ATOM   10779 C CA  . TYR C 1 439 ? 160.482 181.646 156.705 1.00 78.50  ? 439 TYR C CA  1 
ATOM   10780 C C   . TYR C 1 439 ? 159.684 181.616 155.414 1.00 78.50  ? 439 TYR C C   1 
ATOM   10781 O O   . TYR C 1 439 ? 160.284 181.605 154.337 1.00 78.50  ? 439 TYR C O   1 
ATOM   10782 C CB  . TYR C 1 439 ? 160.924 180.238 157.073 1.00 78.50  ? 439 TYR C CB  1 
ATOM   10783 C CG  . TYR C 1 439 ? 162.033 180.200 158.077 1.00 78.50  ? 439 TYR C CG  1 
ATOM   10784 C CD1 . TYR C 1 439 ? 163.347 180.359 157.682 1.00 78.50  ? 439 TYR C CD1 1 
ATOM   10785 C CD2 . TYR C 1 439 ? 161.771 180.010 159.417 1.00 78.50  ? 439 TYR C CD2 1 
ATOM   10786 C CE1 . TYR C 1 439 ? 164.368 180.322 158.589 1.00 78.50  ? 439 TYR C CE1 1 
ATOM   10787 C CE2 . TYR C 1 439 ? 162.788 179.973 160.335 1.00 78.50  ? 439 TYR C CE2 1 
ATOM   10788 C CZ  . TYR C 1 439 ? 164.081 180.129 159.912 1.00 78.50  ? 439 TYR C CZ  1 
ATOM   10789 O OH  . TYR C 1 439 ? 165.100 180.093 160.821 1.00 78.50  ? 439 TYR C OH  1 
ATOM   10790 N N   . CYS C 1 440 ? 158.357 181.602 155.488 1.00 76.89  ? 440 CYS C N   1 
ATOM   10791 C CA  . CYS C 1 440 ? 157.564 181.621 154.273 1.00 76.89  ? 440 CYS C CA  1 
ATOM   10792 C C   . CYS C 1 440 ? 157.635 182.952 153.553 1.00 76.89  ? 440 CYS C C   1 
ATOM   10793 O O   . CYS C 1 440 ? 157.621 182.968 152.325 1.00 76.89  ? 440 CYS C O   1 
ATOM   10794 C CB  . CYS C 1 440 ? 156.111 181.284 154.578 1.00 76.89  ? 440 CYS C CB  1 
ATOM   10795 S SG  . CYS C 1 440 ? 155.854 179.585 155.090 1.00 76.89  ? 440 CYS C SG  1 
ATOM   10796 N N   . PHE C 1 441 ? 157.728 184.064 154.272 1.00 78.58  ? 441 PHE C N   1 
ATOM   10797 C CA  . PHE C 1 441 ? 157.903 185.338 153.590 1.00 78.58  ? 441 PHE C CA  1 
ATOM   10798 C C   . PHE C 1 441 ? 159.338 185.583 153.183 1.00 78.58  ? 441 PHE C C   1 
ATOM   10799 O O   . PHE C 1 441 ? 159.576 186.277 152.190 1.00 78.58  ? 441 PHE C O   1 
ATOM   10800 C CB  . PHE C 1 441 ? 157.435 186.515 154.451 1.00 78.58  ? 441 PHE C CB  1 
ATOM   10801 C CG  . PHE C 1 441 ? 155.958 186.584 154.623 1.00 78.58  ? 441 PHE C CG  1 
ATOM   10802 C CD1 . PHE C 1 441 ? 155.147 186.858 153.547 1.00 78.58  ? 441 PHE C CD1 1 
ATOM   10803 C CD2 . PHE C 1 441 ? 155.387 186.450 155.866 1.00 78.58  ? 441 PHE C CD2 1 
ATOM   10804 C CE1 . PHE C 1 441 ? 153.788 186.931 153.703 1.00 78.58  ? 441 PHE C CE1 1 
ATOM   10805 C CE2 . PHE C 1 441 ? 154.028 186.523 156.027 1.00 78.58  ? 441 PHE C CE2 1 
ATOM   10806 C CZ  . PHE C 1 441 ? 153.232 186.768 154.947 1.00 78.58  ? 441 PHE C CZ  1 
ATOM   10807 N N   . CYS C 1 442 ? 160.297 185.034 153.924 1.00 81.93  ? 442 CYS C N   1 
ATOM   10808 C CA  . CYS C 1 442 ? 161.692 185.257 153.574 1.00 81.93  ? 442 CYS C CA  1 
ATOM   10809 C C   . CYS C 1 442 ? 162.100 184.425 152.371 1.00 81.93  ? 442 CYS C C   1 
ATOM   10810 O O   . CYS C 1 442 ? 162.831 184.900 151.496 1.00 81.93  ? 442 CYS C O   1 
ATOM   10811 C CB  . CYS C 1 442 ? 162.583 184.926 154.755 1.00 81.93  ? 442 CYS C CB  1 
ATOM   10812 S SG  . CYS C 1 442 ? 164.320 185.191 154.439 1.00 81.93  ? 442 CYS C SG  1 
ATOM   10813 N N   . GLY C 1 443 ? 161.653 183.176 152.315 1.00 76.58  ? 443 GLY C N   1 
ATOM   10814 C CA  . GLY C 1 443 ? 162.016 182.321 151.207 1.00 76.58  ? 443 GLY C CA  1 
ATOM   10815 C C   . GLY C 1 443 ? 161.296 182.617 149.920 1.00 76.58  ? 443 GLY C C   1 
ATOM   10816 O O   . GLY C 1 443 ? 161.756 182.193 148.861 1.00 76.58  ? 443 GLY C O   1 
ATOM   10817 N N   . TRP C 1 444 ? 160.190 183.348 149.980 1.00 73.19  ? 444 TRP C N   1 
ATOM   10818 C CA  . TRP C 1 444 ? 159.415 183.640 148.787 1.00 73.19  ? 444 TRP C CA  1 
ATOM   10819 C C   . TRP C 1 444 ? 160.020 184.756 147.957 1.00 73.19  ? 444 TRP C C   1 
ATOM   10820 O O   . TRP C 1 444 ? 159.789 184.814 146.747 1.00 73.19  ? 444 TRP C O   1 
ATOM   10821 C CB  . TRP C 1 444 ? 157.981 183.979 149.186 1.00 73.19  ? 444 TRP C CB  1 
ATOM   10822 C CG  . TRP C 1 444 ? 157.106 184.334 148.062 1.00 73.19  ? 444 TRP C CG  1 
ATOM   10823 C CD1 . TRP C 1 444 ? 156.872 183.598 146.957 1.00 73.19  ? 444 TRP C CD1 1 
ATOM   10824 C CD2 . TRP C 1 444 ? 156.308 185.505 147.944 1.00 73.19  ? 444 TRP C CD2 1 
ATOM   10825 N NE1 . TRP C 1 444 ? 155.995 184.247 146.133 1.00 73.19  ? 444 TRP C NE1 1 
ATOM   10826 C CE2 . TRP C 1 444 ? 155.629 185.424 146.725 1.00 73.19  ? 444 TRP C CE2 1 
ATOM   10827 C CE3 . TRP C 1 444 ? 156.102 186.619 148.753 1.00 73.19  ? 444 TRP C CE3 1 
ATOM   10828 C CZ2 . TRP C 1 444 ? 154.764 186.411 146.294 1.00 73.19  ? 444 TRP C CZ2 1 
ATOM   10829 C CZ3 . TRP C 1 444 ? 155.253 187.595 148.324 1.00 73.19  ? 444 TRP C CZ3 1 
ATOM   10830 C CH2 . TRP C 1 444 ? 154.591 187.488 147.109 1.00 73.19  ? 444 TRP C CH2 1 
ATOM   10831 N N   . ILE C 1 445 ? 160.816 185.629 148.562 1.00 73.24  ? 445 ILE C N   1 
ATOM   10832 C CA  . ILE C 1 445 ? 161.430 186.728 147.838 1.00 73.24  ? 445 ILE C CA  1 
ATOM   10833 C C   . ILE C 1 445 ? 162.826 186.376 147.364 1.00 73.24  ? 445 ILE C C   1 
ATOM   10834 O O   . ILE C 1 445 ? 163.168 186.621 146.208 1.00 73.24  ? 445 ILE C O   1 
ATOM   10835 C CB  . ILE C 1 445 ? 161.425 188.013 148.693 1.00 73.24  ? 445 ILE C CB  1 
ATOM   10836 C CG1 . ILE C 1 445 ? 160.078 188.693 148.582 1.00 73.24  ? 445 ILE C CG1 1 
ATOM   10837 C CG2 . ILE C 1 445 ? 162.490 188.984 148.284 1.00 73.24  ? 445 ILE C CG2 1 
ATOM   10838 C CD1 . ILE C 1 445 ? 159.135 188.274 149.603 1.00 73.24  ? 445 ILE C CD1 1 
ATOM   10839 N N   . VAL C 1 446 ? 163.623 185.759 148.231 1.00 76.44  ? 446 VAL C N   1 
ATOM   10840 C CA  . VAL C 1 446 ? 164.998 185.454 147.872 1.00 76.44  ? 446 VAL C CA  1 
ATOM   10841 C C   . VAL C 1 446 ? 165.050 184.351 146.830 1.00 76.44  ? 446 VAL C C   1 
ATOM   10842 O O   . VAL C 1 446 ? 165.660 184.508 145.770 1.00 76.44  ? 446 VAL C O   1 
ATOM   10843 C CB  . VAL C 1 446 ? 165.799 185.056 149.115 1.00 76.44  ? 446 VAL C CB  1 
ATOM   10844 C CG1 . VAL C 1 446 ? 167.204 184.778 148.700 1.00 76.44  ? 446 VAL C CG1 1 
ATOM   10845 C CG2 . VAL C 1 446 ? 165.736 186.131 150.157 1.00 76.44  ? 446 VAL C CG2 1 
ATOM   10846 N N   . LEU C 1 447 ? 164.407 183.227 147.109 1.00 77.02  ? 447 LEU C N   1 
ATOM   10847 C CA  . LEU C 1 447 ? 164.460 182.061 146.248 1.00 77.02  ? 447 LEU C CA  1 
ATOM   10848 C C   . LEU C 1 447 ? 163.330 182.045 145.239 1.00 77.02  ? 447 LEU C C   1 
ATOM   10849 O O   . LEU C 1 447 ? 163.186 181.075 144.495 1.00 77.02  ? 447 LEU C O   1 
ATOM   10850 C CB  . LEU C 1 447 ? 164.418 180.809 147.104 1.00 77.02  ? 447 LEU C CB  1 
ATOM   10851 C CG  . LEU C 1 447 ? 165.573 180.751 148.090 1.00 77.02  ? 447 LEU C CG  1 
ATOM   10852 C CD1 . LEU C 1 447 ? 165.424 179.615 149.067 1.00 77.02  ? 447 LEU C CD1 1 
ATOM   10853 C CD2 . LEU C 1 447 ? 166.841 180.602 147.315 1.00 77.02  ? 447 LEU C CD2 1 
ATOM   10854 N N   . GLY C 1 448 ? 162.524 183.091 145.211 1.00 77.36  ? 448 GLY C N   1 
ATOM   10855 C CA  . GLY C 1 448 ? 161.416 183.217 144.296 1.00 77.36  ? 448 GLY C CA  1 
ATOM   10856 C C   . GLY C 1 448 ? 161.734 183.281 142.813 1.00 77.36  ? 448 GLY C C   1 
ATOM   10857 O O   . GLY C 1 448 ? 161.161 182.520 142.030 1.00 77.36  ? 448 GLY C O   1 
ATOM   10858 N N   . PRO C 1 449 ? 162.588 184.216 142.376 1.00 78.36  ? 449 PRO C N   1 
ATOM   10859 C CA  . PRO C 1 449 ? 162.838 184.329 140.935 1.00 78.36  ? 449 PRO C CA  1 
ATOM   10860 C C   . PRO C 1 449 ? 163.579 183.158 140.337 1.00 78.36  ? 449 PRO C C   1 
ATOM   10861 O O   . PRO C 1 449 ? 163.366 182.845 139.162 1.00 78.36  ? 449 PRO C O   1 
ATOM   10862 C CB  . PRO C 1 449 ? 163.674 185.607 140.828 1.00 78.36  ? 449 PRO C CB  1 
ATOM   10863 C CG  . PRO C 1 449 ? 163.324 186.372 141.994 1.00 78.36  ? 449 PRO C CG  1 
ATOM   10864 C CD  . PRO C 1 449 ? 163.122 185.394 143.078 1.00 78.36  ? 449 PRO C CD  1 
ATOM   10865 N N   . TYR C 1 450 ? 164.436 182.500 141.090 1.00 83.42  ? 450 TYR C N   1 
ATOM   10866 C CA  . TYR C 1 450 ? 165.360 181.565 140.482 1.00 83.42  ? 450 TYR C CA  1 
ATOM   10867 C C   . TYR C 1 450 ? 164.825 180.147 140.392 1.00 83.42  ? 450 TYR C C   1 
ATOM   10868 O O   . TYR C 1 450 ? 165.448 179.315 139.731 1.00 83.42  ? 450 TYR C O   1 
ATOM   10869 C CB  . TYR C 1 450 ? 166.674 181.574 141.253 1.00 83.42  ? 450 TYR C CB  1 
ATOM   10870 C CG  . TYR C 1 450 ? 167.378 182.900 141.176 1.00 83.42  ? 450 TYR C CG  1 
ATOM   10871 C CD1 . TYR C 1 450 ? 168.117 183.248 140.059 1.00 83.42  ? 450 TYR C CD1 1 
ATOM   10872 C CD2 . TYR C 1 450 ? 167.297 183.808 142.216 1.00 83.42  ? 450 TYR C CD2 1 
ATOM   10873 C CE1 . TYR C 1 450 ? 168.758 184.458 139.981 1.00 83.42  ? 450 TYR C CE1 1 
ATOM   10874 C CE2 . TYR C 1 450 ? 167.936 185.022 142.150 1.00 83.42  ? 450 TYR C CE2 1 
ATOM   10875 C CZ  . TYR C 1 450 ? 168.665 185.342 141.029 1.00 83.42  ? 450 TYR C CZ  1 
ATOM   10876 O OH  . TYR C 1 450 ? 169.306 186.555 140.954 1.00 83.42  ? 450 TYR C OH  1 
ATOM   10877 N N   . HIS C 1 451 ? 163.701 179.832 141.025 1.00 87.41  ? 451 HIS C N   1 
ATOM   10878 C CA  . HIS C 1 451 ? 163.300 178.438 141.121 1.00 87.41  ? 451 HIS C CA  1 
ATOM   10879 C C   . HIS C 1 451 ? 161.826 178.307 140.780 1.00 87.41  ? 451 HIS C C   1 
ATOM   10880 O O   . HIS C 1 451 ? 161.178 179.254 140.331 1.00 87.41  ? 451 HIS C O   1 
ATOM   10881 C CB  . HIS C 1 451 ? 163.636 177.888 142.507 1.00 87.41  ? 451 HIS C CB  1 
ATOM   10882 C CG  . HIS C 1 451 ? 165.094 177.946 142.814 1.00 87.41  ? 451 HIS C CG  1 
ATOM   10883 N ND1 . HIS C 1 451 ? 166.013 177.132 142.192 1.00 87.41  ? 451 HIS C ND1 1 
ATOM   10884 C CD2 . HIS C 1 451 ? 165.799 178.750 143.640 1.00 87.41  ? 451 HIS C CD2 1 
ATOM   10885 C CE1 . HIS C 1 451 ? 167.222 177.420 142.636 1.00 87.41  ? 451 HIS C CE1 1 
ATOM   10886 N NE2 . HIS C 1 451 ? 167.120 178.395 143.521 1.00 87.41  ? 451 HIS C NE2 1 
ATOM   10887 N N   . VAL C 1 452 ? 161.302 177.100 140.974 1.00 81.81  ? 452 VAL C N   1 
ATOM   10888 C CA  . VAL C 1 452 ? 159.965 176.748 140.538 1.00 81.81  ? 452 VAL C CA  1 
ATOM   10889 C C   . VAL C 1 452 ? 159.061 176.418 141.715 1.00 81.81  ? 452 VAL C C   1 
ATOM   10890 O O   . VAL C 1 452 ? 157.910 176.864 141.763 1.00 81.81  ? 452 VAL C O   1 
ATOM   10891 C CB  . VAL C 1 452 ? 160.013 175.571 139.543 1.00 81.81  ? 452 VAL C CB  1 
ATOM   10892 C CG1 . VAL C 1 452 ? 158.632 175.233 139.040 1.00 81.81  ? 452 VAL C CG1 1 
ATOM   10893 C CG2 . VAL C 1 452 ? 160.928 175.898 138.381 1.00 81.81  ? 452 VAL C CG2 1 
ATOM   10894 N N   . LYS C 1 453 ? 159.575 175.669 142.693 1.00 74.74  ? 453 LYS C N   1 
ATOM   10895 C CA  . LYS C 1 453 ? 158.775 175.305 143.855 1.00 74.74  ? 453 LYS C CA  1 
ATOM   10896 C C   . LYS C 1 453 ? 158.459 176.504 144.733 1.00 74.74  ? 453 LYS C C   1 
ATOM   10897 O O   . LYS C 1 453 ? 157.451 176.497 145.439 1.00 74.74  ? 453 LYS C O   1 
ATOM   10898 C CB  . LYS C 1 453 ? 159.494 174.255 144.694 1.00 74.74  ? 453 LYS C CB  1 
ATOM   10899 C CG  . LYS C 1 453 ? 159.632 172.901 144.052 1.00 74.74  ? 453 LYS C CG  1 
ATOM   10900 C CD  . LYS C 1 453 ? 160.308 171.943 145.013 1.00 74.74  ? 453 LYS C CD  1 
ATOM   10901 C CE  . LYS C 1 453 ? 160.370 170.535 144.462 1.00 74.74  ? 453 LYS C CE  1 
ATOM   10902 N NZ  . LYS C 1 453 ? 161.260 170.431 143.272 1.00 74.74  ? 453 LYS C NZ  1 
ATOM   10903 N N   . PHE C 1 454 ? 159.286 177.540 144.699 1.00 74.31  ? 454 PHE C N   1 
ATOM   10904 C CA  . PHE C 1 454 ? 159.166 178.664 145.621 1.00 74.31  ? 454 PHE C CA  1 
ATOM   10905 C C   . PHE C 1 454 ? 158.535 179.878 144.970 1.00 74.31  ? 454 PHE C C   1 
ATOM   10906 O O   . PHE C 1 454 ? 158.992 180.998 145.186 1.00 74.31  ? 454 PHE C O   1 
ATOM   10907 C CB  . PHE C 1 454 ? 160.530 179.023 146.189 1.00 74.31  ? 454 PHE C CB  1 
ATOM   10908 C CG  . PHE C 1 454 ? 161.036 178.060 147.211 1.00 74.31  ? 454 PHE C CG  1 
ATOM   10909 C CD1 . PHE C 1 454 ? 160.177 177.229 147.888 1.00 74.31  ? 454 PHE C CD1 1 
ATOM   10910 C CD2 . PHE C 1 454 ? 162.380 177.975 147.483 1.00 74.31  ? 454 PHE C CD2 1 
ATOM   10911 C CE1 . PHE C 1 454 ? 160.658 176.352 148.827 1.00 74.31  ? 454 PHE C CE1 1 
ATOM   10912 C CE2 . PHE C 1 454 ? 162.855 177.101 148.416 1.00 74.31  ? 454 PHE C CE2 1 
ATOM   10913 C CZ  . PHE C 1 454 ? 161.995 176.288 149.087 1.00 74.31  ? 454 PHE C CZ  1 
ATOM   10914 N N   . ARG C 1 455 ? 157.505 179.702 144.148 1.00 75.81  ? 455 ARG C N   1 
ATOM   10915 C CA  . ARG C 1 455 ? 157.001 180.812 143.354 1.00 75.81  ? 455 ARG C CA  1 
ATOM   10916 C C   . ARG C 1 455 ? 155.855 181.566 144.021 1.00 75.81  ? 455 ARG C C   1 
ATOM   10917 O O   . ARG C 1 455 ? 155.884 182.796 144.071 1.00 75.81  ? 455 ARG C O   1 
ATOM   10918 C CB  . ARG C 1 455 ? 156.577 180.308 141.981 1.00 75.81  ? 455 ARG C CB  1 
ATOM   10919 C CG  . ARG C 1 455 ? 156.252 181.416 141.033 1.00 75.81  ? 455 ARG C CG  1 
ATOM   10920 C CD  . ARG C 1 455 ? 157.464 182.307 140.821 1.00 75.81  ? 455 ARG C CD  1 
ATOM   10921 N NE  . ARG C 1 455 ? 158.626 181.565 140.357 1.00 75.81  ? 455 ARG C NE  1 
ATOM   10922 C CZ  . ARG C 1 455 ? 158.857 181.251 139.088 1.00 75.81  ? 455 ARG C CZ  1 
ATOM   10923 N NH1 . ARG C 1 455 ? 158.000 181.609 138.148 1.00 75.81  ? 455 ARG C NH1 1 
ATOM   10924 N NH2 . ARG C 1 455 ? 159.945 180.574 138.757 1.00 75.81  ? 455 ARG C NH2 1 
ATOM   10925 N N   . SER C 1 456 ? 154.841 180.872 144.525 1.00 79.04  ? 456 SER C N   1 
ATOM   10926 C CA  . SER C 1 456 ? 153.771 181.532 145.256 1.00 79.04  ? 456 SER C CA  1 
ATOM   10927 C C   . SER C 1 456 ? 153.769 181.066 146.705 1.00 79.04  ? 456 SER C C   1 
ATOM   10928 O O   . SER C 1 456 ? 154.424 180.087 147.061 1.00 79.04  ? 456 SER C O   1 
ATOM   10929 C CB  . SER C 1 456 ? 152.421 181.261 144.603 1.00 79.04  ? 456 SER C CB  1 
ATOM   10930 O OG  . SER C 1 456 ? 152.057 179.908 144.761 1.00 79.04  ? 456 SER C OG  1 
ATOM   10931 N N   . LEU C 1 457 ? 153.012 181.772 147.552 1.00 76.08  ? 457 LEU C N   1 
ATOM   10932 C CA  . LEU C 1 457 ? 152.981 181.437 148.973 1.00 76.08  ? 457 LEU C CA  1 
ATOM   10933 C C   . LEU C 1 457 ? 152.297 180.105 149.222 1.00 76.08  ? 457 LEU C C   1 
ATOM   10934 O O   . LEU C 1 457 ? 152.679 179.369 150.136 1.00 76.08  ? 457 LEU C O   1 
ATOM   10935 C CB  . LEU C 1 457 ? 152.267 182.511 149.786 1.00 76.08  ? 457 LEU C CB  1 
ATOM   10936 C CG  . LEU C 1 457 ? 153.016 183.776 150.186 1.00 76.08  ? 457 LEU C CG  1 
ATOM   10937 C CD1 . LEU C 1 457 ? 153.037 184.754 149.046 1.00 76.08  ? 457 LEU C CD1 1 
ATOM   10938 C CD2 . LEU C 1 457 ? 152.398 184.402 151.418 1.00 76.08  ? 457 LEU C CD2 1 
ATOM   10939 N N   . SER C 1 458 ? 151.303 179.774 148.411 1.00 82.19  ? 458 SER C N   1 
ATOM   10940 C CA  . SER C 1 458 ? 150.616 178.504 148.538 1.00 82.19  ? 458 SER C CA  1 
ATOM   10941 C C   . SER C 1 458 ? 151.491 177.323 148.174 1.00 82.19  ? 458 SER C C   1 
ATOM   10942 O O   . SER C 1 458 ? 151.144 176.200 148.532 1.00 82.19  ? 458 SER C O   1 
ATOM   10943 C CB  . SER C 1 458 ? 149.384 178.490 147.655 1.00 82.19  ? 458 SER C CB  1 
ATOM   10944 O OG  . SER C 1 458 ? 149.781 178.528 146.301 1.00 82.19  ? 458 SER C OG  1 
ATOM   10945 N N   . MET C 1 459 ? 152.589 177.532 147.456 1.00 78.42  ? 459 MET C N   1 
ATOM   10946 C CA  . MET C 1 459 ? 153.559 176.467 147.265 1.00 78.42  ? 459 MET C CA  1 
ATOM   10947 C C   . MET C 1 459 ? 154.631 176.465 148.334 1.00 78.42  ? 459 MET C C   1 
ATOM   10948 O O   . MET C 1 459 ? 155.096 175.391 148.724 1.00 78.42  ? 459 MET C O   1 
ATOM   10949 C CB  . MET C 1 459 ? 154.237 176.583 145.905 1.00 78.42  ? 459 MET C CB  1 
ATOM   10950 C CG  . MET C 1 459 ? 153.366 176.273 144.727 1.00 78.42  ? 459 MET C CG  1 
ATOM   10951 S SD  . MET C 1 459 ? 154.309 176.410 143.202 1.00 78.42  ? 459 MET C SD  1 
ATOM   10952 C CE  . MET C 1 459 ? 153.024 176.174 141.988 1.00 78.42  ? 459 MET C CE  1 
ATOM   10953 N N   . VAL C 1 460 ? 155.039 177.642 148.804 1.00 72.36  ? 460 VAL C N   1 
ATOM   10954 C CA  . VAL C 1 460 ? 156.086 177.715 149.814 1.00 72.36  ? 460 VAL C CA  1 
ATOM   10955 C C   . VAL C 1 460 ? 155.584 177.158 151.133 1.00 72.36  ? 460 VAL C C   1 
ATOM   10956 O O   . VAL C 1 460 ? 156.301 176.434 151.830 1.00 72.36  ? 460 VAL C O   1 
ATOM   10957 C CB  . VAL C 1 460 ? 156.588 179.160 149.945 1.00 72.36  ? 460 VAL C CB  1 
ATOM   10958 C CG1 . VAL C 1 460 ? 157.559 179.301 151.078 1.00 72.36  ? 460 VAL C CG1 1 
ATOM   10959 C CG2 . VAL C 1 460 ? 157.270 179.550 148.687 1.00 72.36  ? 460 VAL C CG2 1 
ATOM   10960 N N   . SER C 1 461 ? 154.324 177.404 151.455 1.00 76.58  ? 461 SER C N   1 
ATOM   10961 C CA  . SER C 1 461 ? 153.729 176.786 152.627 1.00 76.58  ? 461 SER C CA  1 
ATOM   10962 C C   . SER C 1 461 ? 153.498 175.297 152.462 1.00 76.58  ? 461 SER C C   1 
ATOM   10963 O O   . SER C 1 461 ? 153.185 174.631 153.448 1.00 76.58  ? 461 SER C O   1 
ATOM   10964 C CB  . SER C 1 461 ? 152.404 177.451 152.965 1.00 76.58  ? 461 SER C CB  1 
ATOM   10965 O OG  . SER C 1 461 ? 151.792 176.781 154.047 1.00 76.58  ? 461 SER C OG  1 
ATOM   10966 N N   . GLU C 1 462 ? 153.611 174.767 151.250 1.00 76.62  ? 462 GLU C N   1 
ATOM   10967 C CA  . GLU C 1 462 ? 153.623 173.333 151.019 1.00 76.62  ? 462 GLU C CA  1 
ATOM   10968 C C   . GLU C 1 462 ? 155.028 172.779 150.904 1.00 76.62  ? 462 GLU C C   1 
ATOM   10969 O O   . GLU C 1 462 ? 155.303 171.702 151.433 1.00 76.62  ? 462 GLU C O   1 
ATOM   10970 C CB  . GLU C 1 462 ? 152.857 172.999 149.746 1.00 76.62  ? 462 GLU C CB  1 
ATOM   10971 C CG  . GLU C 1 462 ? 151.392 173.274 149.843 1.00 76.62  ? 462 GLU C CG  1 
ATOM   10972 C CD  . GLU C 1 462 ? 150.685 173.071 148.523 1.00 76.62  ? 462 GLU C CD  1 
ATOM   10973 O OE1 . GLU C 1 462 ? 151.372 172.821 147.516 1.00 76.62  ? 462 GLU C OE1 1 
ATOM   10974 O OE2 . GLU C 1 462 ? 149.442 173.167 148.484 1.00 76.62  ? 462 GLU C OE2 1 
ATOM   10975 N N   . CYS C 1 463 ? 155.926 173.496 150.230 1.00 71.93  ? 463 CYS C N   1 
ATOM   10976 C CA  . CYS C 1 463 ? 157.273 172.983 150.039 1.00 71.93  ? 463 CYS C CA  1 
ATOM   10977 C C   . CYS C 1 463 ? 158.083 173.047 151.317 1.00 71.93  ? 463 CYS C C   1 
ATOM   10978 O O   . CYS C 1 463 ? 159.035 172.283 151.474 1.00 71.93  ? 463 CYS C O   1 
ATOM   10979 C CB  . CYS C 1 463 ? 157.988 173.752 148.934 1.00 71.93  ? 463 CYS C CB  1 
ATOM   10980 S SG  . CYS C 1 463 ? 159.561 173.040 148.415 1.00 71.93  ? 463 CYS C SG  1 
ATOM   10981 N N   . LEU C 1 464 ? 157.732 173.938 152.237 1.00 71.95  ? 464 LEU C N   1 
ATOM   10982 C CA  . LEU C 1 464 ? 158.399 173.916 153.528 1.00 71.95  ? 464 LEU C CA  1 
ATOM   10983 C C   . LEU C 1 464 ? 157.748 172.940 154.482 1.00 71.95  ? 464 LEU C C   1 
ATOM   10984 O O   . LEU C 1 464 ? 158.444 172.292 155.263 1.00 71.95  ? 464 LEU C O   1 
ATOM   10985 C CB  . LEU C 1 464 ? 158.403 175.294 154.163 1.00 71.95  ? 464 LEU C CB  1 
ATOM   10986 C CG  . LEU C 1 464 ? 159.229 176.346 153.460 1.00 71.95  ? 464 LEU C CG  1 
ATOM   10987 C CD1 . LEU C 1 464 ? 159.015 177.646 154.164 1.00 71.95  ? 464 LEU C CD1 1 
ATOM   10988 C CD2 . LEU C 1 464 ? 160.668 175.959 153.503 1.00 71.95  ? 464 LEU C CD2 1 
ATOM   10989 N N   . PHE C 1 465 ? 156.428 172.826 154.452 1.00 70.52  ? 465 PHE C N   1 
ATOM   10990 C CA  . PHE C 1 465 ? 155.771 171.964 155.416 1.00 70.52  ? 465 PHE C CA  1 
ATOM   10991 C C   . PHE C 1 465 ? 155.960 170.500 155.081 1.00 70.52  ? 465 PHE C C   1 
ATOM   10992 O O   . PHE C 1 465 ? 156.035 169.667 155.986 1.00 70.52  ? 465 PHE C O   1 
ATOM   10993 C CB  . PHE C 1 465 ? 154.290 172.296 155.494 1.00 70.52  ? 465 PHE C CB  1 
ATOM   10994 C CG  . PHE C 1 465 ? 153.549 171.477 156.485 1.00 70.52  ? 465 PHE C CG  1 
ATOM   10995 C CD1 . PHE C 1 465 ? 153.662 171.732 157.834 1.00 70.52  ? 465 PHE C CD1 1 
ATOM   10996 C CD2 . PHE C 1 465 ? 152.740 170.448 156.070 1.00 70.52  ? 465 PHE C CD2 1 
ATOM   10997 C CE1 . PHE C 1 465 ? 152.977 170.970 158.742 1.00 70.52  ? 465 PHE C CE1 1 
ATOM   10998 C CE2 . PHE C 1 465 ? 152.071 169.696 156.971 1.00 70.52  ? 465 PHE C CE2 1 
ATOM   10999 C CZ  . PHE C 1 465 ? 152.180 169.949 158.307 1.00 70.52  ? 465 PHE C CZ  1 
ATOM   11000 N N   . SER C 1 466 ? 156.065 170.167 153.802 1.00 72.24  ? 466 SER C N   1 
ATOM   11001 C CA  . SER C 1 466 ? 156.402 168.805 153.423 1.00 72.24  ? 466 SER C CA  1 
ATOM   11002 C C   . SER C 1 466 ? 157.864 168.501 153.644 1.00 72.24  ? 466 SER C C   1 
ATOM   11003 O O   . SER C 1 466 ? 158.269 167.344 153.527 1.00 72.24  ? 466 SER C O   1 
ATOM   11004 C CB  . SER C 1 466 ? 156.060 168.553 151.960 1.00 72.24  ? 466 SER C CB  1 
ATOM   11005 O OG  . SER C 1 466 ? 156.884 169.328 151.118 1.00 72.24  ? 466 SER C OG  1 
ATOM   11006 N N   . LEU C 1 467 ? 158.659 169.511 153.953 1.00 66.77  ? 467 LEU C N   1 
ATOM   11007 C CA  . LEU C 1 467 ? 160.085 169.334 154.096 1.00 66.77  ? 467 LEU C CA  1 
ATOM   11008 C C   . LEU C 1 467 ? 160.481 168.996 155.517 1.00 66.77  ? 467 LEU C C   1 
ATOM   11009 O O   . LEU C 1 467 ? 161.403 168.207 155.705 1.00 66.77  ? 467 LEU C O   1 
ATOM   11010 C CB  . LEU C 1 467 ? 160.800 170.595 153.615 1.00 66.77  ? 467 LEU C CB  1 
ATOM   11011 C CG  . LEU C 1 467 ? 162.260 170.584 153.213 1.00 66.77  ? 467 LEU C CG  1 
ATOM   11012 C CD1 . LEU C 1 467 ? 162.431 171.555 152.081 1.00 66.77  ? 467 LEU C CD1 1 
ATOM   11013 C CD2 . LEU C 1 467 ? 163.121 171.008 154.354 1.00 66.77  ? 467 LEU C CD2 1 
ATOM   11014 N N   . ILE C 1 468 ? 159.776 169.519 156.523 1.00 69.86  ? 468 ILE C N   1 
ATOM   11015 C CA  . ILE C 1 468 ? 160.121 169.193 157.902 1.00 69.86  ? 468 ILE C CA  1 
ATOM   11016 C C   . ILE C 1 468 ? 159.704 167.783 158.281 1.00 69.86  ? 468 ILE C C   1 
ATOM   11017 O O   . ILE C 1 468 ? 160.230 167.231 159.251 1.00 69.86  ? 468 ILE C O   1 
ATOM   11018 C CB  . ILE C 1 468 ? 159.517 170.188 158.905 1.00 69.86  ? 468 ILE C CB  1 
ATOM   11019 C CG1 . ILE C 1 468 ? 158.003 170.097 158.936 1.00 69.86  ? 468 ILE C CG1 1 
ATOM   11020 C CG2 . ILE C 1 468 ? 159.898 171.588 158.541 1.00 69.86  ? 468 ILE C CG2 1 
ATOM   11021 C CD1 . ILE C 1 468 ? 157.405 170.890 160.048 1.00 69.86  ? 468 ILE C CD1 1 
ATOM   11022 N N   . ASN C 1 469 ? 158.785 167.176 157.543 1.00 70.77  ? 469 ASN C N   1 
ATOM   11023 C CA  . ASN C 1 469 ? 158.467 165.782 157.776 1.00 70.77  ? 469 ASN C CA  1 
ATOM   11024 C C   . ASN C 1 469 ? 159.452 164.864 157.083 1.00 70.77  ? 469 ASN C C   1 
ATOM   11025 O O   . ASN C 1 469 ? 159.458 163.664 157.358 1.00 70.77  ? 469 ASN C O   1 
ATOM   11026 C CB  . ASN C 1 469 ? 157.060 165.488 157.285 1.00 70.77  ? 469 ASN C CB  1 
ATOM   11027 C CG  . ASN C 1 469 ? 156.030 166.327 157.977 1.00 70.77  ? 469 ASN C CG  1 
ATOM   11028 O OD1 . ASN C 1 469 ? 156.085 166.528 159.182 1.00 70.77  ? 469 ASN C OD1 1 
ATOM   11029 N ND2 . ASN C 1 469 ? 155.095 166.850 157.211 1.00 70.77  ? 469 ASN C ND2 1 
ATOM   11030 N N   . GLY C 1 470 ? 160.275 165.400 156.191 1.00 74.90  ? 470 GLY C N   1 
ATOM   11031 C CA  . GLY C 1 470 ? 161.272 164.600 155.515 1.00 74.90  ? 470 GLY C CA  1 
ATOM   11032 C C   . GLY C 1 470 ? 160.816 164.046 154.186 1.00 74.90  ? 470 GLY C C   1 
ATOM   11033 O O   . GLY C 1 470 ? 160.854 162.833 153.974 1.00 74.90  ? 470 GLY C O   1 
ATOM   11034 N N   . ASP C 1 471 ? 160.368 164.916 153.286 1.00 75.85  ? 471 ASP C N   1 
ATOM   11035 C CA  . ASP C 1 471 ? 159.924 164.470 151.975 1.00 75.85  ? 471 ASP C CA  1 
ATOM   11036 C C   . ASP C 1 471 ? 160.206 165.560 150.959 1.00 75.85  ? 471 ASP C C   1 
ATOM   11037 O O   . ASP C 1 471 ? 159.891 166.726 151.210 1.00 75.85  ? 471 ASP C O   1 
ATOM   11038 C CB  . ASP C 1 471 ? 158.437 164.140 151.991 1.00 75.85  ? 471 ASP C CB  1 
ATOM   11039 C CG  . ASP C 1 471 ? 157.996 163.370 150.773 1.00 75.85  ? 471 ASP C CG  1 
ATOM   11040 O OD1 . ASP C 1 471 ? 158.828 163.060 149.898 1.00 75.85  ? 471 ASP C OD1 1 
ATOM   11041 O OD2 . ASP C 1 471 ? 156.795 163.068 150.694 1.00 75.85  ? 471 ASP C OD2 1 
ATOM   11042 N N   . ASP C 1 472 ? 160.733 165.154 149.803 1.00 84.99  ? 472 ASP C N   1 
ATOM   11043 C CA  . ASP C 1 472 ? 161.258 166.044 148.767 1.00 84.99  ? 472 ASP C CA  1 
ATOM   11044 C C   . ASP C 1 472 ? 162.235 167.045 149.364 1.00 84.99  ? 472 ASP C C   1 
ATOM   11045 O O   . ASP C 1 472 ? 162.046 168.257 149.314 1.00 84.99  ? 472 ASP C O   1 
ATOM   11046 C CB  . ASP C 1 472 ? 160.142 166.728 147.987 1.00 84.99  ? 472 ASP C CB  1 
ATOM   11047 C CG  . ASP C 1 472 ? 159.550 165.816 146.952 1.00 84.99  ? 472 ASP C CG  1 
ATOM   11048 O OD1 . ASP C 1 472 ? 160.305 164.964 146.443 1.00 84.99  ? 472 ASP C OD1 1 
ATOM   11049 O OD2 . ASP C 1 472 ? 158.350 165.928 146.648 1.00 84.99  ? 472 ASP C OD2 1 
ATOM   11050 N N   . MET C 1 473 ? 163.284 166.496 149.961 1.00 77.09  ? 473 MET C N   1 
ATOM   11051 C CA  . MET C 1 473 ? 164.333 167.301 150.556 1.00 77.09  ? 473 MET C CA  1 
ATOM   11052 C C   . MET C 1 473 ? 165.567 167.384 149.680 1.00 77.09  ? 473 MET C C   1 
ATOM   11053 O O   . MET C 1 473 ? 166.079 168.480 149.454 1.00 77.09  ? 473 MET C O   1 
ATOM   11054 C CB  . MET C 1 473 ? 164.717 166.737 151.917 1.00 77.09  ? 473 MET C CB  1 
ATOM   11055 C CG  . MET C 1 473 ? 165.587 167.642 152.729 1.00 77.09  ? 473 MET C CG  1 
ATOM   11056 S SD  . MET C 1 473 ? 166.003 166.833 154.266 1.00 77.09  ? 473 MET C SD  1 
ATOM   11057 C CE  . MET C 1 473 ? 164.385 166.699 154.991 1.00 77.09  ? 473 MET C CE  1 
ATOM   11058 N N   . PHE C 1 474 ? 166.053 166.252 149.168 1.00 75.11  ? 474 PHE C N   1 
ATOM   11059 C CA  . PHE C 1 474 ? 167.224 166.289 148.302 1.00 75.11  ? 474 PHE C CA  1 
ATOM   11060 C C   . PHE C 1 474 ? 166.912 166.918 146.956 1.00 75.11  ? 474 PHE C C   1 
ATOM   11061 O O   . PHE C 1 474 ? 167.800 167.512 146.339 1.00 75.11  ? 474 PHE C O   1 
ATOM   11062 C CB  . PHE C 1 474 ? 167.788 164.885 148.118 1.00 75.11  ? 474 PHE C CB  1 
ATOM   11063 C CG  . PHE C 1 474 ? 168.931 164.810 147.150 1.00 75.11  ? 474 PHE C CG  1 
ATOM   11064 C CD1 . PHE C 1 474 ? 170.169 165.313 147.480 1.00 75.11  ? 474 PHE C CD1 1 
ATOM   11065 C CD2 . PHE C 1 474 ? 168.759 164.240 145.907 1.00 75.11  ? 474 PHE C CD2 1 
ATOM   11066 C CE1 . PHE C 1 474 ? 171.210 165.253 146.589 1.00 75.11  ? 474 PHE C CE1 1 
ATOM   11067 C CE2 . PHE C 1 474 ? 169.797 164.177 145.016 1.00 75.11  ? 474 PHE C CE2 1 
ATOM   11068 C CZ  . PHE C 1 474 ? 171.022 164.684 145.359 1.00 75.11  ? 474 PHE C CZ  1 
ATOM   11069 N N   . VAL C 1 475 ? 165.664 166.831 146.497 1.00 74.79  ? 475 VAL C N   1 
ATOM   11070 C CA  . VAL C 1 475 ? 165.323 167.392 145.196 1.00 74.79  ? 475 VAL C CA  1 
ATOM   11071 C C   . VAL C 1 475 ? 165.374 168.912 145.242 1.00 74.79  ? 475 VAL C C   1 
ATOM   11072 O O   . VAL C 1 475 ? 165.774 169.557 144.267 1.00 74.79  ? 475 VAL C O   1 
ATOM   11073 C CB  . VAL C 1 475 ? 163.945 166.874 144.756 1.00 74.79  ? 475 VAL C CB  1 
ATOM   11074 C CG1 . VAL C 1 475 ? 163.604 167.341 143.356 1.00 74.79  ? 475 VAL C CG1 1 
ATOM   11075 C CG2 . VAL C 1 475 ? 163.907 165.368 144.851 1.00 74.79  ? 475 VAL C CG2 1 
ATOM   11076 N N   . THR C 1 476 ? 165.040 169.508 146.386 1.00 78.41  ? 476 THR C N   1 
ATOM   11077 C CA  . THR C 1 476 ? 165.138 170.954 146.513 1.00 78.41  ? 476 THR C CA  1 
ATOM   11078 C C   . THR C 1 476 ? 166.565 171.416 146.744 1.00 78.41  ? 476 THR C C   1 
ATOM   11079 O O   . THR C 1 476 ? 166.909 172.534 146.355 1.00 78.41  ? 476 THR C O   1 
ATOM   11080 C CB  . THR C 1 476 ? 164.266 171.446 147.650 1.00 78.41  ? 476 THR C CB  1 
ATOM   11081 O OG1 . THR C 1 476 ? 164.788 170.952 148.881 1.00 78.41  ? 476 THR C OG1 1 
ATOM   11082 C CG2 . THR C 1 476 ? 162.879 170.917 147.481 1.00 78.41  ? 476 THR C CG2 1 
ATOM   11083 N N   . PHE C 1 477 ? 167.399 170.603 147.382 1.00 80.88  ? 477 PHE C N   1 
ATOM   11084 C CA  . PHE C 1 477 ? 168.817 170.924 147.424 1.00 80.88  ? 477 PHE C CA  1 
ATOM   11085 C C   . PHE C 1 477 ? 169.478 170.783 146.066 1.00 80.88  ? 477 PHE C C   1 
ATOM   11086 O O   . PHE C 1 477 ? 170.392 171.543 145.747 1.00 80.88  ? 477 PHE C O   1 
ATOM   11087 C CB  . PHE C 1 477 ? 169.548 170.037 148.426 1.00 80.88  ? 477 PHE C CB  1 
ATOM   11088 C CG  . PHE C 1 477 ? 169.457 170.508 149.840 1.00 80.88  ? 477 PHE C CG  1 
ATOM   11089 C CD1 . PHE C 1 477 ? 170.287 171.514 150.295 1.00 80.88  ? 477 PHE C CD1 1 
ATOM   11090 C CD2 . PHE C 1 477 ? 168.574 169.930 150.720 1.00 80.88  ? 477 PHE C CD2 1 
ATOM   11091 C CE1 . PHE C 1 477 ? 170.227 171.938 151.592 1.00 80.88  ? 477 PHE C CE1 1 
ATOM   11092 C CE2 . PHE C 1 477 ? 168.506 170.353 152.017 1.00 80.88  ? 477 PHE C CE2 1 
ATOM   11093 C CZ  . PHE C 1 477 ? 169.333 171.360 152.454 1.00 80.88  ? 477 PHE C CZ  1 
ATOM   11094 N N   . ALA C 1 478 ? 169.043 169.823 145.261 1.00 81.93  ? 478 ALA C N   1 
ATOM   11095 C CA  . ALA C 1 478 ? 169.630 169.649 143.944 1.00 81.93  ? 478 ALA C CA  1 
ATOM   11096 C C   . ALA C 1 478 ? 169.225 170.744 142.977 1.00 81.93  ? 478 ALA C C   1 
ATOM   11097 O O   . ALA C 1 478 ? 169.986 171.053 142.057 1.00 81.93  ? 478 ALA C O   1 
ATOM   11098 C CB  . ALA C 1 478 ? 169.231 168.298 143.363 1.00 81.93  ? 478 ALA C CB  1 
ATOM   11099 N N   . ALA C 1 479 ? 168.054 171.339 143.160 1.00 83.61  ? 479 ALA C N   1 
ATOM   11100 C CA  . ALA C 1 479 ? 167.625 172.401 142.269 1.00 83.61  ? 479 ALA C CA  1 
ATOM   11101 C C   . ALA C 1 479 ? 168.333 173.712 142.547 1.00 83.61  ? 479 ALA C C   1 
ATOM   11102 O O   . ALA C 1 479 ? 168.341 174.588 141.680 1.00 83.61  ? 479 ALA C O   1 
ATOM   11103 C CB  . ALA C 1 479 ? 166.118 172.603 142.378 1.00 83.61  ? 479 ALA C CB  1 
ATOM   11104 N N   . MET C 1 480 ? 168.920 173.874 143.731 1.00 90.34  ? 480 MET C N   1 
ATOM   11105 C CA  . MET C 1 480 ? 169.648 175.103 144.006 1.00 90.34  ? 480 MET C CA  1 
ATOM   11106 C C   . MET C 1 480 ? 170.986 175.128 143.292 1.00 90.34  ? 480 MET C C   1 
ATOM   11107 O O   . MET C 1 480 ? 171.510 176.207 143.009 1.00 90.34  ? 480 MET C O   1 
ATOM   11108 C CB  . MET C 1 480 ? 169.888 175.275 145.501 1.00 90.34  ? 480 MET C CB  1 
ATOM   11109 C CG  . MET C 1 480 ? 168.658 175.362 146.386 1.00 90.34  ? 480 MET C CG  1 
ATOM   11110 S SD  . MET C 1 480 ? 167.478 176.672 146.023 1.00 90.34  ? 480 MET C SD  1 
ATOM   11111 C CE  . MET C 1 480 ? 166.048 175.716 145.507 1.00 90.34  ? 480 MET C CE  1 
ATOM   11112 N N   . GLN C 1 481 ? 171.558 173.963 142.991 1.00 91.17  ? 481 GLN C N   1 
ATOM   11113 C CA  . GLN C 1 481 ? 172.915 173.894 142.465 1.00 91.17  ? 481 GLN C CA  1 
ATOM   11114 C C   . GLN C 1 481 ? 172.983 174.029 140.957 1.00 91.17  ? 481 GLN C C   1 
ATOM   11115 O O   . GLN C 1 481 ? 173.979 173.622 140.351 1.00 91.17  ? 481 GLN C O   1 
ATOM   11116 C CB  . GLN C 1 481 ? 173.599 172.606 142.901 1.00 91.17  ? 481 GLN C CB  1 
ATOM   11117 C CG  . GLN C 1 481 ? 173.983 172.593 144.348 1.00 91.17  ? 481 GLN C CG  1 
ATOM   11118 C CD  . GLN C 1 481 ? 174.750 171.350 144.697 1.00 91.17  ? 481 GLN C CD  1 
ATOM   11119 O OE1 . GLN C 1 481 ? 174.941 170.479 143.852 1.00 91.17  ? 481 GLN C OE1 1 
ATOM   11120 N NE2 . GLN C 1 481 ? 175.201 171.257 145.940 1.00 91.17  ? 481 GLN C NE2 1 
ATOM   11121 N N   . ALA C 1 482 ? 171.953 174.576 140.330 1.00 98.69  ? 482 ALA C N   1 
ATOM   11122 C CA  . ALA C 1 482 ? 172.097 175.179 139.018 1.00 98.69  ? 482 ALA C CA  1 
ATOM   11123 C C   . ALA C 1 482 ? 172.466 176.646 139.126 1.00 98.69  ? 482 ALA C C   1 
ATOM   11124 O O   . ALA C 1 482 ? 172.499 177.345 138.113 1.00 98.69  ? 482 ALA C O   1 
ATOM   11125 C CB  . ALA C 1 482 ? 170.810 175.020 138.210 1.00 98.69  ? 482 ALA C CB  1 
ATOM   11126 N N   . GLN C 1 483 ? 172.735 177.119 140.342 1.00 102.28 ? 483 GLN C N   1 
ATOM   11127 C CA  . GLN C 1 483 ? 173.033 178.515 140.620 1.00 102.28 ? 483 GLN C CA  1 
ATOM   11128 C C   . GLN C 1 483 ? 174.353 178.680 141.353 1.00 102.28 ? 483 GLN C C   1 
ATOM   11129 O O   . GLN C 1 483 ? 174.560 179.697 142.016 1.00 102.28 ? 483 GLN C O   1 
ATOM   11130 C CB  . GLN C 1 483 ? 171.914 179.145 141.447 1.00 102.28 ? 483 GLN C CB  1 
ATOM   11131 C CG  . GLN C 1 483 ? 170.597 179.241 140.737 1.00 102.28 ? 483 GLN C CG  1 
ATOM   11132 C CD  . GLN C 1 483 ? 170.682 180.118 139.517 1.00 102.28 ? 483 GLN C CD  1 
ATOM   11133 O OE1 . GLN C 1 483 ? 170.595 179.636 138.390 1.00 102.28 ? 483 GLN C OE1 1 
ATOM   11134 N NE2 . GLN C 1 483 ? 170.866 181.416 139.730 1.00 102.28 ? 483 GLN C NE2 1 
ATOM   11135 N N   . GLN C 1 484 ? 175.241 177.696 141.283 1.00 103.19 ? 484 GLN C N   1 
ATOM   11136 C CA  . GLN C 1 484 ? 176.513 177.850 141.969 1.00 103.19 ? 484 GLN C CA  1 
ATOM   11137 C C   . GLN C 1 484 ? 177.455 178.749 141.183 1.00 103.19 ? 484 GLN C C   1 
ATOM   11138 O O   . GLN C 1 484 ? 178.383 179.322 141.764 1.00 103.19 ? 484 GLN C O   1 
ATOM   11139 C CB  . GLN C 1 484 ? 177.134 176.476 142.230 1.00 103.19 ? 484 GLN C CB  1 
ATOM   11140 C CG  . GLN C 1 484 ? 178.260 176.456 143.258 1.00 103.19 ? 484 GLN C CG  1 
ATOM   11141 C CD  . GLN C 1 484 ? 178.727 175.051 143.581 1.00 103.19 ? 484 GLN C CD  1 
ATOM   11142 O OE1 . GLN C 1 484 ? 178.251 174.080 142.997 1.00 103.19 ? 484 GLN C OE1 1 
ATOM   11143 N NE2 . GLN C 1 484 ? 179.656 174.936 144.522 1.00 103.19 ? 484 GLN C NE2 1 
ATOM   11144 N N   . GLY C 1 485 ? 177.216 178.907 139.884 1.00 112.26 ? 485 GLY C N   1 
ATOM   11145 C CA  . GLY C 1 485 ? 177.896 179.915 139.094 1.00 112.26 ? 485 GLY C CA  1 
ATOM   11146 C C   . GLY C 1 485 ? 177.048 181.155 138.886 1.00 112.26 ? 485 GLY C C   1 
ATOM   11147 O O   . GLY C 1 485 ? 177.527 182.284 139.036 1.00 112.26 ? 485 GLY C O   1 
ATOM   11148 N N   . ARG C 1 486 ? 175.781 180.952 138.537 1.00 107.23 ? 486 ARG C N   1 
ATOM   11149 C CA  . ARG C 1 486 ? 174.843 182.054 138.365 1.00 107.23 ? 486 ARG C CA  1 
ATOM   11150 C C   . ARG C 1 486 ? 174.471 182.617 139.727 1.00 107.23 ? 486 ARG C C   1 
ATOM   11151 O O   . ARG C 1 486 ? 173.709 181.984 140.464 1.00 107.23 ? 486 ARG C O   1 
ATOM   11152 C CB  . ARG C 1 486 ? 173.593 181.568 137.644 1.00 107.23 ? 486 ARG C CB  1 
ATOM   11153 C CG  . ARG C 1 486 ? 173.811 181.095 136.238 1.00 107.23 ? 486 ARG C CG  1 
ATOM   11154 C CD  . ARG C 1 486 ? 172.508 180.572 135.673 1.00 107.23 ? 486 ARG C CD  1 
ATOM   11155 N NE  . ARG C 1 486 ? 172.652 180.056 134.318 1.00 107.23 ? 486 ARG C NE  1 
ATOM   11156 C CZ  . ARG C 1 486 ? 171.679 179.444 133.655 1.00 107.23 ? 486 ARG C CZ  1 
ATOM   11157 N NH1 . ARG C 1 486 ? 170.499 179.265 134.230 1.00 107.23 ? 486 ARG C NH1 1 
ATOM   11158 N NH2 . ARG C 1 486 ? 171.882 179.003 132.422 1.00 107.23 ? 486 ARG C NH2 1 
ATOM   11159 N N   . SER C 1 487 ? 174.997 183.804 140.047 1.00 103.08 ? 487 SER C N   1 
ATOM   11160 C CA  . SER C 1 487 ? 174.654 184.584 141.242 1.00 103.08 ? 487 SER C CA  1 
ATOM   11161 C C   . SER C 1 487 ? 174.948 183.801 142.524 1.00 103.08 ? 487 SER C C   1 
ATOM   11162 O O   . SER C 1 487 ? 174.056 183.413 143.279 1.00 103.08 ? 487 SER C O   1 
ATOM   11163 C CB  . SER C 1 487 ? 173.194 185.047 141.200 1.00 103.08 ? 487 SER C CB  1 
ATOM   11164 O OG  . SER C 1 487 ? 172.965 185.883 140.083 1.00 103.08 ? 487 SER C OG  1 
ATOM   11165 N N   . SER C 1 488 ? 176.236 183.579 142.744 1.00 92.31  ? 488 SER C N   1 
ATOM   11166 C CA  . SER C 1 488 ? 176.773 182.822 143.869 1.00 92.31  ? 488 SER C CA  1 
ATOM   11167 C C   . SER C 1 488 ? 176.473 183.422 145.224 1.00 92.31  ? 488 SER C C   1 
ATOM   11168 O O   . SER C 1 488 ? 176.893 182.803 146.194 1.00 92.31  ? 488 SER C O   1 
ATOM   11169 C CB  . SER C 1 488 ? 178.281 182.669 143.713 1.00 92.31  ? 488 SER C CB  1 
ATOM   11170 O OG  . SER C 1 488 ? 178.829 182.006 144.833 1.00 92.31  ? 488 SER C OG  1 
ATOM   11171 N N   . LEU C 1 489 ? 175.821 184.565 145.406 1.00 87.99  ? 489 LEU C N   1 
ATOM   11172 C CA  . LEU C 1 489 ? 175.360 184.935 146.735 1.00 87.99  ? 489 LEU C CA  1 
ATOM   11173 C C   . LEU C 1 489 ? 174.068 184.223 147.095 1.00 87.99  ? 489 LEU C C   1 
ATOM   11174 O O   . LEU C 1 489 ? 173.898 183.778 148.235 1.00 87.99  ? 489 LEU C O   1 
ATOM   11175 C CB  . LEU C 1 489 ? 175.153 186.443 146.823 1.00 87.99  ? 489 LEU C CB  1 
ATOM   11176 C CG  . LEU C 1 489 ? 174.698 186.938 148.189 1.00 87.99  ? 489 LEU C CG  1 
ATOM   11177 C CD1 . LEU C 1 489 ? 175.738 186.613 149.230 1.00 87.99  ? 489 LEU C CD1 1 
ATOM   11178 C CD2 . LEU C 1 489 ? 174.446 188.416 148.133 1.00 87.99  ? 489 LEU C CD2 1 
ATOM   11179 N N   . VAL C 1 490 ? 173.167 184.088 146.123 1.00 88.67  ? 490 VAL C N   1 
ATOM   11180 C CA  . VAL C 1 490 ? 171.869 183.482 146.370 1.00 88.67  ? 490 VAL C CA  1 
ATOM   11181 C C   . VAL C 1 490 ? 172.02