data_6E8Y
# 
_entry.id   6E8Y 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6E8Y         
WWPDB D_1000235792 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6E8Y 
_pdbx_database_status.recvd_initial_deposition_date   2018-07-31 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Mydy, L.S.'   1 0000-0002-6976-4426 
'Gulick, A.M.' 2 0000-0003-4238-7453 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Biochemistry 
_citation.journal_id_ASTM           BICHAW 
_citation.journal_id_CSD            0033 
_citation.journal_id_ISSN           1520-4995 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            58 
_citation.language                  ? 
_citation.page_first                1061 
_citation.page_last                 1073 
_citation.title                     
'Human Glycerol 3-Phosphate Dehydrogenase: X-ray Crystal Structures That Guide the Interpretation of Mutagenesis Studies.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.biochem.8b01103 
_citation.pdbx_database_id_PubMed   30640445 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Mydy, L.S.'       1 ? 
primary 'Cristobal, J.R.'  2 ? 
primary 'Katigbak, R.D.'   3 ? 
primary 'Bauer, P.'        4 ? 
primary 'Reyes, A.C.'      5 ? 
primary 'Kamerlin, S.C.L.' 6 ? 
primary 'Richard, J.P.'    7 ? 
primary 'Gulick, A.M.'     8 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   96.03 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6E8Y 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     63.370 
_cell.length_a_esd                 ? 
_cell.length_b                     76.160 
_cell.length_b_esd                 ? 
_cell.length_c                     64.390 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6E8Y 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic' 37608.551 2   1.1.1.8 ? ? ? 
2 non-polymer syn 'PHOSPHATE ION'                                            94.971    1   ?       ? ? ? 
3 non-polymer syn '2,2-bis(hydroxymethyl)propane-1,3-diol'                   136.146   1   ?       ? ? ? 
4 non-polymer syn 'POTASSIUM ION'                                            39.098    2   ?       ? ? ? 
5 water       nat water                                                      18.015    366 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        GPDH-C 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLPGHKLPPNVVAVPDVV
QAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERLGIPMSVLMGANIASEVADEK
FCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAK
LFCSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGPETARELYSILQHKGLVDKFP
LFMAVYKVCYEGQPVGEFIHCLQNHPEHM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLPGHKLPPNVVAVPDVV
QAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERLGIPMSVLMGANIASEVADEK
FCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAK
LFCSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGPETARELYSILQHKGLVDKFP
LFMAVYKVCYEGQPVGEFIHCLQNHPEHM
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   LYS n 
1 5   LYS n 
1 6   VAL n 
1 7   CYS n 
1 8   ILE n 
1 9   VAL n 
1 10  GLY n 
1 11  SER n 
1 12  GLY n 
1 13  ASN n 
1 14  TRP n 
1 15  GLY n 
1 16  SER n 
1 17  ALA n 
1 18  ILE n 
1 19  ALA n 
1 20  LYS n 
1 21  ILE n 
1 22  VAL n 
1 23  GLY n 
1 24  GLY n 
1 25  ASN n 
1 26  ALA n 
1 27  ALA n 
1 28  GLN n 
1 29  LEU n 
1 30  ALA n 
1 31  GLN n 
1 32  PHE n 
1 33  ASP n 
1 34  PRO n 
1 35  ARG n 
1 36  VAL n 
1 37  THR n 
1 38  MET n 
1 39  TRP n 
1 40  VAL n 
1 41  PHE n 
1 42  GLU n 
1 43  GLU n 
1 44  ASP n 
1 45  ILE n 
1 46  GLY n 
1 47  GLY n 
1 48  LYS n 
1 49  LYS n 
1 50  LEU n 
1 51  THR n 
1 52  GLU n 
1 53  ILE n 
1 54  ILE n 
1 55  ASN n 
1 56  THR n 
1 57  GLN n 
1 58  HIS n 
1 59  GLU n 
1 60  ASN n 
1 61  VAL n 
1 62  LYS n 
1 63  TYR n 
1 64  LEU n 
1 65  PRO n 
1 66  GLY n 
1 67  HIS n 
1 68  LYS n 
1 69  LEU n 
1 70  PRO n 
1 71  PRO n 
1 72  ASN n 
1 73  VAL n 
1 74  VAL n 
1 75  ALA n 
1 76  VAL n 
1 77  PRO n 
1 78  ASP n 
1 79  VAL n 
1 80  VAL n 
1 81  GLN n 
1 82  ALA n 
1 83  ALA n 
1 84  GLU n 
1 85  ASP n 
1 86  ALA n 
1 87  ASP n 
1 88  ILE n 
1 89  LEU n 
1 90  ILE n 
1 91  PHE n 
1 92  VAL n 
1 93  VAL n 
1 94  PRO n 
1 95  HIS n 
1 96  GLN n 
1 97  PHE n 
1 98  ILE n 
1 99  GLY n 
1 100 LYS n 
1 101 ILE n 
1 102 CYS n 
1 103 ASP n 
1 104 GLN n 
1 105 LEU n 
1 106 LYS n 
1 107 GLY n 
1 108 HIS n 
1 109 LEU n 
1 110 LYS n 
1 111 ALA n 
1 112 ASN n 
1 113 ALA n 
1 114 THR n 
1 115 GLY n 
1 116 ILE n 
1 117 SER n 
1 118 LEU n 
1 119 ILE n 
1 120 LYS n 
1 121 GLY n 
1 122 VAL n 
1 123 ASP n 
1 124 GLU n 
1 125 GLY n 
1 126 PRO n 
1 127 ASN n 
1 128 GLY n 
1 129 LEU n 
1 130 LYS n 
1 131 LEU n 
1 132 ILE n 
1 133 SER n 
1 134 GLU n 
1 135 VAL n 
1 136 ILE n 
1 137 GLY n 
1 138 GLU n 
1 139 ARG n 
1 140 LEU n 
1 141 GLY n 
1 142 ILE n 
1 143 PRO n 
1 144 MET n 
1 145 SER n 
1 146 VAL n 
1 147 LEU n 
1 148 MET n 
1 149 GLY n 
1 150 ALA n 
1 151 ASN n 
1 152 ILE n 
1 153 ALA n 
1 154 SER n 
1 155 GLU n 
1 156 VAL n 
1 157 ALA n 
1 158 ASP n 
1 159 GLU n 
1 160 LYS n 
1 161 PHE n 
1 162 CYS n 
1 163 GLU n 
1 164 THR n 
1 165 THR n 
1 166 ILE n 
1 167 GLY n 
1 168 CYS n 
1 169 LYS n 
1 170 ASP n 
1 171 PRO n 
1 172 ALA n 
1 173 GLN n 
1 174 GLY n 
1 175 GLN n 
1 176 LEU n 
1 177 LEU n 
1 178 LYS n 
1 179 GLU n 
1 180 LEU n 
1 181 MET n 
1 182 GLN n 
1 183 THR n 
1 184 PRO n 
1 185 ASN n 
1 186 PHE n 
1 187 ARG n 
1 188 ILE n 
1 189 THR n 
1 190 VAL n 
1 191 VAL n 
1 192 GLN n 
1 193 GLU n 
1 194 VAL n 
1 195 ASP n 
1 196 THR n 
1 197 VAL n 
1 198 GLU n 
1 199 ILE n 
1 200 CYS n 
1 201 GLY n 
1 202 ALA n 
1 203 LEU n 
1 204 LYS n 
1 205 ASN n 
1 206 VAL n 
1 207 VAL n 
1 208 ALA n 
1 209 VAL n 
1 210 GLY n 
1 211 ALA n 
1 212 GLY n 
1 213 PHE n 
1 214 CYS n 
1 215 ASP n 
1 216 GLY n 
1 217 LEU n 
1 218 GLY n 
1 219 PHE n 
1 220 GLY n 
1 221 ASP n 
1 222 ASN n 
1 223 THR n 
1 224 LYS n 
1 225 ALA n 
1 226 ALA n 
1 227 VAL n 
1 228 ILE n 
1 229 ARG n 
1 230 LEU n 
1 231 GLY n 
1 232 LEU n 
1 233 MET n 
1 234 GLU n 
1 235 MET n 
1 236 ILE n 
1 237 ALA n 
1 238 PHE n 
1 239 ALA n 
1 240 LYS n 
1 241 LEU n 
1 242 PHE n 
1 243 CYS n 
1 244 SER n 
1 245 GLY n 
1 246 PRO n 
1 247 VAL n 
1 248 SER n 
1 249 SER n 
1 250 ALA n 
1 251 THR n 
1 252 PHE n 
1 253 LEU n 
1 254 GLU n 
1 255 SER n 
1 256 CYS n 
1 257 GLY n 
1 258 VAL n 
1 259 ALA n 
1 260 ASP n 
1 261 LEU n 
1 262 ILE n 
1 263 THR n 
1 264 THR n 
1 265 CYS n 
1 266 TYR n 
1 267 GLY n 
1 268 GLY n 
1 269 ARG n 
1 270 ASN n 
1 271 ARG n 
1 272 LYS n 
1 273 VAL n 
1 274 ALA n 
1 275 GLU n 
1 276 ALA n 
1 277 PHE n 
1 278 ALA n 
1 279 ARG n 
1 280 THR n 
1 281 GLY n 
1 282 LYS n 
1 283 SER n 
1 284 ILE n 
1 285 GLU n 
1 286 GLN n 
1 287 LEU n 
1 288 GLU n 
1 289 LYS n 
1 290 GLU n 
1 291 LEU n 
1 292 LEU n 
1 293 ASN n 
1 294 GLY n 
1 295 GLN n 
1 296 LYS n 
1 297 LEU n 
1 298 GLN n 
1 299 GLY n 
1 300 PRO n 
1 301 GLU n 
1 302 THR n 
1 303 ALA n 
1 304 ARG n 
1 305 GLU n 
1 306 LEU n 
1 307 TYR n 
1 308 SER n 
1 309 ILE n 
1 310 LEU n 
1 311 GLN n 
1 312 HIS n 
1 313 LYS n 
1 314 GLY n 
1 315 LEU n 
1 316 VAL n 
1 317 ASP n 
1 318 LYS n 
1 319 PHE n 
1 320 PRO n 
1 321 LEU n 
1 322 PHE n 
1 323 MET n 
1 324 ALA n 
1 325 VAL n 
1 326 TYR n 
1 327 LYS n 
1 328 VAL n 
1 329 CYS n 
1 330 TYR n 
1 331 GLU n 
1 332 GLY n 
1 333 GLN n 
1 334 PRO n 
1 335 VAL n 
1 336 GLY n 
1 337 GLU n 
1 338 PHE n 
1 339 ILE n 
1 340 HIS n 
1 341 CYS n 
1 342 LEU n 
1 343 GLN n 
1 344 ASN n 
1 345 HIS n 
1 346 PRO n 
1 347 GLU n 
1 348 HIS n 
1 349 MET n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   349 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 GPD1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GPDA_HUMAN 
_struct_ref.pdbx_db_accession          P21695 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLPGHKLPPNVVAVPDVV
QAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERLGIPMSVLMGANIASEVADEK
FCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAK
LFCSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGPETARELYSILQHKGLVDKFP
LFMAVYKVCYEGQPVGEFIHCLQNHPEHM
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6E8Y A 1 ? 349 ? P21695 1 ? 349 ? 1 349 
2 1 6E8Y B 1 ? 349 ? P21695 1 ? 349 ? 1 349 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
3SY non-polymer         . '2,2-bis(hydroxymethyl)propane-1,3-diol' ? 'C5 H12 O4'      136.146 
ALA 'L-peptide linking' y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
K   non-polymer         . 'POTASSIUM ION'                          ? 'K 1'            39.098  
LEU 'L-peptide linking' y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION'                          ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6E8Y 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.05 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         40.13 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            287 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '175 mM potassium chloride, 23% PEG 20000, 0.1M bis-tris propane pH 7.0; 10 mg/mL' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-04-08 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0332 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0332 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            23.51 
_reflns.entry_id                         6E8Y 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.85 
_reflns.d_resolution_low                 47.48 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       51748 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.4 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.2 
_reflns.pdbx_Rmerge_I_obs                0.074 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.0 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.089 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.995 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.85 
_reflns_shell.d_res_low                   1.92 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           5043 
_reflns_shell.percent_possible_all        97.6 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.314 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.0 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.385 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.793 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               27.39 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6E8Y 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.850 
_refine.ls_d_res_low                             47.48 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     51727 
_refine.ls_number_reflns_R_free                  4461 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    90.54 
_refine.ls_percent_reflns_R_free                 4.82 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1723 
_refine.ls_R_factor_R_free                       0.2102 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1704 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.09 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6E8Z 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.39 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.22 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5092 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         16 
_refine_hist.number_atoms_solvent             366 
_refine_hist.number_atoms_total               5474 
_refine_hist.d_res_high                       1.850 
_refine_hist.d_res_low                        47.48 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.011  ? 5192 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.048  ? 7032 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 13.441 ? 3106 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.056  ? 819  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007  ? 911  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.8501 1.8711  . . 139 2643 82.00 . . . 0.2989 . 0.2832 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8711 1.8931  . . 122 2773 85.00 . . . 0.3020 . 0.2708 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8931 1.9162  . . 171 2781 86.00 . . . 0.3147 . 0.2608 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9162 1.9404  . . 178 2885 89.00 . . . 0.2884 . 0.2357 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9404 1.9660  . . 144 2835 89.00 . . . 0.2656 . 0.2334 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9660 1.9929  . . 143 2907 89.00 . . . 0.2772 . 0.2262 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9929 2.0214  . . 137 2912 89.00 . . . 0.2641 . 0.2208 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0214 2.0516  . . 149 2888 90.00 . . . 0.2546 . 0.2069 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0516 2.0836  . . 145 2911 90.00 . . . 0.2770 . 0.1981 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0836 2.1178  . . 164 2883 89.00 . . . 0.2446 . 0.2109 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1178 2.1543  . . 148 2907 90.00 . . . 0.2464 . 0.2005 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1543 2.1935  . . 133 2904 89.00 . . . 0.2728 . 0.1941 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1935 2.2357  . . 157 2847 89.00 . . . 0.2311 . 0.1875 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2357 2.2813  . . 105 2857 87.00 . . . 0.2041 . 0.1864 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2813 2.3309  . . 146 2902 89.00 . . . 0.2609 . 0.1899 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3309 2.3851  . . 175 2914 90.00 . . . 0.2223 . 0.1919 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3851 2.4448  . . 143 2887 90.00 . . . 0.2297 . 0.1807 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4448 2.5108  . . 180 2948 92.00 . . . 0.2162 . 0.1755 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5108 2.5847  . . 110 3054 92.00 . . . 0.1921 . 0.1758 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5847 2.6682  . . 128 3064 93.00 . . . 0.2187 . 0.1765 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6682 2.7635  . . 147 2996 93.00 . . . 0.2139 . 0.1727 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7635 2.8741  . . 150 2974 92.00 . . . 0.2156 . 0.1732 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8741 3.0049  . . 205 2955 92.00 . . . 0.2186 . 0.1604 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0049 3.1633  . . 127 3025 92.00 . . . 0.2018 . 0.1636 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1633 3.3615  . . 184 2883 91.00 . . . 0.1965 . 0.1585 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3615 3.6209  . . 98  3051 93.00 . . . 0.1827 . 0.1472 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6209 3.9852  . . 153 3155 96.00 . . . 0.1817 . 0.1342 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9852 4.5615  . . 167 3126 97.00 . . . 0.1671 . 0.1274 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5615 5.7456  . . 108 3139 95.00 . . . 0.1773 . 0.1436 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.7456 49.0295 . . 205 3055 96.00 . . . 0.1705 . 0.1680 . . . . . . . . . . 
# 
_struct.entry_id                     6E8Y 
_struct.title                        'Unliganded Human Glycerol 3-Phosphate Dehydrogenase' 
_struct.pdbx_descriptor              'Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic (E.C.1.1.1.8)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6E8Y 
_struct_keywords.text            oxidoreductase 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 12  ? LEU A 29  ? GLY A 12  LEU A 29  1 ? 18 
HELX_P HELX_P2  AA2 THR A 51  ? HIS A 58  ? THR A 51  HIS A 58  1 ? 8  
HELX_P HELX_P3  AA3 ASP A 78  ? GLU A 84  ? ASP A 78  GLU A 84  1 ? 7  
HELX_P HELX_P4  AA4 PRO A 94  ? LYS A 106 ? PRO A 94  LYS A 106 1 ? 13 
HELX_P HELX_P5  AA5 LEU A 131 ? GLY A 141 ? LEU A 131 GLY A 141 1 ? 11 
HELX_P HELX_P6  AA6 ILE A 152 ? ASP A 158 ? ILE A 152 ASP A 158 1 ? 7  
HELX_P HELX_P7  AA7 ASP A 170 ? GLN A 182 ? ASP A 170 GLN A 182 1 ? 13 
HELX_P HELX_P8  AA8 GLU A 193 ? LEU A 217 ? GLU A 193 LEU A 217 1 ? 25 
HELX_P HELX_P9  AA9 GLY A 220 ? CYS A 243 ? GLY A 220 CYS A 243 1 ? 24 
HELX_P HELX_P10 AB1 SER A 248 ? GLU A 254 ? SER A 248 GLU A 254 5 ? 7  
HELX_P HELX_P11 AB2 GLY A 257 ? GLY A 267 ? GLY A 257 GLY A 267 1 ? 11 
HELX_P HELX_P12 AB3 GLY A 268 ? GLY A 281 ? GLY A 268 GLY A 281 1 ? 14 
HELX_P HELX_P13 AB4 SER A 283 ? ASN A 293 ? SER A 283 ASN A 293 1 ? 11 
HELX_P HELX_P14 AB5 LEU A 297 ? LYS A 313 ? LEU A 297 LYS A 313 1 ? 17 
HELX_P HELX_P15 AB6 LEU A 315 ? LYS A 318 ? LEU A 315 LYS A 318 5 ? 4  
HELX_P HELX_P16 AB7 PHE A 319 ? GLU A 331 ? PHE A 319 GLU A 331 1 ? 13 
HELX_P HELX_P17 AB8 PRO A 334 ? GLN A 343 ? PRO A 334 GLN A 343 5 ? 10 
HELX_P HELX_P18 AB9 HIS A 345 ? MET A 349 ? HIS A 345 MET A 349 5 ? 5  
HELX_P HELX_P19 AC1 GLY B 12  ? LEU B 29  ? GLY B 12  LEU B 29  1 ? 18 
HELX_P HELX_P20 AC2 LEU B 50  ? HIS B 58  ? LEU B 50  HIS B 58  1 ? 9  
HELX_P HELX_P21 AC3 ASP B 78  ? GLU B 84  ? ASP B 78  GLU B 84  1 ? 7  
HELX_P HELX_P22 AC4 PRO B 94  ? LYS B 106 ? PRO B 94  LYS B 106 1 ? 13 
HELX_P HELX_P23 AC5 LEU B 131 ? GLY B 141 ? LEU B 131 GLY B 141 1 ? 11 
HELX_P HELX_P24 AC6 ILE B 152 ? ASP B 158 ? ILE B 152 ASP B 158 1 ? 7  
HELX_P HELX_P25 AC7 ASP B 170 ? GLN B 182 ? ASP B 170 GLN B 182 1 ? 13 
HELX_P HELX_P26 AC8 GLU B 193 ? LEU B 217 ? GLU B 193 LEU B 217 1 ? 25 
HELX_P HELX_P27 AC9 GLY B 220 ? CYS B 243 ? GLY B 220 CYS B 243 1 ? 24 
HELX_P HELX_P28 AD1 SER B 248 ? GLU B 254 ? SER B 248 GLU B 254 5 ? 7  
HELX_P HELX_P29 AD2 GLY B 257 ? GLY B 267 ? GLY B 257 GLY B 267 1 ? 11 
HELX_P HELX_P30 AD3 GLY B 268 ? GLY B 281 ? GLY B 268 GLY B 281 1 ? 14 
HELX_P HELX_P31 AD4 SER B 283 ? ASN B 293 ? SER B 283 ASN B 293 1 ? 11 
HELX_P HELX_P32 AD5 LEU B 297 ? GLY B 314 ? LEU B 297 GLY B 314 1 ? 18 
HELX_P HELX_P33 AD6 LEU B 315 ? LYS B 318 ? LEU B 315 LYS B 318 5 ? 4  
HELX_P HELX_P34 AD7 PHE B 319 ? GLU B 331 ? PHE B 319 GLU B 331 1 ? 13 
HELX_P HELX_P35 AD8 PRO B 334 ? PHE B 338 ? PRO B 334 PHE B 338 5 ? 5  
HELX_P HELX_P36 AD9 ILE B 339 ? GLN B 343 ? ILE B 339 GLN B 343 5 ? 5  
HELX_P HELX_P37 AE1 HIS B 345 ? MET B 349 ? HIS B 345 MET B 349 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ALA 26 O ? ? ? 1_555 E K   . K ? ? A ALA 26  A K   403 1_555 ? ? ? ? ? ? ? 2.443 ? 
metalc2  metalc ? ? A ALA 27 O ? ? ? 1_555 E K   . K ? ? A ALA 27  A K   403 1_555 ? ? ? ? ? ? ? 2.926 ? 
metalc3  metalc ? ? A LEU 29 O ? ? ? 1_555 E K   . K ? ? A LEU 29  A K   403 1_555 ? ? ? ? ? ? ? 2.821 ? 
metalc4  metalc ? ? A PHE 32 O ? ? ? 1_555 E K   . K ? ? A PHE 32  A K   403 1_555 ? ? ? ? ? ? ? 2.730 ? 
metalc5  metalc ? ? B ALA 26 O ? ? ? 1_555 F K   . K ? ? B ALA 26  B K   401 1_555 ? ? ? ? ? ? ? 2.785 ? 
metalc6  metalc ? ? B ALA 27 O ? ? ? 1_555 F K   . K ? ? B ALA 27  B K   401 1_555 ? ? ? ? ? ? ? 3.086 ? 
metalc7  metalc ? ? B LEU 29 O ? ? ? 1_555 F K   . K ? ? B LEU 29  B K   401 1_555 ? ? ? ? ? ? ? 2.687 ? 
metalc8  metalc ? ? B PHE 32 O ? ? ? 1_555 F K   . K ? ? B PHE 32  B K   401 1_555 ? ? ? ? ? ? ? 2.621 ? 
metalc9  metalc ? ? F K   .  K ? ? ? 1_555 H HOH . O ? ? B K   401 B HOH 613 1_555 ? ? ? ? ? ? ? 2.638 ? 
metalc10 metalc ? ? F K   .  K ? ? ? 1_555 H HOH . O ? ? B K   401 B HOH 651 1_555 ? ? ? ? ? ? ? 3.088 ? 
metalc11 metalc ? ? E K   .  K ? ? ? 1_555 G HOH . O ? ? A K   403 A HOH 573 1_455 ? ? ? ? ? ? ? 2.706 ? 
metalc12 metalc ? ? F K   .  K ? ? ? 1_555 H HOH . O ? ? B K   401 B HOH 535 1_655 ? ? ? ? ? ? ? 2.787 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 2 ? 
AA3 ? 8 ? 
AA4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? anti-parallel 
AA1 7 8 ? parallel      
AA2 1 2 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? parallel      
AA3 3 4 ? parallel      
AA3 4 5 ? parallel      
AA3 5 6 ? parallel      
AA3 6 7 ? anti-parallel 
AA3 7 8 ? parallel      
AA4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 73  ? VAL A 76  ? VAL A 73  VAL A 76  
AA1 2 PHE A 32  ? TRP A 39  ? PHE A 32  TRP A 39  
AA1 3 LYS A 4   ? VAL A 9   ? LYS A 4   VAL A 9   
AA1 4 ILE A 88  ? PHE A 91  ? ILE A 88  PHE A 91  
AA1 5 THR A 114 ? SER A 117 ? THR A 114 SER A 117 
AA1 6 MET A 144 ? MET A 148 ? MET A 144 MET A 148 
AA1 7 CYS A 162 ? GLY A 167 ? CYS A 162 GLY A 167 
AA1 8 PHE A 186 ? VAL A 191 ? PHE A 186 VAL A 191 
AA2 1 ASP A 123 ? GLY A 125 ? ASP A 123 GLY A 125 
AA2 2 GLY A 128 ? LYS A 130 ? GLY A 128 LYS A 130 
AA3 1 VAL B 73  ? VAL B 76  ? VAL B 73  VAL B 76  
AA3 2 VAL B 36  ? TRP B 39  ? VAL B 36  TRP B 39  
AA3 3 VAL B 6   ? VAL B 9   ? VAL B 6   VAL B 9   
AA3 4 ILE B 88  ? PHE B 91  ? ILE B 88  PHE B 91  
AA3 5 THR B 114 ? SER B 117 ? THR B 114 SER B 117 
AA3 6 MET B 144 ? MET B 148 ? MET B 144 MET B 148 
AA3 7 CYS B 162 ? GLY B 167 ? CYS B 162 GLY B 167 
AA3 8 PHE B 186 ? VAL B 191 ? PHE B 186 VAL B 191 
AA4 1 ASP B 44  ? ILE B 45  ? ASP B 44  ILE B 45  
AA4 2 LYS B 48  ? LYS B 49  ? LYS B 48  LYS B 49  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O VAL A 74  ? O VAL A 74  N MET A 38  ? N MET A 38  
AA1 2 3 O THR A 37  ? O THR A 37  N ILE A 8   ? N ILE A 8   
AA1 3 4 N CYS A 7   ? N CYS A 7   O ILE A 90  ? O ILE A 90  
AA1 4 5 N PHE A 91  ? N PHE A 91  O ILE A 116 ? O ILE A 116 
AA1 5 6 N SER A 117 ? N SER A 117 O SER A 145 ? O SER A 145 
AA1 6 7 N VAL A 146 ? N VAL A 146 O GLY A 167 ? O GLY A 167 
AA1 7 8 N ILE A 166 ? N ILE A 166 O VAL A 191 ? O VAL A 191 
AA2 1 2 N ASP A 123 ? N ASP A 123 O LYS A 130 ? O LYS A 130 
AA3 1 2 O VAL B 74  ? O VAL B 74  N VAL B 36  ? N VAL B 36  
AA3 2 3 O THR B 37  ? O THR B 37  N ILE B 8   ? N ILE B 8   
AA3 3 4 N VAL B 9   ? N VAL B 9   O ILE B 90  ? O ILE B 90  
AA3 4 5 N PHE B 91  ? N PHE B 91  O ILE B 116 ? O ILE B 116 
AA3 5 6 N SER B 117 ? N SER B 117 O SER B 145 ? O SER B 145 
AA3 6 7 N MET B 148 ? N MET B 148 O THR B 165 ? O THR B 165 
AA3 7 8 N ILE B 166 ? N ILE B 166 O VAL B 191 ? O VAL B 191 
AA4 1 2 N ILE B 45  ? N ILE B 45  O LYS B 48  ? O LYS B 48  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A PO4 401 ? 4 'binding site for residue PO4 A 401' 
AC2 Software A 3SY 402 ? 7 'binding site for residue 3SY A 402' 
AC3 Software A K   403 ? 6 'binding site for residue K A 403'   
AC4 Software B K   401 ? 7 'binding site for residue K B 401'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 LYS A 240 ? LYS A 240 . ? 1_555 ? 
2  AC1 4 CYS A 243 ? CYS A 243 . ? 1_555 ? 
3  AC1 4 GLY A 245 ? GLY A 245 . ? 1_555 ? 
4  AC1 4 HOH G .   ? HOH A 543 . ? 1_555 ? 
5  AC2 7 LYS A 130 ? LYS A 130 . ? 1_555 ? 
6  AC2 7 LEU A 131 ? LEU A 131 . ? 1_555 ? 
7  AC2 7 GLU A 134 ? GLU A 134 . ? 1_555 ? 
8  AC2 7 ASP A 195 ? ASP A 195 . ? 1_555 ? 
9  AC2 7 PHE A 242 ? PHE A 242 . ? 1_555 ? 
10 AC2 7 CYS A 243 ? CYS A 243 . ? 1_555 ? 
11 AC2 7 SER A 244 ? SER A 244 . ? 1_555 ? 
12 AC3 6 ALA A 26  ? ALA A 26  . ? 1_555 ? 
13 AC3 6 ALA A 27  ? ALA A 27  . ? 1_555 ? 
14 AC3 6 LEU A 29  ? LEU A 29  . ? 1_555 ? 
15 AC3 6 PHE A 32  ? PHE A 32  . ? 1_555 ? 
16 AC3 6 PRO A 34  ? PRO A 34  . ? 1_555 ? 
17 AC3 6 HOH G .   ? HOH A 573 . ? 1_455 ? 
18 AC4 7 ALA B 26  ? ALA B 26  . ? 1_555 ? 
19 AC4 7 ALA B 27  ? ALA B 27  . ? 1_555 ? 
20 AC4 7 LEU B 29  ? LEU B 29  . ? 1_555 ? 
21 AC4 7 PHE B 32  ? PHE B 32  . ? 1_555 ? 
22 AC4 7 HOH H .   ? HOH B 535 . ? 1_655 ? 
23 AC4 7 HOH H .   ? HOH B 613 . ? 1_555 ? 
24 AC4 7 HOH H .   ? HOH B 651 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6E8Y 
_atom_sites.fract_transf_matrix[1][1]   0.015780 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001667 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013130 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015617 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
K 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . ALA A 1 2   ? -35.853 -30.244 -29.639 1.00 44.01 ? 2   ALA A N    1 
ATOM   2     C CA   . ALA A 1 2   ? -36.546 -29.091 -30.204 1.00 52.45 ? 2   ALA A CA   1 
ATOM   3     C C    . ALA A 1 2   ? -35.520 -28.072 -30.680 1.00 48.86 ? 2   ALA A C    1 
ATOM   4     O O    . ALA A 1 2   ? -34.368 -28.433 -30.946 1.00 53.71 ? 2   ALA A O    1 
ATOM   5     C CB   . ALA A 1 2   ? -37.499 -28.467 -29.174 1.00 51.28 ? 2   ALA A CB   1 
ATOM   6     H HA   . ALA A 1 2   ? -37.069 -29.376 -30.970 1.00 62.91 ? 2   ALA A HA   1 
ATOM   7     H HB1  . ALA A 1 2   ? -37.944 -27.705 -29.577 1.00 61.52 ? 2   ALA A HB1  1 
ATOM   8     H HB2  . ALA A 1 2   ? -38.154 -29.131 -28.908 1.00 61.52 ? 2   ALA A HB2  1 
ATOM   9     H HB3  . ALA A 1 2   ? -36.986 -28.181 -28.402 1.00 61.52 ? 2   ALA A HB3  1 
ATOM   10    N N    . SER A 1 3   ? -35.931 -26.809 -30.797 1.00 40.80 ? 3   SER A N    1 
ATOM   11    C CA   . SER A 1 3   ? -34.982 -25.758 -31.135 1.00 39.35 ? 3   SER A CA   1 
ATOM   12    C C    . SER A 1 3   ? -34.048 -25.512 -29.946 1.00 38.17 ? 3   SER A C    1 
ATOM   13    O O    . SER A 1 3   ? -34.435 -25.673 -28.785 1.00 40.41 ? 3   SER A O    1 
ATOM   14    C CB   . SER A 1 3   ? -35.711 -24.472 -31.523 1.00 39.45 ? 3   SER A CB   1 
ATOM   15    O OG   . SER A 1 3   ? -36.408 -23.927 -30.411 1.00 41.42 ? 3   SER A OG   1 
ATOM   16    H H    . SER A 1 3   ? -36.741 -26.541 -30.687 1.00 48.94 ? 3   SER A H    1 
ATOM   17    H HA   . SER A 1 3   ? -34.444 -26.042 -31.891 1.00 47.20 ? 3   SER A HA   1 
ATOM   18    H HB2  . SER A 1 3   ? -35.062 -23.823 -31.836 1.00 47.31 ? 3   SER A HB2  1 
ATOM   19    H HB3  . SER A 1 3   ? -36.348 -24.670 -32.227 1.00 47.31 ? 3   SER A HB3  1 
ATOM   20    H HG   . SER A 1 3   ? -36.974 -24.479 -30.128 1.00 49.69 ? 3   SER A HG   1 
ATOM   21    N N    . LYS A 1 4   ? -32.805 -25.129 -30.244 1.00 40.51 ? 4   LYS A N    1 
ATOM   22    C CA   . LYS A 1 4   ? -31.767 -25.017 -29.217 1.00 27.72 ? 4   LYS A CA   1 
ATOM   23    C C    . LYS A 1 4   ? -31.869 -23.691 -28.504 1.00 24.97 ? 4   LYS A C    1 
ATOM   24    O O    . LYS A 1 4   ? -32.051 -22.647 -29.137 1.00 28.27 ? 4   LYS A O    1 
ATOM   25    C CB   . LYS A 1 4   ? -30.383 -25.162 -29.839 1.00 32.24 ? 4   LYS A CB   1 
ATOM   26    C CG   . LYS A 1 4   ? -30.189 -26.438 -30.512 1.00 31.06 ? 4   LYS A CG   1 
ATOM   27    C CD   . LYS A 1 4   ? -29.991 -27.571 -29.554 1.00 32.16 ? 4   LYS A CD   1 
ATOM   28    C CE   . LYS A 1 4   ? -29.063 -28.575 -30.216 1.00 38.79 ? 4   LYS A CE   1 
ATOM   29    N NZ   . LYS A 1 4   ? -29.003 -29.872 -29.535 1.00 47.53 ? 4   LYS A NZ   1 
ATOM   30    H H    . LYS A 1 4   ? -32.536 -24.928 -31.036 1.00 48.59 ? 4   LYS A H    1 
ATOM   31    H HA   . LYS A 1 4   ? -31.884 -25.725 -28.564 1.00 33.24 ? 4   LYS A HA   1 
ATOM   32    H HB2  . LYS A 1 4   ? -30.257 -24.457 -30.494 1.00 38.66 ? 4   LYS A HB2  1 
ATOM   33    H HB3  . LYS A 1 4   ? -29.715 -25.088 -29.141 1.00 38.66 ? 4   LYS A HB3  1 
ATOM   34    H HG2  . LYS A 1 4   ? -30.971 -26.634 -31.051 1.00 37.25 ? 4   LYS A HG2  1 
ATOM   35    H HG3  . LYS A 1 4   ? -29.402 -26.382 -31.076 1.00 37.25 ? 4   LYS A HG3  1 
ATOM   36    H HD2  . LYS A 1 4   ? -29.578 -27.249 -28.738 1.00 38.57 ? 4   LYS A HD2  1 
ATOM   37    H HD3  . LYS A 1 4   ? -30.841 -28.001 -29.368 1.00 38.57 ? 4   LYS A HD3  1 
ATOM   38    H HE2  . LYS A 1 4   ? -29.369 -28.732 -31.123 1.00 46.53 ? 4   LYS A HE2  1 
ATOM   39    H HE3  . LYS A 1 4   ? -28.165 -28.207 -30.231 1.00 46.53 ? 4   LYS A HE3  1 
ATOM   40    H HZ1  . LYS A 1 4   ? -28.447 -30.416 -29.965 1.00 57.01 ? 4   LYS A HZ1  1 
ATOM   41    H HZ2  . LYS A 1 4   ? -28.714 -29.764 -28.700 1.00 57.01 ? 4   LYS A HZ2  1 
ATOM   42    H HZ3  . LYS A 1 4   ? -29.812 -30.242 -29.514 1.00 57.01 ? 4   LYS A HZ3  1 
ATOM   43    N N    . LYS A 1 5   ? -31.783 -23.739 -27.177 1.00 23.69 ? 5   LYS A N    1 
ATOM   44    C CA   . LYS A 1 5   ? -31.846 -22.558 -26.344 1.00 24.61 ? 5   LYS A CA   1 
ATOM   45    C C    . LYS A 1 5   ? -30.438 -22.064 -26.045 1.00 23.33 ? 5   LYS A C    1 
ATOM   46    O O    . LYS A 1 5   ? -29.550 -22.859 -25.737 1.00 23.96 ? 5   LYS A O    1 
ATOM   47    C CB   . LYS A 1 5   ? -32.583 -22.865 -25.038 1.00 29.84 ? 5   LYS A CB   1 
ATOM   48    C CG   . LYS A 1 5   ? -34.062 -23.256 -25.214 1.00 36.50 ? 5   LYS A CG   1 
ATOM   49    C CD   . LYS A 1 5   ? -34.828 -22.995 -23.908 1.00 43.11 ? 5   LYS A CD   1 
ATOM   50    C CE   . LYS A 1 5   ? -36.293 -23.391 -24.024 1.00 54.10 ? 5   LYS A CE   1 
ATOM   51    N NZ   . LYS A 1 5   ? -36.502 -24.839 -24.357 1.00 43.36 ? 5   LYS A NZ   1 
ATOM   52    H H    . LYS A 1 5   ? -31.685 -24.467 -26.731 1.00 28.41 ? 5   LYS A H    1 
ATOM   53    H HA   . LYS A 1 5   ? -32.326 -21.857 -26.811 1.00 29.51 ? 5   LYS A HA   1 
ATOM   54    H HB2  . LYS A 1 5   ? -32.135 -23.603 -24.595 1.00 35.79 ? 5   LYS A HB2  1 
ATOM   55    H HB3  . LYS A 1 5   ? -32.553 -22.078 -24.472 1.00 35.79 ? 5   LYS A HB3  1 
ATOM   56    H HG2  . LYS A 1 5   ? -34.459 -22.720 -25.918 1.00 43.78 ? 5   LYS A HG2  1 
ATOM   57    H HG3  . LYS A 1 5   ? -34.126 -24.200 -25.427 1.00 43.78 ? 5   LYS A HG3  1 
ATOM   58    H HD2  . LYS A 1 5   ? -34.429 -23.516 -23.194 1.00 51.71 ? 5   LYS A HD2  1 
ATOM   59    H HD3  . LYS A 1 5   ? -34.786 -22.049 -23.696 1.00 51.71 ? 5   LYS A HD3  1 
ATOM   60    H HE2  . LYS A 1 5   ? -36.733 -23.215 -23.178 1.00 64.90 ? 5   LYS A HE2  1 
ATOM   61    H HE3  . LYS A 1 5   ? -36.705 -22.863 -24.726 1.00 64.90 ? 5   LYS A HE3  1 
ATOM   62    H HZ1  . LYS A 1 5   ? -37.372 -25.016 -24.413 1.00 52.01 ? 5   LYS A HZ1  1 
ATOM   63    H HZ2  . LYS A 1 5   ? -36.117 -25.031 -25.137 1.00 52.01 ? 5   LYS A HZ2  1 
ATOM   64    H HZ3  . LYS A 1 5   ? -36.143 -25.352 -23.724 1.00 52.01 ? 5   LYS A HZ3  1 
ATOM   65    N N    . VAL A 1 6   ? -30.260 -20.742 -26.112 1.00 26.47 ? 6   VAL A N    1 
ATOM   66    C CA   . VAL A 1 6   ? -28.961 -20.105 -25.941 1.00 23.65 ? 6   VAL A CA   1 
ATOM   67    C C    . VAL A 1 6   ? -29.001 -19.197 -24.722 1.00 25.10 ? 6   VAL A C    1 
ATOM   68    O O    . VAL A 1 6   ? -29.934 -18.402 -24.531 1.00 22.71 ? 6   VAL A O    1 
ATOM   69    C CB   . VAL A 1 6   ? -28.540 -19.302 -27.196 1.00 23.26 ? 6   VAL A CB   1 
ATOM   70    C CG1  . VAL A 1 6   ? -27.186 -18.676 -26.991 1.00 24.69 ? 6   VAL A CG1  1 
ATOM   71    C CG2  . VAL A 1 6   ? -28.546 -20.166 -28.422 1.00 22.54 ? 6   VAL A CG2  1 
ATOM   72    H H    . VAL A 1 6   ? -30.896 -20.183 -26.259 1.00 31.74 ? 6   VAL A H    1 
ATOM   73    H HA   . VAL A 1 6   ? -28.292 -20.789 -25.784 1.00 28.36 ? 6   VAL A HA   1 
ATOM   74    H HB   . VAL A 1 6   ? -29.179 -18.585 -27.337 1.00 27.89 ? 6   VAL A HB   1 
ATOM   75    H HG11 . VAL A 1 6   ? -26.944 -18.179 -27.788 1.00 29.61 ? 6   VAL A HG11 1 
ATOM   76    H HG12 . VAL A 1 6   ? -27.227 -18.079 -26.228 1.00 29.61 ? 6   VAL A HG12 1 
ATOM   77    H HG13 . VAL A 1 6   ? -26.536 -19.378 -26.827 1.00 29.61 ? 6   VAL A HG13 1 
ATOM   78    H HG21 . VAL A 1 6   ? -28.278 -19.632 -29.186 1.00 27.03 ? 6   VAL A HG21 1 
ATOM   79    H HG22 . VAL A 1 6   ? -27.922 -20.898 -28.295 1.00 27.03 ? 6   VAL A HG22 1 
ATOM   80    H HG23 . VAL A 1 6   ? -29.441 -20.514 -28.559 1.00 27.03 ? 6   VAL A HG23 1 
ATOM   81    N N    . CYS A 1 7   ? -27.952 -19.286 -23.919 1.00 19.08 ? 7   CYS A N    1 
ATOM   82    C CA   . CYS A 1 7   ? -27.680 -18.330 -22.868 1.00 21.56 ? 7   CYS A CA   1 
ATOM   83    C C    . CYS A 1 7   ? -26.332 -17.663 -23.141 1.00 23.91 ? 7   CYS A C    1 
ATOM   84    O O    . CYS A 1 7   ? -25.323 -18.343 -23.343 1.00 22.35 ? 7   CYS A O    1 
ATOM   85    C CB   . CYS A 1 7   ? -27.659 -19.004 -21.492 1.00 18.91 ? 7   CYS A CB   1 
ATOM   86    S SG   . CYS A 1 7   ? -27.254 -17.892 -20.199 1.00 25.52 ? 7   CYS A SG   1 
ATOM   87    H H    . CYS A 1 7   ? -27.366 -19.915 -23.967 1.00 22.87 ? 7   CYS A H    1 
ATOM   88    H HA   . CYS A 1 7   ? -28.367 -17.646 -22.865 1.00 25.85 ? 7   CYS A HA   1 
ATOM   89    H HB2  . CYS A 1 7   ? -28.537 -19.372 -21.307 1.00 22.67 ? 7   CYS A HB2  1 
ATOM   90    H HB3  . CYS A 1 7   ? -26.996 -19.713 -21.497 1.00 22.67 ? 7   CYS A HB3  1 
ATOM   91    H HG   . CYS A 1 7   ? -27.257 -18.487 -19.157 1.00 30.60 ? 7   CYS A HG   1 
ATOM   92    N N    . ILE A 1 8   ? -26.337 -16.342 -23.170 1.00 20.41 ? 8   ILE A N    1 
ATOM   93    C CA   . ILE A 1 8   ? -25.122 -15.539 -23.233 1.00 22.64 ? 8   ILE A CA   1 
ATOM   94    C C    . ILE A 1 8   ? -24.735 -15.218 -21.800 1.00 24.31 ? 8   ILE A C    1 
ATOM   95    O O    . ILE A 1 8   ? -25.391 -14.420 -21.127 1.00 25.68 ? 8   ILE A O    1 
ATOM   96    C CB   . ILE A 1 8   ? -25.322 -14.264 -24.069 1.00 21.94 ? 8   ILE A CB   1 
ATOM   97    C CG1  . ILE A 1 8   ? -25.690 -14.626 -25.503 1.00 28.01 ? 8   ILE A CG1  1 
ATOM   98    C CG2  . ILE A 1 8   ? -24.075 -13.415 -24.035 1.00 23.36 ? 8   ILE A CG2  1 
ATOM   99    C CD1  . ILE A 1 8   ? -26.154 -13.446 -26.326 1.00 27.21 ? 8   ILE A CD1  1 
ATOM   100   H H    . ILE A 1 8   ? -27.055 -15.869 -23.153 1.00 24.47 ? 8   ILE A H    1 
ATOM   101   H HA   . ILE A 1 8   ? -24.409 -16.061 -23.634 1.00 27.14 ? 8   ILE A HA   1 
ATOM   102   H HB   . ILE A 1 8   ? -26.052 -13.754 -23.683 1.00 26.31 ? 8   ILE A HB   1 
ATOM   103   H HG12 . ILE A 1 8   ? -24.911 -15.004 -25.940 1.00 33.59 ? 8   ILE A HG12 1 
ATOM   104   H HG13 . ILE A 1 8   ? -26.408 -15.278 -25.487 1.00 33.59 ? 8   ILE A HG13 1 
ATOM   105   H HG21 . ILE A 1 8   ? -24.223 -12.617 -24.567 1.00 28.01 ? 8   ILE A HG21 1 
ATOM   106   H HG22 . ILE A 1 8   ? -23.886 -13.169 -23.116 1.00 28.01 ? 8   ILE A HG22 1 
ATOM   107   H HG23 . ILE A 1 8   ? -23.336 -13.925 -24.401 1.00 28.01 ? 8   ILE A HG23 1 
ATOM   108   H HD11 . ILE A 1 8   ? -26.369 -13.751 -27.221 1.00 32.63 ? 8   ILE A HD11 1 
ATOM   109   H HD12 . ILE A 1 8   ? -26.941 -13.061 -25.909 1.00 32.63 ? 8   ILE A HD12 1 
ATOM   110   H HD13 . ILE A 1 8   ? -25.443 -12.787 -26.362 1.00 32.63 ? 8   ILE A HD13 1 
ATOM   111   N N    . VAL A 1 9   ? -23.663 -15.847 -21.319 1.00 25.76 ? 9   VAL A N    1 
ATOM   112   C CA   . VAL A 1 9   ? -23.191 -15.633 -19.951 1.00 20.77 ? 9   VAL A CA   1 
ATOM   113   C C    . VAL A 1 9   ? -22.179 -14.498 -20.027 1.00 27.85 ? 9   VAL A C    1 
ATOM   114   O O    . VAL A 1 9   ? -21.000 -14.705 -20.286 1.00 21.55 ? 9   VAL A O    1 
ATOM   115   C CB   . VAL A 1 9   ? -22.610 -16.902 -19.335 1.00 20.09 ? 9   VAL A CB   1 
ATOM   116   C CG1  . VAL A 1 9   ? -22.201 -16.657 -17.884 1.00 26.90 ? 9   VAL A CG1  1 
ATOM   117   C CG2  . VAL A 1 9   ? -23.608 -18.013 -19.402 1.00 23.46 ? 9   VAL A CG2  1 
ATOM   118   H H    . VAL A 1 9   ? -23.189 -16.407 -21.768 1.00 30.89 ? 9   VAL A H    1 
ATOM   119   H HA   . VAL A 1 9   ? -23.934 -15.341 -19.399 1.00 24.90 ? 9   VAL A HA   1 
ATOM   120   H HB   . VAL A 1 9   ? -21.822 -17.170 -19.834 1.00 24.09 ? 9   VAL A HB   1 
ATOM   121   H HG11 . VAL A 1 9   ? -21.835 -17.478 -17.517 1.00 32.25 ? 9   VAL A HG11 1 
ATOM   122   H HG12 . VAL A 1 9   ? -21.531 -15.956 -17.860 1.00 32.25 ? 9   VAL A HG12 1 
ATOM   123   H HG13 . VAL A 1 9   ? -22.982 -16.387 -17.378 1.00 32.25 ? 9   VAL A HG13 1 
ATOM   124   H HG21 . VAL A 1 9   ? -23.220 -18.810 -19.006 1.00 28.13 ? 9   VAL A HG21 1 
ATOM   125   H HG22 . VAL A 1 9   ? -24.403 -17.753 -18.910 1.00 28.13 ? 9   VAL A HG22 1 
ATOM   126   H HG23 . VAL A 1 9   ? -23.833 -18.180 -20.330 1.00 28.13 ? 9   VAL A HG23 1 
ATOM   127   N N    . GLY A 1 10  ? -22.667 -13.292 -19.804 1.00 27.26 ? 10  GLY A N    1 
ATOM   128   C CA   . GLY A 1 10  ? -21.860 -12.083 -19.787 1.00 28.03 ? 10  GLY A CA   1 
ATOM   129   C C    . GLY A 1 10  ? -22.622 -11.002 -20.524 1.00 28.56 ? 10  GLY A C    1 
ATOM   130   O O    . GLY A 1 10  ? -23.489 -11.274 -21.358 1.00 26.68 ? 10  GLY A O    1 
ATOM   131   H H    . GLY A 1 10  ? -23.500 -13.141 -19.653 1.00 32.69 ? 10  GLY A H    1 
ATOM   132   H HA2  . GLY A 1 10  ? -21.700 -11.798 -18.874 1.00 33.61 ? 10  GLY A HA2  1 
ATOM   133   H HA3  . GLY A 1 10  ? -21.011 -12.237 -20.230 1.00 33.61 ? 10  GLY A HA3  1 
ATOM   134   N N    . SER A 1 11  ? -22.277 -9.743  -20.229 1.00 30.73 ? 11  SER A N    1 
ATOM   135   C CA   . SER A 1 11  ? -23.032 -8.633  -20.804 1.00 31.68 ? 11  SER A CA   1 
ATOM   136   C C    . SER A 1 11  ? -22.208 -7.355  -20.811 1.00 34.25 ? 11  SER A C    1 
ATOM   137   O O    . SER A 1 11  ? -22.743 -6.245  -20.678 1.00 31.95 ? 11  SER A O    1 
ATOM   138   C CB   . SER A 1 11  ? -24.337 -8.431  -20.029 1.00 28.60 ? 11  SER A CB   1 
ATOM   139   O OG   . SER A 1 11  ? -24.066 -8.249  -18.651 1.00 29.47 ? 11  SER A OG   1 
ATOM   140   H H    . SER A 1 11  ? -21.629 -9.513  -19.713 1.00 36.85 ? 11  SER A H    1 
ATOM   141   H HA   . SER A 1 11  ? -23.259 -8.848  -21.722 1.00 38.00 ? 11  SER A HA   1 
ATOM   142   H HB2  . SER A 1 11  ? -24.790 -7.645  -20.370 1.00 34.29 ? 11  SER A HB2  1 
ATOM   143   H HB3  . SER A 1 11  ? -24.897 -9.215  -20.141 1.00 34.29 ? 11  SER A HB3  1 
ATOM   144   H HG   . SER A 1 11  ? -23.578 -7.574  -18.541 1.00 35.35 ? 11  SER A HG   1 
ATOM   145   N N    . GLY A 1 12  ? -20.906 -7.495  -20.973 1.00 35.33 ? 12  GLY A N    1 
ATOM   146   C CA   . GLY A 1 12  ? -20.037 -6.342  -21.076 1.00 35.67 ? 12  GLY A CA   1 
ATOM   147   C C    . GLY A 1 12  ? -20.099 -5.768  -22.472 1.00 27.31 ? 12  GLY A C    1 
ATOM   148   O O    . GLY A 1 12  ? -21.019 -6.025  -23.247 1.00 28.29 ? 12  GLY A O    1 
ATOM   149   H H    . GLY A 1 12  ? -20.499 -8.250  -21.027 1.00 42.38 ? 12  GLY A H    1 
ATOM   150   H HA2  . GLY A 1 12  ? -20.314 -5.661  -20.443 1.00 42.78 ? 12  GLY A HA2  1 
ATOM   151   H HA3  . GLY A 1 12  ? -19.122 -6.599  -20.881 1.00 42.78 ? 12  GLY A HA3  1 
ATOM   152   N N    . ASN A 1 13  ? -19.089 -4.959  -22.784 1.00 34.16 ? 13  ASN A N    1 
ATOM   153   C CA   . ASN A 1 13  ? -18.934 -4.441  -24.134 1.00 33.89 ? 13  ASN A CA   1 
ATOM   154   C C    . ASN A 1 13  ? -18.946 -5.586  -25.131 1.00 27.79 ? 13  ASN A C    1 
ATOM   155   O O    . ASN A 1 13  ? -19.677 -5.572  -26.124 1.00 29.13 ? 13  ASN A O    1 
ATOM   156   C CB   . ASN A 1 13  ? -17.616 -3.645  -24.192 1.00 46.12 ? 13  ASN A CB   1 
ATOM   157   C CG   . ASN A 1 13  ? -17.377 -2.959  -25.523 1.00 45.86 ? 13  ASN A CG   1 
ATOM   158   O OD1  . ASN A 1 13  ? -16.254 -2.960  -26.032 1.00 45.72 ? 13  ASN A OD1  1 
ATOM   159   N ND2  . ASN A 1 13  ? -18.415 -2.344  -26.080 1.00 47.73 ? 13  ASN A ND2  1 
ATOM   160   H H    . ASN A 1 13  ? -18.483 -4.697  -22.233 1.00 40.97 ? 13  ASN A H    1 
ATOM   161   H HA   . ASN A 1 13  ? -19.669 -3.842  -24.340 1.00 40.65 ? 13  ASN A HA   1 
ATOM   162   H HB2  . ASN A 1 13  ? -17.633 -2.961  -23.504 1.00 55.32 ? 13  ASN A HB2  1 
ATOM   163   H HB3  . ASN A 1 13  ? -16.877 -4.252  -24.034 1.00 55.32 ? 13  ASN A HB3  1 
ATOM   164   H HD21 . ASN A 1 13  ? -18.322 -1.941  -26.834 1.00 57.25 ? 13  ASN A HD21 1 
ATOM   165   H HD22 . ASN A 1 13  ? -19.183 -2.360  -25.693 1.00 57.25 ? 13  ASN A HD22 1 
ATOM   166   N N    . TRP A 1 14  ? -18.167 -6.621  -24.840 1.00 33.84 ? 14  TRP A N    1 
ATOM   167   C CA   . TRP A 1 14  ? -18.034 -7.766  -25.737 1.00 30.38 ? 14  TRP A CA   1 
ATOM   168   C C    . TRP A 1 14  ? -19.286 -8.640  -25.706 1.00 28.17 ? 14  TRP A C    1 
ATOM   169   O O    . TRP A 1 14  ? -19.817 -9.021  -26.754 1.00 26.52 ? 14  TRP A O    1 
ATOM   170   C CB   . TRP A 1 14  ? -16.773 -8.519  -25.316 1.00 27.33 ? 14  TRP A CB   1 
ATOM   171   C CG   . TRP A 1 14  ? -16.324 -9.726  -26.044 1.00 30.02 ? 14  TRP A CG   1 
ATOM   172   C CD1  . TRP A 1 14  ? -15.660 -10.785 -25.487 1.00 32.84 ? 14  TRP A CD1  1 
ATOM   173   C CD2  . TRP A 1 14  ? -16.410 -10.006 -27.441 1.00 32.53 ? 14  TRP A CD2  1 
ATOM   174   N NE1  . TRP A 1 14  ? -15.351 -11.709 -26.440 1.00 29.35 ? 14  TRP A NE1  1 
ATOM   175   C CE2  . TRP A 1 14  ? -15.808 -11.267 -27.649 1.00 29.43 ? 14  TRP A CE2  1 
ATOM   176   C CE3  . TRP A 1 14  ? -16.955 -9.335  -28.533 1.00 35.06 ? 14  TRP A CE3  1 
ATOM   177   C CZ2  . TRP A 1 14  ? -15.727 -11.854 -28.898 1.00 27.15 ? 14  TRP A CZ2  1 
ATOM   178   C CZ3  . TRP A 1 14  ? -16.887 -9.933  -29.774 1.00 34.60 ? 14  TRP A CZ3  1 
ATOM   179   C CH2  . TRP A 1 14  ? -16.276 -11.172 -29.947 1.00 30.38 ? 14  TRP A CH2  1 
ATOM   180   H H    . TRP A 1 14  ? -17.699 -6.686  -24.121 1.00 40.59 ? 14  TRP A H    1 
ATOM   181   H HA   . TRP A 1 14  ? -17.909 -7.448  -26.645 1.00 36.44 ? 14  TRP A HA   1 
ATOM   182   H HB2  . TRP A 1 14  ? -16.036 -7.889  -25.357 1.00 32.77 ? 14  TRP A HB2  1 
ATOM   183   H HB3  . TRP A 1 14  ? -16.895 -8.789  -24.393 1.00 32.77 ? 14  TRP A HB3  1 
ATOM   184   H HD1  . TRP A 1 14  ? -15.446 -10.862 -24.585 1.00 39.38 ? 14  TRP A HD1  1 
ATOM   185   H HE1  . TRP A 1 14  ? -14.945 -12.454 -26.301 1.00 35.20 ? 14  TRP A HE1  1 
ATOM   186   H HE3  . TRP A 1 14  ? -17.367 -8.508  -28.425 1.00 42.06 ? 14  TRP A HE3  1 
ATOM   187   H HZ2  . TRP A 1 14  ? -15.328 -12.686 -29.017 1.00 32.56 ? 14  TRP A HZ2  1 
ATOM   188   H HZ3  . TRP A 1 14  ? -17.244 -9.494  -30.512 1.00 41.50 ? 14  TRP A HZ3  1 
ATOM   189   H HH2  . TRP A 1 14  ? -16.242 -11.546 -30.798 1.00 36.44 ? 14  TRP A HH2  1 
ATOM   190   N N    . GLY A 1 15  ? -19.801 -8.926  -24.509 1.00 30.36 ? 15  GLY A N    1 
ATOM   191   C CA   . GLY A 1 15  ? -21.013 -9.721  -24.402 1.00 26.99 ? 15  GLY A CA   1 
ATOM   192   C C    . GLY A 1 15  ? -22.229 -9.064  -25.028 1.00 26.24 ? 15  GLY A C    1 
ATOM   193   O O    . GLY A 1 15  ? -23.094 -9.757  -25.563 1.00 28.40 ? 15  GLY A O    1 
ATOM   194   H H    . GLY A 1 15  ? -19.469 -8.674  -23.757 1.00 36.42 ? 15  GLY A H    1 
ATOM   195   H HA2  . GLY A 1 15  ? -20.873 -10.577 -24.837 1.00 32.36 ? 15  GLY A HA2  1 
ATOM   196   H HA3  . GLY A 1 15  ? -21.206 -9.884  -23.466 1.00 32.36 ? 15  GLY A HA3  1 
ATOM   197   N N    . SER A 1 16  ? -22.331 -7.728  -24.943 1.00 31.26 ? 16  SER A N    1 
ATOM   198   C CA   . SER A 1 16  ? -23.447 -7.032  -25.586 1.00 27.68 ? 16  SER A CA   1 
ATOM   199   C C    . SER A 1 16  ? -23.287 -7.048  -27.098 1.00 31.00 ? 16  SER A C    1 
ATOM   200   O O    . SER A 1 16  ? -24.234 -7.366  -27.827 1.00 30.52 ? 16  SER A O    1 
ATOM   201   C CB   . SER A 1 16  ? -23.549 -5.598  -25.064 1.00 32.10 ? 16  SER A CB   1 
ATOM   202   O OG   . SER A 1 16  ? -23.716 -5.550  -23.643 1.00 37.41 ? 16  SER A OG   1 
ATOM   203   H H    . SER A 1 16  ? -21.779 -7.217  -24.527 1.00 37.49 ? 16  SER A H    1 
ATOM   204   H HA   . SER A 1 16  ? -24.273 -7.489  -25.367 1.00 33.20 ? 16  SER A HA   1 
ATOM   205   H HB2  . SER A 1 16  ? -22.736 -5.123  -25.298 1.00 38.49 ? 16  SER A HB2  1 
ATOM   206   H HB3  . SER A 1 16  ? -24.311 -5.168  -25.482 1.00 38.49 ? 16  SER A HB3  1 
ATOM   207   H HG   . SER A 1 16  ? -23.061 -5.915  -23.265 1.00 44.87 ? 16  SER A HG   1 
ATOM   208   N N    . ALA A 1 17  ? -22.080 -6.745  -27.593 1.00 27.11 ? 17  ALA A N    1 
ATOM   209   C CA   . ALA A 1 17  ? -21.815 -6.873  -29.026 1.00 26.09 ? 17  ALA A CA   1 
ATOM   210   C C    . ALA A 1 17  ? -22.236 -8.238  -29.530 1.00 26.30 ? 17  ALA A C    1 
ATOM   211   O O    . ALA A 1 17  ? -22.918 -8.364  -30.558 1.00 27.18 ? 17  ALA A O    1 
ATOM   212   C CB   . ALA A 1 17  ? -20.325 -6.635  -29.314 1.00 25.36 ? 17  ALA A CB   1 
ATOM   213   H H    . ALA A 1 17  ? -21.411 -6.468  -27.128 1.00 32.51 ? 17  ALA A H    1 
ATOM   214   H HA   . ALA A 1 17  ? -22.327 -6.203  -29.505 1.00 31.29 ? 17  ALA A HA   1 
ATOM   215   H HB1  . ALA A 1 17  ? -20.169 -6.724  -30.267 1.00 30.41 ? 17  ALA A HB1  1 
ATOM   216   H HB2  . ALA A 1 17  ? -20.086 -5.741  -29.022 1.00 30.41 ? 17  ALA A HB2  1 
ATOM   217   H HB3  . ALA A 1 17  ? -19.801 -7.292  -28.830 1.00 30.41 ? 17  ALA A HB3  1 
ATOM   218   N N    . ILE A 1 18  ? -21.833 -9.290  -28.817 1.00 28.20 ? 18  ILE A N    1 
ATOM   219   C CA   . ILE A 1 18  ? -22.173 -10.635 -29.254 1.00 22.49 ? 18  ILE A CA   1 
ATOM   220   C C    . ILE A 1 18  ? -23.673 -10.886 -29.161 1.00 22.18 ? 18  ILE A C    1 
ATOM   221   O O    . ILE A 1 18  ? -24.218 -11.674 -29.935 1.00 22.12 ? 18  ILE A O    1 
ATOM   222   C CB   . ILE A 1 18  ? -21.390 -11.666 -28.434 1.00 28.71 ? 18  ILE A CB   1 
ATOM   223   C CG1  . ILE A 1 18  ? -19.940 -11.707 -28.919 1.00 30.78 ? 18  ILE A CG1  1 
ATOM   224   C CG2  . ILE A 1 18  ? -22.015 -13.007 -28.532 1.00 29.48 ? 18  ILE A CG2  1 
ATOM   225   C CD1  . ILE A 1 18  ? -19.732 -12.365 -30.284 1.00 31.22 ? 18  ILE A CD1  1 
ATOM   226   H H    . ILE A 1 18  ? -21.371 -9.251  -28.093 1.00 33.82 ? 18  ILE A H    1 
ATOM   227   H HA   . ILE A 1 18  ? -21.914 -10.736 -30.183 1.00 26.97 ? 18  ILE A HA   1 
ATOM   228   H HB   . ILE A 1 18  ? -21.396 -11.390 -27.504 1.00 34.43 ? 18  ILE A HB   1 
ATOM   229   H HG12 . ILE A 1 18  ? -19.609 -10.797 -28.980 1.00 36.91 ? 18  ILE A HG12 1 
ATOM   230   H HG13 . ILE A 1 18  ? -19.412 -12.202 -28.273 1.00 36.91 ? 18  ILE A HG13 1 
ATOM   231   H HG21 . ILE A 1 18  ? -21.497 -13.635 -28.004 1.00 35.35 ? 18  ILE A HG21 1 
ATOM   232   H HG22 . ILE A 1 18  ? -22.922 -12.958 -28.192 1.00 35.35 ? 18  ILE A HG22 1 
ATOM   233   H HG23 . ILE A 1 18  ? -22.024 -13.284 -29.461 1.00 35.35 ? 18  ILE A HG23 1 
ATOM   234   H HD11 . ILE A 1 18  ? -18.788 -12.343 -30.505 1.00 37.44 ? 18  ILE A HD11 1 
ATOM   235   H HD12 . ILE A 1 18  ? -20.042 -13.283 -30.242 1.00 37.44 ? 18  ILE A HD12 1 
ATOM   236   H HD13 . ILE A 1 18  ? -20.239 -11.875 -30.950 1.00 37.44 ? 18  ILE A HD13 1 
ATOM   237   N N    . ALA A 1 19  ? -24.345 -10.282 -28.181 1.00 29.53 ? 19  ALA A N    1 
ATOM   238   C CA   . ALA A 1 19  ? -25.806 -10.385 -28.099 1.00 34.62 ? 19  ALA A CA   1 
ATOM   239   C C    . ALA A 1 19  ? -26.478 -9.916  -29.389 1.00 29.85 ? 19  ALA A C    1 
ATOM   240   O O    . ALA A 1 19  ? -27.377 -10.590 -29.914 1.00 27.77 ? 19  ALA A O    1 
ATOM   241   C CB   . ALA A 1 19  ? -26.315 -9.562  -26.918 1.00 31.20 ? 19  ALA A CB   1 
ATOM   242   H H    . ALA A 1 19  ? -23.985 -9.812  -27.558 1.00 35.42 ? 19  ALA A H    1 
ATOM   243   H HA   . ALA A 1 19  ? -26.052 -11.312 -27.951 1.00 41.52 ? 19  ALA A HA   1 
ATOM   244   H HB1  . ALA A 1 19  ? -27.281 -9.637  -26.873 1.00 37.42 ? 19  ALA A HB1  1 
ATOM   245   H HB2  . ALA A 1 19  ? -25.918 -9.904  -26.101 1.00 37.42 ? 19  ALA A HB2  1 
ATOM   246   H HB3  . ALA A 1 19  ? -26.060 -8.635  -27.046 1.00 37.42 ? 19  ALA A HB3  1 
ATOM   247   N N    . LYS A 1 20  ? -26.069 -8.739  -29.900 1.00 28.99 ? 20  LYS A N    1 
ATOM   248   C CA   . LYS A 1 20  ? -26.616 -8.242  -31.164 1.00 28.46 ? 20  LYS A CA   1 
ATOM   249   C C    . LYS A 1 20  ? -26.625 -9.322  -32.232 1.00 29.11 ? 20  LYS A C    1 
ATOM   250   O O    . LYS A 1 20  ? -27.645 -9.566  -32.883 1.00 26.21 ? 20  LYS A O    1 
ATOM   251   C CB   . LYS A 1 20  ? -25.815 -7.034  -31.653 1.00 31.24 ? 20  LYS A CB   1 
ATOM   252   C CG   . LYS A 1 20  ? -26.066 -5.777  -30.866 1.00 36.26 ? 20  LYS A CG   1 
ATOM   253   C CD   . LYS A 1 20  ? -25.429 -4.556  -31.524 1.00 44.96 ? 20  LYS A CD   1 
ATOM   254   C CE   . LYS A 1 20  ? -25.959 -4.308  -32.922 1.00 47.08 ? 20  LYS A CE   1 
ATOM   255   N NZ   . LYS A 1 20  ? -25.681 -2.903  -33.320 1.00 46.42 ? 20  LYS A NZ   1 
ATOM   256   H H    . LYS A 1 20  ? -25.485 -8.223  -29.536 1.00 34.77 ? 20  LYS A H    1 
ATOM   257   H HA   . LYS A 1 20  ? -27.532 -7.955  -31.020 1.00 34.14 ? 20  LYS A HA   1 
ATOM   258   H HB2  . LYS A 1 20  ? -24.869 -7.239  -31.588 1.00 37.47 ? 20  LYS A HB2  1 
ATOM   259   H HB3  . LYS A 1 20  ? -26.050 -6.857  -32.577 1.00 37.47 ? 20  LYS A HB3  1 
ATOM   260   H HG2  . LYS A 1 20  ? -27.022 -5.624  -30.807 1.00 43.48 ? 20  LYS A HG2  1 
ATOM   261   H HG3  . LYS A 1 20  ? -25.687 -5.875  -29.979 1.00 43.48 ? 20  LYS A HG3  1 
ATOM   262   H HD2  . LYS A 1 20  ? -25.619 -3.771  -30.986 1.00 53.93 ? 20  LYS A HD2  1 
ATOM   263   H HD3  . LYS A 1 20  ? -24.470 -4.693  -31.585 1.00 53.93 ? 20  LYS A HD3  1 
ATOM   264   H HE2  . LYS A 1 20  ? -25.516 -4.901  -33.549 1.00 56.47 ? 20  LYS A HE2  1 
ATOM   265   H HE3  . LYS A 1 20  ? -26.919 -4.450  -32.937 1.00 56.47 ? 20  LYS A HE3  1 
ATOM   266   H HZ1  . LYS A 1 20  ? -26.078 -2.343  -32.753 1.00 55.68 ? 20  LYS A HZ1  1 
ATOM   267   H HZ2  . LYS A 1 20  ? -24.804 -2.752  -33.309 1.00 55.68 ? 20  LYS A HZ2  1 
ATOM   268   H HZ3  . LYS A 1 20  ? -25.990 -2.752  -34.140 1.00 55.68 ? 20  LYS A HZ3  1 
ATOM   269   N N    . ILE A 1 21  ? -25.480 -9.971  -32.441 1.00 26.93 ? 21  ILE A N    1 
ATOM   270   C CA   . ILE A 1 21  ? -25.372 -10.979 -33.482 1.00 27.87 ? 21  ILE A CA   1 
ATOM   271   C C    . ILE A 1 21  ? -26.228 -12.174 -33.132 1.00 23.47 ? 21  ILE A C    1 
ATOM   272   O O    . ILE A 1 21  ? -27.002 -12.671 -33.956 1.00 23.51 ? 21  ILE A O    1 
ATOM   273   C CB   . ILE A 1 21  ? -23.902 -11.411 -33.671 1.00 31.24 ? 21  ILE A CB   1 
ATOM   274   C CG1  . ILE A 1 21  ? -23.109 -10.325 -34.395 1.00 32.62 ? 21  ILE A CG1  1 
ATOM   275   C CG2  . ILE A 1 21  ? -23.848 -12.768 -34.402 1.00 26.67 ? 21  ILE A CG2  1 
ATOM   276   C CD1  . ILE A 1 21  ? -21.648 -10.645 -34.504 1.00 34.53 ? 21  ILE A CD1  1 
ATOM   277   H H    . ILE A 1 21  ? -24.757 -9.844  -31.993 1.00 32.29 ? 21  ILE A H    1 
ATOM   278   H HA   . ILE A 1 21  ? -25.692 -10.610 -34.320 1.00 33.42 ? 21  ILE A HA   1 
ATOM   279   H HB   . ILE A 1 21  ? -23.510 -11.530 -32.792 1.00 37.47 ? 21  ILE A HB   1 
ATOM   280   H HG12 . ILE A 1 21  ? -23.461 -10.222 -35.293 1.00 39.12 ? 21  ILE A HG12 1 
ATOM   281   H HG13 . ILE A 1 21  ? -23.198 -9.491  -33.907 1.00 39.12 ? 21  ILE A HG13 1 
ATOM   282   H HG21 . ILE A 1 21  ? -22.920 -13.028 -34.515 1.00 31.98 ? 21  ILE A HG21 1 
ATOM   283   H HG22 . ILE A 1 21  ? -24.316 -13.431 -33.870 1.00 31.98 ? 21  ILE A HG22 1 
ATOM   284   H HG23 . ILE A 1 21  ? -24.274 -12.676 -35.268 1.00 31.98 ? 21  ILE A HG23 1 
ATOM   285   H HD11 . ILE A 1 21  ? -21.201 -9.922  -34.970 1.00 41.42 ? 21  ILE A HD11 1 
ATOM   286   H HD12 . ILE A 1 21  ? -21.279 -10.742 -33.612 1.00 41.42 ? 21  ILE A HD12 1 
ATOM   287   H HD13 . ILE A 1 21  ? -21.543 -11.473 -34.998 1.00 41.42 ? 21  ILE A HD13 1 
ATOM   288   N N    . VAL A 1 22  ? -26.057 -12.690 -31.912 1.00 27.03 ? 22  VAL A N    1 
ATOM   289   C CA   . VAL A 1 22  ? -26.703 -13.942 -31.560 1.00 25.10 ? 22  VAL A CA   1 
ATOM   290   C C    . VAL A 1 22  ? -28.202 -13.745 -31.424 1.00 23.98 ? 22  VAL A C    1 
ATOM   291   O O    . VAL A 1 22  ? -28.980 -14.612 -31.824 1.00 25.50 ? 22  VAL A O    1 
ATOM   292   C CB   . VAL A 1 22  ? -26.095 -14.536 -30.277 1.00 23.15 ? 22  VAL A CB   1 
ATOM   293   C CG1  . VAL A 1 22  ? -26.964 -15.680 -29.782 1.00 25.84 ? 22  VAL A CG1  1 
ATOM   294   C CG2  . VAL A 1 22  ? -24.671 -15.040 -30.554 1.00 29.24 ? 22  VAL A CG2  1 
ATOM   295   H H    . VAL A 1 22  ? -25.582 -12.339 -31.288 1.00 32.41 ? 22  VAL A H    1 
ATOM   296   H HA   . VAL A 1 22  ? -26.555 -14.579 -32.277 1.00 30.09 ? 22  VAL A HA   1 
ATOM   297   H HB   . VAL A 1 22  ? -26.056 -13.855 -29.588 1.00 27.75 ? 22  VAL A HB   1 
ATOM   298   H HG11 . VAL A 1 22  ? -26.572 -16.047 -28.974 1.00 30.98 ? 22  VAL A HG11 1 
ATOM   299   H HG12 . VAL A 1 22  ? -27.854 -15.342 -29.595 1.00 30.98 ? 22  VAL A HG12 1 
ATOM   300   H HG13 . VAL A 1 22  ? -27.007 -16.363 -30.469 1.00 30.98 ? 22  VAL A HG13 1 
ATOM   301   H HG21 . VAL A 1 22  ? -24.304 -15.411 -29.736 1.00 35.07 ? 22  VAL A HG21 1 
ATOM   302   H HG22 . VAL A 1 22  ? -24.706 -15.724 -31.241 1.00 35.07 ? 22  VAL A HG22 1 
ATOM   303   H HG23 . VAL A 1 22  ? -24.126 -14.296 -30.854 1.00 35.07 ? 22  VAL A HG23 1 
ATOM   304   N N    . GLY A 1 23  ? -28.629 -12.628 -30.831 1.00 28.21 ? 23  GLY A N    1 
ATOM   305   C CA   . GLY A 1 23  ? -30.059 -12.361 -30.774 1.00 32.70 ? 23  GLY A CA   1 
ATOM   306   C C    . GLY A 1 23  ? -30.650 -12.268 -32.162 1.00 33.34 ? 23  GLY A C    1 
ATOM   307   O O    . GLY A 1 23  ? -31.654 -12.919 -32.477 1.00 35.04 ? 23  GLY A O    1 
ATOM   308   H H    . GLY A 1 23  ? -28.128 -12.031 -30.467 1.00 33.84 ? 23  GLY A H    1 
ATOM   309   H HA2  . GLY A 1 23  ? -30.506 -13.074 -30.292 1.00 39.21 ? 23  GLY A HA2  1 
ATOM   310   H HA3  . GLY A 1 23  ? -30.218 -11.524 -30.311 1.00 39.21 ? 23  GLY A HA3  1 
ATOM   311   N N    . GLY A 1 24  ? -30.000 -11.487 -33.032 1.00 28.57 ? 24  GLY A N    1 
ATOM   312   C CA   . GLY A 1 24  ? -30.429 -11.447 -34.416 1.00 27.42 ? 24  GLY A CA   1 
ATOM   313   C C    . GLY A 1 24  ? -30.543 -12.824 -35.027 1.00 27.65 ? 24  GLY A C    1 
ATOM   314   O O    . GLY A 1 24  ? -31.549 -13.159 -35.640 1.00 25.98 ? 24  GLY A O    1 
ATOM   315   H H    . GLY A 1 24  ? -29.326 -10.987 -32.844 1.00 34.26 ? 24  GLY A H    1 
ATOM   316   H HA2  . GLY A 1 24  ? -31.294 -11.013 -34.474 1.00 32.88 ? 24  GLY A HA2  1 
ATOM   317   H HA3  . GLY A 1 24  ? -29.792 -10.932 -34.936 1.00 32.88 ? 24  GLY A HA3  1 
ATOM   318   N N    . ASN A 1 25  ? -29.508 -13.643 -34.887 1.00 29.42 ? 25  ASN A N    1 
ATOM   319   C CA   . ASN A 1 25  ? -29.505 -14.933 -35.585 1.00 19.79 ? 25  ASN A CA   1 
ATOM   320   C C    . ASN A 1 25  ? -30.391 -15.975 -34.927 1.00 27.04 ? 25  ASN A C    1 
ATOM   321   O O    . ASN A 1 25  ? -30.871 -16.889 -35.607 1.00 31.32 ? 25  ASN A O    1 
ATOM   322   C CB   . ASN A 1 25  ? -28.095 -15.524 -35.636 1.00 28.23 ? 25  ASN A CB   1 
ATOM   323   C CG   . ASN A 1 25  ? -27.228 -14.877 -36.680 1.00 33.64 ? 25  ASN A CG   1 
ATOM   324   O OD1  . ASN A 1 25  ? -27.728 -14.202 -37.570 1.00 27.93 ? 25  ASN A OD1  1 
ATOM   325   N ND2  . ASN A 1 25  ? -25.907 -15.086 -36.581 1.00 23.92 ? 25  ASN A ND2  1 
ATOM   326   H H    . ASN A 1 25  ? -28.811 -13.487 -34.408 1.00 35.28 ? 25  ASN A H    1 
ATOM   327   H HA   . ASN A 1 25  ? -29.814 -14.804 -36.495 1.00 23.72 ? 25  ASN A HA   1 
ATOM   328   H HB2  . ASN A 1 25  ? -27.670 -15.399 -34.773 1.00 33.86 ? 25  ASN A HB2  1 
ATOM   329   H HB3  . ASN A 1 25  ? -28.157 -16.470 -35.842 1.00 33.86 ? 25  ASN A HB3  1 
ATOM   330   H HD21 . ASN A 1 25  ? -25.373 -14.736 -37.157 1.00 28.69 ? 25  ASN A HD21 1 
ATOM   331   H HD22 . ASN A 1 25  ? -25.595 -15.568 -35.941 1.00 28.69 ? 25  ASN A HD22 1 
ATOM   332   N N    . ALA A 1 26  ? -30.508 -15.942 -33.600 1.00 24.78 ? 26  ALA A N    1 
ATOM   333   C CA   . ALA A 1 26  ? -31.434 -16.850 -32.937 1.00 30.16 ? 26  ALA A CA   1 
ATOM   334   C C    . ALA A 1 26  ? -32.873 -16.524 -33.332 1.00 29.50 ? 26  ALA A C    1 
ATOM   335   O O    . ALA A 1 26  ? -33.648 -17.429 -33.637 1.00 24.02 ? 26  ALA A O    1 
ATOM   336   C CB   . ALA A 1 26  ? -31.262 -16.786 -31.420 1.00 27.42 ? 26  ALA A CB   1 
ATOM   337   H H    . ALA A 1 26  ? -30.074 -15.417 -33.075 1.00 29.71 ? 26  ALA A H    1 
ATOM   338   H HA   . ALA A 1 26  ? -31.244 -17.757 -33.222 1.00 36.17 ? 26  ALA A HA   1 
ATOM   339   H HB1  . ALA A 1 26  ? -31.889 -17.398 -31.006 1.00 32.88 ? 26  ALA A HB1  1 
ATOM   340   H HB2  . ALA A 1 26  ? -30.353 -17.039 -31.195 1.00 32.88 ? 26  ALA A HB2  1 
ATOM   341   H HB3  . ALA A 1 26  ? -31.437 -15.880 -31.121 1.00 32.88 ? 26  ALA A HB3  1 
ATOM   342   N N    . ALA A 1 27  ? -33.241 -15.235 -33.347 1.00 29.37 ? 27  ALA A N    1 
ATOM   343   C CA   . ALA A 1 27  ? -34.588 -14.867 -33.802 1.00 32.43 ? 27  ALA A CA   1 
ATOM   344   C C    . ALA A 1 27  ? -34.820 -15.318 -35.240 1.00 28.12 ? 27  ALA A C    1 
ATOM   345   O O    . ALA A 1 27  ? -35.842 -15.940 -35.550 1.00 34.62 ? 27  ALA A O    1 
ATOM   346   C CB   . ALA A 1 27  ? -34.808 -13.356 -33.659 1.00 30.37 ? 27  ALA A CB   1 
ATOM   347   H H    . ALA A 1 27  ? -32.745 -14.574 -33.108 1.00 35.23 ? 27  ALA A H    1 
ATOM   348   H HA   . ALA A 1 27  ? -35.240 -15.316 -33.241 1.00 38.89 ? 27  ALA A HA   1 
ATOM   349   H HB1  . ALA A 1 27  ? -35.703 -13.137 -33.964 1.00 36.43 ? 27  ALA A HB1  1 
ATOM   350   H HB2  . ALA A 1 27  ? -34.707 -13.109 -32.726 1.00 36.43 ? 27  ALA A HB2  1 
ATOM   351   H HB3  . ALA A 1 27  ? -34.151 -12.889 -34.198 1.00 36.43 ? 27  ALA A HB3  1 
ATOM   352   N N    . GLN A 1 28  ? -33.865 -15.032 -36.133 1.00 27.98 ? 28  GLN A N    1 
ATOM   353   C CA   . GLN A 1 28  ? -34.034 -15.332 -37.555 1.00 26.67 ? 28  GLN A CA   1 
ATOM   354   C C    . GLN A 1 28  ? -34.085 -16.832 -37.844 1.00 26.77 ? 28  GLN A C    1 
ATOM   355   O O    . GLN A 1 28  ? -34.933 -17.288 -38.611 1.00 24.10 ? 28  GLN A O    1 
ATOM   356   C CB   . GLN A 1 28  ? -32.901 -14.700 -38.363 1.00 28.85 ? 28  GLN A CB   1 
ATOM   357   C CG   . GLN A 1 28  ? -32.877 -15.116 -39.820 1.00 26.01 ? 28  GLN A CG   1 
ATOM   358   C CD   . GLN A 1 28  ? -34.078 -14.569 -40.576 1.00 27.91 ? 28  GLN A CD   1 
ATOM   359   O OE1  . GLN A 1 28  ? -34.479 -13.429 -40.369 1.00 25.46 ? 28  GLN A OE1  1 
ATOM   360   N NE2  . GLN A 1 28  ? -34.647 -15.382 -41.450 1.00 25.48 ? 28  GLN A NE2  1 
ATOM   361   H H    . GLN A 1 28  ? -33.112 -14.664 -35.939 1.00 33.55 ? 28  GLN A H    1 
ATOM   362   H HA   . GLN A 1 28  ? -34.869 -14.943 -37.859 1.00 31.99 ? 28  GLN A HA   1 
ATOM   363   H HB2  . GLN A 1 28  ? -32.997 -13.736 -38.332 1.00 34.60 ? 28  GLN A HB2  1 
ATOM   364   H HB3  . GLN A 1 28  ? -32.054 -14.959 -37.967 1.00 34.60 ? 28  GLN A HB3  1 
ATOM   365   H HG2  . GLN A 1 28  ? -32.072 -14.772 -40.238 1.00 31.19 ? 28  GLN A HG2  1 
ATOM   366   H HG3  . GLN A 1 28  ? -32.897 -16.084 -39.877 1.00 31.19 ? 28  GLN A HG3  1 
ATOM   367   H HE21 . GLN A 1 28  ? -34.335 -16.175 -41.567 1.00 30.56 ? 28  GLN A HE21 1 
ATOM   368   H HE22 . GLN A 1 28  ? -35.329 -15.117 -41.902 1.00 30.56 ? 28  GLN A HE22 1 
ATOM   369   N N    . LEU A 1 29  ? -33.152 -17.609 -37.311 1.00 27.43 ? 29  LEU A N    1 
ATOM   370   C CA   . LEU A 1 29  ? -32.905 -18.958 -37.826 1.00 21.84 ? 29  LEU A CA   1 
ATOM   371   C C    . LEU A 1 29  ? -33.794 -19.975 -37.133 1.00 29.24 ? 29  LEU A C    1 
ATOM   372   O O    . LEU A 1 29  ? -33.888 -19.988 -35.900 1.00 31.37 ? 29  LEU A O    1 
ATOM   373   C CB   . LEU A 1 29  ? -31.434 -19.347 -37.618 1.00 33.79 ? 29  LEU A CB   1 
ATOM   374   C CG   . LEU A 1 29  ? -30.386 -18.561 -38.410 1.00 29.84 ? 29  LEU A CG   1 
ATOM   375   C CD1  . LEU A 1 29  ? -28.984 -18.860 -37.891 1.00 28.64 ? 29  LEU A CD1  1 
ATOM   376   C CD2  . LEU A 1 29  ? -30.500 -18.913 -39.871 1.00 29.65 ? 29  LEU A CD2  1 
ATOM   377   H H    . LEU A 1 29  ? -32.648 -17.383 -36.652 1.00 32.90 ? 29  LEU A H    1 
ATOM   378   H HA   . LEU A 1 29  ? -33.096 -18.980 -38.776 1.00 26.19 ? 29  LEU A HA   1 
ATOM   379   H HB2  . LEU A 1 29  ? -31.223 -19.235 -36.678 1.00 40.52 ? 29  LEU A HB2  1 
ATOM   380   H HB3  . LEU A 1 29  ? -31.332 -20.281 -37.859 1.00 40.52 ? 29  LEU A HB3  1 
ATOM   381   H HG   . LEU A 1 29  ? -30.553 -17.611 -38.310 1.00 35.78 ? 29  LEU A HG   1 
ATOM   382   H HD11 . LEU A 1 29  ? -28.341 -18.351 -38.409 1.00 34.35 ? 29  LEU A HD11 1 
ATOM   383   H HD12 . LEU A 1 29  ? -28.932 -18.605 -36.956 1.00 34.35 ? 29  LEU A HD12 1 
ATOM   384   H HD13 . LEU A 1 29  ? -28.808 -19.809 -37.986 1.00 34.35 ? 29  LEU A HD13 1 
ATOM   385   H HD21 . LEU A 1 29  ? -29.834 -18.412 -40.369 1.00 35.56 ? 29  LEU A HD21 1 
ATOM   386   H HD22 . LEU A 1 29  ? -30.348 -19.864 -39.980 1.00 35.56 ? 29  LEU A HD22 1 
ATOM   387   H HD23 . LEU A 1 29  ? -31.389 -18.681 -40.183 1.00 35.56 ? 29  LEU A HD23 1 
ATOM   388   N N    . ALA A 1 30  ? -34.392 -20.867 -37.929 1.00 36.06 ? 30  ALA A N    1 
ATOM   389   C CA   . ALA A 1 30  ? -35.413 -21.771 -37.407 1.00 32.85 ? 30  ALA A CA   1 
ATOM   390   C C    . ALA A 1 30  ? -34.876 -22.613 -36.269 1.00 39.99 ? 30  ALA A C    1 
ATOM   391   O O    . ALA A 1 30  ? -35.596 -22.882 -35.300 1.00 46.21 ? 30  ALA A O    1 
ATOM   392   C CB   . ALA A 1 30  ? -35.929 -22.680 -38.509 1.00 36.38 ? 30  ALA A CB   1 
ATOM   393   H H    . ALA A 1 30  ? -34.224 -20.966 -38.767 1.00 43.26 ? 30  ALA A H    1 
ATOM   394   H HA   . ALA A 1 30  ? -36.159 -21.248 -37.072 1.00 39.40 ? 30  ALA A HA   1 
ATOM   395   H HB1  . ALA A 1 30  ? -36.605 -23.270 -38.140 1.00 43.64 ? 30  ALA A HB1  1 
ATOM   396   H HB2  . ALA A 1 30  ? -36.314 -22.135 -39.213 1.00 43.64 ? 30  ALA A HB2  1 
ATOM   397   H HB3  . ALA A 1 30  ? -35.190 -23.201 -38.860 1.00 43.64 ? 30  ALA A HB3  1 
ATOM   398   N N    . GLN A 1 31  ? -33.621 -23.044 -36.360 1.00 30.69 ? 31  GLN A N    1 
ATOM   399   C CA   . GLN A 1 31  ? -33.166 -24.133 -35.494 1.00 33.23 ? 31  GLN A CA   1 
ATOM   400   C C    . GLN A 1 31  ? -32.841 -23.666 -34.082 1.00 28.66 ? 31  GLN A C    1 
ATOM   401   O O    . GLN A 1 31  ? -32.471 -24.491 -33.234 1.00 36.22 ? 31  GLN A O    1 
ATOM   402   C CB   . GLN A 1 31  ? -31.953 -24.845 -36.109 1.00 33.33 ? 31  GLN A CB   1 
ATOM   403   C CG   . GLN A 1 31  ? -30.666 -23.992 -36.217 1.00 32.46 ? 31  GLN A CG   1 
ATOM   404   C CD   . GLN A 1 31  ? -30.498 -23.240 -37.556 1.00 39.07 ? 31  GLN A CD   1 
ATOM   405   O OE1  . GLN A 1 31  ? -31.449 -22.677 -38.113 1.00 34.35 ? 31  GLN A OE1  1 
ATOM   406   N NE2  . GLN A 1 31  ? -29.270 -23.235 -38.070 1.00 29.22 ? 31  GLN A NE2  1 
ATOM   407   H H    . GLN A 1 31  ? -33.026 -22.734 -36.899 1.00 36.81 ? 31  GLN A H    1 
ATOM   408   H HA   . GLN A 1 31  ? -33.881 -24.786 -35.425 1.00 39.85 ? 31  GLN A HA   1 
ATOM   409   H HB2  . GLN A 1 31  ? -31.743 -25.620 -35.566 1.00 39.98 ? 31  GLN A HB2  1 
ATOM   410   H HB3  . GLN A 1 31  ? -32.187 -25.132 -37.006 1.00 39.98 ? 31  GLN A HB3  1 
ATOM   411   H HG2  . GLN A 1 31  ? -30.675 -23.330 -35.508 1.00 38.94 ? 31  GLN A HG2  1 
ATOM   412   H HG3  . GLN A 1 31  ? -29.899 -24.575 -36.109 1.00 38.94 ? 31  GLN A HG3  1 
ATOM   413   H HE21 . GLN A 1 31  ? -28.630 -23.636 -37.658 1.00 35.04 ? 31  GLN A HE21 1 
ATOM   414   H HE22 . GLN A 1 31  ? -29.117 -22.832 -38.814 1.00 35.04 ? 31  GLN A HE22 1 
ATOM   415   N N    . PHE A 1 32  ? -32.977 -22.371 -33.814 1.00 36.02 ? 32  PHE A N    1 
ATOM   416   C CA   . PHE A 1 32  ? -32.678 -21.765 -32.529 1.00 32.52 ? 32  PHE A CA   1 
ATOM   417   C C    . PHE A 1 32  ? -33.953 -21.160 -31.949 1.00 39.81 ? 32  PHE A C    1 
ATOM   418   O O    . PHE A 1 32  ? -34.770 -20.568 -32.670 1.00 35.03 ? 32  PHE A O    1 
ATOM   419   C CB   . PHE A 1 32  ? -31.585 -20.671 -32.664 1.00 29.87 ? 32  PHE A CB   1 
ATOM   420   C CG   . PHE A 1 32  ? -30.256 -21.222 -33.135 1.00 36.87 ? 32  PHE A CG   1 
ATOM   421   C CD1  . PHE A 1 32  ? -29.567 -22.142 -32.353 1.00 34.60 ? 32  PHE A CD1  1 
ATOM   422   C CD2  . PHE A 1 32  ? -29.716 -20.868 -34.368 1.00 29.21 ? 32  PHE A CD2  1 
ATOM   423   C CE1  . PHE A 1 32  ? -28.366 -22.682 -32.773 1.00 28.10 ? 32  PHE A CE1  1 
ATOM   424   C CE2  . PHE A 1 32  ? -28.506 -21.419 -34.798 1.00 28.91 ? 32  PHE A CE2  1 
ATOM   425   C CZ   . PHE A 1 32  ? -27.837 -22.328 -33.997 1.00 29.17 ? 32  PHE A CZ   1 
ATOM   426   H H    . PHE A 1 32  ? -33.255 -21.799 -34.394 1.00 43.20 ? 32  PHE A H    1 
ATOM   427   H HA   . PHE A 1 32  ? -32.357 -22.447 -31.919 1.00 39.00 ? 32  PHE A HA   1 
ATOM   428   H HB2  . PHE A 1 32  ? -31.879 -20.008 -33.307 1.00 35.82 ? 32  PHE A HB2  1 
ATOM   429   H HB3  . PHE A 1 32  ? -31.447 -20.256 -31.798 1.00 35.82 ? 32  PHE A HB3  1 
ATOM   430   H HD1  . PHE A 1 32  ? -29.918 -22.395 -31.530 1.00 41.50 ? 32  PHE A HD1  1 
ATOM   431   H HD2  . PHE A 1 32  ? -30.168 -20.264 -34.913 1.00 35.04 ? 32  PHE A HD2  1 
ATOM   432   H HE1  . PHE A 1 32  ? -27.918 -23.291 -32.233 1.00 33.70 ? 32  PHE A HE1  1 
ATOM   433   H HE2  . PHE A 1 32  ? -28.148 -21.172 -35.620 1.00 34.67 ? 32  PHE A HE2  1 
ATOM   434   H HZ   . PHE A 1 32  ? -27.024 -22.686 -34.275 1.00 34.98 ? 32  PHE A HZ   1 
ATOM   435   N N    . ASP A 1 33  ? -34.119 -21.324 -30.653 1.00 33.50 ? 33  ASP A N    1 
ATOM   436   C CA   . ASP A 1 33  ? -35.181 -20.657 -29.947 1.00 26.30 ? 33  ASP A CA   1 
ATOM   437   C C    . ASP A 1 33  ? -34.887 -19.165 -29.918 1.00 39.22 ? 33  ASP A C    1 
ATOM   438   O O    . ASP A 1 33  ? -33.784 -18.764 -29.507 1.00 25.30 ? 33  ASP A O    1 
ATOM   439   C CB   . ASP A 1 33  ? -35.276 -21.213 -28.527 1.00 33.65 ? 33  ASP A CB   1 
ATOM   440   C CG   . ASP A 1 33  ? -36.491 -20.726 -27.797 1.00 28.38 ? 33  ASP A CG   1 
ATOM   441   O OD1  . ASP A 1 33  ? -36.691 -19.493 -27.705 1.00 29.41 ? 33  ASP A OD1  1 
ATOM   442   O OD2  . ASP A 1 33  ? -37.221 -21.587 -27.291 1.00 30.33 ? 33  ASP A OD2  1 
ATOM   443   H H    . ASP A 1 33  ? -33.623 -21.822 -30.157 1.00 40.18 ? 33  ASP A H    1 
ATOM   444   H HA   . ASP A 1 33  ? -36.026 -20.804 -30.401 1.00 31.54 ? 33  ASP A HA   1 
ATOM   445   H HB2  . ASP A 1 33  ? -35.319 -22.181 -28.569 1.00 40.35 ? 33  ASP A HB2  1 
ATOM   446   H HB3  . ASP A 1 33  ? -34.493 -20.937 -28.026 1.00 40.35 ? 33  ASP A HB3  1 
ATOM   447   N N    . PRO A 1 34  ? -35.830 -18.314 -30.334 1.00 29.32 ? 34  PRO A N    1 
ATOM   448   C CA   . PRO A 1 34  ? -35.560 -16.870 -30.325 1.00 26.28 ? 34  PRO A CA   1 
ATOM   449   C C    . PRO A 1 34  ? -35.324 -16.303 -28.963 1.00 26.48 ? 34  PRO A C    1 
ATOM   450   O O    . PRO A 1 34  ? -34.704 -15.233 -28.852 1.00 25.82 ? 34  PRO A O    1 
ATOM   451   C CB   . PRO A 1 34  ? -36.826 -16.276 -30.965 1.00 36.09 ? 34  PRO A CB   1 
ATOM   452   C CG   . PRO A 1 34  ? -37.856 -17.361 -30.883 1.00 31.80 ? 34  PRO A CG   1 
ATOM   453   C CD   . PRO A 1 34  ? -37.132 -18.630 -30.954 1.00 32.62 ? 34  PRO A CD   1 
ATOM   454   H HA   . PRO A 1 34  ? -34.796 -16.670 -30.889 1.00 31.52 ? 34  PRO A HA   1 
ATOM   455   H HB2  . PRO A 1 34  ? -37.110 -15.496 -30.464 1.00 43.28 ? 34  PRO A HB2  1 
ATOM   456   H HB3  . PRO A 1 34  ? -36.646 -16.043 -31.890 1.00 43.28 ? 34  PRO A HB3  1 
ATOM   457   H HG2  . PRO A 1 34  ? -38.333 -17.290 -30.042 1.00 38.13 ? 34  PRO A HG2  1 
ATOM   458   H HG3  . PRO A 1 34  ? -38.471 -17.280 -31.629 1.00 38.13 ? 34  PRO A HG3  1 
ATOM   459   H HD2  . PRO A 1 34  ? -37.594 -19.312 -30.442 1.00 39.12 ? 34  PRO A HD2  1 
ATOM   460   H HD3  . PRO A 1 34  ? -37.011 -18.899 -31.878 1.00 39.12 ? 34  PRO A HD3  1 
ATOM   461   N N    . ARG A 1 35  ? -35.804 -16.948 -27.906 1.00 33.38 ? 35  ARG A N    1 
ATOM   462   C CA   . ARG A 1 35  ? -35.605 -16.384 -26.584 1.00 27.70 ? 35  ARG A CA   1 
ATOM   463   C C    . ARG A 1 35  ? -34.176 -16.706 -26.185 1.00 29.37 ? 35  ARG A C    1 
ATOM   464   O O    . ARG A 1 35  ? -33.837 -17.863 -25.919 1.00 30.24 ? 35  ARG A O    1 
ATOM   465   C CB   . ARG A 1 35  ? -36.592 -16.912 -25.552 1.00 33.52 ? 35  ARG A CB   1 
ATOM   466   C CG   . ARG A 1 35  ? -36.376 -16.258 -24.184 1.00 38.70 ? 35  ARG A CG   1 
ATOM   467   C CD   . ARG A 1 35  ? -37.460 -16.632 -23.136 1.00 46.63 ? 35  ARG A CD   1 
ATOM   468   N NE   . ARG A 1 35  ? -36.927 -16.470 -21.784 1.00 43.72 ? 35  ARG A NE   1 
ATOM   469   C CZ   . ARG A 1 35  ? -36.227 -17.399 -21.139 1.00 42.92 ? 35  ARG A CZ   1 
ATOM   470   N NH1  . ARG A 1 35  ? -35.981 -18.582 -21.704 1.00 48.29 ? 35  ARG A NH1  1 
ATOM   471   N NH2  . ARG A 1 35  ? -35.765 -17.148 -19.926 1.00 51.75 ? 35  ARG A NH2  1 
ATOM   472   H H    . ARG A 1 35  ? -36.236 -17.692 -27.927 1.00 40.03 ? 35  ARG A H    1 
ATOM   473   H HA   . ARG A 1 35  ? -35.700 -15.420 -26.630 1.00 33.22 ? 35  ARG A HA   1 
ATOM   474   H HB2  . ARG A 1 35  ? -37.496 -16.716 -25.843 1.00 40.20 ? 35  ARG A HB2  1 
ATOM   475   H HB3  . ARG A 1 35  ? -36.471 -17.870 -25.453 1.00 40.20 ? 35  ARG A HB3  1 
ATOM   476   H HG2  . ARG A 1 35  ? -35.515 -16.539 -23.835 1.00 46.41 ? 35  ARG A HG2  1 
ATOM   477   H HG3  . ARG A 1 35  ? -36.387 -15.294 -24.293 1.00 46.41 ? 35  ARG A HG3  1 
ATOM   478   H HD2  . ARG A 1 35  ? -38.226 -16.045 -23.237 1.00 55.93 ? 35  ARG A HD2  1 
ATOM   479   H HD3  . ARG A 1 35  ? -37.722 -17.558 -23.256 1.00 55.93 ? 35  ARG A HD3  1 
ATOM   480   H HE   . ARG A 1 35  ? -37.075 -15.726 -21.380 1.00 52.45 ? 35  ARG A HE   1 
ATOM   481   H HH11 . ARG A 1 35  ? -36.273 -18.749 -22.496 1.00 57.92 ? 35  ARG A HH11 1 
ATOM   482   H HH12 . ARG A 1 35  ? -35.530 -19.177 -21.278 1.00 57.92 ? 35  ARG A HH12 1 
ATOM   483   H HH21 . ARG A 1 35  ? -35.924 -16.389 -19.554 1.00 62.07 ? 35  ARG A HH21 1 
ATOM   484   H HH22 . ARG A 1 35  ? -35.321 -17.750 -19.502 1.00 62.07 ? 35  ARG A HH22 1 
ATOM   485   N N    . VAL A 1 36  ? -33.346 -15.678 -26.167 1.00 29.33 ? 36  VAL A N    1 
ATOM   486   C CA   . VAL A 1 36  ? -31.951 -15.784 -25.788 1.00 27.72 ? 36  VAL A CA   1 
ATOM   487   C C    . VAL A 1 36  ? -31.815 -15.082 -24.466 1.00 28.92 ? 36  VAL A C    1 
ATOM   488   O O    . VAL A 1 36  ? -32.033 -13.866 -24.378 1.00 32.55 ? 36  VAL A O    1 
ATOM   489   C CB   . VAL A 1 36  ? -31.030 -15.148 -26.838 1.00 26.77 ? 36  VAL A CB   1 
ATOM   490   C CG1  . VAL A 1 36  ? -29.586 -15.171 -26.358 1.00 22.52 ? 36  VAL A CG1  1 
ATOM   491   C CG2  . VAL A 1 36  ? -31.175 -15.856 -28.132 1.00 25.18 ? 36  VAL A CG2  1 
ATOM   492   H H    . VAL A 1 36  ? -33.578 -14.878 -26.380 1.00 35.17 ? 36  VAL A H    1 
ATOM   493   H HA   . VAL A 1 36  ? -31.707 -16.716 -25.677 1.00 33.25 ? 36  VAL A HA   1 
ATOM   494   H HB   . VAL A 1 36  ? -31.290 -14.222 -26.969 1.00 32.10 ? 36  VAL A HB   1 
ATOM   495   H HG11 . VAL A 1 36  ? -29.022 -14.765 -27.034 1.00 27.00 ? 36  VAL A HG11 1 
ATOM   496   H HG12 . VAL A 1 36  ? -29.521 -14.672 -25.529 1.00 27.00 ? 36  VAL A HG12 1 
ATOM   497   H HG13 . VAL A 1 36  ? -29.317 -16.092 -26.211 1.00 27.00 ? 36  VAL A HG13 1 
ATOM   498   H HG21 . VAL A 1 36  ? -30.588 -15.443 -28.785 1.00 30.19 ? 36  VAL A HG21 1 
ATOM   499   H HG22 . VAL A 1 36  ? -30.932 -16.787 -28.011 1.00 30.19 ? 36  VAL A HG22 1 
ATOM   500   H HG23 . VAL A 1 36  ? -32.096 -15.789 -28.427 1.00 30.19 ? 36  VAL A HG23 1 
ATOM   501   N N    . THR A 1 37  ? -31.406 -15.825 -23.450 1.00 25.60 ? 37  THR A N    1 
ATOM   502   C CA   . THR A 1 37  ? -31.105 -15.222 -22.175 1.00 27.11 ? 37  THR A CA   1 
ATOM   503   C C    . THR A 1 37  ? -29.716 -14.608 -22.196 1.00 30.21 ? 37  THR A C    1 
ATOM   504   O O    . THR A 1 37  ? -28.795 -15.113 -22.847 1.00 29.92 ? 37  THR A O    1 
ATOM   505   C CB   . THR A 1 37  ? -31.211 -16.263 -21.052 1.00 37.04 ? 37  THR A CB   1 
ATOM   506   O OG1  . THR A 1 37  ? -30.449 -17.434 -21.390 1.00 30.46 ? 37  THR A OG1  1 
ATOM   507   C CG2  . THR A 1 37  ? -32.673 -16.634 -20.835 1.00 31.34 ? 37  THR A CG2  1 
ATOM   508   H H    . THR A 1 37  ? -31.296 -16.678 -23.477 1.00 30.70 ? 37  THR A H    1 
ATOM   509   H HA   . THR A 1 37  ? -31.745 -14.516 -21.996 1.00 32.50 ? 37  THR A HA   1 
ATOM   510   H HB   . THR A 1 37  ? -30.868 -15.883 -20.229 1.00 44.42 ? 37  THR A HB   1 
ATOM   511   H HG1  . THR A 1 37  ? -30.509 -18.003 -20.775 1.00 36.53 ? 37  THR A HG1  1 
ATOM   512   H HG21 . THR A 1 37  ? -32.746 -17.292 -20.126 1.00 37.58 ? 37  THR A HG21 1 
ATOM   513   H HG22 . THR A 1 37  ? -33.182 -15.846 -20.587 1.00 37.58 ? 37  THR A HG22 1 
ATOM   514   H HG23 . THR A 1 37  ? -33.045 -17.006 -21.650 1.00 37.58 ? 37  THR A HG23 1 
ATOM   515   N N    . MET A 1 38  ? -29.568 -13.569 -21.413 1.00 27.97 ? 38  MET A N    1 
ATOM   516   C CA   . MET A 1 38  ? -28.307 -12.952 -21.250 1.00 31.03 ? 38  MET A CA   1 
ATOM   517   C C    . MET A 1 38  ? -28.141 -12.614 -19.798 1.00 32.23 ? 38  MET A C    1 
ATOM   518   O O    . MET A 1 38  ? -28.906 -11.854 -19.283 1.00 33.31 ? 38  MET A O    1 
ATOM   519   C CB   . MET A 1 38  ? -28.171 -11.741 -22.162 1.00 28.51 ? 38  MET A CB   1 
ATOM   520   C CG   . MET A 1 38  ? -26.945 -10.947 -21.900 1.00 30.76 ? 38  MET A CG   1 
ATOM   521   S SD   . MET A 1 38  ? -26.697 -9.599  -23.043 1.00 35.75 ? 38  MET A SD   1 
ATOM   522   C CE   . MET A 1 38  ? -25.315 -8.989  -22.219 1.00 41.59 ? 38  MET A CE   1 
ATOM   523   H H    . MET A 1 38  ? -30.202 -13.204 -20.961 1.00 33.55 ? 38  MET A H    1 
ATOM   524   H HA   . MET A 1 38  ? -27.610 -13.593 -21.503 1.00 37.21 ? 38  MET A HA   1 
ATOM   525   H HB2  . MET A 1 38  ? -28.140 -12.043 -23.084 1.00 34.19 ? 38  MET A HB2  1 
ATOM   526   H HB3  . MET A 1 38  ? -28.937 -11.160 -22.031 1.00 34.19 ? 38  MET A HB3  1 
ATOM   527   H HG2  . MET A 1 38  ? -27.002 -10.572 -21.007 1.00 36.89 ? 38  MET A HG2  1 
ATOM   528   H HG3  . MET A 1 38  ? -26.175 -11.533 -21.961 1.00 36.89 ? 38  MET A HG3  1 
ATOM   529   H HE1  . MET A 1 38  ? -24.623 -8.812  -22.860 1.00 49.88 ? 38  MET A HE1  1 
ATOM   530   H HE2  . MET A 1 38  ? -25.556 -8.179  -21.764 1.00 49.88 ? 38  MET A HE2  1 
ATOM   531   H HE3  . MET A 1 38  ? -25.015 -9.644  -21.585 1.00 49.88 ? 38  MET A HE3  1 
ATOM   532   N N    . TRP A 1 39  ? -27.150 -13.184 -19.140 1.00 25.37 ? 39  TRP A N    1 
ATOM   533   C CA   . TRP A 1 39  ? -26.918 -12.906 -17.735 1.00 24.44 ? 39  TRP A CA   1 
ATOM   534   C C    . TRP A 1 39  ? -26.269 -11.542 -17.569 1.00 36.67 ? 39  TRP A C    1 
ATOM   535   O O    . TRP A 1 39  ? -25.208 -11.283 -18.148 1.00 29.32 ? 39  TRP A O    1 
ATOM   536   C CB   . TRP A 1 39  ? -26.030 -13.967 -17.092 1.00 29.18 ? 39  TRP A CB   1 
ATOM   537   C CG   . TRP A 1 39  ? -25.627 -13.541 -15.697 1.00 26.70 ? 39  TRP A CG   1 
ATOM   538   C CD1  . TRP A 1 39  ? -26.453 -13.422 -14.615 1.00 29.08 ? 39  TRP A CD1  1 
ATOM   539   C CD2  . TRP A 1 39  ? -24.331 -13.125 -15.255 1.00 30.58 ? 39  TRP A CD2  1 
ATOM   540   N NE1  . TRP A 1 39  ? -25.754 -12.971 -13.533 1.00 31.22 ? 39  TRP A NE1  1 
ATOM   541   C CE2  . TRP A 1 39  ? -24.445 -12.790 -13.892 1.00 28.46 ? 39  TRP A CE2  1 
ATOM   542   C CE3  . TRP A 1 39  ? -23.080 -13.018 -15.875 1.00 31.28 ? 39  TRP A CE3  1 
ATOM   543   C CZ2  . TRP A 1 39  ? -23.368 -12.351 -13.143 1.00 30.60 ? 39  TRP A CZ2  1 
ATOM   544   C CZ3  . TRP A 1 39  ? -22.017 -12.580 -15.129 1.00 34.53 ? 39  TRP A CZ3  1 
ATOM   545   C CH2  . TRP A 1 39  ? -22.165 -12.253 -13.769 1.00 29.44 ? 39  TRP A CH2  1 
ATOM   546   H H    . TRP A 1 39  ? -26.601 -13.747 -19.486 1.00 30.43 ? 39  TRP A H    1 
ATOM   547   H HA   . TRP A 1 39  ? -27.767 -12.898 -17.267 1.00 29.31 ? 39  TRP A HA   1 
ATOM   548   H HB2  . TRP A 1 39  ? -26.517 -14.803 -17.029 1.00 35.00 ? 39  TRP A HB2  1 
ATOM   549   H HB3  . TRP A 1 39  ? -25.226 -14.081 -17.623 1.00 35.00 ? 39  TRP A HB3  1 
ATOM   550   H HD1  . TRP A 1 39  ? -27.363 -13.615 -14.617 1.00 34.87 ? 39  TRP A HD1  1 
ATOM   551   H HE1  . TRP A 1 39  ? -26.080 -12.839 -12.748 1.00 37.44 ? 39  TRP A HE1  1 
ATOM   552   H HE3  . TRP A 1 39  ? -22.975 -13.230 -16.774 1.00 37.51 ? 39  TRP A HE3  1 
ATOM   553   H HZ2  . TRP A 1 39  ? -23.463 -12.134 -12.243 1.00 36.70 ? 39  TRP A HZ2  1 
ATOM   554   H HZ3  . TRP A 1 39  ? -21.180 -12.506 -15.527 1.00 41.41 ? 39  TRP A HZ3  1 
ATOM   555   H HH2  . TRP A 1 39  ? -21.424 -11.965 -13.288 1.00 35.30 ? 39  TRP A HH2  1 
ATOM   556   N N    . VAL A 1 40  ? -26.893 -10.690 -16.744 1.00 34.61 ? 40  VAL A N    1 
ATOM   557   C CA   . VAL A 1 40  ? -26.408 -9.342  -16.424 1.00 33.00 ? 40  VAL A CA   1 
ATOM   558   C C    . VAL A 1 40  ? -26.191 -9.218  -14.920 1.00 34.11 ? 40  VAL A C    1 
ATOM   559   O O    . VAL A 1 40  ? -27.152 -9.265  -14.148 1.00 46.79 ? 40  VAL A O    1 
ATOM   560   C CB   . VAL A 1 40  ? -27.406 -8.268  -16.874 1.00 35.07 ? 40  VAL A CB   1 
ATOM   561   C CG1  . VAL A 1 40  ? -26.879 -6.870  -16.557 1.00 42.87 ? 40  VAL A CG1  1 
ATOM   562   C CG2  . VAL A 1 40  ? -27.725 -8.407  -18.355 1.00 37.23 ? 40  VAL A CG2  1 
ATOM   563   H H    . VAL A 1 40  ? -27.629 -10.882 -16.344 1.00 41.52 ? 40  VAL A H    1 
ATOM   564   H HA   . VAL A 1 40  ? -25.562 -9.185  -16.872 1.00 39.58 ? 40  VAL A HA   1 
ATOM   565   H HB   . VAL A 1 40  ? -28.234 -8.388  -16.382 1.00 42.06 ? 40  VAL A HB   1 
ATOM   566   H HG11 . VAL A 1 40  ? -27.529 -6.214  -16.852 1.00 51.42 ? 40  VAL A HG11 1 
ATOM   567   H HG12 . VAL A 1 40  ? -26.742 -6.794  -15.600 1.00 51.42 ? 40  VAL A HG12 1 
ATOM   568   H HG13 . VAL A 1 40  ? -26.039 -6.737  -17.024 1.00 51.42 ? 40  VAL A HG13 1 
ATOM   569   H HG21 . VAL A 1 40  ? -28.356 -7.716  -18.608 1.00 44.66 ? 40  VAL A HG21 1 
ATOM   570   H HG22 . VAL A 1 40  ? -26.905 -8.309  -18.864 1.00 44.66 ? 40  VAL A HG22 1 
ATOM   571   H HG23 . VAL A 1 40  ? -28.111 -9.283  -18.513 1.00 44.66 ? 40  VAL A HG23 1 
ATOM   572   N N    . PHE A 1 41  ? -24.955 -9.010  -14.503 1.00 39.02 ? 41  PHE A N    1 
ATOM   573   C CA   . PHE A 1 41  ? -24.705 -8.533  -13.150 1.00 44.65 ? 41  PHE A CA   1 
ATOM   574   C C    . PHE A 1 41  ? -25.446 -7.219  -12.951 1.00 49.22 ? 41  PHE A C    1 
ATOM   575   O O    . PHE A 1 41  ? -25.146 -6.227  -13.620 1.00 54.66 ? 41  PHE A O    1 
ATOM   576   C CB   . PHE A 1 41  ? -23.213 -8.339  -12.932 1.00 48.23 ? 41  PHE A CB   1 
ATOM   577   C CG   . PHE A 1 41  ? -22.845 -7.965  -11.530 1.00 54.89 ? 41  PHE A CG   1 
ATOM   578   C CD1  . PHE A 1 41  ? -23.082 -8.837  -10.484 1.00 55.92 ? 41  PHE A CD1  1 
ATOM   579   C CD2  . PHE A 1 41  ? -22.234 -6.749  -11.263 1.00 56.47 ? 41  PHE A CD2  1 
ATOM   580   C CE1  . PHE A 1 41  ? -22.727 -8.497  -9.186  1.00 60.38 ? 41  PHE A CE1  1 
ATOM   581   C CE2  . PHE A 1 41  ? -21.873 -6.405  -9.974  1.00 55.26 ? 41  PHE A CE2  1 
ATOM   582   C CZ   . PHE A 1 41  ? -22.119 -7.278  -8.937  1.00 61.95 ? 41  PHE A CZ   1 
ATOM   583   H H    . PHE A 1 41  ? -24.247 -9.134  -14.976 1.00 46.80 ? 41  PHE A H    1 
ATOM   584   H HA   . PHE A 1 41  ? -25.035 -9.179  -12.506 1.00 53.56 ? 41  PHE A HA   1 
ATOM   585   H HB2  . PHE A 1 41  ? -22.757 -9.168  -13.145 1.00 57.86 ? 41  PHE A HB2  1 
ATOM   586   H HB3  . PHE A 1 41  ? -22.901 -7.632  -13.518 1.00 57.86 ? 41  PHE A HB3  1 
ATOM   587   H HD1  . PHE A 1 41  ? -23.487 -9.658  -10.650 1.00 67.08 ? 41  PHE A HD1  1 
ATOM   588   H HD2  . PHE A 1 41  ? -22.063 -6.158  -11.961 1.00 67.74 ? 41  PHE A HD2  1 
ATOM   589   H HE1  . PHE A 1 41  ? -22.893 -9.087  -8.487  1.00 72.44 ? 41  PHE A HE1  1 
ATOM   590   H HE2  . PHE A 1 41  ? -21.469 -5.584  -9.807  1.00 66.29 ? 41  PHE A HE2  1 
ATOM   591   H HZ   . PHE A 1 41  ? -21.882 -7.045  -8.068  1.00 74.32 ? 41  PHE A HZ   1 
ATOM   592   N N    . GLU A 1 42  ? -26.428 -7.202  -12.058 1.00 52.76 ? 42  GLU A N    1 
ATOM   593   C CA   . GLU A 1 42  ? -27.285 -6.028  -11.985 1.00 54.49 ? 42  GLU A CA   1 
ATOM   594   C C    . GLU A 1 42  ? -26.551 -4.872  -11.319 1.00 52.00 ? 42  GLU A C    1 
ATOM   595   O O    . GLU A 1 42  ? -25.679 -5.063  -10.465 1.00 50.52 ? 42  GLU A O    1 
ATOM   596   C CB   . GLU A 1 42  ? -28.590 -6.328  -11.250 1.00 51.66 ? 42  GLU A CB   1 
ATOM   597   C CG   . GLU A 1 42  ? -29.763 -5.481  -11.768 1.00 43.98 ? 42  GLU A CG   1 
ATOM   598   C CD   . GLU A 1 42  ? -31.035 -6.284  -11.864 1.00 41.70 ? 42  GLU A CD   1 
ATOM   599   O OE1  . GLU A 1 42  ? -31.750 -6.218  -12.911 1.00 37.47 ? 42  GLU A OE1  1 
ATOM   600   O OE2  . GLU A 1 42  ? -31.320 -7.002  -10.883 1.00 50.05 ? 42  GLU A OE2  1 
ATOM   601   H H    . GLU A 1 42  ? -26.614 -7.831  -11.502 1.00 63.29 ? 42  GLU A H    1 
ATOM   602   H HA   . GLU A 1 42  ? -27.512 -5.753  -12.887 1.00 65.37 ? 42  GLU A HA   1 
ATOM   603   H HB2  . GLU A 1 42  ? -28.816 -7.263  -11.374 1.00 61.97 ? 42  GLU A HB2  1 
ATOM   604   H HB3  . GLU A 1 42  ? -28.474 -6.136  -10.306 1.00 61.97 ? 42  GLU A HB3  1 
ATOM   605   H HG2  . GLU A 1 42  ? -29.917 -4.742  -11.159 1.00 52.76 ? 42  GLU A HG2  1 
ATOM   606   H HG3  . GLU A 1 42  ? -29.548 -5.146  -12.653 1.00 52.76 ? 42  GLU A HG3  1 
ATOM   607   N N    . GLU A 1 43  ? -26.891 -3.664  -11.761 1.00 55.90 ? 43  GLU A N    1 
ATOM   608   C CA   . GLU A 1 43  ? -26.247 -2.429  -11.334 1.00 60.56 ? 43  GLU A CA   1 
ATOM   609   C C    . GLU A 1 43  ? -27.329 -1.412  -11.018 1.00 57.17 ? 43  GLU A C    1 
ATOM   610   O O    . GLU A 1 43  ? -28.336 -1.336  -11.730 1.00 58.77 ? 43  GLU A O    1 
ATOM   611   C CB   . GLU A 1 43  ? -25.313 -1.853  -12.425 1.00 54.77 ? 43  GLU A CB   1 
ATOM   612   C CG   . GLU A 1 43  ? -24.359 -2.855  -13.018 1.00 55.74 ? 43  GLU A CG   1 
ATOM   613   C CD   . GLU A 1 43  ? -22.976 -2.285  -13.271 1.00 59.73 ? 43  GLU A CD   1 
ATOM   614   O OE1  . GLU A 1 43  ? -22.788 -1.058  -13.147 1.00 59.77 ? 43  GLU A OE1  1 
ATOM   615   O OE2  . GLU A 1 43  ? -22.066 -3.076  -13.594 1.00 54.85 ? 43  GLU A OE2  1 
ATOM   616   H H    . GLU A 1 43  ? -27.519 -3.532  -12.333 1.00 67.06 ? 43  GLU A H    1 
ATOM   617   H HA   . GLU A 1 43  ? -25.727 -2.592  -10.532 1.00 72.65 ? 43  GLU A HA   1 
ATOM   618   H HB2  . GLU A 1 43  ? -25.858 -1.502  -13.146 1.00 65.70 ? 43  GLU A HB2  1 
ATOM   619   H HB3  . GLU A 1 43  ? -24.786 -1.138  -12.036 1.00 65.70 ? 43  GLU A HB3  1 
ATOM   620   H HG2  . GLU A 1 43  ? -24.266 -3.602  -12.406 1.00 66.87 ? 43  GLU A HG2  1 
ATOM   621   H HG3  . GLU A 1 43  ? -24.714 -3.164  -13.866 1.00 66.87 ? 43  GLU A HG3  1 
ATOM   622   N N    . ASP A 1 44  ? -27.119 -0.628  -9.956  1.00 49.11 ? 44  ASP A N    1 
ATOM   623   C CA   . ASP A 1 44  ? -28.062 0.435   -9.626  1.00 62.68 ? 44  ASP A CA   1 
ATOM   624   C C    . ASP A 1 44  ? -28.446 1.212   -10.883 1.00 59.09 ? 44  ASP A C    1 
ATOM   625   O O    . ASP A 1 44  ? -29.550 1.045   -11.430 1.00 48.78 ? 44  ASP A O    1 
ATOM   626   C CB   . ASP A 1 44  ? -27.461 1.378   -8.574  1.00 53.40 ? 44  ASP A CB   1 
ATOM   627   H H    . ASP A 1 44  ? -26.448 -0.692  -9.421  1.00 58.92 ? 44  ASP A H    1 
ATOM   628   H HA   . ASP A 1 44  ? -28.868 0.042   -9.255  1.00 75.19 ? 44  ASP A HA   1 
ATOM   629   N N    . ILE A 1 45  ? -27.511 2.032   -11.352 1.00 54.29 ? 45  ILE A N    1 
ATOM   630   C CA   . ILE A 1 45  ? -27.712 2.935   -12.474 1.00 57.14 ? 45  ILE A CA   1 
ATOM   631   C C    . ILE A 1 45  ? -28.378 2.244   -13.647 1.00 57.85 ? 45  ILE A C    1 
ATOM   632   O O    . ILE A 1 45  ? -28.217 2.675   -14.787 1.00 63.69 ? 45  ILE A O    1 
ATOM   633   C CB   . ILE A 1 45  ? -26.367 3.541   -12.915 1.00 66.25 ? 45  ILE A CB   1 
ATOM   634   H H    . ILE A 1 45  ? -26.720 2.083   -11.019 1.00 65.12 ? 45  ILE A H    1 
ATOM   635   H HA   . ILE A 1 45  ? -28.288 3.662   -12.192 1.00 68.55 ? 45  ILE A HA   1 
ATOM   636   N N    . LEU A 1 50  ? -29.870 -2.031  -13.572 1.00 42.93 ? 50  LEU A N    1 
ATOM   637   C CA   . LEU A 1 50  ? -29.412 -2.179  -14.965 1.00 56.35 ? 50  LEU A CA   1 
ATOM   638   C C    . LEU A 1 50  ? -30.206 -3.185  -15.818 1.00 47.11 ? 50  LEU A C    1 
ATOM   639   O O    . LEU A 1 50  ? -30.513 -2.892  -16.967 1.00 40.64 ? 50  LEU A O    1 
ATOM   640   C CB   . LEU A 1 50  ? -27.935 -2.580  -14.993 1.00 55.29 ? 50  LEU A CB   1 
ATOM   641   C CG   . LEU A 1 50  ? -27.329 -2.777  -16.394 1.00 51.59 ? 50  LEU A CG   1 
ATOM   642   C CD1  . LEU A 1 50  ? -27.330 -1.478  -17.175 1.00 50.46 ? 50  LEU A CD1  1 
ATOM   643   C CD2  . LEU A 1 50  ? -25.927 -3.318  -16.287 1.00 55.26 ? 50  LEU A CD2  1 
ATOM   644   H HA   . LEU A 1 50  ? -29.485 -1.315  -15.400 1.00 67.60 ? 50  LEU A HA   1 
ATOM   645   H HB2  . LEU A 1 50  ? -27.421 -1.889  -14.548 1.00 66.32 ? 50  LEU A HB2  1 
ATOM   646   H HB3  . LEU A 1 50  ? -27.836 -3.417  -14.513 1.00 66.32 ? 50  LEU A HB3  1 
ATOM   647   H HG   . LEU A 1 50  ? -27.864 -3.422  -16.883 1.00 61.88 ? 50  LEU A HG   1 
ATOM   648   H HD11 . LEU A 1 50  ? -26.942 -1.636  -18.050 1.00 60.53 ? 50  LEU A HD11 1 
ATOM   649   H HD12 . LEU A 1 50  ? -28.244 -1.167  -17.269 1.00 60.53 ? 50  LEU A HD12 1 
ATOM   650   H HD13 . LEU A 1 50  ? -26.803 -0.821  -16.694 1.00 60.53 ? 50  LEU A HD13 1 
ATOM   651   H HD21 . LEU A 1 50  ? -25.565 -3.434  -17.179 1.00 66.29 ? 50  LEU A HD21 1 
ATOM   652   H HD22 . LEU A 1 50  ? -25.384 -2.689  -15.787 1.00 66.29 ? 50  LEU A HD22 1 
ATOM   653   H HD23 . LEU A 1 50  ? -25.954 -4.172  -15.826 1.00 66.29 ? 50  LEU A HD23 1 
ATOM   654   N N    . THR A 1 51  ? -30.517 -4.376  -15.286 1.00 48.98 ? 51  THR A N    1 
ATOM   655   C CA   . THR A 1 51  ? -31.211 -5.362  -16.117 1.00 47.36 ? 51  THR A CA   1 
ATOM   656   C C    . THR A 1 51  ? -32.600 -4.879  -16.481 1.00 40.53 ? 51  THR A C    1 
ATOM   657   O O    . THR A 1 51  ? -33.135 -5.254  -17.537 1.00 36.18 ? 51  THR A O    1 
ATOM   658   C CB   . THR A 1 51  ? -31.294 -6.724  -15.419 1.00 44.84 ? 51  THR A CB   1 
ATOM   659   H H    . THR A 1 51  ? -30.346 -4.627  -14.482 1.00 58.75 ? 51  THR A H    1 
ATOM   660   H HA   . THR A 1 51  ? -30.713 -5.481  -16.941 1.00 56.82 ? 51  THR A HA   1 
ATOM   661   N N    . GLU A 1 52  ? -33.190 -4.044  -15.617 1.00 46.45 ? 52  GLU A N    1 
ATOM   662   C CA   . GLU A 1 52  ? -34.472 -3.417  -15.917 1.00 50.36 ? 52  GLU A CA   1 
ATOM   663   C C    . GLU A 1 52  ? -34.319 -2.411  -17.051 1.00 47.47 ? 52  GLU A C    1 
ATOM   664   O O    . GLU A 1 52  ? -35.115 -2.407  -18.004 1.00 37.02 ? 52  GLU A O    1 
ATOM   665   C CB   . GLU A 1 52  ? -35.033 -2.756  -14.651 1.00 39.03 ? 52  GLU A CB   1 
ATOM   666   H H    . GLU A 1 52  ? -32.864 -3.828  -14.851 1.00 55.72 ? 52  GLU A H    1 
ATOM   667   H HA   . GLU A 1 52  ? -35.099 -4.100  -16.203 1.00 60.41 ? 52  GLU A HA   1 
ATOM   668   N N    . ILE A 1 53  ? -33.266 -1.590  -16.999 1.00 45.01 ? 53  ILE A N    1 
ATOM   669   C CA   . ILE A 1 53  ? -33.015 -0.660  -18.101 1.00 48.09 ? 53  ILE A CA   1 
ATOM   670   C C    . ILE A 1 53  ? -32.869 -1.423  -19.418 1.00 41.18 ? 53  ILE A C    1 
ATOM   671   O O    . ILE A 1 53  ? -33.377 -0.982  -20.454 1.00 41.02 ? 53  ILE A O    1 
ATOM   672   C CB   . ILE A 1 53  ? -31.784 0.233   -17.820 1.00 44.08 ? 53  ILE A CB   1 
ATOM   673   C CG1  . ILE A 1 53  ? -31.776 0.754   -16.370 1.00 53.18 ? 53  ILE A CG1  1 
ATOM   674   C CG2  . ILE A 1 53  ? -31.799 1.417   -18.761 1.00 45.61 ? 53  ILE A CG2  1 
ATOM   675   C CD1  . ILE A 1 53  ? -30.545 1.620   -15.986 1.00 51.55 ? 53  ILE A CD1  1 
ATOM   676   H H    . ILE A 1 53  ? -32.697 -1.552  -16.356 1.00 53.99 ? 53  ILE A H    1 
ATOM   677   H HA   . ILE A 1 53  ? -33.784 -0.075  -18.189 1.00 57.69 ? 53  ILE A HA   1 
ATOM   678   H HB   . ILE A 1 53  ? -30.978 -0.283  -17.974 1.00 52.87 ? 53  ILE A HB   1 
ATOM   679   H HG12 . ILE A 1 53  ? -32.568 1.297   -16.233 1.00 63.79 ? 53  ILE A HG12 1 
ATOM   680   H HG13 . ILE A 1 53  ? -31.796 -0.007  -15.769 1.00 63.79 ? 53  ILE A HG13 1 
ATOM   681   H HG21 . ILE A 1 53  ? -31.025 1.973   -18.580 1.00 54.71 ? 53  ILE A HG21 1 
ATOM   682   H HG22 . ILE A 1 53  ? -31.768 1.094   -19.675 1.00 54.71 ? 53  ILE A HG22 1 
ATOM   683   H HG23 . ILE A 1 53  ? -32.613 1.925   -18.616 1.00 54.71 ? 53  ILE A HG23 1 
ATOM   684   H HD11 . ILE A 1 53  ? -30.632 1.898   -15.061 1.00 61.84 ? 53  ILE A HD11 1 
ATOM   685   H HD12 . ILE A 1 53  ? -29.740 1.090   -16.099 1.00 61.84 ? 53  ILE A HD12 1 
ATOM   686   H HD13 . ILE A 1 53  ? -30.514 2.398   -16.564 1.00 61.84 ? 53  ILE A HD13 1 
ATOM   687   N N    . ILE A 1 54  ? -32.200 -2.591  -19.403 1.00 47.33 ? 54  ILE A N    1 
ATOM   688   C CA   . ILE A 1 54  ? -31.995 -3.336  -20.656 1.00 49.29 ? 54  ILE A CA   1 
ATOM   689   C C    . ILE A 1 54  ? -33.318 -3.848  -21.214 1.00 41.40 ? 54  ILE A C    1 
ATOM   690   O O    . ILE A 1 54  ? -33.540 -3.809  -22.426 1.00 47.88 ? 54  ILE A O    1 
ATOM   691   C CB   . ILE A 1 54  ? -31.003 -4.511  -20.487 1.00 50.04 ? 54  ILE A CB   1 
ATOM   692   C CG1  . ILE A 1 54  ? -29.570 -4.029  -20.253 1.00 46.94 ? 54  ILE A CG1  1 
ATOM   693   C CG2  . ILE A 1 54  ? -31.032 -5.397  -21.752 1.00 36.02 ? 54  ILE A CG2  1 
ATOM   694   C CD1  . ILE A 1 54  ? -28.557 -5.160  -20.182 1.00 46.54 ? 54  ILE A CD1  1 
ATOM   695   H H    . ILE A 1 54  ? -31.865 -2.962  -18.703 1.00 56.78 ? 54  ILE A H    1 
ATOM   696   H HA   . ILE A 1 54  ? -31.617 -2.731  -21.313 1.00 59.12 ? 54  ILE A HA   1 
ATOM   697   H HB   . ILE A 1 54  ? -31.281 -5.046  -19.726 1.00 60.03 ? 54  ILE A HB   1 
ATOM   698   H HG12 . ILE A 1 54  ? -29.312 -3.443  -20.982 1.00 56.31 ? 54  ILE A HG12 1 
ATOM   699   H HG13 . ILE A 1 54  ? -29.535 -3.545  -19.413 1.00 56.31 ? 54  ILE A HG13 1 
ATOM   700   H HG21 . ILE A 1 54  ? -30.408 -6.130  -21.637 1.00 43.20 ? 54  ILE A HG21 1 
ATOM   701   H HG22 . ILE A 1 54  ? -31.930 -5.742  -21.875 1.00 43.20 ? 54  ILE A HG22 1 
ATOM   702   H HG23 . ILE A 1 54  ? -30.776 -4.860  -22.518 1.00 43.20 ? 54  ILE A HG23 1 
ATOM   703   H HD11 . ILE A 1 54  ? -27.675 -4.785  -20.032 1.00 55.83 ? 54  ILE A HD11 1 
ATOM   704   H HD12 . ILE A 1 54  ? -28.795 -5.750  -19.450 1.00 55.83 ? 54  ILE A HD12 1 
ATOM   705   H HD13 . ILE A 1 54  ? -28.572 -5.649  -21.019 1.00 55.83 ? 54  ILE A HD13 1 
ATOM   706   N N    . ASN A 1 55  ? -34.173 -4.438  -20.370 1.00 46.03 ? 55  ASN A N    1 
ATOM   707   C CA   . ASN A 1 55  ? -35.397 -5.034  -20.916 1.00 40.69 ? 55  ASN A CA   1 
ATOM   708   C C    . ASN A 1 55  ? -36.420 -3.971  -21.307 1.00 48.50 ? 55  ASN A C    1 
ATOM   709   O O    . ASN A 1 55  ? -37.229 -4.202  -22.213 1.00 41.60 ? 55  ASN A O    1 
ATOM   710   C CB   . ASN A 1 55  ? -36.011 -6.021  -19.928 1.00 48.03 ? 55  ASN A CB   1 
ATOM   711   C CG   . ASN A 1 55  ? -35.435 -7.424  -20.073 1.00 51.55 ? 55  ASN A CG   1 
ATOM   712   O OD1  . ASN A 1 55  ? -35.938 -8.261  -20.827 1.00 53.64 ? 55  ASN A OD1  1 
ATOM   713   N ND2  . ASN A 1 55  ? -34.365 -7.675  -19.358 1.00 46.28 ? 55  ASN A ND2  1 
ATOM   714   H H    . ASN A 1 55  ? -34.076 -4.506  -19.518 1.00 55.21 ? 55  ASN A H    1 
ATOM   715   H HA   . ASN A 1 55  ? -35.168 -5.528  -21.719 1.00 48.81 ? 55  ASN A HA   1 
ATOM   716   H HB2  . ASN A 1 55  ? -35.836 -5.716  -19.024 1.00 57.62 ? 55  ASN A HB2  1 
ATOM   717   H HB3  . ASN A 1 55  ? -36.968 -6.071  -20.083 1.00 57.62 ? 55  ASN A HB3  1 
ATOM   718   H HD21 . ASN A 1 55  ? -33.993 -8.449  -19.399 1.00 55.52 ? 55  ASN A HD21 1 
ATOM   719   H HD22 . ASN A 1 55  ? -34.038 -7.067  -18.845 1.00 55.52 ? 55  ASN A HD22 1 
ATOM   720   N N    . THR A 1 56  ? -36.400 -2.806  -20.649 1.00 50.13 ? 56  THR A N    1 
ATOM   721   C CA   . THR A 1 56  ? -37.227 -1.687  -21.097 1.00 53.88 ? 56  THR A CA   1 
ATOM   722   C C    . THR A 1 56  ? -36.623 -1.054  -22.348 1.00 52.68 ? 56  THR A C    1 
ATOM   723   O O    . THR A 1 56  ? -37.139 -1.216  -23.463 1.00 49.32 ? 56  THR A O    1 
ATOM   724   C CB   . THR A 1 56  ? -37.365 -0.639  -19.982 1.00 47.13 ? 56  THR A CB   1 
ATOM   725   H H    . THR A 1 56  ? -35.924 -2.642  -19.953 1.00 60.13 ? 56  THR A H    1 
ATOM   726   H HA   . THR A 1 56  ? -38.113 -2.013  -21.318 1.00 64.64 ? 56  THR A HA   1 
ATOM   727   N N    . GLN A 1 57  ? -35.500 -0.361  -22.172 1.00 47.54 ? 57  GLN A N    1 
ATOM   728   C CA   . GLN A 1 57  ? -34.926 0.457   -23.235 1.00 53.84 ? 57  GLN A CA   1 
ATOM   729   C C    . GLN A 1 57  ? -34.153 -0.356  -24.270 1.00 50.54 ? 57  GLN A C    1 
ATOM   730   O O    . GLN A 1 57  ? -33.878 0.176   -25.346 1.00 44.34 ? 57  GLN A O    1 
ATOM   731   C CB   . GLN A 1 57  ? -34.018 1.535   -22.621 1.00 54.89 ? 57  GLN A CB   1 
ATOM   732   C CG   . GLN A 1 57  ? -34.780 2.596   -21.804 1.00 52.53 ? 57  GLN A CG   1 
ATOM   733   C CD   . GLN A 1 57  ? -33.882 3.407   -20.871 1.00 62.96 ? 57  GLN A CD   1 
ATOM   734   O OE1  . GLN A 1 57  ? -34.202 3.600   -19.697 1.00 60.17 ? 57  GLN A OE1  1 
ATOM   735   N NE2  . GLN A 1 57  ? -32.756 3.892   -21.392 1.00 63.16 ? 57  GLN A NE2  1 
ATOM   736   H H    . GLN A 1 57  ? -35.050 -0.348  -21.439 1.00 57.02 ? 57  GLN A H    1 
ATOM   737   H HA   . GLN A 1 57  ? -35.647 0.910   -23.699 1.00 64.58 ? 57  GLN A HA   1 
ATOM   738   H HB2  . GLN A 1 57  ? -33.379 1.107   -22.029 1.00 65.84 ? 57  GLN A HB2  1 
ATOM   739   H HB3  . GLN A 1 57  ? -33.548 1.993   -23.336 1.00 65.84 ? 57  GLN A HB3  1 
ATOM   740   H HG2  . GLN A 1 57  ? -35.209 3.214   -22.416 1.00 63.02 ? 57  GLN A HG2  1 
ATOM   741   H HG3  . GLN A 1 57  ? -35.449 2.151   -21.260 1.00 63.02 ? 57  GLN A HG3  1 
ATOM   742   H HE21 . GLN A 1 57  ? -32.563 3.739   -22.216 1.00 75.77 ? 57  GLN A HE21 1 
ATOM   743   H HE22 . GLN A 1 57  ? -32.221 4.355   -20.904 1.00 75.77 ? 57  GLN A HE22 1 
ATOM   744   N N    . HIS A 1 58  ? -33.820 -1.629  -23.988 1.00 52.54 ? 58  HIS A N    1 
ATOM   745   C CA   . HIS A 1 58  ? -33.082 -2.498  -24.925 1.00 44.73 ? 58  HIS A CA   1 
ATOM   746   C C    . HIS A 1 58  ? -31.726 -1.889  -25.294 1.00 40.14 ? 58  HIS A C    1 
ATOM   747   O O    . HIS A 1 58  ? -31.376 -1.760  -26.462 1.00 38.39 ? 58  HIS A O    1 
ATOM   748   C CB   . HIS A 1 58  ? -33.902 -2.797  -26.187 1.00 38.24 ? 58  HIS A CB   1 
ATOM   749   C CG   . HIS A 1 58  ? -34.936 -3.866  -26.021 1.00 53.18 ? 58  HIS A CG   1 
ATOM   750   N ND1  . HIS A 1 58  ? -35.104 -4.580  -24.851 1.00 54.34 ? 58  HIS A ND1  1 
ATOM   751   C CD2  . HIS A 1 58  ? -35.850 -4.354  -26.896 1.00 50.84 ? 58  HIS A CD2  1 
ATOM   752   C CE1  . HIS A 1 58  ? -36.085 -5.453  -25.013 1.00 54.13 ? 58  HIS A CE1  1 
ATOM   753   N NE2  . HIS A 1 58  ? -36.553 -5.334  -26.244 1.00 52.71 ? 58  HIS A NE2  1 
ATOM   754   H H    . HIS A 1 58  ? -34.016 -2.018  -23.246 1.00 63.03 ? 58  HIS A H    1 
ATOM   755   H HA   . HIS A 1 58  ? -32.909 -3.344  -24.485 1.00 53.65 ? 58  HIS A HA   1 
ATOM   756   H HB2  . HIS A 1 58  ? -34.360 -1.986  -26.459 1.00 45.86 ? 58  HIS A HB2  1 
ATOM   757   H HB3  . HIS A 1 58  ? -33.297 -3.081  -26.890 1.00 45.86 ? 58  HIS A HB3  1 
ATOM   758   H HD1  . HIS A 1 58  ? -34.648 -4.470  -24.131 1.00 65.18 ? 58  HIS A HD1  1 
ATOM   759   H HD2  . HIS A 1 58  ? -35.981 -4.071  -27.772 1.00 60.99 ? 58  HIS A HD2  1 
ATOM   760   H HE1  . HIS A 1 58  ? -36.393 -6.049  -24.370 1.00 64.94 ? 58  HIS A HE1  1 
ATOM   761   N N    . GLU A 1 59  ? -30.939 -1.540  -24.277 1.00 42.08 ? 59  GLU A N    1 
ATOM   762   C CA   . GLU A 1 59  ? -29.621 -0.982  -24.524 1.00 41.81 ? 59  GLU A CA   1 
ATOM   763   C C    . GLU A 1 59  ? -28.820 -1.051  -23.237 1.00 48.37 ? 59  GLU A C    1 
ATOM   764   O O    . GLU A 1 59  ? -29.300 -0.638  -22.175 1.00 42.31 ? 59  GLU A O    1 
ATOM   765   C CB   . GLU A 1 59  ? -29.718 0.467   -25.020 1.00 46.63 ? 59  GLU A CB   1 
ATOM   766   H H    . GLU A 1 59  ? -31.146 -1.616  -23.445 1.00 50.48 ? 59  GLU A H    1 
ATOM   767   H HA   . GLU A 1 59  ? -29.166 -1.510  -25.199 1.00 50.15 ? 59  GLU A HA   1 
ATOM   768   N N    . ASN A 1 60  ? -27.610 -1.590  -23.330 1.00 38.40 ? 60  ASN A N    1 
ATOM   769   C CA   . ASN A 1 60  ? -26.737 -1.661  -22.170 1.00 46.23 ? 60  ASN A CA   1 
ATOM   770   C C    . ASN A 1 60  ? -26.052 -0.303  -22.016 1.00 49.77 ? 60  ASN A C    1 
ATOM   771   O O    . ASN A 1 60  ? -24.882 -0.099  -22.354 1.00 43.57 ? 60  ASN A O    1 
ATOM   772   C CB   . ASN A 1 60  ? -25.751 -2.804  -22.316 1.00 36.03 ? 60  ASN A CB   1 
ATOM   773   C CG   . ASN A 1 60  ? -25.170 -3.198  -21.023 1.00 44.39 ? 60  ASN A CG   1 
ATOM   774   O OD1  . ASN A 1 60  ? -24.841 -2.339  -20.199 1.00 49.19 ? 60  ASN A OD1  1 
ATOM   775   N ND2  . ASN A 1 60  ? -25.061 -4.501  -20.794 1.00 42.10 ? 60  ASN A ND2  1 
ATOM   776   H H    . ASN A 1 60  ? -27.273 -1.919  -24.049 1.00 46.06 ? 60  ASN A H    1 
ATOM   777   H HA   . ASN A 1 60  ? -27.272 -1.822  -21.377 1.00 55.45 ? 60  ASN A HA   1 
ATOM   778   H HB2  . ASN A 1 60  ? -26.209 -3.574  -22.689 1.00 43.21 ? 60  ASN A HB2  1 
ATOM   779   H HB3  . ASN A 1 60  ? -25.029 -2.529  -22.902 1.00 43.21 ? 60  ASN A HB3  1 
ATOM   780   H HD21 . ASN A 1 60  ? -24.731 -4.781  -20.051 1.00 50.49 ? 60  ASN A HD21 1 
ATOM   781   H HD22 . ASN A 1 60  ? -25.309 -5.065  -21.394 1.00 50.49 ? 60  ASN A HD22 1 
ATOM   782   N N    . VAL A 1 61  ? -26.813 0.636   -21.461 1.00 47.01 ? 61  VAL A N    1 
ATOM   783   C CA   . VAL A 1 61  ? -26.447 2.044   -21.401 1.00 48.05 ? 61  VAL A CA   1 
ATOM   784   C C    . VAL A 1 61  ? -25.094 2.242   -20.725 1.00 46.48 ? 61  VAL A C    1 
ATOM   785   O O    . VAL A 1 61  ? -24.460 3.286   -20.905 1.00 48.10 ? 61  VAL A O    1 
ATOM   786   C CB   . VAL A 1 61  ? -27.550 2.848   -20.676 1.00 47.11 ? 61  VAL A CB   1 
ATOM   787   H H    . VAL A 1 61  ? -27.576 0.472   -21.099 1.00 56.38 ? 61  VAL A H    1 
ATOM   788   H HA   . VAL A 1 61  ? -26.378 2.387   -22.306 1.00 57.63 ? 61  VAL A HA   1 
ATOM   789   N N    . LYS A 1 62  ? -24.642 1.268   -19.928 1.00 35.36 ? 62  LYS A N    1 
ATOM   790   C CA   . LYS A 1 62  ? -23.343 1.414   -19.288 1.00 46.47 ? 62  LYS A CA   1 
ATOM   791   C C    . LYS A 1 62  ? -22.206 0.831   -20.130 1.00 48.48 ? 62  LYS A C    1 
ATOM   792   O O    . LYS A 1 62  ? -21.102 1.393   -20.148 1.00 52.16 ? 62  LYS A O    1 
ATOM   793   C CB   . LYS A 1 62  ? -23.339 0.766   -17.897 1.00 37.54 ? 62  LYS A CB   1 
ATOM   794   C CG   . LYS A 1 62  ? -21.976 0.872   -17.219 1.00 44.41 ? 62  LYS A CG   1 
ATOM   795   C CD   . LYS A 1 62  ? -22.036 0.934   -15.700 1.00 42.53 ? 62  LYS A CD   1 
ATOM   796   C CE   . LYS A 1 62  ? -20.654 0.684   -15.125 1.00 50.23 ? 62  LYS A CE   1 
ATOM   797   N NZ   . LYS A 1 62  ? -20.477 1.080   -13.703 1.00 49.12 ? 62  LYS A NZ   1 
ATOM   798   H H    . LYS A 1 62  ? -25.057 0.537   -19.749 1.00 42.42 ? 62  LYS A H    1 
ATOM   799   H HA   . LYS A 1 62  ? -23.163 2.360   -19.170 1.00 55.74 ? 62  LYS A HA   1 
ATOM   800   H HB2  . LYS A 1 62  ? -23.992 1.213   -17.335 1.00 45.02 ? 62  LYS A HB2  1 
ATOM   801   H HB3  . LYS A 1 62  ? -23.562 -0.174  -17.983 1.00 45.02 ? 62  LYS A HB3  1 
ATOM   802   H HG2  . LYS A 1 62  ? -21.447 0.096   -17.462 1.00 53.27 ? 62  LYS A HG2  1 
ATOM   803   H HG3  . LYS A 1 62  ? -21.536 1.678   -17.530 1.00 53.27 ? 62  LYS A HG3  1 
ATOM   804   H HD2  . LYS A 1 62  ? -22.333 1.814   -15.421 1.00 51.02 ? 62  LYS A HD2  1 
ATOM   805   H HD3  . LYS A 1 62  ? -22.637 0.248   -15.369 1.00 51.02 ? 62  LYS A HD3  1 
ATOM   806   H HE2  . LYS A 1 62  ? -20.460 -0.264  -15.190 1.00 60.25 ? 62  LYS A HE2  1 
ATOM   807   H HE3  . LYS A 1 62  ? -20.008 1.184   -15.649 1.00 60.25 ? 62  LYS A HE3  1 
ATOM   808   H HZ1  . LYS A 1 62  ? -19.645 0.903   -13.439 1.00 58.92 ? 62  LYS A HZ1  1 
ATOM   809   H HZ2  . LYS A 1 62  ? -20.632 1.951   -13.608 1.00 58.92 ? 62  LYS A HZ2  1 
ATOM   810   H HZ3  . LYS A 1 62  ? -21.046 0.627   -13.189 1.00 58.92 ? 62  LYS A HZ3  1 
ATOM   811   N N    . TYR A 1 63  ? -22.453 -0.274  -20.836 1.00 42.23 ? 63  TYR A N    1 
ATOM   812   C CA   . TYR A 1 63  ? -21.390 -1.041  -21.470 1.00 40.13 ? 63  TYR A CA   1 
ATOM   813   C C    . TYR A 1 63  ? -21.434 -1.053  -22.992 1.00 42.06 ? 63  TYR A C    1 
ATOM   814   O O    . TYR A 1 63  ? -20.388 -1.275  -23.614 1.00 44.13 ? 63  TYR A O    1 
ATOM   815   C CB   . TYR A 1 63  ? -21.419 -2.485  -20.942 1.00 36.55 ? 63  TYR A CB   1 
ATOM   816   C CG   . TYR A 1 63  ? -21.190 -2.511  -19.462 1.00 40.64 ? 63  TYR A CG   1 
ATOM   817   C CD1  . TYR A 1 63  ? -19.907 -2.416  -18.941 1.00 37.59 ? 63  TYR A CD1  1 
ATOM   818   C CD2  . TYR A 1 63  ? -22.259 -2.583  -18.578 1.00 40.53 ? 63  TYR A CD2  1 
ATOM   819   C CE1  . TYR A 1 63  ? -19.687 -2.431  -17.587 1.00 43.49 ? 63  TYR A CE1  1 
ATOM   820   C CE2  . TYR A 1 63  ? -22.055 -2.588  -17.218 1.00 42.86 ? 63  TYR A CE2  1 
ATOM   821   C CZ   . TYR A 1 63  ? -20.772 -2.511  -16.725 1.00 46.27 ? 63  TYR A CZ   1 
ATOM   822   O OH   . TYR A 1 63  ? -20.574 -2.520  -15.365 1.00 50.44 ? 63  TYR A OH   1 
ATOM   823   H H    . TYR A 1 63  ? -23.238 -0.600  -20.963 1.00 50.66 ? 63  TYR A H    1 
ATOM   824   H HA   . TYR A 1 63  ? -20.539 -0.655  -21.209 1.00 48.14 ? 63  TYR A HA   1 
ATOM   825   H HB2  . TYR A 1 63  ? -22.287 -2.878  -21.125 1.00 43.84 ? 63  TYR A HB2  1 
ATOM   826   H HB3  . TYR A 1 63  ? -20.717 -3.000  -21.371 1.00 43.84 ? 63  TYR A HB3  1 
ATOM   827   H HD1  . TYR A 1 63  ? -19.182 -2.365  -19.521 1.00 45.09 ? 63  TYR A HD1  1 
ATOM   828   H HD2  . TYR A 1 63  ? -23.126 -2.637  -18.911 1.00 48.62 ? 63  TYR A HD2  1 
ATOM   829   H HE1  . TYR A 1 63  ? -18.822 -2.375  -17.250 1.00 52.17 ? 63  TYR A HE1  1 
ATOM   830   H HE2  . TYR A 1 63  ? -22.778 -2.646  -16.636 1.00 51.42 ? 63  TYR A HE2  1 
ATOM   831   H HH   . TYR A 1 63  ? -21.312 -2.572  -14.968 1.00 60.51 ? 63  TYR A HH   1 
ATOM   832   N N    . LEU A 1 64  ? -22.594 -0.818  -23.607 1.00 38.03 ? 64  LEU A N    1 
ATOM   833   C CA   . LEU A 1 64  ? -22.696 -0.648  -25.060 1.00 42.24 ? 64  LEU A CA   1 
ATOM   834   C C    . LEU A 1 64  ? -23.626 0.523   -25.378 1.00 41.32 ? 64  LEU A C    1 
ATOM   835   O O    . LEU A 1 64  ? -24.612 0.376   -26.113 1.00 35.09 ? 64  LEU A O    1 
ATOM   836   C CB   . LEU A 1 64  ? -23.178 -1.933  -25.735 1.00 40.91 ? 64  LEU A CB   1 
ATOM   837   C CG   . LEU A 1 64  ? -23.001 -2.012  -27.263 1.00 39.05 ? 64  LEU A CG   1 
ATOM   838   C CD1  . LEU A 1 64  ? -21.519 -1.957  -27.650 1.00 40.65 ? 64  LEU A CD1  1 
ATOM   839   C CD2  . LEU A 1 64  ? -23.635 -3.257  -27.900 1.00 35.48 ? 64  LEU A CD2  1 
ATOM   840   H H    . LEU A 1 64  ? -23.349 -0.752  -23.199 1.00 45.61 ? 64  LEU A H    1 
ATOM   841   H HA   . LEU A 1 64  ? -21.817 -0.436  -25.413 1.00 50.67 ? 64  LEU A HA   1 
ATOM   842   H HB2  . LEU A 1 64  ? -22.692 -2.679  -25.351 1.00 49.07 ? 64  LEU A HB2  1 
ATOM   843   H HB3  . LEU A 1 64  ? -24.125 -2.036  -25.550 1.00 49.07 ? 64  LEU A HB3  1 
ATOM   844   H HG   . LEU A 1 64  ? -23.430 -1.237  -27.659 1.00 46.84 ? 64  LEU A HG   1 
ATOM   845   H HD11 . LEU A 1 64  ? -21.443 -2.008  -28.615 1.00 48.75 ? 64  LEU A HD11 1 
ATOM   846   H HD12 . LEU A 1 64  ? -21.141 -1.122  -27.332 1.00 48.75 ? 64  LEU A HD12 1 
ATOM   847   H HD13 . LEU A 1 64  ? -21.058 -2.706  -27.240 1.00 48.75 ? 64  LEU A HD13 1 
ATOM   848   H HD21 . LEU A 1 64  ? -23.482 -3.235  -28.857 1.00 42.55 ? 64  LEU A HD21 1 
ATOM   849   H HD22 . LEU A 1 64  ? -23.226 -4.049  -27.517 1.00 42.55 ? 64  LEU A HD22 1 
ATOM   850   H HD23 . LEU A 1 64  ? -24.588 -3.255  -27.716 1.00 42.55 ? 64  LEU A HD23 1 
ATOM   851   N N    . PRO A 1 65  ? -23.316 1.719   -24.859 1.00 43.43 ? 65  PRO A N    1 
ATOM   852   C CA   . PRO A 1 65  ? -24.172 2.882   -25.125 1.00 41.97 ? 65  PRO A CA   1 
ATOM   853   C C    . PRO A 1 65  ? -24.260 3.164   -26.606 1.00 43.32 ? 65  PRO A C    1 
ATOM   854   O O    . PRO A 1 65  ? -23.292 3.000   -27.347 1.00 43.75 ? 65  PRO A O    1 
ATOM   855   C CB   . PRO A 1 65  ? -23.469 4.030   -24.391 1.00 44.89 ? 65  PRO A CB   1 
ATOM   856   C CG   . PRO A 1 65  ? -22.050 3.600   -24.273 1.00 46.08 ? 65  PRO A CG   1 
ATOM   857   C CD   . PRO A 1 65  ? -22.105 2.101   -24.110 1.00 47.03 ? 65  PRO A CD   1 
ATOM   858   H HA   . PRO A 1 65  ? -25.060 2.749   -24.759 1.00 50.34 ? 65  PRO A HA   1 
ATOM   859   H HB2  . PRO A 1 65  ? -23.538 4.844   -24.913 1.00 53.85 ? 65  PRO A HB2  1 
ATOM   860   H HB3  . PRO A 1 65  ? -23.865 4.149   -23.514 1.00 53.85 ? 65  PRO A HB3  1 
ATOM   861   H HG2  . PRO A 1 65  ? -21.568 3.839   -25.080 1.00 55.28 ? 65  PRO A HG2  1 
ATOM   862   H HG3  . PRO A 1 65  ? -21.646 4.015   -23.496 1.00 55.28 ? 65  PRO A HG3  1 
ATOM   863   H HD2  . PRO A 1 65  ? -21.319 1.689   -24.504 1.00 56.41 ? 65  PRO A HD2  1 
ATOM   864   H HD3  . PRO A 1 65  ? -22.198 1.866   -23.173 1.00 56.41 ? 65  PRO A HD3  1 
ATOM   865   N N    . GLY A 1 66  ? -25.442 3.608   -27.026 1.00 41.54 ? 66  GLY A N    1 
ATOM   866   C CA   . GLY A 1 66  ? -25.729 3.899   -28.410 1.00 42.12 ? 66  GLY A CA   1 
ATOM   867   C C    . GLY A 1 66  ? -26.385 2.774   -29.192 1.00 43.76 ? 66  GLY A C    1 
ATOM   868   O O    . GLY A 1 66  ? -27.117 3.048   -30.146 1.00 44.12 ? 66  GLY A O    1 
ATOM   869   H H    . GLY A 1 66  ? -26.109 3.751   -26.502 1.00 49.83 ? 66  GLY A H    1 
ATOM   870   H HA2  . GLY A 1 66  ? -26.316 4.670   -28.452 1.00 50.52 ? 66  GLY A HA2  1 
ATOM   871   H HA3  . GLY A 1 66  ? -24.901 4.129   -28.860 1.00 50.52 ? 66  GLY A HA3  1 
ATOM   872   N N    . HIS A 1 67  ? -26.140 1.516   -28.827 1.00 50.31 ? 67  HIS A N    1 
ATOM   873   C CA   . HIS A 1 67  ? -26.516 0.383   -29.669 1.00 43.67 ? 67  HIS A CA   1 
ATOM   874   C C    . HIS A 1 67  ? -27.796 -0.274  -29.185 1.00 41.33 ? 67  HIS A C    1 
ATOM   875   O O    . HIS A 1 67  ? -28.097 -0.287  -27.988 1.00 40.72 ? 67  HIS A O    1 
ATOM   876   C CB   . HIS A 1 67  ? -25.413 -0.685  -29.701 1.00 43.97 ? 67  HIS A CB   1 
ATOM   877   C CG   . HIS A 1 67  ? -24.307 -0.396  -30.670 1.00 39.66 ? 67  HIS A CG   1 
ATOM   878   N ND1  . HIS A 1 67  ? -24.406 -0.682  -32.013 1.00 39.24 ? 67  HIS A ND1  1 
ATOM   879   C CD2  . HIS A 1 67  ? -23.073 0.131   -30.488 1.00 41.15 ? 67  HIS A CD2  1 
ATOM   880   C CE1  . HIS A 1 67  ? -23.290 -0.320  -32.620 1.00 36.73 ? 67  HIS A CE1  1 
ATOM   881   N NE2  . HIS A 1 67  ? -22.462 0.164   -31.715 1.00 37.79 ? 67  HIS A NE2  1 
ATOM   882   H H    . HIS A 1 67  ? -25.754 1.292   -28.092 1.00 60.35 ? 67  HIS A H    1 
ATOM   883   H HA   . HIS A 1 67  ? -26.661 0.695   -30.576 1.00 52.38 ? 67  HIS A HA   1 
ATOM   884   H HB2  . HIS A 1 67  ? -25.021 -0.753  -28.816 1.00 52.74 ? 67  HIS A HB2  1 
ATOM   885   H HB3  . HIS A 1 67  ? -25.809 -1.534  -29.949 1.00 52.74 ? 67  HIS A HB3  1 
ATOM   886   H HD2  . HIS A 1 67  ? -22.709 0.420   -29.682 1.00 49.36 ? 67  HIS A HD2  1 
ATOM   887   H HE1  . HIS A 1 67  ? -23.111 -0.411  -33.528 1.00 44.06 ? 67  HIS A HE1  1 
ATOM   888   H HE2  . HIS A 1 67  ? -21.670 0.462   -31.871 1.00 45.32 ? 67  HIS A HE2  1 
ATOM   889   N N    . LYS A 1 68  ? -28.505 -0.886  -30.125 1.00 40.57 ? 68  LYS A N    1 
ATOM   890   C CA   . LYS A 1 68  ? -29.759 -1.564  -29.844 1.00 46.50 ? 68  LYS A CA   1 
ATOM   891   C C    . LYS A 1 68  ? -29.522 -3.064  -29.811 1.00 47.73 ? 68  LYS A C    1 
ATOM   892   O O    . LYS A 1 68  ? -29.315 -3.690  -30.856 1.00 50.03 ? 68  LYS A O    1 
ATOM   893   C CB   . LYS A 1 68  ? -30.817 -1.218  -30.887 1.00 50.41 ? 68  LYS A CB   1 
ATOM   894   H H    . LYS A 1 68  ? -28.273 -0.922  -30.952 1.00 48.66 ? 68  LYS A H    1 
ATOM   895   H HA   . LYS A 1 68  ? -30.087 -1.287  -28.974 1.00 55.77 ? 68  LYS A HA   1 
ATOM   896   N N    . LEU A 1 69  ? -29.574 -3.638  -28.614 1.00 46.01 ? 69  LEU A N    1 
ATOM   897   C CA   . LEU A 1 69  ? -29.650 -5.086  -28.511 1.00 47.09 ? 69  LEU A CA   1 
ATOM   898   C C    . LEU A 1 69  ? -31.034 -5.517  -28.988 1.00 39.35 ? 69  LEU A C    1 
ATOM   899   O O    . LEU A 1 69  ? -32.015 -4.825  -28.706 1.00 51.17 ? 69  LEU A O    1 
ATOM   900   C CB   . LEU A 1 69  ? -29.425 -5.537  -27.076 1.00 40.70 ? 69  LEU A CB   1 
ATOM   901   C CG   . LEU A 1 69  ? -28.427 -4.686  -26.300 1.00 47.91 ? 69  LEU A CG   1 
ATOM   902   C CD1  . LEU A 1 69  ? -28.250 -5.207  -24.891 1.00 46.09 ? 69  LEU A CD1  1 
ATOM   903   C CD2  . LEU A 1 69  ? -27.094 -4.630  -27.072 1.00 49.25 ? 69  LEU A CD2  1 
ATOM   904   H H    . LEU A 1 69  ? -29.566 -3.221  -27.863 1.00 55.19 ? 69  LEU A H    1 
ATOM   905   H HA   . LEU A 1 69  ? -28.979 -5.494  -29.080 1.00 56.48 ? 69  LEU A HA   1 
ATOM   906   H HB2  . LEU A 1 69  ? -30.271 -5.505  -26.603 1.00 48.81 ? 69  LEU A HB2  1 
ATOM   907   H HB3  . LEU A 1 69  ? -29.090 -6.448  -27.086 1.00 48.81 ? 69  LEU A HB3  1 
ATOM   908   H HG   . LEU A 1 69  ? -28.771 -3.781  -26.239 1.00 57.46 ? 69  LEU A HG   1 
ATOM   909   H HD11 . LEU A 1 69  ? -27.611 -4.646  -24.425 1.00 55.29 ? 69  LEU A HD11 1 
ATOM   910   H HD12 . LEU A 1 69  ? -29.106 -5.184  -24.436 1.00 55.29 ? 69  LEU A HD12 1 
ATOM   911   H HD13 . LEU A 1 69  ? -27.921 -6.119  -24.932 1.00 55.29 ? 69  LEU A HD13 1 
ATOM   912   H HD21 . LEU A 1 69  ? -26.464 -4.087  -26.573 1.00 59.07 ? 69  LEU A HD21 1 
ATOM   913   H HD22 . LEU A 1 69  ? -26.749 -5.532  -27.171 1.00 59.07 ? 69  LEU A HD22 1 
ATOM   914   H HD23 . LEU A 1 69  ? -27.251 -4.238  -27.945 1.00 59.07 ? 69  LEU A HD23 1 
ATOM   915   N N    . PRO A 1 70  ? -31.158 -6.625  -29.712 1.00 35.18 ? 70  PRO A N    1 
ATOM   916   C CA   . PRO A 1 70  ? -32.480 -7.005  -30.221 1.00 34.76 ? 70  PRO A CA   1 
ATOM   917   C C    . PRO A 1 70  ? -33.421 -7.356  -29.080 1.00 42.23 ? 70  PRO A C    1 
ATOM   918   O O    . PRO A 1 70  ? -32.983 -7.636  -27.950 1.00 38.73 ? 70  PRO A O    1 
ATOM   919   C CB   . PRO A 1 70  ? -32.204 -8.227  -31.122 1.00 35.45 ? 70  PRO A CB   1 
ATOM   920   C CG   . PRO A 1 70  ? -30.719 -8.278  -31.303 1.00 33.85 ? 70  PRO A CG   1 
ATOM   921   C CD   . PRO A 1 70  ? -30.123 -7.600  -30.098 1.00 40.21 ? 70  PRO A CD   1 
ATOM   922   H HA   . PRO A 1 70  ? -32.862 -6.288  -30.751 1.00 41.69 ? 70  PRO A HA   1 
ATOM   923   H HB2  . PRO A 1 70  ? -32.521 -9.032  -30.684 1.00 42.52 ? 70  PRO A HB2  1 
ATOM   924   H HB3  . PRO A 1 70  ? -32.647 -8.106  -31.976 1.00 42.52 ? 70  PRO A HB3  1 
ATOM   925   H HG2  . PRO A 1 70  ? -30.431 -9.203  -31.350 1.00 40.60 ? 70  PRO A HG2  1 
ATOM   926   H HG3  . PRO A 1 70  ? -30.475 -7.805  -32.114 1.00 40.60 ? 70  PRO A HG3  1 
ATOM   927   H HD2  . PRO A 1 70  ? -29.980 -8.241  -29.384 1.00 48.23 ? 70  PRO A HD2  1 
ATOM   928   H HD3  . PRO A 1 70  ? -29.301 -7.144  -30.337 1.00 48.23 ? 70  PRO A HD3  1 
ATOM   929   N N    . PRO A 1 71  ? -34.732 -7.350  -29.335 1.00 43.61 ? 71  PRO A N    1 
ATOM   930   C CA   . PRO A 1 71  ? -35.698 -7.434  -28.231 1.00 48.29 ? 71  PRO A CA   1 
ATOM   931   C C    . PRO A 1 71  ? -35.896 -8.830  -27.658 1.00 45.51 ? 71  PRO A C    1 
ATOM   932   O O    . PRO A 1 71  ? -36.259 -8.973  -26.482 1.00 48.17 ? 71  PRO A O    1 
ATOM   933   C CB   . PRO A 1 71  ? -36.993 -6.916  -28.874 1.00 47.62 ? 71  PRO A CB   1 
ATOM   934   C CG   . PRO A 1 71  ? -36.864 -7.307  -30.312 1.00 49.29 ? 71  PRO A CG   1 
ATOM   935   C CD   . PRO A 1 71  ? -35.395 -7.131  -30.633 1.00 44.33 ? 71  PRO A CD   1 
ATOM   936   H HA   . PRO A 1 71  ? -35.438 -6.833  -27.516 1.00 57.93 ? 71  PRO A HA   1 
ATOM   937   H HB2  . PRO A 1 71  ? -37.760 -7.347  -28.465 1.00 57.12 ? 71  PRO A HB2  1 
ATOM   938   H HB3  . PRO A 1 71  ? -37.046 -5.952  -28.781 1.00 57.12 ? 71  PRO A HB3  1 
ATOM   939   H HG2  . PRO A 1 71  ? -37.132 -8.232  -30.424 1.00 59.12 ? 71  PRO A HG2  1 
ATOM   940   H HG3  . PRO A 1 71  ? -37.408 -6.721  -30.861 1.00 59.12 ? 71  PRO A HG3  1 
ATOM   941   H HD2  . PRO A 1 71  ? -35.107 -7.798  -31.275 1.00 53.18 ? 71  PRO A HD2  1 
ATOM   942   H HD3  . PRO A 1 71  ? -35.224 -6.232  -30.952 1.00 53.18 ? 71  PRO A HD3  1 
ATOM   943   N N    . ASN A 1 72  ? -35.706 -9.857  -28.485 1.00 40.10 ? 72  ASN A N    1 
ATOM   944   C CA   . ASN A 1 72  ? -35.776 -11.238 -28.021 1.00 36.25 ? 72  ASN A CA   1 
ATOM   945   C C    . ASN A 1 72  ? -34.620 -11.606 -27.083 1.00 36.94 ? 72  ASN A C    1 
ATOM   946   O O    . ASN A 1 72  ? -34.510 -12.775 -26.706 1.00 36.09 ? 72  ASN A O    1 
ATOM   947   C CB   . ASN A 1 72  ? -35.797 -12.172 -29.215 1.00 30.12 ? 72  ASN A CB   1 
ATOM   948   C CG   . ASN A 1 72  ? -34.610 -11.944 -30.167 1.00 41.74 ? 72  ASN A CG   1 
ATOM   949   O OD1  . ASN A 1 72  ? -34.480 -10.869 -30.734 1.00 43.01 ? 72  ASN A OD1  1 
ATOM   950   N ND2  . ASN A 1 72  ? -33.754 -12.964 -30.346 1.00 34.30 ? 72  ASN A ND2  1 
ATOM   951   H H    . ASN A 1 72  ? -35.533 -9.778  -29.324 1.00 48.10 ? 72  ASN A H    1 
ATOM   952   H HA   . ASN A 1 72  ? -36.605 -11.361 -27.532 1.00 43.48 ? 72  ASN A HA   1 
ATOM   953   H HB2  . ASN A 1 72  ? -35.758 -13.089 -28.901 1.00 36.12 ? 72  ASN A HB2  1 
ATOM   954   H HB3  . ASN A 1 72  ? -36.615 -12.027 -29.716 1.00 36.12 ? 72  ASN A HB3  1 
ATOM   955   H HD21 . ASN A 1 72  ? -33.080 -12.872 -30.872 1.00 41.14 ? 72  ASN A HD21 1 
ATOM   956   H HD22 . ASN A 1 72  ? -33.878 -13.707 -29.932 1.00 41.14 ? 72  ASN A HD22 1 
ATOM   957   N N    . VAL A 1 73  ? -33.773 -10.658 -26.694 1.00 37.08 ? 73  VAL A N    1 
ATOM   958   C CA   . VAL A 1 73  ? -32.641 -10.911 -25.817 1.00 33.60 ? 73  VAL A CA   1 
ATOM   959   C C    . VAL A 1 73  ? -33.025 -10.366 -24.444 1.00 36.29 ? 73  VAL A C    1 
ATOM   960   O O    . VAL A 1 73  ? -33.247 -9.154  -24.289 1.00 35.34 ? 73  VAL A O    1 
ATOM   961   C CB   . VAL A 1 73  ? -31.345 -10.268 -26.358 1.00 35.60 ? 73  VAL A CB   1 
ATOM   962   C CG1  . VAL A 1 73  ? -30.255 -10.431 -25.344 1.00 33.06 ? 73  VAL A CG1  1 
ATOM   963   C CG2  . VAL A 1 73  ? -30.923 -10.945 -27.662 1.00 31.19 ? 73  VAL A CG2  1 
ATOM   964   H H    . VAL A 1 73  ? -33.838 -9.835  -26.936 1.00 44.47 ? 73  VAL A H    1 
ATOM   965   H HA   . VAL A 1 73  ? -32.500 -11.868 -25.739 1.00 40.30 ? 73  VAL A HA   1 
ATOM   966   H HB   . VAL A 1 73  ? -31.486 -9.322  -26.523 1.00 42.70 ? 73  VAL A HB   1 
ATOM   967   H HG11 . VAL A 1 73  ? -29.443 -10.026 -25.686 1.00 39.65 ? 73  VAL A HG11 1 
ATOM   968   H HG12 . VAL A 1 73  ? -30.523 -9.992  -24.521 1.00 39.65 ? 73  VAL A HG12 1 
ATOM   969   H HG13 . VAL A 1 73  ? -30.112 -11.376 -25.184 1.00 39.65 ? 73  VAL A HG13 1 
ATOM   970   H HG21 . VAL A 1 73  ? -30.109 -10.528 -27.985 1.00 37.41 ? 73  VAL A HG21 1 
ATOM   971   H HG22 . VAL A 1 73  ? -30.768 -11.887 -27.492 1.00 37.41 ? 73  VAL A HG22 1 
ATOM   972   H HG23 . VAL A 1 73  ? -31.632 -10.839 -28.316 1.00 37.41 ? 73  VAL A HG23 1 
ATOM   973   N N    . VAL A 1 74  ? -33.115 -11.257 -23.450 1.00 38.90 ? 74  VAL A N    1 
ATOM   974   C CA   . VAL A 1 74  ? -33.658 -10.943 -22.120 1.00 34.87 ? 74  VAL A CA   1 
ATOM   975   C C    . VAL A 1 74  ? -32.517 -10.897 -21.115 1.00 35.71 ? 74  VAL A C    1 
ATOM   976   O O    . VAL A 1 74  ? -31.883 -11.924 -20.839 1.00 36.16 ? 74  VAL A O    1 
ATOM   977   C CB   . VAL A 1 74  ? -34.704 -11.979 -21.659 1.00 34.29 ? 74  VAL A CB   1 
ATOM   978   C CG1  . VAL A 1 74  ? -35.342 -11.559 -20.359 1.00 39.51 ? 74  VAL A CG1  1 
ATOM   979   C CG2  . VAL A 1 74  ? -35.800 -12.193 -22.685 1.00 34.65 ? 74  VAL A CG2  1 
ATOM   980   H H    . VAL A 1 74  ? -32.861 -12.075 -23.524 1.00 46.65 ? 74  VAL A H    1 
ATOM   981   H HA   . VAL A 1 74  ? -34.081 -10.071 -22.143 1.00 41.82 ? 74  VAL A HA   1 
ATOM   982   H HB   . VAL A 1 74  ? -34.261 -12.830 -21.513 1.00 41.13 ? 74  VAL A HB   1 
ATOM   983   H HG11 . VAL A 1 74  ? -35.993 -12.228 -20.096 1.00 47.39 ? 74  VAL A HG11 1 
ATOM   984   H HG12 . VAL A 1 74  ? -34.654 -11.482 -19.680 1.00 47.39 ? 74  VAL A HG12 1 
ATOM   985   H HG13 . VAL A 1 74  ? -35.780 -10.702 -20.485 1.00 47.39 ? 74  VAL A HG13 1 
ATOM   986   H HG21 . VAL A 1 74  ? -36.427 -12.851 -22.345 1.00 41.56 ? 74  VAL A HG21 1 
ATOM   987   H HG22 . VAL A 1 74  ? -36.255 -11.351 -22.841 1.00 41.56 ? 74  VAL A HG22 1 
ATOM   988   H HG23 . VAL A 1 74  ? -35.401 -12.512 -23.510 1.00 41.56 ? 74  VAL A HG23 1 
ATOM   989   N N    . ALA A 1 75  ? -32.289 -9.733  -20.512 1.00 31.99 ? 75  ALA A N    1 
ATOM   990   C CA   . ALA A 1 75  ? -31.426 -9.681  -19.341 1.00 37.23 ? 75  ALA A CA   1 
ATOM   991   C C    . ALA A 1 75  ? -32.029 -10.518 -18.210 1.00 40.18 ? 75  ALA A C    1 
ATOM   992   O O    . ALA A 1 75  ? -33.253 -10.568 -18.041 1.00 43.22 ? 75  ALA A O    1 
ATOM   993   C CB   . ALA A 1 75  ? -31.231 -8.238  -18.883 1.00 42.75 ? 75  ALA A CB   1 
ATOM   994   H H    . ALA A 1 75  ? -32.615 -8.976  -20.756 1.00 38.36 ? 75  ALA A H    1 
ATOM   995   H HA   . ALA A 1 75  ? -30.557 -10.051 -19.565 1.00 44.65 ? 75  ALA A HA   1 
ATOM   996   H HB1  . ALA A 1 75  ? -30.654 -8.230  -18.103 1.00 51.28 ? 75  ALA A HB1  1 
ATOM   997   H HB2  . ALA A 1 75  ? -30.823 -7.731  -19.602 1.00 51.28 ? 75  ALA A HB2  1 
ATOM   998   H HB3  . ALA A 1 75  ? -32.095 -7.859  -18.659 1.00 51.28 ? 75  ALA A HB3  1 
ATOM   999   N N    . VAL A 1 76  ? -31.163 -11.202 -17.462 1.00 29.06 ? 76  VAL A N    1 
ATOM   1000  C CA   . VAL A 1 76  ? -31.553 -11.994 -16.292 1.00 35.62 ? 76  VAL A CA   1 
ATOM   1001  C C    . VAL A 1 76  ? -30.486 -11.794 -15.223 1.00 36.16 ? 76  VAL A C    1 
ATOM   1002  O O    . VAL A 1 76  ? -29.306 -12.079 -15.485 1.00 32.32 ? 76  VAL A O    1 
ATOM   1003  C CB   . VAL A 1 76  ? -31.713 -13.485 -16.634 1.00 29.04 ? 76  VAL A CB   1 
ATOM   1004  C CG1  . VAL A 1 76  ? -32.186 -14.274 -15.429 1.00 32.57 ? 76  VAL A CG1  1 
ATOM   1005  C CG2  . VAL A 1 76  ? -32.647 -13.670 -17.763 1.00 29.91 ? 76  VAL A CG2  1 
ATOM   1006  H H    . VAL A 1 76  ? -30.318 -11.223 -17.616 1.00 34.86 ? 76  VAL A H    1 
ATOM   1007  H HA   . VAL A 1 76  ? -32.399 -11.666 -15.947 1.00 42.72 ? 76  VAL A HA   1 
ATOM   1008  H HB   . VAL A 1 76  ? -30.851 -13.839 -16.901 1.00 34.82 ? 76  VAL A HB   1 
ATOM   1009  H HG11 . VAL A 1 76  ? -32.276 -15.207 -15.678 1.00 39.07 ? 76  VAL A HG11 1 
ATOM   1010  H HG12 . VAL A 1 76  ? -31.534 -14.183 -14.716 1.00 39.07 ? 76  VAL A HG12 1 
ATOM   1011  H HG13 . VAL A 1 76  ? -33.043 -13.924 -15.139 1.00 39.07 ? 76  VAL A HG13 1 
ATOM   1012  H HG21 . VAL A 1 76  ? -32.727 -14.618 -17.954 1.00 35.87 ? 76  VAL A HG21 1 
ATOM   1013  H HG22 . VAL A 1 76  ? -33.513 -13.307 -17.519 1.00 35.87 ? 76  VAL A HG22 1 
ATOM   1014  H HG23 . VAL A 1 76  ? -32.300 -13.204 -18.539 1.00 35.87 ? 76  VAL A HG23 1 
ATOM   1015  N N    . PRO A 1 77  ? -30.838 -11.322 -14.016 1.00 30.62 ? 77  PRO A N    1 
ATOM   1016  C CA   . PRO A 1 77  ? -29.800 -10.984 -13.032 1.00 34.19 ? 77  PRO A CA   1 
ATOM   1017  C C    . PRO A 1 77  ? -29.146 -12.189 -12.394 1.00 29.27 ? 77  PRO A C    1 
ATOM   1018  O O    . PRO A 1 77  ? -27.994 -12.094 -11.956 1.00 33.16 ? 77  PRO A O    1 
ATOM   1019  C CB   . PRO A 1 77  ? -30.559 -10.153 -11.987 1.00 40.64 ? 77  PRO A CB   1 
ATOM   1020  C CG   . PRO A 1 77  ? -31.934 -9.933  -12.548 1.00 40.16 ? 77  PRO A CG   1 
ATOM   1021  C CD   . PRO A 1 77  ? -32.190 -11.003 -13.522 1.00 33.24 ? 77  PRO A CD   1 
ATOM   1022  H HA   . PRO A 1 77  ? -29.117 -10.432 -13.443 1.00 41.00 ? 77  PRO A HA   1 
ATOM   1023  H HB2  . PRO A 1 77  ? -30.607 -10.646 -11.153 1.00 48.74 ? 77  PRO A HB2  1 
ATOM   1024  H HB3  . PRO A 1 77  ? -30.106 -9.305  -11.856 1.00 48.74 ? 77  PRO A HB3  1 
ATOM   1025  H HG2  . PRO A 1 77  ? -32.583 -9.972  -11.828 1.00 48.16 ? 77  PRO A HG2  1 
ATOM   1026  H HG3  . PRO A 1 77  ? -31.967 -9.067  -12.984 1.00 48.16 ? 77  PRO A HG3  1 
ATOM   1027  H HD2  . PRO A 1 77  ? -32.583 -11.775 -13.084 1.00 39.86 ? 77  PRO A HD2  1 
ATOM   1028  H HD3  . PRO A 1 77  ? -32.749 -10.679 -14.245 1.00 39.86 ? 77  PRO A HD3  1 
ATOM   1029  N N    . ASP A 1 78  ? -29.846 -13.312 -12.308 1.00 33.67 ? 78  ASP A N    1 
ATOM   1030  C CA   . ASP A 1 78  ? -29.324 -14.511 -11.662 1.00 34.11 ? 78  ASP A CA   1 
ATOM   1031  C C    . ASP A 1 78  ? -28.802 -15.478 -12.721 1.00 25.39 ? 78  ASP A C    1 
ATOM   1032  O O    . ASP A 1 78  ? -29.554 -15.887 -13.609 1.00 25.15 ? 78  ASP A O    1 
ATOM   1033  C CB   . ASP A 1 78  ? -30.399 -15.186 -10.816 1.00 32.88 ? 78  ASP A CB   1 
ATOM   1034  C CG   . ASP A 1 78  ? -29.889 -16.437 -10.164 1.00 30.81 ? 78  ASP A CG   1 
ATOM   1035  O OD1  . ASP A 1 78  ? -29.228 -16.342 -9.111  1.00 46.79 ? 78  ASP A OD1  1 
ATOM   1036  O OD2  . ASP A 1 78  ? -30.087 -17.511 -10.746 1.00 39.24 ? 78  ASP A OD2  1 
ATOM   1037  H H    . ASP A 1 78  ? -30.641 -13.408 -12.621 1.00 40.38 ? 78  ASP A H    1 
ATOM   1038  H HA   . ASP A 1 78  ? -28.586 -14.267 -11.081 1.00 40.91 ? 78  ASP A HA   1 
ATOM   1039  H HB2  . ASP A 1 78  ? -30.687 -14.576 -10.119 1.00 39.43 ? 78  ASP A HB2  1 
ATOM   1040  H HB3  . ASP A 1 78  ? -31.149 -15.424 -11.384 1.00 39.43 ? 78  ASP A HB3  1 
ATOM   1041  N N    . VAL A 1 79  ? -27.523 -15.851 -12.623 1.00 27.84 ? 79  VAL A N    1 
ATOM   1042  C CA   . VAL A 1 79  ? -26.903 -16.586 -13.727 1.00 27.84 ? 79  VAL A CA   1 
ATOM   1043  C C    . VAL A 1 79  ? -27.460 -18.008 -13.826 1.00 28.81 ? 79  VAL A C    1 
ATOM   1044  O O    . VAL A 1 79  ? -27.578 -18.558 -14.931 1.00 25.54 ? 79  VAL A O    1 
ATOM   1045  C CB   . VAL A 1 79  ? -25.365 -16.559 -13.594 1.00 28.06 ? 79  VAL A CB   1 
ATOM   1046  C CG1  . VAL A 1 79  ? -24.880 -17.365 -12.408 1.00 28.93 ? 79  VAL A CG1  1 
ATOM   1047  C CG2  . VAL A 1 79  ? -24.696 -17.037 -14.889 1.00 24.76 ? 79  VAL A CG2  1 
ATOM   1048  H H    . VAL A 1 79  ? -27.009 -15.697 -11.951 1.00 33.39 ? 79  VAL A H    1 
ATOM   1049  H HA   . VAL A 1 79  ? -27.127 -16.133 -14.555 1.00 33.39 ? 79  VAL A HA   1 
ATOM   1050  H HB   . VAL A 1 79  ? -25.089 -15.641 -13.449 1.00 33.65 ? 79  VAL A HB   1 
ATOM   1051  H HG11 . VAL A 1 79  ? -23.912 -17.317 -12.369 1.00 34.69 ? 79  VAL A HG11 1 
ATOM   1052  H HG12 . VAL A 1 79  ? -25.264 -16.996 -11.597 1.00 34.69 ? 79  VAL A HG12 1 
ATOM   1053  H HG13 . VAL A 1 79  ? -25.162 -18.287 -12.517 1.00 34.69 ? 79  VAL A HG13 1 
ATOM   1054  H HG21 . VAL A 1 79  ? -23.733 -17.010 -14.775 1.00 29.69 ? 79  VAL A HG21 1 
ATOM   1055  H HG22 . VAL A 1 79  ? -24.981 -17.946 -15.075 1.00 29.69 ? 79  VAL A HG22 1 
ATOM   1056  H HG23 . VAL A 1 79  ? -24.960 -16.452 -15.615 1.00 29.69 ? 79  VAL A HG23 1 
ATOM   1057  N N    . VAL A 1 80  ? -27.848 -18.620 -12.702 1.00 22.68 ? 80  VAL A N    1 
ATOM   1058  C CA   . VAL A 1 80  ? -28.455 -19.949 -12.790 1.00 22.85 ? 80  VAL A CA   1 
ATOM   1059  C C    . VAL A 1 80  ? -29.777 -19.871 -13.528 1.00 28.61 ? 80  VAL A C    1 
ATOM   1060  O O    . VAL A 1 80  ? -30.081 -20.727 -14.370 1.00 23.36 ? 80  VAL A O    1 
ATOM   1061  C CB   . VAL A 1 80  ? -28.622 -20.578 -11.393 1.00 22.00 ? 80  VAL A CB   1 
ATOM   1062  C CG1  . VAL A 1 80  ? -29.379 -21.900 -11.486 1.00 27.75 ? 80  VAL A CG1  1 
ATOM   1063  C CG2  . VAL A 1 80  ? -27.250 -20.815 -10.766 1.00 29.13 ? 80  VAL A CG2  1 
ATOM   1064  H H    . VAL A 1 80  ? -27.774 -18.300 -11.907 1.00 27.19 ? 80  VAL A H    1 
ATOM   1065  H HA   . VAL A 1 80  ? -27.866 -20.525 -13.303 1.00 27.40 ? 80  VAL A HA   1 
ATOM   1066  H HB   . VAL A 1 80  ? -29.122 -19.975 -10.822 1.00 26.38 ? 80  VAL A HB   1 
ATOM   1067  H HG11 . VAL A 1 80  ? -29.470 -22.274 -10.596 1.00 33.28 ? 80  VAL A HG11 1 
ATOM   1068  H HG12 . VAL A 1 80  ? -30.255 -21.735 -11.867 1.00 33.28 ? 80  VAL A HG12 1 
ATOM   1069  H HG13 . VAL A 1 80  ? -28.880 -22.509 -12.052 1.00 33.28 ? 80  VAL A HG13 1 
ATOM   1070  H HG21 . VAL A 1 80  ? -27.368 -21.210 -9.888  1.00 34.94 ? 80  VAL A HG21 1 
ATOM   1071  H HG22 . VAL A 1 80  ? -26.742 -21.415 -11.334 1.00 34.94 ? 80  VAL A HG22 1 
ATOM   1072  H HG23 . VAL A 1 80  ? -26.789 -19.965 -10.686 1.00 34.94 ? 80  VAL A HG23 1 
ATOM   1073  N N    . GLN A 1 81  ? -30.594 -18.853 -13.224 1.00 26.30 ? 81  GLN A N    1 
ATOM   1074  C CA   . GLN A 1 81  ? -31.876 -18.735 -13.916 1.00 28.76 ? 81  GLN A CA   1 
ATOM   1075  C C    . GLN A 1 81  ? -31.659 -18.434 -15.393 1.00 27.07 ? 81  GLN A C    1 
ATOM   1076  O O    . GLN A 1 81  ? -32.408 -18.913 -16.249 1.00 24.80 ? 81  GLN A O    1 
ATOM   1077  C CB   . GLN A 1 81  ? -32.746 -17.656 -13.262 1.00 28.41 ? 81  GLN A CB   1 
ATOM   1078  H H    . GLN A 1 81  ? -30.435 -18.240 -12.642 1.00 31.53 ? 81  GLN A H    1 
ATOM   1079  H HA   . GLN A 1 81  ? -32.348 -19.580 -13.850 1.00 34.50 ? 81  GLN A HA   1 
ATOM   1080  N N    . ALA A 1 82  ? -30.634 -17.643 -15.710 1.00 27.69 ? 82  ALA A N    1 
ATOM   1081  C CA   . ALA A 1 82  ? -30.338 -17.364 -17.113 1.00 26.17 ? 82  ALA A CA   1 
ATOM   1082  C C    . ALA A 1 82  ? -29.998 -18.645 -17.874 1.00 23.96 ? 82  ALA A C    1 
ATOM   1083  O O    . ALA A 1 82  ? -30.437 -18.836 -19.006 1.00 24.21 ? 82  ALA A O    1 
ATOM   1084  C CB   . ALA A 1 82  ? -29.187 -16.356 -17.204 1.00 27.03 ? 82  ALA A CB   1 
ATOM   1085  H H    . ALA A 1 82  ? -30.107 -17.264 -15.147 1.00 33.21 ? 82  ALA A H    1 
ATOM   1086  H HA   . ALA A 1 82  ? -31.119 -16.967 -17.528 1.00 31.39 ? 82  ALA A HA   1 
ATOM   1087  H HB1  . ALA A 1 82  ? -28.998 -16.177 -18.138 1.00 32.42 ? 82  ALA A HB1  1 
ATOM   1088  H HB2  . ALA A 1 82  ? -29.450 -15.536 -16.756 1.00 32.42 ? 82  ALA A HB2  1 
ATOM   1089  H HB3  . ALA A 1 82  ? -28.404 -16.732 -16.773 1.00 32.42 ? 82  ALA A HB3  1 
ATOM   1090  N N    . ALA A 1 83  ? -29.239 -19.547 -17.255 1.00 23.25 ? 83  ALA A N    1 
ATOM   1091  C CA   . ALA A 1 83  ? -28.550 -20.635 -17.939 1.00 27.89 ? 83  ALA A CA   1 
ATOM   1092  C C    . ALA A 1 83  ? -29.259 -21.979 -17.858 1.00 28.58 ? 83  ALA A C    1 
ATOM   1093  O O    . ALA A 1 83  ? -28.945 -22.881 -18.649 1.00 22.53 ? 83  ALA A O    1 
ATOM   1094  C CB   . ALA A 1 83  ? -27.154 -20.810 -17.320 1.00 27.42 ? 83  ALA A CB   1 
ATOM   1095  H H    . ALA A 1 83  ? -29.105 -19.546 -16.405 1.00 27.88 ? 83  ALA A H    1 
ATOM   1096  H HA   . ALA A 1 83  ? -28.441 -20.405 -18.875 1.00 33.45 ? 83  ALA A HA   1 
ATOM   1097  H HB1  . ALA A 1 83  ? -26.696 -21.534 -17.775 1.00 32.89 ? 83  ALA A HB1  1 
ATOM   1098  H HB2  . ALA A 1 83  ? -26.656 -19.985 -17.426 1.00 32.89 ? 83  ALA A HB2  1 
ATOM   1099  H HB3  . ALA A 1 83  ? -27.251 -21.020 -16.378 1.00 32.89 ? 83  ALA A HB3  1 
ATOM   1100  N N    . GLU A 1 84  ? -30.170 -22.153 -16.905 1.00 25.45 ? 84  GLU A N    1 
ATOM   1101  C CA   . GLU A 1 84  ? -30.546 -23.509 -16.512 1.00 35.76 ? 84  GLU A CA   1 
ATOM   1102  C C    . GLU A 1 84  ? -31.350 -24.254 -17.574 1.00 34.79 ? 84  GLU A C    1 
ATOM   1103  O O    . GLU A 1 84  ? -31.352 -25.493 -17.562 1.00 32.60 ? 84  GLU A O    1 
ATOM   1104  C CB   . GLU A 1 84  ? -31.325 -23.484 -15.195 1.00 34.38 ? 84  GLU A CB   1 
ATOM   1105  C CG   . GLU A 1 84  ? -32.600 -22.647 -15.228 1.00 34.24 ? 84  GLU A CG   1 
ATOM   1106  C CD   . GLU A 1 84  ? -33.325 -22.661 -13.888 1.00 41.68 ? 84  GLU A CD   1 
ATOM   1107  O OE1  . GLU A 1 84  ? -32.903 -23.413 -12.993 1.00 36.48 ? 84  GLU A OE1  1 
ATOM   1108  O OE2  . GLU A 1 84  ? -34.329 -21.934 -13.734 1.00 47.27 ? 84  GLU A OE2  1 
ATOM   1109  H H    . GLU A 1 84  ? -30.575 -21.524 -16.482 1.00 30.52 ? 84  GLU A H    1 
ATOM   1110  H HA   . GLU A 1 84  ? -29.734 -24.017 -16.357 1.00 42.89 ? 84  GLU A HA   1 
ATOM   1111  H HB2  . GLU A 1 84  ? -31.576 -24.393 -14.967 1.00 41.23 ? 84  GLU A HB2  1 
ATOM   1112  H HB3  . GLU A 1 84  ? -30.752 -23.120 -14.503 1.00 41.23 ? 84  GLU A HB3  1 
ATOM   1113  H HG2  . GLU A 1 84  ? -32.372 -21.728 -15.439 1.00 41.07 ? 84  GLU A HG2  1 
ATOM   1114  H HG3  . GLU A 1 84  ? -33.200 -23.006 -15.901 1.00 41.07 ? 84  GLU A HG3  1 
ATOM   1115  N N    . ASP A 1 85  ? -32.042 -23.552 -18.472 1.00 30.97 ? 85  ASP A N    1 
ATOM   1116  C CA   . ASP A 1 85  ? -32.761 -24.198 -19.564 1.00 31.79 ? 85  ASP A CA   1 
ATOM   1117  C C    . ASP A 1 85  ? -31.992 -24.163 -20.877 1.00 32.62 ? 85  ASP A C    1 
ATOM   1118  O O    . ASP A 1 85  ? -32.528 -24.579 -21.901 1.00 28.24 ? 85  ASP A O    1 
ATOM   1119  C CB   . ASP A 1 85  ? -34.135 -23.548 -19.776 1.00 38.75 ? 85  ASP A CB   1 
ATOM   1120  C CG   . ASP A 1 85  ? -35.092 -23.791 -18.618 1.00 49.19 ? 85  ASP A CG   1 
ATOM   1121  O OD1  . ASP A 1 85  ? -34.691 -24.445 -17.634 1.00 56.77 ? 85  ASP A OD1  1 
ATOM   1122  O OD2  . ASP A 1 85  ? -36.245 -23.325 -18.684 1.00 56.63 ? 85  ASP A OD2  1 
ATOM   1123  H H    . ASP A 1 85  ? -32.109 -22.695 -18.468 1.00 37.15 ? 85  ASP A H    1 
ATOM   1124  H HA   . ASP A 1 85  ? -32.907 -25.128 -19.332 1.00 38.12 ? 85  ASP A HA   1 
ATOM   1125  H HB2  . ASP A 1 85  ? -34.019 -22.589 -19.872 1.00 46.47 ? 85  ASP A HB2  1 
ATOM   1126  H HB3  . ASP A 1 85  ? -34.537 -23.915 -20.579 1.00 46.47 ? 85  ASP A HB3  1 
ATOM   1127  N N    . ALA A 1 86  ? -30.752 -23.689 -20.874 1.00 27.99 ? 86  ALA A N    1 
ATOM   1128  C CA   . ALA A 1 86  ? -30.018 -23.470 -22.111 1.00 26.79 ? 86  ALA A CA   1 
ATOM   1129  C C    . ALA A 1 86  ? -29.301 -24.733 -22.570 1.00 29.95 ? 86  ALA A C    1 
ATOM   1130  O O    . ALA A 1 86  ? -28.757 -25.489 -21.759 1.00 30.08 ? 86  ALA A O    1 
ATOM   1131  C CB   . ALA A 1 86  ? -29.001 -22.345 -21.929 1.00 29.73 ? 86  ALA A CB   1 
ATOM   1132  H H    . ALA A 1 86  ? -30.311 -23.486 -20.164 1.00 33.56 ? 86  ALA A H    1 
ATOM   1133  H HA   . ALA A 1 86  ? -30.640 -23.205 -22.807 1.00 32.13 ? 86  ALA A HA   1 
ATOM   1134  H HB1  . ALA A 1 86  ? -28.523 -22.214 -22.763 1.00 35.66 ? 86  ALA A HB1  1 
ATOM   1135  H HB2  . ALA A 1 86  ? -29.470 -21.532 -21.685 1.00 35.66 ? 86  ALA A HB2  1 
ATOM   1136  H HB3  . ALA A 1 86  ? -28.379 -22.593 -21.227 1.00 35.66 ? 86  ALA A HB3  1 
ATOM   1137  N N    . ASP A 1 87  ? -29.313 -24.955 -23.885 1.00 21.94 ? 87  ASP A N    1 
ATOM   1138  C CA   . ASP A 1 87  ? -28.552 -26.013 -24.535 1.00 21.08 ? 87  ASP A CA   1 
ATOM   1139  C C    . ASP A 1 87  ? -27.145 -25.577 -24.902 1.00 22.19 ? 87  ASP A C    1 
ATOM   1140  O O    . ASP A 1 87  ? -26.238 -26.418 -24.994 1.00 23.99 ? 87  ASP A O    1 
ATOM   1141  C CB   . ASP A 1 87  ? -29.259 -26.445 -25.817 1.00 26.58 ? 87  ASP A CB   1 
ATOM   1142  C CG   . ASP A 1 87  ? -30.657 -26.986 -25.550 1.00 28.00 ? 87  ASP A CG   1 
ATOM   1143  O OD1  . ASP A 1 87  ? -30.750 -28.093 -25.011 1.00 25.15 ? 87  ASP A OD1  1 
ATOM   1144  O OD2  . ASP A 1 87  ? -31.620 -26.263 -25.838 1.00 26.23 ? 87  ASP A OD2  1 
ATOM   1145  H H    . ASP A 1 87  ? -29.773 -24.484 -24.438 1.00 26.30 ? 87  ASP A H    1 
ATOM   1146  H HA   . ASP A 1 87  ? -28.492 -26.779 -23.943 1.00 25.28 ? 87  ASP A HA   1 
ATOM   1147  H HB2  . ASP A 1 87  ? -29.340 -25.681 -26.409 1.00 31.87 ? 87  ASP A HB2  1 
ATOM   1148  H HB3  . ASP A 1 87  ? -28.742 -27.145 -26.245 1.00 31.87 ? 87  ASP A HB3  1 
ATOM   1149  N N    . ILE A 1 88  ? -26.973 -24.289 -25.167 1.00 25.82 ? 88  ILE A N    1 
ATOM   1150  C CA   . ILE A 1 88  ? -25.699 -23.716 -25.597 1.00 23.79 ? 88  ILE A CA   1 
ATOM   1151  C C    . ILE A 1 88  ? -25.402 -22.560 -24.666 1.00 23.49 ? 88  ILE A C    1 
ATOM   1152  O O    . ILE A 1 88  ? -26.224 -21.645 -24.532 1.00 18.83 ? 88  ILE A O    1 
ATOM   1153  C CB   . ILE A 1 88  ? -25.747 -23.245 -27.061 1.00 21.71 ? 88  ILE A CB   1 
ATOM   1154  C CG1  . ILE A 1 88  ? -25.987 -24.445 -27.961 1.00 25.38 ? 88  ILE A CG1  1 
ATOM   1155  C CG2  . ILE A 1 88  ? -24.464 -22.514 -27.461 1.00 24.08 ? 88  ILE A CG2  1 
ATOM   1156  C CD1  . ILE A 1 88  ? -26.334 -24.071 -29.416 1.00 24.85 ? 88  ILE A CD1  1 
ATOM   1157  H H    . ILE A 1 88  ? -27.601 -23.705 -25.105 1.00 30.96 ? 88  ILE A H    1 
ATOM   1158  H HA   . ILE A 1 88  ? -24.995 -24.378 -25.506 1.00 28.53 ? 88  ILE A HA   1 
ATOM   1159  H HB   . ILE A 1 88  ? -26.493 -22.633 -27.161 1.00 26.03 ? 88  ILE A HB   1 
ATOM   1160  H HG12 . ILE A 1 88  ? -25.184 -24.989 -27.978 1.00 30.44 ? 88  ILE A HG12 1 
ATOM   1161  H HG13 . ILE A 1 88  ? -26.727 -24.961 -27.603 1.00 30.44 ? 88  ILE A HG13 1 
ATOM   1162  H HG21 . ILE A 1 88  ? -24.536 -22.235 -28.387 1.00 28.88 ? 88  ILE A HG21 1 
ATOM   1163  H HG22 . ILE A 1 88  ? -24.352 -21.739 -26.889 1.00 28.88 ? 88  ILE A HG22 1 
ATOM   1164  H HG23 . ILE A 1 88  ? -23.712 -23.117 -27.354 1.00 28.88 ? 88  ILE A HG23 1 
ATOM   1165  H HD11 . ILE A 1 88  ? -26.472 -24.884 -29.926 1.00 29.80 ? 88  ILE A HD11 1 
ATOM   1166  H HD12 . ILE A 1 88  ? -27.143 -23.535 -29.420 1.00 29.80 ? 88  ILE A HD12 1 
ATOM   1167  H HD13 . ILE A 1 88  ? -25.599 -23.563 -29.794 1.00 29.80 ? 88  ILE A HD13 1 
ATOM   1168  N N    . LEU A 1 89  ? -24.247 -22.604 -24.001 1.00 18.66 ? 89  LEU A N    1 
ATOM   1169  C CA   . LEU A 1 89  ? -23.816 -21.521 -23.127 1.00 20.34 ? 89  LEU A CA   1 
ATOM   1170  C C    . LEU A 1 89  ? -22.644 -20.801 -23.785 1.00 21.50 ? 89  LEU A C    1 
ATOM   1171  O O    . LEU A 1 89  ? -21.669 -21.437 -24.186 1.00 18.85 ? 89  LEU A O    1 
ATOM   1172  C CB   . LEU A 1 89  ? -23.406 -22.046 -21.751 1.00 19.51 ? 89  LEU A CB   1 
ATOM   1173  C CG   . LEU A 1 89  ? -24.516 -22.734 -20.921 1.00 30.36 ? 89  LEU A CG   1 
ATOM   1174  C CD1  . LEU A 1 89  ? -23.932 -23.630 -19.849 1.00 29.73 ? 89  LEU A CD1  1 
ATOM   1175  C CD2  . LEU A 1 89  ? -25.385 -21.714 -20.253 1.00 28.30 ? 89  LEU A CD2  1 
ATOM   1176  H H    . LEU A 1 89  ? -23.691 -23.259 -24.042 1.00 22.37 ? 89  LEU A H    1 
ATOM   1177  H HA   . LEU A 1 89  ? -24.542 -20.888 -23.012 1.00 24.39 ? 89  LEU A HA   1 
ATOM   1178  H HB2  . LEU A 1 89  ? -22.694 -22.693 -21.873 1.00 23.39 ? 89  LEU A HB2  1 
ATOM   1179  H HB3  . LEU A 1 89  ? -23.076 -21.300 -21.227 1.00 23.39 ? 89  LEU A HB3  1 
ATOM   1180  H HG   . LEU A 1 89  ? -25.070 -23.275 -21.506 1.00 36.41 ? 89  LEU A HG   1 
ATOM   1181  H HD11 . LEU A 1 89  ? -24.656 -24.041 -19.353 1.00 35.66 ? 89  LEU A HD11 1 
ATOM   1182  H HD12 . LEU A 1 89  ? -23.389 -24.314 -20.271 1.00 35.66 ? 89  LEU A HD12 1 
ATOM   1183  H HD13 . LEU A 1 89  ? -23.385 -23.093 -19.254 1.00 35.66 ? 89  LEU A HD13 1 
ATOM   1184  H HD21 . LEU A 1 89  ? -26.070 -22.171 -19.741 1.00 33.93 ? 89  LEU A HD21 1 
ATOM   1185  H HD22 . LEU A 1 89  ? -24.837 -21.172 -19.664 1.00 33.93 ? 89  LEU A HD22 1 
ATOM   1186  H HD23 . LEU A 1 89  ? -25.795 -21.156 -20.932 1.00 33.93 ? 89  LEU A HD23 1 
ATOM   1187  N N    . ILE A 1 90  ? -22.760 -19.492 -23.922 1.00 17.71 ? 90  ILE A N    1 
ATOM   1188  C CA   . ILE A 1 90  ? -21.732 -18.662 -24.543 1.00 15.64 ? 90  ILE A CA   1 
ATOM   1189  C C    . ILE A 1 90  ? -21.094 -17.872 -23.421 1.00 16.32 ? 90  ILE A C    1 
ATOM   1190  O O    . ILE A 1 90  ? -21.703 -16.942 -22.879 1.00 19.69 ? 90  ILE A O    1 
ATOM   1191  C CB   . ILE A 1 90  ? -22.308 -17.713 -25.598 1.00 21.23 ? 90  ILE A CB   1 
ATOM   1192  C CG1  . ILE A 1 90  ? -23.000 -18.501 -26.697 1.00 19.79 ? 90  ILE A CG1  1 
ATOM   1193  C CG2  . ILE A 1 90  ? -21.206 -16.808 -26.140 1.00 16.67 ? 90  ILE A CG2  1 
ATOM   1194  C CD1  . ILE A 1 90  ? -23.689 -17.593 -27.789 1.00 19.07 ? 90  ILE A CD1  1 
ATOM   1195  H H    . ILE A 1 90  ? -23.444 -19.045 -23.656 1.00 21.23 ? 90  ILE A H    1 
ATOM   1196  H HA   . ILE A 1 90  ? -21.058 -19.223 -24.958 1.00 18.75 ? 90  ILE A HA   1 
ATOM   1197  H HB   . ILE A 1 90  ? -22.972 -17.153 -25.167 1.00 25.46 ? 90  ILE A HB   1 
ATOM   1198  H HG12 . ILE A 1 90  ? -22.343 -19.058 -27.144 1.00 23.73 ? 90  ILE A HG12 1 
ATOM   1199  H HG13 . ILE A 1 90  ? -23.687 -19.058 -26.297 1.00 23.73 ? 90  ILE A HG13 1 
ATOM   1200  H HG21 . ILE A 1 90  ? -21.585 -16.213 -26.806 1.00 19.99 ? 90  ILE A HG21 1 
ATOM   1201  H HG22 . ILE A 1 90  ? -20.834 -16.291 -25.408 1.00 19.99 ? 90  ILE A HG22 1 
ATOM   1202  H HG23 . ILE A 1 90  ? -20.515 -17.358 -26.541 1.00 19.99 ? 90  ILE A HG23 1 
ATOM   1203  H HD11 . ILE A 1 90  ? -24.108 -18.161 -28.454 1.00 22.86 ? 90  ILE A HD11 1 
ATOM   1204  H HD12 . ILE A 1 90  ? -24.358 -17.036 -27.361 1.00 22.86 ? 90  ILE A HD12 1 
ATOM   1205  H HD13 . ILE A 1 90  ? -23.014 -17.036 -28.208 1.00 22.86 ? 90  ILE A HD13 1 
ATOM   1206  N N    . PHE A 1 91  ? -19.874 -18.243 -23.052 1.00 18.32 ? 91  PHE A N    1 
ATOM   1207  C CA   . PHE A 1 91  ? -19.177 -17.578 -21.958 1.00 19.18 ? 91  PHE A CA   1 
ATOM   1208  C C    . PHE A 1 91  ? -18.426 -16.365 -22.471 1.00 20.97 ? 91  PHE A C    1 
ATOM   1209  O O    . PHE A 1 91  ? -17.496 -16.493 -23.272 1.00 22.48 ? 91  PHE A O    1 
ATOM   1210  C CB   . PHE A 1 91  ? -18.231 -18.552 -21.269 1.00 21.38 ? 91  PHE A CB   1 
ATOM   1211  C CG   . PHE A 1 91  ? -18.940 -19.680 -20.630 1.00 19.49 ? 91  PHE A CG   1 
ATOM   1212  C CD1  . PHE A 1 91  ? -19.222 -20.826 -21.331 1.00 19.60 ? 91  PHE A CD1  1 
ATOM   1213  C CD2  . PHE A 1 91  ? -19.394 -19.564 -19.334 1.00 22.58 ? 91  PHE A CD2  1 
ATOM   1214  C CE1  . PHE A 1 91  ? -19.903 -21.869 -20.720 1.00 21.08 ? 91  PHE A CE1  1 
ATOM   1215  C CE2  . PHE A 1 91  ? -20.076 -20.598 -18.740 1.00 21.67 ? 91  PHE A CE2  1 
ATOM   1216  C CZ   . PHE A 1 91  ? -20.334 -21.738 -19.436 1.00 24.84 ? 91  PHE A CZ   1 
ATOM   1217  H H    . PHE A 1 91  ? -19.427 -18.878 -23.421 1.00 21.96 ? 91  PHE A H    1 
ATOM   1218  H HA   . PHE A 1 91  ? -19.827 -17.276 -21.304 1.00 22.99 ? 91  PHE A HA   1 
ATOM   1219  H HB2  . PHE A 1 91  ? -17.618 -18.916 -21.927 1.00 25.63 ? 91  PHE A HB2  1 
ATOM   1220  H HB3  . PHE A 1 91  ? -17.737 -18.079 -20.581 1.00 25.63 ? 91  PHE A HB3  1 
ATOM   1221  H HD1  . PHE A 1 91  ? -18.928 -20.916 -22.209 1.00 23.50 ? 91  PHE A HD1  1 
ATOM   1222  H HD2  . PHE A 1 91  ? -19.222 -18.787 -18.853 1.00 27.08 ? 91  PHE A HD2  1 
ATOM   1223  H HE1  . PHE A 1 91  ? -20.082 -22.649 -21.195 1.00 25.28 ? 91  PHE A HE1  1 
ATOM   1224  H HE2  . PHE A 1 91  ? -20.367 -20.516 -17.861 1.00 25.98 ? 91  PHE A HE2  1 
ATOM   1225  H HZ   . PHE A 1 91  ? -20.792 -22.437 -19.027 1.00 29.79 ? 91  PHE A HZ   1 
ATOM   1226  N N    . VAL A 1 92  ? -18.819 -15.192 -21.997 1.00 20.67 ? 92  VAL A N    1 
ATOM   1227  C CA   . VAL A 1 92  ? -18.248 -13.955 -22.490 1.00 20.02 ? 92  VAL A CA   1 
ATOM   1228  C C    . VAL A 1 92  ? -18.186 -12.970 -21.331 1.00 23.04 ? 92  VAL A C    1 
ATOM   1229  O O    . VAL A 1 92  ? -18.760 -11.882 -21.377 1.00 30.01 ? 92  VAL A O    1 
ATOM   1230  C CB   . VAL A 1 92  ? -19.058 -13.443 -23.699 1.00 24.32 ? 92  VAL A CB   1 
ATOM   1231  C CG1  . VAL A 1 92  ? -20.526 -13.262 -23.330 1.00 26.17 ? 92  VAL A CG1  1 
ATOM   1232  C CG2  . VAL A 1 92  ? -18.452 -12.190 -24.294 1.00 25.18 ? 92  VAL A CG2  1 
ATOM   1233  H H    . VAL A 1 92  ? -19.416 -15.088 -21.387 1.00 24.78 ? 92  VAL A H    1 
ATOM   1234  H HA   . VAL A 1 92  ? -17.341 -14.123 -22.788 1.00 24.00 ? 92  VAL A HA   1 
ATOM   1235  H HB   . VAL A 1 92  ? -19.024 -14.125 -24.388 1.00 29.16 ? 92  VAL A HB   1 
ATOM   1236  H HG11 . VAL A 1 92  ? -21.009 -12.940 -24.107 1.00 31.38 ? 92  VAL A HG11 1 
ATOM   1237  H HG12 . VAL A 1 92  ? -20.887 -14.116 -23.045 1.00 31.38 ? 92  VAL A HG12 1 
ATOM   1238  H HG13 . VAL A 1 92  ? -20.592 -12.617 -22.608 1.00 31.38 ? 92  VAL A HG13 1 
ATOM   1239  H HG21 . VAL A 1 92  ? -18.993 -11.906 -25.048 1.00 30.19 ? 92  VAL A HG21 1 
ATOM   1240  H HG22 . VAL A 1 92  ? -18.437 -11.495 -23.617 1.00 30.19 ? 92  VAL A HG22 1 
ATOM   1241  H HG23 . VAL A 1 92  ? -17.549 -12.385 -24.588 1.00 30.19 ? 92  VAL A HG23 1 
ATOM   1242  N N    . VAL A 1 93  ? -17.485 -13.349 -20.274 1.00 31.05 ? 93  VAL A N    1 
ATOM   1243  C CA   . VAL A 1 93  ? -17.304 -12.451 -19.140 1.00 27.79 ? 93  VAL A CA   1 
ATOM   1244  C C    . VAL A 1 93  ? -15.824 -12.135 -19.013 1.00 30.77 ? 93  VAL A C    1 
ATOM   1245  O O    . VAL A 1 93  ? -14.975 -12.852 -19.572 1.00 28.19 ? 93  VAL A O    1 
ATOM   1246  C CB   . VAL A 1 93  ? -17.828 -13.057 -17.837 1.00 28.62 ? 93  VAL A CB   1 
ATOM   1247  C CG1  . VAL A 1 93  ? -19.329 -13.173 -17.887 1.00 30.29 ? 93  VAL A CG1  1 
ATOM   1248  C CG2  . VAL A 1 93  ? -17.169 -14.410 -17.605 1.00 28.42 ? 93  VAL A CG2  1 
ATOM   1249  H H    . VAL A 1 93  ? -17.104 -14.115 -20.186 1.00 37.24 ? 93  VAL A H    1 
ATOM   1250  H HA   . VAL A 1 93  ? -17.781 -11.623 -19.305 1.00 33.33 ? 93  VAL A HA   1 
ATOM   1251  H HB   . VAL A 1 93  ? -17.593 -12.475 -17.097 1.00 34.32 ? 93  VAL A HB   1 
ATOM   1252  H HG11 . VAL A 1 93  ? -19.643 -13.558 -17.054 1.00 36.32 ? 93  VAL A HG11 1 
ATOM   1253  H HG12 . VAL A 1 93  ? -19.709 -12.289 -18.007 1.00 36.32 ? 93  VAL A HG12 1 
ATOM   1254  H HG13 . VAL A 1 93  ? -19.576 -13.745 -18.630 1.00 36.32 ? 93  VAL A HG13 1 
ATOM   1255  H HG21 . VAL A 1 93  ? -17.506 -14.787 -16.777 1.00 34.08 ? 93  VAL A HG21 1 
ATOM   1256  H HG22 . VAL A 1 93  ? -17.383 -14.996 -18.347 1.00 34.08 ? 93  VAL A HG22 1 
ATOM   1257  H HG23 . VAL A 1 93  ? -16.209 -14.287 -17.546 1.00 34.08 ? 93  VAL A HG23 1 
ATOM   1258  N N    . PRO A 1 94  ? -15.472 -11.097 -18.272 1.00 32.50 ? 94  PRO A N    1 
ATOM   1259  C CA   . PRO A 1 94  ? -14.060 -10.870 -17.963 1.00 30.34 ? 94  PRO A CA   1 
ATOM   1260  C C    . PRO A 1 94  ? -13.460 -12.099 -17.309 1.00 33.39 ? 94  PRO A C    1 
ATOM   1261  O O    . PRO A 1 94  ? -14.094 -12.753 -16.474 1.00 27.64 ? 94  PRO A O    1 
ATOM   1262  C CB   . PRO A 1 94  ? -14.097 -9.677  -17.000 1.00 34.05 ? 94  PRO A CB   1 
ATOM   1263  C CG   . PRO A 1 94  ? -15.331 -8.946  -17.385 1.00 38.70 ? 94  PRO A CG   1 
ATOM   1264  C CD   . PRO A 1 94  ? -16.332 -10.010 -17.780 1.00 33.64 ? 94  PRO A CD   1 
ATOM   1265  H HA   . PRO A 1 94  ? -13.560 -10.638 -18.762 1.00 36.38 ? 94  PRO A HA   1 
ATOM   1266  H HB2  . PRO A 1 94  ? -14.152 -9.992  -16.085 1.00 40.83 ? 94  PRO A HB2  1 
ATOM   1267  H HB3  . PRO A 1 94  ? -13.312 -9.122  -17.130 1.00 40.83 ? 94  PRO A HB3  1 
ATOM   1268  H HG2  . PRO A 1 94  ? -15.656 -8.437  -16.626 1.00 46.42 ? 94  PRO A HG2  1 
ATOM   1269  H HG3  . PRO A 1 94  ? -15.141 -8.360  -18.134 1.00 46.42 ? 94  PRO A HG3  1 
ATOM   1270  H HD2  . PRO A 1 94  ? -16.841 -10.302 -17.008 1.00 40.34 ? 94  PRO A HD2  1 
ATOM   1271  H HD3  . PRO A 1 94  ? -16.910 -9.687  -18.489 1.00 40.34 ? 94  PRO A HD3  1 
ATOM   1272  N N    . HIS A 1 95  ? -12.219 -12.399 -17.688 1.00 30.44 ? 95  HIS A N    1 
ATOM   1273  C CA   . HIS A 1 95  ? -11.527 -13.546 -17.118 1.00 36.52 ? 95  HIS A CA   1 
ATOM   1274  C C    . HIS A 1 95  ? -11.616 -13.582 -15.597 1.00 33.99 ? 95  HIS A C    1 
ATOM   1275  O O    . HIS A 1 95  ? -11.683 -14.663 -15.011 1.00 34.31 ? 95  HIS A O    1 
ATOM   1276  C CB   . HIS A 1 95  ? -10.062 -13.537 -17.554 1.00 40.57 ? 95  HIS A CB   1 
ATOM   1277  C CG   . HIS A 1 95  ? -9.269  -14.701 -17.041 1.00 43.51 ? 95  HIS A CG   1 
ATOM   1278  N ND1  . HIS A 1 95  ? -9.856  -15.882 -16.631 1.00 45.95 ? 95  HIS A ND1  1 
ATOM   1279  C CD2  . HIS A 1 95  ? -7.934  -14.862 -16.858 1.00 45.97 ? 95  HIS A CD2  1 
ATOM   1280  C CE1  . HIS A 1 95  ? -8.917  -16.717 -16.217 1.00 44.36 ? 95  HIS A CE1  1 
ATOM   1281  N NE2  . HIS A 1 95  ? -7.743  -16.125 -16.345 1.00 45.77 ? 95  HIS A NE2  1 
ATOM   1282  H H    . HIS A 1 95  ? -11.762 -11.957 -18.267 1.00 36.51 ? 95  HIS A H    1 
ATOM   1283  H HA   . HIS A 1 95  ? -11.933 -14.358 -17.459 1.00 43.80 ? 95  HIS A HA   1 
ATOM   1284  H HB2  . HIS A 1 95  ? -10.024 -13.557 -18.523 1.00 48.66 ? 95  HIS A HB2  1 
ATOM   1285  H HB3  . HIS A 1 95  ? -9.644  -12.725 -17.226 1.00 48.66 ? 95  HIS A HB3  1 
ATOM   1286  H HD2  . HIS A 1 95  ? -7.273  -14.235 -17.042 1.00 55.14 ? 95  HIS A HD2  1 
ATOM   1287  H HE1  . HIS A 1 95  ? -9.060  -17.579 -15.896 1.00 53.21 ? 95  HIS A HE1  1 
ATOM   1288  H HE2  . HIS A 1 95  ? -6.982  -16.472 -16.145 1.00 54.90 ? 95  HIS A HE2  1 
ATOM   1289  N N    . GLN A 1 96  ? -11.629 -12.428 -14.933 1.00 36.62 ? 96  GLN A N    1 
ATOM   1290  C CA   . GLN A 1 96  ? -11.570 -12.458 -13.470 1.00 40.82 ? 96  GLN A CA   1 
ATOM   1291  C C    . GLN A 1 96  ? -12.859 -12.957 -12.832 1.00 31.88 ? 96  GLN A C    1 
ATOM   1292  O O    . GLN A 1 96  ? -12.863 -13.264 -11.639 1.00 35.06 ? 96  GLN A O    1 
ATOM   1293  C CB   . GLN A 1 96  ? -11.209 -11.070 -12.919 1.00 35.51 ? 96  GLN A CB   1 
ATOM   1294  C CG   . GLN A 1 96  ? -12.135 -9.955  -13.314 1.00 37.16 ? 96  GLN A CG   1 
ATOM   1295  C CD   . GLN A 1 96  ? -11.649 -8.585  -12.838 1.00 51.14 ? 96  GLN A CD   1 
ATOM   1296  O OE1  . GLN A 1 96  ? -10.652 -8.055  -13.341 1.00 58.10 ? 96  GLN A OE1  1 
ATOM   1297  N NE2  . GLN A 1 96  ? -12.350 -8.007  -11.860 1.00 61.12 ? 96  GLN A NE2  1 
ATOM   1298  H H    . GLN A 1 96  ? -11.669 -11.645 -15.286 1.00 43.92 ? 96  GLN A H    1 
ATOM   1299  H HA   . GLN A 1 96  ? -10.863 -13.067 -13.206 1.00 48.96 ? 96  GLN A HA   1 
ATOM   1300  H HB2  . GLN A 1 96  ? -11.207 -11.115 -11.950 1.00 42.59 ? 96  GLN A HB2  1 
ATOM   1301  H HB3  . GLN A 1 96  ? -10.322 -10.836 -13.234 1.00 42.59 ? 96  GLN A HB3  1 
ATOM   1302  H HG2  . GLN A 1 96  ? -12.204 -9.929  -14.281 1.00 44.57 ? 96  GLN A HG2  1 
ATOM   1303  H HG3  . GLN A 1 96  ? -13.008 -10.116 -12.923 1.00 44.57 ? 96  GLN A HG3  1 
ATOM   1304  H HE21 . GLN A 1 96  ? -13.039 -8.405  -11.532 1.00 73.32 ? 96  GLN A HE21 1 
ATOM   1305  H HE22 . GLN A 1 96  ? -12.115 -7.237  -11.559 1.00 73.32 ? 96  GLN A HE22 1 
ATOM   1306  N N    . PHE A 1 97  ? -13.938 -13.063 -13.582 1.00 32.48 ? 97  PHE A N    1 
ATOM   1307  C CA   . PHE A 1 97  ? -15.200 -13.520 -13.034 1.00 31.39 ? 97  PHE A CA   1 
ATOM   1308  C C    . PHE A 1 97  ? -15.555 -14.947 -13.423 1.00 33.55 ? 97  PHE A C    1 
ATOM   1309  O O    . PHE A 1 97  ? -16.472 -15.522 -12.823 1.00 29.82 ? 97  PHE A O    1 
ATOM   1310  C CB   . PHE A 1 97  ? -16.309 -12.557 -13.470 1.00 33.99 ? 97  PHE A CB   1 
ATOM   1311  C CG   . PHE A 1 97  ? -16.042 -11.139 -13.052 1.00 42.39 ? 97  PHE A CG   1 
ATOM   1312  C CD1  . PHE A 1 97  ? -15.552 -10.872 -11.786 1.00 50.72 ? 97  PHE A CD1  1 
ATOM   1313  C CD2  . PHE A 1 97  ? -16.223 -10.083 -13.929 1.00 47.16 ? 97  PHE A CD2  1 
ATOM   1314  C CE1  . PHE A 1 97  ? -15.273 -9.570  -11.387 1.00 50.68 ? 97  PHE A CE1  1 
ATOM   1315  C CE2  . PHE A 1 97  ? -15.953 -8.786  -13.543 1.00 46.10 ? 97  PHE A CE2  1 
ATOM   1316  C CZ   . PHE A 1 97  ? -15.472 -8.527  -12.270 1.00 47.10 ? 97  PHE A CZ   1 
ATOM   1317  H H    . PHE A 1 97  ? -13.967 -12.876 -14.421 1.00 38.96 ? 97  PHE A H    1 
ATOM   1318  H HA   . PHE A 1 97  ? -15.146 -13.486 -12.066 1.00 37.65 ? 97  PHE A HA   1 
ATOM   1319  H HB2  . PHE A 1 97  ? -16.382 -12.577 -14.437 1.00 40.77 ? 97  PHE A HB2  1 
ATOM   1320  H HB3  . PHE A 1 97  ? -17.146 -12.836 -13.067 1.00 40.77 ? 97  PHE A HB3  1 
ATOM   1321  H HD1  . PHE A 1 97  ? -15.415 -11.573 -11.191 1.00 60.85 ? 97  PHE A HD1  1 
ATOM   1322  H HD2  . PHE A 1 97  ? -16.544 -10.249 -14.786 1.00 56.57 ? 97  PHE A HD2  1 
ATOM   1323  H HE1  . PHE A 1 97  ? -14.954 -9.403  -10.530 1.00 60.79 ? 97  PHE A HE1  1 
ATOM   1324  H HE2  . PHE A 1 97  ? -16.088 -8.085  -14.140 1.00 55.30 ? 97  PHE A HE2  1 
ATOM   1325  H HZ   . PHE A 1 97  ? -15.292 -7.653  -12.007 1.00 56.49 ? 97  PHE A HZ   1 
ATOM   1326  N N    . ILE A 1 98  ? -14.853 -15.550 -14.387 1.00 29.33 ? 98  ILE A N    1 
ATOM   1327  C CA   . ILE A 1 98  ? -15.321 -16.833 -14.908 1.00 30.16 ? 98  ILE A CA   1 
ATOM   1328  C C    . ILE A 1 98  ? -15.314 -17.877 -13.797 1.00 29.86 ? 98  ILE A C    1 
ATOM   1329  O O    . ILE A 1 98  ? -16.189 -18.748 -13.739 1.00 26.10 ? 98  ILE A O    1 
ATOM   1330  C CB   . ILE A 1 98  ? -14.489 -17.276 -16.132 1.00 30.43 ? 98  ILE A CB   1 
ATOM   1331  C CG1  . ILE A 1 98  ? -15.108 -18.516 -16.799 1.00 27.45 ? 98  ILE A CG1  1 
ATOM   1332  C CG2  . ILE A 1 98  ? -13.064 -17.600 -15.736 1.00 32.43 ? 98  ILE A CG2  1 
ATOM   1333  C CD1  . ILE A 1 98  ? -16.500 -18.289 -17.416 1.00 30.08 ? 98  ILE A CD1  1 
ATOM   1334  H H    . ILE A 1 98  ? -14.131 -15.249 -14.744 1.00 35.18 ? 98  ILE A H    1 
ATOM   1335  H HA   . ILE A 1 98  ? -16.239 -16.729 -15.203 1.00 36.17 ? 98  ILE A HA   1 
ATOM   1336  H HB   . ILE A 1 98  ? -14.475 -16.552 -16.777 1.00 36.50 ? 98  ILE A HB   1 
ATOM   1337  H HG12 . ILE A 1 98  ? -14.517 -18.813 -17.509 1.00 32.91 ? 98  ILE A HG12 1 
ATOM   1338  H HG13 . ILE A 1 98  ? -15.193 -19.215 -16.133 1.00 32.91 ? 98  ILE A HG13 1 
ATOM   1339  H HG21 . ILE A 1 98  ? -12.571 -17.874 -16.526 1.00 38.89 ? 98  ILE A HG21 1 
ATOM   1340  H HG22 . ILE A 1 98  ? -12.657 -16.809 -15.349 1.00 38.89 ? 98  ILE A HG22 1 
ATOM   1341  H HG23 . ILE A 1 98  ? -13.073 -18.320 -15.086 1.00 38.89 ? 98  ILE A HG23 1 
ATOM   1342  H HD11 . ILE A 1 98  ? -16.809 -19.119 -17.811 1.00 36.08 ? 98  ILE A HD11 1 
ATOM   1343  H HD12 . ILE A 1 98  ? -17.112 -18.006 -16.719 1.00 36.08 ? 98  ILE A HD12 1 
ATOM   1344  H HD13 . ILE A 1 98  ? -16.435 -17.602 -18.098 1.00 36.08 ? 98  ILE A HD13 1 
ATOM   1345  N N    . GLY A 1 99  ? -14.367 -17.787 -12.872 1.00 25.59 ? 99  GLY A N    1 
ATOM   1346  C CA   . GLY A 1 99  ? -14.324 -18.756 -11.791 1.00 28.41 ? 99  GLY A CA   1 
ATOM   1347  C C    . GLY A 1 99  ? -15.581 -18.722 -10.951 1.00 31.21 ? 99  GLY A C    1 
ATOM   1348  O O    . GLY A 1 99  ? -16.189 -19.761 -10.672 1.00 26.42 ? 99  GLY A O    1 
ATOM   1349  H H    . GLY A 1 99  ? -13.751 -17.187 -12.849 1.00 30.69 ? 99  GLY A H    1 
ATOM   1350  H HA2  . GLY A 1 99  ? -14.223 -19.648 -12.159 1.00 34.07 ? 99  GLY A HA2  1 
ATOM   1351  H HA3  . GLY A 1 99  ? -13.564 -18.570 -11.218 1.00 34.07 ? 99  GLY A HA3  1 
ATOM   1352  N N    . LYS A 1 100 ? -15.988 -17.519 -10.549 1.00 26.61 ? 100 LYS A N    1 
ATOM   1353  C CA   . LYS A 1 100 ? -17.159 -17.339 -9.704  1.00 29.30 ? 100 LYS A CA   1 
ATOM   1354  C C    . LYS A 1 100 ? -18.435 -17.735 -10.435 1.00 28.77 ? 100 LYS A C    1 
ATOM   1355  O O    . LYS A 1 100 ? -19.326 -18.360 -9.851  1.00 25.02 ? 100 LYS A O    1 
ATOM   1356  C CB   . LYS A 1 100 ? -17.234 -15.880 -9.236  1.00 31.64 ? 100 LYS A CB   1 
ATOM   1357  H H    . LYS A 1 100 ? -15.595 -16.783 -10.757 1.00 31.91 ? 100 LYS A H    1 
ATOM   1358  H HA   . LYS A 1 100 ? -17.074 -17.903 -8.920  1.00 35.14 ? 100 LYS A HA   1 
ATOM   1359  N N    . ILE A 1 101 ? -18.538 -17.389 -11.717 1.00 24.28 ? 101 ILE A N    1 
ATOM   1360  C CA   . ILE A 1 101 ? -19.703 -17.799 -12.499 1.00 26.86 ? 101 ILE A CA   1 
ATOM   1361  C C    . ILE A 1 101 ? -19.804 -19.319 -12.562 1.00 24.59 ? 101 ILE A C    1 
ATOM   1362  O O    . ILE A 1 101 ? -20.876 -19.896 -12.348 1.00 24.86 ? 101 ILE A O    1 
ATOM   1363  C CB   . ILE A 1 101 ? -19.640 -17.169 -13.902 1.00 26.26 ? 101 ILE A CB   1 
ATOM   1364  C CG1  . ILE A 1 101 ? -20.044 -15.712 -13.792 1.00 29.01 ? 101 ILE A CG1  1 
ATOM   1365  C CG2  . ILE A 1 101 ? -20.520 -17.915 -14.897 1.00 33.62 ? 101 ILE A CG2  1 
ATOM   1366  C CD1  . ILE A 1 101 ? -19.425 -14.881 -14.830 1.00 41.66 ? 101 ILE A CD1  1 
ATOM   1367  H H    . ILE A 1 101 ? -17.959 -16.924 -12.150 1.00 29.12 ? 101 ILE A H    1 
ATOM   1368  H HA   . ILE A 1 101 ? -20.503 -17.469 -12.063 1.00 32.20 ? 101 ILE A HA   1 
ATOM   1369  H HB   . ILE A 1 101 ? -18.722 -17.210 -14.215 1.00 31.49 ? 101 ILE A HB   1 
ATOM   1370  H HG12 . ILE A 1 101 ? -21.007 -15.642 -13.884 1.00 34.79 ? 101 ILE A HG12 1 
ATOM   1371  H HG13 . ILE A 1 101 ? -19.766 -15.370 -12.927 1.00 34.79 ? 101 ILE A HG13 1 
ATOM   1372  H HG21 . ILE A 1 101 ? -20.450 -17.485 -15.764 1.00 40.32 ? 101 ILE A HG21 1 
ATOM   1373  H HG22 . ILE A 1 101 ? -20.218 -18.835 -14.958 1.00 40.32 ? 101 ILE A HG22 1 
ATOM   1374  H HG23 . ILE A 1 101 ? -21.439 -17.888 -14.588 1.00 40.32 ? 101 ILE A HG23 1 
ATOM   1375  H HD11 . ILE A 1 101 ? -19.716 -13.963 -14.714 1.00 49.97 ? 101 ILE A HD11 1 
ATOM   1376  H HD12 . ILE A 1 101 ? -18.461 -14.936 -14.745 1.00 49.97 ? 101 ILE A HD12 1 
ATOM   1377  H HD13 . ILE A 1 101 ? -19.700 -15.208 -15.701 1.00 49.97 ? 101 ILE A HD13 1 
ATOM   1378  N N    . CYS A 1 102 ? -18.697 -19.997 -12.872 1.00 22.07 ? 102 CYS A N    1 
ATOM   1379  C CA   . CYS A 1 102 ? -18.758 -21.447 -12.955 1.00 25.03 ? 102 CYS A CA   1 
ATOM   1380  C C    . CYS A 1 102 ? -19.135 -22.050 -11.604 1.00 23.58 ? 102 CYS A C    1 
ATOM   1381  O O    . CYS A 1 102 ? -19.895 -23.025 -11.540 1.00 25.07 ? 102 CYS A O    1 
ATOM   1382  C CB   . CYS A 1 102 ? -17.432 -21.999 -13.481 1.00 23.98 ? 102 CYS A CB   1 
ATOM   1383  S SG   . CYS A 1 102 ? -17.170 -21.601 -15.243 1.00 30.63 ? 102 CYS A SG   1 
ATOM   1384  H H    . CYS A 1 102 ? -17.927 -19.651 -13.034 1.00 26.46 ? 102 CYS A H    1 
ATOM   1385  H HA   . CYS A 1 102 ? -19.451 -21.693 -13.588 1.00 30.02 ? 102 CYS A HA   1 
ATOM   1386  H HB2  . CYS A 1 102 ? -16.703 -21.612 -12.973 1.00 28.76 ? 102 CYS A HB2  1 
ATOM   1387  H HB3  . CYS A 1 102 ? -17.430 -22.964 -13.386 1.00 28.76 ? 102 CYS A HB3  1 
ATOM   1388  H HG   . CYS A 1 102 ? -16.118 -22.059 -15.595 1.00 36.73 ? 102 CYS A HG   1 
ATOM   1389  N N    . ASP A 1 103 ? -18.670 -21.455 -10.506 1.00 24.09 ? 103 ASP A N    1 
ATOM   1390  C CA   . ASP A 1 103 ? -19.040 -21.995 -9.197  1.00 23.04 ? 103 ASP A CA   1 
ATOM   1391  C C    . ASP A 1 103 ? -20.541 -21.868 -8.921  1.00 22.35 ? 103 ASP A C    1 
ATOM   1392  O O    . ASP A 1 103 ? -21.128 -22.735 -8.267  1.00 24.80 ? 103 ASP A O    1 
ATOM   1393  C CB   . ASP A 1 103 ? -18.236 -21.315 -8.098  1.00 29.20 ? 103 ASP A CB   1 
ATOM   1394  C CG   . ASP A 1 103 ? -16.737 -21.685 -8.137  1.00 31.14 ? 103 ASP A CG   1 
ATOM   1395  O OD1  . ASP A 1 103 ? -16.354 -22.745 -8.687  1.00 31.86 ? 103 ASP A OD1  1 
ATOM   1396  O OD2  . ASP A 1 103 ? -15.941 -20.894 -7.609  1.00 33.22 ? 103 ASP A OD2  1 
ATOM   1397  H H    . ASP A 1 103 ? -18.159 -20.763 -10.488 1.00 28.88 ? 103 ASP A H    1 
ATOM   1398  H HA   . ASP A 1 103 ? -18.818 -22.939 -9.179  1.00 27.62 ? 103 ASP A HA   1 
ATOM   1399  H HB2  . ASP A 1 103 ? -18.311 -20.353 -8.202  1.00 35.02 ? 103 ASP A HB2  1 
ATOM   1400  H HB3  . ASP A 1 103 ? -18.590 -21.584 -7.236  1.00 35.02 ? 103 ASP A HB3  1 
ATOM   1401  N N    . GLN A 1 104 ? -21.186 -20.812 -9.407  1.00 28.04 ? 104 GLN A N    1 
ATOM   1402  C CA   . GLN A 1 104 ? -22.630 -20.714 -9.219  1.00 23.49 ? 104 GLN A CA   1 
ATOM   1403  C C    . GLN A 1 104 ? -23.380 -21.663 -10.141 1.00 26.58 ? 104 GLN A C    1 
ATOM   1404  O O    . GLN A 1 104 ? -24.504 -22.062 -9.817  1.00 26.34 ? 104 GLN A O    1 
ATOM   1405  C CB   . GLN A 1 104 ? -23.131 -19.297 -9.473  1.00 26.11 ? 104 GLN A CB   1 
ATOM   1406  C CG   . GLN A 1 104 ? -22.512 -18.252 -8.582  1.00 34.30 ? 104 GLN A CG   1 
ATOM   1407  C CD   . GLN A 1 104 ? -23.184 -16.897 -8.743  1.00 41.57 ? 104 GLN A CD   1 
ATOM   1408  O OE1  . GLN A 1 104 ? -23.574 -16.508 -9.841  1.00 45.28 ? 104 GLN A OE1  1 
ATOM   1409  N NE2  . GLN A 1 104 ? -23.331 -16.181 -7.642  1.00 53.88 ? 104 GLN A NE2  1 
ATOM   1410  H H    . GLN A 1 104 ? -20.826 -20.159 -9.835  1.00 33.63 ? 104 GLN A H    1 
ATOM   1411  H HA   . GLN A 1 104 ? -22.846 -20.950 -8.303  1.00 28.16 ? 104 GLN A HA   1 
ATOM   1412  H HB2  . GLN A 1 104 ? -22.932 -19.056 -10.391 1.00 31.31 ? 104 GLN A HB2  1 
ATOM   1413  H HB3  . GLN A 1 104 ? -24.090 -19.276 -9.329  1.00 31.31 ? 104 GLN A HB3  1 
ATOM   1414  H HG2  . GLN A 1 104 ? -22.603 -18.527 -7.656  1.00 41.14 ? 104 GLN A HG2  1 
ATOM   1415  H HG3  . GLN A 1 104 ? -21.574 -18.154 -8.810  1.00 41.14 ? 104 GLN A HG3  1 
ATOM   1416  H HE21 . GLN A 1 104 ? -23.047 -16.486 -6.889  1.00 64.63 ? 104 GLN A HE21 1 
ATOM   1417  H HE22 . GLN A 1 104 ? -23.706 -15.408 -7.678  1.00 64.63 ? 104 GLN A HE22 1 
ATOM   1418  N N    . LEU A 1 105 ? -22.809 -21.989 -11.313 1.00 20.77 ? 105 LEU A N    1 
ATOM   1419  C CA   . LEU A 1 105 ? -23.521 -22.785 -12.309 1.00 21.20 ? 105 LEU A CA   1 
ATOM   1420  C C    . LEU A 1 105 ? -23.316 -24.280 -12.122 1.00 21.80 ? 105 LEU A C    1 
ATOM   1421  O O    . LEU A 1 105 ? -24.131 -25.082 -12.611 1.00 19.82 ? 105 LEU A O    1 
ATOM   1422  C CB   . LEU A 1 105 ? -23.081 -22.397 -13.736 1.00 21.10 ? 105 LEU A CB   1 
ATOM   1423  C CG   . LEU A 1 105 ? -23.553 -21.062 -14.309 1.00 24.42 ? 105 LEU A CG   1 
ATOM   1424  C CD1  . LEU A 1 105 ? -22.951 -20.785 -15.694 1.00 18.56 ? 105 LEU A CD1  1 
ATOM   1425  C CD2  . LEU A 1 105 ? -25.092 -20.949 -14.367 1.00 24.15 ? 105 LEU A CD2  1 
ATOM   1426  H H    . LEU A 1 105 ? -22.014 -21.759 -11.548 1.00 24.90 ? 105 LEU A H    1 
ATOM   1427  H HA   . LEU A 1 105 ? -24.471 -22.605 -12.232 1.00 25.42 ? 105 LEU A HA   1 
ATOM   1428  H HB2  . LEU A 1 105 ? -22.112 -22.382 -13.752 1.00 25.30 ? 105 LEU A HB2  1 
ATOM   1429  H HB3  . LEU A 1 105 ? -23.396 -23.088 -14.340 1.00 25.30 ? 105 LEU A HB3  1 
ATOM   1430  H HG   . LEU A 1 105 ? -23.241 -20.358 -13.719 1.00 29.28 ? 105 LEU A HG   1 
ATOM   1431  H HD11 . LEU A 1 105 ? -23.279 -19.930 -16.015 1.00 22.25 ? 105 LEU A HD11 1 
ATOM   1432  H HD12 . LEU A 1 105 ? -21.984 -20.762 -15.619 1.00 22.25 ? 105 LEU A HD12 1 
ATOM   1433  H HD13 . LEU A 1 105 ? -23.220 -21.492 -16.302 1.00 22.25 ? 105 LEU A HD13 1 
ATOM   1434  H HD21 . LEU A 1 105 ? -25.332 -20.085 -14.737 1.00 28.95 ? 105 LEU A HD21 1 
ATOM   1435  H HD22 . LEU A 1 105 ? -25.440 -21.658 -14.930 1.00 28.95 ? 105 LEU A HD22 1 
ATOM   1436  H HD23 . LEU A 1 105 ? -25.449 -21.035 -13.468 1.00 28.95 ? 105 LEU A HD23 1 
ATOM   1437  N N    . LYS A 1 106 ? -22.249 -24.670 -11.442 1.00 21.75 ? 106 LYS A N    1 
ATOM   1438  C CA   . LYS A 1 106 ? -21.909 -26.075 -11.252 1.00 20.58 ? 106 LYS A CA   1 
ATOM   1439  C C    . LYS A 1 106 ? -23.110 -26.884 -10.779 1.00 18.99 ? 106 LYS A C    1 
ATOM   1440  O O    . LYS A 1 106 ? -23.689 -26.599 -9.723  1.00 21.43 ? 106 LYS A O    1 
ATOM   1441  C CB   . LYS A 1 106 ? -20.763 -26.168 -10.234 1.00 21.27 ? 106 LYS A CB   1 
ATOM   1442  C CG   . LYS A 1 106 ? -20.256 -27.602 -10.008 1.00 24.69 ? 106 LYS A CG   1 
ATOM   1443  C CD   . LYS A 1 106 ? -19.019 -27.639 -9.076  1.00 25.84 ? 106 LYS A CD   1 
ATOM   1444  C CE   . LYS A 1 106 ? -18.640 -29.090 -8.798  1.00 30.30 ? 106 LYS A CE   1 
ATOM   1445  N NZ   . LYS A 1 106 ? -17.413 -29.284 -7.951  1.00 29.39 ? 106 LYS A NZ   1 
ATOM   1446  H H    . LYS A 1 106 ? -21.692 -24.128 -11.072 1.00 26.08 ? 106 LYS A H    1 
ATOM   1447  H HA   . LYS A 1 106 ? -21.601 -26.448 -12.093 1.00 24.67 ? 106 LYS A HA   1 
ATOM   1448  H HB2  . LYS A 1 106 ? -20.017 -25.636 -10.552 1.00 25.50 ? 106 LYS A HB2  1 
ATOM   1449  H HB3  . LYS A 1 106 ? -21.073 -25.825 -9.381  1.00 25.50 ? 106 LYS A HB3  1 
ATOM   1450  H HG2  . LYS A 1 106 ? -20.960 -28.128 -9.598  1.00 29.60 ? 106 LYS A HG2  1 
ATOM   1451  H HG3  . LYS A 1 106 ? -20.004 -27.989 -10.861 1.00 29.60 ? 106 LYS A HG3  1 
ATOM   1452  H HD2  . LYS A 1 106 ? -18.271 -27.199 -9.509  1.00 30.98 ? 106 LYS A HD2  1 
ATOM   1453  H HD3  . LYS A 1 106 ? -19.231 -27.206 -8.234  1.00 30.98 ? 106 LYS A HD3  1 
ATOM   1454  H HE2  . LYS A 1 106 ? -19.380 -29.519 -8.341  1.00 36.34 ? 106 LYS A HE2  1 
ATOM   1455  H HE3  . LYS A 1 106 ? -18.481 -29.534 -9.646  1.00 36.34 ? 106 LYS A HE3  1 
ATOM   1456  H HZ1  . LYS A 1 106 ? -17.259 -30.153 -7.834  1.00 35.25 ? 106 LYS A HZ1  1 
ATOM   1457  H HZ2  . LYS A 1 106 ? -16.708 -28.915 -8.348  1.00 35.25 ? 106 LYS A HZ2  1 
ATOM   1458  H HZ3  . LYS A 1 106 ? -17.530 -28.902 -7.155  1.00 35.25 ? 106 LYS A HZ3  1 
ATOM   1459  N N    . GLY A 1 107 ? -23.467 -27.913 -11.552 1.00 17.85 ? 107 GLY A N    1 
ATOM   1460  C CA   . GLY A 1 107 ? -24.534 -28.813 -11.156 1.00 18.16 ? 107 GLY A CA   1 
ATOM   1461  C C    . GLY A 1 107 ? -25.929 -28.321 -11.460 1.00 21.62 ? 107 GLY A C    1 
ATOM   1462  O O    . GLY A 1 107 ? -26.900 -29.026 -11.147 1.00 22.00 ? 107 GLY A O    1 
ATOM   1463  H H    . GLY A 1 107 ? -23.104 -28.105 -12.307 1.00 21.40 ? 107 GLY A H    1 
ATOM   1464  H HA2  . GLY A 1 107 ? -24.412 -29.663 -11.607 1.00 21.77 ? 107 GLY A HA2  1 
ATOM   1465  H HA3  . GLY A 1 107 ? -24.475 -28.969 -10.200 1.00 21.77 ? 107 GLY A HA3  1 
ATOM   1466  N N    . HIS A 1 108 ? -26.066 -27.162 -12.104 1.00 21.95 ? 108 HIS A N    1 
ATOM   1467  C CA   . HIS A 1 108 ? -27.379 -26.563 -12.377 1.00 21.66 ? 108 HIS A CA   1 
ATOM   1468  C C    . HIS A 1 108 ? -27.703 -26.459 -13.866 1.00 26.88 ? 108 HIS A C    1 
ATOM   1469  O O    . HIS A 1 108 ? -28.648 -25.750 -14.240 1.00 25.42 ? 108 HIS A O    1 
ATOM   1470  C CB   . HIS A 1 108 ? -27.453 -25.178 -11.739 1.00 21.38 ? 108 HIS A CB   1 
ATOM   1471  C CG   . HIS A 1 108 ? -27.347 -25.222 -10.255 1.00 26.78 ? 108 HIS A CG   1 
ATOM   1472  N ND1  . HIS A 1 108 ? -28.322 -25.794 -9.467  1.00 24.08 ? 108 HIS A ND1  1 
ATOM   1473  C CD2  . HIS A 1 108 ? -26.368 -24.817 -9.416  1.00 24.43 ? 108 HIS A CD2  1 
ATOM   1474  C CE1  . HIS A 1 108 ? -27.961 -25.711 -8.198  1.00 27.04 ? 108 HIS A CE1  1 
ATOM   1475  N NE2  . HIS A 1 108 ? -26.782 -25.122 -8.139  1.00 26.38 ? 108 HIS A NE2  1 
ATOM   1476  H H    . HIS A 1 108 ? -25.407 -26.695 -12.398 1.00 26.32 ? 108 HIS A H    1 
ATOM   1477  H HA   . HIS A 1 108 ? -28.063 -27.114 -11.965 1.00 25.97 ? 108 HIS A HA   1 
ATOM   1478  H HB2  . HIS A 1 108 ? -26.723 -24.636 -12.077 1.00 25.64 ? 108 HIS A HB2  1 
ATOM   1479  H HB3  . HIS A 1 108 ? -28.303 -24.770 -11.967 1.00 25.64 ? 108 HIS A HB3  1 
ATOM   1480  H HD2  . HIS A 1 108 ? -25.575 -24.394 -9.654  1.00 29.30 ? 108 HIS A HD2  1 
ATOM   1481  H HE1  . HIS A 1 108 ? -28.453 -26.018 -7.471  1.00 32.43 ? 108 HIS A HE1  1 
ATOM   1482  H HE2  . HIS A 1 108 ? -26.340 -24.960 -7.419  1.00 31.64 ? 108 HIS A HE2  1 
ATOM   1483  N N    . LEU A 1 109 ? -26.972 -27.162 -14.718 1.00 22.41 ? 109 LEU A N    1 
ATOM   1484  C CA   . LEU A 1 109 ? -27.134 -27.042 -16.158 1.00 22.60 ? 109 LEU A CA   1 
ATOM   1485  C C    . LEU A 1 109 ? -28.012 -28.151 -16.698 1.00 24.99 ? 109 LEU A C    1 
ATOM   1486  O O    . LEU A 1 109 ? -28.099 -29.243 -16.130 1.00 24.35 ? 109 LEU A O    1 
ATOM   1487  C CB   . LEU A 1 109 ? -25.767 -27.055 -16.856 1.00 25.11 ? 109 LEU A CB   1 
ATOM   1488  C CG   . LEU A 1 109 ? -24.807 -25.937 -16.384 1.00 24.34 ? 109 LEU A CG   1 
ATOM   1489  C CD1  . LEU A 1 109 ? -23.494 -25.946 -17.151 1.00 24.28 ? 109 LEU A CD1  1 
ATOM   1490  C CD2  . LEU A 1 109 ? -25.481 -24.593 -16.509 1.00 23.35 ? 109 LEU A CD2  1 
ATOM   1491  H H    . LEU A 1 109 ? -26.365 -27.724 -14.482 1.00 26.87 ? 109 LEU A H    1 
ATOM   1492  H HA   . LEU A 1 109 ? -27.564 -26.196 -16.358 1.00 27.10 ? 109 LEU A HA   1 
ATOM   1493  H HB2  . LEU A 1 109 ? -25.337 -27.907 -16.683 1.00 30.11 ? 109 LEU A HB2  1 
ATOM   1494  H HB3  . LEU A 1 109 ? -25.904 -26.944 -17.810 1.00 30.11 ? 109 LEU A HB3  1 
ATOM   1495  H HG   . LEU A 1 109 ? -24.602 -26.078 -15.447 1.00 29.19 ? 109 LEU A HG   1 
ATOM   1496  H HD11 . LEU A 1 109 ? -22.930 -25.230 -16.820 1.00 29.11 ? 109 LEU A HD11 1 
ATOM   1497  H HD12 . LEU A 1 109 ? -23.057 -26.802 -17.017 1.00 29.11 ? 109 LEU A HD12 1 
ATOM   1498  H HD13 . LEU A 1 109 ? -23.679 -25.813 -18.094 1.00 29.11 ? 109 LEU A HD13 1 
ATOM   1499  H HD21 . LEU A 1 109 ? -24.868 -23.903 -16.210 1.00 28.00 ? 109 LEU A HD21 1 
ATOM   1500  H HD22 . LEU A 1 109 ? -25.719 -24.445 -17.438 1.00 28.00 ? 109 LEU A HD22 1 
ATOM   1501  H HD23 . LEU A 1 109 ? -26.279 -24.588 -15.958 1.00 28.00 ? 109 LEU A HD23 1 
ATOM   1502  N N    . LYS A 1 110 ? -28.673 -27.852 -17.810 1.00 23.62 ? 110 LYS A N    1 
ATOM   1503  C CA   . LYS A 1 110 ? -29.495 -28.830 -18.506 1.00 22.93 ? 110 LYS A CA   1 
ATOM   1504  C C    . LYS A 1 110 ? -28.655 -30.007 -18.980 1.00 25.12 ? 110 LYS A C    1 
ATOM   1505  O O    . LYS A 1 110 ? -27.485 -29.863 -19.337 1.00 21.38 ? 110 LYS A O    1 
ATOM   1506  C CB   . LYS A 1 110 ? -30.167 -28.173 -19.699 1.00 25.17 ? 110 LYS A CB   1 
ATOM   1507  C CG   . LYS A 1 110 ? -31.197 -29.016 -20.424 1.00 32.08 ? 110 LYS A CG   1 
ATOM   1508  C CD   . LYS A 1 110 ? -31.746 -28.205 -21.600 1.00 31.65 ? 110 LYS A CD   1 
ATOM   1509  C CE   . LYS A 1 110 ? -32.747 -28.955 -22.454 1.00 32.82 ? 110 LYS A CE   1 
ATOM   1510  N NZ   . LYS A 1 110 ? -33.316 -28.007 -23.467 1.00 36.84 ? 110 LYS A NZ   1 
ATOM   1511  H H    . LYS A 1 110 ? -28.662 -27.078 -18.185 1.00 28.33 ? 110 LYS A H    1 
ATOM   1512  H HA   . LYS A 1 110 ? -30.182 -29.162 -17.908 1.00 27.50 ? 110 LYS A HA   1 
ATOM   1513  H HB2  . LYS A 1 110 ? -30.614 -27.368 -19.393 1.00 30.18 ? 110 LYS A HB2  1 
ATOM   1514  H HB3  . LYS A 1 110 ? -29.482 -27.935 -20.343 1.00 30.18 ? 110 LYS A HB3  1 
ATOM   1515  H HG2  . LYS A 1 110 ? -30.781 -29.822 -20.767 1.00 38.47 ? 110 LYS A HG2  1 
ATOM   1516  H HG3  . LYS A 1 110 ? -31.928 -29.231 -19.824 1.00 38.47 ? 110 LYS A HG3  1 
ATOM   1517  H HD2  . LYS A 1 110 ? -32.187 -27.413 -21.254 1.00 37.96 ? 110 LYS A HD2  1 
ATOM   1518  H HD3  . LYS A 1 110 ? -31.006 -27.944 -22.171 1.00 37.96 ? 110 LYS A HD3  1 
ATOM   1519  H HE2  . LYS A 1 110 ? -32.304 -29.681 -22.920 1.00 39.37 ? 110 LYS A HE2  1 
ATOM   1520  H HE3  . LYS A 1 110 ? -33.468 -29.290 -21.899 1.00 39.37 ? 110 LYS A HE3  1 
ATOM   1521  H HZ1  . LYS A 1 110 ? -33.908 -28.430 -23.980 1.00 44.18 ? 110 LYS A HZ1  1 
ATOM   1522  H HZ2  . LYS A 1 110 ? -33.721 -27.330 -23.055 1.00 44.18 ? 110 LYS A HZ2  1 
ATOM   1523  H HZ3  . LYS A 1 110 ? -32.665 -27.685 -23.981 1.00 44.18 ? 110 LYS A HZ3  1 
ATOM   1524  N N    . ALA A 1 111 ? -29.259 -31.191 -18.986 1.00 23.61 ? 111 ALA A N    1 
ATOM   1525  C CA   . ALA A 1 111 ? -28.536 -32.369 -19.454 1.00 25.39 ? 111 ALA A CA   1 
ATOM   1526  C C    . ALA A 1 111 ? -28.034 -32.116 -20.868 1.00 25.79 ? 111 ALA A C    1 
ATOM   1527  O O    . ALA A 1 111 ? -28.710 -31.478 -21.673 1.00 23.57 ? 111 ALA A O    1 
ATOM   1528  C CB   . ALA A 1 111 ? -29.429 -33.615 -19.425 1.00 28.54 ? 111 ALA A CB   1 
ATOM   1529  H H    . ALA A 1 111 ? -30.067 -31.338 -18.732 1.00 28.31 ? 111 ALA A H    1 
ATOM   1530  H HA   . ALA A 1 111 ? -27.770 -32.527 -18.880 1.00 30.45 ? 111 ALA A HA   1 
ATOM   1531  H HB1  . ALA A 1 111 ? -28.919 -34.377 -19.741 1.00 34.23 ? 111 ALA A HB1  1 
ATOM   1532  H HB2  . ALA A 1 111 ? -29.726 -33.769 -18.514 1.00 34.23 ? 111 ALA A HB2  1 
ATOM   1533  H HB3  . ALA A 1 111 ? -30.195 -33.467 -20.002 1.00 34.23 ? 111 ALA A HB3  1 
ATOM   1534  N N    . ASN A 1 112 ? -26.821 -32.575 -21.158 1.00 23.13 ? 112 ASN A N    1 
ATOM   1535  C CA   . ASN A 1 112 ? -26.212 -32.480 -22.478 1.00 25.10 ? 112 ASN A CA   1 
ATOM   1536  C C    . ASN A 1 112 ? -25.885 -31.047 -22.913 1.00 26.04 ? 112 ASN A C    1 
ATOM   1537  O O    . ASN A 1 112 ? -25.521 -30.830 -24.069 1.00 28.59 ? 112 ASN A O    1 
ATOM   1538  C CB   . ASN A 1 112 ? -27.113 -33.162 -23.504 1.00 27.03 ? 112 ASN A CB   1 
ATOM   1539  C CG   . ASN A 1 112 ? -27.449 -34.592 -23.101 1.00 30.11 ? 112 ASN A CG   1 
ATOM   1540  O OD1  . ASN A 1 112 ? -26.577 -35.348 -22.654 1.00 30.37 ? 112 ASN A OD1  1 
ATOM   1541  N ND2  . ASN A 1 112 ? -28.716 -34.955 -23.220 1.00 31.17 ? 112 ASN A ND2  1 
ATOM   1542  H H    . ASN A 1 112 ? -26.314 -32.961 -20.581 1.00 27.74 ? 112 ASN A H    1 
ATOM   1543  H HA   . ASN A 1 112 ? -25.375 -32.970 -22.460 1.00 30.10 ? 112 ASN A HA   1 
ATOM   1544  H HB2  . ASN A 1 112 ? -27.943 -32.666 -23.580 1.00 32.41 ? 112 ASN A HB2  1 
ATOM   1545  H HB3  . ASN A 1 112 ? -26.659 -33.188 -24.361 1.00 32.41 ? 112 ASN A HB3  1 
ATOM   1546  H HD21 . ASN A 1 112 ? -28.957 -35.751 -23.003 1.00 37.38 ? 112 ASN A HD21 1 
ATOM   1547  H HD22 . ASN A 1 112 ? -29.295 -34.399 -23.529 1.00 37.38 ? 112 ASN A HD22 1 
ATOM   1548  N N    . ALA A 1 113 ? -26.002 -30.068 -22.031 1.00 23.72 ? 113 ALA A N    1 
ATOM   1549  C CA   . ALA A 1 113 ? -25.634 -28.699 -22.382 1.00 25.53 ? 113 ALA A CA   1 
ATOM   1550  C C    . ALA A 1 113 ? -24.176 -28.617 -22.829 1.00 29.07 ? 113 ALA A C    1 
ATOM   1551  O O    . ALA A 1 113 ? -23.318 -29.370 -22.361 1.00 21.41 ? 113 ALA A O    1 
ATOM   1552  C CB   . ALA A 1 113 ? -25.827 -27.766 -21.196 1.00 26.01 ? 113 ALA A CB   1 
ATOM   1553  H H    . ALA A 1 113 ? -26.291 -30.165 -21.226 1.00 28.44 ? 113 ALA A H    1 
ATOM   1554  H HA   . ALA A 1 113 ? -26.196 -28.391 -23.110 1.00 30.62 ? 113 ALA A HA   1 
ATOM   1555  H HB1  . ALA A 1 113 ? -25.575 -26.867 -21.458 1.00 31.19 ? 113 ALA A HB1  1 
ATOM   1556  H HB2  . ALA A 1 113 ? -26.760 -27.785 -20.929 1.00 31.19 ? 113 ALA A HB2  1 
ATOM   1557  H HB3  . ALA A 1 113 ? -25.267 -28.067 -20.463 1.00 31.19 ? 113 ALA A HB3  1 
ATOM   1558  N N    . THR A 1 114 ? -23.889 -27.656 -23.713 1.00 24.08 ? 114 THR A N    1 
ATOM   1559  C CA   . THR A 1 114 ? -22.536 -27.460 -24.221 1.00 22.38 ? 114 THR A CA   1 
ATOM   1560  C C    . THR A 1 114 ? -22.169 -25.990 -24.137 1.00 20.11 ? 114 THR A C    1 
ATOM   1561  O O    . THR A 1 114 ? -23.028 -25.120 -24.034 1.00 16.54 ? 114 THR A O    1 
ATOM   1562  C CB   . THR A 1 114 ? -22.384 -27.917 -25.679 1.00 28.97 ? 114 THR A CB   1 
ATOM   1563  O OG1  . THR A 1 114 ? -23.241 -27.124 -26.494 1.00 27.09 ? 114 THR A OG1  1 
ATOM   1564  C CG2  . THR A 1 114 ? -22.746 -29.395 -25.856 1.00 27.05 ? 114 THR A CG2  1 
ATOM   1565  H H    . THR A 1 114 ? -24.465 -27.105 -24.034 1.00 28.87 ? 114 THR A H    1 
ATOM   1566  H HA   . THR A 1 114 ? -21.911 -27.963 -23.675 1.00 26.84 ? 114 THR A HA   1 
ATOM   1567  H HB   . THR A 1 114 ? -21.465 -27.792 -25.962 1.00 34.74 ? 114 THR A HB   1 
ATOM   1568  H HG1  . THR A 1 114 ? -23.173 -27.359 -27.298 1.00 32.49 ? 114 THR A HG1  1 
ATOM   1569  H HG21 . THR A 1 114 ? -22.641 -29.653 -26.785 1.00 32.44 ? 114 THR A HG21 1 
ATOM   1570  H HG22 . THR A 1 114 ? -22.166 -29.946 -25.308 1.00 32.44 ? 114 THR A HG22 1 
ATOM   1571  H HG23 . THR A 1 114 ? -23.667 -29.544 -25.590 1.00 32.44 ? 114 THR A HG23 1 
ATOM   1572  N N    . GLY A 1 115 ? -20.873 -25.718 -24.228 1.00 17.63 ? 115 GLY A N    1 
ATOM   1573  C CA   . GLY A 1 115 ? -20.370 -24.378 -24.012 1.00 19.73 ? 115 GLY A CA   1 
ATOM   1574  C C    . GLY A 1 115 ? -19.405 -23.931 -25.091 1.00 15.98 ? 115 GLY A C    1 
ATOM   1575  O O    . GLY A 1 115 ? -18.733 -24.734 -25.741 1.00 16.97 ? 115 GLY A O    1 
ATOM   1576  H H    . GLY A 1 115 ? -20.265 -26.297 -24.414 1.00 21.13 ? 115 GLY A H    1 
ATOM   1577  H HA2  . GLY A 1 115 ? -21.113 -23.755 -23.989 1.00 23.66 ? 115 GLY A HA2  1 
ATOM   1578  H HA3  . GLY A 1 115 ? -19.912 -24.340 -23.158 1.00 23.66 ? 115 GLY A HA3  1 
ATOM   1579  N N    . ILE A 1 116 ? -19.343 -22.621 -25.267 1.00 17.10 ? 116 ILE A N    1 
ATOM   1580  C CA   . ILE A 1 116 ? -18.278 -22.015 -26.061 1.00 19.74 ? 116 ILE A CA   1 
ATOM   1581  C C    . ILE A 1 116 ? -17.739 -20.804 -25.318 1.00 17.52 ? 116 ILE A C    1 
ATOM   1582  O O    . ILE A 1 116 ? -18.502 -19.990 -24.780 1.00 17.37 ? 116 ILE A O    1 
ATOM   1583  C CB   . ILE A 1 116 ? -18.755 -21.650 -27.478 1.00 17.25 ? 116 ILE A CB   1 
ATOM   1584  C CG1  . ILE A 1 116 ? -17.578 -21.066 -28.291 1.00 22.66 ? 116 ILE A CG1  1 
ATOM   1585  C CG2  . ILE A 1 116 ? -19.924 -20.686 -27.431 1.00 20.23 ? 116 ILE A CG2  1 
ATOM   1586  C CD1  . ILE A 1 116 ? -17.949 -20.848 -29.733 1.00 20.41 ? 116 ILE A CD1  1 
ATOM   1587  H H    . ILE A 1 116 ? -19.904 -22.057 -24.939 1.00 20.50 ? 116 ILE A H    1 
ATOM   1588  H HA   . ILE A 1 116 ? -17.553 -22.654 -26.149 1.00 23.67 ? 116 ILE A HA   1 
ATOM   1589  H HB   . ILE A 1 116 ? -19.051 -22.463 -27.917 1.00 20.68 ? 116 ILE A HB   1 
ATOM   1590  H HG12 . ILE A 1 116 ? -17.322 -20.211 -27.911 1.00 27.17 ? 116 ILE A HG12 1 
ATOM   1591  H HG13 . ILE A 1 116 ? -16.831 -21.683 -28.260 1.00 27.17 ? 116 ILE A HG13 1 
ATOM   1592  H HG21 . ILE A 1 116 ? -20.197 -20.478 -28.339 1.00 24.26 ? 116 ILE A HG21 1 
ATOM   1593  H HG22 . ILE A 1 116 ? -20.657 -21.103 -26.952 1.00 24.26 ? 116 ILE A HG22 1 
ATOM   1594  H HG23 . ILE A 1 116 ? -19.647 -19.877 -26.975 1.00 24.26 ? 116 ILE A HG23 1 
ATOM   1595  H HD11 . ILE A 1 116 ? -17.184 -20.482 -30.203 1.00 24.47 ? 116 ILE A HD11 1 
ATOM   1596  H HD12 . ILE A 1 116 ? -18.204 -21.698 -30.125 1.00 24.47 ? 116 ILE A HD12 1 
ATOM   1597  H HD13 . ILE A 1 116 ? -18.693 -20.227 -29.777 1.00 24.47 ? 116 ILE A HD13 1 
ATOM   1598  N N    . SER A 1 117 ? -16.411 -20.703 -25.257 1.00 16.74 ? 117 SER A N    1 
ATOM   1599  C CA   . SER A 1 117 ? -15.744 -19.638 -24.542 1.00 16.00 ? 117 SER A CA   1 
ATOM   1600  C C    . SER A 1 117 ? -15.215 -18.599 -25.521 1.00 16.56 ? 117 SER A C    1 
ATOM   1601  O O    . SER A 1 117 ? -14.522 -18.950 -26.482 1.00 14.19 ? 117 SER A O    1 
ATOM   1602  C CB   . SER A 1 117 ? -14.576 -20.169 -23.718 1.00 17.86 ? 117 SER A CB   1 
ATOM   1603  O OG   . SER A 1 117 ? -13.926 -19.064 -23.119 1.00 20.17 ? 117 SER A OG   1 
ATOM   1604  H H    . SER A 1 117 ? -15.870 -21.256 -25.633 1.00 20.07 ? 117 SER A H    1 
ATOM   1605  H HA   . SER A 1 117 ? -16.373 -19.206 -23.943 1.00 19.18 ? 117 SER A HA   1 
ATOM   1606  H HB2  . SER A 1 117 ? -14.909 -20.764 -23.027 1.00 21.40 ? 117 SER A HB2  1 
ATOM   1607  H HB3  . SER A 1 117 ? -13.954 -20.636 -24.298 1.00 21.40 ? 117 SER A HB3  1 
ATOM   1608  H HG   . SER A 1 117 ? -13.276 -19.329 -22.657 1.00 24.18 ? 117 SER A HG   1 
ATOM   1609  N N    . LEU A 1 118 ? -15.579 -17.331 -25.281 1.00 16.56 ? 118 LEU A N    1 
ATOM   1610  C CA   . LEU A 1 118 ? -15.060 -16.188 -26.028 1.00 16.79 ? 118 LEU A CA   1 
ATOM   1611  C C    . LEU A 1 118 ? -14.055 -15.393 -25.206 1.00 19.76 ? 118 LEU A C    1 
ATOM   1612  O O    . LEU A 1 118 ? -13.652 -14.292 -25.617 1.00 22.10 ? 118 LEU A O    1 
ATOM   1613  C CB   . LEU A 1 118 ? -16.199 -15.277 -26.501 1.00 21.08 ? 118 LEU A CB   1 
ATOM   1614  C CG   . LEU A 1 118 ? -17.036 -15.756 -27.704 1.00 21.34 ? 118 LEU A CG   1 
ATOM   1615  C CD1  . LEU A 1 118 ? -17.625 -17.152 -27.506 1.00 22.93 ? 118 LEU A CD1  1 
ATOM   1616  C CD2  . LEU A 1 118 ? -18.173 -14.767 -27.932 1.00 25.42 ? 118 LEU A CD2  1 
ATOM   1617  H H    . LEU A 1 118 ? -16.142 -17.108 -24.671 1.00 19.85 ? 118 LEU A H    1 
ATOM   1618  H HA   . LEU A 1 118 ? -14.599 -16.516 -26.816 1.00 20.13 ? 118 LEU A HA   1 
ATOM   1619  H HB2  . LEU A 1 118 ? -16.812 -15.153 -25.759 1.00 25.28 ? 118 LEU A HB2  1 
ATOM   1620  H HB3  . LEU A 1 118 ? -15.817 -14.420 -26.744 1.00 25.28 ? 118 LEU A HB3  1 
ATOM   1621  H HG   . LEU A 1 118 ? -16.480 -15.770 -28.498 1.00 25.59 ? 118 LEU A HG   1 
ATOM   1622  H HD11 . LEU A 1 118 ? -18.137 -17.393 -28.294 1.00 27.49 ? 118 LEU A HD11 1 
ATOM   1623  H HD12 . LEU A 1 118 ? -16.901 -17.784 -27.376 1.00 27.49 ? 118 LEU A HD12 1 
ATOM   1624  H HD13 . LEU A 1 118 ? -18.201 -17.144 -26.726 1.00 27.49 ? 118 LEU A HD13 1 
ATOM   1625  H HD21 . LEU A 1 118 ? -18.703 -15.064 -28.688 1.00 30.48 ? 118 LEU A HD21 1 
ATOM   1626  H HD22 . LEU A 1 118 ? -18.725 -14.731 -27.135 1.00 30.48 ? 118 LEU A HD22 1 
ATOM   1627  H HD23 . LEU A 1 118 ? -17.798 -13.891 -28.114 1.00 30.48 ? 118 LEU A HD23 1 
ATOM   1628  N N    . ILE A 1 119 ? -13.625 -15.939 -24.069 1.00 18.72 ? 119 ILE A N    1 
ATOM   1629  C CA   . ILE A 1 119 ? -12.751 -15.246 -23.136 1.00 21.07 ? 119 ILE A CA   1 
ATOM   1630  C C    . ILE A 1 119 ? -11.297 -15.416 -23.585 1.00 21.87 ? 119 ILE A C    1 
ATOM   1631  O O    . ILE A 1 119 ? -10.729 -16.503 -23.517 1.00 17.48 ? 119 ILE A O    1 
ATOM   1632  C CB   . ILE A 1 119 ? -12.958 -15.761 -21.707 1.00 21.40 ? 119 ILE A CB   1 
ATOM   1633  C CG1  . ILE A 1 119 ? -14.468 -15.734 -21.338 1.00 23.09 ? 119 ILE A CG1  1 
ATOM   1634  C CG2  . ILE A 1 119 ? -12.118 -14.902 -20.718 1.00 22.41 ? 119 ILE A CG2  1 
ATOM   1635  C CD1  . ILE A 1 119 ? -14.804 -16.338 -19.997 1.00 25.64 ? 119 ILE A CD1  1 
ATOM   1636  H H    . ILE A 1 119 ? -13.834 -16.733 -23.813 1.00 22.44 ? 119 ILE A H    1 
ATOM   1637  H HA   . ILE A 1 119 ? -12.961 -14.299 -23.148 1.00 25.26 ? 119 ILE A HA   1 
ATOM   1638  H HB   . ILE A 1 119 ? -12.646 -16.678 -21.661 1.00 25.66 ? 119 ILE A HB   1 
ATOM   1639  H HG12 . ILE A 1 119 ? -14.767 -14.811 -21.326 1.00 27.69 ? 119 ILE A HG12 1 
ATOM   1640  H HG13 . ILE A 1 119 ? -14.960 -16.226 -22.013 1.00 27.69 ? 119 ILE A HG13 1 
ATOM   1641  H HG21 . ILE A 1 119 ? -12.255 -15.235 -19.817 1.00 26.87 ? 119 ILE A HG21 1 
ATOM   1642  H HG22 . ILE A 1 119 ? -11.181 -14.971 -20.958 1.00 26.87 ? 119 ILE A HG22 1 
ATOM   1643  H HG23 . ILE A 1 119 ? -12.408 -13.979 -20.777 1.00 26.87 ? 119 ILE A HG23 1 
ATOM   1644  H HD11 . ILE A 1 119 ? -15.762 -16.277 -19.855 1.00 30.75 ? 119 ILE A HD11 1 
ATOM   1645  H HD12 . ILE A 1 119 ? -14.528 -17.268 -19.993 1.00 30.75 ? 119 ILE A HD12 1 
ATOM   1646  H HD13 . ILE A 1 119 ? -14.334 -15.849 -19.304 1.00 30.75 ? 119 ILE A HD13 1 
ATOM   1647  N N    . LYS A 1 120 ? -10.676 -14.342 -24.033 1.00 25.06 ? 120 LYS A N    1 
ATOM   1648  C CA   . LYS A 1 120 ? -9.331  -14.465 -24.589 1.00 31.63 ? 120 LYS A CA   1 
ATOM   1649  C C    . LYS A 1 120 ? -8.310  -14.350 -23.471 1.00 32.42 ? 120 LYS A C    1 
ATOM   1650  O O    . LYS A 1 120 ? -8.393  -13.437 -22.651 1.00 31.88 ? 120 LYS A O    1 
ATOM   1651  C CB   . LYS A 1 120 ? -9.056  -13.403 -25.657 1.00 33.35 ? 120 LYS A CB   1 
ATOM   1652  C CG   . LYS A 1 120 ? -8.084  -13.900 -26.723 1.00 37.65 ? 120 LYS A CG   1 
ATOM   1653  C CD   . LYS A 1 120 ? -7.878  -12.906 -27.862 1.00 38.56 ? 120 LYS A CD   1 
ATOM   1654  C CE   . LYS A 1 120 ? -9.052  -12.884 -28.792 1.00 34.96 ? 120 LYS A CE   1 
ATOM   1655  N NZ   . LYS A 1 120 ? -8.804  -11.947 -29.916 1.00 22.65 ? 120 LYS A NZ   1 
ATOM   1656  H H    . LYS A 1 120 ? -10.998 -13.545 -24.031 1.00 30.05 ? 120 LYS A H    1 
ATOM   1657  H HA   . LYS A 1 120 ? -9.234  -15.339 -24.999 1.00 37.93 ? 120 LYS A HA   1 
ATOM   1658  H HB2  . LYS A 1 120 ? -9.890  -13.168 -26.094 1.00 40.00 ? 120 LYS A HB2  1 
ATOM   1659  H HB3  . LYS A 1 120 ? -8.668  -12.621 -25.235 1.00 40.00 ? 120 LYS A HB3  1 
ATOM   1660  H HG2  . LYS A 1 120 ? -7.221  -14.063 -26.310 1.00 45.16 ? 120 LYS A HG2  1 
ATOM   1661  H HG3  . LYS A 1 120 ? -8.429  -14.723 -27.104 1.00 45.16 ? 120 LYS A HG3  1 
ATOM   1662  H HD2  . LYS A 1 120 ? -7.765  -12.016 -27.493 1.00 46.25 ? 120 LYS A HD2  1 
ATOM   1663  H HD3  . LYS A 1 120 ? -7.092  -13.161 -28.371 1.00 46.25 ? 120 LYS A HD3  1 
ATOM   1664  H HE2  . LYS A 1 120 ? -9.193  -13.772 -29.157 1.00 41.93 ? 120 LYS A HE2  1 
ATOM   1665  H HE3  . LYS A 1 120 ? -9.840  -12.586 -28.311 1.00 41.93 ? 120 LYS A HE3  1 
ATOM   1666  H HZ1  . LYS A 1 120 ? -9.505  -11.938 -30.465 1.00 27.15 ? 120 LYS A HZ1  1 
ATOM   1667  H HZ2  . LYS A 1 120 ? -8.671  -11.124 -29.603 1.00 27.15 ? 120 LYS A HZ2  1 
ATOM   1668  H HZ3  . LYS A 1 120 ? -8.083  -12.202 -30.372 1.00 27.15 ? 120 LYS A HZ3  1 
ATOM   1669  N N    . GLY A 1 121 ? -7.355  -15.263 -23.438 1.00 29.24 ? 121 GLY A N    1 
ATOM   1670  C CA   . GLY A 1 121 ? -6.340  -15.221 -22.405 1.00 31.81 ? 121 GLY A CA   1 
ATOM   1671  C C    . GLY A 1 121 ? -6.003  -16.609 -21.909 1.00 31.54 ? 121 GLY A C    1 
ATOM   1672  O O    . GLY A 1 121 ? -6.222  -17.605 -22.597 1.00 29.87 ? 121 GLY A O    1 
ATOM   1673  H H    . GLY A 1 121 ? -7.272  -15.911 -23.998 1.00 35.07 ? 121 GLY A H    1 
ATOM   1674  H HA2  . GLY A 1 121 ? -5.533  -14.812 -22.756 1.00 38.16 ? 121 GLY A HA2  1 
ATOM   1675  H HA3  . GLY A 1 121 ? -6.657  -14.692 -21.657 1.00 38.16 ? 121 GLY A HA3  1 
ATOM   1676  N N    . VAL A 1 122 ? -5.427  -16.698 -20.705 1.00 26.63 ? 122 VAL A N    1 
ATOM   1677  C CA   . VAL A 1 122 ? -5.015  -17.996 -20.189 1.00 28.88 ? 122 VAL A CA   1 
ATOM   1678  C C    . VAL A 1 122 ? -5.093  -17.972 -18.667 1.00 28.82 ? 122 VAL A C    1 
ATOM   1679  O O    . VAL A 1 122 ? -5.042  -16.913 -18.041 1.00 31.08 ? 122 VAL A O    1 
ATOM   1680  C CB   . VAL A 1 122 ? -3.608  -18.367 -20.707 1.00 33.28 ? 122 VAL A CB   1 
ATOM   1681  C CG1  . VAL A 1 122 ? -2.516  -17.567 -19.991 1.00 35.28 ? 122 VAL A CG1  1 
ATOM   1682  C CG2  . VAL A 1 122 ? -3.360  -19.844 -20.601 1.00 34.31 ? 122 VAL A CG2  1 
ATOM   1683  H H    . VAL A 1 122 ? -5.269  -16.034 -20.182 1.00 31.93 ? 122 VAL A H    1 
ATOM   1684  H HA   . VAL A 1 122 ? -5.635  -18.671 -20.507 1.00 34.63 ? 122 VAL A HA   1 
ATOM   1685  H HB   . VAL A 1 122 ? -3.561  -18.135 -21.648 1.00 39.92 ? 122 VAL A HB   1 
ATOM   1686  H HG11 . VAL A 1 122 ? -1.651  -17.828 -20.343 1.00 42.32 ? 122 VAL A HG11 1 
ATOM   1687  H HG12 . VAL A 1 122 ? -2.665  -16.621 -20.145 1.00 42.32 ? 122 VAL A HG12 1 
ATOM   1688  H HG13 . VAL A 1 122 ? -2.557  -17.758 -19.041 1.00 42.32 ? 122 VAL A HG13 1 
ATOM   1689  H HG21 . VAL A 1 122 ? -2.470  -20.039 -20.935 1.00 41.15 ? 122 VAL A HG21 1 
ATOM   1690  H HG22 . VAL A 1 122 ? -3.430  -20.110 -19.671 1.00 41.15 ? 122 VAL A HG22 1 
ATOM   1691  H HG23 . VAL A 1 122 ? -4.022  -20.314 -21.131 1.00 41.15 ? 122 VAL A HG23 1 
ATOM   1692  N N    . ASP A 1 123 ? -5.275  -19.160 -18.075 1.00 33.14 ? 123 ASP A N    1 
ATOM   1693  C CA   . ASP A 1 123 ? -5.407  -19.327 -16.636 1.00 31.50 ? 123 ASP A CA   1 
ATOM   1694  C C    . ASP A 1 123 ? -4.185  -20.070 -16.110 1.00 32.90 ? 123 ASP A C    1 
ATOM   1695  O O    . ASP A 1 123 ? -3.217  -20.294 -16.842 1.00 29.56 ? 123 ASP A O    1 
ATOM   1696  C CB   . ASP A 1 123 ? -6.711  -20.060 -16.317 1.00 33.33 ? 123 ASP A CB   1 
ATOM   1697  C CG   . ASP A 1 123 ? -7.313  -19.640 -14.984 1.00 36.49 ? 123 ASP A CG   1 
ATOM   1698  O OD1  . ASP A 1 123 ? -6.919  -20.209 -13.954 1.00 36.24 ? 123 ASP A OD1  1 
ATOM   1699  O OD2  . ASP A 1 123 ? -8.172  -18.738 -14.968 1.00 39.08 ? 123 ASP A OD2  1 
ATOM   1700  H H    . ASP A 1 123 ? -5.326  -19.902 -18.507 1.00 39.74 ? 123 ASP A H    1 
ATOM   1701  H HA   . ASP A 1 123 ? -5.437  -18.455 -16.214 1.00 37.78 ? 123 ASP A HA   1 
ATOM   1702  H HB2  . ASP A 1 123 ? -7.359  -19.868 -17.013 1.00 39.97 ? 123 ASP A HB2  1 
ATOM   1703  H HB3  . ASP A 1 123 ? -6.537  -21.013 -16.280 1.00 39.97 ? 123 ASP A HB3  1 
ATOM   1704  N N    . GLU A 1 124 ? -4.236  -20.454 -14.834 1.00 36.86 ? 124 GLU A N    1 
ATOM   1705  C CA   . GLU A 1 124 ? -3.136  -21.116 -14.141 1.00 42.51 ? 124 GLU A CA   1 
ATOM   1706  C C    . GLU A 1 124 ? -3.545  -22.531 -13.733 1.00 40.78 ? 124 GLU A C    1 
ATOM   1707  O O    . GLU A 1 124 ? -4.715  -22.795 -13.437 1.00 37.87 ? 124 GLU A O    1 
ATOM   1708  C CB   . GLU A 1 124 ? -2.718  -20.303 -12.907 1.00 32.98 ? 124 GLU A CB   1 
ATOM   1709  H H    . GLU A 1 124 ? -4.925  -20.336 -14.333 1.00 44.21 ? 124 GLU A H    1 
ATOM   1710  H HA   . GLU A 1 124 ? -2.373  -21.179 -14.737 1.00 50.99 ? 124 GLU A HA   1 
ATOM   1711  N N    . GLY A 1 125 ? -2.579  -23.455 -13.729 1.00 38.51 ? 125 GLY A N    1 
ATOM   1712  C CA   . GLY A 1 125 ? -2.889  -24.839 -13.424 1.00 41.57 ? 125 GLY A CA   1 
ATOM   1713  C C    . GLY A 1 125 ? -1.698  -25.761 -13.193 1.00 44.71 ? 125 GLY A C    1 
ATOM   1714  O O    . GLY A 1 125 ? -0.533  -25.336 -13.168 1.00 39.12 ? 125 GLY A O    1 
ATOM   1715  H H    . GLY A 1 125 ? -1.749  -23.302 -13.899 1.00 46.19 ? 125 GLY A H    1 
ATOM   1716  H HA2  . GLY A 1 125 ? -3.440  -24.864 -12.626 1.00 49.86 ? 125 GLY A HA2  1 
ATOM   1717  H HA3  . GLY A 1 125 ? -3.409  -25.208 -14.155 1.00 49.86 ? 125 GLY A HA3  1 
ATOM   1718  N N    . PRO A 1 126 ? -1.981  -27.064 -13.045 1.00 47.73 ? 126 PRO A N    1 
ATOM   1719  C CA   . PRO A 1 126 ? -0.908  -28.014 -12.679 1.00 48.12 ? 126 PRO A CA   1 
ATOM   1720  C C    . PRO A 1 126 ? 0.245   -28.035 -13.663 1.00 46.21 ? 126 PRO A C    1 
ATOM   1721  O O    . PRO A 1 126 ? 1.387   -28.323 -13.274 1.00 45.28 ? 126 PRO A O    1 
ATOM   1722  C CB   . PRO A 1 126 ? -1.623  -29.375 -12.640 1.00 43.12 ? 126 PRO A CB   1 
ATOM   1723  C CG   . PRO A 1 126 ? -3.104  -29.071 -12.630 1.00 48.43 ? 126 PRO A CG   1 
ATOM   1724  C CD   . PRO A 1 126 ? -3.274  -27.734 -13.286 1.00 44.30 ? 126 PRO A CD   1 
ATOM   1725  H HA   . PRO A 1 126 ? -0.567  -27.809 -11.795 1.00 57.73 ? 126 PRO A HA   1 
ATOM   1726  H HB2  . PRO A 1 126 ? -1.387  -29.888 -13.429 1.00 51.73 ? 126 PRO A HB2  1 
ATOM   1727  H HB3  . PRO A 1 126 ? -1.369  -29.853 -11.835 1.00 51.73 ? 126 PRO A HB3  1 
ATOM   1728  H HG2  . PRO A 1 126 ? -3.577  -29.755 -13.129 1.00 58.10 ? 126 PRO A HG2  1 
ATOM   1729  H HG3  . PRO A 1 126 ? -3.420  -29.040 -11.714 1.00 58.10 ? 126 PRO A HG3  1 
ATOM   1730  H HD2  . PRO A 1 126 ? -3.426  -27.842 -14.237 1.00 53.14 ? 126 PRO A HD2  1 
ATOM   1731  H HD3  . PRO A 1 126 ? -3.994  -27.240 -12.864 1.00 53.14 ? 126 PRO A HD3  1 
ATOM   1732  N N    . ASN A 1 127 ? -0.024  -27.753 -14.935 1.00 46.38 ? 127 ASN A N    1 
ATOM   1733  C CA   . ASN A 1 127 ? 1.005   -27.662 -15.960 1.00 41.81 ? 127 ASN A CA   1 
ATOM   1734  C C    . ASN A 1 127 ? 1.480   -26.230 -16.179 1.00 39.53 ? 127 ASN A C    1 
ATOM   1735  O O    . ASN A 1 127 ? 2.004   -25.913 -17.250 1.00 48.44 ? 127 ASN A O    1 
ATOM   1736  C CB   . ASN A 1 127 ? 0.484   -28.260 -17.266 1.00 43.24 ? 127 ASN A CB   1 
ATOM   1737  C CG   . ASN A 1 127 ? 0.392   -29.776 -17.215 1.00 45.71 ? 127 ASN A CG   1 
ATOM   1738  O OD1  . ASN A 1 127 ? 1.307   -30.449 -16.732 1.00 51.69 ? 127 ASN A OD1  1 
ATOM   1739  N ND2  . ASN A 1 127 ? -0.720  -30.323 -17.701 1.00 38.86 ? 127 ASN A ND2  1 
ATOM   1740  H H    . ASN A 1 127 ? -0.817  -27.607 -15.234 1.00 55.63 ? 127 ASN A H    1 
ATOM   1741  H HA   . ASN A 1 127 ? 1.771   -28.187 -15.679 1.00 50.16 ? 127 ASN A HA   1 
ATOM   1742  H HB2  . ASN A 1 127 ? -0.403  -27.911 -17.443 1.00 51.86 ? 127 ASN A HB2  1 
ATOM   1743  H HB3  . ASN A 1 127 ? 1.087   -28.020 -17.987 1.00 51.86 ? 127 ASN A HB3  1 
ATOM   1744  H HD21 . ASN A 1 127 ? -0.818  -31.177 -17.692 1.00 46.61 ? 127 ASN A HD21 1 
ATOM   1745  H HD22 . ASN A 1 127 ? -1.338  -29.822 -18.028 1.00 46.61 ? 127 ASN A HD22 1 
ATOM   1746  N N    . GLY A 1 128 ? 1.325   -25.359 -15.183 1.00 39.24 ? 128 GLY A N    1 
ATOM   1747  C CA   . GLY A 1 128 ? 1.680   -23.958 -15.334 1.00 38.55 ? 128 GLY A CA   1 
ATOM   1748  C C    . GLY A 1 128 ? 0.552   -23.146 -15.948 1.00 42.44 ? 128 GLY A C    1 
ATOM   1749  O O    . GLY A 1 128 ? -0.286  -22.576 -15.235 1.00 35.63 ? 128 GLY A O    1 
ATOM   1750  H H    . GLY A 1 128 ? 1.014   -25.560 -14.407 1.00 47.07 ? 128 GLY A H    1 
ATOM   1751  H HA2  . GLY A 1 128 ? 1.893   -23.582 -14.465 1.00 46.24 ? 128 GLY A HA2  1 
ATOM   1752  H HA3  . GLY A 1 128 ? 2.461   -23.881 -15.904 1.00 46.24 ? 128 GLY A HA3  1 
ATOM   1753  N N    . LEU A 1 129 ? 0.507   -23.092 -17.274 1.00 36.79 ? 129 LEU A N    1 
ATOM   1754  C CA   . LEU A 1 129 ? -0.620  -22.462 -17.940 1.00 34.21 ? 129 LEU A CA   1 
ATOM   1755  C C    . LEU A 1 129 ? -1.794  -23.436 -17.983 1.00 29.77 ? 129 LEU A C    1 
ATOM   1756  O O    . LEU A 1 129 ? -1.618  -24.655 -18.063 1.00 26.88 ? 129 LEU A O    1 
ATOM   1757  C CB   . LEU A 1 129 ? -0.243  -22.029 -19.360 1.00 35.31 ? 129 LEU A CB   1 
ATOM   1758  C CG   . LEU A 1 129 ? 0.767   -20.897 -19.519 1.00 37.46 ? 129 LEU A CG   1 
ATOM   1759  C CD1  . LEU A 1 129 ? 1.010   -20.612 -20.993 1.00 36.23 ? 129 LEU A CD1  1 
ATOM   1760  C CD2  . LEU A 1 129 ? 0.278   -19.651 -18.795 1.00 40.37 ? 129 LEU A CD2  1 
ATOM   1761  H H    . LEU A 1 129 ? 1.108   -23.407 -17.803 1.00 44.13 ? 129 LEU A H    1 
ATOM   1762  H HA   . LEU A 1 129 ? -0.891  -21.675 -17.440 1.00 41.03 ? 129 LEU A HA   1 
ATOM   1763  H HB2  . LEU A 1 129 ? 0.122   -22.800 -19.819 1.00 42.34 ? 129 LEU A HB2  1 
ATOM   1764  H HB3  . LEU A 1 129 ? -1.055  -21.747 -19.810 1.00 42.34 ? 129 LEU A HB3  1 
ATOM   1765  H HG   . LEU A 1 129 ? 1.610   -21.166 -19.120 1.00 44.93 ? 129 LEU A HG   1 
ATOM   1766  H HD11 . LEU A 1 129 ? 1.655   -19.891 -21.072 1.00 43.45 ? 129 LEU A HD11 1 
ATOM   1767  H HD12 . LEU A 1 129 ? 1.356   -21.413 -21.416 1.00 43.45 ? 129 LEU A HD12 1 
ATOM   1768  H HD13 . LEU A 1 129 ? 0.172   -20.354 -21.407 1.00 43.45 ? 129 LEU A HD13 1 
ATOM   1769  H HD21 . LEU A 1 129 ? 0.933   -18.944 -18.907 1.00 48.42 ? 129 LEU A HD21 1 
ATOM   1770  H HD22 . LEU A 1 129 ? -0.572  -19.379 -19.175 1.00 48.42 ? 129 LEU A HD22 1 
ATOM   1771  H HD23 . LEU A 1 129 ? 0.169   -19.855 -17.853 1.00 48.42 ? 129 LEU A HD23 1 
ATOM   1772  N N    . LYS A 1 130 ? -3.004  -22.888 -17.923 1.00 30.42 ? 130 LYS A N    1 
ATOM   1773  C CA   . LYS A 1 130 ? -4.204  -23.685 -18.122 1.00 25.23 ? 130 LYS A CA   1 
ATOM   1774  C C    . LYS A 1 130 ? -5.211  -22.871 -18.922 1.00 22.02 ? 130 LYS A C    1 
ATOM   1775  O O    . LYS A 1 130 ? -5.522  -21.725 -18.577 1.00 22.58 ? 130 LYS A O    1 
ATOM   1776  C CB   . LYS A 1 130 ? -4.841  -24.136 -16.799 1.00 30.49 ? 130 LYS A CB   1 
ATOM   1777  C CG   . LYS A 1 130 ? -6.031  -25.113 -17.012 1.00 29.48 ? 130 LYS A CG   1 
ATOM   1778  C CD   . LYS A 1 130 ? -6.512  -25.754 -15.700 1.00 33.34 ? 130 LYS A CD   1 
ATOM   1779  C CE   . LYS A 1 130 ? -7.541  -26.871 -15.917 1.00 28.94 ? 130 LYS A CE   1 
ATOM   1780  N NZ   . LYS A 1 130 ? -7.023  -28.063 -16.684 1.00 30.01 ? 130 LYS A NZ   1 
ATOM   1781  H H    . LYS A 1 130 ? -3.155  -22.055 -17.767 1.00 36.49 ? 130 LYS A H    1 
ATOM   1782  H HA   . LYS A 1 130 ? -3.978  -24.477 -18.634 1.00 30.25 ? 130 LYS A HA   1 
ATOM   1783  H HB2  . LYS A 1 130 ? -4.171  -24.591 -16.264 1.00 36.56 ? 130 LYS A HB2  1 
ATOM   1784  H HB3  . LYS A 1 130 ? -5.172  -23.357 -16.325 1.00 36.56 ? 130 LYS A HB3  1 
ATOM   1785  H HG2  . LYS A 1 130 ? -6.776  -24.625 -17.398 1.00 35.35 ? 130 LYS A HG2  1 
ATOM   1786  H HG3  . LYS A 1 130 ? -5.754  -25.824 -17.610 1.00 35.35 ? 130 LYS A HG3  1 
ATOM   1787  H HD2  . LYS A 1 130 ? -5.750  -26.136 -15.238 1.00 39.99 ? 130 LYS A HD2  1 
ATOM   1788  H HD3  . LYS A 1 130 ? -6.925  -25.071 -15.148 1.00 39.99 ? 130 LYS A HD3  1 
ATOM   1789  H HE2  . LYS A 1 130 ? -7.842  -27.187 -15.051 1.00 34.71 ? 130 LYS A HE2  1 
ATOM   1790  H HE3  . LYS A 1 130 ? -8.292  -26.508 -16.412 1.00 34.71 ? 130 LYS A HE3  1 
ATOM   1791  H HZ1  . LYS A 1 130 ? -7.668  -28.670 -16.773 1.00 35.99 ? 130 LYS A HZ1  1 
ATOM   1792  H HZ2  . LYS A 1 130 ? -6.750  -27.810 -17.492 1.00 35.99 ? 130 LYS A HZ2  1 
ATOM   1793  H HZ3  . LYS A 1 130 ? -6.339  -28.430 -16.249 1.00 35.99 ? 130 LYS A HZ3  1 
ATOM   1794  N N    . LEU A 1 131 ? -5.742  -23.484 -19.965 1.00 24.10 ? 131 LEU A N    1 
ATOM   1795  C CA   . LEU A 1 131 ? -6.736  -22.817 -20.802 1.00 25.99 ? 131 LEU A CA   1 
ATOM   1796  C C    . LEU A 1 131 ? -8.018  -22.543 -20.020 1.00 23.50 ? 131 LEU A C    1 
ATOM   1797  O O    . LEU A 1 131 ? -8.526  -23.404 -19.297 1.00 21.68 ? 131 LEU A O    1 
ATOM   1798  C CB   . LEU A 1 131 ? -7.043  -23.690 -22.017 1.00 24.10 ? 131 LEU A CB   1 
ATOM   1799  C CG   . LEU A 1 131 ? -5.898  -24.133 -22.940 1.00 24.91 ? 131 LEU A CG   1 
ATOM   1800  C CD1  . LEU A 1 131 ? -6.433  -24.993 -24.079 1.00 25.11 ? 131 LEU A CD1  1 
ATOM   1801  C CD2  . LEU A 1 131 ? -5.153  -22.954 -23.492 1.00 24.33 ? 131 LEU A CD2  1 
ATOM   1802  H H    . LEU A 1 131 ? -5.547  -24.285 -20.213 1.00 28.90 ? 131 LEU A H    1 
ATOM   1803  H HA   . LEU A 1 131 ? -6.380  -21.971 -21.115 1.00 31.17 ? 131 LEU A HA   1 
ATOM   1804  H HB2  . LEU A 1 131 ? -7.468  -24.501 -21.694 1.00 28.90 ? 131 LEU A HB2  1 
ATOM   1805  H HB3  . LEU A 1 131 ? -7.675  -23.207 -22.572 1.00 28.90 ? 131 LEU A HB3  1 
ATOM   1806  H HG   . LEU A 1 131 ? -5.271  -24.669 -22.429 1.00 29.87 ? 131 LEU A HG   1 
ATOM   1807  H HD11 . LEU A 1 131 ? -5.694  -25.260 -24.647 1.00 30.12 ? 131 LEU A HD11 1 
ATOM   1808  H HD12 . LEU A 1 131 ? -6.864  -25.778 -23.706 1.00 30.12 ? 131 LEU A HD12 1 
ATOM   1809  H HD13 . LEU A 1 131 ? -7.074  -24.476 -24.591 1.00 30.12 ? 131 LEU A HD13 1 
ATOM   1810  H HD21 . LEU A 1 131 ? -4.440  -23.272 -24.067 1.00 29.18 ? 131 LEU A HD21 1 
ATOM   1811  H HD22 . LEU A 1 131 ? -5.768  -22.402 -24.000 1.00 29.18 ? 131 LEU A HD22 1 
ATOM   1812  H HD23 . LEU A 1 131 ? -4.781  -22.443 -22.755 1.00 29.18 ? 131 LEU A HD23 1 
ATOM   1813  N N    . ILE A 1 132 ? -8.559  -21.337 -20.182 1.00 23.29 ? 132 ILE A N    1 
ATOM   1814  C CA   . ILE A 1 132 ? -9.843  -20.993 -19.565 1.00 22.91 ? 132 ILE A CA   1 
ATOM   1815  C C    . ILE A 1 132 ? -10.941 -22.002 -19.938 1.00 18.79 ? 132 ILE A C    1 
ATOM   1816  O O    . ILE A 1 132 ? -11.759 -22.392 -19.088 1.00 19.53 ? 132 ILE A O    1 
ATOM   1817  C CB   . ILE A 1 132 ? -10.218 -19.547 -19.947 1.00 18.93 ? 132 ILE A CB   1 
ATOM   1818  C CG1  . ILE A 1 132 ? -9.202  -18.579 -19.315 1.00 26.83 ? 132 ILE A CG1  1 
ATOM   1819  C CG2  . ILE A 1 132 ? -11.587 -19.179 -19.490 1.00 23.48 ? 132 ILE A CG2  1 
ATOM   1820  C CD1  . ILE A 1 132 ? -9.174  -17.222 -19.953 1.00 31.38 ? 132 ILE A CD1  1 
ATOM   1821  H H    . ILE A 1 132 ? -8.206  -20.701 -20.641 1.00 27.92 ? 132 ILE A H    1 
ATOM   1822  H HA   . ILE A 1 132 ? -9.738  -21.021 -18.601 1.00 27.47 ? 132 ILE A HA   1 
ATOM   1823  H HB   . ILE A 1 132 ? -10.177 -19.458 -20.912 1.00 22.69 ? 132 ILE A HB   1 
ATOM   1824  H HG12 . ILE A 1 132 ? -9.425  -18.462 -18.379 1.00 32.17 ? 132 ILE A HG12 1 
ATOM   1825  H HG13 . ILE A 1 132 ? -8.315  -18.963 -19.396 1.00 32.17 ? 132 ILE A HG13 1 
ATOM   1826  H HG21 . ILE A 1 132 ? -11.773 -18.264 -19.754 1.00 28.15 ? 132 ILE A HG21 1 
ATOM   1827  H HG22 . ILE A 1 132 ? -12.229 -19.779 -19.900 1.00 28.15 ? 132 ILE A HG22 1 
ATOM   1828  H HG23 . ILE A 1 132 ? -11.629 -19.260 -18.524 1.00 28.15 ? 132 ILE A HG23 1 
ATOM   1829  H HD11 . ILE A 1 132 ? -8.513  -16.675 -19.501 1.00 37.64 ? 132 ILE A HD11 1 
ATOM   1830  H HD12 . ILE A 1 132 ? -8.940  -17.318 -20.889 1.00 37.64 ? 132 ILE A HD12 1 
ATOM   1831  H HD13 . ILE A 1 132 ? -10.051 -16.816 -19.870 1.00 37.64 ? 132 ILE A HD13 1 
ATOM   1832  N N    . SER A 1 133 ? -10.976 -22.455 -21.198 1.00 20.50 ? 133 SER A N    1 
ATOM   1833  C CA   . SER A 1 133 ? -12.024 -23.395 -21.609 1.00 18.52 ? 133 SER A CA   1 
ATOM   1834  C C    . SER A 1 133 ? -11.983 -24.680 -20.791 1.00 25.90 ? 133 SER A C    1 
ATOM   1835  O O    . SER A 1 133 ? -13.024 -25.310 -20.570 1.00 19.77 ? 133 SER A O    1 
ATOM   1836  C CB   . SER A 1 133 ? -11.907 -23.726 -23.097 1.00 17.95 ? 133 SER A CB   1 
ATOM   1837  O OG   . SER A 1 133 ? -10.815 -24.589 -23.393 1.00 20.46 ? 133 SER A OG   1 
ATOM   1838  H H    . SER A 1 133 ? -10.420 -22.239 -21.817 1.00 24.58 ? 133 SER A H    1 
ATOM   1839  H HA   . SER A 1 133 ? -12.889 -22.980 -21.466 1.00 22.20 ? 133 SER A HA   1 
ATOM   1840  H HB2  . SER A 1 133 ? -12.727 -24.158 -23.382 1.00 21.51 ? 133 SER A HB2  1 
ATOM   1841  H HB3  . SER A 1 133 ? -11.788 -22.899 -23.588 1.00 21.51 ? 133 SER A HB3  1 
ATOM   1842  H HG   . SER A 1 133 ? -10.093 -24.230 -23.159 1.00 24.54 ? 133 SER A HG   1 
ATOM   1843  N N    . GLU A 1 134 ? -10.794 -25.090 -20.344 1.00 19.44 ? 134 GLU A N    1 
ATOM   1844  C CA   . GLU A 1 134 ? -10.656 -26.255 -19.479 1.00 20.56 ? 134 GLU A CA   1 
ATOM   1845  C C    . GLU A 1 134 ? -11.086 -25.951 -18.061 1.00 21.47 ? 134 GLU A C    1 
ATOM   1846  O O    . GLU A 1 134 ? -11.744 -26.783 -17.428 1.00 21.63 ? 134 GLU A O    1 
ATOM   1847  C CB   . GLU A 1 134 ? -9.218  -26.749 -19.476 1.00 21.51 ? 134 GLU A CB   1 
ATOM   1848  C CG   . GLU A 1 134 ? -8.897  -27.558 -20.676 1.00 24.87 ? 134 GLU A CG   1 
ATOM   1849  C CD   . GLU A 1 134 ? -7.456  -27.945 -20.747 1.00 31.63 ? 134 GLU A CD   1 
ATOM   1850  O OE1  . GLU A 1 134 ? -6.736  -27.806 -19.726 1.00 27.80 ? 134 GLU A OE1  1 
ATOM   1851  O OE2  . GLU A 1 134 ? -7.056  -28.355 -21.848 1.00 35.27 ? 134 GLU A OE2  1 
ATOM   1852  H H    . GLU A 1 134 ? -10.049 -24.705 -20.532 1.00 23.31 ? 134 GLU A H    1 
ATOM   1853  H HA   . GLU A 1 134 ? -11.218 -26.969 -19.818 1.00 24.65 ? 134 GLU A HA   1 
ATOM   1854  H HB2  . GLU A 1 134 ? -8.620  -25.986 -19.459 1.00 25.79 ? 134 GLU A HB2  1 
ATOM   1855  H HB3  . GLU A 1 134 ? -9.075  -27.302 -18.692 1.00 25.79 ? 134 GLU A HB3  1 
ATOM   1856  H HG2  . GLU A 1 134 ? -9.424  -28.372 -20.658 1.00 29.82 ? 134 GLU A HG2  1 
ATOM   1857  H HG3  . GLU A 1 134 ? -9.108  -27.043 -21.470 1.00 29.82 ? 134 GLU A HG3  1 
ATOM   1858  N N    . VAL A 1 135 ? -10.736 -24.772 -17.546 1.00 20.26 ? 135 VAL A N    1 
ATOM   1859  C CA   . VAL A 1 135 ? -11.258 -24.362 -16.252 1.00 20.00 ? 135 VAL A CA   1 
ATOM   1860  C C    . VAL A 1 135 ? -12.776 -24.482 -16.272 1.00 23.31 ? 135 VAL A C    1 
ATOM   1861  O O    . VAL A 1 135 ? -13.392 -25.056 -15.364 1.00 19.35 ? 135 VAL A O    1 
ATOM   1862  C CB   . VAL A 1 135 ? -10.815 -22.928 -15.919 1.00 20.02 ? 135 VAL A CB   1 
ATOM   1863  C CG1  . VAL A 1 135 ? -11.597 -22.394 -14.752 1.00 29.02 ? 135 VAL A CG1  1 
ATOM   1864  C CG2  . VAL A 1 135 ? -9.307  -22.854 -15.602 1.00 22.41 ? 135 VAL A CG2  1 
ATOM   1865  H H    . VAL A 1 135 ? -10.208 -24.205 -17.920 1.00 24.29 ? 135 VAL A H    1 
ATOM   1866  H HA   . VAL A 1 135 ? -10.914 -24.954 -15.565 1.00 23.98 ? 135 VAL A HA   1 
ATOM   1867  H HB   . VAL A 1 135 ? -10.989 -22.358 -16.684 1.00 24.00 ? 135 VAL A HB   1 
ATOM   1868  H HG11 . VAL A 1 135 ? -11.300 -21.491 -14.561 1.00 34.80 ? 135 VAL A HG11 1 
ATOM   1869  H HG12 . VAL A 1 135 ? -12.540 -22.393 -14.978 1.00 34.80 ? 135 VAL A HG12 1 
ATOM   1870  H HG13 . VAL A 1 135 ? -11.442 -22.964 -13.982 1.00 34.80 ? 135 VAL A HG13 1 
ATOM   1871  H HG21 . VAL A 1 135 ? -9.072  -21.935 -15.399 1.00 26.87 ? 135 VAL A HG21 1 
ATOM   1872  H HG22 . VAL A 1 135 ? -9.117  -23.421 -14.839 1.00 26.87 ? 135 VAL A HG22 1 
ATOM   1873  H HG23 . VAL A 1 135 ? -8.807  -23.160 -16.375 1.00 26.87 ? 135 VAL A HG23 1 
ATOM   1874  N N    . ILE A 1 136 ? -13.401 -23.948 -17.328 1.00 18.10 ? 136 ILE A N    1 
ATOM   1875  C CA   . ILE A 1 136 ? -14.863 -23.970 -17.401 1.00 19.35 ? 136 ILE A CA   1 
ATOM   1876  C C    . ILE A 1 136 ? -15.369 -25.398 -17.545 1.00 18.04 ? 136 ILE A C    1 
ATOM   1877  O O    . ILE A 1 136 ? -16.236 -25.851 -16.782 1.00 21.47 ? 136 ILE A O    1 
ATOM   1878  C CB   . ILE A 1 136 ? -15.370 -23.081 -18.558 1.00 18.64 ? 136 ILE A CB   1 
ATOM   1879  C CG1  . ILE A 1 136 ? -15.084 -21.615 -18.324 1.00 18.89 ? 136 ILE A CG1  1 
ATOM   1880  C CG2  . ILE A 1 136 ? -16.870 -23.200 -18.679 1.00 20.82 ? 136 ILE A CG2  1 
ATOM   1881  C CD1  . ILE A 1 136 ? -15.166 -20.764 -19.651 1.00 20.86 ? 136 ILE A CD1  1 
ATOM   1882  H H    . ILE A 1 136 ? -13.011 -23.578 -17.999 1.00 21.70 ? 136 ILE A H    1 
ATOM   1883  H HA   . ILE A 1 136 ? -15.222 -23.612 -16.574 1.00 23.20 ? 136 ILE A HA   1 
ATOM   1884  H HB   . ILE A 1 136 ? -14.956 -23.363 -19.389 1.00 22.34 ? 136 ILE A HB   1 
ATOM   1885  H HG12 . ILE A 1 136 ? -15.735 -21.261 -17.699 1.00 22.64 ? 136 ILE A HG12 1 
ATOM   1886  H HG13 . ILE A 1 136 ? -14.189 -21.521 -17.962 1.00 22.64 ? 136 ILE A HG13 1 
ATOM   1887  H HG21 . ILE A 1 136 ? -17.174 -22.638 -19.408 1.00 24.96 ? 136 ILE A HG21 1 
ATOM   1888  H HG22 . ILE A 1 136 ? -17.099 -24.126 -18.857 1.00 24.96 ? 136 ILE A HG22 1 
ATOM   1889  H HG23 . ILE A 1 136 ? -17.277 -22.912 -17.847 1.00 24.96 ? 136 ILE A HG23 1 
ATOM   1890  H HD11 . ILE A 1 136 ? -14.974 -19.836 -19.443 1.00 25.01 ? 136 ILE A HD11 1 
ATOM   1891  H HD12 . ILE A 1 136 ? -14.514 -21.103 -20.284 1.00 25.01 ? 136 ILE A HD12 1 
ATOM   1892  H HD13 . ILE A 1 136 ? -16.059 -20.843 -20.021 1.00 25.01 ? 136 ILE A HD13 1 
ATOM   1893  N N    . GLY A 1 137 ? -14.829 -26.130 -18.532 1.00 17.40 ? 137 GLY A N    1 
ATOM   1894  C CA   . GLY A 1 137 ? -15.333 -27.449 -18.861 1.00 23.25 ? 137 GLY A CA   1 
ATOM   1895  C C    . GLY A 1 137 ? -15.165 -28.462 -17.746 1.00 26.08 ? 137 GLY A C    1 
ATOM   1896  O O    . GLY A 1 137 ? -16.012 -29.340 -17.571 1.00 21.05 ? 137 GLY A O    1 
ATOM   1897  H H    . GLY A 1 137 ? -14.169 -25.874 -19.021 1.00 20.86 ? 137 GLY A H    1 
ATOM   1898  H HA2  . GLY A 1 137 ? -16.277 -27.386 -19.073 1.00 27.87 ? 137 GLY A HA2  1 
ATOM   1899  H HA3  . GLY A 1 137 ? -14.867 -27.782 -19.645 1.00 27.87 ? 137 GLY A HA3  1 
ATOM   1900  N N    . GLU A 1 138 ? -14.057 -28.373 -16.988 1.00 23.20 ? 138 GLU A N    1 
ATOM   1901  C CA   . GLU A 1 138 ? -13.883 -29.272 -15.846 1.00 25.05 ? 138 GLU A CA   1 
ATOM   1902  C C    . GLU A 1 138 ? -14.760 -28.867 -14.662 1.00 23.44 ? 138 GLU A C    1 
ATOM   1903  O O    . GLU A 1 138 ? -15.297 -29.734 -13.965 1.00 24.45 ? 138 GLU A O    1 
ATOM   1904  C CB   . GLU A 1 138 ? -12.405 -29.321 -15.406 1.00 22.25 ? 138 GLU A CB   1 
ATOM   1905  C CG   . GLU A 1 138 ? -11.492 -30.009 -16.402 1.00 29.33 ? 138 GLU A CG   1 
ATOM   1906  C CD   . GLU A 1 138 ? -10.006 -29.732 -16.146 1.00 34.89 ? 138 GLU A CD   1 
ATOM   1907  O OE1  . GLU A 1 138 ? -9.636  -29.309 -15.020 1.00 35.09 ? 138 GLU A OE1  1 
ATOM   1908  O OE2  . GLU A 1 138 ? -9.219  -29.924 -17.091 1.00 42.07 ? 138 GLU A OE2  1 
ATOM   1909  H H    . GLU A 1 138 ? -13.413 -27.816 -17.113 1.00 27.82 ? 138 GLU A H    1 
ATOM   1910  H HA   . GLU A 1 138 ? -14.142 -30.168 -16.113 1.00 30.03 ? 138 GLU A HA   1 
ATOM   1911  H HB2  . GLU A 1 138 ? -12.084 -28.413 -15.287 1.00 26.68 ? 138 GLU A HB2  1 
ATOM   1912  H HB3  . GLU A 1 138 ? -12.345 -29.803 -14.566 1.00 26.68 ? 138 GLU A HB3  1 
ATOM   1913  H HG2  . GLU A 1 138 ? -11.632 -30.967 -16.347 1.00 35.17 ? 138 GLU A HG2  1 
ATOM   1914  H HG3  . GLU A 1 138 ? -11.706 -29.694 -17.294 1.00 35.17 ? 138 GLU A HG3  1 
ATOM   1915  N N    . ARG A 1 139 ? -14.940 -27.567 -14.413 1.00 21.84 ? 139 ARG A N    1 
ATOM   1916  C CA   . ARG A 1 139 ? -15.759 -27.165 -13.280 1.00 21.82 ? 139 ARG A CA   1 
ATOM   1917  C C    . ARG A 1 139 ? -17.209 -27.575 -13.482 1.00 25.83 ? 139 ARG A C    1 
ATOM   1918  O O    . ARG A 1 139 ? -17.883 -27.964 -12.519 1.00 20.48 ? 139 ARG A O    1 
ATOM   1919  C CB   . ARG A 1 139 ? -15.677 -25.659 -13.040 1.00 24.32 ? 139 ARG A CB   1 
ATOM   1920  C CG   . ARG A 1 139 ? -14.290 -25.153 -12.757 1.00 44.72 ? 139 ARG A CG   1 
ATOM   1921  C CD   . ARG A 1 139 ? -14.054 -24.897 -11.288 1.00 40.55 ? 139 ARG A CD   1 
ATOM   1922  N NE   . ARG A 1 139 ? -12.756 -24.240 -11.134 1.00 42.99 ? 139 ARG A NE   1 
ATOM   1923  C CZ   . ARG A 1 139 ? -12.587 -22.972 -10.796 1.00 43.76 ? 139 ARG A CZ   1 
ATOM   1924  N NH1  . ARG A 1 139 ? -13.638 -22.197 -10.546 1.00 36.84 ? 139 ARG A NH1  1 
ATOM   1925  N NH2  . ARG A 1 139 ? -11.354 -22.485 -10.689 1.00 47.55 ? 139 ARG A NH2  1 
ATOM   1926  H H    . ARG A 1 139 ? -14.607 -26.920 -14.872 1.00 26.19 ? 139 ARG A H    1 
ATOM   1927  H HA   . ARG A 1 139 ? -15.432 -27.611 -12.483 1.00 26.16 ? 139 ARG A HA   1 
ATOM   1928  H HB2  . ARG A 1 139 ? -16.003 -25.201 -13.831 1.00 29.16 ? 139 ARG A HB2  1 
ATOM   1929  H HB3  . ARG A 1 139 ? -16.234 -25.435 -12.279 1.00 29.16 ? 139 ARG A HB3  1 
ATOM   1930  H HG2  . ARG A 1 139 ? -13.645 -25.814 -13.055 1.00 53.64 ? 139 ARG A HG2  1 
ATOM   1931  H HG3  . ARG A 1 139 ? -14.154 -24.319 -13.233 1.00 53.64 ? 139 ARG A HG3  1 
ATOM   1932  H HD2  . ARG A 1 139 ? -14.745 -24.312 -10.940 1.00 48.63 ? 139 ARG A HD2  1 
ATOM   1933  H HD3  . ARG A 1 139 ? -14.038 -25.738 -10.805 1.00 48.63 ? 139 ARG A HD3  1 
ATOM   1934  H HE   . ARG A 1 139 ? -12.051 -24.712 -11.272 1.00 51.56 ? 139 ARG A HE   1 
ATOM   1935  H HH11 . ARG A 1 139 ? -14.434 -22.515 -10.615 1.00 44.19 ? 139 ARG A HH11 1 
ATOM   1936  H HH12 . ARG A 1 139 ? -13.522 -21.374 -10.323 1.00 44.19 ? 139 ARG A HH12 1 
ATOM   1937  H HH21 . ARG A 1 139 ? -10.677 -22.991 -10.848 1.00 57.04 ? 139 ARG A HH21 1 
ATOM   1938  H HH22 . ARG A 1 139 ? -11.234 -21.664 -10.465 1.00 57.04 ? 139 ARG A HH22 1 
ATOM   1939  N N    . LEU A 1 140 ? -17.702 -27.511 -14.733 1.00 23.88 ? 140 LEU A N    1 
ATOM   1940  C CA   . LEU A 1 140 ? -19.102 -27.711 -15.053 1.00 20.04 ? 140 LEU A CA   1 
ATOM   1941  C C    . LEU A 1 140 ? -19.397 -29.071 -15.678 1.00 18.71 ? 140 LEU A C    1 
ATOM   1942  O O    . LEU A 1 140 ? -20.569 -29.452 -15.760 1.00 21.32 ? 140 LEU A O    1 
ATOM   1943  C CB   . LEU A 1 140 ? -19.588 -26.621 -16.026 1.00 19.24 ? 140 LEU A CB   1 
ATOM   1944  C CG   . LEU A 1 140 ? -19.443 -25.159 -15.636 1.00 17.03 ? 140 LEU A CG   1 
ATOM   1945  C CD1  . LEU A 1 140 ? -19.980 -24.210 -16.748 1.00 23.56 ? 140 LEU A CD1  1 
ATOM   1946  C CD2  . LEU A 1 140 ? -20.202 -24.940 -14.354 1.00 22.42 ? 140 LEU A CD2  1 
ATOM   1947  H H    . LEU A 1 140 ? -17.218 -27.347 -15.424 1.00 28.63 ? 140 LEU A H    1 
ATOM   1948  H HA   . LEU A 1 140 ? -19.623 -27.638 -14.238 1.00 24.03 ? 140 LEU A HA   1 
ATOM   1949  H HB2  . LEU A 1 140 ? -19.105 -26.735 -16.859 1.00 23.07 ? 140 LEU A HB2  1 
ATOM   1950  H HB3  . LEU A 1 140 ? -20.532 -26.772 -16.188 1.00 23.07 ? 140 LEU A HB3  1 
ATOM   1951  H HG   . LEU A 1 140 ? -18.507 -24.955 -15.480 1.00 20.41 ? 140 LEU A HG   1 
ATOM   1952  H HD11 . LEU A 1 140 ? -19.869 -23.291 -16.459 1.00 28.24 ? 140 LEU A HD11 1 
ATOM   1953  H HD12 . LEU A 1 140 ? -19.478 -24.364 -17.564 1.00 28.24 ? 140 LEU A HD12 1 
ATOM   1954  H HD13 . LEU A 1 140 ? -20.920 -24.399 -16.897 1.00 28.24 ? 140 LEU A HD13 1 
ATOM   1955  H HD21 . LEU A 1 140 ? -20.118 -24.010 -14.093 1.00 26.88 ? 140 LEU A HD21 1 
ATOM   1956  H HD22 . LEU A 1 140 ? -21.136 -25.161 -14.499 1.00 26.88 ? 140 LEU A HD22 1 
ATOM   1957  H HD23 . LEU A 1 140 ? -19.829 -25.513 -13.665 1.00 26.88 ? 140 LEU A HD23 1 
ATOM   1958  N N    . GLY A 1 141 ? -18.381 -29.785 -16.151 1.00 18.39 ? 141 GLY A N    1 
ATOM   1959  C CA   . GLY A 1 141 ? -18.567 -31.031 -16.866 1.00 20.84 ? 141 GLY A CA   1 
ATOM   1960  C C    . GLY A 1 141 ? -19.270 -30.934 -18.194 1.00 22.48 ? 141 GLY A C    1 
ATOM   1961  O O    . GLY A 1 141 ? -20.110 -31.795 -18.508 1.00 22.74 ? 141 GLY A O    1 
ATOM   1962  H H    . GLY A 1 141 ? -17.556 -29.558 -16.065 1.00 22.05 ? 141 GLY A H    1 
ATOM   1963  H HA2  . GLY A 1 141 ? -17.697 -31.432 -17.021 1.00 24.98 ? 141 GLY A HA2  1 
ATOM   1964  H HA3  . GLY A 1 141 ? -19.077 -31.637 -16.306 1.00 24.98 ? 141 GLY A HA3  1 
ATOM   1965  N N    . ILE A 1 142 ? -19.002 -29.883 -18.969 1.00 21.41 ? 142 ILE A N    1 
ATOM   1966  C CA   . ILE A 1 142 ? -19.629 -29.789 -20.286 1.00 19.77 ? 142 ILE A CA   1 
ATOM   1967  C C    . ILE A 1 142 ? -18.583 -29.749 -21.398 1.00 19.32 ? 142 ILE A C    1 
ATOM   1968  O O    . ILE A 1 142 ? -17.447 -29.307 -21.173 1.00 19.40 ? 142 ILE A O    1 
ATOM   1969  C CB   . ILE A 1 142 ? -20.551 -28.566 -20.366 1.00 21.50 ? 142 ILE A CB   1 
ATOM   1970  C CG1  . ILE A 1 142 ? -19.760 -27.285 -20.127 1.00 20.27 ? 142 ILE A CG1  1 
ATOM   1971  C CG2  . ILE A 1 142 ? -21.730 -28.728 -19.380 1.00 22.33 ? 142 ILE A CG2  1 
ATOM   1972  C CD1  . ILE A 1 142 ? -20.602 -26.009 -20.190 1.00 23.38 ? 142 ILE A CD1  1 
ATOM   1973  H H    . ILE A 1 142 ? -18.479 -29.231 -18.765 1.00 25.67 ? 142 ILE A H    1 
ATOM   1974  H HA   . ILE A 1 142 ? -20.176 -30.578 -20.425 1.00 23.70 ? 142 ILE A HA   1 
ATOM   1975  H HB   . ILE A 1 142 ? -20.916 -28.526 -21.264 1.00 25.78 ? 142 ILE A HB   1 
ATOM   1976  H HG12 . ILE A 1 142 ? -19.356 -27.329 -19.246 1.00 24.30 ? 142 ILE A HG12 1 
ATOM   1977  H HG13 . ILE A 1 142 ? -19.067 -27.216 -20.802 1.00 24.30 ? 142 ILE A HG13 1 
ATOM   1978  H HG21 . ILE A 1 142 ? -22.303 -27.948 -19.442 1.00 26.78 ? 142 ILE A HG21 1 
ATOM   1979  H HG22 . ILE A 1 142 ? -22.230 -29.526 -19.615 1.00 26.78 ? 142 ILE A HG22 1 
ATOM   1980  H HG23 . ILE A 1 142 ? -21.379 -28.810 -18.480 1.00 26.78 ? 142 ILE A HG23 1 
ATOM   1981  H HD11 . ILE A 1 142 ? -20.028 -25.244 -20.028 1.00 28.03 ? 142 ILE A HD11 1 
ATOM   1982  H HD12 . ILE A 1 142 ? -21.005 -25.940 -21.070 1.00 28.03 ? 142 ILE A HD12 1 
ATOM   1983  H HD13 . ILE A 1 142 ? -21.294 -26.053 -19.511 1.00 28.03 ? 142 ILE A HD13 1 
ATOM   1984  N N    . PRO A 1 143 ? -18.905 -30.179 -22.604 1.00 19.86 ? 143 PRO A N    1 
ATOM   1985  C CA   . PRO A 1 143 ? -17.955 -30.009 -23.709 1.00 20.39 ? 143 PRO A CA   1 
ATOM   1986  C C    . PRO A 1 143 ? -17.820 -28.545 -24.073 1.00 21.99 ? 143 PRO A C    1 
ATOM   1987  O O    . PRO A 1 143 ? -18.795 -27.790 -24.037 1.00 19.08 ? 143 PRO A O    1 
ATOM   1988  C CB   . PRO A 1 143 ? -18.577 -30.812 -24.860 1.00 25.79 ? 143 PRO A CB   1 
ATOM   1989  C CG   . PRO A 1 143 ? -19.614 -31.694 -24.203 1.00 28.55 ? 143 PRO A CG   1 
ATOM   1990  C CD   . PRO A 1 143 ? -20.106 -30.911 -23.023 1.00 25.66 ? 143 PRO A CD   1 
ATOM   1991  H HA   . PRO A 1 143 ? -17.087 -30.377 -23.480 1.00 24.45 ? 143 PRO A HA   1 
ATOM   1992  H HB2  . PRO A 1 143 ? -18.992 -30.208 -25.494 1.00 30.93 ? 143 PRO A HB2  1 
ATOM   1993  H HB3  . PRO A 1 143 ? -17.893 -31.349 -25.291 1.00 30.93 ? 143 PRO A HB3  1 
ATOM   1994  H HG2  . PRO A 1 143 ? -20.338 -31.867 -24.825 1.00 34.23 ? 143 PRO A HG2  1 
ATOM   1995  H HG3  . PRO A 1 143 ? -19.203 -32.525 -23.916 1.00 34.23 ? 143 PRO A HG3  1 
ATOM   1996  H HD2  . PRO A 1 143 ? -20.805 -30.295 -23.291 1.00 30.77 ? 143 PRO A HD2  1 
ATOM   1997  H HD3  . PRO A 1 143 ? -20.404 -31.508 -22.319 1.00 30.77 ? 143 PRO A HD3  1 
ATOM   1998  N N    . MET A 1 144 ? -16.595 -28.157 -24.439 1.00 18.96 ? 144 MET A N    1 
ATOM   1999  C CA   . MET A 1 144 ? -16.258 -26.761 -24.662 1.00 17.34 ? 144 MET A CA   1 
ATOM   2000  C C    . MET A 1 144 ? -15.653 -26.549 -26.033 1.00 16.95 ? 144 MET A C    1 
ATOM   2001  O O    . MET A 1 144 ? -14.793 -27.306 -26.499 1.00 21.40 ? 144 MET A O    1 
ATOM   2002  C CB   . MET A 1 144 ? -15.267 -26.229 -23.622 1.00 21.71 ? 144 MET A CB   1 
ATOM   2003  C CG   . MET A 1 144 ? -15.866 -26.067 -22.221 1.00 23.22 ? 144 MET A CG   1 
ATOM   2004  S SD   . MET A 1 144 ? -17.249 -24.905 -22.115 1.00 21.11 ? 144 MET A SD   1 
ATOM   2005  C CE   . MET A 1 144 ? -16.435 -23.351 -22.580 1.00 20.89 ? 144 MET A CE   1 
ATOM   2006  H H    . MET A 1 144 ? -15.937 -28.696 -24.565 1.00 22.73 ? 144 MET A H    1 
ATOM   2007  H HA   . MET A 1 144 ? -17.069 -26.233 -24.595 1.00 20.78 ? 144 MET A HA   1 
ATOM   2008  H HB2  . MET A 1 144 ? -14.522 -26.846 -23.556 1.00 26.03 ? 144 MET A HB2  1 
ATOM   2009  H HB3  . MET A 1 144 ? -14.949 -25.359 -23.910 1.00 26.03 ? 144 MET A HB3  1 
ATOM   2010  H HG2  . MET A 1 144 ? -16.186 -26.932 -21.919 1.00 27.85 ? 144 MET A HG2  1 
ATOM   2011  H HG3  . MET A 1 144 ? -15.171 -25.750 -21.623 1.00 27.85 ? 144 MET A HG3  1 
ATOM   2012  H HE1  . MET A 1 144 ? -17.089 -22.635 -22.560 1.00 25.04 ? 144 MET A HE1  1 
ATOM   2013  H HE2  . MET A 1 144 ? -15.723 -23.167 -21.948 1.00 25.04 ? 144 MET A HE2  1 
ATOM   2014  H HE3  . MET A 1 144 ? -16.070 -23.442 -23.474 1.00 25.04 ? 144 MET A HE3  1 
ATOM   2015  N N    . SER A 1 145 ? -16.084 -25.468 -26.638 1.00 18.66 ? 145 SER A N    1 
ATOM   2016  C CA   . SER A 1 145 ? -15.529 -24.936 -27.850 1.00 19.09 ? 145 SER A CA   1 
ATOM   2017  C C    . SER A 1 145 ? -14.954 -23.567 -27.507 1.00 15.29 ? 145 SER A C    1 
ATOM   2018  O O    . SER A 1 145 ? -15.139 -23.039 -26.396 1.00 14.99 ? 145 SER A O    1 
ATOM   2019  C CB   . SER A 1 145 ? -16.618 -24.849 -28.931 1.00 19.58 ? 145 SER A CB   1 
ATOM   2020  O OG   . SER A 1 145 ? -17.169 -26.136 -29.186 1.00 20.22 ? 145 SER A OG   1 
ATOM   2021  H H    . SER A 1 145 ? -16.741 -24.998 -26.341 1.00 22.38 ? 145 SER A H    1 
ATOM   2022  H HA   . SER A 1 145 ? -14.814 -25.509 -28.167 1.00 22.89 ? 145 SER A HA   1 
ATOM   2023  H HB2  . SER A 1 145 ? -17.323 -24.257 -28.625 1.00 23.48 ? 145 SER A HB2  1 
ATOM   2024  H HB3  . SER A 1 145 ? -16.226 -24.504 -29.749 1.00 23.48 ? 145 SER A HB3  1 
ATOM   2025  H HG   . SER A 1 145 ? -17.763 -26.082 -29.778 1.00 24.24 ? 145 SER A HG   1 
ATOM   2026  N N    . VAL A 1 146 ? -14.256 -22.972 -28.477 1.00 16.60 ? 146 VAL A N    1 
ATOM   2027  C CA   . VAL A 1 146 ? -13.748 -21.619 -28.299 1.00 14.94 ? 146 VAL A CA   1 
ATOM   2028  C C    . VAL A 1 146 ? -13.988 -20.821 -29.561 1.00 16.83 ? 146 VAL A C    1 
ATOM   2029  O O    . VAL A 1 146 ? -14.116 -21.376 -30.652 1.00 17.15 ? 146 VAL A O    1 
ATOM   2030  C CB   . VAL A 1 146 ? -12.243 -21.561 -27.935 1.00 17.69 ? 146 VAL A CB   1 
ATOM   2031  C CG1  . VAL A 1 146 ? -12.042 -22.202 -26.584 1.00 15.47 ? 146 VAL A CG1  1 
ATOM   2032  C CG2  . VAL A 1 146 ? -11.405 -22.200 -29.008 1.00 16.57 ? 146 VAL A CG2  1 
ATOM   2033  H H    . VAL A 1 146 ? -14.067 -23.328 -29.237 1.00 19.89 ? 146 VAL A H    1 
ATOM   2034  H HA   . VAL A 1 146 ? -14.242 -21.194 -27.581 1.00 17.90 ? 146 VAL A HA   1 
ATOM   2035  H HB   . VAL A 1 146 ? -11.975 -20.632 -27.864 1.00 21.21 ? 146 VAL A HB   1 
ATOM   2036  H HG11 . VAL A 1 146 ? -11.100 -22.166 -26.355 1.00 18.54 ? 146 VAL A HG11 1 
ATOM   2037  H HG12 . VAL A 1 146 ? -12.562 -21.717 -25.924 1.00 18.54 ? 146 VAL A HG12 1 
ATOM   2038  H HG13 . VAL A 1 146 ? -12.338 -23.125 -26.625 1.00 18.54 ? 146 VAL A HG13 1 
ATOM   2039  H HG21 . VAL A 1 146 ? -10.471 -22.147 -28.752 1.00 19.86 ? 146 VAL A HG21 1 
ATOM   2040  H HG22 . VAL A 1 146 ? -11.670 -23.127 -29.106 1.00 19.86 ? 146 VAL A HG22 1 
ATOM   2041  H HG23 . VAL A 1 146 ? -11.546 -21.725 -29.843 1.00 19.86 ? 146 VAL A HG23 1 
ATOM   2042  N N    . LEU A 1 147 ? -14.059 -19.495 -29.382 1.00 15.82 ? 147 LEU A N    1 
ATOM   2043  C CA   . LEU A 1 147 ? -14.137 -18.543 -30.485 1.00 19.22 ? 147 LEU A CA   1 
ATOM   2044  C C    . LEU A 1 147 ? -13.095 -17.450 -30.272 1.00 16.42 ? 147 LEU A C    1 
ATOM   2045  O O    . LEU A 1 147 ? -13.159 -16.723 -29.273 1.00 16.34 ? 147 LEU A O    1 
ATOM   2046  C CB   . LEU A 1 147 ? -15.523 -17.914 -30.579 1.00 18.20 ? 147 LEU A CB   1 
ATOM   2047  C CG   . LEU A 1 147 ? -15.717 -16.946 -31.737 1.00 15.63 ? 147 LEU A CG   1 
ATOM   2048  C CD1  . LEU A 1 147 ? -17.182 -16.950 -32.071 1.00 20.62 ? 147 LEU A CD1  1 
ATOM   2049  C CD2  . LEU A 1 147 ? -15.313 -15.551 -31.365 1.00 19.20 ? 147 LEU A CD2  1 
ATOM   2050  H H    . LEU A 1 147 ? -14.064 -19.119 -28.608 1.00 18.96 ? 147 LEU A H    1 
ATOM   2051  H HA   . LEU A 1 147 ? -13.945 -18.996 -31.321 1.00 23.05 ? 147 LEU A HA   1 
ATOM   2052  H HB2  . LEU A 1 147 ? -16.177 -18.623 -30.678 1.00 21.82 ? 147 LEU A HB2  1 
ATOM   2053  H HB3  . LEU A 1 147 ? -15.696 -17.426 -29.759 1.00 21.82 ? 147 LEU A HB3  1 
ATOM   2054  H HG   . LEU A 1 147 ? -15.208 -17.236 -32.511 1.00 18.74 ? 147 LEU A HG   1 
ATOM   2055  H HD11 . LEU A 1 147 ? -17.339 -16.341 -32.809 1.00 24.72 ? 147 LEU A HD11 1 
ATOM   2056  H HD12 . LEU A 1 147 ? -17.446 -17.850 -32.322 1.00 24.72 ? 147 LEU A HD12 1 
ATOM   2057  H HD13 . LEU A 1 147 ? -17.684 -16.664 -31.292 1.00 24.72 ? 147 LEU A HD13 1 
ATOM   2058  H HD21 . LEU A 1 147 ? -15.452 -14.969 -32.129 1.00 23.02 ? 147 LEU A HD21 1 
ATOM   2059  H HD22 . LEU A 1 147 ? -15.857 -15.254 -30.619 1.00 23.02 ? 147 LEU A HD22 1 
ATOM   2060  H HD23 . LEU A 1 147 ? -14.377 -15.550 -31.114 1.00 23.02 ? 147 LEU A HD23 1 
ATOM   2061  N N    . MET A 1 148 ? -12.151 -17.351 -31.185 1.00 17.50 ? 148 MET A N    1 
ATOM   2062  C CA   . MET A 1 148 ? -11.029 -16.390 -31.095 1.00 19.78 ? 148 MET A CA   1 
ATOM   2063  C C    . MET A 1 148 ? -10.609 -15.899 -32.476 1.00 15.58 ? 148 MET A C    1 
ATOM   2064  O O    . MET A 1 148 ? -10.514 -16.692 -33.368 1.00 15.86 ? 148 MET A O    1 
ATOM   2065  C CB   . MET A 1 148 ? -9.801  -17.069 -30.484 1.00 18.21 ? 148 MET A CB   1 
ATOM   2066  C CG   . MET A 1 148 ? -10.113 -17.877 -29.252 1.00 25.55 ? 148 MET A CG   1 
ATOM   2067  S SD   . MET A 1 148 ? -10.063 -16.750 -27.962 1.00 39.37 ? 148 MET A SD   1 
ATOM   2068  C CE   . MET A 1 148 ? -10.822 -17.756 -26.686 1.00 26.77 ? 148 MET A CE   1 
ATOM   2069  H H    . MET A 1 148 ? -12.133 -17.873 -31.932 1.00 20.98 ? 148 MET A H    1 
ATOM   2070  H HA   . MET A 1 148 ? -11.305 -15.622 -30.544 1.00 23.71 ? 148 MET A HA   1 
ATOM   2071  H HB2  . MET A 1 148 ? -9.399  -17.654 -31.156 1.00 21.83 ? 148 MET A HB2  1 
ATOM   2072  H HB3  . MET A 1 148 ? -9.144  -16.381 -30.256 1.00 21.83 ? 148 MET A HB3  1 
ATOM   2073  H HG2  . MET A 1 148 ? -11.004 -18.282 -29.318 1.00 30.64 ? 148 MET A HG2  1 
ATOM   2074  H HG3  . MET A 1 148 ? -9.441  -18.580 -29.118 1.00 30.64 ? 148 MET A HG3  1 
ATOM   2075  H HE1  . MET A 1 148 ? -11.529 -18.286 -27.074 1.00 32.10 ? 148 MET A HE1  1 
ATOM   2076  H HE2  . MET A 1 148 ? -10.157 -18.339 -26.299 1.00 32.10 ? 148 MET A HE2  1 
ATOM   2077  H HE3  . MET A 1 148 ? -11.187 -17.184 -26.000 1.00 32.10 ? 148 MET A HE3  1 
ATOM   2078  N N    . GLY A 1 149 ? -10.368 -14.610 -32.608 1.00 15.05 ? 149 GLY A N    1 
ATOM   2079  C CA   . GLY A 1 149 ? -9.788  -14.089 -33.839 1.00 18.54 ? 149 GLY A CA   1 
ATOM   2080  C C    . GLY A 1 149 ? -9.472  -12.606 -33.755 1.00 17.71 ? 149 GLY A C    1 
ATOM   2081  O O    . GLY A 1 149 ? -9.522  -11.996 -32.687 1.00 16.91 ? 149 GLY A O    1 
ATOM   2082  H H    . GLY A 1 149 ? -10.514 -14.017 -32.003 1.00 18.04 ? 149 GLY A H    1 
ATOM   2083  H HA2  . GLY A 1 149 ? -8.967  -14.566 -34.036 1.00 22.22 ? 149 GLY A HA2  1 
ATOM   2084  H HA3  . GLY A 1 149 ? -10.407 -14.230 -34.572 1.00 22.22 ? 149 GLY A HA3  1 
ATOM   2085  N N    . ALA A 1 150 ? -9.156  -12.019 -34.920 1.00 15.13 ? 150 ALA A N    1 
ATOM   2086  C CA   . ALA A 1 150 ? -8.810  -10.603 -34.985 1.00 16.94 ? 150 ALA A CA   1 
ATOM   2087  C C    . ALA A 1 150 ? -10.103 -9.804  -34.995 1.00 19.99 ? 150 ALA A C    1 
ATOM   2088  O O    . ALA A 1 150 ? -10.648 -9.486  -36.051 1.00 17.19 ? 150 ALA A O    1 
ATOM   2089  C CB   . ALA A 1 150 ? -7.959  -10.311 -36.214 1.00 14.68 ? 150 ALA A CB   1 
ATOM   2090  H H    . ALA A 1 150 ? -9.137  -12.422 -35.679 1.00 18.14 ? 150 ALA A H    1 
ATOM   2091  H HA   . ALA A 1 150 ? -8.303  -10.358 -34.195 1.00 20.31 ? 150 ALA A HA   1 
ATOM   2092  H HB1  . ALA A 1 150 ? -7.744  -9.365  -36.231 1.00 17.59 ? 150 ALA A HB1  1 
ATOM   2093  H HB2  . ALA A 1 150 ? -7.144  -10.835 -36.165 1.00 17.59 ? 150 ALA A HB2  1 
ATOM   2094  H HB3  . ALA A 1 150 ? -8.460  -10.552 -37.009 1.00 17.59 ? 150 ALA A HB3  1 
ATOM   2095  N N    . ASN A 1 151 ? -10.592 -9.479  -33.807 1.00 19.31 ? 151 ASN A N    1 
ATOM   2096  C CA   . ASN A 1 151 ? -11.859 -8.777  -33.701 1.00 18.90 ? 151 ASN A CA   1 
ATOM   2097  C C    . ASN A 1 151 ? -11.930 -8.074  -32.353 1.00 26.54 ? 151 ASN A C    1 
ATOM   2098  O O    . ASN A 1 151 ? -11.252 -8.448  -31.392 1.00 16.66 ? 151 ASN A O    1 
ATOM   2099  C CB   . ASN A 1 151 ? -13.036 -9.725  -33.911 1.00 20.39 ? 151 ASN A CB   1 
ATOM   2100  C CG   . ASN A 1 151 ? -12.923 -10.994 -33.124 1.00 17.06 ? 151 ASN A CG   1 
ATOM   2101  O OD1  . ASN A 1 151 ? -12.977 -10.986 -31.887 1.00 26.38 ? 151 ASN A OD1  1 
ATOM   2102  N ND2  . ASN A 1 151 ? -12.759 -12.112 -33.829 1.00 19.44 ? 151 ASN A ND2  1 
ATOM   2103  H H    . ASN A 1 151 ? -10.214 -9.652  -33.054 1.00 23.15 ? 151 ASN A H    1 
ATOM   2104  H HA   . ASN A 1 151 ? -11.899 -8.098  -34.392 1.00 22.66 ? 151 ASN A HA   1 
ATOM   2105  H HB2  . ASN A 1 151 ? -13.852 -9.277  -33.638 1.00 24.44 ? 151 ASN A HB2  1 
ATOM   2106  H HB3  . ASN A 1 151 ? -13.086 -9.960  -34.850 1.00 24.44 ? 151 ASN A HB3  1 
ATOM   2107  H HD21 . ASN A 1 151 ? -12.688 -12.868 -33.426 1.00 23.30 ? 151 ASN A HD21 1 
ATOM   2108  H HD22 . ASN A 1 151 ? -12.726 -12.077 -34.688 1.00 23.30 ? 151 ASN A HD22 1 
ATOM   2109  N N    . ILE A 1 152 ? -12.725 -7.009  -32.308 1.00 21.16 ? 152 ILE A N    1 
ATOM   2110  C CA   . ILE A 1 152 ? -12.953 -6.287  -31.068 1.00 23.67 ? 152 ILE A CA   1 
ATOM   2111  C C    . ILE A 1 152 ? -14.428 -5.918  -30.980 1.00 26.56 ? 152 ILE A C    1 
ATOM   2112  O O    . ILE A 1 152 ? -15.140 -5.826  -31.989 1.00 27.31 ? 152 ILE A O    1 
ATOM   2113  C CB   . ILE A 1 152 ? -12.065 -5.043  -30.946 1.00 27.86 ? 152 ILE A CB   1 
ATOM   2114  C CG1  . ILE A 1 152 ? -12.335 -4.079  -32.085 1.00 23.95 ? 152 ILE A CG1  1 
ATOM   2115  C CG2  . ILE A 1 152 ? -10.590 -5.442  -30.948 1.00 31.81 ? 152 ILE A CG2  1 
ATOM   2116  C CD1  . ILE A 1 152 ? -11.798 -2.701  -31.799 1.00 37.50 ? 152 ILE A CD1  1 
ATOM   2117  H H    . ILE A 1 152 ? -13.144 -6.685  -32.986 1.00 25.37 ? 152 ILE A H    1 
ATOM   2118  H HA   . ILE A 1 152 ? -12.748 -6.873  -30.323 1.00 28.38 ? 152 ILE A HA   1 
ATOM   2119  H HB   . ILE A 1 152 ? -12.266 -4.598  -30.107 1.00 33.41 ? 152 ILE A HB   1 
ATOM   2120  H HG12 . ILE A 1 152 ? -11.907 -4.410  -32.890 1.00 28.71 ? 152 ILE A HG12 1 
ATOM   2121  H HG13 . ILE A 1 152 ? -13.293 -4.008  -32.221 1.00 28.71 ? 152 ILE A HG13 1 
ATOM   2122  H HG21 . ILE A 1 152 ? -10.047 -4.642  -30.870 1.00 38.15 ? 152 ILE A HG21 1 
ATOM   2123  H HG22 . ILE A 1 152 ? -10.422 -6.031  -30.196 1.00 38.15 ? 152 ILE A HG22 1 
ATOM   2124  H HG23 . ILE A 1 152 ? -10.388 -5.899  -31.779 1.00 38.15 ? 152 ILE A HG23 1 
ATOM   2125  H HD11 . ILE A 1 152 ? -11.994 -2.123  -32.553 1.00 44.98 ? 152 ILE A HD11 1 
ATOM   2126  H HD12 . ILE A 1 152 ? -12.223 -2.356  -30.998 1.00 44.98 ? 152 ILE A HD12 1 
ATOM   2127  H HD13 . ILE A 1 152 ? -10.839 -2.758  -31.666 1.00 44.98 ? 152 ILE A HD13 1 
ATOM   2128  N N    . ALA A 1 153 ? -14.889 -5.718  -29.747 1.00 26.13 ? 153 ALA A N    1 
ATOM   2129  C CA   . ALA A 1 153 ? -16.328 -5.601  -29.511 1.00 28.61 ? 153 ALA A CA   1 
ATOM   2130  C C    . ALA A 1 153 ? -16.914 -4.406  -30.247 1.00 25.27 ? 153 ALA A C    1 
ATOM   2131  O O    . ALA A 1 153 ? -17.949 -4.518  -30.909 1.00 24.91 ? 153 ALA A O    1 
ATOM   2132  C CB   . ALA A 1 153 ? -16.596 -5.490  -28.008 1.00 31.70 ? 153 ALA A CB   1 
ATOM   2133  H H    . ALA A 1 153 ? -14.401 -5.647  -29.042 1.00 31.33 ? 153 ALA A H    1 
ATOM   2134  H HA   . ALA A 1 153 ? -16.769 -6.401  -29.837 1.00 34.31 ? 153 ALA A HA   1 
ATOM   2135  H HB1  . ALA A 1 153 ? -17.552 -5.413  -27.863 1.00 38.01 ? 153 ALA A HB1  1 
ATOM   2136  H HB2  . ALA A 1 153 ? -16.257 -6.285  -27.567 1.00 38.01 ? 153 ALA A HB2  1 
ATOM   2137  H HB3  . ALA A 1 153 ? -16.145 -4.703  -27.664 1.00 38.01 ? 153 ALA A HB3  1 
ATOM   2138  N N    . SER A 1 154 ? -16.248 -3.250  -30.162 1.00 30.93 ? 154 SER A N    1 
ATOM   2139  C CA   . SER A 1 154 ? -16.814 -2.042  -30.760 1.00 32.01 ? 154 SER A CA   1 
ATOM   2140  C C    . SER A 1 154 ? -17.077 -2.231  -32.248 1.00 32.74 ? 154 SER A C    1 
ATOM   2141  O O    . SER A 1 154 ? -18.094 -1.756  -32.769 1.00 30.61 ? 154 SER A O    1 
ATOM   2142  C CB   . SER A 1 154 ? -15.897 -0.850  -30.524 1.00 35.98 ? 154 SER A CB   1 
ATOM   2143  O OG   . SER A 1 154 ? -14.604 -1.069  -31.055 1.00 38.56 ? 154 SER A OG   1 
ATOM   2144  H H    . SER A 1 154 ? -15.488 -3.142  -29.775 1.00 37.10 ? 154 SER A H    1 
ATOM   2145  H HA   . SER A 1 154 ? -17.663 -1.852  -30.332 1.00 38.39 ? 154 SER A HA   1 
ATOM   2146  H HB2  . SER A 1 154 ? -16.283 -0.069  -30.952 1.00 43.16 ? 154 SER A HB2  1 
ATOM   2147  H HB3  . SER A 1 154 ? -15.822 -0.698  -29.569 1.00 43.16 ? 154 SER A HB3  1 
ATOM   2148  H HG   . SER A 1 154 ? -14.117 -0.399  -30.913 1.00 46.25 ? 154 SER A HG   1 
ATOM   2149  N N    . GLU A 1 155 ? -16.180 -2.931  -32.948 1.00 30.61 ? 155 GLU A N    1 
ATOM   2150  C CA   . GLU A 1 155 ? -16.316 -3.115  -34.385 1.00 28.22 ? 155 GLU A CA   1 
ATOM   2151  C C    . GLU A 1 155 ? -17.333 -4.186  -34.761 1.00 26.53 ? 155 GLU A C    1 
ATOM   2152  O O    . GLU A 1 155 ? -18.012 -4.053  -35.787 1.00 28.73 ? 155 GLU A O    1 
ATOM   2153  C CB   . GLU A 1 155 ? -14.938 -3.441  -34.993 1.00 28.34 ? 155 GLU A CB   1 
ATOM   2154  C CG   . GLU A 1 155 ? -13.964 -2.260  -34.924 1.00 33.18 ? 155 GLU A CG   1 
ATOM   2155  C CD   . GLU A 1 155 ? -12.574 -2.583  -35.454 1.00 36.86 ? 155 GLU A CD   1 
ATOM   2156  O OE1  . GLU A 1 155 ? -12.306 -3.776  -35.749 1.00 33.16 ? 155 GLU A OE1  1 
ATOM   2157  O OE2  . GLU A 1 155 ? -11.755 -1.634  -35.563 1.00 36.13 ? 155 GLU A OE2  1 
ATOM   2158  H H    . GLU A 1 155 ? -15.485 -3.307  -32.609 1.00 36.71 ? 155 GLU A H    1 
ATOM   2159  H HA   . GLU A 1 155 ? -16.616 -2.279  -34.774 1.00 33.84 ? 155 GLU A HA   1 
ATOM   2160  H HB2  . GLU A 1 155 ? -14.545 -4.182  -34.506 1.00 33.99 ? 155 GLU A HB2  1 
ATOM   2161  H HB3  . GLU A 1 155 ? -15.053 -3.680  -35.926 1.00 33.99 ? 155 GLU A HB3  1 
ATOM   2162  H HG2  . GLU A 1 155 ? -14.321 -1.529  -35.452 1.00 39.80 ? 155 GLU A HG2  1 
ATOM   2163  H HG3  . GLU A 1 155 ? -13.872 -1.984  -33.998 1.00 39.80 ? 155 GLU A HG3  1 
ATOM   2164  N N    . VAL A 1 156 ? -17.449 -5.262  -33.974 1.00 25.97 ? 156 VAL A N    1 
ATOM   2165  C CA   . VAL A 1 156 ? -18.501 -6.247  -34.213 1.00 21.70 ? 156 VAL A CA   1 
ATOM   2166  C C    . VAL A 1 156 ? -19.882 -5.599  -34.063 1.00 23.91 ? 156 VAL A C    1 
ATOM   2167  O O    . VAL A 1 156 ? -20.789 -5.828  -34.876 1.00 26.04 ? 156 VAL A O    1 
ATOM   2168  C CB   . VAL A 1 156 ? -18.311 -7.435  -33.250 1.00 27.97 ? 156 VAL A CB   1 
ATOM   2169  C CG1  . VAL A 1 156 ? -19.486 -8.382  -33.264 1.00 27.02 ? 156 VAL A CG1  1 
ATOM   2170  C CG2  . VAL A 1 156 ? -17.026 -8.182  -33.610 1.00 26.30 ? 156 VAL A CG2  1 
ATOM   2171  H H    . VAL A 1 156 ? -16.938 -5.440  -33.306 1.00 31.14 ? 156 VAL A H    1 
ATOM   2172  H HA   . VAL A 1 156 ? -18.422 -6.580  -35.121 1.00 26.01 ? 156 VAL A HA   1 
ATOM   2173  H HB   . VAL A 1 156 ? -18.214 -7.095  -32.347 1.00 33.55 ? 156 VAL A HB   1 
ATOM   2174  H HG11 . VAL A 1 156 ? -19.314 -9.107  -32.644 1.00 32.40 ? 156 VAL A HG11 1 
ATOM   2175  H HG12 . VAL A 1 156 ? -20.283 -7.898  -32.997 1.00 32.40 ? 156 VAL A HG12 1 
ATOM   2176  H HG13 . VAL A 1 156 ? -19.597 -8.733  -34.162 1.00 32.40 ? 156 VAL A HG13 1 
ATOM   2177  H HG21 . VAL A 1 156 ? -16.914 -8.928  -33.001 1.00 31.53 ? 156 VAL A HG21 1 
ATOM   2178  H HG22 . VAL A 1 156 ? -17.095 -8.506  -34.522 1.00 31.53 ? 156 VAL A HG22 1 
ATOM   2179  H HG23 . VAL A 1 156 ? -16.275 -7.573  -33.531 1.00 31.53 ? 156 VAL A HG23 1 
ATOM   2180  N N    . ALA A 1 157 ? -20.059 -4.785  -33.022 1.00 26.70 ? 157 ALA A N    1 
ATOM   2181  C CA   . ALA A 1 157 ? -21.335 -4.099  -32.844 1.00 27.87 ? 157 ALA A CA   1 
ATOM   2182  C C    . ALA A 1 157 ? -21.586 -3.135  -33.997 1.00 32.42 ? 157 ALA A C    1 
ATOM   2183  O O    . ALA A 1 157 ? -22.709 -3.054  -34.515 1.00 33.61 ? 157 ALA A O    1 
ATOM   2184  C CB   . ALA A 1 157 ? -21.346 -3.363  -31.513 1.00 33.10 ? 157 ALA A CB   1 
ATOM   2185  H H    . ALA A 1 157 ? -19.469 -4.617  -32.419 1.00 32.02 ? 157 ALA A H    1 
ATOM   2186  H HA   . ALA A 1 157 ? -22.050 -4.754  -32.835 1.00 33.42 ? 157 ALA A HA   1 
ATOM   2187  H HB1  . ALA A 1 157 ? -22.199 -2.913  -31.409 1.00 39.70 ? 157 ALA A HB1  1 
ATOM   2188  H HB2  . ALA A 1 157 ? -21.221 -4.005  -30.796 1.00 39.70 ? 157 ALA A HB2  1 
ATOM   2189  H HB3  . ALA A 1 157 ? -20.626 -2.714  -31.505 1.00 39.70 ? 157 ALA A HB3  1 
ATOM   2190  N N    . ASP A 1 158 ? -20.549 -2.422  -34.434 1.00 31.33 ? 158 ASP A N    1 
ATOM   2191  C CA   . ASP A 1 158 ? -20.684 -1.500  -35.563 1.00 32.03 ? 158 ASP A CA   1 
ATOM   2192  C C    . ASP A 1 158 ? -20.790 -2.208  -36.912 1.00 34.66 ? 158 ASP A C    1 
ATOM   2193  O O    . ASP A 1 158 ? -20.964 -1.543  -37.936 1.00 33.81 ? 158 ASP A O    1 
ATOM   2194  C CB   . ASP A 1 158 ? -19.516 -0.519  -35.569 1.00 35.65 ? 158 ASP A CB   1 
ATOM   2195  C CG   . ASP A 1 158 ? -19.714 0.624   -34.581 1.00 42.76 ? 158 ASP A CG   1 
ATOM   2196  O OD1  . ASP A 1 158 ? -20.872 0.834   -34.165 1.00 44.26 ? 158 ASP A OD1  1 
ATOM   2197  O OD2  . ASP A 1 158 ? -18.735 1.314   -34.218 1.00 35.83 ? 158 ASP A OD2  1 
ATOM   2198  H H    . ASP A 1 158 ? -19.758 -2.453  -34.096 1.00 37.57 ? 158 ASP A H    1 
ATOM   2199  H HA   . ASP A 1 158 ? -21.496 -0.984  -35.442 1.00 38.42 ? 158 ASP A HA   1 
ATOM   2200  H HB2  . ASP A 1 158 ? -18.704 -0.991  -35.325 1.00 42.76 ? 158 ASP A HB2  1 
ATOM   2201  H HB3  . ASP A 1 158 ? -19.425 -0.138  -36.456 1.00 42.76 ? 158 ASP A HB3  1 
ATOM   2202  N N    . GLU A 1 159 ? -20.700 -3.533  -36.950 1.00 24.94 ? 159 GLU A N    1 
ATOM   2203  C CA   . GLU A 1 159 ? -20.816 -4.298  -38.173 1.00 22.18 ? 159 GLU A CA   1 
ATOM   2204  C C    . GLU A 1 159 ? -19.668 -4.020  -39.159 1.00 28.10 ? 159 GLU A C    1 
ATOM   2205  O O    . GLU A 1 159 ? -19.847 -4.133  -40.375 1.00 24.92 ? 159 GLU A O    1 
ATOM   2206  C CB   . GLU A 1 159 ? -22.176 -4.070  -38.835 1.00 33.18 ? 159 GLU A CB   1 
ATOM   2207  C CG   . GLU A 1 159 ? -23.304 -4.859  -38.161 1.00 38.23 ? 159 GLU A CG   1 
ATOM   2208  C CD   . GLU A 1 159 ? -24.692 -4.419  -38.594 1.00 40.43 ? 159 GLU A CD   1 
ATOM   2209  O OE1  . GLU A 1 159 ? -25.145 -4.810  -39.699 1.00 36.37 ? 159 GLU A OE1  1 
ATOM   2210  O OE2  . GLU A 1 159 ? -25.328 -3.674  -37.814 1.00 46.78 ? 159 GLU A OE2  1 
ATOM   2211  H H    . GLU A 1 159 ? -20.568 -4.022  -36.255 1.00 29.91 ? 159 GLU A H    1 
ATOM   2212  H HA   . GLU A 1 159 ? -20.768 -5.239  -37.943 1.00 26.60 ? 159 GLU A HA   1 
ATOM   2213  H HB2  . GLU A 1 159 ? -22.398 -3.127  -38.784 1.00 39.79 ? 159 GLU A HB2  1 
ATOM   2214  H HB3  . GLU A 1 159 ? -22.128 -4.349  -39.762 1.00 39.79 ? 159 GLU A HB3  1 
ATOM   2215  H HG2  . GLU A 1 159 ? -23.206 -5.798  -38.384 1.00 45.85 ? 159 GLU A HG2  1 
ATOM   2216  H HG3  . GLU A 1 159 ? -23.240 -4.740  -37.201 1.00 45.85 ? 159 GLU A HG3  1 
ATOM   2217  N N    . LYS A 1 160 ? -18.476 -3.721  -38.640 1.00 25.52 ? 160 LYS A N    1 
ATOM   2218  C CA   . LYS A 1 160 ? -17.285 -3.602  -39.465 1.00 24.63 ? 160 LYS A CA   1 
ATOM   2219  C C    . LYS A 1 160 ? -16.714 -4.980  -39.782 1.00 21.51 ? 160 LYS A C    1 
ATOM   2220  O O    . LYS A 1 160 ? -16.557 -5.806  -38.889 1.00 20.46 ? 160 LYS A O    1 
ATOM   2221  C CB   . LYS A 1 160 ? -16.237 -2.763  -38.759 1.00 26.81 ? 160 LYS A CB   1 
ATOM   2222  C CG   . LYS A 1 160 ? -16.652 -1.312  -38.542 1.00 32.08 ? 160 LYS A CG   1 
ATOM   2223  C CD   . LYS A 1 160 ? -15.586 -0.578  -37.771 1.00 40.47 ? 160 LYS A CD   1 
ATOM   2224  H H    . LYS A 1 160 ? -18.334 -3.583  -37.803 1.00 30.60 ? 160 LYS A H    1 
ATOM   2225  H HA   . LYS A 1 160 ? -17.514 -3.166  -40.300 1.00 29.54 ? 160 LYS A HA   1 
ATOM   2226  H HB2  . LYS A 1 160 ? -16.058 -3.153  -37.889 1.00 32.15 ? 160 LYS A HB2  1 
ATOM   2227  H HB3  . LYS A 1 160 ? -15.426 -2.762  -39.291 1.00 32.15 ? 160 LYS A HB3  1 
ATOM   2228  H HG2  . LYS A 1 160 ? -16.767 -0.876  -39.401 1.00 38.48 ? 160 LYS A HG2  1 
ATOM   2229  H HG3  . LYS A 1 160 ? -17.477 -1.284  -38.032 1.00 38.48 ? 160 LYS A HG3  1 
ATOM   2230  N N    . PHE A 1 161 ? -16.393 -5.214  -41.052 1.00 21.10 ? 161 PHE A N    1 
ATOM   2231  C CA   . PHE A 1 161 ? -16.023 -6.545  -41.519 1.00 21.86 ? 161 PHE A CA   1 
ATOM   2232  C C    . PHE A 1 161 ? -14.820 -7.100  -40.774 1.00 20.29 ? 161 PHE A C    1 
ATOM   2233  O O    . PHE A 1 161 ? -13.790 -6.439  -40.632 1.00 19.61 ? 161 PHE A O    1 
ATOM   2234  C CB   . PHE A 1 161 ? -15.722 -6.509  -43.006 1.00 21.83 ? 161 PHE A CB   1 
ATOM   2235  C CG   . PHE A 1 161 ? -15.363 -7.841  -43.585 1.00 22.82 ? 161 PHE A CG   1 
ATOM   2236  C CD1  . PHE A 1 161 ? -16.347 -8.719  -44.003 1.00 21.02 ? 161 PHE A CD1  1 
ATOM   2237  C CD2  . PHE A 1 161 ? -14.041 -8.224  -43.710 1.00 20.23 ? 161 PHE A CD2  1 
ATOM   2238  C CE1  . PHE A 1 161 ? -16.010 -9.947  -44.532 1.00 20.20 ? 161 PHE A CE1  1 
ATOM   2239  C CE2  . PHE A 1 161 ? -13.710 -9.455  -44.230 1.00 24.60 ? 161 PHE A CE2  1 
ATOM   2240  C CZ   . PHE A 1 161 ? -14.695 -10.323 -44.639 1.00 23.05 ? 161 PHE A CZ   1 
ATOM   2241  H H    . PHE A 1 161 ? -16.383 -4.613  -41.667 1.00 25.30 ? 161 PHE A H    1 
ATOM   2242  H HA   . PHE A 1 161 ? -16.769 -7.149  -41.378 1.00 26.21 ? 161 PHE A HA   1 
ATOM   2243  H HB2  . PHE A 1 161 ? -16.506 -6.184  -43.476 1.00 26.17 ? 161 PHE A HB2  1 
ATOM   2244  H HB3  . PHE A 1 161 ? -14.975 -5.909  -43.159 1.00 26.17 ? 161 PHE A HB3  1 
ATOM   2245  H HD1  . PHE A 1 161 ? -17.242 -8.478  -43.928 1.00 25.20 ? 161 PHE A HD1  1 
ATOM   2246  H HD2  . PHE A 1 161 ? -13.367 -7.648  -43.428 1.00 24.25 ? 161 PHE A HD2  1 
ATOM   2247  H HE1  . PHE A 1 161 ? -16.681 -10.530 -44.807 1.00 24.22 ? 161 PHE A HE1  1 
ATOM   2248  H HE2  . PHE A 1 161 ? -12.816 -9.699  -44.307 1.00 29.50 ? 161 PHE A HE2  1 
ATOM   2249  H HZ   . PHE A 1 161 ? -14.471 -11.150 -45.000 1.00 27.63 ? 161 PHE A HZ   1 
ATOM   2250  N N    . CYS A 1 162 ? -14.951 -8.334  -40.317 1.00 18.80 ? 162 CYS A N    1 
ATOM   2251  C CA   . CYS A 1 162 ? -13.823 -9.003  -39.679 1.00 15.70 ? 162 CYS A CA   1 
ATOM   2252  C C    . CYS A 1 162 ? -14.121 -10.498 -39.640 1.00 21.15 ? 162 CYS A C    1 
ATOM   2253  O O    . CYS A 1 162 ? -15.206 -10.943 -40.023 1.00 13.67 ? 162 CYS A O    1 
ATOM   2254  C CB   . CYS A 1 162 ? -13.550 -8.434  -38.287 1.00 17.92 ? 162 CYS A CB   1 
ATOM   2255  S SG   . CYS A 1 162 ? -14.881 -8.578  -37.066 1.00 20.89 ? 162 CYS A SG   1 
ATOM   2256  H H    . CYS A 1 162 ? -15.671 -8.803  -40.361 1.00 22.54 ? 162 CYS A H    1 
ATOM   2257  H HA   . CYS A 1 162 ? -13.028 -8.869  -40.219 1.00 18.82 ? 162 CYS A HA   1 
ATOM   2258  H HB2  . CYS A 1 162 ? -12.776 -8.890  -37.921 1.00 21.49 ? 162 CYS A HB2  1 
ATOM   2259  H HB3  . CYS A 1 162 ? -13.350 -7.490  -38.381 1.00 21.49 ? 162 CYS A HB3  1 
ATOM   2260  H HG   . CYS A 1 162 ? -15.849 -7.999  -37.474 1.00 25.04 ? 162 CYS A HG   1 
ATOM   2261  N N    . GLU A 1 163 ? -13.146 -11.279 -39.176 1.00 16.01 ? 163 GLU A N    1 
ATOM   2262  C CA   . GLU A 1 163 ? -13.311 -12.732 -39.135 1.00 14.06 ? 163 GLU A CA   1 
ATOM   2263  C C    . GLU A 1 163 ? -13.102 -13.226 -37.711 1.00 16.46 ? 163 GLU A C    1 
ATOM   2264  O O    . GLU A 1 163 ? -12.606 -12.504 -36.829 1.00 15.54 ? 163 GLU A O    1 
ATOM   2265  C CB   . GLU A 1 163 ? -12.311 -13.491 -40.014 1.00 22.03 ? 163 GLU A CB   1 
ATOM   2266  C CG   . GLU A 1 163 ? -11.931 -12.949 -41.331 1.00 21.08 ? 163 GLU A CG   1 
ATOM   2267  C CD   . GLU A 1 163 ? -10.838 -13.815 -41.972 1.00 16.89 ? 163 GLU A CD   1 
ATOM   2268  O OE1  . GLU A 1 163 ? -11.171 -14.749 -42.740 1.00 17.45 ? 163 GLU A OE1  1 
ATOM   2269  O OE2  . GLU A 1 163 ? -9.649  -13.575 -41.650 1.00 14.63 ? 163 GLU A OE2  1 
ATOM   2270  H H    . GLU A 1 163 ? -12.388 -10.997 -38.883 1.00 19.19 ? 163 GLU A H    1 
ATOM   2271  H HA   . GLU A 1 163 ? -14.210 -12.965 -39.415 1.00 16.85 ? 163 GLU A HA   1 
ATOM   2272  H HB2  . GLU A 1 163 ? -11.490 -13.584 -39.507 1.00 26.42 ? 163 GLU A HB2  1 
ATOM   2273  H HB3  . GLU A 1 163 ? -12.678 -14.375 -40.176 1.00 26.42 ? 163 GLU A HB3  1 
ATOM   2274  H HG2  . GLU A 1 163 ? -12.705 -12.948 -41.916 1.00 25.28 ? 163 GLU A HG2  1 
ATOM   2275  H HG3  . GLU A 1 163 ? -11.586 -12.049 -41.222 1.00 25.28 ? 163 GLU A HG3  1 
ATOM   2276  N N    . THR A 1 164 ? -13.444 -14.497 -37.510 1.00 14.48 ? 164 THR A N    1 
ATOM   2277  C CA   . THR A 1 164 ? -13.053 -15.192 -36.295 1.00 17.02 ? 164 THR A CA   1 
ATOM   2278  C C    . THR A 1 164 ? -12.913 -16.678 -36.595 1.00 14.91 ? 164 THR A C    1 
ATOM   2279  O O    . THR A 1 164 ? -13.385 -17.192 -37.615 1.00 16.78 ? 164 THR A O    1 
ATOM   2280  C CB   . THR A 1 164 ? -14.030 -14.968 -35.143 1.00 16.79 ? 164 THR A CB   1 
ATOM   2281  O OG1  . THR A 1 164 ? -13.352 -15.193 -33.899 1.00 19.11 ? 164 THR A OG1  1 
ATOM   2282  C CG2  . THR A 1 164 ? -15.287 -15.890 -35.257 1.00 15.65 ? 164 THR A CG2  1 
ATOM   2283  H H    . THR A 1 164 ? -13.899 -14.974 -38.062 1.00 17.36 ? 164 THR A H    1 
ATOM   2284  H HA   . THR A 1 164 ? -12.184 -14.863 -36.014 1.00 20.40 ? 164 THR A HA   1 
ATOM   2285  H HB   . THR A 1 164 ? -14.335 -14.048 -35.169 1.00 20.13 ? 164 THR A HB   1 
ATOM   2286  H HG1  . THR A 1 164 ? -13.061 -15.981 -33.868 1.00 22.91 ? 164 THR A HG1  1 
ATOM   2287  H HG21 . THR A 1 164 ? -15.887 -15.725 -34.513 1.00 18.76 ? 164 THR A HG21 1 
ATOM   2288  H HG22 . THR A 1 164 ? -15.756 -15.708 -36.087 1.00 18.76 ? 164 THR A HG22 1 
ATOM   2289  H HG23 . THR A 1 164 ? -15.017 -16.821 -35.245 1.00 18.76 ? 164 THR A HG23 1 
ATOM   2290  N N    . THR A 1 165 ? -12.217 -17.349 -35.707 1.00 15.54 ? 165 THR A N    1 
ATOM   2291  C CA   . THR A 1 165 ? -12.066 -18.789 -35.745 1.00 13.15 ? 165 THR A CA   1 
ATOM   2292  C C    . THR A 1 165 ? -12.889 -19.424 -34.633 1.00 14.11 ? 165 THR A C    1 
ATOM   2293  O O    . THR A 1 165 ? -12.953 -18.907 -33.511 1.00 16.34 ? 165 THR A O    1 
ATOM   2294  C CB   . THR A 1 165 ? -10.600 -19.189 -35.564 1.00 16.79 ? 165 THR A CB   1 
ATOM   2295  O OG1  . THR A 1 165 ? -9.772  -18.399 -36.405 1.00 17.38 ? 165 THR A OG1  1 
ATOM   2296  C CG2  . THR A 1 165 ? -10.402 -20.612 -35.955 1.00 17.21 ? 165 THR A CG2  1 
ATOM   2297  H H    . THR A 1 165 ? -11.806 -16.981 -35.047 1.00 18.63 ? 165 THR A H    1 
ATOM   2298  H HA   . THR A 1 165 ? -12.379 -19.129 -36.598 1.00 15.76 ? 165 THR A HA   1 
ATOM   2299  H HB   . THR A 1 165 ? -10.336 -19.076 -34.637 1.00 20.13 ? 165 THR A HB   1 
ATOM   2300  H HG1  . THR A 1 165 ? -9.988  -18.512 -37.209 1.00 20.83 ? 165 THR A HG1  1 
ATOM   2301  H HG21 . THR A 1 165 ? -9.472  -20.862 -35.838 1.00 20.63 ? 165 THR A HG21 1 
ATOM   2302  H HG22 . THR A 1 165 ? -10.954 -21.187 -35.402 1.00 20.63 ? 165 THR A HG22 1 
ATOM   2303  H HG23 . THR A 1 165 ? -10.649 -20.738 -36.884 1.00 20.63 ? 165 THR A HG23 1 
ATOM   2304  N N    . ILE A 1 166 ? -13.526 -20.559 -34.929 1.00 16.47 ? 166 ILE A N    1 
ATOM   2305  C CA   . ILE A 1 166 ? -14.182 -21.363 -33.912 1.00 16.01 ? 166 ILE A CA   1 
ATOM   2306  C C    . ILE A 1 166 ? -13.425 -22.669 -33.828 1.00 17.39 ? 166 ILE A C    1 
ATOM   2307  O O    . ILE A 1 166 ? -13.220 -23.339 -34.848 1.00 15.75 ? 166 ILE A O    1 
ATOM   2308  C CB   . ILE A 1 166 ? -15.681 -21.595 -34.215 1.00 12.12 ? 166 ILE A CB   1 
ATOM   2309  C CG1  . ILE A 1 166 ? -16.424 -20.318 -33.908 1.00 17.45 ? 166 ILE A CG1  1 
ATOM   2310  C CG2  . ILE A 1 166 ? -16.221 -22.755 -33.405 1.00 15.58 ? 166 ILE A CG2  1 
ATOM   2311  C CD1  . ILE A 1 166 ? -17.951 -20.389 -34.143 1.00 23.45 ? 166 ILE A CD1  1 
ATOM   2312  H H    . ILE A 1 166 ? -13.590 -20.884 -35.723 1.00 19.75 ? 166 ILE A H    1 
ATOM   2313  H HA   . ILE A 1 166 ? -14.111 -20.915 -33.054 1.00 19.19 ? 166 ILE A HA   1 
ATOM   2314  H HB   . ILE A 1 166 ? -15.782 -21.798 -35.159 1.00 14.53 ? 166 ILE A HB   1 
ATOM   2315  H HG12 . ILE A 1 166 ? -16.280 -20.093 -32.975 1.00 20.92 ? 166 ILE A HG12 1 
ATOM   2316  H HG13 . ILE A 1 166 ? -16.073 -19.611 -34.472 1.00 20.92 ? 166 ILE A HG13 1 
ATOM   2317  H HG21 . ILE A 1 166 ? -17.160 -22.877 -33.615 1.00 18.67 ? 166 ILE A HG21 1 
ATOM   2318  H HG22 . ILE A 1 166 ? -15.724 -23.556 -33.632 1.00 18.67 ? 166 ILE A HG22 1 
ATOM   2319  H HG23 . ILE A 1 166 ? -16.116 -22.556 -32.461 1.00 18.67 ? 166 ILE A HG23 1 
ATOM   2320  H HD11 . ILE A 1 166 ? -18.344 -19.530 -33.921 1.00 28.12 ? 166 ILE A HD11 1 
ATOM   2321  H HD12 . ILE A 1 166 ? -18.117 -20.599 -35.075 1.00 28.12 ? 166 ILE A HD12 1 
ATOM   2322  H HD13 . ILE A 1 166 ? -18.325 -21.081 -33.576 1.00 28.12 ? 166 ILE A HD13 1 
ATOM   2323  N N    . GLY A 1 167 ? -12.991 -23.022 -32.617 1.00 16.97 ? 167 GLY A N    1 
ATOM   2324  C CA   . GLY A 1 167 ? -12.356 -24.309 -32.377 1.00 13.83 ? 167 GLY A CA   1 
ATOM   2325  C C    . GLY A 1 167 ? -13.393 -25.192 -31.712 1.00 18.32 ? 167 GLY A C    1 
ATOM   2326  O O    . GLY A 1 167 ? -13.871 -24.883 -30.624 1.00 15.66 ? 167 GLY A O    1 
ATOM   2327  H H    . GLY A 1 167 ? -13.055 -22.527 -31.917 1.00 20.34 ? 167 GLY A H    1 
ATOM   2328  H HA2  . GLY A 1 167 ? -12.074 -24.712 -33.213 1.00 16.57 ? 167 GLY A HA2  1 
ATOM   2329  H HA3  . GLY A 1 167 ? -11.591 -24.208 -31.790 1.00 16.57 ? 167 GLY A HA3  1 
ATOM   2330  N N    . CYS A 1 168 ? -13.726 -26.299 -32.376 1.00 19.73 ? 168 CYS A N    1 
ATOM   2331  C CA   . CYS A 1 168 ? -14.750 -27.201 -31.856 1.00 17.34 ? 168 CYS A CA   1 
ATOM   2332  C C    . CYS A 1 168 ? -14.452 -28.627 -32.307 1.00 19.28 ? 168 CYS A C    1 
ATOM   2333  O O    . CYS A 1 168 ? -14.355 -28.888 -33.513 1.00 20.64 ? 168 CYS A O    1 
ATOM   2334  C CB   . CYS A 1 168 ? -16.124 -26.771 -32.348 1.00 22.08 ? 168 CYS A CB   1 
ATOM   2335  S SG   . CYS A 1 168 ? -17.452 -27.826 -31.780 1.00 22.70 ? 168 CYS A SG   1 
ATOM   2336  H H    . CYS A 1 168 ? -13.378 -26.547 -33.122 1.00 23.66 ? 168 CYS A H    1 
ATOM   2337  H HA   . CYS A 1 168 ? -14.746 -27.175 -30.887 1.00 20.78 ? 168 CYS A HA   1 
ATOM   2338  H HB2  . CYS A 1 168 ? -16.302 -25.872 -32.031 1.00 26.47 ? 168 CYS A HB2  1 
ATOM   2339  H HB3  . CYS A 1 168 ? -16.128 -26.785 -33.318 1.00 26.47 ? 168 CYS A HB3  1 
ATOM   2340  H HG   . CYS A 1 168 ? -17.259 -28.943 -32.173 1.00 27.22 ? 168 CYS A HG   1 
ATOM   2341  N N    . LYS A 1 169 ? -14.365 -29.539 -31.333 1.00 21.33 ? 169 LYS A N    1 
ATOM   2342  C CA   . LYS A 1 169 ? -14.020 -30.939 -31.591 1.00 22.75 ? 169 LYS A CA   1 
ATOM   2343  C C    . LYS A 1 169 ? -15.110 -31.653 -32.395 1.00 27.15 ? 169 LYS A C    1 
ATOM   2344  O O    . LYS A 1 169 ? -14.810 -32.492 -33.251 1.00 28.69 ? 169 LYS A O    1 
ATOM   2345  C CB   . LYS A 1 169 ? -13.778 -31.662 -30.258 1.00 25.96 ? 169 LYS A CB   1 
ATOM   2346  H H    . LYS A 1 169 ? -14.503 -29.367 -30.501 1.00 25.57 ? 169 LYS A H    1 
ATOM   2347  H HA   . LYS A 1 169 ? -13.198 -30.972 -32.105 1.00 27.28 ? 169 LYS A HA   1 
ATOM   2348  N N    . ASP A 1 170 ? -16.369 -31.349 -32.124 1.00 25.83 ? 170 ASP A N    1 
ATOM   2349  C CA   . ASP A 1 170 ? -17.486 -32.085 -32.721 1.00 29.76 ? 170 ASP A CA   1 
ATOM   2350  C C    . ASP A 1 170 ? -17.998 -31.380 -33.966 1.00 24.63 ? 170 ASP A C    1 
ATOM   2351  O O    . ASP A 1 170 ? -18.460 -30.234 -33.859 1.00 27.33 ? 170 ASP A O    1 
ATOM   2352  C CB   . ASP A 1 170 ? -18.616 -32.232 -31.724 1.00 30.23 ? 170 ASP A CB   1 
ATOM   2353  C CG   . ASP A 1 170 ? -19.773 -33.025 -32.294 1.00 35.48 ? 170 ASP A CG   1 
ATOM   2354  O OD1  . ASP A 1 170 ? -19.563 -34.193 -32.678 1.00 37.14 ? 170 ASP A OD1  1 
ATOM   2355  O OD2  . ASP A 1 170 ? -20.867 -32.464 -32.399 1.00 36.44 ? 170 ASP A OD2  1 
ATOM   2356  H H    . ASP A 1 170 ? -16.611 -30.717 -31.593 1.00 30.98 ? 170 ASP A H    1 
ATOM   2357  H HA   . ASP A 1 170 ? -17.186 -32.972 -32.975 1.00 35.69 ? 170 ASP A HA   1 
ATOM   2358  H HB2  . ASP A 1 170 ? -18.289 -32.697 -30.938 1.00 36.25 ? 170 ASP A HB2  1 
ATOM   2359  H HB3  . ASP A 1 170 ? -18.943 -31.352 -31.481 1.00 36.25 ? 170 ASP A HB3  1 
ATOM   2360  N N    . PRO A 1 171 ? -17.994 -32.026 -35.136 1.00 28.92 ? 171 PRO A N    1 
ATOM   2361  C CA   . PRO A 1 171 ? -18.386 -31.318 -36.372 1.00 28.37 ? 171 PRO A CA   1 
ATOM   2362  C C    . PRO A 1 171 ? -19.796 -30.757 -36.355 1.00 30.49 ? 171 PRO A C    1 
ATOM   2363  O O    . PRO A 1 171 ? -20.025 -29.608 -36.768 1.00 26.94 ? 171 PRO A O    1 
ATOM   2364  C CB   . PRO A 1 171 ? -18.215 -32.402 -37.444 1.00 30.92 ? 171 PRO A CB   1 
ATOM   2365  C CG   . PRO A 1 171 ? -17.205 -33.296 -36.903 1.00 29.70 ? 171 PRO A CG   1 
ATOM   2366  C CD   . PRO A 1 171 ? -17.463 -33.360 -35.438 1.00 28.36 ? 171 PRO A CD   1 
ATOM   2367  H HA   . PRO A 1 171 ? -17.763 -30.597 -36.551 1.00 34.02 ? 171 PRO A HA   1 
ATOM   2368  H HB2  . PRO A 1 171 ? -19.055 -32.869 -37.575 1.00 37.08 ? 171 PRO A HB2  1 
ATOM   2369  H HB3  . PRO A 1 171 ? -17.911 -31.999 -38.272 1.00 37.08 ? 171 PRO A HB3  1 
ATOM   2370  H HG2  . PRO A 1 171 ? -17.300 -34.174 -37.305 1.00 35.61 ? 171 PRO A HG2  1 
ATOM   2371  H HG3  . PRO A 1 171 ? -16.322 -32.934 -37.079 1.00 35.61 ? 171 PRO A HG3  1 
ATOM   2372  H HD2  . PRO A 1 171 ? -18.124 -34.042 -35.239 1.00 34.01 ? 171 PRO A HD2  1 
ATOM   2373  H HD3  . PRO A 1 171 ? -16.636 -33.514 -34.954 1.00 34.01 ? 171 PRO A HD3  1 
ATOM   2374  N N    . ALA A 1 172 ? -20.768 -31.535 -35.900 1.00 28.18 ? 172 ALA A N    1 
ATOM   2375  C CA   . ALA A 1 172 ? -22.129 -31.036 -35.947 1.00 30.86 ? 172 ALA A CA   1 
ATOM   2376  C C    . ALA A 1 172 ? -22.294 -29.866 -34.985 1.00 25.36 ? 172 ALA A C    1 
ATOM   2377  O O    . ALA A 1 172 ? -22.982 -28.888 -35.291 1.00 26.55 ? 172 ALA A O    1 
ATOM   2378  C CB   . ALA A 1 172 ? -23.103 -32.168 -35.631 1.00 34.40 ? 172 ALA A CB   1 
ATOM   2379  H H    . ALA A 1 172 ? -20.671 -32.324 -35.572 1.00 33.80 ? 172 ALA A H    1 
ATOM   2380  H HA   . ALA A 1 172 ? -22.319 -30.717 -36.843 1.00 37.01 ? 172 ALA A HA   1 
ATOM   2381  H HB1  . ALA A 1 172 ? -24.009 -31.824 -35.665 1.00 41.26 ? 172 ALA A HB1  1 
ATOM   2382  H HB2  . ALA A 1 172 ? -22.991 -32.872 -36.289 1.00 41.26 ? 172 ALA A HB2  1 
ATOM   2383  H HB3  . ALA A 1 172 ? -22.912 -32.510 -34.744 1.00 41.26 ? 172 ALA A HB3  1 
ATOM   2384  N N    . GLN A 1 173 ? -21.638 -29.927 -33.826 1.00 28.67 ? 173 GLN A N    1 
ATOM   2385  C CA   . GLN A 1 173 ? -21.713 -28.810 -32.898 1.00 29.50 ? 173 GLN A CA   1 
ATOM   2386  C C    . GLN A 1 173 ? -21.016 -27.571 -33.470 1.00 24.16 ? 173 GLN A C    1 
ATOM   2387  O O    . GLN A 1 173 ? -21.523 -26.453 -33.332 1.00 22.88 ? 173 GLN A O    1 
ATOM   2388  C CB   . GLN A 1 173 ? -21.099 -29.216 -31.559 1.00 32.71 ? 173 GLN A CB   1 
ATOM   2389  C CG   . GLN A 1 173 ? -20.922 -28.065 -30.600 1.00 28.54 ? 173 GLN A CG   1 
ATOM   2390  C CD   . GLN A 1 173 ? -22.176 -27.635 -29.855 1.00 39.47 ? 173 GLN A CD   1 
ATOM   2391  O OE1  . GLN A 1 173 ? -22.087 -26.793 -28.953 1.00 41.15 ? 173 GLN A OE1  1 
ATOM   2392  N NE2  . GLN A 1 173 ? -23.351 -28.183 -30.222 1.00 39.59 ? 173 GLN A NE2  1 
ATOM   2393  H H    . GLN A 1 173 ? -21.156 -30.588 -33.562 1.00 34.39 ? 173 GLN A H    1 
ATOM   2394  H HA   . GLN A 1 173 ? -22.644 -28.586 -32.746 1.00 35.38 ? 173 GLN A HA   1 
ATOM   2395  H HB2  . GLN A 1 173 ? -21.677 -29.869 -31.135 1.00 39.23 ? 173 GLN A HB2  1 
ATOM   2396  H HB3  . GLN A 1 173 ? -20.225 -29.605 -31.721 1.00 39.23 ? 173 GLN A HB3  1 
ATOM   2397  H HG2  . GLN A 1 173 ? -20.261 -28.318 -29.936 1.00 34.22 ? 173 GLN A HG2  1 
ATOM   2398  H HG3  . GLN A 1 173 ? -20.601 -27.297 -31.099 1.00 34.22 ? 173 GLN A HG3  1 
ATOM   2399  H HE21 . GLN A 1 173 ? -23.375 -28.764 -30.856 1.00 47.49 ? 173 GLN A HE21 1 
ATOM   2400  H HE22 . GLN A 1 173 ? -24.075 -27.956 -29.818 1.00 47.49 ? 173 GLN A HE22 1 
ATOM   2401  N N    . GLY A 1 174 ? -19.854 -27.762 -34.095 1.00 23.71 ? 174 GLY A N    1 
ATOM   2402  C CA   . GLY A 1 174 ? -19.192 -26.664 -34.783 1.00 25.53 ? 174 GLY A CA   1 
ATOM   2403  C C    . GLY A 1 174 ? -20.078 -25.959 -35.794 1.00 24.63 ? 174 GLY A C    1 
ATOM   2404  O O    . GLY A 1 174 ? -20.089 -24.729 -35.879 1.00 22.14 ? 174 GLY A O    1 
ATOM   2405  H H    . GLY A 1 174 ? -19.435 -28.512 -34.134 1.00 28.42 ? 174 GLY A H    1 
ATOM   2406  H HA2  . GLY A 1 174 ? -18.897 -26.010 -34.130 1.00 30.61 ? 174 GLY A HA2  1 
ATOM   2407  H HA3  . GLY A 1 174 ? -18.411 -27.003 -35.248 1.00 30.61 ? 174 GLY A HA3  1 
ATOM   2408  N N    . GLN A 1 175 ? -20.812 -26.722 -36.586 1.00 25.13 ? 175 GLN A N    1 
ATOM   2409  C CA   . GLN A 1 175 ? -21.660 -26.134 -37.623 1.00 23.08 ? 175 GLN A CA   1 
ATOM   2410  C C    . GLN A 1 175 ? -22.797 -25.339 -37.004 1.00 22.21 ? 175 GLN A C    1 
ATOM   2411  O O    . GLN A 1 175 ? -23.173 -24.270 -37.503 1.00 22.08 ? 175 GLN A O    1 
ATOM   2412  C CB   . GLN A 1 175 ? -22.161 -27.261 -38.539 1.00 28.74 ? 175 GLN A CB   1 
ATOM   2413  C CG   . GLN A 1 175 ? -23.048 -26.834 -39.696 1.00 33.12 ? 175 GLN A CG   1 
ATOM   2414  C CD   . GLN A 1 175 ? -22.371 -25.856 -40.630 1.00 38.52 ? 175 GLN A CD   1 
ATOM   2415  O OE1  . GLN A 1 175 ? -21.161 -25.930 -40.871 1.00 36.12 ? 175 GLN A OE1  1 
ATOM   2416  N NE2  . GLN A 1 175 ? -23.156 -24.920 -41.166 1.00 38.92 ? 175 GLN A NE2  1 
ATOM   2417  H H    . GLN A 1 175 ? -20.842 -27.581 -36.548 1.00 30.13 ? 175 GLN A H    1 
ATOM   2418  H HA   . GLN A 1 175 ? -21.127 -25.527 -38.159 1.00 27.68 ? 175 GLN A HA   1 
ATOM   2419  H HB2  . GLN A 1 175 ? -21.390 -27.712 -38.917 1.00 34.47 ? 175 GLN A HB2  1 
ATOM   2420  H HB3  . GLN A 1 175 ? -22.669 -27.888 -38.001 1.00 34.47 ? 175 GLN A HB3  1 
ATOM   2421  H HG2  . GLN A 1 175 ? -23.293 -27.619 -40.211 1.00 39.72 ? 175 GLN A HG2  1 
ATOM   2422  H HG3  . GLN A 1 175 ? -23.845 -26.409 -39.343 1.00 39.72 ? 175 GLN A HG3  1 
ATOM   2423  H HE21 . GLN A 1 175 ? -23.994 -24.900 -40.974 1.00 46.68 ? 175 GLN A HE21 1 
ATOM   2424  H HE22 . GLN A 1 175 ? -22.825 -24.337 -41.704 1.00 46.68 ? 175 GLN A HE22 1 
ATOM   2425  N N    . LEU A 1 176 ? -23.357 -25.852 -35.909 1.00 23.24 ? 176 LEU A N    1 
ATOM   2426  C CA   . LEU A 1 176 ? -24.367 -25.139 -35.140 1.00 22.57 ? 176 LEU A CA   1 
ATOM   2427  C C    . LEU A 1 176 ? -23.830 -23.833 -34.595 1.00 23.29 ? 176 LEU A C    1 
ATOM   2428  O O    . LEU A 1 176 ? -24.496 -22.790 -34.652 1.00 21.16 ? 176 LEU A O    1 
ATOM   2429  C CB   . LEU A 1 176 ? -24.831 -26.046 -33.996 1.00 27.12 ? 176 LEU A CB   1 
ATOM   2430  C CG   . LEU A 1 176 ? -26.237 -25.933 -33.432 1.00 34.77 ? 176 LEU A CG   1 
ATOM   2431  C CD1  . LEU A 1 176 ? -27.265 -25.859 -34.535 1.00 30.44 ? 176 LEU A CD1  1 
ATOM   2432  C CD2  . LEU A 1 176 ? -26.501 -27.152 -32.556 1.00 30.69 ? 176 LEU A CD2  1 
ATOM   2433  H H    . LEU A 1 176 ? -23.164 -26.626 -35.588 1.00 27.86 ? 176 LEU A H    1 
ATOM   2434  H HA   . LEU A 1 176 ? -25.129 -24.945 -35.708 1.00 27.07 ? 176 LEU A HA   1 
ATOM   2435  H HB2  . LEU A 1 176 ? -24.733 -26.962 -34.299 1.00 32.52 ? 176 LEU A HB2  1 
ATOM   2436  H HB3  . LEU A 1 176 ? -24.227 -25.900 -33.251 1.00 32.52 ? 176 LEU A HB3  1 
ATOM   2437  H HG   . LEU A 1 176 ? -26.308 -25.136 -32.885 1.00 41.71 ? 176 LEU A HG   1 
ATOM   2438  H HD11 . LEU A 1 176 ? -28.148 -25.788 -34.139 1.00 36.51 ? 176 LEU A HD11 1 
ATOM   2439  H HD12 . LEU A 1 176 ? -27.084 -25.079 -35.082 1.00 36.51 ? 176 LEU A HD12 1 
ATOM   2440  H HD13 . LEU A 1 176 ? -27.207 -26.663 -35.074 1.00 36.51 ? 176 LEU A HD13 1 
ATOM   2441  H HD21 . LEU A 1 176 ? -27.398 -27.090 -32.191 1.00 36.80 ? 176 LEU A HD21 1 
ATOM   2442  H HD22 . LEU A 1 176 ? -26.420 -27.953 -33.097 1.00 36.80 ? 176 LEU A HD22 1 
ATOM   2443  H HD23 . LEU A 1 176 ? -25.851 -27.171 -31.837 1.00 36.80 ? 176 LEU A HD23 1 
ATOM   2444  N N    . LEU A 1 177 ? -22.607 -23.855 -34.069 1.00 21.11 ? 177 LEU A N    1 
ATOM   2445  C CA   . LEU A 1 177 ? -22.072 -22.625 -33.529 1.00 16.07 ? 177 LEU A CA   1 
ATOM   2446  C C    . LEU A 1 177 ? -21.810 -21.605 -34.648 1.00 13.55 ? 177 LEU A C    1 
ATOM   2447  O O    . LEU A 1 177 ? -22.026 -20.403 -34.459 1.00 18.88 ? 177 LEU A O    1 
ATOM   2448  C CB   . LEU A 1 177 ? -20.801 -22.954 -32.735 1.00 16.17 ? 177 LEU A CB   1 
ATOM   2449  C CG   . LEU A 1 177 ? -21.038 -23.821 -31.491 1.00 21.50 ? 177 LEU A CG   1 
ATOM   2450  C CD1  . LEU A 1 177 ? -19.712 -24.363 -30.977 1.00 22.38 ? 177 LEU A CD1  1 
ATOM   2451  C CD2  . LEU A 1 177 ? -21.716 -23.014 -30.430 1.00 24.24 ? 177 LEU A CD2  1 
ATOM   2452  H H    . LEU A 1 177 ? -22.091 -24.541 -34.016 1.00 25.31 ? 177 LEU A H    1 
ATOM   2453  H HA   . LEU A 1 177 ? -22.718 -22.241 -32.916 1.00 19.26 ? 177 LEU A HA   1 
ATOM   2454  H HB2  . LEU A 1 177 ? -20.188 -23.433 -33.315 1.00 19.38 ? 177 LEU A HB2  1 
ATOM   2455  H HB3  . LEU A 1 177 ? -20.393 -22.124 -32.442 1.00 19.38 ? 177 LEU A HB3  1 
ATOM   2456  H HG   . LEU A 1 177 ? -21.610 -24.570 -31.721 1.00 25.78 ? 177 LEU A HG   1 
ATOM   2457  H HD11 . LEU A 1 177 ? -19.876 -24.908 -30.192 1.00 26.83 ? 177 LEU A HD11 1 
ATOM   2458  H HD12 . LEU A 1 177 ? -19.300 -24.900 -31.672 1.00 26.83 ? 177 LEU A HD12 1 
ATOM   2459  H HD13 . LEU A 1 177 ? -19.134 -23.618 -30.748 1.00 26.83 ? 177 LEU A HD13 1 
ATOM   2460  H HD21 . LEU A 1 177 ? -21.859 -23.574 -29.651 1.00 29.07 ? 177 LEU A HD21 1 
ATOM   2461  H HD22 . LEU A 1 177 ? -21.150 -22.261 -30.197 1.00 29.07 ? 177 LEU A HD22 1 
ATOM   2462  H HD23 . LEU A 1 177 ? -22.567 -22.696 -30.771 1.00 29.07 ? 177 LEU A HD23 1 
ATOM   2463  N N    . LYS A 1 178 ? -21.370 -22.076 -35.816 1.00 16.75 ? 178 LYS A N    1 
ATOM   2464  C CA   . LYS A 1 178 ? -21.114 -21.191 -36.951 1.00 20.92 ? 178 LYS A CA   1 
ATOM   2465  C C    . LYS A 1 178 ? -22.402 -20.510 -37.395 1.00 21.83 ? 178 LYS A C    1 
ATOM   2466  O O    . LYS A 1 178 ? -22.422 -19.301 -37.658 1.00 21.25 ? 178 LYS A O    1 
ATOM   2467  C CB   . LYS A 1 178 ? -20.482 -21.995 -38.088 1.00 23.13 ? 178 LYS A CB   1 
ATOM   2468  C CG   . LYS A 1 178 ? -20.246 -21.240 -39.405 1.00 18.68 ? 178 LYS A CG   1 
ATOM   2469  C CD   . LYS A 1 178 ? -19.758 -22.212 -40.433 1.00 26.20 ? 178 LYS A CD   1 
ATOM   2470  C CE   . LYS A 1 178 ? -19.646 -21.636 -41.842 1.00 26.98 ? 178 LYS A CE   1 
ATOM   2471  N NZ   . LYS A 1 178 ? -18.474 -20.801 -41.956 1.00 21.23 ? 178 LYS A NZ   1 
ATOM   2472  H H    . LYS A 1 178 ? -21.211 -22.906 -35.975 1.00 20.07 ? 178 LYS A H    1 
ATOM   2473  H HA   . LYS A 1 178 ? -20.485 -20.503 -36.683 1.00 25.08 ? 178 LYS A HA   1 
ATOM   2474  H HB2  . LYS A 1 178 ? -19.621 -22.325 -37.786 1.00 27.73 ? 178 LYS A HB2  1 
ATOM   2475  H HB3  . LYS A 1 178 ? -21.062 -22.747 -38.288 1.00 27.73 ? 178 LYS A HB3  1 
ATOM   2476  H HG2  . LYS A 1 178 ? -21.078 -20.849 -39.715 1.00 22.39 ? 178 LYS A HG2  1 
ATOM   2477  H HG3  . LYS A 1 178 ? -19.570 -20.556 -39.276 1.00 22.39 ? 178 LYS A HG3  1 
ATOM   2478  H HD2  . LYS A 1 178 ? -18.878 -22.525 -40.171 1.00 31.42 ? 178 LYS A HD2  1 
ATOM   2479  H HD3  . LYS A 1 178 ? -20.374 -22.961 -40.468 1.00 31.42 ? 178 LYS A HD3  1 
ATOM   2480  H HE2  . LYS A 1 178 ? -19.569 -22.361 -42.482 1.00 32.36 ? 178 LYS A HE2  1 
ATOM   2481  H HE3  . LYS A 1 178 ? -20.428 -21.096 -42.034 1.00 32.36 ? 178 LYS A HE3  1 
ATOM   2482  H HZ1  . LYS A 1 178 ? -18.416 -20.470 -42.780 1.00 25.45 ? 178 LYS A HZ1  1 
ATOM   2483  H HZ2  . LYS A 1 178 ? -18.524 -20.128 -41.376 1.00 25.45 ? 178 LYS A HZ2  1 
ATOM   2484  H HZ3  . LYS A 1 178 ? -17.743 -21.279 -41.783 1.00 25.45 ? 178 LYS A HZ3  1 
ATOM   2485  N N    . GLU A 1 179 ? -23.503 -21.261 -37.397 1.00 23.98 ? 179 GLU A N    1 
ATOM   2486  C CA   . GLU A 1 179 ? -24.817 -20.701 -37.763 1.00 18.47 ? 179 GLU A CA   1 
ATOM   2487  C C    . GLU A 1 179 ? -25.294 -19.698 -36.739 1.00 20.09 ? 179 GLU A C    1 
ATOM   2488  O O    . GLU A 1 179 ? -25.874 -18.661 -37.083 1.00 19.89 ? 179 GLU A O    1 
ATOM   2489  C CB   . GLU A 1 179 ? -25.820 -21.846 -37.926 1.00 26.37 ? 179 GLU A CB   1 
ATOM   2490  C CG   . GLU A 1 179 ? -25.468 -22.762 -39.089 1.00 27.03 ? 179 GLU A CG   1 
ATOM   2491  C CD   . GLU A 1 179 ? -26.120 -24.137 -39.003 1.00 28.45 ? 179 GLU A CD   1 
ATOM   2492  O OE1  . GLU A 1 179 ? -26.735 -24.451 -37.963 1.00 26.71 ? 179 GLU A OE1  1 
ATOM   2493  O OE2  . GLU A 1 179 ? -25.975 -24.912 -39.967 1.00 28.20 ? 179 GLU A OE2  1 
ATOM   2494  H H    . GLU A 1 179 ? -23.522 -22.095 -37.192 1.00 28.76 ? 179 GLU A H    1 
ATOM   2495  H HA   . GLU A 1 179 ? -24.741 -20.245 -38.616 1.00 22.14 ? 179 GLU A HA   1 
ATOM   2496  H HB2  . GLU A 1 179 ? -25.829 -22.378 -37.115 1.00 31.62 ? 179 GLU A HB2  1 
ATOM   2497  H HB3  . GLU A 1 179 ? -26.701 -21.475 -38.091 1.00 31.62 ? 179 GLU A HB3  1 
ATOM   2498  H HG2  . GLU A 1 179 ? -25.760 -22.346 -39.915 1.00 32.42 ? 179 GLU A HG2  1 
ATOM   2499  H HG3  . GLU A 1 179 ? -24.507 -22.890 -39.106 1.00 32.42 ? 179 GLU A HG3  1 
ATOM   2500  N N    . LEU A 1 180 ? -25.024 -19.951 -35.459 1.00 21.62 ? 180 LEU A N    1 
ATOM   2501  C CA   . LEU A 1 180 ? -25.462 -19.008 -34.452 1.00 17.54 ? 180 LEU A CA   1 
ATOM   2502  C C    . LEU A 1 180 ? -24.704 -17.685 -34.564 1.00 21.71 ? 180 LEU A C    1 
ATOM   2503  O O    . LEU A 1 180 ? -25.277 -16.614 -34.313 1.00 23.00 ? 180 LEU A O    1 
ATOM   2504  C CB   . LEU A 1 180 ? -25.299 -19.673 -33.077 1.00 21.01 ? 180 LEU A CB   1 
ATOM   2505  C CG   . LEU A 1 180 ? -25.889 -18.971 -31.885 1.00 21.53 ? 180 LEU A CG   1 
ATOM   2506  C CD1  . LEU A 1 180 ? -27.413 -18.926 -32.038 1.00 24.22 ? 180 LEU A CD1  1 
ATOM   2507  C CD2  . LEU A 1 180 ? -25.521 -19.714 -30.600 1.00 23.96 ? 180 LEU A CD2  1 
ATOM   2508  H H    . LEU A 1 180 ? -24.602 -20.638 -35.162 1.00 25.93 ? 180 LEU A H    1 
ATOM   2509  H HA   . LEU A 1 180 ? -26.405 -18.823 -34.584 1.00 21.02 ? 180 LEU A HA   1 
ATOM   2510  H HB2  . LEU A 1 180 ? -25.708 -20.552 -33.119 1.00 25.19 ? 180 LEU A HB2  1 
ATOM   2511  H HB3  . LEU A 1 180 ? -24.349 -19.774 -32.905 1.00 25.19 ? 180 LEU A HB3  1 
ATOM   2512  H HG   . LEU A 1 180 ? -25.551 -18.063 -31.833 1.00 25.82 ? 180 LEU A HG   1 
ATOM   2513  H HD11 . LEU A 1 180 ? -27.794 -18.473 -31.270 1.00 29.05 ? 180 LEU A HD11 1 
ATOM   2514  H HD12 . LEU A 1 180 ? -27.634 -18.444 -32.850 1.00 29.05 ? 180 LEU A HD12 1 
ATOM   2515  H HD13 . LEU A 1 180 ? -27.751 -19.834 -32.089 1.00 29.05 ? 180 LEU A HD13 1 
ATOM   2516  H HD21 . LEU A 1 180 ? -25.910 -19.248 -29.844 1.00 28.73 ? 180 LEU A HD21 1 
ATOM   2517  H HD22 . LEU A 1 180 ? -25.871 -20.618 -30.648 1.00 28.73 ? 180 LEU A HD22 1 
ATOM   2518  H HD23 . LEU A 1 180 ? -24.555 -19.737 -30.515 1.00 28.73 ? 180 LEU A HD23 1 
ATOM   2519  N N    . MET A 1 181 ? -23.427 -17.727 -34.974 1.00 17.93 ? 181 MET A N    1 
ATOM   2520  C CA   . MET A 1 181 ? -22.558 -16.570 -34.830 1.00 21.63 ? 181 MET A CA   1 
ATOM   2521  C C    . MET A 1 181 ? -22.249 -15.816 -36.117 1.00 18.14 ? 181 MET A C    1 
ATOM   2522  O O    . MET A 1 181 ? -21.821 -14.666 -36.035 1.00 25.29 ? 181 MET A O    1 
ATOM   2523  C CB   . MET A 1 181 ? -21.210 -16.990 -34.209 1.00 23.78 ? 181 MET A CB   1 
ATOM   2524  C CG   . MET A 1 181 ? -21.328 -17.679 -32.911 1.00 31.67 ? 181 MET A CG   1 
ATOM   2525  S SD   . MET A 1 181 ? -21.273 -16.567 -31.528 1.00 38.01 ? 181 MET A SD   1 
ATOM   2526  C CE   . MET A 1 181 ? -20.880 -17.781 -30.378 1.00 27.78 ? 181 MET A CE   1 
ATOM   2527  H H    . MET A 1 181 ? -23.051 -18.411 -35.336 1.00 21.50 ? 181 MET A H    1 
ATOM   2528  H HA   . MET A 1 181 ? -22.979 -15.952 -34.212 1.00 25.94 ? 181 MET A HA   1 
ATOM   2529  H HB2  . MET A 1 181 ? -20.760 -17.592 -34.822 1.00 28.51 ? 181 MET A HB2  1 
ATOM   2530  H HB3  . MET A 1 181 ? -20.669 -16.197 -34.074 1.00 28.51 ? 181 MET A HB3  1 
ATOM   2531  H HG2  . MET A 1 181 ? -22.174 -18.152 -32.881 1.00 37.98 ? 181 MET A HG2  1 
ATOM   2532  H HG3  . MET A 1 181 ? -20.594 -18.306 -32.819 1.00 37.98 ? 181 MET A HG3  1 
ATOM   2533  H HE1  . MET A 1 181 ? -20.798 -17.371 -29.503 1.00 33.31 ? 181 MET A HE1  1 
ATOM   2534  H HE2  . MET A 1 181 ? -21.587 -18.446 -30.368 1.00 33.31 ? 181 MET A HE2  1 
ATOM   2535  H HE3  . MET A 1 181 ? -20.040 -18.195 -30.631 1.00 33.31 ? 181 MET A HE3  1 
ATOM   2536  N N    . GLN A 1 182 ? -22.417 -16.422 -37.276 1.00 21.13 ? 182 GLN A N    1 
ATOM   2537  C CA   . GLN A 1 182 ? -21.904 -15.837 -38.502 1.00 20.29 ? 182 GLN A CA   1 
ATOM   2538  C C    . GLN A 1 182 ? -22.894 -14.836 -39.105 1.00 28.37 ? 182 GLN A C    1 
ATOM   2539  O O    . GLN A 1 182 ? -24.115 -15.061 -39.123 1.00 23.59 ? 182 GLN A O    1 
ATOM   2540  C CB   . GLN A 1 182 ? -21.591 -16.924 -39.514 1.00 23.24 ? 182 GLN A CB   1 
ATOM   2541  C CG   . GLN A 1 182 ? -20.959 -16.390 -40.802 1.00 20.09 ? 182 GLN A CG   1 
ATOM   2542  C CD   . GLN A 1 182 ? -20.404 -17.474 -41.667 1.00 21.56 ? 182 GLN A CD   1 
ATOM   2543  O OE1  . GLN A 1 182 ? -19.247 -17.870 -41.531 1.00 22.25 ? 182 GLN A OE1  1 
ATOM   2544  N NE2  . GLN A 1 182 ? -21.224 -17.966 -42.591 1.00 24.46 ? 182 GLN A NE2  1 
ATOM   2545  H H    . GLN A 1 182 ? -22.824 -17.172 -37.382 1.00 25.34 ? 182 GLN A H    1 
ATOM   2546  H HA   . GLN A 1 182 ? -21.080 -15.364 -38.306 1.00 24.32 ? 182 GLN A HA   1 
ATOM   2547  H HB2  . GLN A 1 182 ? -20.970 -17.554 -39.116 1.00 27.86 ? 182 GLN A HB2  1 
ATOM   2548  H HB3  . GLN A 1 182 ? -22.415 -17.378 -39.752 1.00 27.86 ? 182 GLN A HB3  1 
ATOM   2549  H HG2  . GLN A 1 182 ? -21.634 -15.915 -41.312 1.00 24.09 ? 182 GLN A HG2  1 
ATOM   2550  H HG3  . GLN A 1 182 ? -20.233 -15.788 -40.572 1.00 24.09 ? 182 GLN A HG3  1 
ATOM   2551  H HE21 . GLN A 1 182 ? -22.026 -17.664 -42.659 1.00 29.33 ? 182 GLN A HE21 1 
ATOM   2552  H HE22 . GLN A 1 182 ? -20.954 -18.591 -43.116 1.00 29.33 ? 182 GLN A HE22 1 
ATOM   2553  N N    . THR A 1 183 ? -22.343 -13.699 -39.568 1.00 23.01 ? 183 THR A N    1 
ATOM   2554  C CA   . THR A 1 183 ? -23.076 -12.720 -40.362 1.00 21.05 ? 183 THR A CA   1 
ATOM   2555  C C    . THR A 1 183 ? -22.230 -12.327 -41.564 1.00 28.28 ? 183 THR A C    1 
ATOM   2556  O O    . THR A 1 183 ? -21.057 -12.737 -41.670 1.00 18.11 ? 183 THR A O    1 
ATOM   2557  C CB   . THR A 1 183 ? -23.379 -11.463 -39.561 1.00 21.17 ? 183 THR A CB   1 
ATOM   2558  O OG1  . THR A 1 183 ? -22.165 -10.714 -39.365 1.00 27.82 ? 183 THR A OG1  1 
ATOM   2559  C CG2  . THR A 1 183 ? -23.989 -11.785 -38.218 1.00 28.70 ? 183 THR A CG2  1 
ATOM   2560  H H    . THR A 1 183 ? -21.525 -13.476 -39.426 1.00 27.59 ? 183 THR A H    1 
ATOM   2561  H HA   . THR A 1 183 ? -23.910 -13.104 -40.675 1.00 25.24 ? 183 THR A HA   1 
ATOM   2562  H HB   . THR A 1 183 ? -24.011 -10.918 -40.055 1.00 25.38 ? 183 THR A HB   1 
ATOM   2563  H HG1  . THR A 1 183 ? -22.326 -10.018 -38.923 1.00 33.37 ? 183 THR A HG1  1 
ATOM   2564  H HG21 . THR A 1 183 ? -24.170 -10.965 -37.732 1.00 34.42 ? 183 THR A HG21 1 
ATOM   2565  H HG22 . THR A 1 183 ? -24.820 -12.270 -38.340 1.00 34.42 ? 183 THR A HG22 1 
ATOM   2566  H HG23 . THR A 1 183 ? -23.378 -12.331 -37.699 1.00 34.42 ? 183 THR A HG23 1 
ATOM   2567  N N    . PRO A 1 184 ? -22.760 -11.505 -42.471 1.00 23.54 ? 184 PRO A N    1 
ATOM   2568  C CA   . PRO A 1 184 ? -21.937 -11.064 -43.603 1.00 28.15 ? 184 PRO A CA   1 
ATOM   2569  C C    . PRO A 1 184 ? -20.710 -10.261 -43.202 1.00 23.51 ? 184 PRO A C    1 
ATOM   2570  O O    . PRO A 1 184 ? -19.796 -10.175 -44.020 1.00 25.67 ? 184 PRO A O    1 
ATOM   2571  C CB   . PRO A 1 184 ? -22.916 -10.219 -44.443 1.00 29.83 ? 184 PRO A CB   1 
ATOM   2572  C CG   . PRO A 1 184 ? -24.237 -10.836 -44.156 1.00 30.47 ? 184 PRO A CG   1 
ATOM   2573  C CD   . PRO A 1 184 ? -24.171 -11.117 -42.664 1.00 29.78 ? 184 PRO A CD   1 
ATOM   2574  H HA   . PRO A 1 184 ? -21.654 -11.831 -44.125 1.00 33.76 ? 184 PRO A HA   1 
ATOM   2575  H HB2  . PRO A 1 184 ? -22.892 -9.295  -44.150 1.00 35.78 ? 184 PRO A HB2  1 
ATOM   2576  H HB3  . PRO A 1 184 ? -22.694 -10.293 -45.384 1.00 35.78 ? 184 PRO A HB3  1 
ATOM   2577  H HG2  . PRO A 1 184 ? -24.948 -10.210 -44.362 1.00 36.54 ? 184 PRO A HG2  1 
ATOM   2578  H HG3  . PRO A 1 184 ? -24.337 -11.658 -44.662 1.00 36.54 ? 184 PRO A HG3  1 
ATOM   2579  H HD2  . PRO A 1 184 ? -24.376 -10.316 -42.157 1.00 35.72 ? 184 PRO A HD2  1 
ATOM   2580  H HD3  . PRO A 1 184 ? -24.761 -11.851 -42.429 1.00 35.72 ? 184 PRO A HD3  1 
ATOM   2581  N N    . ASN A 1 185 ? -20.669 -9.646  -42.013 1.00 19.49 ? 185 ASN A N    1 
ATOM   2582  C CA   . ASN A 1 185 ? -19.496 -8.899  -41.570 1.00 23.09 ? 185 ASN A CA   1 
ATOM   2583  C C    . ASN A 1 185 ? -18.778 -9.555  -40.398 1.00 22.71 ? 185 ASN A C    1 
ATOM   2584  O O    . ASN A 1 185 ? -17.893 -8.931  -39.791 1.00 21.95 ? 185 ASN A O    1 
ATOM   2585  C CB   . ASN A 1 185 ? -19.880 -7.472  -41.195 1.00 24.43 ? 185 ASN A CB   1 
ATOM   2586  C CG   . ASN A 1 185 ? -20.229 -6.654  -42.408 1.00 29.68 ? 185 ASN A CG   1 
ATOM   2587  O OD1  . ASN A 1 185 ? -19.369 -6.391  -43.247 1.00 27.62 ? 185 ASN A OD1  1 
ATOM   2588  N ND2  . ASN A 1 185 ? -21.500 -6.291  -42.538 1.00 25.27 ? 185 ASN A ND2  1 
ATOM   2589  H H    . ASN A 1 185 ? -21.314 -9.651  -41.444 1.00 23.37 ? 185 ASN A H    1 
ATOM   2590  H HA   . ASN A 1 185 ? -18.867 -8.848  -42.306 1.00 27.68 ? 185 ASN A HA   1 
ATOM   2591  H HB2  . ASN A 1 185 ? -20.653 -7.492  -40.610 1.00 29.29 ? 185 ASN A HB2  1 
ATOM   2592  H HB3  . ASN A 1 185 ? -19.132 -7.046  -40.747 1.00 29.29 ? 185 ASN A HB3  1 
ATOM   2593  H HD21 . ASN A 1 185 ? -21.747 -5.827  -43.219 1.00 30.30 ? 185 ASN A HD21 1 
ATOM   2594  H HD22 . ASN A 1 185 ? -22.072 -6.504  -41.932 1.00 30.30 ? 185 ASN A HD22 1 
ATOM   2595  N N    . PHE A 1 186 ? -19.141 -10.788 -40.051 1.00 18.97 ? 186 PHE A N    1 
ATOM   2596  C CA   . PHE A 1 186 ? -18.479 -11.532 -38.978 1.00 21.62 ? 186 PHE A CA   1 
ATOM   2597  C C    . PHE A 1 186 ? -18.356 -12.964 -39.494 1.00 18.67 ? 186 PHE A C    1 
ATOM   2598  O O    . PHE A 1 186 ? -19.232 -13.795 -39.256 1.00 21.10 ? 186 PHE A O    1 
ATOM   2599  C CB   . PHE A 1 186 ? -19.264 -11.441 -37.666 1.00 23.79 ? 186 PHE A CB   1 
ATOM   2600  C CG   . PHE A 1 186 ? -18.503 -11.938 -36.456 1.00 18.44 ? 186 PHE A CG   1 
ATOM   2601  C CD1  . PHE A 1 186 ? -17.229 -11.470 -36.181 1.00 20.77 ? 186 PHE A CD1  1 
ATOM   2602  C CD2  . PHE A 1 186 ? -19.067 -12.867 -35.596 1.00 22.14 ? 186 PHE A CD2  1 
ATOM   2603  C CE1  . PHE A 1 186 ? -16.545 -11.908 -35.068 1.00 22.65 ? 186 PHE A CE1  1 
ATOM   2604  C CE2  . PHE A 1 186 ? -18.396 -13.294 -34.499 1.00 24.44 ? 186 PHE A CE2  1 
ATOM   2605  C CZ   . PHE A 1 186 ? -17.138 -12.830 -34.230 1.00 20.09 ? 186 PHE A CZ   1 
ATOM   2606  H H    . PHE A 1 186 ? -19.779 -11.223 -40.429 1.00 22.75 ? 186 PHE A H    1 
ATOM   2607  H HA   . PHE A 1 186 ? -17.589 -11.175 -38.833 1.00 25.92 ? 186 PHE A HA   1 
ATOM   2608  H HB2  . PHE A 1 186 ? -19.498 -10.513 -37.506 1.00 28.53 ? 186 PHE A HB2  1 
ATOM   2609  H HB3  . PHE A 1 186 ? -20.070 -11.973 -37.747 1.00 28.53 ? 186 PHE A HB3  1 
ATOM   2610  H HD1  . PHE A 1 186 ? -16.836 -10.844 -36.746 1.00 24.91 ? 186 PHE A HD1  1 
ATOM   2611  H HD2  . PHE A 1 186 ? -19.924 -13.186 -35.763 1.00 26.55 ? 186 PHE A HD2  1 
ATOM   2612  H HE1  . PHE A 1 186 ? -15.689 -11.591 -34.888 1.00 27.15 ? 186 PHE A HE1  1 
ATOM   2613  H HE2  . PHE A 1 186 ? -18.788 -13.919 -33.932 1.00 29.31 ? 186 PHE A HE2  1 
ATOM   2614  H HZ   . PHE A 1 186 ? -16.681 -13.137 -33.481 1.00 24.09 ? 186 PHE A HZ   1 
ATOM   2615  N N    . ARG A 1 187 ? -17.265 -13.235 -40.218 1.00 15.98 ? 187 ARG A N    1 
ATOM   2616  C CA   . ARG A 1 187 ? -17.099 -14.483 -40.943 1.00 15.79 ? 187 ARG A CA   1 
ATOM   2617  C C    . ARG A 1 187 ? -16.341 -15.498 -40.104 1.00 17.10 ? 187 ARG A C    1 
ATOM   2618  O O    . ARG A 1 187 ? -15.320 -15.175 -39.500 1.00 14.94 ? 187 ARG A O    1 
ATOM   2619  C CB   . ARG A 1 187 ? -16.356 -14.279 -42.264 1.00 15.51 ? 187 ARG A CB   1 
ATOM   2620  C CG   . ARG A 1 187 ? -16.882 -13.141 -43.117 1.00 21.04 ? 187 ARG A CG   1 
ATOM   2621  C CD   . ARG A 1 187 ? -18.351 -13.380 -43.476 1.00 18.48 ? 187 ARG A CD   1 
ATOM   2622  N NE   . ARG A 1 187 ? -18.560 -14.533 -44.327 1.00 18.95 ? 187 ARG A NE   1 
ATOM   2623  C CZ   . ARG A 1 187 ? -19.735 -15.154 -44.460 1.00 22.27 ? 187 ARG A CZ   1 
ATOM   2624  N NH1  . ARG A 1 187 ? -20.768 -14.778 -43.742 1.00 18.86 ? 187 ARG A NH1  1 
ATOM   2625  N NH2  . ARG A 1 187 ? -19.876 -16.166 -45.293 1.00 25.39 ? 187 ARG A NH2  1 
ATOM   2626  H H    . ARG A 1 187 ? -16.599 -12.698 -40.301 1.00 19.16 ? 187 ARG A H    1 
ATOM   2627  H HA   . ARG A 1 187 ? -17.974 -14.851 -41.143 1.00 18.93 ? 187 ARG A HA   1 
ATOM   2628  H HB2  . ARG A 1 187 ? -15.424 -14.095 -42.070 1.00 18.59 ? 187 ARG A HB2  1 
ATOM   2629  H HB3  . ARG A 1 187 ? -16.425 -15.094 -42.786 1.00 18.59 ? 187 ARG A HB3  1 
ATOM   2630  H HG2  . ARG A 1 187 ? -16.818 -12.309 -42.623 1.00 25.23 ? 187 ARG A HG2  1 
ATOM   2631  H HG3  . ARG A 1 187 ? -16.369 -13.088 -43.939 1.00 25.23 ? 187 ARG A HG3  1 
ATOM   2632  H HD2  . ARG A 1 187 ? -18.855 -13.519 -42.659 1.00 22.16 ? 187 ARG A HD2  1 
ATOM   2633  H HD3  . ARG A 1 187 ? -18.690 -12.601 -43.944 1.00 22.16 ? 187 ARG A HD3  1 
ATOM   2634  H HE   . ARG A 1 187 ? -17.869 -14.895 -44.690 1.00 22.72 ? 187 ARG A HE   1 
ATOM   2635  H HH11 . ARG A 1 187 ? -20.697 -14.110 -43.204 1.00 22.61 ? 187 ARG A HH11 1 
ATOM   2636  H HH12 . ARG A 1 187 ? -21.520 -15.187 -43.822 1.00 22.61 ? 187 ARG A HH12 1 
ATOM   2637  H HH21 . ARG A 1 187 ? -19.205 -16.437 -45.757 1.00 30.44 ? 187 ARG A HH21 1 
ATOM   2638  H HH22 . ARG A 1 187 ? -20.630 -16.576 -45.347 1.00 30.44 ? 187 ARG A HH22 1 
ATOM   2639  N N    . ILE A 1 188 ? -16.812 -16.744 -40.126 1.00 17.55 ? 188 ILE A N    1 
ATOM   2640  C CA   . ILE A 1 188 ? -16.328 -17.777 -39.218 1.00 18.34 ? 188 ILE A CA   1 
ATOM   2641  C C    . ILE A 1 188 ? -15.717 -18.918 -39.998 1.00 18.81 ? 188 ILE A C    1 
ATOM   2642  O O    . ILE A 1 188 ? -16.283 -19.379 -40.998 1.00 18.13 ? 188 ILE A O    1 
ATOM   2643  C CB   . ILE A 1 188 ? -17.477 -18.268 -38.320 1.00 16.88 ? 188 ILE A CB   1 
ATOM   2644  C CG1  . ILE A 1 188 ? -18.031 -17.045 -37.564 1.00 23.53 ? 188 ILE A CG1  1 
ATOM   2645  C CG2  . ILE A 1 188 ? -16.990 -19.437 -37.450 1.00 20.00 ? 188 ILE A CG2  1 
ATOM   2646  C CD1  . ILE A 1 188 ? -18.813 -17.324 -36.426 1.00 27.81 ? 188 ILE A CD1  1 
ATOM   2647  H H    . ILE A 1 188 ? -17.422 -17.018 -40.667 1.00 21.04 ? 188 ILE A H    1 
ATOM   2648  H HA   . ILE A 1 188 ? -15.640 -17.401 -38.647 1.00 21.99 ? 188 ILE A HA   1 
ATOM   2649  H HB   . ILE A 1 188 ? -18.182 -18.603 -38.896 1.00 20.23 ? 188 ILE A HB   1 
ATOM   2650  H HG12 . ILE A 1 188 ? -17.282 -16.501 -37.274 1.00 28.22 ? 188 ILE A HG12 1 
ATOM   2651  H HG13 . ILE A 1 188 ? -18.583 -16.533 -38.176 1.00 28.22 ? 188 ILE A HG13 1 
ATOM   2652  H HG21 . ILE A 1 188 ? -17.721 -19.739 -36.889 1.00 23.97 ? 188 ILE A HG21 1 
ATOM   2653  H HG22 . ILE A 1 188 ? -16.697 -20.159 -38.028 1.00 23.97 ? 188 ILE A HG22 1 
ATOM   2654  H HG23 . ILE A 1 188 ? -16.252 -19.134 -36.899 1.00 23.97 ? 188 ILE A HG23 1 
ATOM   2655  H HD11 . ILE A 1 188 ? -19.107 -16.488 -36.032 1.00 33.35 ? 188 ILE A HD11 1 
ATOM   2656  H HD12 . ILE A 1 188 ? -19.582 -17.852 -36.694 1.00 33.35 ? 188 ILE A HD12 1 
ATOM   2657  H HD13 . ILE A 1 188 ? -18.277 -17.821 -35.789 1.00 33.35 ? 188 ILE A HD13 1 
ATOM   2658  N N    . THR A 1 189 ? -14.546 -19.378 -39.539 1.00 14.15 ? 189 THR A N    1 
ATOM   2659  C CA   . THR A 1 189 ? -13.987 -20.649 -39.963 1.00 15.50 ? 189 THR A CA   1 
ATOM   2660  C C    . THR A 1 189 ? -13.988 -21.577 -38.763 1.00 20.75 ? 189 THR A C    1 
ATOM   2661  O O    . THR A 1 189 ? -13.497 -21.201 -37.697 1.00 16.61 ? 189 THR A O    1 
ATOM   2662  C CB   . THR A 1 189 ? -12.559 -20.502 -40.487 1.00 17.26 ? 189 THR A CB   1 
ATOM   2663  O OG1  . THR A 1 189 ? -12.536 -19.551 -41.544 1.00 17.89 ? 189 THR A OG1  1 
ATOM   2664  C CG2  . THR A 1 189 ? -12.081 -21.825 -40.968 1.00 15.07 ? 189 THR A CG2  1 
ATOM   2665  H H    . THR A 1 189 ? -14.055 -18.958 -38.972 1.00 16.96 ? 189 THR A H    1 
ATOM   2666  H HA   . THR A 1 189 ? -14.539 -21.036 -40.660 1.00 18.58 ? 189 THR A HA   1 
ATOM   2667  H HB   . THR A 1 189 ? -11.978 -20.205 -39.769 1.00 20.69 ? 189 THR A HB   1 
ATOM   2668  H HG1  . THR A 1 189 ? -12.806 -18.805 -41.266 1.00 21.45 ? 189 THR A HG1  1 
ATOM   2669  H HG21 . THR A 1 189 ? -11.174 -21.747 -41.304 1.00 18.07 ? 189 THR A HG21 1 
ATOM   2670  H HG22 . THR A 1 189 ? -12.093 -22.466 -40.240 1.00 18.07 ? 189 THR A HG22 1 
ATOM   2671  H HG23 . THR A 1 189 ? -12.655 -22.146 -41.681 1.00 18.07 ? 189 THR A HG23 1 
ATOM   2672  N N    . VAL A 1 190 ? -14.562 -22.768 -38.921 1.00 15.91 ? 190 VAL A N    1 
ATOM   2673  C CA   . VAL A 1 190 ? -14.555 -23.767 -37.859 1.00 18.65 ? 190 VAL A CA   1 
ATOM   2674  C C    . VAL A 1 190 ? -13.370 -24.684 -38.098 1.00 18.28 ? 190 VAL A C    1 
ATOM   2675  O O    . VAL A 1 190 ? -13.174 -25.168 -39.212 1.00 17.07 ? 190 VAL A O    1 
ATOM   2676  C CB   . VAL A 1 190 ? -15.854 -24.592 -37.837 1.00 19.60 ? 190 VAL A CB   1 
ATOM   2677  C CG1  . VAL A 1 190 ? -15.812 -25.650 -36.755 1.00 21.63 ? 190 VAL A CG1  1 
ATOM   2678  C CG2  . VAL A 1 190 ? -17.035 -23.720 -37.644 1.00 18.82 ? 190 VAL A CG2  1 
ATOM   2679  H H    . VAL A 1 190 ? -14.963 -23.022 -39.638 1.00 19.07 ? 190 VAL A H    1 
ATOM   2680  H HA   . VAL A 1 190 ? -14.446 -23.332 -36.999 1.00 22.36 ? 190 VAL A HA   1 
ATOM   2681  H HB   . VAL A 1 190 ? -15.954 -25.043 -38.690 1.00 23.49 ? 190 VAL A HB   1 
ATOM   2682  H HG11 . VAL A 1 190 ? -16.643 -26.150 -36.769 1.00 25.93 ? 190 VAL A HG11 1 
ATOM   2683  H HG12 . VAL A 1 190 ? -15.065 -26.245 -36.925 1.00 25.93 ? 190 VAL A HG12 1 
ATOM   2684  H HG13 . VAL A 1 190 ? -15.700 -25.216 -35.894 1.00 25.93 ? 190 VAL A HG13 1 
ATOM   2685  H HG21 . VAL A 1 190 ? -17.834 -24.270 -37.634 1.00 22.57 ? 190 VAL A HG21 1 
ATOM   2686  H HG22 . VAL A 1 190 ? -16.946 -23.251 -36.799 1.00 22.57 ? 190 VAL A HG22 1 
ATOM   2687  H HG23 . VAL A 1 190 ? -17.079 -23.083 -38.373 1.00 22.57 ? 190 VAL A HG23 1 
ATOM   2688  N N    . VAL A 1 191 ? -12.578 -24.924 -37.050 1.00 18.01 ? 191 VAL A N    1 
ATOM   2689  C CA   . VAL A 1 191 ? -11.531 -25.933 -37.116 1.00 16.64 ? 191 VAL A CA   1 
ATOM   2690  C C    . VAL A 1 191 ? -11.740 -26.861 -35.939 1.00 18.43 ? 191 VAL A C    1 
ATOM   2691  O O    . VAL A 1 191 ? -12.424 -26.519 -34.979 1.00 19.28 ? 191 VAL A O    1 
ATOM   2692  C CB   . VAL A 1 191 ? -10.108 -25.344 -37.096 1.00 18.44 ? 191 VAL A CB   1 
ATOM   2693  C CG1  . VAL A 1 191 ? -9.859  -24.472 -38.345 1.00 20.45 ? 191 VAL A CG1  1 
ATOM   2694  C CG2  . VAL A 1 191 ? -9.889  -24.590 -35.852 1.00 18.36 ? 191 VAL A CG2  1 
ATOM   2695  H H    . VAL A 1 191 ? -12.630 -24.516 -36.295 1.00 21.59 ? 191 VAL A H    1 
ATOM   2696  H HA   . VAL A 1 191 ? -11.635 -26.448 -37.931 1.00 19.95 ? 191 VAL A HA   1 
ATOM   2697  H HB   . VAL A 1 191 ? -9.470  -26.074 -37.114 1.00 22.10 ? 191 VAL A HB   1 
ATOM   2698  H HG11 . VAL A 1 191 ? -8.958  -24.116 -38.306 1.00 24.52 ? 191 VAL A HG11 1 
ATOM   2699  H HG12 . VAL A 1 191 ? -9.964  -25.021 -39.138 1.00 24.52 ? 191 VAL A HG12 1 
ATOM   2700  H HG13 . VAL A 1 191 ? -10.503 -23.747 -38.356 1.00 24.52 ? 191 VAL A HG13 1 
ATOM   2701  H HG21 . VAL A 1 191 ? -8.990  -24.227 -35.857 1.00 22.00 ? 191 VAL A HG21 1 
ATOM   2702  H HG22 . VAL A 1 191 ? -10.537 -23.869 -35.801 1.00 22.00 ? 191 VAL A HG22 1 
ATOM   2703  H HG23 . VAL A 1 191 ? -10.000 -25.188 -35.096 1.00 22.00 ? 191 VAL A HG23 1 
ATOM   2704  N N    . GLN A 1 192 ? -11.128 -28.055 -36.017 1.00 19.72 ? 192 GLN A N    1 
ATOM   2705  C CA   . GLN A 1 192 ? -11.309 -29.075 -34.983 1.00 23.84 ? 192 GLN A CA   1 
ATOM   2706  C C    . GLN A 1 192 ? -10.384 -28.916 -33.782 1.00 25.82 ? 192 GLN A C    1 
ATOM   2707  O O    . GLN A 1 192 ? -10.578 -29.620 -32.785 1.00 29.57 ? 192 GLN A O    1 
ATOM   2708  C CB   . GLN A 1 192 ? -11.113 -30.487 -35.578 1.00 25.78 ? 192 GLN A CB   1 
ATOM   2709  H H    . GLN A 1 192 ? -10.606 -28.293 -36.658 1.00 23.65 ? 192 GLN A H    1 
ATOM   2710  H HA   . GLN A 1 192 ? -12.221 -29.020 -34.656 1.00 28.59 ? 192 GLN A HA   1 
ATOM   2711  N N    . GLU A 1 193 ? -9.416  -28.013 -33.813 1.00 21.12 ? 193 GLU A N    1 
ATOM   2712  C CA   . GLU A 1 193 ? -8.430  -27.905 -32.739 1.00 20.45 ? 193 GLU A CA   1 
ATOM   2713  C C    . GLU A 1 193 ? -8.786  -26.792 -31.754 1.00 26.21 ? 193 GLU A C    1 
ATOM   2714  O O    . GLU A 1 193 ? -8.457  -25.626 -31.984 1.00 29.88 ? 193 GLU A O    1 
ATOM   2715  C CB   . GLU A 1 193 ? -7.050  -27.685 -33.347 1.00 22.38 ? 193 GLU A CB   1 
ATOM   2716  C CG   . GLU A 1 193 ? -6.586  -28.830 -34.224 1.00 23.64 ? 193 GLU A CG   1 
ATOM   2717  C CD   . GLU A 1 193 ? -5.247  -28.592 -34.936 1.00 22.62 ? 193 GLU A CD   1 
ATOM   2718  O OE1  . GLU A 1 193 ? -4.564  -27.565 -34.660 1.00 21.22 ? 193 GLU A OE1  1 
ATOM   2719  O OE2  . GLU A 1 193 ? -4.888  -29.420 -35.791 1.00 21.95 ? 193 GLU A OE2  1 
ATOM   2720  H H    . GLU A 1 193 ? -9.304  -27.445 -34.449 1.00 25.33 ? 193 GLU A H    1 
ATOM   2721  H HA   . GLU A 1 193 ? -8.409  -28.741 -32.248 1.00 24.52 ? 193 GLU A HA   1 
ATOM   2722  H HB2  . GLU A 1 193 ? -7.072  -26.883 -33.892 1.00 26.83 ? 193 GLU A HB2  1 
ATOM   2723  H HB3  . GLU A 1 193 ? -6.405  -27.579 -32.630 1.00 26.83 ? 193 GLU A HB3  1 
ATOM   2724  H HG2  . GLU A 1 193 ? -6.488  -29.622 -33.673 1.00 28.35 ? 193 GLU A HG2  1 
ATOM   2725  H HG3  . GLU A 1 193 ? -7.257  -28.989 -34.906 1.00 28.35 ? 193 GLU A HG3  1 
ATOM   2726  N N    . VAL A 1 194 ? -9.343  -27.172 -30.600 1.00 18.35 ? 194 VAL A N    1 
ATOM   2727  C CA   . VAL A 1 194 ? -9.699  -26.206 -29.557 1.00 18.22 ? 194 VAL A CA   1 
ATOM   2728  C C    . VAL A 1 194 ? -8.455  -25.582 -28.934 1.00 19.51 ? 194 VAL A C    1 
ATOM   2729  O O    . VAL A 1 194 ? -8.292  -24.350 -28.925 1.00 17.23 ? 194 VAL A O    1 
ATOM   2730  C CB   . VAL A 1 194 ? -10.586 -26.882 -28.490 1.00 20.91 ? 194 VAL A CB   1 
ATOM   2731  C CG1  . VAL A 1 194 ? -10.958 -25.934 -27.359 1.00 18.81 ? 194 VAL A CG1  1 
ATOM   2732  C CG2  . VAL A 1 194 ? -11.852 -27.401 -29.153 1.00 21.85 ? 194 VAL A CG2  1 
ATOM   2733  H H    . VAL A 1 194 ? -9.525  -27.987 -30.397 1.00 22.00 ? 194 VAL A H    1 
ATOM   2734  H HA   . VAL A 1 194 ? -10.216 -25.491 -29.960 1.00 21.85 ? 194 VAL A HA   1 
ATOM   2735  H HB   . VAL A 1 194 ? -10.111 -27.637 -28.110 1.00 25.07 ? 194 VAL A HB   1 
ATOM   2736  H HG11 . VAL A 1 194 ? -11.513 -26.408 -26.720 1.00 22.55 ? 194 VAL A HG11 1 
ATOM   2737  H HG12 . VAL A 1 194 ? -10.147 -25.624 -26.927 1.00 22.55 ? 194 VAL A HG12 1 
ATOM   2738  H HG13 . VAL A 1 194 ? -11.446 -25.180 -27.726 1.00 22.55 ? 194 VAL A HG13 1 
ATOM   2739  H HG21 . VAL A 1 194 ? -12.408 -27.825 -28.481 1.00 26.20 ? 194 VAL A HG21 1 
ATOM   2740  H HG22 . VAL A 1 194 ? -12.327 -26.656 -29.553 1.00 26.20 ? 194 VAL A HG22 1 
ATOM   2741  H HG23 . VAL A 1 194 ? -11.609 -28.044 -29.837 1.00 26.20 ? 194 VAL A HG23 1 
ATOM   2742  N N    . ASP A 1 195 ? -7.592  -26.417 -28.339 1.00 18.68 ? 195 ASP A N    1 
ATOM   2743  C CA   . ASP A 1 195 ? -6.439  -25.912 -27.585 1.00 21.57 ? 195 ASP A CA   1 
ATOM   2744  C C    . ASP A 1 195 ? -5.587  -24.984 -28.434 1.00 14.72 ? 195 ASP A C    1 
ATOM   2745  O O    . ASP A 1 195 ? -5.130  -23.936 -27.963 1.00 17.38 ? 195 ASP A O    1 
ATOM   2746  C CB   . ASP A 1 195 ? -5.578  -27.072 -27.089 1.00 18.84 ? 195 ASP A CB   1 
ATOM   2747  C CG   . ASP A 1 195 ? -6.304  -28.006 -26.130 1.00 31.11 ? 195 ASP A CG   1 
ATOM   2748  O OD1  . ASP A 1 195 ? -7.543  -28.178 -26.226 1.00 27.12 ? 195 ASP A OD1  1 
ATOM   2749  O OD2  . ASP A 1 195 ? -5.603  -28.583 -25.264 1.00 33.58 ? 195 ASP A OD2  1 
ATOM   2750  H H    . ASP A 1 195 ? -7.653  -27.275 -28.358 1.00 22.39 ? 195 ASP A H    1 
ATOM   2751  H HA   . ASP A 1 195 ? -6.754  -25.415 -26.813 1.00 25.86 ? 195 ASP A HA   1 
ATOM   2752  H HB2  . ASP A 1 195 ? -5.290  -27.596 -27.853 1.00 22.59 ? 195 ASP A HB2  1 
ATOM   2753  H HB3  . ASP A 1 195 ? -4.806  -26.712 -26.626 1.00 22.59 ? 195 ASP A HB3  1 
ATOM   2754  N N    . THR A 1 196 ? -5.388  -25.346 -29.703 1.00 14.04 ? 196 THR A N    1 
ATOM   2755  C CA   . THR A 1 196 ? -4.538  -24.566 -30.576 1.00 18.17 ? 196 THR A CA   1 
ATOM   2756  C C    . THR A 1 196 ? -5.128  -23.193 -30.855 1.00 17.92 ? 196 THR A C    1 
ATOM   2757  O O    . THR A 1 196 ? -4.401  -22.203 -30.889 1.00 19.05 ? 196 THR A O    1 
ATOM   2758  C CB   . THR A 1 196 ? -4.329  -25.294 -31.886 1.00 22.18 ? 196 THR A CB   1 
ATOM   2759  O OG1  . THR A 1 196 ? -3.799  -26.599 -31.634 1.00 23.78 ? 196 THR A OG1  1 
ATOM   2760  C CG2  . THR A 1 196 ? -3.340  -24.508 -32.734 1.00 25.93 ? 196 THR A CG2  1 
ATOM   2761  H H    . THR A 1 196 ? -5.737  -26.039 -30.074 1.00 16.83 ? 196 THR A H    1 
ATOM   2762  H HA   . THR A 1 196 ? -3.672  -24.444 -30.155 1.00 21.78 ? 196 THR A HA   1 
ATOM   2763  H HB   . THR A 1 196 ? -5.169  -25.364 -32.365 1.00 26.59 ? 196 THR A HB   1 
ATOM   2764  H HG1  . THR A 1 196 ? -3.681  -27.006 -32.359 1.00 28.51 ? 196 THR A HG1  1 
ATOM   2765  H HG21 . THR A 1 196 ? -3.194  -24.961 -33.579 1.00 31.09 ? 196 THR A HG21 1 
ATOM   2766  H HG22 . THR A 1 196 ? -3.687  -23.619 -32.909 1.00 31.09 ? 196 THR A HG22 1 
ATOM   2767  H HG23 . THR A 1 196 ? -2.493  -24.429 -32.268 1.00 31.09 ? 196 THR A HG23 1 
ATOM   2768  N N    . VAL A 1 197 ? -6.424  -23.126 -31.141 1.00 15.89 ? 197 VAL A N    1 
ATOM   2769  C CA   . VAL A 1 197 ? -7.053  -21.836 -31.358 1.00 14.29 ? 197 VAL A CA   1 
ATOM   2770  C C    . VAL A 1 197 ? -6.932  -20.983 -30.116 1.00 14.16 ? 197 VAL A C    1 
ATOM   2771  O O    . VAL A 1 197 ? -6.643  -19.777 -30.195 1.00 16.03 ? 197 VAL A O    1 
ATOM   2772  C CB   . VAL A 1 197 ? -8.522  -22.021 -31.762 1.00 12.18 ? 197 VAL A CB   1 
ATOM   2773  C CG1  . VAL A 1 197 ? -9.242  -20.677 -31.778 1.00 15.82 ? 197 VAL A CG1  1 
ATOM   2774  C CG2  . VAL A 1 197 ? -8.634  -22.693 -33.106 1.00 15.79 ? 197 VAL A CG2  1 
ATOM   2775  H H    . VAL A 1 197 ? -6.951  -23.802 -31.213 1.00 19.05 ? 197 VAL A H    1 
ATOM   2776  H HA   . VAL A 1 197 ? -6.597  -21.379 -32.083 1.00 17.12 ? 197 VAL A HA   1 
ATOM   2777  H HB   . VAL A 1 197 ? -8.960  -22.587 -31.107 1.00 14.59 ? 197 VAL A HB   1 
ATOM   2778  H HG11 . VAL A 1 197 ? -10.167 -20.818 -32.035 1.00 18.97 ? 197 VAL A HG11 1 
ATOM   2779  H HG12 . VAL A 1 197 ? -9.200  -20.286 -30.891 1.00 18.97 ? 197 VAL A HG12 1 
ATOM   2780  H HG13 . VAL A 1 197 ? -8.805  -20.094 -32.418 1.00 18.97 ? 197 VAL A HG13 1 
ATOM   2781  H HG21 . VAL A 1 197 ? -9.572  -22.795 -33.331 1.00 18.93 ? 197 VAL A HG21 1 
ATOM   2782  H HG22 . VAL A 1 197 ? -8.192  -22.143 -33.772 1.00 18.93 ? 197 VAL A HG22 1 
ATOM   2783  H HG23 . VAL A 1 197 ? -8.208  -23.563 -33.060 1.00 18.93 ? 197 VAL A HG23 1 
ATOM   2784  N N    . GLU A 1 198 ? -7.150  -21.591 -28.949 1.00 13.95 ? 198 GLU A N    1 
ATOM   2785  C CA   . GLU A 1 198 ? -7.266  -20.844 -27.718 1.00 14.29 ? 198 GLU A CA   1 
ATOM   2786  C C    . GLU A 1 198 ? -5.912  -20.383 -27.216 1.00 17.60 ? 198 GLU A C    1 
ATOM   2787  O O    . GLU A 1 198 ? -5.815  -19.310 -26.613 1.00 18.06 ? 198 GLU A O    1 
ATOM   2788  C CB   . GLU A 1 198 ? -7.949  -21.689 -26.648 1.00 14.29 ? 198 GLU A CB   1 
ATOM   2789  C CG   . GLU A 1 198 ? -8.321  -20.901 -25.402 1.00 16.18 ? 198 GLU A CG   1 
ATOM   2790  C CD   . GLU A 1 198 ? -9.077  -21.732 -24.357 1.00 17.91 ? 198 GLU A CD   1 
ATOM   2791  O OE1  . GLU A 1 198 ? -9.187  -22.966 -24.563 1.00 17.90 ? 198 GLU A OE1  1 
ATOM   2792  O OE2  . GLU A 1 198 ? -9.530  -21.143 -23.351 1.00 17.44 ? 198 GLU A OE2  1 
ATOM   2793  H H    . GLU A 1 198 ? -7.233  -22.442 -28.853 1.00 16.72 ? 198 GLU A H    1 
ATOM   2794  H HA   . GLU A 1 198 ? -7.812  -20.058 -27.874 1.00 17.13 ? 198 GLU A HA   1 
ATOM   2795  H HB2  . GLU A 1 198 ? -8.764  -22.064 -27.017 1.00 17.12 ? 198 GLU A HB2  1 
ATOM   2796  H HB3  . GLU A 1 198 ? -7.349  -22.402 -26.381 1.00 17.12 ? 198 GLU A HB3  1 
ATOM   2797  H HG2  . GLU A 1 198 ? -7.510  -20.568 -24.987 1.00 19.39 ? 198 GLU A HG2  1 
ATOM   2798  H HG3  . GLU A 1 198 ? -8.889  -20.158 -25.659 1.00 19.39 ? 198 GLU A HG3  1 
ATOM   2799  N N    . ILE A 1 199 ? -4.869  -21.196 -27.412 1.00 15.61 ? 199 ILE A N    1 
ATOM   2800  C CA   . ILE A 1 199 ? -3.567  -20.844 -26.846 1.00 14.49 ? 199 ILE A CA   1 
ATOM   2801  C C    . ILE A 1 199 ? -2.968  -19.659 -27.600 1.00 16.80 ? 199 ILE A C    1 
ATOM   2802  O O    . ILE A 1 199 ? -2.140  -18.925 -27.047 1.00 17.25 ? 199 ILE A O    1 
ATOM   2803  C CB   . ILE A 1 199 ? -2.609  -22.064 -26.834 1.00 20.63 ? 199 ILE A CB   1 
ATOM   2804  C CG1  . ILE A 1 199 ? -1.430  -21.839 -25.877 1.00 21.53 ? 199 ILE A CG1  1 
ATOM   2805  C CG2  . ILE A 1 199 ? -2.007  -22.339 -28.208 1.00 17.28 ? 199 ILE A CG2  1 
ATOM   2806  C CD1  . ILE A 1 199 ? -1.760  -21.897 -24.418 1.00 24.42 ? 199 ILE A CD1  1 
ATOM   2807  H H    . ILE A 1 199 ? -4.888  -21.933 -27.854 1.00 18.72 ? 199 ILE A H    1 
ATOM   2808  H HA   . ILE A 1 199 ? -3.696  -20.567 -25.925 1.00 17.37 ? 199 ILE A HA   1 
ATOM   2809  H HB   . ILE A 1 199 ? -3.102  -22.847 -26.545 1.00 24.74 ? 199 ILE A HB   1 
ATOM   2810  H HG12 . ILE A 1 199 ? -0.761  -22.520 -26.050 1.00 25.82 ? 199 ILE A HG12 1 
ATOM   2811  H HG13 . ILE A 1 199 ? -1.054  -20.963 -26.055 1.00 25.82 ? 199 ILE A HG13 1 
ATOM   2812  H HG21 . ILE A 1 199 ? -1.419  -23.108 -28.146 1.00 20.71 ? 199 ILE A HG21 1 
ATOM   2813  H HG22 . ILE A 1 199 ? -2.724  -22.521 -28.835 1.00 20.71 ? 199 ILE A HG22 1 
ATOM   2814  H HG23 . ILE A 1 199 ? -1.506  -21.560 -28.494 1.00 20.71 ? 199 ILE A HG23 1 
ATOM   2815  H HD11 . ILE A 1 199 ? -0.951  -21.744 -23.906 1.00 29.28 ? 199 ILE A HD11 1 
ATOM   2816  H HD12 . ILE A 1 199 ? -2.416  -21.212 -24.216 1.00 29.28 ? 199 ILE A HD12 1 
ATOM   2817  H HD13 . ILE A 1 199 ? -2.122  -22.773 -24.211 1.00 29.28 ? 199 ILE A HD13 1 
ATOM   2818  N N    . CYS A 1 200 ? -3.408  -19.418 -28.832 1.00 16.69 ? 200 CYS A N    1 
ATOM   2819  C CA   . CYS A 1 200 ? -2.914  -18.263 -29.577 1.00 21.70 ? 200 CYS A CA   1 
ATOM   2820  C C    . CYS A 1 200 ? -3.169  -16.963 -28.824 1.00 23.05 ? 200 CYS A C    1 
ATOM   2821  O O    . CYS A 1 200 ? -2.315  -16.061 -28.820 1.00 18.50 ? 200 CYS A O    1 
ATOM   2822  C CB   . CYS A 1 200 ? -3.579  -18.206 -30.955 1.00 16.56 ? 200 CYS A CB   1 
ATOM   2823  S SG   . CYS A 1 200 ? -3.032  -19.369 -32.189 1.00 18.79 ? 200 CYS A SG   1 
ATOM   2824  H H    . CYS A 1 200 ? -3.983  -19.899 -29.253 1.00 20.01 ? 200 CYS A H    1 
ATOM   2825  H HA   . CYS A 1 200 ? -1.957  -18.355 -29.707 1.00 26.02 ? 200 CYS A HA   1 
ATOM   2826  H HB2  . CYS A 1 200 ? -4.531  -18.350 -30.833 1.00 19.86 ? 200 CYS A HB2  1 
ATOM   2827  H HB3  . CYS A 1 200 ? -3.436  -17.319 -31.319 1.00 19.86 ? 200 CYS A HB3  1 
ATOM   2828  H HG   . CYS A 1 200 ? -1.862  -19.202 -32.392 1.00 22.53 ? 200 CYS A HG   1 
ATOM   2829  N N    . GLY A 1 201 ? -4.336  -16.852 -28.177 1.00 22.69 ? 201 GLY A N    1 
ATOM   2830  C CA   . GLY A 1 201 ? -4.725  -15.600 -27.533 1.00 20.32 ? 201 GLY A CA   1 
ATOM   2831  C C    . GLY A 1 201 ? -3.802  -15.157 -26.426 1.00 26.46 ? 201 GLY A C    1 
ATOM   2832  O O    . GLY A 1 201 ? -3.618  -13.958 -26.207 1.00 25.42 ? 201 GLY A O    1 
ATOM   2833  H H    . GLY A 1 201 ? -4.914  -17.484 -28.100 1.00 27.21 ? 201 GLY A H    1 
ATOM   2834  H HA2  . GLY A 1 201 ? -4.754  -14.896 -28.200 1.00 24.36 ? 201 GLY A HA2  1 
ATOM   2835  H HA3  . GLY A 1 201 ? -5.615  -15.699 -27.161 1.00 24.36 ? 201 GLY A HA3  1 
ATOM   2836  N N    . ALA A 1 202 ? -3.208  -16.100 -25.710 1.00 20.92 ? 202 ALA A N    1 
ATOM   2837  C CA   . ALA A 1 202 ? -2.261  -15.733 -24.673 1.00 24.36 ? 202 ALA A CA   1 
ATOM   2838  C C    . ALA A 1 202 ? -0.870  -15.511 -25.225 1.00 23.22 ? 202 ALA A C    1 
ATOM   2839  O O    . ALA A 1 202 ? -0.198  -14.556 -24.825 1.00 23.43 ? 202 ALA A O    1 
ATOM   2840  C CB   . ALA A 1 202 ? -2.184  -16.816 -23.599 1.00 26.20 ? 202 ALA A CB   1 
ATOM   2841  H H    . ALA A 1 202 ? -3.334  -16.946 -25.803 1.00 25.09 ? 202 ALA A H    1 
ATOM   2842  H HA   . ALA A 1 202 ? -2.554  -14.910 -24.252 1.00 29.21 ? 202 ALA A HA   1 
ATOM   2843  H HB1  . ALA A 1 202 ? -1.545  -16.543 -22.922 1.00 31.42 ? 202 ALA A HB1  1 
ATOM   2844  H HB2  . ALA A 1 202 ? -3.061  -16.928 -23.200 1.00 31.42 ? 202 ALA A HB2  1 
ATOM   2845  H HB3  . ALA A 1 202 ? -1.898  -17.647 -24.009 1.00 31.42 ? 202 ALA A HB3  1 
ATOM   2846  N N    . LEU A 1 203 ? -0.434  -16.362 -26.156 1.00 20.41 ? 203 LEU A N    1 
ATOM   2847  C CA   . LEU A 1 203 ? 0.940   -16.283 -26.625 1.00 17.86 ? 203 LEU A CA   1 
ATOM   2848  C C    . LEU A 1 203 ? 1.163   -15.052 -27.487 1.00 17.70 ? 203 LEU A C    1 
ATOM   2849  O O    . LEU A 1 203 ? 2.257   -14.468 -27.484 1.00 14.44 ? 203 LEU A O    1 
ATOM   2850  C CB   . LEU A 1 203 ? 1.289   -17.546 -27.403 1.00 16.06 ? 203 LEU A CB   1 
ATOM   2851  C CG   . LEU A 1 203 ? 1.206   -18.854 -26.612 1.00 15.84 ? 203 LEU A CG   1 
ATOM   2852  C CD1  . LEU A 1 203 ? 1.572   -20.035 -27.503 1.00 14.19 ? 203 LEU A CD1  1 
ATOM   2853  C CD2  . LEU A 1 203 ? 2.090   -18.817 -25.390 1.00 19.72 ? 203 LEU A CD2  1 
ATOM   2854  H H    . LEU A 1 203 ? -0.906  -16.980 -26.523 1.00 24.47 ? 203 LEU A H    1 
ATOM   2855  H HA   . LEU A 1 203 ? 1.533   -16.226 -25.860 1.00 21.41 ? 203 LEU A HA   1 
ATOM   2856  H HB2  . LEU A 1 203 ? 0.679   -17.621 -28.154 1.00 19.25 ? 203 LEU A HB2  1 
ATOM   2857  H HB3  . LEU A 1 203 ? 2.198   -17.462 -27.732 1.00 19.25 ? 203 LEU A HB3  1 
ATOM   2858  H HG   . LEU A 1 203 ? 0.292   -18.980 -26.313 1.00 18.99 ? 203 LEU A HG   1 
ATOM   2859  H HD11 . LEU A 1 203 ? 1.513   -20.852 -26.983 1.00 17.01 ? 203 LEU A HD11 1 
ATOM   2860  H HD12 . LEU A 1 203 ? 0.952   -20.072 -28.248 1.00 17.01 ? 203 LEU A HD12 1 
ATOM   2861  H HD13 . LEU A 1 203 ? 2.477   -19.915 -27.830 1.00 17.01 ? 203 LEU A HD13 1 
ATOM   2862  H HD21 . LEU A 1 203 ? 2.010   -19.660 -24.917 1.00 23.65 ? 203 LEU A HD21 1 
ATOM   2863  H HD22 . LEU A 1 203 ? 3.009   -18.679 -25.669 1.00 23.65 ? 203 LEU A HD22 1 
ATOM   2864  H HD23 . LEU A 1 203 ? 1.805   -18.088 -24.817 1.00 23.65 ? 203 LEU A HD23 1 
ATOM   2865  N N    . LYS A 1 204 ? 0.130   -14.610 -28.193 1.00 16.49 ? 204 LYS A N    1 
ATOM   2866  C CA   . LYS A 1 204 ? 0.287   -13.458 -29.065 1.00 15.89 ? 204 LYS A CA   1 
ATOM   2867  C C    . LYS A 1 204 ? 0.715   -12.228 -28.286 1.00 14.55 ? 204 LYS A C    1 
ATOM   2868  O O    . LYS A 1 204 ? 1.437   -11.383 -28.813 1.00 16.08 ? 204 LYS A O    1 
ATOM   2869  C CB   . LYS A 1 204 ? -1.025  -13.203 -29.812 1.00 17.72 ? 204 LYS A CB   1 
ATOM   2870  C CG   . LYS A 1 204 ? -2.117  -12.573 -28.939 1.00 20.25 ? 204 LYS A CG   1 
ATOM   2871  C CD   . LYS A 1 204 ? -3.340  -12.284 -29.777 1.00 20.08 ? 204 LYS A CD   1 
ATOM   2872  C CE   . LYS A 1 204 ? -4.503  -11.834 -28.936 1.00 24.88 ? 204 LYS A CE   1 
ATOM   2873  N NZ   . LYS A 1 204 ? -4.364  -10.435 -28.558 1.00 23.50 ? 204 LYS A NZ   1 
ATOM   2874  H H    . LYS A 1 204 ? -0.659  -14.954 -28.185 1.00 19.77 ? 204 LYS A H    1 
ATOM   2875  H HA   . LYS A 1 204 ? 0.974   -13.650 -29.723 1.00 19.04 ? 204 LYS A HA   1 
ATOM   2876  H HB2  . LYS A 1 204 ? -0.852  -12.600 -30.552 1.00 21.24 ? 204 LYS A HB2  1 
ATOM   2877  H HB3  . LYS A 1 204 ? -1.364  -14.048 -30.147 1.00 21.24 ? 204 LYS A HB3  1 
ATOM   2878  H HG2  . LYS A 1 204 ? -2.365  -13.189 -28.233 1.00 24.27 ? 204 LYS A HG2  1 
ATOM   2879  H HG3  . LYS A 1 204 ? -1.794  -11.738 -28.566 1.00 24.27 ? 204 LYS A HG3  1 
ATOM   2880  H HD2  . LYS A 1 204 ? -3.133  -11.579 -30.410 1.00 24.08 ? 204 LYS A HD2  1 
ATOM   2881  H HD3  . LYS A 1 204 ? -3.601  -13.091 -30.248 1.00 24.08 ? 204 LYS A HD3  1 
ATOM   2882  H HE2  . LYS A 1 204 ? -5.324  -11.933 -29.442 1.00 29.84 ? 204 LYS A HE2  1 
ATOM   2883  H HE3  . LYS A 1 204 ? -4.539  -12.367 -28.126 1.00 29.84 ? 204 LYS A HE3  1 
ATOM   2884  H HZ1  . LYS A 1 204 ? -5.058  -10.183 -28.061 1.00 28.18 ? 204 LYS A HZ1  1 
ATOM   2885  H HZ2  . LYS A 1 204 ? -3.616  -10.320 -28.090 1.00 28.18 ? 204 LYS A HZ2  1 
ATOM   2886  H HZ3  . LYS A 1 204 ? -4.330  -9.925  -29.287 1.00 28.18 ? 204 LYS A HZ3  1 
ATOM   2887  N N    . ASN A 1 205 ? 0.310   -12.117 -27.026 1.00 15.63 ? 205 ASN A N    1 
ATOM   2888  C CA   . ASN A 1 205 ? 0.650   -10.927 -26.262 1.00 17.47 ? 205 ASN A CA   1 
ATOM   2889  C C    . ASN A 1 205 ? 2.119   -10.895 -25.887 1.00 17.22 ? 205 ASN A C    1 
ATOM   2890  O O    . ASN A 1 205 ? 2.680   -9.818  -25.732 1.00 14.92 ? 205 ASN A O    1 
ATOM   2891  C CB   . ASN A 1 205 ? -0.201  -10.854 -25.014 1.00 16.00 ? 205 ASN A CB   1 
ATOM   2892  C CG   . ASN A 1 205 ? -1.646  -10.547 -25.338 1.00 23.82 ? 205 ASN A CG   1 
ATOM   2893  O OD1  . ASN A 1 205 ? -1.937  -9.932  -26.358 1.00 20.90 ? 205 ASN A OD1  1 
ATOM   2894  N ND2  . ASN A 1 205 ? -2.544  -10.966 -24.486 1.00 22.15 ? 205 ASN A ND2  1 
ATOM   2895  H H    . ASN A 1 205 ? -0.152  -12.703 -26.600 1.00 18.74 ? 205 ASN A H    1 
ATOM   2896  H HA   . ASN A 1 205 ? 0.461   -10.142 -26.799 1.00 20.94 ? 205 ASN A HA   1 
ATOM   2897  H HB2  . ASN A 1 205 ? -0.168  -11.708 -24.555 1.00 19.17 ? 205 ASN A HB2  1 
ATOM   2898  H HB3  . ASN A 1 205 ? 0.137   -10.151 -24.437 1.00 19.17 ? 205 ASN A HB3  1 
ATOM   2899  H HD21 . ASN A 1 205 ? -3.378  -10.813 -24.629 1.00 26.55 ? 205 ASN A HD21 1 
ATOM   2900  H HD22 . ASN A 1 205 ? -2.300  -11.394 -23.781 1.00 26.55 ? 205 ASN A HD22 1 
ATOM   2901  N N    . VAL A 1 206 ? 2.753   -12.058 -25.758 1.00 15.85 ? 206 VAL A N    1 
ATOM   2902  C CA   . VAL A 1 206 ? 4.201   -12.092 -25.561 1.00 14.69 ? 206 VAL A CA   1 
ATOM   2903  C C    . VAL A 1 206 ? 4.921   -11.571 -26.801 1.00 14.66 ? 206 VAL A C    1 
ATOM   2904  O O    . VAL A 1 206 ? 5.868   -10.794 -26.704 1.00 15.60 ? 206 VAL A O    1 
ATOM   2905  C CB   . VAL A 1 206 ? 4.686   -13.512 -25.220 1.00 14.56 ? 206 VAL A CB   1 
ATOM   2906  C CG1  . VAL A 1 206 ? 6.197   -13.491 -24.957 1.00 14.93 ? 206 VAL A CG1  1 
ATOM   2907  C CG2  . VAL A 1 206 ? 3.938   -14.064 -24.010 1.00 14.23 ? 206 VAL A CG2  1 
ATOM   2908  H H    . VAL A 1 206 ? 2.376   -12.831 -25.780 1.00 19.00 ? 206 VAL A H    1 
ATOM   2909  H HA   . VAL A 1 206 ? 4.430   -11.512 -24.818 1.00 17.60 ? 206 VAL A HA   1 
ATOM   2910  H HB   . VAL A 1 206 ? 4.518   -14.098 -25.974 1.00 17.45 ? 206 VAL A HB   1 
ATOM   2911  H HG11 . VAL A 1 206 ? 6.492   -14.390 -24.742 1.00 17.90 ? 206 VAL A HG11 1 
ATOM   2912  H HG12 . VAL A 1 206 ? 6.651   -13.174 -25.753 1.00 17.90 ? 206 VAL A HG12 1 
ATOM   2913  H HG13 . VAL A 1 206 ? 6.379   -12.896 -24.212 1.00 17.90 ? 206 VAL A HG13 1 
ATOM   2914  H HG21 . VAL A 1 206 ? 4.264   -14.957 -23.819 1.00 17.05 ? 206 VAL A HG21 1 
ATOM   2915  H HG22 . VAL A 1 206 ? 4.097   -13.483 -23.250 1.00 17.05 ? 206 VAL A HG22 1 
ATOM   2916  H HG23 . VAL A 1 206 ? 2.990   -14.093 -24.213 1.00 17.05 ? 206 VAL A HG23 1 
ATOM   2917  N N    . VAL A 1 207 ? 4.516   -12.021 -27.984 1.00 14.81 ? 207 VAL A N    1 
ATOM   2918  C CA   . VAL A 1 207 ? 5.145   -11.535 -29.217 1.00 11.51 ? 207 VAL A CA   1 
ATOM   2919  C C    . VAL A 1 207 ? 4.922   -10.039 -29.352 1.00 12.80 ? 207 VAL A C    1 
ATOM   2920  O O    . VAL A 1 207 ? 5.806   -9.295  -29.798 1.00 14.00 ? 207 VAL A O    1 
ATOM   2921  C CB   . VAL A 1 207 ? 4.589   -12.302 -30.431 1.00 14.04 ? 207 VAL A CB   1 
ATOM   2922  C CG1  . VAL A 1 207 ? 5.252   -11.868 -31.701 1.00 12.00 ? 207 VAL A CG1  1 
ATOM   2923  C CG2  . VAL A 1 207 ? 4.731   -13.818 -30.208 1.00 16.47 ? 207 VAL A CG2  1 
ATOM   2924  H H    . VAL A 1 207 ? 3.890   -12.599 -28.104 1.00 17.75 ? 207 VAL A H    1 
ATOM   2925  H HA   . VAL A 1 207 ? 6.101   -11.695 -29.171 1.00 13.79 ? 207 VAL A HA   1 
ATOM   2926  H HB   . VAL A 1 207 ? 3.642   -12.105 -30.514 1.00 16.83 ? 207 VAL A HB   1 
ATOM   2927  H HG11 . VAL A 1 207 ? 4.877   -12.371 -32.440 1.00 14.37 ? 207 VAL A HG11 1 
ATOM   2928  H HG12 . VAL A 1 207 ? 5.094   -10.919 -31.831 1.00 14.37 ? 207 VAL A HG12 1 
ATOM   2929  H HG13 . VAL A 1 207 ? 6.204   -12.038 -31.633 1.00 14.37 ? 207 VAL A HG13 1 
ATOM   2930  H HG21 . VAL A 1 207 ? 4.376   -14.285 -30.981 1.00 19.74 ? 207 VAL A HG21 1 
ATOM   2931  H HG22 . VAL A 1 207 ? 5.669   -14.033 -30.093 1.00 19.74 ? 207 VAL A HG22 1 
ATOM   2932  H HG23 . VAL A 1 207 ? 4.234   -14.067 -29.414 1.00 19.74 ? 207 VAL A HG23 1 
ATOM   2933  N N    . ALA A 1 208 ? 3.736   -9.572  -28.967 1.00 15.89 ? 208 ALA A N    1 
ATOM   2934  C CA   . ALA A 1 208 ? 3.429   -8.136  -29.098 1.00 15.10 ? 208 ALA A CA   1 
ATOM   2935  C C    . ALA A 1 208 ? 4.346   -7.273  -28.235 1.00 15.28 ? 208 ALA A C    1 
ATOM   2936  O O    . ALA A 1 208 ? 4.730   -6.156  -28.635 1.00 14.24 ? 208 ALA A O    1 
ATOM   2937  C CB   . ALA A 1 208 ? 1.948   -7.912  -28.769 1.00 15.44 ? 208 ALA A CB   1 
ATOM   2938  H H    . ALA A 1 208 ? 3.102   -10.048 -28.634 1.00 19.05 ? 208 ALA A H    1 
ATOM   2939  H HA   . ALA A 1 208 ? 3.566   -7.874  -30.022 1.00 18.10 ? 208 ALA A HA   1 
ATOM   2940  H HB1  . ALA A 1 208 ? 1.745   -6.967  -28.855 1.00 18.51 ? 208 ALA A HB1  1 
ATOM   2941  H HB2  . ALA A 1 208 ? 1.406   -8.425  -29.388 1.00 18.51 ? 208 ALA A HB2  1 
ATOM   2942  H HB3  . ALA A 1 208 ? 1.779   -8.206  -27.860 1.00 18.51 ? 208 ALA A HB3  1 
ATOM   2943  N N    . VAL A 1 209 ? 4.732   -7.771  -27.071 1.00 13.58 ? 209 VAL A N    1 
ATOM   2944  C CA   . VAL A 1 209 ? 5.727   -7.075  -26.272 1.00 15.28 ? 209 VAL A CA   1 
ATOM   2945  C C    . VAL A 1 209 ? 7.035   -6.955  -27.046 1.00 15.75 ? 209 VAL A C    1 
ATOM   2946  O O    . VAL A 1 209 ? 7.669   -5.892  -27.065 1.00 16.32 ? 209 VAL A O    1 
ATOM   2947  C CB   . VAL A 1 209 ? 5.928   -7.780  -24.919 1.00 16.10 ? 209 VAL A CB   1 
ATOM   2948  C CG1  . VAL A 1 209 ? 7.132   -7.146  -24.170 1.00 14.41 ? 209 VAL A CG1  1 
ATOM   2949  C CG2  . VAL A 1 209 ? 4.692   -7.721  -24.063 1.00 17.04 ? 209 VAL A CG2  1 
ATOM   2950  H H    . VAL A 1 209 ? 4.437   -8.501  -26.724 1.00 16.28 ? 209 VAL A H    1 
ATOM   2951  H HA   . VAL A 1 209 ? 5.408   -6.177  -26.092 1.00 18.31 ? 209 VAL A HA   1 
ATOM   2952  H HB   . VAL A 1 209 ? 6.135   -8.714  -25.080 1.00 19.30 ? 209 VAL A HB   1 
ATOM   2953  H HG11 . VAL A 1 209 ? 7.248   -7.599  -23.320 1.00 17.27 ? 209 VAL A HG11 1 
ATOM   2954  H HG12 . VAL A 1 209 ? 7.930   -7.249  -24.712 1.00 17.27 ? 209 VAL A HG12 1 
ATOM   2955  H HG13 . VAL A 1 209 ? 6.952   -6.205  -24.022 1.00 17.27 ? 209 VAL A HG13 1 
ATOM   2956  H HG21 . VAL A 1 209 ? 4.867   -8.176  -23.225 1.00 20.43 ? 209 VAL A HG21 1 
ATOM   2957  H HG22 . VAL A 1 209 ? 4.469   -6.792  -23.895 1.00 20.43 ? 209 VAL A HG22 1 
ATOM   2958  H HG23 . VAL A 1 209 ? 3.963   -8.157  -24.531 1.00 20.43 ? 209 VAL A HG23 1 
ATOM   2959  N N    . GLY A 1 210 ? 7.460   -8.031  -27.711 1.00 17.25 ? 210 GLY A N    1 
ATOM   2960  C CA   . GLY A 1 210 ? 8.636   -7.937  -28.550 1.00 17.42 ? 210 GLY A CA   1 
ATOM   2961  C C    . GLY A 1 210 ? 8.454   -6.971  -29.700 1.00 18.59 ? 210 GLY A C    1 
ATOM   2962  O O    . GLY A 1 210 ? 9.348   -6.191  -30.018 1.00 15.50 ? 210 GLY A O    1 
ATOM   2963  H H    . GLY A 1 210 ? 7.088   -8.807  -27.691 1.00 20.68 ? 210 GLY A H    1 
ATOM   2964  H HA2  . GLY A 1 210 ? 9.389   -7.641  -28.016 1.00 20.88 ? 210 GLY A HA2  1 
ATOM   2965  H HA3  . GLY A 1 210 ? 8.843   -8.812  -28.914 1.00 20.88 ? 210 GLY A HA3  1 
ATOM   2966  N N    . ALA A 1 211 ? 7.288   -7.001  -30.336 1.00 13.20 ? 211 ALA A N    1 
ATOM   2967  C CA   . ALA A 1 211 ? 7.021   -6.056  -31.424 1.00 14.35 ? 211 ALA A CA   1 
ATOM   2968  C C    . ALA A 1 211 ? 7.066   -4.611  -30.921 1.00 15.85 ? 211 ALA A C    1 
ATOM   2969  O O    . ALA A 1 211 ? 7.605   -3.721  -31.599 1.00 17.89 ? 211 ALA A O    1 
ATOM   2970  C CB   . ALA A 1 211 ? 5.671   -6.365  -32.054 1.00 20.93 ? 211 ALA A CB   1 
ATOM   2971  H H    . ALA A 1 211 ? 6.644   -7.545  -30.165 1.00 15.82 ? 211 ALA A H    1 
ATOM   2972  H HA   . ALA A 1 211 ? 7.702   -6.158  -32.106 1.00 17.19 ? 211 ALA A HA   1 
ATOM   2973  H HB1  . ALA A 1 211 ? 5.506   -5.733  -32.771 1.00 25.10 ? 211 ALA A HB1  1 
ATOM   2974  H HB2  . ALA A 1 211 ? 5.687   -7.269  -32.405 1.00 25.10 ? 211 ALA A HB2  1 
ATOM   2975  H HB3  . ALA A 1 211 ? 4.981   -6.285  -31.377 1.00 25.10 ? 211 ALA A HB3  1 
ATOM   2976  N N    . GLY A 1 212 ? 6.517   -4.369  -29.730 1.00 14.44 ? 212 GLY A N    1 
ATOM   2977  C CA   . GLY A 1 212 ? 6.612   -3.052  -29.109 1.00 17.20 ? 212 GLY A CA   1 
ATOM   2978  C C    . GLY A 1 212 ? 8.043   -2.631  -28.824 1.00 19.94 ? 212 GLY A C    1 
ATOM   2979  O O    . GLY A 1 212 ? 8.411   -1.473  -29.048 1.00 19.01 ? 212 GLY A O    1 
ATOM   2980  H H    . GLY A 1 212 ? 6.087   -4.950  -29.264 1.00 17.30 ? 212 GLY A H    1 
ATOM   2981  H HA2  . GLY A 1 212 ? 6.210   -2.392  -29.695 1.00 20.62 ? 212 GLY A HA2  1 
ATOM   2982  H HA3  . GLY A 1 212 ? 6.122   -3.056  -28.272 1.00 20.62 ? 212 GLY A HA3  1 
ATOM   2983  N N    . PHE A 1 213 ? 8.900   -3.555  -28.412 1.00 15.19 ? 213 PHE A N    1 
ATOM   2984  C CA   . PHE A 1 213 ? 10.337  -3.244  -28.198 1.00 18.06 ? 213 PHE A CA   1 
ATOM   2985  C C    . PHE A 1 213 ? 10.944  -2.663  -29.505 1.00 20.42 ? 213 PHE A C    1 
ATOM   2986  O O    . PHE A 1 213 ? 11.581  -1.712  -29.455 1.00 18.15 ? 213 PHE A O    1 
ATOM   2987  C CB   . PHE A 1 213 ? 11.113  -4.445  -27.657 1.00 15.82 ? 213 PHE A CB   1 
ATOM   2988  C CG   . PHE A 1 213 ? 10.782  -4.863  -26.248 1.00 16.46 ? 213 PHE A CG   1 
ATOM   2989  C CD1  . PHE A 1 213 ? 10.088  -4.031  -25.399 1.00 14.42 ? 213 PHE A CD1  1 
ATOM   2990  C CD2  . PHE A 1 213 ? 11.183  -6.092  -25.760 1.00 19.61 ? 213 PHE A CD2  1 
ATOM   2991  C CE1  . PHE A 1 213 ? 9.795   -4.425  -24.110 1.00 16.85 ? 213 PHE A CE1  1 
ATOM   2992  C CE2  . PHE A 1 213 ? 10.860  -6.494  -24.484 1.00 16.96 ? 213 PHE A CE2  1 
ATOM   2993  C CZ   . PHE A 1 213 ? 10.170  -5.658  -23.659 1.00 17.43 ? 213 PHE A CZ   1 
ATOM   2994  H H    . PHE A 1 213 ? 8.684   -4.422  -28.235 1.00 18.21 ? 213 PHE A H    1 
ATOM   2995  H HA   . PHE A 1 213 ? 10.384  -2.530  -27.512 1.00 21.65 ? 213 PHE A HA   1 
ATOM   2996  H HB2  . PHE A 1 213 ? 10.951  -5.205  -28.253 1.00 18.97 ? 213 PHE A HB2  1 
ATOM   2997  H HB3  . PHE A 1 213 ? 12.069  -4.235  -27.702 1.00 18.97 ? 213 PHE A HB3  1 
ATOM   2998  H HD1  . PHE A 1 213 ? 9.813   -3.180  -25.702 1.00 17.29 ? 213 PHE A HD1  1 
ATOM   2999  H HD2  . PHE A 1 213 ? 11.647  -6.685  -26.330 1.00 23.52 ? 213 PHE A HD2  1 
ATOM   3000  H HE1  . PHE A 1 213 ? 9.310   -3.846  -23.544 1.00 20.20 ? 213 PHE A HE1  1 
ATOM   3001  H HE2  . PHE A 1 213 ? 11.139  -7.340  -24.172 1.00 20.33 ? 213 PHE A HE2  1 
ATOM   3002  H HZ   . PHE A 1 213 ? 9.969   -5.921  -22.775 1.00 20.90 ? 213 PHE A HZ   1 
ATOM   3003  N N    . CYS A 1 214 ? 10.745  -3.298  -30.644 1.00 16.38 ? 214 CYS A N    1 
ATOM   3004  C CA   . CYS A 1 214 ? 11.236  -2.935  -31.993 1.00 17.92 ? 214 CYS A CA   1 
ATOM   3005  C C    . CYS A 1 214 ? 10.697  -1.595  -32.421 1.00 23.26 ? 214 CYS A C    1 
ATOM   3006  O O    . CYS A 1 214 ? 11.452  -0.804  -32.947 1.00 18.38 ? 214 CYS A O    1 
ATOM   3007  C CB   . CYS A 1 214 ? 10.749  -3.832  -33.102 1.00 26.25 ? 214 CYS A CB   1 
ATOM   3008  S SG   . CYS A 1 214 ? 11.401  -5.463  -32.866 1.00 36.38 ? 214 CYS A SG   1 
ATOM   3009  H H    . CYS A 1 214 ? 10.299  -4.092  -30.616 1.00 19.63 ? 214 CYS A H    1 
ATOM   3010  H HA   . CYS A 1 214 ? 12.221  -2.914  -31.989 1.00 21.48 ? 214 CYS A HA   1 
ATOM   3011  H HB2  . CYS A 1 214 ? 9.771   -3.870  -33.096 1.00 31.48 ? 214 CYS A HB2  1 
ATOM   3012  H HB3  . CYS A 1 214 ? 11.046  -3.485  -33.968 1.00 31.48 ? 214 CYS A HB3  1 
ATOM   3013  H HG   . CYS A 1 214 ? 10.807  -5.719  -31.852 1.00 43.63 ? 214 CYS A HG   1 
ATOM   3014  N N    . ASP A 1 215 ? 9.401   -1.342  -32.020 1.00 17.22 ? 215 ASP A N    1 
ATOM   3015  C CA   . ASP A 1 215 ? 8.942   0.009   -32.326 1.00 17.96 ? 215 ASP A CA   1 
ATOM   3016  C C    . ASP A 1 215 ? 9.672   1.048   -31.480 1.00 22.51 ? 215 ASP A C    1 
ATOM   3017  O O    . ASP A 1 215 ? 10.087  2.085   -31.994 1.00 23.13 ? 215 ASP A O    1 
ATOM   3018  C CB   . ASP A 1 215 ? 7.417   0.119   -32.116 1.00 18.09 ? 215 ASP A CB   1 
ATOM   3019  C CG   . ASP A 1 215 ? 6.613   -0.623  -33.169 1.00 20.05 ? 215 ASP A CG   1 
ATOM   3020  O OD1  . ASP A 1 215 ? 7.043   -0.652  -34.350 1.00 18.68 ? 215 ASP A OD1  1 
ATOM   3021  O OD2  . ASP A 1 215 ? 5.521   -1.139  -32.809 1.00 19.51 ? 215 ASP A OD2  1 
ATOM   3022  H H    . ASP A 1 215 ? 8.797   -1.854  -31.684 1.00 20.64 ? 215 ASP A H    1 
ATOM   3023  H HA   . ASP A 1 215 ? 9.128   0.200   -33.258 1.00 21.53 ? 215 ASP A HA   1 
ATOM   3024  H HB2  . ASP A 1 215 ? 7.191   -0.254  -31.249 1.00 21.69 ? 215 ASP A HB2  1 
ATOM   3025  H HB3  . ASP A 1 215 ? 7.162   1.054   -32.149 1.00 21.69 ? 215 ASP A HB3  1 
ATOM   3026  N N    . GLY A 1 216 ? 9.837   0.795   -30.185 1.00 19.58 ? 216 GLY A N    1 
ATOM   3027  C CA   . GLY A 1 216 ? 10.440  1.792   -29.301 1.00 20.87 ? 216 GLY A CA   1 
ATOM   3028  C C    . GLY A 1 216 ? 11.944  1.921   -29.429 1.00 20.29 ? 216 GLY A C    1 
ATOM   3029  O O    . GLY A 1 216 ? 12.511  2.920   -28.969 1.00 23.32 ? 216 GLY A O    1 
ATOM   3030  H H    . GLY A 1 216 ? 9.611   0.062   -29.796 1.00 23.47 ? 216 GLY A H    1 
ATOM   3031  H HA2  . GLY A 1 216 ? 10.048  2.659   -29.489 1.00 25.02 ? 216 GLY A HA2  1 
ATOM   3032  H HA3  . GLY A 1 216 ? 10.236  1.562   -28.381 1.00 25.02 ? 216 GLY A HA3  1 
ATOM   3033  N N    . LEU A 1 217 ? 12.595  0.941   -30.041 1.00 18.93 ? 217 LEU A N    1 
ATOM   3034  C CA   . LEU A 1 217 ? 14.010  1.006   -30.374 1.00 22.08 ? 217 LEU A CA   1 
ATOM   3035  C C    . LEU A 1 217 ? 14.239  1.536   -31.790 1.00 25.13 ? 217 LEU A C    1 
ATOM   3036  O O    . LEU A 1 217 ? 15.384  1.695   -32.220 1.00 24.26 ? 217 LEU A O    1 
ATOM   3037  C CB   . LEU A 1 217 ? 14.635  -0.369  -30.222 1.00 22.44 ? 217 LEU A CB   1 
ATOM   3038  C CG   . LEU A 1 217 ? 14.614  -1.026  -28.837 1.00 25.40 ? 217 LEU A CG   1 
ATOM   3039  C CD1  . LEU A 1 217 ? 14.978  -2.479  -28.934 1.00 29.05 ? 217 LEU A CD1  1 
ATOM   3040  C CD2  . LEU A 1 217 ? 15.582  -0.320  -27.917 1.00 32.09 ? 217 LEU A CD2  1 
ATOM   3041  H H    . LEU A 1 217 ? 12.225  0.203   -30.281 1.00 22.69 ? 217 LEU A H    1 
ATOM   3042  H HA   . LEU A 1 217 ? 14.452  1.606   -29.754 1.00 26.48 ? 217 LEU A HA   1 
ATOM   3043  H HB2  . LEU A 1 217 ? 14.177  -0.973  -30.827 1.00 26.90 ? 217 LEU A HB2  1 
ATOM   3044  H HB3  . LEU A 1 217 ? 15.566  -0.303  -30.487 1.00 26.90 ? 217 LEU A HB3  1 
ATOM   3045  H HG   . LEU A 1 217 ? 13.723  -0.956  -28.459 1.00 30.46 ? 217 LEU A HG   1 
ATOM   3046  H HD11 . LEU A 1 217 ? 14.957  -2.869  -28.047 1.00 34.84 ? 217 LEU A HD11 1 
ATOM   3047  H HD12 . LEU A 1 217 ? 14.338  -2.927  -29.509 1.00 34.84 ? 217 LEU A HD12 1 
ATOM   3048  H HD13 . LEU A 1 217 ? 15.870  -2.555  -29.309 1.00 34.84 ? 217 LEU A HD13 1 
ATOM   3049  H HD21 . LEU A 1 217 ? 15.556  -0.746  -27.046 1.00 38.48 ? 217 LEU A HD21 1 
ATOM   3050  H HD22 . LEU A 1 217 ? 16.475  -0.383  -28.290 1.00 38.48 ? 217 LEU A HD22 1 
ATOM   3051  H HD23 . LEU A 1 217 ? 15.320  0.611   -27.838 1.00 38.48 ? 217 LEU A HD23 1 
ATOM   3052  N N    . GLY A 1 218 ? 13.183  1.798   -32.527 1.00 23.64 ? 218 GLY A N    1 
ATOM   3053  C CA   . GLY A 1 218 ? 13.309  2.470   -33.792 1.00 26.15 ? 218 GLY A CA   1 
ATOM   3054  C C    . GLY A 1 218 ? 13.573  1.586   -34.980 1.00 32.22 ? 218 GLY A C    1 
ATOM   3055  O O    . GLY A 1 218 ? 13.920  2.108   -36.042 1.00 28.11 ? 218 GLY A O    1 
ATOM   3056  H H    . GLY A 1 218 ? 12.375  1.593   -32.314 1.00 28.35 ? 218 GLY A H    1 
ATOM   3057  H HA2  . GLY A 1 218 ? 12.491  2.962   -33.966 1.00 31.36 ? 218 GLY A HA2  1 
ATOM   3058  H HA3  . GLY A 1 218 ? 14.035  3.111   -33.733 1.00 31.36 ? 218 GLY A HA3  1 
ATOM   3059  N N    . PHE A 1 219 ? 13.442  0.268   -34.844 1.00 24.93 ? 219 PHE A N    1 
ATOM   3060  C CA   . PHE A 1 219 ? 13.573  -0.572  -36.017 1.00 27.67 ? 219 PHE A CA   1 
ATOM   3061  C C    . PHE A 1 219 ? 12.372  -0.383  -36.937 1.00 28.14 ? 219 PHE A C    1 
ATOM   3062  O O    . PHE A 1 219 ? 11.302  0.122   -36.552 1.00 23.77 ? 219 PHE A O    1 
ATOM   3063  C CB   . PHE A 1 219 ? 13.762  -2.035  -35.595 1.00 26.56 ? 219 PHE A CB   1 
ATOM   3064  C CG   . PHE A 1 219 ? 14.797  -2.222  -34.510 1.00 28.06 ? 219 PHE A CG   1 
ATOM   3065  C CD1  . PHE A 1 219 ? 15.978  -1.536  -34.539 1.00 41.30 ? 219 PHE A CD1  1 
ATOM   3066  C CD2  . PHE A 1 219 ? 14.558  -3.041  -33.429 1.00 34.23 ? 219 PHE A CD2  1 
ATOM   3067  C CE1  . PHE A 1 219 ? 16.916  -1.690  -33.536 1.00 35.13 ? 219 PHE A CE1  1 
ATOM   3068  C CE2  . PHE A 1 219 ? 15.479  -3.176  -32.423 1.00 35.11 ? 219 PHE A CE2  1 
ATOM   3069  C CZ   . PHE A 1 219 ? 16.676  -2.500  -32.490 1.00 33.78 ? 219 PHE A CZ   1 
ATOM   3070  H H    . PHE A 1 219 ? 13.283  -0.147  -34.109 1.00 29.90 ? 219 PHE A H    1 
ATOM   3071  H HA   . PHE A 1 219 ? 14.365  -0.302  -36.507 1.00 33.18 ? 219 PHE A HA   1 
ATOM   3072  H HB2  . PHE A 1 219 ? 12.918  -2.377  -35.263 1.00 31.85 ? 219 PHE A HB2  1 
ATOM   3073  H HB3  . PHE A 1 219 ? 14.045  -2.550  -36.368 1.00 31.85 ? 219 PHE A HB3  1 
ATOM   3074  H HD1  . PHE A 1 219 ? 16.163  -0.974  -35.257 1.00 49.54 ? 219 PHE A HD1  1 
ATOM   3075  H HD2  . PHE A 1 219 ? 13.753  -3.504  -33.377 1.00 41.05 ? 219 PHE A HD2  1 
ATOM   3076  H HE1  . PHE A 1 219 ? 17.719  -1.223  -33.581 1.00 42.14 ? 219 PHE A HE1  1 
ATOM   3077  H HE2  . PHE A 1 219 ? 15.307  -3.747  -31.709 1.00 42.12 ? 219 PHE A HE2  1 
ATOM   3078  H HZ   . PHE A 1 219 ? 17.309  -2.596  -31.816 1.00 40.52 ? 219 PHE A HZ   1 
ATOM   3079  N N    . GLY A 1 220 ? 12.584  -0.733  -38.201 1.00 28.88 ? 220 GLY A N    1 
ATOM   3080  C CA   . GLY A 1 220 ? 11.579  -0.564  -39.216 1.00 27.03 ? 220 GLY A CA   1 
ATOM   3081  C C    . GLY A 1 220 ? 10.751  -1.806  -39.371 1.00 28.71 ? 220 GLY A C    1 
ATOM   3082  O O    . GLY A 1 220 ? 10.893  -2.783  -38.632 1.00 22.53 ? 220 GLY A O    1 
ATOM   3083  H H    . GLY A 1 220 ? 13.318  -1.075  -38.492 1.00 34.63 ? 220 GLY A H    1 
ATOM   3084  H HA2  . GLY A 1 220 ? 10.994  0.172   -38.977 1.00 32.41 ? 220 GLY A HA2  1 
ATOM   3085  H HA3  . GLY A 1 220 ? 12.002  -0.363  -40.065 1.00 32.41 ? 220 GLY A HA3  1 
ATOM   3086  N N    . ASP A 1 221 ? 9.894   -1.766  -40.384 1.00 23.43 ? 221 ASP A N    1 
ATOM   3087  C CA   . ASP A 1 221 ? 8.874   -2.780  -40.585 1.00 27.66 ? 221 ASP A CA   1 
ATOM   3088  C C    . ASP A 1 221 ? 9.486   -4.139  -40.958 1.00 23.20 ? 221 ASP A C    1 
ATOM   3089  O O    . ASP A 1 221 ? 8.893   -5.167  -40.650 1.00 20.82 ? 221 ASP A O    1 
ATOM   3090  C CB   . ASP A 1 221 ? 7.892   -2.307  -41.673 1.00 32.81 ? 221 ASP A CB   1 
ATOM   3091  C CG   . ASP A 1 221 ? 6.545   -1.801  -41.111 1.00 37.60 ? 221 ASP A CG   1 
ATOM   3092  O OD1  . ASP A 1 221 ? 6.069   -2.272  -40.055 1.00 36.14 ? 221 ASP A OD1  1 
ATOM   3093  O OD2  . ASP A 1 221 ? 5.964   -0.900  -41.742 1.00 39.94 ? 221 ASP A OD2  1 
ATOM   3094  H H    . ASP A 1 221 ? 9.886   -1.146  -40.981 1.00 28.10 ? 221 ASP A H    1 
ATOM   3095  H HA   . ASP A 1 221 ? 8.376   -2.893  -39.760 1.00 33.17 ? 221 ASP A HA   1 
ATOM   3096  H HB2  . ASP A 1 221 ? 8.299   -1.579  -42.168 1.00 39.35 ? 221 ASP A HB2  1 
ATOM   3097  H HB3  . ASP A 1 221 ? 7.705   -3.048  -42.270 1.00 39.35 ? 221 ASP A HB3  1 
ATOM   3098  N N    . ASN A 1 222 ? 10.656  -4.179  -41.614 1.00 20.53 ? 222 ASN A N    1 
ATOM   3099  C CA   . ASN A 1 222 ? 11.232  -5.486  -41.966 1.00 23.77 ? 222 ASN A CA   1 
ATOM   3100  C C    . ASN A 1 222 ? 11.794  -6.194  -40.740 1.00 25.52 ? 222 ASN A C    1 
ATOM   3101  O O    . ASN A 1 222 ? 11.680  -7.433  -40.609 1.00 22.91 ? 222 ASN A O    1 
ATOM   3102  C CB   . ASN A 1 222 ? 12.324  -5.329  -43.015 1.00 21.96 ? 222 ASN A CB   1 
ATOM   3103  C CG   . ASN A 1 222 ? 11.780  -4.905  -44.340 1.00 23.88 ? 222 ASN A CG   1 
ATOM   3104  O OD1  . ASN A 1 222 ? 10.786  -5.444  -44.813 1.00 22.22 ? 222 ASN A OD1  1 
ATOM   3105  N ND2  . ASN A 1 222 ? 12.374  -3.873  -44.912 1.00 25.05 ? 222 ASN A ND2  1 
ATOM   3106  H H    . ASN A 1 222 ? 11.118  -3.496  -41.858 1.00 24.62 ? 222 ASN A H    1 
ATOM   3107  H HA   . ASN A 1 222 ? 10.535  -6.046  -42.341 1.00 28.50 ? 222 ASN A HA   1 
ATOM   3108  H HB2  . ASN A 1 222 ? 12.955  -4.655  -42.718 1.00 26.33 ? 222 ASN A HB2  1 
ATOM   3109  H HB3  . ASN A 1 222 ? 12.776  -6.179  -43.133 1.00 26.33 ? 222 ASN A HB3  1 
ATOM   3110  H HD21 . ASN A 1 222 ? 12.095  -3.583  -45.672 1.00 30.03 ? 222 ASN A HD21 1 
ATOM   3111  H HD22 . ASN A 1 222 ? 13.060  -3.511  -44.540 1.00 30.03 ? 222 ASN A HD22 1 
ATOM   3112  N N    . THR A 1 223 ? 12.445  -5.432  -39.854 1.00 18.87 ? 223 THR A N    1 
ATOM   3113  C CA   . THR A 1 223 ? 12.865  -5.990  -38.577 1.00 20.74 ? 223 THR A CA   1 
ATOM   3114  C C    . THR A 1 223 ? 11.653  -6.443  -37.785 1.00 22.65 ? 223 THR A C    1 
ATOM   3115  O O    . THR A 1 223 ? 11.605  -7.569  -37.283 1.00 20.98 ? 223 THR A O    1 
ATOM   3116  C CB   . THR A 1 223 ? 13.675  -4.978  -37.774 1.00 22.76 ? 223 THR A CB   1 
ATOM   3117  O OG1  . THR A 1 223 ? 14.873  -4.612  -38.482 1.00 21.08 ? 223 THR A OG1  1 
ATOM   3118  C CG2  . THR A 1 223 ? 14.059  -5.560  -36.404 1.00 20.65 ? 223 THR A CG2  1 
ATOM   3119  H H    . THR A 1 223 ? 12.650  -4.605  -39.970 1.00 22.63 ? 223 THR A H    1 
ATOM   3120  H HA   . THR A 1 223 ? 13.427  -6.764  -38.739 1.00 24.86 ? 223 THR A HA   1 
ATOM   3121  H HB   . THR A 1 223 ? 13.138  -4.184  -37.626 1.00 27.29 ? 223 THR A HB   1 
ATOM   3122  H HG1  . THR A 1 223 ? 15.348  -5.293  -38.614 1.00 25.28 ? 223 THR A HG1  1 
ATOM   3123  H HG21 . THR A 1 223 ? 14.574  -4.910  -35.900 1.00 24.76 ? 223 THR A HG21 1 
ATOM   3124  H HG22 . THR A 1 223 ? 13.259  -5.785  -35.904 1.00 24.76 ? 223 THR A HG22 1 
ATOM   3125  H HG23 . THR A 1 223 ? 14.593  -6.362  -36.522 1.00 24.76 ? 223 THR A HG23 1 
ATOM   3126  N N    . LYS A 1 224 ? 10.652  -5.581  -37.671 1.00 20.81 ? 224 LYS A N    1 
ATOM   3127  C CA   . LYS A 1 224 ? 9.447   -5.949  -36.945 1.00 21.37 ? 224 LYS A CA   1 
ATOM   3128  C C    . LYS A 1 224 ? 8.768   -7.186  -37.547 1.00 20.65 ? 224 LYS A C    1 
ATOM   3129  O O    . LYS A 1 224 ? 8.271   -8.048  -36.815 1.00 18.00 ? 224 LYS A O    1 
ATOM   3130  C CB   . LYS A 1 224 ? 8.508   -4.741  -36.912 1.00 15.70 ? 224 LYS A CB   1 
ATOM   3131  C CG   . LYS A 1 224 ? 7.229   -4.957  -36.202 1.00 19.11 ? 224 LYS A CG   1 
ATOM   3132  C CD   . LYS A 1 224 ? 6.449   -3.624  -36.002 1.00 22.28 ? 224 LYS A CD   1 
ATOM   3133  C CE   . LYS A 1 224 ? 5.193   -3.847  -35.207 1.00 24.11 ? 224 LYS A CE   1 
ATOM   3134  N NZ   . LYS A 1 224 ? 4.417   -2.576  -34.894 1.00 20.21 ? 224 LYS A NZ   1 
ATOM   3135  H H    . LYS A 1 224 ? 10.646  -4.786  -37.999 1.00 24.95 ? 224 LYS A H    1 
ATOM   3136  H HA   . LYS A 1 224 ? 9.687   -6.162  -36.030 1.00 25.62 ? 224 LYS A HA   1 
ATOM   3137  H HB2  . LYS A 1 224 ? 8.965   -4.008  -36.472 1.00 18.82 ? 224 LYS A HB2  1 
ATOM   3138  H HB3  . LYS A 1 224 ? 8.296   -4.491  -37.825 1.00 18.82 ? 224 LYS A HB3  1 
ATOM   3139  H HG2  . LYS A 1 224 ? 6.673   -5.559  -36.721 1.00 22.91 ? 224 LYS A HG2  1 
ATOM   3140  H HG3  . LYS A 1 224 ? 7.410   -5.337  -35.328 1.00 22.91 ? 224 LYS A HG3  1 
ATOM   3141  H HD2  . LYS A 1 224 ? 7.008   -2.994  -35.521 1.00 26.72 ? 224 LYS A HD2  1 
ATOM   3142  H HD3  . LYS A 1 224 ? 6.203   -3.263  -36.868 1.00 26.72 ? 224 LYS A HD3  1 
ATOM   3143  H HE2  . LYS A 1 224 ? 4.607   -4.435  -35.710 1.00 28.91 ? 224 LYS A HE2  1 
ATOM   3144  H HE3  . LYS A 1 224 ? 5.429   -4.264  -34.364 1.00 28.91 ? 224 LYS A HE3  1 
ATOM   3145  H HZ1  . LYS A 1 224 ? 3.687   -2.774  -34.424 1.00 24.23 ? 224 LYS A HZ1  1 
ATOM   3146  H HZ2  . LYS A 1 224 ? 4.924   -2.019  -34.421 1.00 24.23 ? 224 LYS A HZ2  1 
ATOM   3147  H HZ3  . LYS A 1 224 ? 4.173   -2.175  -35.651 1.00 24.23 ? 224 LYS A HZ3  1 
ATOM   3148  N N    . ALA A 1 225 ? 8.726   -7.300  -38.873 1.00 19.43 ? 225 ALA A N    1 
ATOM   3149  C CA   . ALA A 1 225 ? 8.122   -8.485  -39.489 1.00 18.34 ? 225 ALA A CA   1 
ATOM   3150  C C    . ALA A 1 225 ? 8.846   -9.768  -39.088 1.00 19.76 ? 225 ALA A C    1 
ATOM   3151  O O    . ALA A 1 225 ? 8.206   -10.810 -38.890 1.00 13.92 ? 225 ALA A O    1 
ATOM   3152  C CB   . ALA A 1 225 ? 8.097   -8.332  -41.020 1.00 18.26 ? 225 ALA A CB   1 
ATOM   3153  H H    . ALA A 1 225 ? 9.033   -6.720  -39.430 1.00 23.30 ? 225 ALA A H    1 
ATOM   3154  H HA   . ALA A 1 225 ? 7.203   -8.558  -39.185 1.00 21.99 ? 225 ALA A HA   1 
ATOM   3155  H HB1  . ALA A 1 225 ? 7.694   -9.124  -41.410 1.00 21.89 ? 225 ALA A HB1  1 
ATOM   3156  H HB2  . ALA A 1 225 ? 7.575   -7.547  -41.251 1.00 21.89 ? 225 ALA A HB2  1 
ATOM   3157  H HB3  . ALA A 1 225 ? 9.006   -8.230  -41.342 1.00 21.89 ? 225 ALA A HB3  1 
ATOM   3158  N N    . ALA A 1 226 ? 10.179  -9.721  -38.978 1.00 16.77 ? 226 ALA A N    1 
ATOM   3159  C CA   . ALA A 1 226 ? 10.931  -10.874 -38.488 1.00 20.45 ? 226 ALA A CA   1 
ATOM   3160  C C    . ALA A 1 226 ? 10.624  -11.171 -37.019 1.00 17.70 ? 226 ALA A C    1 
ATOM   3161  O O    . ALA A 1 226 ? 10.467  -12.332 -36.644 1.00 16.03 ? 226 ALA A O    1 
ATOM   3162  C CB   . ALA A 1 226 ? 12.428  -10.643 -38.684 1.00 15.61 ? 226 ALA A CB   1 
ATOM   3163  H H    . ALA A 1 226 ? 10.663  -9.039  -39.179 1.00 20.11 ? 226 ALA A H    1 
ATOM   3164  H HA   . ALA A 1 226 ? 10.681  -11.654 -39.007 1.00 24.52 ? 226 ALA A HA   1 
ATOM   3165  H HB1  . ALA A 1 226 ? 12.912  -11.416 -38.354 1.00 18.71 ? 226 ALA A HB1  1 
ATOM   3166  H HB2  . ALA A 1 226 ? 12.607  -10.519 -39.629 1.00 18.71 ? 226 ALA A HB2  1 
ATOM   3167  H HB3  . ALA A 1 226 ? 12.692  -9.851  -38.189 1.00 18.71 ? 226 ALA A HB3  1 
ATOM   3168  N N    . VAL A 1 227 ? 10.545  -10.147 -36.169 1.00 18.07 ? 227 VAL A N    1 
ATOM   3169  C CA   . VAL A 1 227 ? 10.133  -10.367 -34.775 1.00 18.15 ? 227 VAL A CA   1 
ATOM   3170  C C    . VAL A 1 227 ? 8.764   -11.030 -34.718 1.00 18.44 ? 227 VAL A C    1 
ATOM   3171  O O    . VAL A 1 227 ? 8.554   -11.992 -33.957 1.00 16.80 ? 227 VAL A O    1 
ATOM   3172  C CB   . VAL A 1 227 ? 10.144  -9.049  -33.978 1.00 17.44 ? 227 VAL A CB   1 
ATOM   3173  C CG1  . VAL A 1 227 ? 9.512   -9.228  -32.572 1.00 19.02 ? 227 VAL A CG1  1 
ATOM   3174  C CG2  . VAL A 1 227 ? 11.543  -8.533  -33.851 1.00 23.43 ? 227 VAL A CG2  1 
ATOM   3175  H H    . VAL A 1 227 ? 10.719  -9.328  -36.366 1.00 21.67 ? 227 VAL A H    1 
ATOM   3176  H HA   . VAL A 1 227 ? 10.769  -10.969 -34.356 1.00 21.76 ? 227 VAL A HA   1 
ATOM   3177  H HB   . VAL A 1 227 ? 9.623   -8.386  -34.457 1.00 20.90 ? 227 VAL A HB   1 
ATOM   3178  H HG11 . VAL A 1 227 ? 9.538   -8.379  -32.104 1.00 22.80 ? 227 VAL A HG11 1 
ATOM   3179  H HG12 . VAL A 1 227 ? 8.594   -9.522  -32.674 1.00 22.80 ? 227 VAL A HG12 1 
ATOM   3180  H HG13 . VAL A 1 227 ? 10.020  -9.892  -32.081 1.00 22.80 ? 227 VAL A HG13 1 
ATOM   3181  H HG21 . VAL A 1 227 ? 11.529  -7.704  -33.347 1.00 28.09 ? 227 VAL A HG21 1 
ATOM   3182  H HG22 . VAL A 1 227 ? 12.082  -9.194  -33.387 1.00 28.09 ? 227 VAL A HG22 1 
ATOM   3183  H HG23 . VAL A 1 227 ? 11.903  -8.376  -34.738 1.00 28.09 ? 227 VAL A HG23 1 
ATOM   3184  N N    . ILE A 1 228 ? 7.803   -10.521 -35.507 1.00 17.19 ? 228 ILE A N    1 
ATOM   3185  C CA   . ILE A 1 228 ? 6.471   -11.111 -35.528 1.00 15.75 ? 228 ILE A CA   1 
ATOM   3186  C C    . ILE A 1 228 ? 6.549   -12.550 -36.006 1.00 15.47 ? 228 ILE A C    1 
ATOM   3187  O O    . ILE A 1 228 ? 6.003   -13.458 -35.377 1.00 15.44 ? 228 ILE A O    1 
ATOM   3188  C CB   . ILE A 1 228 ? 5.503   -10.291 -36.410 1.00 17.99 ? 228 ILE A CB   1 
ATOM   3189  C CG1  . ILE A 1 228 ? 5.244   -8.917  -35.784 1.00 23.63 ? 228 ILE A CG1  1 
ATOM   3190  C CG2  . ILE A 1 228 ? 4.189   -11.058 -36.623 1.00 17.77 ? 228 ILE A CG2  1 
ATOM   3191  C CD1  . ILE A 1 228 ? 4.473   -7.964  -36.740 1.00 19.87 ? 228 ILE A CD1  1 
ATOM   3192  H H    . ILE A 1 228 ? 7.902   -9.844  -36.028 1.00 20.61 ? 228 ILE A H    1 
ATOM   3193  H HA   . ILE A 1 228 ? 6.117   -11.117 -34.625 1.00 18.87 ? 228 ILE A HA   1 
ATOM   3194  H HB   . ILE A 1 228 ? 5.920   -10.157 -37.276 1.00 21.56 ? 228 ILE A HB   1 
ATOM   3195  H HG12 . ILE A 1 228 ? 4.714   -9.030  -34.980 1.00 28.34 ? 228 ILE A HG12 1 
ATOM   3196  H HG13 . ILE A 1 228 ? 6.094   -8.503  -35.567 1.00 28.34 ? 228 ILE A HG13 1 
ATOM   3197  H HG21 . ILE A 1 228 ? 3.599   -10.525 -37.178 1.00 21.30 ? 228 ILE A HG21 1 
ATOM   3198  H HG22 . ILE A 1 228 ? 4.383   -11.902 -37.061 1.00 21.30 ? 228 ILE A HG22 1 
ATOM   3199  H HG23 . ILE A 1 228 ? 3.775   -11.221 -35.761 1.00 21.30 ? 228 ILE A HG23 1 
ATOM   3200  H HD11 . ILE A 1 228 ? 4.338   -7.113  -36.294 1.00 23.82 ? 228 ILE A HD11 1 
ATOM   3201  H HD12 . ILE A 1 228 ? 4.996   -7.836  -37.547 1.00 23.82 ? 228 ILE A HD12 1 
ATOM   3202  H HD13 . ILE A 1 228 ? 3.617   -8.363  -36.960 1.00 23.82 ? 228 ILE A HD13 1 
ATOM   3203  N N    . ARG A 1 229 ? 7.269   -12.787 -37.101 1.00 15.69 ? 229 ARG A N    1 
ATOM   3204  C CA   . ARG A 1 229 ? 7.298   -14.128 -37.677 1.00 11.99 ? 229 ARG A CA   1 
ATOM   3205  C C    . ARG A 1 229 ? 8.004   -15.117 -36.757 1.00 12.82 ? 229 ARG A C    1 
ATOM   3206  O O    . ARG A 1 229 ? 7.508   -16.236 -36.550 1.00 14.49 ? 229 ARG A O    1 
ATOM   3207  C CB   . ARG A 1 229 ? 7.941   -14.097 -39.064 1.00 16.01 ? 229 ARG A CB   1 
ATOM   3208  C CG   . ARG A 1 229 ? 7.817   -15.395 -39.819 1.00 14.10 ? 229 ARG A CG   1 
ATOM   3209  C CD   . ARG A 1 229 ? 8.732   -15.459 -41.007 1.00 15.70 ? 229 ARG A CD   1 
ATOM   3210  N NE   . ARG A 1 229 ? 10.062  -15.872 -40.566 1.00 15.50 ? 229 ARG A NE   1 
ATOM   3211  C CZ   . ARG A 1 229 ? 10.402  -17.135 -40.309 1.00 15.14 ? 229 ARG A CZ   1 
ATOM   3212  N NH1  . ARG A 1 229 ? 9.536   -18.117 -40.501 1.00 15.52 ? 229 ARG A NH1  1 
ATOM   3213  N NH2  . ARG A 1 229 ? 11.622  -17.436 -39.880 1.00 14.58 ? 229 ARG A NH2  1 
ATOM   3214  H H    . ARG A 1 229 ? 7.739   -12.203 -37.521 1.00 18.80 ? 229 ARG A H    1 
ATOM   3215  H HA   . ARG A 1 229 ? 6.385   -14.435 -37.787 1.00 14.37 ? 229 ARG A HA   1 
ATOM   3216  H HB2  . ARG A 1 229 ? 7.513   -13.405 -39.592 1.00 19.19 ? 229 ARG A HB2  1 
ATOM   3217  H HB3  . ARG A 1 229 ? 8.885   -13.900 -38.967 1.00 19.19 ? 229 ARG A HB3  1 
ATOM   3218  H HG2  . ARG A 1 229 ? 8.042   -16.129 -39.227 1.00 16.90 ? 229 ARG A HG2  1 
ATOM   3219  H HG3  . ARG A 1 229 ? 6.905   -15.491 -40.137 1.00 16.90 ? 229 ARG A HG3  1 
ATOM   3220  H HD2  . ARG A 1 229 ? 8.398   -16.112 -41.643 1.00 18.82 ? 229 ARG A HD2  1 
ATOM   3221  H HD3  . ARG A 1 229 ? 8.798   -14.583 -41.417 1.00 18.82 ? 229 ARG A HD3  1 
ATOM   3222  H HE   . ARG A 1 229 ? 10.682  -15.276 -40.544 1.00 18.58 ? 229 ARG A HE   1 
ATOM   3223  H HH11 . ARG A 1 229 ? 8.739   -17.941 -40.772 1.00 18.60 ? 229 ARG A HH11 1 
ATOM   3224  H HH12 . ARG A 1 229 ? 9.765   -18.930 -40.341 1.00 18.60 ? 229 ARG A HH12 1 
ATOM   3225  H HH21 . ARG A 1 229 ? 12.202  -16.812 -39.761 1.00 17.48 ? 229 ARG A HH21 1 
ATOM   3226  H HH22 . ARG A 1 229 ? 11.837  -18.256 -39.737 1.00 17.48 ? 229 ARG A HH22 1 
ATOM   3227  N N    . LEU A 1 230 ? 9.151   -14.735 -36.176 1.00 14.63 ? 230 LEU A N    1 
ATOM   3228  C CA   . LEU A 1 230 ? 9.818   -15.650 -35.251 1.00 14.61 ? 230 LEU A CA   1 
ATOM   3229  C C    . LEU A 1 230 ? 8.952   -15.883 -34.025 1.00 18.70 ? 230 LEU A C    1 
ATOM   3230  O O    . LEU A 1 230 ? 8.884   -17.004 -33.486 1.00 12.13 ? 230 LEU A O    1 
ATOM   3231  C CB   . LEU A 1 230 ? 11.199  -15.100 -34.868 1.00 11.80 ? 230 LEU A CB   1 
ATOM   3232  C CG   . LEU A 1 230 ? 12.247  -15.164 -35.997 1.00 12.79 ? 230 LEU A CG   1 
ATOM   3233  C CD1  . LEU A 1 230 ? 13.475  -14.294 -35.639 1.00 15.91 ? 230 LEU A CD1  1 
ATOM   3234  C CD2  . LEU A 1 230 ? 12.679  -16.610 -36.385 1.00 12.65 ? 230 LEU A CD2  1 
ATOM   3235  H H    . LEU A 1 230 ? 9.547   -13.981 -36.297 1.00 17.54 ? 230 LEU A H    1 
ATOM   3236  H HA   . LEU A 1 230 ? 9.948   -16.505 -35.691 1.00 17.51 ? 230 LEU A HA   1 
ATOM   3237  H HB2  . LEU A 1 230 ? 11.101  -14.170 -34.609 1.00 14.14 ? 230 LEU A HB2  1 
ATOM   3238  H HB3  . LEU A 1 230 ? 11.541  -15.613 -34.119 1.00 14.14 ? 230 LEU A HB3  1 
ATOM   3239  H HG   . LEU A 1 230 ? 11.849  -14.771 -36.789 1.00 15.32 ? 230 LEU A HG   1 
ATOM   3240  H HD11 . LEU A 1 230 ? 14.121  -14.348 -36.360 1.00 19.07 ? 230 LEU A HD11 1 
ATOM   3241  H HD12 . LEU A 1 230 ? 13.188  -13.375 -35.520 1.00 19.07 ? 230 LEU A HD12 1 
ATOM   3242  H HD13 . LEU A 1 230 ? 13.869  -14.627 -34.817 1.00 19.07 ? 230 LEU A HD13 1 
ATOM   3243  H HD21 . LEU A 1 230 ? 13.336  -16.562 -37.097 1.00 15.16 ? 230 LEU A HD21 1 
ATOM   3244  H HD22 . LEU A 1 230 ? 13.065  -17.043 -35.607 1.00 15.16 ? 230 LEU A HD22 1 
ATOM   3245  H HD23 . LEU A 1 230 ? 11.900  -17.102 -36.686 1.00 15.16 ? 230 LEU A HD23 1 
ATOM   3246  N N    . GLY A 1 231 ? 8.241   -14.837 -33.591 1.00 13.29 ? 231 GLY A N    1 
ATOM   3247  C CA   . GLY A 1 231 ? 7.284   -15.004 -32.526 1.00 14.25 ? 231 GLY A CA   1 
ATOM   3248  C C    . GLY A 1 231 ? 6.222   -16.019 -32.893 1.00 14.90 ? 231 GLY A C    1 
ATOM   3249  O O    . GLY A 1 231 ? 5.900   -16.890 -32.099 1.00 15.26 ? 231 GLY A O    1 
ATOM   3250  H H    . GLY A 1 231 ? 8.301   -14.036 -33.900 1.00 15.93 ? 231 GLY A H    1 
ATOM   3251  H HA2  . GLY A 1 231 ? 7.739   -15.305 -31.723 1.00 17.07 ? 231 GLY A HA2  1 
ATOM   3252  H HA3  . GLY A 1 231 ? 6.852   -14.156 -32.338 1.00 17.07 ? 231 GLY A HA3  1 
ATOM   3253  N N    . LEU A 1 232 ? 5.723   -15.963 -34.131 1.00 14.90 ? 232 LEU A N    1 
ATOM   3254  C CA   . LEU A 1 232 ? 4.735   -16.947 -34.587 1.00 14.47 ? 232 LEU A CA   1 
ATOM   3255  C C    . LEU A 1 232 ? 5.333   -18.356 -34.615 1.00 16.41 ? 232 LEU A C    1 
ATOM   3256  O O    . LEU A 1 232 ? 4.681   -19.317 -34.195 1.00 15.68 ? 232 LEU A O    1 
ATOM   3257  C CB   . LEU A 1 232 ? 4.186   -16.546 -35.975 1.00 15.06 ? 232 LEU A CB   1 
ATOM   3258  C CG   . LEU A 1 232 ? 3.161   -17.469 -36.645 1.00 16.01 ? 232 LEU A CG   1 
ATOM   3259  C CD1  . LEU A 1 232 ? 1.881   -17.605 -35.854 1.00 15.45 ? 232 LEU A CD1  1 
ATOM   3260  C CD2  . LEU A 1 232 ? 2.851   -16.987 -38.060 1.00 16.96 ? 232 LEU A CD2  1 
ATOM   3261  H H    . LEU A 1 232 ? 5.937   -15.374 -34.720 1.00 17.86 ? 232 LEU A H    1 
ATOM   3262  H HA   . LEU A 1 232 ? 3.991   -16.954 -33.964 1.00 17.34 ? 232 LEU A HA   1 
ATOM   3263  H HB2  . LEU A 1 232 ? 3.765   -15.676 -35.888 1.00 18.05 ? 232 LEU A HB2  1 
ATOM   3264  H HB3  . LEU A 1 232 ? 4.938   -16.473 -36.583 1.00 18.05 ? 232 LEU A HB3  1 
ATOM   3265  H HG   . LEU A 1 232 ? 3.550   -18.355 -36.720 1.00 19.19 ? 232 LEU A HG   1 
ATOM   3266  H HD11 . LEU A 1 232 ? 1.278   -18.198 -36.328 1.00 18.51 ? 232 LEU A HD11 1 
ATOM   3267  H HD12 . LEU A 1 232 ? 2.089   -17.972 -34.980 1.00 18.51 ? 232 LEU A HD12 1 
ATOM   3268  H HD13 . LEU A 1 232 ? 1.476   -16.729 -35.757 1.00 18.51 ? 232 LEU A HD13 1 
ATOM   3269  H HD21 . LEU A 1 232 ? 2.203   -17.585 -38.463 1.00 20.33 ? 232 LEU A HD21 1 
ATOM   3270  H HD22 . LEU A 1 232 ? 2.490   -16.088 -38.014 1.00 20.33 ? 232 LEU A HD22 1 
ATOM   3271  H HD23 . LEU A 1 232 ? 3.671   -16.988 -38.580 1.00 20.33 ? 232 LEU A HD23 1 
ATOM   3272  N N    . MET A 1 233 ? 6.579   -18.491 -35.049 1.00 13.59 ? 233 MET A N    1 
ATOM   3273  C CA   . MET A 1 233 ? 7.250   -19.774 -35.075 1.00 15.26 ? 233 MET A CA   1 
ATOM   3274  C C    . MET A 1 233 ? 7.404   -20.317 -33.646 1.00 13.86 ? 233 MET A C    1 
ATOM   3275  O O    . MET A 1 233 ? 7.320   -21.465 -33.441 1.00 16.01 ? 233 MET A O    1 
ATOM   3276  C CB   . MET A 1 233 ? 8.595   -19.683 -35.770 1.00 14.03 ? 233 MET A CB   1 
ATOM   3277  C CG   . MET A 1 233 ? 8.544   -19.304 -37.243 1.00 17.09 ? 233 MET A CG   1 
ATOM   3278  S SD   . MET A 1 233 ? 7.272   -20.122 -38.228 1.00 21.23 ? 233 MET A SD   1 
ATOM   3279  C CE   . MET A 1 233 ? 7.929   -21.703 -38.245 1.00 26.84 ? 233 MET A CE   1 
ATOM   3280  H H    . MET A 1 233 ? 7.061   -17.840 -35.339 1.00 16.29 ? 233 MET A H    1 
ATOM   3281  H HA   . MET A 1 233 ? 6.699   -20.402 -35.586 1.00 18.30 ? 233 MET A HA   1 
ATOM   3282  H HB2  . MET A 1 233 ? 9.131   -19.014 -35.316 1.00 16.82 ? 233 MET A HB2  1 
ATOM   3283  H HB3  . MET A 1 233 ? 9.033   -20.546 -35.706 1.00 16.82 ? 233 MET A HB3  1 
ATOM   3284  H HG2  . MET A 1 233 ? 8.389   -18.349 -37.307 1.00 20.48 ? 233 MET A HG2  1 
ATOM   3285  H HG3  . MET A 1 233 ? 9.401   -19.519 -37.643 1.00 20.48 ? 233 MET A HG3  1 
ATOM   3286  H HE1  . MET A 1 233 ? 7.266   -22.320 -37.925 1.00 32.18 ? 233 MET A HE1  1 
ATOM   3287  H HE2  . MET A 1 233 ? 8.179   -21.927 -39.144 1.00 32.18 ? 233 MET A HE2  1 
ATOM   3288  H HE3  . MET A 1 233 ? 8.701   -21.726 -37.675 1.00 32.18 ? 233 MET A HE3  1 
ATOM   3289  N N    . GLU A 1 234 ? 7.653   -19.458 -32.676 1.00 14.47 ? 234 GLU A N    1 
ATOM   3290  C CA   . GLU A 1 234 ? 7.716   -19.914 -31.296 1.00 15.13 ? 234 GLU A CA   1 
ATOM   3291  C C    . GLU A 1 234 ? 6.332   -20.252 -30.749 1.00 14.59 ? 234 GLU A C    1 
ATOM   3292  O O    . GLU A 1 234 ? 6.190   -21.203 -29.980 1.00 16.75 ? 234 GLU A O    1 
ATOM   3293  C CB   . GLU A 1 234 ? 8.422   -18.887 -30.415 1.00 13.93 ? 234 GLU A CB   1 
ATOM   3294  C CG   . GLU A 1 234 ? 9.899   -18.756 -30.766 1.00 13.58 ? 234 GLU A CG   1 
ATOM   3295  C CD   . GLU A 1 234 ? 10.730  -17.949 -29.769 1.00 16.27 ? 234 GLU A CD   1 
ATOM   3296  O OE1  . GLU A 1 234 ? 10.232  -17.684 -28.641 1.00 16.43 ? 234 GLU A OE1  1 
ATOM   3297  O OE2  . GLU A 1 234 ? 11.891  -17.560 -30.126 1.00 20.67 ? 234 GLU A OE2  1 
ATOM   3298  H H    . GLU A 1 234 ? 7.767   -18.613 -32.785 1.00 17.34 ? 234 GLU A H    1 
ATOM   3299  H HA   . GLU A 1 234 ? 8.243   -20.728 -31.269 1.00 18.14 ? 234 GLU A HA   1 
ATOM   3300  H HB2  . GLU A 1 234 ? 8.003   -18.020 -30.537 1.00 16.70 ? 234 GLU A HB2  1 
ATOM   3301  H HB3  . GLU A 1 234 ? 8.354   -19.163 -29.487 1.00 16.70 ? 234 GLU A HB3  1 
ATOM   3302  H HG2  . GLU A 1 234 ? 10.284  -19.645 -30.816 1.00 16.28 ? 234 GLU A HG2  1 
ATOM   3303  H HG3  . GLU A 1 234 ? 9.973   -18.320 -31.629 1.00 16.28 ? 234 GLU A HG3  1 
ATOM   3304  N N    . MET A 1 235 ? 5.296   -19.499 -31.114 1.00 13.67 ? 235 MET A N    1 
ATOM   3305  C CA   . MET A 1 235 ? 3.937   -19.913 -30.757 1.00 13.59 ? 235 MET A CA   1 
ATOM   3306  C C    . MET A 1 235 ? 3.660   -21.329 -31.224 1.00 13.81 ? 235 MET A C    1 
ATOM   3307  O O    . MET A 1 235 ? 3.121   -22.145 -30.472 1.00 14.79 ? 235 MET A O    1 
ATOM   3308  C CB   . MET A 1 235 ? 2.918   -18.941 -31.355 1.00 16.33 ? 235 MET A CB   1 
ATOM   3309  C CG   . MET A 1 235 ? 3.041   -17.525 -30.780 1.00 18.37 ? 235 MET A CG   1 
ATOM   3310  S SD   . MET A 1 235 ? 2.040   -16.306 -31.668 1.00 14.43 ? 235 MET A SD   1 
ATOM   3311  C CE   . MET A 1 235 ? 0.409   -17.030 -31.475 1.00 16.39 ? 235 MET A CE   1 
ATOM   3312  H H    . MET A 1 235 ? 5.347   -18.764 -31.556 1.00 16.38 ? 235 MET A H    1 
ATOM   3313  H HA   . MET A 1 235 ? 3.845   -19.879 -29.792 1.00 16.29 ? 235 MET A HA   1 
ATOM   3314  H HB2  . MET A 1 235 ? 3.057   -18.888 -32.314 1.00 19.58 ? 235 MET A HB2  1 
ATOM   3315  H HB3  . MET A 1 235 ? 2.024   -19.265 -31.167 1.00 19.58 ? 235 MET A HB3  1 
ATOM   3316  H HG2  . MET A 1 235 ? 2.748   -17.535 -29.855 1.00 22.02 ? 235 MET A HG2  1 
ATOM   3317  H HG3  . MET A 1 235 ? 3.968   -17.244 -30.830 1.00 22.02 ? 235 MET A HG3  1 
ATOM   3318  H HE1  . MET A 1 235 ? -0.242  -16.463 -31.916 1.00 19.65 ? 235 MET A HE1  1 
ATOM   3319  H HE2  . MET A 1 235 ? 0.407   -17.913 -31.877 1.00 19.65 ? 235 MET A HE2  1 
ATOM   3320  H HE3  . MET A 1 235 ? 0.204   -17.096 -30.529 1.00 19.65 ? 235 MET A HE3  1 
ATOM   3321  N N    . ILE A 1 236 ? 3.983   -21.623 -32.473 1.00 12.26 ? 236 ILE A N    1 
ATOM   3322  C CA   . ILE A 1 236 ? 3.721   -22.939 -33.041 1.00 14.98 ? 236 ILE A CA   1 
ATOM   3323  C C    . ILE A 1 236 ? 4.496   -24.006 -32.278 1.00 15.61 ? 236 ILE A C    1 
ATOM   3324  O O    . ILE A 1 236 ? 3.943   -25.033 -31.850 1.00 14.63 ? 236 ILE A O    1 
ATOM   3325  C CB   . ILE A 1 236 ? 4.091   -22.939 -34.533 1.00 15.14 ? 236 ILE A CB   1 
ATOM   3326  C CG1  . ILE A 1 236 ? 3.152   -22.028 -35.303 1.00 15.26 ? 236 ILE A CG1  1 
ATOM   3327  C CG2  . ILE A 1 236 ? 4.069   -24.358 -35.131 1.00 17.62 ? 236 ILE A CG2  1 
ATOM   3328  C CD1  . ILE A 1 236 ? 3.622   -21.778 -36.730 1.00 18.39 ? 236 ILE A CD1  1 
ATOM   3329  H H    . ILE A 1 236 ? 4.359   -21.074 -33.019 1.00 14.69 ? 236 ILE A H    1 
ATOM   3330  H HA   . ILE A 1 236 ? 2.774   -23.138 -32.963 1.00 17.96 ? 236 ILE A HA   1 
ATOM   3331  H HB   . ILE A 1 236 ? 4.991   -22.589 -34.620 1.00 18.15 ? 236 ILE A HB   1 
ATOM   3332  H HG12 . ILE A 1 236 ? 2.274   -22.438 -35.342 1.00 18.29 ? 236 ILE A HG12 1 
ATOM   3333  H HG13 . ILE A 1 236 ? 3.100   -21.172 -34.849 1.00 18.29 ? 236 ILE A HG13 1 
ATOM   3334  H HG21 . ILE A 1 236 ? 4.308   -24.308 -36.070 1.00 21.13 ? 236 ILE A HG21 1 
ATOM   3335  H HG22 . ILE A 1 236 ? 4.708   -24.911 -34.656 1.00 21.13 ? 236 ILE A HG22 1 
ATOM   3336  H HG23 . ILE A 1 236 ? 3.177   -24.726 -35.036 1.00 21.13 ? 236 ILE A HG23 1 
ATOM   3337  H HD11 . ILE A 1 236 ? 2.988   -21.193 -37.173 1.00 22.04 ? 236 ILE A HD11 1 
ATOM   3338  H HD12 . ILE A 1 236 ? 4.497   -21.361 -36.706 1.00 22.04 ? 236 ILE A HD12 1 
ATOM   3339  H HD13 . ILE A 1 236 ? 3.672   -22.627 -37.198 1.00 22.04 ? 236 ILE A HD13 1 
ATOM   3340  N N    . ALA A 1 237 ? 5.803   -23.795 -32.124 1.00 16.38 ? 237 ALA A N    1 
ATOM   3341  C CA   . ALA A 1 237 ? 6.614   -24.809 -31.456 1.00 15.79 ? 237 ALA A CA   1 
ATOM   3342  C C    . ALA A 1 237 ? 6.181   -24.986 -30.002 1.00 14.91 ? 237 ALA A C    1 
ATOM   3343  O O    . ALA A 1 237 ? 6.147   -26.113 -29.484 1.00 17.94 ? 237 ALA A O    1 
ATOM   3344  C CB   . ALA A 1 237 ? 8.106   -24.451 -31.559 1.00 16.74 ? 237 ALA A CB   1 
ATOM   3345  H H    . ALA A 1 237 ? 6.231   -23.097 -32.388 1.00 19.64 ? 237 ALA A H    1 
ATOM   3346  H HA   . ALA A 1 237 ? 6.483   -25.658 -31.907 1.00 18.93 ? 237 ALA A HA   1 
ATOM   3347  H HB1  . ALA A 1 237 ? 8.626   -25.136 -31.110 1.00 20.07 ? 237 ALA A HB1  1 
ATOM   3348  H HB2  . ALA A 1 237 ? 8.355   -24.406 -32.495 1.00 20.07 ? 237 ALA A HB2  1 
ATOM   3349  H HB3  . ALA A 1 237 ? 8.254   -23.591 -31.135 1.00 20.07 ? 237 ALA A HB3  1 
ATOM   3350  N N    . PHE A 1 238 ? 5.809   -23.902 -29.326 1.00 13.49 ? 238 PHE A N    1 
ATOM   3351  C CA   . PHE A 1 238 ? 5.379   -24.062 -27.939 1.00 12.81 ? 238 PHE A CA   1 
ATOM   3352  C C    . PHE A 1 238 ? 4.040   -24.799 -27.860 1.00 19.39 ? 238 PHE A C    1 
ATOM   3353  O O    . PHE A 1 238 ? 3.866   -25.711 -27.038 1.00 18.07 ? 238 PHE A O    1 
ATOM   3354  C CB   . PHE A 1 238 ? 5.290   -22.713 -27.216 1.00 13.47 ? 238 PHE A CB   1 
ATOM   3355  C CG   . PHE A 1 238 ? 4.886   -22.863 -25.789 1.00 15.24 ? 238 PHE A CG   1 
ATOM   3356  C CD1  . PHE A 1 238 ? 5.827   -23.111 -24.823 1.00 15.30 ? 238 PHE A CD1  1 
ATOM   3357  C CD2  . PHE A 1 238 ? 3.558   -22.856 -25.437 1.00 18.89 ? 238 PHE A CD2  1 
ATOM   3358  C CE1  . PHE A 1 238 ? 5.473   -23.305 -23.516 1.00 18.22 ? 238 PHE A CE1  1 
ATOM   3359  C CE2  . PHE A 1 238 ? 3.181   -23.049 -24.111 1.00 22.24 ? 238 PHE A CE2  1 
ATOM   3360  C CZ   . PHE A 1 238 ? 4.151   -23.292 -23.154 1.00 20.45 ? 238 PHE A CZ   1 
ATOM   3361  H H    . PHE A 1 238 ? 5.796   -23.097 -29.630 1.00 16.17 ? 238 PHE A H    1 
ATOM   3362  H HA   . PHE A 1 238 ? 6.038   -24.600 -27.473 1.00 15.35 ? 238 PHE A HA   1 
ATOM   3363  H HB2  . PHE A 1 238 ? 6.158   -22.281 -27.240 1.00 16.14 ? 238 PHE A HB2  1 
ATOM   3364  H HB3  . PHE A 1 238 ? 4.630   -22.158 -27.660 1.00 16.14 ? 238 PHE A HB3  1 
ATOM   3365  H HD1  . PHE A 1 238 ? 6.726   -23.137 -25.059 1.00 18.33 ? 238 PHE A HD1  1 
ATOM   3366  H HD2  . PHE A 1 238 ? 2.908   -22.707 -26.086 1.00 22.64 ? 238 PHE A HD2  1 
ATOM   3367  H HE1  . PHE A 1 238 ? 6.129   -23.458 -22.875 1.00 21.84 ? 238 PHE A HE1  1 
ATOM   3368  H HE2  . PHE A 1 238 ? 2.283   -23.030 -23.872 1.00 26.67 ? 238 PHE A HE2  1 
ATOM   3369  H HZ   . PHE A 1 238 ? 3.910   -23.407 -22.263 1.00 24.52 ? 238 PHE A HZ   1 
ATOM   3370  N N    . ALA A 1 239 ? 3.097   -24.473 -28.745 1.00 13.29 ? 239 ALA A N    1 
ATOM   3371  C CA   . ALA A 1 239 ? 1.834   -25.195 -28.709 1.00 14.34 ? 239 ALA A CA   1 
ATOM   3372  C C    . ALA A 1 239 ? 2.046   -26.678 -28.999 1.00 15.00 ? 239 ALA A C    1 
ATOM   3373  O O    . ALA A 1 239 ? 1.387   -27.533 -28.397 1.00 17.73 ? 239 ALA A O    1 
ATOM   3374  C CB   . ALA A 1 239 ? 0.838   -24.593 -29.706 1.00 16.47 ? 239 ALA A CB   1 
ATOM   3375  H H    . ALA A 1 239 ? 3.160   -23.864 -29.350 1.00 15.92 ? 239 ALA A H    1 
ATOM   3376  H HA   . ALA A 1 239 ? 1.452   -25.117 -27.821 1.00 17.19 ? 239 ALA A HA   1 
ATOM   3377  H HB1  . ALA A 1 239 ? 0.007   -25.092 -29.662 1.00 19.74 ? 239 ALA A HB1  1 
ATOM   3378  H HB2  . ALA A 1 239 ? 0.680   -23.665 -29.472 1.00 19.74 ? 239 ALA A HB2  1 
ATOM   3379  H HB3  . ALA A 1 239 ? 1.212   -24.651 -30.599 1.00 19.74 ? 239 ALA A HB3  1 
ATOM   3380  N N    . LYS A 1 240 ? 2.942   -27.004 -29.929 1.00 17.79 ? 240 LYS A N    1 
ATOM   3381  C CA   . LYS A 1 240 ? 3.183   -28.409 -30.250 1.00 19.45 ? 240 LYS A CA   1 
ATOM   3382  C C    . LYS A 1 240 ? 3.726   -29.174 -29.046 1.00 24.35 ? 240 LYS A C    1 
ATOM   3383  O O    . LYS A 1 240 ? 3.354   -30.334 -28.808 1.00 22.79 ? 240 LYS A O    1 
ATOM   3384  C CB   . LYS A 1 240 ? 4.129   -28.535 -31.457 1.00 20.57 ? 240 LYS A CB   1 
ATOM   3385  C CG   . LYS A 1 240 ? 3.386   -28.383 -32.757 1.00 24.23 ? 240 LYS A CG   1 
ATOM   3386  C CD   . LYS A 1 240 ? 4.244   -28.318 -33.983 1.00 23.60 ? 240 LYS A CD   1 
ATOM   3387  C CE   . LYS A 1 240 ? 3.366   -28.372 -35.221 1.00 27.33 ? 240 LYS A CE   1 
ATOM   3388  N NZ   . LYS A 1 240 ? 4.126   -28.065 -36.476 1.00 31.27 ? 240 LYS A NZ   1 
ATOM   3389  H H    . LYS A 1 240 ? 3.414   -26.444 -30.380 1.00 21.33 ? 240 LYS A H    1 
ATOM   3390  H HA   . LYS A 1 240 ? 2.339   -28.817 -30.498 1.00 23.31 ? 240 LYS A HA   1 
ATOM   3391  H HB2  . LYS A 1 240 ? 4.803   -27.839 -31.409 1.00 24.67 ? 240 LYS A HB2  1 
ATOM   3392  H HB3  . LYS A 1 240 ? 4.548   -29.410 -31.446 1.00 24.67 ? 240 LYS A HB3  1 
ATOM   3393  H HG2  . LYS A 1 240 ? 2.789   -29.141 -32.860 1.00 29.05 ? 240 LYS A HG2  1 
ATOM   3394  H HG3  . LYS A 1 240 ? 2.867   -27.564 -32.721 1.00 29.05 ? 240 LYS A HG3  1 
ATOM   3395  H HD2  . LYS A 1 240 ? 4.740   -27.485 -33.990 1.00 28.29 ? 240 LYS A HD2  1 
ATOM   3396  H HD3  . LYS A 1 240 ? 4.849   -29.076 -33.999 1.00 28.29 ? 240 LYS A HD3  1 
ATOM   3397  H HE2  . LYS A 1 240 ? 2.991   -29.262 -35.306 1.00 32.78 ? 240 LYS A HE2  1 
ATOM   3398  H HE3  . LYS A 1 240 ? 2.654   -27.718 -35.133 1.00 32.78 ? 240 LYS A HE3  1 
ATOM   3399  H HZ1  . LYS A 1 240 ? 3.581   -28.106 -37.179 1.00 37.50 ? 240 LYS A HZ1  1 
ATOM   3400  H HZ2  . LYS A 1 240 ? 4.476   -27.249 -36.428 1.00 37.50 ? 240 LYS A HZ2  1 
ATOM   3401  H HZ3  . LYS A 1 240 ? 4.783   -28.656 -36.585 1.00 37.50 ? 240 LYS A HZ3  1 
ATOM   3402  N N    . LEU A 1 241 ? 4.603   -28.556 -28.269 1.00 23.07 ? 241 LEU A N    1 
ATOM   3403  C CA   . LEU A 1 241 ? 5.131   -29.281 -27.127 1.00 29.13 ? 241 LEU A CA   1 
ATOM   3404  C C    . LEU A 1 241 ? 4.224   -29.221 -25.900 1.00 24.73 ? 241 LEU A C    1 
ATOM   3405  O O    . LEU A 1 241 ? 4.283   -30.142 -25.090 1.00 23.68 ? 241 LEU A O    1 
ATOM   3406  C CB   . LEU A 1 241 ? 6.532   -28.772 -26.817 1.00 27.23 ? 241 LEU A CB   1 
ATOM   3407  C CG   . LEU A 1 241 ? 6.728   -27.586 -25.893 1.00 29.44 ? 241 LEU A CG   1 
ATOM   3408  C CD1  . LEU A 1 241 ? 6.857   -28.049 -24.447 1.00 39.27 ? 241 LEU A CD1  1 
ATOM   3409  C CD2  . LEU A 1 241 ? 8.019   -26.857 -26.326 1.00 33.00 ? 241 LEU A CD2  1 
ATOM   3410  H H    . LEU A 1 241 ? 4.897   -27.755 -28.373 1.00 27.66 ? 241 LEU A H    1 
ATOM   3411  H HA   . LEU A 1 241 ? 5.213   -30.216 -27.374 1.00 34.93 ? 241 LEU A HA   1 
ATOM   3412  H HB2  . LEU A 1 241 ? 7.028   -29.508 -26.426 1.00 32.66 ? 241 LEU A HB2  1 
ATOM   3413  H HB3  . LEU A 1 241 ? 6.946   -28.533 -27.661 1.00 32.66 ? 241 LEU A HB3  1 
ATOM   3414  H HG   . LEU A 1 241 ? 5.978   -26.976 -25.968 1.00 35.30 ? 241 LEU A HG   1 
ATOM   3415  H HD11 . LEU A 1 241 ? 6.981   -27.273 -23.878 1.00 47.10 ? 241 LEU A HD11 1 
ATOM   3416  H HD12 . LEU A 1 241 ? 6.048   -28.519 -24.194 1.00 47.10 ? 241 LEU A HD12 1 
ATOM   3417  H HD13 . LEU A 1 241 ? 7.622   -28.641 -24.373 1.00 47.10 ? 241 LEU A HD13 1 
ATOM   3418  H HD21 . LEU A 1 241 ? 8.161   -26.094 -25.745 1.00 39.57 ? 241 LEU A HD21 1 
ATOM   3419  H HD22 . LEU A 1 241 ? 8.767   -27.471 -26.255 1.00 39.57 ? 241 LEU A HD22 1 
ATOM   3420  H HD23 . LEU A 1 241 ? 7.921   -26.560 -27.245 1.00 39.57 ? 241 LEU A HD23 1 
ATOM   3421  N N    . PHE A 1 242 ? 3.334   -28.228 -25.772 1.00 19.50 ? 242 PHE A N    1 
ATOM   3422  C CA   . PHE A 1 242 ? 2.591   -28.000 -24.535 1.00 18.36 ? 242 PHE A CA   1 
ATOM   3423  C C    . PHE A 1 242 ? 1.136   -28.446 -24.601 1.00 22.52 ? 242 PHE A C    1 
ATOM   3424  O O    . PHE A 1 242 ? 0.633   -28.995 -23.620 1.00 23.51 ? 242 PHE A O    1 
ATOM   3425  C CB   . PHE A 1 242 ? 2.657   -26.507 -24.121 1.00 21.15 ? 242 PHE A CB   1 
ATOM   3426  C CG   . PHE A 1 242 ? 1.849   -26.159 -22.880 1.00 22.34 ? 242 PHE A CG   1 
ATOM   3427  C CD1  . PHE A 1 242 ? 2.361   -26.380 -21.610 1.00 32.96 ? 242 PHE A CD1  1 
ATOM   3428  C CD2  . PHE A 1 242 ? 0.578   -25.636 -22.978 1.00 25.70 ? 242 PHE A CD2  1 
ATOM   3429  C CE1  . PHE A 1 242 ? 1.602   -26.065 -20.473 1.00 30.47 ? 242 PHE A CE1  1 
ATOM   3430  C CE2  . PHE A 1 242 ? -0.160  -25.320 -21.849 1.00 28.72 ? 242 PHE A CE2  1 
ATOM   3431  C CZ   . PHE A 1 242 ? 0.339   -25.539 -20.611 1.00 28.58 ? 242 PHE A CZ   1 
ATOM   3432  H H    . PHE A 1 242 ? 3.145   -27.669 -26.398 1.00 23.38 ? 242 PHE A H    1 
ATOM   3433  H HA   . PHE A 1 242 ? 3.015   -28.513 -23.829 1.00 22.01 ? 242 PHE A HA   1 
ATOM   3434  H HB2  . PHE A 1 242 ? 3.582   -26.275 -23.945 1.00 25.36 ? 242 PHE A HB2  1 
ATOM   3435  H HB3  . PHE A 1 242 ? 2.318   -25.968 -24.853 1.00 25.36 ? 242 PHE A HB3  1 
ATOM   3436  H HD1  . PHE A 1 242 ? 3.213   -26.738 -21.511 1.00 39.53 ? 242 PHE A HD1  1 
ATOM   3437  H HD2  . PHE A 1 242 ? 0.213   -25.479 -23.819 1.00 30.82 ? 242 PHE A HD2  1 
ATOM   3438  H HE1  . PHE A 1 242 ? 1.954   -26.213 -19.625 1.00 36.54 ? 242 PHE A HE1  1 
ATOM   3439  H HE2  . PHE A 1 242 ? -1.015  -24.966 -21.943 1.00 34.45 ? 242 PHE A HE2  1 
ATOM   3440  H HZ   . PHE A 1 242 ? -0.164  -25.325 -19.858 1.00 34.27 ? 242 PHE A HZ   1 
ATOM   3441  N N    . CYS A 1 243 ? 0.449   -28.239 -25.725 1.00 17.02 ? 243 CYS A N    1 
ATOM   3442  C CA   . CYS A 1 243 ? -0.988  -28.389 -25.786 1.00 20.85 ? 243 CYS A CA   1 
ATOM   3443  C C    . CYS A 1 243 ? -1.417  -29.843 -25.864 1.00 19.92 ? 243 CYS A C    1 
ATOM   3444  O O    . CYS A 1 243 ? -0.749  -30.678 -26.477 1.00 23.03 ? 243 CYS A O    1 
ATOM   3445  C CB   . CYS A 1 243 ? -1.545  -27.682 -27.005 1.00 18.18 ? 243 CYS A CB   1 
ATOM   3446  S SG   . CYS A 1 243 ? -1.499  -25.945 -26.847 1.00 22.41 ? 243 CYS A SG   1 
ATOM   3447  H H    . CYS A 1 243 ? 0.806   -28.007 -26.473 1.00 20.41 ? 243 CYS A H    1 
ATOM   3448  H HA   . CYS A 1 243 ? -1.386  -27.995 -24.994 1.00 25.00 ? 243 CYS A HA   1 
ATOM   3449  H HB2  . CYS A 1 243 ? -1.018  -27.927 -27.782 1.00 21.80 ? 243 CYS A HB2  1 
ATOM   3450  H HB3  . CYS A 1 243 ? -2.469  -27.949 -27.132 1.00 21.80 ? 243 CYS A HB3  1 
ATOM   3451  H HG   . CYS A 1 243 ? -1.952  -25.450 -27.841 1.00 26.87 ? 243 CYS A HG   1 
ATOM   3452  N N    . SER A 1 244 ? -2.579  -30.117 -25.271 1.00 24.77 ? 244 SER A N    1 
ATOM   3453  C CA   . SER A 1 244 ? -3.325  -31.330 -25.565 1.00 33.07 ? 244 SER A CA   1 
ATOM   3454  C C    . SER A 1 244 ? -4.076  -31.158 -26.877 1.00 30.02 ? 244 SER A C    1 
ATOM   3455  O O    . SER A 1 244 ? -4.331  -30.049 -27.334 1.00 37.17 ? 244 SER A O    1 
ATOM   3456  C CB   . SER A 1 244 ? -4.377  -31.632 -24.492 1.00 30.31 ? 244 SER A CB   1 
ATOM   3457  O OG   . SER A 1 244 ? -3.902  -31.436 -23.204 1.00 31.78 ? 244 SER A OG   1 
ATOM   3458  H H    . SER A 1 244 ? -2.957  -29.608 -24.690 1.00 29.70 ? 244 SER A H    1 
ATOM   3459  H HA   . SER A 1 244 ? -2.721  -32.085 -25.640 1.00 39.66 ? 244 SER A HA   1 
ATOM   3460  H HB2  . SER A 1 244 ? -5.139  -31.047 -24.633 1.00 36.35 ? 244 SER A HB2  1 
ATOM   3461  H HB3  . SER A 1 244 ? -4.655  -32.556 -24.582 1.00 36.35 ? 244 SER A HB3  1 
ATOM   3462  H HG   . SER A 1 244 ? -4.505  -31.611 -22.646 1.00 38.11 ? 244 SER A HG   1 
ATOM   3463  N N    . GLY A 1 245 ? -4.492  -32.260 -27.445 1.00 33.19 ? 245 GLY A N    1 
ATOM   3464  C CA   . GLY A 1 245 ? -5.282  -32.183 -28.643 1.00 30.71 ? 245 GLY A CA   1 
ATOM   3465  C C    . GLY A 1 245 ? -4.363  -31.894 -29.798 1.00 25.39 ? 245 GLY A C    1 
ATOM   3466  O O    . GLY A 1 245 ? -3.212  -31.496 -29.632 1.00 35.84 ? 245 GLY A O    1 
ATOM   3467  H H    . GLY A 1 245 ? -4.334  -33.057 -27.162 1.00 39.81 ? 245 GLY A H    1 
ATOM   3468  H HA2  . GLY A 1 245 ? -5.739  -33.024 -28.799 1.00 36.83 ? 245 GLY A HA2  1 
ATOM   3469  H HA3  . GLY A 1 245 ? -5.937  -31.471 -28.569 1.00 36.83 ? 245 GLY A HA3  1 
ATOM   3470  N N    . PRO A 1 246 ? -4.861  -32.105 -31.001 1.00 25.33 ? 246 PRO A N    1 
ATOM   3471  C CA   . PRO A 1 246 ? -3.999  -31.991 -32.175 1.00 23.73 ? 246 PRO A CA   1 
ATOM   3472  C C    . PRO A 1 246 ? -3.552  -30.562 -32.401 1.00 21.63 ? 246 PRO A C    1 
ATOM   3473  O O    . PRO A 1 246 ? -4.346  -29.626 -32.271 1.00 20.51 ? 246 PRO A O    1 
ATOM   3474  C CB   . PRO A 1 246 ? -4.891  -32.481 -33.319 1.00 21.95 ? 246 PRO A CB   1 
ATOM   3475  C CG   . PRO A 1 246 ? -6.297  -32.513 -32.788 1.00 27.96 ? 246 PRO A CG   1 
ATOM   3476  C CD   . PRO A 1 246 ? -6.283  -32.152 -31.328 1.00 22.09 ? 246 PRO A CD   1 
ATOM   3477  H HA   . PRO A 1 246 ? -3.225  -32.569 -32.091 1.00 28.45 ? 246 PRO A HA   1 
ATOM   3478  H HB2  . PRO A 1 246 ? -4.825  -31.865 -34.066 1.00 26.32 ? 246 PRO A HB2  1 
ATOM   3479  H HB3  . PRO A 1 246 ? -4.611  -33.370 -33.588 1.00 26.32 ? 246 PRO A HB3  1 
ATOM   3480  H HG2  . PRO A 1 246 ? -6.834  -31.873 -33.281 1.00 33.53 ? 246 PRO A HG2  1 
ATOM   3481  H HG3  . PRO A 1 246 ? -6.657  -33.406 -32.904 1.00 33.53 ? 246 PRO A HG3  1 
ATOM   3482  H HD2  . PRO A 1 246 ? -6.690  -31.282 -31.191 1.00 26.49 ? 246 PRO A HD2  1 
ATOM   3483  H HD3  . PRO A 1 246 ? -6.728  -32.839 -30.806 1.00 26.49 ? 246 PRO A HD3  1 
ATOM   3484  N N    . VAL A 1 247 ? -2.287  -30.396 -32.787 1.00 22.39 ? 247 VAL A N    1 
ATOM   3485  C CA   . VAL A 1 247 ? -1.739  -29.075 -33.121 1.00 23.08 ? 247 VAL A CA   1 
ATOM   3486  C C    . VAL A 1 247 ? -1.178  -29.079 -34.538 1.00 19.67 ? 247 VAL A C    1 
ATOM   3487  O O    . VAL A 1 247 ? -0.199  -29.776 -34.825 1.00 21.72 ? 247 VAL A O    1 
ATOM   3488  C CB   . VAL A 1 247 ? -0.661  -28.631 -32.126 1.00 22.94 ? 247 VAL A CB   1 
ATOM   3489  C CG1  . VAL A 1 247 ? -0.134  -27.237 -32.515 1.00 23.23 ? 247 VAL A CG1  1 
ATOM   3490  C CG2  . VAL A 1 247 ? -1.204  -28.638 -30.696 1.00 28.14 ? 247 VAL A CG2  1 
ATOM   3491  H H    . VAL A 1 247 ? -1.719  -31.037 -32.866 1.00 26.85 ? 247 VAL A H    1 
ATOM   3492  H HA   . VAL A 1 247 ? -2.457  -28.424 -33.089 1.00 27.68 ? 247 VAL A HA   1 
ATOM   3493  H HB   . VAL A 1 247 ? 0.082   -29.253 -32.168 1.00 27.51 ? 247 VAL A HB   1 
ATOM   3494  H HG11 . VAL A 1 247 ? 0.547   -26.968 -31.879 1.00 27.86 ? 247 VAL A HG11 1 
ATOM   3495  H HG12 . VAL A 1 247 ? 0.245   -27.281 -33.407 1.00 27.86 ? 247 VAL A HG12 1 
ATOM   3496  H HG13 . VAL A 1 247 ? -0.871  -26.606 -32.499 1.00 27.86 ? 247 VAL A HG13 1 
ATOM   3497  H HG21 . VAL A 1 247 ? -0.502  -28.354 -30.090 1.00 33.74 ? 247 VAL A HG21 1 
ATOM   3498  H HG22 . VAL A 1 247 ? -1.957  -28.028 -30.641 1.00 33.74 ? 247 VAL A HG22 1 
ATOM   3499  H HG23 . VAL A 1 247 ? -1.490  -29.538 -30.472 1.00 33.74 ? 247 VAL A HG23 1 
ATOM   3500  N N    . SER A 1 248 ? -1.758  -28.248 -35.392 1.00 16.92 ? 248 SER A N    1 
ATOM   3501  C CA   . SER A 1 248 ? -1.366  -28.064 -36.785 1.00 19.19 ? 248 SER A CA   1 
ATOM   3502  C C    . SER A 1 248 ? -0.776  -26.677 -36.973 1.00 18.15 ? 248 SER A C    1 
ATOM   3503  O O    . SER A 1 248 ? -1.400  -25.699 -36.560 1.00 21.33 ? 248 SER A O    1 
ATOM   3504  C CB   . SER A 1 248 ? -2.578  -28.169 -37.729 1.00 22.56 ? 248 SER A CB   1 
ATOM   3505  O OG   . SER A 1 248 ? -3.186  -29.445 -37.728 1.00 19.24 ? 248 SER A OG   1 
ATOM   3506  H H    . SER A 1 248 ? -2.423  -27.749 -35.172 1.00 20.28 ? 248 SER A H    1 
ATOM   3507  H HA   . SER A 1 248 ? -0.706  -28.728 -37.038 1.00 23.01 ? 248 SER A HA   1 
ATOM   3508  H HB2  . SER A 1 248 ? -3.239  -27.514 -37.454 1.00 27.06 ? 248 SER A HB2  1 
ATOM   3509  H HB3  . SER A 1 248 ? -2.283  -27.971 -38.631 1.00 27.06 ? 248 SER A HB3  1 
ATOM   3510  H HG   . SER A 1 248 ? -3.457  -29.633 -36.955 1.00 23.06 ? 248 SER A HG   1 
ATOM   3511  N N    . SER A 1 249 ? 0.361   -26.588 -37.681 1.00 16.98 ? 249 SER A N    1 
ATOM   3512  C CA   . SER A 1 249 ? 0.843   -25.287 -38.173 1.00 20.60 ? 249 SER A CA   1 
ATOM   3513  C C    . SER A 1 249 ? -0.228  -24.527 -38.957 1.00 21.02 ? 249 SER A C    1 
ATOM   3514  O O    . SER A 1 249 ? -0.303  -23.291 -38.902 1.00 22.17 ? 249 SER A O    1 
ATOM   3515  C CB   . SER A 1 249 ? 2.061   -25.495 -39.057 1.00 21.59 ? 249 SER A CB   1 
ATOM   3516  O OG   . SER A 1 249 ? 3.167   -25.939 -38.291 1.00 25.18 ? 249 SER A OG   1 
ATOM   3517  H H    . SER A 1 249 ? 0.863   -27.255 -37.888 1.00 20.35 ? 249 SER A H    1 
ATOM   3518  H HA   . SER A 1 249 ? 1.108   -24.741 -37.417 1.00 24.70 ? 249 SER A HA   1 
ATOM   3519  H HB2  . SER A 1 249 ? 1.854   -26.164 -39.729 1.00 25.89 ? 249 SER A HB2  1 
ATOM   3520  H HB3  . SER A 1 249 ? 2.289   -24.655 -39.485 1.00 25.89 ? 249 SER A HB3  1 
ATOM   3521  H HG   . SER A 1 249 ? 3.835   -26.051 -38.787 1.00 30.19 ? 249 SER A HG   1 
ATOM   3522  N N    . ALA A 1 250 ? -1.020  -25.243 -39.743 1.00 21.17 ? 250 ALA A N    1 
ATOM   3523  C CA   . ALA A 1 250 ? -2.068  -24.603 -40.536 1.00 21.85 ? 250 ALA A CA   1 
ATOM   3524  C C    . ALA A 1 250 ? -3.075  -23.850 -39.675 1.00 19.43 ? 250 ALA A C    1 
ATOM   3525  O O    . ALA A 1 250 ? -3.702  -22.889 -40.143 1.00 20.47 ? 250 ALA A O    1 
ATOM   3526  C CB   . ALA A 1 250 ? -2.793  -25.654 -41.378 1.00 24.75 ? 250 ALA A CB   1 
ATOM   3527  H H    . ALA A 1 250 ? -0.975  -26.096 -39.837 1.00 25.38 ? 250 ALA A H    1 
ATOM   3528  H HA   . ALA A 1 250 ? -1.658  -23.966 -41.142 1.00 26.20 ? 250 ALA A HA   1 
ATOM   3529  H HB1  . ALA A 1 250 ? -3.485  -25.218 -41.900 1.00 29.68 ? 250 ALA A HB1  1 
ATOM   3530  H HB2  . ALA A 1 250 ? -2.153  -26.081 -41.969 1.00 29.68 ? 250 ALA A HB2  1 
ATOM   3531  H HB3  . ALA A 1 250 ? -3.189  -26.313 -40.787 1.00 29.68 ? 250 ALA A HB3  1 
ATOM   3532  N N    . THR A 1 251 ? -3.275  -24.266 -38.431 1.00 17.53 ? 251 THR A N    1 
ATOM   3533  C CA   . THR A 1 251 ? -4.249  -23.564 -37.608 1.00 16.35 ? 251 THR A CA   1 
ATOM   3534  C C    . THR A 1 251 ? -3.806  -22.139 -37.321 1.00 14.71 ? 251 THR A C    1 
ATOM   3535  O O    . THR A 1 251 ? -4.636  -21.252 -37.093 1.00 16.43 ? 251 THR A O    1 
ATOM   3536  C CB   . THR A 1 251 ? -4.466  -24.334 -36.318 1.00 24.46 ? 251 THR A CB   1 
ATOM   3537  O OG1  . THR A 1 251 ? -4.922  -25.655 -36.656 1.00 25.15 ? 251 THR A OG1  1 
ATOM   3538  C CG2  . THR A 1 251 ? -5.472  -23.622 -35.413 1.00 21.13 ? 251 THR A CG2  1 
ATOM   3539  H H    . THR A 1 251 ? -2.877  -24.926 -38.051 1.00 21.01 ? 251 THR A H    1 
ATOM   3540  H HA   . THR A 1 251 ? -5.095  -23.526 -38.082 1.00 19.60 ? 251 THR A HA   1 
ATOM   3541  H HB   . THR A 1 251 ? -3.624  -24.400 -35.841 1.00 29.33 ? 251 THR A HB   1 
ATOM   3542  H HG1  . THR A 1 251 ? -5.050  -26.102 -35.956 1.00 30.16 ? 251 THR A HG1  1 
ATOM   3543  H HG21 . THR A 1 251 ? -5.597  -24.127 -34.595 1.00 25.33 ? 251 THR A HG21 1 
ATOM   3544  H HG22 . THR A 1 251 ? -5.147  -22.736 -35.190 1.00 25.33 ? 251 THR A HG22 1 
ATOM   3545  H HG23 . THR A 1 251 ? -6.325  -23.539 -35.867 1.00 25.33 ? 251 THR A HG23 1 
ATOM   3546  N N    . PHE A 1 252 ? -2.495  -21.912 -37.289 1.00 14.62 ? 252 PHE A N    1 
ATOM   3547  C CA   . PHE A 1 252 ? -1.941  -20.602 -37.036 1.00 14.19 ? 252 PHE A CA   1 
ATOM   3548  C C    . PHE A 1 252 ? -2.109  -19.642 -38.194 1.00 15.36 ? 252 PHE A C    1 
ATOM   3549  O O    . PHE A 1 252 ? -1.778  -18.455 -38.044 1.00 18.35 ? 252 PHE A O    1 
ATOM   3550  C CB   . PHE A 1 252 ? -0.471  -20.815 -36.670 1.00 13.19 ? 252 PHE A CB   1 
ATOM   3551  C CG   . PHE A 1 252 ? -0.321  -21.423 -35.329 1.00 16.06 ? 252 PHE A CG   1 
ATOM   3552  C CD1  . PHE A 1 252 ? -0.234  -20.633 -34.206 1.00 15.33 ? 252 PHE A CD1  1 
ATOM   3553  C CD2  . PHE A 1 252 ? -0.360  -22.807 -35.176 1.00 16.72 ? 252 PHE A CD2  1 
ATOM   3554  C CE1  . PHE A 1 252 ? -0.151  -21.192 -32.970 1.00 16.97 ? 252 PHE A CE1  1 
ATOM   3555  C CE2  . PHE A 1 252 ? -0.262  -23.370 -33.948 1.00 16.60 ? 252 PHE A CE2  1 
ATOM   3556  C CZ   . PHE A 1 252 ? -0.162  -22.563 -32.828 1.00 19.39 ? 252 PHE A CZ   1 
ATOM   3557  H H    . PHE A 1 252 ? -1.900  -22.520 -37.414 1.00 17.52 ? 252 PHE A H    1 
ATOM   3558  H HA   . PHE A 1 252 ? -2.386  -20.217 -36.266 1.00 17.00 ? 252 PHE A HA   1 
ATOM   3559  H HB2  . PHE A 1 252 ? -0.063  -21.409 -37.320 1.00 15.80 ? 252 PHE A HB2  1 
ATOM   3560  H HB3  . PHE A 1 252 ? -0.015  -19.959 -36.667 1.00 15.80 ? 252 PHE A HB3  1 
ATOM   3561  H HD1  . PHE A 1 252 ? -0.229  -19.707 -34.294 1.00 18.37 ? 252 PHE A HD1  1 
ATOM   3562  H HD2  . PHE A 1 252 ? -0.431  -23.351 -35.927 1.00 20.04 ? 252 PHE A HD2  1 
ATOM   3563  H HE1  . PHE A 1 252 ? -0.073  -20.649 -32.219 1.00 20.34 ? 252 PHE A HE1  1 
ATOM   3564  H HE2  . PHE A 1 252 ? -0.274  -24.295 -33.857 1.00 19.89 ? 252 PHE A HE2  1 
ATOM   3565  H HZ   . PHE A 1 252 ? -0.093  -22.945 -31.983 1.00 23.24 ? 252 PHE A HZ   1 
ATOM   3566  N N    . LEU A 1 253 ? -2.577  -20.121 -39.339 1.00 16.46 ? 253 LEU A N    1 
ATOM   3567  C CA   . LEU A 1 253 ? -2.941  -19.248 -40.435 1.00 20.25 ? 253 LEU A CA   1 
ATOM   3568  C C    . LEU A 1 253 ? -4.433  -18.887 -40.423 1.00 15.45 ? 253 LEU A C    1 
ATOM   3569  O O    . LEU A 1 253 ? -4.875  -18.135 -41.295 1.00 15.97 ? 253 LEU A O    1 
ATOM   3570  C CB   . LEU A 1 253 ? -2.551  -19.911 -41.750 1.00 22.56 ? 253 LEU A CB   1 
ATOM   3571  C CG   . LEU A 1 253 ? -1.042  -20.155 -41.910 1.00 27.02 ? 253 LEU A CG   1 
ATOM   3572  C CD1  . LEU A 1 253 ? -0.731  -20.498 -43.304 1.00 25.62 ? 253 LEU A CD1  1 
ATOM   3573  C CD2  . LEU A 1 253 ? -0.187  -18.958 -41.484 1.00 26.13 ? 253 LEU A CD2  1 
ATOM   3574  H H    . LEU A 1 253 ? -2.692  -20.957 -39.505 1.00 19.73 ? 253 LEU A H    1 
ATOM   3575  H HA   . LEU A 1 253 ? -2.437  -18.423 -40.357 1.00 24.28 ? 253 LEU A HA   1 
ATOM   3576  H HB2  . LEU A 1 253 ? -2.997  -20.770 -41.810 1.00 27.05 ? 253 LEU A HB2  1 
ATOM   3577  H HB3  . LEU A 1 253 ? -2.837  -19.342 -42.482 1.00 27.05 ? 253 LEU A HB3  1 
ATOM   3578  H HG   . LEU A 1 253 ? -0.789  -20.910 -41.356 1.00 32.41 ? 253 LEU A HG   1 
ATOM   3579  H HD11 . LEU A 1 253 ? 0.223   -20.649 -43.386 1.00 30.72 ? 253 LEU A HD11 1 
ATOM   3580  H HD12 . LEU A 1 253 ? -1.216  -21.303 -43.546 1.00 30.72 ? 253 LEU A HD12 1 
ATOM   3581  H HD13 . LEU A 1 253 ? -1.002  -19.764 -43.877 1.00 30.72 ? 253 LEU A HD13 1 
ATOM   3582  H HD21 . LEU A 1 253 ? 0.749   -19.179 -41.610 1.00 31.33 ? 253 LEU A HD21 1 
ATOM   3583  H HD22 . LEU A 1 253 ? -0.423  -18.192 -42.030 1.00 31.33 ? 253 LEU A HD22 1 
ATOM   3584  H HD23 . LEU A 1 253 ? -0.359  -18.764 -40.550 1.00 31.33 ? 253 LEU A HD23 1 
ATOM   3585  N N    . GLU A 1 254 ? -5.177  -19.345 -39.428 1.00 14.62 ? 254 GLU A N    1 
ATOM   3586  C CA   . GLU A 1 254 ? -6.540  -18.898 -39.178 1.00 14.82 ? 254 GLU A CA   1 
ATOM   3587  C C    . GLU A 1 254 ? -6.537  -17.555 -38.448 1.00 13.69 ? 254 GLU A C    1 
ATOM   3588  O O    . GLU A 1 254 ? -5.497  -17.022 -38.070 1.00 16.48 ? 254 GLU A O    1 
ATOM   3589  C CB   . GLU A 1 254 ? -7.296  -19.952 -38.379 1.00 12.72 ? 254 GLU A CB   1 
ATOM   3590  C CG   . GLU A 1 254 ? -7.421  -21.267 -39.080 1.00 21.11 ? 254 GLU A CG   1 
ATOM   3591  C CD   . GLU A 1 254 ? -8.255  -21.235 -40.358 1.00 21.61 ? 254 GLU A CD   1 
ATOM   3592  O OE1  . GLU A 1 254 ? -9.069  -20.298 -40.554 1.00 19.87 ? 254 GLU A OE1  1 
ATOM   3593  O OE2  . GLU A 1 254 ? -8.082  -22.171 -41.155 1.00 22.39 ? 254 GLU A OE2  1 
ATOM   3594  H H    . GLU A 1 254 ? -4.905  -19.935 -38.864 1.00 17.53 ? 254 GLU A H    1 
ATOM   3595  H HA   . GLU A 1 254 ? -6.995  -18.779 -40.026 1.00 17.76 ? 254 GLU A HA   1 
ATOM   3596  H HB2  . GLU A 1 254 ? -6.829  -20.105 -37.543 1.00 15.24 ? 254 GLU A HB2  1 
ATOM   3597  H HB3  . GLU A 1 254 ? -8.192  -19.625 -38.200 1.00 15.24 ? 254 GLU A HB3  1 
ATOM   3598  H HG2  . GLU A 1 254 ? -6.533  -21.576 -39.318 1.00 25.31 ? 254 GLU A HG2  1 
ATOM   3599  H HG3  . GLU A 1 254 ? -7.836  -21.902 -38.475 1.00 25.31 ? 254 GLU A HG3  1 
ATOM   3600  N N    . SER A 1 255 ? -7.718  -16.967 -38.299 1.00 12.02 ? 255 SER A N    1 
ATOM   3601  C CA   . SER A 1 255 ? -7.806  -15.618 -37.729 1.00 13.99 ? 255 SER A CA   1 
ATOM   3602  C C    . SER A 1 255 ? -7.247  -15.563 -36.311 1.00 13.42 ? 255 SER A C    1 
ATOM   3603  O O    . SER A 1 255 ? -6.616  -14.569 -35.919 1.00 13.41 ? 255 SER A O    1 
ATOM   3604  C CB   . SER A 1 255 ? -9.257  -15.164 -37.766 1.00 13.96 ? 255 SER A CB   1 
ATOM   3605  O OG   . SER A 1 255 ? -9.406  -13.836 -37.344 1.00 15.07 ? 255 SER A OG   1 
ATOM   3606  H H    . SER A 1 255 ? -8.474  -17.316 -38.514 1.00 14.40 ? 255 SER A H    1 
ATOM   3607  H HA   . SER A 1 255 ? -7.288  -15.010 -38.278 1.00 16.76 ? 255 SER A HA   1 
ATOM   3608  H HB2  . SER A 1 255 ? -9.584  -15.240 -38.676 1.00 16.73 ? 255 SER A HB2  1 
ATOM   3609  H HB3  . SER A 1 255 ? -9.778  -15.737 -37.182 1.00 16.73 ? 255 SER A HB3  1 
ATOM   3610  H HG   . SER A 1 255 ? -8.963  -13.325 -37.842 1.00 18.06 ? 255 SER A HG   1 
ATOM   3611  N N    . CYS A 1 256 ? -7.432  -16.638 -35.539 1.00 14.02 ? 256 CYS A N    1 
ATOM   3612  C CA   . CYS A 1 256 ? -6.912  -16.734 -34.184 1.00 12.13 ? 256 CYS A CA   1 
ATOM   3613  C C    . CYS A 1 256 ? -5.395  -16.657 -34.133 1.00 11.81 ? 256 CYS A C    1 
ATOM   3614  O O    . CYS A 1 256 ? -4.852  -16.300 -33.089 1.00 14.70 ? 256 CYS A O    1 
ATOM   3615  C CB   . CYS A 1 256 ? -7.360  -18.045 -33.557 1.00 13.65 ? 256 CYS A CB   1 
ATOM   3616  S SG   . CYS A 1 256 ? -6.843  -19.531 -34.456 1.00 15.89 ? 256 CYS A SG   1 
ATOM   3617  H H    . CYS A 1 256 ? -7.867  -17.337 -35.790 1.00 16.80 ? 256 CYS A H    1 
ATOM   3618  H HA   . CYS A 1 256 ? -7.270  -16.006 -33.653 1.00 14.53 ? 256 CYS A HA   1 
ATOM   3619  H HB2  . CYS A 1 256 ? -6.993  -18.101 -32.661 1.00 16.35 ? 256 CYS A HB2  1 
ATOM   3620  H HB3  . CYS A 1 256 ? -8.329  -18.051 -33.513 1.00 16.35 ? 256 CYS A HB3  1 
ATOM   3621  H HG   . CYS A 1 256 ? -5.645  -19.559 -34.509 1.00 19.04 ? 256 CYS A HG   1 
ATOM   3622  N N    . GLY A 1 257 ? -4.720  -16.991 -35.224 1.00 13.05 ? 257 GLY A N    1 
ATOM   3623  C CA   . GLY A 1 257 ? -3.271  -17.055 -35.262 1.00 12.53 ? 257 GLY A CA   1 
ATOM   3624  C C    . GLY A 1 257 ? -2.667  -15.821 -35.890 1.00 12.17 ? 257 GLY A C    1 
ATOM   3625  O O    . GLY A 1 257 ? -2.569  -14.780 -35.235 1.00 14.60 ? 257 GLY A O    1 
ATOM   3626  H H    . GLY A 1 257 ? -5.091  -17.190 -35.974 1.00 15.64 ? 257 GLY A H    1 
ATOM   3627  H HA2  . GLY A 1 257 ? -2.925  -17.143 -34.360 1.00 15.02 ? 257 GLY A HA2  1 
ATOM   3628  H HA3  . GLY A 1 257 ? -2.993  -17.830 -35.776 1.00 15.02 ? 257 GLY A HA3  1 
ATOM   3629  N N    . VAL A 1 258 ? -2.344  -15.905 -37.186 1.00 12.61 ? 258 VAL A N    1 
ATOM   3630  C CA   . VAL A 1 258 ? -1.570  -14.849 -37.836 1.00 16.80 ? 258 VAL A CA   1 
ATOM   3631  C C    . VAL A 1 258 ? -2.328  -13.521 -37.839 1.00 13.27 ? 258 VAL A C    1 
ATOM   3632  O O    . VAL A 1 258 ? -1.720  -12.454 -37.747 1.00 13.41 ? 258 VAL A O    1 
ATOM   3633  C CB   . VAL A 1 258 ? -1.152  -15.274 -39.264 1.00 20.61 ? 258 VAL A CB   1 
ATOM   3634  C CG1  . VAL A 1 258 ? -2.311  -15.395 -40.169 1.00 18.79 ? 258 VAL A CG1  1 
ATOM   3635  C CG2  . VAL A 1 258 ? -0.194  -14.258 -39.848 1.00 22.96 ? 258 VAL A CG2  1 
ATOM   3636  H H    . VAL A 1 258 ? -2.560  -16.557 -37.703 1.00 15.11 ? 258 VAL A H    1 
ATOM   3637  H HA   . VAL A 1 258 ? -0.755  -14.713 -37.327 1.00 20.14 ? 258 VAL A HA   1 
ATOM   3638  H HB   . VAL A 1 258 ? -0.702  -16.132 -39.226 1.00 24.71 ? 258 VAL A HB   1 
ATOM   3639  H HG11 . VAL A 1 258 ? -1.999  -15.662 -41.048 1.00 22.53 ? 258 VAL A HG11 1 
ATOM   3640  H HG12 . VAL A 1 258 ? -2.918  -16.064 -39.816 1.00 22.53 ? 258 VAL A HG12 1 
ATOM   3641  H HG13 . VAL A 1 258 ? -2.760  -14.537 -40.224 1.00 22.53 ? 258 VAL A HG13 1 
ATOM   3642  H HG21 . VAL A 1 258 ? 0.057   -14.539 -40.742 1.00 27.52 ? 258 VAL A HG21 1 
ATOM   3643  H HG22 . VAL A 1 258 ? -0.634  -13.394 -39.884 1.00 27.52 ? 258 VAL A HG22 1 
ATOM   3644  H HG23 . VAL A 1 258 ? 0.593   -14.206 -39.283 1.00 27.52 ? 258 VAL A HG23 1 
ATOM   3645  N N    . ALA A 1 259 ? -3.653  -13.542 -38.016 1.00 15.50 ? 259 ALA A N    1 
ATOM   3646  C CA   . ALA A 1 259 ? -4.379  -12.271 -38.129 1.00 16.75 ? 259 ALA A CA   1 
ATOM   3647  C C    . ALA A 1 259 ? -4.453  -11.537 -36.787 1.00 11.56 ? 259 ALA A C    1 
ATOM   3648  O O    . ALA A 1 259 ? -4.273  -10.306 -36.724 1.00 12.56 ? 259 ALA A O    1 
ATOM   3649  C CB   . ALA A 1 259 ? -5.793  -12.484 -38.678 1.00 16.55 ? 259 ALA A CB   1 
ATOM   3650  H H    . ALA A 1 259 ? -4.139  -14.249 -38.073 1.00 18.58 ? 259 ALA A H    1 
ATOM   3651  H HA   . ALA A 1 259 ? -3.905  -11.698 -38.751 1.00 20.08 ? 259 ALA A HA   1 
ATOM   3652  H HB1  . ALA A 1 259 ? -6.241  -11.626 -38.738 1.00 19.84 ? 259 ALA A HB1  1 
ATOM   3653  H HB2  . ALA A 1 259 ? -5.732  -12.888 -39.557 1.00 19.84 ? 259 ALA A HB2  1 
ATOM   3654  H HB3  . ALA A 1 259 ? -6.280  -13.070 -38.077 1.00 19.84 ? 259 ALA A HB3  1 
ATOM   3655  N N    . ASP A 1 260 ? -4.827  -12.242 -35.730 1.00 11.05 ? 260 ASP A N    1 
ATOM   3656  C CA   . ASP A 1 260 ? -4.863  -11.617 -34.415 1.00 12.06 ? 260 ASP A CA   1 
ATOM   3657  C C    . ASP A 1 260 ? -3.445  -11.221 -33.983 1.00 15.27 ? 260 ASP A C    1 
ATOM   3658  O O    . ASP A 1 260 ? -3.246  -10.193 -33.331 1.00 14.46 ? 260 ASP A O    1 
ATOM   3659  C CB   . ASP A 1 260 ? -5.499  -12.578 -33.403 1.00 15.47 ? 260 ASP A CB   1 
ATOM   3660  C CG   . ASP A 1 260 ? -6.091  -11.864 -32.187 1.00 19.39 ? 260 ASP A CG   1 
ATOM   3661  O OD1  . ASP A 1 260 ? -6.199  -10.617 -32.202 1.00 19.12 ? 260 ASP A OD1  1 
ATOM   3662  O OD2  . ASP A 1 260 ? -6.478  -12.554 -31.232 1.00 18.62 ? 260 ASP A OD2  1 
ATOM   3663  H H    . ASP A 1 260 ? -5.061  -13.070 -35.744 1.00 13.24 ? 260 ASP A H    1 
ATOM   3664  H HA   . ASP A 1 260 ? -5.405  -10.814 -34.456 1.00 14.45 ? 260 ASP A HA   1 
ATOM   3665  H HB2  . ASP A 1 260 ? -6.215  -13.067 -33.839 1.00 18.54 ? 260 ASP A HB2  1 
ATOM   3666  H HB3  . ASP A 1 260 ? -4.822  -13.195 -33.086 1.00 18.54 ? 260 ASP A HB3  1 
ATOM   3667  N N    . LEU A 1 261 ? -2.455  -12.022 -34.351 1.00 12.73 ? 261 LEU A N    1 
ATOM   3668  C CA   . LEU A 1 261 ? -1.071  -11.649 -34.058 1.00 14.29 ? 261 LEU A CA   1 
ATOM   3669  C C    . LEU A 1 261 ? -0.679  -10.319 -34.718 1.00 16.13 ? 261 LEU A C    1 
ATOM   3670  O O    . LEU A 1 261 ? -0.100  -9.435  -34.072 1.00 18.04 ? 261 LEU A O    1 
ATOM   3671  C CB   . LEU A 1 261 ? -0.145  -12.790 -34.486 1.00 14.85 ? 261 LEU A CB   1 
ATOM   3672  C CG   . LEU A 1 261 ? 1.345   -12.527 -34.177 1.00 14.09 ? 261 LEU A CG   1 
ATOM   3673  C CD1  . LEU A 1 261 ? 1.535   -12.400 -32.710 1.00 12.56 ? 261 LEU A CD1  1 
ATOM   3674  C CD2  . LEU A 1 261 ? 2.231   -13.625 -34.758 1.00 18.02 ? 261 LEU A CD2  1 
ATOM   3675  H H    . LEU A 1 261 ? -2.550  -12.772 -34.761 1.00 15.25 ? 261 LEU A H    1 
ATOM   3676  H HA   . LEU A 1 261 ? -0.977  -11.538 -33.099 1.00 17.12 ? 261 LEU A HA   1 
ATOM   3677  H HB2  . LEU A 1 261 ? -0.407  -13.598 -34.019 1.00 17.80 ? 261 LEU A HB2  1 
ATOM   3678  H HB3  . LEU A 1 261 ? -0.230  -12.921 -35.444 1.00 17.80 ? 261 LEU A HB3  1 
ATOM   3679  H HG   . LEU A 1 261 ? 1.607   -11.687 -34.584 1.00 16.89 ? 261 LEU A HG   1 
ATOM   3680  H HD11 . LEU A 1 261 ? 2.473   -12.235 -32.526 1.00 15.05 ? 261 LEU A HD11 1 
ATOM   3681  H HD12 . LEU A 1 261 ? 0.999   -11.659 -32.385 1.00 15.05 ? 261 LEU A HD12 1 
ATOM   3682  H HD13 . LEU A 1 261 ? 1.254   -13.224 -32.283 1.00 15.05 ? 261 LEU A HD13 1 
ATOM   3683  H HD21 . LEU A 1 261 ? 3.157   -13.429 -34.546 1.00 21.60 ? 261 LEU A HD21 1 
ATOM   3684  H HD22 . LEU A 1 261 ? 1.975   -14.476 -34.369 1.00 21.60 ? 261 LEU A HD22 1 
ATOM   3685  H HD23 . LEU A 1 261 ? 2.110   -13.651 -35.720 1.00 21.60 ? 261 LEU A HD23 1 
ATOM   3686  N N    . ILE A 1 262 ? -0.992  -10.153 -36.007 1.00 16.52 ? 262 ILE A N    1 
ATOM   3687  C CA   . ILE A 1 262 ? -0.664  -8.921  -36.729 1.00 17.16 ? 262 ILE A CA   1 
ATOM   3688  C C    . ILE A 1 262 ? -1.344  -7.724  -36.080 1.00 19.51 ? 262 ILE A C    1 
ATOM   3689  O O    . ILE A 1 262 ? -0.719  -6.685  -35.834 1.00 16.78 ? 262 ILE A O    1 
ATOM   3690  C CB   . ILE A 1 262 ? -1.077  -9.050  -38.212 1.00 18.37 ? 262 ILE A CB   1 
ATOM   3691  C CG1  . ILE A 1 262 ? -0.157  -10.054 -38.925 1.00 20.65 ? 262 ILE A CG1  1 
ATOM   3692  C CG2  . ILE A 1 262 ? -1.076  -7.701  -38.899 1.00 23.25 ? 262 ILE A CG2  1 
ATOM   3693  C CD1  . ILE A 1 262 ? -0.702  -10.498 -40.272 1.00 25.40 ? 262 ILE A CD1  1 
ATOM   3694  H H    . ILE A 1 262 ? -1.395  -10.742 -36.486 1.00 19.80 ? 262 ILE A H    1 
ATOM   3695  H HA   . ILE A 1 262 ? 0.294   -8.778  -36.695 1.00 20.58 ? 262 ILE A HA   1 
ATOM   3696  H HB   . ILE A 1 262 ? -1.981  -9.400  -38.241 1.00 22.02 ? 262 ILE A HB   1 
ATOM   3697  H HG12 . ILE A 1 262 ? 0.707   -9.639  -39.074 1.00 24.76 ? 262 ILE A HG12 1 
ATOM   3698  H HG13 . ILE A 1 262 ? -0.056  -10.841 -38.368 1.00 24.76 ? 262 ILE A HG13 1 
ATOM   3699  H HG21 . ILE A 1 262 ? -1.338  -7.819  -39.825 1.00 27.87 ? 262 ILE A HG21 1 
ATOM   3700  H HG22 . ILE A 1 262 ? -1.705  -7.117  -38.447 1.00 27.87 ? 262 ILE A HG22 1 
ATOM   3701  H HG23 . ILE A 1 262 ? -0.183  -7.325  -38.853 1.00 27.87 ? 262 ILE A HG23 1 
ATOM   3702  H HD11 . ILE A 1 262 ? -0.081  -11.127 -40.672 1.00 30.46 ? 262 ILE A HD11 1 
ATOM   3703  H HD12 . ILE A 1 262 ? -1.564  -10.923 -40.139 1.00 30.46 ? 262 ILE A HD12 1 
ATOM   3704  H HD13 . ILE A 1 262 ? -0.801  -9.721  -40.845 1.00 30.46 ? 262 ILE A HD13 1 
ATOM   3705  N N    . THR A 1 263 ? -2.653  -7.839  -35.823 1.00 16.08 ? 263 THR A N    1 
ATOM   3706  C CA   . THR A 1 263 ? -3.389  -6.693  -35.314 1.00 16.07 ? 263 THR A CA   1 
ATOM   3707  C C    . THR A 1 263 ? -2.896  -6.314  -33.916 1.00 16.38 ? 263 THR A C    1 
ATOM   3708  O O    . THR A 1 263 ? -2.685  -5.134  -33.614 1.00 18.72 ? 263 THR A O    1 
ATOM   3709  C CB   . THR A 1 263 ? -4.909  -6.990  -35.342 1.00 17.72 ? 263 THR A CB   1 
ATOM   3710  O OG1  . THR A 1 263 ? -5.603  -5.789  -35.085 1.00 27.71 ? 263 THR A OG1  1 
ATOM   3711  C CG2  . THR A 1 263 ? -5.318  -8.012  -34.269 1.00 19.55 ? 263 THR A CG2  1 
ATOM   3712  H H    . THR A 1 263 ? -3.121  -8.552  -35.933 1.00 19.27 ? 263 THR A H    1 
ATOM   3713  H HA   . THR A 1 263 ? -3.226  -5.935  -35.898 1.00 19.26 ? 263 THR A HA   1 
ATOM   3714  H HB   . THR A 1 263 ? -5.161  -7.334  -36.213 1.00 21.24 ? 263 THR A HB   1 
ATOM   3715  H HG1  . THR A 1 263 ? -6.431  -5.928  -35.095 1.00 33.23 ? 263 THR A HG1  1 
ATOM   3716  H HG21 . THR A 1 263 ? -6.273  -8.175  -34.313 1.00 23.44 ? 263 THR A HG21 1 
ATOM   3717  H HG22 . THR A 1 263 ? -4.848  -8.849  -34.413 1.00 23.44 ? 263 THR A HG22 1 
ATOM   3718  H HG23 . THR A 1 263 ? -5.096  -7.674  -33.387 1.00 23.44 ? 263 THR A HG23 1 
ATOM   3719  N N    . THR A 1 264 ? -2.570  -7.318  -33.101 1.00 15.68 ? 264 THR A N    1 
ATOM   3720  C CA   . THR A 1 264 ? -2.068  -7.077  -31.752 1.00 19.44 ? 264 THR A CA   1 
ATOM   3721  C C    . THR A 1 264 ? -0.659  -6.490  -31.760 1.00 17.70 ? 264 THR A C    1 
ATOM   3722  O O    . THR A 1 264 ? -0.347  -5.665  -30.900 1.00 22.03 ? 264 THR A O    1 
ATOM   3723  C CB   . THR A 1 264 ? -2.122  -8.385  -30.969 1.00 17.66 ? 264 THR A CB   1 
ATOM   3724  O OG1  . THR A 1 264 ? -3.460  -8.887  -31.009 1.00 20.30 ? 264 THR A OG1  1 
ATOM   3725  C CG2  . THR A 1 264 ? -1.719  -8.175  -29.492 1.00 18.71 ? 264 THR A CG2  1 
ATOM   3726  H H    . THR A 1 264 ? -2.632  -8.151  -33.309 1.00 18.80 ? 264 THR A H    1 
ATOM   3727  H HA   . THR A 1 264 ? -2.652  -6.441  -31.310 1.00 23.31 ? 264 THR A HA   1 
ATOM   3728  H HB   . THR A 1 264 ? -1.518  -9.031  -31.368 1.00 21.17 ? 264 THR A HB   1 
ATOM   3729  H HG1  . THR A 1 264 ? -3.691  -9.024  -31.805 1.00 24.34 ? 264 THR A HG1  1 
ATOM   3730  H HG21 . THR A 1 264 ? -1.760  -9.019  -29.014 1.00 22.43 ? 264 THR A HG21 1 
ATOM   3731  H HG22 . THR A 1 264 ? -0.815  -7.828  -29.441 1.00 22.43 ? 264 THR A HG22 1 
ATOM   3732  H HG23 . THR A 1 264 ? -2.323  -7.544  -29.070 1.00 22.43 ? 264 THR A HG23 1 
ATOM   3733  N N    . CYS A 1 265 ? 0.183   -6.872  -32.720 1.00 18.96 ? 265 CYS A N    1 
ATOM   3734  C CA   . CYS A 1 265 ? 1.534   -6.315  -32.845 1.00 13.77 ? 265 CYS A CA   1 
ATOM   3735  C C    . CYS A 1 265 ? 1.545   -4.924  -33.477 1.00 18.93 ? 265 CYS A C    1 
ATOM   3736  O O    . CYS A 1 265 ? 2.583   -4.260  -33.443 1.00 17.28 ? 265 CYS A O    1 
ATOM   3737  C CB   . CYS A 1 265 ? 2.411   -7.224  -33.673 1.00 15.40 ? 265 CYS A CB   1 
ATOM   3738  S SG   . CYS A 1 265 ? 2.792   -8.753  -32.778 1.00 17.00 ? 265 CYS A SG   1 
ATOM   3739  H H    . CYS A 1 265 ? -0.006  -7.460  -33.319 1.00 22.73 ? 265 CYS A H    1 
ATOM   3740  H HA   . CYS A 1 265 ? 1.927   -6.244  -31.961 1.00 16.51 ? 265 CYS A HA   1 
ATOM   3741  H HB2  . CYS A 1 265 ? 1.948   -7.457  -34.493 1.00 18.45 ? 265 CYS A HB2  1 
ATOM   3742  H HB3  . CYS A 1 265 ? 3.245   -6.771  -33.873 1.00 18.45 ? 265 CYS A HB3  1 
ATOM   3743  H HG   . CYS A 1 265 ? 1.768   -9.325  -32.526 1.00 20.38 ? 265 CYS A HG   1 
ATOM   3744  N N    . TYR A 1 266 ? 0.428   -4.480  -34.091 1.00 17.38 ? 266 TYR A N    1 
ATOM   3745  C CA   . TYR A 1 266 ? 0.362   -3.150  -34.695 1.00 18.20 ? 266 TYR A CA   1 
ATOM   3746  C C    . TYR A 1 266 ? -0.575  -2.208  -33.945 1.00 20.04 ? 266 TYR A C    1 
ATOM   3747  O O    . TYR A 1 266 ? -0.550  -1.002  -34.208 1.00 23.20 ? 266 TYR A O    1 
ATOM   3748  C CB   . TYR A 1 266 ? -0.031  -3.250  -36.186 1.00 20.26 ? 266 TYR A CB   1 
ATOM   3749  C CG   . TYR A 1 266 ? 1.158   -3.585  -37.062 1.00 21.66 ? 266 TYR A CG   1 
ATOM   3750  C CD1  . TYR A 1 266 ? 1.987   -2.581  -37.568 1.00 32.80 ? 266 TYR A CD1  1 
ATOM   3751  C CD2  . TYR A 1 266 ? 1.483   -4.898  -37.352 1.00 20.79 ? 266 TYR A CD2  1 
ATOM   3752  C CE1  . TYR A 1 266 ? 3.089   -2.891  -38.363 1.00 27.95 ? 266 TYR A CE1  1 
ATOM   3753  C CE2  . TYR A 1 266 ? 2.571   -5.214  -38.142 1.00 26.04 ? 266 TYR A CE2  1 
ATOM   3754  C CZ   . TYR A 1 266 ? 3.378   -4.202  -38.637 1.00 27.12 ? 266 TYR A CZ   1 
ATOM   3755  O OH   . TYR A 1 266 ? 4.458   -4.516  -39.411 1.00 32.63 ? 266 TYR A OH   1 
ATOM   3756  H H    . TYR A 1 266 ? -0.298  -4.935  -34.166 1.00 20.83 ? 266 TYR A H    1 
ATOM   3757  H HA   . TYR A 1 266 ? 1.248   -2.758  -34.659 1.00 21.82 ? 266 TYR A HA   1 
ATOM   3758  H HB2  . TYR A 1 266 ? -0.694  -3.949  -36.295 1.00 24.29 ? 266 TYR A HB2  1 
ATOM   3759  H HB3  . TYR A 1 266 ? -0.392  -2.398  -36.479 1.00 24.29 ? 266 TYR A HB3  1 
ATOM   3760  H HD1  . TYR A 1 266 ? 1.794   -1.691  -37.381 1.00 39.34 ? 266 TYR A HD1  1 
ATOM   3761  H HD2  . TYR A 1 266 ? 0.947   -5.582  -37.022 1.00 24.93 ? 266 TYR A HD2  1 
ATOM   3762  H HE1  . TYR A 1 266 ? 3.631   -2.212  -38.697 1.00 33.52 ? 266 TYR A HE1  1 
ATOM   3763  H HE2  . TYR A 1 266 ? 2.769   -6.103  -38.328 1.00 31.23 ? 266 TYR A HE2  1 
ATOM   3764  H HH   . TYR A 1 266 ? 4.854   -3.815  -39.651 1.00 39.13 ? 266 TYR A HH   1 
ATOM   3765  N N    . GLY A 1 267 ? -1.312  -2.709  -32.969 1.00 15.61 ? 267 GLY A N    1 
ATOM   3766  C CA   . GLY A 1 267 ? -2.194  -1.923  -32.127 1.00 23.75 ? 267 GLY A CA   1 
ATOM   3767  C C    . GLY A 1 267 ? -2.760  -2.715  -30.960 1.00 23.13 ? 267 GLY A C    1 
ATOM   3768  O O    . GLY A 1 267 ? -3.403  -3.754  -31.151 1.00 33.55 ? 267 GLY A O    1 
ATOM   3769  H H    . GLY A 1 267 ? -1.317  -3.545  -32.766 1.00 18.71 ? 267 GLY A H    1 
ATOM   3770  H HA2  . GLY A 1 267 ? -1.707  -1.162  -31.773 1.00 28.47 ? 267 GLY A HA2  1 
ATOM   3771  H HA3  . GLY A 1 267 ? -2.935  -1.592  -32.659 1.00 28.47 ? 267 GLY A HA3  1 
ATOM   3772  N N    . GLY A 1 268 ? -2.626  -2.188  -29.760 1.00 24.18 ? 268 GLY A N    1 
ATOM   3773  C CA   . GLY A 1 268 ? -2.968  -2.916  -28.553 1.00 24.56 ? 268 GLY A CA   1 
ATOM   3774  C C    . GLY A 1 268 ? -2.093  -2.489  -27.389 1.00 24.88 ? 268 GLY A C    1 
ATOM   3775  O O    . GLY A 1 268 ? -1.014  -1.919  -27.542 1.00 23.32 ? 268 GLY A O    1 
ATOM   3776  H H    . GLY A 1 268 ? -2.334  -1.393  -29.614 1.00 29.00 ? 268 GLY A H    1 
ATOM   3777  H HA2  . GLY A 1 268 ? -3.895  -2.750  -28.323 1.00 29.45 ? 268 GLY A HA2  1 
ATOM   3778  H HA3  . GLY A 1 268 ? -2.848  -3.867  -28.700 1.00 29.45 ? 268 GLY A HA3  1 
ATOM   3779  N N    . ARG A 1 269 ? -2.576  -2.772  -26.182 1.00 23.02 ? 269 ARG A N    1 
ATOM   3780  C CA   . ARG A 1 269 ? -1.918  -2.253  -24.991 1.00 23.94 ? 269 ARG A CA   1 
ATOM   3781  C C    . ARG A 1 269 ? -0.567  -2.917  -24.741 1.00 25.97 ? 269 ARG A C    1 
ATOM   3782  O O    . ARG A 1 269 ? 0.349   -2.247  -24.265 1.00 22.22 ? 269 ARG A O    1 
ATOM   3783  C CB   . ARG A 1 269 ? -2.812  -2.414  -23.771 1.00 26.54 ? 269 ARG A CB   1 
ATOM   3784  C CG   . ARG A 1 269 ? -3.239  -3.822  -23.517 1.00 30.49 ? 269 ARG A CG   1 
ATOM   3785  C CD   . ARG A 1 269 ? -4.601  -3.833  -22.841 1.00 48.01 ? 269 ARG A CD   1 
ATOM   3786  N NE   . ARG A 1 269 ? -4.505  -3.511  -21.427 1.00 51.97 ? 269 ARG A NE   1 
ATOM   3787  C CZ   . ARG A 1 269 ? -5.480  -2.965  -20.706 1.00 54.19 ? 269 ARG A CZ   1 
ATOM   3788  N NH1  . ARG A 1 269 ? -6.639  -2.642  -21.261 1.00 59.49 ? 269 ARG A NH1  1 
ATOM   3789  N NH2  . ARG A 1 269 ? -5.287  -2.733  -19.419 1.00 55.14 ? 269 ARG A NH2  1 
ATOM   3790  H H    . ARG A 1 269 ? -3.272  -3.254  -26.028 1.00 27.60 ? 269 ARG A H    1 
ATOM   3791  H HA   . ARG A 1 269 ? -1.759  -1.304  -25.115 1.00 28.71 ? 269 ARG A HA   1 
ATOM   3792  H HB2  . ARG A 1 269 ? -2.331  -2.104  -22.987 1.00 31.83 ? 269 ARG A HB2  1 
ATOM   3793  H HB3  . ARG A 1 269 ? -3.612  -1.880  -23.897 1.00 31.83 ? 269 ARG A HB3  1 
ATOM   3794  H HG2  . ARG A 1 269 ? -3.308  -4.298  -24.359 1.00 36.56 ? 269 ARG A HG2  1 
ATOM   3795  H HG3  . ARG A 1 269 ? -2.600  -4.256  -22.931 1.00 36.56 ? 269 ARG A HG3  1 
ATOM   3796  H HD2  . ARG A 1 269 ? -5.173  -3.172  -23.263 1.00 57.60 ? 269 ARG A HD2  1 
ATOM   3797  H HD3  . ARG A 1 269 ? -4.992  -4.716  -22.924 1.00 57.60 ? 269 ARG A HD3  1 
ATOM   3798  H HE   . ARG A 1 269 ? -3.764  -3.686  -21.027 1.00 62.35 ? 269 ARG A HE   1 
ATOM   3799  H HH11 . ARG A 1 269 ? -6.773  -2.794  -22.096 1.00 71.37 ? 269 ARG A HH11 1 
ATOM   3800  H HH12 . ARG A 1 269 ? -7.260  -2.286  -20.783 1.00 71.37 ? 269 ARG A HH12 1 
ATOM   3801  H HH21 . ARG A 1 269 ? -4.535  -2.934  -19.053 1.00 66.14 ? 269 ARG A HH21 1 
ATOM   3802  H HH22 . ARG A 1 269 ? -5.910  -2.370  -18.949 1.00 66.14 ? 269 ARG A HH22 1 
ATOM   3803  N N    . ASN A 1 270 ? -0.424  -4.226  -25.006 1.00 21.41 ? 270 ASN A N    1 
ATOM   3804  C CA   . ASN A 1 270 ? 0.894   -4.860  -24.857 1.00 20.08 ? 270 ASN A CA   1 
ATOM   3805  C C    . ASN A 1 270 ? 1.939   -4.185  -25.749 1.00 17.26 ? 270 ASN A C    1 
ATOM   3806  O O    . ASN A 1 270 ? 3.048   -3.854  -25.297 1.00 16.70 ? 270 ASN A O    1 
ATOM   3807  C CB   . ASN A 1 270 ? 0.811   -6.358  -25.167 1.00 18.47 ? 270 ASN A CB   1 
ATOM   3808  C CG   . ASN A 1 270 ? 0.206   -7.151  -24.030 1.00 19.19 ? 270 ASN A CG   1 
ATOM   3809  O OD1  . ASN A 1 270 ? 0.896   -7.553  -23.092 1.00 20.54 ? 270 ASN A OD1  1 
ATOM   3810  N ND2  . ASN A 1 270 ? -1.101  -7.371  -24.093 1.00 20.75 ? 270 ASN A ND2  1 
ATOM   3811  H H    . ASN A 1 270 ? -1.054  -4.752  -25.264 1.00 25.67 ? 270 ASN A H    1 
ATOM   3812  H HA   . ASN A 1 270 ? 1.184   -4.763  -23.937 1.00 24.07 ? 270 ASN A HA   1 
ATOM   3813  H HB2  . ASN A 1 270 ? 0.257   -6.489  -25.952 1.00 22.15 ? 270 ASN A HB2  1 
ATOM   3814  H HB3  . ASN A 1 270 ? 1.704   -6.698  -25.329 1.00 22.15 ? 270 ASN A HB3  1 
ATOM   3815  H HD21 . ASN A 1 270 ? -1.492  -7.816  -23.470 1.00 24.88 ? 270 ASN A HD21 1 
ATOM   3816  H HD22 . ASN A 1 270 ? -1.555  -7.074  -24.760 1.00 24.88 ? 270 ASN A HD22 1 
ATOM   3817  N N    . ARG A 1 271 ? 1.625   -3.999  -27.029 1.00 16.16 ? 271 ARG A N    1 
ATOM   3818  C CA   . ARG A 1 271 ? 2.567   -3.325  -27.908 1.00 20.05 ? 271 ARG A CA   1 
ATOM   3819  C C    . ARG A 1 271 ? 2.850   -1.914  -27.409 1.00 19.13 ? 271 ARG A C    1 
ATOM   3820  O O    . ARG A 1 271 ? 4.006   -1.478  -27.392 1.00 16.05 ? 271 ARG A O    1 
ATOM   3821  C CB   . ARG A 1 271 ? 2.044   -3.288  -29.343 1.00 17.46 ? 271 ARG A CB   1 
ATOM   3822  C CG   . ARG A 1 271 ? 3.045   -2.735  -30.390 1.00 17.34 ? 271 ARG A CG   1 
ATOM   3823  C CD   . ARG A 1 271 ? 2.370   -1.895  -31.440 1.00 17.36 ? 271 ARG A CD   1 
ATOM   3824  N NE   . ARG A 1 271 ? 1.904   -0.635  -30.871 1.00 20.73 ? 271 ARG A NE   1 
ATOM   3825  C CZ   . ARG A 1 271 ? 2.685   0.395   -30.594 1.00 20.85 ? 271 ARG A CZ   1 
ATOM   3826  N NH1  . ARG A 1 271 ? 3.970   0.326   -30.825 1.00 19.42 ? 271 ARG A NH1  1 
ATOM   3827  N NH2  . ARG A 1 271 ? 2.174   1.498   -30.039 1.00 23.51 ? 271 ARG A NH2  1 
ATOM   3828  H H    . ARG A 1 271 ? 0.891   -4.248  -27.403 1.00 19.37 ? 271 ARG A H    1 
ATOM   3829  H HA   . ARG A 1 271 ? 3.404   -3.815  -27.908 1.00 24.04 ? 271 ARG A HA   1 
ATOM   3830  H HB2  . ARG A 1 271 ? 1.812   -4.192  -29.609 1.00 20.93 ? 271 ARG A HB2  1 
ATOM   3831  H HB3  . ARG A 1 271 ? 1.254   -2.727  -29.369 1.00 20.93 ? 271 ARG A HB3  1 
ATOM   3832  H HG2  . ARG A 1 271 ? 3.702   -2.183  -29.939 1.00 20.79 ? 271 ARG A HG2  1 
ATOM   3833  H HG3  . ARG A 1 271 ? 3.482   -3.478  -30.834 1.00 20.79 ? 271 ARG A HG3  1 
ATOM   3834  H HD2  . ARG A 1 271 ? 3.002   -1.696  -32.148 1.00 20.81 ? 271 ARG A HD2  1 
ATOM   3835  H HD3  . ARG A 1 271 ? 1.604   -2.374  -31.793 1.00 20.81 ? 271 ARG A HD3  1 
ATOM   3836  H HE   . ARG A 1 271 ? 1.064   -0.557  -30.705 1.00 24.86 ? 271 ARG A HE   1 
ATOM   3837  H HH11 . ARG A 1 271 ? 4.307   -0.386  -31.171 1.00 23.29 ? 271 ARG A HH11 1 
ATOM   3838  H HH12 . ARG A 1 271 ? 4.477   0.997   -30.643 1.00 23.29 ? 271 ARG A HH12 1 
ATOM   3839  H HH21 . ARG A 1 271 ? 1.329   1.550   -29.886 1.00 28.19 ? 271 ARG A HH21 1 
ATOM   3840  H HH22 . ARG A 1 271 ? 2.684   2.169   -29.867 1.00 28.19 ? 271 ARG A HH22 1 
ATOM   3841  N N    . LYS A 1 272 ? 1.802   -1.176  -27.028 1.00 18.46 ? 272 LYS A N    1 
ATOM   3842  C CA   . LYS A 1 272 ? 1.977   0.220   -26.641 1.00 20.34 ? 272 LYS A CA   1 
ATOM   3843  C C    . LYS A 1 272 ? 2.829   0.331   -25.383 1.00 17.47 ? 272 LYS A C    1 
ATOM   3844  O O    . LYS A 1 272 ? 3.753   1.150   -25.310 1.00 16.45 ? 272 LYS A O    1 
ATOM   3845  C CB   . LYS A 1 272 ? 0.609   0.873   -26.420 1.00 20.28 ? 272 LYS A CB   1 
ATOM   3846  C CG   . LYS A 1 272 ? 0.685   2.334   -26.029 1.00 22.00 ? 272 LYS A CG   1 
ATOM   3847  C CD   . LYS A 1 272 ? -0.712  2.873   -25.805 1.00 26.14 ? 272 LYS A CD   1 
ATOM   3848  C CE   . LYS A 1 272 ? -0.806  3.792   -24.611 1.00 44.50 ? 272 LYS A CE   1 
ATOM   3849  N NZ   . LYS A 1 272 ? -0.663  5.234   -24.976 1.00 44.03 ? 272 LYS A NZ   1 
ATOM   3850  H H    . LYS A 1 272 ? 0.991   -1.459  -26.986 1.00 22.13 ? 272 LYS A H    1 
ATOM   3851  H HA   . LYS A 1 272 ? 2.428   0.696   -27.356 1.00 24.38 ? 272 LYS A HA   1 
ATOM   3852  H HB2  . LYS A 1 272 ? 0.097   0.812   -27.241 1.00 24.31 ? 272 LYS A HB2  1 
ATOM   3853  H HB3  . LYS A 1 272 ? 0.148   0.399   -25.709 1.00 24.31 ? 272 LYS A HB3  1 
ATOM   3854  H HG2  . LYS A 1 272 ? 1.188   2.426   -25.205 1.00 26.37 ? 272 LYS A HG2  1 
ATOM   3855  H HG3  . LYS A 1 272 ? 1.102   2.842   -26.743 1.00 26.37 ? 272 LYS A HG3  1 
ATOM   3856  H HD2  . LYS A 1 272 ? -0.986  3.374   -26.590 1.00 31.35 ? 272 LYS A HD2  1 
ATOM   3857  H HD3  . LYS A 1 272 ? -1.317  2.130   -25.659 1.00 31.35 ? 272 LYS A HD3  1 
ATOM   3858  H HE2  . LYS A 1 272 ? -1.672  3.675   -24.189 1.00 53.38 ? 272 LYS A HE2  1 
ATOM   3859  H HE3  . LYS A 1 272 ? -0.099  3.570   -23.985 1.00 53.38 ? 272 LYS A HE3  1 
ATOM   3860  H HZ1  . LYS A 1 272 ? -0.724  5.740   -24.246 1.00 52.81 ? 272 LYS A HZ1  1 
ATOM   3861  H HZ2  . LYS A 1 272 ? 0.128   5.373   -25.359 1.00 52.81 ? 272 LYS A HZ2  1 
ATOM   3862  H HZ3  . LYS A 1 272 ? -1.305  5.468   -25.545 1.00 52.81 ? 272 LYS A HZ3  1 
ATOM   3863  N N    . VAL A 1 273 ? 2.522   -0.474  -24.365 1.00 15.49 ? 273 VAL A N    1 
ATOM   3864  C CA   . VAL A 1 273 ? 3.295   -0.371  -23.130 1.00 21.75 ? 273 VAL A CA   1 
ATOM   3865  C C    . VAL A 1 273 ? 4.729   -0.828  -23.354 1.00 20.15 ? 273 VAL A C    1 
ATOM   3866  O O    . VAL A 1 273 ? 5.672   -0.238  -22.821 1.00 21.01 ? 273 VAL A O    1 
ATOM   3867  C CB   . VAL A 1 273 ? 2.620   -1.178  -22.021 1.00 17.43 ? 273 VAL A CB   1 
ATOM   3868  C CG1  . VAL A 1 273 ? 3.507   -1.236  -20.829 1.00 23.00 ? 273 VAL A CG1  1 
ATOM   3869  C CG2  . VAL A 1 273 ? 1.294   -0.537  -21.677 1.00 19.72 ? 273 VAL A CG2  1 
ATOM   3870  H H    . VAL A 1 273 ? 1.896   -1.064  -24.362 1.00 18.56 ? 273 VAL A H    1 
ATOM   3871  H HA   . VAL A 1 273 ? 3.318   0.557   -22.851 1.00 26.08 ? 273 VAL A HA   1 
ATOM   3872  H HB   . VAL A 1 273 ? 2.456   -2.083  -22.330 1.00 20.89 ? 273 VAL A HB   1 
ATOM   3873  H HG11 . VAL A 1 273 ? 3.067   -1.750  -20.134 1.00 27.58 ? 273 VAL A HG11 1 
ATOM   3874  H HG12 . VAL A 1 273 ? 4.342   -1.662  -21.078 1.00 27.58 ? 273 VAL A HG12 1 
ATOM   3875  H HG13 . VAL A 1 273 ? 3.676   -0.333  -20.517 1.00 27.58 ? 273 VAL A HG13 1 
ATOM   3876  H HG21 . VAL A 1 273 ? 0.869   -1.052  -20.973 1.00 23.64 ? 273 VAL A HG21 1 
ATOM   3877  H HG22 . VAL A 1 273 ? 1.452   0.371   -21.375 1.00 23.64 ? 273 VAL A HG22 1 
ATOM   3878  H HG23 . VAL A 1 273 ? 0.733   -0.531  -22.468 1.00 23.64 ? 273 VAL A HG23 1 
ATOM   3879  N N    . ALA A 1 274 ? 4.921   -1.876  -24.148 1.00 17.65 ? 274 ALA A N    1 
ATOM   3880  C CA   . ALA A 1 274 ? 6.283   -2.338  -24.448 1.00 21.20 ? 274 ALA A CA   1 
ATOM   3881  C C    . ALA A 1 274 ? 7.098   -1.256  -25.154 1.00 17.45 ? 274 ALA A C    1 
ATOM   3882  O O    . ALA A 1 274 ? 8.266   -1.020  -24.813 1.00 18.73 ? 274 ALA A O    1 
ATOM   3883  C CB   . ALA A 1 274 ? 6.221   -3.599  -25.308 1.00 17.94 ? 274 ALA A CB   1 
ATOM   3884  H H    . ALA A 1 274 ? 4.296   -2.333  -24.521 1.00 21.16 ? 274 ALA A H    1 
ATOM   3885  H HA   . ALA A 1 274 ? 6.733   -2.560  -23.618 1.00 25.41 ? 274 ALA A HA   1 
ATOM   3886  H HB1  . ALA A 1 274 ? 7.125   -3.894  -25.499 1.00 21.51 ? 274 ALA A HB1  1 
ATOM   3887  H HB2  . ALA A 1 274 ? 5.743   -4.289  -24.822 1.00 21.51 ? 274 ALA A HB2  1 
ATOM   3888  H HB3  . ALA A 1 274 ? 5.757   -3.394  -26.135 1.00 21.51 ? 274 ALA A HB3  1 
ATOM   3889  N N    . GLU A 1 275 ? 6.504   -0.602  -26.165 1.00 16.08 ? 275 GLU A N    1 
ATOM   3890  C CA   . GLU A 1 275 ? 7.199   0.493   -26.833 1.00 19.58 ? 275 GLU A CA   1 
ATOM   3891  C C    . GLU A 1 275 ? 7.595   1.567   -25.827 1.00 16.28 ? 275 GLU A C    1 
ATOM   3892  O O    . GLU A 1 275 ? 8.723   2.064   -25.847 1.00 18.02 ? 275 GLU A O    1 
ATOM   3893  C CB   . GLU A 1 275 ? 6.334   1.105   -27.928 1.00 19.96 ? 275 GLU A CB   1 
ATOM   3894  C CG   . GLU A 1 275 ? 7.047   2.276   -28.705 1.00 20.79 ? 275 GLU A CG   1 
ATOM   3895  C CD   . GLU A 1 275 ? 6.100   3.186   -29.484 1.00 25.84 ? 275 GLU A CD   1 
ATOM   3896  O OE1  . GLU A 1 275 ? 5.160   2.678   -30.149 1.00 26.66 ? 275 GLU A OE1  1 
ATOM   3897  O OE2  . GLU A 1 275 ? 6.277   4.435   -29.416 1.00 22.80 ? 275 GLU A OE2  1 
ATOM   3898  H H    . GLU A 1 275 ? 5.719   -0.772  -26.472 1.00 19.27 ? 275 GLU A H    1 
ATOM   3899  H HA   . GLU A 1 275 ? 8.009   0.151   -27.244 1.00 23.47 ? 275 GLU A HA   1 
ATOM   3900  H HB2  . GLU A 1 275 ? 6.107   0.416   -28.572 1.00 23.93 ? 275 GLU A HB2  1 
ATOM   3901  H HB3  . GLU A 1 275 ? 5.526   1.462   -27.528 1.00 23.93 ? 275 GLU A HB3  1 
ATOM   3902  H HG2  . GLU A 1 275 ? 7.524   2.827   -28.065 1.00 24.93 ? 275 GLU A HG2  1 
ATOM   3903  H HG3  . GLU A 1 275 ? 7.674   1.893   -29.338 1.00 24.93 ? 275 GLU A HG3  1 
ATOM   3904  N N    . ALA A 1 276 ? 6.665   1.958   -24.953 1.00 18.99 ? 276 ALA A N    1 
ATOM   3905  C CA   . ALA A 1 276 ? 6.977   2.975   -23.944 1.00 20.16 ? 276 ALA A CA   1 
ATOM   3906  C C    . ALA A 1 276 ? 8.110   2.522   -23.025 1.00 23.12 ? 276 ALA A C    1 
ATOM   3907  O O    . ALA A 1 276 ? 9.017   3.302   -22.706 1.00 20.12 ? 276 ALA A O    1 
ATOM   3908  C CB   . ALA A 1 276 ? 5.733   3.314   -23.119 1.00 21.41 ? 276 ALA A CB   1 
ATOM   3909  H H    . ALA A 1 276 ? 5.860   1.657   -24.923 1.00 22.77 ? 276 ALA A H    1 
ATOM   3910  H HA   . ALA A 1 276 ? 7.265   3.785   -24.393 1.00 24.17 ? 276 ALA A HA   1 
ATOM   3911  H HB1  . ALA A 1 276 ? 5.965   3.987   -22.460 1.00 25.67 ? 276 ALA A HB1  1 
ATOM   3912  H HB2  . ALA A 1 276 ? 5.044   3.654   -23.711 1.00 25.67 ? 276 ALA A HB2  1 
ATOM   3913  H HB3  . ALA A 1 276 ? 5.420   2.510   -22.675 1.00 25.67 ? 276 ALA A HB3  1 
ATOM   3914  N N    . PHE A 1 277 ? 8.075   1.264   -22.574 1.00 20.06 ? 277 PHE A N    1 
ATOM   3915  C CA   . PHE A 1 277 ? 9.204   0.709   -21.822 1.00 23.13 ? 277 PHE A CA   1 
ATOM   3916  C C    . PHE A 1 277 ? 10.522  0.904   -22.569 1.00 22.28 ? 277 PHE A C    1 
ATOM   3917  O O    . PHE A 1 277 ? 11.511  1.406   -22.003 1.00 20.29 ? 277 PHE A O    1 
ATOM   3918  C CB   . PHE A 1 277 ? 8.929   -0.772  -21.558 1.00 25.82 ? 277 PHE A CB   1 
ATOM   3919  C CG   . PHE A 1 277 ? 10.025  -1.511  -20.841 1.00 23.32 ? 277 PHE A CG   1 
ATOM   3920  C CD1  . PHE A 1 277 ? 11.144  -1.971  -21.521 1.00 25.18 ? 277 PHE A CD1  1 
ATOM   3921  C CD2  . PHE A 1 277 ? 9.896   -1.810  -19.491 1.00 29.20 ? 277 PHE A CD2  1 
ATOM   3922  C CE1  . PHE A 1 277 ? 12.127  -2.676  -20.862 1.00 22.56 ? 277 PHE A CE1  1 
ATOM   3923  C CE2  . PHE A 1 277 ? 10.874  -2.516  -18.836 1.00 30.55 ? 277 PHE A CE2  1 
ATOM   3924  C CZ   . PHE A 1 277 ? 11.990  -2.947  -19.521 1.00 27.12 ? 277 PHE A CZ   1 
ATOM   3925  H H    . PHE A 1 277 ? 7.419   0.720   -22.688 1.00 24.05 ? 277 PHE A H    1 
ATOM   3926  H HA   . PHE A 1 277 ? 9.271   1.161   -20.967 1.00 27.74 ? 277 PHE A HA   1 
ATOM   3927  H HB2  . PHE A 1 277 ? 8.127   -0.844  -21.017 1.00 30.96 ? 277 PHE A HB2  1 
ATOM   3928  H HB3  . PHE A 1 277 ? 8.788   -1.215  -22.409 1.00 30.96 ? 277 PHE A HB3  1 
ATOM   3929  H HD1  . PHE A 1 277 ? 11.238  -1.788  -22.428 1.00 30.19 ? 277 PHE A HD1  1 
ATOM   3930  H HD2  . PHE A 1 277 ? 9.145   -1.521  -19.025 1.00 35.02 ? 277 PHE A HD2  1 
ATOM   3931  H HE1  . PHE A 1 277 ? 12.880  -2.968  -21.323 1.00 27.05 ? 277 PHE A HE1  1 
ATOM   3932  H HE2  . PHE A 1 277 ? 10.786  -2.699  -17.929 1.00 36.64 ? 277 PHE A HE2  1 
ATOM   3933  H HZ   . PHE A 1 277 ? 12.654  -3.421  -19.074 1.00 32.53 ? 277 PHE A HZ   1 
ATOM   3934  N N    . ALA A 1 278 ? 10.556  0.515   -23.847 1.00 17.98 ? 278 ALA A N    1 
ATOM   3935  C CA   . ALA A 1 278 ? 11.787  0.624   -24.626 1.00 19.57 ? 278 ALA A CA   1 
ATOM   3936  C C    . ALA A 1 278 ? 12.221  2.072   -24.786 1.00 23.79 ? 278 ALA A C    1 
ATOM   3937  O O    . ALA A 1 278 ? 13.407  2.367   -24.701 1.00 22.50 ? 278 ALA A O    1 
ATOM   3938  C CB   . ALA A 1 278 ? 11.628  -0.013  -26.010 1.00 17.49 ? 278 ALA A CB   1 
ATOM   3939  H H    . ALA A 1 278 ? 9.887   0.190   -24.280 1.00 21.55 ? 278 ALA A H    1 
ATOM   3940  H HA   . ALA A 1 278 ? 12.494  0.151   -24.160 1.00 23.46 ? 278 ALA A HA   1 
ATOM   3941  H HB1  . ALA A 1 278 ? 12.463  0.078   -26.497 1.00 20.96 ? 278 ALA A HB1  1 
ATOM   3942  H HB2  . ALA A 1 278 ? 11.408  -0.952  -25.903 1.00 20.96 ? 278 ALA A HB2  1 
ATOM   3943  H HB3  . ALA A 1 278 ? 10.916  0.441   -26.487 1.00 20.96 ? 278 ALA A HB3  1 
ATOM   3944  N N    . ARG A 1 279 ? 11.278  2.980   -25.034 1.00 18.74 ? 279 ARG A N    1 
ATOM   3945  C CA   . ARG A 1 279 ? 11.613  4.384   -25.303 1.00 19.87 ? 279 ARG A CA   1 
ATOM   3946  C C    . ARG A 1 279 ? 12.006  5.157   -24.059 1.00 22.22 ? 279 ARG A C    1 
ATOM   3947  O O    . ARG A 1 279 ? 12.762  6.130   -24.169 1.00 24.48 ? 279 ARG A O    1 
ATOM   3948  C CB   . ARG A 1 279 ? 10.433  5.119   -25.915 1.00 22.87 ? 279 ARG A CB   1 
ATOM   3949  C CG   . ARG A 1 279 ? 10.068  4.704   -27.317 1.00 22.11 ? 279 ARG A CG   1 
ATOM   3950  C CD   . ARG A 1 279 ? 9.034   5.689   -27.856 1.00 21.43 ? 279 ARG A CD   1 
ATOM   3951  N NE   . ARG A 1 279 ? 7.676   5.479   -27.374 1.00 17.87 ? 279 ARG A NE   1 
ATOM   3952  C CZ   . ARG A 1 279 ? 7.112   6.078   -26.325 1.00 22.69 ? 279 ARG A CZ   1 
ATOM   3953  N NH1  . ARG A 1 279 ? 7.771   6.957   -25.589 1.00 20.77 ? 279 ARG A NH1  1 
ATOM   3954  N NH2  . ARG A 1 279 ? 5.854   5.795   -26.010 1.00 19.02 ? 279 ARG A NH2  1 
ATOM   3955  H H    . ARG A 1 279 ? 10.435  2.811   -25.053 1.00 22.46 ? 279 ARG A H    1 
ATOM   3956  H HA   . ARG A 1 279 ? 12.353  4.421   -25.929 1.00 23.82 ? 279 ARG A HA   1 
ATOM   3957  H HB2  . ARG A 1 279 ? 9.655   4.970   -25.355 1.00 27.42 ? 279 ARG A HB2  1 
ATOM   3958  H HB3  . ARG A 1 279 ? 10.640  6.067   -25.936 1.00 27.42 ? 279 ARG A HB3  1 
ATOM   3959  H HG2  . ARG A 1 279 ? 10.854  4.734   -27.885 1.00 26.51 ? 279 ARG A HG2  1 
ATOM   3960  H HG3  . ARG A 1 279 ? 9.681   3.815   -27.308 1.00 26.51 ? 279 ARG A HG3  1 
ATOM   3961  H HD2  . ARG A 1 279 ? 9.299   6.586   -27.600 1.00 25.69 ? 279 ARG A HD2  1 
ATOM   3962  H HD3  . ARG A 1 279 ? 9.015   5.618   -28.823 1.00 25.69 ? 279 ARG A HD3  1 
ATOM   3963  H HE   . ARG A 1 279 ? 7.193   4.914   -27.807 1.00 21.43 ? 279 ARG A HE   1 
ATOM   3964  H HH11 . ARG A 1 279 ? 8.585   7.154   -25.782 1.00 24.90 ? 279 ARG A HH11 1 
ATOM   3965  H HH12 . ARG A 1 279 ? 7.386   7.330   -24.917 1.00 24.90 ? 279 ARG A HH12 1 
ATOM   3966  H HH21 . ARG A 1 279 ? 5.411   5.224   -26.477 1.00 22.81 ? 279 ARG A HH21 1 
ATOM   3967  H HH22 . ARG A 1 279 ? 5.485   6.175   -25.332 1.00 22.81 ? 279 ARG A HH22 1 
ATOM   3968  N N    . THR A 1 280 ? 11.427  4.827   -22.896 1.00 21.15 ? 280 THR A N    1 
ATOM   3969  C CA   . THR A 1 280 ? 11.568  5.681   -21.714 1.00 27.59 ? 280 THR A CA   1 
ATOM   3970  C C    . THR A 1 280 ? 12.371  5.069   -20.579 1.00 33.34 ? 280 THR A C    1 
ATOM   3971  O O    . THR A 1 280 ? 12.763  5.803   -19.665 1.00 31.81 ? 280 THR A O    1 
ATOM   3972  C CB   . THR A 1 280 ? 10.196  6.071   -21.133 1.00 24.51 ? 280 THR A CB   1 
ATOM   3973  O OG1  . THR A 1 280 ? 9.565   4.921   -20.548 1.00 27.89 ? 280 THR A OG1  1 
ATOM   3974  C CG2  . THR A 1 280 ? 9.308   6.666   -22.185 1.00 26.28 ? 280 THR A CG2  1 
ATOM   3975  H H    . THR A 1 280 ? 10.952  4.122   -22.768 1.00 25.36 ? 280 THR A H    1 
ATOM   3976  H HA   . THR A 1 280 ? 12.017  6.499   -21.980 1.00 33.09 ? 280 THR A HA   1 
ATOM   3977  H HB   . THR A 1 280 ? 10.328  6.740   -20.444 1.00 29.39 ? 280 THR A HB   1 
ATOM   3978  H HG1  . THR A 1 280 ? 9.456   4.326   -21.131 1.00 33.44 ? 280 THR A HG1  1 
ATOM   3979  H HG21 . THR A 1 280 ? 8.450   6.903   -21.799 1.00 31.52 ? 280 THR A HG21 1 
ATOM   3980  H HG22 . THR A 1 280 ? 9.719   7.463   -22.555 1.00 31.52 ? 280 THR A HG22 1 
ATOM   3981  H HG23 . THR A 1 280 ? 9.165   6.025   -22.899 1.00 31.52 ? 280 THR A HG23 1 
ATOM   3982  N N    . GLY A 1 281 ? 12.602  3.763   -20.588 1.00 26.58 ? 281 GLY A N    1 
ATOM   3983  C CA   . GLY A 1 281 ? 13.220  3.113   -19.456 1.00 26.29 ? 281 GLY A CA   1 
ATOM   3984  C C    . GLY A 1 281 ? 12.360  2.992   -18.211 1.00 26.10 ? 281 GLY A C    1 
ATOM   3985  O O    . GLY A 1 281 ? 12.868  2.555   -17.167 1.00 27.41 ? 281 GLY A O    1 
ATOM   3986  H H    . GLY A 1 281 ? 12.408  3.236   -21.239 1.00 31.87 ? 281 GLY A H    1 
ATOM   3987  H HA2  . GLY A 1 281 ? 13.487  2.218   -19.718 1.00 31.53 ? 281 GLY A HA2  1 
ATOM   3988  H HA3  . GLY A 1 281 ? 14.021  3.604   -19.215 1.00 31.53 ? 281 GLY A HA3  1 
ATOM   3989  N N    . LYS A 1 282 ? 11.096  3.388   -18.265 1.00 25.96 ? 282 LYS A N    1 
ATOM   3990  C CA   . LYS A 1 282 ? 10.180  3.144   -17.158 1.00 30.54 ? 282 LYS A CA   1 
ATOM   3991  C C    . LYS A 1 282 ? 9.862   1.661   -17.074 1.00 30.62 ? 282 LYS A C    1 
ATOM   3992  O O    . LYS A 1 282 ? 9.757   0.978   -18.093 1.00 33.62 ? 282 LYS A O    1 
ATOM   3993  C CB   . LYS A 1 282 ? 8.884   3.919   -17.344 1.00 32.04 ? 282 LYS A CB   1 
ATOM   3994  C CG   . LYS A 1 282 ? 8.994   5.401   -17.130 1.00 38.47 ? 282 LYS A CG   1 
ATOM   3995  C CD   . LYS A 1 282 ? 7.845   6.124   -17.788 1.00 38.72 ? 282 LYS A CD   1 
ATOM   3996  C CE   . LYS A 1 282 ? 7.865   7.604   -17.467 1.00 46.30 ? 282 LYS A CE   1 
ATOM   3997  N NZ   . LYS A 1 282 ? 6.642   8.291   -17.991 1.00 58.96 ? 282 LYS A NZ   1 
ATOM   3998  H H    . LYS A 1 282 ? 10.742  3.801   -18.931 1.00 31.13 ? 282 LYS A H    1 
ATOM   3999  H HA   . LYS A 1 282 ? 10.592  3.421   -16.325 1.00 36.63 ? 282 LYS A HA   1 
ATOM   4000  H HB2  . LYS A 1 282 ? 8.567   3.777   -18.250 1.00 38.43 ? 282 LYS A HB2  1 
ATOM   4001  H HB3  . LYS A 1 282 ? 8.229   3.580   -16.714 1.00 38.43 ? 282 LYS A HB3  1 
ATOM   4002  H HG2  . LYS A 1 282 ? 8.972   5.591   -16.179 1.00 46.15 ? 282 LYS A HG2  1 
ATOM   4003  H HG3  . LYS A 1 282 ? 9.822   5.722   -17.520 1.00 46.15 ? 282 LYS A HG3  1 
ATOM   4004  H HD2  . LYS A 1 282 ? 7.910   6.021   -18.750 1.00 46.44 ? 282 LYS A HD2  1 
ATOM   4005  H HD3  . LYS A 1 282 ? 7.008   5.755   -17.466 1.00 46.44 ? 282 LYS A HD3  1 
ATOM   4006  H HE2  . LYS A 1 282 ? 7.892   7.724   -16.505 1.00 55.53 ? 282 LYS A HE2  1 
ATOM   4007  H HE3  . LYS A 1 282 ? 8.643   8.011   -17.880 1.00 55.53 ? 282 LYS A HE3  1 
ATOM   4008  H HZ1  . LYS A 1 282 ? 6.673   9.159   -17.793 1.00 70.73 ? 282 LYS A HZ1  1 
ATOM   4009  H HZ2  . LYS A 1 282 ? 6.596   8.198   -18.875 1.00 70.73 ? 282 LYS A HZ2  1 
ATOM   4010  H HZ3  . LYS A 1 282 ? 5.913   7.936   -17.624 1.00 70.73 ? 282 LYS A HZ3  1 
ATOM   4011  N N    . SER A 1 283 ? 9.694   1.171   -15.848 1.00 30.98 ? 283 SER A N    1 
ATOM   4012  C CA   . SER A 1 283 ? 9.369   -0.233  -15.635 1.00 30.15 ? 283 SER A CA   1 
ATOM   4013  C C    . SER A 1 283 ? 7.949   -0.547  -16.100 1.00 27.21 ? 283 SER A C    1 
ATOM   4014  O O    . SER A 1 283 ? 7.092   0.331   -16.194 1.00 29.15 ? 283 SER A O    1 
ATOM   4015  C CB   . SER A 1 283 ? 9.482   -0.576  -14.161 1.00 30.10 ? 283 SER A CB   1 
ATOM   4016  O OG   . SER A 1 283 ? 8.426   0.045   -13.492 1.00 31.41 ? 283 SER A OG   1 
ATOM   4017  H H    . SER A 1 283 ? 9.762   1.631   -15.125 1.00 37.15 ? 283 SER A H    1 
ATOM   4018  H HA   . SER A 1 283 ? 9.989   -0.790  -16.132 1.00 36.16 ? 283 SER A HA   1 
ATOM   4019  H HB2  . SER A 1 283 ? 9.419   -1.538  -14.046 1.00 36.10 ? 283 SER A HB2  1 
ATOM   4020  H HB3  . SER A 1 283 ? 10.326  -0.246  -13.814 1.00 36.10 ? 283 SER A HB3  1 
ATOM   4021  H HG   . SER A 1 283 ? 8.465   -0.129  -12.671 1.00 37.68 ? 283 SER A HG   1 
ATOM   4022  N N    . ILE A 1 284 ? 7.687   -1.835  -16.348 1.00 26.54 ? 284 ILE A N    1 
ATOM   4023  C CA   . ILE A 1 284 ? 6.332   -2.261  -16.699 1.00 28.44 ? 284 ILE A CA   1 
ATOM   4024  C C    . ILE A 1 284 ? 5.351   -1.840  -15.618 1.00 29.61 ? 284 ILE A C    1 
ATOM   4025  O O    . ILE A 1 284 ? 4.242   -1.370  -15.914 1.00 29.72 ? 284 ILE A O    1 
ATOM   4026  C CB   . ILE A 1 284 ? 6.263   -3.785  -16.915 1.00 27.79 ? 284 ILE A CB   1 
ATOM   4027  C CG1  . ILE A 1 284 ? 7.171   -4.249  -18.065 1.00 29.65 ? 284 ILE A CG1  1 
ATOM   4028  C CG2  . ILE A 1 284 ? 4.799   -4.211  -17.141 1.00 31.83 ? 284 ILE A CG2  1 
ATOM   4029  C CD1  . ILE A 1 284 ? 6.736   -3.835  -19.416 1.00 24.99 ? 284 ILE A CD1  1 
ATOM   4030  H H    . ILE A 1 284 ? 8.267   -2.470  -16.319 1.00 31.82 ? 284 ILE A H    1 
ATOM   4031  H HA   . ILE A 1 284 ? 6.070   -1.829  -17.527 1.00 34.11 ? 284 ILE A HA   1 
ATOM   4032  H HB   . ILE A 1 284 ? 6.574   -4.214  -16.102 1.00 33.32 ? 284 ILE A HB   1 
ATOM   4033  H HG12 . ILE A 1 284 ? 8.060   -3.888  -17.921 1.00 35.56 ? 284 ILE A HG12 1 
ATOM   4034  H HG13 . ILE A 1 284 ? 7.209   -5.219  -18.055 1.00 35.56 ? 284 ILE A HG13 1 
ATOM   4035  H HG21 . ILE A 1 284 ? 4.767   -5.171  -17.276 1.00 38.17 ? 284 ILE A HG21 1 
ATOM   4036  H HG22 . ILE A 1 284 ? 4.276   -3.968  -16.361 1.00 38.17 ? 284 ILE A HG22 1 
ATOM   4037  H HG23 . ILE A 1 284 ? 4.455   -3.754  -17.925 1.00 38.17 ? 284 ILE A HG23 1 
ATOM   4038  H HD11 . ILE A 1 284 ? 7.368   -4.173  -20.069 1.00 29.97 ? 284 ILE A HD11 1 
ATOM   4039  H HD12 . ILE A 1 284 ? 5.854   -4.200  -19.589 1.00 29.97 ? 284 ILE A HD12 1 
ATOM   4040  H HD13 . ILE A 1 284 ? 6.706   -2.866  -19.454 1.00 29.97 ? 284 ILE A HD13 1 
ATOM   4041  N N    . GLU A 1 285 ? 5.714   -2.064  -14.348 1.00 32.59 ? 285 GLU A N    1 
ATOM   4042  C CA   . GLU A 1 285 ? 4.799   -1.738  -13.252 1.00 34.18 ? 285 GLU A CA   1 
ATOM   4043  C C    . GLU A 1 285 ? 4.452   -0.259  -13.273 1.00 35.05 ? 285 GLU A C    1 
ATOM   4044  O O    . GLU A 1 285 ? 3.280   0.118   -13.159 1.00 36.68 ? 285 GLU A O    1 
ATOM   4045  C CB   . GLU A 1 285 ? 5.415   -2.125  -11.903 1.00 26.84 ? 285 GLU A CB   1 
ATOM   4046  H H    . GLU A 1 285 ? 6.468   -2.396  -14.101 1.00 39.08 ? 285 GLU A H    1 
ATOM   4047  H HA   . GLU A 1 285 ? 3.978   -2.242  -13.364 1.00 40.99 ? 285 GLU A HA   1 
ATOM   4048  N N    . GLN A 1 286 ? 5.466   0.592   -13.451 1.00 33.68 ? 286 GLN A N    1 
ATOM   4049  C CA   . GLN A 1 286 ? 5.244   2.034   -13.493 1.00 33.05 ? 286 GLN A CA   1 
ATOM   4050  C C    . GLN A 1 286 ? 4.358   2.416   -14.663 1.00 35.83 ? 286 GLN A C    1 
ATOM   4051  O O    . GLN A 1 286 ? 3.460   3.257   -14.521 1.00 32.08 ? 286 GLN A O    1 
ATOM   4052  C CB   . GLN A 1 286 ? 6.591   2.766   -13.579 1.00 33.23 ? 286 GLN A CB   1 
ATOM   4053  H H    . GLN A 1 286 ? 6.288   0.358   -13.550 1.00 40.39 ? 286 GLN A H    1 
ATOM   4054  H HA   . GLN A 1 286 ? 4.802   2.311   -12.676 1.00 39.63 ? 286 GLN A HA   1 
ATOM   4055  N N    . LEU A 1 287 ? 4.605   1.815   -15.837 1.00 31.35 ? 287 LEU A N    1 
ATOM   4056  C CA   . LEU A 1 287 ? 3.788   2.102   -17.012 1.00 27.91 ? 287 LEU A CA   1 
ATOM   4057  C C    . LEU A 1 287 ? 2.366   1.608   -16.833 1.00 26.99 ? 287 LEU A C    1 
ATOM   4058  O O    . LEU A 1 287 ? 1.429   2.245   -17.310 1.00 29.53 ? 287 LEU A O    1 
ATOM   4059  C CB   . LEU A 1 287 ? 4.408   1.470   -18.258 1.00 21.53 ? 287 LEU A CB   1 
ATOM   4060  C CG   . LEU A 1 287 ? 5.632   2.242   -18.743 1.00 29.03 ? 287 LEU A CG   1 
ATOM   4061  C CD1  . LEU A 1 287 ? 6.514   1.409   -19.677 1.00 23.58 ? 287 LEU A CD1  1 
ATOM   4062  C CD2  . LEU A 1 287 ? 5.135   3.472   -19.425 1.00 27.19 ? 287 LEU A CD2  1 
ATOM   4063  H H    . LEU A 1 287 ? 5.234   1.244   -15.972 1.00 37.60 ? 287 LEU A H    1 
ATOM   4064  H HA   . LEU A 1 287 ? 3.757   3.062   -17.147 1.00 33.48 ? 287 LEU A HA   1 
ATOM   4065  H HB2  . LEU A 1 287 ? 4.685   0.563   -18.051 1.00 25.81 ? 287 LEU A HB2  1 
ATOM   4066  H HB3  . LEU A 1 287 ? 3.752   1.464   -18.972 1.00 25.81 ? 287 LEU A HB3  1 
ATOM   4067  H HG   . LEU A 1 287 ? 6.166   2.511   -17.979 1.00 34.81 ? 287 LEU A HG   1 
ATOM   4068  H HD11 . LEU A 1 287 ? 7.273   1.945   -19.954 1.00 28.28 ? 287 LEU A HD11 1 
ATOM   4069  H HD12 . LEU A 1 287 ? 6.820   0.621   -19.201 1.00 28.28 ? 287 LEU A HD12 1 
ATOM   4070  H HD13 . LEU A 1 287 ? 5.993   1.147   -20.452 1.00 28.28 ? 287 LEU A HD13 1 
ATOM   4071  H HD21 . LEU A 1 287 ? 5.894   3.984   -19.744 1.00 32.60 ? 287 LEU A HD21 1 
ATOM   4072  H HD22 . LEU A 1 287 ? 4.572   3.213   -20.171 1.00 32.60 ? 287 LEU A HD22 1 
ATOM   4073  H HD23 . LEU A 1 287 ? 4.624   3.998   -18.791 1.00 32.60 ? 287 LEU A HD23 1 
ATOM   4074  N N    . GLU A 1 288 ? 2.188   0.453   -16.188 1.00 32.14 ? 288 GLU A N    1 
ATOM   4075  C CA   . GLU A 1 288 ? 0.840   -0.010  -15.867 1.00 35.16 ? 288 GLU A CA   1 
ATOM   4076  C C    . GLU A 1 288 ? 0.100   1.023   -15.023 1.00 35.87 ? 288 GLU A C    1 
ATOM   4077  O O    . GLU A 1 288 ? -1.081  1.304   -15.267 1.00 33.88 ? 288 GLU A O    1 
ATOM   4078  C CB   . GLU A 1 288 ? 0.904   -1.348  -15.123 1.00 37.27 ? 288 GLU A CB   1 
ATOM   4079  C CG   . GLU A 1 288 ? 1.264   -2.542  -15.998 1.00 38.81 ? 288 GLU A CG   1 
ATOM   4080  C CD   . GLU A 1 288 ? 1.659   -3.790  -15.192 1.00 39.91 ? 288 GLU A CD   1 
ATOM   4081  O OE1  . GLU A 1 288 ? 2.026   -3.672  -13.997 1.00 37.04 ? 288 GLU A OE1  1 
ATOM   4082  O OE2  . GLU A 1 288 ? 1.616   -4.897  -15.771 1.00 34.39 ? 288 GLU A OE2  1 
ATOM   4083  H H    . GLU A 1 288 ? 2.820   -0.071  -15.930 1.00 38.55 ? 288 GLU A H    1 
ATOM   4084  H HA   . GLU A 1 288 ? 0.343   -0.143  -16.689 1.00 42.17 ? 288 GLU A HA   1 
ATOM   4085  H HB2  . GLU A 1 288 ? 1.574   -1.283  -14.425 1.00 44.70 ? 288 GLU A HB2  1 
ATOM   4086  H HB3  . GLU A 1 288 ? 0.037   -1.525  -14.727 1.00 44.70 ? 288 GLU A HB3  1 
ATOM   4087  H HG2  . GLU A 1 288 ? 0.498   -2.772  -16.546 1.00 46.55 ? 288 GLU A HG2  1 
ATOM   4088  H HG3  . GLU A 1 288 ? 2.015   -2.302  -16.563 1.00 46.55 ? 288 GLU A HG3  1 
ATOM   4089  N N    . LYS A 1 289 ? 0.783   1.584   -14.015 1.00 34.68 ? 289 LYS A N    1 
ATOM   4090  C CA   . LYS A 1 289 ? 0.186   2.626   -13.176 1.00 40.49 ? 289 LYS A CA   1 
ATOM   4091  C C    . LYS A 1 289 ? -0.187  3.853   -14.004 1.00 41.30 ? 289 LYS A C    1 
ATOM   4092  O O    . LYS A 1 289 ? -1.335  4.318   -13.974 1.00 43.53 ? 289 LYS A O    1 
ATOM   4093  C CB   . LYS A 1 289 ? 1.156   3.001   -12.056 1.00 31.57 ? 289 LYS A CB   1 
ATOM   4094  H H    . LYS A 1 289 ? 1.590   1.377   -13.800 1.00 41.59 ? 289 LYS A H    1 
ATOM   4095  H HA   . LYS A 1 289 ? -0.624  2.280   -12.769 1.00 48.56 ? 289 LYS A HA   1 
ATOM   4096  N N    . GLU A 1 290 ? 0.769   4.373   -14.783 1.00 40.96 ? 290 GLU A N    1 
ATOM   4097  C CA   . GLU A 1 290 ? 0.505   5.567   -15.588 1.00 36.00 ? 290 GLU A CA   1 
ATOM   4098  C C    . GLU A 1 290 ? -0.561  5.333   -16.648 1.00 37.32 ? 290 GLU A C    1 
ATOM   4099  O O    . GLU A 1 290 ? -1.394  6.213   -16.895 1.00 44.78 ? 290 GLU A O    1 
ATOM   4100  C CB   . GLU A 1 290 ? 1.787   6.052   -16.258 1.00 36.29 ? 290 GLU A CB   1 
ATOM   4101  C CG   . GLU A 1 290 ? 2.887   6.374   -15.295 1.00 42.68 ? 290 GLU A CG   1 
ATOM   4102  C CD   . GLU A 1 290 ? 4.063   7.019   -15.975 1.00 40.76 ? 290 GLU A CD   1 
ATOM   4103  O OE1  . GLU A 1 290 ? 4.012   7.212   -17.211 1.00 41.15 ? 290 GLU A OE1  1 
ATOM   4104  O OE2  . GLU A 1 290 ? 5.023   7.354   -15.262 1.00 42.43 ? 290 GLU A OE2  1 
ATOM   4105  H H    . GLU A 1 290 ? 1.566   4.059   -14.860 1.00 49.13 ? 290 GLU A H    1 
ATOM   4106  H HA   . GLU A 1 290 ? 0.190   6.274   -15.003 1.00 43.18 ? 290 GLU A HA   1 
ATOM   4107  H HB2  . GLU A 1 290 ? 2.109   5.359   -16.855 1.00 43.53 ? 290 GLU A HB2  1 
ATOM   4108  H HB3  . GLU A 1 290 ? 1.590   6.856   -16.763 1.00 43.53 ? 290 GLU A HB3  1 
ATOM   4109  H HG2  . GLU A 1 290 ? 2.553   6.989   -14.623 1.00 51.19 ? 290 GLU A HG2  1 
ATOM   4110  H HG3  . GLU A 1 290 ? 3.193   5.555   -14.875 1.00 51.19 ? 290 GLU A HG3  1 
ATOM   4111  N N    . LEU A 1 291 ? -0.526  4.188   -17.337 1.00 34.98 ? 291 LEU A N    1 
ATOM   4112  C CA   . LEU A 1 291 ? -1.339  4.024   -18.539 1.00 31.78 ? 291 LEU A CA   1 
ATOM   4113  C C    . LEU A 1 291 ? -2.565  3.120   -18.380 1.00 40.26 ? 291 LEU A C    1 
ATOM   4114  O O    . LEU A 1 291 ? -3.483  3.227   -19.200 1.00 34.77 ? 291 LEU A O    1 
ATOM   4115  C CB   . LEU A 1 291 ? -0.486  3.470   -19.692 1.00 36.99 ? 291 LEU A CB   1 
ATOM   4116  C CG   . LEU A 1 291 ? 0.724   4.309   -20.127 1.00 38.26 ? 291 LEU A CG   1 
ATOM   4117  C CD1  . LEU A 1 291 ? 1.585   3.653   -21.218 1.00 27.20 ? 291 LEU A CD1  1 
ATOM   4118  C CD2  . LEU A 1 291 ? 0.231   5.663   -20.588 1.00 38.74 ? 291 LEU A CD2  1 
ATOM   4119  H H    . LEU A 1 291 ? -0.047  3.503   -17.132 1.00 41.96 ? 291 LEU A H    1 
ATOM   4120  H HA   . LEU A 1 291 ? -1.660  4.899   -18.810 1.00 38.11 ? 291 LEU A HA   1 
ATOM   4121  H HB2  . LEU A 1 291 ? -0.149  2.600   -19.428 1.00 44.36 ? 291 LEU A HB2  1 
ATOM   4122  H HB3  . LEU A 1 291 ? -1.057  3.369   -20.470 1.00 44.36 ? 291 LEU A HB3  1 
ATOM   4123  H HG   . LEU A 1 291 ? 1.292   4.453   -19.354 1.00 45.89 ? 291 LEU A HG   1 
ATOM   4124  H HD11 . LEU A 1 291 ? 2.323   4.243   -21.435 1.00 32.61 ? 291 LEU A HD11 1 
ATOM   4125  H HD12 . LEU A 1 291 ? 1.924   2.807   -20.886 1.00 32.61 ? 291 LEU A HD12 1 
ATOM   4126  H HD13 . LEU A 1 291 ? 1.038   3.504   -22.005 1.00 32.61 ? 291 LEU A HD13 1 
ATOM   4127  H HD21 . LEU A 1 291 ? 0.991   6.198   -20.864 1.00 46.47 ? 291 LEU A HD21 1 
ATOM   4128  H HD22 . LEU A 1 291 ? -0.376  5.539   -21.335 1.00 46.47 ? 291 LEU A HD22 1 
ATOM   4129  H HD23 . LEU A 1 291 ? -0.231  6.097   -19.854 1.00 46.47 ? 291 LEU A HD23 1 
ATOM   4130  N N    . LEU A 1 292 ? -2.613  2.227   -17.377 1.00 42.09 ? 292 LEU A N    1 
ATOM   4131  C CA   . LEU A 1 292 ? -3.653  1.195   -17.322 1.00 44.87 ? 292 LEU A CA   1 
ATOM   4132  C C    . LEU A 1 292 ? -4.272  1.065   -15.926 1.00 45.35 ? 292 LEU A C    1 
ATOM   4133  O O    . LEU A 1 292 ? -4.730  -0.020  -15.544 1.00 41.33 ? 292 LEU A O    1 
ATOM   4134  C CB   . LEU A 1 292 ? -3.081  -0.158  -17.757 1.00 45.00 ? 292 LEU A CB   1 
ATOM   4135  C CG   . LEU A 1 292 ? -2.167  -0.242  -18.984 1.00 41.95 ? 292 LEU A CG   1 
ATOM   4136  C CD1  . LEU A 1 292 ? -1.546  -1.627  -19.077 1.00 36.17 ? 292 LEU A CD1  1 
ATOM   4137  C CD2  . LEU A 1 292 ? -2.923  0.044   -20.253 1.00 38.34 ? 292 LEU A CD2  1 
ATOM   4138  H H    . LEU A 1 292 ? -2.057  2.201   -16.722 1.00 50.49 ? 292 LEU A H    1 
ATOM   4139  H HA   . LEU A 1 292 ? -4.362  1.432   -17.940 1.00 53.82 ? 292 LEU A HA   1 
ATOM   4140  H HB2  . LEU A 1 292 ? -2.573  -0.512  -17.010 1.00 53.97 ? 292 LEU A HB2  1 
ATOM   4141  H HB3  . LEU A 1 292 ? -3.830  -0.749  -17.931 1.00 53.97 ? 292 LEU A HB3  1 
ATOM   4142  H HG   . LEU A 1 292 ? -1.453  0.409   -18.899 1.00 50.31 ? 292 LEU A HG   1 
ATOM   4143  H HD11 . LEU A 1 292 ? -0.971  -1.664  -19.858 1.00 43.39 ? 292 LEU A HD11 1 
ATOM   4144  H HD12 . LEU A 1 292 ? -1.026  -1.795  -18.275 1.00 43.39 ? 292 LEU A HD12 1 
ATOM   4145  H HD13 . LEU A 1 292 ? -2.254  -2.285  -19.156 1.00 43.39 ? 292 LEU A HD13 1 
ATOM   4146  H HD21 . LEU A 1 292 ? -2.312  -0.018  -21.004 1.00 45.99 ? 292 LEU A HD21 1 
ATOM   4147  H HD22 . LEU A 1 292 ? -3.634  -0.608  -20.349 1.00 45.99 ? 292 LEU A HD22 1 
ATOM   4148  H HD23 . LEU A 1 292 ? -3.296  0.938   -20.203 1.00 45.99 ? 292 LEU A HD23 1 
ATOM   4149  N N    . ASN A 1 293 ? -4.283  2.154   -15.152 1.00 45.94 ? 293 ASN A N    1 
ATOM   4150  C CA   . ASN A 1 293 ? -4.784  2.163   -13.766 1.00 41.13 ? 293 ASN A CA   1 
ATOM   4151  C C    . ASN A 1 293 ? -4.266  0.993   -12.936 1.00 44.15 ? 293 ASN A C    1 
ATOM   4152  O O    . ASN A 1 293 ? -4.984  0.430   -12.106 1.00 46.78 ? 293 ASN A O    1 
ATOM   4153  C CB   . ASN A 1 293 ? -6.307  2.181   -13.734 1.00 51.04 ? 293 ASN A CB   1 
ATOM   4154  C CG   . ASN A 1 293 ? -6.874  3.406   -14.382 1.00 56.24 ? 293 ASN A CG   1 
ATOM   4155  O OD1  . ASN A 1 293 ? -6.956  4.469   -13.760 1.00 53.00 ? 293 ASN A OD1  1 
ATOM   4156  N ND2  . ASN A 1 293 ? -7.267  3.275   -15.645 1.00 55.29 ? 293 ASN A ND2  1 
ATOM   4157  H H    . ASN A 1 293 ? -3.997  2.922   -15.412 1.00 55.11 ? 293 ASN A H    1 
ATOM   4158  H HA   . ASN A 1 293 ? -4.477  2.978   -13.338 1.00 49.33 ? 293 ASN A HA   1 
ATOM   4159  H HB2  . ASN A 1 293 ? -6.643  1.405   -14.210 1.00 61.23 ? 293 ASN A HB2  1 
ATOM   4160  H HB3  . ASN A 1 293 ? -6.605  2.162   -12.811 1.00 61.23 ? 293 ASN A HB3  1 
ATOM   4161  H HD21 . ASN A 1 293 ? -7.600  3.948   -16.064 1.00 66.33 ? 293 ASN A HD21 1 
ATOM   4162  H HD22 . ASN A 1 293 ? -7.191  2.516   -16.042 1.00 66.33 ? 293 ASN A HD22 1 
ATOM   4163  N N    . GLY A 1 294 ? -2.999  0.641   -13.124 1.00 41.62 ? 294 GLY A N    1 
ATOM   4164  C CA   . GLY A 1 294 ? -2.424  -0.453  -12.370 1.00 43.00 ? 294 GLY A CA   1 
ATOM   4165  C C    . GLY A 1 294 ? -2.881  -1.828  -12.789 1.00 39.39 ? 294 GLY A C    1 
ATOM   4166  O O    . GLY A 1 294 ? -2.396  -2.815  -12.225 1.00 47.75 ? 294 GLY A O    1 
ATOM   4167  H H    . GLY A 1 294 ? -2.460  1.019   -13.677 1.00 49.92 ? 294 GLY A H    1 
ATOM   4168  H HA2  . GLY A 1 294 ? -1.459  -0.420  -12.457 1.00 51.57 ? 294 GLY A HA2  1 
ATOM   4169  H HA3  . GLY A 1 294 ? -2.644  -0.338  -11.433 1.00 51.57 ? 294 GLY A HA3  1 
ATOM   4170  N N    . GLN A 1 295 ? -3.783  -1.930  -13.765 1.00 43.91 ? 295 GLN A N    1 
ATOM   4171  C CA   . GLN A 1 295 ? -4.103  -3.219  -14.370 1.00 49.75 ? 295 GLN A CA   1 
ATOM   4172  C C    . GLN A 1 295 ? -2.832  -3.897  -14.887 1.00 42.74 ? 295 GLN A C    1 
ATOM   4173  O O    . GLN A 1 295 ? -1.906  -3.238  -15.367 1.00 39.29 ? 295 GLN A O    1 
ATOM   4174  C CB   . GLN A 1 295 ? -5.107  -3.022  -15.513 1.00 41.37 ? 295 GLN A CB   1 
ATOM   4175  C CG   . GLN A 1 295 ? -6.484  -2.586  -15.075 1.00 51.97 ? 295 GLN A CG   1 
ATOM   4176  C CD   . GLN A 1 295 ? -7.501  -2.649  -16.201 1.00 56.26 ? 295 GLN A CD   1 
ATOM   4177  O OE1  . GLN A 1 295 ? -7.143  -2.666  -17.380 1.00 52.99 ? 295 GLN A OE1  1 
ATOM   4178  N NE2  . GLN A 1 295 ? -8.779  -2.708  -15.841 1.00 68.97 ? 295 GLN A NE2  1 
ATOM   4179  H H    . GLN A 1 295 ? -4.223  -1.268  -14.093 1.00 52.67 ? 295 GLN A H    1 
ATOM   4180  H HA   . GLN A 1 295 ? -4.508  -3.796  -13.703 1.00 59.67 ? 295 GLN A HA   1 
ATOM   4181  H HB2  . GLN A 1 295 ? -4.762  -2.345  -16.115 1.00 49.62 ? 295 GLN A HB2  1 
ATOM   4182  H HB3  . GLN A 1 295 ? -5.203  -3.862  -15.989 1.00 49.62 ? 295 GLN A HB3  1 
ATOM   4183  H HG2  . GLN A 1 295 ? -6.789  -3.168  -14.362 1.00 62.35 ? 295 GLN A HG2  1 
ATOM   4184  H HG3  . GLN A 1 295 ? -6.441  -1.669  -14.761 1.00 62.35 ? 295 GLN A HG3  1 
ATOM   4185  H HE21 . GLN A 1 295 ? -8.992  -2.697  -15.008 1.00 82.74 ? 295 GLN A HE21 1 
ATOM   4186  H HE22 . GLN A 1 295 ? -9.393  -2.747  -16.442 1.00 82.74 ? 295 GLN A HE22 1 
ATOM   4187  N N    . LYS A 1 296 ? -2.782  -5.224  -14.777 1.00 37.76 ? 296 LYS A N    1 
ATOM   4188  C CA   . LYS A 1 296 ? -1.576  -5.971  -15.099 1.00 35.16 ? 296 LYS A CA   1 
ATOM   4189  C C    . LYS A 1 296 ? -1.568  -6.293  -16.586 1.00 32.67 ? 296 LYS A C    1 
ATOM   4190  O O    . LYS A 1 296 ? -2.562  -6.783  -17.126 1.00 34.60 ? 296 LYS A O    1 
ATOM   4191  C CB   . LYS A 1 296 ? -1.476  -7.263  -14.275 1.00 37.12 ? 296 LYS A CB   1 
ATOM   4192  C CG   . LYS A 1 296 ? -0.683  -7.127  -12.966 1.00 44.17 ? 296 LYS A CG   1 
ATOM   4193  C CD   . LYS A 1 296 ? 0.835   -7.165  -13.184 1.00 44.45 ? 296 LYS A CD   1 
ATOM   4194  C CE   . LYS A 1 296 ? 1.547   -6.167  -12.276 1.00 41.92 ? 296 LYS A CE   1 
ATOM   4195  N NZ   . LYS A 1 296 ? 3.020   -6.077  -12.496 1.00 40.58 ? 296 LYS A NZ   1 
ATOM   4196  H H    . LYS A 1 296 ? -3.439  -5.714  -14.517 1.00 45.29 ? 296 LYS A H    1 
ATOM   4197  H HA   . LYS A 1 296 ? -0.799  -5.424  -14.902 1.00 42.18 ? 296 LYS A HA   1 
ATOM   4198  H HB2  . LYS A 1 296 ? -2.372  -7.555  -14.047 1.00 44.52 ? 296 LYS A HB2  1 
ATOM   4199  H HB3  . LYS A 1 296 ? -1.039  -7.941  -14.815 1.00 44.52 ? 296 LYS A HB3  1 
ATOM   4200  H HG2  . LYS A 1 296 ? -0.905  -6.281  -12.548 1.00 52.99 ? 296 LYS A HG2  1 
ATOM   4201  H HG3  . LYS A 1 296 ? -0.920  -7.861  -12.376 1.00 52.99 ? 296 LYS A HG3  1 
ATOM   4202  H HD2  . LYS A 1 296 ? 1.167   -8.053  -12.980 1.00 53.32 ? 296 LYS A HD2  1 
ATOM   4203  H HD3  . LYS A 1 296 ? 1.033   -6.935  -14.105 1.00 53.32 ? 296 LYS A HD3  1 
ATOM   4204  H HE2  . LYS A 1 296 ? 1.172   -5.286  -12.429 1.00 50.28 ? 296 LYS A HE2  1 
ATOM   4205  H HE3  . LYS A 1 296 ? 1.402   -6.428  -11.353 1.00 50.28 ? 296 LYS A HE3  1 
ATOM   4206  H HZ1  . LYS A 1 296 ? 3.375   -5.481  -11.938 1.00 48.67 ? 296 LYS A HZ1  1 
ATOM   4207  H HZ2  . LYS A 1 296 ? 3.398   -6.870  -12.350 1.00 48.67 ? 296 LYS A HZ2  1 
ATOM   4208  H HZ3  . LYS A 1 296 ? 3.188   -5.826  -13.333 1.00 48.67 ? 296 LYS A HZ3  1 
ATOM   4209  N N    . LEU A 1 297 ? -0.445  -6.011  -17.234 1.00 33.09 ? 297 LEU A N    1 
ATOM   4210  C CA   . LEU A 1 297 ? -0.262  -6.305  -18.650 1.00 29.90 ? 297 LEU A CA   1 
ATOM   4211  C C    . LEU A 1 297 ? 0.038   -7.795  -18.797 1.00 29.11 ? 297 LEU A C    1 
ATOM   4212  O O    . LEU A 1 297 ? 0.957   -8.310  -18.149 1.00 28.30 ? 297 LEU A O    1 
ATOM   4213  C CB   . LEU A 1 297 ? 0.867   -5.440  -19.209 1.00 29.42 ? 297 LEU A CB   1 
ATOM   4214  C CG   . LEU A 1 297 ? 0.951   -5.264  -20.716 1.00 27.25 ? 297 LEU A CG   1 
ATOM   4215  C CD1  . LEU A 1 297 ? -0.206  -4.362  -21.163 1.00 24.66 ? 297 LEU A CD1  1 
ATOM   4216  C CD2  . LEU A 1 297 ? 2.361   -4.707  -21.110 1.00 25.01 ? 297 LEU A CD2  1 
ATOM   4217  H H    . LEU A 1 297 ? 0.241   -5.642  -16.868 1.00 39.68 ? 297 LEU A H    1 
ATOM   4218  H HA   . LEU A 1 297 ? -1.078  -6.103  -19.134 1.00 35.86 ? 297 LEU A HA   1 
ATOM   4219  H HB2  . LEU A 1 297 ? 0.780   -4.553  -18.827 1.00 35.28 ? 297 LEU A HB2  1 
ATOM   4220  H HB3  . LEU A 1 297 ? 1.709   -5.827  -18.923 1.00 35.28 ? 297 LEU A HB3  1 
ATOM   4221  H HG   . LEU A 1 297 ? 0.840   -6.129  -21.142 1.00 32.68 ? 297 LEU A HG   1 
ATOM   4222  H HD11 . LEU A 1 297 ? -0.161  -4.244  -22.124 1.00 29.57 ? 297 LEU A HD11 1 
ATOM   4223  H HD12 . LEU A 1 297 ? -1.046  -4.782  -20.920 1.00 29.57 ? 297 LEU A HD12 1 
ATOM   4224  H HD13 . LEU A 1 297 ? -0.125  -3.503  -20.719 1.00 29.57 ? 297 LEU A HD13 1 
ATOM   4225  H HD21 . LEU A 1 297 ? 2.400   -4.601  -22.074 1.00 29.99 ? 297 LEU A HD21 1 
ATOM   4226  H HD22 . LEU A 1 297 ? 2.494   -3.850  -20.677 1.00 29.99 ? 297 LEU A HD22 1 
ATOM   4227  H HD23 . LEU A 1 297 ? 3.041   -5.335  -20.819 1.00 29.99 ? 297 LEU A HD23 1 
ATOM   4228  N N    . GLN A 1 298 ? -0.757  -8.499  -19.611 1.00 29.05 ? 298 GLN A N    1 
ATOM   4229  C CA   . GLN A 1 298 ? -0.724  -9.961  -19.570 1.00 28.34 ? 298 GLN A CA   1 
ATOM   4230  C C    . GLN A 1 298 ? 0.453   -10.555 -20.324 1.00 23.33 ? 298 GLN A C    1 
ATOM   4231  O O    . GLN A 1 298 ? 0.851   -11.693 -20.046 1.00 22.82 ? 298 GLN A O    1 
ATOM   4232  C CB   . GLN A 1 298 ? -2.028  -10.545 -20.123 1.00 30.78 ? 298 GLN A CB   1 
ATOM   4233  C CG   . GLN A 1 298 ? -3.184  -10.548 -19.087 1.00 36.49 ? 298 GLN A CG   1 
ATOM   4234  C CD   . GLN A 1 298 ? -2.769  -11.014 -17.677 1.00 46.47 ? 298 GLN A CD   1 
ATOM   4235  O OE1  . GLN A 1 298 ? -2.223  -12.116 -17.486 1.00 47.62 ? 298 GLN A OE1  1 
ATOM   4236  N NE2  . GLN A 1 298 ? -3.015  -10.162 -16.685 1.00 43.31 ? 298 GLN A NE2  1 
ATOM   4237  H H    . GLN A 1 298 ? -1.309  -8.163  -20.180 1.00 34.84 ? 298 GLN A H    1 
ATOM   4238  H HA   . GLN A 1 298 ? -0.648  -10.241 -18.644 1.00 33.98 ? 298 GLN A HA   1 
ATOM   4239  H HB2  . GLN A 1 298 ? -2.311  -10.016 -20.885 1.00 36.92 ? 298 GLN A HB2  1 
ATOM   4240  H HB3  . GLN A 1 298 ? -1.870  -11.462 -20.397 1.00 36.92 ? 298 GLN A HB3  1 
ATOM   4241  H HG2  . GLN A 1 298 ? -3.534  -9.647  -19.009 1.00 43.76 ? 298 GLN A HG2  1 
ATOM   4242  H HG3  . GLN A 1 298 ? -3.882  -11.144 -19.401 1.00 43.76 ? 298 GLN A HG3  1 
ATOM   4243  H HE21 . GLN A 1 298 ? -3.391  -9.406  -16.851 1.00 51.96 ? 298 GLN A HE21 1 
ATOM   4244  H HE22 . GLN A 1 298 ? -2.803  -10.369 -15.878 1.00 51.96 ? 298 GLN A HE22 1 
ATOM   4245  N N    . GLY A 1 299 ? 1.004   -9.833  -21.282 1.00 18.98 ? 299 GLY A N    1 
ATOM   4246  C CA   . GLY A 1 299 ? 2.093   -10.362 -22.072 1.00 19.02 ? 299 GLY A CA   1 
ATOM   4247  C C    . GLY A 1 299 ? 3.298   -10.706 -21.232 1.00 22.33 ? 299 GLY A C    1 
ATOM   4248  O O    . GLY A 1 299 ? 3.863   -11.799 -21.323 1.00 17.65 ? 299 GLY A O    1 
ATOM   4249  H H    . GLY A 1 299 ? 0.764   -9.035  -21.494 1.00 22.76 ? 299 GLY A H    1 
ATOM   4250  H HA2  . GLY A 1 299 ? 1.799   -11.164 -22.531 1.00 22.80 ? 299 GLY A HA2  1 
ATOM   4251  H HA3  . GLY A 1 299 ? 2.358   -9.706  -22.736 1.00 22.80 ? 299 GLY A HA3  1 
ATOM   4252  N N    . PRO A 1 300 ? 3.730   -9.769  -20.399 1.00 20.83 ? 300 PRO A N    1 
ATOM   4253  C CA   . PRO A 1 300 ? 4.856   -10.099 -19.516 1.00 20.00 ? 300 PRO A CA   1 
ATOM   4254  C C    . PRO A 1 300 ? 4.513   -11.222 -18.548 1.00 19.19 ? 300 PRO A C    1 
ATOM   4255  O O    . PRO A 1 300 ? 5.338   -12.114 -18.302 1.00 20.10 ? 300 PRO A O    1 
ATOM   4256  C CB   . PRO A 1 300 ? 5.148   -8.760  -18.829 1.00 19.57 ? 300 PRO A CB   1 
ATOM   4257  C CG   . PRO A 1 300 ? 4.668   -7.704  -19.826 1.00 23.54 ? 300 PRO A CG   1 
ATOM   4258  C CD   . PRO A 1 300 ? 3.406   -8.326  -20.388 1.00 20.00 ? 300 PRO A CD   1 
ATOM   4259  H HA   . PRO A 1 300 ? 5.628   -10.359 -20.043 1.00 23.98 ? 300 PRO A HA   1 
ATOM   4260  H HB2  . PRO A 1 300 ? 4.650   -8.701  -17.998 1.00 23.47 ? 300 PRO A HB2  1 
ATOM   4261  H HB3  . PRO A 1 300 ? 6.100   -8.673  -18.667 1.00 23.47 ? 300 PRO A HB3  1 
ATOM   4262  H HG2  . PRO A 1 300 ? 4.473   -6.873  -19.365 1.00 28.22 ? 300 PRO A HG2  1 
ATOM   4263  H HG3  . PRO A 1 300 ? 5.333   -7.574  -20.520 1.00 28.22 ? 300 PRO A HG3  1 
ATOM   4264  H HD2  . PRO A 1 300 ? 2.651   -8.151  -19.805 1.00 23.98 ? 300 PRO A HD2  1 
ATOM   4265  H HD3  . PRO A 1 300 ? 3.243   -8.008  -21.290 1.00 23.98 ? 300 PRO A HD3  1 
ATOM   4266  N N    . GLU A 1 301 ? 3.300   -11.225 -18.001 1.00 20.52 ? 301 GLU A N    1 
ATOM   4267  C CA   . GLU A 1 301 ? 2.934   -12.272 -17.046 1.00 29.09 ? 301 GLU A CA   1 
ATOM   4268  C C    . GLU A 1 301 ? 2.954   -13.637 -17.708 1.00 21.85 ? 301 GLU A C    1 
ATOM   4269  O O    . GLU A 1 301 ? 3.430   -14.608 -17.122 1.00 21.70 ? 301 GLU A O    1 
ATOM   4270  C CB   . GLU A 1 301 ? 1.550   -12.014 -16.436 1.00 31.47 ? 301 GLU A CB   1 
ATOM   4271  C CG   . GLU A 1 301 ? 1.373   -10.633 -15.924 1.00 38.95 ? 301 GLU A CG   1 
ATOM   4272  C CD   . GLU A 1 301 ? 0.755   -10.614 -14.556 1.00 53.72 ? 301 GLU A CD   1 
ATOM   4273  O OE1  . GLU A 1 301 ? -0.498  -10.696 -14.475 1.00 54.03 ? 301 GLU A OE1  1 
ATOM   4274  O OE2  . GLU A 1 301 ? 1.533   -10.532 -13.574 1.00 52.27 ? 301 GLU A OE2  1 
ATOM   4275  H H    . GLU A 1 301 ? 2.683   -10.648 -18.159 1.00 24.60 ? 301 GLU A H    1 
ATOM   4276  H HA   . GLU A 1 301 ? 3.582   -12.280 -16.325 1.00 34.88 ? 301 GLU A HA   1 
ATOM   4277  H HB2  . GLU A 1 301 ? 0.875   -12.167 -17.115 1.00 37.74 ? 301 GLU A HB2  1 
ATOM   4278  H HB3  . GLU A 1 301 ? 1.416   -12.625 -15.694 1.00 37.74 ? 301 GLU A HB3  1 
ATOM   4279  H HG2  . GLU A 1 301 ? 2.239   -10.200 -15.870 1.00 46.71 ? 301 GLU A HG2  1 
ATOM   4280  H HG3  . GLU A 1 301 ? 0.791   -10.143 -16.525 1.00 46.71 ? 301 GLU A HG3  1 
ATOM   4281  N N    . THR A 1 302 ? 2.461   -13.723 -18.939 1.00 19.03 ? 302 THR A N    1 
ATOM   4282  C CA   . THR A 1 302 ? 2.487   -14.982 -19.659 1.00 21.58 ? 302 THR A CA   1 
ATOM   4283  C C    . THR A 1 302 ? 3.915   -15.417 -19.923 1.00 16.92 ? 302 THR A C    1 
ATOM   4284  O O    . THR A 1 302 ? 4.229   -16.606 -19.826 1.00 16.59 ? 302 THR A O    1 
ATOM   4285  C CB   . THR A 1 302 ? 1.702   -14.847 -20.963 1.00 18.96 ? 302 THR A CB   1 
ATOM   4286  O OG1  . THR A 1 302 ? 0.340   -14.611 -20.638 1.00 21.60 ? 302 THR A OG1  1 
ATOM   4287  C CG2  . THR A 1 302 ? 1.782   -16.106 -21.821 1.00 21.05 ? 302 THR A CG2  1 
ATOM   4288  H H    . THR A 1 302 ? 2.108   -13.070 -19.373 1.00 22.82 ? 302 THR A H    1 
ATOM   4289  H HA   . THR A 1 302 ? 2.059   -15.665 -19.120 1.00 25.87 ? 302 THR A HA   1 
ATOM   4290  H HB   . THR A 1 302 ? 2.048   -14.100 -21.476 1.00 22.73 ? 302 THR A HB   1 
ATOM   4291  H HG1  . THR A 1 302 ? 0.270   -13.905 -20.189 1.00 25.90 ? 302 THR A HG1  1 
ATOM   4292  H HG21 . THR A 1 302 ? 1.273   -15.983 -22.638 1.00 25.23 ? 302 THR A HG21 1 
ATOM   4293  H HG22 . THR A 1 302 ? 2.706   -16.293 -22.050 1.00 25.23 ? 302 THR A HG22 1 
ATOM   4294  H HG23 . THR A 1 302 ? 1.419   -16.862 -21.334 1.00 25.23 ? 302 THR A HG23 1 
ATOM   4295  N N    . ALA A 1 303 ? 4.797   -14.460 -20.245 1.00 16.00 ? 303 ALA A N    1 
ATOM   4296  C CA   . ALA A 1 303 ? 6.197   -14.779 -20.482 1.00 17.55 ? 303 ALA A CA   1 
ATOM   4297  C C    . ALA A 1 303 ? 6.843   -15.403 -19.250 1.00 18.03 ? 303 ALA A C    1 
ATOM   4298  O O    . ALA A 1 303 ? 7.688   -16.302 -19.372 1.00 21.24 ? 303 ALA A O    1 
ATOM   4299  C CB   . ALA A 1 303 ? 6.948   -13.518 -20.905 1.00 15.99 ? 303 ALA A CB   1 
ATOM   4300  H H    . ALA A 1 303 ? 4.604   -13.626 -20.331 1.00 19.18 ? 303 ALA A H    1 
ATOM   4301  H HA   . ALA A 1 303 ? 6.256   -15.420 -21.207 1.00 21.04 ? 303 ALA A HA   1 
ATOM   4302  H HB1  . ALA A 1 303 ? 7.879   -13.743 -21.059 1.00 19.16 ? 303 ALA A HB1  1 
ATOM   4303  H HB2  . ALA A 1 303 ? 6.551   -13.174 -21.720 1.00 19.16 ? 303 ALA A HB2  1 
ATOM   4304  H HB3  . ALA A 1 303 ? 6.880   -12.858 -20.198 1.00 19.16 ? 303 ALA A HB3  1 
ATOM   4305  N N    . ARG A 1 304 ? 6.470   -14.953 -18.065 1.00 16.99 ? 304 ARG A N    1 
ATOM   4306  C CA   . ARG A 1 304 ? 7.030   -15.533 -16.820 1.00 21.75 ? 304 ARG A CA   1 
ATOM   4307  C C    . ARG A 1 304 ? 6.587   -16.996 -16.740 1.00 20.67 ? 304 ARG A C    1 
ATOM   4308  O O    . ARG A 1 304 ? 7.391   -17.822 -16.404 1.00 22.56 ? 304 ARG A O    1 
ATOM   4309  C CB   . ARG A 1 304 ? 6.586   -14.783 -15.563 1.00 26.50 ? 304 ARG A CB   1 
ATOM   4310  C CG   . ARG A 1 304 ? 6.859   -15.553 -14.281 1.00 34.80 ? 304 ARG A CG   1 
ATOM   4311  C CD   . ARG A 1 304 ? 6.236   -14.987 -13.031 1.00 39.55 ? 304 ARG A CD   1 
ATOM   4312  N NE   . ARG A 1 304 ? 6.706   -13.663 -12.800 1.00 38.87 ? 304 ARG A NE   1 
ATOM   4313  C CZ   . ARG A 1 304 ? 7.897   -13.391 -12.317 1.00 38.82 ? 304 ARG A CZ   1 
ATOM   4314  N NH1  . ARG A 1 304 ? 8.393   -12.184 -12.452 1.00 41.10 ? 304 ARG A NH1  1 
ATOM   4315  N NH2  . ARG A 1 304 ? 8.585   -14.314 -11.681 1.00 43.55 ? 304 ARG A NH2  1 
ATOM   4316  H H    . ARG A 1 304 ? 5.867   -14.282 -17.944 1.00 20.37 ? 304 ARG A H    1 
ATOM   4317  H HA   . ARG A 1 304 ? 8.013   -15.504 -16.878 1.00 26.08 ? 304 ARG A HA   1 
ATOM   4318  H HB2  . ARG A 1 304 ? 7.056   -13.924 -15.526 1.00 31.78 ? 304 ARG A HB2  1 
ATOM   4319  H HB3  . ARG A 1 304 ? 5.625   -14.601 -15.627 1.00 31.78 ? 304 ARG A HB3  1 
ATOM   4320  H HG2  . ARG A 1 304 ? 6.536   -16.471 -14.378 1.00 41.74 ? 304 ARG A HG2  1 
ATOM   4321  H HG3  . ARG A 1 304 ? 7.829   -15.600 -14.146 1.00 41.74 ? 304 ARG A HG3  1 
ATOM   4322  H HD2  . ARG A 1 304 ? 5.260   -14.977 -13.126 1.00 47.43 ? 304 ARG A HD2  1 
ATOM   4323  H HD3  . ARG A 1 304 ? 6.464   -15.554 -12.264 1.00 47.43 ? 304 ARG A HD3  1 
ATOM   4324  H HE   . ARG A 1 304 ? 6.176   -12.996 -12.988 1.00 46.62 ? 304 ARG A HE   1 
ATOM   4325  H HH11 . ARG A 1 304 ? 7.979   -11.595 -12.956 1.00 49.30 ? 304 ARG A HH11 1 
ATOM   4326  H HH12 . ARG A 1 304 ? 9.137   -11.969 -12.037 1.00 49.30 ? 304 ARG A HH12 1 
ATOM   4327  H HH21 . ARG A 1 304 ? 8.316   -15.152 -11.701 1.00 52.24 ? 304 ARG A HH21 1 
ATOM   4328  H HH22 . ARG A 1 304 ? 9.312   -14.090 -11.237 1.00 52.24 ? 304 ARG A HH22 1 
ATOM   4329  N N    . GLU A 1 305 ? 5.328   -17.274 -17.038 1.00 19.18 ? 305 GLU A N    1 
ATOM   4330  C CA   . GLU A 1 305 ? 4.801   -18.632 -16.972 1.00 21.66 ? 305 GLU A CA   1 
ATOM   4331  C C    . GLU A 1 305 ? 5.472   -19.521 -17.999 1.00 21.83 ? 305 GLU A C    1 
ATOM   4332  O O    . GLU A 1 305 ? 5.802   -20.674 -17.705 1.00 19.73 ? 305 GLU A O    1 
ATOM   4333  C CB   . GLU A 1 305 ? 3.283   -18.628 -17.175 1.00 22.16 ? 305 GLU A CB   1 
ATOM   4334  C CG   . GLU A 1 305 ? 2.534   -17.935 -16.064 1.00 32.66 ? 305 GLU A CG   1 
ATOM   4335  C CD   . GLU A 1 305 ? 2.904   -18.522 -14.694 1.00 40.04 ? 305 GLU A CD   1 
ATOM   4336  O OE1  . GLU A 1 305 ? 2.814   -19.768 -14.546 1.00 38.50 ? 305 GLU A OE1  1 
ATOM   4337  O OE2  . GLU A 1 305 ? 3.353   -17.755 -13.800 1.00 38.91 ? 305 GLU A OE2  1 
ATOM   4338  H H    . GLU A 1 305 ? 4.757   -16.687 -17.298 1.00 22.99 ? 305 GLU A H    1 
ATOM   4339  H HA   . GLU A 1 305 ? 4.985   -18.999 -16.093 1.00 25.97 ? 305 GLU A HA   1 
ATOM   4340  H HB2  . GLU A 1 305 ? 3.079   -18.169 -18.004 1.00 26.57 ? 305 GLU A HB2  1 
ATOM   4341  H HB3  . GLU A 1 305 ? 2.970   -19.545 -17.218 1.00 26.57 ? 305 GLU A HB3  1 
ATOM   4342  H HG2  . GLU A 1 305 ? 2.762   -16.992 -16.063 1.00 39.17 ? 305 GLU A HG2  1 
ATOM   4343  H HG3  . GLU A 1 305 ? 1.580   -18.051 -16.199 1.00 39.17 ? 305 GLU A HG3  1 
ATOM   4344  N N    . LEU A 1 306 ? 5.693   -19.001 -19.216 1.00 20.29 ? 306 LEU A N    1 
ATOM   4345  C CA   . LEU A 1 306 ? 6.444   -19.759 -20.204 1.00 16.54 ? 306 LEU A CA   1 
ATOM   4346  C C    . LEU A 1 306 ? 7.828   -20.102 -19.697 1.00 21.63 ? 306 LEU A C    1 
ATOM   4347  O O    . LEU A 1 306 ? 8.319   -21.216 -19.899 1.00 17.51 ? 306 LEU A O    1 
ATOM   4348  C CB   . LEU A 1 306 ? 6.569   -18.973 -21.502 1.00 18.39 ? 306 LEU A CB   1 
ATOM   4349  C CG   . LEU A 1 306 ? 5.264   -18.745 -22.242 1.00 18.07 ? 306 LEU A CG   1 
ATOM   4350  C CD1  . LEU A 1 306 ? 5.513   -17.878 -23.449 1.00 18.92 ? 306 LEU A CD1  1 
ATOM   4351  C CD2  . LEU A 1 306 ? 4.653   -20.063 -22.684 1.00 20.78 ? 306 LEU A CD2  1 
ATOM   4352  H H    . LEU A 1 306 ? 5.422   -18.230 -19.482 1.00 24.33 ? 306 LEU A H    1 
ATOM   4353  H HA   . LEU A 1 306 ? 5.976   -20.587 -20.394 1.00 19.83 ? 306 LEU A HA   1 
ATOM   4354  H HB2  . LEU A 1 306 ? 6.947   -18.103 -21.300 1.00 22.04 ? 306 LEU A HB2  1 
ATOM   4355  H HB3  . LEU A 1 306 ? 7.163   -19.455 -22.098 1.00 22.04 ? 306 LEU A HB3  1 
ATOM   4356  H HG   . LEU A 1 306 ? 4.634   -18.291 -21.660 1.00 21.67 ? 306 LEU A HG   1 
ATOM   4357  H HD11 . LEU A 1 306 ? 4.674   -17.738 -23.915 1.00 22.68 ? 306 LEU A HD11 1 
ATOM   4358  H HD12 . LEU A 1 306 ? 5.876   -17.027 -23.156 1.00 22.68 ? 306 LEU A HD12 1 
ATOM   4359  H HD13 . LEU A 1 306 ? 6.146   -18.325 -24.033 1.00 22.68 ? 306 LEU A HD13 1 
ATOM   4360  H HD21 . LEU A 1 306 ? 3.823   -19.884 -23.153 1.00 24.91 ? 306 LEU A HD21 1 
ATOM   4361  H HD22 . LEU A 1 306 ? 5.276   -20.516 -23.274 1.00 24.91 ? 306 LEU A HD22 1 
ATOM   4362  H HD23 . LEU A 1 306 ? 4.481   -20.609 -21.901 1.00 24.91 ? 306 LEU A HD23 1 
ATOM   4363  N N    . TYR A 1 307 ? 8.503   -19.129 -19.098 1.00 18.98 ? 307 TYR A N    1 
ATOM   4364  C CA   . TYR A 1 307 ? 9.840   -19.379 -18.586 1.00 22.61 ? 307 TYR A CA   1 
ATOM   4365  C C    . TYR A 1 307 ? 9.844   -20.581 -17.648 1.00 21.67 ? 307 TYR A C    1 
ATOM   4366  O O    . TYR A 1 307 ? 10.701  -21.461 -17.745 1.00 25.57 ? 307 TYR A O    1 
ATOM   4367  C CB   . TYR A 1 307 ? 10.361  -18.138 -17.868 1.00 23.66 ? 307 TYR A CB   1 
ATOM   4368  C CG   . TYR A 1 307 ? 11.662  -18.409 -17.155 1.00 25.44 ? 307 TYR A CG   1 
ATOM   4369  C CD1  . TYR A 1 307 ? 12.840  -18.529 -17.867 1.00 32.91 ? 307 TYR A CD1  1 
ATOM   4370  C CD2  . TYR A 1 307 ? 11.692  -18.598 -15.787 1.00 32.12 ? 307 TYR A CD2  1 
ATOM   4371  C CE1  . TYR A 1 307 ? 14.035  -18.803 -17.229 1.00 38.61 ? 307 TYR A CE1  1 
ATOM   4372  C CE2  . TYR A 1 307 ? 12.873  -18.875 -15.132 1.00 40.10 ? 307 TYR A CE2  1 
ATOM   4373  C CZ   . TYR A 1 307 ? 14.051  -18.979 -15.859 1.00 42.12 ? 307 TYR A CZ   1 
ATOM   4374  O OH   . TYR A 1 307 ? 15.242  -19.258 -15.208 1.00 45.06 ? 307 TYR A OH   1 
ATOM   4375  H H    . TYR A 1 307 ? 8.214   -18.328 -18.978 1.00 22.76 ? 307 TYR A H    1 
ATOM   4376  H HA   . TYR A 1 307 ? 10.435  -19.571 -19.327 1.00 27.11 ? 307 TYR A HA   1 
ATOM   4377  H HB2  . TYR A 1 307 ? 10.512  -17.433 -18.517 1.00 28.37 ? 307 TYR A HB2  1 
ATOM   4378  H HB3  . TYR A 1 307 ? 9.708   -17.852 -17.209 1.00 28.37 ? 307 TYR A HB3  1 
ATOM   4379  H HD1  . TYR A 1 307 ? 12.831  -18.413 -18.790 1.00 39.47 ? 307 TYR A HD1  1 
ATOM   4380  H HD2  . TYR A 1 307 ? 10.903  -18.531 -15.298 1.00 38.52 ? 307 TYR A HD2  1 
ATOM   4381  H HE1  . TYR A 1 307 ? 14.823  -18.874 -17.720 1.00 46.31 ? 307 TYR A HE1  1 
ATOM   4382  H HE2  . TYR A 1 307 ? 12.881  -18.992 -14.210 1.00 48.10 ? 307 TYR A HE2  1 
ATOM   4383  H HH   . TYR A 1 307 ? 15.107  -19.340 -14.383 1.00 54.05 ? 307 TYR A HH   1 
ATOM   4384  N N    . SER A 1 308 ? 8.925   -20.623 -16.694 1.00 23.37 ? 308 SER A N    1 
ATOM   4385  C CA   . SER A 1 308 ? 8.824   -21.722 -15.696 1.00 25.32 ? 308 SER A CA   1 
ATOM   4386  C C    . SER A 1 308 ? 8.569   -23.022 -16.426 1.00 24.05 ? 308 SER A C    1 
ATOM   4387  O O    . SER A 1 308 ? 9.227   -23.962 -16.135 1.00 24.73 ? 308 SER A O    1 
ATOM   4388  C CB   . SER A 1 308 ? 7.755   -21.547 -14.667 1.00 21.72 ? 308 SER A CB   1 
ATOM   4389  O OG   . SER A 1 308 ? 7.941   -20.373 -13.966 1.00 36.49 ? 308 SER A OG   1 
ATOM   4390  H H    . SER A 1 308 ? 8.288   -19.983 -16.577 1.00 28.02 ? 308 SER A H    1 
ATOM   4391  H HA   . SER A 1 308 ? 9.700   -21.795 -15.230 1.00 30.37 ? 308 SER A HA   1 
ATOM   4392  H HB2  . SER A 1 308 ? 6.875   -21.532 -15.108 1.00 26.04 ? 308 SER A HB2  1 
ATOM   4393  H HB3  . SER A 1 308 ? 7.773   -22.309 -14.044 1.00 26.04 ? 308 SER A HB3  1 
ATOM   4394  H HG   . SER A 1 308 ? 8.771   -20.246 -13.870 1.00 43.76 ? 308 SER A HG   1 
ATOM   4395  N N    . ILE A 1 309 ? 7.605   -23.042 -17.334 1.00 21.37 ? 309 ILE A N    1 
ATOM   4396  C CA   . ILE A 1 309 ? 7.337   -24.277 -18.062 1.00 20.77 ? 309 ILE A CA   1 
ATOM   4397  C C    . ILE A 1 309 ? 8.581   -24.750 -18.780 1.00 20.05 ? 309 ILE A C    1 
ATOM   4398  O O    . ILE A 1 309 ? 8.916   -25.939 -18.766 1.00 24.91 ? 309 ILE A O    1 
ATOM   4399  C CB   . ILE A 1 309 ? 6.193   -24.072 -19.074 1.00 21.85 ? 309 ILE A CB   1 
ATOM   4400  C CG1  . ILE A 1 309 ? 4.888   -23.842 -18.340 1.00 26.07 ? 309 ILE A CG1  1 
ATOM   4401  C CG2  . ILE A 1 309 ? 6.113   -25.281 -20.048 1.00 22.94 ? 309 ILE A CG2  1 
ATOM   4402  C CD1  . ILE A 1 309 ? 3.802   -23.326 -19.211 1.00 26.90 ? 309 ILE A CD1  1 
ATOM   4403  H H    . ILE A 1 309 ? 7.122   -22.371 -17.572 1.00 25.62 ? 309 ILE A H    1 
ATOM   4404  H HA   . ILE A 1 309 ? 7.067   -24.966 -17.435 1.00 24.91 ? 309 ILE A HA   1 
ATOM   4405  H HB   . ILE A 1 309 ? 6.389   -23.278 -19.595 1.00 26.19 ? 309 ILE A HB   1 
ATOM   4406  H HG12 . ILE A 1 309 ? 4.590   -24.683 -17.959 1.00 31.26 ? 309 ILE A HG12 1 
ATOM   4407  H HG13 . ILE A 1 309 ? 5.036   -23.195 -17.633 1.00 31.26 ? 309 ILE A HG13 1 
ATOM   4408  H HG21 . ILE A 1 309 ? 5.388   -25.133 -20.676 1.00 27.50 ? 309 ILE A HG21 1 
ATOM   4409  H HG22 . ILE A 1 309 ? 6.954   -25.358 -20.526 1.00 27.50 ? 309 ILE A HG22 1 
ATOM   4410  H HG23 . ILE A 1 309 ? 5.948   -26.089 -19.536 1.00 27.50 ? 309 ILE A HG23 1 
ATOM   4411  H HD11 . ILE A 1 309 ? 3.001   -23.203 -18.677 1.00 32.25 ? 309 ILE A HD11 1 
ATOM   4412  H HD12 . ILE A 1 309 ? 4.079   -22.478 -19.592 1.00 32.25 ? 309 ILE A HD12 1 
ATOM   4413  H HD13 . ILE A 1 309 ? 3.633   -23.967 -19.919 1.00 32.25 ? 309 ILE A HD13 1 
ATOM   4414  N N    . LEU A 1 310 ? 9.239   -23.837 -19.498 1.00 19.44 ? 310 LEU A N    1 
ATOM   4415  C CA   . LEU A 1 310 ? 10.380  -24.216 -20.309 1.00 17.11 ? 310 LEU A CA   1 
ATOM   4416  C C    . LEU A 1 310 ? 11.590  -24.573 -19.454 1.00 21.94 ? 310 LEU A C    1 
ATOM   4417  O O    . LEU A 1 310 ? 12.386  -25.424 -19.842 1.00 23.19 ? 310 LEU A O    1 
ATOM   4418  C CB   . LEU A 1 310 ? 10.747  -23.082 -21.264 1.00 22.18 ? 310 LEU A CB   1 
ATOM   4419  C CG   . LEU A 1 310 ? 9.689   -22.784 -22.357 1.00 17.51 ? 310 LEU A CG   1 
ATOM   4420  C CD1  . LEU A 1 310 ? 10.131  -21.516 -23.067 1.00 16.65 ? 310 LEU A CD1  1 
ATOM   4421  C CD2  . LEU A 1 310 ? 9.512   -23.915 -23.319 1.00 20.42 ? 310 LEU A CD2  1 
ATOM   4422  H H    . LEU A 1 310 ? 9.041   -23.000 -19.528 1.00 23.31 ? 310 LEU A H    1 
ATOM   4423  H HA   . LEU A 1 310 ? 10.147  -24.993 -20.841 1.00 20.51 ? 310 LEU A HA   1 
ATOM   4424  H HB2  . LEU A 1 310 ? 10.872  -22.271 -20.747 1.00 26.60 ? 310 LEU A HB2  1 
ATOM   4425  H HB3  . LEU A 1 310 ? 11.575  -23.313 -21.713 1.00 26.60 ? 310 LEU A HB3  1 
ATOM   4426  H HG   . LEU A 1 310 ? 8.833   -22.610 -21.933 1.00 20.99 ? 310 LEU A HG   1 
ATOM   4427  H HD11 . LEU A 1 310 ? 9.487   -21.302 -23.760 1.00 19.96 ? 310 LEU A HD11 1 
ATOM   4428  H HD12 . LEU A 1 310 ? 10.177  -20.793 -22.422 1.00 19.96 ? 310 LEU A HD12 1 
ATOM   4429  H HD13 . LEU A 1 310 ? 11.005  -21.664 -23.462 1.00 19.96 ? 310 LEU A HD13 1 
ATOM   4430  H HD21 . LEU A 1 310 ? 8.841   -23.669 -23.975 1.00 24.48 ? 310 LEU A HD21 1 
ATOM   4431  H HD22 . LEU A 1 310 ? 10.359  -24.088 -23.760 1.00 24.48 ? 310 LEU A HD22 1 
ATOM   4432  H HD23 . LEU A 1 310 ? 9.226   -24.702 -22.830 1.00 24.48 ? 310 LEU A HD23 1 
ATOM   4433  N N    . GLN A 1 311 ? 11.736  -23.942 -18.298 1.00 21.01 ? 311 GLN A N    1 
ATOM   4434  C CA   . GLN A 1 311 ? 12.840  -24.295 -17.404 1.00 24.35 ? 311 GLN A CA   1 
ATOM   4435  C C    . GLN A 1 311 ? 12.674  -25.717 -16.857 1.00 25.19 ? 311 GLN A C    1 
ATOM   4436  O O    . GLN A 1 311 ? 13.638  -26.490 -16.817 1.00 30.36 ? 311 GLN A O    1 
ATOM   4437  C CB   . GLN A 1 311 ? 12.913  -23.241 -16.301 1.00 33.12 ? 311 GLN A CB   1 
ATOM   4438  C CG   . GLN A 1 311 ? 13.838  -23.501 -15.147 1.00 42.55 ? 311 GLN A CG   1 
ATOM   4439  C CD   . GLN A 1 311 ? 13.528  -22.535 -14.011 1.00 52.39 ? 311 GLN A CD   1 
ATOM   4440  O OE1  . GLN A 1 311 ? 14.304  -21.621 -13.735 1.00 60.53 ? 311 GLN A OE1  1 
ATOM   4441  N NE2  . GLN A 1 311 ? 12.357  -22.706 -13.376 1.00 52.33 ? 311 GLN A NE2  1 
ATOM   4442  H H    . GLN A 1 311 ? 11.222  -23.317 -18.007 1.00 25.18 ? 311 GLN A H    1 
ATOM   4443  H HA   . GLN A 1 311 ? 13.672  -24.263 -17.903 1.00 29.19 ? 311 GLN A HA   1 
ATOM   4444  H HB2  . GLN A 1 311 ? 13.191  -22.405 -16.705 1.00 39.73 ? 311 GLN A HB2  1 
ATOM   4445  H HB3  . GLN A 1 311 ? 12.022  -23.134 -15.932 1.00 39.73 ? 311 GLN A HB3  1 
ATOM   4446  H HG2  . GLN A 1 311 ? 13.710  -24.408 -14.825 1.00 51.04 ? 311 GLN A HG2  1 
ATOM   4447  H HG3  . GLN A 1 311 ? 14.756  -23.365 -15.428 1.00 51.04 ? 311 GLN A HG3  1 
ATOM   4448  H HE21 . GLN A 1 311 ? 11.836  -23.351 -13.602 1.00 62.77 ? 311 GLN A HE21 1 
ATOM   4449  H HE22 . GLN A 1 311 ? 12.138  -22.181 -12.731 1.00 62.77 ? 311 GLN A HE22 1 
ATOM   4450  N N    . HIS A 1 312 ? 11.444  -26.118 -16.530 1.00 27.57 ? 312 HIS A N    1 
ATOM   4451  C CA   . HIS A 1 312 ? 11.212  -27.494 -16.080 1.00 28.38 ? 312 HIS A CA   1 
ATOM   4452  C C    . HIS A 1 312 ? 11.425  -28.524 -17.174 1.00 33.21 ? 312 HIS A C    1 
ATOM   4453  O O    . HIS A 1 312 ? 11.628  -29.704 -16.864 1.00 28.44 ? 312 HIS A O    1 
ATOM   4454  C CB   . HIS A 1 312 ? 9.803   -27.653 -15.542 1.00 24.09 ? 312 HIS A CB   1 
ATOM   4455  C CG   . HIS A 1 312 ? 9.588   -27.036 -14.199 1.00 30.37 ? 312 HIS A CG   1 
ATOM   4456  N ND1  . HIS A 1 312 ? 8.394   -26.447 -13.840 1.00 43.24 ? 312 HIS A ND1  1 
ATOM   4457  C CD2  . HIS A 1 312 ? 10.396  -26.935 -13.119 1.00 38.77 ? 312 HIS A CD2  1 
ATOM   4458  C CE1  . HIS A 1 312 ? 8.475   -26.006 -12.598 1.00 46.36 ? 312 HIS A CE1  1 
ATOM   4459  N NE2  . HIS A 1 312 ? 9.681   -26.287 -12.138 1.00 49.22 ? 312 HIS A NE2  1 
ATOM   4460  H H    . HIS A 1 312 ? 10.739  -25.625 -16.559 1.00 33.06 ? 312 HIS A H    1 
ATOM   4461  H HA   . HIS A 1 312 ? 11.830  -27.694 -15.359 1.00 34.03 ? 312 HIS A HA   1 
ATOM   4462  H HB2  . HIS A 1 312 ? 9.184   -27.235 -16.161 1.00 28.88 ? 312 HIS A HB2  1 
ATOM   4463  H HB3  . HIS A 1 312 ? 9.603   -28.599 -15.467 1.00 28.88 ? 312 HIS A HB3  1 
ATOM   4464  H HD2  . HIS A 1 312 ? 11.270  -27.244 -13.052 1.00 46.50 ? 312 HIS A HD2  1 
ATOM   4465  H HE1  . HIS A 1 312 ? 7.802   -25.566 -12.130 1.00 55.62 ? 312 HIS A HE1  1 
ATOM   4466  H HE2  . HIS A 1 312 ? 9.973   -26.094 -11.353 1.00 59.05 ? 312 HIS A HE2  1 
ATOM   4467  N N    . LYS A 1 313 ? 11.359  -28.126 -18.444 1.00 24.44 ? 313 LYS A N    1 
ATOM   4468  C CA   . LYS A 1 313 ? 11.616  -29.033 -19.549 1.00 17.96 ? 313 LYS A CA   1 
ATOM   4469  C C    . LYS A 1 313 ? 13.029  -28.909 -20.118 1.00 23.27 ? 313 LYS A C    1 
ATOM   4470  O O    . LYS A 1 313 ? 13.360  -29.624 -21.066 1.00 25.28 ? 313 LYS A O    1 
ATOM   4471  C CB   . LYS A 1 313 ? 10.594  -28.817 -20.677 1.00 26.48 ? 313 LYS A CB   1 
ATOM   4472  C CG   . LYS A 1 313 ? 9.128   -29.104 -20.279 1.00 28.32 ? 313 LYS A CG   1 
ATOM   4473  C CD   . LYS A 1 313 ? 8.137   -28.737 -21.406 1.00 31.90 ? 313 LYS A CD   1 
ATOM   4474  C CE   . LYS A 1 313 ? 6.715   -29.293 -21.148 1.00 39.23 ? 313 LYS A CE   1 
ATOM   4475  N NZ   . LYS A 1 313 ? 6.666   -30.785 -21.011 1.00 40.93 ? 313 LYS A NZ   1 
ATOM   4476  H H    . LYS A 1 313 ? 11.165  -27.325 -18.690 1.00 29.31 ? 313 LYS A H    1 
ATOM   4477  H HA   . LYS A 1 313 ? 11.510  -29.943 -19.230 1.00 21.53 ? 313 LYS A HA   1 
ATOM   4478  H HB2  . LYS A 1 313 ? 10.644  -27.893 -20.967 1.00 31.75 ? 313 LYS A HB2  1 
ATOM   4479  H HB3  . LYS A 1 313 ? 10.818  -29.404 -21.415 1.00 31.75 ? 313 LYS A HB3  1 
ATOM   4480  H HG2  . LYS A 1 313 ? 9.030   -30.050 -20.087 1.00 33.96 ? 313 LYS A HG2  1 
ATOM   4481  H HG3  . LYS A 1 313 ? 8.902   -28.579 -19.495 1.00 33.96 ? 313 LYS A HG3  1 
ATOM   4482  H HD2  . LYS A 1 313 ? 8.076   -27.772 -21.471 1.00 38.26 ? 313 LYS A HD2  1 
ATOM   4483  H HD3  . LYS A 1 313 ? 8.458   -29.108 -22.243 1.00 38.26 ? 313 LYS A HD3  1 
ATOM   4484  H HE2  . LYS A 1 313 ? 6.373   -28.909 -20.325 1.00 47.06 ? 313 LYS A HE2  1 
ATOM   4485  H HE3  . LYS A 1 313 ? 6.142   -29.044 -21.890 1.00 47.06 ? 313 LYS A HE3  1 
ATOM   4486  H HZ1  . LYS A 1 313 ? 5.829   -31.050 -20.865 1.00 49.09 ? 313 LYS A HZ1  1 
ATOM   4487  H HZ2  . LYS A 1 313 ? 6.964   -31.169 -21.757 1.00 49.09 ? 313 LYS A HZ2  1 
ATOM   4488  H HZ3  . LYS A 1 313 ? 7.174   -31.045 -20.329 1.00 49.09 ? 313 LYS A HZ3  1 
ATOM   4489  N N    . GLY A 1 314 ? 13.855  -28.004 -19.591 1.00 19.59 ? 314 GLY A N    1 
ATOM   4490  C CA   . GLY A 1 314 ? 15.175  -27.802 -20.156 1.00 26.52 ? 314 GLY A CA   1 
ATOM   4491  C C    . GLY A 1 314 ? 15.173  -27.219 -21.557 1.00 24.44 ? 314 GLY A C    1 
ATOM   4492  O O    . GLY A 1 314 ? 16.043  -27.552 -22.365 1.00 22.98 ? 314 GLY A O    1 
ATOM   4493  H H    . GLY A 1 314 ? 13.672  -27.504 -18.916 1.00 23.48 ? 314 GLY A H    1 
ATOM   4494  H HA2  . GLY A 1 314 ? 15.677  -27.202 -19.581 1.00 31.80 ? 314 GLY A HA2  1 
ATOM   4495  H HA3  . GLY A 1 314 ? 15.641  -28.652 -20.185 1.00 31.80 ? 314 GLY A HA3  1 
ATOM   4496  N N    . LEU A 1 315 ? 14.214  -26.361 -21.870 1.00 22.09 ? 315 LEU A N    1 
ATOM   4497  C CA   . LEU A 1 315 ? 14.037  -25.879 -23.233 1.00 22.75 ? 315 LEU A CA   1 
ATOM   4498  C C    . LEU A 1 315 ? 14.099  -24.359 -23.334 1.00 24.77 ? 315 LEU A C    1 
ATOM   4499  O O    . LEU A 1 315 ? 13.699  -23.800 -24.356 1.00 22.00 ? 315 LEU A O    1 
ATOM   4500  C CB   . LEU A 1 315 ? 12.708  -26.396 -23.796 1.00 21.44 ? 315 LEU A CB   1 
ATOM   4501  C CG   . LEU A 1 315 ? 12.645  -27.909 -24.043 1.00 21.21 ? 315 LEU A CG   1 
ATOM   4502  C CD1  . LEU A 1 315 ? 11.247  -28.352 -24.379 1.00 31.42 ? 315 LEU A CD1  1 
ATOM   4503  C CD2  . LEU A 1 315 ? 13.648  -28.288 -25.139 1.00 27.96 ? 315 LEU A CD2  1 
ATOM   4504  H H    . LEU A 1 315 ? 13.647  -26.040 -21.309 1.00 26.49 ? 315 LEU A H    1 
ATOM   4505  H HA   . LEU A 1 315 ? 14.750  -26.239 -23.783 1.00 27.28 ? 315 LEU A HA   1 
ATOM   4506  H HB2  . LEU A 1 315 ? 12.001  -26.174 -23.170 1.00 25.71 ? 315 LEU A HB2  1 
ATOM   4507  H HB3  . LEU A 1 315 ? 12.541  -25.955 -24.643 1.00 25.71 ? 315 LEU A HB3  1 
ATOM   4508  H HG   . LEU A 1 315 ? 12.911  -28.367 -23.231 1.00 25.44 ? 315 LEU A HG   1 
ATOM   4509  H HD11 . LEU A 1 315 ? 11.247  -29.310 -24.528 1.00 37.68 ? 315 LEU A HD11 1 
ATOM   4510  H HD12 . LEU A 1 315 ? 10.660  -28.132 -23.639 1.00 37.68 ? 315 LEU A HD12 1 
ATOM   4511  H HD13 . LEU A 1 315 ? 10.954  -27.892 -25.181 1.00 37.68 ? 315 LEU A HD13 1 
ATOM   4512  H HD21 . LEU A 1 315 ? 13.603  -29.245 -25.290 1.00 33.54 ? 315 LEU A HD21 1 
ATOM   4513  H HD22 . LEU A 1 315 ? 13.421  -27.812 -25.953 1.00 33.54 ? 315 LEU A HD22 1 
ATOM   4514  H HD23 . LEU A 1 315 ? 14.540  -28.040 -24.849 1.00 33.54 ? 315 LEU A HD23 1 
ATOM   4515  N N    . VAL A 1 316 ? 14.619  -23.672 -22.316 1.00 22.82 ? 316 VAL A N    1 
ATOM   4516  C CA   . VAL A 1 316 ? 14.692  -22.212 -22.376 1.00 24.16 ? 316 VAL A CA   1 
ATOM   4517  C C    . VAL A 1 316 ? 15.422  -21.752 -23.635 1.00 21.78 ? 316 VAL A C    1 
ATOM   4518  O O    . VAL A 1 316 ? 15.018  -20.773 -24.273 1.00 23.68 ? 316 VAL A O    1 
ATOM   4519  C CB   . VAL A 1 316 ? 15.331  -21.669 -21.087 1.00 27.40 ? 316 VAL A CB   1 
ATOM   4520  C CG1  . VAL A 1 316 ? 15.657  -20.195 -21.197 1.00 27.60 ? 316 VAL A CG1  1 
ATOM   4521  C CG2  . VAL A 1 316 ? 14.366  -21.919 -19.892 1.00 27.27 ? 316 VAL A CG2  1 
ATOM   4522  H H    . VAL A 1 316 ? 14.930  -24.020 -21.594 1.00 27.36 ? 316 VAL A H    1 
ATOM   4523  H HA   . VAL A 1 316 ? 13.788  -21.862 -22.421 1.00 28.97 ? 316 VAL A HA   1 
ATOM   4524  H HB   . VAL A 1 316 ? 16.156  -22.149 -20.914 1.00 32.86 ? 316 VAL A HB   1 
ATOM   4525  H HG11 . VAL A 1 316 ? 16.057  -19.897 -20.365 1.00 33.10 ? 316 VAL A HG11 1 
ATOM   4526  H HG12 . VAL A 1 316 ? 16.279  -20.063 -21.929 1.00 33.10 ? 316 VAL A HG12 1 
ATOM   4527  H HG13 . VAL A 1 316 ? 14.838  -19.703 -21.366 1.00 33.10 ? 316 VAL A HG13 1 
ATOM   4528  H HG21 . VAL A 1 316 ? 14.772  -21.575 -19.081 1.00 32.71 ? 316 VAL A HG21 1 
ATOM   4529  H HG22 . VAL A 1 316 ? 13.528  -21.460 -20.062 1.00 32.71 ? 316 VAL A HG22 1 
ATOM   4530  H HG23 . VAL A 1 316 ? 14.210  -22.872 -19.806 1.00 32.71 ? 316 VAL A HG23 1 
ATOM   4531  N N    . ASP A 1 317 ? 16.486  -22.437 -23.996 1.00 24.13 ? 317 ASP A N    1 
ATOM   4532  C CA   . ASP A 1 317 ? 17.279  -22.048 -25.149 1.00 29.28 ? 317 ASP A CA   1 
ATOM   4533  C C    . ASP A 1 317 ? 16.577  -22.159 -26.500 1.00 25.03 ? 317 ASP A C    1 
ATOM   4534  O O    . ASP A 1 317 ? 16.977  -21.545 -27.400 1.00 27.28 ? 317 ASP A O    1 
ATOM   4535  C CB   . ASP A 1 317 ? 18.653  -22.738 -25.184 1.00 27.73 ? 317 ASP A CB   1 
ATOM   4536  C CG   . ASP A 1 317 ? 18.574  -24.199 -25.490 1.00 49.76 ? 317 ASP A CG   1 
ATOM   4537  O OD1  . ASP A 1 317 ? 17.923  -24.953 -24.757 1.00 47.88 ? 317 ASP A OD1  1 
ATOM   4538  O OD2  . ASP A 1 317 ? 19.153  -24.643 -26.496 1.00 62.29 ? 317 ASP A OD2  1 
ATOM   4539  H H    . ASP A 1 317 ? 16.776  -23.137 -23.589 1.00 28.93 ? 317 ASP A H    1 
ATOM   4540  H HA   . ASP A 1 317 ? 17.472  -21.094 -25.037 1.00 35.12 ? 317 ASP A HA   1 
ATOM   4541  H HB2  . ASP A 1 317 ? 19.198  -22.319 -25.868 1.00 33.25 ? 317 ASP A HB2  1 
ATOM   4542  H HB3  . ASP A 1 317 ? 19.077  -22.638 -24.317 1.00 33.25 ? 317 ASP A HB3  1 
ATOM   4543  N N    . LYS A 1 318 ? 15.486  -22.878 -26.584 1.00 22.12 ? 318 LYS A N    1 
ATOM   4544  C CA   . LYS A 1 318 ? 14.795  -23.051 -27.859 1.00 20.43 ? 318 LYS A CA   1 
ATOM   4545  C C    . LYS A 1 318 ? 13.760  -21.972 -28.140 1.00 15.01 ? 318 LYS A C    1 
ATOM   4546  O O    . LYS A 1 318 ? 13.187  -21.976 -29.226 1.00 18.12 ? 318 LYS A O    1 
ATOM   4547  C CB   . LYS A 1 318 ? 14.106  -24.421 -27.917 1.00 25.29 ? 318 LYS A CB   1 
ATOM   4548  C CG   . LYS A 1 318 ? 15.067  -25.594 -27.750 1.00 30.89 ? 318 LYS A CG   1 
ATOM   4549  C CD   . LYS A 1 318 ? 16.219  -25.610 -28.763 1.00 40.88 ? 318 LYS A CD   1 
ATOM   4550  C CE   . LYS A 1 318 ? 15.739  -25.913 -30.187 1.00 44.02 ? 318 LYS A CE   1 
ATOM   4551  N NZ   . LYS A 1 318 ? 16.836  -26.496 -31.042 1.00 49.89 ? 318 LYS A NZ   1 
ATOM   4552  H H    . LYS A 1 318 ? 15.121  -23.290 -25.924 1.00 26.52 ? 318 LYS A H    1 
ATOM   4553  H HA   . LYS A 1 318 ? 15.451  -23.021 -28.572 1.00 24.50 ? 318 LYS A HA   1 
ATOM   4554  H HB2  . LYS A 1 318 ? 13.448  -24.471 -27.205 1.00 30.33 ? 318 LYS A HB2  1 
ATOM   4555  H HB3  . LYS A 1 318 ? 13.668  -24.515 -28.777 1.00 30.33 ? 318 LYS A HB3  1 
ATOM   4556  H HG2  . LYS A 1 318 ? 15.455  -25.554 -26.862 1.00 37.04 ? 318 LYS A HG2  1 
ATOM   4557  H HG3  . LYS A 1 318 ? 14.570  -26.420 -27.854 1.00 37.04 ? 318 LYS A HG3  1 
ATOM   4558  H HD2  . LYS A 1 318 ? 16.649  -24.740 -28.768 1.00 49.03 ? 318 LYS A HD2  1 
ATOM   4559  H HD3  . LYS A 1 318 ? 16.856  -26.295 -28.507 1.00 49.03 ? 318 LYS A HD3  1 
ATOM   4560  H HE2  . LYS A 1 318 ? 15.013  -26.555 -30.149 1.00 52.80 ? 318 LYS A HE2  1 
ATOM   4561  H HE3  . LYS A 1 318 ? 15.436  -25.090 -30.603 1.00 52.80 ? 318 LYS A HE3  1 
ATOM   4562  H HZ1  . LYS A 1 318 ? 16.528  -26.661 -31.861 1.00 59.85 ? 318 LYS A HZ1  1 
ATOM   4563  H HZ2  . LYS A 1 318 ? 17.515  -25.923 -31.098 1.00 59.85 ? 318 LYS A HZ2  1 
ATOM   4564  H HZ3  . LYS A 1 318 ? 17.128  -27.256 -30.684 1.00 59.85 ? 318 LYS A HZ3  1 
ATOM   4565  N N    . PHE A 1 319 ? 13.517  -21.053 -27.208 1.00 16.96 ? 319 PHE A N    1 
ATOM   4566  C CA   . PHE A 1 319 ? 12.523  -19.995 -27.377 1.00 16.10 ? 319 PHE A CA   1 
ATOM   4567  C C    . PHE A 1 319 ? 13.142  -18.645 -27.038 1.00 16.25 ? 319 PHE A C    1 
ATOM   4568  O O    . PHE A 1 319 ? 12.736  -17.969 -26.090 1.00 17.55 ? 319 PHE A O    1 
ATOM   4569  C CB   . PHE A 1 319 ? 11.290  -20.282 -26.533 1.00 14.55 ? 319 PHE A CB   1 
ATOM   4570  C CG   . PHE A 1 319 ? 10.571  -21.523 -26.945 1.00 17.22 ? 319 PHE A CG   1 
ATOM   4571  C CD1  . PHE A 1 319 ? 10.965  -22.760 -26.472 1.00 16.28 ? 319 PHE A CD1  1 
ATOM   4572  C CD2  . PHE A 1 319 ? 9.488   -21.455 -27.817 1.00 18.40 ? 319 PHE A CD2  1 
ATOM   4573  C CE1  . PHE A 1 319 ? 10.292  -23.918 -26.848 1.00 19.29 ? 319 PHE A CE1  1 
ATOM   4574  C CE2  . PHE A 1 319 ? 8.820   -22.588 -28.181 1.00 16.90 ? 319 PHE A CE2  1 
ATOM   4575  C CZ   . PHE A 1 319 ? 9.238   -23.833 -27.709 1.00 17.52 ? 319 PHE A CZ   1 
ATOM   4576  H H    . PHE A 1 319 ? 13.924  -21.022 -26.451 1.00 20.33 ? 319 PHE A H    1 
ATOM   4577  H HA   . PHE A 1 319 ? 12.247  -19.971 -28.306 1.00 19.30 ? 319 PHE A HA   1 
ATOM   4578  H HB2  . PHE A 1 319 ? 11.560  -20.387 -25.607 1.00 17.44 ? 319 PHE A HB2  1 
ATOM   4579  H HB3  . PHE A 1 319 ? 10.673  -19.538 -26.615 1.00 17.44 ? 319 PHE A HB3  1 
ATOM   4580  H HD1  . PHE A 1 319 ? 11.688  -22.819 -25.890 1.00 19.52 ? 319 PHE A HD1  1 
ATOM   4581  H HD2  . PHE A 1 319 ? 9.208   -20.629 -28.140 1.00 22.06 ? 319 PHE A HD2  1 
ATOM   4582  H HE1  . PHE A 1 319 ? 10.568  -24.746 -26.527 1.00 23.12 ? 319 PHE A HE1  1 
ATOM   4583  H HE2  . PHE A 1 319 ? 8.101   -22.533 -28.769 1.00 20.26 ? 319 PHE A HE2  1 
ATOM   4584  H HZ   . PHE A 1 319 ? 8.781   -24.603 -27.962 1.00 21.00 ? 319 PHE A HZ   1 
ATOM   4585  N N    . PRO A 1 320 ? 14.110  -18.208 -27.830 1.00 18.40 ? 320 PRO A N    1 
ATOM   4586  C CA   . PRO A 1 320 ? 14.824  -16.966 -27.498 1.00 15.75 ? 320 PRO A CA   1 
ATOM   4587  C C    . PRO A 1 320 ? 13.950  -15.723 -27.447 1.00 15.08 ? 320 PRO A C    1 
ATOM   4588  O O    . PRO A 1 320 ? 14.236  -14.798 -26.681 1.00 18.03 ? 320 PRO A O    1 
ATOM   4589  C CB   . PRO A 1 320 ? 15.859  -16.859 -28.619 1.00 21.53 ? 320 PRO A CB   1 
ATOM   4590  C CG   . PRO A 1 320 ? 15.821  -18.098 -29.349 1.00 23.24 ? 320 PRO A CG   1 
ATOM   4591  C CD   . PRO A 1 320 ? 14.627  -18.859 -29.042 1.00 16.10 ? 320 PRO A CD   1 
ATOM   4592  H HA   . PRO A 1 320 ? 15.284  -17.064 -26.650 1.00 18.87 ? 320 PRO A HA   1 
ATOM   4593  H HB2  . PRO A 1 320 ? 15.626  -16.118 -29.200 1.00 25.81 ? 320 PRO A HB2  1 
ATOM   4594  H HB3  . PRO A 1 320 ? 16.738  -16.722 -28.233 1.00 25.81 ? 320 PRO A HB3  1 
ATOM   4595  H HG2  . PRO A 1 320 ? 15.840  -17.896 -30.298 1.00 27.86 ? 320 PRO A HG2  1 
ATOM   4596  H HG3  . PRO A 1 320 ? 16.605  -18.618 -29.113 1.00 27.86 ? 320 PRO A HG3  1 
ATOM   4597  H HD2  . PRO A 1 320 ? 13.984  -18.786 -29.765 1.00 19.30 ? 320 PRO A HD2  1 
ATOM   4598  H HD3  . PRO A 1 320 ? 14.853  -19.784 -28.859 1.00 19.30 ? 320 PRO A HD3  1 
ATOM   4599  N N    . LEU A 1 321 ? 12.915  -15.630 -28.292 1.00 14.25 ? 321 LEU A N    1 
ATOM   4600  C CA   . LEU A 1 321 ? 12.092  -14.432 -28.257 1.00 16.40 ? 321 LEU A CA   1 
ATOM   4601  C C    . LEU A 1 321 ? 11.248  -14.399 -26.982 1.00 15.67 ? 321 LEU A C    1 
ATOM   4602  O O    . LEU A 1 321 ? 11.252  -13.393 -26.258 1.00 14.51 ? 321 LEU A O    1 
ATOM   4603  C CB   . LEU A 1 321 ? 11.232  -14.351 -29.524 1.00 15.55 ? 321 LEU A CB   1 
ATOM   4604  C CG   . LEU A 1 321 ? 10.487  -13.006 -29.683 1.00 15.25 ? 321 LEU A CG   1 
ATOM   4605  C CD1  . LEU A 1 321 ? 10.183  -12.766 -31.142 1.00 24.89 ? 321 LEU A CD1  1 
ATOM   4606  C CD2  . LEU A 1 321 ? 9.208   -13.039 -28.918 1.00 21.59 ? 321 LEU A CD2  1 
ATOM   4607  H H    . LEU A 1 321 ? 12.681  -16.223 -28.870 1.00 17.08 ? 321 LEU A H    1 
ATOM   4608  H HA   . LEU A 1 321 ? 12.673  -13.656 -28.245 1.00 19.66 ? 321 LEU A HA   1 
ATOM   4609  H HB2  . LEU A 1 321 ? 11.804  -14.467 -30.298 1.00 18.63 ? 321 LEU A HB2  1 
ATOM   4610  H HB3  . LEU A 1 321 ? 10.568  -15.057 -29.497 1.00 18.63 ? 321 LEU A HB3  1 
ATOM   4611  H HG   . LEU A 1 321 ? 11.037  -12.279 -29.350 1.00 18.28 ? 321 LEU A HG   1 
ATOM   4612  H HD11 . LEU A 1 321 ? 9.716   -11.921 -31.232 1.00 29.84 ? 321 LEU A HD11 1 
ATOM   4613  H HD12 . LEU A 1 321 ? 11.017  -12.738 -31.637 1.00 29.84 ? 321 LEU A HD12 1 
ATOM   4614  H HD13 . LEU A 1 321 ? 9.626   -13.489 -31.471 1.00 29.84 ? 321 LEU A HD13 1 
ATOM   4615  H HD21 . LEU A 1 321 ? 8.753   -12.189 -29.028 1.00 25.89 ? 321 LEU A HD21 1 
ATOM   4616  H HD22 . LEU A 1 321 ? 8.654   -13.758 -29.260 1.00 25.89 ? 321 LEU A HD22 1 
ATOM   4617  H HD23 . LEU A 1 321 ? 9.405   -13.190 -27.980 1.00 25.89 ? 321 LEU A HD23 1 
ATOM   4618  N N    . PHE A 1 322 ? 10.488  -15.481 -26.714 1.00 15.75 ? 322 PHE A N    1 
ATOM   4619  C CA   . PHE A 1 322 ? 9.725   -15.584 -25.481 1.00 16.34 ? 322 PHE A CA   1 
ATOM   4620  C C    . PHE A 1 322 ? 10.606  -15.303 -24.285 1.00 14.72 ? 322 PHE A C    1 
ATOM   4621  O O    . PHE A 1 322 ? 10.198  -14.590 -23.372 1.00 16.89 ? 322 PHE A O    1 
ATOM   4622  C CB   . PHE A 1 322 ? 9.108   -16.978 -25.322 1.00 16.52 ? 322 PHE A CB   1 
ATOM   4623  C CG   . PHE A 1 322 ? 7.961   -17.298 -26.247 1.00 15.37 ? 322 PHE A CG   1 
ATOM   4624  C CD1  . PHE A 1 322 ? 7.368   -16.344 -27.042 1.00 13.16 ? 322 PHE A CD1  1 
ATOM   4625  C CD2  . PHE A 1 322 ? 7.460   -18.575 -26.285 1.00 16.75 ? 322 PHE A CD2  1 
ATOM   4626  C CE1  . PHE A 1 322 ? 6.303   -16.673 -27.875 1.00 16.92 ? 322 PHE A CE1  1 
ATOM   4627  C CE2  . PHE A 1 322 ? 6.391   -18.900 -27.099 1.00 16.65 ? 322 PHE A CE2  1 
ATOM   4628  C CZ   . PHE A 1 322 ? 5.819   -17.935 -27.894 1.00 14.18 ? 322 PHE A CZ   1 
ATOM   4629  H H    . PHE A 1 322 ? 10.405  -16.159 -27.237 1.00 18.88 ? 322 PHE A H    1 
ATOM   4630  H HA   . PHE A 1 322 ? 9.007   -14.931 -25.491 1.00 19.58 ? 322 PHE A HA   1 
ATOM   4631  H HB2  . PHE A 1 322 ? 9.800   -17.639 -25.479 1.00 19.80 ? 322 PHE A HB2  1 
ATOM   4632  H HB3  . PHE A 1 322 ? 8.779   -17.065 -24.413 1.00 19.80 ? 322 PHE A HB3  1 
ATOM   4633  H HD1  . PHE A 1 322 ? 7.691   -15.472 -27.032 1.00 15.77 ? 322 PHE A HD1  1 
ATOM   4634  H HD2  . PHE A 1 322 ? 7.839   -19.231 -25.746 1.00 20.08 ? 322 PHE A HD2  1 
ATOM   4635  H HE1  . PHE A 1 322 ? 5.914   -16.019 -28.409 1.00 20.28 ? 322 PHE A HE1  1 
ATOM   4636  H HE2  . PHE A 1 322 ? 6.068   -19.771 -27.117 1.00 19.95 ? 322 PHE A HE2  1 
ATOM   4637  H HZ   . PHE A 1 322 ? 5.108   -18.153 -28.452 1.00 16.99 ? 322 PHE A HZ   1 
ATOM   4638  N N    . MET A 1 323 ? 11.811  -15.874 -24.259 1.00 15.11 ? 323 MET A N    1 
ATOM   4639  C CA   . MET A 1 323 ? 12.695  -15.725 -23.099 1.00 21.07 ? 323 MET A CA   1 
ATOM   4640  C C    . MET A 1 323 ? 13.355  -14.354 -23.024 1.00 16.62 ? 323 MET A C    1 
ATOM   4641  O O    . MET A 1 323 ? 13.575  -13.849 -21.917 1.00 17.45 ? 323 MET A O    1 
ATOM   4642  C CB   . MET A 1 323 ? 13.744  -16.839 -23.098 1.00 18.82 ? 323 MET A CB   1 
ATOM   4643  C CG   . MET A 1 323 ? 13.075  -18.205 -22.925 1.00 23.03 ? 323 MET A CG   1 
ATOM   4644  S SD   . MET A 1 323 ? 12.087  -18.396 -21.397 1.00 26.66 ? 323 MET A SD   1 
ATOM   4645  C CE   . MET A 1 323 ? 10.427  -17.877 -21.855 1.00 25.91 ? 323 MET A CE   1 
ATOM   4646  H H    . MET A 1 323 ? 12.139  -16.349 -24.896 1.00 18.11 ? 323 MET A H    1 
ATOM   4647  H HA   . MET A 1 323 ? 12.159  -15.841 -22.299 1.00 25.27 ? 323 MET A HA   1 
ATOM   4648  H HB2  . MET A 1 323 ? 14.221  -16.835 -23.942 1.00 22.57 ? 323 MET A HB2  1 
ATOM   4649  H HB3  . MET A 1 323 ? 14.359  -16.703 -22.360 1.00 22.57 ? 323 MET A HB3  1 
ATOM   4650  H HG2  . MET A 1 323 ? 12.481  -18.355 -23.678 1.00 27.61 ? 323 MET A HG2  1 
ATOM   4651  H HG3  . MET A 1 323 ? 13.764  -18.887 -22.915 1.00 27.61 ? 323 MET A HG3  1 
ATOM   4652  H HE1  . MET A 1 323 ? 9.848   -17.954 -21.081 1.00 31.08 ? 323 MET A HE1  1 
ATOM   4653  H HE2  . MET A 1 323 ? 10.457  -16.955 -22.156 1.00 31.08 ? 323 MET A HE2  1 
ATOM   4654  H HE3  . MET A 1 323 ? 10.104  -18.448 -22.570 1.00 31.08 ? 323 MET A HE3  1 
ATOM   4655  N N    . ALA A 1 324 ? 13.597  -13.696 -24.160 1.00 14.37 ? 324 ALA A N    1 
ATOM   4656  C CA   . ALA A 1 324 ? 14.065  -12.322 -24.118 1.00 14.34 ? 324 ALA A CA   1 
ATOM   4657  C C    . ALA A 1 324 ? 12.996  -11.398 -23.557 1.00 16.95 ? 324 ALA A C    1 
ATOM   4658  O O    . ALA A 1 324 ? 13.310  -10.485 -22.791 1.00 18.56 ? 324 ALA A O    1 
ATOM   4659  C CB   . ALA A 1 324 ? 14.524  -11.846 -25.509 1.00 13.33 ? 324 ALA A CB   1 
ATOM   4660  H H    . ALA A 1 324 ? 13.499  -14.020 -24.950 1.00 17.23 ? 324 ALA A H    1 
ATOM   4661  H HA   . ALA A 1 324 ? 14.832  -12.276 -23.525 1.00 17.18 ? 324 ALA A HA   1 
ATOM   4662  H HB1  . ALA A 1 324 ? 14.829  -10.927 -25.443 1.00 15.97 ? 324 ALA A HB1  1 
ATOM   4663  H HB2  . ALA A 1 324 ? 15.249  -12.414 -25.814 1.00 15.97 ? 324 ALA A HB2  1 
ATOM   4664  H HB3  . ALA A 1 324 ? 13.777  -11.903 -26.125 1.00 15.97 ? 324 ALA A HB3  1 
ATOM   4665  N N    . VAL A 1 325 ? 11.726  -11.592 -23.938 1.00 16.04 ? 325 VAL A N    1 
ATOM   4666  C CA   . VAL A 1 325 ? 10.662  -10.817 -23.315 1.00 15.80 ? 325 VAL A CA   1 
ATOM   4667  C C    . VAL A 1 325 ? 10.696  -11.000 -21.800 1.00 16.47 ? 325 VAL A C    1 
ATOM   4668  O O    . VAL A 1 325 ? 10.553  -10.036 -21.042 1.00 16.88 ? 325 VAL A O    1 
ATOM   4669  C CB   . VAL A 1 325 ? 9.288   -11.194 -23.894 1.00 15.02 ? 325 VAL A CB   1 
ATOM   4670  C CG1  . VAL A 1 325 ? 8.215   -10.508 -23.110 1.00 14.85 ? 325 VAL A CG1  1 
ATOM   4671  C CG2  . VAL A 1 325 ? 9.235   -10.800 -25.370 1.00 15.15 ? 325 VAL A CG2  1 
ATOM   4672  H H    . VAL A 1 325 ? 11.466  -12.152 -24.536 1.00 19.23 ? 325 VAL A H    1 
ATOM   4673  H HA   . VAL A 1 325 ? 10.813  -9.877  -23.502 1.00 18.94 ? 325 VAL A HA   1 
ATOM   4674  H HB   . VAL A 1 325 ? 9.158   -12.152 -23.825 1.00 18.00 ? 325 VAL A HB   1 
ATOM   4675  H HG11 . VAL A 1 325 ? 7.351   -10.749 -23.479 1.00 17.80 ? 325 VAL A HG11 1 
ATOM   4676  H HG12 . VAL A 1 325 ? 8.270   -10.792 -22.184 1.00 17.80 ? 325 VAL A HG12 1 
ATOM   4677  H HG13 . VAL A 1 325 ? 8.345   -9.548  -23.170 1.00 17.80 ? 325 VAL A HG13 1 
ATOM   4678  H HG21 . VAL A 1 325 ? 8.366   -11.040 -25.730 1.00 18.16 ? 325 VAL A HG21 1 
ATOM   4679  H HG22 . VAL A 1 325 ? 9.371   -9.843  -25.446 1.00 18.16 ? 325 VAL A HG22 1 
ATOM   4680  H HG23 . VAL A 1 325 ? 9.934   -11.273 -25.848 1.00 18.16 ? 325 VAL A HG23 1 
ATOM   4681  N N    . TYR A 1 326 ? 10.829  -12.243 -21.339 1.00 16.20 ? 326 TYR A N    1 
ATOM   4682  C CA   . TYR A 1 326 ? 10.825  -12.470 -19.895 1.00 18.12 ? 326 TYR A CA   1 
ATOM   4683  C C    . TYR A 1 326 ? 12.036  -11.797 -19.232 1.00 18.86 ? 326 TYR A C    1 
ATOM   4684  O O    . TYR A 1 326 ? 11.898  -11.080 -18.231 1.00 23.24 ? 326 TYR A O    1 
ATOM   4685  C CB   . TYR A 1 326 ? 10.777  -13.979 -19.580 1.00 19.18 ? 326 TYR A CB   1 
ATOM   4686  C CG   . TYR A 1 326 ? 11.188  -14.229 -18.151 1.00 24.49 ? 326 TYR A CG   1 
ATOM   4687  C CD1  . TYR A 1 326 ? 10.329  -13.948 -17.119 1.00 21.13 ? 326 TYR A CD1  1 
ATOM   4688  C CD2  . TYR A 1 326 ? 12.461  -14.706 -17.846 1.00 22.02 ? 326 TYR A CD2  1 
ATOM   4689  C CE1  . TYR A 1 326 ? 10.714  -14.129 -15.809 1.00 27.55 ? 326 TYR A CE1  1 
ATOM   4690  C CE2  . TYR A 1 326 ? 12.858  -14.878 -16.543 1.00 24.86 ? 326 TYR A CE2  1 
ATOM   4691  C CZ   . TYR A 1 326 ? 11.982  -14.595 -15.535 1.00 26.88 ? 326 TYR A CZ   1 
ATOM   4692  O OH   . TYR A 1 326 ? 12.373  -14.756 -14.236 1.00 28.74 ? 326 TYR A OH   1 
ATOM   4693  H H    . TYR A 1 326 ? 10.919  -12.949 -21.821 1.00 19.42 ? 326 TYR A H    1 
ATOM   4694  H HA   . TYR A 1 326 ? 10.025  -12.068 -19.521 1.00 21.72 ? 326 TYR A HA   1 
ATOM   4695  H HB2  . TYR A 1 326 ? 9.872   -14.306 -19.702 1.00 23.00 ? 326 TYR A HB2  1 
ATOM   4696  H HB3  . TYR A 1 326 ? 11.390  -14.452 -20.164 1.00 23.00 ? 326 TYR A HB3  1 
ATOM   4697  H HD1  . TYR A 1 326 ? 9.479   -13.620 -17.306 1.00 25.33 ? 326 TYR A HD1  1 
ATOM   4698  H HD2  . TYR A 1 326 ? 13.060  -14.884 -18.535 1.00 26.40 ? 326 TYR A HD2  1 
ATOM   4699  H HE1  . TYR A 1 326 ? 10.127  -13.931 -15.116 1.00 33.04 ? 326 TYR A HE1  1 
ATOM   4700  H HE2  . TYR A 1 326 ? 13.711  -15.195 -16.349 1.00 29.81 ? 326 TYR A HE2  1 
ATOM   4701  H HH   . TYR A 1 326 ? 13.162  -15.043 -14.207 1.00 34.47 ? 326 TYR A HH   1 
ATOM   4702  N N    . LYS A 1 327 ? 13.216  -11.974 -19.800 1.00 18.08 ? 327 LYS A N    1 
ATOM   4703  C CA   . LYS A 1 327 ? 14.416  -11.441 -19.163 1.00 22.42 ? 327 LYS A CA   1 
ATOM   4704  C C    . LYS A 1 327 ? 14.464  -9.925  -19.212 1.00 23.64 ? 327 LYS A C    1 
ATOM   4705  O O    . LYS A 1 327 ? 15.009  -9.298  -18.301 1.00 20.67 ? 327 LYS A O    1 
ATOM   4706  C CB   . LYS A 1 327 ? 15.645  -12.016 -19.818 1.00 17.72 ? 327 LYS A CB   1 
ATOM   4707  C CG   . LYS A 1 327 ? 15.725  -13.536 -19.616 1.00 26.42 ? 327 LYS A CG   1 
ATOM   4708  C CD   . LYS A 1 327 ? 17.105  -14.183 -19.971 1.00 35.50 ? 327 LYS A CD   1 
ATOM   4709  C CE   . LYS A 1 327 ? 17.762  -13.678 -21.251 1.00 43.54 ? 327 LYS A CE   1 
ATOM   4710  N NZ   . LYS A 1 327 ? 17.030  -13.995 -22.531 1.00 39.92 ? 327 LYS A NZ   1 
ATOM   4711  H H    . LYS A 1 327 ? 13.352  -12.390 -20.539 1.00 21.68 ? 327 LYS A H    1 
ATOM   4712  H HA   . LYS A 1 327 ? 14.422  -11.709 -18.231 1.00 26.89 ? 327 LYS A HA   1 
ATOM   4713  H HB2  . LYS A 1 327 ? 15.615  -11.837 -20.771 1.00 21.24 ? 327 LYS A HB2  1 
ATOM   4714  H HB3  . LYS A 1 327 ? 16.436  -11.615 -19.426 1.00 21.24 ? 327 LYS A HB3  1 
ATOM   4715  H HG2  . LYS A 1 327 ? 15.542  -13.733 -18.684 1.00 31.69 ? 327 LYS A HG2  1 
ATOM   4716  H HG3  . LYS A 1 327 ? 15.053  -13.957 -20.175 1.00 31.69 ? 327 LYS A HG3  1 
ATOM   4717  H HD2  . LYS A 1 327 ? 17.721  -14.010 -19.242 1.00 42.58 ? 327 LYS A HD2  1 
ATOM   4718  H HD3  . LYS A 1 327 ? 16.979  -15.139 -20.068 1.00 42.58 ? 327 LYS A HD3  1 
ATOM   4719  H HE2  . LYS A 1 327 ? 17.841  -12.713 -21.194 1.00 52.22 ? 327 LYS A HE2  1 
ATOM   4720  H HE3  . LYS A 1 327 ? 18.646  -14.071 -21.317 1.00 52.22 ? 327 LYS A HE3  1 
ATOM   4721  H HZ1  . LYS A 1 327 ? 17.477  -13.667 -23.226 1.00 47.89 ? 327 LYS A HZ1  1 
ATOM   4722  H HZ2  . LYS A 1 327 ? 16.953  -14.877 -22.626 1.00 47.89 ? 327 LYS A HZ2  1 
ATOM   4723  H HZ3  . LYS A 1 327 ? 16.216  -13.634 -22.513 1.00 47.89 ? 327 LYS A HZ3  1 
ATOM   4724  N N    . VAL A 1 328 ? 13.926  -9.314  -20.268 1.00 20.83 ? 328 VAL A N    1 
ATOM   4725  C CA   . VAL A 1 328 ? 13.894  -7.865  -20.298 1.00 21.59 ? 328 VAL A CA   1 
ATOM   4726  C C    . VAL A 1 328 ? 12.910  -7.342  -19.273 1.00 21.46 ? 328 VAL A C    1 
ATOM   4727  O O    . VAL A 1 328 ? 13.173  -6.343  -18.597 1.00 23.24 ? 328 VAL A O    1 
ATOM   4728  C CB   . VAL A 1 328 ? 13.566  -7.357  -21.711 1.00 19.68 ? 328 VAL A CB   1 
ATOM   4729  C CG1  . VAL A 1 328 ? 13.255  -5.822  -21.663 1.00 17.09 ? 328 VAL A CG1  1 
ATOM   4730  C CG2  . VAL A 1 328 ? 14.686  -7.659  -22.654 1.00 19.59 ? 328 VAL A CG2  1 
ATOM   4731  H H    . VAL A 1 328 ? 13.586  -9.705  -20.954 1.00 24.98 ? 328 VAL A H    1 
ATOM   4732  H HA   . VAL A 1 328 ? 14.773  -7.529  -20.061 1.00 25.89 ? 328 VAL A HA   1 
ATOM   4733  H HB   . VAL A 1 328 ? 12.772  -7.813  -22.033 1.00 23.60 ? 328 VAL A HB   1 
ATOM   4734  H HG11 . VAL A 1 328 ? 13.049  -5.513  -22.560 1.00 20.49 ? 328 VAL A HG11 1 
ATOM   4735  H HG12 . VAL A 1 328 ? 12.495  -5.672  -21.079 1.00 20.49 ? 328 VAL A HG12 1 
ATOM   4736  H HG13 . VAL A 1 328 ? 14.032  -5.353  -21.322 1.00 20.49 ? 328 VAL A HG13 1 
ATOM   4737  H HG21 . VAL A 1 328 ? 14.453  -7.329  -23.536 1.00 23.49 ? 328 VAL A HG21 1 
ATOM   4738  H HG22 . VAL A 1 328 ? 15.491  -7.221  -22.338 1.00 23.49 ? 328 VAL A HG22 1 
ATOM   4739  H HG23 . VAL A 1 328 ? 14.822  -8.619  -22.685 1.00 23.49 ? 328 VAL A HG23 1 
ATOM   4740  N N    . CYS A 1 329 ? 11.740  -7.978  -19.158 1.00 19.62 ? 329 CYS A N    1 
ATOM   4741  C CA   . CYS A 1 329 ? 10.719  -7.473  -18.256 1.00 23.37 ? 329 CYS A CA   1 
ATOM   4742  C C    . CYS A 1 329 ? 11.036  -7.771  -16.791 1.00 23.24 ? 329 CYS A C    1 
ATOM   4743  O O    . CYS A 1 329 ? 10.554  -7.047  -15.924 1.00 24.73 ? 329 CYS A O    1 
ATOM   4744  C CB   . CYS A 1 329 ? 9.346   -8.066  -18.597 1.00 19.20 ? 329 CYS A CB   1 
ATOM   4745  S SG   . CYS A 1 329 ? 8.687   -7.481  -20.183 1.00 20.20 ? 329 CYS A SG   1 
ATOM   4746  H H    . CYS A 1 329 ? 11.521  -8.690  -19.587 1.00 23.53 ? 329 CYS A H    1 
ATOM   4747  H HA   . CYS A 1 329 ? 10.661  -6.510  -18.357 1.00 28.02 ? 329 CYS A HA   1 
ATOM   4748  H HB2  . CYS A 1 329 ? 9.423   -9.032  -18.644 1.00 23.02 ? 329 CYS A HB2  1 
ATOM   4749  H HB3  . CYS A 1 329 ? 8.715   -7.819  -17.902 1.00 23.02 ? 329 CYS A HB3  1 
ATOM   4750  H HG   . CYS A 1 329 ? 9.447   -7.788  -21.060 1.00 24.22 ? 329 CYS A HG   1 
ATOM   4751  N N    . TYR A 1 330 ? 11.788  -8.836  -16.483 1.00 20.65 ? 330 TYR A N    1 
ATOM   4752  C CA   . TYR A 1 330 ? 11.895  -9.299  -15.084 1.00 24.33 ? 330 TYR A CA   1 
ATOM   4753  C C    . TYR A 1 330 ? 13.314  -9.474  -14.542 1.00 24.76 ? 330 TYR A C    1 
ATOM   4754  O O    . TYR A 1 330 ? 13.482  -9.463  -13.309 1.00 23.00 ? 330 TYR A O    1 
ATOM   4755  C CB   . TYR A 1 330 ? 11.145  -10.624 -14.885 1.00 23.51 ? 330 TYR A CB   1 
ATOM   4756  C CG   . TYR A 1 330 ? 9.643   -10.483 -15.086 1.00 26.91 ? 330 TYR A CG   1 
ATOM   4757  C CD1  . TYR A 1 330 ? 8.843   -9.863  -14.128 1.00 31.01 ? 330 TYR A CD1  1 
ATOM   4758  C CD2  . TYR A 1 330 ? 9.027   -10.955 -16.231 1.00 23.27 ? 330 TYR A CD2  1 
ATOM   4759  C CE1  . TYR A 1 330 ? 7.435   -9.722  -14.319 1.00 26.89 ? 330 TYR A CE1  1 
ATOM   4760  C CE2  . TYR A 1 330 ? 7.657   -10.814 -16.414 1.00 19.44 ? 330 TYR A CE2  1 
ATOM   4761  C CZ   . TYR A 1 330 ? 6.877   -10.197 -15.475 1.00 24.94 ? 330 TYR A CZ   1 
ATOM   4762  O OH   . TYR A 1 330 ? 5.531   -10.108 -15.711 1.00 25.85 ? 330 TYR A OH   1 
ATOM   4763  H H    . TYR A 1 330 ? 12.237  -9.302  -17.049 1.00 24.76 ? 330 TYR A H    1 
ATOM   4764  H HA   . TYR A 1 330 ? 11.459  -8.640  -14.521 1.00 29.18 ? 330 TYR A HA   1 
ATOM   4765  H HB2  . TYR A 1 330 ? 11.474  -11.274 -15.526 1.00 28.19 ? 330 TYR A HB2  1 
ATOM   4766  H HB3  . TYR A 1 330 ? 11.299  -10.942 -13.981 1.00 28.19 ? 330 TYR A HB3  1 
ATOM   4767  H HD1  . TYR A 1 330 ? 9.233   -9.535  -13.350 1.00 37.20 ? 330 TYR A HD1  1 
ATOM   4768  H HD2  . TYR A 1 330 ? 9.538   -11.369 -16.889 1.00 27.90 ? 330 TYR A HD2  1 
ATOM   4769  H HE1  . TYR A 1 330 ? 6.909   -9.308  -13.674 1.00 32.25 ? 330 TYR A HE1  1 
ATOM   4770  H HE2  . TYR A 1 330 ? 7.263   -11.139 -17.191 1.00 23.31 ? 330 TYR A HE2  1 
ATOM   4771  H HH   . TYR A 1 330 ? 5.149   -9.736  -15.062 1.00 31.00 ? 330 TYR A HH   1 
ATOM   4772  N N    . GLU A 1 331 ? 14.325  -9.620  -15.390 1.00 25.23 ? 331 GLU A N    1 
ATOM   4773  C CA   . GLU A 1 331 ? 15.688  -9.846  -14.929 1.00 22.52 ? 331 GLU A CA   1 
ATOM   4774  C C    . GLU A 1 331 ? 16.621  -8.712  -15.323 1.00 27.24 ? 331 GLU A C    1 
ATOM   4775  O O    . GLU A 1 331 ? 17.842  -8.862  -15.228 1.00 32.94 ? 331 GLU A O    1 
ATOM   4776  C CB   . GLU A 1 331 ? 16.210  -11.183 -15.455 1.00 26.66 ? 331 GLU A CB   1 
ATOM   4777  C CG   . GLU A 1 331 ? 15.398  -12.387 -14.959 1.00 31.46 ? 331 GLU A CG   1 
ATOM   4778  C CD   . GLU A 1 331 ? 16.113  -13.705 -15.180 1.00 30.73 ? 331 GLU A CD   1 
ATOM   4779  O OE1  . GLU A 1 331 ? 17.089  -13.726 -15.954 1.00 35.66 ? 331 GLU A OE1  1 
ATOM   4780  O OE2  . GLU A 1 331 ? 15.705  -14.698 -14.561 1.00 39.50 ? 331 GLU A OE2  1 
ATOM   4781  H H    . GLU A 1 331 ? 14.246  -9.593  -16.246 1.00 30.25 ? 331 GLU A H    1 
ATOM   4782  H HA   . GLU A 1 331 ? 15.681  -9.896  -13.960 1.00 27.00 ? 331 GLU A HA   1 
ATOM   4783  H HB2  . GLU A 1 331 ? 16.171  -11.176 -16.425 1.00 31.97 ? 331 GLU A HB2  1 
ATOM   4784  H HB3  . GLU A 1 331 ? 17.127  -11.299 -15.162 1.00 31.97 ? 331 GLU A HB3  1 
ATOM   4785  H HG2  . GLU A 1 331 ? 15.237  -12.289 -14.007 1.00 37.73 ? 331 GLU A HG2  1 
ATOM   4786  H HG3  . GLU A 1 331 ? 14.555  -12.419 -15.437 1.00 37.73 ? 331 GLU A HG3  1 
ATOM   4787  N N    . GLY A 1 332 ? 16.092  -7.582  -15.753 1.00 22.57 ? 332 GLY A N    1 
ATOM   4788  C CA   . GLY A 1 332 ? 16.959  -6.449  -16.012 1.00 27.87 ? 332 GLY A CA   1 
ATOM   4789  C C    . GLY A 1 332 ? 17.794  -6.548  -17.260 1.00 31.26 ? 332 GLY A C    1 
ATOM   4790  O O    . GLY A 1 332 ? 18.734  -5.766  -17.437 1.00 24.67 ? 332 GLY A O    1 
ATOM   4791  H H    . GLY A 1 332 ? 15.256  -7.446  -15.901 1.00 27.06 ? 332 GLY A H    1 
ATOM   4792  H HA2  . GLY A 1 332 ? 16.416  -5.648  -16.081 1.00 33.42 ? 332 GLY A HA2  1 
ATOM   4793  H HA3  . GLY A 1 332 ? 17.561  -6.337  -15.260 1.00 33.42 ? 332 GLY A HA3  1 
ATOM   4794  N N    . GLN A 1 333 ? 17.479  -7.467  -18.147 1.00 23.96 ? 333 GLN A N    1 
ATOM   4795  C CA   . GLN A 1 333 ? 18.222  -7.532  -19.395 1.00 21.26 ? 333 GLN A CA   1 
ATOM   4796  C C    . GLN A 1 333 ? 17.949  -6.260  -20.193 1.00 23.99 ? 333 GLN A C    1 
ATOM   4797  O O    . GLN A 1 333 ? 16.789  -5.890  -20.379 1.00 21.56 ? 333 GLN A O    1 
ATOM   4798  C CB   . GLN A 1 333 ? 17.857  -8.778  -20.216 1.00 24.36 ? 333 GLN A CB   1 
ATOM   4799  C CG   . GLN A 1 333 ? 18.534  -8.830  -21.575 1.00 28.40 ? 333 GLN A CG   1 
ATOM   4800  C CD   . GLN A 1 333 ? 18.325  -10.156 -22.292 1.00 34.44 ? 333 GLN A CD   1 
ATOM   4801  O OE1  . GLN A 1 333 ? 17.199  -10.625 -22.438 1.00 37.77 ? 333 GLN A OE1  1 
ATOM   4802  N NE2  . GLN A 1 333 ? 19.416  -10.763 -22.744 1.00 44.08 ? 333 GLN A NE2  1 
ATOM   4803  H H    . GLN A 1 333 ? 16.857  -8.054  -18.059 1.00 28.74 ? 333 GLN A H    1 
ATOM   4804  H HA   . GLN A 1 333 ? 19.171  -7.568  -19.199 1.00 25.49 ? 333 GLN A HA   1 
ATOM   4805  H HB2  . GLN A 1 333 ? 18.123  -9.569  -19.721 1.00 29.21 ? 333 GLN A HB2  1 
ATOM   4806  H HB3  . GLN A 1 333 ? 16.898  -8.788  -20.360 1.00 29.21 ? 333 GLN A HB3  1 
ATOM   4807  H HG2  . GLN A 1 333 ? 18.170  -8.126  -22.136 1.00 34.06 ? 333 GLN A HG2  1 
ATOM   4808  H HG3  . GLN A 1 333 ? 19.488  -8.700  -21.458 1.00 34.06 ? 333 GLN A HG3  1 
ATOM   4809  H HE21 . GLN A 1 333 ? 20.188  -10.404 -22.623 1.00 52.87 ? 333 GLN A HE21 1 
ATOM   4810  H HE22 . GLN A 1 333 ? 19.351  -11.515 -23.156 1.00 52.87 ? 333 GLN A HE22 1 
ATOM   4811  N N    . PRO A 1 334 ? 18.968  -5.551  -20.657 1.00 23.00 ? 334 PRO A N    1 
ATOM   4812  C CA   . PRO A 1 334 ? 18.706  -4.279  -21.351 1.00 26.60 ? 334 PRO A CA   1 
ATOM   4813  C C    . PRO A 1 334 ? 17.875  -4.498  -22.612 1.00 24.67 ? 334 PRO A C    1 
ATOM   4814  O O    . PRO A 1 334 ? 18.173  -5.378  -23.422 1.00 17.59 ? 334 PRO A O    1 
ATOM   4815  C CB   . PRO A 1 334 ? 20.106  -3.739  -21.672 1.00 27.95 ? 334 PRO A CB   1 
ATOM   4816  C CG   . PRO A 1 334 ? 21.062  -4.575  -20.833 1.00 29.47 ? 334 PRO A CG   1 
ATOM   4817  C CD   . PRO A 1 334 ? 20.398  -5.881  -20.594 1.00 24.89 ? 334 PRO A CD   1 
ATOM   4818  H HA   . PRO A 1 334 ? 18.246  -3.659  -20.762 1.00 31.89 ? 334 PRO A HA   1 
ATOM   4819  H HB2  . PRO A 1 334 ? 20.291  -3.854  -22.618 1.00 33.52 ? 334 PRO A HB2  1 
ATOM   4820  H HB3  . PRO A 1 334 ? 20.160  -2.803  -21.423 1.00 33.52 ? 334 PRO A HB3  1 
ATOM   4821  H HG2  . PRO A 1 334 ? 21.891  -4.702  -21.320 1.00 35.34 ? 334 PRO A HG2  1 
ATOM   4822  H HG3  . PRO A 1 334 ? 21.230  -4.123  -19.991 1.00 35.34 ? 334 PRO A HG3  1 
ATOM   4823  H HD2  . PRO A 1 334 ? 20.631  -6.512  -21.293 1.00 29.85 ? 334 PRO A HD2  1 
ATOM   4824  H HD3  . PRO A 1 334 ? 20.627  -6.222  -19.715 1.00 29.85 ? 334 PRO A HD3  1 
ATOM   4825  N N    . VAL A 1 335 ? 16.803  -3.707  -22.757 1.00 22.52 ? 335 VAL A N    1 
ATOM   4826  C CA   . VAL A 1 335 ? 15.883  -3.893  -23.883 1.00 20.79 ? 335 VAL A CA   1 
ATOM   4827  C C    . VAL A 1 335 ? 16.636  -3.714  -25.191 1.00 21.77 ? 335 VAL A C    1 
ATOM   4828  O O    . VAL A 1 335 ? 16.305  -4.336  -26.204 1.00 20.98 ? 335 VAL A O    1 
ATOM   4829  C CB   . VAL A 1 335 ? 14.669  -2.932  -23.756 1.00 19.78 ? 335 VAL A CB   1 
ATOM   4830  C CG1  . VAL A 1 335 ? 15.102  -1.477  -23.809 1.00 19.24 ? 335 VAL A CG1  1 
ATOM   4831  C CG2  . VAL A 1 335 ? 13.628  -3.214  -24.847 1.00 18.52 ? 335 VAL A CG2  1 
ATOM   4832  H H    . VAL A 1 335 ? 16.590  -3.065  -22.225 1.00 27.01 ? 335 VAL A H    1 
ATOM   4833  H HA   . VAL A 1 335 ? 15.544  -4.801  -23.860 1.00 24.93 ? 335 VAL A HA   1 
ATOM   4834  H HB   . VAL A 1 335 ? 14.243  -3.082  -22.898 1.00 23.71 ? 335 VAL A HB   1 
ATOM   4835  H HG11 . VAL A 1 335 ? 14.319  -0.911  -23.727 1.00 23.07 ? 335 VAL A HG11 1 
ATOM   4836  H HG12 . VAL A 1 335 ? 15.714  -1.303  -23.077 1.00 23.07 ? 335 VAL A HG12 1 
ATOM   4837  H HG13 . VAL A 1 335 ? 15.544  -1.310  -24.657 1.00 23.07 ? 335 VAL A HG13 1 
ATOM   4838  H HG21 . VAL A 1 335 ? 12.885  -2.600  -24.741 1.00 22.20 ? 335 VAL A HG21 1 
ATOM   4839  H HG22 . VAL A 1 335 ? 14.040  -3.088  -25.716 1.00 22.20 ? 335 VAL A HG22 1 
ATOM   4840  H HG23 . VAL A 1 335 ? 13.317  -4.129  -24.758 1.00 22.20 ? 335 VAL A HG23 1 
ATOM   4841  N N    . GLY A 1 336 ? 17.711  -2.921  -25.179 1.00 25.74 ? 336 GLY A N    1 
ATOM   4842  C CA   . GLY A 1 336 ? 18.454  -2.713  -26.401 1.00 29.37 ? 336 GLY A CA   1 
ATOM   4843  C C    . GLY A 1 336 ? 19.128  -3.957  -26.917 1.00 28.92 ? 336 GLY A C    1 
ATOM   4844  O O    . GLY A 1 336 ? 19.576  -3.962  -28.065 1.00 36.90 ? 336 GLY A O    1 
ATOM   4845  H H    . GLY A 1 336 ? 18.017  -2.507  -24.490 1.00 30.87 ? 336 GLY A H    1 
ATOM   4846  H HA2  . GLY A 1 336 ? 17.853  -2.387  -27.089 1.00 35.22 ? 336 GLY A HA2  1 
ATOM   4847  H HA3  . GLY A 1 336 ? 19.136  -2.040  -26.249 1.00 35.22 ? 336 GLY A HA3  1 
ATOM   4848  N N    . GLU A 1 337 ? 19.200  -5.001  -26.098 1.00 28.72 ? 337 GLU A N    1 
ATOM   4849  C CA   . GLU A 1 337 ? 19.747  -6.297  -26.453 1.00 27.10 ? 337 GLU A CA   1 
ATOM   4850  C C    . GLU A 1 337 ? 18.727  -7.229  -27.061 1.00 27.99 ? 337 GLU A C    1 
ATOM   4851  O O    . GLU A 1 337 ? 19.098  -8.339  -27.455 1.00 25.55 ? 337 GLU A O    1 
ATOM   4852  C CB   . GLU A 1 337 ? 20.331  -6.974  -25.203 1.00 33.59 ? 337 GLU A CB   1 
ATOM   4853  C CG   . GLU A 1 337 ? 21.516  -6.249  -24.626 1.00 35.50 ? 337 GLU A CG   1 
ATOM   4854  C CD   . GLU A 1 337 ? 22.572  -5.984  -25.682 1.00 43.61 ? 337 GLU A CD   1 
ATOM   4855  O OE1  . GLU A 1 337 ? 23.045  -6.962  -26.319 1.00 44.32 ? 337 GLU A OE1  1 
ATOM   4856  O OE2  . GLU A 1 337 ? 22.893  -4.797  -25.906 1.00 42.69 ? 337 GLU A OE2  1 
ATOM   4857  H H    . GLU A 1 337 ? 18.921  -4.974  -25.285 1.00 34.44 ? 337 GLU A H    1 
ATOM   4858  H HA   . GLU A 1 337 ? 20.464  -6.174  -27.094 1.00 32.49 ? 337 GLU A HA   1 
ATOM   4859  H HB2  . GLU A 1 337 ? 19.645  -7.014  -24.518 1.00 40.28 ? 337 GLU A HB2  1 
ATOM   4860  H HB3  . GLU A 1 337 ? 20.616  -7.871  -25.437 1.00 40.28 ? 337 GLU A HB3  1 
ATOM   4861  H HG2  . GLU A 1 337 ? 21.226  -5.397  -24.266 1.00 42.58 ? 337 GLU A HG2  1 
ATOM   4862  H HG3  . GLU A 1 337 ? 21.914  -6.792  -23.928 1.00 42.58 ? 337 GLU A HG3  1 
ATOM   4863  N N    . PHE A 1 338 ? 17.463  -6.809  -27.144 1.00 27.16 ? 338 PHE A N    1 
ATOM   4864  C CA   . PHE A 1 338 ? 16.388  -7.709  -27.568 1.00 24.59 ? 338 PHE A CA   1 
ATOM   4865  C C    . PHE A 1 338 ? 16.696  -8.319  -28.929 1.00 26.06 ? 338 PHE A C    1 
ATOM   4866  O O    . PHE A 1 338 ? 16.558  -9.530  -29.127 1.00 22.08 ? 338 PHE A O    1 
ATOM   4867  C CB   . PHE A 1 338 ? 15.046  -6.957  -27.606 1.00 21.62 ? 338 PHE A CB   1 
ATOM   4868  C CG   . PHE A 1 338 ? 13.912  -7.767  -28.119 1.00 19.11 ? 338 PHE A CG   1 
ATOM   4869  C CD1  . PHE A 1 338 ? 13.356  -8.755  -27.342 1.00 25.86 ? 338 PHE A CD1  1 
ATOM   4870  C CD2  . PHE A 1 338 ? 13.403  -7.546  -29.394 1.00 19.50 ? 338 PHE A CD2  1 
ATOM   4871  C CE1  . PHE A 1 338 ? 12.294  -9.529  -27.818 1.00 20.16 ? 338 PHE A CE1  1 
ATOM   4872  C CE2  . PHE A 1 338 ? 12.356  -8.307  -29.886 1.00 22.83 ? 338 PHE A CE2  1 
ATOM   4873  C CZ   . PHE A 1 338 ? 11.793  -9.301  -29.098 1.00 23.76 ? 338 PHE A CZ   1 
ATOM   4874  H H    . PHE A 1 338 ? 17.202  -6.010  -26.961 1.00 32.57 ? 338 PHE A H    1 
ATOM   4875  H HA   . PHE A 1 338 ? 16.310  -8.432  -26.926 1.00 29.49 ? 338 PHE A HA   1 
ATOM   4876  H HB2  . PHE A 1 338 ? 14.823  -6.673  -26.706 1.00 25.92 ? 338 PHE A HB2  1 
ATOM   4877  H HB3  . PHE A 1 338 ? 15.139  -6.181  -28.181 1.00 25.92 ? 338 PHE A HB3  1 
ATOM   4878  H HD1  . PHE A 1 338 ? 13.691  -8.910  -26.488 1.00 31.01 ? 338 PHE A HD1  1 
ATOM   4879  H HD2  . PHE A 1 338 ? 13.778  -6.883  -29.927 1.00 23.38 ? 338 PHE A HD2  1 
ATOM   4880  H HE1  . PHE A 1 338 ? 11.925  -10.194 -27.283 1.00 24.17 ? 338 PHE A HE1  1 
ATOM   4881  H HE2  . PHE A 1 338 ? 12.024  -8.146  -30.739 1.00 27.38 ? 338 PHE A HE2  1 
ATOM   4882  H HZ   . PHE A 1 338 ? 11.086  -9.810  -29.422 1.00 28.49 ? 338 PHE A HZ   1 
ATOM   4883  N N    . ILE A 1 339 ? 17.112  -7.497  -29.886 1.00 24.40 ? 339 ILE A N    1 
ATOM   4884  C CA   . ILE A 1 339 ? 17.302  -8.014  -31.236 1.00 19.08 ? 339 ILE A CA   1 
ATOM   4885  C C    . ILE A 1 339 ? 18.451  -9.005  -31.258 1.00 23.02 ? 339 ILE A C    1 
ATOM   4886  O O    . ILE A 1 339 ? 18.392  -10.027 -31.949 1.00 24.36 ? 339 ILE A O    1 
ATOM   4887  C CB   . ILE A 1 339 ? 17.521  -6.859  -32.228 1.00 22.52 ? 339 ILE A CB   1 
ATOM   4888  C CG1  . ILE A 1 339 ? 16.227  -6.085  -32.445 1.00 31.83 ? 339 ILE A CG1  1 
ATOM   4889  C CG2  . ILE A 1 339 ? 18.038  -7.363  -33.591 1.00 29.92 ? 339 ILE A CG2  1 
ATOM   4890  C CD1  . ILE A 1 339 ? 15.088  -6.902  -32.995 1.00 32.33 ? 339 ILE A CD1  1 
ATOM   4891  H H    . ILE A 1 339 ? 17.287  -6.661  -29.785 1.00 29.26 ? 339 ILE A H    1 
ATOM   4892  H HA   . ILE A 1 339 ? 16.498  -8.486  -31.505 1.00 22.88 ? 339 ILE A HA   1 
ATOM   4893  H HB   . ILE A 1 339 ? 18.181  -6.255  -31.854 1.00 27.00 ? 339 ILE A HB   1 
ATOM   4894  H HG12 . ILE A 1 339 ? 15.940  -5.716  -31.595 1.00 38.17 ? 339 ILE A HG12 1 
ATOM   4895  H HG13 . ILE A 1 339 ? 16.400  -5.364  -33.071 1.00 38.17 ? 339 ILE A HG13 1 
ATOM   4896  H HG21 . ILE A 1 339 ? 18.161  -6.604  -34.182 1.00 35.88 ? 339 ILE A HG21 1 
ATOM   4897  H HG22 . ILE A 1 339 ? 18.884  -7.820  -33.458 1.00 35.88 ? 339 ILE A HG22 1 
ATOM   4898  H HG23 . ILE A 1 339 ? 17.387  -7.975  -33.969 1.00 35.88 ? 339 ILE A HG23 1 
ATOM   4899  H HD11 . ILE A 1 339 ? 14.312  -6.330  -33.100 1.00 38.77 ? 339 ILE A HD11 1 
ATOM   4900  H HD12 . ILE A 1 339 ? 15.349  -7.268  -33.855 1.00 38.77 ? 339 ILE A HD12 1 
ATOM   4901  H HD13 . ILE A 1 339 ? 14.889  -7.621  -32.375 1.00 38.77 ? 339 ILE A HD13 1 
ATOM   4902  N N    . HIS A 1 340 ? 19.513  -8.719  -30.500 1.00 25.68 ? 340 HIS A N    1 
ATOM   4903  C CA   . HIS A 1 340 ? 20.664  -9.610  -30.457 1.00 24.33 ? 340 HIS A CA   1 
ATOM   4904  C C    . HIS A 1 340 ? 20.234  -11.014 -30.076 1.00 27.26 ? 340 HIS A C    1 
ATOM   4905  O O    . HIS A 1 340 ? 20.800  -12.001 -30.570 1.00 26.18 ? 340 HIS A O    1 
ATOM   4906  C CB   . HIS A 1 340 ? 21.726  -9.075  -29.466 1.00 26.06 ? 340 HIS A CB   1 
ATOM   4907  C CG   . HIS A 1 340 ? 22.260  -7.717  -29.827 1.00 30.05 ? 340 HIS A CG   1 
ATOM   4908  N ND1  . HIS A 1 340 ? 22.741  -6.828  -28.890 1.00 28.91 ? 340 HIS A ND1  1 
ATOM   4909  C CD2  . HIS A 1 340 ? 22.366  -7.090  -31.024 1.00 37.90 ? 340 HIS A CD2  1 
ATOM   4910  C CE1  . HIS A 1 340 ? 23.131  -5.719  -29.492 1.00 29.23 ? 340 HIS A CE1  1 
ATOM   4911  N NE2  . HIS A 1 340 ? 22.912  -5.849  -30.787 1.00 29.92 ? 340 HIS A NE2  1 
ATOM   4912  H H    . HIS A 1 340 ? 19.587  -8.019  -30.007 1.00 30.79 ? 340 HIS A H    1 
ATOM   4913  H HA   . HIS A 1 340 ? 21.068  -9.649  -31.338 1.00 29.17 ? 340 HIS A HA   1 
ATOM   4914  H HB2  . HIS A 1 340 ? 21.328  -9.012  -28.584 1.00 31.26 ? 340 HIS A HB2  1 
ATOM   4915  H HB3  . HIS A 1 340 ? 22.474  -9.692  -29.446 1.00 31.26 ? 340 HIS A HB3  1 
ATOM   4916  H HD1  . HIS A 1 340 ? 22.786  -6.976  -28.043 1.00 34.67 ? 340 HIS A HD1  1 
ATOM   4917  H HD2  . HIS A 1 340 ? 22.119  -7.435  -31.852 1.00 45.46 ? 340 HIS A HD2  1 
ATOM   4918  H HE1  . HIS A 1 340 ? 23.495  -4.972  -29.074 1.00 35.05 ? 340 HIS A HE1  1 
ATOM   4919  N N    . CYS A 1 341 ? 19.223  -11.129 -29.221 1.00 24.99 ? 341 CYS A N    1 
ATOM   4920  C CA   . CYS A 1 341 ? 18.766  -12.444 -28.794 1.00 24.30 ? 341 CYS A CA   1 
ATOM   4921  C C    . CYS A 1 341 ? 18.083  -13.216 -29.916 1.00 25.01 ? 341 CYS A C    1 
ATOM   4922  O O    . CYS A 1 341 ? 17.760  -14.388 -29.726 1.00 30.26 ? 341 CYS A O    1 
ATOM   4923  C CB   . CYS A 1 341 ? 17.801  -12.316 -27.606 1.00 28.04 ? 341 CYS A CB   1 
ATOM   4924  S SG   . CYS A 1 341 ? 18.455  -11.493 -26.116 1.00 35.37 ? 341 CYS A SG   1 
ATOM   4925  H H    . CYS A 1 341 ? 18.790  -10.470 -28.878 1.00 29.96 ? 341 CYS A H    1 
ATOM   4926  H HA   . CYS A 1 341 ? 19.533  -12.962 -28.500 1.00 29.14 ? 341 CYS A HA   1 
ATOM   4927  H HB2  . CYS A 1 341 ? 17.027  -11.810 -27.897 1.00 33.62 ? 341 CYS A HB2  1 
ATOM   4928  H HB3  . CYS A 1 341 ? 17.522  -13.207 -27.343 1.00 33.62 ? 341 CYS A HB3  1 
ATOM   4929  H HG   . CYS A 1 341 ? 18.786  -10.375 -26.400 1.00 42.42 ? 341 CYS A HG   1 
ATOM   4930  N N    . LEU A 1 342 ? 17.815  -12.585 -31.063 1.00 25.35 ? 342 LEU A N    1 
ATOM   4931  C CA   . LEU A 1 342 ? 17.202  -13.259 -32.203 1.00 19.24 ? 342 LEU A CA   1 
ATOM   4932  C C    . LEU A 1 342 ? 18.214  -13.636 -33.279 1.00 17.31 ? 342 LEU A C    1 
ATOM   4933  O O    . LEU A 1 342 ? 17.827  -14.138 -34.332 1.00 17.82 ? 342 LEU A O    1 
ATOM   4934  C CB   . LEU A 1 342 ? 16.118  -12.383 -32.819 1.00 20.11 ? 342 LEU A CB   1 
ATOM   4935  C CG   . LEU A 1 342 ? 15.112  -11.807 -31.829 1.00 23.54 ? 342 LEU A CG   1 
ATOM   4936  C CD1  . LEU A 1 342 ? 14.028  -11.113 -32.608 1.00 21.21 ? 342 LEU A CD1  1 
ATOM   4937  C CD2  . LEU A 1 342 ? 14.509  -12.886 -30.925 1.00 24.39 ? 342 LEU A CD2  1 
ATOM   4938  H H    . LEU A 1 342 ? 17.984  -11.754 -31.203 1.00 30.39 ? 342 LEU A H    1 
ATOM   4939  H HA   . LEU A 1 342 ? 16.782  -14.076 -31.893 1.00 23.07 ? 342 LEU A HA   1 
ATOM   4940  H HB2  . LEU A 1 342 ? 16.543  -11.637 -33.271 1.00 24.10 ? 342 LEU A HB2  1 
ATOM   4941  H HB3  . LEU A 1 342 ? 15.623  -12.913 -33.463 1.00 24.10 ? 342 LEU A HB3  1 
ATOM   4942  H HG   . LEU A 1 342 ? 15.553  -11.150 -31.268 1.00 28.22 ? 342 LEU A HG   1 
ATOM   4943  H HD11 . LEU A 1 342 ? 13.382  -10.742 -31.988 1.00 25.43 ? 342 LEU A HD11 1 
ATOM   4944  H HD12 . LEU A 1 342 ? 14.425  -10.403 -33.137 1.00 25.43 ? 342 LEU A HD12 1 
ATOM   4945  H HD13 . LEU A 1 342 ? 13.597  -11.758 -33.190 1.00 25.43 ? 342 LEU A HD13 1 
ATOM   4946  H HD21 . LEU A 1 342 ? 13.879  -12.471 -30.315 1.00 29.25 ? 342 LEU A HD21 1 
ATOM   4947  H HD22 . LEU A 1 342 ? 14.054  -13.541 -31.476 1.00 29.25 ? 342 LEU A HD22 1 
ATOM   4948  H HD23 . LEU A 1 342 ? 15.222  -13.312 -30.424 1.00 29.25 ? 342 LEU A HD23 1 
ATOM   4949  N N    . GLN A 1 343 ? 19.497  -13.413 -33.039 1.00 18.42 ? 343 GLN A N    1 
ATOM   4950  C CA   . GLN A 1 343 ? 20.495  -13.614 -34.089 1.00 22.52 ? 343 GLN A CA   1 
ATOM   4951  C C    . GLN A 1 343 ? 21.058  -15.027 -34.132 1.00 21.64 ? 343 GLN A C    1 
ATOM   4952  O O    . GLN A 1 343 ? 21.896  -15.315 -34.995 1.00 17.79 ? 343 GLN A O    1 
ATOM   4953  C CB   . GLN A 1 343 ? 21.650  -12.611 -33.932 1.00 19.93 ? 343 GLN A CB   1 
ATOM   4954  C CG   . GLN A 1 343 ? 21.247  -11.156 -34.141 1.00 21.21 ? 343 GLN A CG   1 
ATOM   4955  C CD   . GLN A 1 343 ? 22.404  -10.209 -33.884 1.00 29.62 ? 343 GLN A CD   1 
ATOM   4956  O OE1  . GLN A 1 343 ? 23.062  -10.295 -32.850 1.00 23.41 ? 343 GLN A OE1  1 
ATOM   4957  N NE2  . GLN A 1 343 ? 22.671  -9.322  -34.828 1.00 25.43 ? 343 GLN A NE2  1 
ATOM   4958  H H    . GLN A 1 343 ? 19.818  -13.148 -32.286 1.00 22.08 ? 343 GLN A H    1 
ATOM   4959  H HA   . GLN A 1 343 ? 20.075  -13.442 -34.947 1.00 27.00 ? 343 GLN A HA   1 
ATOM   4960  H HB2  . GLN A 1 343 ? 22.012  -12.692 -33.036 1.00 23.90 ? 343 GLN A HB2  1 
ATOM   4961  H HB3  . GLN A 1 343 ? 22.337  -12.823 -34.583 1.00 23.90 ? 343 GLN A HB3  1 
ATOM   4962  H HG2  . GLN A 1 343 ? 20.954  -11.034 -35.057 1.00 25.43 ? 343 GLN A HG2  1 
ATOM   4963  H HG3  . GLN A 1 343 ? 20.530  -10.932 -33.527 1.00 25.43 ? 343 GLN A HG3  1 
ATOM   4964  H HE21 . GLN A 1 343 ? 22.190  -9.294  -35.540 1.00 30.49 ? 343 GLN A HE21 1 
ATOM   4965  H HE22 . GLN A 1 343 ? 23.320  -8.767  -34.725 1.00 30.49 ? 343 GLN A HE22 1 
ATOM   4966  N N    . ASN A 1 344 ? 20.631  -15.915 -33.234 1.00 20.25 ? 344 ASN A N    1 
ATOM   4967  C CA   . ASN A 1 344 ? 21.034  -17.314 -33.302 1.00 19.64 ? 344 ASN A CA   1 
ATOM   4968  C C    . ASN A 1 344 ? 19.824  -18.201 -33.074 1.00 16.97 ? 344 ASN A C    1 
ATOM   4969  O O    . ASN A 1 344 ? 19.841  -19.139 -32.273 1.00 17.57 ? 344 ASN A O    1 
ATOM   4970  C CB   . ASN A 1 344 ? 22.135  -17.658 -32.301 1.00 24.01 ? 344 ASN A CB   1 
ATOM   4971  C CG   . ASN A 1 344 ? 22.745  -19.027 -32.576 1.00 30.22 ? 344 ASN A CG   1 
ATOM   4972  O OD1  . ASN A 1 344 ? 22.838  -19.457 -33.731 1.00 28.96 ? 344 ASN A OD1  1 
ATOM   4973  N ND2  . ASN A 1 344 ? 23.130  -19.735 -31.515 1.00 30.25 ? 344 ASN A ND2  1 
ATOM   4974  H H    . ASN A 1 344 ? 20.107  -15.731 -32.578 1.00 24.28 ? 344 ASN A H    1 
ATOM   4975  H HA   . ASN A 1 344 ? 21.374  -17.498 -34.191 1.00 23.54 ? 344 ASN A HA   1 
ATOM   4976  H HB2  . ASN A 1 344 ? 22.840  -16.995 -32.363 1.00 28.79 ? 344 ASN A HB2  1 
ATOM   4977  H HB3  . ASN A 1 344 ? 21.761  -17.667 -31.406 1.00 28.79 ? 344 ASN A HB3  1 
ATOM   4978  H HD21 . ASN A 1 344 ? 23.477  -20.514 -31.622 1.00 36.28 ? 344 ASN A HD21 1 
ATOM   4979  H HD22 . ASN A 1 344 ? 23.045  -19.407 -30.725 1.00 36.28 ? 344 ASN A HD22 1 
ATOM   4980  N N    . HIS A 1 345 ? 18.737  -17.899 -33.814 1.00 19.50 ? 345 HIS A N    1 
ATOM   4981  C CA   . HIS A 1 345 ? 17.461  -18.484 -33.515 1.00 18.92 ? 345 HIS A CA   1 
ATOM   4982  C C    . HIS A 1 345 ? 17.414  -19.928 -34.009 1.00 16.27 ? 345 HIS A C    1 
ATOM   4983  O O    . HIS A 1 345 ? 17.951  -20.238 -35.078 1.00 15.12 ? 345 HIS A O    1 
ATOM   4984  C CB   . HIS A 1 345 ? 16.332  -17.662 -34.176 1.00 16.70 ? 345 HIS A CB   1 
ATOM   4985  C CG   . HIS A 1 345 ? 14.987  -17.930 -33.595 1.00 17.37 ? 345 HIS A CG   1 
ATOM   4986  N ND1  . HIS A 1 345 ? 14.267  -19.058 -33.906 1.00 15.22 ? 345 HIS A ND1  1 
ATOM   4987  C CD2  . HIS A 1 345 ? 14.249  -17.248 -32.684 1.00 16.45 ? 345 HIS A CD2  1 
ATOM   4988  C CE1  . HIS A 1 345 ? 13.148  -19.071 -33.201 1.00 17.96 ? 345 HIS A CE1  1 
ATOM   4989  N NE2  . HIS A 1 345 ? 13.111  -17.978 -32.458 1.00 16.08 ? 345 HIS A NE2  1 
ATOM   4990  H H    . HIS A 1 345 ? 18.734  -17.360 -34.484 1.00 23.38 ? 345 HIS A H    1 
ATOM   4991  H HA   . HIS A 1 345 ? 17.321  -18.483 -32.555 1.00 22.69 ? 345 HIS A HA   1 
ATOM   4992  H HB2  . HIS A 1 345 ? 16.523  -16.718 -34.061 1.00 20.01 ? 345 HIS A HB2  1 
ATOM   4993  H HB3  . HIS A 1 345 ? 16.298  -17.879 -35.120 1.00 20.01 ? 345 HIS A HB3  1 
ATOM   4994  H HD2  . HIS A 1 345 ? 14.480  -16.444 -32.277 1.00 19.71 ? 345 HIS A HD2  1 
ATOM   4995  H HE1  . HIS A 1 345 ? 12.485  -19.721 -33.246 1.00 21.54 ? 345 HIS A HE1  1 
ATOM   4996  H HE2  . HIS A 1 345 ? 12.470  -17.754 -31.930 1.00 19.28 ? 345 HIS A HE2  1 
ATOM   4997  N N    . PRO A 1 346 ? 16.731  -20.811 -33.286 1.00 18.45 ? 346 PRO A N    1 
ATOM   4998  C CA   . PRO A 1 346 ? 16.546  -22.182 -33.786 1.00 18.00 ? 346 PRO A CA   1 
ATOM   4999  C C    . PRO A 1 346 ? 16.023  -22.272 -35.220 1.00 19.03 ? 346 PRO A C    1 
ATOM   5000  O O    . PRO A 1 346 ? 16.416  -23.182 -35.964 1.00 18.34 ? 346 PRO A O    1 
ATOM   5001  C CB   . PRO A 1 346 ? 15.537  -22.775 -32.788 1.00 23.91 ? 346 PRO A CB   1 
ATOM   5002  C CG   . PRO A 1 346 ? 15.823  -22.081 -31.517 1.00 22.10 ? 346 PRO A CG   1 
ATOM   5003  C CD   . PRO A 1 346 ? 16.277  -20.663 -31.898 1.00 18.34 ? 346 PRO A CD   1 
ATOM   5004  H HA   . PRO A 1 346 ? 17.380  -22.674 -33.722 1.00 21.57 ? 346 PRO A HA   1 
ATOM   5005  H HB2  . PRO A 1 346 ? 14.632  -22.589 -33.086 1.00 28.67 ? 346 PRO A HB2  1 
ATOM   5006  H HB3  . PRO A 1 346 ? 15.683  -23.730 -32.700 1.00 28.67 ? 346 PRO A HB3  1 
ATOM   5007  H HG2  . PRO A 1 346 ? 15.018  -22.047 -30.978 1.00 26.50 ? 346 PRO A HG2  1 
ATOM   5008  H HG3  . PRO A 1 346 ? 16.530  -22.549 -31.045 1.00 26.50 ? 346 PRO A HG3  1 
ATOM   5009  H HD2  . PRO A 1 346 ? 15.531  -20.045 -31.850 1.00 21.99 ? 346 PRO A HD2  1 
ATOM   5010  H HD3  . PRO A 1 346 ? 17.011  -20.379 -31.331 1.00 21.99 ? 346 PRO A HD3  1 
ATOM   5011  N N    . GLU A 1 347 ? 15.147  -21.351 -35.634 1.00 15.48 ? 347 GLU A N    1 
ATOM   5012  C CA   . GLU A 1 347 ? 14.581  -21.419 -36.973 1.00 16.87 ? 347 GLU A CA   1 
ATOM   5013  C C    . GLU A 1 347 ? 15.635  -21.327 -38.055 1.00 22.29 ? 347 GLU A C    1 
ATOM   5014  O O    . GLU A 1 347 ? 15.390  -21.793 -39.177 1.00 19.53 ? 347 GLU A O    1 
ATOM   5015  C CB   . GLU A 1 347 ? 13.562  -20.300 -37.173 1.00 20.23 ? 347 GLU A CB   1 
ATOM   5016  C CG   . GLU A 1 347 ? 12.302  -20.498 -36.408 1.00 21.93 ? 347 GLU A CG   1 
ATOM   5017  C CD   . GLU A 1 347 ? 11.588  -21.774 -36.764 1.00 23.14 ? 347 GLU A CD   1 
ATOM   5018  O OE1  . GLU A 1 347 ? 11.520  -22.079 -37.962 1.00 24.84 ? 347 GLU A OE1  1 
ATOM   5019  O OE2  . GLU A 1 347 ? 11.089  -22.463 -35.847 1.00 23.65 ? 347 GLU A OE2  1 
ATOM   5020  H H    . GLU A 1 347 ? 14.871  -20.687 -35.162 1.00 18.56 ? 347 GLU A H    1 
ATOM   5021  H HA   . GLU A 1 347 ? 14.120  -22.266 -37.077 1.00 20.22 ? 347 GLU A HA   1 
ATOM   5022  H HB2  . GLU A 1 347 ? 13.956  -19.462 -36.884 1.00 24.26 ? 347 GLU A HB2  1 
ATOM   5023  H HB3  . GLU A 1 347 ? 13.333  -20.249 -38.114 1.00 24.26 ? 347 GLU A HB3  1 
ATOM   5024  H HG2  . GLU A 1 347 ? 12.510  -20.526 -35.461 1.00 26.30 ? 347 GLU A HG2  1 
ATOM   5025  H HG3  . GLU A 1 347 ? 11.702  -19.758 -36.593 1.00 26.30 ? 347 GLU A HG3  1 
ATOM   5026  N N    . HIS A 1 348 ? 16.791  -20.724 -37.751 1.00 15.07 ? 348 HIS A N    1 
ATOM   5027  C CA   . HIS A 1 348 ? 17.852  -20.520 -38.722 1.00 14.74 ? 348 HIS A CA   1 
ATOM   5028  C C    . HIS A 1 348 ? 19.015  -21.475 -38.542 1.00 18.76 ? 348 HIS A C    1 
ATOM   5029  O O    . HIS A 1 348 ? 20.016  -21.343 -39.248 1.00 19.92 ? 348 HIS A O    1 
ATOM   5030  C CB   . HIS A 1 348 ? 18.372  -19.106 -38.635 1.00 19.67 ? 348 HIS A CB   1 
ATOM   5031  C CG   . HIS A 1 348 ? 17.301  -18.087 -38.795 1.00 17.60 ? 348 HIS A CG   1 
ATOM   5032  N ND1  . HIS A 1 348 ? 16.985  -17.171 -37.822 1.00 14.34 ? 348 HIS A ND1  1 
ATOM   5033  C CD2  . HIS A 1 348 ? 16.463  -17.847 -39.828 1.00 16.27 ? 348 HIS A CD2  1 
ATOM   5034  C CE1  . HIS A 1 348 ? 15.978  -16.425 -38.236 1.00 16.92 ? 348 HIS A CE1  1 
ATOM   5035  N NE2  . HIS A 1 348 ? 15.655  -16.804 -39.458 1.00 15.57 ? 348 HIS A NE2  1 
ATOM   5036  H H    . HIS A 1 348 ? 16.980  -20.419 -36.969 1.00 18.07 ? 348 HIS A H    1 
ATOM   5037  H HA   . HIS A 1 348 ? 17.493  -20.653 -39.613 1.00 17.66 ? 348 HIS A HA   1 
ATOM   5038  H HB2  . HIS A 1 348 ? 18.785  -18.974 -37.767 1.00 23.58 ? 348 HIS A HB2  1 
ATOM   5039  H HB3  . HIS A 1 348 ? 19.026  -18.967 -39.338 1.00 23.58 ? 348 HIS A HB3  1 
ATOM   5040  H HD2  . HIS A 1 348 ? 16.436  -18.306 -40.636 1.00 19.50 ? 348 HIS A HD2  1 
ATOM   5041  H HE1  . HIS A 1 348 ? 15.587  -15.727 -37.762 1.00 20.28 ? 348 HIS A HE1  1 
ATOM   5042  H HE2  . HIS A 1 348 ? 15.034  -16.458 -39.941 1.00 18.66 ? 348 HIS A HE2  1 
ATOM   5043  N N    . MET A 1 349 ? 18.908  -22.422 -37.631 1.00 21.22 ? 349 MET A N    1 
ATOM   5044  C CA   . MET A 1 349 ? 19.994  -23.406 -37.418 1.00 25.65 ? 349 MET A CA   1 
ATOM   5045  C C    . MET A 1 349 ? 19.963  -24.455 -38.532 1.00 30.65 ? 349 MET A C    1 
ATOM   5046  O O    . MET A 1 349 ? 18.999  -24.606 -39.168 1.00 24.98 ? 349 MET A O    1 
ATOM   5047  C CB   . MET A 1 349 ? 19.890  -24.061 -36.043 1.00 23.88 ? 349 MET A CB   1 
ATOM   5048  C CG   . MET A 1 349 ? 20.505  -23.201 -34.964 1.00 29.19 ? 349 MET A CG   1 
ATOM   5049  S SD   . MET A 1 349 ? 20.055  -23.675 -33.310 1.00 31.43 ? 349 MET A SD   1 
ATOM   5050  C CE   . MET A 1 349 ? 19.866  -25.439 -33.516 1.00 41.33 ? 349 MET A CE   1 
ATOM   5051  O OXT  . MET A 1 349 ? 20.985  -25.099 -38.707 1.00 33.73 ? 349 MET A OXT  1 
ATOM   5052  H H    . MET A 1 349 ? 18.181  -22.525 -37.092 1.00 25.44 ? 349 MET A H    1 
ATOM   5053  H HA   . MET A 1 349 ? 20.851  -22.924 -37.476 1.00 30.76 ? 349 MET A HA   1 
ATOM   5054  H HB2  . MET A 1 349 ? 18.947  -24.218 -35.834 1.00 28.64 ? 349 MET A HB2  1 
ATOM   5055  H HB3  . MET A 1 349 ? 20.344  -24.926 -36.066 1.00 28.64 ? 349 MET A HB3  1 
ATOM   5056  H HG2  . MET A 1 349 ? 21.482  -23.241 -35.046 1.00 35.00 ? 349 MET A HG2  1 
ATOM   5057  H HG3  . MET A 1 349 ? 20.232  -22.270 -35.107 1.00 35.00 ? 349 MET A HG3  1 
ATOM   5058  H HE1  . MET A 1 349 ? 19.615  -25.836 -32.673 1.00 49.57 ? 349 MET A HE1  1 
ATOM   5059  H HE2  . MET A 1 349 ? 19.179  -25.614 -34.172 1.00 49.57 ? 349 MET A HE2  1 
ATOM   5060  H HE3  . MET A 1 349 ? 20.701  -25.819 -33.816 1.00 49.57 ? 349 MET A HE3  1 
ATOM   5061  N N    . ALA B 1 2   ? 38.434  -26.072 -57.369 1.00 50.92 ? 2   ALA B N    1 
ATOM   5062  C CA   . ALA B 1 2   ? 38.312  -26.593 -56.010 1.00 48.15 ? 2   ALA B CA   1 
ATOM   5063  C C    . ALA B 1 2   ? 37.315  -25.766 -55.215 1.00 42.75 ? 2   ALA B C    1 
ATOM   5064  O O    . ALA B 1 2   ? 36.147  -26.127 -55.113 1.00 43.96 ? 2   ALA B O    1 
ATOM   5065  C CB   . ALA B 1 2   ? 39.666  -26.603 -55.318 1.00 56.72 ? 2   ALA B CB   1 
ATOM   5066  H HA   . ALA B 1 2   ? 37.986  -27.505 -56.047 1.00 57.76 ? 2   ALA B HA   1 
ATOM   5067  H HB1  . ALA B 1 2   ? 39.559  -26.952 -54.419 1.00 68.04 ? 2   ALA B HB1  1 
ATOM   5068  H HB2  . ALA B 1 2   ? 40.274  -27.167 -55.822 1.00 68.04 ? 2   ALA B HB2  1 
ATOM   5069  H HB3  . ALA B 1 2   ? 40.009  -25.696 -55.282 1.00 68.04 ? 2   ALA B HB3  1 
ATOM   5070  N N    . SER B 1 3   ? 37.779  -24.665 -54.632 1.00 37.07 ? 3   SER B N    1 
ATOM   5071  C CA   . SER B 1 3   ? 36.863  -23.744 -53.976 1.00 35.38 ? 3   SER B CA   1 
ATOM   5072  C C    . SER B 1 3   ? 35.945  -23.109 -55.021 1.00 30.34 ? 3   SER B C    1 
ATOM   5073  O O    . SER B 1 3   ? 36.356  -22.843 -56.154 1.00 30.60 ? 3   SER B O    1 
ATOM   5074  C CB   . SER B 1 3   ? 37.657  -22.665 -53.229 1.00 31.14 ? 3   SER B CB   1 
ATOM   5075  O OG   . SER B 1 3   ? 38.262  -21.775 -54.163 1.00 37.38 ? 3   SER B OG   1 
ATOM   5076  H H    . SER B 1 3   ? 38.606  -24.433 -54.602 1.00 44.46 ? 3   SER B H    1 
ATOM   5077  H HA   . SER B 1 3   ? 36.318  -24.227 -53.335 1.00 42.44 ? 3   SER B HA   1 
ATOM   5078  H HB2  . SER B 1 3   ? 37.055  -22.165 -52.656 1.00 37.34 ? 3   SER B HB2  1 
ATOM   5079  H HB3  . SER B 1 3   ? 38.349  -23.089 -52.698 1.00 37.34 ? 3   SER B HB3  1 
ATOM   5080  H HG   . SER B 1 3   ? 38.698  -21.184 -53.755 1.00 44.83 ? 3   SER B HG   1 
ATOM   5081  N N    . LYS B 1 4   ? 34.690  -22.856 -54.639 1.00 26.99 ? 4   LYS B N    1 
ATOM   5082  C CA   . LYS B 1 4   ? 33.714  -22.341 -55.593 1.00 26.00 ? 4   LYS B CA   1 
ATOM   5083  C C    . LYS B 1 4   ? 33.890  -20.845 -55.837 1.00 22.11 ? 4   LYS B C    1 
ATOM   5084  O O    . LYS B 1 4   ? 34.067  -20.062 -54.906 1.00 24.37 ? 4   LYS B O    1 
ATOM   5085  C CB   . LYS B 1 4   ? 32.282  -22.616 -55.110 1.00 24.88 ? 4   LYS B CB   1 
ATOM   5086  C CG   . LYS B 1 4   ? 32.004  -24.069 -54.799 1.00 28.15 ? 4   LYS B CG   1 
ATOM   5087  C CD   . LYS B 1 4   ? 31.543  -24.811 -56.010 1.00 30.46 ? 4   LYS B CD   1 
ATOM   5088  C CE   . LYS B 1 4   ? 31.076  -26.215 -55.645 1.00 45.13 ? 4   LYS B CE   1 
ATOM   5089  N NZ   . LYS B 1 4   ? 29.572  -26.345 -55.627 1.00 52.65 ? 4   LYS B NZ   1 
ATOM   5090  H H    . LYS B 1 4   ? 34.385  -22.974 -53.843 1.00 32.36 ? 4   LYS B H    1 
ATOM   5091  H HA   . LYS B 1 4   ? 33.834  -22.797 -56.441 1.00 31.18 ? 4   LYS B HA   1 
ATOM   5092  H HB2  . LYS B 1 4   ? 32.122  -22.105 -54.301 1.00 29.83 ? 4   LYS B HB2  1 
ATOM   5093  H HB3  . LYS B 1 4   ? 31.661  -22.338 -55.802 1.00 29.83 ? 4   LYS B HB3  1 
ATOM   5094  H HG2  . LYS B 1 4   ? 32.818  -24.488 -54.478 1.00 33.76 ? 4   LYS B HG2  1 
ATOM   5095  H HG3  . LYS B 1 4   ? 31.309  -24.125 -54.125 1.00 33.76 ? 4   LYS B HG3  1 
ATOM   5096  H HD2  . LYS B 1 4   ? 30.799  -24.336 -56.414 1.00 36.53 ? 4   LYS B HD2  1 
ATOM   5097  H HD3  . LYS B 1 4   ? 32.277  -24.887 -56.640 1.00 36.53 ? 4   LYS B HD3  1 
ATOM   5098  H HE2  . LYS B 1 4   ? 31.423  -26.843 -56.298 1.00 54.14 ? 4   LYS B HE2  1 
ATOM   5099  H HE3  . LYS B 1 4   ? 31.406  -26.438 -54.761 1.00 54.14 ? 4   LYS B HE3  1 
ATOM   5100  H HZ1  . LYS B 1 4   ? 29.341  -27.177 -55.410 1.00 63.16 ? 4   LYS B HZ1  1 
ATOM   5101  H HZ2  . LYS B 1 4   ? 29.226  -25.784 -55.030 1.00 63.16 ? 4   LYS B HZ2  1 
ATOM   5102  H HZ3  . LYS B 1 4   ? 29.241  -26.153 -56.430 1.00 63.16 ? 4   LYS B HZ3  1 
ATOM   5103  N N    . LYS B 1 5   ? 33.787  -20.446 -57.102 1.00 23.02 ? 5   LYS B N    1 
ATOM   5104  C CA   . LYS B 1 5   ? 33.905  -19.048 -57.498 1.00 26.60 ? 5   LYS B CA   1 
ATOM   5105  C C    . LYS B 1 5   ? 32.519  -18.446 -57.697 1.00 20.49 ? 5   LYS B C    1 
ATOM   5106  O O    . LYS B 1 5   ? 31.638  -19.076 -58.279 1.00 21.46 ? 5   LYS B O    1 
ATOM   5107  C CB   . LYS B 1 5   ? 34.705  -18.899 -58.795 1.00 24.65 ? 5   LYS B CB   1 
ATOM   5108  C CG   . LYS B 1 5   ? 36.163  -19.269 -58.681 1.00 30.41 ? 5   LYS B CG   1 
ATOM   5109  C CD   . LYS B 1 5   ? 36.815  -19.346 -60.041 1.00 41.35 ? 5   LYS B CD   1 
ATOM   5110  C CE   . LYS B 1 5   ? 38.189  -19.984 -59.944 1.00 38.54 ? 5   LYS B CE   1 
ATOM   5111  N NZ   . LYS B 1 5   ? 38.809  -20.061 -61.283 1.00 52.08 ? 5   LYS B NZ   1 
ATOM   5112  H H    . LYS B 1 5   ? 33.646  -20.979 -57.762 1.00 27.60 ? 5   LYS B H    1 
ATOM   5113  H HA   . LYS B 1 5   ? 34.358  -18.551 -56.798 1.00 31.89 ? 5   LYS B HA   1 
ATOM   5114  H HB2  . LYS B 1 5   ? 34.309  -19.471 -59.471 1.00 29.56 ? 5   LYS B HB2  1 
ATOM   5115  H HB3  . LYS B 1 5   ? 34.659  -17.974 -59.083 1.00 29.56 ? 5   LYS B HB3  1 
ATOM   5116  H HG2  . LYS B 1 5   ? 36.626  -18.595 -58.158 1.00 36.47 ? 5   LYS B HG2  1 
ATOM   5117  H HG3  . LYS B 1 5   ? 36.242  -20.137 -58.255 1.00 36.47 ? 5   LYS B HG3  1 
ATOM   5118  H HD2  . LYS B 1 5   ? 36.267  -19.887 -60.631 1.00 49.59 ? 5   LYS B HD2  1 
ATOM   5119  H HD3  . LYS B 1 5   ? 36.918  -18.451 -60.401 1.00 49.59 ? 5   LYS B HD3  1 
ATOM   5120  H HE2  . LYS B 1 5   ? 38.757  -19.446 -59.371 1.00 46.22 ? 5   LYS B HE2  1 
ATOM   5121  H HE3  . LYS B 1 5   ? 38.105  -20.884 -59.592 1.00 46.22 ? 5   LYS B HE3  1 
ATOM   5122  H HZ1  . LYS B 1 5   ? 39.615  -20.435 -61.224 1.00 62.47 ? 5   LYS B HZ1  1 
ATOM   5123  H HZ2  . LYS B 1 5   ? 38.302  -20.550 -61.826 1.00 62.47 ? 5   LYS B HZ2  1 
ATOM   5124  H HZ3  . LYS B 1 5   ? 38.895  -19.243 -61.626 1.00 62.47 ? 5   LYS B HZ3  1 
ATOM   5125  N N    . VAL B 1 6   ? 32.366  -17.204 -57.270 1.00 20.87 ? 6   VAL B N    1 
ATOM   5126  C CA   . VAL B 1 6   ? 31.083  -16.500 -57.224 1.00 20.60 ? 6   VAL B CA   1 
ATOM   5127  C C    . VAL B 1 6   ? 31.146  -15.280 -58.128 1.00 19.46 ? 6   VAL B C    1 
ATOM   5128  O O    . VAL B 1 6   ? 32.139  -14.545 -58.128 1.00 19.84 ? 6   VAL B O    1 
ATOM   5129  C CB   . VAL B 1 6   ? 30.760  -16.069 -55.772 1.00 20.31 ? 6   VAL B CB   1 
ATOM   5130  C CG1  . VAL B 1 6   ? 29.472  -15.258 -55.707 1.00 20.36 ? 6   VAL B CG1  1 
ATOM   5131  C CG2  . VAL B 1 6   ? 30.702  -17.287 -54.834 1.00 20.26 ? 6   VAL B CG2  1 
ATOM   5132  H H    . VAL B 1 6   ? 33.020  -16.723 -56.987 1.00 25.02 ? 6   VAL B H    1 
ATOM   5133  H HA   . VAL B 1 6   ? 30.377  -17.086 -57.539 1.00 24.70 ? 6   VAL B HA   1 
ATOM   5134  H HB   . VAL B 1 6   ? 31.477  -15.496 -55.458 1.00 24.35 ? 6   VAL B HB   1 
ATOM   5135  H HG11 . VAL B 1 6   ? 29.304  -15.007 -54.785 1.00 24.41 ? 6   VAL B HG11 1 
ATOM   5136  H HG12 . VAL B 1 6   ? 29.572  -14.463 -56.254 1.00 24.41 ? 6   VAL B HG12 1 
ATOM   5137  H HG13 . VAL B 1 6   ? 28.741  -15.800 -56.041 1.00 24.41 ? 6   VAL B HG13 1 
ATOM   5138  H HG21 . VAL B 1 6   ? 30.498  -16.983 -53.936 1.00 24.29 ? 6   VAL B HG21 1 
ATOM   5139  H HG22 . VAL B 1 6   ? 30.009  -17.891 -55.145 1.00 24.29 ? 6   VAL B HG22 1 
ATOM   5140  H HG23 . VAL B 1 6   ? 31.562  -17.735 -54.845 1.00 24.29 ? 6   VAL B HG23 1 
ATOM   5141  N N    . CYS B 1 7   ? 30.078  -15.051 -58.885 1.00 18.76 ? 7   CYS B N    1 
ATOM   5142  C CA   . CYS B 1 7   ? 29.874  -13.827 -59.641 1.00 17.28 ? 7   CYS B CA   1 
ATOM   5143  C C    . CYS B 1 7   ? 28.535  -13.232 -59.257 1.00 19.61 ? 7   CYS B C    1 
ATOM   5144  O O    . CYS B 1 7   ? 27.503  -13.907 -59.333 1.00 19.27 ? 7   CYS B O    1 
ATOM   5145  C CB   . CYS B 1 7   ? 29.912  -14.071 -61.169 1.00 17.57 ? 7   CYS B CB   1 
ATOM   5146  S SG   . CYS B 1 7   ? 29.378  -12.682 -62.133 1.00 20.00 ? 7   CYS B SG   1 
ATOM   5147  H H    . CYS B 1 7   ? 29.436  -15.615 -58.978 1.00 22.49 ? 7   CYS B H    1 
ATOM   5148  H HA   . CYS B 1 7   ? 30.569  -13.190 -59.415 1.00 20.72 ? 7   CYS B HA   1 
ATOM   5149  H HB2  . CYS B 1 7   ? 30.823  -14.280 -61.430 1.00 21.06 ? 7   CYS B HB2  1 
ATOM   5150  H HB3  . CYS B 1 7   ? 29.331  -14.819 -61.380 1.00 21.06 ? 7   CYS B HB3  1 
ATOM   5151  H HG   . CYS B 1 7   ? 29.443  -12.966 -63.297 1.00 23.97 ? 7   CYS B HG   1 
ATOM   5152  N N    . ILE B 1 8   ? 28.571  -11.973 -58.842 1.00 19.21 ? 8   ILE B N    1 
ATOM   5153  C CA   . ILE B 1 8   ? 27.377  -11.167 -58.627 1.00 19.08 ? 8   ILE B CA   1 
ATOM   5154  C C    . ILE B 1 8   ? 27.032  -10.458 -59.932 1.00 21.44 ? 8   ILE B C    1 
ATOM   5155  O O    . ILE B 1 8   ? 27.734  -9.533  -60.366 1.00 19.58 ? 8   ILE B O    1 
ATOM   5156  C CB   . ILE B 1 8   ? 27.574  -10.169 -57.481 1.00 18.59 ? 8   ILE B CB   1 
ATOM   5157  C CG1  . ILE B 1 8   ? 27.996  -10.946 -56.224 1.00 21.62 ? 8   ILE B CG1  1 
ATOM   5158  C CG2  . ILE B 1 8   ? 26.303  -9.414  -57.270 1.00 18.33 ? 8   ILE B CG2  1 
ATOM   5159  C CD1  . ILE B 1 8   ? 28.460  -10.081 -55.041 1.00 20.49 ? 8   ILE B CD1  1 
ATOM   5160  H H    . ILE B 1 8   ? 29.301  -11.550 -58.673 1.00 23.04 ? 8   ILE B H    1 
ATOM   5161  H HA   . ILE B 1 8   ? 26.638  -11.750 -58.396 1.00 22.87 ? 8   ILE B HA   1 
ATOM   5162  H HB   . ILE B 1 8   ? 28.278  -9.545  -57.720 1.00 22.29 ? 8   ILE B HB   1 
ATOM   5163  H HG12 . ILE B 1 8   ? 27.241  -11.473 -55.920 1.00 25.92 ? 8   ILE B HG12 1 
ATOM   5164  H HG13 . ILE B 1 8   ? 28.729  -11.536 -56.459 1.00 25.92 ? 8   ILE B HG13 1 
ATOM   5165  H HG21 . ILE B 1 8   ? 26.428  -8.782  -56.544 1.00 21.98 ? 8   ILE B HG21 1 
ATOM   5166  H HG22 . ILE B 1 8   ? 26.078  -8.940  -58.086 1.00 21.98 ? 8   ILE B HG22 1 
ATOM   5167  H HG23 . ILE B 1 8   ? 25.597  -10.041 -57.046 1.00 21.98 ? 8   ILE B HG23 1 
ATOM   5168  H HD11 . ILE B 1 8   ? 28.703  -10.661 -54.303 1.00 24.57 ? 8   ILE B HD11 1 
ATOM   5169  H HD12 . ILE B 1 8   ? 29.228  -9.557  -55.316 1.00 24.57 ? 8   ILE B HD12 1 
ATOM   5170  H HD13 . ILE B 1 8   ? 27.735  -9.494  -54.776 1.00 24.57 ? 8   ILE B HD13 1 
ATOM   5171  N N    . VAL B 1 9   ? 25.922  -10.879 -60.543 1.00 17.66 ? 9   VAL B N    1 
ATOM   5172  C CA   . VAL B 1 9   ? 25.419  -10.277 -61.785 1.00 15.07 ? 9   VAL B CA   1 
ATOM   5173  C C    . VAL B 1 9   ? 24.494  -9.130  -61.382 1.00 19.00 ? 9   VAL B C    1 
ATOM   5174  O O    . VAL B 1 9   ? 23.296  -9.312  -61.164 1.00 21.44 ? 9   VAL B O    1 
ATOM   5175  C CB   . VAL B 1 9   ? 24.713  -11.314 -62.658 1.00 16.09 ? 9   VAL B CB   1 
ATOM   5176  C CG1  . VAL B 1 9   ? 24.314  -10.708 -63.977 1.00 22.52 ? 9   VAL B CG1  1 
ATOM   5177  C CG2  . VAL B 1 9   ? 25.622  -12.518 -62.867 1.00 19.11 ? 9   VAL B CG2  1 
ATOM   5178  H H    . VAL B 1 9   ? 25.433  -11.524 -60.253 1.00 21.17 ? 9   VAL B H    1 
ATOM   5179  H HA   . VAL B 1 9   ? 26.162  -9.909  -62.288 1.00 18.06 ? 9   VAL B HA   1 
ATOM   5180  H HB   . VAL B 1 9   ? 23.908  -11.616 -62.208 1.00 19.29 ? 9   VAL B HB   1 
ATOM   5181  H HG11 . VAL B 1 9   ? 23.869  -11.383 -64.513 1.00 27.00 ? 9   VAL B HG11 1 
ATOM   5182  H HG12 . VAL B 1 9   ? 23.713  -9.965  -63.814 1.00 27.00 ? 9   VAL B HG12 1 
ATOM   5183  H HG13 . VAL B 1 9   ? 25.111  -10.395 -64.434 1.00 27.00 ? 9   VAL B HG13 1 
ATOM   5184  H HG21 . VAL B 1 9   ? 25.162  -13.167 -63.423 1.00 22.91 ? 9   VAL B HG21 1 
ATOM   5185  H HG22 . VAL B 1 9   ? 26.436  -12.225 -63.305 1.00 22.91 ? 9   VAL B HG22 1 
ATOM   5186  H HG23 . VAL B 1 9   ? 25.831  -12.908 -62.005 1.00 22.91 ? 9   VAL B HG23 1 
ATOM   5187  N N    . GLY B 1 10  ? 25.048  -7.914  -61.343 1.00 19.56 ? 10  GLY B N    1 
ATOM   5188  C CA   . GLY B 1 10  ? 24.314  -6.764  -60.904 1.00 22.20 ? 10  GLY B CA   1 
ATOM   5189  C C    . GLY B 1 10  ? 25.079  -5.984  -59.855 1.00 23.51 ? 10  GLY B C    1 
ATOM   5190  O O    . GLY B 1 10  ? 25.936  -6.535  -59.162 1.00 20.34 ? 10  GLY B O    1 
ATOM   5191  H H    . GLY B 1 10  ? 25.860  -7.744  -61.572 1.00 23.46 ? 10  GLY B H    1 
ATOM   5192  H HA2  . GLY B 1 10  ? 24.140  -6.180  -61.659 1.00 26.61 ? 10  GLY B HA2  1 
ATOM   5193  H HA3  . GLY B 1 10  ? 23.466  -7.043  -60.525 1.00 26.61 ? 10  GLY B HA3  1 
ATOM   5194  N N    . SER B 1 11  ? 24.803  -4.693  -59.767 1.00 21.69 ? 11  SER B N    1 
ATOM   5195  C CA   . SER B 1 11  ? 25.628  -3.785  -58.955 1.00 21.37 ? 11  SER B CA   1 
ATOM   5196  C C    . SER B 1 11  ? 24.892  -2.522  -58.511 1.00 21.44 ? 11  SER B C    1 
ATOM   5197  O O    . SER B 1 11  ? 25.560  -1.590  -58.218 1.00 23.41 ? 11  SER B O    1 
ATOM   5198  C CB   . SER B 1 11  ? 26.850  -3.431  -59.725 1.00 19.15 ? 11  SER B CB   1 
ATOM   5199  O OG   . SER B 1 11  ? 26.518  -2.775  -60.899 1.00 20.17 ? 11  SER B OG   1 
ATOM   5200  H H    . SER B 1 11  ? 24.108  -4.278  -60.184 1.00 26.00 ? 11  SER B H    1 
ATOM   5201  H HA   . SER B 1 11  ? 25.908  -4.279  -58.138 1.00 25.63 ? 11  SER B HA   1 
ATOM   5202  H HB2  . SER B 1 11  ? 27.426  -2.852  -59.176 1.00 22.96 ? 11  SER B HB2  1 
ATOM   5203  H HB3  . SER B 1 11  ? 27.352  -4.250  -59.937 1.00 22.96 ? 11  SER B HB3  1 
ATOM   5204  H HG   . SER B 1 11  ? 25.906  -2.216  -60.731 1.00 24.18 ? 11  SER B HG   1 
ATOM   5205  N N    . GLY B 1 12  ? 23.575  -2.489  -58.515 1.00 20.37 ? 12  GLY B N    1 
ATOM   5206  C CA   . GLY B 1 12  ? 22.867  -1.359  -57.940 1.00 23.55 ? 12  GLY B CA   1 
ATOM   5207  C C    . GLY B 1 12  ? 22.924  -1.348  -56.429 1.00 19.74 ? 12  GLY B C    1 
ATOM   5208  O O    . GLY B 1 12  ? 23.840  -1.921  -55.818 1.00 21.33 ? 12  GLY B O    1 
ATOM   5209  H H    . GLY B 1 12  ? 23.064  -3.100  -58.838 1.00 24.42 ? 12  GLY B H    1 
ATOM   5210  H HA2  . GLY B 1 12  ? 23.256  -0.533  -58.268 1.00 28.23 ? 12  GLY B HA2  1 
ATOM   5211  H HA3  . GLY B 1 12  ? 21.936  -1.389  -58.212 1.00 28.23 ? 12  GLY B HA3  1 
ATOM   5212  N N    . ASN B 1 13  ? 21.913  -0.739  -55.847 1.00 20.09 ? 13  ASN B N    1 
ATOM   5213  C CA   . ASN B 1 13  ? 21.721  -0.690  -54.431 1.00 22.91 ? 13  ASN B CA   1 
ATOM   5214  C C    . ASN B 1 13  ? 21.733  -2.097  -53.866 1.00 21.17 ? 13  ASN B C    1 
ATOM   5215  O O    . ASN B 1 13  ? 22.449  -2.408  -52.978 1.00 19.55 ? 13  ASN B O    1 
ATOM   5216  C CB   . ASN B 1 13  ? 20.343  -0.095  -54.165 1.00 29.06 ? 13  ASN B CB   1 
ATOM   5217  C CG   . ASN B 1 13  ? 20.172  0.378   -52.745 1.00 36.45 ? 13  ASN B CG   1 
ATOM   5218  O OD1  . ASN B 1 13  ? 19.090  0.442   -52.239 1.00 32.73 ? 13  ASN B OD1  1 
ATOM   5219  N ND2  . ASN B 1 13  ? 21.269  0.769   -52.126 1.00 42.35 ? 13  ASN B ND2  1 
ATOM   5220  H H    . ASN B 1 13  ? 21.296  -0.328  -56.283 1.00 24.09 ? 13  ASN B H    1 
ATOM   5221  H HA   . ASN B 1 13  ? 22.412  -0.146  -53.999 1.00 27.47 ? 13  ASN B HA   1 
ATOM   5222  H HB2  . ASN B 1 13  ? 20.208  0.665   -54.752 1.00 34.85 ? 13  ASN B HB2  1 
ATOM   5223  H HB3  . ASN B 1 13  ? 19.669  -0.771  -54.338 1.00 34.85 ? 13  ASN B HB3  1 
ATOM   5224  H HD21 . ASN B 1 13  ? 21.704  0.175   -51.479 1.00 50.80 ? 13  ASN B HD21 1 
ATOM   5225  H HD22 . ASN B 1 13  ? 21.649  1.653   -52.313 1.00 50.80 ? 13  ASN B HD22 1 
ATOM   5226  N N    . TRP B 1 14  ? 20.923  -2.937  -54.477 1.00 18.83 ? 14  TRP B N    1 
ATOM   5227  C CA   . TRP B 1 14  ? 20.741  -4.308  -54.024 1.00 21.92 ? 14  TRP B CA   1 
ATOM   5228  C C    . TRP B 1 14  ? 21.996  -5.130  -54.261 1.00 15.00 ? 14  TRP B C    1 
ATOM   5229  O O    . TRP B 1 14  ? 22.479  -5.817  -53.353 1.00 17.14 ? 14  TRP B O    1 
ATOM   5230  C CB   . TRP B 1 14  ? 19.517  -4.874  -54.760 1.00 19.86 ? 14  TRP B CB   1 
ATOM   5231  C CG   . TRP B 1 14  ? 18.911  -6.165  -54.339 1.00 23.48 ? 14  TRP B CG   1 
ATOM   5232  C CD1  . TRP B 1 14  ? 18.104  -6.936  -55.126 1.00 31.99 ? 14  TRP B CD1  1 
ATOM   5233  C CD2  . TRP B 1 14  ? 18.946  -6.821  -53.053 1.00 25.83 ? 14  TRP B CD2  1 
ATOM   5234  N NE1  . TRP B 1 14  ? 17.675  -8.038  -54.442 1.00 27.62 ? 14  TRP B NE1  1 
ATOM   5235  C CE2  . TRP B 1 14  ? 18.168  -7.993  -53.165 1.00 28.74 ? 14  TRP B CE2  1 
ATOM   5236  C CE3  . TRP B 1 14  ? 19.569  -6.553  -51.838 1.00 32.39 ? 14  TRP B CE3  1 
ATOM   5237  C CZ2  . TRP B 1 14  ? 18.004  -8.896  -52.108 1.00 29.49 ? 14  TRP B CZ2  1 
ATOM   5238  C CZ3  . TRP B 1 14  ? 19.408  -7.469  -50.782 1.00 25.95 ? 14  TRP B CZ3  1 
ATOM   5239  C CH2  . TRP B 1 14  ? 18.635  -8.611  -50.927 1.00 26.95 ? 14  TRP B CH2  1 
ATOM   5240  H H    . TRP B 1 14  ? 20.465  -2.740  -55.178 1.00 22.57 ? 14  TRP B H    1 
ATOM   5241  H HA   . TRP B 1 14  ? 20.551  -4.309  -53.073 1.00 26.28 ? 14  TRP B HA   1 
ATOM   5242  H HB2  . TRP B 1 14  ? 18.812  -4.210  -54.701 1.00 23.81 ? 14  TRP B HB2  1 
ATOM   5243  H HB3  . TRP B 1 14  ? 19.765  -4.981  -55.692 1.00 23.81 ? 14  TRP B HB3  1 
ATOM   5244  H HD1  . TRP B 1 14  ? 17.887  -6.743  -56.010 1.00 38.36 ? 14  TRP B HD1  1 
ATOM   5245  H HE1  . TRP B 1 14  ? 17.164  -8.654  -54.759 1.00 33.12 ? 14  TRP B HE1  1 
ATOM   5246  H HE3  . TRP B 1 14  ? 20.095  -5.793  -51.732 1.00 38.85 ? 14  TRP B HE3  1 
ATOM   5247  H HZ2  . TRP B 1 14  ? 17.490  -9.665  -52.207 1.00 35.37 ? 14  TRP B HZ2  1 
ATOM   5248  H HZ3  . TRP B 1 14  ? 19.816  -7.297  -49.965 1.00 31.12 ? 14  TRP B HZ3  1 
ATOM   5249  H HH2  . TRP B 1 14  ? 18.539  -9.192  -50.207 1.00 32.32 ? 14  TRP B HH2  1 
ATOM   5250  N N    . GLY B 1 15  ? 22.547  -5.075  -55.476 1.00 19.04 ? 15  GLY B N    1 
ATOM   5251  C CA   . GLY B 1 15  ? 23.708  -5.885  -55.785 1.00 17.89 ? 15  GLY B CA   1 
ATOM   5252  C C    . GLY B 1 15  ? 24.922  -5.468  -54.977 1.00 15.62 ? 15  GLY B C    1 
ATOM   5253  O O    . GLY B 1 15  ? 25.747  -6.297  -54.615 1.00 18.86 ? 15  GLY B O    1 
ATOM   5254  H H    . GLY B 1 15  ? 22.267  -4.584  -56.124 1.00 22.83 ? 15  GLY B H    1 
ATOM   5255  H HA2  . GLY B 1 15  ? 23.515  -6.816  -55.594 1.00 21.45 ? 15  GLY B HA2  1 
ATOM   5256  H HA3  . GLY B 1 15  ? 23.921  -5.801  -56.727 1.00 21.45 ? 15  GLY B HA3  1 
ATOM   5257  N N    . SER B 1 16  ? 25.050  -4.177  -54.695 1.00 14.94 ? 16  SER B N    1 
ATOM   5258  C CA   . SER B 1 16  ? 26.166  -3.718  -53.882 1.00 14.94 ? 16  SER B CA   1 
ATOM   5259  C C    . SER B 1 16  ? 26.000  -4.167  -52.452 1.00 16.15 ? 16  SER B C    1 
ATOM   5260  O O    . SER B 1 16  ? 26.968  -4.576  -51.814 1.00 17.96 ? 16  SER B O    1 
ATOM   5261  C CB   . SER B 1 16  ? 26.290  -2.198  -53.950 1.00 19.24 ? 16  SER B CB   1 
ATOM   5262  O OG   . SER B 1 16  ? 26.509  -1.770  -55.283 1.00 22.09 ? 16  SER B OG   1 
ATOM   5263  H H    . SER B 1 16  ? 24.514  -3.558  -54.956 1.00 17.90 ? 16  SER B H    1 
ATOM   5264  H HA   . SER B 1 16  ? 26.988  -4.103  -54.225 1.00 17.91 ? 16  SER B HA   1 
ATOM   5265  H HB2  . SER B 1 16  ? 25.469  -1.799  -53.622 1.00 23.07 ? 16  SER B HB2  1 
ATOM   5266  H HB3  . SER B 1 16  ? 27.039  -1.917  -53.401 1.00 23.07 ? 16  SER B HB3  1 
ATOM   5267  H HG   . SER B 1 16  ? 25.867  -2.007  -55.770 1.00 26.49 ? 16  SER B HG   1 
ATOM   5268  N N    . ALA B 1 17  ? 24.770  -4.122  -51.935 1.00 21.32 ? 17  ALA B N    1 
ATOM   5269  C CA   . ALA B 1 17  ? 24.552  -4.546  -50.563 1.00 16.35 ? 17  ALA B CA   1 
ATOM   5270  C C    . ALA B 1 17  ? 24.868  -6.020  -50.417 1.00 20.82 ? 17  ALA B C    1 
ATOM   5271  O O    . ALA B 1 17  ? 25.471  -6.442  -49.422 1.00 17.48 ? 17  ALA B O    1 
ATOM   5272  C CB   . ALA B 1 17  ? 23.119  -4.255  -50.142 1.00 20.02 ? 17  ALA B CB   1 
ATOM   5273  H H    . ALA B 1 17  ? 24.066  -3.855  -52.351 1.00 25.56 ? 17  ALA B H    1 
ATOM   5274  H HA   . ALA B 1 17  ? 25.145  -4.050  -49.978 1.00 19.59 ? 17  ALA B HA   1 
ATOM   5275  H HB1  . ALA B 1 17  ? 22.995  -4.546  -49.225 1.00 24.00 ? 17  ALA B HB1  1 
ATOM   5276  H HB2  . ALA B 1 17  ? 22.957  -3.301  -50.212 1.00 24.00 ? 17  ALA B HB2  1 
ATOM   5277  H HB3  . ALA B 1 17  ? 22.514  -4.738  -50.727 1.00 24.00 ? 17  ALA B HB3  1 
ATOM   5278  N N    . ILE B 1 18  ? 24.490  -6.821  -51.418 1.00 16.97 ? 18  ILE B N    1 
ATOM   5279  C CA   . ILE B 1 18  ? 24.801  -8.246  -51.376 1.00 20.36 ? 18  ILE B CA   1 
ATOM   5280  C C    . ILE B 1 18  ? 26.296  -8.478  -51.494 1.00 17.69 ? 18  ILE B C    1 
ATOM   5281  O O    . ILE B 1 18  ? 26.841  -9.386  -50.851 1.00 20.60 ? 18  ILE B O    1 
ATOM   5282  C CB   . ILE B 1 18  ? 24.024  -8.992  -52.477 1.00 19.83 ? 18  ILE B CB   1 
ATOM   5283  C CG1  . ILE B 1 18  ? 22.526  -8.977  -52.145 1.00 24.21 ? 18  ILE B CG1  1 
ATOM   5284  C CG2  . ILE B 1 18  ? 24.534  -10.403 -52.611 1.00 24.25 ? 18  ILE B CG2  1 
ATOM   5285  C CD1  . ILE B 1 18  ? 22.121  -9.849  -50.964 1.00 27.36 ? 18  ILE B CD1  1 
ATOM   5286  H H    . ILE B 1 18  ? 24.060  -6.567  -52.118 1.00 20.34 ? 18  ILE B H    1 
ATOM   5287  H HA   . ILE B 1 18  ? 24.514  -8.602  -50.520 1.00 24.41 ? 18  ILE B HA   1 
ATOM   5288  H HB   . ILE B 1 18  ? 24.160  -8.531  -53.320 1.00 23.78 ? 18  ILE B HB   1 
ATOM   5289  H HG12 . ILE B 1 18  ? 22.264  -8.066  -51.940 1.00 29.04 ? 18  ILE B HG12 1 
ATOM   5290  H HG13 . ILE B 1 18  ? 22.035  -9.289  -52.922 1.00 29.04 ? 18  ILE B HG13 1 
ATOM   5291  H HG21 . ILE B 1 18  ? 24.032  -10.855 -53.308 1.00 29.08 ? 18  ILE B HG21 1 
ATOM   5292  H HG22 . ILE B 1 18  ? 25.475  -10.378 -52.844 1.00 29.08 ? 18  ILE B HG22 1 
ATOM   5293  H HG23 . ILE B 1 18  ? 24.414  -10.863 -51.765 1.00 29.08 ? 18  ILE B HG23 1 
ATOM   5294  H HD11 . ILE B 1 18  ? 21.162  -9.775  -50.832 1.00 32.81 ? 18  ILE B HD11 1 
ATOM   5295  H HD12 . ILE B 1 18  ? 22.359  -10.769 -51.156 1.00 32.81 ? 18  ILE B HD12 1 
ATOM   5296  H HD13 . ILE B 1 18  ? 22.589  -9.543  -50.172 1.00 32.81 ? 18  ILE B HD13 1 
ATOM   5297  N N    . ALA B 1 19  ? 26.993  -7.655  -52.289 1.00 19.63 ? 19  ALA B N    1 
ATOM   5298  C CA   . ALA B 1 19  ? 28.444  -7.810  -52.421 1.00 21.16 ? 19  ALA B CA   1 
ATOM   5299  C C    . ALA B 1 19  ? 29.148  -7.630  -51.081 1.00 18.33 ? 19  ALA B C    1 
ATOM   5300  O O    . ALA B 1 19  ? 30.132  -8.322  -50.793 1.00 19.59 ? 19  ALA B O    1 
ATOM   5301  C CB   . ALA B 1 19  ? 29.004  -6.819  -53.448 1.00 21.07 ? 19  ALA B CB   1 
ATOM   5302  H H    . ALA B 1 19  ? 26.656  -7.013  -52.751 1.00 23.54 ? 19  ALA B H    1 
ATOM   5303  H HA   . ALA B 1 19  ? 28.635  -8.707  -52.738 1.00 25.37 ? 19  ALA B HA   1 
ATOM   5304  H HB1  . ALA B 1 19  ? 29.963  -6.943  -53.516 1.00 25.27 ? 19  ALA B HB1  1 
ATOM   5305  H HB2  . ALA B 1 19  ? 28.586  -6.987  -54.308 1.00 25.27 ? 19  ALA B HB2  1 
ATOM   5306  H HB3  . ALA B 1 19  ? 28.806  -5.916  -53.155 1.00 25.27 ? 19  ALA B HB3  1 
ATOM   5307  N N    . LYS B 1 20  ? 28.666  -6.695  -50.252 1.00 22.24 ? 20  LYS B N    1 
ATOM   5308  C CA   . LYS B 1 20  ? 29.211  -6.542  -48.895 1.00 18.70 ? 20  LYS B CA   1 
ATOM   5309  C C    . LYS B 1 20  ? 29.161  -7.838  -48.112 1.00 20.11 ? 20  LYS B C    1 
ATOM   5310  O O    . LYS B 1 20  ? 30.127  -8.211  -47.423 1.00 22.15 ? 20  LYS B O    1 
ATOM   5311  C CB   . LYS B 1 20  ? 28.437  -5.474  -48.118 1.00 25.48 ? 20  LYS B CB   1 
ATOM   5312  C CG   . LYS B 1 20  ? 28.724  -4.068  -48.511 1.00 26.65 ? 20  LYS B CG   1 
ATOM   5313  C CD   . LYS B 1 20  ? 27.979  -3.116  -47.621 1.00 27.17 ? 20  LYS B CD   1 
ATOM   5314  C CE   . LYS B 1 20  ? 28.564  -3.052  -46.245 1.00 27.32 ? 20  LYS B CE   1 
ATOM   5315  N NZ   . LYS B 1 20  ? 27.893  -2.013  -45.425 1.00 30.84 ? 20  LYS B NZ   1 
ATOM   5316  H H    . LYS B 1 20  ? 28.034  -6.145  -50.446 1.00 26.66 ? 20  LYS B H    1 
ATOM   5317  H HA   . LYS B 1 20  ? 30.137  -6.261  -48.955 1.00 22.41 ? 20  LYS B HA   1 
ATOM   5318  H HB2  . LYS B 1 20  ? 27.488  -5.626  -48.249 1.00 30.55 ? 20  LYS B HB2  1 
ATOM   5319  H HB3  . LYS B 1 20  ? 28.653  -5.563  -47.176 1.00 30.55 ? 20  LYS B HB3  1 
ATOM   5320  H HG2  . LYS B 1 20  ? 29.674  -3.893  -48.421 1.00 31.95 ? 20  LYS B HG2  1 
ATOM   5321  H HG3  . LYS B 1 20  ? 28.437  -3.922  -49.426 1.00 31.95 ? 20  LYS B HG3  1 
ATOM   5322  H HD2  . LYS B 1 20  ? 28.015  -2.226  -48.006 1.00 32.59 ? 20  LYS B HD2  1 
ATOM   5323  H HD3  . LYS B 1 20  ? 27.057  -3.408  -47.544 1.00 32.59 ? 20  LYS B HD3  1 
ATOM   5324  H HE2  . LYS B 1 20  ? 28.447  -3.909  -45.806 1.00 32.76 ? 20  LYS B HE2  1 
ATOM   5325  H HE3  . LYS B 1 20  ? 29.506  -2.830  -46.306 1.00 32.76 ? 20  LYS B HE3  1 
ATOM   5326  H HZ1  . LYS B 1 20  ? 28.253  -1.989  -44.611 1.00 36.98 ? 20  LYS B HZ1  1 
ATOM   5327  H HZ2  . LYS B 1 20  ? 27.989  -1.215  -45.807 1.00 36.98 ? 20  LYS B HZ2  1 
ATOM   5328  H HZ3  . LYS B 1 20  ? 27.026  -2.197  -45.352 1.00 36.98 ? 20  LYS B HZ3  1 
ATOM   5329  N N    . ILE B 1 21  ? 28.003  -8.500  -48.124 1.00 18.71 ? 21  ILE B N    1 
ATOM   5330  C CA   . ILE B 1 21  ? 27.839  -9.759  -47.404 1.00 16.49 ? 21  ILE B CA   1 
ATOM   5331  C C    . ILE B 1 21  ? 28.646  -10.863 -48.061 1.00 20.96 ? 21  ILE B C    1 
ATOM   5332  O O    . ILE B 1 21  ? 29.395  -11.585 -47.400 1.00 16.98 ? 21  ILE B O    1 
ATOM   5333  C CB   . ILE B 1 21  ? 26.342  -10.152 -47.321 1.00 19.96 ? 21  ILE B CB   1 
ATOM   5334  C CG1  . ILE B 1 21  ? 25.605  -9.272  -46.322 1.00 20.77 ? 21  ILE B CG1  1 
ATOM   5335  C CG2  . ILE B 1 21  ? 26.179  -11.601 -46.943 1.00 24.54 ? 21  ILE B CG2  1 
ATOM   5336  C CD1  . ILE B 1 21  ? 24.137  -9.497  -46.306 1.00 24.41 ? 21  ILE B CD1  1 
ATOM   5337  H H    . ILE B 1 21  ? 27.298  -8.240  -48.543 1.00 22.43 ? 21  ILE B H    1 
ATOM   5338  H HA   . ILE B 1 21  ? 28.168  -9.647  -46.498 1.00 19.76 ? 21  ILE B HA   1 
ATOM   5339  H HB   . ILE B 1 21  ? 25.944  -10.019 -48.196 1.00 23.94 ? 21  ILE B HB   1 
ATOM   5340  H HG12 . ILE B 1 21  ? 25.945  -9.455  -45.432 1.00 24.90 ? 21  ILE B HG12 1 
ATOM   5341  H HG13 . ILE B 1 21  ? 25.761  -8.341  -46.549 1.00 24.90 ? 21  ILE B HG13 1 
ATOM   5342  H HG21 . ILE B 1 21  ? 25.233  -11.811 -46.901 1.00 29.43 ? 21  ILE B HG21 1 
ATOM   5343  H HG22 . ILE B 1 21  ? 26.612  -12.152 -47.614 1.00 29.43 ? 21  ILE B HG22 1 
ATOM   5344  H HG23 . ILE B 1 21  ? 26.590  -11.749 -46.077 1.00 29.43 ? 21  ILE B HG23 1 
ATOM   5345  H HD11 . ILE B 1 21  ? 23.734  -8.906  -45.650 1.00 29.26 ? 21  ILE B HD11 1 
ATOM   5346  H HD12 . ILE B 1 21  ? 23.779  -9.307  -47.187 1.00 29.26 ? 21  ILE B HD12 1 
ATOM   5347  H HD13 . ILE B 1 21  ? 23.962  -10.422 -46.069 1.00 29.26 ? 21  ILE B HD13 1 
ATOM   5348  N N    . VAL B 1 22  ? 28.480  -11.033 -49.373 1.00 16.81 ? 22  VAL B N    1 
ATOM   5349  C CA   . VAL B 1 22  ? 29.085  -12.166 -50.074 1.00 17.67 ? 22  VAL B CA   1 
ATOM   5350  C C    . VAL B 1 22  ? 30.607  -12.069 -50.077 1.00 17.64 ? 22  VAL B C    1 
ATOM   5351  O O    . VAL B 1 22  ? 31.305  -13.080 -49.961 1.00 20.01 ? 22  VAL B O    1 
ATOM   5352  C CB   . VAL B 1 22  ? 28.531  -12.225 -51.510 1.00 18.61 ? 22  VAL B CB   1 
ATOM   5353  C CG1  . VAL B 1 22  ? 29.327  -13.163 -52.384 1.00 19.32 ? 22  VAL B CG1  1 
ATOM   5354  C CG2  . VAL B 1 22  ? 27.069  -12.643 -51.458 1.00 21.17 ? 22  VAL B CG2  1 
ATOM   5355  H H    . VAL B 1 22  ? 28.023  -10.508 -49.878 1.00 20.16 ? 22  VAL B H    1 
ATOM   5356  H HA   . VAL B 1 22  ? 28.837  -12.987 -49.622 1.00 21.18 ? 22  VAL B HA   1 
ATOM   5357  H HB   . VAL B 1 22  ? 28.575  -11.339 -51.903 1.00 22.31 ? 22  VAL B HB   1 
ATOM   5358  H HG11 . VAL B 1 22  ? 28.943  -13.167 -53.275 1.00 23.16 ? 22  VAL B HG11 1 
ATOM   5359  H HG12 . VAL B 1 22  ? 30.246  -12.855 -52.422 1.00 23.16 ? 22  VAL B HG12 1 
ATOM   5360  H HG13 . VAL B 1 22  ? 29.292  -14.055 -52.004 1.00 23.16 ? 22  VAL B HG13 1 
ATOM   5361  H HG21 . VAL B 1 22  ? 26.720  -12.681 -52.362 1.00 25.38 ? 22  VAL B HG21 1 
ATOM   5362  H HG22 . VAL B 1 22  ? 27.006  -13.518 -51.042 1.00 25.38 ? 22  VAL B HG22 1 
ATOM   5363  H HG23 . VAL B 1 22  ? 26.573  -11.992 -50.938 1.00 25.38 ? 22  VAL B HG23 1 
ATOM   5364  N N    . GLY B 1 23  ? 31.140  -10.879 -50.314 1.00 20.95 ? 23  GLY B N    1 
ATOM   5365  C CA   . GLY B 1 23  ? 32.587  -10.720 -50.271 1.00 22.21 ? 23  GLY B CA   1 
ATOM   5366  C C    . GLY B 1 23  ? 33.168  -11.185 -48.950 1.00 19.32 ? 23  GLY B C    1 
ATOM   5367  O O    . GLY B 1 23  ? 34.221  -11.824 -48.915 1.00 20.54 ? 23  GLY B O    1 
ATOM   5368  H H    . GLY B 1 23  ? 30.699  -10.163 -50.499 1.00 25.12 ? 23  GLY B H    1 
ATOM   5369  H HA2  . GLY B 1 23  ? 32.992  -11.236 -50.985 1.00 26.63 ? 23  GLY B HA2  1 
ATOM   5370  H HA3  . GLY B 1 23  ? 32.815  -9.786  -50.397 1.00 26.63 ? 23  GLY B HA3  1 
ATOM   5371  N N    . GLY B 1 24  ? 32.461  -10.913 -47.848 1.00 18.93 ? 24  GLY B N    1 
ATOM   5372  C CA   . GLY B 1 24  ? 32.983  -11.257 -46.532 1.00 19.69 ? 24  GLY B CA   1 
ATOM   5373  C C    . GLY B 1 24  ? 32.993  -12.748 -46.270 1.00 25.92 ? 24  GLY B C    1 
ATOM   5374  O O    . GLY B 1 24  ? 34.000  -13.312 -45.815 1.00 23.59 ? 24  GLY B O    1 
ATOM   5375  H H    . GLY B 1 24  ? 31.688  -10.536 -47.839 1.00 22.70 ? 24  GLY B H    1 
ATOM   5376  H HA2  . GLY B 1 24  ? 33.891  -10.927 -46.451 1.00 23.60 ? 24  GLY B HA2  1 
ATOM   5377  H HA3  . GLY B 1 24  ? 32.440  -10.831 -45.850 1.00 23.60 ? 24  GLY B HA3  1 
ATOM   5378  N N    . ASN B 1 25  ? 31.876  -13.416 -46.572 1.00 17.44 ? 25  ASN B N    1 
ATOM   5379  C CA   . ASN B 1 25  ? 31.809  -14.858 -46.392 1.00 19.96 ? 25  ASN B CA   1 
ATOM   5380  C C    . ASN B 1 25  ? 32.716  -15.600 -47.378 1.00 20.84 ? 25  ASN B C    1 
ATOM   5381  O O    . ASN B 1 25  ? 33.254  -16.662 -47.042 1.00 21.70 ? 25  ASN B O    1 
ATOM   5382  C CB   . ASN B 1 25  ? 30.357  -15.325 -46.523 1.00 21.57 ? 25  ASN B CB   1 
ATOM   5383  C CG   . ASN B 1 25  ? 29.497  -14.850 -45.356 1.00 25.05 ? 25  ASN B CG   1 
ATOM   5384  O OD1  . ASN B 1 25  ? 29.996  -14.675 -44.244 1.00 20.49 ? 25  ASN B OD1  1 
ATOM   5385  N ND2  . ASN B 1 25  ? 28.202  -14.634 -45.605 1.00 16.41 ? 25  ASN B ND2  1 
ATOM   5386  H H    . ASN B 1 25  ? 31.156  -13.059 -46.879 1.00 20.91 ? 25  ASN B H    1 
ATOM   5387  H HA   . ASN B 1 25  ? 32.109  -15.074 -45.495 1.00 23.94 ? 25  ASN B HA   1 
ATOM   5388  H HB2  . ASN B 1 25  ? 29.980  -14.967 -47.342 1.00 25.87 ? 25  ASN B HB2  1 
ATOM   5389  H HB3  . ASN B 1 25  ? 30.334  -16.295 -46.541 1.00 25.87 ? 25  ASN B HB3  1 
ATOM   5390  H HD21 . ASN B 1 25  ? 27.682  -14.365 -44.975 1.00 19.67 ? 25  ASN B HD21 1 
ATOM   5391  H HD22 . ASN B 1 25  ? 27.888  -14.766 -46.394 1.00 19.67 ? 25  ASN B HD22 1 
ATOM   5392  N N    . ALA B 1 26  ? 32.872  -15.085 -48.601 1.00 20.51 ? 26  ALA B N    1 
ATOM   5393  C CA   . ALA B 1 26  ? 33.694  -15.772 -49.593 1.00 19.64 ? 26  ALA B CA   1 
ATOM   5394  C C    . ALA B 1 26  ? 35.170  -15.765 -49.191 1.00 17.43 ? 26  ALA B C    1 
ATOM   5395  O O    . ALA B 1 26  ? 35.874  -16.747 -49.420 1.00 21.47 ? 26  ALA B O    1 
ATOM   5396  C CB   . ALA B 1 26  ? 33.535  -15.126 -50.962 1.00 21.63 ? 26  ALA B CB   1 
ATOM   5397  H H    . ALA B 1 26  ? 32.518  -14.351 -48.876 1.00 24.59 ? 26  ALA B H    1 
ATOM   5398  H HA   . ALA B 1 26  ? 33.404  -16.695 -49.660 1.00 23.55 ? 26  ALA B HA   1 
ATOM   5399  H HB1  . ALA B 1 26  ? 34.090  -15.600 -51.601 1.00 25.93 ? 26  ALA B HB1  1 
ATOM   5400  H HB2  . ALA B 1 26  ? 32.604  -15.178 -51.229 1.00 25.93 ? 26  ALA B HB2  1 
ATOM   5401  H HB3  . ALA B 1 26  ? 33.812  -14.198 -50.907 1.00 25.93 ? 26  ALA B HB3  1 
ATOM   5402  N N    . ALA B 1 27  ? 35.625  -14.669 -48.596 1.00 20.43 ? 27  ALA B N    1 
ATOM   5403  C CA   . ALA B 1 27  ? 36.963  -14.582 -48.004 1.00 20.91 ? 27  ALA B CA   1 
ATOM   5404  C C    . ALA B 1 27  ? 37.132  -15.521 -46.806 1.00 23.87 ? 27  ALA B C    1 
ATOM   5405  O O    . ALA B 1 27  ? 38.126  -16.250 -46.703 1.00 24.47 ? 27  ALA B O    1 
ATOM   5406  C CB   . ALA B 1 27  ? 37.220  -13.136 -47.585 1.00 24.07 ? 27  ALA B CB   1 
ATOM   5407  H H    . ALA B 1 27  ? 35.170  -13.944 -48.518 1.00 24.50 ? 27  ALA B H    1 
ATOM   5408  H HA   . ALA B 1 27  ? 37.623  -14.824 -48.673 1.00 25.08 ? 27  ALA B HA   1 
ATOM   5409  H HB1  . ALA B 1 27  ? 38.104  -13.074 -47.192 1.00 28.87 ? 27  ALA B HB1  1 
ATOM   5410  H HB2  . ALA B 1 27  ? 37.164  -12.566 -48.367 1.00 28.87 ? 27  ALA B HB2  1 
ATOM   5411  H HB3  . ALA B 1 27  ? 36.550  -12.873 -46.935 1.00 28.87 ? 27  ALA B HB3  1 
ATOM   5412  N N    . GLN B 1 28  ? 36.181  -15.519 -45.881 1.00 24.47 ? 28  GLN B N    1 
ATOM   5413  C CA   . GLN B 1 28  ? 36.378  -16.223 -44.617 1.00 22.19 ? 28  GLN B CA   1 
ATOM   5414  C C    . GLN B 1 28  ? 36.293  -17.741 -44.778 1.00 31.20 ? 28  GLN B C    1 
ATOM   5415  O O    . GLN B 1 28  ? 37.053  -18.480 -44.144 1.00 26.32 ? 28  GLN B O    1 
ATOM   5416  C CB   . GLN B 1 28  ? 35.355  -15.725 -43.598 1.00 23.97 ? 28  GLN B CB   1 
ATOM   5417  C CG   . GLN B 1 28  ? 35.367  -16.512 -42.297 1.00 29.66 ? 28  GLN B CG   1 
ATOM   5418  C CD   . GLN B 1 28  ? 34.703  -15.769 -41.155 1.00 31.33 ? 28  GLN B CD   1 
ATOM   5419  O OE1  . GLN B 1 28  ? 33.627  -15.193 -41.315 1.00 32.47 ? 28  GLN B OE1  1 
ATOM   5420  N NE2  . GLN B 1 28  ? 35.341  -15.787 -39.989 1.00 35.01 ? 28  GLN B NE2  1 
ATOM   5421  H H    . GLN B 1 28  ? 35.421  -15.124 -45.957 1.00 29.35 ? 28  GLN B H    1 
ATOM   5422  H HA   . GLN B 1 28  ? 37.261  -16.011 -44.277 1.00 26.60 ? 28  GLN B HA   1 
ATOM   5423  H HB2  . GLN B 1 28  ? 35.548  -14.798 -43.387 1.00 28.75 ? 28  GLN B HB2  1 
ATOM   5424  H HB3  . GLN B 1 28  ? 34.468  -15.798 -43.983 1.00 28.75 ? 28  GLN B HB3  1 
ATOM   5425  H HG2  . GLN B 1 28  ? 34.891  -17.347 -42.429 1.00 35.57 ? 28  GLN B HG2  1 
ATOM   5426  H HG3  . GLN B 1 28  ? 36.286  -16.691 -42.044 1.00 35.57 ? 28  GLN B HG3  1 
ATOM   5427  H HE21 . GLN B 1 28  ? 36.091  -16.202 -39.915 1.00 41.99 ? 28  GLN B HE21 1 
ATOM   5428  H HE22 . GLN B 1 28  ? 35.006  -15.381 -39.309 1.00 41.99 ? 28  GLN B HE22 1 
ATOM   5429  N N    . LEU B 1 29  ? 35.383  -18.234 -45.605 1.00 25.86 ? 29  LEU B N    1 
ATOM   5430  C CA   . LEU B 1 29  ? 35.080  -19.653 -45.614 1.00 26.82 ? 29  LEU B CA   1 
ATOM   5431  C C    . LEU B 1 29  ? 35.933  -20.365 -46.658 1.00 29.66 ? 29  LEU B C    1 
ATOM   5432  O O    . LEU B 1 29  ? 35.956  -19.986 -47.839 1.00 25.14 ? 29  LEU B O    1 
ATOM   5433  C CB   . LEU B 1 29  ? 33.583  -19.880 -45.866 1.00 25.33 ? 29  LEU B CB   1 
ATOM   5434  C CG   . LEU B 1 29  ? 32.631  -19.240 -44.848 1.00 23.64 ? 29  LEU B CG   1 
ATOM   5435  C CD1  . LEU B 1 29  ? 31.193  -19.351 -45.348 1.00 21.03 ? 29  LEU B CD1  1 
ATOM   5436  C CD2  . LEU B 1 29  ? 32.735  -19.873 -43.479 1.00 22.78 ? 29  LEU B CD2  1 
ATOM   5437  H H    . LEU B 1 29  ? 34.929  -17.769 -46.168 1.00 31.01 ? 29  LEU B H    1 
ATOM   5438  H HA   . LEU B 1 29  ? 35.297  -20.027 -44.746 1.00 32.16 ? 29  LEU B HA   1 
ATOM   5439  H HB2  . LEU B 1 29  ? 33.361  -19.517 -46.738 1.00 30.38 ? 29  LEU B HB2  1 
ATOM   5440  H HB3  . LEU B 1 29  ? 33.413  -20.835 -45.861 1.00 30.38 ? 29  LEU B HB3  1 
ATOM   5441  H HG   . LEU B 1 29  ? 32.847  -18.299 -44.761 1.00 28.34 ? 29  LEU B HG   1 
ATOM   5442  H HD11 . LEU B 1 29  ? 30.600  -18.943 -44.697 1.00 25.21 ? 29  LEU B HD11 1 
ATOM   5443  H HD12 . LEU B 1 29  ? 31.118  -18.889 -46.198 1.00 25.21 ? 29  LEU B HD12 1 
ATOM   5444  H HD13 . LEU B 1 29  ? 30.969  -20.288 -45.459 1.00 25.21 ? 29  LEU B HD13 1 
ATOM   5445  H HD21 . LEU B 1 29  ? 32.114  -19.431 -42.879 1.00 27.31 ? 29  LEU B HD21 1 
ATOM   5446  H HD22 . LEU B 1 29  ? 32.514  -20.815 -43.550 1.00 27.31 ? 29  LEU B HD22 1 
ATOM   5447  H HD23 . LEU B 1 29  ? 33.642  -19.769 -43.152 1.00 27.31 ? 29  LEU B HD23 1 
ATOM   5448  N N    . ALA B 1 30  ? 36.636  -21.403 -46.208 1.00 32.14 ? 30  ALA B N    1 
ATOM   5449  C CA   . ALA B 1 30  ? 37.529  -22.138 -47.083 1.00 32.68 ? 30  ALA B CA   1 
ATOM   5450  C C    . ALA B 1 30  ? 36.822  -22.616 -48.340 1.00 31.66 ? 30  ALA B C    1 
ATOM   5451  O O    . ALA B 1 30  ? 37.445  -22.726 -49.397 1.00 32.22 ? 30  ALA B O    1 
ATOM   5452  C CB   . ALA B 1 30  ? 38.120  -23.338 -46.339 1.00 32.93 ? 30  ALA B CB   1 
ATOM   5453  H H    . ALA B 1 30  ? 36.610  -21.698 -45.400 1.00 38.55 ? 30  ALA B H    1 
ATOM   5454  H HA   . ALA B 1 30  ? 38.260  -21.558 -47.350 1.00 39.20 ? 30  ALA B HA   1 
ATOM   5455  H HB1  . ALA B 1 30  ? 38.714  -23.818 -46.937 1.00 39.49 ? 30  ALA B HB1  1 
ATOM   5456  H HB2  . ALA B 1 30  ? 38.614  -23.018 -45.567 1.00 39.49 ? 30  ALA B HB2  1 
ATOM   5457  H HB3  . ALA B 1 30  ? 37.398  -23.918 -46.053 1.00 39.49 ? 30  ALA B HB3  1 
ATOM   5458  N N    . GLN B 1 31  ? 35.527  -22.908 -48.266 1.00 30.35 ? 31  GLN B N    1 
ATOM   5459  C CA   . GLN B 1 31  ? 34.909  -23.550 -49.419 1.00 24.41 ? 31  GLN B CA   1 
ATOM   5460  C C    . GLN B 1 31  ? 34.652  -22.593 -50.574 1.00 26.21 ? 31  GLN B C    1 
ATOM   5461  O O    . GLN B 1 31  ? 34.241  -23.056 -51.642 1.00 29.51 ? 31  GLN B O    1 
ATOM   5462  C CB   . GLN B 1 31  ? 33.600  -24.251 -49.033 1.00 32.07 ? 31  GLN B CB   1 
ATOM   5463  C CG   . GLN B 1 31  ? 32.536  -23.347 -48.457 1.00 29.68 ? 31  GLN B CG   1 
ATOM   5464  C CD   . GLN B 1 31  ? 32.546  -23.316 -46.938 1.00 32.01 ? 31  GLN B CD   1 
ATOM   5465  O OE1  . GLN B 1 31  ? 33.600  -23.231 -46.309 1.00 33.35 ? 31  GLN B OE1  1 
ATOM   5466  N NE2  . GLN B 1 31  ? 31.362  -23.336 -46.348 1.00 34.68 ? 31  GLN B NE2  1 
ATOM   5467  H H    . GLN B 1 31  ? 35.008  -22.755 -47.597 1.00 36.40 ? 31  GLN B H    1 
ATOM   5468  H HA   . GLN B 1 31  ? 35.516  -24.234 -49.744 1.00 29.27 ? 31  GLN B HA   1 
ATOM   5469  H HB2  . GLN B 1 31  ? 33.230  -24.670 -49.825 1.00 38.47 ? 31  GLN B HB2  1 
ATOM   5470  H HB3  . GLN B 1 31  ? 33.798  -24.929 -48.368 1.00 38.47 ? 31  GLN B HB3  1 
ATOM   5471  H HG2  . GLN B 1 31  ? 32.683  -22.443 -48.776 1.00 35.59 ? 31  GLN B HG2  1 
ATOM   5472  H HG3  . GLN B 1 31  ? 31.665  -23.663 -48.745 1.00 35.59 ? 31  GLN B HG3  1 
ATOM   5473  H HE21 . GLN B 1 31  ? 30.646  -23.387 -46.821 1.00 41.60 ? 31  GLN B HE21 1 
ATOM   5474  H HE22 . GLN B 1 31  ? 31.310  -23.316 -45.489 1.00 41.60 ? 31  GLN B HE22 1 
ATOM   5475  N N    . PHE B 1 32  ? 34.912  -21.298 -50.411 1.00 28.23 ? 32  PHE B N    1 
ATOM   5476  C CA   . PHE B 1 32  ? 34.715  -20.322 -51.477 1.00 24.51 ? 32  PHE B CA   1 
ATOM   5477  C C    . PHE B 1 32  ? 36.043  -19.700 -51.875 1.00 26.74 ? 32  PHE B C    1 
ATOM   5478  O O    . PHE B 1 32  ? 36.915  -19.441 -51.026 1.00 26.58 ? 32  PHE B O    1 
ATOM   5479  C CB   . PHE B 1 32  ? 33.746  -19.200 -51.066 1.00 22.51 ? 32  PHE B CB   1 
ATOM   5480  C CG   . PHE B 1 32  ? 32.359  -19.696 -50.733 1.00 18.60 ? 32  PHE B CG   1 
ATOM   5481  C CD1  . PHE B 1 32  ? 31.568  -20.277 -51.699 1.00 23.24 ? 32  PHE B CD1  1 
ATOM   5482  C CD2  . PHE B 1 32  ? 31.871  -19.621 -49.443 1.00 20.76 ? 32  PHE B CD2  1 
ATOM   5483  C CE1  . PHE B 1 32  ? 30.292  -20.761 -51.385 1.00 23.22 ? 32  PHE B CE1  1 
ATOM   5484  C CE2  . PHE B 1 32  ? 30.605  -20.085 -49.132 1.00 23.17 ? 32  PHE B CE2  1 
ATOM   5485  C CZ   . PHE B 1 32  ? 29.822  -20.656 -50.093 1.00 21.33 ? 32  PHE B CZ   1 
ATOM   5486  H H    . PHE B 1 32  ? 35.209  -20.956 -49.680 1.00 33.85 ? 32  PHE B H    1 
ATOM   5487  H HA   . PHE B 1 32  ? 34.346  -20.771 -52.254 1.00 29.39 ? 32  PHE B HA   1 
ATOM   5488  H HB2  . PHE B 1 32  ? 34.099  -18.753 -50.280 1.00 26.99 ? 32  PHE B HB2  1 
ATOM   5489  H HB3  . PHE B 1 32  ? 33.669  -18.568 -51.798 1.00 26.99 ? 32  PHE B HB3  1 
ATOM   5490  H HD1  . PHE B 1 32  ? 31.884  -20.348 -52.571 1.00 27.87 ? 32  PHE B HD1  1 
ATOM   5491  H HD2  . PHE B 1 32  ? 32.393  -19.234 -48.778 1.00 24.89 ? 32  PHE B HD2  1 
ATOM   5492  H HE1  . PHE B 1 32  ? 29.761  -21.142 -52.046 1.00 27.84 ? 32  PHE B HE1  1 
ATOM   5493  H HE2  . PHE B 1 32  ? 30.291  -20.019 -48.259 1.00 27.78 ? 32  PHE B HE2  1 
ATOM   5494  H HZ   . PHE B 1 32  ? 28.973  -20.970 -49.878 1.00 25.58 ? 32  PHE B HZ   1 
ATOM   5495  N N    . ASP B 1 33  ? 36.168  -19.449 -53.164 1.00 27.52 ? 33  ASP B N    1 
ATOM   5496  C CA   . ASP B 1 33  ? 37.267  -18.640 -53.679 1.00 25.45 ? 33  ASP B CA   1 
ATOM   5497  C C    . ASP B 1 33  ? 37.076  -17.190 -53.239 1.00 23.56 ? 33  ASP B C    1 
ATOM   5498  O O    . ASP B 1 33  ? 35.965  -16.651 -53.366 1.00 23.93 ? 33  ASP B O    1 
ATOM   5499  C CB   . ASP B 1 33  ? 37.285  -18.757 -55.189 1.00 24.53 ? 33  ASP B CB   1 
ATOM   5500  C CG   . ASP B 1 33  ? 38.508  -18.122 -55.825 1.00 24.51 ? 33  ASP B CG   1 
ATOM   5501  O OD1  . ASP B 1 33  ? 38.850  -17.000 -55.446 1.00 23.28 ? 33  ASP B OD1  1 
ATOM   5502  O OD2  . ASP B 1 33  ? 39.103  -18.760 -56.715 1.00 30.23 ? 33  ASP B OD2  1 
ATOM   5503  H H    . ASP B 1 33  ? 35.629  -19.736 -53.769 1.00 33.00 ? 33  ASP B H    1 
ATOM   5504  H HA   . ASP B 1 33  ? 38.111  -18.966 -53.328 1.00 30.52 ? 33  ASP B HA   1 
ATOM   5505  H HB2  . ASP B 1 33  ? 37.276  -19.696 -55.432 1.00 29.41 ? 33  ASP B HB2  1 
ATOM   5506  H HB3  . ASP B 1 33  ? 36.499  -18.316 -55.548 1.00 29.41 ? 33  ASP B HB3  1 
ATOM   5507  N N    . PRO B 1 34  ? 38.101  -16.531 -52.682 1.00 21.70 ? 34  PRO B N    1 
ATOM   5508  C CA   . PRO B 1 34  ? 37.895  -15.152 -52.203 1.00 21.12 ? 34  PRO B CA   1 
ATOM   5509  C C    . PRO B 1 34  ? 37.691  -14.141 -53.314 1.00 19.95 ? 34  PRO B C    1 
ATOM   5510  O O    . PRO B 1 34  ? 37.244  -13.018 -53.037 1.00 18.74 ? 34  PRO B O    1 
ATOM   5511  C CB   . PRO B 1 34  ? 39.186  -14.848 -51.413 1.00 27.64 ? 34  PRO B CB   1 
ATOM   5512  C CG   . PRO B 1 34  ? 40.207  -15.756 -51.986 1.00 27.26 ? 34  PRO B CG   1 
ATOM   5513  C CD   . PRO B 1 34  ? 39.456  -17.026 -52.370 1.00 24.06 ? 34  PRO B CD   1 
ATOM   5514  H HA   . PRO B 1 34  ? 37.138  -15.118 -51.598 1.00 25.32 ? 34  PRO B HA   1 
ATOM   5515  H HB2  . PRO B 1 34  ? 39.439  -13.921 -51.543 1.00 33.14 ? 34  PRO B HB2  1 
ATOM   5516  H HB3  . PRO B 1 34  ? 39.047  -15.038 -50.472 1.00 33.14 ? 34  PRO B HB3  1 
ATOM   5517  H HG2  . PRO B 1 34  ? 40.605  -15.345 -52.769 1.00 32.70 ? 34  PRO B HG2  1 
ATOM   5518  H HG3  . PRO B 1 34  ? 40.884  -15.948 -51.319 1.00 32.70 ? 34  PRO B HG3  1 
ATOM   5519  H HD2  . PRO B 1 34  ? 39.857  -17.434 -53.153 1.00 28.85 ? 34  PRO B HD2  1 
ATOM   5520  H HD3  . PRO B 1 34  ? 39.428  -17.643 -51.621 1.00 28.85 ? 34  PRO B HD3  1 
ATOM   5521  N N    . ARG B 1 35  ? 38.028  -14.479 -54.555 1.00 20.58 ? 35  ARG B N    1 
ATOM   5522  C CA   . ARG B 1 35  ? 37.899  -13.530 -55.655 1.00 19.98 ? 35  ARG B CA   1 
ATOM   5523  C C    . ARG B 1 35  ? 36.456  -13.557 -56.140 1.00 24.37 ? 35  ARG B C    1 
ATOM   5524  O O    . ARG B 1 35  ? 36.056  -14.463 -56.876 1.00 20.37 ? 35  ARG B O    1 
ATOM   5525  C CB   . ARG B 1 35  ? 38.843  -13.877 -56.794 1.00 23.90 ? 35  ARG B CB   1 
ATOM   5526  C CG   . ARG B 1 35  ? 38.740  -12.870 -57.928 1.00 32.20 ? 35  ARG B CG   1 
ATOM   5527  C CD   . ARG B 1 35  ? 39.872  -12.994 -58.920 1.00 42.30 ? 35  ARG B CD   1 
ATOM   5528  N NE   . ARG B 1 35  ? 39.729  -11.988 -59.973 1.00 45.91 ? 35  ARG B NE   1 
ATOM   5529  C CZ   . ARG B 1 35  ? 38.900  -12.101 -61.005 1.00 37.62 ? 35  ARG B CZ   1 
ATOM   5530  N NH1  . ARG B 1 35  ? 38.139  -13.184 -61.139 1.00 36.70 ? 35  ARG B NH1  1 
ATOM   5531  N NH2  . ARG B 1 35  ? 38.824  -11.125 -61.903 1.00 37.00 ? 35  ARG B NH2  1 
ATOM   5532  H H    . ARG B 1 35  ? 38.334  -15.249 -54.786 1.00 24.67 ? 35  ARG B H    1 
ATOM   5533  H HA   . ARG B 1 35  ? 38.106  -12.635 -55.342 1.00 23.96 ? 35  ARG B HA   1 
ATOM   5534  H HB2  . ARG B 1 35  ? 39.756  -13.873 -56.466 1.00 28.66 ? 35  ARG B HB2  1 
ATOM   5535  H HB3  . ARG B 1 35  ? 38.615  -14.753 -57.143 1.00 28.66 ? 35  ARG B HB3  1 
ATOM   5536  H HG2  . ARG B 1 35  ? 37.907  -13.014 -58.404 1.00 38.62 ? 35  ARG B HG2  1 
ATOM   5537  H HG3  . ARG B 1 35  ? 38.760  -11.974 -57.558 1.00 38.62 ? 35  ARG B HG3  1 
ATOM   5538  H HD2  . ARG B 1 35  ? 40.717  -12.848 -58.467 1.00 50.74 ? 35  ARG B HD2  1 
ATOM   5539  H HD3  . ARG B 1 35  ? 39.852  -13.873 -59.328 1.00 50.74 ? 35  ARG B HD3  1 
ATOM   5540  H HE   . ARG B 1 35  ? 40.194  -11.267 -59.906 1.00 55.07 ? 35  ARG B HE   1 
ATOM   5541  H HH11 . ARG B 1 35  ? 38.182  -13.814 -60.555 1.00 44.02 ? 35  ARG B HH11 1 
ATOM   5542  H HH12 . ARG B 1 35  ? 37.605  -13.254 -61.809 1.00 44.02 ? 35  ARG B HH12 1 
ATOM   5543  H HH21 . ARG B 1 35  ? 39.318  -10.426 -61.821 1.00 44.38 ? 35  ARG B HH21 1 
ATOM   5544  H HH22 . ARG B 1 35  ? 38.293  -11.200 -62.576 1.00 44.38 ? 35  ARG B HH22 1 
ATOM   5545  N N    . VAL B 1 36  ? 35.675  -12.568 -55.726 1.00 21.51 ? 36  VAL B N    1 
ATOM   5546  C CA   . VAL B 1 36  ? 34.272  -12.458 -56.118 1.00 20.63 ? 36  VAL B CA   1 
ATOM   5547  C C    . VAL B 1 36  ? 34.177  -11.397 -57.193 1.00 19.33 ? 36  VAL B C    1 
ATOM   5548  O O    . VAL B 1 36  ? 34.515  -10.237 -56.961 1.00 21.06 ? 36  VAL B O    1 
ATOM   5549  C CB   . VAL B 1 36  ? 33.386  -12.103 -54.921 1.00 16.25 ? 36  VAL B CB   1 
ATOM   5550  C CG1  . VAL B 1 36  ? 31.928  -11.866 -55.372 1.00 19.03 ? 36  VAL B CG1  1 
ATOM   5551  C CG2  . VAL B 1 36  ? 33.474  -13.196 -53.875 1.00 17.37 ? 36  VAL B CG2  1 
ATOM   5552  H H    . VAL B 1 36  ? 35.937  -11.935 -55.206 1.00 25.80 ? 36  VAL B H    1 
ATOM   5553  H HA   . VAL B 1 36  ? 33.970  -13.302 -56.488 1.00 24.74 ? 36  VAL B HA   1 
ATOM   5554  H HB   . VAL B 1 36  ? 33.711  -11.282 -54.522 1.00 19.47 ? 36  VAL B HB   1 
ATOM   5555  H HG11 . VAL B 1 36  ? 31.390  -11.644 -54.596 1.00 22.81 ? 36  VAL B HG11 1 
ATOM   5556  H HG12 . VAL B 1 36  ? 31.910  -11.134 -56.009 1.00 22.81 ? 36  VAL B HG12 1 
ATOM   5557  H HG13 . VAL B 1 36  ? 31.591  -12.675 -55.788 1.00 22.81 ? 36  VAL B HG13 1 
ATOM   5558  H HG21 . VAL B 1 36  ? 32.909  -12.959 -53.123 1.00 20.82 ? 36  VAL B HG21 1 
ATOM   5559  H HG22 . VAL B 1 36  ? 33.174  -14.031 -54.265 1.00 20.82 ? 36  VAL B HG22 1 
ATOM   5560  H HG23 . VAL B 1 36  ? 34.396  -13.279 -53.583 1.00 20.82 ? 36  VAL B HG23 1 
ATOM   5561  N N    . THR B 1 37  ? 33.695  -11.770 -58.368 1.00 20.97 ? 37  THR B N    1 
ATOM   5562  C CA   . THR B 1 37  ? 33.489  -10.786 -59.407 1.00 18.80 ? 37  THR B CA   1 
ATOM   5563  C C    . THR B 1 37  ? 32.099  -10.199 -59.272 1.00 18.76 ? 37  THR B C    1 
ATOM   5564  O O    . THR B 1 37  ? 31.159  -10.858 -58.816 1.00 20.75 ? 37  THR B O    1 
ATOM   5565  C CB   . THR B 1 37  ? 33.654  -11.377 -60.815 1.00 21.82 ? 37  THR B CB   1 
ATOM   5566  O OG1  . THR B 1 37  ? 32.765  -12.474 -60.983 1.00 20.64 ? 37  THR B OG1  1 
ATOM   5567  C CG2  . THR B 1 37  ? 35.028  -11.864 -61.036 1.00 21.54 ? 37  THR B CG2  1 
ATOM   5568  H H    . THR B 1 37  ? 33.483  -12.574 -58.584 1.00 25.14 ? 37  THR B H    1 
ATOM   5569  H HA   . THR B 1 37  ? 34.134  -10.070 -59.301 1.00 22.54 ? 37  THR B HA   1 
ATOM   5570  H HB   . THR B 1 37  ? 33.458  -10.696 -61.478 1.00 26.16 ? 37  THR B HB   1 
ATOM   5571  H HG1  . THR B 1 37  ? 32.852  -12.800 -61.752 1.00 24.75 ? 37  THR B HG1  1 
ATOM   5572  H HG21 . THR B 1 37  ? 35.109  -12.232 -61.930 1.00 25.83 ? 37  THR B HG21 1 
ATOM   5573  H HG22 . THR B 1 37  ? 35.659  -11.133 -60.938 1.00 25.83 ? 37  THR B HG22 1 
ATOM   5574  H HG23 . THR B 1 37  ? 35.243  -12.555 -60.390 1.00 25.83 ? 37  THR B HG23 1 
ATOM   5575  N N    . MET B 1 38  ? 31.978  -8.947  -59.674 1.00 19.68 ? 38  MET B N    1 
ATOM   5576  C CA   . MET B 1 38  ? 30.700  -8.278  -59.734 1.00 20.77 ? 38  MET B CA   1 
ATOM   5577  C C    . MET B 1 38  ? 30.588  -7.577  -61.071 1.00 21.16 ? 38  MET B C    1 
ATOM   5578  O O    . MET B 1 38  ? 31.435  -6.752  -61.417 1.00 22.86 ? 38  MET B O    1 
ATOM   5579  C CB   . MET B 1 38  ? 30.537  -7.293  -58.581 1.00 21.40 ? 38  MET B CB   1 
ATOM   5580  C CG   . MET B 1 38  ? 29.309  -6.429  -58.660 1.00 24.39 ? 38  MET B CG   1 
ATOM   5581  S SD   . MET B 1 38  ? 29.125  -5.495  -57.110 1.00 24.31 ? 38  MET B SD   1 
ATOM   5582  C CE   . MET B 1 38  ? 30.457  -4.331  -57.257 1.00 23.22 ? 38  MET B CE   1 
ATOM   5583  H H    . MET B 1 38  ? 32.638  -8.455  -59.921 1.00 23.59 ? 38  MET B H    1 
ATOM   5584  H HA   . MET B 1 38  ? 29.994  -8.939  -59.665 1.00 24.90 ? 38  MET B HA   1 
ATOM   5585  H HB2  . MET B 1 38  ? 30.491  -7.793  -57.752 1.00 25.65 ? 38  MET B HB2  1 
ATOM   5586  H HB3  . MET B 1 38  ? 31.308  -6.705  -58.565 1.00 25.65 ? 38  MET B HB3  1 
ATOM   5587  H HG2  . MET B 1 38  ? 29.398  -5.800  -59.393 1.00 29.25 ? 38  MET B HG2  1 
ATOM   5588  H HG3  . MET B 1 38  ? 28.524  -6.987  -58.781 1.00 29.25 ? 38  MET B HG3  1 
ATOM   5589  H HE1  . MET B 1 38  ? 30.466  -3.760  -56.473 1.00 27.85 ? 38  MET B HE1  1 
ATOM   5590  H HE2  . MET B 1 38  ? 31.294  -4.816  -57.324 1.00 27.85 ? 38  MET B HE2  1 
ATOM   5591  H HE3  . MET B 1 38  ? 30.321  -3.795  -58.055 1.00 27.85 ? 38  MET B HE3  1 
ATOM   5592  N N    . TRP B 1 39  ? 29.572  -7.939  -61.842 1.00 18.76 ? 39  TRP B N    1 
ATOM   5593  C CA   . TRP B 1 39  ? 29.342  -7.285  -63.121 1.00 23.21 ? 39  TRP B CA   1 
ATOM   5594  C C    . TRP B 1 39  ? 28.750  -5.912  -62.862 1.00 21.23 ? 39  TRP B C    1 
ATOM   5595  O O    . TRP B 1 39  ? 27.701  -5.801  -62.222 1.00 20.96 ? 39  TRP B O    1 
ATOM   5596  C CB   . TRP B 1 39  ? 28.401  -8.072  -64.023 1.00 20.83 ? 39  TRP B CB   1 
ATOM   5597  C CG   . TRP B 1 39  ? 28.022  -7.217  -65.186 1.00 22.04 ? 39  TRP B CG   1 
ATOM   5598  C CD1  . TRP B 1 39  ? 28.878  -6.733  -66.130 1.00 22.46 ? 39  TRP B CD1  1 
ATOM   5599  C CD2  . TRP B 1 39  ? 26.724  -6.690  -65.519 1.00 24.10 ? 39  TRP B CD2  1 
ATOM   5600  N NE1  . TRP B 1 39  ? 28.207  -5.954  -67.022 1.00 22.46 ? 39  TRP B NE1  1 
ATOM   5601  C CE2  . TRP B 1 39  ? 26.883  -5.913  -66.682 1.00 22.88 ? 39  TRP B CE2  1 
ATOM   5602  C CE3  . TRP B 1 39  ? 25.446  -6.807  -64.957 1.00 20.31 ? 39  TRP B CE3  1 
ATOM   5603  C CZ2  . TRP B 1 39  ? 25.820  -5.243  -67.284 1.00 25.56 ? 39  TRP B CZ2  1 
ATOM   5604  C CZ3  . TRP B 1 39  ? 24.392  -6.159  -65.558 1.00 25.14 ? 39  TRP B CZ3  1 
ATOM   5605  C CH2  . TRP B 1 39  ? 24.581  -5.384  -66.717 1.00 24.37 ? 39  TRP B CH2  1 
ATOM   5606  H H    . TRP B 1 39  ? 29.004  -8.555  -61.649 1.00 22.49 ? 39  TRP B H    1 
ATOM   5607  H HA   . TRP B 1 39  ? 30.187  -7.172  -63.583 1.00 27.83 ? 39  TRP B HA   1 
ATOM   5608  H HB2  . TRP B 1 39  ? 28.849  -8.867  -64.352 1.00 24.97 ? 39  TRP B HB2  1 
ATOM   5609  H HB3  . TRP B 1 39  ? 27.597  -8.308  -63.534 1.00 24.97 ? 39  TRP B HB3  1 
ATOM   5610  H HD1  . TRP B 1 39  ? 29.793  -6.903  -66.155 1.00 26.92 ? 39  TRP B HD1  1 
ATOM   5611  H HE1  . TRP B 1 39  ? 28.558  -5.558  -67.699 1.00 26.94 ? 39  TRP B HE1  1 
ATOM   5612  H HE3  . TRP B 1 39  ? 25.313  -7.313  -64.188 1.00 24.35 ? 39  TRP B HE3  1 
ATOM   5613  H HZ2  . TRP B 1 39  ? 25.942  -4.741  -68.058 1.00 30.66 ? 39  TRP B HZ2  1 
ATOM   5614  H HZ3  . TRP B 1 39  ? 23.541  -6.230  -65.189 1.00 30.15 ? 39  TRP B HZ3  1 
ATOM   5615  H HH2  . TRP B 1 39  ? 23.851  -4.958  -67.104 1.00 29.22 ? 39  TRP B HH2  1 
ATOM   5616  N N    . VAL B 1 40  ? 29.429  -4.881  -63.355 1.00 21.06 ? 40  VAL B N    1 
ATOM   5617  C CA   . VAL B 1 40  ? 29.061  -3.478  -63.178 1.00 20.80 ? 40  VAL B CA   1 
ATOM   5618  C C    . VAL B 1 40  ? 28.955  -2.856  -64.567 1.00 25.33 ? 40  VAL B C    1 
ATOM   5619  O O    . VAL B 1 40  ? 29.973  -2.684  -65.246 1.00 23.38 ? 40  VAL B O    1 
ATOM   5620  C CB   . VAL B 1 40  ? 30.114  -2.722  -62.333 1.00 22.05 ? 40  VAL B CB   1 
ATOM   5621  C CG1  . VAL B 1 40  ? 29.794  -1.244  -62.192 1.00 23.17 ? 40  VAL B CG1  1 
ATOM   5622  C CG2  . VAL B 1 40  ? 30.297  -3.356  -60.989 1.00 18.88 ? 40  VAL B CG2  1 
ATOM   5623  H H    . VAL B 1 40  ? 30.145  -4.976  -63.822 1.00 25.25 ? 40  VAL B H    1 
ATOM   5624  H HA   . VAL B 1 40  ? 28.200  -3.415  -62.737 1.00 24.93 ? 40  VAL B HA   1 
ATOM   5625  H HB   . VAL B 1 40  ? 30.966  -2.784  -62.793 1.00 26.44 ? 40  VAL B HB   1 
ATOM   5626  H HG11 . VAL B 1 40  ? 30.483  -0.822  -61.655 1.00 27.78 ? 40  VAL B HG11 1 
ATOM   5627  H HG12 . VAL B 1 40  ? 29.767  -0.841  -63.074 1.00 27.78 ? 40  VAL B HG12 1 
ATOM   5628  H HG13 . VAL B 1 40  ? 28.931  -1.148  -61.758 1.00 27.78 ? 40  VAL B HG13 1 
ATOM   5629  H HG21 . VAL B 1 40  ? 30.962  -2.855  -60.492 1.00 22.64 ? 40  VAL B HG21 1 
ATOM   5630  H HG22 . VAL B 1 40  ? 29.450  -3.343  -60.516 1.00 22.64 ? 40  VAL B HG22 1 
ATOM   5631  H HG23 . VAL B 1 40  ? 30.594  -4.272  -61.110 1.00 22.64 ? 40  VAL B HG23 1 
ATOM   5632  N N    . PHE B 1 41  ? 27.743  -2.486  -64.972 1.00 22.50 ? 41  PHE B N    1 
ATOM   5633  C CA   . PHE B 1 41  ? 27.563  -1.702  -66.181 1.00 27.59 ? 41  PHE B CA   1 
ATOM   5634  C C    . PHE B 1 41  ? 28.392  -0.422  -66.087 1.00 27.73 ? 41  PHE B C    1 
ATOM   5635  O O    . PHE B 1 41  ? 28.158  0.422   -65.204 1.00 25.62 ? 41  PHE B O    1 
ATOM   5636  C CB   . PHE B 1 41  ? 26.088  -1.364  -66.367 1.00 27.54 ? 41  PHE B CB   1 
ATOM   5637  C CG   . PHE B 1 41  ? 25.812  -0.513  -67.572 1.00 28.88 ? 41  PHE B CG   1 
ATOM   5638  C CD1  . PHE B 1 41  ? 25.798  -1.068  -68.832 1.00 33.65 ? 41  PHE B CD1  1 
ATOM   5639  C CD2  . PHE B 1 41  ? 25.588  0.845   -67.444 1.00 34.55 ? 41  PHE B CD2  1 
ATOM   5640  C CE1  . PHE B 1 41  ? 25.556  -0.296  -69.945 1.00 35.22 ? 41  PHE B CE1  1 
ATOM   5641  C CE2  . PHE B 1 41  ? 25.344  1.627   -68.565 1.00 37.42 ? 41  PHE B CE2  1 
ATOM   5642  C CZ   . PHE B 1 41  ? 25.333  1.048   -69.809 1.00 31.82 ? 41  PHE B CZ   1 
ATOM   5643  H H    . PHE B 1 41  ? 27.012  -2.679  -64.563 1.00 26.98 ? 41  PHE B H    1 
ATOM   5644  H HA   . PHE B 1 41  ? 27.865  -2.211  -66.949 1.00 33.08 ? 41  PHE B HA   1 
ATOM   5645  H HB2  . PHE B 1 41  ? 25.588  -2.190  -66.467 1.00 33.02 ? 41  PHE B HB2  1 
ATOM   5646  H HB3  . PHE B 1 41  ? 25.776  -0.883  -65.585 1.00 33.02 ? 41  PHE B HB3  1 
ATOM   5647  H HD1  . PHE B 1 41  ? 25.951  -1.980  -68.932 1.00 40.36 ? 41  PHE B HD1  1 
ATOM   5648  H HD2  . PHE B 1 41  ? 25.598  1.236   -66.600 1.00 41.43 ? 41  PHE B HD2  1 
ATOM   5649  H HE1  . PHE B 1 41  ? 25.547  -0.686  -70.789 1.00 42.25 ? 41  PHE B HE1  1 
ATOM   5650  H HE2  . PHE B 1 41  ? 25.191  2.540   -68.473 1.00 44.89 ? 41  PHE B HE2  1 
ATOM   5651  H HZ   . PHE B 1 41  ? 25.167  1.569   -70.562 1.00 38.16 ? 41  PHE B HZ   1 
ATOM   5652  N N    . GLU B 1 42  ? 29.363  -0.285  -66.990 1.00 31.41 ? 42  GLU B N    1 
ATOM   5653  C CA   . GLU B 1 42  ? 30.331  0.796   -66.872 1.00 28.36 ? 42  GLU B CA   1 
ATOM   5654  C C    . GLU B 1 42  ? 29.620  2.127   -67.007 1.00 32.15 ? 42  GLU B C    1 
ATOM   5655  O O    . GLU B 1 42  ? 28.700  2.279   -67.813 1.00 28.83 ? 42  GLU B O    1 
ATOM   5656  C CB   . GLU B 1 42  ? 31.438  0.681   -67.922 1.00 29.39 ? 42  GLU B CB   1 
ATOM   5657  C CG   . GLU B 1 42  ? 32.654  1.572   -67.616 1.00 25.80 ? 42  GLU B CG   1 
ATOM   5658  C CD   . GLU B 1 42  ? 33.349  1.178   -66.346 1.00 23.38 ? 42  GLU B CD   1 
ATOM   5659  O OE1  . GLU B 1 42  ? 34.231  0.321   -66.405 1.00 24.87 ? 42  GLU B OE1  1 
ATOM   5660  O OE2  . GLU B 1 42  ? 32.979  1.713   -65.276 1.00 28.58 ? 42  GLU B OE2  1 
ATOM   5661  H H    . GLU B 1 42  ? 29.480  -0.798  -67.670 1.00 37.67 ? 42  GLU B H    1 
ATOM   5662  H HA   . GLU B 1 42  ? 30.743  0.761   -65.994 1.00 34.01 ? 42  GLU B HA   1 
ATOM   5663  H HB2  . GLU B 1 42  ? 31.743  -0.239  -67.959 1.00 35.25 ? 42  GLU B HB2  1 
ATOM   5664  H HB3  . GLU B 1 42  ? 31.082  0.946   -68.785 1.00 35.25 ? 42  GLU B HB3  1 
ATOM   5665  H HG2  . GLU B 1 42  ? 33.292  1.499   -68.343 1.00 30.93 ? 42  GLU B HG2  1 
ATOM   5666  H HG3  . GLU B 1 42  ? 32.358  2.492   -67.524 1.00 30.93 ? 42  GLU B HG3  1 
ATOM   5667  N N    . GLU B 1 43  ? 30.034  3.080   -66.175 1.00 29.19 ? 43  GLU B N    1 
ATOM   5668  C CA   . GLU B 1 43  ? 29.486  4.423   -66.191 1.00 30.84 ? 43  GLU B CA   1 
ATOM   5669  C C    . GLU B 1 43  ? 30.609  5.402   -65.926 1.00 26.21 ? 43  GLU B C    1 
ATOM   5670  O O    . GLU B 1 43  ? 31.563  5.105   -65.210 1.00 32.50 ? 43  GLU B O    1 
ATOM   5671  C CB   . GLU B 1 43  ? 28.366  4.607   -65.161 1.00 31.29 ? 43  GLU B CB   1 
ATOM   5672  C CG   . GLU B 1 43  ? 27.036  3.926   -65.549 1.00 32.24 ? 43  GLU B CG   1 
ATOM   5673  C CD   . GLU B 1 43  ? 25.905  4.244   -64.584 1.00 28.74 ? 43  GLU B CD   1 
ATOM   5674  O OE1  . GLU B 1 43  ? 25.561  3.396   -63.725 1.00 30.82 ? 43  GLU B OE1  1 
ATOM   5675  O OE2  . GLU B 1 43  ? 25.365  5.357   -64.674 1.00 33.80 ? 43  GLU B OE2  1 
ATOM   5676  H H    . GLU B 1 43  ? 30.646  2.966   -65.581 1.00 35.01 ? 43  GLU B H    1 
ATOM   5677  H HA   . GLU B 1 43  ? 29.122  4.608   -67.071 1.00 36.99 ? 43  GLU B HA   1 
ATOM   5678  H HB2  . GLU B 1 43  ? 28.655  4.229   -64.315 1.00 37.53 ? 43  GLU B HB2  1 
ATOM   5679  H HB3  . GLU B 1 43  ? 28.193  5.555   -65.055 1.00 37.53 ? 43  GLU B HB3  1 
ATOM   5680  H HG2  . GLU B 1 43  ? 26.771  4.230   -66.431 1.00 38.67 ? 43  GLU B HG2  1 
ATOM   5681  H HG3  . GLU B 1 43  ? 27.163  2.964   -65.554 1.00 38.67 ? 43  GLU B HG3  1 
ATOM   5682  N N    . ASP B 1 44  ? 30.479  6.578   -66.512 1.00 31.27 ? 44  ASP B N    1 
ATOM   5683  C CA   . ASP B 1 44  ? 31.444  7.654   -66.315 1.00 38.45 ? 44  ASP B CA   1 
ATOM   5684  C C    . ASP B 1 44  ? 30.998  8.497   -65.125 1.00 31.98 ? 44  ASP B C    1 
ATOM   5685  O O    . ASP B 1 44  ? 29.924  9.110   -65.157 1.00 31.88 ? 44  ASP B O    1 
ATOM   5686  C CB   . ASP B 1 44  ? 31.562  8.497   -67.589 1.00 43.26 ? 44  ASP B CB   1 
ATOM   5687  C CG   . ASP B 1 44  ? 32.388  9.768   -67.393 1.00 45.14 ? 44  ASP B CG   1 
ATOM   5688  O OD1  . ASP B 1 44  ? 33.394  9.735   -66.646 1.00 47.33 ? 44  ASP B OD1  1 
ATOM   5689  O OD2  . ASP B 1 44  ? 32.035  10.794  -68.016 1.00 48.43 ? 44  ASP B OD2  1 
ATOM   5690  H H    . ASP B 1 44  ? 29.832  6.786   -67.038 1.00 37.50 ? 44  ASP B H    1 
ATOM   5691  H HA   . ASP B 1 44  ? 32.315  7.276   -66.115 1.00 46.12 ? 44  ASP B HA   1 
ATOM   5692  H HB2  . ASP B 1 44  ? 31.990  7.967   -68.279 1.00 51.89 ? 44  ASP B HB2  1 
ATOM   5693  H HB3  . ASP B 1 44  ? 30.674  8.760   -67.876 1.00 51.89 ? 44  ASP B HB3  1 
ATOM   5694  N N    . ILE B 1 45  ? 31.806  8.495   -64.071 1.00 33.70 ? 45  ILE B N    1 
ATOM   5695  C CA   . ILE B 1 45  ? 31.541  9.243   -62.852 1.00 35.90 ? 45  ILE B CA   1 
ATOM   5696  C C    . ILE B 1 45  ? 32.591  10.348  -62.825 1.00 35.29 ? 45  ILE B C    1 
ATOM   5697  O O    . ILE B 1 45  ? 33.736  10.110  -62.424 1.00 32.10 ? 45  ILE B O    1 
ATOM   5698  C CB   . ILE B 1 45  ? 31.627  8.365   -61.597 1.00 34.05 ? 45  ILE B CB   1 
ATOM   5699  C CG1  . ILE B 1 45  ? 30.788  7.081   -61.755 1.00 27.87 ? 45  ILE B CG1  1 
ATOM   5700  C CG2  . ILE B 1 45  ? 31.194  9.152   -60.387 1.00 28.87 ? 45  ILE B CG2  1 
ATOM   5701  C CD1  . ILE B 1 45  ? 29.335  7.290   -61.837 1.00 29.63 ? 45  ILE B CD1  1 
ATOM   5702  H H    . ILE B 1 45  ? 32.541  8.050   -64.039 1.00 40.42 ? 45  ILE B H    1 
ATOM   5703  H HA   . ILE B 1 45  ? 30.660  9.647   -62.896 1.00 43.06 ? 45  ILE B HA   1 
ATOM   5704  H HB   . ILE B 1 45  ? 32.553  8.106   -61.473 1.00 40.84 ? 45  ILE B HB   1 
ATOM   5705  H HG12 . ILE B 1 45  ? 31.065  6.631   -62.569 1.00 33.42 ? 45  ILE B HG12 1 
ATOM   5706  H HG13 . ILE B 1 45  ? 30.958  6.507   -60.993 1.00 33.42 ? 45  ILE B HG13 1 
ATOM   5707  H HG21 . ILE B 1 45  ? 31.253  8.583   -59.603 1.00 34.63 ? 45  ILE B HG21 1 
ATOM   5708  H HG22 . ILE B 1 45  ? 31.777  9.920   -60.284 1.00 34.63 ? 45  ILE B HG22 1 
ATOM   5709  H HG23 . ILE B 1 45  ? 30.278  9.447   -60.513 1.00 34.63 ? 45  ILE B HG23 1 
ATOM   5710  H HD11 . ILE B 1 45  ? 28.898  6.430   -61.935 1.00 35.53 ? 45  ILE B HD11 1 
ATOM   5711  H HD12 . ILE B 1 45  ? 29.032  7.725   -61.025 1.00 35.53 ? 45  ILE B HD12 1 
ATOM   5712  H HD13 . ILE B 1 45  ? 29.139  7.850   -62.605 1.00 35.53 ? 45  ILE B HD13 1 
ATOM   5713  N N    . GLY B 1 46  ? 32.227  11.532  -63.306 1.00 38.82 ? 46  GLY B N    1 
ATOM   5714  C CA   . GLY B 1 46  ? 33.113  12.679  -63.289 1.00 38.90 ? 46  GLY B CA   1 
ATOM   5715  C C    . GLY B 1 46  ? 34.481  12.381  -63.860 1.00 32.78 ? 46  GLY B C    1 
ATOM   5716  O O    . GLY B 1 46  ? 35.505  12.636  -63.219 1.00 40.75 ? 46  GLY B O    1 
ATOM   5717  H H    . GLY B 1 46  ? 31.457  11.695  -63.653 1.00 46.57 ? 46  GLY B H    1 
ATOM   5718  H HA2  . GLY B 1 46  ? 32.717  13.398  -63.806 1.00 46.66 ? 46  GLY B HA2  1 
ATOM   5719  H HA3  . GLY B 1 46  ? 33.224  12.984  -62.375 1.00 46.66 ? 46  GLY B HA3  1 
ATOM   5720  N N    . GLY B 1 47  ? 34.509  11.804  -65.054 1.00 35.91 ? 47  GLY B N    1 
ATOM   5721  C CA   . GLY B 1 47  ? 35.757  11.558  -65.732 1.00 40.43 ? 47  GLY B CA   1 
ATOM   5722  C C    . GLY B 1 47  ? 36.434  10.255  -65.384 1.00 39.32 ? 47  GLY B C    1 
ATOM   5723  O O    . GLY B 1 47  ? 37.510  9.971   -65.926 1.00 41.33 ? 47  GLY B O    1 
ATOM   5724  H H    . GLY B 1 47  ? 33.813  11.547  -65.489 1.00 43.07 ? 47  GLY B H    1 
ATOM   5725  H HA2  . GLY B 1 47  ? 35.600  11.566  -66.689 1.00 48.49 ? 47  GLY B HA2  1 
ATOM   5726  H HA3  . GLY B 1 47  ? 36.374  12.278  -65.525 1.00 48.49 ? 47  GLY B HA3  1 
ATOM   5727  N N    . LYS B 1 48  ? 35.854  9.445   -64.502 1.00 32.25 ? 48  LYS B N    1 
ATOM   5728  C CA   . LYS B 1 48  ? 36.483  8.190   -64.140 1.00 31.17 ? 48  LYS B CA   1 
ATOM   5729  C C    . LYS B 1 48  ? 35.479  7.048   -64.234 1.00 31.05 ? 48  LYS B C    1 
ATOM   5730  O O    . LYS B 1 48  ? 34.279  7.226   -64.034 1.00 32.09 ? 48  LYS B O    1 
ATOM   5731  C CB   . LYS B 1 48  ? 37.079  8.256   -62.746 1.00 35.32 ? 48  LYS B CB   1 
ATOM   5732  C CG   . LYS B 1 48  ? 38.337  7.435   -62.633 1.00 42.12 ? 48  LYS B CG   1 
ATOM   5733  C CD   . LYS B 1 48  ? 38.611  7.069   -61.196 1.00 42.59 ? 48  LYS B CD   1 
ATOM   5734  C CE   . LYS B 1 48  ? 40.075  7.044   -60.898 1.00 45.99 ? 48  LYS B CE   1 
ATOM   5735  N NZ   . LYS B 1 48  ? 40.469  5.772   -60.249 1.00 40.83 ? 48  LYS B NZ   1 
ATOM   5736  H H    . LYS B 1 48  ? 35.106  9.600   -64.106 1.00 38.68 ? 48  LYS B H    1 
ATOM   5737  H HA   . LYS B 1 48  ? 37.203  8.008   -64.764 1.00 37.38 ? 48  LYS B HA   1 
ATOM   5738  H HB2  . LYS B 1 48  ? 37.299  9.177   -62.536 1.00 42.36 ? 48  LYS B HB2  1 
ATOM   5739  H HB3  . LYS B 1 48  ? 36.435  7.911   -62.108 1.00 42.36 ? 48  LYS B HB3  1 
ATOM   5740  H HG2  . LYS B 1 48  ? 38.236  6.617   -63.144 1.00 50.52 ? 48  LYS B HG2  1 
ATOM   5741  H HG3  . LYS B 1 48  ? 39.089  7.950   -62.966 1.00 50.52 ? 48  LYS B HG3  1 
ATOM   5742  H HD2  . LYS B 1 48  ? 38.195  7.725   -60.614 1.00 51.08 ? 48  LYS B HD2  1 
ATOM   5743  H HD3  . LYS B 1 48  ? 38.250  6.186   -61.017 1.00 51.08 ? 48  LYS B HD3  1 
ATOM   5744  H HE2  . LYS B 1 48  ? 40.573  7.130   -61.727 1.00 55.16 ? 48  LYS B HE2  1 
ATOM   5745  H HE3  . LYS B 1 48  ? 40.293  7.774   -60.297 1.00 55.16 ? 48  LYS B HE3  1 
ATOM   5746  H HZ1  . LYS B 1 48  ? 41.342  5.774   -60.079 1.00 48.97 ? 48  LYS B HZ1  1 
ATOM   5747  H HZ2  . LYS B 1 48  ? 40.026  5.671   -59.483 1.00 48.97 ? 48  LYS B HZ2  1 
ATOM   5748  H HZ3  . LYS B 1 48  ? 40.280  5.086   -60.784 1.00 48.97 ? 48  LYS B HZ3  1 
ATOM   5749  N N    . LYS B 1 49  ? 35.998  5.880   -64.568 1.00 33.68 ? 49  LYS B N    1 
ATOM   5750  C CA   . LYS B 1 49  ? 35.179  4.691   -64.733 1.00 33.50 ? 49  LYS B CA   1 
ATOM   5751  C C    . LYS B 1 49  ? 34.718  4.169   -63.379 1.00 28.99 ? 49  LYS B C    1 
ATOM   5752  O O    . LYS B 1 49  ? 35.522  3.969   -62.458 1.00 26.21 ? 49  LYS B O    1 
ATOM   5753  C CB   . LYS B 1 49  ? 35.972  3.616   -65.470 1.00 36.67 ? 49  LYS B CB   1 
ATOM   5754  C CG   . LYS B 1 49  ? 35.870  3.668   -66.987 1.00 38.22 ? 49  LYS B CG   1 
ATOM   5755  C CD   . LYS B 1 49  ? 36.942  2.785   -67.610 1.00 40.57 ? 49  LYS B CD   1 
ATOM   5756  C CE   . LYS B 1 49  ? 36.815  2.731   -69.122 1.00 47.38 ? 49  LYS B CE   1 
ATOM   5757  N NZ   . LYS B 1 49  ? 36.769  4.094   -69.696 1.00 62.64 ? 49  LYS B NZ   1 
ATOM   5758  H H    . LYS B 1 49  ? 36.836  5.746   -64.706 1.00 40.40 ? 49  LYS B H    1 
ATOM   5759  H HA   . LYS B 1 49  ? 34.395  4.910   -65.260 1.00 40.18 ? 49  LYS B HA   1 
ATOM   5760  H HB2  . LYS B 1 49  ? 36.909  3.709   -65.237 1.00 43.99 ? 49  LYS B HB2  1 
ATOM   5761  H HB3  . LYS B 1 49  ? 35.651  2.746   -65.185 1.00 43.99 ? 49  LYS B HB3  1 
ATOM   5762  H HG2  . LYS B 1 49  ? 35.000  3.341   -67.266 1.00 45.84 ? 49  LYS B HG2  1 
ATOM   5763  H HG3  . LYS B 1 49  ? 36.005  4.579   -67.291 1.00 45.84 ? 49  LYS B HG3  1 
ATOM   5764  H HD2  . LYS B 1 49  ? 37.817  3.142   -67.392 1.00 48.66 ? 49  LYS B HD2  1 
ATOM   5765  H HD3  . LYS B 1 49  ? 36.853  1.882   -67.265 1.00 48.66 ? 49  LYS B HD3  1 
ATOM   5766  H HE2  . LYS B 1 49  ? 37.582  2.268   -69.494 1.00 56.84 ? 49  LYS B HE2  1 
ATOM   5767  H HE3  . LYS B 1 49  ? 35.995  2.271   -69.360 1.00 56.84 ? 49  LYS B HE3  1 
ATOM   5768  H HZ1  . LYS B 1 49  ? 36.694  4.049   -70.581 1.00 75.15 ? 49  LYS B HZ1  1 
ATOM   5769  H HZ2  . LYS B 1 49  ? 36.070  4.538   -69.369 1.00 75.15 ? 49  LYS B HZ2  1 
ATOM   5770  H HZ3  . LYS B 1 49  ? 37.514  4.536   -69.490 1.00 75.15 ? 49  LYS B HZ3  1 
ATOM   5771  N N    . LEU B 1 50  ? 33.416  3.913   -63.272 1.00 30.85 ? 50  LEU B N    1 
ATOM   5772  C CA   . LEU B 1 50  ? 32.864  3.379   -62.035 1.00 25.32 ? 50  LEU B CA   1 
ATOM   5773  C C    . LEU B 1 50  ? 33.599  2.112   -61.606 1.00 22.05 ? 50  LEU B C    1 
ATOM   5774  O O    . LEU B 1 50  ? 33.934  1.956   -60.428 1.00 25.51 ? 50  LEU B O    1 
ATOM   5775  C CB   . LEU B 1 50  ? 31.370  3.125   -62.221 1.00 23.40 ? 50  LEU B CB   1 
ATOM   5776  C CG   . LEU B 1 50  ? 30.555  2.638   -61.025 1.00 25.23 ? 50  LEU B CG   1 
ATOM   5777  C CD1  . LEU B 1 50  ? 30.722  3.534   -59.815 1.00 22.45 ? 50  LEU B CD1  1 
ATOM   5778  C CD2  . LEU B 1 50  ? 29.071  2.529   -61.429 1.00 23.23 ? 50  LEU B CD2  1 
ATOM   5779  H H    . LEU B 1 50  ? 32.837  4.038   -63.896 1.00 37.00 ? 50  LEU B H    1 
ATOM   5780  H HA   . LEU B 1 50  ? 32.970  4.039   -61.332 1.00 30.36 ? 50  LEU B HA   1 
ATOM   5781  H HB2  . LEU B 1 50  ? 30.964  3.955   -62.517 1.00 28.06 ? 50  LEU B HB2  1 
ATOM   5782  H HB3  . LEU B 1 50  ? 31.269  2.459   -62.919 1.00 28.06 ? 50  LEU B HB3  1 
ATOM   5783  H HG   . LEU B 1 50  ? 30.860  1.750   -60.780 1.00 30.25 ? 50  LEU B HG   1 
ATOM   5784  H HD11 . LEU B 1 50  ? 30.186  3.183   -59.087 1.00 26.92 ? 50  LEU B HD11 1 
ATOM   5785  H HD12 . LEU B 1 50  ? 31.658  3.549   -59.561 1.00 26.92 ? 50  LEU B HD12 1 
ATOM   5786  H HD13 . LEU B 1 50  ? 30.425  4.429   -60.043 1.00 26.92 ? 50  LEU B HD13 1 
ATOM   5787  H HD21 . LEU B 1 50  ? 28.558  2.219   -60.666 1.00 27.86 ? 50  LEU B HD21 1 
ATOM   5788  H HD22 . LEU B 1 50  ? 28.755  3.403   -61.708 1.00 27.86 ? 50  LEU B HD22 1 
ATOM   5789  H HD23 . LEU B 1 50  ? 28.989  1.898   -62.162 1.00 27.86 ? 50  LEU B HD23 1 
ATOM   5790  N N    . THR B 1 51  ? 33.889  1.205   -62.550 1.00 24.12 ? 51  THR B N    1 
ATOM   5791  C CA   . THR B 1 51  ? 34.582  -0.030  -62.184 1.00 24.99 ? 51  THR B CA   1 
ATOM   5792  C C    . THR B 1 51  ? 35.957  0.266   -61.599 1.00 23.04 ? 51  THR B C    1 
ATOM   5793  O O    . THR B 1 51  ? 36.397  -0.412  -60.664 1.00 21.43 ? 51  THR B O    1 
ATOM   5794  C CB   . THR B 1 51  ? 34.714  -0.982  -63.387 1.00 25.57 ? 51  THR B CB   1 
ATOM   5795  O OG1  . THR B 1 51  ? 35.567  -0.410  -64.393 1.00 28.84 ? 51  THR B OG1  1 
ATOM   5796  C CG2  . THR B 1 51  ? 33.354  -1.315  -63.985 1.00 21.03 ? 51  THR B CG2  1 
ATOM   5797  H H    . THR B 1 51  ? 33.700  1.281   -63.385 1.00 28.92 ? 51  THR B H    1 
ATOM   5798  H HA   . THR B 1 51  ? 34.064  -0.486  -61.503 1.00 29.97 ? 51  THR B HA   1 
ATOM   5799  H HB   . THR B 1 51  ? 35.110  -1.812  -63.081 1.00 30.66 ? 51  THR B HB   1 
ATOM   5800  H HG1  . THR B 1 51  ? 35.246  0.318   -64.661 1.00 34.59 ? 51  THR B HG1  1 
ATOM   5801  H HG21 . THR B 1 51  ? 33.462  -1.914  -64.740 1.00 25.22 ? 51  THR B HG21 1 
ATOM   5802  H HG22 . THR B 1 51  ? 32.795  -1.744  -63.318 1.00 25.22 ? 51  THR B HG22 1 
ATOM   5803  H HG23 . THR B 1 51  ? 32.918  -0.503  -64.287 1.00 25.22 ? 51  THR B HG23 1 
ATOM   5804  N N    . GLU B 1 52  ? 36.649  1.281   -62.127 1.00 26.72 ? 52  GLU B N    1 
ATOM   5805  C CA   . GLU B 1 52  ? 37.963  1.647   -61.592 1.00 27.20 ? 52  GLU B CA   1 
ATOM   5806  C C    . GLU B 1 52  ? 37.843  2.290   -60.216 1.00 23.20 ? 52  GLU B C    1 
ATOM   5807  O O    . GLU B 1 52  ? 38.678  2.060   -59.335 1.00 22.16 ? 52  GLU B O    1 
ATOM   5808  C CB   . GLU B 1 52  ? 38.683  2.587   -62.564 1.00 34.65 ? 52  GLU B CB   1 
ATOM   5809  C CG   . GLU B 1 52  ? 39.369  1.845   -63.706 1.00 39.05 ? 52  GLU B CG   1 
ATOM   5810  C CD   . GLU B 1 52  ? 39.964  2.768   -64.771 1.00 51.74 ? 52  GLU B CD   1 
ATOM   5811  O OE1  . GLU B 1 52  ? 40.147  3.976   -64.505 1.00 42.52 ? 52  GLU B OE1  1 
ATOM   5812  O OE2  . GLU B 1 52  ? 40.244  2.267   -65.885 1.00 52.99 ? 52  GLU B OE2  1 
ATOM   5813  H H    . GLU B 1 52  ? 36.383  1.767   -62.785 1.00 32.04 ? 52  GLU B H    1 
ATOM   5814  H HA   . GLU B 1 52  ? 38.500  0.844   -61.501 1.00 32.62 ? 52  GLU B HA   1 
ATOM   5815  H HB2  . GLU B 1 52  ? 38.035  3.198   -62.950 1.00 41.56 ? 52  GLU B HB2  1 
ATOM   5816  H HB3  . GLU B 1 52  ? 39.360  3.084   -62.080 1.00 41.56 ? 52  GLU B HB3  1 
ATOM   5817  H HG2  . GLU B 1 52  ? 40.091  1.309   -63.341 1.00 46.83 ? 52  GLU B HG2  1 
ATOM   5818  H HG3  . GLU B 1 52  ? 38.720  1.270   -64.141 1.00 46.83 ? 52  GLU B HG3  1 
ATOM   5819  N N    . ILE B 1 53  ? 36.805  3.082   -60.009 1.00 26.41 ? 53  ILE B N    1 
ATOM   5820  C CA   . ILE B 1 53  ? 36.536  3.607   -58.672 1.00 28.09 ? 53  ILE B CA   1 
ATOM   5821  C C    . ILE B 1 53  ? 36.301  2.469   -57.685 1.00 22.04 ? 53  ILE B C    1 
ATOM   5822  O O    . ILE B 1 53  ? 36.869  2.445   -56.595 1.00 23.71 ? 53  ILE B O    1 
ATOM   5823  C CB   . ILE B 1 53  ? 35.345  4.572   -58.719 1.00 26.45 ? 53  ILE B CB   1 
ATOM   5824  C CG1  . ILE B 1 53  ? 35.699  5.769   -59.612 1.00 28.50 ? 53  ILE B CG1  1 
ATOM   5825  C CG2  . ILE B 1 53  ? 34.949  4.986   -57.296 1.00 24.83 ? 53  ILE B CG2  1 
ATOM   5826  C CD1  . ILE B 1 53  ? 34.571  6.743   -59.815 1.00 27.29 ? 53  ILE B CD1  1 
ATOM   5827  H H    . ILE B 1 53  ? 36.245  3.331   -60.612 1.00 31.67 ? 53  ILE B H    1 
ATOM   5828  H HA   . ILE B 1 53  ? 37.311  4.106   -58.370 1.00 33.69 ? 53  ILE B HA   1 
ATOM   5829  H HB   . ILE B 1 53  ? 34.594  4.108   -59.119 1.00 31.72 ? 53  ILE B HB   1 
ATOM   5830  H HG12 . ILE B 1 53  ? 36.437  6.251   -59.207 1.00 34.17 ? 53  ILE B HG12 1 
ATOM   5831  H HG13 . ILE B 1 53  ? 35.964  5.438   -60.484 1.00 34.17 ? 53  ILE B HG13 1 
ATOM   5832  H HG21 . ILE B 1 53  ? 34.196  5.595   -57.343 1.00 29.78 ? 53  ILE B HG21 1 
ATOM   5833  H HG22 . ILE B 1 53  ? 34.703  4.193   -56.794 1.00 29.78 ? 53  ILE B HG22 1 
ATOM   5834  H HG23 . ILE B 1 53  ? 35.704  5.424   -56.873 1.00 29.78 ? 53  ILE B HG23 1 
ATOM   5835  H HD11 . ILE B 1 53  ? 34.877  7.464   -60.387 1.00 32.73 ? 53  ILE B HD11 1 
ATOM   5836  H HD12 . ILE B 1 53  ? 33.827  6.282   -60.232 1.00 32.73 ? 53  ILE B HD12 1 
ATOM   5837  H HD13 . ILE B 1 53  ? 34.301  7.096   -58.953 1.00 32.73 ? 53  ILE B HD13 1 
ATOM   5838  N N    . ILE B 1 54  ? 35.473  1.495   -58.058 1.00 24.04 ? 54  ILE B N    1 
ATOM   5839  C CA   . ILE B 1 54  ? 35.217  0.370   -57.159 1.00 22.44 ? 54  ILE B CA   1 
ATOM   5840  C C    . ILE B 1 54  ? 36.498  -0.399  -56.871 1.00 21.89 ? 54  ILE B C    1 
ATOM   5841  O O    . ILE B 1 54  ? 36.757  -0.806  -55.723 1.00 19.24 ? 54  ILE B O    1 
ATOM   5842  C CB   . ILE B 1 54  ? 34.115  -0.527  -57.755 1.00 18.80 ? 54  ILE B CB   1 
ATOM   5843  C CG1  . ILE B 1 54  ? 32.820  0.243   -57.737 1.00 20.50 ? 54  ILE B CG1  1 
ATOM   5844  C CG2  . ILE B 1 54  ? 33.991  -1.817  -56.972 1.00 24.27 ? 54  ILE B CG2  1 
ATOM   5845  C CD1  . ILE B 1 54  ? 31.689  -0.423  -58.491 1.00 24.97 ? 54  ILE B CD1  1 
ATOM   5846  H H    . ILE B 1 54  ? 35.055  1.461   -58.808 1.00 28.83 ? 54  ILE B H    1 
ATOM   5847  H HA   . ILE B 1 54  ? 34.888  0.716   -56.315 1.00 26.91 ? 54  ILE B HA   1 
ATOM   5848  H HB   . ILE B 1 54  ? 34.343  -0.737  -58.674 1.00 22.54 ? 54  ILE B HB   1 
ATOM   5849  H HG12 . ILE B 1 54  ? 32.536  0.352   -56.815 1.00 24.58 ? 54  ILE B HG12 1 
ATOM   5850  H HG13 . ILE B 1 54  ? 32.970  1.113   -58.138 1.00 24.58 ? 54  ILE B HG13 1 
ATOM   5851  H HG21 . ILE B 1 54  ? 33.291  -2.360  -57.368 1.00 29.10 ? 54  ILE B HG21 1 
ATOM   5852  H HG22 . ILE B 1 54  ? 34.837  -2.290  -57.007 1.00 29.10 ? 54  ILE B HG22 1 
ATOM   5853  H HG23 . ILE B 1 54  ? 33.766  -1.607  -56.052 1.00 29.10 ? 54  ILE B HG23 1 
ATOM   5854  H HD11 . ILE B 1 54  ? 30.897  0.134   -58.430 1.00 29.94 ? 54  ILE B HD11 1 
ATOM   5855  H HD12 . ILE B 1 54  ? 31.949  -0.529  -59.420 1.00 29.94 ? 54  ILE B HD12 1 
ATOM   5856  H HD13 . ILE B 1 54  ? 31.514  -1.292  -58.095 1.00 29.94 ? 54  ILE B HD13 1 
ATOM   5857  N N    . ASN B 1 55  ? 37.355  -0.574  -57.883 1.00 20.16 ? 55  ASN B N    1 
ATOM   5858  C CA   . ASN B 1 55  ? 38.513  -1.433  -57.662 1.00 21.04 ? 55  ASN B CA   1 
ATOM   5859  C C    . ASN B 1 55  ? 39.670  -0.691  -57.009 1.00 27.20 ? 55  ASN B C    1 
ATOM   5860  O O    . ASN B 1 55  ? 40.715  -1.300  -56.782 1.00 27.74 ? 55  ASN B O    1 
ATOM   5861  C CB   . ASN B 1 55  ? 38.954  -2.077  -58.980 1.00 21.94 ? 55  ASN B CB   1 
ATOM   5862  C CG   . ASN B 1 55  ? 37.936  -3.093  -59.480 1.00 23.63 ? 55  ASN B CG   1 
ATOM   5863  O OD1  . ASN B 1 55  ? 37.236  -3.710  -58.671 1.00 22.55 ? 55  ASN B OD1  1 
ATOM   5864  N ND2  . ASN B 1 55  ? 37.825  -3.254  -60.796 1.00 25.33 ? 55  ASN B ND2  1 
ATOM   5865  H H    . ASN B 1 55  ? 37.292  -0.225  -58.667 1.00 24.17 ? 55  ASN B H    1 
ATOM   5866  H HA   . ASN B 1 55  ? 38.253  -2.149  -57.062 1.00 25.23 ? 55  ASN B HA   1 
ATOM   5867  H HB2  . ASN B 1 55  ? 39.051  -1.387  -59.655 1.00 26.30 ? 55  ASN B HB2  1 
ATOM   5868  H HB3  . ASN B 1 55  ? 39.799  -2.534  -58.845 1.00 26.30 ? 55  ASN B HB3  1 
ATOM   5869  H HD21 . ASN B 1 55  ? 37.259  -3.818  -61.114 1.00 30.37 ? 55  ASN B HD21 1 
ATOM   5870  H HD22 . ASN B 1 55  ? 38.327  -2.803  -61.329 1.00 30.37 ? 55  ASN B HD22 1 
ATOM   5871  N N    . THR B 1 56  ? 39.499  0.590   -56.695 1.00 24.90 ? 56  THR B N    1 
ATOM   5872  C CA   . THR B 1 56  ? 40.521  1.377   -56.005 1.00 26.23 ? 56  THR B CA   1 
ATOM   5873  C C    . THR B 1 56  ? 40.028  1.913   -54.674 1.00 27.00 ? 56  THR B C    1 
ATOM   5874  O O    . THR B 1 56  ? 40.730  1.768   -53.662 1.00 29.87 ? 56  THR B O    1 
ATOM   5875  C CB   . THR B 1 56  ? 41.002  2.533   -56.906 1.00 27.72 ? 56  THR B CB   1 
ATOM   5876  O OG1  . THR B 1 56  ? 39.895  3.320   -57.341 1.00 35.01 ? 56  THR B OG1  1 
ATOM   5877  C CG2  . THR B 1 56  ? 41.673  1.994   -58.104 1.00 30.19 ? 56  THR B CG2  1 
ATOM   5878  H H    . THR B 1 56  ? 38.785  1.035   -56.873 1.00 29.85 ? 56  THR B H    1 
ATOM   5879  H HA   . THR B 1 56  ? 41.285  0.805   -55.827 1.00 31.46 ? 56  THR B HA   1 
ATOM   5880  H HB   . THR B 1 56  ? 41.631  3.090   -56.419 1.00 33.24 ? 56  THR B HB   1 
ATOM   5881  H HG1  . THR B 1 56  ? 39.359  2.844   -57.778 1.00 41.99 ? 56  THR B HG1  1 
ATOM   5882  H HG21 . THR B 1 56  ? 41.976  2.721   -58.670 1.00 36.20 ? 56  THR B HG21 1 
ATOM   5883  H HG22 . THR B 1 56  ? 42.439  1.458   -57.842 1.00 36.20 ? 56  THR B HG22 1 
ATOM   5884  H HG23 . THR B 1 56  ? 41.057  1.438   -58.607 1.00 36.20 ? 56  THR B HG23 1 
ATOM   5885  N N    . GLN B 1 57  ? 38.818  2.490   -54.646 1.00 21.19 ? 57  GLN B N    1 
ATOM   5886  C CA   . GLN B 1 57  ? 38.148  2.985   -53.442 1.00 24.02 ? 57  GLN B CA   1 
ATOM   5887  C C    . GLN B 1 57  ? 37.296  1.941   -52.734 1.00 23.17 ? 57  GLN B C    1 
ATOM   5888  O O    . GLN B 1 57  ? 36.862  2.190   -51.606 1.00 22.42 ? 57  GLN B O    1 
ATOM   5889  C CB   . GLN B 1 57  ? 37.154  4.119   -53.756 1.00 25.99 ? 57  GLN B CB   1 
ATOM   5890  C CG   . GLN B 1 57  ? 37.649  5.459   -54.173 1.00 36.23 ? 57  GLN B CG   1 
ATOM   5891  C CD   . GLN B 1 57  ? 36.527  6.502   -54.072 1.00 38.44 ? 57  GLN B CD   1 
ATOM   5892  O OE1  . GLN B 1 57  ? 35.768  6.536   -53.078 1.00 40.51 ? 57  GLN B OE1  1 
ATOM   5893  N NE2  . GLN B 1 57  ? 36.390  7.327   -55.101 1.00 44.20 ? 57  GLN B NE2  1 
ATOM   5894  H H    . GLN B 1 57  ? 38.346  2.610   -55.355 1.00 25.40 ? 57  GLN B H    1 
ATOM   5895  H HA   . GLN B 1 57  ? 38.810  3.319   -52.817 1.00 28.81 ? 57  GLN B HA   1 
ATOM   5896  H HB2  . GLN B 1 57  ? 36.576  3.807   -54.470 1.00 31.16 ? 57  GLN B HB2  1 
ATOM   5897  H HB3  . GLN B 1 57  ? 36.617  4.261   -52.961 1.00 31.16 ? 57  GLN B HB3  1 
ATOM   5898  H HG2  . GLN B 1 57  ? 38.375  5.731   -53.590 1.00 43.46 ? 57  GLN B HG2  1 
ATOM   5899  H HG3  . GLN B 1 57  ? 37.951  5.420   -55.094 1.00 43.46 ? 57  GLN B HG3  1 
ATOM   5900  H HE21 . GLN B 1 57  ? 36.927  7.271   -55.771 1.00 53.02 ? 57  GLN B HE21 1 
ATOM   5901  H HE22 . GLN B 1 57  ? 35.774  7.927   -55.092 1.00 53.02 ? 57  GLN B HE22 1 
ATOM   5902  N N    . HIS B 1 58  ? 36.946  0.844   -53.402 1.00 21.42 ? 58  HIS B N    1 
ATOM   5903  C CA   . HIS B 1 58  ? 36.087  -0.195  -52.831 1.00 24.11 ? 58  HIS B CA   1 
ATOM   5904  C C    . HIS B 1 58  ? 34.772  0.392   -52.321 1.00 19.57 ? 58  HIS B C    1 
ATOM   5905  O O    . HIS B 1 58  ? 34.253  0.031   -51.267 1.00 20.04 ? 58  HIS B O    1 
ATOM   5906  C CB   . HIS B 1 58  ? 36.863  -0.970  -51.773 1.00 23.92 ? 58  HIS B CB   1 
ATOM   5907  C CG   . HIS B 1 58  ? 38.120  -1.551  -52.344 1.00 22.29 ? 58  HIS B CG   1 
ATOM   5908  N ND1  . HIS B 1 58  ? 38.098  -2.554  -53.287 1.00 22.06 ? 58  HIS B ND1  1 
ATOM   5909  C CD2  . HIS B 1 58  ? 39.411  -1.150  -52.251 1.00 23.54 ? 58  HIS B CD2  1 
ATOM   5910  C CE1  . HIS B 1 58  ? 39.331  -2.798  -53.698 1.00 25.49 ? 58  HIS B CE1  1 
ATOM   5911  N NE2  . HIS B 1 58  ? 40.147  -1.954  -53.088 1.00 21.95 ? 58  HIS B NE2  1 
ATOM   5912  H H    . HIS B 1 58  ? 37.200  0.674   -54.206 1.00 25.69 ? 58  HIS B H    1 
ATOM   5913  H HA   . HIS B 1 58  ? 35.863  -0.822  -53.537 1.00 28.91 ? 58  HIS B HA   1 
ATOM   5914  H HB2  . HIS B 1 58  ? 37.105  -0.372  -51.049 1.00 28.68 ? 58  HIS B HB2  1 
ATOM   5915  H HB3  . HIS B 1 58  ? 36.315  -1.698  -51.441 1.00 28.68 ? 58  HIS B HB3  1 
ATOM   5916  H HD1  . HIS B 1 58  ? 37.395  -2.971  -53.553 1.00 26.45 ? 58  HIS B HD1  1 
ATOM   5917  H HD2  . HIS B 1 58  ? 39.741  -0.473  -51.706 1.00 28.23 ? 58  HIS B HD2  1 
ATOM   5918  H HE1  . HIS B 1 58  ? 39.582  -3.456  -54.305 1.00 30.57 ? 58  HIS B HE1  1 
ATOM   5919  N N    . GLU B 1 59  ? 34.194  1.252   -53.150 1.00 18.13 ? 59  GLU B N    1 
ATOM   5920  C CA   . GLU B 1 59  ? 32.921  1.902   -52.866 1.00 21.90 ? 59  GLU B CA   1 
ATOM   5921  C C    . GLU B 1 59  ? 32.180  2.143   -54.182 1.00 17.92 ? 59  GLU B C    1 
ATOM   5922  O O    . GLU B 1 59  ? 32.722  2.777   -55.097 1.00 19.03 ? 59  GLU B O    1 
ATOM   5923  C CB   . GLU B 1 59  ? 33.181  3.222   -52.111 1.00 24.50 ? 59  GLU B CB   1 
ATOM   5924  C CG   . GLU B 1 59  ? 31.960  4.064   -51.844 1.00 21.01 ? 59  GLU B CG   1 
ATOM   5925  C CD   . GLU B 1 59  ? 32.298  5.318   -51.059 1.00 26.89 ? 59  GLU B CD   1 
ATOM   5926  O OE1  . GLU B 1 59  ? 33.419  5.390   -50.513 1.00 28.32 ? 59  GLU B OE1  1 
ATOM   5927  O OE2  . GLU B 1 59  ? 31.449  6.223   -51.004 1.00 21.60 ? 59  GLU B OE2  1 
ATOM   5928  H H    . GLU B 1 59  ? 34.531  1.482   -53.907 1.00 21.74 ? 59  GLU B H    1 
ATOM   5929  H HA   . GLU B 1 59  ? 32.378  1.326   -52.305 1.00 26.26 ? 59  GLU B HA   1 
ATOM   5930  H HB2  . GLU B 1 59  ? 33.583  3.011   -51.254 1.00 29.38 ? 59  GLU B HB2  1 
ATOM   5931  H HB3  . GLU B 1 59  ? 33.797  3.758   -52.634 1.00 29.38 ? 59  GLU B HB3  1 
ATOM   5932  H HG2  . GLU B 1 59  ? 31.567  4.333   -52.690 1.00 25.19 ? 59  GLU B HG2  1 
ATOM   5933  H HG3  . GLU B 1 59  ? 31.322  3.547   -51.329 1.00 25.19 ? 59  GLU B HG3  1 
ATOM   5934  N N    . ASN B 1 60  ? 30.943  1.639   -54.295 1.00 19.67 ? 60  ASN B N    1 
ATOM   5935  C CA   . ASN B 1 60  ? 30.085  1.991   -55.430 1.00 19.84 ? 60  ASN B CA   1 
ATOM   5936  C C    . ASN B 1 60  ? 29.548  3.377   -55.128 1.00 22.40 ? 60  ASN B C    1 
ATOM   5937  O O    . ASN B 1 60  ? 28.531  3.550   -54.446 1.00 18.42 ? 60  ASN B O    1 
ATOM   5938  C CB   . ASN B 1 60  ? 28.949  0.991   -55.641 1.00 19.01 ? 60  ASN B CB   1 
ATOM   5939  C CG   . ASN B 1 60  ? 28.203  1.220   -56.954 1.00 20.09 ? 60  ASN B CG   1 
ATOM   5940  O OD1  . ASN B 1 60  ? 28.000  2.363   -57.398 1.00 21.22 ? 60  ASN B OD1  1 
ATOM   5941  N ND2  . ASN B 1 60  ? 27.779  0.123   -57.575 1.00 21.65 ? 60  ASN B ND2  1 
ATOM   5942  H H    . ASN B 1 60  ? 30.582  1.097   -53.733 1.00 23.59 ? 60  ASN B H    1 
ATOM   5943  H HA   . ASN B 1 60  ? 30.617  2.033   -56.240 1.00 23.79 ? 60  ASN B HA   1 
ATOM   5944  H HB2  . ASN B 1 60  ? 29.317  0.093   -55.656 1.00 22.79 ? 60  ASN B HB2  1 
ATOM   5945  H HB3  . ASN B 1 60  ? 28.313  1.077   -54.914 1.00 22.79 ? 60  ASN B HB3  1 
ATOM   5946  H HD21 . ASN B 1 60  ? 27.352  0.188   -58.319 1.00 25.96 ? 60  ASN B HD21 1 
ATOM   5947  H HD22 . ASN B 1 60  ? 27.937  -0.651  -57.236 1.00 25.96 ? 60  ASN B HD22 1 
ATOM   5948  N N    . VAL B 1 61  ? 30.270  4.383   -55.629 1.00 23.69 ? 61  VAL B N    1 
ATOM   5949  C CA   . VAL B 1 61  ? 29.990  5.772   -55.281 1.00 19.53 ? 61  VAL B CA   1 
ATOM   5950  C C    . VAL B 1 61  ? 28.685  6.259   -55.881 1.00 23.56 ? 61  VAL B C    1 
ATOM   5951  O O    . VAL B 1 61  ? 28.129  7.270   -55.412 1.00 20.28 ? 61  VAL B O    1 
ATOM   5952  C CB   . VAL B 1 61  ? 31.144  6.690   -55.718 1.00 18.50 ? 61  VAL B CB   1 
ATOM   5953  C CG1  . VAL B 1 61  ? 32.399  6.339   -54.968 1.00 21.51 ? 61  VAL B CG1  1 
ATOM   5954  C CG2  . VAL B 1 61  ? 31.358  6.602   -57.212 1.00 19.49 ? 61  VAL B CG2  1 
ATOM   5955  H H    . VAL B 1 61  ? 30.929  4.283   -56.172 1.00 28.40 ? 61  VAL B H    1 
ATOM   5956  H HA   . VAL B 1 61  ? 29.911  5.838   -54.316 1.00 23.41 ? 61  VAL B HA   1 
ATOM   5957  H HB   . VAL B 1 61  ? 30.915  7.608   -55.503 1.00 22.18 ? 61  VAL B HB   1 
ATOM   5958  H HG11 . VAL B 1 61  ? 33.114  6.928   -55.256 1.00 25.79 ? 61  VAL B HG11 1 
ATOM   5959  H HG12 . VAL B 1 61  ? 32.240  6.453   -54.017 1.00 25.79 ? 61  VAL B HG12 1 
ATOM   5960  H HG13 . VAL B 1 61  ? 32.632  5.417   -55.157 1.00 25.79 ? 61  VAL B HG13 1 
ATOM   5961  H HG21 . VAL B 1 61  ? 32.089  7.188   -57.462 1.00 23.36 ? 61  VAL B HG21 1 
ATOM   5962  H HG22 . VAL B 1 61  ? 31.574  5.685   -57.446 1.00 23.36 ? 61  VAL B HG22 1 
ATOM   5963  H HG23 . VAL B 1 61  ? 30.544  6.876   -57.664 1.00 23.36 ? 61  VAL B HG23 1 
ATOM   5964  N N    . LYS B 1 62  ? 28.158  5.571   -56.893 1.00 23.45 ? 62  LYS B N    1 
ATOM   5965  C CA   . LYS B 1 62  ? 26.872  5.994   -57.428 1.00 23.95 ? 62  LYS B CA   1 
ATOM   5966  C C    . LYS B 1 62  ? 25.677  5.316   -56.759 1.00 22.45 ? 62  LYS B C    1 
ATOM   5967  O O    . LYS B 1 62  ? 24.672  5.983   -56.486 1.00 24.16 ? 62  LYS B O    1 
ATOM   5968  C CB   . LYS B 1 62  ? 26.793  5.751   -58.937 1.00 22.87 ? 62  LYS B CB   1 
ATOM   5969  C CG   . LYS B 1 62  ? 25.450  6.234   -59.485 1.00 24.83 ? 62  LYS B CG   1 
ATOM   5970  C CD   . LYS B 1 62  ? 25.448  6.397   -60.992 1.00 28.69 ? 62  LYS B CD   1 
ATOM   5971  C CE   . LYS B 1 62  ? 24.031  6.619   -61.504 1.00 26.96 ? 62  LYS B CE   1 
ATOM   5972  N NZ   . LYS B 1 62  ? 24.085  6.999   -62.942 1.00 31.37 ? 62  LYS B NZ   1 
ATOM   5973  H H    . LYS B 1 62  ? 28.510  4.884   -57.272 1.00 28.12 ? 62  LYS B H    1 
ATOM   5974  H HA   . LYS B 1 62  ? 26.781  6.949   -57.284 1.00 28.72 ? 62  LYS B HA   1 
ATOM   5975  H HB2  . LYS B 1 62  ? 27.501  6.242   -59.382 1.00 27.42 ? 62  LYS B HB2  1 
ATOM   5976  H HB3  . LYS B 1 62  ? 26.874  4.801   -59.116 1.00 27.42 ? 62  LYS B HB3  1 
ATOM   5977  H HG2  . LYS B 1 62  ? 24.765  5.588   -59.253 1.00 29.77 ? 62  LYS B HG2  1 
ATOM   5978  H HG3  . LYS B 1 62  ? 25.240  7.095   -59.090 1.00 29.77 ? 62  LYS B HG3  1 
ATOM   5979  H HD2  . LYS B 1 62  ? 25.986  7.167   -61.234 1.00 34.41 ? 62  LYS B HD2  1 
ATOM   5980  H HD3  . LYS B 1 62  ? 25.802  5.594   -61.404 1.00 34.41 ? 62  LYS B HD3  1 
ATOM   5981  H HE2  . LYS B 1 62  ? 23.520  5.800   -61.418 1.00 32.33 ? 62  LYS B HE2  1 
ATOM   5982  H HE3  . LYS B 1 62  ? 23.612  7.340   -61.008 1.00 32.33 ? 62  LYS B HE3  1 
ATOM   5983  H HZ1  . LYS B 1 62  ? 23.261  7.132   -63.253 1.00 37.63 ? 62  LYS B HZ1  1 
ATOM   5984  H HZ2  . LYS B 1 62  ? 24.555  7.748   -63.041 1.00 37.63 ? 62  LYS B HZ2  1 
ATOM   5985  H HZ3  . LYS B 1 62  ? 24.471  6.351   -63.414 1.00 37.63 ? 62  LYS B HZ3  1 
ATOM   5986  N N    . TYR B 1 63  ? 25.736  4.010   -56.493 1.00 19.78 ? 63  TYR B N    1 
ATOM   5987  C CA   . TYR B 1 63  ? 24.537  3.294   -56.061 1.00 18.16 ? 63  TYR B CA   1 
ATOM   5988  C C    . TYR B 1 63  ? 24.554  2.878   -54.596 1.00 25.66 ? 63  TYR B C    1 
ATOM   5989  O O    . TYR B 1 63  ? 23.495  2.520   -54.064 1.00 19.60 ? 63  TYR B O    1 
ATOM   5990  C CB   . TYR B 1 63  ? 24.308  2.055   -56.943 1.00 19.17 ? 63  TYR B CB   1 
ATOM   5991  C CG   . TYR B 1 63  ? 24.096  2.428   -58.386 1.00 18.00 ? 63  TYR B CG   1 
ATOM   5992  C CD1  . TYR B 1 63  ? 22.841  2.821   -58.835 1.00 27.22 ? 63  TYR B CD1  1 
ATOM   5993  C CD2  . TYR B 1 63  ? 25.142  2.415   -59.294 1.00 23.22 ? 63  TYR B CD2  1 
ATOM   5994  C CE1  . TYR B 1 63  ? 22.633  3.176   -60.153 1.00 29.74 ? 63  TYR B CE1  1 
ATOM   5995  C CE2  . TYR B 1 63  ? 24.941  2.782   -60.635 1.00 22.60 ? 63  TYR B CE2  1 
ATOM   5996  C CZ   . TYR B 1 63  ? 23.682  3.156   -61.048 1.00 28.73 ? 63  TYR B CZ   1 
ATOM   5997  O OH   . TYR B 1 63  ? 23.475  3.526   -62.360 1.00 29.15 ? 63  TYR B OH   1 
ATOM   5998  H H    . TYR B 1 63  ? 26.443  3.525   -56.554 1.00 23.72 ? 63  TYR B H    1 
ATOM   5999  H HA   . TYR B 1 63  ? 23.774  3.881   -56.184 1.00 21.77 ? 63  TYR B HA   1 
ATOM   6000  H HB2  . TYR B 1 63  ? 25.086  1.478   -56.891 1.00 22.98 ? 63  TYR B HB2  1 
ATOM   6001  H HB3  . TYR B 1 63  ? 23.520  1.583   -56.633 1.00 22.98 ? 63  TYR B HB3  1 
ATOM   6002  H HD1  . TYR B 1 63  ? 22.127  2.838   -58.240 1.00 32.64 ? 63  TYR B HD1  1 
ATOM   6003  H HD2  . TYR B 1 63  ? 25.991  2.162   -59.011 1.00 27.85 ? 63  TYR B HD2  1 
ATOM   6004  H HE1  . TYR B 1 63  ? 21.786  3.436   -60.436 1.00 35.66 ? 63  TYR B HE1  1 
ATOM   6005  H HE2  . TYR B 1 63  ? 25.649  2.767   -61.238 1.00 27.10 ? 63  TYR B HE2  1 
ATOM   6006  H HH   . TYR B 1 63  ? 24.193  3.467   -62.792 1.00 34.96 ? 63  TYR B HH   1 
ATOM   6007  N N    . LEU B 1 64  ? 25.713  2.875   -53.944 1.00 18.71 ? 64  LEU B N    1 
ATOM   6008  C CA   . LEU B 1 64  ? 25.796  2.586   -52.509 1.00 17.28 ? 64  LEU B CA   1 
ATOM   6009  C C    . LEU B 1 64  ? 26.890  3.465   -51.896 1.00 16.71 ? 64  LEU B C    1 
ATOM   6010  O O    . LEU B 1 64  ? 27.899  2.975   -51.371 1.00 14.62 ? 64  LEU B O    1 
ATOM   6011  C CB   . LEU B 1 64  ? 26.059  1.099   -52.244 1.00 16.94 ? 64  LEU B CB   1 
ATOM   6012  C CG   . LEU B 1 64  ? 25.746  0.647   -50.809 1.00 15.91 ? 64  LEU B CG   1 
ATOM   6013  C CD1  . LEU B 1 64  ? 24.278  0.748   -50.509 1.00 22.94 ? 64  LEU B CD1  1 
ATOM   6014  C CD2  . LEU B 1 64  ? 26.207  -0.772  -50.568 1.00 21.72 ? 64  LEU B CD2  1 
ATOM   6015  H H    . LEU B 1 64  ? 26.473  3.039   -54.310 1.00 22.44 ? 64  LEU B H    1 
ATOM   6016  H HA   . LEU B 1 64  ? 24.953  2.820   -52.089 1.00 20.72 ? 64  LEU B HA   1 
ATOM   6017  H HB2  . LEU B 1 64  ? 25.508  0.574   -52.845 1.00 20.31 ? 64  LEU B HB2  1 
ATOM   6018  H HB3  . LEU B 1 64  ? 26.996  0.913   -52.414 1.00 20.31 ? 64  LEU B HB3  1 
ATOM   6019  H HG   . LEU B 1 64  ? 26.218  1.224   -50.188 1.00 19.07 ? 64  LEU B HG   1 
ATOM   6020  H HD11 . LEU B 1 64  ? 24.122  0.455   -49.597 1.00 27.50 ? 64  LEU B HD11 1 
ATOM   6021  H HD12 . LEU B 1 64  ? 23.997  1.670   -50.614 1.00 27.50 ? 64  LEU B HD12 1 
ATOM   6022  H HD13 . LEU B 1 64  ? 23.791  0.181   -51.127 1.00 27.50 ? 64  LEU B HD13 1 
ATOM   6023  H HD21 . LEU B 1 64  ? 25.994  -1.022  -49.655 1.00 26.04 ? 64  LEU B HD21 1 
ATOM   6024  H HD22 . LEU B 1 64  ? 25.749  -1.361  -51.188 1.00 26.04 ? 64  LEU B HD22 1 
ATOM   6025  H HD23 . LEU B 1 64  ? 27.165  -0.822  -50.710 1.00 26.04 ? 64  LEU B HD23 1 
ATOM   6026  N N    . PRO B 1 65  ? 26.726  4.780   -51.976 1.00 18.71 ? 65  PRO B N    1 
ATOM   6027  C CA   . PRO B 1 65  ? 27.766  5.672   -51.457 1.00 18.46 ? 65  PRO B CA   1 
ATOM   6028  C C    . PRO B 1 65  ? 27.867  5.539   -49.949 1.00 20.82 ? 65  PRO B C    1 
ATOM   6029  O O    . PRO B 1 65  ? 26.905  5.163   -49.279 1.00 16.07 ? 65  PRO B O    1 
ATOM   6030  C CB   . PRO B 1 65  ? 27.300  7.072   -51.879 1.00 19.63 ? 65  PRO B CB   1 
ATOM   6031  C CG   . PRO B 1 65  ? 25.781  6.953   -52.039 1.00 23.89 ? 65  PRO B CG   1 
ATOM   6032  C CD   . PRO B 1 65  ? 25.598  5.514   -52.576 1.00 20.25 ? 65  PRO B CD   1 
ATOM   6033  H HA   . PRO B 1 65  ? 28.624  5.474   -51.863 1.00 22.13 ? 65  PRO B HA   1 
ATOM   6034  H HB2  . PRO B 1 65  ? 27.524  7.714   -51.187 1.00 23.54 ? 65  PRO B HB2  1 
ATOM   6035  H HB3  . PRO B 1 65  ? 27.716  7.315   -52.721 1.00 23.54 ? 65  PRO B HB3  1 
ATOM   6036  H HG2  . PRO B 1 65  ? 25.347  7.063   -51.178 1.00 28.65 ? 65  PRO B HG2  1 
ATOM   6037  H HG3  . PRO B 1 65  ? 25.462  7.609   -52.679 1.00 28.65 ? 65  PRO B HG3  1 
ATOM   6038  H HD2  . PRO B 1 65  ? 24.754  5.145   -52.272 1.00 24.27 ? 65  PRO B HD2  1 
ATOM   6039  H HD3  . PRO B 1 65  ? 25.663  5.503   -53.544 1.00 24.27 ? 65  PRO B HD3  1 
ATOM   6040  N N    . GLY B 1 66  ? 29.073  5.812   -49.421 1.00 18.70 ? 66  GLY B N    1 
ATOM   6041  C CA   . GLY B 1 66  ? 29.320  5.742   -47.993 1.00 20.78 ? 66  GLY B CA   1 
ATOM   6042  C C    . GLY B 1 66  ? 29.552  4.358   -47.406 1.00 23.78 ? 66  GLY B C    1 
ATOM   6043  O O    . GLY B 1 66  ? 29.732  4.254   -46.185 1.00 24.00 ? 66  GLY B O    1 
ATOM   6044  H H    . GLY B 1 66  ? 29.762  6.041   -49.883 1.00 22.42 ? 66  GLY B H    1 
ATOM   6045  H HA2  . GLY B 1 66  ? 30.101  6.280   -47.788 1.00 24.91 ? 66  GLY B HA2  1 
ATOM   6046  H HA3  . GLY B 1 66  ? 28.563  6.133   -47.530 1.00 24.91 ? 66  GLY B HA3  1 
ATOM   6047  N N    . HIS B 1 67  ? 29.553  3.296   -48.221 1.00 17.54 ? 67  HIS B N    1 
ATOM   6048  C CA   . HIS B 1 67  ? 29.762  1.937   -47.755 1.00 19.53 ? 67  HIS B CA   1 
ATOM   6049  C C    . HIS B 1 67  ? 30.982  1.389   -48.456 1.00 21.42 ? 67  HIS B C    1 
ATOM   6050  O O    . HIS B 1 67  ? 31.138  1.578   -49.667 1.00 24.15 ? 67  HIS B O    1 
ATOM   6051  C CB   . HIS B 1 67  ? 28.566  1.029   -48.054 1.00 18.90 ? 67  HIS B CB   1 
ATOM   6052  C CG   . HIS B 1 67  ? 27.351  1.352   -47.262 1.00 22.18 ? 67  HIS B CG   1 
ATOM   6053  N ND1  . HIS B 1 67  ? 26.846  0.508   -46.297 1.00 22.01 ? 67  HIS B ND1  1 
ATOM   6054  C CD2  . HIS B 1 67  ? 26.543  2.437   -47.280 1.00 25.03 ? 67  HIS B CD2  1 
ATOM   6055  C CE1  . HIS B 1 67  ? 25.780  1.067   -45.750 1.00 26.00 ? 67  HIS B CE1  1 
ATOM   6056  N NE2  . HIS B 1 67  ? 25.571  2.232   -46.336 1.00 23.33 ? 67  HIS B NE2  1 
ATOM   6057  H H    . HIS B 1 67  ? 29.430  3.348   -49.070 1.00 21.03 ? 67  HIS B H    1 
ATOM   6058  H HA   . HIS B 1 67  ? 29.924  1.938   -46.799 1.00 23.41 ? 67  HIS B HA   1 
ATOM   6059  H HB2  . HIS B 1 67  ? 28.337  1.112   -48.993 1.00 22.66 ? 67  HIS B HB2  1 
ATOM   6060  H HB3  . HIS B 1 67  ? 28.813  0.112   -47.857 1.00 22.66 ? 67  HIS B HB3  1 
ATOM   6061  H HD2  . HIS B 1 67  ? 26.630  3.181   -47.831 1.00 30.02 ? 67  HIS B HD2  1 
ATOM   6062  H HE1  . HIS B 1 67  ? 25.255  0.694   -45.079 1.00 31.18 ? 67  HIS B HE1  1 
ATOM   6063  H HE2  . HIS B 1 67  ? 24.932  2.776   -46.151 1.00 27.97 ? 67  HIS B HE2  1 
ATOM   6064  N N    . LYS B 1 68  ? 31.824  0.689   -47.704 1.00 20.97 ? 68  LYS B N    1 
ATOM   6065  C CA   . LYS B 1 68  ? 32.945  -0.009  -48.300 1.00 19.54 ? 68  LYS B CA   1 
ATOM   6066  C C    . LYS B 1 68  ? 32.565  -1.451  -48.594 1.00 22.63 ? 68  LYS B C    1 
ATOM   6067  O O    . LYS B 1 68  ? 31.922  -2.122  -47.781 1.00 21.91 ? 68  LYS B O    1 
ATOM   6068  C CB   . LYS B 1 68  ? 34.176  0.055   -47.393 1.00 24.72 ? 68  LYS B CB   1 
ATOM   6069  C CG   . LYS B 1 68  ? 34.746  1.471   -47.272 1.00 26.15 ? 68  LYS B CG   1 
ATOM   6070  C CD   . LYS B 1 68  ? 35.112  2.088   -48.625 1.00 27.11 ? 68  LYS B CD   1 
ATOM   6071  C CE   . LYS B 1 68  ? 35.662  3.517   -48.440 1.00 30.56 ? 68  LYS B CE   1 
ATOM   6072  N NZ   . LYS B 1 68  ? 35.833  4.262   -49.738 1.00 27.57 ? 68  LYS B NZ   1 
ATOM   6073  H H    . LYS B 1 68  ? 31.765  0.604   -46.850 1.00 25.14 ? 68  LYS B H    1 
ATOM   6074  H HA   . LYS B 1 68  ? 33.170  0.418   -49.141 1.00 23.42 ? 68  LYS B HA   1 
ATOM   6075  H HB2  . LYS B 1 68  ? 33.931  -0.247  -46.505 1.00 29.64 ? 68  LYS B HB2  1 
ATOM   6076  H HB3  . LYS B 1 68  ? 34.868  -0.517  -47.759 1.00 29.64 ? 68  LYS B HB3  1 
ATOM   6077  H HG2  . LYS B 1 68  ? 34.084  2.042   -46.851 1.00 31.36 ? 68  LYS B HG2  1 
ATOM   6078  H HG3  . LYS B 1 68  ? 35.550  1.441   -46.729 1.00 31.36 ? 68  LYS B HG3  1 
ATOM   6079  H HD2  . LYS B 1 68  ? 35.797  1.549   -49.052 1.00 32.51 ? 68  LYS B HD2  1 
ATOM   6080  H HD3  . LYS B 1 68  ? 34.321  2.134   -49.184 1.00 32.51 ? 68  LYS B HD3  1 
ATOM   6081  H HE2  . LYS B 1 68  ? 35.046  4.021   -47.886 1.00 36.64 ? 68  LYS B HE2  1 
ATOM   6082  H HE3  . LYS B 1 68  ? 36.529  3.467   -48.009 1.00 36.64 ? 68  LYS B HE3  1 
ATOM   6083  H HZ1  . LYS B 1 68  ? 36.151  5.078   -49.580 1.00 33.06 ? 68  LYS B HZ1  1 
ATOM   6084  H HZ2  . LYS B 1 68  ? 36.402  3.826   -50.265 1.00 33.06 ? 68  LYS B HZ2  1 
ATOM   6085  H HZ3  . LYS B 1 68  ? 35.049  4.332   -50.153 1.00 33.06 ? 68  LYS B HZ3  1 
ATOM   6086  N N    . LEU B 1 69  ? 32.950  -1.901  -49.764 1.00 18.26 ? 69  LEU B N    1 
ATOM   6087  C CA   . LEU B 1 69  ? 32.855  -3.286  -50.168 1.00 17.95 ? 69  LEU B CA   1 
ATOM   6088  C C    . LEU B 1 69  ? 34.137  -4.024  -49.827 1.00 18.86 ? 69  LEU B C    1 
ATOM   6089  O O    . LEU B 1 69  ? 35.219  -3.431  -49.842 1.00 19.99 ? 69  LEU B O    1 
ATOM   6090  C CB   . LEU B 1 69  ? 32.600  -3.369  -51.669 1.00 17.43 ? 69  LEU B CB   1 
ATOM   6091  C CG   . LEU B 1 69  ? 31.463  -2.466  -52.153 1.00 23.88 ? 69  LEU B CG   1 
ATOM   6092  C CD1  . LEU B 1 69  ? 31.283  -2.605  -53.648 1.00 20.11 ? 69  LEU B CD1  1 
ATOM   6093  C CD2  . LEU B 1 69  ? 30.157  -2.746  -51.445 1.00 20.53 ? 69  LEU B CD2  1 
ATOM   6094  H H    . LEU B 1 69  ? 33.289  -1.397  -50.373 1.00 21.89 ? 69  LEU B H    1 
ATOM   6095  H HA   . LEU B 1 69  ? 32.118  -3.712  -49.703 1.00 21.52 ? 69  LEU B HA   1 
ATOM   6096  H HB2  . LEU B 1 69  ? 33.407  -3.106  -52.138 1.00 20.89 ? 69  LEU B HB2  1 
ATOM   6097  H HB3  . LEU B 1 69  ? 32.370  -4.283  -51.897 1.00 20.89 ? 69  LEU B HB3  1 
ATOM   6098  H HG   . LEU B 1 69  ? 31.703  -1.544  -51.971 1.00 28.63 ? 69  LEU B HG   1 
ATOM   6099  H HD11 . LEU B 1 69  ? 30.560  -2.025  -53.934 1.00 24.11 ? 69  LEU B HD11 1 
ATOM   6100  H HD12 . LEU B 1 69  ? 32.108  -2.347  -54.090 1.00 24.11 ? 69  LEU B HD12 1 
ATOM   6101  H HD13 . LEU B 1 69  ? 31.070  -3.528  -53.856 1.00 24.11 ? 69  LEU B HD13 1 
ATOM   6102  H HD21 . LEU B 1 69  ? 29.477  -2.147  -51.791 1.00 24.62 ? 69  LEU B HD21 1 
ATOM   6103  H HD22 . LEU B 1 69  ? 29.901  -3.667  -51.608 1.00 24.62 ? 69  LEU B HD22 1 
ATOM   6104  H HD23 . LEU B 1 69  ? 30.276  -2.599  -50.494 1.00 24.62 ? 69  LEU B HD23 1 
ATOM   6105  N N    . PRO B 1 70  ? 34.053  -5.299  -49.478 1.00 20.49 ? 70  PRO B N    1 
ATOM   6106  C CA   . PRO B 1 70  ? 35.264  -6.060  -49.218 1.00 23.25 ? 70  PRO B CA   1 
ATOM   6107  C C    . PRO B 1 70  ? 36.194  -5.970  -50.413 1.00 22.07 ? 70  PRO B C    1 
ATOM   6108  O O    . PRO B 1 70  ? 35.723  -6.026  -51.562 1.00 17.85 ? 70  PRO B O    1 
ATOM   6109  C CB   . PRO B 1 70  ? 34.740  -7.494  -48.995 1.00 24.85 ? 70  PRO B CB   1 
ATOM   6110  C CG   . PRO B 1 70  ? 33.401  -7.304  -48.449 1.00 23.43 ? 70  PRO B CG   1 
ATOM   6111  C CD   . PRO B 1 70  ? 32.867  -6.133  -49.264 1.00 20.64 ? 70  PRO B CD   1 
ATOM   6112  H HA   . PRO B 1 70  ? 35.713  -5.740  -48.419 1.00 27.88 ? 70  PRO B HA   1 
ATOM   6113  H HB2  . PRO B 1 70  ? 34.704  -7.967  -49.841 1.00 29.80 ? 70  PRO B HB2  1 
ATOM   6114  H HB3  . PRO B 1 70  ? 35.309  -7.958  -48.361 1.00 29.80 ? 70  PRO B HB3  1 
ATOM   6115  H HG2  . PRO B 1 70  ? 32.867  -8.102  -48.591 1.00 28.09 ? 70  PRO B HG2  1 
ATOM   6116  H HG3  . PRO B 1 70  ? 33.454  -7.080  -47.507 1.00 28.09 ? 70  PRO B HG3  1 
ATOM   6117  H HD2  . PRO B 1 70  ? 32.515  -6.444  -50.112 1.00 24.75 ? 70  PRO B HD2  1 
ATOM   6118  H HD3  . PRO B 1 70  ? 32.199  -5.646  -48.757 1.00 24.75 ? 70  PRO B HD3  1 
ATOM   6119  N N    . PRO B 1 71  ? 37.503  -5.755  -50.194 1.00 21.18 ? 71  PRO B N    1 
ATOM   6120  C CA   . PRO B 1 71  ? 38.401  -5.472  -51.325 1.00 22.74 ? 71  PRO B CA   1 
ATOM   6121  C C    . PRO B 1 71  ? 38.588  -6.664  -52.239 1.00 19.26 ? 71  PRO B C    1 
ATOM   6122  O O    . PRO B 1 71  ? 39.104  -6.501  -53.341 1.00 23.11 ? 71  PRO B O    1 
ATOM   6123  C CB   . PRO B 1 71  ? 39.723  -5.070  -50.649 1.00 27.53 ? 71  PRO B CB   1 
ATOM   6124  C CG   . PRO B 1 71  ? 39.644  -5.635  -49.270 1.00 22.83 ? 71  PRO B CG   1 
ATOM   6125  C CD   . PRO B 1 71  ? 38.185  -5.615  -48.896 1.00 23.93 ? 71  PRO B CD   1 
ATOM   6126  H HA   . PRO B 1 71  ? 38.064  -4.723  -51.841 1.00 27.27 ? 71  PRO B HA   1 
ATOM   6127  H HB2  . PRO B 1 71  ? 40.469  -5.454  -51.135 1.00 33.01 ? 71  PRO B HB2  1 
ATOM   6128  H HB3  . PRO B 1 71  ? 39.794  -4.103  -50.620 1.00 33.01 ? 71  PRO B HB3  1 
ATOM   6129  H HG2  . PRO B 1 71  ? 39.983  -6.544  -49.272 1.00 27.38 ? 71  PRO B HG2  1 
ATOM   6130  H HG3  . PRO B 1 71  ? 40.159  -5.081  -48.662 1.00 27.38 ? 71  PRO B HG3  1 
ATOM   6131  H HD2  . PRO B 1 71  ? 37.972  -6.365  -48.319 1.00 28.70 ? 71  PRO B HD2  1 
ATOM   6132  H HD3  . PRO B 1 71  ? 37.953  -4.769  -48.482 1.00 28.70 ? 71  PRO B HD3  1 
ATOM   6133  N N    . ASN B 1 72  ? 38.164  -7.845  -51.822 1.00 22.29 ? 72  ASN B N    1 
ATOM   6134  C CA   . ASN B 1 72  ? 38.231  -8.994  -52.693 1.00 23.33 ? 72  ASN B CA   1 
ATOM   6135  C C    . ASN B 1 72  ? 37.081  -9.042  -53.682 1.00 22.07 ? 72  ASN B C    1 
ATOM   6136  O O    . ASN B 1 72  ? 37.061  -9.943  -54.518 1.00 22.98 ? 72  ASN B O    1 
ATOM   6137  C CB   . ASN B 1 72  ? 38.262  -10.263 -51.866 1.00 21.99 ? 72  ASN B CB   1 
ATOM   6138  C CG   . ASN B 1 72  ? 37.101  -10.346 -50.901 1.00 23.72 ? 72  ASN B CG   1 
ATOM   6139  O OD1  . ASN B 1 72  ? 36.893  -9.450  -50.065 1.00 21.43 ? 72  ASN B OD1  1 
ATOM   6140  N ND2  . ASN B 1 72  ? 36.339  -11.414 -51.009 1.00 21.74 ? 72  ASN B ND2  1 
ATOM   6141  H H    . ASN B 1 72  ? 37.836  -8.004  -51.044 1.00 26.72 ? 72  ASN B H    1 
ATOM   6142  H HA   . ASN B 1 72  ? 39.056  -8.952  -53.202 1.00 27.97 ? 72  ASN B HA   1 
ATOM   6143  H HB2  . ASN B 1 72  ? 38.219  -11.029 -52.458 1.00 26.37 ? 72  ASN B HB2  1 
ATOM   6144  H HB3  . ASN B 1 72  ? 39.084  -10.285 -51.351 1.00 26.37 ? 72  ASN B HB3  1 
ATOM   6145  H HD21 . ASN B 1 72  ? 35.664  -11.515 -50.486 1.00 26.06 ? 72  ASN B HD21 1 
ATOM   6146  H HD22 . ASN B 1 72  ? 36.517  -12.012 -51.602 1.00 26.06 ? 72  ASN B HD22 1 
ATOM   6147  N N    . VAL B 1 73  ? 36.139  -8.108  -53.623 1.00 17.10 ? 73  VAL B N    1 
ATOM   6148  C CA   . VAL B 1 73  ? 35.115  -7.990  -54.661 1.00 14.94 ? 73  VAL B CA   1 
ATOM   6149  C C    . VAL B 1 73  ? 35.660  -7.126  -55.797 1.00 25.05 ? 73  VAL B C    1 
ATOM   6150  O O    . VAL B 1 73  ? 36.080  -5.981  -55.578 1.00 20.86 ? 73  VAL B O    1 
ATOM   6151  C CB   . VAL B 1 73  ? 33.810  -7.421  -54.094 1.00 16.24 ? 73  VAL B CB   1 
ATOM   6152  C CG1  . VAL B 1 73  ? 32.791  -7.207  -55.189 1.00 22.81 ? 73  VAL B CG1  1 
ATOM   6153  C CG2  . VAL B 1 73  ? 33.256  -8.390  -53.046 1.00 22.97 ? 73  VAL B CG2  1 
ATOM   6154  H H    . VAL B 1 73  ? 36.068  -7.529  -52.991 1.00 20.49 ? 73  VAL B H    1 
ATOM   6155  H HA   . VAL B 1 73  ? 34.926  -8.871  -55.019 1.00 17.91 ? 73  VAL B HA   1 
ATOM   6156  H HB   . VAL B 1 73  ? 33.986  -6.569  -53.665 1.00 19.46 ? 73  VAL B HB   1 
ATOM   6157  H HG11 . VAL B 1 73  ? 31.979  -6.847  -54.799 1.00 27.35 ? 73  VAL B HG11 1 
ATOM   6158  H HG12 . VAL B 1 73  ? 33.151  -6.582  -55.837 1.00 27.35 ? 73  VAL B HG12 1 
ATOM   6159  H HG13 . VAL B 1 73  ? 32.604  -8.057  -55.617 1.00 27.35 ? 73  VAL B HG13 1 
ATOM   6160  H HG21 . VAL B 1 73  ? 32.430  -8.028  -52.688 1.00 27.54 ? 73  VAL B HG21 1 
ATOM   6161  H HG22 . VAL B 1 73  ? 33.088  -9.247  -53.467 1.00 27.54 ? 73  VAL B HG22 1 
ATOM   6162  H HG23 . VAL B 1 73  ? 33.909  -8.492  -52.336 1.00 27.54 ? 73  VAL B HG23 1 
ATOM   6163  N N    . VAL B 1 74  ? 35.668  -7.686  -57.012 1.00 20.26 ? 74  VAL B N    1 
ATOM   6164  C CA   . VAL B 1 74  ? 36.272  -7.058  -58.179 1.00 22.66 ? 74  VAL B CA   1 
ATOM   6165  C C    . VAL B 1 74  ? 35.163  -6.696  -59.146 1.00 20.59 ? 74  VAL B C    1 
ATOM   6166  O O    . VAL B 1 74  ? 34.376  -7.566  -59.556 1.00 21.79 ? 74  VAL B O    1 
ATOM   6167  C CB   . VAL B 1 74  ? 37.297  -7.986  -58.860 1.00 21.59 ? 74  VAL B CB   1 
ATOM   6168  C CG1  . VAL B 1 74  ? 37.910  -7.281  -60.053 1.00 23.18 ? 74  VAL B CG1  1 
ATOM   6169  C CG2  . VAL B 1 74  ? 38.382  -8.361  -57.907 1.00 24.35 ? 74  VAL B CG2  1 
ATOM   6170  H H    . VAL B 1 74  ? 35.317  -8.453  -57.183 1.00 24.29 ? 74  VAL B H    1 
ATOM   6171  H HA   . VAL B 1 74  ? 36.725  -6.244  -57.911 1.00 27.17 ? 74  VAL B HA   1 
ATOM   6172  H HB   . VAL B 1 74  ? 36.856  -8.794  -59.166 1.00 25.89 ? 74  VAL B HB   1 
ATOM   6173  H HG11 . VAL B 1 74  ? 38.553  -7.874  -60.473 1.00 27.80 ? 74  VAL B HG11 1 
ATOM   6174  H HG12 . VAL B 1 74  ? 37.207  -7.056  -60.683 1.00 27.80 ? 74  VAL B HG12 1 
ATOM   6175  H HG13 . VAL B 1 74  ? 38.354  -6.474  -59.749 1.00 27.80 ? 74  VAL B HG13 1 
ATOM   6176  H HG21 . VAL B 1 74  ? 39.012  -8.943  -58.360 1.00 29.19 ? 74  VAL B HG21 1 
ATOM   6177  H HG22 . VAL B 1 74  ? 38.832  -7.555  -57.609 1.00 29.19 ? 74  VAL B HG22 1 
ATOM   6178  H HG23 . VAL B 1 74  ? 37.991  -8.822  -57.149 1.00 29.19 ? 74  VAL B HG23 1 
ATOM   6179  N N    . ALA B 1 75  ? 35.112  -5.427  -59.533 1.00 19.11 ? 75  ALA B N    1 
ATOM   6180  C CA   . ALA B 1 75  ? 34.151  -4.983  -60.530 1.00 26.72 ? 75  ALA B CA   1 
ATOM   6181  C C    . ALA B 1 75  ? 34.657  -5.270  -61.944 1.00 26.87 ? 75  ALA B C    1 
ATOM   6182  O O    . ALA B 1 75  ? 35.814  -4.990  -62.278 1.00 23.04 ? 75  ALA B O    1 
ATOM   6183  C CB   . ALA B 1 75  ? 33.865  -3.500  -60.378 1.00 21.20 ? 75  ALA B CB   1 
ATOM   6184  H H    . ALA B 1 75  ? 35.622  -4.804  -59.232 1.00 22.91 ? 75  ALA B H    1 
ATOM   6185  H HA   . ALA B 1 75  ? 33.318  -5.464  -60.405 1.00 32.04 ? 75  ALA B HA   1 
ATOM   6186  H HB1  . ALA B 1 75  ? 33.223  -3.231  -61.054 1.00 25.41 ? 75  ALA B HB1  1 
ATOM   6187  H HB2  . ALA B 1 75  ? 33.503  -3.338  -59.493 1.00 25.41 ? 75  ALA B HB2  1 
ATOM   6188  H HB3  . ALA B 1 75  ? 34.693  -3.006  -60.492 1.00 25.41 ? 75  ALA B HB3  1 
ATOM   6189  N N    . VAL B 1 76  ? 33.763  -5.802  -62.780 1.00 21.14 ? 76  VAL B N    1 
ATOM   6190  C CA   . VAL B 1 76  ? 34.099  -6.252  -64.124 1.00 22.98 ? 76  VAL B CA   1 
ATOM   6191  C C    . VAL B 1 76  ? 33.033  -5.717  -65.067 1.00 22.54 ? 76  VAL B C    1 
ATOM   6192  O O    . VAL B 1 76  ? 31.852  -6.011  -64.892 1.00 25.08 ? 76  VAL B O    1 
ATOM   6193  C CB   . VAL B 1 76  ? 34.172  -7.786  -64.219 1.00 22.50 ? 76  VAL B CB   1 
ATOM   6194  C CG1  . VAL B 1 76  ? 34.422  -8.264  -65.682 1.00 24.25 ? 76  VAL B CG1  1 
ATOM   6195  C CG2  . VAL B 1 76  ? 35.249  -8.282  -63.322 1.00 25.88 ? 76  VAL B CG2  1 
ATOM   6196  H H    . VAL B 1 76  ? 32.934  -5.915  -62.581 1.00 25.35 ? 76  VAL B H    1 
ATOM   6197  H HA   . VAL B 1 76  ? 34.958  -5.884  -64.386 1.00 27.56 ? 76  VAL B HA   1 
ATOM   6198  H HB   . VAL B 1 76  ? 33.331  -8.164  -63.918 1.00 26.98 ? 76  VAL B HB   1 
ATOM   6199  H HG11 . VAL B 1 76  ? 34.461  -9.233  -65.695 1.00 29.08 ? 76  VAL B HG11 1 
ATOM   6200  H HG12 . VAL B 1 76  ? 33.694  -7.955  -66.243 1.00 29.08 ? 76  VAL B HG12 1 
ATOM   6201  H HG13 . VAL B 1 76  ? 35.262  -7.895  -65.995 1.00 29.08 ? 76  VAL B HG13 1 
ATOM   6202  H HG21 . VAL B 1 76  ? 35.292  -9.249  -63.385 1.00 31.03 ? 76  VAL B HG21 1 
ATOM   6203  H HG22 . VAL B 1 76  ? 36.094  -7.895  -63.599 1.00 31.03 ? 76  VAL B HG22 1 
ATOM   6204  H HG23 . VAL B 1 76  ? 35.047  -8.018  -62.411 1.00 31.03 ? 76  VAL B HG23 1 
ATOM   6205  N N    . PRO B 1 77  ? 33.381  -4.903  -66.071 1.00 23.95 ? 77  PRO B N    1 
ATOM   6206  C CA   . PRO B 1 77  ? 32.333  -4.259  -66.881 1.00 26.95 ? 77  PRO B CA   1 
ATOM   6207  C C    . PRO B 1 77  ? 31.711  -5.147  -67.948 1.00 20.15 ? 77  PRO B C    1 
ATOM   6208  O O    . PRO B 1 77  ? 30.609  -4.837  -68.413 1.00 21.36 ? 77  PRO B O    1 
ATOM   6209  C CB   . PRO B 1 77  ? 33.065  -3.068  -67.529 1.00 27.38 ? 77  PRO B CB   1 
ATOM   6210  C CG   . PRO B 1 77  ? 34.511  -3.426  -67.481 1.00 26.51 ? 77  PRO B CG   1 
ATOM   6211  C CD   . PRO B 1 77  ? 34.735  -4.407  -66.385 1.00 25.23 ? 77  PRO B CD   1 
ATOM   6212  H HA   . PRO B 1 77  ? 31.630  -3.920  -66.305 1.00 32.32 ? 77  PRO B HA   1 
ATOM   6213  H HB2  . PRO B 1 77  ? 32.768  -2.963  -68.447 1.00 32.84 ? 77  PRO B HB2  1 
ATOM   6214  H HB3  . PRO B 1 77  ? 32.893  -2.262  -67.018 1.00 32.84 ? 77  PRO B HB3  1 
ATOM   6215  H HG2  . PRO B 1 77  ? 34.768  -3.817  -68.331 1.00 31.79 ? 77  PRO B HG2  1 
ATOM   6216  H HG3  . PRO B 1 77  ? 35.029  -2.623  -67.316 1.00 31.79 ? 77  PRO B HG3  1 
ATOM   6217  H HD2  . PRO B 1 77  ? 35.297  -5.134  -66.694 1.00 30.26 ? 77  PRO B HD2  1 
ATOM   6218  H HD3  . PRO B 1 77  ? 35.120  -3.965  -65.612 1.00 30.26 ? 77  PRO B HD3  1 
ATOM   6219  N N    . ASP B 1 78  ? 32.382  -6.213  -68.360 1.00 26.30 ? 78  ASP B N    1 
ATOM   6220  C CA   . ASP B 1 78  ? 31.853  -7.114  -69.372 1.00 26.79 ? 78  ASP B CA   1 
ATOM   6221  C C    . ASP B 1 78  ? 31.209  -8.299  -68.656 1.00 23.88 ? 78  ASP B C    1 
ATOM   6222  O O    . ASP B 1 78  ? 31.887  -9.035  -67.935 1.00 24.08 ? 78  ASP B O    1 
ATOM   6223  C CB   . ASP B 1 78  ? 32.953  -7.573  -70.335 1.00 27.33 ? 78  ASP B CB   1 
ATOM   6224  C CG   . ASP B 1 78  ? 32.430  -8.558  -71.384 1.00 32.55 ? 78  ASP B CG   1 
ATOM   6225  O OD1  . ASP B 1 78  ? 32.218  -9.746  -71.061 1.00 33.44 ? 78  ASP B OD1  1 
ATOM   6226  O OD2  . ASP B 1 78  ? 32.195  -8.135  -72.521 1.00 41.65 ? 78  ASP B OD2  1 
ATOM   6227  H H    . ASP B 1 78  ? 33.157  -6.439  -68.064 1.00 31.54 ? 78  ASP B H    1 
ATOM   6228  H HA   . ASP B 1 78  ? 31.168  -6.657  -69.885 1.00 32.12 ? 78  ASP B HA   1 
ATOM   6229  H HB2  . ASP B 1 78  ? 33.312  -6.800  -70.799 1.00 32.77 ? 78  ASP B HB2  1 
ATOM   6230  H HB3  . ASP B 1 78  ? 33.654  -8.014  -69.830 1.00 32.77 ? 78  ASP B HB3  1 
ATOM   6231  N N    . VAL B 1 79  ? 29.897  -8.466  -68.843 1.00 23.61 ? 79  VAL B N    1 
ATOM   6232  C CA   . VAL B 1 79  ? 29.142  -9.453  -68.078 1.00 23.83 ? 79  VAL B CA   1 
ATOM   6233  C C    . VAL B 1 79  ? 29.629  -10.873 -68.372 1.00 26.61 ? 79  VAL B C    1 
ATOM   6234  O O    . VAL B 1 79  ? 29.649  -11.727 -67.475 1.00 24.10 ? 79  VAL B O    1 
ATOM   6235  C CB   . VAL B 1 79  ? 27.641  -9.266  -68.356 1.00 24.75 ? 79  VAL B CB   1 
ATOM   6236  C CG1  . VAL B 1 79  ? 27.263  -9.781  -69.749 1.00 26.27 ? 79  VAL B CG1  1 
ATOM   6237  C CG2  . VAL B 1 79  ? 26.797  -9.942  -67.278 1.00 25.23 ? 79  VAL B CG2  1 
ATOM   6238  H H    . VAL B 1 79  ? 29.425  -8.019  -69.406 1.00 28.31 ? 79  VAL B H    1 
ATOM   6239  H HA   . VAL B 1 79  ? 29.287  -9.286  -67.134 1.00 28.57 ? 79  VAL B HA   1 
ATOM   6240  H HB   . VAL B 1 79  ? 27.439  -8.318  -68.331 1.00 29.67 ? 79  VAL B HB   1 
ATOM   6241  H HG11 . VAL B 1 79  ? 26.312  -9.648  -69.888 1.00 31.50 ? 79  VAL B HG11 1 
ATOM   6242  H HG12 . VAL B 1 79  ? 27.768  -9.289  -70.415 1.00 31.50 ? 79  VAL B HG12 1 
ATOM   6243  H HG13 . VAL B 1 79  ? 27.476  -10.726 -69.805 1.00 31.50 ? 79  VAL B HG13 1 
ATOM   6244  H HG21 . VAL B 1 79  ? 25.859  -9.806  -67.481 1.00 30.26 ? 79  VAL B HG21 1 
ATOM   6245  H HG22 . VAL B 1 79  ? 27.000  -10.890 -67.268 1.00 30.26 ? 79  VAL B HG22 1 
ATOM   6246  H HG23 . VAL B 1 79  ? 27.011  -9.548  -66.418 1.00 30.26 ? 79  VAL B HG23 1 
ATOM   6247  N N    . VAL B 1 80  ? 30.045  -11.155 -69.610 1.00 26.53 ? 80  VAL B N    1 
ATOM   6248  C CA   . VAL B 1 80  ? 30.578  -12.481 -69.915 1.00 27.57 ? 80  VAL B CA   1 
ATOM   6249  C C    . VAL B 1 80  ? 31.880  -12.714 -69.155 1.00 26.48 ? 80  VAL B C    1 
ATOM   6250  O O    . VAL B 1 80  ? 32.096  -13.770 -68.549 1.00 26.79 ? 80  VAL B O    1 
ATOM   6251  C CB   . VAL B 1 80  ? 30.778  -12.659 -71.437 1.00 27.43 ? 80  VAL B CB   1 
ATOM   6252  C CG1  . VAL B 1 80  ? 31.446  -13.945 -71.706 1.00 22.19 ? 80  VAL B CG1  1 
ATOM   6253  C CG2  . VAL B 1 80  ? 29.462  -12.645 -72.175 1.00 27.49 ? 80  VAL B CG2  1 
ATOM   6254  H H    . VAL B 1 80  ? 30.030  -10.609 -70.274 1.00 31.82 ? 80  VAL B H    1 
ATOM   6255  H HA   . VAL B 1 80  ? 29.939  -13.149 -69.620 1.00 33.07 ? 80  VAL B HA   1 
ATOM   6256  H HB   . VAL B 1 80  ? 31.335  -11.943 -71.780 1.00 32.90 ? 80  VAL B HB   1 
ATOM   6257  H HG11 . VAL B 1 80  ? 31.565  -14.044 -72.664 1.00 26.61 ? 80  VAL B HG11 1 
ATOM   6258  H HG12 . VAL B 1 80  ? 32.308  -13.951 -71.263 1.00 26.61 ? 80  VAL B HG12 1 
ATOM   6259  H HG13 . VAL B 1 80  ? 30.892  -14.665 -71.365 1.00 26.61 ? 80  VAL B HG13 1 
ATOM   6260  H HG21 . VAL B 1 80  ? 29.630  -12.759 -73.123 1.00 32.97 ? 80  VAL B HG21 1 
ATOM   6261  H HG22 . VAL B 1 80  ? 28.909  -13.371 -71.847 1.00 32.97 ? 80  VAL B HG22 1 
ATOM   6262  H HG23 . VAL B 1 80  ? 29.021  -11.795 -72.016 1.00 32.97 ? 80  VAL B HG23 1 
ATOM   6263  N N    . GLN B 1 81  ? 32.793  -11.762 -69.222 1.00 26.19 ? 81  GLN B N    1 
ATOM   6264  C CA   . GLN B 1 81  ? 34.042  -11.921 -68.484 1.00 29.19 ? 81  GLN B CA   1 
ATOM   6265  C C    . GLN B 1 81  ? 33.796  -12.042 -66.981 1.00 25.25 ? 81  GLN B C    1 
ATOM   6266  O O    . GLN B 1 81  ? 34.542  -12.728 -66.276 1.00 26.73 ? 81  GLN B O    1 
ATOM   6267  C CB   . GLN B 1 81  ? 34.973  -10.744 -68.779 1.00 30.17 ? 81  GLN B CB   1 
ATOM   6268  C CG   . GLN B 1 81  ? 35.383  -10.633 -70.276 1.00 43.09 ? 81  GLN B CG   1 
ATOM   6269  C CD   . GLN B 1 81  ? 36.403  -9.514  -70.554 1.00 51.09 ? 81  GLN B CD   1 
ATOM   6270  O OE1  . GLN B 1 81  ? 36.770  -8.755  -69.656 1.00 50.37 ? 81  GLN B OE1  1 
ATOM   6271  N NE2  . GLN B 1 81  ? 36.871  -9.426  -71.804 1.00 54.57 ? 81  GLN B NE2  1 
ATOM   6272  H H    . GLN B 1 81  ? 32.723  -11.032 -69.671 1.00 31.40 ? 81  GLN B H    1 
ATOM   6273  H HA   . GLN B 1 81  ? 34.482  -12.733 -68.782 1.00 35.00 ? 81  GLN B HA   1 
ATOM   6274  H HB2  . GLN B 1 81  ? 34.524  -9.920  -68.531 1.00 36.18 ? 81  GLN B HB2  1 
ATOM   6275  H HB3  . GLN B 1 81  ? 35.783  -10.847 -68.256 1.00 36.18 ? 81  GLN B HB3  1 
ATOM   6276  H HG2  . GLN B 1 81  ? 35.779  -11.473 -70.556 1.00 51.68 ? 81  GLN B HG2  1 
ATOM   6277  H HG3  . GLN B 1 81  ? 34.590  -10.450 -70.805 1.00 51.68 ? 81  GLN B HG3  1 
ATOM   6278  H HE21 . GLN B 1 81  ? 36.595  -9.974  -72.406 1.00 65.46 ? 81  GLN B HE21 1 
ATOM   6279  H HE22 . GLN B 1 81  ? 37.444  -8.817  -72.007 1.00 65.46 ? 81  GLN B HE22 1 
ATOM   6280  N N    . ALA B 1 82  ? 32.768  -11.378 -66.466 1.00 20.52 ? 82  ALA B N    1 
ATOM   6281  C CA   . ALA B 1 82  ? 32.488  -11.465 -65.037 1.00 19.56 ? 82  ALA B CA   1 
ATOM   6282  C C    . ALA B 1 82  ? 32.061  -12.869 -64.652 1.00 21.43 ? 82  ALA B C    1 
ATOM   6283  O O    . ALA B 1 82  ? 32.479  -13.398 -63.622 1.00 23.70 ? 82  ALA B O    1 
ATOM   6284  C CB   . ALA B 1 82  ? 31.401  -10.458 -64.674 1.00 23.42 ? 82  ALA B CB   1 
ATOM   6285  H H    . ALA B 1 82  ? 32.226  -10.880 -66.911 1.00 24.61 ? 82  ALA B H    1 
ATOM   6286  H HA   . ALA B 1 82  ? 33.290  -11.242 -64.538 1.00 23.45 ? 82  ALA B HA   1 
ATOM   6287  H HB1  . ALA B 1 82  ? 31.219  -10.519 -63.723 1.00 28.09 ? 82  ALA B HB1  1 
ATOM   6288  H HB2  . ALA B 1 82  ? 31.711  -9.566  -64.894 1.00 28.09 ? 82  ALA B HB2  1 
ATOM   6289  H HB3  . ALA B 1 82  ? 30.599  -10.664 -65.179 1.00 28.09 ? 82  ALA B HB3  1 
ATOM   6290  N N    . ALA B 1 83  ? 31.246  -13.488 -65.491 1.00 24.32 ? 83  ALA B N    1 
ATOM   6291  C CA   . ALA B 1 83  ? 30.521  -14.699 -65.157 1.00 24.49 ? 83  ALA B CA   1 
ATOM   6292  C C    . ALA B 1 83  ? 31.191  -15.978 -65.634 1.00 28.21 ? 83  ALA B C    1 
ATOM   6293  O O    . ALA B 1 83  ? 30.845  -17.053 -65.137 1.00 23.83 ? 83  ALA B O    1 
ATOM   6294  C CB   . ALA B 1 83  ? 29.104  -14.602 -65.767 1.00 23.10 ? 83  ALA B CB   1 
ATOM   6295  H H    . ALA B 1 83  ? 31.093  -13.213 -66.291 1.00 29.16 ? 83  ALA B H    1 
ATOM   6296  H HA   . ALA B 1 83  ? 30.428  -14.753 -64.193 1.00 29.37 ? 83  ALA B HA   1 
ATOM   6297  H HB1  . ALA B 1 83  ? 28.611  -15.408 -65.548 1.00 27.70 ? 83  ALA B HB1  1 
ATOM   6298  H HB2  . ALA B 1 83  ? 28.653  -13.827 -65.396 1.00 27.70 ? 83  ALA B HB2  1 
ATOM   6299  H HB3  . ALA B 1 83  ? 29.181  -14.512 -66.729 1.00 27.70 ? 83  ALA B HB3  1 
ATOM   6300  N N    . GLU B 1 84  ? 32.155  -15.902 -66.564 1.00 30.80 ? 84  GLU B N    1 
ATOM   6301  C CA   . GLU B 1 84  ? 32.492  -17.086 -67.365 1.00 32.82 ? 84  GLU B CA   1 
ATOM   6302  C C    . GLU B 1 84  ? 33.235  -18.163 -66.581 1.00 29.39 ? 84  GLU B C    1 
ATOM   6303  O O    . GLU B 1 84  ? 33.183  -19.327 -66.975 1.00 34.99 ? 84  GLU B O    1 
ATOM   6304  C CB   . GLU B 1 84  ? 33.318  -16.703 -68.603 1.00 33.02 ? 84  GLU B CB   1 
ATOM   6305  C CG   . GLU B 1 84  ? 34.633  -15.976 -68.296 1.00 30.50 ? 84  GLU B CG   1 
ATOM   6306  C CD   . GLU B 1 84  ? 35.317  -15.408 -69.550 1.00 34.97 ? 84  GLU B CD   1 
ATOM   6307  O OE1  . GLU B 1 84  ? 34.958  -15.792 -70.684 1.00 34.44 ? 84  GLU B OE1  1 
ATOM   6308  O OE2  . GLU B 1 84  ? 36.205  -14.551 -69.386 1.00 40.74 ? 84  GLU B OE2  1 
ATOM   6309  H H    . GLU B 1 84  ? 32.616  -15.199 -66.745 1.00 36.93 ? 84  GLU B H    1 
ATOM   6310  H HA   . GLU B 1 84  ? 31.665  -17.482 -67.682 1.00 39.36 ? 84  GLU B HA   1 
ATOM   6311  H HB2  . GLU B 1 84  ? 33.537  -17.512 -69.092 1.00 39.61 ? 84  GLU B HB2  1 
ATOM   6312  H HB3  . GLU B 1 84  ? 32.783  -16.119 -69.163 1.00 39.61 ? 84  GLU B HB3  1 
ATOM   6313  H HG2  . GLU B 1 84  ? 34.451  -15.237 -67.694 1.00 36.58 ? 84  GLU B HG2  1 
ATOM   6314  H HG3  . GLU B 1 84  ? 35.247  -16.599 -67.877 1.00 36.58 ? 84  GLU B HG3  1 
ATOM   6315  N N    . ASP B 1 85  ? 33.903  -17.819 -65.499 1.00 31.15 ? 85  ASP B N    1 
ATOM   6316  C CA   . ASP B 1 85  ? 34.533  -18.830 -64.677 1.00 33.88 ? 85  ASP B CA   1 
ATOM   6317  C C    . ASP B 1 85  ? 33.766  -19.065 -63.349 1.00 32.97 ? 85  ASP B C    1 
ATOM   6318  O O    . ASP B 1 85  ? 34.215  -19.771 -62.525 1.00 26.12 ? 85  ASP B O    1 
ATOM   6319  C CB   . ASP B 1 85  ? 35.973  -18.483 -64.375 1.00 38.27 ? 85  ASP B CB   1 
ATOM   6320  C CG   . ASP B 1 85  ? 36.753  -18.073 -65.626 1.00 55.48 ? 85  ASP B CG   1 
ATOM   6321  O OD1  . ASP B 1 85  ? 36.470  -18.610 -66.691 1.00 58.51 ? 85  ASP B OD1  1 
ATOM   6322  O OD2  . ASP B 1 85  ? 37.627  -17.188 -65.542 1.00 60.77 ? 85  ASP B OD2  1 
ATOM   6323  H H    . ASP B 1 85  ? 34.007  -17.013 -65.218 1.00 37.36 ? 85  ASP B H    1 
ATOM   6324  H HA   . ASP B 1 85  ? 34.532  -19.676 -65.172 1.00 40.64 ? 85  ASP B HA   1 
ATOM   6325  H HB2  . ASP B 1 85  ? 35.996  -17.742 -63.750 1.00 45.90 ? 85  ASP B HB2  1 
ATOM   6326  H HB3  . ASP B 1 85  ? 36.411  -19.258 -63.989 1.00 45.90 ? 85  ASP B HB3  1 
ATOM   6327  N N    . ALA B 1 86  ? 32.577  -18.495 -63.206 1.00 30.21 ? 86  ALA B N    1 
ATOM   6328  C CA   . ALA B 1 86  ? 31.866  -18.615 -61.946 1.00 24.78 ? 86  ALA B CA   1 
ATOM   6329  C C    . ALA B 1 86  ? 31.191  -19.975 -61.812 1.00 26.26 ? 86  ALA B C    1 
ATOM   6330  O O    . ALA B 1 86  ? 30.581  -20.477 -62.764 1.00 22.67 ? 86  ALA B O    1 
ATOM   6331  C CB   . ALA B 1 86  ? 30.817  -17.525 -61.832 1.00 24.06 ? 86  ALA B CB   1 
ATOM   6332  H H    . ALA B 1 86  ? 32.174  -18.025 -63.804 1.00 36.23 ? 86  ALA B H    1 
ATOM   6333  H HA   . ALA B 1 86  ? 32.494  -18.513 -61.213 1.00 29.71 ? 86  ALA B HA   1 
ATOM   6334  H HB1  . ALA B 1 86  ? 30.354  -17.621 -60.985 1.00 28.85 ? 86  ALA B HB1  1 
ATOM   6335  H HB2  . ALA B 1 86  ? 31.255  -16.660 -61.873 1.00 28.85 ? 86  ALA B HB2  1 
ATOM   6336  H HB3  . ALA B 1 86  ? 30.189  -17.614 -62.566 1.00 28.85 ? 86  ALA B HB3  1 
ATOM   6337  N N    . ASP B 1 87  ? 31.291  -20.548 -60.606 1.00 21.70 ? 87  ASP B N    1 
ATOM   6338  C CA   . ASP B 1 87  ? 30.514  -21.722 -60.224 1.00 22.23 ? 87  ASP B CA   1 
ATOM   6339  C C    . ASP B 1 87  ? 29.129  -21.347 -59.703 1.00 21.28 ? 87  ASP B C    1 
ATOM   6340  O O    . ASP B 1 87  ? 28.183  -22.149 -59.806 1.00 20.49 ? 87  ASP B O    1 
ATOM   6341  C CB   . ASP B 1 87  ? 31.251  -22.507 -59.135 1.00 24.57 ? 87  ASP B CB   1 
ATOM   6342  C CG   . ASP B 1 87  ? 32.592  -23.036 -59.591 1.00 29.16 ? 87  ASP B CG   1 
ATOM   6343  O OD1  . ASP B 1 87  ? 32.610  -23.872 -60.515 1.00 29.68 ? 87  ASP B OD1  1 
ATOM   6344  O OD2  . ASP B 1 87  ? 33.620  -22.607 -59.037 1.00 26.34 ? 87  ASP B OD2  1 
ATOM   6345  H H    . ASP B 1 87  ? 31.815  -20.267 -59.985 1.00 26.02 ? 87  ASP B H    1 
ATOM   6346  H HA   . ASP B 1 87  ? 30.404  -22.299 -60.995 1.00 26.66 ? 87  ASP B HA   1 
ATOM   6347  H HB2  . ASP B 1 87  ? 31.403  -21.925 -58.374 1.00 29.46 ? 87  ASP B HB2  1 
ATOM   6348  H HB3  . ASP B 1 87  ? 30.706  -23.264 -58.868 1.00 29.46 ? 87  ASP B HB3  1 
ATOM   6349  N N    . ILE B 1 88  ? 29.006  -20.160 -59.111 1.00 25.19 ? 88  ILE B N    1 
ATOM   6350  C CA   . ILE B 1 88  ? 27.763  -19.693 -58.509 1.00 16.12 ? 88  ILE B CA   1 
ATOM   6351  C C    . ILE B 1 88  ? 27.507  -18.276 -59.017 1.00 18.81 ? 88  ILE B C    1 
ATOM   6352  O O    . ILE B 1 88  ? 28.357  -17.392 -58.868 1.00 17.25 ? 88  ILE B O    1 
ATOM   6353  C CB   . ILE B 1 88  ? 27.824  -19.735 -56.966 1.00 16.34 ? 88  ILE B CB   1 
ATOM   6354  C CG1  . ILE B 1 88  ? 27.947  -21.173 -56.460 1.00 22.45 ? 88  ILE B CG1  1 
ATOM   6355  C CG2  . ILE B 1 88  ? 26.585  -19.087 -56.343 1.00 19.95 ? 88  ILE B CG2  1 
ATOM   6356  C CD1  . ILE B 1 88  ? 28.203  -21.288 -54.981 1.00 25.87 ? 88  ILE B CD1  1 
ATOM   6357  H H    . ILE B 1 88  ? 29.650  -19.593 -59.044 1.00 30.21 ? 88  ILE B H    1 
ATOM   6358  H HA   . ILE B 1 88  ? 27.031  -20.259 -58.802 1.00 19.32 ? 88  ILE B HA   1 
ATOM   6359  H HB   . ILE B 1 88  ? 28.606  -19.240 -56.677 1.00 19.59 ? 88  ILE B HB   1 
ATOM   6360  H HG12 . ILE B 1 88  ? 27.121  -21.644 -56.655 1.00 26.92 ? 88  ILE B HG12 1 
ATOM   6361  H HG13 . ILE B 1 88  ? 28.685  -21.603 -56.921 1.00 26.92 ? 88  ILE B HG13 1 
ATOM   6362  H HG21 . ILE B 1 88  ? 26.658  -19.132 -55.377 1.00 23.92 ? 88  ILE B HG21 1 
ATOM   6363  H HG22 . ILE B 1 88  ? 26.535  -18.162 -56.629 1.00 23.92 ? 88  ILE B HG22 1 
ATOM   6364  H HG23 . ILE B 1 88  ? 25.796  -19.568 -56.639 1.00 23.92 ? 88  ILE B HG23 1 
ATOM   6365  H HD11 . ILE B 1 88  ? 28.268  -22.226 -54.743 1.00 31.02 ? 88  ILE B HD11 1 
ATOM   6366  H HD12 . ILE B 1 88  ? 29.033  -20.834 -54.768 1.00 31.02 ? 88  ILE B HD12 1 
ATOM   6367  H HD13 . ILE B 1 88  ? 27.468  -20.875 -54.501 1.00 31.02 ? 88  ILE B HD13 1 
ATOM   6368  N N    . LEU B 1 89  ? 26.341  -18.070 -59.629 1.00 18.45 ? 89  LEU B N    1 
ATOM   6369  C CA   . LEU B 1 89  ? 25.913  -16.782 -60.151 1.00 19.51 ? 89  LEU B CA   1 
ATOM   6370  C C    . LEU B 1 89  ? 24.720  -16.287 -59.351 1.00 21.66 ? 89  LEU B C    1 
ATOM   6371  O O    . LEU B 1 89  ? 23.721  -17.004 -59.200 1.00 16.64 ? 89  LEU B O    1 
ATOM   6372  C CB   . LEU B 1 89  ? 25.504  -16.850 -61.623 1.00 17.22 ? 89  LEU B CB   1 
ATOM   6373  C CG   . LEU B 1 89  ? 26.650  -16.849 -62.637 1.00 25.91 ? 89  LEU B CG   1 
ATOM   6374  C CD1  . LEU B 1 89  ? 27.423  -18.113 -62.528 1.00 27.94 ? 89  LEU B CD1  1 
ATOM   6375  C CD2  . LEU B 1 89  ? 26.104  -16.687 -64.024 1.00 33.07 ? 89  LEU B CD2  1 
ATOM   6376  H H    . LEU B 1 89  ? 25.760  -18.692 -59.756 1.00 22.12 ? 89  LEU B H    1 
ATOM   6377  H HA   . LEU B 1 89  ? 26.634  -16.140 -60.060 1.00 23.39 ? 89  LEU B HA   1 
ATOM   6378  H HB2  . LEU B 1 89  ? 24.996  -17.665 -61.761 1.00 20.64 ? 89  LEU B HB2  1 
ATOM   6379  H HB3  . LEU B 1 89  ? 24.943  -16.084 -61.819 1.00 20.64 ? 89  LEU B HB3  1 
ATOM   6380  H HG   . LEU B 1 89  ? 27.246  -16.106 -62.452 1.00 31.07 ? 89  LEU B HG   1 
ATOM   6381  H HD11 . LEU B 1 89  ? 28.144  -18.098 -63.176 1.00 33.50 ? 89  LEU B HD11 1 
ATOM   6382  H HD12 . LEU B 1 89  ? 27.784  -18.186 -61.631 1.00 33.50 ? 89  LEU B HD12 1 
ATOM   6383  H HD13 . LEU B 1 89  ? 26.831  -18.861 -62.709 1.00 33.50 ? 89  LEU B HD13 1 
ATOM   6384  H HD21 . LEU B 1 89  ? 26.840  -16.688 -64.655 1.00 39.66 ? 89  LEU B HD21 1 
ATOM   6385  H HD22 . LEU B 1 89  ? 25.503  -17.424 -64.215 1.00 39.66 ? 89  LEU B HD22 1 
ATOM   6386  H HD23 . LEU B 1 89  ? 25.623  -15.846 -64.078 1.00 39.66 ? 89  LEU B HD23 1 
ATOM   6387  N N    . ILE B 1 90  ? 24.833  -15.059 -58.877 1.00 17.17 ? 90  ILE B N    1 
ATOM   6388  C CA   . ILE B 1 90  ? 23.827  -14.374 -58.077 1.00 19.04 ? 90  ILE B CA   1 
ATOM   6389  C C    . ILE B 1 90  ? 23.241  -13.288 -58.978 1.00 17.06 ? 90  ILE B C    1 
ATOM   6390  O O    . ILE B 1 90  ? 23.928  -12.332 -59.331 1.00 15.54 ? 90  ILE B O    1 
ATOM   6391  C CB   . ILE B 1 90  ? 24.448  -13.782 -56.801 1.00 17.38 ? 90  ILE B CB   1 
ATOM   6392  C CG1  . ILE B 1 90  ? 25.132  -14.875 -55.967 1.00 18.40 ? 90  ILE B CG1  1 
ATOM   6393  C CG2  . ILE B 1 90  ? 23.415  -12.994 -55.979 1.00 19.86 ? 90  ILE B CG2  1 
ATOM   6394  C CD1  . ILE B 1 90  ? 25.955  -14.361 -54.803 1.00 22.29 ? 90  ILE B CD1  1 
ATOM   6395  H H    . ILE B 1 90  ? 25.529  -14.572 -59.015 1.00 20.59 ? 90  ILE B H    1 
ATOM   6396  H HA   . ILE B 1 90  ? 23.123  -14.993 -57.828 1.00 22.83 ? 90  ILE B HA   1 
ATOM   6397  H HB   . ILE B 1 90  ? 25.136  -13.157 -57.078 1.00 20.83 ? 90  ILE B HB   1 
ATOM   6398  H HG12 . ILE B 1 90  ? 24.450  -15.463 -55.607 1.00 22.05 ? 90  ILE B HG12 1 
ATOM   6399  H HG13 . ILE B 1 90  ? 25.725  -15.381 -56.545 1.00 22.05 ? 90  ILE B HG13 1 
ATOM   6400  H HG21 . ILE B 1 90  ? 23.847  -12.639 -55.186 1.00 23.82 ? 90  ILE B HG21 1 
ATOM   6401  H HG22 . ILE B 1 90  ? 23.069  -12.268 -56.521 1.00 23.82 ? 90  ILE B HG22 1 
ATOM   6402  H HG23 . ILE B 1 90  ? 22.693  -13.590 -55.725 1.00 23.82 ? 90  ILE B HG23 1 
ATOM   6403  H HD11 . ILE B 1 90  ? 26.347  -15.115 -54.337 1.00 26.72 ? 90  ILE B HD11 1 
ATOM   6404  H HD12 . ILE B 1 90  ? 26.655  -13.782 -55.144 1.00 26.72 ? 90  ILE B HD12 1 
ATOM   6405  H HD13 . ILE B 1 90  ? 25.377  -13.864 -54.204 1.00 26.72 ? 90  ILE B HD13 1 
ATOM   6406  N N    . PHE B 1 91  ? 21.980  -13.451 -59.382 1.00 15.82 ? 91  PHE B N    1 
ATOM   6407  C CA   . PHE B 1 91  ? 21.306  -12.524 -60.276 1.00 18.88 ? 91  PHE B CA   1 
ATOM   6408  C C    . PHE B 1 91  ? 20.588  -11.468 -59.451 1.00 17.88 ? 91  PHE B C    1 
ATOM   6409  O O    . PHE B 1 91  ? 19.632  -11.767 -58.718 1.00 19.40 ? 91  PHE B O    1 
ATOM   6410  C CB   . PHE B 1 91  ? 20.349  -13.294 -61.190 1.00 14.83 ? 91  PHE B CB   1 
ATOM   6411  C CG   . PHE B 1 91  ? 21.080  -14.227 -62.106 1.00 14.49 ? 91  PHE B CG   1 
ATOM   6412  C CD1  . PHE B 1 91  ? 21.595  -13.773 -63.313 1.00 19.52 ? 91  PHE B CD1  1 
ATOM   6413  C CD2  . PHE B 1 91  ? 21.323  -15.519 -61.739 1.00 19.53 ? 91  PHE B CD2  1 
ATOM   6414  C CE1  . PHE B 1 91  ? 22.290  -14.621 -64.142 1.00 23.01 ? 91  PHE B CE1  1 
ATOM   6415  C CE2  . PHE B 1 91  ? 22.023  -16.383 -62.590 1.00 19.54 ? 91  PHE B CE2  1 
ATOM   6416  C CZ   . PHE B 1 91  ? 22.498  -15.934 -63.775 1.00 18.16 ? 91  PHE B CZ   1 
ATOM   6417  H H    . PHE B 1 91  ? 21.485  -14.113 -59.141 1.00 18.96 ? 91  PHE B H    1 
ATOM   6418  H HA   . PHE B 1 91  ? 21.965  -12.079 -60.831 1.00 22.63 ? 91  PHE B HA   1 
ATOM   6419  H HB2  . PHE B 1 91  ? 19.741  -13.818 -60.646 1.00 17.77 ? 91  PHE B HB2  1 
ATOM   6420  H HB3  . PHE B 1 91  ? 19.852  -12.663 -61.735 1.00 17.77 ? 91  PHE B HB3  1 
ATOM   6421  H HD1  . PHE B 1 91  ? 21.452  -12.892 -63.572 1.00 23.41 ? 91  PHE B HD1  1 
ATOM   6422  H HD2  . PHE B 1 91  ? 20.992  -15.838 -60.931 1.00 23.41 ? 91  PHE B HD2  1 
ATOM   6423  H HE1  . PHE B 1 91  ? 22.614  -14.310 -64.956 1.00 27.60 ? 91  PHE B HE1  1 
ATOM   6424  H HE2  . PHE B 1 91  ? 22.168  -17.266 -62.337 1.00 23.43 ? 91  PHE B HE2  1 
ATOM   6425  H HZ   . PHE B 1 91  ? 22.970  -16.506 -64.335 1.00 21.77 ? 91  PHE B HZ   1 
ATOM   6426  N N    . VAL B 1 92  ? 21.054  -10.228 -59.564 1.00 18.43 ? 92  VAL B N    1 
ATOM   6427  C CA   . VAL B 1 92  ? 20.524  -9.139  -58.751 1.00 21.58 ? 92  VAL B CA   1 
ATOM   6428  C C    . VAL B 1 92  ? 20.470  -7.888  -59.625 1.00 22.61 ? 92  VAL B C    1 
ATOM   6429  O O    . VAL B 1 92  ? 21.151  -6.893  -59.383 1.00 25.13 ? 92  VAL B O    1 
ATOM   6430  C CB   . VAL B 1 92  ? 21.362  -8.974  -57.462 1.00 21.94 ? 92  VAL B CB   1 
ATOM   6431  C CG1  . VAL B 1 92  ? 22.828  -8.736  -57.773 1.00 24.97 ? 92  VAL B CG1  1 
ATOM   6432  C CG2  . VAL B 1 92  ? 20.807  -7.898  -56.563 1.00 27.18 ? 92  VAL B CG2  1 
ATOM   6433  H H    . VAL B 1 92  ? 21.679  -9.991  -60.105 1.00 22.09 ? 92  VAL B H    1 
ATOM   6434  H HA   . VAL B 1 92  ? 19.616  -9.357  -58.488 1.00 25.88 ? 92  VAL B HA   1 
ATOM   6435  H HB   . VAL B 1 92  ? 21.312  -9.807  -56.967 1.00 26.31 ? 92  VAL B HB   1 
ATOM   6436  H HG11 . VAL B 1 92  ? 23.315  -8.638  -56.940 1.00 29.94 ? 92  VAL B HG11 1 
ATOM   6437  H HG12 . VAL B 1 92  ? 23.172  -9.493  -58.271 1.00 29.94 ? 92  VAL B HG12 1 
ATOM   6438  H HG13 . VAL B 1 92  ? 22.911  -7.926  -58.301 1.00 29.94 ? 92  VAL B HG13 1 
ATOM   6439  H HG21 . VAL B 1 92  ? 21.363  -7.832  -55.771 1.00 32.59 ? 92  VAL B HG21 1 
ATOM   6440  H HG22 . VAL B 1 92  ? 20.810  -7.055  -57.042 1.00 32.59 ? 92  VAL B HG22 1 
ATOM   6441  H HG23 . VAL B 1 92  ? 19.900  -8.134  -56.312 1.00 32.59 ? 92  VAL B HG23 1 
ATOM   6442  N N    . VAL B 1 93  ? 19.685  -7.957  -60.694 1.00 26.61 ? 93  VAL B N    1 
ATOM   6443  C CA   . VAL B 1 93  ? 19.462  -6.813  -61.566 1.00 25.51 ? 93  VAL B CA   1 
ATOM   6444  C C    . VAL B 1 93  ? 17.967  -6.564  -61.598 1.00 30.49 ? 93  VAL B C    1 
ATOM   6445  O O    . VAL B 1 93  ? 17.183  -7.411  -61.143 1.00 24.53 ? 93  VAL B O    1 
ATOM   6446  C CB   . VAL B 1 93  ? 19.983  -7.039  -62.995 1.00 24.23 ? 93  VAL B CB   1 
ATOM   6447  C CG1  . VAL B 1 93  ? 21.468  -7.107  -63.021 1.00 25.57 ? 93  VAL B CG1  1 
ATOM   6448  C CG2  . VAL B 1 93  ? 19.368  -8.288  -63.590 1.00 23.98 ? 93  VAL B CG2  1 
ATOM   6449  H H    . VAL B 1 93  ? 19.264  -8.667  -60.938 1.00 31.91 ? 93  VAL B H    1 
ATOM   6450  H HA   . VAL B 1 93  ? 19.899  -6.030  -61.196 1.00 30.59 ? 93  VAL B HA   1 
ATOM   6451  H HB   . VAL B 1 93  ? 19.714  -6.288  -63.546 1.00 29.05 ? 93  VAL B HB   1 
ATOM   6452  H HG11 . VAL B 1 93  ? 21.761  -7.250  -63.935 1.00 30.66 ? 93  VAL B HG11 1 
ATOM   6453  H HG12 . VAL B 1 93  ? 21.828  -6.272  -62.685 1.00 30.66 ? 93  VAL B HG12 1 
ATOM   6454  H HG13 . VAL B 1 93  ? 21.760  -7.843  -62.461 1.00 30.66 ? 93  VAL B HG13 1 
ATOM   6455  H HG21 . VAL B 1 93  ? 19.710  -8.411  -64.489 1.00 28.75 ? 93  VAL B HG21 1 
ATOM   6456  H HG22 . VAL B 1 93  ? 19.605  -9.050  -63.038 1.00 28.75 ? 93  VAL B HG22 1 
ATOM   6457  H HG23 . VAL B 1 93  ? 18.404  -8.184  -63.614 1.00 28.75 ? 93  VAL B HG23 1 
ATOM   6458  N N    . PRO B 1 94  ? 17.529  -5.429  -62.123 1.00 30.99 ? 94  PRO B N    1 
ATOM   6459  C CA   . PRO B 1 94  ? 16.092  -5.216  -62.261 1.00 29.08 ? 94  PRO B CA   1 
ATOM   6460  C C    . PRO B 1 94  ? 15.470  -6.171  -63.267 1.00 28.52 ? 94  PRO B C    1 
ATOM   6461  O O    . PRO B 1 94  ? 16.078  -6.545  -64.273 1.00 27.77 ? 94  PRO B O    1 
ATOM   6462  C CB   . PRO B 1 94  ? 15.994  -3.764  -62.723 1.00 27.36 ? 94  PRO B CB   1 
ATOM   6463  C CG   . PRO B 1 94  ? 17.216  -3.116  -62.162 1.00 31.08 ? 94  PRO B CG   1 
ATOM   6464  C CD   . PRO B 1 94  ? 18.293  -4.172  -62.251 1.00 26.06 ? 94  PRO B CD   1 
ATOM   6465  H HA   . PRO B 1 94  ? 15.650  -5.313  -61.403 1.00 34.88 ? 94  PRO B HA   1 
ATOM   6466  H HB2  . PRO B 1 94  ? 15.997  -3.725  -63.692 1.00 32.81 ? 94  PRO B HB2  1 
ATOM   6467  H HB3  . PRO B 1 94  ? 15.191  -3.357  -62.363 1.00 32.81 ? 94  PRO B HB3  1 
ATOM   6468  H HG2  . PRO B 1 94  ? 17.450  -2.341  -62.696 1.00 37.27 ? 94  PRO B HG2  1 
ATOM   6469  H HG3  . PRO B 1 94  ? 17.057  -2.863  -61.239 1.00 37.27 ? 94  PRO B HG3  1 
ATOM   6470  H HD2  . PRO B 1 94  ? 18.740  -4.131  -63.111 1.00 31.24 ? 94  PRO B HD2  1 
ATOM   6471  H HD3  . PRO B 1 94  ? 18.921  -4.080  -61.517 1.00 31.24 ? 94  PRO B HD3  1 
ATOM   6472  N N    . HIS B 1 95  ? 14.237  -6.568  -62.955 1.00 32.48 ? 95  HIS B N    1 
ATOM   6473  C CA   . HIS B 1 95  ? 13.396  -7.420  -63.777 1.00 38.14 ? 95  HIS B CA   1 
ATOM   6474  C C    . HIS B 1 95  ? 13.507  -7.010  -65.243 1.00 37.21 ? 95  HIS B C    1 
ATOM   6475  O O    . HIS B 1 95  ? 13.658  -7.869  -66.118 1.00 29.84 ? 95  HIS B O    1 
ATOM   6476  C CB   . HIS B 1 95  ? 11.957  -7.314  -63.239 1.00 39.52 ? 95  HIS B CB   1 
ATOM   6477  C CG   . HIS B 1 95  ? 10.982  -8.269  -63.849 1.00 50.30 ? 95  HIS B CG   1 
ATOM   6478  N ND1  . HIS B 1 95  ? 11.360  -9.374  -64.583 1.00 49.55 ? 95  HIS B ND1  1 
ATOM   6479  C CD2  . HIS B 1 95  ? 9.626   -8.285  -63.816 1.00 52.47 ? 95  HIS B CD2  1 
ATOM   6480  C CE1  . HIS B 1 95  ? 10.280  -10.023 -64.983 1.00 52.01 ? 95  HIS B CE1  1 
ATOM   6481  N NE2  . HIS B 1 95  ? 9.216   -9.383  -64.530 1.00 53.49 ? 95  HIS B NE2  1 
ATOM   6482  H H    . HIS B 1 95  ? 13.849  -6.338  -62.223 1.00 38.96 ? 95  HIS B H    1 
ATOM   6483  H HA   . HIS B 1 95  ? 13.689  -8.341  -63.693 1.00 45.75 ? 95  HIS B HA   1 
ATOM   6484  H HB2  . HIS B 1 95  ? 11.971  -7.480  -62.283 1.00 47.40 ? 95  HIS B HB2  1 
ATOM   6485  H HB3  . HIS B 1 95  ? 11.630  -6.416  -63.407 1.00 47.40 ? 95  HIS B HB3  1 
ATOM   6486  H HD1  . HIS B 1 95  ? 12.171  -9.602  -64.757 1.00 59.44 ? 95  HIS B HD1  1 
ATOM   6487  H HD2  . HIS B 1 95  ? 9.077   -7.665  -63.393 1.00 62.95 ? 95  HIS B HD2  1 
ATOM   6488  H HE1  . HIS B 1 95  ? 10.271  -10.800 -65.494 1.00 62.39 ? 95  HIS B HE1  1 
ATOM   6489  N N    . GLN B 1 96  ? 13.463  -5.691  -65.496 1.00 32.21 ? 96  GLN B N    1 
ATOM   6490  C CA   . GLN B 1 96  ? 13.500  -5.139  -66.856 1.00 36.63 ? 96  GLN B CA   1 
ATOM   6491  C C    . GLN B 1 96  ? 14.652  -5.678  -67.687 1.00 37.07 ? 96  GLN B C    1 
ATOM   6492  O O    . GLN B 1 96  ? 14.549  -5.725  -68.919 1.00 35.29 ? 96  GLN B O    1 
ATOM   6493  C CB   . GLN B 1 96  ? 13.652  -3.613  -66.841 1.00 40.16 ? 96  GLN B CB   1 
ATOM   6494  C CG   . GLN B 1 96  ? 12.550  -2.836  -66.192 1.00 51.01 ? 96  GLN B CG   1 
ATOM   6495  C CD   . GLN B 1 96  ? 12.762  -2.697  -64.708 1.00 48.14 ? 96  GLN B CD   1 
ATOM   6496  O OE1  . GLN B 1 96  ? 12.600  -3.661  -63.951 1.00 42.32 ? 96  GLN B OE1  1 
ATOM   6497  N NE2  . GLN B 1 96  ? 13.133  -1.492  -64.276 1.00 49.73 ? 96  GLN B NE2  1 
ATOM   6498  H H    . GLN B 1 96  ? 13.412  -5.089  -64.884 1.00 38.63 ? 96  GLN B H    1 
ATOM   6499  H HA   . GLN B 1 96  ? 12.671  -5.356  -67.311 1.00 43.94 ? 96  GLN B HA   1 
ATOM   6500  H HB2  . GLN B 1 96  ? 14.473  -3.396  -66.371 1.00 48.17 ? 96  GLN B HB2  1 
ATOM   6501  H HB3  . GLN B 1 96  ? 13.718  -3.306  -67.759 1.00 48.17 ? 96  GLN B HB3  1 
ATOM   6502  H HG2  . GLN B 1 96  ? 12.517  -1.947  -66.578 1.00 61.19 ? 96  GLN B HG2  1 
ATOM   6503  H HG3  . GLN B 1 96  ? 11.708  -3.296  -66.336 1.00 61.19 ? 96  GLN B HG3  1 
ATOM   6504  H HE21 . GLN B 1 96  ? 13.236  -0.847  -64.836 1.00 59.65 ? 96  GLN B HE21 1 
ATOM   6505  H HE22 . GLN B 1 96  ? 13.268  -1.359  -63.437 1.00 59.65 ? 96  GLN B HE22 1 
ATOM   6506  N N    . PHE B 1 97  ? 15.784  -5.997  -67.052 1.00 28.36 ? 97  PHE B N    1 
ATOM   6507  C CA   . PHE B 1 97  ? 17.030  -6.226  -67.773 1.00 29.58 ? 97  PHE B CA   1 
ATOM   6508  C C    . PHE B 1 97  ? 17.482  -7.671  -67.803 1.00 25.96 ? 97  PHE B C    1 
ATOM   6509  O O    . PHE B 1 97  ? 18.415  -7.994  -68.547 1.00 23.67 ? 97  PHE B O    1 
ATOM   6510  C CB   . PHE B 1 97  ? 18.131  -5.366  -67.160 1.00 27.84 ? 97  PHE B CB   1 
ATOM   6511  C CG   . PHE B 1 97  ? 17.831  -3.909  -67.248 1.00 39.98 ? 97  PHE B CG   1 
ATOM   6512  C CD1  . PHE B 1 97  ? 17.829  -3.268  -68.484 1.00 42.99 ? 97  PHE B CD1  1 
ATOM   6513  C CD2  . PHE B 1 97  ? 17.492  -3.184  -66.117 1.00 39.75 ? 97  PHE B CD2  1 
ATOM   6514  C CE1  . PHE B 1 97  ? 17.522  -1.928  -68.587 1.00 44.79 ? 97  PHE B CE1  1 
ATOM   6515  C CE2  . PHE B 1 97  ? 17.183  -1.828  -66.211 1.00 45.24 ? 97  PHE B CE2  1 
ATOM   6516  C CZ   . PHE B 1 97  ? 17.196  -1.205  -67.447 1.00 46.42 ? 97  PHE B CZ   1 
ATOM   6517  H H    . PHE B 1 97  ? 15.853  -6.087  -66.199 1.00 34.01 ? 97  PHE B H    1 
ATOM   6518  H HA   . PHE B 1 97  ? 16.911  -5.938  -68.691 1.00 35.47 ? 97  PHE B HA   1 
ATOM   6519  H HB2  . PHE B 1 97  ? 18.229  -5.597  -66.223 1.00 33.39 ? 97  PHE B HB2  1 
ATOM   6520  H HB3  . PHE B 1 97  ? 18.961  -5.532  -67.633 1.00 33.39 ? 97  PHE B HB3  1 
ATOM   6521  H HD1  . PHE B 1 97  ? 18.044  -3.750  -69.251 1.00 51.56 ? 97  PHE B HD1  1 
ATOM   6522  H HD2  . PHE B 1 97  ? 17.480  -3.604  -65.287 1.00 47.68 ? 97  PHE B HD2  1 
ATOM   6523  H HE1  . PHE B 1 97  ? 17.534  -1.509  -69.417 1.00 53.73 ? 97  PHE B HE1  1 
ATOM   6524  H HE2  . PHE B 1 97  ? 16.966  -1.344  -65.447 1.00 54.26 ? 97  PHE B HE2  1 
ATOM   6525  H HZ   . PHE B 1 97  ? 16.995  -0.300  -67.513 1.00 55.68 ? 97  PHE B HZ   1 
ATOM   6526  N N    . ILE B 1 98  ? 16.848  -8.546  -67.026 1.00 25.62 ? 98  ILE B N    1 
ATOM   6527  C CA   . ILE B 1 98  ? 17.395  -9.886  -66.869 1.00 32.70 ? 98  ILE B CA   1 
ATOM   6528  C C    . ILE B 1 98  ? 17.332  -10.652 -68.191 1.00 25.15 ? 98  ILE B C    1 
ATOM   6529  O O    . ILE B 1 98  ? 18.235  -11.434 -68.504 1.00 23.37 ? 98  ILE B O    1 
ATOM   6530  C CB   . ILE B 1 98  ? 16.655  -10.610 -65.733 1.00 24.46 ? 98  ILE B CB   1 
ATOM   6531  C CG1  . ILE B 1 98  ? 17.287  -11.961 -65.480 1.00 21.37 ? 98  ILE B CG1  1 
ATOM   6532  C CG2  . ILE B 1 98  ? 15.150  -10.754 -66.063 1.00 23.70 ? 98  ILE B CG2  1 
ATOM   6533  C CD1  . ILE B 1 98  ? 18.710  -11.904 -64.994 1.00 25.49 ? 98  ILE B CD1  1 
ATOM   6534  H H    . ILE B 1 98  ? 16.121  -8.395  -66.592 1.00 30.73 ? 98  ILE B H    1 
ATOM   6535  H HA   . ILE B 1 98  ? 18.328  -9.813  -66.614 1.00 39.22 ? 98  ILE B HA   1 
ATOM   6536  H HB   . ILE B 1 98  ? 16.741  -10.079 -64.927 1.00 29.34 ? 98  ILE B HB   1 
ATOM   6537  H HG12 . ILE B 1 98  ? 16.765  -12.426 -64.808 1.00 25.62 ? 98  ILE B HG12 1 
ATOM   6538  H HG13 . ILE B 1 98  ? 17.279  -12.467 -66.308 1.00 25.62 ? 98  ILE B HG13 1 
ATOM   6539  H HG21 . ILE B 1 98  ? 14.710  -11.214 -65.331 1.00 28.42 ? 98  ILE B HG21 1 
ATOM   6540  H HG22 . ILE B 1 98  ? 14.767  -9.870  -66.177 1.00 28.42 ? 98  ILE B HG22 1 
ATOM   6541  H HG23 . ILE B 1 98  ? 15.054  -11.266 -66.881 1.00 28.42 ? 98  ILE B HG23 1 
ATOM   6542  H HD11 . ILE B 1 98  ? 19.034  -12.808 -64.859 1.00 30.56 ? 98  ILE B HD11 1 
ATOM   6543  H HD12 . ILE B 1 98  ? 19.253  -11.454 -65.661 1.00 30.56 ? 98  ILE B HD12 1 
ATOM   6544  H HD13 . ILE B 1 98  ? 18.739  -11.413 -64.158 1.00 30.56 ? 98  ILE B HD13 1 
ATOM   6545  N N    . GLY B 1 99  ? 16.291  -10.418 -68.991 1.00 23.19 ? 99  GLY B N    1 
ATOM   6546  C CA   . GLY B 1 99  ? 16.203  -11.071 -70.291 1.00 28.84 ? 99  GLY B CA   1 
ATOM   6547  C C    . GLY B 1 99  ? 17.370  -10.732 -71.198 1.00 25.66 ? 99  GLY B C    1 
ATOM   6548  O O    . GLY B 1 99  ? 17.952  -11.614 -71.829 1.00 26.67 ? 99  GLY B O    1 
ATOM   6549  H H    . GLY B 1 99  ? 15.634  -9.895  -68.806 1.00 27.80 ? 99  GLY B H    1 
ATOM   6550  H HA2  . GLY B 1 99  ? 16.180  -12.032 -70.168 1.00 34.59 ? 99  GLY B HA2  1 
ATOM   6551  H HA3  . GLY B 1 99  ? 15.383  -10.799 -70.733 1.00 34.59 ? 99  GLY B HA3  1 
ATOM   6552  N N    . LYS B 1 100 ? 17.711  -9.440  -71.298 1.00 22.45 ? 100 LYS B N    1 
ATOM   6553  C CA   . LYS B 1 100 ? 18.819  -9.017  -72.158 1.00 27.20 ? 100 LYS B CA   1 
ATOM   6554  C C    . LYS B 1 100 ? 20.143  -9.565  -71.649 1.00 27.09 ? 100 LYS B C    1 
ATOM   6555  O O    . LYS B 1 100 ? 20.996  -9.999  -72.438 1.00 25.43 ? 100 LYS B O    1 
ATOM   6556  C CB   . LYS B 1 100 ? 18.865  -7.492  -72.231 1.00 29.30 ? 100 LYS B CB   1 
ATOM   6557  C CG   . LYS B 1 100 ? 20.162  -6.882  -72.769 1.00 38.83 ? 100 LYS B CG   1 
ATOM   6558  C CD   . LYS B 1 100 ? 20.255  -6.900  -74.293 1.00 45.25 ? 100 LYS B CD   1 
ATOM   6559  C CE   . LYS B 1 100 ? 21.667  -6.524  -74.784 1.00 52.21 ? 100 LYS B CE   1 
ATOM   6560  N NZ   . LYS B 1 100 ? 21.847  -6.605  -76.291 1.00 47.08 ? 100 LYS B NZ   1 
ATOM   6561  H H    . LYS B 1 100 ? 17.319  -8.797  -70.881 1.00 26.91 ? 100 LYS B H    1 
ATOM   6562  H HA   . LYS B 1 100 ? 18.675  -9.359  -73.054 1.00 32.62 ? 100 LYS B HA   1 
ATOM   6563  H HB2  . LYS B 1 100 ? 18.144  -7.193  -72.808 1.00 35.13 ? 100 LYS B HB2  1 
ATOM   6564  H HB3  . LYS B 1 100 ? 18.729  -7.140  -71.338 1.00 35.13 ? 100 LYS B HB3  1 
ATOM   6565  H HG2  . LYS B 1 100 ? 20.218  -5.959  -72.479 1.00 46.57 ? 100 LYS B HG2  1 
ATOM   6566  H HG3  . LYS B 1 100 ? 20.913  -7.385  -72.419 1.00 46.57 ? 100 LYS B HG3  1 
ATOM   6567  H HD2  . LYS B 1 100 ? 20.050  -7.792  -74.615 1.00 54.28 ? 100 LYS B HD2  1 
ATOM   6568  H HD3  . LYS B 1 100 ? 19.626  -6.259  -74.659 1.00 54.28 ? 100 LYS B HD3  1 
ATOM   6569  H HE2  . LYS B 1 100 ? 21.858  -5.612  -74.513 1.00 62.63 ? 100 LYS B HE2  1 
ATOM   6570  H HE3  . LYS B 1 100 ? 22.309  -7.127  -74.378 1.00 62.63 ? 100 LYS B HE3  1 
ATOM   6571  H HZ1  . LYS B 1 100 ? 22.679  -6.377  -76.511 1.00 56.47 ? 100 LYS B HZ1  1 
ATOM   6572  H HZ2  . LYS B 1 100 ? 21.691  -7.435  -76.572 1.00 56.47 ? 100 LYS B HZ2  1 
ATOM   6573  H HZ3  . LYS B 1 100 ? 21.279  -6.052  -76.696 1.00 56.47 ? 100 LYS B HZ3  1 
ATOM   6574  N N    . ILE B 1 101 ? 20.332  -9.553  -70.330 1.00 28.93 ? 101 ILE B N    1 
ATOM   6575  C CA   . ILE B 1 101 ? 21.558  -10.073 -69.743 1.00 21.59 ? 101 ILE B CA   1 
ATOM   6576  C C    . ILE B 1 101 ? 21.695  -11.565 -70.013 1.00 23.57 ? 101 ILE B C    1 
ATOM   6577  O O    . ILE B 1 101 ? 22.785  -12.062 -70.298 1.00 21.61 ? 101 ILE B O    1 
ATOM   6578  C CB   . ILE B 1 101 ? 21.576  -9.773  -68.235 1.00 25.19 ? 101 ILE B CB   1 
ATOM   6579  C CG1  . ILE B 1 101 ? 21.709  -8.264  -68.007 1.00 22.27 ? 101 ILE B CG1  1 
ATOM   6580  C CG2  . ILE B 1 101 ? 22.718  -10.483 -67.549 1.00 26.61 ? 101 ILE B CG2  1 
ATOM   6581  C CD1  . ILE B 1 101 ? 21.285  -7.821  -66.623 1.00 28.87 ? 101 ILE B CD1  1 
ATOM   6582  H H    . ILE B 1 101 ? 19.765  -9.251  -69.758 1.00 34.69 ? 101 ILE B H    1 
ATOM   6583  H HA   . ILE B 1 101 ? 22.317  -9.624  -70.147 1.00 25.89 ? 101 ILE B HA   1 
ATOM   6584  H HB   . ILE B 1 101 ? 20.741  -10.076 -67.846 1.00 30.20 ? 101 ILE B HB   1 
ATOM   6585  H HG12 . ILE B 1 101 ? 22.637  -8.009  -68.129 1.00 26.70 ? 101 ILE B HG12 1 
ATOM   6586  H HG13 . ILE B 1 101 ? 21.153  -7.799  -68.652 1.00 26.70 ? 101 ILE B HG13 1 
ATOM   6587  H HG21 . ILE B 1 101 ? 22.698  -10.272 -66.603 1.00 31.91 ? 101 ILE B HG21 1 
ATOM   6588  H HG22 . ILE B 1 101 ? 22.617  -11.440 -67.677 1.00 31.91 ? 101 ILE B HG22 1 
ATOM   6589  H HG23 . ILE B 1 101 ? 23.555  -10.183 -67.938 1.00 31.91 ? 101 ILE B HG23 1 
ATOM   6590  H HD11 . ILE B 1 101 ? 21.395  -6.860  -66.551 1.00 34.62 ? 101 ILE B HD11 1 
ATOM   6591  H HD12 . ILE B 1 101 ? 20.354  -8.059  -66.487 1.00 34.62 ? 101 ILE B HD12 1 
ATOM   6592  H HD13 . ILE B 1 101 ? 21.840  -8.269  -65.965 1.00 34.62 ? 101 ILE B HD13 1 
ATOM   6593  N N    . CYS B 1 102 ? 20.606  -12.310 -69.885 1.00 22.99 ? 102 CYS B N    1 
ATOM   6594  C CA   . CYS B 1 102 ? 20.694  -13.741 -70.163 1.00 26.15 ? 102 CYS B CA   1 
ATOM   6595  C C    . CYS B 1 102 ? 21.023  -14.004 -71.632 1.00 25.21 ? 102 CYS B C    1 
ATOM   6596  O O    . CYS B 1 102 ? 21.758  -14.948 -71.959 1.00 26.13 ? 102 CYS B O    1 
ATOM   6597  C CB   . CYS B 1 102 ? 19.391  -14.402 -69.760 1.00 25.41 ? 102 CYS B CB   1 
ATOM   6598  S SG   . CYS B 1 102 ? 19.227  -14.529 -67.933 1.00 28.61 ? 102 CYS B SG   1 
ATOM   6599  H H    . CYS B 1 102 ? 19.829  -12.028 -69.647 1.00 27.56 ? 102 CYS B H    1 
ATOM   6600  H HA   . CYS B 1 102 ? 21.403  -14.124 -69.624 1.00 31.36 ? 102 CYS B HA   1 
ATOM   6601  H HB2  . CYS B 1 102 ? 18.648  -13.876 -70.096 1.00 30.47 ? 102 CYS B HB2  1 
ATOM   6602  H HB3  . CYS B 1 102 ? 19.360  -15.298 -70.131 1.00 30.47 ? 102 CYS B HB3  1 
ATOM   6603  H HG   . CYS B 1 102 ? 18.183  -15.059 -67.670 1.00 34.31 ? 102 CYS B HG   1 
ATOM   6604  N N    . ASP B 1 103 ? 20.485  -13.183 -72.528 1.00 25.30 ? 103 ASP B N    1 
ATOM   6605  C CA   . ASP B 1 103 ? 20.756  -13.358 -73.950 1.00 27.32 ? 103 ASP B CA   1 
ATOM   6606  C C    . ASP B 1 103 ? 22.223  -13.135 -74.270 1.00 27.95 ? 103 ASP B C    1 
ATOM   6607  O O    . ASP B 1 103 ? 22.733  -13.708 -75.235 1.00 29.64 ? 103 ASP B O    1 
ATOM   6608  C CB   . ASP B 1 103 ? 19.892  -12.401 -74.766 1.00 27.76 ? 103 ASP B CB   1 
ATOM   6609  C CG   . ASP B 1 103 ? 18.441  -12.843 -74.849 1.00 26.21 ? 103 ASP B CG   1 
ATOM   6610  O OD1  . ASP B 1 103 ? 18.109  -13.991 -74.484 1.00 30.47 ? 103 ASP B OD1  1 
ATOM   6611  O OD2  . ASP B 1 103 ? 17.633  -12.018 -75.286 1.00 33.78 ? 103 ASP B OD2  1 
ATOM   6612  H H    . ASP B 1 103 ? 19.964  -12.524 -72.342 1.00 30.34 ? 103 ASP B H    1 
ATOM   6613  H HA   . ASP B 1 103 ? 20.527  -14.265 -74.207 1.00 32.76 ? 103 ASP B HA   1 
ATOM   6614  H HB2  . ASP B 1 103 ? 19.915  -11.523 -74.353 1.00 33.29 ? 103 ASP B HB2  1 
ATOM   6615  H HB3  . ASP B 1 103 ? 20.243  -12.351 -75.669 1.00 33.29 ? 103 ASP B HB3  1 
ATOM   6616  N N    . GLN B 1 104 ? 22.912  -12.296 -73.490 1.00 24.99 ? 104 GLN B N    1 
ATOM   6617  C CA   . GLN B 1 104 ? 24.364  -12.140 -73.635 1.00 24.71 ? 104 GLN B CA   1 
ATOM   6618  C C    . GLN B 1 104 ? 25.145  -13.268 -72.979 1.00 27.06 ? 104 GLN B C    1 
ATOM   6619  O O    . GLN B 1 104 ? 26.232  -13.620 -73.455 1.00 22.64 ? 104 GLN B O    1 
ATOM   6620  C CB   . GLN B 1 104 ? 24.841  -10.812 -73.038 1.00 27.18 ? 104 GLN B CB   1 
ATOM   6621  C CG   . GLN B 1 104 ? 24.084  -9.598  -73.507 1.00 34.69 ? 104 GLN B CG   1 
ATOM   6622  C CD   . GLN B 1 104 ? 24.081  -9.462  -75.029 1.00 43.53 ? 104 GLN B CD   1 
ATOM   6623  O OE1  . GLN B 1 104 ? 23.060  -9.118  -75.617 1.00 41.03 ? 104 GLN B OE1  1 
ATOM   6624  N NE2  . GLN B 1 104 ? 25.228  -9.734  -75.664 1.00 45.71 ? 104 GLN B NE2  1 
ATOM   6625  H H    . GLN B 1 104 ? 22.565  -11.808 -72.873 1.00 29.96 ? 104 GLN B H    1 
ATOM   6626  H HA   . GLN B 1 104 ? 24.585  -12.137 -74.580 1.00 29.63 ? 104 GLN B HA   1 
ATOM   6627  H HB2  . GLN B 1 104 ? 24.752  -10.858 -72.074 1.00 32.59 ? 104 GLN B HB2  1 
ATOM   6628  H HB3  . GLN B 1 104 ? 25.773  -10.685 -73.274 1.00 32.59 ? 104 GLN B HB3  1 
ATOM   6629  H HG2  . GLN B 1 104 ? 23.163  -9.664  -73.210 1.00 41.61 ? 104 GLN B HG2  1 
ATOM   6630  H HG3  . GLN B 1 104 ? 24.498  -8.803  -73.135 1.00 41.61 ? 104 GLN B HG3  1 
ATOM   6631  H HE21 . GLN B 1 104 ? 25.922  -9.972  -75.215 1.00 54.83 ? 104 GLN B HE21 1 
ATOM   6632  H HE22 . GLN B 1 104 ? 25.271  -9.670  -76.520 1.00 54.83 ? 104 GLN B HE22 1 
ATOM   6633  N N    . LEU B 1 105 ? 24.639  -13.834 -71.879 1.00 25.37 ? 105 LEU B N    1 
ATOM   6634  C CA   . LEU B 1 105 ? 25.407  -14.849 -71.158 1.00 23.36 ? 105 LEU B CA   1 
ATOM   6635  C C    . LEU B 1 105 ? 25.244  -16.243 -71.754 1.00 24.23 ? 105 LEU B C    1 
ATOM   6636  O O    . LEU B 1 105 ? 26.117  -17.103 -71.567 1.00 23.78 ? 105 LEU B O    1 
ATOM   6637  C CB   . LEU B 1 105 ? 24.975  -14.898 -69.682 1.00 23.21 ? 105 LEU B CB   1 
ATOM   6638  C CG   . LEU B 1 105 ? 25.515  -13.769 -68.803 1.00 25.93 ? 105 LEU B CG   1 
ATOM   6639  C CD1  . LEU B 1 105 ? 24.886  -13.819 -67.378 1.00 21.85 ? 105 LEU B CD1  1 
ATOM   6640  C CD2  . LEU B 1 105 ? 27.024  -13.870 -68.697 1.00 20.68 ? 105 LEU B CD2  1 
ATOM   6641  H H    . LEU B 1 105 ? 23.871  -13.652 -71.538 1.00 30.42 ? 105 LEU B H    1 
ATOM   6642  H HA   . LEU B 1 105 ? 26.348  -14.616 -71.190 1.00 28.01 ? 105 LEU B HA   1 
ATOM   6643  H HB2  . LEU B 1 105 ? 24.007  -14.859 -69.644 1.00 27.83 ? 105 LEU B HB2  1 
ATOM   6644  H HB3  . LEU B 1 105 ? 25.281  -15.736 -69.301 1.00 27.83 ? 105 LEU B HB3  1 
ATOM   6645  H HG   . LEU B 1 105 ? 25.293  -12.915 -69.205 1.00 31.09 ? 105 LEU B HG   1 
ATOM   6646  H HD11 . LEU B 1 105 ? 25.249  -13.092 -66.848 1.00 26.20 ? 105 LEU B HD11 1 
ATOM   6647  H HD12 . LEU B 1 105 ? 23.924  -13.725 -67.455 1.00 26.20 ? 105 LEU B HD12 1 
ATOM   6648  H HD13 . LEU B 1 105 ? 25.104  -14.670 -66.967 1.00 26.20 ? 105 LEU B HD13 1 
ATOM   6649  H HD21 . LEU B 1 105 ? 27.349  -13.147 -68.137 1.00 24.79 ? 105 LEU B HD21 1 
ATOM   6650  H HD22 . LEU B 1 105 ? 27.256  -14.725 -68.303 1.00 24.79 ? 105 LEU B HD22 1 
ATOM   6651  H HD23 . LEU B 1 105 ? 27.408  -13.799 -69.585 1.00 24.79 ? 105 LEU B HD23 1 
ATOM   6652  N N    . LYS B 1 106 ? 24.112  -16.488 -72.401 1.00 22.09 ? 106 LYS B N    1 
ATOM   6653  C CA   . LYS B 1 106 ? 23.774  -17.801 -72.916 1.00 26.30 ? 106 LYS B CA   1 
ATOM   6654  C C    . LYS B 1 106 ? 24.952  -18.388 -73.656 1.00 30.20 ? 106 LYS B C    1 
ATOM   6655  O O    . LYS B 1 106 ? 25.464  -17.773 -74.598 1.00 28.65 ? 106 LYS B O    1 
ATOM   6656  C CB   . LYS B 1 106 ? 22.579  -17.698 -73.860 1.00 28.70 ? 106 LYS B CB   1 
ATOM   6657  C CG   . LYS B 1 106 ? 22.392  -18.977 -74.648 1.00 36.99 ? 106 LYS B CG   1 
ATOM   6658  C CD   . LYS B 1 106 ? 20.952  -19.306 -74.927 1.00 46.79 ? 106 LYS B CD   1 
ATOM   6659  C CE   . LYS B 1 106 ? 20.689  -20.807 -74.707 1.00 49.04 ? 106 LYS B CE   1 
ATOM   6660  N NZ   . LYS B 1 106 ? 19.235  -21.054 -74.468 1.00 46.58 ? 106 LYS B NZ   1 
ATOM   6661  H H    . LYS B 1 106 ? 23.511  -15.893 -72.557 1.00 26.49 ? 106 LYS B H    1 
ATOM   6662  H HA   . LYS B 1 106 ? 23.541  -18.391 -72.182 1.00 31.54 ? 106 LYS B HA   1 
ATOM   6663  H HB2  . LYS B 1 106 ? 21.773  -17.538 -73.344 1.00 34.42 ? 106 LYS B HB2  1 
ATOM   6664  H HB3  . LYS B 1 106 ? 22.726  -16.972 -74.487 1.00 34.42 ? 106 LYS B HB3  1 
ATOM   6665  H HG2  . LYS B 1 106 ? 22.848  -18.889 -75.500 1.00 44.37 ? 106 LYS B HG2  1 
ATOM   6666  H HG3  . LYS B 1 106 ? 22.774  -19.713 -74.145 1.00 44.37 ? 106 LYS B HG3  1 
ATOM   6667  H HD2  . LYS B 1 106 ? 20.383  -18.803 -74.324 1.00 56.13 ? 106 LYS B HD2  1 
ATOM   6668  H HD3  . LYS B 1 106 ? 20.744  -19.090 -75.850 1.00 56.13 ? 106 LYS B HD3  1 
ATOM   6669  H HE2  . LYS B 1 106 ? 20.959  -21.301 -75.496 1.00 58.83 ? 106 LYS B HE2  1 
ATOM   6670  H HE3  . LYS B 1 106 ? 21.184  -21.111 -73.930 1.00 58.83 ? 106 LYS B HE3  1 
ATOM   6671  H HZ1  . LYS B 1 106 ? 19.091  -21.923 -74.342 1.00 55.87 ? 106 LYS B HZ1  1 
ATOM   6672  H HZ2  . LYS B 1 106 ? 18.965  -20.608 -73.746 1.00 55.87 ? 106 LYS B HZ2  1 
ATOM   6673  H HZ3  . LYS B 1 106 ? 18.761  -20.781 -75.170 1.00 55.87 ? 106 LYS B HZ3  1 
ATOM   6674  N N    . GLY B 1 107 ? 25.378  -19.570 -73.206 1.00 26.60 ? 107 GLY B N    1 
ATOM   6675  C CA   . GLY B 1 107 ? 26.398  -20.341 -73.861 1.00 31.26 ? 107 GLY B CA   1 
ATOM   6676  C C    . GLY B 1 107 ? 27.795  -20.075 -73.370 1.00 36.41 ? 107 GLY B C    1 
ATOM   6677  O O    . GLY B 1 107 ? 28.719  -20.802 -73.753 1.00 29.35 ? 107 GLY B O    1 
ATOM   6678  H H    . GLY B 1 107 ? 25.071  -19.946 -72.496 1.00 31.90 ? 107 GLY B H    1 
ATOM   6679  H HA2  . GLY B 1 107 ? 26.210  -21.284 -73.735 1.00 37.49 ? 107 GLY B HA2  1 
ATOM   6680  H HA3  . GLY B 1 107 ? 26.373  -20.154 -74.812 1.00 37.49 ? 107 GLY B HA3  1 
ATOM   6681  N N    . HIS B 1 108 ? 27.988  -19.053 -72.546 1.00 27.56 ? 108 HIS B N    1 
ATOM   6682  C CA   . HIS B 1 108 ? 29.317  -18.659 -72.125 1.00 30.21 ? 108 HIS B CA   1 
ATOM   6683  C C    . HIS B 1 108 ? 29.612  -19.065 -70.698 1.00 29.97 ? 108 HIS B C    1 
ATOM   6684  O O    . HIS B 1 108 ? 30.635  -18.654 -70.151 1.00 33.70 ? 108 HIS B O    1 
ATOM   6685  C CB   . HIS B 1 108 ? 29.486  -17.148 -72.287 1.00 27.42 ? 108 HIS B CB   1 
ATOM   6686  C CG   . HIS B 1 108 ? 29.377  -16.691 -73.708 1.00 34.19 ? 108 HIS B CG   1 
ATOM   6687  N ND1  . HIS B 1 108 ? 30.269  -17.086 -74.682 1.00 39.45 ? 108 HIS B ND1  1 
ATOM   6688  C CD2  . HIS B 1 108 ? 28.464  -15.905 -74.330 1.00 37.32 ? 108 HIS B CD2  1 
ATOM   6689  C CE1  . HIS B 1 108 ? 29.920  -16.548 -75.838 1.00 38.81 ? 108 HIS B CE1  1 
ATOM   6690  N NE2  . HIS B 1 108 ? 28.831  -15.825 -75.651 1.00 41.65 ? 108 HIS B NE2  1 
ATOM   6691  H H    . HIS B 1 108 ? 27.357  -18.570 -72.216 1.00 33.05 ? 108 HIS B H    1 
ATOM   6692  H HA   . HIS B 1 108 ? 29.968  -19.094 -72.697 1.00 36.23 ? 108 HIS B HA   1 
ATOM   6693  H HB2  . HIS B 1 108 ? 28.796  -16.698 -71.775 1.00 32.89 ? 108 HIS B HB2  1 
ATOM   6694  H HB3  . HIS B 1 108 ? 30.362  -16.892 -71.957 1.00 32.89 ? 108 HIS B HB3  1 
ATOM   6695  H HD2  . HIS B 1 108 ? 27.733  -15.487 -73.933 1.00 44.76 ? 108 HIS B HD2  1 
ATOM   6696  H HE1  . HIS B 1 108 ? 30.368  -16.658 -76.645 1.00 46.55 ? 108 HIS B HE1  1 
ATOM   6697  H HE2  . HIS B 1 108 ? 28.416  -15.379 -76.259 1.00 49.95 ? 108 HIS B HE2  1 
ATOM   6698  N N    . LEU B 1 109 ? 28.755  -19.861 -70.080 1.00 32.05 ? 109 LEU B N    1 
ATOM   6699  C CA   . LEU B 1 109 ? 28.938  -20.155 -68.667 1.00 29.14 ? 109 LEU B CA   1 
ATOM   6700  C C    . LEU B 1 109 ? 29.722  -21.446 -68.480 1.00 31.39 ? 109 LEU B C    1 
ATOM   6701  O O    . LEU B 1 109 ? 29.857  -22.272 -69.382 1.00 29.88 ? 109 LEU B O    1 
ATOM   6702  C CB   . LEU B 1 109 ? 27.586  -20.242 -67.935 1.00 27.99 ? 109 LEU B CB   1 
ATOM   6703  C CG   . LEU B 1 109 ? 26.655  -19.033 -68.037 1.00 22.79 ? 109 LEU B CG   1 
ATOM   6704  C CD1  . LEU B 1 109 ? 25.312  -19.252 -67.269 1.00 25.54 ? 109 LEU B CD1  1 
ATOM   6705  C CD2  . LEU B 1 109 ? 27.355  -17.774 -67.511 1.00 30.26 ? 109 LEU B CD2  1 
ATOM   6706  H H    . LEU B 1 109 ? 28.073  -20.237 -70.445 1.00 38.44 ? 109 LEU B H    1 
ATOM   6707  H HA   . LEU B 1 109 ? 29.449  -19.436 -68.262 1.00 34.94 ? 109 LEU B HA   1 
ATOM   6708  H HB2  . LEU B 1 109 ? 27.102  -21.005 -68.289 1.00 33.57 ? 109 LEU B HB2  1 
ATOM   6709  H HB3  . LEU B 1 109 ? 27.763  -20.387 -66.993 1.00 33.57 ? 109 LEU B HB3  1 
ATOM   6710  H HG   . LEU B 1 109 ? 26.439  -18.884 -68.971 1.00 27.33 ? 109 LEU B HG   1 
ATOM   6711  H HD11 . LEU B 1 109 ? 24.761  -18.459 -67.366 1.00 30.63 ? 109 LEU B HD11 1 
ATOM   6712  H HD12 . LEU B 1 109 ? 24.856  -20.020 -67.646 1.00 30.63 ? 109 LEU B HD12 1 
ATOM   6713  H HD13 . LEU B 1 109 ? 25.507  -19.408 -66.332 1.00 30.63 ? 109 LEU B HD13 1 
ATOM   6714  H HD21 . LEU B 1 109 ? 26.747  -17.022 -67.585 1.00 36.29 ? 109 LEU B HD21 1 
ATOM   6715  H HD22 . LEU B 1 109 ? 27.598  -17.914 -66.583 1.00 36.29 ? 109 LEU B HD22 1 
ATOM   6716  H HD23 . LEU B 1 109 ? 28.150  -17.611 -68.042 1.00 36.29 ? 109 LEU B HD23 1 
ATOM   6717  N N    . LYS B 1 110 ? 30.255  -21.597 -67.284 1.00 26.41 ? 110 LYS B N    1 
ATOM   6718  C CA   . LYS B 1 110 ? 30.990  -22.787 -66.921 1.00 28.84 ? 110 LYS B CA   1 
ATOM   6719  C C    . LYS B 1 110 ? 30.038  -23.968 -66.803 1.00 30.31 ? 110 LYS B C    1 
ATOM   6720  O O    . LYS B 1 110 ? 28.885  -23.824 -66.396 1.00 24.06 ? 110 LYS B O    1 
ATOM   6721  C CB   . LYS B 1 110 ? 31.705  -22.528 -65.597 1.00 34.56 ? 110 LYS B CB   1 
ATOM   6722  C CG   . LYS B 1 110 ? 32.662  -23.585 -65.138 1.00 36.09 ? 110 LYS B CG   1 
ATOM   6723  C CD   . LYS B 1 110 ? 33.443  -23.065 -63.927 1.00 37.29 ? 110 LYS B CD   1 
ATOM   6724  C CE   . LYS B 1 110 ? 34.134  -24.201 -63.191 1.00 35.81 ? 110 LYS B CE   1 
ATOM   6725  N NZ   . LYS B 1 110 ? 35.109  -23.660 -62.224 1.00 39.36 ? 110 LYS B NZ   1 
ATOM   6726  H H    . LYS B 1 110 ? 30.203  -21.013 -66.655 1.00 31.67 ? 110 LYS B H    1 
ATOM   6727  H HA   . LYS B 1 110 ? 31.652  -22.986 -67.602 1.00 34.59 ? 110 LYS B HA   1 
ATOM   6728  H HB2  . LYS B 1 110 ? 32.207  -21.703 -65.680 1.00 41.45 ? 110 LYS B HB2  1 
ATOM   6729  H HB3  . LYS B 1 110 ? 31.034  -22.427 -64.904 1.00 41.45 ? 110 LYS B HB3  1 
ATOM   6730  H HG2  . LYS B 1 110 ? 32.171  -24.379 -64.874 1.00 43.28 ? 110 LYS B HG2  1 
ATOM   6731  H HG3  . LYS B 1 110 ? 33.290  -23.790 -65.848 1.00 43.28 ? 110 LYS B HG3  1 
ATOM   6732  H HD2  . LYS B 1 110 ? 34.120  -22.438 -64.226 1.00 44.72 ? 110 LYS B HD2  1 
ATOM   6733  H HD3  . LYS B 1 110 ? 32.830  -22.632 -63.312 1.00 44.72 ? 110 LYS B HD3  1 
ATOM   6734  H HE2  . LYS B 1 110 ? 33.476  -24.722 -62.706 1.00 42.95 ? 110 LYS B HE2  1 
ATOM   6735  H HE3  . LYS B 1 110 ? 34.608  -24.759 -63.827 1.00 42.95 ? 110 LYS B HE3  1 
ATOM   6736  H HZ1  . LYS B 1 110 ? 35.513  -24.326 -61.795 1.00 47.21 ? 110 LYS B HZ1  1 
ATOM   6737  H HZ2  . LYS B 1 110 ? 35.723  -23.176 -62.650 1.00 47.21 ? 110 LYS B HZ2  1 
ATOM   6738  H HZ3  . LYS B 1 110 ? 34.694  -23.143 -61.631 1.00 47.21 ? 110 LYS B HZ3  1 
ATOM   6739  N N    . ALA B 1 111 ? 30.513  -25.146 -67.194 1.00 29.76 ? 111 ALA B N    1 
ATOM   6740  C CA   . ALA B 1 111 ? 29.734  -26.349 -66.968 1.00 34.36 ? 111 ALA B CA   1 
ATOM   6741  C C    . ALA B 1 111 ? 29.492  -26.527 -65.475 1.00 31.70 ? 111 ALA B C    1 
ATOM   6742  O O    . ALA B 1 111 ? 30.340  -26.193 -64.644 1.00 36.95 ? 111 ALA B O    1 
ATOM   6743  C CB   . ALA B 1 111 ? 30.457  -27.568 -67.535 1.00 38.87 ? 111 ALA B CB   1 
ATOM   6744  H H    . ALA B 1 111 ? 31.269  -25.271 -67.584 1.00 35.70 ? 111 ALA B H    1 
ATOM   6745  H HA   . ALA B 1 111 ? 28.875  -26.267 -67.411 1.00 41.21 ? 111 ALA B HA   1 
ATOM   6746  H HB1  . ALA B 1 111 ? 29.919  -28.358 -67.372 1.00 46.63 ? 111 ALA B HB1  1 
ATOM   6747  H HB2  . ALA B 1 111 ? 30.584  -27.444 -68.489 1.00 46.63 ? 111 ALA B HB2  1 
ATOM   6748  H HB3  . ALA B 1 111 ? 31.317  -27.657 -67.095 1.00 46.63 ? 111 ALA B HB3  1 
ATOM   6749  N N    . ASN B 1 112 ? 28.329  -27.051 -65.132 1.00 32.06 ? 112 ASN B N    1 
ATOM   6750  C CA   . ASN B 1 112 ? 27.967  -27.304 -63.737 1.00 37.72 ? 112 ASN B CA   1 
ATOM   6751  C C    . ASN B 1 112 ? 27.760  -26.027 -62.928 1.00 34.16 ? 112 ASN B C    1 
ATOM   6752  O O    . ASN B 1 112 ? 27.606  -26.110 -61.690 1.00 27.44 ? 112 ASN B O    1 
ATOM   6753  C CB   . ASN B 1 112 ? 29.013  -28.166 -63.028 1.00 37.75 ? 112 ASN B CB   1 
ATOM   6754  C CG   . ASN B 1 112 ? 29.144  -29.553 -63.657 1.00 52.04 ? 112 ASN B CG   1 
ATOM   6755  O OD1  . ASN B 1 112 ? 28.183  -30.082 -64.238 1.00 48.71 ? 112 ASN B OD1  1 
ATOM   6756  N ND2  . ASN B 1 112 ? 30.332  -30.149 -63.540 1.00 53.35 ? 112 ASN B ND2  1 
ATOM   6757  H H    . ASN B 1 112 ? 27.718  -27.274 -65.694 1.00 38.45 ? 112 ASN B H    1 
ATOM   6758  H HA   . ASN B 1 112 ? 27.130  -27.794 -63.724 1.00 45.24 ? 112 ASN B HA   1 
ATOM   6759  H HB2  . ASN B 1 112 ? 29.877  -27.727 -63.084 1.00 45.28 ? 112 ASN B HB2  1 
ATOM   6760  H HB3  . ASN B 1 112 ? 28.756  -28.278 -62.100 1.00 45.28 ? 112 ASN B HB3  1 
ATOM   6761  H HD21 . ASN B 1 112 ? 30.456  -30.930 -63.876 1.00 64.00 ? 112 ASN B HD21 1 
ATOM   6762  H HD22 . ASN B 1 112 ? 30.974  -29.751 -63.129 1.00 64.00 ? 112 ASN B HD22 1 
ATOM   6763  N N    . ALA B 1 113 ? 27.759  -24.858 -63.579 1.00 26.27 ? 113 ALA B N    1 
ATOM   6764  C CA   . ALA B 1 113 ? 27.452  -23.613 -62.890 1.00 25.24 ? 113 ALA B CA   1 
ATOM   6765  C C    . ALA B 1 113 ? 26.014  -23.643 -62.380 1.00 25.04 ? 113 ALA B C    1 
ATOM   6766  O O    . ALA B 1 113 ? 25.136  -24.269 -62.976 1.00 20.51 ? 113 ALA B O    1 
ATOM   6767  C CB   . ALA B 1 113 ? 27.651  -22.428 -63.821 1.00 24.91 ? 113 ALA B CB   1 
ATOM   6768  H H    . ALA B 1 113 ? 27.934  -24.765 -64.416 1.00 31.50 ? 113 ALA B H    1 
ATOM   6769  H HA   . ALA B 1 113 ? 28.045  -23.509 -62.129 1.00 30.27 ? 113 ALA B HA   1 
ATOM   6770  H HB1  . ALA B 1 113 ? 27.441  -21.611 -63.342 1.00 29.88 ? 113 ALA B HB1  1 
ATOM   6771  H HB2  . ALA B 1 113 ? 28.575  -22.410 -64.116 1.00 29.88 ? 113 ALA B HB2  1 
ATOM   6772  H HB3  . ALA B 1 113 ? 27.062  -22.524 -64.586 1.00 29.88 ? 113 ALA B HB3  1 
ATOM   6773  N N    . THR B 1 114 ? 25.774  -22.952 -61.266 1.00 21.77 ? 114 THR B N    1 
ATOM   6774  C CA   . THR B 1 114 ? 24.458  -22.860 -60.660 1.00 20.01 ? 114 THR B CA   1 
ATOM   6775  C C    . THR B 1 114 ? 24.139  -21.389 -60.393 1.00 19.64 ? 114 THR B C    1 
ATOM   6776  O O    . THR B 1 114 ? 25.021  -20.525 -60.395 1.00 23.40 ? 114 THR B O    1 
ATOM   6777  C CB   . THR B 1 114 ? 24.379  -23.658 -59.351 1.00 25.05 ? 114 THR B CB   1 
ATOM   6778  O OG1  . THR B 1 114 ? 25.274  -23.075 -58.420 1.00 23.52 ? 114 THR B OG1  1 
ATOM   6779  C CG2  . THR B 1 114 ? 24.758  -25.134 -59.555 1.00 25.90 ? 114 THR B CG2  1 
ATOM   6780  H H    . THR B 1 114 ? 26.378  -22.519 -60.834 1.00 26.11 ? 114 THR B H    1 
ATOM   6781  H HA   . THR B 1 114 ? 23.794  -23.211 -61.274 1.00 23.98 ? 114 THR B HA   1 
ATOM   6782  H HB   . THR B 1 114 ? 23.475  -23.617 -59.001 1.00 30.04 ? 114 THR B HB   1 
ATOM   6783  H HG1  . THR B 1 114 ? 25.248  -23.497 -57.694 1.00 28.20 ? 114 THR B HG1  1 
ATOM   6784  H HG21 . THR B 1 114 ? 24.699  -25.610 -58.712 1.00 31.06 ? 114 THR B HG21 1 
ATOM   6785  H HG22 . THR B 1 114 ? 24.155  -25.546 -60.193 1.00 31.06 ? 114 THR B HG22 1 
ATOM   6786  H HG23 . THR B 1 114 ? 25.666  -25.199 -59.890 1.00 31.06 ? 114 THR B HG23 1 
ATOM   6787  N N    . GLY B 1 115 ? 22.856  -21.091 -60.211 1.00 20.14 ? 115 GLY B N    1 
ATOM   6788  C CA   . GLY B 1 115 ? 22.423  -19.718 -60.027 1.00 18.13 ? 115 GLY B CA   1 
ATOM   6789  C C    . GLY B 1 115 ? 21.462  -19.569 -58.865 1.00 21.18 ? 115 GLY B C    1 
ATOM   6790  O O    . GLY B 1 115 ? 20.794  -20.521 -58.440 1.00 18.45 ? 115 GLY B O    1 
ATOM   6791  H H    . GLY B 1 115 ? 22.219  -21.668 -60.192 1.00 24.14 ? 115 GLY B H    1 
ATOM   6792  H HA2  . GLY B 1 115 ? 23.195  -19.154 -59.863 1.00 21.73 ? 115 GLY B HA2  1 
ATOM   6793  H HA3  . GLY B 1 115 ? 21.981  -19.407 -60.833 1.00 21.73 ? 115 GLY B HA3  1 
ATOM   6794  N N    . ILE B 1 116 ? 21.373  -18.332 -58.375 1.00 18.45 ? 116 ILE B N    1 
ATOM   6795  C CA   . ILE B 1 116 ? 20.328  -17.961 -57.435 1.00 14.74 ? 116 ILE B CA   1 
ATOM   6796  C C    . ILE B 1 116 ? 19.803  -16.599 -57.853 1.00 17.78 ? 116 ILE B C    1 
ATOM   6797  O O    . ILE B 1 116 ? 20.575  -15.697 -58.198 1.00 16.25 ? 116 ILE B O    1 
ATOM   6798  C CB   . ILE B 1 116 ? 20.837  -17.974 -55.973 1.00 13.13 ? 116 ILE B CB   1 
ATOM   6799  C CG1  . ILE B 1 116 ? 19.732  -17.581 -54.992 1.00 19.96 ? 116 ILE B CG1  1 
ATOM   6800  C CG2  . ILE B 1 116 ? 22.043  -17.068 -55.846 1.00 17.35 ? 116 ILE B CG2  1 
ATOM   6801  C CD1  . ILE B 1 116 ? 20.013  -18.057 -53.548 1.00 18.06 ? 116 ILE B CD1  1 
ATOM   6802  H H    . ILE B 1 116 ? 21.910  -17.690 -58.575 1.00 22.11 ? 116 ILE B H    1 
ATOM   6803  H HA   . ILE B 1 116 ? 19.599  -18.598 -57.504 1.00 17.66 ? 116 ILE B HA   1 
ATOM   6804  H HB   . ILE B 1 116 ? 21.118  -18.878 -55.761 1.00 15.74 ? 116 ILE B HB   1 
ATOM   6805  H HG12 . ILE B 1 116 ? 19.652  -16.614 -54.978 1.00 23.93 ? 116 ILE B HG12 1 
ATOM   6806  H HG13 . ILE B 1 116 ? 18.897  -17.979 -55.282 1.00 23.93 ? 116 ILE B HG13 1 
ATOM   6807  H HG21 . ILE B 1 116 ? 22.354  -17.083 -54.927 1.00 20.80 ? 116 ILE B HG21 1 
ATOM   6808  H HG22 . ILE B 1 116 ? 22.742  -17.389 -56.437 1.00 20.80 ? 116 ILE B HG22 1 
ATOM   6809  H HG23 . ILE B 1 116 ? 21.787  -16.166 -56.094 1.00 20.80 ? 116 ILE B HG23 1 
ATOM   6810  H HD11 . ILE B 1 116 ? 19.280  -17.779 -52.977 1.00 21.64 ? 116 ILE B HD11 1 
ATOM   6811  H HD12 . ILE B 1 116 ? 20.087  -19.024 -53.544 1.00 21.64 ? 116 ILE B HD12 1 
ATOM   6812  H HD13 . ILE B 1 116 ? 20.842  -17.660 -53.241 1.00 21.64 ? 116 ILE B HD13 1 
ATOM   6813  N N    . SER B 1 117 ? 18.484  -16.471 -57.909 1.00 15.36 ? 117 SER B N    1 
ATOM   6814  C CA   . SER B 1 117 ? 17.837  -15.232 -58.299 1.00 13.67 ? 117 SER B CA   1 
ATOM   6815  C C    . SER B 1 117 ? 17.350  -14.473 -57.064 1.00 18.52 ? 117 SER B C    1 
ATOM   6816  O O    . SER B 1 117 ? 16.609  -15.026 -56.238 1.00 18.41 ? 117 SER B O    1 
ATOM   6817  C CB   . SER B 1 117 ? 16.669  -15.525 -59.223 1.00 15.85 ? 117 SER B CB   1 
ATOM   6818  O OG   . SER B 1 117 ? 16.014  -14.320 -59.569 1.00 18.97 ? 117 SER B OG   1 
ATOM   6819  H H    . SER B 1 117 ? 17.932  -17.104 -57.721 1.00 18.41 ? 117 SER B H    1 
ATOM   6820  H HA   . SER B 1 117 ? 18.472  -14.672 -58.773 1.00 16.38 ? 117 SER B HA   1 
ATOM   6821  H HB2  . SER B 1 117 ? 17.000  -15.950 -60.030 1.00 19.00 ? 117 SER B HB2  1 
ATOM   6822  H HB3  . SER B 1 117 ? 16.042  -16.109 -58.769 1.00 19.00 ? 117 SER B HB3  1 
ATOM   6823  H HG   . SER B 1 117 ? 15.368  -14.481 -60.080 1.00 22.74 ? 117 SER B HG   1 
ATOM   6824  N N    . LEU B 1 118 ? 17.748  -13.200 -56.970 1.00 16.27 ? 118 LEU B N    1 
ATOM   6825  C CA   . LEU B 1 118 ? 17.266  -12.258 -55.964 1.00 21.42 ? 118 LEU B CA   1 
ATOM   6826  C C    . LEU B 1 118 ? 16.276  -11.268 -56.545 1.00 26.20 ? 118 LEU B C    1 
ATOM   6827  O O    . LEU B 1 118 ? 15.969  -10.262 -55.899 1.00 24.14 ? 118 LEU B O    1 
ATOM   6828  C CB   . LEU B 1 118 ? 18.437  -11.493 -55.330 1.00 23.57 ? 118 LEU B CB   1 
ATOM   6829  C CG   . LEU B 1 118 ? 19.280  -12.230 -54.305 1.00 17.13 ? 118 LEU B CG   1 
ATOM   6830  C CD1  . LEU B 1 118 ? 19.819  -13.551 -54.806 1.00 17.80 ? 118 LEU B CD1  1 
ATOM   6831  C CD2  . LEU B 1 118 ? 20.449  -11.338 -53.888 1.00 28.74 ? 118 LEU B CD2  1 
ATOM   6832  H H    . LEU B 1 118 ? 18.323  -12.849 -57.505 1.00 19.50 ? 118 LEU B H    1 
ATOM   6833  H HA   . LEU B 1 118 ? 16.817  -12.752 -55.260 1.00 25.68 ? 118 LEU B HA   1 
ATOM   6834  H HB2  . LEU B 1 118 ? 19.034  -11.215 -56.042 1.00 28.27 ? 118 LEU B HB2  1 
ATOM   6835  H HB3  . LEU B 1 118 ? 18.078  -10.707 -54.890 1.00 28.27 ? 118 LEU B HB3  1 
ATOM   6836  H HG   . LEU B 1 118 ? 18.740  -12.405 -53.518 1.00 20.53 ? 118 LEU B HG   1 
ATOM   6837  H HD11 . LEU B 1 118 ? 20.345  -13.964 -54.103 1.00 21.34 ? 118 LEU B HD11 1 
ATOM   6838  H HD12 . LEU B 1 118 ? 19.074  -14.126 -55.043 1.00 21.34 ? 118 LEU B HD12 1 
ATOM   6839  H HD13 . LEU B 1 118 ? 20.375  -13.390 -55.584 1.00 21.34 ? 118 LEU B HD13 1 
ATOM   6840  H HD21 . LEU B 1 118 ? 20.987  -11.810 -53.233 1.00 34.46 ? 118 LEU B HD21 1 
ATOM   6841  H HD22 . LEU B 1 118 ? 20.984  -11.133 -54.670 1.00 34.46 ? 118 LEU B HD22 1 
ATOM   6842  H HD23 . LEU B 1 118 ? 20.099  -10.520 -53.502 1.00 34.46 ? 118 LEU B HD23 1 
ATOM   6843  N N    . ILE B 1 119 ? 15.785  -11.525 -57.756 1.00 20.72 ? 119 ILE B N    1 
ATOM   6844  C CA   . ILE B 1 119 ? 14.887  -10.626 -58.464 1.00 24.29 ? 119 ILE B CA   1 
ATOM   6845  C C    . ILE B 1 119 ? 13.460  -10.961 -58.031 1.00 24.77 ? 119 ILE B C    1 
ATOM   6846  O O    . ILE B 1 119 ? 12.927  -12.017 -58.378 1.00 27.84 ? 119 ILE B O    1 
ATOM   6847  C CB   . ILE B 1 119 ? 15.071  -10.764 -59.984 1.00 23.10 ? 119 ILE B CB   1 
ATOM   6848  C CG1  . ILE B 1 119 ? 16.568  -10.580 -60.339 1.00 22.52 ? 119 ILE B CG1  1 
ATOM   6849  C CG2  . ILE B 1 119 ? 14.240  -9.746  -60.712 1.00 28.93 ? 119 ILE B CG2  1 
ATOM   6850  C CD1  . ILE B 1 119 ? 16.975  -11.053 -61.748 1.00 22.85 ? 119 ILE B CD1  1 
ATOM   6851  H H    . ILE B 1 119 ? 15.966  -12.240 -58.198 1.00 24.84 ? 119 ILE B H    1 
ATOM   6852  H HA   . ILE B 1 119 ? 15.080  -9.710  -58.212 1.00 29.12 ? 119 ILE B HA   1 
ATOM   6853  H HB   . ILE B 1 119 ? 14.790  -11.652 -60.256 1.00 27.69 ? 119 ILE B HB   1 
ATOM   6854  H HG12 . ILE B 1 119 ? 16.786  -9.637  -60.273 1.00 27.00 ? 119 ILE B HG12 1 
ATOM   6855  H HG13 . ILE B 1 119 ? 17.099  -11.081 -59.699 1.00 27.00 ? 119 ILE B HG13 1 
ATOM   6856  H HG21 . ILE B 1 119 ? 14.374  -9.854  -61.667 1.00 34.69 ? 119 ILE B HG21 1 
ATOM   6857  H HG22 . ILE B 1 119 ? 13.306  -9.885  -60.491 1.00 34.69 ? 119 ILE B HG22 1 
ATOM   6858  H HG23 . ILE B 1 119 ? 14.517  -8.858  -60.438 1.00 34.69 ? 119 ILE B HG23 1 
ATOM   6859  H HD11 . ILE B 1 119 ? 17.924  -10.896 -61.872 1.00 27.40 ? 119 ILE B HD11 1 
ATOM   6860  H HD12 . ILE B 1 119 ? 16.782  -12.000 -61.831 1.00 27.40 ? 119 ILE B HD12 1 
ATOM   6861  H HD13 . ILE B 1 119 ? 16.468  -10.552 -62.407 1.00 27.40 ? 119 ILE B HD13 1 
ATOM   6862  N N    . LYS B 1 120 ? 12.825  -10.060 -57.290 1.00 30.10 ? 120 LYS B N    1 
ATOM   6863  C CA   . LYS B 1 120 ? 11.473  -10.306 -56.798 1.00 34.10 ? 120 LYS B CA   1 
ATOM   6864  C C    . LYS B 1 120 ? 10.446  -9.747  -57.778 1.00 38.86 ? 120 LYS B C    1 
ATOM   6865  O O    . LYS B 1 120 ? 10.601  -8.641  -58.297 1.00 33.99 ? 120 LYS B O    1 
ATOM   6866  C CB   . LYS B 1 120 ? 11.276  -9.693  -55.406 1.00 35.75 ? 120 LYS B CB   1 
ATOM   6867  C CG   . LYS B 1 120 ? 10.157  -10.339 -54.607 1.00 34.37 ? 120 LYS B CG   1 
ATOM   6868  C CD   . LYS B 1 120 ? 9.903   -9.663  -53.260 1.00 36.58 ? 120 LYS B CD   1 
ATOM   6869  C CE   . LYS B 1 120 ? 11.075  -9.785  -52.327 1.00 31.30 ? 120 LYS B CE   1 
ATOM   6870  N NZ   . LYS B 1 120 ? 10.799  -9.156  -50.979 1.00 23.53 ? 120 LYS B NZ   1 
ATOM   6871  H H    . LYS B 1 120 ? 13.153  -9.299  -57.058 1.00 36.10 ? 120 LYS B H    1 
ATOM   6872  H HA   . LYS B 1 120 ? 11.331  -11.263 -56.728 1.00 40.90 ? 120 LYS B HA   1 
ATOM   6873  H HB2  . LYS B 1 120 ? 12.098  -9.794  -54.901 1.00 42.88 ? 120 LYS B HB2  1 
ATOM   6874  H HB3  . LYS B 1 120 ? 11.065  -8.752  -55.505 1.00 42.88 ? 120 LYS B HB3  1 
ATOM   6875  H HG2  . LYS B 1 120 ? 9.337   -10.294 -55.122 1.00 41.22 ? 120 LYS B HG2  1 
ATOM   6876  H HG3  . LYS B 1 120 ? 10.389  -11.266 -54.436 1.00 41.22 ? 120 LYS B HG3  1 
ATOM   6877  H HD2  . LYS B 1 120 ? 9.732   -8.719  -53.406 1.00 43.88 ? 120 LYS B HD2  1 
ATOM   6878  H HD3  . LYS B 1 120 ? 9.136   -10.079 -52.836 1.00 43.88 ? 120 LYS B HD3  1 
ATOM   6879  H HE2  . LYS B 1 120 ? 11.273  -10.724 -52.186 1.00 37.54 ? 120 LYS B HE2  1 
ATOM   6880  H HE3  . LYS B 1 120 ? 11.841  -9.337  -52.718 1.00 37.54 ? 120 LYS B HE3  1 
ATOM   6881  H HZ1  . LYS B 1 120 ? 11.510  -9.245  -50.451 1.00 28.21 ? 120 LYS B HZ1  1 
ATOM   6882  H HZ2  . LYS B 1 120 ? 10.619  -8.290  -51.079 1.00 28.21 ? 120 LYS B HZ2  1 
ATOM   6883  H HZ3  . LYS B 1 120 ? 10.102  -9.554  -50.595 1.00 28.21 ? 120 LYS B HZ3  1 
ATOM   6884  N N    . GLY B 1 121 ? 9.401   -10.525 -58.035 1.00 45.48 ? 121 GLY B N    1 
ATOM   6885  C CA   . GLY B 1 121 ? 8.425   -10.197 -59.064 1.00 42.82 ? 121 GLY B CA   1 
ATOM   6886  C C    . GLY B 1 121 ? 8.329   -11.295 -60.106 1.00 46.60 ? 121 GLY B C    1 
ATOM   6887  O O    . GLY B 1 121 ? 8.874   -12.394 -59.945 1.00 46.47 ? 121 GLY B O    1 
ATOM   6888  H H    . GLY B 1 121 ? 9.234   -11.259 -57.620 1.00 54.55 ? 121 GLY B H    1 
ATOM   6889  H HA2  . GLY B 1 121 ? 7.552   -10.076 -58.659 1.00 51.36 ? 121 GLY B HA2  1 
ATOM   6890  H HA3  . GLY B 1 121 ? 8.680   -9.372  -59.505 1.00 51.36 ? 121 GLY B HA3  1 
ATOM   6891  N N    . VAL B 1 122 ? 7.614   -10.991 -61.195 1.00 45.84 ? 122 VAL B N    1 
ATOM   6892  C CA   . VAL B 1 122 ? 7.397   -11.991 -62.251 1.00 48.82 ? 122 VAL B CA   1 
ATOM   6893  C C    . VAL B 1 122 ? 7.413   -11.432 -63.662 1.00 44.27 ? 122 VAL B C    1 
ATOM   6894  O O    . VAL B 1 122 ? 7.249   -12.203 -64.617 1.00 47.52 ? 122 VAL B O    1 
ATOM   6895  C CB   . VAL B 1 122 ? 6.066   -12.748 -62.053 1.00 45.28 ? 122 VAL B CB   1 
ATOM   6896  C CG1  . VAL B 1 122 ? 6.211   -13.788 -60.982 1.00 48.35 ? 122 VAL B CG1  1 
ATOM   6897  C CG2  . VAL B 1 122 ? 4.918   -11.779 -61.755 1.00 44.99 ? 122 VAL B CG2  1 
ATOM   6898  H H    . VAL B 1 122 ? 7.249   -10.227 -61.346 1.00 54.98 ? 122 VAL B H    1 
ATOM   6899  H HA   . VAL B 1 122 ? 8.110   -12.646 -62.195 1.00 58.57 ? 122 VAL B HA   1 
ATOM   6900  H HB   . VAL B 1 122 ? 5.849   -13.209 -62.878 1.00 54.32 ? 122 VAL B HB   1 
ATOM   6901  H HG11 . VAL B 1 122 ? 5.365   -14.250 -60.875 1.00 58.00 ? 122 VAL B HG11 1 
ATOM   6902  H HG12 . VAL B 1 122 ? 6.901   -14.417 -61.245 1.00 58.00 ? 122 VAL B HG12 1 
ATOM   6903  H HG13 . VAL B 1 122 ? 6.459   -13.353 -60.152 1.00 58.00 ? 122 VAL B HG13 1 
ATOM   6904  H HG21 . VAL B 1 122 ? 4.100   -12.286 -61.636 1.00 53.96 ? 122 VAL B HG21 1 
ATOM   6905  H HG22 . VAL B 1 122 ? 5.123   -11.287 -60.945 1.00 53.96 ? 122 VAL B HG22 1 
ATOM   6906  H HG23 . VAL B 1 122 ? 4.822   -11.165 -62.500 1.00 53.96 ? 122 VAL B HG23 1 
ATOM   6907  N N    . LEU B 1 129 ? 1.684   -16.380 -66.269 1.00 49.69 ? 129 LEU B N    1 
ATOM   6908  C CA   . LEU B 1 129 ? 2.832   -15.963 -65.471 1.00 43.25 ? 129 LEU B CA   1 
ATOM   6909  C C    . LEU B 1 129 ? 4.003   -16.898 -65.715 1.00 46.31 ? 129 LEU B C    1 
ATOM   6910  O O    . LEU B 1 129 ? 3.814   -18.107 -65.903 1.00 47.83 ? 129 LEU B O    1 
ATOM   6911  C CB   . LEU B 1 129 ? 2.507   -15.959 -63.971 1.00 44.63 ? 129 LEU B CB   1 
ATOM   6912  C CG   . LEU B 1 129 ? 1.419   -15.048 -63.406 1.00 46.24 ? 129 LEU B CG   1 
ATOM   6913  C CD1  . LEU B 1 129 ? 1.063   -15.512 -61.999 1.00 43.38 ? 129 LEU B CD1  1 
ATOM   6914  C CD2  . LEU B 1 129 ? 1.884   -13.605 -63.381 1.00 44.19 ? 129 LEU B CD2  1 
ATOM   6915  H H    . LEU B 1 129 ? 1.344   -17.132 -66.028 1.00 59.60 ? 129 LEU B H    1 
ATOM   6916  H HA   . LEU B 1 129 ? 3.096   -15.067 -65.729 1.00 51.88 ? 129 LEU B HA   1 
ATOM   6917  H HB2  . LEU B 1 129 ? 2.256   -16.864 -63.729 1.00 53.54 ? 129 LEU B HB2  1 
ATOM   6918  H HB3  . LEU B 1 129 ? 3.324   -15.730 -63.501 1.00 53.54 ? 129 LEU B HB3  1 
ATOM   6919  H HG   . LEU B 1 129 ? 0.625   -15.107 -63.960 1.00 55.47 ? 129 LEU B HG   1 
ATOM   6920  H HD11 . LEU B 1 129 ? 0.373   -14.932 -61.641 1.00 52.04 ? 129 LEU B HD11 1 
ATOM   6921  H HD12 . LEU B 1 129 ? 0.741   -16.425 -62.040 1.00 52.04 ? 129 LEU B HD12 1 
ATOM   6922  H HD13 . LEU B 1 129 ? 1.856   -15.465 -61.442 1.00 52.04 ? 129 LEU B HD13 1 
ATOM   6923  H HD21 . LEU B 1 129 ? 1.174   -13.051 -63.018 1.00 53.01 ? 129 LEU B HD21 1 
ATOM   6924  H HD22 . LEU B 1 129 ? 2.674   -13.538 -62.823 1.00 53.01 ? 129 LEU B HD22 1 
ATOM   6925  H HD23 . LEU B 1 129 ? 2.092   -13.325 -64.286 1.00 53.01 ? 129 LEU B HD23 1 
ATOM   6926  N N    . LYS B 1 130 ? 5.211   -16.335 -65.710 1.00 43.68 ? 130 LYS B N    1 
ATOM   6927  C CA   . LYS B 1 130 ? 6.442   -17.112 -65.718 1.00 40.75 ? 130 LYS B CA   1 
ATOM   6928  C C    . LYS B 1 130 ? 7.341   -16.559 -64.622 1.00 38.09 ? 130 LYS B C    1 
ATOM   6929  O O    . LYS B 1 130 ? 7.548   -15.342 -64.535 1.00 31.70 ? 130 LYS B O    1 
ATOM   6930  C CB   . LYS B 1 130 ? 7.139   -17.065 -67.087 1.00 35.01 ? 130 LYS B CB   1 
ATOM   6931  H H    . LYS B 1 130 ? 5.342   -15.485 -65.701 1.00 52.40 ? 130 LYS B H    1 
ATOM   6932  H HA   . LYS B 1 130 ? 6.239   -18.037 -65.510 1.00 48.88 ? 130 LYS B HA   1 
ATOM   6933  N N    . LEU B 1 131 ? 7.813   -17.452 -63.754 1.00 31.90 ? 131 LEU B N    1 
ATOM   6934  C CA   . LEU B 1 131 ? 8.764   -17.078 -62.713 1.00 30.73 ? 131 LEU B CA   1 
ATOM   6935  C C    . LEU B 1 131 ? 10.053  -16.599 -63.361 1.00 27.92 ? 131 LEU B C    1 
ATOM   6936  O O    . LEU B 1 131 ? 10.506  -17.173 -64.349 1.00 29.61 ? 131 LEU B O    1 
ATOM   6937  C CB   . LEU B 1 131 ? 9.037   -18.282 -61.805 1.00 36.01 ? 131 LEU B CB   1 
ATOM   6938  C CG   . LEU B 1 131 ? 7.834   -18.933 -61.087 1.00 32.07 ? 131 LEU B CG   1 
ATOM   6939  C CD1  . LEU B 1 131 ? 8.189   -20.215 -60.378 1.00 35.17 ? 131 LEU B CD1  1 
ATOM   6940  C CD2  . LEU B 1 131 ? 7.242   -17.946 -60.102 1.00 29.85 ? 131 LEU B CD2  1 
ATOM   6941  H H    . LEU B 1 131 ? 7.596   -18.284 -63.747 1.00 38.26 ? 131 LEU B H    1 
ATOM   6942  H HA   . LEU B 1 131 ? 8.398   -16.358 -62.176 1.00 36.85 ? 131 LEU B HA   1 
ATOM   6943  H HB2  . LEU B 1 131 ? 9.452   -18.974 -62.343 1.00 43.19 ? 131 LEU B HB2  1 
ATOM   6944  H HB3  . LEU B 1 131 ? 9.659   -18.001 -61.115 1.00 43.19 ? 131 LEU B HB3  1 
ATOM   6945  H HG   . LEU B 1 131 ? 7.152   -19.138 -61.746 1.00 38.46 ? 131 LEU B HG   1 
ATOM   6946  H HD11 . LEU B 1 131 ? 7.394   -20.570 -59.951 1.00 42.18 ? 131 LEU B HD11 1 
ATOM   6947  H HD12 . LEU B 1 131 ? 8.528   -20.851 -61.028 1.00 42.18 ? 131 LEU B HD12 1 
ATOM   6948  H HD13 . LEU B 1 131 ? 8.869   -20.029 -59.712 1.00 42.18 ? 131 LEU B HD13 1 
ATOM   6949  H HD21 . LEU B 1 131 ? 6.487   -18.361 -59.655 1.00 35.80 ? 131 LEU B HD21 1 
ATOM   6950  H HD22 . LEU B 1 131 ? 7.920   -17.704 -59.452 1.00 35.80 ? 131 LEU B HD22 1 
ATOM   6951  H HD23 . LEU B 1 131 ? 6.949   -17.157 -60.584 1.00 35.80 ? 131 LEU B HD23 1 
ATOM   6952  N N    . ILE B 1 132 ? 10.658  -15.547 -62.802 1.00 30.44 ? 132 ILE B N    1 
ATOM   6953  C CA   . ILE B 1 132 ? 11.914  -15.048 -63.368 1.00 26.34 ? 132 ILE B CA   1 
ATOM   6954  C C    . ILE B 1 132 ? 13.000  -16.112 -63.291 1.00 28.62 ? 132 ILE B C    1 
ATOM   6955  O O    . ILE B 1 132 ? 13.830  -16.228 -64.197 1.00 24.46 ? 132 ILE B O    1 
ATOM   6956  C CB   . ILE B 1 132 ? 12.350  -13.753 -62.662 1.00 23.79 ? 132 ILE B CB   1 
ATOM   6957  C CG1  . ILE B 1 132 ? 11.349  -12.655 -62.952 1.00 30.42 ? 132 ILE B CG1  1 
ATOM   6958  C CG2  . ILE B 1 132 ? 13.766  -13.342 -63.105 1.00 30.30 ? 132 ILE B CG2  1 
ATOM   6959  C CD1  . ILE B 1 132 ? 11.473  -11.483 -62.034 1.00 37.97 ? 132 ILE B CD1  1 
ATOM   6960  H H    . ILE B 1 132 ? 10.372  -15.116 -62.116 1.00 36.51 ? 132 ILE B H    1 
ATOM   6961  H HA   . ILE B 1 132 ? 11.772  -14.840 -64.305 1.00 31.59 ? 132 ILE B HA   1 
ATOM   6962  H HB   . ILE B 1 132 ? 12.362  -13.913 -61.705 1.00 28.52 ? 132 ILE B HB   1 
ATOM   6963  H HG12 . ILE B 1 132 ? 11.484  -12.339 -63.859 1.00 36.49 ? 132 ILE B HG12 1 
ATOM   6964  H HG13 . ILE B 1 132 ? 10.453  -13.015 -62.856 1.00 36.49 ? 132 ILE B HG13 1 
ATOM   6965  H HG21 . ILE B 1 132 ? 14.016  -12.525 -62.646 1.00 36.34 ? 132 ILE B HG21 1 
ATOM   6966  H HG22 . ILE B 1 132 ? 14.386  -14.052 -62.877 1.00 36.34 ? 132 ILE B HG22 1 
ATOM   6967  H HG23 . ILE B 1 132 ? 13.767  -13.197 -64.064 1.00 36.34 ? 132 ILE B HG23 1 
ATOM   6968  H HD11 . ILE B 1 132 ? 10.806  -10.822 -62.275 1.00 45.54 ? 132 ILE B HD11 1 
ATOM   6969  H HD12 . ILE B 1 132 ? 11.331  -11.779 -61.122 1.00 45.54 ? 132 ILE B HD12 1 
ATOM   6970  H HD13 . ILE B 1 132 ? 12.362  -11.104 -62.125 1.00 45.54 ? 132 ILE B HD13 1 
ATOM   6971  N N    . SER B 1 133 ? 13.039  -16.887 -62.200 1.00 22.25 ? 133 SER B N    1 
ATOM   6972  C CA   . SER B 1 133 ? 14.125  -17.845 -62.058 1.00 22.66 ? 133 SER B CA   1 
ATOM   6973  C C    . SER B 1 133 ? 14.039  -18.910 -63.146 1.00 29.36 ? 133 SER B C    1 
ATOM   6974  O O    . SER B 1 133 ? 15.064  -19.461 -63.560 1.00 21.32 ? 133 SER B O    1 
ATOM   6975  C CB   . SER B 1 133 ? 14.105  -18.471 -60.668 1.00 20.09 ? 133 SER B CB   1 
ATOM   6976  O OG   . SER B 1 133 ? 13.132  -19.485 -60.540 1.00 27.22 ? 133 SER B OG   1 
ATOM   6977  H H    . SER B 1 133 ? 12.471  -16.875 -61.555 1.00 26.68 ? 133 SER B H    1 
ATOM   6978  H HA   . SER B 1 133 ? 14.969  -17.380 -62.163 1.00 27.17 ? 133 SER B HA   1 
ATOM   6979  H HB2  . SER B 1 133 ? 14.977  -18.854 -60.489 1.00 24.08 ? 133 SER B HB2  1 
ATOM   6980  H HB3  . SER B 1 133 ? 13.915  -17.776 -60.019 1.00 24.08 ? 133 SER B HB3  1 
ATOM   6981  H HG   . SER B 1 133 ? 12.367  -19.170 -60.687 1.00 32.65 ? 133 SER B HG   1 
ATOM   6982  N N    . GLU B 1 134 ? 12.825  -19.166 -63.651 1.00 30.55 ? 134 GLU B N    1 
ATOM   6983  C CA   . GLU B 1 134 ? 12.636  -20.118 -64.742 1.00 30.60 ? 134 GLU B CA   1 
ATOM   6984  C C    . GLU B 1 134 ? 13.142  -19.553 -66.061 1.00 30.70 ? 134 GLU B C    1 
ATOM   6985  O O    . GLU B 1 134 ? 13.761  -20.274 -66.857 1.00 29.66 ? 134 GLU B O    1 
ATOM   6986  C CB   . GLU B 1 134 ? 11.158  -20.481 -64.865 1.00 38.14 ? 134 GLU B CB   1 
ATOM   6987  C CG   . GLU B 1 134 ? 10.694  -21.537 -63.885 1.00 38.68 ? 134 GLU B CG   1 
ATOM   6988  C CD   . GLU B 1 134 ? 9.215   -21.884 -64.087 1.00 53.61 ? 134 GLU B CD   1 
ATOM   6989  O OE1  . GLU B 1 134 ? 8.725   -21.775 -65.241 1.00 48.99 ? 134 GLU B OE1  1 
ATOM   6990  O OE2  . GLU B 1 134 ? 8.545   -22.237 -63.090 1.00 50.26 ? 134 GLU B OE2  1 
ATOM   6991  H H    . GLU B 1 134 ? 12.098  -18.799 -63.376 1.00 36.64 ? 134 GLU B H    1 
ATOM   6992  H HA   . GLU B 1 134 ? 13.132  -20.928 -64.548 1.00 36.70 ? 134 GLU B HA   1 
ATOM   6993  H HB2  . GLU B 1 134 ? 10.628  -19.683 -64.712 1.00 45.75 ? 134 GLU B HB2  1 
ATOM   6994  H HB3  . GLU B 1 134 ? 10.994  -20.816 -65.760 1.00 45.75 ? 134 GLU B HB3  1 
ATOM   6995  H HG2  . GLU B 1 134 ? 11.216  -22.345 -64.015 1.00 46.39 ? 134 GLU B HG2  1 
ATOM   6996  H HG3  . GLU B 1 134 ? 10.808  -21.206 -62.980 1.00 46.39 ? 134 GLU B HG3  1 
ATOM   6997  N N    . VAL B 1 135 ? 12.868  -18.273 -66.317 1.00 26.88 ? 135 VAL B N    1 
ATOM   6998  C CA   . VAL B 1 135 ? 13.404  -17.607 -67.496 1.00 29.56 ? 135 VAL B CA   1 
ATOM   6999  C C    . VAL B 1 135 ? 14.922  -17.699 -67.503 1.00 30.14 ? 135 VAL B C    1 
ATOM   7000  O O    . VAL B 1 135 ? 15.546  -17.988 -68.528 1.00 27.23 ? 135 VAL B O    1 
ATOM   7001  C CB   . VAL B 1 135 ? 12.962  -16.134 -67.528 1.00 26.69 ? 135 VAL B CB   1 
ATOM   7002  C CG1  . VAL B 1 135 ? 13.634  -15.418 -68.690 1.00 34.76 ? 135 VAL B CG1  1 
ATOM   7003  C CG2  . VAL B 1 135 ? 11.466  -16.000 -67.569 1.00 30.75 ? 135 VAL B CG2  1 
ATOM   7004  H H    . VAL B 1 135 ? 12.374  -17.772 -65.822 1.00 32.24 ? 135 VAL B H    1 
ATOM   7005  H HA   . VAL B 1 135 ? 13.067  -18.045 -68.294 1.00 35.46 ? 135 VAL B HA   1 
ATOM   7006  H HB   . VAL B 1 135 ? 13.267  -15.707 -66.712 1.00 32.00 ? 135 VAL B HB   1 
ATOM   7007  H HG11 . VAL B 1 135 ? 13.347  -14.492 -68.699 1.00 41.69 ? 135 VAL B HG11 1 
ATOM   7008  H HG12 . VAL B 1 135 ? 14.596  -15.466 -68.576 1.00 41.69 ? 135 VAL B HG12 1 
ATOM   7009  H HG13 . VAL B 1 135 ? 13.377  -15.852 -69.519 1.00 41.69 ? 135 VAL B HG13 1 
ATOM   7010  H HG21 . VAL B 1 135 ? 11.234  -15.059 -67.588 1.00 36.87 ? 135 VAL B HG21 1 
ATOM   7011  H HG22 . VAL B 1 135 ? 11.132  -16.440 -68.366 1.00 36.87 ? 135 VAL B HG22 1 
ATOM   7012  H HG23 . VAL B 1 135 ? 11.091  -16.418 -66.778 1.00 36.87 ? 135 VAL B HG23 1 
ATOM   7013  N N    . ILE B 1 136 ? 15.540  -17.411 -66.357 1.00 21.56 ? 136 ILE B N    1 
ATOM   7014  C CA   . ILE B 1 136 ? 16.990  -17.473 -66.250 1.00 21.37 ? 136 ILE B CA   1 
ATOM   7015  C C    . ILE B 1 136 ? 17.478  -18.888 -66.525 1.00 21.75 ? 136 ILE B C    1 
ATOM   7016  O O    . ILE B 1 136 ? 18.345  -19.113 -67.378 1.00 25.92 ? 136 ILE B O    1 
ATOM   7017  C CB   . ILE B 1 136 ? 17.449  -16.997 -64.858 1.00 18.66 ? 136 ILE B CB   1 
ATOM   7018  C CG1  . ILE B 1 136 ? 17.157  -15.500 -64.651 1.00 18.49 ? 136 ILE B CG1  1 
ATOM   7019  C CG2  . ILE B 1 136 ? 18.952  -17.225 -64.701 1.00 20.10 ? 136 ILE B CG2  1 
ATOM   7020  C CD1  . ILE B 1 136 ? 17.245  -15.070 -63.147 1.00 22.15 ? 136 ILE B CD1  1 
ATOM   7021  H H    . ILE B 1 136 ? 15.141  -17.178 -65.631 1.00 25.85 ? 136 ILE B H    1 
ATOM   7022  H HA   . ILE B 1 136 ? 17.382  -16.885 -66.914 1.00 25.62 ? 136 ILE B HA   1 
ATOM   7023  H HB   . ILE B 1 136 ? 16.979  -17.507 -64.179 1.00 22.36 ? 136 ILE B HB   1 
ATOM   7024  H HG12 . ILE B 1 136 ? 17.805  -14.979 -65.151 1.00 22.16 ? 136 ILE B HG12 1 
ATOM   7025  H HG13 . ILE B 1 136 ? 16.260  -15.305 -64.967 1.00 22.16 ? 136 ILE B HG13 1 
ATOM   7026  H HG21 . ILE B 1 136 ? 19.226  -16.921 -63.821 1.00 24.09 ? 136 ILE B HG21 1 
ATOM   7027  H HG22 . ILE B 1 136 ? 19.139  -18.172 -64.797 1.00 24.09 ? 136 ILE B HG22 1 
ATOM   7028  H HG23 . ILE B 1 136 ? 19.420  -16.723 -65.386 1.00 24.09 ? 136 ILE B HG23 1 
ATOM   7029  H HD11 . ILE B 1 136 ? 17.053  -14.122 -63.078 1.00 26.56 ? 136 ILE B HD11 1 
ATOM   7030  H HD12 . ILE B 1 136 ? 16.596  -15.578 -62.636 1.00 26.56 ? 136 ILE B HD12 1 
ATOM   7031  H HD13 . ILE B 1 136 ? 18.140  -15.251 -62.819 1.00 26.56 ? 136 ILE B HD13 1 
ATOM   7032  N N    . GLY B 1 137 ? 16.949  -19.856 -65.778 1.00 20.63 ? 137 GLY B N    1 
ATOM   7033  C CA   . GLY B 1 137 ? 17.440  -21.216 -65.889 1.00 28.79 ? 137 GLY B CA   1 
ATOM   7034  C C    . GLY B 1 137 ? 17.241  -21.810 -67.274 1.00 31.13 ? 137 GLY B C    1 
ATOM   7035  O O    . GLY B 1 137 ? 18.078  -22.570 -67.740 1.00 25.39 ? 137 GLY B O    1 
ATOM   7036  H H    . GLY B 1 137 ? 16.314  -19.748 -65.209 1.00 24.73 ? 137 GLY B H    1 
ATOM   7037  H HA2  . GLY B 1 137 ? 18.387  -21.233 -65.682 1.00 34.53 ? 137 GLY B HA2  1 
ATOM   7038  H HA3  . GLY B 1 137 ? 16.977  -21.777 -65.247 1.00 34.53 ? 137 GLY B HA3  1 
ATOM   7039  N N    . GLU B 1 138 ? 16.129  -21.476 -67.944 1.00 26.82 ? 138 GLU B N    1 
ATOM   7040  C CA   . GLU B 1 138 ? 15.862  -22.012 -69.279 1.00 33.33 ? 138 GLU B CA   1 
ATOM   7041  C C    . GLU B 1 138 ? 16.840  -21.468 -70.303 1.00 35.10 ? 138 GLU B C    1 
ATOM   7042  O O    . GLU B 1 138 ? 17.395  -22.231 -71.106 1.00 30.11 ? 138 GLU B O    1 
ATOM   7043  C CB   . GLU B 1 138 ? 14.425  -21.691 -69.720 1.00 36.03 ? 138 GLU B CB   1 
ATOM   7044  C CG   . GLU B 1 138 ? 13.392  -22.545 -69.023 1.00 45.19 ? 138 GLU B CG   1 
ATOM   7045  C CD   . GLU B 1 138 ? 11.954  -22.218 -69.416 1.00 53.09 ? 138 GLU B CD   1 
ATOM   7046  O OE1  . GLU B 1 138 ? 11.733  -21.270 -70.217 1.00 49.37 ? 138 GLU B OE1  1 
ATOM   7047  O OE2  . GLU B 1 138 ? 11.053  -22.921 -68.902 1.00 48.15 ? 138 GLU B OE2  1 
ATOM   7048  H H    . GLU B 1 138 ? 15.521  -20.945 -67.647 1.00 32.17 ? 138 GLU B H    1 
ATOM   7049  H HA   . GLU B 1 138 ? 15.959  -22.977 -69.256 1.00 39.97 ? 138 GLU B HA   1 
ATOM   7050  H HB2  . GLU B 1 138 ? 14.232  -20.762 -69.517 1.00 43.21 ? 138 GLU B HB2  1 
ATOM   7051  H HB3  . GLU B 1 138 ? 14.346  -21.844 -70.675 1.00 43.21 ? 138 GLU B HB3  1 
ATOM   7052  H HG2  . GLU B 1 138 ? 13.556  -23.475 -69.244 1.00 54.21 ? 138 GLU B HG2  1 
ATOM   7053  H HG3  . GLU B 1 138 ? 13.474  -22.415 -68.066 1.00 54.21 ? 138 GLU B HG3  1 
ATOM   7054  N N    . ARG B 1 139 ? 17.036  -20.144 -70.313 1.00 28.49 ? 139 ARG B N    1 
ATOM   7055  C CA   . ARG B 1 139 ? 17.939  -19.533 -71.276 1.00 31.15 ? 139 ARG B CA   1 
ATOM   7056  C C    . ARG B 1 139 ? 19.385  -19.915 -71.005 1.00 31.73 ? 139 ARG B C    1 
ATOM   7057  O O    . ARG B 1 139 ? 20.159  -20.105 -71.948 1.00 31.14 ? 139 ARG B O    1 
ATOM   7058  C CB   . ARG B 1 139 ? 17.789  -18.020 -71.268 1.00 28.64 ? 139 ARG B CB   1 
ATOM   7059  C CG   . ARG B 1 139 ? 16.480  -17.550 -71.831 1.00 40.69 ? 139 ARG B CG   1 
ATOM   7060  C CD   . ARG B 1 139 ? 16.477  -16.064 -72.108 1.00 41.13 ? 139 ARG B CD   1 
ATOM   7061  N NE   . ARG B 1 139 ? 15.106  -15.573 -72.170 1.00 47.91 ? 139 ARG B NE   1 
ATOM   7062  C CZ   . ARG B 1 139 ? 14.778  -14.301 -72.353 1.00 49.57 ? 139 ARG B CZ   1 
ATOM   7063  N NH1  . ARG B 1 139 ? 15.736  -13.391 -72.481 1.00 50.96 ? 139 ARG B NH1  1 
ATOM   7064  N NH2  . ARG B 1 139 ? 13.495  -13.941 -72.405 1.00 47.11 ? 139 ARG B NH2  1 
ATOM   7065  H H    . ARG B 1 139 ? 16.660  -19.588 -69.776 1.00 34.16 ? 139 ARG B H    1 
ATOM   7066  H HA   . ARG B 1 139 ? 17.710  -19.849 -72.164 1.00 37.36 ? 139 ARG B HA   1 
ATOM   7067  H HB2  . ARG B 1 139 ? 17.851  -17.703 -70.353 1.00 34.35 ? 139 ARG B HB2  1 
ATOM   7068  H HB3  . ARG B 1 139 ? 18.500  -17.631 -71.801 1.00 34.35 ? 139 ARG B HB3  1 
ATOM   7069  H HG2  . ARG B 1 139 ? 16.309  -18.013 -72.666 1.00 48.81 ? 139 ARG B HG2  1 
ATOM   7070  H HG3  . ARG B 1 139 ? 15.773  -17.740 -71.194 1.00 48.81 ? 139 ARG B HG3  1 
ATOM   7071  H HD2  . ARG B 1 139 ? 16.939  -15.600 -71.393 1.00 49.33 ? 139 ARG B HD2  1 
ATOM   7072  H HD3  . ARG B 1 139 ? 16.906  -15.892 -72.960 1.00 49.33 ? 139 ARG B HD3  1 
ATOM   7073  H HE   . ARG B 1 139 ? 14.469  -16.150 -72.121 1.00 57.47 ? 139 ARG B HE   1 
ATOM   7074  H HH11 . ARG B 1 139 ? 16.562  -13.629 -72.449 1.00 61.13 ? 139 ARG B HH11 1 
ATOM   7075  H HH12 . ARG B 1 139 ? 15.531  -12.565 -72.598 1.00 61.13 ? 139 ARG B HH12 1 
ATOM   7076  H HH21 . ARG B 1 139 ? 12.878  -14.533 -72.319 1.00 56.52 ? 139 ARG B HH21 1 
ATOM   7077  H HH22 . ARG B 1 139 ? 13.285  -13.115 -72.519 1.00 56.52 ? 139 ARG B HH22 1 
ATOM   7078  N N    . LEU B 1 140 ? 19.783  -20.031 -69.730 1.00 23.04 ? 140 LEU B N    1 
ATOM   7079  C CA   . LEU B 1 140 ? 21.180  -20.238 -69.419 1.00 17.44 ? 140 LEU B CA   1 
ATOM   7080  C C    . LEU B 1 140 ? 21.548  -21.706 -69.198 1.00 23.15 ? 140 LEU B C    1 
ATOM   7081  O O    . LEU B 1 140 ? 22.742  -22.021 -69.155 1.00 29.57 ? 140 LEU B O    1 
ATOM   7082  C CB   . LEU B 1 140 ? 21.579  -19.396 -68.177 1.00 23.39 ? 140 LEU B CB   1 
ATOM   7083  C CG   . LEU B 1 140 ? 21.454  -17.856 -68.341 1.00 19.81 ? 140 LEU B CG   1 
ATOM   7084  C CD1  . LEU B 1 140 ? 21.944  -17.112 -67.126 1.00 25.05 ? 140 LEU B CD1  1 
ATOM   7085  C CD2  . LEU B 1 140 ? 22.187  -17.341 -69.555 1.00 25.05 ? 140 LEU B CD2  1 
ATOM   7086  H H    . LEU B 1 140 ? 19.264  -19.993 -69.046 1.00 27.63 ? 140 LEU B H    1 
ATOM   7087  H HA   . LEU B 1 140 ? 21.708  -19.918 -70.167 1.00 20.91 ? 140 LEU B HA   1 
ATOM   7088  H HB2  . LEU B 1 140 ? 21.011  -19.655 -67.435 1.00 28.05 ? 140 LEU B HB2  1 
ATOM   7089  H HB3  . LEU B 1 140 ? 22.504  -19.590 -67.959 1.00 28.05 ? 140 LEU B HB3  1 
ATOM   7090  H HG   . LEU B 1 140 ? 20.516  -17.637 -68.456 1.00 23.75 ? 140 LEU B HG   1 
ATOM   7091  H HD11 . LEU B 1 140 ? 21.845  -16.159 -67.278 1.00 30.04 ? 140 LEU B HD11 1 
ATOM   7092  H HD12 . LEU B 1 140 ? 21.416  -17.381 -66.358 1.00 30.04 ? 140 LEU B HD12 1 
ATOM   7093  H HD13 . LEU B 1 140 ? 22.877  -17.329 -66.978 1.00 30.04 ? 140 LEU B HD13 1 
ATOM   7094  H HD21 . LEU B 1 140 ? 22.074  -16.379 -69.606 1.00 30.04 ? 140 LEU B HD21 1 
ATOM   7095  H HD22 . LEU B 1 140 ? 23.128  -17.560 -69.472 1.00 30.04 ? 140 LEU B HD22 1 
ATOM   7096  H HD23 . LEU B 1 140 ? 21.818  -17.760 -70.348 1.00 30.04 ? 140 LEU B HD23 1 
ATOM   7097  N N    . GLY B 1 141 ? 20.573  -22.589 -69.014 1.00 22.65 ? 141 GLY B N    1 
ATOM   7098  C CA   . GLY B 1 141 ? 20.816  -24.000 -68.717 1.00 27.05 ? 141 GLY B CA   1 
ATOM   7099  C C    . GLY B 1 141 ? 21.482  -24.294 -67.392 1.00 30.00 ? 141 GLY B C    1 
ATOM   7100  O O    . GLY B 1 141 ? 22.343  -25.178 -67.318 1.00 27.88 ? 141 GLY B O    1 
ATOM   7101  H H    . GLY B 1 141 ? 19.737  -22.390 -69.058 1.00 27.15 ? 141 GLY B H    1 
ATOM   7102  H HA2  . GLY B 1 141 ? 19.968  -24.471 -68.731 1.00 32.44 ? 141 GLY B HA2  1 
ATOM   7103  H HA3  . GLY B 1 141 ? 21.374  -24.373 -69.417 1.00 32.44 ? 141 GLY B HA3  1 
ATOM   7104  N N    . ILE B 1 142 ? 21.104  -23.586 -66.334 1.00 24.80 ? 142 ILE B N    1 
ATOM   7105  C CA   . ILE B 1 142 ? 21.735  -23.815 -65.037 1.00 22.94 ? 142 ILE B CA   1 
ATOM   7106  C C    . ILE B 1 142 ? 20.634  -24.069 -64.016 1.00 23.06 ? 142 ILE B C    1 
ATOM   7107  O O    . ILE B 1 142 ? 19.529  -23.521 -64.156 1.00 21.62 ? 142 ILE B O    1 
ATOM   7108  C CB   . ILE B 1 142 ? 22.640  -22.639 -64.619 1.00 24.11 ? 142 ILE B CB   1 
ATOM   7109  C CG1  . ILE B 1 142 ? 21.810  -21.363 -64.469 1.00 22.40 ? 142 ILE B CG1  1 
ATOM   7110  C CG2  . ILE B 1 142 ? 23.753  -22.449 -65.621 1.00 24.98 ? 142 ILE B CG2  1 
ATOM   7111  C CD1  . ILE B 1 142 ? 22.606  -20.132 -64.127 1.00 23.66 ? 142 ILE B CD1  1 
ATOM   7112  H H    . ILE B 1 142 ? 20.497  -22.977 -66.338 1.00 29.74 ? 142 ILE B H    1 
ATOM   7113  H HA   . ILE B 1 142 ? 22.286  -24.612 -65.090 1.00 27.51 ? 142 ILE B HA   1 
ATOM   7114  H HB   . ILE B 1 142 ? 23.035  -22.849 -63.758 1.00 28.91 ? 142 ILE B HB   1 
ATOM   7115  H HG12 . ILE B 1 142 ? 21.351  -21.192 -65.307 1.00 26.85 ? 142 ILE B HG12 1 
ATOM   7116  H HG13 . ILE B 1 142 ? 21.159  -21.498 -63.763 1.00 26.85 ? 142 ILE B HG13 1 
ATOM   7117  H HG21 . ILE B 1 142 ? 24.308  -21.706 -65.338 1.00 29.96 ? 142 ILE B HG21 1 
ATOM   7118  H HG22 . ILE B 1 142 ? 24.282  -23.261 -65.662 1.00 29.96 ? 142 ILE B HG22 1 
ATOM   7119  H HG23 . ILE B 1 142 ? 23.365  -22.262 -66.490 1.00 29.96 ? 142 ILE B HG23 1 
ATOM   7120  H HD11 . ILE B 1 142 ? 22.002  -19.376 -64.053 1.00 28.37 ? 142 ILE B HD11 1 
ATOM   7121  H HD12 . ILE B 1 142 ? 23.062  -20.276 -63.283 1.00 28.37 ? 142 ILE B HD12 1 
ATOM   7122  H HD13 . ILE B 1 142 ? 23.254  -19.970 -64.830 1.00 28.37 ? 142 ILE B HD13 1 
ATOM   7123  N N    . PRO B 1 143 ? 20.885  -24.904 -63.003 1.00 19.23 ? 143 PRO B N    1 
ATOM   7124  C CA   . PRO B 1 143 ? 19.925  -25.076 -61.904 1.00 22.70 ? 143 PRO B CA   1 
ATOM   7125  C C    . PRO B 1 143 ? 19.751  -23.780 -61.113 1.00 22.16 ? 143 PRO B C    1 
ATOM   7126  O O    . PRO B 1 143 ? 20.722  -23.086 -60.818 1.00 22.09 ? 143 PRO B O    1 
ATOM   7127  C CB   . PRO B 1 143 ? 20.573  -26.166 -61.032 1.00 23.79 ? 143 PRO B CB   1 
ATOM   7128  C CG   . PRO B 1 143 ? 21.685  -26.714 -61.826 1.00 31.62 ? 143 PRO B CG   1 
ATOM   7129  C CD   . PRO B 1 143 ? 22.114  -25.682 -62.808 1.00 25.46 ? 143 PRO B CD   1 
ATOM   7130  H HA   . PRO B 1 143 ? 19.067  -25.382 -62.236 1.00 27.22 ? 143 PRO B HA   1 
ATOM   7131  H HB2  . PRO B 1 143 ? 20.903  -25.771 -60.211 1.00 28.53 ? 143 PRO B HB2  1 
ATOM   7132  H HB3  . PRO B 1 143 ? 19.920  -26.857 -60.839 1.00 28.53 ? 143 PRO B HB3  1 
ATOM   7133  H HG2  . PRO B 1 143 ? 22.420  -26.934 -61.233 1.00 37.92 ? 143 PRO B HG2  1 
ATOM   7134  H HG3  . PRO B 1 143 ? 21.382  -27.510 -62.290 1.00 37.92 ? 143 PRO B HG3  1 
ATOM   7135  H HD2  . PRO B 1 143 ? 22.815  -25.125 -62.434 1.00 30.53 ? 143 PRO B HD2  1 
ATOM   7136  H HD3  . PRO B 1 143 ? 22.391  -26.097 -63.640 1.00 30.53 ? 143 PRO B HD3  1 
ATOM   7137  N N    . MET B 1 144 ? 18.508  -23.442 -60.777 1.00 22.38 ? 144 MET B N    1 
ATOM   7138  C CA   . MET B 1 144 ? 18.213  -22.149 -60.158 1.00 18.96 ? 144 MET B CA   1 
ATOM   7139  C C    . MET B 1 144 ? 17.605  -22.280 -58.766 1.00 23.99 ? 144 MET B C    1 
ATOM   7140  O O    . MET B 1 144 ? 16.684  -23.087 -58.523 1.00 17.79 ? 144 MET B O    1 
ATOM   7141  C CB   . MET B 1 144 ? 17.262  -21.317 -61.034 1.00 21.05 ? 144 MET B CB   1 
ATOM   7142  C CG   . MET B 1 144 ? 17.933  -20.776 -62.294 1.00 22.30 ? 144 MET B CG   1 
ATOM   7143  S SD   . MET B 1 144 ? 19.337  -19.676 -61.964 1.00 22.58 ? 144 MET B SD   1 
ATOM   7144  C CE   . MET B 1 144 ? 18.415  -18.329 -61.217 1.00 19.43 ? 144 MET B CE   1 
ATOM   7145  H H    . MET B 1 144 ? 17.818  -23.942 -60.895 1.00 26.83 ? 144 MET B H    1 
ATOM   7146  H HA   . MET B 1 144 ? 19.043  -21.653 -60.081 1.00 22.73 ? 144 MET B HA   1 
ATOM   7147  H HB2  . MET B 1 144 ? 16.517  -21.875 -61.308 1.00 25.23 ? 144 MET B HB2  1 
ATOM   7148  H HB3  . MET B 1 144 ? 16.939  -20.562 -60.520 1.00 25.23 ? 144 MET B HB3  1 
ATOM   7149  H HG2  . MET B 1 144 ? 18.260  -21.523 -62.819 1.00 26.74 ? 144 MET B HG2  1 
ATOM   7150  H HG3  . MET B 1 144 ? 17.279  -20.276 -62.806 1.00 26.74 ? 144 MET B HG3  1 
ATOM   7151  H HE1  . MET B 1 144 ? 19.033  -17.624 -60.969 1.00 23.29 ? 144 MET B HE1  1 
ATOM   7152  H HE2  . MET B 1 144 ? 17.770  -17.994 -61.860 1.00 23.29 ? 144 MET B HE2  1 
ATOM   7153  H HE3  . MET B 1 144 ? 17.957  -18.660 -60.429 1.00 23.29 ? 144 MET B HE3  1 
ATOM   7154  N N    . SER B 1 145 ? 18.100  -21.423 -57.873 1.00 18.09 ? 145 SER B N    1 
ATOM   7155  C CA   . SER B 1 145 ? 17.530  -21.169 -56.565 1.00 18.51 ? 145 SER B CA   1 
ATOM   7156  C C    . SER B 1 145 ? 16.991  -19.734 -56.538 1.00 13.64 ? 145 SER B C    1 
ATOM   7157  O O    . SER B 1 145 ? 17.199  -18.941 -57.473 1.00 15.43 ? 145 SER B O    1 
ATOM   7158  C CB   . SER B 1 145 ? 18.594  -21.412 -55.490 1.00 17.73 ? 145 SER B CB   1 
ATOM   7159  O OG   . SER B 1 145 ? 19.010  -22.759 -55.534 1.00 22.74 ? 145 SER B OG   1 
ATOM   7160  H H    . SER B 1 145 ? 18.807  -20.954 -58.020 1.00 21.69 ? 145 SER B H    1 
ATOM   7161  H HA   . SER B 1 145 ? 16.792  -21.778 -56.410 1.00 22.19 ? 145 SER B HA   1 
ATOM   7162  H HB2  . SER B 1 145 ? 19.356  -20.836 -55.659 1.00 21.26 ? 145 SER B HB2  1 
ATOM   7163  H HB3  . SER B 1 145 ? 18.215  -21.222 -54.618 1.00 21.26 ? 145 SER B HB3  1 
ATOM   7164  H HG   . SER B 1 145 ? 19.594  -22.898 -54.946 1.00 27.27 ? 145 SER B HG   1 
ATOM   7165  N N    . VAL B 1 146 ? 16.303  -19.399 -55.452 1.00 15.42 ? 146 VAL B N    1 
ATOM   7166  C CA   . VAL B 1 146 ? 15.769  -18.061 -55.267 1.00 12.56 ? 146 VAL B CA   1 
ATOM   7167  C C    . VAL B 1 146 ? 16.021  -17.616 -53.837 1.00 16.88 ? 146 VAL B C    1 
ATOM   7168  O O    . VAL B 1 146 ? 16.158  -18.424 -52.918 1.00 19.16 ? 146 VAL B O    1 
ATOM   7169  C CB   . VAL B 1 146 ? 14.250  -17.949 -55.565 1.00 16.25 ? 146 VAL B CB   1 
ATOM   7170  C CG1  . VAL B 1 146 ? 13.976  -18.332 -56.951 1.00 16.49 ? 146 VAL B CG1  1 
ATOM   7171  C CG2  . VAL B 1 146 ? 13.487  -18.822 -54.619 1.00 20.61 ? 146 VAL B CG2  1 
ATOM   7172  H H    . VAL B 1 146 ? 16.132  -19.936 -54.803 1.00 18.49 ? 146 VAL B H    1 
ATOM   7173  H HA   . VAL B 1 146 ? 16.236  -17.451 -55.859 1.00 15.05 ? 146 VAL B HA   1 
ATOM   7174  H HB   . VAL B 1 146 ? 13.962  -17.032 -55.438 1.00 19.47 ? 146 VAL B HB   1 
ATOM   7175  H HG11 . VAL B 1 146 ? 13.024  -18.255 -57.117 1.00 19.77 ? 146 VAL B HG11 1 
ATOM   7176  H HG12 . VAL B 1 146 ? 14.465  -17.740 -57.545 1.00 19.77 ? 146 VAL B HG12 1 
ATOM   7177  H HG13 . VAL B 1 146 ? 14.263  -19.249 -57.088 1.00 19.77 ? 146 VAL B HG13 1 
ATOM   7178  H HG21 . VAL B 1 146 ? 12.540  -18.745 -54.813 1.00 24.71 ? 146 VAL B HG21 1 
ATOM   7179  H HG22 . VAL B 1 146 ? 13.775  -19.741 -54.735 1.00 24.71 ? 146 VAL B HG22 1 
ATOM   7180  H HG23 . VAL B 1 146 ? 13.664  -18.532 -53.710 1.00 24.71 ? 146 VAL B HG23 1 
ATOM   7181  N N    . LEU B 1 147 ? 16.086  -16.306 -53.670 1.00 14.18 ? 147 LEU B N    1 
ATOM   7182  C CA   . LEU B 1 147 ? 16.247  -15.690 -52.363 1.00 18.34 ? 147 LEU B CA   1 
ATOM   7183  C C    . LEU B 1 147 ? 15.213  -14.586 -52.255 1.00 21.08 ? 147 LEU B C    1 
ATOM   7184  O O    . LEU B 1 147 ? 15.236  -13.636 -53.049 1.00 23.23 ? 147 LEU B O    1 
ATOM   7185  C CB   . LEU B 1 147 ? 17.663  -15.154 -52.199 1.00 14.39 ? 147 LEU B CB   1 
ATOM   7186  C CG   . LEU B 1 147 ? 18.006  -14.526 -50.831 1.00 17.11 ? 147 LEU B CG   1 
ATOM   7187  C CD1  . LEU B 1 147 ? 19.487  -14.601 -50.631 1.00 23.89 ? 147 LEU B CD1  1 
ATOM   7188  C CD2  . LEU B 1 147 ? 17.571  -13.099 -50.672 1.00 21.28 ? 147 LEU B CD2  1 
ATOM   7189  H H    . LEU B 1 147 ? 16.040  -15.737 -54.314 1.00 17.00 ? 147 LEU B H    1 
ATOM   7190  H HA   . LEU B 1 147 ? 16.078  -16.345 -51.668 1.00 21.98 ? 147 LEU B HA   1 
ATOM   7191  H HB2  . LEU B 1 147 ? 18.283  -15.886 -52.343 1.00 17.24 ? 147 LEU B HB2  1 
ATOM   7192  H HB3  . LEU B 1 147 ? 17.810  -14.472 -52.873 1.00 17.24 ? 147 LEU B HB3  1 
ATOM   7193  H HG   . LEU B 1 147 ? 17.583  -15.047 -50.131 1.00 20.51 ? 147 LEU B HG   1 
ATOM   7194  H HD11 . LEU B 1 147 ? 19.709  -14.207 -49.772 1.00 28.65 ? 147 LEU B HD11 1 
ATOM   7195  H HD12 . LEU B 1 147 ? 19.761  -15.531 -50.650 1.00 28.65 ? 147 LEU B HD12 1 
ATOM   7196  H HD13 . LEU B 1 147 ? 19.927  -14.111 -51.343 1.00 28.65 ? 147 LEU B HD13 1 
ATOM   7197  H HD21 . LEU B 1 147 ? 17.826  -12.789 -49.789 1.00 25.52 ? 147 LEU B HD21 1 
ATOM   7198  H HD22 . LEU B 1 147 ? 18.005  -12.559 -51.350 1.00 25.52 ? 147 LEU B HD22 1 
ATOM   7199  H HD23 . LEU B 1 147 ? 16.608  -13.049 -50.775 1.00 25.52 ? 147 LEU B HD23 1 
ATOM   7200  N N    . MET B 1 148 ? 14.306  -14.746 -51.310 1.00 15.86 ? 148 MET B N    1 
ATOM   7201  C CA   . MET B 1 148 ? 13.162  -13.831 -51.154 1.00 14.35 ? 148 MET B CA   1 
ATOM   7202  C C    . MET B 1 148 ? 12.778  -13.706 -49.697 1.00 11.49 ? 148 MET B C    1 
ATOM   7203  O O    . MET B 1 148 ? 12.665  -14.701 -49.048 1.00 13.68 ? 148 MET B O    1 
ATOM   7204  C CB   . MET B 1 148 ? 11.928  -14.371 -51.882 1.00 17.41 ? 148 MET B CB   1 
ATOM   7205  C CG   . MET B 1 148 ? 12.160  -14.842 -53.283 1.00 26.78 ? 148 MET B CG   1 
ATOM   7206  S SD   . MET B 1 148 ? 12.149  -13.419 -54.270 1.00 43.08 ? 148 MET B SD   1 
ATOM   7207  C CE   . MET B 1 148 ? 13.048  -14.042 -55.687 1.00 31.10 ? 148 MET B CE   1 
ATOM   7208  H H    . MET B 1 148 ? 14.333  -15.424 -50.703 1.00 19.01 ? 148 MET B H    1 
ATOM   7209  H HA   . MET B 1 148 ? 13.406  -12.945 -51.507 1.00 17.19 ? 148 MET B HA   1 
ATOM   7210  H HB2  . MET B 1 148 ? 11.565  -15.114 -51.360 1.00 20.88 ? 148 MET B HB2  1 
ATOM   7211  H HB3  . MET B 1 148 ? 11.249  -13.667 -51.898 1.00 20.88 ? 148 MET B HB3  1 
ATOM   7212  H HG2  . MET B 1 148 ? 13.025  -15.297 -53.354 1.00 32.12 ? 148 MET B HG2  1 
ATOM   7213  H HG3  . MET B 1 148 ? 11.446  -15.454 -53.563 1.00 32.12 ? 148 MET B HG3  1 
ATOM   7214  H HE1  . MET B 1 148 ? 13.679  -14.712 -55.398 1.00 37.30 ? 148 MET B HE1  1 
ATOM   7215  H HE2  . MET B 1 148 ? 12.427  -14.433 -56.314 1.00 37.30 ? 148 MET B HE2  1 
ATOM   7216  H HE3  . MET B 1 148 ? 13.520  -13.315 -56.112 1.00 37.30 ? 148 MET B HE3  1 
ATOM   7217  N N    . GLY B 1 149 ? 12.525  -12.494 -49.252 1.00 15.34 ? 149 GLY B N    1 
ATOM   7218  C CA   . GLY B 1 149 ? 11.998  -12.336 -47.905 1.00 15.34 ? 149 GLY B CA   1 
ATOM   7219  C C    . GLY B 1 149 ? 11.659  -10.894 -47.605 1.00 16.69 ? 149 GLY B C    1 
ATOM   7220  O O    . GLY B 1 149 ? 11.773  -10.017 -48.461 1.00 16.49 ? 149 GLY B O    1 
ATOM   7221  H H    . GLY B 1 149 ? 12.659  -11.761 -49.683 1.00 18.38 ? 149 GLY B H    1 
ATOM   7222  H HA2  . GLY B 1 149 ? 11.195  -12.871 -47.804 1.00 18.39 ? 149 GLY B HA2  1 
ATOM   7223  H HA3  . GLY B 1 149 ? 12.656  -12.641 -47.260 1.00 18.39 ? 149 GLY B HA3  1 
ATOM   7224  N N    . ALA B 1 150 ? 11.278  -10.651 -46.352 1.00 14.60 ? 150 ALA B N    1 
ATOM   7225  C CA   . ALA B 1 150 ? 11.001  -9.290  -45.884 1.00 13.49 ? 150 ALA B CA   1 
ATOM   7226  C C    . ALA B 1 150 ? 12.325  -8.577  -45.659 1.00 16.76 ? 150 ALA B C    1 
ATOM   7227  O O    . ALA B 1 150 ? 12.882  -8.564  -44.551 1.00 14.14 ? 150 ALA B O    1 
ATOM   7228  C CB   . ALA B 1 150 ? 10.181  -9.305  -44.601 1.00 14.54 ? 150 ALA B CB   1 
ATOM   7229  H H    . ALA B 1 150 ? 11.171  -11.257 -45.750 1.00 17.50 ? 150 ALA B H    1 
ATOM   7230  H HA   . ALA B 1 150 ? 10.502  -8.809  -46.562 1.00 16.16 ? 150 ALA B HA   1 
ATOM   7231  H HB1  . ALA B 1 150 ? 10.017  -8.391  -44.321 1.00 17.42 ? 150 ALA B HB1  1 
ATOM   7232  H HB2  . ALA B 1 150 ? 9.339   -9.756  -44.770 1.00 17.42 ? 150 ALA B HB2  1 
ATOM   7233  H HB3  . ALA B 1 150 ? 10.678  -9.778  -43.915 1.00 17.42 ? 150 ALA B HB3  1 
ATOM   7234  N N    . ASN B 1 151 ? 12.838  -7.969  -46.718 1.00 16.48 ? 151 ASN B N    1 
ATOM   7235  C CA   . ASN B 1 151 ? 14.093  -7.245  -46.612 1.00 18.31 ? 151 ASN B CA   1 
ATOM   7236  C C    . ASN B 1 151 ? 14.204  -6.224  -47.741 1.00 21.62 ? 151 ASN B C    1 
ATOM   7237  O O    . ASN B 1 151 ? 13.541  -6.331  -48.772 1.00 18.52 ? 151 ASN B O    1 
ATOM   7238  C CB   . ASN B 1 151 ? 15.273  -8.211  -46.613 1.00 13.26 ? 151 ASN B CB   1 
ATOM   7239  C CG   . ASN B 1 151 ? 15.185  -9.248  -47.683 1.00 15.37 ? 151 ASN B CG   1 
ATOM   7240  O OD1  . ASN B 1 151 ? 15.281  -8.926  -48.860 1.00 18.22 ? 151 ASN B OD1  1 
ATOM   7241  N ND2  . ASN B 1 151 ? 14.993  -10.523 -47.287 1.00 18.21 ? 151 ASN B ND2  1 
ATOM   7242  H H    . ASN B 1 151 ? 12.484  -7.961  -47.502 1.00 19.76 ? 151 ASN B H    1 
ATOM   7243  H HA   . ASN B 1 151 ? 14.105  -6.761  -45.771 1.00 21.95 ? 151 ASN B HA   1 
ATOM   7244  H HB2  . ASN B 1 151 ? 16.091  -7.709  -46.752 1.00 15.89 ? 151 ASN B HB2  1 
ATOM   7245  H HB3  . ASN B 1 151 ? 15.307  -8.667  -45.758 1.00 15.89 ? 151 ASN B HB3  1 
ATOM   7246  H HD21 . ASN B 1 151 ? 14.936  -11.151 -47.872 1.00 21.83 ? 151 ASN B HD21 1 
ATOM   7247  H HD22 . ASN B 1 151 ? 14.929  -10.708 -46.450 1.00 21.83 ? 151 ASN B HD22 1 
ATOM   7248  N N    . ILE B 1 152 ? 15.049  -5.222  -47.538 1.00 21.52 ? 152 ILE B N    1 
ATOM   7249  C CA   . ILE B 1 152 ? 15.318  -4.235  -48.576 1.00 25.60 ? 152 ILE B CA   1 
ATOM   7250  C C    . ILE B 1 152 ? 16.801  -3.897  -48.569 1.00 20.86 ? 152 ILE B C    1 
ATOM   7251  O O    . ILE B 1 152 ? 17.473  -3.972  -47.543 1.00 19.25 ? 152 ILE B O    1 
ATOM   7252  C CB   . ILE B 1 152 ? 14.485  -2.956  -48.403 1.00 23.66 ? 152 ILE B CB   1 
ATOM   7253  C CG1  . ILE B 1 152 ? 14.775  -2.299  -47.066 1.00 24.43 ? 152 ILE B CG1  1 
ATOM   7254  C CG2  . ILE B 1 152 ? 13.018  -3.286  -48.504 1.00 34.70 ? 152 ILE B CG2  1 
ATOM   7255  C CD1  . ILE B 1 152 ? 14.285  -0.892  -46.985 1.00 30.02 ? 152 ILE B CD1  1 
ATOM   7256  H H    . ILE B 1 152 ? 15.481  -5.090  -46.806 1.00 25.81 ? 152 ILE B H    1 
ATOM   7257  H HA   . ILE B 1 152 ? 15.102  -4.619  -49.440 1.00 30.69 ? 152 ILE B HA   1 
ATOM   7258  H HB   . ILE B 1 152 ? 14.714  -2.335  -49.112 1.00 28.38 ? 152 ILE B HB   1 
ATOM   7259  H HG12 . ILE B 1 152 ? 14.340  -2.807  -46.364 1.00 29.29 ? 152 ILE B HG12 1 
ATOM   7260  H HG13 . ILE B 1 152 ? 15.734  -2.290  -46.922 1.00 29.29 ? 152 ILE B HG13 1 
ATOM   7261  H HG21 . ILE B 1 152 ? 12.503  -2.471  -48.394 1.00 41.62 ? 152 ILE B HG21 1 
ATOM   7262  H HG22 . ILE B 1 152 ? 12.842  -3.674  -49.375 1.00 41.62 ? 152 ILE B HG22 1 
ATOM   7263  H HG23 . ILE B 1 152 ? 12.789  -3.920  -47.807 1.00 41.62 ? 152 ILE B HG23 1 
ATOM   7264  H HD11 . ILE B 1 152 ? 14.501  -0.533  -46.111 1.00 36.00 ? 152 ILE B HD11 1 
ATOM   7265  H HD12 . ILE B 1 152 ? 14.719  -0.367  -47.676 1.00 36.00 ? 152 ILE B HD12 1 
ATOM   7266  H HD13 . ILE B 1 152 ? 13.324  -0.885  -47.118 1.00 36.00 ? 152 ILE B HD13 1 
ATOM   7267  N N    . ALA B 1 153 ? 17.281  -3.454  -49.730 1.00 19.34 ? 153 ALA B N    1 
ATOM   7268  C CA   . ALA B 1 153 ? 18.717  -3.320  -49.973 1.00 23.44 ? 153 ALA B CA   1 
ATOM   7269  C C    . ALA B 1 153 ? 19.377  -2.402  -48.961 1.00 19.80 ? 153 ALA B C    1 
ATOM   7270  O O    . ALA B 1 153 ? 20.437  -2.720  -48.416 1.00 19.30 ? 153 ALA B O    1 
ATOM   7271  C CB   . ALA B 1 153 ? 18.944  -2.803  -51.394 1.00 23.53 ? 153 ALA B CB   1 
ATOM   7272  H H    . ALA B 1 153 ? 16.791  -3.223  -50.399 1.00 23.19 ? 153 ALA B H    1 
ATOM   7273  H HA   . ALA B 1 153 ? 19.133  -4.194  -49.901 1.00 28.11 ? 153 ALA B HA   1 
ATOM   7274  H HB1  . ALA B 1 153 ? 19.898  -2.716  -51.550 1.00 28.21 ? 153 ALA B HB1  1 
ATOM   7275  H HB2  . ALA B 1 153 ? 18.562  -3.434  -52.024 1.00 28.21 ? 153 ALA B HB2  1 
ATOM   7276  H HB3  . ALA B 1 153 ? 18.513  -1.939  -51.488 1.00 28.21 ? 153 ALA B HB3  1 
ATOM   7277  N N    . SER B 1 154 ? 18.781  -1.240  -48.714 1.00 21.49 ? 154 SER B N    1 
ATOM   7278  C CA   . SER B 1 154 ? 19.436  -0.255  -47.858 1.00 26.16 ? 154 SER B CA   1 
ATOM   7279  C C    . SER B 1 154 ? 19.589  -0.776  -46.443 1.00 24.65 ? 154 SER B C    1 
ATOM   7280  O O    . SER B 1 154 ? 20.615  -0.529  -45.794 1.00 22.01 ? 154 SER B O    1 
ATOM   7281  C CB   . SER B 1 154 ? 18.661  1.063   -47.867 1.00 32.44 ? 154 SER B CB   1 
ATOM   7282  O OG   . SER B 1 154 ? 17.285  0.864   -47.633 1.00 28.35 ? 154 SER B OG   1 
ATOM   7283  H H    . SER B 1 154 ? 18.015  -1.000  -49.022 1.00 25.76 ? 154 SER B H    1 
ATOM   7284  H HA   . SER B 1 154 ? 20.324  -0.079  -48.207 1.00 31.37 ? 154 SER B HA   1 
ATOM   7285  H HB2  . SER B 1 154 ? 19.016  1.639   -47.172 1.00 38.91 ? 154 SER B HB2  1 
ATOM   7286  H HB3  . SER B 1 154 ? 18.773  1.485   -48.733 1.00 38.91 ? 154 SER B HB3  1 
ATOM   7287  H HG   . SER B 1 154 ? 16.883  1.601   -47.643 1.00 34.00 ? 154 SER B HG   1 
ATOM   7288  N N    . GLU B 1 155 ? 18.597  -1.530  -45.953 1.00 23.15 ? 155 GLU B N    1 
ATOM   7289  C CA   . GLU B 1 155 ? 18.695  -2.097  -44.611 1.00 21.02 ? 155 GLU B CA   1 
ATOM   7290  C C    . GLU B 1 155 ? 19.731  -3.211  -44.556 1.00 20.18 ? 155 GLU B C    1 
ATOM   7291  O O    . GLU B 1 155 ? 20.458  -3.339  -43.569 1.00 19.56 ? 155 GLU B O    1 
ATOM   7292  C CB   . GLU B 1 155 ? 17.319  -2.596  -44.145 1.00 24.38 ? 155 GLU B CB   1 
ATOM   7293  C CG   . GLU B 1 155 ? 16.346  -1.411  -43.965 1.00 26.88 ? 155 GLU B CG   1 
ATOM   7294  C CD   . GLU B 1 155 ? 15.009  -1.748  -43.368 1.00 33.24 ? 155 GLU B CD   1 
ATOM   7295  O OE1  . GLU B 1 155 ? 14.582  -2.924  -43.419 1.00 24.12 ? 155 GLU B OE1  1 
ATOM   7296  O OE2  . GLU B 1 155 ? 14.379  -0.794  -42.853 1.00 32.60 ? 155 GLU B OE2  1 
ATOM   7297  H H    . GLU B 1 155 ? 17.871  -1.723  -46.372 1.00 27.76 ? 155 GLU B H    1 
ATOM   7298  H HA   . GLU B 1 155 ? 18.979  -1.400  -43.999 1.00 25.20 ? 155 GLU B HA   1 
ATOM   7299  H HB2  . GLU B 1 155 ? 16.951  -3.198  -44.811 1.00 29.23 ? 155 GLU B HB2  1 
ATOM   7300  H HB3  . GLU B 1 155 ? 17.411  -3.050  -43.293 1.00 29.23 ? 155 GLU B HB3  1 
ATOM   7301  H HG2  . GLU B 1 155 ? 16.765  -0.756  -43.386 1.00 32.24 ? 155 GLU B HG2  1 
ATOM   7302  H HG3  . GLU B 1 155 ? 16.183  -1.014  -44.836 1.00 32.24 ? 155 GLU B HG3  1 
ATOM   7303  N N    . VAL B 1 156 ? 19.821  -4.033  -45.599 1.00 17.65 ? 156 VAL B N    1 
ATOM   7304  C CA   . VAL B 1 156 ? 20.880  -5.041  -45.621 1.00 14.67 ? 156 VAL B CA   1 
ATOM   7305  C C    . VAL B 1 156 ? 22.260  -4.372  -45.644 1.00 18.00 ? 156 VAL B C    1 
ATOM   7306  O O    . VAL B 1 156 ? 23.186  -4.827  -44.965 1.00 21.66 ? 156 VAL B O    1 
ATOM   7307  C CB   . VAL B 1 156 ? 20.703  -6.003  -46.811 1.00 16.41 ? 156 VAL B CB   1 
ATOM   7308  C CG1  . VAL B 1 156 ? 21.938  -6.889  -46.953 1.00 24.50 ? 156 VAL B CG1  1 
ATOM   7309  C CG2  . VAL B 1 156 ? 19.397  -6.836  -46.644 1.00 19.10 ? 156 VAL B CG2  1 
ATOM   7310  H H    . VAL B 1 156 ? 19.302  -4.031  -46.285 1.00 21.16 ? 156 VAL B H    1 
ATOM   7311  H HA   . VAL B 1 156 ? 20.822  -5.567  -44.808 1.00 17.58 ? 156 VAL B HA   1 
ATOM   7312  H HB   . VAL B 1 156 ? 20.619  -5.481  -47.624 1.00 19.67 ? 156 VAL B HB   1 
ATOM   7313  H HG11 . VAL B 1 156 ? 21.812  -7.489  -47.706 1.00 29.38 ? 156 VAL B HG11 1 
ATOM   7314  H HG12 . VAL B 1 156 ? 22.714  -6.327  -47.105 1.00 29.38 ? 156 VAL B HG12 1 
ATOM   7315  H HG13 . VAL B 1 156 ? 22.055  -7.402  -46.138 1.00 29.38 ? 156 VAL B HG13 1 
ATOM   7316  H HG21 . VAL B 1 156 ? 19.305  -7.434  -47.402 1.00 22.90 ? 156 VAL B HG21 1 
ATOM   7317  H HG22 . VAL B 1 156 ? 19.453  -7.349  -45.822 1.00 22.90 ? 156 VAL B HG22 1 
ATOM   7318  H HG23 . VAL B 1 156 ? 18.640  -6.231  -46.605 1.00 22.90 ? 156 VAL B HG23 1 
ATOM   7319  N N    . ALA B 1 157 ? 22.411  -3.279  -46.409 1.00 21.95 ? 157 ALA B N    1 
ATOM   7320  C CA   . ALA B 1 157 ? 23.687  -2.562  -46.417 1.00 20.59 ? 157 ALA B CA   1 
ATOM   7321  C C    . ALA B 1 157 ? 24.016  -2.020  -45.037 1.00 22.43 ? 157 ALA B C    1 
ATOM   7322  O O    . ALA B 1 157 ? 25.180  -2.047  -44.611 1.00 25.50 ? 157 ALA B O    1 
ATOM   7323  C CB   . ALA B 1 157 ? 23.651  -1.429  -47.438 1.00 24.54 ? 157 ALA B CB   1 
ATOM   7324  H H    . ALA B 1 157 ? 21.804  -2.944  -46.918 1.00 26.32 ? 157 ALA B H    1 
ATOM   7325  H HA   . ALA B 1 157 ? 24.392  -3.176  -46.675 1.00 24.69 ? 157 ALA B HA   1 
ATOM   7326  H HB1  . ALA B 1 157 ? 24.505  -0.968  -47.427 1.00 29.43 ? 157 ALA B HB1  1 
ATOM   7327  H HB2  . ALA B 1 157 ? 23.488  -1.803  -48.318 1.00 29.43 ? 157 ALA B HB2  1 
ATOM   7328  H HB3  . ALA B 1 157 ? 22.940  -0.814  -47.202 1.00 29.43 ? 157 ALA B HB3  1 
ATOM   7329  N N    . ASP B 1 158 ? 23.006  -1.509  -44.334 1.00 21.98 ? 158 ASP B N    1 
ATOM   7330  C CA   . ASP B 1 158 ? 23.163  -0.938  -43.004 1.00 21.01 ? 158 ASP B CA   1 
ATOM   7331  C C    . ASP B 1 158 ? 23.185  -1.990  -41.905 1.00 24.15 ? 158 ASP B C    1 
ATOM   7332  O O    . ASP B 1 158 ? 23.251  -1.627  -40.721 1.00 20.58 ? 158 ASP B O    1 
ATOM   7333  C CB   . ASP B 1 158 ? 22.034  0.069   -42.749 1.00 25.32 ? 158 ASP B CB   1 
ATOM   7334  C CG   . ASP B 1 158 ? 22.225  1.381   -43.508 1.00 29.26 ? 158 ASP B CG   1 
ATOM   7335  O OD1  . ASP B 1 158 ? 23.372  1.715   -43.869 1.00 28.64 ? 158 ASP B OD1  1 
ATOM   7336  O OD2  . ASP B 1 158 ? 21.207  2.068   -43.742 1.00 24.49 ? 158 ASP B OD2  1 
ATOM   7337  H H    . ASP B 1 158 ? 22.195  -1.484  -44.619 1.00 26.36 ? 158 ASP B H    1 
ATOM   7338  H HA   . ASP B 1 158 ? 24.004  -0.456  -42.969 1.00 25.19 ? 158 ASP B HA   1 
ATOM   7339  H HB2  . ASP B 1 158 ? 21.193  -0.321  -43.032 1.00 30.37 ? 158 ASP B HB2  1 
ATOM   7340  H HB3  . ASP B 1 158 ? 22.002  0.274   -41.801 1.00 30.37 ? 158 ASP B HB3  1 
ATOM   7341  N N    . GLU B 1 159 ? 23.134  -3.284  -42.248 1.00 21.02 ? 159 GLU B N    1 
ATOM   7342  C CA   . GLU B 1 159 ? 23.216  -4.358  -41.250 1.00 19.88 ? 159 GLU B CA   1 
ATOM   7343  C C    . GLU B 1 159 ? 22.087  -4.268  -40.222 1.00 21.48 ? 159 GLU B C    1 
ATOM   7344  O O    . GLU B 1 159 ? 22.244  -4.652  -39.058 1.00 20.37 ? 159 GLU B O    1 
ATOM   7345  C CB   . GLU B 1 159 ? 24.591  -4.364  -40.566 1.00 24.16 ? 159 GLU B CB   1 
ATOM   7346  C CG   . GLU B 1 159 ? 25.688  -4.765  -41.565 1.00 28.74 ? 159 GLU B CG   1 
ATOM   7347  C CD   . GLU B 1 159 ? 27.101  -4.627  -41.032 1.00 34.51 ? 159 GLU B CD   1 
ATOM   7348  O OE1  . GLU B 1 159 ? 27.314  -4.735  -39.811 1.00 30.77 ? 159 GLU B OE1  1 
ATOM   7349  O OE2  . GLU B 1 159 ? 27.998  -4.424  -41.869 1.00 45.94 ? 159 GLU B OE2  1 
ATOM   7350  H H    . GLU B 1 159 ? 23.052  -3.566  -43.056 1.00 25.20 ? 159 GLU B H    1 
ATOM   7351  H HA   . GLU B 1 159 ? 23.120  -5.207  -41.709 1.00 23.83 ? 159 GLU B HA   1 
ATOM   7352  H HB2  . GLU B 1 159 ? 24.790  -3.475  -40.233 1.00 28.97 ? 159 GLU B HB2  1 
ATOM   7353  H HB3  . GLU B 1 159 ? 24.588  -5.006  -39.839 1.00 28.97 ? 159 GLU B HB3  1 
ATOM   7354  H HG2  . GLU B 1 159 ? 25.557  -5.694  -41.814 1.00 34.47 ? 159 GLU B HG2  1 
ATOM   7355  H HG3  . GLU B 1 159 ? 25.614  -4.202  -42.351 1.00 34.47 ? 159 GLU B HG3  1 
ATOM   7356  N N    . LYS B 1 160 ? 20.931  -3.784  -40.655 1.00 23.82 ? 160 LYS B N    1 
ATOM   7357  C CA   . LYS B 1 160 ? 19.736  -3.854  -39.840 1.00 20.97 ? 160 LYS B CA   1 
ATOM   7358  C C    . LYS B 1 160 ? 19.140  -5.259  -39.879 1.00 25.40 ? 160 LYS B C    1 
ATOM   7359  O O    . LYS B 1 160 ? 19.002  -5.863  -40.945 1.00 19.04 ? 160 LYS B O    1 
ATOM   7360  C CB   . LYS B 1 160 ? 18.736  -2.810  -40.315 1.00 23.88 ? 160 LYS B CB   1 
ATOM   7361  C CG   . LYS B 1 160 ? 19.220  -1.379  -39.950 1.00 27.45 ? 160 LYS B CG   1 
ATOM   7362  C CD   . LYS B 1 160 ? 18.502  -0.337  -40.744 1.00 35.74 ? 160 LYS B CD   1 
ATOM   7363  C CE   . LYS B 1 160 ? 18.774  1.049   -40.180 1.00 33.94 ? 160 LYS B CE   1 
ATOM   7364  N NZ   . LYS B 1 160 ? 17.878  2.026   -40.853 1.00 46.60 ? 160 LYS B NZ   1 
ATOM   7365  H H    . LYS B 1 160 ? 20.815  -3.410  -41.421 1.00 28.56 ? 160 LYS B H    1 
ATOM   7366  H HA   . LYS B 1 160 ? 19.967  -3.652  -38.920 1.00 25.15 ? 160 LYS B HA   1 
ATOM   7367  H HB2  . LYS B 1 160 ? 18.645  -2.866  -41.279 1.00 28.64 ? 160 LYS B HB2  1 
ATOM   7368  H HB3  . LYS B 1 160 ? 17.881  -2.964  -39.885 1.00 28.64 ? 160 LYS B HB3  1 
ATOM   7369  H HG2  . LYS B 1 160 ? 19.050  -1.215  -39.009 1.00 32.92 ? 160 LYS B HG2  1 
ATOM   7370  H HG3  . LYS B 1 160 ? 20.169  -1.305  -40.138 1.00 32.92 ? 160 LYS B HG3  1 
ATOM   7371  H HD2  . LYS B 1 160 ? 18.812  -0.361  -41.663 1.00 42.86 ? 160 LYS B HD2  1 
ATOM   7372  H HD3  . LYS B 1 160 ? 17.547  -0.502  -40.705 1.00 42.86 ? 160 LYS B HD3  1 
ATOM   7373  H HE2  . LYS B 1 160 ? 18.589  1.058   -39.228 1.00 40.71 ? 160 LYS B HE2  1 
ATOM   7374  H HE3  . LYS B 1 160 ? 19.695  1.299   -40.354 1.00 40.71 ? 160 LYS B HE3  1 
ATOM   7375  H HZ1  . LYS B 1 160 ? 18.025  2.843   -40.533 1.00 55.89 ? 160 LYS B HZ1  1 
ATOM   7376  H HZ2  . LYS B 1 160 ? 18.031  2.026   -41.729 1.00 55.89 ? 160 LYS B HZ2  1 
ATOM   7377  H HZ3  . LYS B 1 160 ? 17.027  1.807   -40.708 1.00 55.89 ? 160 LYS B HZ3  1 
ATOM   7378  N N    . PHE B 1 161 ? 18.770  -5.764  -38.710 1.00 20.53 ? 161 PHE B N    1 
ATOM   7379  C CA   . PHE B 1 161 ? 18.369  -7.162  -38.576 1.00 17.23 ? 161 PHE B CA   1 
ATOM   7380  C C    . PHE B 1 161 ? 17.139  -7.481  -39.422 1.00 17.68 ? 161 PHE B C    1 
ATOM   7381  O O    . PHE B 1 161 ? 16.110  -6.811  -39.325 1.00 15.23 ? 161 PHE B O    1 
ATOM   7382  C CB   . PHE B 1 161 ? 18.083  -7.474  -37.117 1.00 20.03 ? 161 PHE B CB   1 
ATOM   7383  C CG   . PHE B 1 161 ? 17.665  -8.895  -36.888 1.00 20.04 ? 161 PHE B CG   1 
ATOM   7384  C CD1  . PHE B 1 161 ? 18.609  -9.902  -36.741 1.00 17.19 ? 161 PHE B CD1  1 
ATOM   7385  C CD2  . PHE B 1 161 ? 16.335  -9.231  -36.837 1.00 18.84 ? 161 PHE B CD2  1 
ATOM   7386  C CE1  . PHE B 1 161 ? 18.217  -11.208 -36.559 1.00 13.86 ? 161 PHE B CE1  1 
ATOM   7387  C CE2  . PHE B 1 161 ? 15.954  -10.554 -36.630 1.00 15.89 ? 161 PHE B CE2  1 
ATOM   7388  C CZ   . PHE B 1 161 ? 16.897  -11.523 -36.505 1.00 16.21 ? 161 PHE B CZ   1 
ATOM   7389  H H    . PHE B 1 161 ? 18.741  -5.318  -37.976 1.00 24.62 ? 161 PHE B H    1 
ATOM   7390  H HA   . PHE B 1 161 ? 19.096  -7.732  -38.871 1.00 20.66 ? 161 PHE B HA   1 
ATOM   7391  H HB2  . PHE B 1 161 ? 18.885  -7.311  -36.597 1.00 24.01 ? 161 PHE B HB2  1 
ATOM   7392  H HB3  . PHE B 1 161 ? 17.365  -6.899  -36.807 1.00 24.01 ? 161 PHE B HB3  1 
ATOM   7393  H HD1  . PHE B 1 161 ? 19.514  -9.695  -36.785 1.00 20.61 ? 161 PHE B HD1  1 
ATOM   7394  H HD2  . PHE B 1 161 ? 15.686  -8.571  -36.930 1.00 22.59 ? 161 PHE B HD2  1 
ATOM   7395  H HE1  . PHE B 1 161 ? 18.858  -11.874 -36.458 1.00 16.61 ? 161 PHE B HE1  1 
ATOM   7396  H HE2  . PHE B 1 161 ? 15.052  -10.778 -36.598 1.00 19.05 ? 161 PHE B HE2  1 
ATOM   7397  H HZ   . PHE B 1 161 ? 16.638  -12.406 -36.367 1.00 19.43 ? 161 PHE B HZ   1 
ATOM   7398  N N    . CYS B 1 162 ? 17.248  -8.536  -40.229 1.00 17.48 ? 162 CYS B N    1 
ATOM   7399  C CA   . CYS B 1 162 ? 16.119  -9.020  -41.016 1.00 15.24 ? 162 CYS B CA   1 
ATOM   7400  C C    . CYS B 1 162 ? 16.398  -10.458 -41.431 1.00 16.47 ? 162 CYS B C    1 
ATOM   7401  O O    . CYS B 1 162 ? 17.476  -11.005 -41.191 1.00 14.84 ? 162 CYS B O    1 
ATOM   7402  C CB   . CYS B 1 162 ? 15.852  -8.104  -42.223 1.00 15.14 ? 162 CYS B CB   1 
ATOM   7403  S SG   . CYS B 1 162 ? 17.202  -8.030  -43.337 1.00 20.54 ? 162 CYS B SG   1 
ATOM   7404  H H    . CYS B 1 162 ? 17.970  -8.990  -40.338 1.00 20.96 ? 162 CYS B H    1 
ATOM   7405  H HA   . CYS B 1 162 ? 15.325  -9.019  -40.459 1.00 18.27 ? 162 CYS B HA   1 
ATOM   7406  H HB2  . CYS B 1 162 ? 15.082  -8.438  -42.708 1.00 18.15 ? 162 CYS B HB2  1 
ATOM   7407  H HB3  . CYS B 1 162 ? 15.678  -7.205  -41.904 1.00 18.15 ? 162 CYS B HB3  1 
ATOM   7408  H HG   . CYS B 1 162 ? 17.426  -9.133  -43.753 1.00 24.63 ? 162 CYS B HG   1 
ATOM   7409  N N    . GLU B 1 163 ? 15.396  -11.081 -42.037 1.00 13.53 ? 163 GLU B N    1 
ATOM   7410  C CA   . GLU B 1 163 ? 15.487  -12.470 -42.466 1.00 16.97 ? 163 GLU B CA   1 
ATOM   7411  C C    . GLU B 1 163 ? 15.294  -12.565 -43.962 1.00 15.47 ? 163 GLU B C    1 
ATOM   7412  O O    . GLU B 1 163 ? 14.764  -11.652 -44.593 1.00 17.54 ? 163 GLU B O    1 
ATOM   7413  C CB   . GLU B 1 163 ? 14.398  -13.363 -41.855 1.00 19.50 ? 163 GLU B CB   1 
ATOM   7414  C CG   . GLU B 1 163 ? 14.194  -13.340 -40.386 1.00 17.90 ? 163 GLU B CG   1 
ATOM   7415  C CD   . GLU B 1 163 ? 13.068  -14.289 -40.039 1.00 15.03 ? 163 GLU B CD   1 
ATOM   7416  O OE1  . GLU B 1 163 ? 13.404  -15.409 -39.577 1.00 17.69 ? 163 GLU B OE1  1 
ATOM   7417  O OE2  . GLU B 1 163 ? 11.890  -13.904 -40.290 1.00 14.45 ? 163 GLU B OE2  1 
ATOM   7418  H H    . GLU B 1 163 ? 14.638  -10.714 -42.215 1.00 16.21 ? 163 GLU B H    1 
ATOM   7419  H HA   . GLU B 1 163 ? 16.358  -12.832 -42.236 1.00 20.34 ? 163 GLU B HA   1 
ATOM   7420  H HB2  . GLU B 1 163 ? 13.552  -13.113 -42.258 1.00 23.38 ? 163 GLU B HB2  1 
ATOM   7421  H HB3  . GLU B 1 163 ? 14.600  -14.281 -42.094 1.00 23.38 ? 163 GLU B HB3  1 
ATOM   7422  H HG2  . GLU B 1 163 ? 15.001  -13.635 -39.937 1.00 21.46 ? 163 GLU B HG2  1 
ATOM   7423  H HG3  . GLU B 1 163 ? 13.948  -12.446 -40.102 1.00 21.46 ? 163 GLU B HG3  1 
ATOM   7424  N N    . THR B 1 164 ? 15.623  -13.745 -44.500 1.00 14.46 ? 164 THR B N    1 
ATOM   7425  C CA   . THR B 1 164 ? 15.215  -14.093 -45.853 1.00 14.70 ? 164 THR B CA   1 
ATOM   7426  C C    . THR B 1 164 ? 15.053  -15.607 -45.970 1.00 18.08 ? 164 THR B C    1 
ATOM   7427  O O    . THR B 1 164 ? 15.532  -16.372 -45.136 1.00 15.28 ? 164 THR B O    1 
ATOM   7428  C CB   . THR B 1 164 ? 16.200  -13.551 -46.911 1.00 19.72 ? 164 THR B CB   1 
ATOM   7429  O OG1  . THR B 1 164 ? 15.536  -13.470 -48.192 1.00 15.87 ? 164 THR B OG1  1 
ATOM   7430  C CG2  . THR B 1 164 ? 17.456  -14.406 -47.062 1.00 15.37 ? 164 THR B CG2  1 
ATOM   7431  H H    . THR B 1 164 ? 16.081  -14.353 -44.100 1.00 17.32 ? 164 THR B H    1 
ATOM   7432  H HA   . THR B 1 164 ? 14.349  -13.691 -46.027 1.00 17.62 ? 164 THR B HA   1 
ATOM   7433  H HB   . THR B 1 164 ? 16.480  -12.660 -46.648 1.00 23.65 ? 164 THR B HB   1 
ATOM   7434  H HG1  . THR B 1 164 ? 15.270  -14.232 -48.426 1.00 19.02 ? 164 THR B HG1  1 
ATOM   7435  H HG21 . THR B 1 164 ? 18.039  -14.023 -47.736 1.00 18.42 ? 164 THR B HG21 1 
ATOM   7436  H HG22 . THR B 1 164 ? 17.933  -14.446 -46.218 1.00 18.42 ? 164 THR B HG22 1 
ATOM   7437  H HG23 . THR B 1 164 ? 17.213  -15.307 -47.329 1.00 18.42 ? 164 THR B HG23 1 
ATOM   7438  N N    . THR B 1 165 ? 14.335  -16.026 -47.004 1.00 14.75 ? 165 THR B N    1 
ATOM   7439  C CA   . THR B 1 165 ? 14.193  -17.427 -47.363 1.00 16.73 ? 165 THR B CA   1 
ATOM   7440  C C    . THR B 1 165 ? 15.006  -17.731 -48.610 1.00 16.08 ? 165 THR B C    1 
ATOM   7441  O O    . THR B 1 165 ? 15.040  -16.941 -49.547 1.00 18.09 ? 165 THR B O    1 
ATOM   7442  C CB   . THR B 1 165 ? 12.734  -17.757 -47.634 1.00 11.71 ? 165 THR B CB   1 
ATOM   7443  O OG1  . THR B 1 165 ? 11.894  -17.164 -46.615 1.00 16.08 ? 165 THR B OG1  1 
ATOM   7444  C CG2  . THR B 1 165 ? 12.535  -19.253 -47.703 1.00 15.45 ? 165 THR B CG2  1 
ATOM   7445  H H    . THR B 1 165 ? 13.907  -15.497 -47.531 1.00 17.67 ? 165 THR B H    1 
ATOM   7446  H HA   . THR B 1 165 ? 14.511  -17.987 -46.637 1.00 20.05 ? 165 THR B HA   1 
ATOM   7447  H HB   . THR B 1 165 ? 12.487  -17.387 -48.496 1.00 14.03 ? 165 THR B HB   1 
ATOM   7448  H HG1  . THR B 1 165 ? 12.105  -17.463 -45.859 1.00 19.28 ? 165 THR B HG1  1 
ATOM   7449  H HG21 . THR B 1 165 ? 11.602  -19.456 -47.877 1.00 18.52 ? 165 THR B HG21 1 
ATOM   7450  H HG22 . THR B 1 165 ? 13.077  -19.627 -48.416 1.00 18.52 ? 165 THR B HG22 1 
ATOM   7451  H HG23 . THR B 1 165 ? 12.795  -19.661 -46.862 1.00 18.52 ? 165 THR B HG23 1 
ATOM   7452  N N    . ILE B 1 166 ? 15.658  -18.877 -48.630 1.00 14.66 ? 166 ILE B N    1 
ATOM   7453  C CA   . ILE B 1 166 ? 16.297  -19.381 -49.841 1.00 14.21 ? 166 ILE B CA   1 
ATOM   7454  C C    . ILE B 1 166 ? 15.507  -20.604 -50.250 1.00 19.25 ? 166 ILE B C    1 
ATOM   7455  O O    . ILE B 1 166 ? 15.339  -21.523 -49.440 1.00 18.81 ? 166 ILE B O    1 
ATOM   7456  C CB   . ILE B 1 166 ? 17.784  -19.731 -49.626 1.00 15.14 ? 166 ILE B CB   1 
ATOM   7457  C CG1  . ILE B 1 166 ? 18.628  -18.486 -49.594 1.00 14.53 ? 166 ILE B CG1  1 
ATOM   7458  C CG2  . ILE B 1 166 ? 18.307  -20.629 -50.787 1.00 17.65 ? 166 ILE B CG2  1 
ATOM   7459  C CD1  . ILE B 1 166 ? 20.151  -18.753 -49.359 1.00 19.45 ? 166 ILE B CD1  1 
ATOM   7460  H H    . ILE B 1 166 ? 15.749  -19.392 -47.948 1.00 17.57 ? 166 ILE B H    1 
ATOM   7461  H HA   . ILE B 1 166 ? 16.232  -18.718 -50.546 1.00 17.03 ? 166 ILE B HA   1 
ATOM   7462  H HB   . ILE B 1 166 ? 17.882  -20.206 -48.786 1.00 18.14 ? 166 ILE B HB   1 
ATOM   7463  H HG12 . ILE B 1 166 ? 18.536  -18.025 -50.442 1.00 17.41 ? 166 ILE B HG12 1 
ATOM   7464  H HG13 . ILE B 1 166 ? 18.314  -17.915 -48.875 1.00 17.41 ? 166 ILE B HG13 1 
ATOM   7465  H HG21 . ILE B 1 166 ? 19.241  -20.835 -50.630 1.00 21.15 ? 166 ILE B HG21 1 
ATOM   7466  H HG22 . ILE B 1 166 ? 17.786  -21.448 -50.811 1.00 21.15 ? 166 ILE B HG22 1 
ATOM   7467  H HG23 . ILE B 1 166 ? 18.209  -20.150 -51.625 1.00 21.15 ? 166 ILE B HG23 1 
ATOM   7468  H HD11 . ILE B 1 166 ? 20.622  -17.906 -49.352 1.00 23.32 ? 166 ILE B HD11 1 
ATOM   7469  H HD12 . ILE B 1 166 ? 20.264  -19.203 -48.507 1.00 23.32 ? 166 ILE B HD12 1 
ATOM   7470  H HD13 . ILE B 1 166 ? 20.487  -19.313 -50.076 1.00 23.32 ? 166 ILE B HD13 1 
ATOM   7471  N N    . GLY B 1 167 ? 14.999  -20.613 -51.473 1.00 17.31 ? 167 GLY B N    1 
ATOM   7472  C CA   . GLY B 1 167 ? 14.396  -21.800 -52.039 1.00 17.56 ? 167 GLY B CA   1 
ATOM   7473  C C    . GLY B 1 167 ? 15.429  -22.490 -52.910 1.00 17.17 ? 167 GLY B C    1 
ATOM   7474  O O    . GLY B 1 167 ? 15.905  -21.922 -53.895 1.00 16.60 ? 167 GLY B O    1 
ATOM   7475  H H    . GLY B 1 167 ? 14.993  -19.933 -52.000 1.00 20.75 ? 167 GLY B H    1 
ATOM   7476  H HA2  . GLY B 1 167 ? 14.116  -22.404 -51.334 1.00 21.05 ? 167 GLY B HA2  1 
ATOM   7477  H HA3  . GLY B 1 167 ? 13.628  -21.561 -52.582 1.00 21.05 ? 167 GLY B HA3  1 
ATOM   7478  N N    . CYS B 1 168 ? 15.778  -23.716 -52.538 1.00 17.19 ? 168 CYS B N    1 
ATOM   7479  C CA   . CYS B 1 168 ? 16.784  -24.445 -53.295 1.00 18.69 ? 168 CYS B CA   1 
ATOM   7480  C C    . CYS B 1 168 ? 16.452  -25.929 -53.196 1.00 24.00 ? 168 CYS B C    1 
ATOM   7481  O O    . CYS B 1 168 ? 16.317  -26.449 -52.084 1.00 19.06 ? 168 CYS B O    1 
ATOM   7482  C CB   . CYS B 1 168 ? 18.182  -24.165 -52.762 1.00 21.28 ? 168 CYS B CB   1 
ATOM   7483  S SG   . CYS B 1 168 ? 19.466  -25.077 -53.642 1.00 22.23 ? 168 CYS B SG   1 
ATOM   7484  H H    . CYS B 1 168 ? 15.454  -24.140 -51.864 1.00 20.60 ? 168 CYS B H    1 
ATOM   7485  H HA   . CYS B 1 168 ? 16.748  -24.180 -54.227 1.00 22.40 ? 168 CYS B HA   1 
ATOM   7486  H HB2  . CYS B 1 168 ? 18.370  -23.218 -52.854 1.00 25.51 ? 168 CYS B HB2  1 
ATOM   7487  H HB3  . CYS B 1 168 ? 18.220  -24.421 -51.827 1.00 25.51 ? 168 CYS B HB3  1 
ATOM   7488  H HG   . CYS B 1 168 ? 19.256  -26.253 -53.531 1.00 26.65 ? 168 CYS B HG   1 
ATOM   7489  N N    . LYS B 1 169 ? 16.327  -26.601 -54.362 1.00 24.11 ? 169 LYS B N    1 
ATOM   7490  C CA   . LYS B 1 169 ? 15.934  -28.008 -54.383 1.00 26.33 ? 169 LYS B CA   1 
ATOM   7491  C C    . LYS B 1 169 ? 17.022  -28.916 -53.812 1.00 24.81 ? 169 LYS B C    1 
ATOM   7492  O O    . LYS B 1 169 ? 16.720  -29.864 -53.071 1.00 27.19 ? 169 LYS B O    1 
ATOM   7493  C CB   . LYS B 1 169 ? 15.575  -28.424 -55.816 1.00 26.13 ? 169 LYS B CB   1 
ATOM   7494  H H    . LYS B 1 169 ? 16.466  -26.260 -55.140 1.00 28.91 ? 169 LYS B H    1 
ATOM   7495  H HA   . LYS B 1 169 ? 15.141  -28.118 -53.836 1.00 31.58 ? 169 LYS B HA   1 
ATOM   7496  N N    . ASP B 1 170 ? 18.280  -28.662 -54.140 1.00 24.29 ? 170 ASP B N    1 
ATOM   7497  C CA   . ASP B 1 170 ? 19.366  -29.562 -53.740 1.00 27.42 ? 170 ASP B CA   1 
ATOM   7498  C C    . ASP B 1 170 ? 19.865  -29.229 -52.329 1.00 28.91 ? 170 ASP B C    1 
ATOM   7499  O O    . ASP B 1 170 ? 20.299  -28.097 -52.095 1.00 23.07 ? 170 ASP B O    1 
ATOM   7500  C CB   . ASP B 1 170 ? 20.515  -29.473 -54.724 1.00 28.94 ? 170 ASP B CB   1 
ATOM   7501  C CG   . ASP B 1 170 ? 21.674  -30.355 -54.324 1.00 29.54 ? 170 ASP B CG   1 
ATOM   7502  O OD1  . ASP B 1 170 ? 21.452  -31.570 -54.202 1.00 36.30 ? 170 ASP B OD1  1 
ATOM   7503  O OD2  . ASP B 1 170 ? 22.787  -29.841 -54.114 1.00 31.32 ? 170 ASP B OD2  1 
ATOM   7504  H H    . ASP B 1 170 ? 18.537  -27.978 -54.594 1.00 29.13 ? 170 ASP B H    1 
ATOM   7505  H HA   . ASP B 1 170 ? 19.039  -30.476 -53.738 1.00 32.89 ? 170 ASP B HA   1 
ATOM   7506  H HB2  . ASP B 1 170 ? 20.207  -29.756 -55.599 1.00 34.70 ? 170 ASP B HB2  1 
ATOM   7507  H HB3  . ASP B 1 170 ? 20.831  -28.557 -54.761 1.00 34.70 ? 170 ASP B HB3  1 
ATOM   7508  N N    . PRO B 1 171 ? 19.852  -30.167 -51.375 1.00 28.94 ? 171 PRO B N    1 
ATOM   7509  C CA   . PRO B 1 171 ? 20.241  -29.797 -50.000 1.00 27.64 ? 171 PRO B CA   1 
ATOM   7510  C C    . PRO B 1 171 ? 21.650  -29.259 -49.885 1.00 28.18 ? 171 PRO B C    1 
ATOM   7511  O O    . PRO B 1 171 ? 21.878  -28.266 -49.180 1.00 22.11 ? 171 PRO B O    1 
ATOM   7512  C CB   . PRO B 1 171 ? 20.087  -31.111 -49.234 1.00 32.01 ? 171 PRO B CB   1 
ATOM   7513  C CG   . PRO B 1 171 ? 19.048  -31.827 -49.994 1.00 31.67 ? 171 PRO B CG   1 
ATOM   7514  C CD   . PRO B 1 171 ? 19.334  -31.539 -51.423 1.00 30.82 ? 171 PRO B CD   1 
ATOM   7515  H HA   . PRO B 1 171 ? 19.620  -29.144 -49.642 1.00 33.14 ? 171 PRO B HA   1 
ATOM   7516  H HB2  . PRO B 1 171 ? 20.924  -31.600 -49.242 1.00 38.39 ? 171 PRO B HB2  1 
ATOM   7517  H HB3  . PRO B 1 171 ? 19.794  -30.934 -48.326 1.00 38.39 ? 171 PRO B HB3  1 
ATOM   7518  H HG2  . PRO B 1 171 ? 19.112  -32.778 -49.818 1.00 37.99 ? 171 PRO B HG2  1 
ATOM   7519  H HG3  . PRO B 1 171 ? 18.173  -31.490 -49.746 1.00 37.99 ? 171 PRO B HG3  1 
ATOM   7520  H HD2  . PRO B 1 171 ? 20.008  -32.147 -51.764 1.00 36.96 ? 171 PRO B HD2  1 
ATOM   7521  H HD3  . PRO B 1 171 ? 18.519  -31.577 -51.947 1.00 36.96 ? 171 PRO B HD3  1 
ATOM   7522  N N    . ALA B 1 172 ? 22.617  -29.896 -50.550 1.00 28.09 ? 172 ALA B N    1 
ATOM   7523  C CA   . ALA B 1 172 ? 23.994  -29.460 -50.396 1.00 29.97 ? 172 ALA B CA   1 
ATOM   7524  C C    . ALA B 1 172 ? 24.193  -28.075 -50.999 1.00 24.76 ? 172 ALA B C    1 
ATOM   7525  O O    . ALA B 1 172 ? 24.921  -27.242 -50.439 1.00 23.14 ? 172 ALA B O    1 
ATOM   7526  C CB   . ALA B 1 172 ? 24.947  -30.461 -51.036 1.00 30.63 ? 172 ALA B CB   1 
ATOM   7527  H H    . ALA B 1 172 ? 22.502  -30.563 -51.081 1.00 33.69 ? 172 ALA B H    1 
ATOM   7528  H HA   . ALA B 1 172 ? 24.205  -29.408 -49.451 1.00 35.95 ? 172 ALA B HA   1 
ATOM   7529  H HB1  . ALA B 1 172 ? 25.858  -30.148 -50.920 1.00 36.73 ? 172 ALA B HB1  1 
ATOM   7530  H HB2  . ALA B 1 172 ? 24.836  -31.323 -50.605 1.00 36.73 ? 172 ALA B HB2  1 
ATOM   7531  H HB3  . ALA B 1 172 ? 24.740  -30.534 -51.981 1.00 36.73 ? 172 ALA B HB3  1 
ATOM   7532  N N    . GLN B 1 173 ? 23.575  -27.821 -52.146 1.00 23.61 ? 173 GLN B N    1 
ATOM   7533  C CA   . GLN B 1 173 ? 23.650  -26.493 -52.757 1.00 26.62 ? 173 GLN B CA   1 
ATOM   7534  C C    . GLN B 1 173 ? 22.943  -25.447 -51.895 1.00 24.07 ? 173 GLN B C    1 
ATOM   7535  O O    . GLN B 1 173 ? 23.397  -24.297 -51.807 1.00 20.50 ? 173 GLN B O    1 
ATOM   7536  C CB   . GLN B 1 173 ? 23.037  -26.533 -54.150 1.00 28.96 ? 173 GLN B CB   1 
ATOM   7537  C CG   . GLN B 1 173 ? 22.880  -25.201 -54.823 1.00 28.88 ? 173 GLN B CG   1 
ATOM   7538  C CD   . GLN B 1 173 ? 24.154  -24.602 -55.394 1.00 35.05 ? 173 GLN B CD   1 
ATOM   7539  O OE1  . GLN B 1 173 ? 24.104  -23.518 -56.003 1.00 37.30 ? 173 GLN B OE1  1 
ATOM   7540  N NE2  . GLN B 1 173 ? 25.295  -25.287 -55.231 1.00 33.59 ? 173 GLN B NE2  1 
ATOM   7541  H H    . GLN B 1 173 ? 23.109  -28.391 -52.590 1.00 28.31 ? 173 GLN B H    1 
ATOM   7542  H HA   . GLN B 1 173 ? 24.581  -26.235 -52.843 1.00 31.92 ? 173 GLN B HA   1 
ATOM   7543  H HB2  . GLN B 1 173 ? 23.602  -27.081 -54.718 1.00 34.73 ? 173 GLN B HB2  1 
ATOM   7544  H HB3  . GLN B 1 173 ? 22.156  -26.933 -54.087 1.00 34.73 ? 173 GLN B HB3  1 
ATOM   7545  H HG2  . GLN B 1 173 ? 22.252  -25.300 -55.555 1.00 34.63 ? 173 GLN B HG2  1 
ATOM   7546  H HG3  . GLN B 1 173 ? 22.527  -24.571 -54.176 1.00 34.63 ? 173 GLN B HG3  1 
ATOM   7547  H HE21 . GLN B 1 173 ? 25.290  -26.035 -54.807 1.00 40.29 ? 173 GLN B HE21 1 
ATOM   7548  H HE22 . GLN B 1 173 ? 26.032  -24.975 -55.544 1.00 40.29 ? 173 GLN B HE22 1 
ATOM   7549  N N    . GLY B 1 174 ? 21.822  -25.814 -51.270 1.00 22.33 ? 174 GLY B N    1 
ATOM   7550  C CA   . GLY B 1 174 ? 21.184  -24.886 -50.333 1.00 22.50 ? 174 GLY B CA   1 
ATOM   7551  C C    . GLY B 1 174 ? 22.099  -24.499 -49.182 1.00 19.13 ? 174 GLY B C    1 
ATOM   7552  O O    . GLY B 1 174 ? 22.185  -23.327 -48.787 1.00 20.15 ? 174 GLY B O    1 
ATOM   7553  H H    . GLY B 1 174 ? 21.422  -26.569 -51.365 1.00 26.78 ? 174 GLY B H    1 
ATOM   7554  H HA2  . GLY B 1 174 ? 20.925  -24.078 -50.804 1.00 26.97 ? 174 GLY B HA2  1 
ATOM   7555  H HA3  . GLY B 1 174 ? 20.385  -25.296 -49.965 1.00 26.97 ? 174 GLY B HA3  1 
ATOM   7556  N N    . GLN B 1 175 ? 22.794  -25.477 -48.616 1.00 23.98 ? 175 GLN B N    1 
ATOM   7557  C CA   . GLN B 1 175 ? 23.680  -25.177 -47.496 1.00 23.13 ? 175 GLN B CA   1 
ATOM   7558  C C    . GLN B 1 175 ? 24.808  -24.244 -47.922 1.00 20.45 ? 175 GLN B C    1 
ATOM   7559  O O    . GLN B 1 175 ? 25.190  -23.328 -47.179 1.00 20.52 ? 175 GLN B O    1 
ATOM   7560  C CB   . GLN B 1 175 ? 24.220  -26.479 -46.910 1.00 28.62 ? 175 GLN B CB   1 
ATOM   7561  C CG   . GLN B 1 175 ? 25.224  -26.300 -45.774 1.00 27.45 ? 175 GLN B CG   1 
ATOM   7562  C CD   . GLN B 1 175 ? 24.611  -25.645 -44.550 1.00 31.59 ? 175 GLN B CD   1 
ATOM   7563  O OE1  . GLN B 1 175 ? 23.418  -25.810 -44.278 1.00 30.73 ? 175 GLN B OE1  1 
ATOM   7564  N NE2  . GLN B 1 175 ? 25.421  -24.863 -43.822 1.00 28.01 ? 175 GLN B NE2  1 
ATOM   7565  H H    . GLN B 1 175 ? 22.774  -26.303 -48.853 1.00 28.75 ? 175 GLN B H    1 
ATOM   7566  H HA   . GLN B 1 175 ? 23.169  -24.729 -46.804 1.00 27.73 ? 175 GLN B HA   1 
ATOM   7567  H HB2  . GLN B 1 175 ? 23.476  -26.996 -46.565 1.00 34.32 ? 175 GLN B HB2  1 
ATOM   7568  H HB3  . GLN B 1 175 ? 24.662  -26.976 -47.617 1.00 34.32 ? 175 GLN B HB3  1 
ATOM   7569  H HG2  . GLN B 1 175 ? 25.563  -27.170 -45.511 1.00 32.92 ? 175 GLN B HG2  1 
ATOM   7570  H HG3  . GLN B 1 175 ? 25.953  -25.739 -46.081 1.00 32.92 ? 175 GLN B HG3  1 
ATOM   7571  H HE21 . GLN B 1 175 ? 26.245  -24.768 -44.048 1.00 33.59 ? 175 GLN B HE21 1 
ATOM   7572  H HE22 . GLN B 1 175 ? 25.120  -24.467 -43.120 1.00 33.59 ? 175 GLN B HE22 1 
ATOM   7573  N N    . LEU B 1 176 ? 25.364  -24.464 -49.109 1.00 19.11 ? 176 LEU B N    1 
ATOM   7574  C CA   . LEU B 1 176 ? 26.400  -23.581 -49.630 1.00 19.78 ? 176 LEU B CA   1 
ATOM   7575  C C    . LEU B 1 176 ? 25.887  -22.161 -49.807 1.00 20.71 ? 176 LEU B C    1 
ATOM   7576  O O    . LEU B 1 176 ? 26.568  -21.196 -49.451 1.00 17.73 ? 176 LEU B O    1 
ATOM   7577  C CB   . LEU B 1 176 ? 26.897  -24.146 -50.959 1.00 19.85 ? 176 LEU B CB   1 
ATOM   7578  C CG   . LEU B 1 176 ? 28.337  -24.055 -51.406 1.00 29.58 ? 176 LEU B CG   1 
ATOM   7579  C CD1  . LEU B 1 176 ? 29.330  -24.429 -50.300 1.00 26.47 ? 176 LEU B CD1  1 
ATOM   7580  C CD2  . LEU B 1 176 ? 28.528  -24.962 -52.628 1.00 32.29 ? 176 LEU B CD2  1 
ATOM   7581  H H    . LEU B 1 176 ? 25.159  -25.116 -49.631 1.00 22.91 ? 176 LEU B H    1 
ATOM   7582  H HA   . LEU B 1 176 ? 27.145  -23.560 -49.010 1.00 23.71 ? 176 LEU B HA   1 
ATOM   7583  H HB2  . LEU B 1 176 ? 26.680  -25.091 -50.959 1.00 23.80 ? 176 LEU B HB2  1 
ATOM   7584  H HB3  . LEU B 1 176 ? 26.378  -23.716 -51.657 1.00 23.80 ? 176 LEU B HB3  1 
ATOM   7585  H HG   . LEU B 1 176 ? 28.525  -23.144 -51.679 1.00 35.47 ? 176 LEU B HG   1 
ATOM   7586  H HD11 . LEU B 1 176 ? 30.232  -24.352 -50.647 1.00 31.75 ? 176 LEU B HD11 1 
ATOM   7587  H HD12 . LEU B 1 176 ? 29.210  -23.825 -49.551 1.00 31.75 ? 176 LEU B HD12 1 
ATOM   7588  H HD13 . LEU B 1 176 ? 29.160  -25.342 -50.019 1.00 31.75 ? 176 LEU B HD13 1 
ATOM   7589  H HD21 . LEU B 1 176 ? 29.451  -24.908 -52.920 1.00 38.73 ? 176 LEU B HD21 1 
ATOM   7590  H HD22 . LEU B 1 176 ? 28.311  -25.874 -52.380 1.00 38.73 ? 176 LEU B HD22 1 
ATOM   7591  H HD23 . LEU B 1 176 ? 27.938  -24.663 -53.338 1.00 38.73 ? 176 LEU B HD23 1 
ATOM   7592  N N    . LEU B 1 177 ? 24.688  -22.001 -50.377 1.00 18.42 ? 177 LEU B N    1 
ATOM   7593  C CA   . LEU B 1 177 ? 24.140  -20.656 -50.530 1.00 14.73 ? 177 LEU B CA   1 
ATOM   7594  C C    . LEU B 1 177 ? 23.885  -19.998 -49.174 1.00 15.15 ? 177 LEU B C    1 
ATOM   7595  O O    . LEU B 1 177 ? 24.065  -18.786 -49.017 1.00 17.63 ? 177 LEU B O    1 
ATOM   7596  C CB   . LEU B 1 177 ? 22.855  -20.711 -51.348 1.00 15.60 ? 177 LEU B CB   1 
ATOM   7597  C CG   . LEU B 1 177 ? 23.097  -21.192 -52.781 1.00 20.26 ? 177 LEU B CG   1 
ATOM   7598  C CD1  . LEU B 1 177 ? 21.811  -21.519 -53.532 1.00 25.53 ? 177 LEU B CD1  1 
ATOM   7599  C CD2  . LEU B 1 177 ? 23.864  -20.152 -53.558 1.00 21.71 ? 177 LEU B CD2  1 
ATOM   7600  H H    . LEU B 1 177 ? 24.189  -22.635 -50.675 1.00 22.08 ? 177 LEU B H    1 
ATOM   7601  H HA   . LEU B 1 177 ? 24.779  -20.108 -51.012 1.00 17.66 ? 177 LEU B HA   1 
ATOM   7602  H HB2  . LEU B 1 177 ? 22.235  -21.325 -50.925 1.00 18.70 ? 177 LEU B HB2  1 
ATOM   7603  H HB3  . LEU B 1 177 ? 22.467  -19.823 -51.389 1.00 18.70 ? 177 LEU B HB3  1 
ATOM   7604  H HG   . LEU B 1 177 ? 23.636  -21.998 -52.753 1.00 24.29 ? 177 LEU B HG   1 
ATOM   7605  H HD11 . LEU B 1 177 ? 22.035  -21.816 -54.428 1.00 30.62 ? 177 LEU B HD11 1 
ATOM   7606  H HD12 . LEU B 1 177 ? 21.340  -22.222 -53.058 1.00 30.62 ? 177 LEU B HD12 1 
ATOM   7607  H HD13 . LEU B 1 177 ? 21.260  -20.722 -53.575 1.00 30.62 ? 177 LEU B HD13 1 
ATOM   7608  H HD21 . LEU B 1 177 ? 24.007  -20.475 -54.462 1.00 26.03 ? 177 LEU B HD21 1 
ATOM   7609  H HD22 . LEU B 1 177 ? 23.350  -19.330 -53.578 1.00 26.03 ? 177 LEU B HD22 1 
ATOM   7610  H HD23 . LEU B 1 177 ? 24.717  -19.998 -53.122 1.00 26.03 ? 177 LEU B HD23 1 
ATOM   7611  N N    . LYS B 1 178 ? 23.410  -20.765 -48.193 1.00 18.23 ? 178 LYS B N    1 
ATOM   7612  C CA   . LYS B 1 178 ? 23.215  -20.203 -46.861 1.00 20.03 ? 178 LYS B CA   1 
ATOM   7613  C C    . LYS B 1 178 ? 24.537  -19.705 -46.302 1.00 20.36 ? 178 LYS B C    1 
ATOM   7614  O O    . LYS B 1 178 ? 24.627  -18.604 -45.741 1.00 18.00 ? 178 LYS B O    1 
ATOM   7615  C CB   . LYS B 1 178 ? 22.606  -21.259 -45.944 1.00 21.60 ? 178 LYS B CB   1 
ATOM   7616  C CG   . LYS B 1 178 ? 22.402  -20.805 -44.490 1.00 17.73 ? 178 LYS B CG   1 
ATOM   7617  C CD   . LYS B 1 178 ? 21.783  -21.873 -43.630 1.00 23.72 ? 178 LYS B CD   1 
ATOM   7618  C CE   . LYS B 1 178 ? 21.419  -21.253 -42.304 1.00 22.98 ? 178 LYS B CE   1 
ATOM   7619  N NZ   . LYS B 1 178 ? 20.236  -21.706 -41.733 1.00 25.63 ? 178 LYS B NZ   1 
ATOM   7620  H H    . LYS B 1 178 ? 23.198  -21.595 -48.271 1.00 21.86 ? 178 LYS B H    1 
ATOM   7621  H HA   . LYS B 1 178 ? 22.603  -19.453 -46.914 1.00 24.01 ? 178 LYS B HA   1 
ATOM   7622  H HB2  . LYS B 1 178 ? 21.738  -21.511 -46.296 1.00 25.90 ? 178 LYS B HB2  1 
ATOM   7623  H HB3  . LYS B 1 178 ? 23.190  -22.033 -45.931 1.00 25.90 ? 178 LYS B HB3  1 
ATOM   7624  H HG2  . LYS B 1 178 ? 23.263  -20.573 -44.108 1.00 21.26 ? 178 LYS B HG2  1 
ATOM   7625  H HG3  . LYS B 1 178 ? 21.816  -20.033 -44.479 1.00 21.26 ? 178 LYS B HG3  1 
ATOM   7626  H HD2  . LYS B 1 178 ? 20.977  -22.211 -44.051 1.00 28.44 ? 178 LYS B HD2  1 
ATOM   7627  H HD3  . LYS B 1 178 ? 22.422  -22.587 -43.478 1.00 28.44 ? 178 LYS B HD3  1 
ATOM   7628  H HE2  . LYS B 1 178 ? 22.134  -21.435 -41.674 1.00 27.56 ? 178 LYS B HE2  1 
ATOM   7629  H HE3  . LYS B 1 178 ? 21.333  -20.295 -42.427 1.00 27.56 ? 178 LYS B HE3  1 
ATOM   7630  H HZ1  . LYS B 1 178 ? 20.096  -21.292 -40.957 1.00 30.73 ? 178 LYS B HZ1  1 
ATOM   7631  H HZ2  . LYS B 1 178 ? 19.552  -21.540 -42.277 1.00 30.73 ? 178 LYS B HZ2  1 
ATOM   7632  H HZ3  . LYS B 1 178 ? 20.285  -22.583 -41.589 1.00 30.73 ? 178 LYS B HZ3  1 
ATOM   7633  N N    . GLU B 1 179 ? 25.572  -20.525 -46.430 1.00 20.66 ? 179 GLU B N    1 
ATOM   7634  C CA   . GLU B 1 179 ? 26.898  -20.148 -45.945 1.00 20.35 ? 179 GLU B CA   1 
ATOM   7635  C C    . GLU B 1 179 ? 27.419  -18.905 -46.651 1.00 18.04 ? 179 GLU B C    1 
ATOM   7636  O O    . GLU B 1 179 ? 28.096  -18.073 -46.039 1.00 18.82 ? 179 GLU B O    1 
ATOM   7637  C CB   . GLU B 1 179 ? 27.849  -21.337 -46.132 1.00 19.32 ? 179 GLU B CB   1 
ATOM   7638  C CG   . GLU B 1 179 ? 27.575  -22.431 -45.156 1.00 23.76 ? 179 GLU B CG   1 
ATOM   7639  C CD   . GLU B 1 179 ? 28.174  -23.766 -45.590 1.00 31.62 ? 179 GLU B CD   1 
ATOM   7640  O OE1  . GLU B 1 179 ? 28.725  -23.839 -46.708 1.00 29.85 ? 179 GLU B OE1  1 
ATOM   7641  O OE2  . GLU B 1 179 ? 28.070  -24.745 -44.828 1.00 31.04 ? 179 GLU B OE2  1 
ATOM   7642  H H    . GLU B 1 179 ? 25.535  -21.304 -46.793 1.00 24.77 ? 179 GLU B H    1 
ATOM   7643  H HA   . GLU B 1 179 ? 26.844  -19.954 -44.997 1.00 24.40 ? 179 GLU B HA   1 
ATOM   7644  H HB2  . GLU B 1 179 ? 27.739  -21.695 -47.026 1.00 23.16 ? 179 GLU B HB2  1 
ATOM   7645  H HB3  . GLU B 1 179 ? 28.762  -21.037 -46.002 1.00 23.16 ? 179 GLU B HB3  1 
ATOM   7646  H HG2  . GLU B 1 179 ? 27.960  -22.194 -44.298 1.00 28.49 ? 179 GLU B HG2  1 
ATOM   7647  H HG3  . GLU B 1 179 ? 26.616  -22.546 -45.070 1.00 28.49 ? 179 GLU B HG3  1 
ATOM   7648  N N    . LEU B 1 180 ? 27.114  -18.755 -47.944 1.00 18.03 ? 180 LEU B N    1 
ATOM   7649  C CA   . LEU B 1 180 ? 27.579  -17.596 -48.702 1.00 18.24 ? 180 LEU B CA   1 
ATOM   7650  C C    . LEU B 1 180 ? 26.881  -16.304 -48.278 1.00 18.88 ? 180 LEU B C    1 
ATOM   7651  O O    . LEU B 1 180 ? 27.491  -15.234 -48.330 1.00 16.93 ? 180 LEU B O    1 
ATOM   7652  C CB   . LEU B 1 180 ? 27.362  -17.836 -50.200 1.00 15.20 ? 180 LEU B CB   1 
ATOM   7653  C CG   . LEU B 1 180 ? 27.949  -16.793 -51.132 1.00 26.25 ? 180 LEU B CG   1 
ATOM   7654  C CD1  . LEU B 1 180 ? 29.469  -16.761 -50.949 1.00 18.92 ? 180 LEU B CD1  1 
ATOM   7655  C CD2  . LEU B 1 180 ? 27.610  -17.095 -52.604 1.00 24.34 ? 180 LEU B CD2  1 
ATOM   7656  H H    . LEU B 1 180 ? 26.641  -19.310 -48.401 1.00 21.62 ? 180 LEU B H    1 
ATOM   7657  H HA   . LEU B 1 180 ? 28.530  -17.484 -48.552 1.00 21.87 ? 180 LEU B HA   1 
ATOM   7658  H HB2  . LEU B 1 180 ? 27.761  -18.689 -50.433 1.00 18.21 ? 180 LEU B HB2  1 
ATOM   7659  H HB3  . LEU B 1 180 ? 26.408  -17.870 -50.369 1.00 18.21 ? 180 LEU B HB3  1 
ATOM   7660  H HG   . LEU B 1 180 ? 27.593  -15.919 -50.907 1.00 31.48 ? 180 LEU B HG   1 
ATOM   7661  H HD11 . LEU B 1 180 ? 29.844  -16.094 -51.545 1.00 22.69 ? 180 LEU B HD11 1 
ATOM   7662  H HD12 . LEU B 1 180 ? 29.671  -16.533 -50.028 1.00 22.69 ? 180 LEU B HD12 1 
ATOM   7663  H HD13 . LEU B 1 180 ? 29.831  -17.635 -51.161 1.00 22.69 ? 180 LEU B HD13 1 
ATOM   7664  H HD21 . LEU B 1 180 ? 28.002  -16.408 -53.165 1.00 29.19 ? 180 LEU B HD21 1 
ATOM   7665  H HD22 . LEU B 1 180 ? 27.974  -17.963 -52.839 1.00 29.19 ? 180 LEU B HD22 1 
ATOM   7666  H HD23 . LEU B 1 180 ? 26.646  -17.101 -52.711 1.00 29.19 ? 180 LEU B HD23 1 
ATOM   7667  N N    . MET B 1 181 ? 25.618  -16.387 -47.839 1.00 15.85 ? 181 MET B N    1 
ATOM   7668  C CA   . MET B 1 181 ? 24.770  -15.212 -47.659 1.00 16.95 ? 181 MET B CA   1 
ATOM   7669  C C    . MET B 1 181 ? 24.459  -14.836 -46.217 1.00 18.48 ? 181 MET B C    1 
ATOM   7670  O O    . MET B 1 181 ? 23.995  -13.717 -45.982 1.00 18.75 ? 181 MET B O    1 
ATOM   7671  C CB   . MET B 1 181 ? 23.430  -15.422 -48.371 1.00 22.47 ? 181 MET B CB   1 
ATOM   7672  C CG   . MET B 1 181 ? 23.586  -15.648 -49.819 1.00 31.23 ? 181 MET B CG   1 
ATOM   7673  S SD   . MET B 1 181 ? 23.418  -14.115 -50.695 1.00 35.34 ? 181 MET B SD   1 
ATOM   7674  C CE   . MET B 1 181 ? 23.084  -14.896 -52.200 1.00 23.06 ? 181 MET B CE   1 
ATOM   7675  H H    . MET B 1 181 ? 25.228  -17.126 -47.637 1.00 19.00 ? 181 MET B H    1 
ATOM   7676  H HA   . MET B 1 181 ? 25.207  -14.456 -48.082 1.00 20.32 ? 181 MET B HA   1 
ATOM   7677  H HB2  . MET B 1 181 ? 22.989  -16.198 -47.992 1.00 26.94 ? 181 MET B HB2  1 
ATOM   7678  H HB3  . MET B 1 181 ? 22.879  -14.633 -48.248 1.00 26.94 ? 181 MET B HB3  1 
ATOM   7679  H HG2  . MET B 1 181 ? 24.468  -16.010 -49.998 1.00 37.45 ? 181 MET B HG2  1 
ATOM   7680  H HG3  . MET B 1 181 ? 22.898  -16.257 -50.128 1.00 37.45 ? 181 MET B HG3  1 
ATOM   7681  H HE1  . MET B 1 181 ? 22.947  -14.220 -52.882 1.00 27.65 ? 181 MET B HE1  1 
ATOM   7682  H HE2  . MET B 1 181 ? 23.839  -15.458 -52.438 1.00 27.65 ? 181 MET B HE2  1 
ATOM   7683  H HE3  . MET B 1 181 ? 22.285  -15.437 -52.104 1.00 27.65 ? 181 MET B HE3  1 
ATOM   7684  N N    . GLN B 1 182 ? 24.681  -15.716 -45.257 1.00 17.91 ? 182 GLN B N    1 
ATOM   7685  C CA   . GLN B 1 182 ? 24.143  -15.489 -43.926 1.00 14.92 ? 182 GLN B CA   1 
ATOM   7686  C C    . GLN B 1 182 ? 25.146  -14.715 -43.072 1.00 18.79 ? 182 GLN B C    1 
ATOM   7687  O O    . GLN B 1 182 ? 26.356  -14.926 -43.171 1.00 20.43 ? 182 GLN B O    1 
ATOM   7688  C CB   . GLN B 1 182 ? 23.774  -16.803 -43.245 1.00 19.49 ? 182 GLN B CB   1 
ATOM   7689  C CG   . GLN B 1 182 ? 23.158  -16.602 -41.884 1.00 19.31 ? 182 GLN B CG   1 
ATOM   7690  C CD   . GLN B 1 182 ? 22.532  -17.862 -41.360 1.00 18.23 ? 182 GLN B CD   1 
ATOM   7691  O OE1  . GLN B 1 182 ? 21.349  -18.143 -41.619 1.00 20.21 ? 182 GLN B OE1  1 
ATOM   7692  N NE2  . GLN B 1 182 ? 23.310  -18.643 -40.629 1.00 21.17 ? 182 GLN B NE2  1 
ATOM   7693  H H    . GLN B 1 182 ? 25.132  -16.443 -45.346 1.00 21.47 ? 182 GLN B H    1 
ATOM   7694  H HA   . GLN B 1 182 ? 23.338  -14.954 -44.000 1.00 17.88 ? 182 GLN B HA   1 
ATOM   7695  H HB2  . GLN B 1 182 ? 23.133  -17.276 -43.798 1.00 23.37 ? 182 GLN B HB2  1 
ATOM   7696  H HB3  . GLN B 1 182 ? 24.576  -17.338 -43.135 1.00 23.37 ? 182 GLN B HB3  1 
ATOM   7697  H HG2  . GLN B 1 182 ? 23.846  -16.324 -41.261 1.00 23.15 ? 182 GLN B HG2  1 
ATOM   7698  H HG3  . GLN B 1 182 ? 22.467  -15.924 -41.944 1.00 23.15 ? 182 GLN B HG3  1 
ATOM   7699  H HE21 . GLN B 1 182 ? 24.124  -18.415 -40.473 1.00 25.38 ? 182 GLN B HE21 1 
ATOM   7700  H HE22 . GLN B 1 182 ? 23.000  -19.377 -40.305 1.00 25.38 ? 182 GLN B HE22 1 
ATOM   7701  N N    . THR B 1 183 ? 24.633  -13.779 -42.287 1.00 20.43 ? 183 THR B N    1 
ATOM   7702  C CA   . THR B 1 183 ? 25.387  -13.037 -41.276 1.00 21.55 ? 183 THR B CA   1 
ATOM   7703  C C    . THR B 1 183 ? 24.517  -12.873 -40.039 1.00 19.38 ? 183 THR B C    1 
ATOM   7704  O O    . THR B 1 183 ? 23.328  -13.218 -40.068 1.00 17.13 ? 183 THR B O    1 
ATOM   7705  C CB   . THR B 1 183 ? 25.770  -11.643 -41.745 1.00 19.75 ? 183 THR B CB   1 
ATOM   7706  O OG1  . THR B 1 183 ? 24.603  -10.802 -41.699 1.00 20.51 ? 183 THR B OG1  1 
ATOM   7707  C CG2  . THR B 1 183 ? 26.335  -11.659 -43.157 1.00 24.06 ? 183 THR B CG2  1 
ATOM   7708  H H    . THR B 1 183 ? 23.807  -13.543 -42.322 1.00 24.49 ? 183 THR B H    1 
ATOM   7709  H HA   . THR B 1 183 ? 26.191  -13.523 -41.036 1.00 25.84 ? 183 THR B HA   1 
ATOM   7710  H HB   . THR B 1 183 ? 26.447  -11.281 -41.152 1.00 23.68 ? 183 THR B HB   1 
ATOM   7711  H HG1  . THR B 1 183 ? 24.797  -10.026 -41.956 1.00 24.59 ? 183 THR B HG1  1 
ATOM   7712  H HG21 . THR B 1 183 ? 26.570  -10.759 -43.430 1.00 28.85 ? 183 THR B HG21 1 
ATOM   7713  H HG22 . THR B 1 183 ? 27.128  -12.216 -43.190 1.00 28.85 ? 183 THR B HG22 1 
ATOM   7714  H HG23 . THR B 1 183 ? 25.675  -12.013 -43.774 1.00 28.85 ? 183 THR B HG23 1 
ATOM   7715  N N    . PRO B 1 184 ? 25.038  -12.294 -38.956 1.00 19.37 ? 184 PRO B N    1 
ATOM   7716  C CA   . PRO B 1 184 ? 24.207  -12.140 -37.757 1.00 18.73 ? 184 PRO B CA   1 
ATOM   7717  C C    . PRO B 1 184 ? 23.010  -11.252 -37.970 1.00 18.80 ? 184 PRO B C    1 
ATOM   7718  O O    . PRO B 1 184 ? 22.026  -11.408 -37.246 1.00 16.77 ? 184 PRO B O    1 
ATOM   7719  C CB   . PRO B 1 184 ? 25.190  -11.561 -36.730 1.00 21.72 ? 184 PRO B CB   1 
ATOM   7720  C CG   . PRO B 1 184 ? 26.481  -12.174 -37.164 1.00 18.48 ? 184 PRO B CG   1 
ATOM   7721  C CD   . PRO B 1 184 ? 26.469  -12.104 -38.651 1.00 19.31 ? 184 PRO B CD   1 
ATOM   7722  H HA   . PRO B 1 184 ? 23.905  -13.009 -37.450 1.00 22.45 ? 184 PRO B HA   1 
ATOM   7723  H HB2  . PRO B 1 184 ? 25.217  -10.594 -36.798 1.00 26.05 ? 184 PRO B HB2  1 
ATOM   7724  H HB3  . PRO B 1 184 ? 24.947  -11.847 -35.835 1.00 26.05 ? 184 PRO B HB3  1 
ATOM   7725  H HG2  . PRO B 1 184 ? 27.222  -11.663 -36.803 1.00 22.16 ? 184 PRO B HG2  1 
ATOM   7726  H HG3  . PRO B 1 184 ? 26.522  -13.095 -36.865 1.00 22.16 ? 184 PRO B HG3  1 
ATOM   7727  H HD2  . PRO B 1 184 ? 26.771  -11.234 -38.955 1.00 23.15 ? 184 PRO B HD2  1 
ATOM   7728  H HD3  . PRO B 1 184 ? 26.998  -12.823 -39.031 1.00 23.15 ? 184 PRO B HD3  1 
ATOM   7729  N N    . ASN B 1 185 ? 23.017  -10.375 -38.979 1.00 16.79 ? 185 ASN B N    1 
ATOM   7730  C CA   . ASN B 1 185 ? 21.872  -9.526  -39.245 1.00 17.88 ? 185 ASN B CA   1 
ATOM   7731  C C    . ASN B 1 185 ? 21.112  -9.875  -40.521 1.00 15.87 ? 185 ASN B C    1 
ATOM   7732  O O    . ASN B 1 185 ? 20.161  -9.166  -40.860 1.00 15.28 ? 185 ASN B O    1 
ATOM   7733  C CB   . ASN B 1 185 ? 22.328  -8.087  -39.269 1.00 19.66 ? 185 ASN B CB   1 
ATOM   7734  C CG   . ASN B 1 185 ? 22.596  -7.585  -37.864 1.00 24.60 ? 185 ASN B CG   1 
ATOM   7735  O OD1  . ASN B 1 185 ? 21.657  -7.403  -37.083 1.00 22.44 ? 185 ASN B OD1  1 
ATOM   7736  N ND2  . ASN B 1 185 ? 23.869  -7.415  -37.523 1.00 22.64 ? 185 ASN B ND2  1 
ATOM   7737  H H    . ASN B 1 185 ? 23.676  -10.258 -39.519 1.00 20.13 ? 185 ASN B H    1 
ATOM   7738  H HA   . ASN B 1 185 ? 21.249  -9.619  -38.507 1.00 21.44 ? 185 ASN B HA   1 
ATOM   7739  H HB2  . ASN B 1 185 ? 23.148  -8.016  -39.781 1.00 23.57 ? 185 ASN B HB2  1 
ATOM   7740  H HB3  . ASN B 1 185 ? 21.634  -7.535  -39.663 1.00 23.57 ? 185 ASN B HB3  1 
ATOM   7741  H HD21 . ASN B 1 185 ? 24.069  -7.136  -36.734 1.00 27.14 ? 185 ASN B HD21 1 
ATOM   7742  H HD22 . ASN B 1 185 ? 24.491  -7.563  -38.097 1.00 27.14 ? 185 ASN B HD22 1 
ATOM   7743  N N    . PHE B 1 186 ? 21.466  -10.966 -41.192 1.00 12.04 ? 186 PHE B N    1 
ATOM   7744  C CA   . PHE B 1 186 ? 20.775  -11.404 -42.401 1.00 10.37 ? 186 PHE B CA   1 
ATOM   7745  C C    . PHE B 1 186 ? 20.629  -12.919 -42.261 1.00 15.61 ? 186 PHE B C    1 
ATOM   7746  O O    . PHE B 1 186 ? 21.507  -13.701 -42.640 1.00 15.08 ? 186 PHE B O    1 
ATOM   7747  C CB   . PHE B 1 186 ? 21.540  -10.966 -43.632 1.00 15.61 ? 186 PHE B CB   1 
ATOM   7748  C CG   . PHE B 1 186 ? 20.768  -11.088 -44.931 1.00 13.51 ? 186 PHE B CG   1 
ATOM   7749  C CD1  . PHE B 1 186 ? 19.558  -10.428 -45.110 1.00 16.64 ? 186 PHE B CD1  1 
ATOM   7750  C CD2  . PHE B 1 186 ? 21.245  -11.868 -45.946 1.00 12.34 ? 186 PHE B CD2  1 
ATOM   7751  C CE1  . PHE B 1 186 ? 18.864  -10.523 -46.320 1.00 18.63 ? 186 PHE B CE1  1 
ATOM   7752  C CE2  . PHE B 1 186 ? 20.556  -11.957 -47.164 1.00 18.43 ? 186 PHE B CE2  1 
ATOM   7753  C CZ   . PHE B 1 186 ? 19.377  -11.298 -47.337 1.00 16.02 ? 186 PHE B CZ   1 
ATOM   7754  H H    . PHE B 1 186 ? 22.117  -11.479 -40.964 1.00 14.42 ? 186 PHE B H    1 
ATOM   7755  H HA   . PHE B 1 186 ? 19.889  -11.009 -42.431 1.00 12.42 ? 186 PHE B HA   1 
ATOM   7756  H HB2  . PHE B 1 186 ? 21.792  -10.035 -43.526 1.00 18.71 ? 186 PHE B HB2  1 
ATOM   7757  H HB3  . PHE B 1 186 ? 22.337  -11.513 -43.712 1.00 18.71 ? 186 PHE B HB3  1 
ATOM   7758  H HD1  . PHE B 1 186 ? 19.222  -9.893  -44.428 1.00 19.94 ? 186 PHE B HD1  1 
ATOM   7759  H HD2  . PHE B 1 186 ? 22.057  -12.309 -45.844 1.00 14.79 ? 186 PHE B HD2  1 
ATOM   7760  H HE1  . PHE B 1 186 ? 18.057  -10.074 -46.434 1.00 22.33 ? 186 PHE B HE1  1 
ATOM   7761  H HE2  . PHE B 1 186 ? 20.894  -12.488 -47.848 1.00 22.10 ? 186 PHE B HE2  1 
ATOM   7762  H HZ   . PHE B 1 186 ? 18.913  -11.379 -48.139 1.00 19.20 ? 186 PHE B HZ   1 
ATOM   7763  N N    . ARG B 1 187 ? 19.526  -13.319 -41.650 1.00 13.35 ? 187 ARG B N    1 
ATOM   7764  C CA   . ARG B 1 187 ? 19.307  -14.691 -41.222 1.00 15.43 ? 187 ARG B CA   1 
ATOM   7765  C C    . ARG B 1 187 ? 18.551  -15.453 -42.303 1.00 15.70 ? 187 ARG B C    1 
ATOM   7766  O O    . ARG B 1 187 ? 17.569  -14.951 -42.827 1.00 16.62 ? 187 ARG B O    1 
ATOM   7767  C CB   . ARG B 1 187 ? 18.524  -14.731 -39.919 1.00 14.39 ? 187 ARG B CB   1 
ATOM   7768  C CG   . ARG B 1 187 ? 19.129  -13.910 -38.753 1.00 17.54 ? 187 ARG B CG   1 
ATOM   7769  C CD   . ARG B 1 187 ? 20.595  -14.317 -38.511 1.00 16.92 ? 187 ARG B CD   1 
ATOM   7770  N NE   . ARG B 1 187 ? 20.753  -15.678 -37.998 1.00 16.57 ? 187 ARG B NE   1 
ATOM   7771  C CZ   . ARG B 1 187 ? 21.912  -16.322 -38.030 1.00 18.34 ? 187 ARG B CZ   1 
ATOM   7772  N NH1  . ARG B 1 187 ? 22.965  -15.732 -38.571 1.00 17.92 ? 187 ARG B NH1  1 
ATOM   7773  N NH2  . ARG B 1 187 ? 22.024  -17.551 -37.542 1.00 17.54 ? 187 ARG B NH2  1 
ATOM   7774  H H    . ARG B 1 187 ? 18.867  -12.797 -41.467 1.00 16.00 ? 187 ARG B H    1 
ATOM   7775  H HA   . ARG B 1 187 ? 20.162  -15.125 -41.080 1.00 18.49 ? 187 ARG B HA   1 
ATOM   7776  H HB2  . ARG B 1 187 ? 17.633  -14.386 -40.086 1.00 17.24 ? 187 ARG B HB2  1 
ATOM   7777  H HB3  . ARG B 1 187 ? 18.464  -15.653 -39.625 1.00 17.24 ? 187 ARG B HB3  1 
ATOM   7778  H HG2  . ARG B 1 187 ? 19.105  -12.966 -38.975 1.00 21.03 ? 187 ARG B HG2  1 
ATOM   7779  H HG3  . ARG B 1 187 ? 18.625  -14.081 -37.942 1.00 21.03 ? 187 ARG B HG3  1 
ATOM   7780  H HD2  . ARG B 1 187 ? 21.078  -14.259 -39.350 1.00 20.28 ? 187 ARG B HD2  1 
ATOM   7781  H HD3  . ARG B 1 187 ? 20.985  -13.709 -37.864 1.00 20.28 ? 187 ARG B HD3  1 
ATOM   7782  H HE   . ARG B 1 187 ? 20.131  -15.993 -37.494 1.00 19.86 ? 187 ARG B HE   1 
ATOM   7783  H HH11 . ARG B 1 187 ? 22.896  -14.934 -38.884 1.00 21.48 ? 187 ARG B HH11 1 
ATOM   7784  H HH12 . ARG B 1 187 ? 23.720  -16.142 -38.600 1.00 21.48 ? 187 ARG B HH12 1 
ATOM   7785  H HH21 . ARG B 1 187 ? 21.340  -17.940 -37.196 1.00 21.03 ? 187 ARG B HH21 1 
ATOM   7786  H HH22 . ARG B 1 187 ? 22.779  -17.961 -37.578 1.00 21.03 ? 187 ARG B HH22 1 
ATOM   7787  N N    . ILE B 1 188 ? 19.010  -16.657 -42.625 1.00 15.80 ? 188 ILE B N    1 
ATOM   7788  C CA   . ILE B 1 188 ? 18.503  -17.398 -43.768 1.00 15.67 ? 188 ILE B CA   1 
ATOM   7789  C C    . ILE B 1 188 ? 17.824  -18.682 -43.300 1.00 16.28 ? 188 ILE B C    1 
ATOM   7790  O O    . ILE B 1 188 ? 18.396  -19.443 -42.509 1.00 15.26 ? 188 ILE B O    1 
ATOM   7791  C CB   . ILE B 1 188 ? 19.644  -17.691 -44.743 1.00 13.45 ? 188 ILE B CB   1 
ATOM   7792  C CG1  . ILE B 1 188 ? 20.149  -16.351 -45.287 1.00 20.19 ? 188 ILE B CG1  1 
ATOM   7793  C CG2  . ILE B 1 188 ? 19.211  -18.715 -45.810 1.00 21.49 ? 188 ILE B CG2  1 
ATOM   7794  C CD1  . ILE B 1 188 ? 21.125  -16.448 -46.358 1.00 25.05 ? 188 ILE B CD1  1 
ATOM   7795  H H    . ILE B 1 188 ? 19.625  -17.071 -42.189 1.00 18.94 ? 188 ILE B H    1 
ATOM   7796  H HA   . ILE B 1 188 ? 17.842  -16.858 -44.230 1.00 18.78 ? 188 ILE B HA   1 
ATOM   7797  H HB   . ILE B 1 188 ? 20.367  -18.091 -44.235 1.00 16.12 ? 188 ILE B HB   1 
ATOM   7798  H HG12 . ILE B 1 188 ? 19.391  -15.851 -45.627 1.00 24.20 ? 188 ILE B HG12 1 
ATOM   7799  H HG13 . ILE B 1 188 ? 20.562  -15.860 -44.559 1.00 24.20 ? 188 ILE B HG13 1 
ATOM   7800  H HG21 . ILE B 1 188 ? 19.955  -18.878 -46.410 1.00 25.77 ? 188 ILE B HG21 1 
ATOM   7801  H HG22 . ILE B 1 188 ? 18.954  -19.540 -45.369 1.00 25.77 ? 188 ILE B HG22 1 
ATOM   7802  H HG23 . ILE B 1 188 ? 18.459  -18.355 -46.305 1.00 25.77 ? 188 ILE B HG23 1 
ATOM   7803  H HD11 . ILE B 1 188 ? 21.382  -15.554 -46.632 1.00 30.03 ? 188 ILE B HD11 1 
ATOM   7804  H HD12 . ILE B 1 188 ? 21.902  -16.931 -46.035 1.00 30.03 ? 188 ILE B HD12 1 
ATOM   7805  H HD13 . ILE B 1 188 ? 20.728  -16.922 -47.105 1.00 30.03 ? 188 ILE B HD13 1 
ATOM   7806  N N    . THR B 1 189 ? 16.641  -18.963 -43.845 1.00 14.38 ? 189 THR B N    1 
ATOM   7807  C CA   . THR B 1 189 ? 16.067  -20.304 -43.757 1.00 14.75 ? 189 THR B CA   1 
ATOM   7808  C C    . THR B 1 189 ? 16.046  -20.882 -45.166 1.00 16.48 ? 189 THR B C    1 
ATOM   7809  O O    . THR B 1 189 ? 15.550  -20.238 -46.091 1.00 17.12 ? 189 THR B O    1 
ATOM   7810  C CB   . THR B 1 189 ? 14.654  -20.297 -43.152 1.00 14.06 ? 189 THR B CB   1 
ATOM   7811  O OG1  . THR B 1 189 ? 14.674  -19.653 -41.867 1.00 19.95 ? 189 THR B OG1  1 
ATOM   7812  C CG2  . THR B 1 189 ? 14.117  -21.763 -42.994 1.00 18.16 ? 189 THR B CG2  1 
ATOM   7813  H H    . THR B 1 189 ? 16.152  -18.397 -44.269 1.00 17.24 ? 189 THR B H    1 
ATOM   7814  H HA   . THR B 1 189 ? 16.635  -20.862 -43.204 1.00 17.68 ? 189 THR B HA   1 
ATOM   7815  H HB   . THR B 1 189 ? 14.055  -19.815 -43.743 1.00 16.85 ? 189 THR B HB   1 
ATOM   7816  H HG1  . THR B 1 189 ? 14.941  -18.860 -41.948 1.00 23.92 ? 189 THR B HG1  1 
ATOM   7817  H HG21 . THR B 1 189 ? 13.225  -21.749 -42.612 1.00 21.77 ? 189 THR B HG21 1 
ATOM   7818  H HG22 . THR B 1 189 ? 14.082  -22.199 -43.860 1.00 21.77 ? 189 THR B HG22 1 
ATOM   7819  H HG23 . THR B 1 189 ? 14.702  -22.270 -42.410 1.00 21.77 ? 189 THR B HG23 1 
ATOM   7820  N N    . VAL B 1 190 ? 16.610  -22.076 -45.333 1.00 16.53 ? 190 VAL B N    1 
ATOM   7821  C CA   . VAL B 1 190 ? 16.578  -22.802 -46.609 1.00 16.94 ? 190 VAL B CA   1 
ATOM   7822  C C    . VAL B 1 190 ? 15.381  -23.740 -46.621 1.00 17.12 ? 190 VAL B C    1 
ATOM   7823  O O    . VAL B 1 190 ? 15.200  -24.544 -45.702 1.00 18.39 ? 190 VAL B O    1 
ATOM   7824  C CB   . VAL B 1 190 ? 17.864  -23.615 -46.846 1.00 15.44 ? 190 VAL B CB   1 
ATOM   7825  C CG1  . VAL B 1 190 ? 17.825  -24.304 -48.174 1.00 23.40 ? 190 VAL B CG1  1 
ATOM   7826  C CG2  . VAL B 1 190 ? 19.127  -22.727 -46.803 1.00 22.05 ? 190 VAL B CG2  1 
ATOM   7827  H H    . VAL B 1 190 ? 17.028  -22.498 -44.711 1.00 19.82 ? 190 VAL B H    1 
ATOM   7828  H HA   . VAL B 1 190 ? 16.479  -22.169 -47.337 1.00 20.31 ? 190 VAL B HA   1 
ATOM   7829  H HB   . VAL B 1 190 ? 17.945  -24.291 -46.155 1.00 18.51 ? 190 VAL B HB   1 
ATOM   7830  H HG11 . VAL B 1 190 ? 18.646  -24.806 -48.293 1.00 28.05 ? 190 VAL B HG11 1 
ATOM   7831  H HG12 . VAL B 1 190 ? 17.064  -24.905 -48.196 1.00 28.05 ? 190 VAL B HG12 1 
ATOM   7832  H HG13 . VAL B 1 190 ? 17.740  -23.637 -48.874 1.00 28.05 ? 190 VAL B HG13 1 
ATOM   7833  H HG21 . VAL B 1 190 ? 19.908  -23.282 -46.956 1.00 26.44 ? 190 VAL B HG21 1 
ATOM   7834  H HG22 . VAL B 1 190 ? 19.060  -22.050 -47.494 1.00 26.44 ? 190 VAL B HG22 1 
ATOM   7835  H HG23 . VAL B 1 190 ? 19.187  -22.305 -45.931 1.00 26.44 ? 190 VAL B HG23 1 
ATOM   7836  N N    . VAL B 1 191 ? 14.615  -23.687 -47.701 1.00 16.95 ? 191 VAL B N    1 
ATOM   7837  C CA   . VAL B 1 191 ? 13.541  -24.640 -47.965 1.00 18.39 ? 191 VAL B CA   1 
ATOM   7838  C C    . VAL B 1 191 ? 13.707  -25.152 -49.386 1.00 19.35 ? 191 VAL B C    1 
ATOM   7839  O O    . VAL B 1 191 ? 14.391  -24.545 -50.219 1.00 19.21 ? 191 VAL B O    1 
ATOM   7840  C CB   . VAL B 1 191 ? 12.142  -24.027 -47.756 1.00 19.45 ? 191 VAL B CB   1 
ATOM   7841  C CG1  . VAL B 1 191 ? 12.034  -23.417 -46.407 1.00 20.38 ? 191 VAL B CG1  1 
ATOM   7842  C CG2  . VAL B 1 191 ? 11.811  -22.996 -48.832 1.00 19.55 ? 191 VAL B CG2  1 
ATOM   7843  H H    . VAL B 1 191 ? 14.699  -23.091 -48.315 1.00 20.32 ? 191 VAL B H    1 
ATOM   7844  H HA   . VAL B 1 191 ? 13.631  -25.393 -47.361 1.00 22.05 ? 191 VAL B HA   1 
ATOM   7845  H HB   . VAL B 1 191 ? 11.481  -24.735 -47.813 1.00 23.32 ? 191 VAL B HB   1 
ATOM   7846  H HG11 . VAL B 1 191 ? 11.146  -23.040 -46.302 1.00 24.44 ? 191 VAL B HG11 1 
ATOM   7847  H HG12 . VAL B 1 191 ? 12.184  -24.103 -45.738 1.00 24.44 ? 191 VAL B HG12 1 
ATOM   7848  H HG13 . VAL B 1 191 ? 12.702  -22.719 -46.322 1.00 24.44 ? 191 VAL B HG13 1 
ATOM   7849  H HG21 . VAL B 1 191 ? 10.926  -22.637 -48.663 1.00 23.44 ? 191 VAL B HG21 1 
ATOM   7850  H HG22 . VAL B 1 191 ? 12.469  -22.284 -48.800 1.00 23.44 ? 191 VAL B HG22 1 
ATOM   7851  H HG23 . VAL B 1 191 ? 11.833  -23.429 -49.700 1.00 23.44 ? 191 VAL B HG23 1 
ATOM   7852  N N    . GLN B 1 192 ? 13.095  -26.307 -49.658 1.00 18.63 ? 192 GLN B N    1 
ATOM   7853  C CA   . GLN B 1 192 ? 13.315  -26.959 -50.936 1.00 20.87 ? 192 GLN B CA   1 
ATOM   7854  C C    . GLN B 1 192 ? 12.290  -26.562 -52.000 1.00 25.89 ? 192 GLN B C    1 
ATOM   7855  O O    . GLN B 1 192 ? 12.528  -26.820 -53.187 1.00 28.44 ? 192 GLN B O    1 
ATOM   7856  C CB   . GLN B 1 192 ? 13.382  -28.487 -50.712 1.00 23.25 ? 192 GLN B CB   1 
ATOM   7857  C CG   . GLN B 1 192 ? 14.786  -28.871 -50.132 1.00 27.46 ? 192 GLN B CG   1 
ATOM   7858  C CD   . GLN B 1 192 ? 14.877  -30.251 -49.517 1.00 37.55 ? 192 GLN B CD   1 
ATOM   7859  O OE1  . GLN B 1 192 ? 14.026  -31.102 -49.731 1.00 38.34 ? 192 GLN B OE1  1 
ATOM   7860  N NE2  . GLN B 1 192 ? 15.924  -30.468 -48.734 1.00 40.67 ? 192 GLN B NE2  1 
ATOM   7861  H H    . GLN B 1 192 ? 12.559  -26.721 -49.128 1.00 22.34 ? 192 GLN B H    1 
ATOM   7862  H HA   . GLN B 1 192 ? 14.184  -26.683 -51.266 1.00 25.02 ? 192 GLN B HA   1 
ATOM   7863  H HB2  . GLN B 1 192 ? 12.701  -28.754 -50.075 1.00 27.88 ? 192 GLN B HB2  1 
ATOM   7864  H HB3  . GLN B 1 192 ? 13.260  -28.947 -51.557 1.00 27.88 ? 192 GLN B HB3  1 
ATOM   7865  H HG2  . GLN B 1 192 ? 15.437  -28.828 -50.850 1.00 32.93 ? 192 GLN B HG2  1 
ATOM   7866  H HG3  . GLN B 1 192 ? 15.021  -28.229 -49.443 1.00 32.93 ? 192 GLN B HG3  1 
ATOM   7867  H HE21 . GLN B 1 192 ? 16.502  -29.844 -48.606 1.00 48.79 ? 192 GLN B HE21 1 
ATOM   7868  H HE22 . GLN B 1 192 ? 16.027  -31.234 -48.357 1.00 48.79 ? 192 GLN B HE22 1 
ATOM   7869  N N    . GLU B 1 193 ? 11.208  -25.863 -51.636 1.00 20.64 ? 193 GLU B N    1 
ATOM   7870  C CA   . GLU B 1 193 ? 10.165  -25.499 -52.601 1.00 20.81 ? 193 GLU B CA   1 
ATOM   7871  C C    . GLU B 1 193 ? 10.464  -24.150 -53.260 1.00 24.73 ? 193 GLU B C    1 
ATOM   7872  O O    . GLU B 1 193 ? 9.868   -23.103 -52.947 1.00 24.91 ? 193 GLU B O    1 
ATOM   7873  C CB   . GLU B 1 193 ? 8.810   -25.484 -51.922 1.00 21.99 ? 193 GLU B CB   1 
ATOM   7874  C CG   . GLU B 1 193 ? 8.392   -26.837 -51.345 1.00 31.60 ? 193 GLU B CG   1 
ATOM   7875  C CD   . GLU B 1 193 ? 7.072   -26.765 -50.597 1.00 35.82 ? 193 GLU B CD   1 
ATOM   7876  O OE1  . GLU B 1 193 ? 6.375   -25.727 -50.693 1.00 31.41 ? 193 GLU B OE1  1 
ATOM   7877  O OE2  . GLU B 1 193 ? 6.739   -27.750 -49.908 1.00 33.41 ? 193 GLU B OE2  1 
ATOM   7878  H H    . GLU B 1 193 ? 11.056  -25.588 -50.835 1.00 24.75 ? 193 GLU B H    1 
ATOM   7879  H HA   . GLU B 1 193 ? 10.138  -26.170 -53.300 1.00 24.95 ? 193 GLU B HA   1 
ATOM   7880  H HB2  . GLU B 1 193 ? 8.833   -24.846 -51.192 1.00 26.37 ? 193 GLU B HB2  1 
ATOM   7881  H HB3  . GLU B 1 193 ? 8.139   -25.218 -52.569 1.00 26.37 ? 193 GLU B HB3  1 
ATOM   7882  H HG2  . GLU B 1 193 ? 8.293   -27.474 -52.070 1.00 37.89 ? 193 GLU B HG2  1 
ATOM   7883  H HG3  . GLU B 1 193 ? 9.073   -27.142 -50.725 1.00 37.89 ? 193 GLU B HG3  1 
ATOM   7884  N N    . VAL B 1 194 ? 11.356  -24.210 -54.246 1.00 17.42 ? 194 VAL B N    1 
ATOM   7885  C CA   . VAL B 1 194 ? 11.744  -23.042 -55.047 1.00 16.97 ? 194 VAL B CA   1 
ATOM   7886  C C    . VAL B 1 194 ? 10.521  -22.282 -55.580 1.00 21.98 ? 194 VAL B C    1 
ATOM   7887  O O    . VAL B 1 194 ? 10.385  -21.071 -55.385 1.00 17.90 ? 194 VAL B O    1 
ATOM   7888  C CB   . VAL B 1 194 ? 12.661  -23.458 -56.208 1.00 22.72 ? 194 VAL B CB   1 
ATOM   7889  C CG1  . VAL B 1 194 ? 13.073  -22.244 -56.990 1.00 25.99 ? 194 VAL B CG1  1 
ATOM   7890  C CG2  . VAL B 1 194 ? 13.895  -24.158 -55.698 1.00 25.97 ? 194 VAL B CG2  1 
ATOM   7891  H H    . VAL B 1 194 ? 11.762  -24.931 -54.479 1.00 20.88 ? 194 VAL B H    1 
ATOM   7892  H HA   . VAL B 1 194 ? 12.244  -22.433 -54.482 1.00 20.35 ? 194 VAL B HA   1 
ATOM   7893  H HB   . VAL B 1 194 ? 12.184  -24.061 -56.800 1.00 27.25 ? 194 VAL B HB   1 
ATOM   7894  H HG11 . VAL B 1 194 ? 13.650  -22.520 -57.719 1.00 31.17 ? 194 VAL B HG11 1 
ATOM   7895  H HG12 . VAL B 1 194 ? 12.279  -21.811 -57.341 1.00 31.17 ? 194 VAL B HG12 1 
ATOM   7896  H HG13 . VAL B 1 194 ? 13.548  -21.637 -56.402 1.00 31.17 ? 194 VAL B HG13 1 
ATOM   7897  H HG21 . VAL B 1 194 ? 14.451  -24.407 -56.453 1.00 31.14 ? 194 VAL B HG21 1 
ATOM   7898  H HG22 . VAL B 1 194 ? 14.380  -23.555 -55.113 1.00 31.14 ? 194 VAL B HG22 1 
ATOM   7899  H HG23 . VAL B 1 194 ? 13.627  -24.951 -55.208 1.00 31.14 ? 194 VAL B HG23 1 
ATOM   7900  N N    . ASP B 1 195 ? 9.644   -22.960 -56.327 1.00 20.44 ? 195 ASP B N    1 
ATOM   7901  C CA   . ASP B 1 195 ? 8.526   -22.242 -56.960 1.00 21.42 ? 195 ASP B CA   1 
ATOM   7902  C C    . ASP B 1 195 ? 7.642   -21.574 -55.922 1.00 20.15 ? 195 ASP B C    1 
ATOM   7903  O O    . ASP B 1 195 ? 7.160   -20.447 -56.125 1.00 22.76 ? 195 ASP B O    1 
ATOM   7904  C CB   . ASP B 1 195 ? 7.669   -23.188 -57.806 1.00 29.66 ? 195 ASP B CB   1 
ATOM   7905  C CG   . ASP B 1 195 ? 8.384   -23.704 -59.047 1.00 31.77 ? 195 ASP B CG   1 
ATOM   7906  O OD1  . ASP B 1 195 ? 9.594   -23.447 -59.213 1.00 43.06 ? 195 ASP B OD1  1 
ATOM   7907  O OD2  . ASP B 1 195 ? 7.715   -24.361 -59.876 1.00 44.41 ? 195 ASP B OD2  1 
ATOM   7908  H H    . ASP B 1 195 ? 9.669   -23.805 -56.481 1.00 24.51 ? 195 ASP B H    1 
ATOM   7909  H HA   . ASP B 1 195 ? 8.880   -21.553 -57.543 1.00 25.69 ? 195 ASP B HA   1 
ATOM   7910  H HB2  . ASP B 1 195 ? 7.419   -23.953 -57.266 1.00 35.57 ? 195 ASP B HB2  1 
ATOM   7911  H HB3  . ASP B 1 195 ? 6.873   -22.715 -58.097 1.00 35.57 ? 195 ASP B HB3  1 
ATOM   7912  N N    . THR B 1 196 ? 7.395   -22.254 -54.805 1.00 18.23 ? 196 THR B N    1 
ATOM   7913  C CA   . THR B 1 196 ? 6.528   -21.672 -53.795 1.00 20.36 ? 196 THR B CA   1 
ATOM   7914  C C    . THR B 1 196 ? 7.147   -20.397 -53.213 1.00 22.70 ? 196 THR B C    1 
ATOM   7915  O O    . THR B 1 196 ? 6.466   -19.372 -53.046 1.00 18.02 ? 196 THR B O    1 
ATOM   7916  C CB   . THR B 1 196 ? 6.244   -22.711 -52.718 1.00 25.98 ? 196 THR B CB   1 
ATOM   7917  O OG1  . THR B 1 196 ? 5.735   -23.902 -53.343 1.00 25.92 ? 196 THR B OG1  1 
ATOM   7918  C CG2  . THR B 1 196 ? 5.244   -22.190 -51.710 1.00 25.96 ? 196 THR B CG2  1 
ATOM   7919  H H    . THR B 1 196 ? 7.708   -23.032 -54.614 1.00 21.85 ? 196 THR B H    1 
ATOM   7920  H HA   . THR B 1 196 ? 5.683   -21.431 -54.207 1.00 24.42 ? 196 THR B HA   1 
ATOM   7921  H HB   . THR B 1 196 ? 7.067   -22.921 -52.250 1.00 31.15 ? 196 THR B HB   1 
ATOM   7922  H HG1  . THR B 1 196 ? 5.574   -24.486 -52.761 1.00 31.09 ? 196 THR B HG1  1 
ATOM   7923  H HG21 . THR B 1 196 ? 5.075   -22.863 -51.032 1.00 31.13 ? 196 THR B HG21 1 
ATOM   7924  H HG22 . THR B 1 196 ? 5.590   -21.392 -51.281 1.00 31.13 ? 196 THR B HG22 1 
ATOM   7925  H HG23 . THR B 1 196 ? 4.409   -21.973 -52.153 1.00 31.13 ? 196 THR B HG23 1 
ATOM   7926  N N    . VAL B 1 197 ? 8.447   -20.426 -52.922 1.00 18.12 ? 197 VAL B N    1 
ATOM   7927  C CA   . VAL B 1 197 ? 9.100   -19.235 -52.393 1.00 19.44 ? 197 VAL B CA   1 
ATOM   7928  C C    . VAL B 1 197 ? 8.968   -18.078 -53.374 1.00 18.30 ? 197 VAL B C    1 
ATOM   7929  O O    . VAL B 1 197 ? 8.614   -16.957 -52.994 1.00 19.50 ? 197 VAL B O    1 
ATOM   7930  C CB   . VAL B 1 197 ? 10.572  -19.546 -52.078 1.00 17.65 ? 197 VAL B CB   1 
ATOM   7931  C CG1  . VAL B 1 197 ? 11.339  -18.270 -51.743 1.00 16.75 ? 197 VAL B CG1  1 
ATOM   7932  C CG2  . VAL B 1 197 ? 10.632  -20.507 -50.924 1.00 19.03 ? 197 VAL B CG2  1 
ATOM   7933  H H    . VAL B 1 197 ? 8.961   -21.108 -53.020 1.00 21.72 ? 197 VAL B H    1 
ATOM   7934  H HA   . VAL B 1 197 ? 8.665   -18.977 -51.565 1.00 23.31 ? 197 VAL B HA   1 
ATOM   7935  H HB   . VAL B 1 197 ? 10.988  -19.962 -52.849 1.00 21.16 ? 197 VAL B HB   1 
ATOM   7936  H HG11 . VAL B 1 197 ? 12.261  -18.499 -51.550 1.00 20.08 ? 197 VAL B HG11 1 
ATOM   7937  H HG12 . VAL B 1 197 ? 11.298  -17.669 -52.504 1.00 20.08 ? 197 VAL B HG12 1 
ATOM   7938  H HG13 . VAL B 1 197 ? 10.932  -17.852 -50.968 1.00 20.08 ? 197 VAL B HG13 1 
ATOM   7939  H HG21 . VAL B 1 197 ? 11.561  -20.704 -50.726 1.00 22.82 ? 197 VAL B HG21 1 
ATOM   7940  H HG22 . VAL B 1 197 ? 10.208  -20.101 -50.153 1.00 22.82 ? 197 VAL B HG22 1 
ATOM   7941  H HG23 . VAL B 1 197 ? 10.166  -21.322 -51.168 1.00 22.82 ? 197 VAL B HG23 1 
ATOM   7942  N N    . GLU B 1 198 ? 9.224   -18.342 -54.656 1.00 18.88 ? 198 GLU B N    1 
ATOM   7943  C CA   . GLU B 1 198 ? 9.298   -17.278 -55.649 1.00 20.64 ? 198 GLU B CA   1 
ATOM   7944  C C    . GLU B 1 198 ? 7.926   -16.701 -55.967 1.00 20.15 ? 198 GLU B C    1 
ATOM   7945  O O    . GLU B 1 198 ? 7.802   -15.511 -56.221 1.00 17.74 ? 198 GLU B O    1 
ATOM   7946  C CB   . GLU B 1 198 ? 9.934   -17.807 -56.934 1.00 18.32 ? 198 GLU B CB   1 
ATOM   7947  C CG   . GLU B 1 198 ? 10.304  -16.699 -57.907 1.00 18.35 ? 198 GLU B CG   1 
ATOM   7948  C CD   . GLU B 1 198 ? 11.133  -17.197 -59.082 1.00 23.76 ? 198 GLU B CD   1 
ATOM   7949  O OE1  . GLU B 1 198 ? 11.290  -18.433 -59.225 1.00 22.76 ? 198 GLU B OE1  1 
ATOM   7950  O OE2  . GLU B 1 198 ? 11.641  -16.349 -59.849 1.00 19.39 ? 198 GLU B OE2  1 
ATOM   7951  H H    . GLU B 1 198 ? 9.358   -19.130 -54.973 1.00 22.64 ? 198 GLU B H    1 
ATOM   7952  H HA   . GLU B 1 198 ? 9.856   -16.562 -55.308 1.00 24.75 ? 198 GLU B HA   1 
ATOM   7953  H HB2  . GLU B 1 198 ? 10.743  -18.292 -56.710 1.00 21.96 ? 198 GLU B HB2  1 
ATOM   7954  H HB3  . GLU B 1 198 ? 9.305   -18.398 -57.378 1.00 21.96 ? 198 GLU B HB3  1 
ATOM   7955  H HG2  . GLU B 1 198 ? 9.491   -16.304 -58.260 1.00 22.00 ? 198 GLU B HG2  1 
ATOM   7956  H HG3  . GLU B 1 198 ? 10.822  -16.027 -57.438 1.00 22.00 ? 198 GLU B HG3  1 
ATOM   7957  N N    . ILE B 1 199 ? 6.887   -17.532 -55.997 1.00 20.09 ? 199 ILE B N    1 
ATOM   7958  C CA   . ILE B 1 199 ? 5.585   -17.006 -56.382 1.00 21.26 ? 199 ILE B CA   1 
ATOM   7959  C C    . ILE B 1 199 ? 5.051   -16.082 -55.283 1.00 20.24 ? 199 ILE B C    1 
ATOM   7960  O O    . ILE B 1 199 ? 4.284   -15.163 -55.564 1.00 21.51 ? 199 ILE B O    1 
ATOM   7961  C CB   . ILE B 1 199 ? 4.619   -18.162 -56.742 1.00 20.01 ? 199 ILE B CB   1 
ATOM   7962  C CG1  . ILE B 1 199 ? 3.401   -17.657 -57.529 1.00 26.25 ? 199 ILE B CG1  1 
ATOM   7963  C CG2  . ILE B 1 199 ? 4.092   -18.885 -55.532 1.00 17.37 ? 199 ILE B CG2  1 
ATOM   7964  C CD1  . ILE B 1 199 ? 3.740   -17.166 -58.896 1.00 29.43 ? 199 ILE B CD1  1 
ATOM   7965  H H    . ILE B 1 199 ? 6.907   -18.370 -55.807 1.00 24.08 ? 199 ILE B H    1 
ATOM   7966  H HA   . ILE B 1 199 ? 5.698   -16.467 -57.181 1.00 25.49 ? 199 ILE B HA   1 
ATOM   7967  H HB   . ILE B 1 199 ? 5.098   -18.799 -57.295 1.00 24.00 ? 199 ILE B HB   1 
ATOM   7968  H HG12 . ILE B 1 199 ? 2.765   -18.383 -57.623 1.00 31.48 ? 199 ILE B HG12 1 
ATOM   7969  H HG13 . ILE B 1 199 ? 2.995   -16.923 -57.042 1.00 31.48 ? 199 ILE B HG13 1 
ATOM   7970  H HG21 . ILE B 1 199 ? 3.496   -19.593 -55.822 1.00 20.83 ? 199 ILE B HG21 1 
ATOM   7971  H HG22 . ILE B 1 199 ? 4.838   -19.261 -55.039 1.00 20.83 ? 199 ILE B HG22 1 
ATOM   7972  H HG23 . ILE B 1 199 ? 3.610   -18.255 -54.973 1.00 20.83 ? 199 ILE B HG23 1 
ATOM   7973  H HD11 . ILE B 1 199 ? 2.928   -16.865 -59.333 1.00 35.29 ? 199 ILE B HD11 1 
ATOM   7974  H HD12 . ILE B 1 199 ? 4.368   -16.431 -58.821 1.00 35.29 ? 199 ILE B HD12 1 
ATOM   7975  H HD13 . ILE B 1 199 ? 4.138   -17.892 -59.402 1.00 35.29 ? 199 ILE B HD13 1 
ATOM   7976  N N    . CYS B 1 200 ? 5.504   -16.257 -54.035 1.00 20.38 ? 200 CYS B N    1 
ATOM   7977  C CA   . CYS B 1 200 ? 5.071   -15.379 -52.947 1.00 25.93 ? 200 CYS B CA   1 
ATOM   7978  C C    . CYS B 1 200 ? 5.373   -13.912 -53.243 1.00 29.81 ? 200 CYS B C    1 
ATOM   7979  O O    . CYS B 1 200 ? 4.538   -13.037 -52.973 1.00 21.74 ? 200 CYS B O    1 
ATOM   7980  C CB   . CYS B 1 200 ? 5.744   -15.799 -51.642 1.00 19.75 ? 200 CYS B CB   1 
ATOM   7981  S SG   . CYS B 1 200 ? 5.046   -17.245 -50.841 1.00 22.98 ? 200 CYS B SG   1 
ATOM   7982  H H    . CYS B 1 200 ? 6.057   -16.870 -53.797 1.00 24.44 ? 200 CYS B H    1 
ATOM   7983  H HA   . CYS B 1 200 ? 4.112   -15.470 -52.832 1.00 31.09 ? 200 CYS B HA   1 
ATOM   7984  H HB2  . CYS B 1 200 ? 6.677   -15.990 -51.825 1.00 23.68 ? 200 CYS B HB2  1 
ATOM   7985  H HB3  . CYS B 1 200 ? 5.683   -15.061 -51.014 1.00 23.68 ? 200 CYS B HB3  1 
ATOM   7986  H HG   . CYS B 1 200 ? 3.895   -17.029 -50.580 1.00 27.56 ? 200 CYS B HG   1 
ATOM   7987  N N    . GLY B 1 201 ? 6.555   -13.625 -53.815 1.00 28.81 ? 201 GLY B N    1 
ATOM   7988  C CA   . GLY B 1 201 ? 6.942   -12.244 -54.102 1.00 23.80 ? 201 GLY B CA   1 
ATOM   7989  C C    . GLY B 1 201 ? 6.031   -11.525 -55.067 1.00 26.32 ? 201 GLY B C    1 
ATOM   7990  O O    . GLY B 1 201 ? 5.859   -10.306 -54.977 1.00 35.56 ? 201 GLY B O    1 
ATOM   7991  H H    . GLY B 1 201 ? 7.142   -14.211 -54.043 1.00 34.56 ? 201 GLY B H    1 
ATOM   7992  H HA2  . GLY B 1 201 ? 6.957   -11.742 -53.273 1.00 28.54 ? 201 GLY B HA2  1 
ATOM   7993  H HA3  . GLY B 1 201 ? 7.838   -12.238 -54.475 1.00 28.54 ? 201 GLY B HA3  1 
ATOM   7994  N N    . ALA B 1 202 ? 5.436   -12.254 -56.012 1.00 25.39 ? 202 ALA B N    1 
ATOM   7995  C CA   . ALA B 1 202 ? 4.510   -11.630 -56.940 1.00 23.92 ? 202 ALA B CA   1 
ATOM   7996  C C    . ALA B 1 202 ? 3.117   -11.519 -56.350 1.00 26.44 ? 202 ALA B C    1 
ATOM   7997  O O    . ALA B 1 202 ? 2.474   -10.467 -56.454 1.00 23.45 ? 202 ALA B O    1 
ATOM   7998  C CB   . ALA B 1 202 ? 4.457   -12.426 -58.244 1.00 32.36 ? 202 ALA B CB   1 
ATOM   7999  H H    . ALA B 1 202 ? 5.551   -13.098 -56.131 1.00 30.45 ? 202 ALA B H    1 
ATOM   8000  H HA   . ALA B 1 202 ? 4.823   -10.735 -57.146 1.00 28.69 ? 202 ALA B HA   1 
ATOM   8001  H HB1  . ALA B 1 202 ? 3.835   -11.996 -58.851 1.00 38.80 ? 202 ALA B HB1  1 
ATOM   8002  H HB2  . ALA B 1 202 ? 5.343   -12.447 -58.637 1.00 38.80 ? 202 ALA B HB2  1 
ATOM   8003  H HB3  . ALA B 1 202 ? 4.159   -13.329 -58.050 1.00 38.80 ? 202 ALA B HB3  1 
ATOM   8004  N N    . LEU B 1 203 ? 2.634   -12.576 -55.706 1.00 20.15 ? 203 LEU B N    1 
ATOM   8005  C CA   . LEU B 1 203 ? 1.241   -12.538 -55.279 1.00 19.11 ? 203 LEU B CA   1 
ATOM   8006  C C    . LEU B 1 203 ? 1.024   -11.537 -54.146 1.00 18.54 ? 203 LEU B C    1 
ATOM   8007  O O    . LEU B 1 203 ? -0.063  -10.977 -54.021 1.00 17.16 ? 203 LEU B O    1 
ATOM   8008  C CB   . LEU B 1 203 ? 0.786   -13.915 -54.861 1.00 19.13 ? 203 LEU B CB   1 
ATOM   8009  C CG   . LEU B 1 203 ? 0.942   -15.001 -55.912 1.00 21.83 ? 203 LEU B CG   1 
ATOM   8010  C CD1  . LEU B 1 203 ? 0.393   -16.268 -55.339 1.00 16.81 ? 203 LEU B CD1  1 
ATOM   8011  C CD2  . LEU B 1 203 ? 0.272   -14.701 -57.217 1.00 25.78 ? 203 LEU B CD2  1 
ATOM   8012  H H    . LEU B 1 203 ? 3.066   -13.293 -55.512 1.00 24.15 ? 203 LEU B H    1 
ATOM   8013  H HA   . LEU B 1 203 ? 0.693   -12.260 -56.029 1.00 22.91 ? 203 LEU B HA   1 
ATOM   8014  H HB2  . LEU B 1 203 ? 1.301   -14.185 -54.084 1.00 22.93 ? 203 LEU B HB2  1 
ATOM   8015  H HB3  . LEU B 1 203 ? -0.154  -13.869 -54.627 1.00 22.93 ? 203 LEU B HB3  1 
ATOM   8016  H HG   . LEU B 1 203 ? 1.887   -15.137 -56.086 1.00 26.18 ? 203 LEU B HG   1 
ATOM   8017  H HD11 . LEU B 1 203 ? 0.483   -16.976 -55.996 1.00 20.15 ? 203 LEU B HD11 1 
ATOM   8018  H HD12 . LEU B 1 203 ? 0.891   -16.494 -54.538 1.00 20.15 ? 203 LEU B HD12 1 
ATOM   8019  H HD13 . LEU B 1 203 ? -0.543  -16.136 -55.121 1.00 20.15 ? 203 LEU B HD13 1 
ATOM   8020  H HD21 . LEU B 1 203 ? 0.421   -15.442 -57.826 1.00 30.92 ? 203 LEU B HD21 1 
ATOM   8021  H HD22 . LEU B 1 203 ? -0.679  -14.584 -57.064 1.00 30.92 ? 203 LEU B HD22 1 
ATOM   8022  H HD23 . LEU B 1 203 ? 0.650   -13.888 -57.587 1.00 30.92 ? 203 LEU B HD23 1 
ATOM   8023  N N    . LYS B 1 204 ? 2.045   -11.300 -53.329 1.00 21.05 ? 204 LYS B N    1 
ATOM   8024  C CA   . LYS B 1 204 ? 1.882   -10.448 -52.162 1.00 16.47 ? 204 LYS B CA   1 
ATOM   8025  C C    . LYS B 1 204 ? 1.485   -9.038  -52.552 1.00 18.48 ? 204 LYS B C    1 
ATOM   8026  O O    . LYS B 1 204 ? 0.763   -8.373  -51.812 1.00 21.12 ? 204 LYS B O    1 
ATOM   8027  C CB   . LYS B 1 204 ? 3.175   -10.411 -51.360 1.00 23.39 ? 204 LYS B CB   1 
ATOM   8028  C CG   . LYS B 1 204 ? 4.242   -9.548  -51.991 1.00 22.20 ? 204 LYS B CG   1 
ATOM   8029  C CD   . LYS B 1 204 ? 5.505   -9.551  -51.124 1.00 23.01 ? 204 LYS B CD   1 
ATOM   8030  C CE   . LYS B 1 204 ? 6.650   -8.800  -51.790 1.00 26.68 ? 204 LYS B CE   1 
ATOM   8031  N NZ   . LYS B 1 204 ? 6.349   -7.383  -51.994 1.00 27.29 ? 204 LYS B NZ   1 
ATOM   8032  H H    . LYS B 1 204 ? 2.837   -11.619 -53.428 1.00 25.24 ? 204 LYS B H    1 
ATOM   8033  H HA   . LYS B 1 204 ? 1.185   -10.814 -51.596 1.00 19.74 ? 204 LYS B HA   1 
ATOM   8034  H HB2  . LYS B 1 204 ? 2.987   -10.055 -50.477 1.00 28.05 ? 204 LYS B HB2  1 
ATOM   8035  H HB3  . LYS B 1 204 ? 3.525   -11.312 -51.286 1.00 28.05 ? 204 LYS B HB3  1 
ATOM   8036  H HG2  . LYS B 1 204 ? 4.469   -9.900  -52.866 1.00 26.61 ? 204 LYS B HG2  1 
ATOM   8037  H HG3  . LYS B 1 204 ? 3.921   -8.636  -52.065 1.00 26.61 ? 204 LYS B HG3  1 
ATOM   8038  H HD2  . LYS B 1 204 ? 5.312   -9.120  -50.277 1.00 27.59 ? 204 LYS B HD2  1 
ATOM   8039  H HD3  . LYS B 1 204 ? 5.789   -10.467 -50.976 1.00 27.59 ? 204 LYS B HD3  1 
ATOM   8040  H HE2  . LYS B 1 204 ? 7.439   -8.862  -51.229 1.00 32.00 ? 204 LYS B HE2  1 
ATOM   8041  H HE3  . LYS B 1 204 ? 6.827   -9.197  -52.657 1.00 32.00 ? 204 LYS B HE3  1 
ATOM   8042  H HZ1  . LYS B 1 204 ? 7.039   -6.978  -52.384 1.00 32.72 ? 204 LYS B HZ1  1 
ATOM   8043  H HZ2  . LYS B 1 204 ? 5.631   -7.296  -52.513 1.00 32.72 ? 204 LYS B HZ2  1 
ATOM   8044  H HZ3  . LYS B 1 204 ? 6.188   -6.990  -51.211 1.00 32.72 ? 204 LYS B HZ3  1 
ATOM   8045  N N    . ASN B 1 205 ? 1.949   -8.570  -53.715 1.00 20.69 ? 205 ASN B N    1 
ATOM   8046  C CA   . ASN B 1 205 ? 1.621   -7.234  -54.166 1.00 17.53 ? 205 ASN B CA   1 
ATOM   8047  C C    . ASN B 1 205 ? 0.167   -7.098  -54.548 1.00 14.55 ? 205 ASN B C    1 
ATOM   8048  O O    . ASN B 1 205 ? -0.365  -5.995  -54.471 1.00 17.06 ? 205 ASN B O    1 
ATOM   8049  C CB   . ASN B 1 205 ? 2.499   -6.868  -55.357 1.00 23.80 ? 205 ASN B CB   1 
ATOM   8050  C CG   . ASN B 1 205 ? 3.932   -6.719  -54.964 1.00 23.97 ? 205 ASN B CG   1 
ATOM   8051  O OD1  . ASN B 1 205 ? 4.230   -6.409  -53.803 1.00 23.81 ? 205 ASN B OD1  1 
ATOM   8052  N ND2  . ASN B 1 205 ? 4.834   -6.914  -55.915 1.00 30.67 ? 205 ASN B ND2  1 
ATOM   8053  H H    . ASN B 1 205 ? 2.453   -9.011  -54.253 1.00 24.80 ? 205 ASN B H    1 
ATOM   8054  H HA   . ASN B 1 205 ? 1.804   -6.605  -53.452 1.00 21.01 ? 205 ASN B HA   1 
ATOM   8055  H HB2  . ASN B 1 205 ? 2.439   -7.568  -56.026 1.00 28.54 ? 205 ASN B HB2  1 
ATOM   8056  H HB3  . ASN B 1 205 ? 2.197   -6.024  -55.729 1.00 28.54 ? 205 ASN B HB3  1 
ATOM   8057  H HD21 . ASN B 1 205 ? 5.672   -6.837  -55.735 1.00 36.79 ? 205 ASN B HD21 1 
ATOM   8058  H HD22 . ASN B 1 205 ? 4.583   -7.125  -56.710 1.00 36.79 ? 205 ASN B HD22 1 
ATOM   8059  N N    . VAL B 1 206 ? -0.469  -8.183  -54.991 1.00 19.47 ? 206 VAL B N    1 
ATOM   8060  C CA   . VAL B 1 206 ? -1.911  -8.147  -55.233 1.00 17.85 ? 206 VAL B CA   1 
ATOM   8061  C C    . VAL B 1 206 ? -2.659  -7.948  -53.918 1.00 21.45 ? 206 VAL B C    1 
ATOM   8062  O O    . VAL B 1 206 ? -3.557  -7.100  -53.800 1.00 16.99 ? 206 VAL B O    1 
ATOM   8063  C CB   . VAL B 1 206 ? -2.365  -9.434  -55.945 1.00 18.07 ? 206 VAL B CB   1 
ATOM   8064  C CG1  . VAL B 1 206 ? -3.866  -9.361  -56.178 1.00 20.22 ? 206 VAL B CG1  1 
ATOM   8065  C CG2  . VAL B 1 206 ? -1.571  -9.654  -57.246 1.00 18.62 ? 206 VAL B CG2  1 
ATOM   8066  H H    . VAL B 1 206 ? -0.095  -8.939  -55.157 1.00 23.35 ? 206 VAL B H    1 
ATOM   8067  H HA   . VAL B 1 206 ? -2.116  -7.396  -55.812 1.00 21.40 ? 206 VAL B HA   1 
ATOM   8068  H HB   . VAL B 1 206 ? -2.192  -10.190 -55.362 1.00 21.66 ? 206 VAL B HB   1 
ATOM   8069  H HG11 . VAL B 1 206 ? -4.155  -10.171 -56.626 1.00 24.24 ? 206 VAL B HG11 1 
ATOM   8070  H HG12 . VAL B 1 206 ? -4.314  -9.278  -55.321 1.00 24.24 ? 206 VAL B HG12 1 
ATOM   8071  H HG13 . VAL B 1 206 ? -4.062  -8.588  -56.730 1.00 24.24 ? 206 VAL B HG13 1 
ATOM   8072  H HG21 . VAL B 1 206 ? -1.880  -10.470 -57.670 1.00 22.33 ? 206 VAL B HG21 1 
ATOM   8073  H HG22 . VAL B 1 206 ? -1.718  -8.899  -57.837 1.00 22.33 ? 206 VAL B HG22 1 
ATOM   8074  H HG23 . VAL B 1 206 ? -0.628  -9.728  -57.032 1.00 22.33 ? 206 VAL B HG23 1 
ATOM   8075  N N    . VAL B 1 207 ? -2.311  -8.743  -52.909 1.00 15.74 ? 207 VAL B N    1 
ATOM   8076  C CA   . VAL B 1 207 ? -2.916  -8.576  -51.590 1.00 13.39 ? 207 VAL B CA   1 
ATOM   8077  C C    . VAL B 1 207 ? -2.660  -7.168  -51.069 1.00 14.95 ? 207 VAL B C    1 
ATOM   8078  O O    . VAL B 1 207 ? -3.526  -6.553  -50.439 1.00 14.86 ? 207 VAL B O    1 
ATOM   8079  C CB   . VAL B 1 207 ? -2.392  -9.668  -50.627 1.00 16.46 ? 207 VAL B CB   1 
ATOM   8080  C CG1  . VAL B 1 207 ? -3.085  -9.578  -49.305 1.00 16.89 ? 207 VAL B CG1  1 
ATOM   8081  C CG2  . VAL B 1 207 ? -2.580  -11.087 -51.246 1.00 15.15 ? 207 VAL B CG2  1 
ATOM   8082  H H    . VAL B 1 207 ? -1.734  -9.378  -52.960 1.00 18.87 ? 207 VAL B H    1 
ATOM   8083  H HA   . VAL B 1 207 ? -3.876  -8.690  -51.671 1.00 16.05 ? 207 VAL B HA   1 
ATOM   8084  H HB   . VAL B 1 207 ? -1.444  -9.529  -50.478 1.00 19.73 ? 207 VAL B HB   1 
ATOM   8085  H HG11 . VAL B 1 207 ? -2.740  -10.271 -48.721 1.00 20.25 ? 207 VAL B HG11 1 
ATOM   8086  H HG12 . VAL B 1 207 ? -2.915  -8.705  -48.919 1.00 20.25 ? 207 VAL B HG12 1 
ATOM   8087  H HG13 . VAL B 1 207 ? -4.037  -9.702  -49.439 1.00 20.25 ? 207 VAL B HG13 1 
ATOM   8088  H HG21 . VAL B 1 207 ? -2.244  -11.750 -50.623 1.00 18.16 ? 207 VAL B HG21 1 
ATOM   8089  H HG22 . VAL B 1 207 ? -3.524  -11.237 -51.411 1.00 18.16 ? 207 VAL B HG22 1 
ATOM   8090  H HG23 . VAL B 1 207 ? -2.086  -11.136 -52.079 1.00 18.16 ? 207 VAL B HG23 1 
ATOM   8091  N N    . ALA B 1 208 ? -1.463  -6.635  -51.315 1.00 18.93 ? 208 ALA B N    1 
ATOM   8092  C CA   . ALA B 1 208 ? -1.151  -5.321  -50.777 1.00 17.58 ? 208 ALA B CA   1 
ATOM   8093  C C    . ALA B 1 208 ? -2.024  -4.230  -51.391 1.00 18.02 ? 208 ALA B C    1 
ATOM   8094  O O    . ALA B 1 208 ? -2.415  -3.287  -50.699 1.00 15.84 ? 208 ALA B O    1 
ATOM   8095  C CB   . ALA B 1 208 ? 0.336   -5.034  -50.956 1.00 19.73 ? 208 ALA B CB   1 
ATOM   8096  H H    . ALA B 1 208 ? -0.836  -7.002  -51.776 1.00 22.70 ? 208 ALA B H    1 
ATOM   8097  H HA   . ALA B 1 208 ? -1.331  -5.332  -49.824 1.00 21.07 ? 208 ALA B HA   1 
ATOM   8098  H HB1  . ALA B 1 208 ? 0.533   -4.156  -50.594 1.00 23.65 ? 208 ALA B HB1  1 
ATOM   8099  H HB2  . ALA B 1 208 ? 0.847   -5.710  -50.484 1.00 23.65 ? 208 ALA B HB2  1 
ATOM   8100  H HB3  . ALA B 1 208 ? 0.550   -5.058  -51.902 1.00 23.65 ? 208 ALA B HB3  1 
ATOM   8101  N N    . VAL B 1 209 ? -2.358  -4.341  -52.677 1.00 16.62 ? 209 VAL B N    1 
ATOM   8102  C CA   . VAL B 1 209 ? -3.335  -3.422  -53.249 1.00 17.21 ? 209 VAL B CA   1 
ATOM   8103  C C    . VAL B 1 209 ? -4.653  -3.503  -52.495 1.00 18.80 ? 209 VAL B C    1 
ATOM   8104  O O    . VAL B 1 209 ? -5.268  -2.481  -52.170 1.00 17.88 ? 209 VAL B O    1 
ATOM   8105  C CB   . VAL B 1 209 ? -3.526  -3.711  -54.752 1.00 19.40 ? 209 VAL B CB   1 
ATOM   8106  C CG1  . VAL B 1 209 ? -4.724  -2.929  -55.296 1.00 19.24 ? 209 VAL B CG1  1 
ATOM   8107  C CG2  . VAL B 1 209 ? -2.262  -3.361  -55.495 1.00 22.74 ? 209 VAL B CG2  1 
ATOM   8108  H H    . VAL B 1 209 ? -2.042  -4.924  -53.224 1.00 19.92 ? 209 VAL B H    1 
ATOM   8109  H HA   . VAL B 1 209 ? -3.000  -2.516  -53.162 1.00 20.63 ? 209 VAL B HA   1 
ATOM   8110  H HB   . VAL B 1 209 ? -3.699  -4.657  -54.876 1.00 23.26 ? 209 VAL B HB   1 
ATOM   8111  H HG11 . VAL B 1 209 ? -4.825  -3.125  -56.240 1.00 23.07 ? 209 VAL B HG11 1 
ATOM   8112  H HG12 . VAL B 1 209 ? -5.521  -3.199  -54.814 1.00 23.07 ? 209 VAL B HG12 1 
ATOM   8113  H HG13 . VAL B 1 209 ? -4.565  -1.980  -55.169 1.00 23.07 ? 209 VAL B HG13 1 
ATOM   8114  H HG21 . VAL B 1 209 ? -2.389  -3.545  -56.439 1.00 27.27 ? 209 VAL B HG21 1 
ATOM   8115  H HG22 . VAL B 1 209 ? -2.069  -2.419  -55.364 1.00 27.27 ? 209 VAL B HG22 1 
ATOM   8116  H HG23 . VAL B 1 209 ? -1.533  -3.899  -55.148 1.00 27.27 ? 209 VAL B HG23 1 
ATOM   8117  N N    . GLY B 1 210 ? -5.117  -4.715  -52.198 1.00 19.81 ? 210 GLY B N    1 
ATOM   8118  C CA   . GLY B 1 210 ? -6.344  -4.834  -51.421 1.00 15.93 ? 210 GLY B CA   1 
ATOM   8119  C C    . GLY B 1 210 ? -6.218  -4.243  -50.030 1.00 17.09 ? 210 GLY B C    1 
ATOM   8120  O O    . GLY B 1 210 ? -7.141  -3.599  -49.520 1.00 17.29 ? 210 GLY B O    1 
ATOM   8121  H H    . GLY B 1 210 ? -4.754  -5.460  -52.427 1.00 23.75 ? 210 GLY B H    1 
ATOM   8122  H HA2  . GLY B 1 210 ? -7.064  -4.376  -51.884 1.00 19.09 ? 210 GLY B HA2  1 
ATOM   8123  H HA3  . GLY B 1 210 ? -6.581  -5.770  -51.335 1.00 19.09 ? 210 GLY B HA3  1 
ATOM   8124  N N    . ALA B 1 211 ? -5.075  -4.450  -49.392 1.00 17.39 ? 211 ALA B N    1 
ATOM   8125  C CA   . ALA B 1 211 ? -4.882  -3.854  -48.081 1.00 18.02 ? 211 ALA B CA   1 
ATOM   8126  C C    . ALA B 1 211 ? -4.931  -2.341  -48.173 1.00 17.94 ? 211 ALA B C    1 
ATOM   8127  O O    . ALA B 1 211 ? -5.458  -1.668  -47.283 1.00 18.08 ? 211 ALA B O    1 
ATOM   8128  C CB   . ALA B 1 211 ? -3.554  -4.313  -47.515 1.00 17.56 ? 211 ALA B CB   1 
ATOM   8129  H H    . ALA B 1 211 ? -4.415  -4.917  -49.686 1.00 20.84 ? 211 ALA B H    1 
ATOM   8130  H HA   . ALA B 1 211 ? -5.588  -4.149  -47.485 1.00 21.60 ? 211 ALA B HA   1 
ATOM   8131  H HB1  . ALA B 1 211 ? -3.429  -3.913  -46.641 1.00 21.05 ? 211 ALA B HB1  1 
ATOM   8132  H HB2  . ALA B 1 211 ? -3.561  -5.280  -47.440 1.00 21.05 ? 211 ALA B HB2  1 
ATOM   8133  H HB3  . ALA B 1 211 ? -2.843  -4.032  -48.112 1.00 21.05 ? 211 ALA B HB3  1 
ATOM   8134  N N    . GLY B 1 212 ? -4.350  -1.784  -49.226 1.00 18.12 ? 212 GLY B N    1 
ATOM   8135  C CA   . GLY B 1 212 ? -4.418  -0.340  -49.391 1.00 17.19 ? 212 GLY B CA   1 
ATOM   8136  C C    . GLY B 1 212 ? -5.829  0.141   -49.667 1.00 18.30 ? 212 GLY B C    1 
ATOM   8137  O O    . GLY B 1 212 ? -6.246  1.184   -49.162 1.00 21.02 ? 212 GLY B O    1 
ATOM   8138  H H    . GLY B 1 212 ? -3.923  -2.204  -49.842 1.00 21.72 ? 212 GLY B H    1 
ATOM   8139  H HA2  . GLY B 1 212 ? -4.097  0.094   -48.585 1.00 20.60 ? 212 GLY B HA2  1 
ATOM   8140  H HA3  . GLY B 1 212 ? -3.852  -0.072  -50.132 1.00 20.60 ? 212 GLY B HA3  1 
ATOM   8141  N N    . PHE B 1 213 ? -6.588  -0.603  -50.474 1.00 19.67 ? 213 PHE B N    1 
ATOM   8142  C CA   . PHE B 1 213 ? -8.010  -0.274  -50.605 1.00 21.06 ? 213 PHE B CA   1 
ATOM   8143  C C    . PHE B 1 213 ? -8.669  -0.204  -49.238 1.00 19.92 ? 213 PHE B C    1 
ATOM   8144  O O    . PHE B 1 213 ? -9.385  0.749   -48.920 1.00 23.15 ? 213 PHE B O    1 
ATOM   8145  C CB   . PHE B 1 213 ? -8.733  -1.306  -51.459 1.00 20.02 ? 213 PHE B CB   1 
ATOM   8146  C CG   . PHE B 1 213 ? -8.361  -1.281  -52.933 1.00 19.14 ? 213 PHE B CG   1 
ATOM   8147  C CD1  . PHE B 1 213 ? -7.656  -0.230  -53.498 1.00 18.60 ? 213 PHE B CD1  1 
ATOM   8148  C CD2  . PHE B 1 213 ? -8.780  -2.317  -53.764 1.00 22.86 ? 213 PHE B CD2  1 
ATOM   8149  C CE1  . PHE B 1 213 ? -7.376  -0.239  -54.842 1.00 18.09 ? 213 PHE B CE1  1 
ATOM   8150  C CE2  . PHE B 1 213 ? -8.479  -2.321  -55.123 1.00 23.02 ? 213 PHE B CE2  1 
ATOM   8151  C CZ   . PHE B 1 213 ? -7.797  -1.276  -55.658 1.00 20.76 ? 213 PHE B CZ   1 
ATOM   8152  H H    . PHE B 1 213 ? -6.320  -1.276  -50.937 1.00 23.58 ? 213 PHE B H    1 
ATOM   8153  H HA   . PHE B 1 213 ? -8.100  0.592   -51.032 1.00 25.25 ? 213 PHE B HA   1 
ATOM   8154  H HB2  . PHE B 1 213 ? -8.526  -2.190  -51.119 1.00 24.00 ? 213 PHE B HB2  1 
ATOM   8155  H HB3  . PHE B 1 213 ? -9.687  -1.147  -51.395 1.00 24.00 ? 213 PHE B HB3  1 
ATOM   8156  H HD1  . PHE B 1 213 ? -7.377  0.482   -52.969 1.00 22.30 ? 213 PHE B HD1  1 
ATOM   8157  H HD2  . PHE B 1 213 ? -9.259  -3.027  -53.402 1.00 27.41 ? 213 PHE B HD2  1 
ATOM   8158  H HE1  . PHE B 1 213 ? -6.898  0.467   -55.213 1.00 21.69 ? 213 PHE B HE1  1 
ATOM   8159  H HE2  . PHE B 1 213 ? -8.763  -3.021  -55.665 1.00 27.60 ? 213 PHE B HE2  1 
ATOM   8160  H HZ   . PHE B 1 213 ? -7.584  -1.273  -56.563 1.00 24.89 ? 213 PHE B HZ   1 
ATOM   8161  N N    . CYS B 1 214 ? -8.454  -1.234  -48.420 1.00 19.21 ? 214 CYS B N    1 
ATOM   8162  C CA   . CYS B 1 214 ? -9.046  -1.283  -47.090 1.00 19.06 ? 214 CYS B CA   1 
ATOM   8163  C C    . CYS B 1 214 ? -8.673  -0.035  -46.279 1.00 23.58 ? 214 CYS B C    1 
ATOM   8164  O O    . CYS B 1 214 ? -9.548  0.621   -45.691 1.00 23.42 ? 214 CYS B O    1 
ATOM   8165  C CB   . CYS B 1 214 ? -8.610  -2.599  -46.408 1.00 20.92 ? 214 CYS B CB   1 
ATOM   8166  S SG   . CYS B 1 214 ? -9.117  -2.857  -44.720 1.00 26.64 ? 214 CYS B SG   1 
ATOM   8167  H H    . CYS B 1 214 ? -7.968  -1.916  -48.615 1.00 23.03 ? 214 CYS B H    1 
ATOM   8168  H HA   . CYS B 1 214 ? -10.012 -1.301  -47.178 1.00 22.85 ? 214 CYS B HA   1 
ATOM   8169  H HB2  . CYS B 1 214 ? -8.966  -3.338  -46.927 1.00 25.08 ? 214 CYS B HB2  1 
ATOM   8170  H HB3  . CYS B 1 214 ? -7.641  -2.638  -46.423 1.00 25.08 ? 214 CYS B HB3  1 
ATOM   8171  H HG   . CYS B 1 214 ? -8.668  -1.976  -44.039 1.00 31.95 ? 214 CYS B HG   1 
ATOM   8172  N N    . ASP B 1 215 ? -7.385  0.354   -46.289 1.00 19.87 ? 215 ASP B N    1 
ATOM   8173  C CA   . ASP B 1 215 ? -6.991  1.569   -45.573 1.00 22.02 ? 215 ASP B CA   1 
ATOM   8174  C C    . ASP B 1 215 ? -7.755  2.772   -46.106 1.00 20.37 ? 215 ASP B C    1 
ATOM   8175  O O    . ASP B 1 215 ? -8.315  3.558   -45.338 1.00 26.13 ? 215 ASP B O    1 
ATOM   8176  C CB   . ASP B 1 215 ? -5.481  1.824   -45.699 1.00 20.10 ? 215 ASP B CB   1 
ATOM   8177  C CG   . ASP B 1 215 ? -4.651  0.871   -44.868 1.00 19.95 ? 215 ASP B CG   1 
ATOM   8178  O OD1  . ASP B 1 215 ? -5.184  0.308   -43.878 1.00 27.18 ? 215 ASP B OD1  1 
ATOM   8179  O OD2  . ASP B 1 215 ? -3.468  0.667   -45.238 1.00 21.62 ? 215 ASP B OD2  1 
ATOM   8180  H H    . ASP B 1 215 ? -6.745  -0.056  -46.690 1.00 23.82 ? 215 ASP B H    1 
ATOM   8181  H HA   . ASP B 1 215 ? -7.203  1.467   -44.632 1.00 26.40 ? 215 ASP B HA   1 
ATOM   8182  H HB2  . ASP B 1 215 ? -5.219  1.717   -46.627 1.00 24.09 ? 215 ASP B HB2  1 
ATOM   8183  H HB3  . ASP B 1 215 ? -5.288  2.726   -45.402 1.00 24.09 ? 215 ASP B HB3  1 
ATOM   8184  N N    . GLY B 1 216 ? -7.783  2.925   -47.426 1.00 24.04 ? 216 GLY B N    1 
ATOM   8185  C CA   . GLY B 1 216 ? -8.393  4.089   -48.032 1.00 27.56 ? 216 GLY B CA   1 
ATOM   8186  C C    . GLY B 1 216 ? -9.890  4.166   -47.847 1.00 26.45 ? 216 GLY B C    1 
ATOM   8187  O O    . GLY B 1 216 ? -10.452 5.264   -47.864 1.00 30.82 ? 216 GLY B O    1 
ATOM   8188  H H    . GLY B 1 216 ? -7.454  2.364   -47.989 1.00 28.82 ? 216 GLY B H    1 
ATOM   8189  H HA2  . GLY B 1 216 ? -8.000  4.889   -47.649 1.00 33.05 ? 216 GLY B HA2  1 
ATOM   8190  H HA3  . GLY B 1 216 ? -8.207  4.087   -48.984 1.00 33.05 ? 216 GLY B HA3  1 
ATOM   8191  N N    . LEU B 1 217 ? -10.548 3.035   -47.650 1.00 27.10 ? 217 LEU B N    1 
ATOM   8192  C CA   . LEU B 1 217 ? -11.971 3.053   -47.378 1.00 26.83 ? 217 LEU B CA   1 
ATOM   8193  C C    . LEU B 1 217 ? -12.277 3.361   -45.926 1.00 30.14 ? 217 LEU B C    1 
ATOM   8194  O O    . LEU B 1 217 ? -13.451 3.373   -45.557 1.00 30.96 ? 217 LEU B O    1 
ATOM   8195  C CB   . LEU B 1 217 ? -12.599 1.711   -47.760 1.00 26.86 ? 217 LEU B CB   1 
ATOM   8196  C CG   . LEU B 1 217 ? -12.551 1.372   -49.250 1.00 29.01 ? 217 LEU B CG   1 
ATOM   8197  C CD1  . LEU B 1 217 ? -12.963 -0.060  -49.440 1.00 28.27 ? 217 LEU B CD1  1 
ATOM   8198  C CD2  . LEU B 1 217 ? -13.430 2.285   -50.106 1.00 29.37 ? 217 LEU B CD2  1 
ATOM   8199  H H    . LEU B 1 217 ? -10.197 2.250   -47.669 1.00 32.49 ? 217 LEU B H    1 
ATOM   8200  H HA   . LEU B 1 217 ? -12.385 3.741   -47.921 1.00 32.18 ? 217 LEU B HA   1 
ATOM   8201  H HB2  . LEU B 1 217 ? -12.132 1.006   -47.285 1.00 32.21 ? 217 LEU B HB2  1 
ATOM   8202  H HB3  . LEU B 1 217 ? -13.531 1.720   -47.493 1.00 32.21 ? 217 LEU B HB3  1 
ATOM   8203  H HG   . LEU B 1 217 ? -11.637 1.462   -49.562 1.00 34.79 ? 217 LEU B HG   1 
ATOM   8204  H HD11 . LEU B 1 217 ? -12.933 -0.274  -50.385 1.00 33.90 ? 217 LEU B HD11 1 
ATOM   8205  H HD12 . LEU B 1 217 ? -12.352 -0.632  -48.951 1.00 33.90 ? 217 LEU B HD12 1 
ATOM   8206  H HD13 . LEU B 1 217 ? -13.866 -0.175  -49.103 1.00 33.90 ? 217 LEU B HD13 1 
ATOM   8207  H HD21 . LEU B 1 217 ? -13.353 2.016   -51.035 1.00 35.22 ? 217 LEU B HD21 1 
ATOM   8208  H HD22 . LEU B 1 217 ? -14.351 2.201   -49.812 1.00 35.22 ? 217 LEU B HD22 1 
ATOM   8209  H HD23 . LEU B 1 217 ? -13.131 3.201   -50.000 1.00 35.22 ? 217 LEU B HD23 1 
ATOM   8210  N N    . GLY B 1 218 ? -11.261 3.623   -45.107 1.00 25.35 ? 218 GLY B N    1 
ATOM   8211  C CA   . GLY B 1 218 ? -11.460 3.962   -43.719 1.00 25.88 ? 218 GLY B CA   1 
ATOM   8212  C C    . GLY B 1 218 ? -11.579 2.806   -42.758 1.00 28.38 ? 218 GLY B C    1 
ATOM   8213  O O    . GLY B 1 218 ? -11.987 3.024   -41.613 1.00 30.44 ? 218 GLY B O    1 
ATOM   8214  H H    . GLY B 1 218 ? -10.434 3.607   -45.344 1.00 30.39 ? 218 GLY B H    1 
ATOM   8215  H HA2  . GLY B 1 218 ? -10.717 4.512   -43.426 1.00 31.04 ? 218 GLY B HA2  1 
ATOM   8216  H HA3  . GLY B 1 218 ? -12.269 4.491   -43.643 1.00 31.04 ? 218 GLY B HA3  1 
ATOM   8217  N N    . PHE B 1 219 ? -11.217 1.588   -43.159 1.00 27.22 ? 219 PHE B N    1 
ATOM   8218  C CA   . PHE B 1 219 ? -11.359 0.457   -42.256 1.00 24.84 ? 219 PHE B CA   1 
ATOM   8219  C C    . PHE B 1 219 ? -10.162 0.349   -41.322 1.00 23.46 ? 219 PHE B C    1 
ATOM   8220  O O    . PHE B 1 219 ? -9.071  0.841   -41.608 1.00 24.38 ? 219 PHE B O    1 
ATOM   8221  C CB   . PHE B 1 219 ? -11.515 -0.840  -43.052 1.00 31.85 ? 219 PHE B CB   1 
ATOM   8222  C CG   . PHE B 1 219 ? -12.881 -1.033  -43.601 1.00 26.41 ? 219 PHE B CG   1 
ATOM   8223  C CD1  . PHE B 1 219 ? -13.887 -1.551  -42.803 1.00 36.15 ? 219 PHE B CD1  1 
ATOM   8224  C CD2  . PHE B 1 219 ? -13.169 -0.691  -44.905 1.00 26.43 ? 219 PHE B CD2  1 
ATOM   8225  C CE1  . PHE B 1 219 ? -15.158 -1.719  -43.300 1.00 32.47 ? 219 PHE B CE1  1 
ATOM   8226  C CE2  . PHE B 1 219 ? -14.437 -0.854  -45.414 1.00 31.64 ? 219 PHE B CE2  1 
ATOM   8227  C CZ   . PHE B 1 219 ? -15.432 -1.369  -44.611 1.00 40.10 ? 219 PHE B CZ   1 
ATOM   8228  H H    . PHE B 1 219 ? -10.894 1.396   -43.932 1.00 32.65 ? 219 PHE B H    1 
ATOM   8229  H HA   . PHE B 1 219 ? -12.155 0.578   -41.715 1.00 29.79 ? 219 PHE B HA   1 
ATOM   8230  H HB2  . PHE B 1 219 ? -10.893 -0.828  -43.796 1.00 38.20 ? 219 PHE B HB2  1 
ATOM   8231  H HB3  . PHE B 1 219 ? -11.319 -1.591  -42.470 1.00 38.20 ? 219 PHE B HB3  1 
ATOM   8232  H HD1  . PHE B 1 219 ? -13.703 -1.782  -41.921 1.00 43.36 ? 219 PHE B HD1  1 
ATOM   8233  H HD2  . PHE B 1 219 ? -12.499 -0.339  -45.445 1.00 31.69 ? 219 PHE B HD2  1 
ATOM   8234  H HE1  . PHE B 1 219 ? -15.829 -2.069  -42.759 1.00 38.94 ? 219 PHE B HE1  1 
ATOM   8235  H HE2  . PHE B 1 219 ? -14.620 -0.620  -46.295 1.00 37.94 ? 219 PHE B HE2  1 
ATOM   8236  H HZ   . PHE B 1 219 ? -16.289 -1.486  -44.953 1.00 48.10 ? 219 PHE B HZ   1 
ATOM   8237  N N    . GLY B 1 220 ? -10.373 -0.339  -40.201 1.00 27.83 ? 220 GLY B N    1 
ATOM   8238  C CA   . GLY B 1 220 ? -9.351  -0.481  -39.189 1.00 26.52 ? 220 GLY B CA   1 
ATOM   8239  C C    . GLY B 1 220 ? -8.510  -1.729  -39.355 1.00 27.19 ? 220 GLY B C    1 
ATOM   8240  O O    . GLY B 1 220 ? -8.631  -2.468  -40.330 1.00 27.97 ? 220 GLY B O    1 
ATOM   8241  H H    . GLY B 1 220 ? -11.112 -0.735  -40.009 1.00 33.37 ? 220 GLY B H    1 
ATOM   8242  H HA2  . GLY B 1 220 ? -8.762  0.289   -39.218 1.00 31.80 ? 220 GLY B HA2  1 
ATOM   8243  H HA3  . GLY B 1 220 ? -9.770  -0.511  -38.314 1.00 31.80 ? 220 GLY B HA3  1 
ATOM   8244  N N    . ASP B 1 221 ? -7.640  -1.953  -38.355 1.00 26.60 ? 221 ASP B N    1 
ATOM   8245  C CA   . ASP B 1 221 ? -6.616  -3.001  -38.407 1.00 27.25 ? 221 ASP B CA   1 
ATOM   8246  C C    . ASP B 1 221 ? -7.203  -4.411  -38.378 1.00 26.70 ? 221 ASP B C    1 
ATOM   8247  O O    . ASP B 1 221 ? -6.556  -5.341  -38.863 1.00 19.22 ? 221 ASP B O    1 
ATOM   8248  C CB   . ASP B 1 221 ? -5.645  -2.878  -37.220 1.00 29.87 ? 221 ASP B CB   1 
ATOM   8249  C CG   . ASP B 1 221 ? -4.338  -2.123  -37.548 1.00 40.72 ? 221 ASP B CG   1 
ATOM   8250  O OD1  . ASP B 1 221 ? -3.753  -2.275  -38.646 1.00 38.44 ? 221 ASP B OD1  1 
ATOM   8251  O OD2  . ASP B 1 221 ? -3.877  -1.371  -36.663 1.00 40.78 ? 221 ASP B OD2  1 
ATOM   8252  H H    . ASP B 1 221 ? -7.627  -1.500  -37.624 1.00 31.90 ? 221 ASP B H    1 
ATOM   8253  H HA   . ASP B 1 221 ? -6.105  -2.904  -39.226 1.00 32.68 ? 221 ASP B HA   1 
ATOM   8254  H HB2  . ASP B 1 221 ? -6.090  -2.399  -36.503 1.00 35.82 ? 221 ASP B HB2  1 
ATOM   8255  H HB3  . ASP B 1 221 ? -5.405  -3.768  -36.920 1.00 35.82 ? 221 ASP B HB3  1 
ATOM   8256  N N    . ASN B 1 222 ? -8.375  -4.617  -37.757 1.00 24.75 ? 222 ASN B N    1 
ATOM   8257  C CA   . ASN B 1 222 ? -8.928  -5.977  -37.731 1.00 22.30 ? 222 ASN B CA   1 
ATOM   8258  C C    . ASN B 1 222 ? -9.494  -6.350  -39.089 1.00 23.48 ? 222 ASN B C    1 
ATOM   8259  O O    . ASN B 1 222 ? -9.406  -7.517  -39.507 1.00 18.72 ? 222 ASN B O    1 
ATOM   8260  C CB   . ASN B 1 222 ? -10.014 -6.123  -36.656 1.00 22.59 ? 222 ASN B CB   1 
ATOM   8261  C CG   . ASN B 1 222 ? -9.462  -6.119  -35.243 1.00 22.55 ? 222 ASN B CG   1 
ATOM   8262  O OD1  . ASN B 1 222 ? -8.629  -6.944  -34.886 1.00 30.49 ? 222 ASN B OD1  1 
ATOM   8263  N ND2  . ASN B 1 222 ? -9.921  -5.182  -34.435 1.00 27.06 ? 222 ASN B ND2  1 
ATOM   8264  H H    . ASN B 1 222 ? -8.847  -4.018  -37.362 1.00 29.68 ? 222 ASN B H    1 
ATOM   8265  H HA   . ASN B 1 222 ? -8.216  -6.602  -37.523 1.00 26.73 ? 222 ASN B HA   1 
ATOM   8266  H HB2  . ASN B 1 222 ? -10.636 -5.384  -36.735 1.00 27.09 ? 222 ASN B HB2  1 
ATOM   8267  H HB3  . ASN B 1 222 ? -10.479 -6.963  -36.792 1.00 27.09 ? 222 ASN B HB3  1 
ATOM   8268  H HD21 . ASN B 1 222 ? -9.639  -5.137  -33.624 1.00 32.45 ? 222 ASN B HD21 1 
ATOM   8269  H HD22 . ASN B 1 222 ? -10.505 -4.617  -34.719 1.00 32.45 ? 222 ASN B HD22 1 
ATOM   8270  N N    . THR B 1 223 ? -10.102 -5.371  -39.786 1.00 24.15 ? 223 THR B N    1 
ATOM   8271  C CA   . THR B 1 223 ? -10.532 -5.587  -41.172 1.00 23.33 ? 223 THR B CA   1 
ATOM   8272  C C    . THR B 1 223 ? -9.327  -5.793  -42.078 1.00 21.55 ? 223 THR B C    1 
ATOM   8273  O O    . THR B 1 223 ? -9.337  -6.651  -42.976 1.00 19.50 ? 223 THR B O    1 
ATOM   8274  C CB   . THR B 1 223 ? -11.345 -4.392  -41.681 1.00 23.21 ? 223 THR B CB   1 
ATOM   8275  O OG1  . THR B 1 223 ? -12.437 -4.112  -40.812 1.00 25.72 ? 223 THR B OG1  1 
ATOM   8276  C CG2  . THR B 1 223 ? -11.896 -4.638  -43.059 1.00 25.89 ? 223 THR B CG2  1 
ATOM   8277  H H    . THR B 1 223 ? -10.274 -4.586  -39.479 1.00 28.96 ? 223 THR B H    1 
ATOM   8278  H HA   . THR B 1 223 ? -11.090 -6.380  -41.217 1.00 27.97 ? 223 THR B HA   1 
ATOM   8279  H HB   . THR B 1 223 ? -10.769 -3.614  -41.724 1.00 27.83 ? 223 THR B HB   1 
ATOM   8280  H HG1  . THR B 1 223 ? -12.945 -4.779  -40.765 1.00 30.84 ? 223 THR B HG1  1 
ATOM   8281  H HG21 . THR B 1 223 ? -12.405 -3.867  -43.355 1.00 31.05 ? 223 THR B HG21 1 
ATOM   8282  H HG22 . THR B 1 223 ? -11.170 -4.795  -43.683 1.00 31.05 ? 223 THR B HG22 1 
ATOM   8283  H HG23 . THR B 1 223 ? -12.477 -5.415  -43.050 1.00 31.05 ? 223 THR B HG23 1 
ATOM   8284  N N    . LYS B 1 224 ? -8.292  -4.984  -41.877 1.00 21.33 ? 224 LYS B N    1 
ATOM   8285  C CA   . LYS B 1 224 ? -7.077  -5.133  -42.658 1.00 21.47 ? 224 LYS B CA   1 
ATOM   8286  C C    . LYS B 1 224 ? -6.426  -6.481  -42.403 1.00 18.12 ? 224 LYS B C    1 
ATOM   8287  O O    . LYS B 1 224 ? -5.907  -7.097  -43.329 1.00 17.47 ? 224 LYS B O    1 
ATOM   8288  C CB   . LYS B 1 224 ? -6.112  -4.018  -42.325 1.00 24.34 ? 224 LYS B CB   1 
ATOM   8289  C CG   . LYS B 1 224 ? -4.858  -4.037  -43.152 1.00 26.72 ? 224 LYS B CG   1 
ATOM   8290  C CD   . LYS B 1 224 ? -3.988  -2.815  -42.823 1.00 24.70 ? 224 LYS B CD   1 
ATOM   8291  C CE   . LYS B 1 224 ? -2.958  -2.567  -43.860 1.00 25.37 ? 224 LYS B CE   1 
ATOM   8292  N NZ   . LYS B 1 224 ? -2.200  -1.290  -43.544 1.00 28.10 ? 224 LYS B NZ   1 
ATOM   8293  H H    . LYS B 1 224 ? -8.270  -4.347  -41.299 1.00 25.58 ? 224 LYS B H    1 
ATOM   8294  H HA   . LYS B 1 224 ? -7.294  -5.075  -43.601 1.00 25.74 ? 224 LYS B HA   1 
ATOM   8295  H HB2  . LYS B 1 224 ? -6.553  -3.167  -42.475 1.00 29.19 ? 224 LYS B HB2  1 
ATOM   8296  H HB3  . LYS B 1 224 ? -5.854  -4.095  -41.393 1.00 29.19 ? 224 LYS B HB3  1 
ATOM   8297  H HG2  . LYS B 1 224 ? -4.350  -4.839  -42.953 1.00 32.04 ? 224 LYS B HG2  1 
ATOM   8298  H HG3  . LYS B 1 224 ? -5.089  -4.006  -44.093 1.00 32.04 ? 224 LYS B HG3  1 
ATOM   8299  H HD2  . LYS B 1 224 ? -4.554  -2.028  -42.765 1.00 29.62 ? 224 LYS B HD2  1 
ATOM   8300  H HD3  . LYS B 1 224 ? -3.536  -2.964  -41.978 1.00 29.62 ? 224 LYS B HD3  1 
ATOM   8301  H HE2  . LYS B 1 224 ? -2.328  -3.305  -43.875 1.00 30.42 ? 224 LYS B HE2  1 
ATOM   8302  H HE3  . LYS B 1 224 ? -3.385  -2.467  -44.725 1.00 30.42 ? 224 LYS B HE3  1 
ATOM   8303  H HZ1  . LYS B 1 224 ? -1.582  -1.142  -44.167 1.00 33.70 ? 224 LYS B HZ1  1 
ATOM   8304  H HZ2  . LYS B 1 224 ? -2.762  -0.600  -43.524 1.00 33.70 ? 224 LYS B HZ2  1 
ATOM   8305  H HZ3  . LYS B 1 224 ? -1.801  -1.361  -42.752 1.00 33.70 ? 224 LYS B HZ3  1 
ATOM   8306  N N    . ALA B 1 225 ? -6.459  -6.971  -41.155 1.00 19.37 ? 225 ALA B N    1 
ATOM   8307  C CA   . ALA B 1 225 ? -5.873  -8.279  -40.860 1.00 17.89 ? 225 ALA B CA   1 
ATOM   8308  C C    . ALA B 1 225 ? -6.610  -9.413  -41.581 1.00 19.26 ? 225 ALA B C    1 
ATOM   8309  O O    . ALA B 1 225 ? -5.977  -10.382 -42.023 1.00 15.23 ? 225 ALA B O    1 
ATOM   8310  C CB   . ALA B 1 225 ? -5.836  -8.526  -39.342 1.00 18.63 ? 225 ALA B CB   1 
ATOM   8311  H H    . ALA B 1 225 ? -6.808  -6.572  -40.478 1.00 23.22 ? 225 ALA B H    1 
ATOM   8312  H HA   . ALA B 1 225 ? -4.956  -8.282  -41.176 1.00 21.45 ? 225 ALA B HA   1 
ATOM   8313  H HB1  . ALA B 1 225 ? -5.445  -9.397  -39.174 1.00 22.33 ? 225 ALA B HB1  1 
ATOM   8314  H HB2  . ALA B 1 225 ? -5.300  -7.835  -38.924 1.00 22.33 ? 225 ALA B HB2  1 
ATOM   8315  H HB3  . ALA B 1 225 ? -6.742  -8.497  -38.996 1.00 22.33 ? 225 ALA B HB3  1 
ATOM   8316  N N    . ALA B 1 226 ? -7.943  -9.295  -41.719 1.00 18.53 ? 226 ALA B N    1 
ATOM   8317  C CA   . ALA B 1 226 ? -8.747  -10.229 -42.513 1.00 19.43 ? 226 ALA B CA   1 
ATOM   8318  C C    . ALA B 1 226 ? -8.388  -10.170 -43.986 1.00 14.14 ? 226 ALA B C    1 
ATOM   8319  O O    . ALA B 1 226 ? -8.293  -11.201 -44.637 1.00 17.32 ? 226 ALA B O    1 
ATOM   8320  C CB   . ALA B 1 226 ? -10.222 -9.918  -42.365 1.00 19.22 ? 226 ALA B CB   1 
ATOM   8321  H H    . ALA B 1 226 ? -8.407  -8.670  -41.354 1.00 22.22 ? 226 ALA B H    1 
ATOM   8322  H HA   . ALA B 1 226 ? -8.593  -11.133 -42.198 1.00 23.30 ? 226 ALA B HA   1 
ATOM   8323  H HB1  . ALA B 1 226 ? -10.732 -10.548 -42.898 1.00 23.04 ? 226 ALA B HB1  1 
ATOM   8324  H HB2  . ALA B 1 226 ? -10.469 -10.000 -41.430 1.00 23.04 ? 226 ALA B HB2  1 
ATOM   8325  H HB3  . ALA B 1 226 ? -10.386 -9.013  -42.673 1.00 23.04 ? 226 ALA B HB3  1 
ATOM   8326  N N    . VAL B 1 227 ? -8.223  -8.964  -44.537 1.00 17.91 ? 227 VAL B N    1 
ATOM   8327  C CA   . VAL B 1 227 ? -7.832  -8.831  -45.947 1.00 19.78 ? 227 VAL B CA   1 
ATOM   8328  C C    . VAL B 1 227 ? -6.482  -9.499  -46.205 1.00 16.31 ? 227 VAL B C    1 
ATOM   8329  O O    . VAL B 1 227 ? -6.288  -10.194 -47.212 1.00 18.40 ? 227 VAL B O    1 
ATOM   8330  C CB   . VAL B 1 227 ? -7.789  -7.346  -46.361 1.00 18.13 ? 227 VAL B CB   1 
ATOM   8331  C CG1  . VAL B 1 227 ? -7.213  -7.186  -47.800 1.00 22.03 ? 227 VAL B CG1  1 
ATOM   8332  C CG2  . VAL B 1 227 ? -9.153  -6.696  -46.252 1.00 28.56 ? 227 VAL B CG2  1 
ATOM   8333  H H    . VAL B 1 227 ? -8.329  -8.216  -44.125 1.00 21.48 ? 227 VAL B H    1 
ATOM   8334  H HA   . VAL B 1 227 ? -8.494  -9.275  -46.499 1.00 23.72 ? 227 VAL B HA   1 
ATOM   8335  H HB   . VAL B 1 227 ? -7.195  -6.876  -45.756 1.00 21.73 ? 227 VAL B HB   1 
ATOM   8336  H HG11 . VAL B 1 227 ? -7.199  -6.244  -48.031 1.00 26.42 ? 227 VAL B HG11 1 
ATOM   8337  H HG12 . VAL B 1 227 ? -6.312  -7.545  -47.820 1.00 26.42 ? 227 VAL B HG12 1 
ATOM   8338  H HG13 . VAL B 1 227 ? -7.777  -7.671  -48.421 1.00 26.42 ? 227 VAL B HG13 1 
ATOM   8339  H HG21 . VAL B 1 227 ? -9.081  -5.767  -46.521 1.00 34.25 ? 227 VAL B HG21 1 
ATOM   8340  H HG22 . VAL B 1 227 ? -9.772  -7.163  -46.835 1.00 34.25 ? 227 VAL B HG22 1 
ATOM   8341  H HG23 . VAL B 1 227 ? -9.457  -6.753  -45.333 1.00 34.25 ? 227 VAL B HG23 1 
ATOM   8342  N N    . ILE B 1 228 ? -5.513  -9.252  -45.331 1.00 16.06 ? 228 ILE B N    1 
ATOM   8343  C CA   . ILE B 1 228 ? -4.204  -9.855  -45.475 1.00 16.34 ? 228 ILE B CA   1 
ATOM   8344  C C    . ILE B 1 228 ? -4.308  -11.370 -45.370 1.00 16.04 ? 228 ILE B C    1 
ATOM   8345  O O    . ILE B 1 228 ? -3.732  -12.106 -46.176 1.00 16.89 ? 228 ILE B O    1 
ATOM   8346  C CB   . ILE B 1 228 ? -3.240  -9.267  -44.432 1.00 17.31 ? 228 ILE B CB   1 
ATOM   8347  C CG1  . ILE B 1 228 ? -2.991  -7.783  -44.766 1.00 16.63 ? 228 ILE B CG1  1 
ATOM   8348  C CG2  . ILE B 1 228 ? -1.909  -10.007 -44.402 1.00 17.77 ? 228 ILE B CG2  1 
ATOM   8349  C CD1  . ILE B 1 228 ? -2.376  -7.073  -43.617 1.00 24.85 ? 228 ILE B CD1  1 
ATOM   8350  H H    . ILE B 1 228 ? -5.592  -8.736  -44.647 1.00 19.25 ? 228 ILE B H    1 
ATOM   8351  H HA   . ILE B 1 228 ? -3.856  -9.642  -46.355 1.00 19.59 ? 228 ILE B HA   1 
ATOM   8352  H HB   . ILE B 1 228 ? -3.652  -9.326  -43.556 1.00 20.75 ? 228 ILE B HB   1 
ATOM   8353  H HG12 . ILE B 1 228 ? -2.386  -7.721  -45.522 1.00 19.94 ? 228 ILE B HG12 1 
ATOM   8354  H HG13 . ILE B 1 228 ? -3.836  -7.354  -44.974 1.00 19.94 ? 228 ILE B HG13 1 
ATOM   8355  H HG21 . ILE B 1 228 ? -1.338  -9.601  -43.731 1.00 21.30 ? 228 ILE B HG21 1 
ATOM   8356  H HG22 . ILE B 1 228 ? -2.071  -10.937 -44.179 1.00 21.30 ? 228 ILE B HG22 1 
ATOM   8357  H HG23 . ILE B 1 228 ? -1.493  -9.943  -45.275 1.00 21.30 ? 228 ILE B HG23 1 
ATOM   8358  H HD11 . ILE B 1 228 ? -2.233  -6.145  -43.860 1.00 29.80 ? 228 ILE B HD11 1 
ATOM   8359  H HD12 . ILE B 1 228 ? -2.974  -7.128  -42.856 1.00 29.80 ? 228 ILE B HD12 1 
ATOM   8360  H HD13 . ILE B 1 228 ? -1.528  -7.494  -43.403 1.00 29.80 ? 228 ILE B HD13 1 
ATOM   8361  N N    . ARG B 1 229 ? -5.045  -11.859 -44.387 1.00 16.00 ? 229 ARG B N    1 
ATOM   8362  C CA   . ARG B 1 229 ? -5.094  -13.306 -44.170 1.00 14.43 ? 229 ARG B CA   1 
ATOM   8363  C C    . ARG B 1 229 ? -5.819  -14.019 -45.307 1.00 15.22 ? 229 ARG B C    1 
ATOM   8364  O O    . ARG B 1 229 ? -5.340  -15.045 -45.811 1.00 16.96 ? 229 ARG B O    1 
ATOM   8365  C CB   . ARG B 1 229 ? -5.763  -13.595 -42.823 1.00 15.28 ? 229 ARG B CB   1 
ATOM   8366  C CG   . ARG B 1 229 ? -5.580  -15.014 -42.374 1.00 12.49 ? 229 ARG B CG   1 
ATOM   8367  C CD   . ARG B 1 229 ? -6.595  -15.401 -41.316 1.00 15.42 ? 229 ARG B CD   1 
ATOM   8368  N NE   . ARG B 1 229 ? -7.908  -15.712 -41.903 1.00 16.70 ? 229 ARG B NE   1 
ATOM   8369  C CZ   . ARG B 1 229 ? -8.251  -16.880 -42.452 1.00 20.54 ? 229 ARG B CZ   1 
ATOM   8370  N NH1  . ARG B 1 229 ? -7.389  -17.884 -42.507 1.00 15.84 ? 229 ARG B NH1  1 
ATOM   8371  N NH2  . ARG B 1 229 ? -9.479  -17.039 -42.964 1.00 15.13 ? 229 ARG B NH2  1 
ATOM   8372  H H    . ARG B 1 229 ? -5.518  -11.393 -43.841 1.00 19.17 ? 229 ARG B H    1 
ATOM   8373  H HA   . ARG B 1 229 ? -4.187  -13.649 -44.133 1.00 17.30 ? 229 ARG B HA   1 
ATOM   8374  H HB2  . ARG B 1 229 ? -5.377  -13.015 -42.147 1.00 18.32 ? 229 ARG B HB2  1 
ATOM   8375  H HB3  . ARG B 1 229 ? -6.715  -13.425 -42.900 1.00 18.32 ? 229 ARG B HB3  1 
ATOM   8376  H HG2  . ARG B 1 229 ? -5.693  -15.607 -43.134 1.00 14.97 ? 229 ARG B HG2  1 
ATOM   8377  H HG3  . ARG B 1 229 ? -4.693  -15.119 -41.997 1.00 14.97 ? 229 ARG B HG3  1 
ATOM   8378  H HD2  . ARG B 1 229 ? -6.280  -16.189 -40.845 1.00 18.48 ? 229 ARG B HD2  1 
ATOM   8379  H HD3  . ARG B 1 229 ? -6.707  -14.663 -40.696 1.00 18.48 ? 229 ARG B HD3  1 
ATOM   8380  H HE   . ARG B 1 229 ? -8.503  -15.090 -41.892 1.00 20.02 ? 229 ARG B HE   1 
ATOM   8381  H HH11 . ARG B 1 229 ? -6.598  -17.789 -42.183 1.00 18.98 ? 229 ARG B HH11 1 
ATOM   8382  H HH12 . ARG B 1 229 ? -7.621  -18.632 -42.863 1.00 18.98 ? 229 ARG B HH12 1 
ATOM   8383  H HH21 . ARG B 1 229 ? -10.045 -16.392 -42.932 1.00 18.13 ? 229 ARG B HH21 1 
ATOM   8384  H HH22 . ARG B 1 229 ? -9.705  -17.790 -43.316 1.00 18.13 ? 229 ARG B HH22 1 
ATOM   8385  N N    . LEU B 1 230 ? -6.971  -13.494 -45.734 1.00 15.14 ? 230 LEU B N    1 
ATOM   8386  C CA   . LEU B 1 230 ? -7.645  -14.072 -46.891 1.00 14.30 ? 230 LEU B CA   1 
ATOM   8387  C C    . LEU B 1 230 ? -6.766  -13.988 -48.123 1.00 15.85 ? 230 LEU B C    1 
ATOM   8388  O O    . LEU B 1 230 ? -6.740  -14.908 -48.940 1.00 14.88 ? 230 LEU B O    1 
ATOM   8389  C CB   . LEU B 1 230 ? -8.985  -13.389 -47.152 1.00 16.03 ? 230 LEU B CB   1 
ATOM   8390  C CG   . LEU B 1 230 ? -9.999  -13.631 -46.026 1.00 19.36 ? 230 LEU B CG   1 
ATOM   8391  C CD1  . LEU B 1 230 ? -11.206 -12.713 -46.138 1.00 21.82 ? 230 LEU B CD1  1 
ATOM   8392  C CD2  . LEU B 1 230 ? -10.445 -15.073 -46.063 1.00 20.73 ? 230 LEU B CD2  1 
ATOM   8393  H H    . LEU B 1 230 ? -7.371  -12.821 -45.379 1.00 18.15 ? 230 LEU B H    1 
ATOM   8394  H HA   . LEU B 1 230 ? -7.819  -15.010 -46.714 1.00 17.13 ? 230 LEU B HA   1 
ATOM   8395  H HB2  . LEU B 1 230 ? -8.843  -12.432 -47.228 1.00 19.21 ? 230 LEU B HB2  1 
ATOM   8396  H HB3  . LEU B 1 230 ? -9.362  -13.735 -47.976 1.00 19.21 ? 230 LEU B HB3  1 
ATOM   8397  H HG   . LEU B 1 230 ? -9.572  -13.468 -45.171 1.00 23.21 ? 230 LEU B HG   1 
ATOM   8398  H HD11 . LEU B 1 230 ? -11.816 -12.902 -45.408 1.00 26.16 ? 230 LEU B HD11 1 
ATOM   8399  H HD12 . LEU B 1 230 ? -10.907 -11.791 -46.089 1.00 26.16 ? 230 LEU B HD12 1 
ATOM   8400  H HD13 . LEU B 1 230 ? -11.647 -12.872 -46.988 1.00 26.16 ? 230 LEU B HD13 1 
ATOM   8401  H HD21 . LEU B 1 230 ? -11.085 -15.224 -45.351 1.00 24.86 ? 230 LEU B HD21 1 
ATOM   8402  H HD22 . LEU B 1 230 ? -10.856 -15.254 -46.923 1.00 24.86 ? 230 LEU B HD22 1 
ATOM   8403  H HD23 . LEU B 1 230 ? -9.671  -15.645 -45.940 1.00 24.86 ? 230 LEU B HD23 1 
ATOM   8404  N N    . GLY B 1 231 ? -6.057  -12.878 -48.280 1.00 16.42 ? 231 GLY B N    1 
ATOM   8405  C CA   . GLY B 1 231 ? -5.070  -12.798 -49.330 1.00 18.83 ? 231 GLY B CA   1 
ATOM   8406  C C    . GLY B 1 231 ? -4.059  -13.924 -49.234 1.00 14.10 ? 231 GLY B C    1 
ATOM   8407  O O    . GLY B 1 231 ? -3.726  -14.549 -50.227 1.00 14.73 ? 231 GLY B O    1 
ATOM   8408  H H    . GLY B 1 231 ? -6.130  -12.170 -47.796 1.00 19.68 ? 231 GLY B H    1 
ATOM   8409  H HA2  . GLY B 1 231 ? -5.508  -12.848 -50.194 1.00 22.57 ? 231 GLY B HA2  1 
ATOM   8410  H HA3  . GLY B 1 231 ? -4.598  -11.952 -49.270 1.00 22.57 ? 231 GLY B HA3  1 
ATOM   8411  N N    . LEU B 1 232 ? -3.593  -14.221 -48.023 1.00 18.79 ? 232 LEU B N    1 
ATOM   8412  C CA   . LEU B 1 232 ? -2.621  -15.296 -47.850 1.00 14.96 ? 232 LEU B CA   1 
ATOM   8413  C C    . LEU B 1 232 ? -3.250  -16.635 -48.213 1.00 15.17 ? 232 LEU B C    1 
ATOM   8414  O O    . LEU B 1 232 ? -2.608  -17.484 -48.844 1.00 15.04 ? 232 LEU B O    1 
ATOM   8415  C CB   . LEU B 1 232 ? -2.096  -15.313 -46.400 1.00 17.80 ? 232 LEU B CB   1 
ATOM   8416  C CG   . LEU B 1 232 ? -1.078  -16.411 -46.060 1.00 21.33 ? 232 LEU B CG   1 
ATOM   8417  C CD1  . LEU B 1 232 ? 0.213   -16.234 -46.824 1.00 19.67 ? 232 LEU B CD1  1 
ATOM   8418  C CD2  . LEU B 1 232 ? -0.782  -16.457 -44.581 1.00 20.72 ? 232 LEU B CD2  1 
ATOM   8419  H H    . LEU B 1 232 ? -3.820  -13.822 -47.296 1.00 22.52 ? 232 LEU B H    1 
ATOM   8420  H HA   . LEU B 1 232 ? -1.868  -15.144 -48.443 1.00 17.94 ? 232 LEU B HA   1 
ATOM   8421  H HB2  . LEU B 1 232 ? -1.671  -14.460 -46.221 1.00 21.34 ? 232 LEU B HB2  1 
ATOM   8422  H HB3  . LEU B 1 232 ? -2.853  -15.427 -45.804 1.00 21.34 ? 232 LEU B HB3  1 
ATOM   8423  H HG   . LEU B 1 232 ? -1.453  -17.269 -46.311 1.00 25.57 ? 232 LEU B HG   1 
ATOM   8424  H HD11 . LEU B 1 232 ? 0.824   -16.946 -46.579 1.00 23.59 ? 232 LEU B HD11 1 
ATOM   8425  H HD12 . LEU B 1 232 ? 0.024   -16.271 -47.775 1.00 23.59 ? 232 LEU B HD12 1 
ATOM   8426  H HD13 . LEU B 1 232 ? 0.598   -15.373 -46.597 1.00 23.59 ? 232 LEU B HD13 1 
ATOM   8427  H HD21 . LEU B 1 232 ? -0.138  -17.161 -44.410 1.00 24.84 ? 232 LEU B HD21 1 
ATOM   8428  H HD22 . LEU B 1 232 ? -0.419  -15.601 -44.305 1.00 24.84 ? 232 LEU B HD22 1 
ATOM   8429  H HD23 . LEU B 1 232 ? -1.605  -16.638 -44.100 1.00 24.84 ? 232 LEU B HD23 1 
ATOM   8430  N N    . MET B 1 233 ? -4.522  -16.823 -47.859 1.00 17.68 ? 233 MET B N    1 
ATOM   8431  C CA   . MET B 1 233 ? -5.202  -18.067 -48.196 1.00 16.72 ? 233 MET B CA   1 
ATOM   8432  C C    . MET B 1 233 ? -5.329  -18.213 -49.707 1.00 16.88 ? 233 MET B C    1 
ATOM   8433  O O    . MET B 1 233 ? -5.194  -19.321 -50.241 1.00 15.52 ? 233 MET B O    1 
ATOM   8434  C CB   . MET B 1 233 ? -6.557  -18.114 -47.504 1.00 15.61 ? 233 MET B CB   1 
ATOM   8435  C CG   . MET B 1 233 ? -6.466  -18.083 -45.980 1.00 18.38 ? 233 MET B CG   1 
ATOM   8436  S SD   . MET B 1 233 ? -5.439  -19.425 -45.337 1.00 31.22 ? 233 MET B SD   1 
ATOM   8437  C CE   . MET B 1 233 ? -6.687  -20.619 -45.013 1.00 33.84 ? 233 MET B CE   1 
ATOM   8438  H H    . MET B 1 233 ? -5.004  -16.254 -47.430 1.00 21.19 ? 233 MET B H    1 
ATOM   8439  H HA   . MET B 1 233 ? -4.675  -18.808 -47.858 1.00 20.05 ? 233 MET B HA   1 
ATOM   8440  H HB2  . MET B 1 233 ? -7.079  -17.347 -47.786 1.00 18.71 ? 233 MET B HB2  1 
ATOM   8441  H HB3  . MET B 1 233 ? -7.010  -18.933 -47.759 1.00 18.71 ? 233 MET B HB3  1 
ATOM   8442  H HG2  . MET B 1 233 ? -6.074  -17.241 -45.700 1.00 22.04 ? 233 MET B HG2  1 
ATOM   8443  H HG3  . MET B 1 233 ? -7.357  -18.178 -45.606 1.00 22.04 ? 233 MET B HG3  1 
ATOM   8444  H HE1  . MET B 1 233 ? -6.273  -21.419 -44.653 1.00 40.59 ? 233 MET B HE1  1 
ATOM   8445  H HE2  . MET B 1 233 ? -7.314  -20.253 -44.371 1.00 40.59 ? 233 MET B HE2  1 
ATOM   8446  H HE3  . MET B 1 233 ? -7.145  -20.828 -45.842 1.00 40.59 ? 233 MET B HE3  1 
ATOM   8447  N N    . GLU B 1 234 ? -5.561  -17.107 -50.419 1.00 15.88 ? 234 GLU B N    1 
ATOM   8448  C CA   . GLU B 1 234 ? -5.621  -17.184 -51.870 1.00 14.33 ? 234 GLU B CA   1 
ATOM   8449  C C    . GLU B 1 234 ? -4.227  -17.406 -52.456 1.00 16.98 ? 234 GLU B C    1 
ATOM   8450  O O    . GLU B 1 234 ? -4.070  -18.153 -53.423 1.00 16.18 ? 234 GLU B O    1 
ATOM   8451  C CB   . GLU B 1 234 ? -6.296  -15.927 -52.440 1.00 15.47 ? 234 GLU B CB   1 
ATOM   8452  C CG   . GLU B 1 234 ? -7.820  -15.897 -52.173 1.00 15.98 ? 234 GLU B CG   1 
ATOM   8453  C CD   . GLU B 1 234 ? -8.553  -14.794 -52.909 1.00 20.34 ? 234 GLU B CD   1 
ATOM   8454  O OE1  . GLU B 1 234 ? -8.016  -14.241 -53.911 1.00 20.17 ? 234 GLU B OE1  1 
ATOM   8455  O OE2  . GLU B 1 234 ? -9.679  -14.486 -52.480 1.00 19.33 ? 234 GLU B OE2  1 
ATOM   8456  H H    . GLU B 1 234 ? -5.683  -16.321 -50.091 1.00 19.03 ? 234 GLU B H    1 
ATOM   8457  H HA   . GLU B 1 234 ? -6.168  -17.946 -52.117 1.00 17.17 ? 234 GLU B HA   1 
ATOM   8458  H HB2  . GLU B 1 234 ? -5.903  -15.142 -52.026 1.00 18.54 ? 234 GLU B HB2  1 
ATOM   8459  H HB3  . GLU B 1 234 ? -6.159  -15.901 -53.399 1.00 18.54 ? 234 GLU B HB3  1 
ATOM   8460  H HG2  . GLU B 1 234 ? -8.202  -16.743 -52.452 1.00 19.15 ? 234 GLU B HG2  1 
ATOM   8461  H HG3  . GLU B 1 234 ? -7.968  -15.767 -51.223 1.00 19.15 ? 234 GLU B HG3  1 
ATOM   8462  N N    . MET B 1 235 ? -3.181  -16.813 -51.856 1.00 16.14 ? 235 MET B N    1 
ATOM   8463  C CA   . MET B 1 235 ? -1.833  -17.118 -52.319 1.00 16.12 ? 235 MET B CA   1 
ATOM   8464  C C    . MET B 1 235 ? -1.564  -18.614 -52.255 1.00 15.22 ? 235 MET B C    1 
ATOM   8465  O O    . MET B 1 235 ? -1.011  -19.193 -53.199 1.00 18.13 ? 235 MET B O    1 
ATOM   8466  C CB   . MET B 1 235 ? -0.786  -16.355 -51.492 1.00 17.27 ? 235 MET B CB   1 
ATOM   8467  C CG   . MET B 1 235 ? -0.745  -14.866 -51.765 1.00 20.01 ? 235 MET B CG   1 
ATOM   8468  S SD   . MET B 1 235 ? 0.196   -13.913 -50.535 1.00 16.99 ? 235 MET B SD   1 
ATOM   8469  C CE   . MET B 1 235 ? 1.812   -14.626 -50.753 1.00 19.03 ? 235 MET B CE   1 
ATOM   8470  H H    . MET B 1 235 ? -3.229  -16.253 -51.206 1.00 19.34 ? 235 MET B H    1 
ATOM   8471  H HA   . MET B 1 235 ? -1.748  -16.827 -53.241 1.00 19.32 ? 235 MET B HA   1 
ATOM   8472  H HB2  . MET B 1 235 ? -0.984  -16.478 -50.551 1.00 20.70 ? 235 MET B HB2  1 
ATOM   8473  H HB3  . MET B 1 235 ? 0.091   -16.717 -51.692 1.00 20.70 ? 235 MET B HB3  1 
ATOM   8474  H HG2  . MET B 1 235 ? -0.333  -14.719 -52.631 1.00 24.00 ? 235 MET B HG2  1 
ATOM   8475  H HG3  . MET B 1 235 ? -1.653  -14.525 -51.773 1.00 24.00 ? 235 MET B HG3  1 
ATOM   8476  H HE1  . MET B 1 235 ? 2.431   -14.199 -50.141 1.00 22.81 ? 235 MET B HE1  1 
ATOM   8477  H HE2  . MET B 1 235 ? 1.764   -15.577 -50.566 1.00 22.81 ? 235 MET B HE2  1 
ATOM   8478  H HE3  . MET B 1 235 ? 2.099   -14.483 -51.668 1.00 22.81 ? 235 MET B HE3  1 
ATOM   8479  N N    . ILE B 1 236 ? -1.940  -19.249 -51.148 1.00 13.36 ? 236 ILE B N    1 
ATOM   8480  C CA   . ILE B 1 236 ? -1.685  -20.671 -50.948 1.00 17.26 ? 236 ILE B CA   1 
ATOM   8481  C C    . ILE B 1 236 ? -2.457  -21.492 -51.970 1.00 18.91 ? 236 ILE B C    1 
ATOM   8482  O O    . ILE B 1 236 ? -1.897  -22.371 -52.642 1.00 17.82 ? 236 ILE B O    1 
ATOM   8483  C CB   . ILE B 1 236 ? -2.056  -21.082 -49.513 1.00 15.29 ? 236 ILE B CB   1 
ATOM   8484  C CG1  . ILE B 1 236 ? -1.118  -20.430 -48.518 1.00 17.09 ? 236 ILE B CG1  1 
ATOM   8485  C CG2  . ILE B 1 236 ? -2.039  -22.587 -49.370 1.00 19.58 ? 236 ILE B CG2  1 
ATOM   8486  C CD1  . ILE B 1 236 ? -1.528  -20.634 -47.087 1.00 20.81 ? 236 ILE B CD1  1 
ATOM   8487  H H    . ILE B 1 236 ? -2.348  -18.873 -50.491 1.00 16.01 ? 236 ILE B H    1 
ATOM   8488  H HA   . ILE B 1 236 ? -0.740  -20.844 -51.075 1.00 20.69 ? 236 ILE B HA   1 
ATOM   8489  H HB   . ILE B 1 236 ? -2.957  -20.770 -49.331 1.00 18.32 ? 236 ILE B HB   1 
ATOM   8490  H HG12 . ILE B 1 236 ? -0.231  -20.807 -48.630 1.00 20.49 ? 236 ILE B HG12 1 
ATOM   8491  H HG13 . ILE B 1 236 ? -1.094  -19.476 -48.688 1.00 20.49 ? 236 ILE B HG13 1 
ATOM   8492  H HG21 . ILE B 1 236 ? -2.276  -22.819 -48.458 1.00 23.48 ? 236 ILE B HG21 1 
ATOM   8493  H HG22 . ILE B 1 236 ? -2.682  -22.970 -49.987 1.00 23.48 ? 236 ILE B HG22 1 
ATOM   8494  H HG23 . ILE B 1 236 ? -1.148  -22.913 -49.574 1.00 23.48 ? 236 ILE B HG23 1 
ATOM   8495  H HD11 . ILE B 1 236 ? -0.886  -20.193 -46.509 1.00 24.94 ? 236 ILE B HD11 1 
ATOM   8496  H HD12 . ILE B 1 236 ? -2.410  -20.253 -46.954 1.00 24.94 ? 236 ILE B HD12 1 
ATOM   8497  H HD13 . ILE B 1 236 ? -1.547  -21.585 -46.896 1.00 24.94 ? 236 ILE B HD13 1 
ATOM   8498  N N    . ALA B 1 237 ? -3.752  -21.220 -52.097 1.00 17.60 ? 237 ALA B N    1 
ATOM   8499  C CA   . ALA B 1 237 ? -4.562  -21.975 -53.040 1.00 18.66 ? 237 ALA B CA   1 
ATOM   8500  C C    . ALA B 1 237 ? -4.039  -21.799 -54.450 1.00 17.01 ? 237 ALA B C    1 
ATOM   8501  O O    . ALA B 1 237 ? -3.942  -22.776 -55.204 1.00 19.73 ? 237 ALA B O    1 
ATOM   8502  C CB   . ALA B 1 237 ? -6.023  -21.547 -52.934 1.00 14.47 ? 237 ALA B CB   1 
ATOM   8503  H H    . ALA B 1 237 ? -4.177  -20.616 -51.657 1.00 21.09 ? 237 ALA B H    1 
ATOM   8504  H HA   . ALA B 1 237 ? -4.510  -22.917 -52.817 1.00 22.37 ? 237 ALA B HA   1 
ATOM   8505  H HB1  . ALA B 1 237 ? -6.548  -22.059 -53.568 1.00 17.34 ? 237 ALA B HB1  1 
ATOM   8506  H HB2  . ALA B 1 237 ? -6.336  -21.715 -52.032 1.00 17.34 ? 237 ALA B HB2  1 
ATOM   8507  H HB3  . ALA B 1 237 ? -6.089  -20.600 -53.136 1.00 17.34 ? 237 ALA B HB3  1 
ATOM   8508  N N    . PHE B 1 238 ? -3.664  -20.568 -54.828 1.00 14.98 ? 238 PHE B N    1 
ATOM   8509  C CA   . PHE B 1 238 ? -3.166  -20.351 -56.180 1.00 17.91 ? 238 PHE B CA   1 
ATOM   8510  C C    . PHE B 1 238 ? -1.846  -21.071 -56.414 1.00 23.94 ? 238 PHE B C    1 
ATOM   8511  O O    . PHE B 1 238 ? -1.624  -21.664 -57.479 1.00 21.14 ? 238 PHE B O    1 
ATOM   8512  C CB   . PHE B 1 238 ? -2.994  -18.870 -56.501 1.00 19.47 ? 238 PHE B CB   1 
ATOM   8513  C CG   . PHE B 1 238 ? -2.638  -18.647 -57.949 1.00 22.24 ? 238 PHE B CG   1 
ATOM   8514  C CD1  . PHE B 1 238 ? -3.636  -18.593 -58.918 1.00 27.21 ? 238 PHE B CD1  1 
ATOM   8515  C CD2  . PHE B 1 238 ? -1.323  -18.613 -58.354 1.00 22.72 ? 238 PHE B CD2  1 
ATOM   8516  C CE1  . PHE B 1 238 ? -3.315  -18.442 -60.236 1.00 25.17 ? 238 PHE B CE1  1 
ATOM   8517  C CE2  . PHE B 1 238 ? -0.991  -18.471 -59.674 1.00 24.78 ? 238 PHE B CE2  1 
ATOM   8518  C CZ   . PHE B 1 238 ? -1.986  -18.395 -60.623 1.00 26.42 ? 238 PHE B CZ   1 
ATOM   8519  H H    . PHE B 1 238 ? -3.689  -19.866 -54.332 1.00 17.95 ? 238 PHE B H    1 
ATOM   8520  H HA   . PHE B 1 238 ? -3.812  -20.712 -56.807 1.00 21.46 ? 238 PHE B HA   1 
ATOM   8521  H HB2  . PHE B 1 238 ? -3.825  -18.405 -56.318 1.00 23.34 ? 238 PHE B HB2  1 
ATOM   8522  H HB3  . PHE B 1 238 ? -2.280  -18.506 -55.954 1.00 23.34 ? 238 PHE B HB3  1 
ATOM   8523  H HD1  . PHE B 1 238 ? -4.529  -18.633 -58.662 1.00 32.62 ? 238 PHE B HD1  1 
ATOM   8524  H HD2  . PHE B 1 238 ? -0.647  -18.673 -57.718 1.00 27.24 ? 238 PHE B HD2  1 
ATOM   8525  H HE1  . PHE B 1 238 ? -3.988  -18.388 -60.876 1.00 30.18 ? 238 PHE B HE1  1 
ATOM   8526  H HE2  . PHE B 1 238 ? -0.097  -18.430 -59.929 1.00 29.71 ? 238 PHE B HE2  1 
ATOM   8527  H HZ   . PHE B 1 238 ? -1.766  -18.283 -61.520 1.00 31.68 ? 238 PHE B HZ   1 
ATOM   8528  N N    . ALA B 1 239 ? -0.936  -21.000 -55.446 1.00 20.71 ? 239 ALA B N    1 
ATOM   8529  C CA   . ALA B 1 239 ? 0.338   -21.681 -55.602 1.00 22.92 ? 239 ALA B CA   1 
ATOM   8530  C C    . ALA B 1 239 ? 0.132   -23.173 -55.818 1.00 22.82 ? 239 ALA B C    1 
ATOM   8531  O O    . ALA B 1 239 ? 0.795   -23.772 -56.661 1.00 25.33 ? 239 ALA B O    1 
ATOM   8532  C CB   . ALA B 1 239 ? 1.208   -21.450 -54.382 1.00 21.60 ? 239 ALA B CB   1 
ATOM   8533  H H    . ALA B 1 239 ? -1.031  -20.572 -54.706 1.00 24.83 ? 239 ALA B H    1 
ATOM   8534  H HA   . ALA B 1 239 ? 0.799   -21.323 -56.376 1.00 27.49 ? 239 ALA B HA   1 
ATOM   8535  H HB1  . ALA B 1 239 ? 2.052   -21.913 -54.505 1.00 25.90 ? 239 ALA B HB1  1 
ATOM   8536  H HB2  . ALA B 1 239 ? 1.364   -20.498 -54.281 1.00 25.90 ? 239 ALA B HB2  1 
ATOM   8537  H HB3  . ALA B 1 239 ? 0.752   -21.796 -53.599 1.00 25.90 ? 239 ALA B HB3  1 
ATOM   8538  N N    . LYS B 1 240 ? -0.793  -23.782 -55.075 1.00 20.17 ? 240 LYS B N    1 
ATOM   8539  C CA   . LYS B 1 240 ? -1.053  -25.212 -55.239 1.00 26.46 ? 240 LYS B CA   1 
ATOM   8540  C C    . LYS B 1 240 ? -1.566  -25.562 -56.637 1.00 32.03 ? 240 LYS B C    1 
ATOM   8541  O O    . LYS B 1 240 ? -1.244  -26.630 -57.168 1.00 33.29 ? 240 LYS B O    1 
ATOM   8542  C CB   . LYS B 1 240 ? -2.041  -25.689 -54.192 1.00 20.58 ? 240 LYS B CB   1 
ATOM   8543  C CG   . LYS B 1 240 ? -1.546  -25.569 -52.786 1.00 28.32 ? 240 LYS B CG   1 
ATOM   8544  C CD   . LYS B 1 240 ? -2.558  -26.125 -51.839 1.00 29.76 ? 240 LYS B CD   1 
ATOM   8545  C CE   . LYS B 1 240 ? -2.059  -26.022 -50.416 1.00 35.76 ? 240 LYS B CE   1 
ATOM   8546  N NZ   . LYS B 1 240 ? -2.764  -26.969 -49.512 1.00 49.10 ? 240 LYS B NZ   1 
ATOM   8547  H H    . LYS B 1 240 ? -1.277  -23.396 -54.478 1.00 24.19 ? 240 LYS B H    1 
ATOM   8548  H HA   . LYS B 1 240 ? -0.223  -25.695 -55.101 1.00 31.73 ? 240 LYS B HA   1 
ATOM   8549  H HB2  . LYS B 1 240 ? -2.852  -25.162 -54.266 1.00 24.67 ? 240 LYS B HB2  1 
ATOM   8550  H HB3  . LYS B 1 240 ? -2.241  -26.624 -54.356 1.00 24.67 ? 240 LYS B HB3  1 
ATOM   8551  H HG2  . LYS B 1 240 ? -0.722  -26.071 -52.688 1.00 33.96 ? 240 LYS B HG2  1 
ATOM   8552  H HG3  . LYS B 1 240 ? -1.403  -24.634 -52.571 1.00 33.96 ? 240 LYS B HG3  1 
ATOM   8553  H HD2  . LYS B 1 240 ? -3.383  -25.620 -51.913 1.00 35.69 ? 240 LYS B HD2  1 
ATOM   8554  H HD3  . LYS B 1 240 ? -2.714  -27.060 -52.044 1.00 35.69 ? 240 LYS B HD3  1 
ATOM   8555  H HE2  . LYS B 1 240 ? -1.112  -26.231 -50.394 1.00 42.89 ? 240 LYS B HE2  1 
ATOM   8556  H HE3  . LYS B 1 240 ? -2.210  -25.121 -50.089 1.00 42.89 ? 240 LYS B HE3  1 
ATOM   8557  H HZ1  . LYS B 1 240 ? -2.451  -26.887 -48.683 1.00 58.90 ? 240 LYS B HZ1  1 
ATOM   8558  H HZ2  . LYS B 1 240 ? -3.637  -26.794 -49.511 1.00 58.90 ? 240 LYS B HZ2  1 
ATOM   8559  H HZ3  . LYS B 1 240 ? -2.637  -27.805 -49.789 1.00 58.90 ? 240 LYS B HZ3  1 
ATOM   8560  N N    . LEU B 1 241 ? -2.387  -24.709 -57.244 1.00 27.94 ? 241 LEU B N    1 
ATOM   8561  C CA   . LEU B 1 241 ? -2.894  -25.073 -58.561 1.00 31.91 ? 241 LEU B CA   1 
ATOM   8562  C C    . LEU B 1 241 ? -1.933  -24.680 -59.672 1.00 37.78 ? 241 LEU B C    1 
ATOM   8563  O O    . LEU B 1 241 ? -1.938  -25.322 -60.726 1.00 37.62 ? 241 LEU B O    1 
ATOM   8564  C CB   . LEU B 1 241 ? -4.292  -24.470 -58.802 1.00 33.22 ? 241 LEU B CB   1 
ATOM   8565  C CG   . LEU B 1 241 ? -4.514  -22.981 -58.834 1.00 35.11 ? 241 LEU B CG   1 
ATOM   8566  C CD1  . LEU B 1 241 ? -4.098  -22.402 -60.172 1.00 41.63 ? 241 LEU B CD1  1 
ATOM   8567  C CD2  . LEU B 1 241 ? -5.986  -22.665 -58.538 1.00 31.28 ? 241 LEU B CD2  1 
ATOM   8568  H H    . LEU B 1 241 ? -2.654  -23.953 -56.935 1.00 33.50 ? 241 LEU B H    1 
ATOM   8569  H HA   . LEU B 1 241 ? -2.988  -26.038 -58.593 1.00 38.27 ? 241 LEU B HA   1 
ATOM   8570  H HB2  . LEU B 1 241 ? -4.604  -24.807 -59.656 1.00 39.84 ? 241 LEU B HB2  1 
ATOM   8571  H HB3  . LEU B 1 241 ? -4.874  -24.814 -58.106 1.00 39.84 ? 241 LEU B HB3  1 
ATOM   8572  H HG   . LEU B 1 241 ? -3.973  -22.565 -58.145 1.00 42.11 ? 241 LEU B HG   1 
ATOM   8573  H HD11 . LEU B 1 241 ? -4.253  -21.445 -60.163 1.00 49.94 ? 241 LEU B HD11 1 
ATOM   8574  H HD12 . LEU B 1 241 ? -3.156  -22.584 -60.315 1.00 49.94 ? 241 LEU B HD12 1 
ATOM   8575  H HD13 . LEU B 1 241 ? -4.626  -22.816 -60.873 1.00 49.94 ? 241 LEU B HD13 1 
ATOM   8576  H HD21 . LEU B 1 241 ? -6.113  -21.704 -58.562 1.00 37.51 ? 241 LEU B HD21 1 
ATOM   8577  H HD22 . LEU B 1 241 ? -6.541  -23.090 -59.210 1.00 37.51 ? 241 LEU B HD22 1 
ATOM   8578  H HD23 . LEU B 1 241 ? -6.211  -23.007 -57.658 1.00 37.51 ? 241 LEU B HD23 1 
ATOM   8579  N N    . PHE B 1 242 ? -1.075  -23.687 -59.449 1.00 33.16 ? 242 PHE B N    1 
ATOM   8580  C CA   . PHE B 1 242 ? -0.185  -23.193 -60.489 1.00 33.24 ? 242 PHE B CA   1 
ATOM   8581  C C    . PHE B 1 242 ? 1.209   -23.793 -60.440 1.00 37.87 ? 242 PHE B C    1 
ATOM   8582  O O    . PHE B 1 242 ? 1.800   -24.042 -61.493 1.00 41.55 ? 242 PHE B O    1 
ATOM   8583  C CB   . PHE B 1 242 ? -0.067  -21.672 -60.408 1.00 39.29 ? 242 PHE B CB   1 
ATOM   8584  C CG   . PHE B 1 242 ? 0.926   -21.089 -61.376 1.00 47.54 ? 242 PHE B CG   1 
ATOM   8585  C CD1  . PHE B 1 242 ? 0.591   -20.922 -62.713 1.00 52.55 ? 242 PHE B CD1  1 
ATOM   8586  C CD2  . PHE B 1 242 ? 2.191   -20.711 -60.955 1.00 39.85 ? 242 PHE B CD2  1 
ATOM   8587  C CE1  . PHE B 1 242 ? 1.504   -20.392 -63.611 1.00 45.33 ? 242 PHE B CE1  1 
ATOM   8588  C CE2  . PHE B 1 242 ? 3.114   -20.179 -61.855 1.00 46.45 ? 242 PHE B CE2  1 
ATOM   8589  C CZ   . PHE B 1 242 ? 2.764   -20.021 -63.181 1.00 45.01 ? 242 PHE B CZ   1 
ATOM   8590  H H    . PHE B 1 242 ? -0.990  -23.281 -58.696 1.00 39.77 ? 242 PHE B H    1 
ATOM   8591  H HA   . PHE B 1 242 ? -0.568  -23.413 -61.353 1.00 39.87 ? 242 PHE B HA   1 
ATOM   8592  H HB2  . PHE B 1 242 ? -0.933  -21.280 -60.599 1.00 47.13 ? 242 PHE B HB2  1 
ATOM   8593  H HB3  . PHE B 1 242 ? 0.213   -21.427 -59.512 1.00 47.13 ? 242 PHE B HB3  1 
ATOM   8594  H HD1  . PHE B 1 242 ? -0.254  -21.172 -63.011 1.00 63.03 ? 242 PHE B HD1  1 
ATOM   8595  H HD2  . PHE B 1 242 ? 2.429   -20.820 -60.063 1.00 47.80 ? 242 PHE B HD2  1 
ATOM   8596  H HE1  . PHE B 1 242 ? 1.269   -20.285 -64.504 1.00 54.37 ? 242 PHE B HE1  1 
ATOM   8597  H HE2  . PHE B 1 242 ? 3.960   -19.928 -61.563 1.00 55.72 ? 242 PHE B HE2  1 
ATOM   8598  H HZ   . PHE B 1 242 ? 3.375   -19.663 -63.784 1.00 53.99 ? 242 PHE B HZ   1 
ATOM   8599  N N    . CYS B 1 243 ? 1.768   -24.020 -59.257 1.00 33.13 ? 243 CYS B N    1 
ATOM   8600  C CA   . CYS B 1 243 ? 3.167   -24.399 -59.171 1.00 37.98 ? 243 CYS B CA   1 
ATOM   8601  C C    . CYS B 1 243 ? 3.370   -25.882 -59.432 1.00 43.85 ? 243 CYS B C    1 
ATOM   8602  O O    . CYS B 1 243 ? 2.607   -26.731 -58.961 1.00 43.55 ? 243 CYS B O    1 
ATOM   8603  C CB   . CYS B 1 243 ? 3.733   -24.055 -57.801 1.00 34.31 ? 243 CYS B CB   1 
ATOM   8604  S SG   . CYS B 1 243 ? 3.785   -22.287 -57.487 1.00 33.64 ? 243 CYS B SG   1 
ATOM   8605  H H    . CYS B 1 243 ? 1.363   -23.962 -58.500 1.00 39.74 ? 243 CYS B H    1 
ATOM   8606  H HA   . CYS B 1 243 ? 3.669   -23.905 -59.838 1.00 45.56 ? 243 CYS B HA   1 
ATOM   8607  H HB2  . CYS B 1 243 ? 3.178   -24.464 -57.119 1.00 41.15 ? 243 CYS B HB2  1 
ATOM   8608  H HB3  . CYS B 1 243 ? 4.639   -24.396 -57.740 1.00 41.15 ? 243 CYS B HB3  1 
ATOM   8609  H HG   . CYS B 1 243 ? 4.241   -22.097 -56.393 1.00 40.34 ? 243 CYS B HG   1 
ATOM   8610  N N    . SER B 1 244 ? 4.409   -26.181 -60.202 1.00 54.83 ? 244 SER B N    1 
ATOM   8611  C CA   . SER B 1 244 ? 4.995   -27.508 -60.192 1.00 58.25 ? 244 SER B CA   1 
ATOM   8612  C C    . SER B 1 244 ? 5.784   -27.696 -58.898 1.00 56.08 ? 244 SER B C    1 
ATOM   8613  O O    . SER B 1 244 ? 6.187   -26.735 -58.238 1.00 58.67 ? 244 SER B O    1 
ATOM   8614  C CB   . SER B 1 244 ? 5.915   -27.695 -61.396 1.00 61.46 ? 244 SER B CB   1 
ATOM   8615  O OG   . SER B 1 244 ? 7.048   -26.847 -61.258 1.00 54.61 ? 244 SER B OG   1 
ATOM   8616  H H    . SER B 1 244 ? 4.793   -25.630 -60.740 1.00 65.78 ? 244 SER B H    1 
ATOM   8617  H HA   . SER B 1 244 ? 4.293   -28.176 -60.229 1.00 69.87 ? 244 SER B HA   1 
ATOM   8618  H HB2  . SER B 1 244 ? 6.209   -28.618 -61.435 1.00 73.73 ? 244 SER B HB2  1 
ATOM   8619  H HB3  . SER B 1 244 ? 5.436   -27.459 -62.206 1.00 73.73 ? 244 SER B HB3  1 
ATOM   8620  H HG   . SER B 1 244 ? 6.803   -26.044 -61.218 1.00 65.51 ? 244 SER B HG   1 
ATOM   8621  N N    . GLY B 1 245 ? 6.023   -28.946 -58.539 1.00 56.95 ? 245 GLY B N    1 
ATOM   8622  C CA   . GLY B 1 245 ? 6.740   -29.225 -57.320 1.00 50.36 ? 245 GLY B CA   1 
ATOM   8623  C C    . GLY B 1 245 ? 5.769   -29.239 -56.164 1.00 49.77 ? 245 GLY B C    1 
ATOM   8624  O O    . GLY B 1 245 ? 4.598   -28.878 -56.310 1.00 50.57 ? 245 GLY B O    1 
ATOM   8625  H H    . GLY B 1 245 ? 5.780   -29.643 -58.981 1.00 68.32 ? 245 GLY B H    1 
ATOM   8626  H HA2  . GLY B 1 245 ? 7.176   -30.089 -57.379 1.00 60.41 ? 245 GLY B HA2  1 
ATOM   8627  H HA3  . GLY B 1 245 ? 7.410   -28.541 -57.163 1.00 60.41 ? 245 GLY B HA3  1 
ATOM   8628  N N    . PRO B 1 246 ? 6.224   -29.672 -54.996 1.00 44.86 ? 246 PRO B N    1 
ATOM   8629  C CA   . PRO B 1 246 ? 5.334   -29.709 -53.834 1.00 42.44 ? 246 PRO B CA   1 
ATOM   8630  C C    . PRO B 1 246 ? 5.074   -28.300 -53.328 1.00 39.05 ? 246 PRO B C    1 
ATOM   8631  O O    . PRO B 1 246 ? 5.965   -27.448 -53.343 1.00 39.87 ? 246 PRO B O    1 
ATOM   8632  C CB   . PRO B 1 246 ? 6.113   -30.546 -52.809 1.00 43.72 ? 246 PRO B CB   1 
ATOM   8633  C CG   . PRO B 1 246 ? 7.490   -30.827 -53.453 1.00 42.24 ? 246 PRO B CG   1 
ATOM   8634  C CD   . PRO B 1 246 ? 7.622   -29.899 -54.618 1.00 49.19 ? 246 PRO B CD   1 
ATOM   8635  H HA   . PRO B 1 246 ? 4.495   -30.146 -54.051 1.00 50.91 ? 246 PRO B HA   1 
ATOM   8636  H HB2  . PRO B 1 246 ? 6.217   -30.039 -51.988 1.00 52.45 ? 246 PRO B HB2  1 
ATOM   8637  H HB3  . PRO B 1 246 ? 5.639   -31.375 -52.640 1.00 52.45 ? 246 PRO B HB3  1 
ATOM   8638  H HG2  . PRO B 1 246 ? 8.190   -30.656 -52.804 1.00 50.67 ? 246 PRO B HG2  1 
ATOM   8639  H HG3  . PRO B 1 246 ? 7.524   -31.750 -53.751 1.00 50.67 ? 246 PRO B HG3  1 
ATOM   8640  H HD2  . PRO B 1 246 ? 8.041   -29.067 -54.346 1.00 59.00 ? 246 PRO B HD2  1 
ATOM   8641  H HD3  . PRO B 1 246 ? 8.107   -30.326 -55.342 1.00 59.00 ? 246 PRO B HD3  1 
ATOM   8642  N N    . VAL B 1 247 ? 3.837   -28.055 -52.896 1.00 37.15 ? 247 VAL B N    1 
ATOM   8643  C CA   . VAL B 1 247 ? 3.411   -26.752 -52.397 1.00 30.91 ? 247 VAL B CA   1 
ATOM   8644  C C    . VAL B 1 247 ? 2.732   -27.001 -51.067 1.00 34.01 ? 247 VAL B C    1 
ATOM   8645  O O    . VAL B 1 247 ? 1.602   -27.506 -51.020 1.00 38.56 ? 247 VAL B O    1 
ATOM   8646  C CB   . VAL B 1 247 ? 2.466   -26.015 -53.359 1.00 30.16 ? 247 VAL B CB   1 
ATOM   8647  C CG1  . VAL B 1 247 ? 1.922   -24.731 -52.707 1.00 28.13 ? 247 VAL B CG1  1 
ATOM   8648  C CG2  . VAL B 1 247 ? 3.177   -25.661 -54.642 1.00 33.75 ? 247 VAL B CG2  1 
ATOM   8649  H H    . VAL B 1 247 ? 3.212   -28.646 -52.882 1.00 44.56 ? 247 VAL B H    1 
ATOM   8650  H HA   . VAL B 1 247 ? 4.190   -26.194 -52.245 1.00 37.08 ? 247 VAL B HA   1 
ATOM   8651  H HB   . VAL B 1 247 ? 1.715   -26.589 -53.575 1.00 36.17 ? 247 VAL B HB   1 
ATOM   8652  H HG11 . VAL B 1 247 ? 1.330   -24.286 -53.333 1.00 33.73 ? 247 VAL B HG11 1 
ATOM   8653  H HG12 . VAL B 1 247 ? 1.436   -24.968 -51.902 1.00 33.73 ? 247 VAL B HG12 1 
ATOM   8654  H HG13 . VAL B 1 247 ? 2.667   -24.150 -52.485 1.00 33.73 ? 247 VAL B HG13 1 
ATOM   8655  H HG21 . VAL B 1 247 ? 2.559   -25.198 -55.229 1.00 40.48 ? 247 VAL B HG21 1 
ATOM   8656  H HG22 . VAL B 1 247 ? 3.931   -25.087 -54.437 1.00 40.48 ? 247 VAL B HG22 1 
ATOM   8657  H HG23 . VAL B 1 247 ? 3.488   -26.476 -55.066 1.00 40.48 ? 247 VAL B HG23 1 
ATOM   8658  N N    . SER B 1 248 ? 3.390   -26.621 -49.994 1.00 28.03 ? 248 SER B N    1 
ATOM   8659  C CA   . SER B 1 248 ? 2.882   -26.854 -48.655 1.00 32.46 ? 248 SER B CA   1 
ATOM   8660  C C    . SER B 1 248 ? 2.576   -25.529 -47.983 1.00 33.17 ? 248 SER B C    1 
ATOM   8661  O O    . SER B 1 248 ? 3.328   -24.563 -48.132 1.00 26.34 ? 248 SER B O    1 
ATOM   8662  C CB   . SER B 1 248 ? 3.894   -27.638 -47.826 1.00 34.54 ? 248 SER B CB   1 
ATOM   8663  O OG   . SER B 1 248 ? 5.162   -27.025 -47.887 1.00 43.77 ? 248 SER B OG   1 
ATOM   8664  H H    . SER B 1 248 ? 4.149   -26.217 -50.012 1.00 33.61 ? 248 SER B H    1 
ATOM   8665  H HA   . SER B 1 248 ? 2.062   -27.370 -48.705 1.00 38.93 ? 248 SER B HA   1 
ATOM   8666  H HB2  . SER B 1 248 ? 3.598   -27.662 -46.903 1.00 41.42 ? 248 SER B HB2  1 
ATOM   8667  H HB3  . SER B 1 248 ? 3.961   -28.540 -48.177 1.00 41.42 ? 248 SER B HB3  1 
ATOM   8668  H HG   . SER B 1 248 ? 5.429   -26.997 -48.683 1.00 52.50 ? 248 SER B HG   1 
ATOM   8669  N N    . SER B 1 249 ? 1.466   -25.488 -47.245 1.00 28.40 ? 249 SER B N    1 
ATOM   8670  C CA   . SER B 1 249 ? 1.104   -24.256 -46.553 1.00 27.00 ? 249 SER B CA   1 
ATOM   8671  C C    . SER B 1 249 ? 2.227   -23.818 -45.618 1.00 30.44 ? 249 SER B C    1 
ATOM   8672  O O    . SER B 1 249 ? 2.423   -22.617 -45.411 1.00 27.68 ? 249 SER B O    1 
ATOM   8673  C CB   . SER B 1 249 ? -0.226  -24.451 -45.818 1.00 29.57 ? 249 SER B CB   1 
ATOM   8674  O OG   . SER B 1 249 ? -0.037  -24.948 -44.510 1.00 36.90 ? 249 SER B OG   1 
ATOM   8675  H H    . SER B 1 249 ? 0.920   -26.142 -47.131 1.00 34.05 ? 249 SER B H    1 
ATOM   8676  H HA   . SER B 1 249 ? 0.978   -23.555 -47.211 1.00 32.38 ? 249 SER B HA   1 
ATOM   8677  H HB2  . SER B 1 249 ? -0.682  -23.597 -45.764 1.00 35.46 ? 249 SER B HB2  1 
ATOM   8678  H HB3  . SER B 1 249 ? -0.768  -25.082 -46.316 1.00 35.46 ? 249 SER B HB3  1 
ATOM   8679  H HG   . SER B 1 249 ? -0.779  -25.046 -44.129 1.00 44.25 ? 249 SER B HG   1 
ATOM   8680  N N    . ALA B 1 250 ? 3.026   -24.769 -45.122 1.00 29.42 ? 250 ALA B N    1 
ATOM   8681  C CA   . ALA B 1 250 ? 4.132   -24.462 -44.208 1.00 24.72 ? 250 ALA B CA   1 
ATOM   8682  C C    . ALA B 1 250 ? 5.173   -23.523 -44.817 1.00 24.47 ? 250 ALA B C    1 
ATOM   8683  O O    . ALA B 1 250 ? 5.801   -22.745 -44.095 1.00 20.53 ? 250 ALA B O    1 
ATOM   8684  C CB   . ALA B 1 250 ? 4.801   -25.765 -43.783 1.00 31.59 ? 250 ALA B CB   1 
ATOM   8685  H H    . ALA B 1 250 ? 2.947   -25.606 -45.303 1.00 35.29 ? 250 ALA B H    1 
ATOM   8686  H HA   . ALA B 1 250 ? 3.774   -24.036 -43.413 1.00 29.64 ? 250 ALA B HA   1 
ATOM   8687  H HB1  . ALA B 1 250 ? 5.532   -25.562 -43.178 1.00 37.88 ? 250 ALA B HB1  1 
ATOM   8688  H HB2  . ALA B 1 250 ? 4.147   -26.324 -43.336 1.00 37.88 ? 250 ALA B HB2  1 
ATOM   8689  H HB3  . ALA B 1 250 ? 5.139   -26.217 -44.572 1.00 37.88 ? 250 ALA B HB3  1 
ATOM   8690  N N    . THR B 1 251 ? 5.413   -23.598 -46.129 1.00 20.51 ? 251 THR B N    1 
ATOM   8691  C CA   . THR B 1 251 ? 6.375   -22.684 -46.734 1.00 20.16 ? 251 THR B CA   1 
ATOM   8692  C C    . THR B 1 251 ? 5.939   -21.229 -46.569 1.00 19.05 ? 251 THR B C    1 
ATOM   8693  O O    . THR B 1 251 ? 6.786   -20.321 -46.550 1.00 19.35 ? 251 THR B O    1 
ATOM   8694  C CB   . THR B 1 251 ? 6.544   -23.036 -48.214 1.00 24.85 ? 251 THR B CB   1 
ATOM   8695  O OG1  . THR B 1 251 ? 6.874   -24.421 -48.315 1.00 27.36 ? 251 THR B OG1  1 
ATOM   8696  C CG2  . THR B 1 251 ? 7.619   -22.185 -48.888 1.00 19.72 ? 251 THR B CG2  1 
ATOM   8697  H H    . THR B 1 251 ? 5.043   -24.152 -46.673 1.00 24.58 ? 251 THR B H    1 
ATOM   8698  H HA   . THR B 1 251 ? 7.234   -22.792 -46.298 1.00 24.16 ? 251 THR B HA   1 
ATOM   8699  H HB   . THR B 1 251 ? 5.705   -22.878 -48.673 1.00 29.80 ? 251 THR B HB   1 
ATOM   8700  H HG1  . THR B 1 251 ? 6.971   -24.635 -49.121 1.00 32.81 ? 251 THR B HG1  1 
ATOM   8701  H HG21 . THR B 1 251 ? 7.701   -22.433 -49.822 1.00 23.65 ? 251 THR B HG21 1 
ATOM   8702  H HG22 . THR B 1 251 ? 7.382   -21.246 -48.831 1.00 23.65 ? 251 THR B HG22 1 
ATOM   8703  H HG23 . THR B 1 251 ? 8.473   -22.321 -48.449 1.00 23.65 ? 251 THR B HG23 1 
ATOM   8704  N N    . PHE B 1 252 ? 4.627   -20.983 -46.491 1.00 16.63 ? 252 PHE B N    1 
ATOM   8705  C CA   . PHE B 1 252 ? 4.109   -19.626 -46.400 1.00 17.76 ? 252 PHE B CA   1 
ATOM   8706  C C    . PHE B 1 252 ? 4.286   -19.009 -45.022 1.00 16.01 ? 252 PHE B C    1 
ATOM   8707  O O    . PHE B 1 252 ? 4.029   -17.809 -44.854 1.00 17.57 ? 252 PHE B O    1 
ATOM   8708  C CB   . PHE B 1 252 ? 2.627   -19.618 -46.800 1.00 15.83 ? 252 PHE B CB   1 
ATOM   8709  C CG   . PHE B 1 252 ? 2.431   -19.925 -48.239 1.00 19.84 ? 252 PHE B CG   1 
ATOM   8710  C CD1  . PHE B 1 252 ? 2.471   -21.235 -48.685 1.00 20.56 ? 252 PHE B CD1  1 
ATOM   8711  C CD2  . PHE B 1 252 ? 2.354   -18.908 -49.168 1.00 20.96 ? 252 PHE B CD2  1 
ATOM   8712  C CE1  . PHE B 1 252 ? 2.355   -21.545 -50.045 1.00 21.66 ? 252 PHE B CE1  1 
ATOM   8713  C CE2  . PHE B 1 252 ? 2.229   -19.201 -50.525 1.00 22.22 ? 252 PHE B CE2  1 
ATOM   8714  C CZ   . PHE B 1 252 ? 2.210   -20.536 -50.962 1.00 22.63 ? 252 PHE B CZ   1 
ATOM   8715  H H    . PHE B 1 252 ? 4.019   -21.591 -46.488 1.00 19.94 ? 252 PHE B H    1 
ATOM   8716  H HA   . PHE B 1 252 ? 4.587   -19.069 -47.033 1.00 21.29 ? 252 PHE B HA   1 
ATOM   8717  H HB2  . PHE B 1 252 ? 2.154   -20.287 -46.282 1.00 18.98 ? 252 PHE B HB2  1 
ATOM   8718  H HB3  . PHE B 1 252 ? 2.256   -18.738 -46.627 1.00 18.98 ? 252 PHE B HB3  1 
ATOM   8719  H HD1  . PHE B 1 252 ? 2.550   -21.925 -48.066 1.00 24.64 ? 252 PHE B HD1  1 
ATOM   8720  H HD2  . PHE B 1 252 ? 2.346   -18.022 -48.884 1.00 25.12 ? 252 PHE B HD2  1 
ATOM   8721  H HE1  . PHE B 1 252 ? 2.347   -22.432 -50.322 1.00 25.97 ? 252 PHE B HE1  1 
ATOM   8722  H HE2  . PHE B 1 252 ? 2.142   -18.510 -51.142 1.00 26.64 ? 252 PHE B HE2  1 
ATOM   8723  H HZ   . PHE B 1 252 ? 2.136   -20.733 -51.868 1.00 27.14 ? 252 PHE B HZ   1 
ATOM   8724  N N    . LEU B 1 253 ? 4.717   -19.800 -44.039 1.00 18.73 ? 253 LEU B N    1 
ATOM   8725  C CA   . LEU B 1 253 ? 5.139   -19.272 -42.748 1.00 14.82 ? 253 LEU B CA   1 
ATOM   8726  C C    . LEU B 1 253 ? 6.554   -18.689 -42.768 1.00 13.36 ? 253 LEU B C    1 
ATOM   8727  O O    . LEU B 1 253 ? 6.958   -18.063 -41.778 1.00 15.27 ? 253 LEU B O    1 
ATOM   8728  C CB   . LEU B 1 253 ? 5.115   -20.366 -41.703 1.00 22.59 ? 253 LEU B CB   1 
ATOM   8729  C CG   . LEU B 1 253 ? 3.745   -21.022 -41.515 1.00 26.65 ? 253 LEU B CG   1 
ATOM   8730  C CD1  . LEU B 1 253 ? 3.965   -22.386 -40.901 1.00 30.30 ? 253 LEU B CD1  1 
ATOM   8731  C CD2  . LEU B 1 253 ? 2.905   -20.137 -40.633 1.00 24.19 ? 253 LEU B CD2  1 
ATOM   8732  H H    . LEU B 1 253 ? 4.774   -20.656 -44.100 1.00 22.45 ? 253 LEU B H    1 
ATOM   8733  H HA   . LEU B 1 253 ? 4.526   -18.573 -42.472 1.00 17.76 ? 253 LEU B HA   1 
ATOM   8734  H HB2  . LEU B 1 253 ? 5.741   -21.060 -41.963 1.00 27.08 ? 253 LEU B HB2  1 
ATOM   8735  H HB3  . LEU B 1 253 ? 5.381   -19.988 -40.850 1.00 27.08 ? 253 LEU B HB3  1 
ATOM   8736  H HG   . LEU B 1 253 ? 3.305   -21.126 -42.373 1.00 31.96 ? 253 LEU B HG   1 
ATOM   8737  H HD11 . LEU B 1 253 ? 3.105   -22.817 -40.775 1.00 36.34 ? 253 LEU B HD11 1 
ATOM   8738  H HD12 . LEU B 1 253 ? 4.516   -22.916 -41.499 1.00 36.34 ? 253 LEU B HD12 1 
ATOM   8739  H HD13 . LEU B 1 253 ? 4.411   -22.280 -40.047 1.00 36.34 ? 253 LEU B HD13 1 
ATOM   8740  H HD21 . LEU B 1 253 ? 2.036   -20.548 -40.510 1.00 29.01 ? 253 LEU B HD21 1 
ATOM   8741  H HD22 . LEU B 1 253 ? 3.348   -20.035 -39.775 1.00 29.01 ? 253 LEU B HD22 1 
ATOM   8742  H HD23 . LEU B 1 253 ? 2.805   -19.271 -41.058 1.00 29.01 ? 253 LEU B HD23 1 
ATOM   8743  N N    . GLU B 1 254 ? 7.290   -18.889 -43.846 1.00 15.20 ? 254 GLU B N    1 
ATOM   8744  C CA   . GLU B 1 254 ? 8.651   -18.388 -43.966 1.00 13.35 ? 254 GLU B CA   1 
ATOM   8745  C C    . GLU B 1 254 ? 8.634   -16.893 -44.311 1.00 16.24 ? 254 GLU B C    1 
ATOM   8746  O O    . GLU B 1 254 ? 7.582   -16.290 -44.566 1.00 14.87 ? 254 GLU B O    1 
ATOM   8747  C CB   . GLU B 1 254 ? 9.419   -19.199 -45.007 1.00 15.44 ? 254 GLU B CB   1 
ATOM   8748  C CG   . GLU B 1 254 ? 9.571   -20.667 -44.703 1.00 18.20 ? 254 GLU B CG   1 
ATOM   8749  C CD   . GLU B 1 254 ? 10.348  -20.991 -43.438 1.00 20.95 ? 254 GLU B CD   1 
ATOM   8750  O OE1  . GLU B 1 254 ? 11.141  -20.149 -42.949 1.00 17.58 ? 254 GLU B OE1  1 
ATOM   8751  O OE2  . GLU B 1 254 ? 10.160  -22.123 -42.925 1.00 21.18 ? 254 GLU B OE2  1 
ATOM   8752  H H    . GLU B 1 254 ? 7.020   -19.321 -44.538 1.00 18.21 ? 254 GLU B H    1 
ATOM   8753  H HA   . GLU B 1 254 ? 9.102   -18.493 -43.113 1.00 16.00 ? 254 GLU B HA   1 
ATOM   8754  H HB2  . GLU B 1 254 ? 8.956   -19.125 -45.856 1.00 18.50 ? 254 GLU B HB2  1 
ATOM   8755  H HB3  . GLU B 1 254 ? 10.310  -18.826 -45.091 1.00 18.50 ? 254 GLU B HB3  1 
ATOM   8756  H HG2  . GLU B 1 254 ? 8.687   -21.055 -44.610 1.00 21.82 ? 254 GLU B HG2  1 
ATOM   8757  H HG3  . GLU B 1 254 ? 10.034  -21.088 -45.445 1.00 21.82 ? 254 GLU B HG3  1 
ATOM   8758  N N    . SER B 1 255 ? 9.822   -16.279 -44.285 1.00 12.04 ? 255 SER B N    1 
ATOM   8759  C CA   . SER B 1 255 ? 9.921   -14.834 -44.495 1.00 14.02 ? 255 SER B CA   1 
ATOM   8760  C C    . SER B 1 255 ? 9.339   -14.424 -45.842 1.00 14.44 ? 255 SER B C    1 
ATOM   8761  O O    . SER B 1 255 ? 8.692   -13.375 -45.952 1.00 13.37 ? 255 SER B O    1 
ATOM   8762  C CB   . SER B 1 255 ? 11.380  -14.381 -44.402 1.00 14.18 ? 255 SER B CB   1 
ATOM   8763  O OG   . SER B 1 255 ? 11.499  -12.974 -44.496 1.00 13.28 ? 255 SER B OG   1 
ATOM   8764  H H    . SER B 1 255 ? 10.575  -16.672 -44.150 1.00 14.42 ? 255 SER B H    1 
ATOM   8765  H HA   . SER B 1 255 ? 9.420   -14.379 -43.800 1.00 16.80 ? 255 SER B HA   1 
ATOM   8766  H HB2  . SER B 1 255 ? 11.744  -14.670 -43.551 1.00 17.00 ? 255 SER B HB2  1 
ATOM   8767  H HB3  . SER B 1 255 ? 11.880  -14.787 -45.128 1.00 17.00 ? 255 SER B HB3  1 
ATOM   8768  H HG   . SER B 1 255 ? 11.072  -12.607 -43.872 1.00 15.92 ? 255 SER B HG   1 
ATOM   8769  N N    . CYS B 1 256 ? 9.570   -15.236 -46.874 1.00 14.27 ? 256 CYS B N    1 
ATOM   8770  C CA   . CYS B 1 256 ? 9.021   -14.986 -48.197 1.00 12.73 ? 256 CYS B CA   1 
ATOM   8771  C C    . CYS B 1 256 ? 7.509   -14.892 -48.185 1.00 14.53 ? 256 CYS B C    1 
ATOM   8772  O O    . CYS B 1 256 ? 6.945   -14.301 -49.108 1.00 15.01 ? 256 CYS B O    1 
ATOM   8773  C CB   . CYS B 1 256 ? 9.465   -16.095 -49.166 1.00 17.09 ? 256 CYS B CB   1 
ATOM   8774  S SG   . CYS B 1 256 ? 8.908   -17.759 -48.658 1.00 17.76 ? 256 CYS B SG   1 
ATOM   8775  H H    . CYS B 1 256 ? 10.050  -15.948 -46.828 1.00 17.10 ? 256 CYS B H    1 
ATOM   8776  H HA   . CYS B 1 256 ? 9.369   -14.143 -48.527 1.00 15.25 ? 256 CYS B HA   1 
ATOM   8777  H HB2  . CYS B 1 256 ? 9.097   -15.912 -50.044 1.00 20.49 ? 256 CYS B HB2  1 
ATOM   8778  H HB3  . CYS B 1 256 ? 10.434  -16.105 -49.209 1.00 20.49 ? 256 CYS B HB3  1 
ATOM   8779  H HG   . CYS B 1 256 ? 7.709   -17.772 -48.610 1.00 21.28 ? 256 CYS B HG   1 
ATOM   8780  N N    . GLY B 1 257 ? 6.842   -15.489 -47.194 1.00 15.51 ? 257 GLY B N    1 
ATOM   8781  C CA   . GLY B 1 257 ? 5.391   -15.527 -47.180 1.00 14.26 ? 257 GLY B CA   1 
ATOM   8782  C C    . GLY B 1 257 ? 4.809   -14.516 -46.229 1.00 13.78 ? 257 GLY B C    1 
ATOM   8783  O O    . GLY B 1 257 ? 4.681   -13.332 -46.541 1.00 15.02 ? 257 GLY B O    1 
ATOM   8784  H H    . GLY B 1 257 ? 7.213   -15.877 -46.521 1.00 18.59 ? 257 GLY B H    1 
ATOM   8785  H HA2  . GLY B 1 257 ? 5.053   -15.343 -48.071 1.00 17.09 ? 257 GLY B HA2  1 
ATOM   8786  H HA3  . GLY B 1 257 ? 5.092   -16.411 -46.913 1.00 17.09 ? 257 GLY B HA3  1 
ATOM   8787  N N    . VAL B 1 258 ? 4.495   -14.968 -45.022 1.00 14.28 ? 258 VAL B N    1 
ATOM   8788  C CA   . VAL B 1 258 ? 3.788   -14.113 -44.084 1.00 19.32 ? 258 VAL B CA   1 
ATOM   8789  C C    . VAL B 1 258 ? 4.573   -12.831 -43.757 1.00 16.00 ? 258 VAL B C    1 
ATOM   8790  O O    . VAL B 1 258 ? 3.981   -11.748 -43.653 1.00 15.86 ? 258 VAL B O    1 
ATOM   8791  C CB   . VAL B 1 258 ? 3.413   -14.929 -42.832 1.00 23.94 ? 258 VAL B CB   1 
ATOM   8792  C CG1  . VAL B 1 258 ? 4.614   -15.356 -42.163 1.00 18.56 ? 258 VAL B CG1  1 
ATOM   8793  C CG2  . VAL B 1 258 ? 2.529   -14.125 -41.910 1.00 28.83 ? 258 VAL B CG2  1 
ATOM   8794  H H    . VAL B 1 258 ? 4.679   -15.754 -44.726 1.00 17.11 ? 258 VAL B H    1 
ATOM   8795  H HA   . VAL B 1 258 ? 2.956   -13.836 -44.500 1.00 23.16 ? 258 VAL B HA   1 
ATOM   8796  H HB   . VAL B 1 258 ? 2.923   -15.720 -43.105 1.00 28.70 ? 258 VAL B HB   1 
ATOM   8797  H HG11 . VAL B 1 258 ? 4.370   -15.868 -41.376 1.00 22.25 ? 258 VAL B HG11 1 
ATOM   8798  H HG12 . VAL B 1 258 ? 5.134   -15.906 -42.769 1.00 22.25 ? 258 VAL B HG12 1 
ATOM   8799  H HG13 . VAL B 1 258 ? 5.125   -14.573 -41.903 1.00 22.25 ? 258 VAL B HG13 1 
ATOM   8800  H HG21 . VAL B 1 258 ? 2.310   -14.663 -41.134 1.00 34.57 ? 258 VAL B HG21 1 
ATOM   8801  H HG22 . VAL B 1 258 ? 3.004   -13.325 -41.636 1.00 34.57 ? 258 VAL B HG22 1 
ATOM   8802  H HG23 . VAL B 1 258 ? 1.718   -13.882 -42.384 1.00 34.57 ? 258 VAL B HG23 1 
ATOM   8803  N N    . ALA B 1 259 ? 5.900   -12.897 -43.604 1.00 15.67 ? 259 ALA B N    1 
ATOM   8804  C CA   . ALA B 1 259 ? 6.598   -11.682 -43.166 1.00 15.53 ? 259 ALA B CA   1 
ATOM   8805  C C    . ALA B 1 259 ? 6.622   -10.631 -44.264 1.00 13.73 ? 259 ALA B C    1 
ATOM   8806  O O    . ALA B 1 259 ? 6.349   -9.453  -44.008 1.00 15.74 ? 259 ALA B O    1 
ATOM   8807  C CB   . ALA B 1 259 ? 8.039   -11.966 -42.703 1.00 16.41 ? 259 ALA B CB   1 
ATOM   8808  H H    . ALA B 1 259 ? 6.394   -13.588 -43.738 1.00 18.78 ? 259 ALA B H    1 
ATOM   8809  H HA   . ALA B 1 259 ? 6.117   -11.306 -42.412 1.00 18.62 ? 259 ALA B HA   1 
ATOM   8810  H HB1  . ALA B 1 259 ? 8.451   -11.133 -42.427 1.00 19.67 ? 259 ALA B HB1  1 
ATOM   8811  H HB2  . ALA B 1 259 ? 8.014   -12.587 -41.959 1.00 19.67 ? 259 ALA B HB2  1 
ATOM   8812  H HB3  . ALA B 1 259 ? 8.536   -12.352 -43.441 1.00 19.67 ? 259 ALA B HB3  1 
ATOM   8813  N N    . ASP B 1 260 ? 6.952   -11.032 -45.481 1.00 13.11 ? 260 ASP B N    1 
ATOM   8814  C CA   . ASP B 1 260 ? 7.009   -10.089 -46.596 1.00 11.75 ? 260 ASP B CA   1 
ATOM   8815  C C    . ASP B 1 260 ? 5.611   -9.564  -46.886 1.00 13.87 ? 260 ASP B C    1 
ATOM   8816  O O    . ASP B 1 260 ? 5.438   -8.395  -47.236 1.00 12.23 ? 260 ASP B O    1 
ATOM   8817  C CB   . ASP B 1 260 ? 7.597   -10.786 -47.808 1.00 14.50 ? 260 ASP B CB   1 
ATOM   8818  C CG   . ASP B 1 260 ? 8.252   -9.817  -48.809 1.00 19.33 ? 260 ASP B CG   1 
ATOM   8819  O OD1  . ASP B 1 260 ? 8.363   -8.606  -48.508 1.00 18.19 ? 260 ASP B OD1  1 
ATOM   8820  O OD2  . ASP B 1 260 ? 8.666   -10.294 -49.900 1.00 20.27 ? 260 ASP B OD2  1 
ATOM   8821  H H    . ASP B 1 260 ? 7.148   -11.842 -45.693 1.00 15.71 ? 260 ASP B H    1 
ATOM   8822  H HA   . ASP B 1 260 ? 7.579   -9.340  -46.361 1.00 14.07 ? 260 ASP B HA   1 
ATOM   8823  H HB2  . ASP B 1 260 ? 8.276   -11.413 -47.512 1.00 17.38 ? 260 ASP B HB2  1 
ATOM   8824  H HB3  . ASP B 1 260 ? 6.890   -11.261 -48.272 1.00 17.38 ? 260 ASP B HB3  1 
ATOM   8825  N N    . LEU B 1 261 ? 4.603   -10.417 -46.700 1.00 16.34 ? 261 LEU B N    1 
ATOM   8826  C CA   . LEU B 1 261 ? 3.231   -9.974  -46.887 1.00 15.08 ? 261 LEU B CA   1 
ATOM   8827  C C    . LEU B 1 261 ? 2.874   -8.891  -45.884 1.00 14.70 ? 261 LEU B C    1 
ATOM   8828  O O    . LEU B 1 261 ? 2.310   -7.852  -46.245 1.00 20.29 ? 261 LEU B O    1 
ATOM   8829  C CB   . LEU B 1 261 ? 2.293   -11.183 -46.781 1.00 17.93 ? 261 LEU B CB   1 
ATOM   8830  C CG   . LEU B 1 261 ? 0.814   -10.897 -46.997 1.00 20.47 ? 261 LEU B CG   1 
ATOM   8831  C CD1  . LEU B 1 261 ? 0.554   -10.401 -48.409 1.00 18.51 ? 261 LEU B CD1  1 
ATOM   8832  C CD2  . LEU B 1 261 ? -0.020  -12.174 -46.686 1.00 18.24 ? 261 LEU B CD2  1 
ATOM   8833  H H    . LEU B 1 261 ? 4.689   -11.241 -46.470 1.00 19.58 ? 261 LEU B H    1 
ATOM   8834  H HA   . LEU B 1 261 ? 3.138   -9.599  -47.777 1.00 18.07 ? 261 LEU B HA   1 
ATOM   8835  H HB2  . LEU B 1 261 ? 2.562   -11.836 -47.446 1.00 21.50 ? 261 LEU B HB2  1 
ATOM   8836  H HB3  . LEU B 1 261 ? 2.388   -11.567 -45.896 1.00 21.50 ? 261 LEU B HB3  1 
ATOM   8837  H HG   . LEU B 1 261 ? 0.536   -10.202 -46.380 1.00 24.54 ? 261 LEU B HG   1 
ATOM   8838  H HD11 . LEU B 1 261 ? -0.395  -10.228 -48.513 1.00 22.19 ? 261 LEU B HD11 1 
ATOM   8839  H HD12 . LEU B 1 261 ? 1.057   -9.584  -48.554 1.00 22.19 ? 261 LEU B HD12 1 
ATOM   8840  H HD13 . LEU B 1 261 ? 0.838   -11.081 -49.040 1.00 22.19 ? 261 LEU B HD13 1 
ATOM   8841  H HD21 . LEU B 1 261 ? -0.959  -11.980 -46.827 1.00 21.87 ? 261 LEU B HD21 1 
ATOM   8842  H HD22 . LEU B 1 261 ? 0.263   -12.888 -47.280 1.00 21.87 ? 261 LEU B HD22 1 
ATOM   8843  H HD23 . LEU B 1 261 ? 0.131   -12.432 -45.763 1.00 21.87 ? 261 LEU B HD23 1 
ATOM   8844  N N    . ILE B 1 262 ? 3.230   -9.094  -44.607 1.00 14.46 ? 262 ILE B N    1 
ATOM   8845  C CA   . ILE B 1 262 ? 2.940   -8.094  -43.584 1.00 16.40 ? 262 ILE B CA   1 
ATOM   8846  C C    . ILE B 1 262 ? 3.621   -6.776  -43.913 1.00 18.80 ? 262 ILE B C    1 
ATOM   8847  O O    . ILE B 1 262 ? 2.990   -5.717  -43.895 1.00 18.22 ? 262 ILE B O    1 
ATOM   8848  C CB   . ILE B 1 262 ? 3.372   -8.595  -42.191 1.00 22.39 ? 262 ILE B CB   1 
ATOM   8849  C CG1  . ILE B 1 262 ? 2.417   -9.691  -41.703 1.00 19.96 ? 262 ILE B CG1  1 
ATOM   8850  C CG2  . ILE B 1 262 ? 3.407   -7.424  -41.171 1.00 24.76 ? 262 ILE B CG2  1 
ATOM   8851  C CD1  . ILE B 1 262 ? 2.948   -10.478 -40.543 1.00 22.85 ? 262 ILE B CD1  1 
ATOM   8852  H H    . ILE B 1 262 ? 3.636   -9.794  -44.317 1.00 17.33 ? 262 ILE B H    1 
ATOM   8853  H HA   . ILE B 1 262 ? 1.983   -7.937  -43.560 1.00 19.66 ? 262 ILE B HA   1 
ATOM   8854  H HB   . ILE B 1 262 ? 4.264   -8.970  -42.261 1.00 26.84 ? 262 ILE B HB   1 
ATOM   8855  H HG12 . ILE B 1 262 ? 1.584   -9.279  -41.426 1.00 23.93 ? 262 ILE B HG12 1 
ATOM   8856  H HG13 . ILE B 1 262 ? 2.252   -10.310 -42.431 1.00 23.93 ? 262 ILE B HG13 1 
ATOM   8857  H HG21 . ILE B 1 262 ? 3.681   -7.768  -40.307 1.00 29.69 ? 262 ILE B HG21 1 
ATOM   8858  H HG22 . ILE B 1 262 ? 4.040   -6.757  -41.479 1.00 29.69 ? 262 ILE B HG22 1 
ATOM   8859  H HG23 . ILE B 1 262 ? 2.520   -7.036  -41.107 1.00 29.69 ? 262 ILE B HG23 1 
ATOM   8860  H HD11 . ILE B 1 262 ? 2.294   -11.148 -40.291 1.00 27.39 ? 262 ILE B HD11 1 
ATOM   8861  H HD12 . ILE B 1 262 ? 3.777   -10.907 -40.806 1.00 27.39 ? 262 ILE B HD12 1 
ATOM   8862  H HD13 . ILE B 1 262 ? 3.108   -9.875  -39.800 1.00 27.39 ? 262 ILE B HD13 1 
ATOM   8863  N N    . THR B 1 263 ? 4.934   -6.810  -44.144 1.00 16.31 ? 263 THR B N    1 
ATOM   8864  C CA   . THR B 1 263 ? 5.658   -5.557  -44.346 1.00 18.68 ? 263 THR B CA   1 
ATOM   8865  C C    . THR B 1 263 ? 5.184   -4.842  -45.604 1.00 19.70 ? 263 THR B C    1 
ATOM   8866  O O    . THR B 1 263 ? 5.071   -3.613  -45.621 1.00 21.55 ? 263 THR B O    1 
ATOM   8867  C CB   . THR B 1 263 ? 7.167   -5.826  -44.391 1.00 20.11 ? 263 THR B CB   1 
ATOM   8868  O OG1  . THR B 1 263 ? 7.869   -4.594  -44.257 1.00 25.73 ? 263 THR B OG1  1 
ATOM   8869  C CG2  . THR B 1 263 ? 7.579   -6.512  -45.680 1.00 21.50 ? 263 THR B CG2  1 
ATOM   8870  H H    . THR B 1 263 ? 5.415   -7.522  -44.188 1.00 19.55 ? 263 THR B H    1 
ATOM   8871  H HA   . THR B 1 263 ? 5.485   -4.973  -43.591 1.00 22.39 ? 263 THR B HA   1 
ATOM   8872  H HB   . THR B 1 263 ? 7.407   -6.407  -43.653 1.00 24.11 ? 263 THR B HB   1 
ATOM   8873  H HG1  . THR B 1 263 ? 8.697   -4.731  -44.281 1.00 30.86 ? 263 THR B HG1  1 
ATOM   8874  H HG21 . THR B 1 263 ? 8.537   -6.669  -45.681 1.00 25.78 ? 263 THR B HG21 1 
ATOM   8875  H HG22 . THR B 1 263 ? 7.121   -7.363  -45.764 1.00 25.78 ? 263 THR B HG22 1 
ATOM   8876  H HG23 . THR B 1 263 ? 7.351   -5.955  -46.440 1.00 25.78 ? 263 THR B HG23 1 
ATOM   8877  N N    . THR B 1 264 ? 4.841   -5.594  -46.645 1.00 16.11 ? 264 THR B N    1 
ATOM   8878  C CA   . THR B 1 264 ? 4.357   -4.970  -47.873 1.00 17.26 ? 264 THR B CA   1 
ATOM   8879  C C    . THR B 1 264 ? 2.973   -4.377  -47.665 1.00 18.12 ? 264 THR B C    1 
ATOM   8880  O O    . THR B 1 264 ? 2.683   -3.283  -48.164 1.00 23.11 ? 264 THR B O    1 
ATOM   8881  C CB   . THR B 1 264 ? 4.361   -5.999  -49.007 1.00 19.78 ? 264 THR B CB   1 
ATOM   8882  O OG1  . THR B 1 264 ? 5.687   -6.545  -49.157 1.00 18.04 ? 264 THR B OG1  1 
ATOM   8883  C CG2  . THR B 1 264 ? 3.905   -5.390  -50.307 1.00 20.82 ? 264 THR B CG2  1 
ATOM   8884  H H    . THR B 1 264 ? 4.878   -6.453  -46.667 1.00 19.31 ? 264 THR B H    1 
ATOM   8885  H HA   . THR B 1 264 ? 4.957   -4.249  -48.119 1.00 20.69 ? 264 THR B HA   1 
ATOM   8886  H HB   . THR B 1 264 ? 3.748   -6.717  -48.782 1.00 23.71 ? 264 THR B HB   1 
ATOM   8887  H HG1  . THR B 1 264 ? 5.926   -6.919  -48.444 1.00 21.63 ? 264 THR B HG1  1 
ATOM   8888  H HG21 . THR B 1 264 ? 3.916   -6.059  -51.009 1.00 24.96 ? 264 THR B HG21 1 
ATOM   8889  H HG22 . THR B 1 264 ? 3.003   -5.046  -50.214 1.00 24.96 ? 264 THR B HG22 1 
ATOM   8890  H HG23 . THR B 1 264 ? 4.496   -4.662  -50.557 1.00 24.96 ? 264 THR B HG23 1 
ATOM   8891  N N    . CYS B 1 265 ? 2.112   -5.053  -46.902 1.00 19.50 ? 265 CYS B N    1 
ATOM   8892  C CA   . CYS B 1 265 ? 0.774   -4.517  -46.666 1.00 19.42 ? 265 CYS B CA   1 
ATOM   8893  C C    . CYS B 1 265 ? 0.759   -3.367  -45.663 1.00 18.48 ? 265 CYS B C    1 
ATOM   8894  O O    . CYS B 1 265 ? -0.260  -2.690  -45.543 1.00 19.25 ? 265 CYS B O    1 
ATOM   8895  C CB   . CYS B 1 265 ? -0.169  -5.618  -46.173 1.00 19.13 ? 265 CYS B CB   1 
ATOM   8896  S SG   . CYS B 1 265 ? -0.522  -6.818  -47.438 1.00 17.40 ? 265 CYS B SG   1 
ATOM   8897  H H    . CYS B 1 265 ? 2.274   -5.806  -46.519 1.00 23.38 ? 265 CYS B H    1 
ATOM   8898  H HA   . CYS B 1 265 ? 0.422   -4.181  -47.505 1.00 23.28 ? 265 CYS B HA   1 
ATOM   8899  H HB2  . CYS B 1 265 ? 0.245   -6.079  -45.426 1.00 22.94 ? 265 CYS B HB2  1 
ATOM   8900  H HB3  . CYS B 1 265 ? -1.007  -5.217  -45.895 1.00 22.94 ? 265 CYS B HB3  1 
ATOM   8901  H HG   . CYS B 1 265 ? 0.506   -7.330  -47.789 1.00 20.86 ? 265 CYS B HG   1 
ATOM   8902  N N    . TYR B 1 266 ? 1.819   -3.178  -44.888 1.00 17.56 ? 266 TYR B N    1 
ATOM   8903  C CA   . TYR B 1 266 ? 1.885   -2.051  -43.972 1.00 17.29 ? 266 TYR B CA   1 
ATOM   8904  C C    . TYR B 1 266 ? 2.790   -0.929  -44.476 1.00 26.52 ? 266 TYR B C    1 
ATOM   8905  O O    . TYR B 1 266 ? 2.710   0.190   -43.965 1.00 27.87 ? 266 TYR B O    1 
ATOM   8906  C CB   . TYR B 1 266 ? 2.330   -2.518  -42.589 1.00 22.13 ? 266 TYR B CB   1 
ATOM   8907  C CG   . TYR B 1 266 ? 1.162   -3.016  -41.766 1.00 23.43 ? 266 TYR B CG   1 
ATOM   8908  C CD1  . TYR B 1 266 ? 0.745   -4.340  -41.830 1.00 21.40 ? 266 TYR B CD1  1 
ATOM   8909  C CD2  . TYR B 1 266 ? 0.457   -2.146  -40.952 1.00 28.35 ? 266 TYR B CD2  1 
ATOM   8910  C CE1  . TYR B 1 266 ? -0.353  -4.782  -41.083 1.00 28.49 ? 266 TYR B CE1  1 
ATOM   8911  C CE2  . TYR B 1 266 ? -0.620  -2.570  -40.208 1.00 27.62 ? 266 TYR B CE2  1 
ATOM   8912  C CZ   . TYR B 1 266 ? -1.025  -3.876  -40.277 1.00 29.92 ? 266 TYR B CZ   1 
ATOM   8913  O OH   . TYR B 1 266 ? -2.094  -4.227  -39.506 1.00 31.41 ? 266 TYR B OH   1 
ATOM   8914  H H    . TYR B 1 266 ? 2.511   -3.688  -44.874 1.00 21.05 ? 266 TYR B H    1 
ATOM   8915  H HA   . TYR B 1 266 ? 0.993   -1.682  -43.879 1.00 20.72 ? 266 TYR B HA   1 
ATOM   8916  H HB2  . TYR B 1 266 ? 2.965   -3.246  -42.686 1.00 26.53 ? 266 TYR B HB2  1 
ATOM   8917  H HB3  . TYR B 1 266 ? 2.740   -1.776  -42.117 1.00 26.53 ? 266 TYR B HB3  1 
ATOM   8918  H HD1  . TYR B 1 266 ? 1.199   -4.939  -42.378 1.00 25.66 ? 266 TYR B HD1  1 
ATOM   8919  H HD2  . TYR B 1 266 ? 0.721   -1.256  -40.903 1.00 34.00 ? 266 TYR B HD2  1 
ATOM   8920  H HE1  . TYR B 1 266 ? -0.625  -5.670  -41.123 1.00 34.16 ? 266 TYR B HE1  1 
ATOM   8921  H HE2  . TYR B 1 266 ? -1.076  -1.969  -39.664 1.00 33.12 ? 266 TYR B HE2  1 
ATOM   8922  H HH   . TYR B 1 266 ? -2.376  -3.557  -39.085 1.00 37.67 ? 266 TYR B HH   1 
ATOM   8923  N N    . GLY B 1 267 ? 3.597   -1.175  -45.492 1.00 26.18 ? 267 GLY B N    1 
ATOM   8924  C CA   . GLY B 1 267 ? 4.425   -0.129  -46.063 1.00 25.73 ? 267 GLY B CA   1 
ATOM   8925  C C    . GLY B 1 267 ? 5.002   -0.554  -47.398 1.00 32.63 ? 267 GLY B C    1 
ATOM   8926  O O    . GLY B 1 267 ? 5.779   -1.511  -47.483 1.00 41.71 ? 267 GLY B O    1 
ATOM   8927  H H    . GLY B 1 267 ? 3.684   -1.942  -45.872 1.00 31.39 ? 267 GLY B H    1 
ATOM   8928  H HA2  . GLY B 1 267 ? 3.896   0.673   -46.195 1.00 30.86 ? 267 GLY B HA2  1 
ATOM   8929  H HA3  . GLY B 1 267 ? 5.156   0.076   -45.460 1.00 30.86 ? 267 GLY B HA3  1 
ATOM   8930  N N    . GLY B 1 268 ? 4.633   0.145   -48.447 1.00 32.43 ? 268 GLY B N    1 
ATOM   8931  C CA   . GLY B 1 268 ? 5.103   -0.178  -49.773 1.00 27.69 ? 268 GLY B CA   1 
ATOM   8932  C C    . GLY B 1 268 ? 4.264   0.533   -50.796 1.00 30.76 ? 268 GLY B C    1 
ATOM   8933  O O    . GLY B 1 268 ? 3.157   1.003   -50.529 1.00 31.20 ? 268 GLY B O    1 
ATOM   8934  H H    . GLY B 1 268 ? 4.102   0.821   -48.418 1.00 38.90 ? 268 GLY B H    1 
ATOM   8935  H HA2  . GLY B 1 268 ? 6.027   0.100   -49.874 1.00 33.20 ? 268 GLY B HA2  1 
ATOM   8936  H HA3  . GLY B 1 268 ? 5.042   -1.134  -49.923 1.00 33.20 ? 268 GLY B HA3  1 
ATOM   8937  N N    . ARG B 1 269 ? 4.801   0.617   -52.004 1.00 30.99 ? 269 ARG B N    1 
ATOM   8938  C CA   . ARG B 1 269 ? 4.138   1.462   -52.977 1.00 31.61 ? 269 ARG B CA   1 
ATOM   8939  C C    . ARG B 1 269 ? 2.841   0.848   -53.458 1.00 28.43 ? 269 ARG B C    1 
ATOM   8940  O O    . ARG B 1 269 ? 1.917   1.588   -53.790 1.00 26.84 ? 269 ARG B O    1 
ATOM   8941  C CB   . ARG B 1 269 ? 5.035   1.753   -54.162 1.00 41.86 ? 269 ARG B CB   1 
ATOM   8942  C CG   . ARG B 1 269 ? 5.591   0.544   -54.800 1.00 33.91 ? 269 ARG B CG   1 
ATOM   8943  C CD   . ARG B 1 269 ? 7.120   0.628   -54.783 1.00 55.47 ? 269 ARG B CD   1 
ATOM   8944  N NE   . ARG B 1 269 ? 7.636   1.247   -55.997 1.00 49.97 ? 269 ARG B NE   1 
ATOM   8945  C CZ   . ARG B 1 269 ? 7.490   0.707   -57.195 1.00 48.54 ? 269 ARG B CZ   1 
ATOM   8946  N NH1  . ARG B 1 269 ? 7.991   1.305   -58.264 1.00 53.28 ? 269 ARG B NH1  1 
ATOM   8947  N NH2  . ARG B 1 269 ? 6.823   -0.432  -57.321 1.00 49.73 ? 269 ARG B NH2  1 
ATOM   8948  H H    . ARG B 1 269 ? 5.513   0.216   -52.274 1.00 37.16 ? 269 ARG B H    1 
ATOM   8949  H HA   . ARG B 1 269 ? 3.923   2.309   -52.556 1.00 37.91 ? 269 ARG B HA   1 
ATOM   8950  H HB2  . ARG B 1 269 ? 4.523   2.233   -54.831 1.00 50.21 ? 269 ARG B HB2  1 
ATOM   8951  H HB3  . ARG B 1 269 ? 5.779   2.300   -53.863 1.00 50.21 ? 269 ARG B HB3  1 
ATOM   8952  H HG2  . ARG B 1 269 ? 5.317   -0.244  -54.305 1.00 40.67 ? 269 ARG B HG2  1 
ATOM   8953  H HG3  . ARG B 1 269 ? 5.292   0.493   -55.721 1.00 40.67 ? 269 ARG B HG3  1 
ATOM   8954  H HD2  . ARG B 1 269 ? 7.403   1.163   -54.025 1.00 66.54 ? 269 ARG B HD2  1 
ATOM   8955  H HD3  . ARG B 1 269 ? 7.489   -0.267  -54.718 1.00 66.54 ? 269 ARG B HD3  1 
ATOM   8956  H HE   . ARG B 1 269 ? 8.202   1.889   -55.911 1.00 59.94 ? 269 ARG B HE   1 
ATOM   8957  H HH11 . ARG B 1 269 ? 8.418   2.047   -58.181 1.00 63.91 ? 269 ARG B HH11 1 
ATOM   8958  H HH12 . ARG B 1 269 ? 7.885   0.954   -59.042 1.00 63.91 ? 269 ARG B HH12 1 
ATOM   8959  H HH21 . ARG B 1 269 ? 6.501   -0.821  -56.625 1.00 59.65 ? 269 ARG B HH21 1 
ATOM   8960  H HH22 . ARG B 1 269 ? 6.721   -0.787  -58.098 1.00 59.65 ? 269 ARG B HH22 1 
ATOM   8961  N N    . ASN B 1 270 ? 2.742   -0.481  -53.534 1.00 28.17 ? 270 ASN B N    1 
ATOM   8962  C CA   . ASN B 1 270 ? 1.452   -1.059  -53.889 1.00 27.34 ? 270 ASN B CA   1 
ATOM   8963  C C    . ASN B 1 270 ? 0.370   -0.621  -52.884 1.00 29.79 ? 270 ASN B C    1 
ATOM   8964  O O    . ASN B 1 270 ? -0.711  -0.168  -53.284 1.00 26.93 ? 270 ASN B O    1 
ATOM   8965  C CB   . ASN B 1 270 ? 1.566   -2.590  -54.008 1.00 27.41 ? 270 ASN B CB   1 
ATOM   8966  C CG   . ASN B 1 270 ? 2.192   -3.047  -55.358 1.00 29.04 ? 270 ASN B CG   1 
ATOM   8967  O OD1  . ASN B 1 270 ? 1.483   -3.289  -56.341 1.00 28.40 ? 270 ASN B OD1  1 
ATOM   8968  N ND2  . ASN B 1 270 ? 3.514   -3.180  -55.385 1.00 30.58 ? 270 ASN B ND2  1 
ATOM   8969  H H    . ASN B 1 270 ? 3.377   -1.044  -53.393 1.00 33.78 ? 270 ASN B H    1 
ATOM   8970  H HA   . ASN B 1 270 ? 1.193   -0.720  -54.760 1.00 32.78 ? 270 ASN B HA   1 
ATOM   8971  H HB2  . ASN B 1 270 ? 2.128   -2.921  -53.290 1.00 32.87 ? 270 ASN B HB2  1 
ATOM   8972  H HB3  . ASN B 1 270 ? 0.680   -2.979  -53.942 1.00 32.87 ? 270 ASN B HB3  1 
ATOM   8973  H HD21 . ASN B 1 270 ? 3.906   -3.432  -56.107 1.00 36.68 ? 270 ASN B HD21 1 
ATOM   8974  H HD22 . ASN B 1 270 ? 3.978   -3.007  -54.682 1.00 36.68 ? 270 ASN B HD22 1 
ATOM   8975  N N    . ARG B 1 271 ? 0.652   -0.708  -51.568 1.00 22.87 ? 271 ARG B N    1 
ATOM   8976  C CA   . ARG B 1 271 ? -0.326  -0.242  -50.584 1.00 25.28 ? 271 ARG B CA   1 
ATOM   8977  C C    . ARG B 1 271 ? -0.551  1.264   -50.699 1.00 27.87 ? 271 ARG B C    1 
ATOM   8978  O O    . ARG B 1 271 ? -1.695  1.736   -50.591 1.00 23.03 ? 271 ARG B O    1 
ATOM   8979  C CB   . ARG B 1 271 ? 0.107   -0.594  -49.154 1.00 21.33 ? 271 ARG B CB   1 
ATOM   8980  C CG   . ARG B 1 271 ? -0.941  -0.331  -48.062 1.00 18.69 ? 271 ARG B CG   1 
ATOM   8981  C CD   . ARG B 1 271 ? -0.322  0.258   -46.767 1.00 24.96 ? 271 ARG B CD   1 
ATOM   8982  N NE   . ARG B 1 271 ? 0.189   1.606   -47.041 1.00 25.07 ? 271 ARG B NE   1 
ATOM   8983  C CZ   . ARG B 1 271 ? -0.547  2.714   -46.992 1.00 29.68 ? 271 ARG B CZ   1 
ATOM   8984  N NH1  . ARG B 1 271 ? -1.806  2.653   -46.632 1.00 24.48 ? 271 ARG B NH1  1 
ATOM   8985  N NH2  . ARG B 1 271 ? -0.020  3.896   -47.294 1.00 31.50 ? 271 ARG B NH2  1 
ATOM   8986  H H    . ARG B 1 271 ? 1.380   -1.023  -51.236 1.00 27.42 ? 271 ARG B H    1 
ATOM   8987  H HA   . ARG B 1 271 ? -1.173  -0.682  -50.754 1.00 30.32 ? 271 ARG B HA   1 
ATOM   8988  H HB2  . ARG B 1 271 ? 0.327   -1.538  -49.124 1.00 25.57 ? 271 ARG B HB2  1 
ATOM   8989  H HB3  . ARG B 1 271 ? 0.894   -0.071  -48.935 1.00 25.57 ? 271 ARG B HB3  1 
ATOM   8990  H HG2  . ARG B 1 271 ? -1.594  0.303   -48.397 1.00 22.41 ? 271 ARG B HG2  1 
ATOM   8991  H HG3  . ARG B 1 271 ? -1.376  -1.167  -47.834 1.00 22.41 ? 271 ARG B HG3  1 
ATOM   8992  H HD2  . ARG B 1 271 ? -1.002  0.317   -46.078 1.00 29.93 ? 271 ARG B HD2  1 
ATOM   8993  H HD3  . ARG B 1 271 ? 0.415   -0.300  -46.474 1.00 29.93 ? 271 ARG B HD3  1 
ATOM   8994  H HE   . ARG B 1 271 ? 1.020   1.685   -47.248 1.00 30.06 ? 271 ARG B HE   1 
ATOM   8995  H HH11 . ARG B 1 271 ? -2.162  1.893   -46.445 1.00 29.35 ? 271 ARG B HH11 1 
ATOM   8996  H HH12 . ARG B 1 271 ? -2.277  3.371   -46.594 1.00 29.35 ? 271 ARG B HH12 1 
ATOM   8997  H HH21 . ARG B 1 271 ? 0.808   3.952   -47.520 1.00 37.78 ? 271 ARG B HH21 1 
ATOM   8998  H HH22 . ARG B 1 271 ? -0.500  4.607   -47.238 1.00 37.78 ? 271 ARG B HH22 1 
ATOM   8999  N N    . LYS B 1 272 ? 0.517   2.045   -50.898 1.00 26.63 ? 272 LYS B N    1 
ATOM   9000  C CA   . LYS B 1 272 ? 0.321   3.494   -50.932 1.00 26.75 ? 272 LYS B CA   1 
ATOM   9001  C C    . LYS B 1 272 ? -0.441  3.921   -52.177 1.00 23.77 ? 272 LYS B C    1 
ATOM   9002  O O    . LYS B 1 272 ? -1.329  4.769   -52.094 1.00 23.04 ? 272 LYS B O    1 
ATOM   9003  C CB   . LYS B 1 272 ? 1.642   4.245   -50.867 1.00 28.28 ? 272 LYS B CB   1 
ATOM   9004  C CG   . LYS B 1 272 ? 1.400   5.712   -50.502 1.00 34.18 ? 272 LYS B CG   1 
ATOM   9005  C CD   . LYS B 1 272 ? 2.442   6.634   -51.072 1.00 47.15 ? 272 LYS B CD   1 
ATOM   9006  C CE   . LYS B 1 272 ? 3.823   6.285   -50.578 1.00 50.94 ? 272 LYS B CE   1 
ATOM   9007  N NZ   . LYS B 1 272 ? 3.882   6.245   -49.084 1.00 56.06 ? 272 LYS B NZ   1 
ATOM   9008  H H    . LYS B 1 272 ? 1.326   1.776   -51.011 1.00 31.94 ? 272 LYS B H    1 
ATOM   9009  H HA   . LYS B 1 272 ? -0.205  3.754   -50.160 1.00 32.07 ? 272 LYS B HA   1 
ATOM   9010  H HB2  . LYS B 1 272 ? 2.207   3.848   -50.185 1.00 33.91 ? 272 LYS B HB2  1 
ATOM   9011  H HB3  . LYS B 1 272 ? 2.078   4.210   -51.732 1.00 33.91 ? 272 LYS B HB3  1 
ATOM   9012  H HG2  . LYS B 1 272 ? 0.536   5.985   -50.850 1.00 41.00 ? 272 LYS B HG2  1 
ATOM   9013  H HG3  . LYS B 1 272 ? 1.413   5.804   -49.537 1.00 41.00 ? 272 LYS B HG3  1 
ATOM   9014  H HD2  . LYS B 1 272 ? 2.439   6.562   -52.039 1.00 56.56 ? 272 LYS B HD2  1 
ATOM   9015  H HD3  . LYS B 1 272 ? 2.245   7.545   -50.803 1.00 56.56 ? 272 LYS B HD3  1 
ATOM   9016  H HE2  . LYS B 1 272 ? 4.072   5.411   -50.916 1.00 61.11 ? 272 LYS B HE2  1 
ATOM   9017  H HE3  . LYS B 1 272 ? 4.452   6.956   -50.888 1.00 61.11 ? 272 LYS B HE3  1 
ATOM   9018  H HZ1  . LYS B 1 272 ? 4.705   6.037   -48.818 1.00 67.24 ? 272 LYS B HZ1  1 
ATOM   9019  H HZ2  . LYS B 1 272 ? 3.661   7.039   -48.749 1.00 67.24 ? 272 LYS B HZ2  1 
ATOM   9020  H HZ3  . LYS B 1 272 ? 3.315   5.633   -48.774 1.00 67.24 ? 272 LYS B HZ3  1 
ATOM   9021  N N    . VAL B 1 273 ? -0.129  3.352   -53.336 1.00 26.31 ? 273 VAL B N    1 
ATOM   9022  C CA   . VAL B 1 273 ? -0.891  3.734   -54.523 1.00 27.84 ? 273 VAL B CA   1 
ATOM   9023  C C    . VAL B 1 273 ? -2.342  3.318   -54.356 1.00 29.85 ? 273 VAL B C    1 
ATOM   9024  O O    . VAL B 1 273 ? -3.252  4.070   -54.714 1.00 25.06 ? 273 VAL B O    1 
ATOM   9025  C CB   . VAL B 1 273 ? -0.273  3.139   -55.800 1.00 30.18 ? 273 VAL B CB   1 
ATOM   9026  C CG1  . VAL B 1 273 ? -1.266  3.189   -56.957 1.00 34.67 ? 273 VAL B CG1  1 
ATOM   9027  C CG2  . VAL B 1 273 ? 0.978   3.887   -56.174 1.00 30.43 ? 273 VAL B CG2  1 
ATOM   9028  H H    . VAL B 1 273 ? 0.491   2.769   -53.463 1.00 31.55 ? 273 VAL B H    1 
ATOM   9029  H HA   . VAL B 1 273 ? -0.869  4.699   -54.608 1.00 33.38 ? 273 VAL B HA   1 
ATOM   9030  H HB   . VAL B 1 273 ? -0.037  2.211   -55.641 1.00 36.19 ? 273 VAL B HB   1 
ATOM   9031  H HG11 . VAL B 1 273 ? -0.850  2.809   -57.747 1.00 41.58 ? 273 VAL B HG11 1 
ATOM   9032  H HG12 . VAL B 1 273 ? -2.055  2.677   -56.719 1.00 41.58 ? 273 VAL B HG12 1 
ATOM   9033  H HG13 . VAL B 1 273 ? -1.509  4.113   -57.124 1.00 41.58 ? 273 VAL B HG13 1 
ATOM   9034  H HG21 . VAL B 1 273 ? 1.351   3.497   -56.980 1.00 36.50 ? 273 VAL B HG21 1 
ATOM   9035  H HG22 . VAL B 1 273 ? 0.754   4.818   -56.330 1.00 36.50 ? 273 VAL B HG22 1 
ATOM   9036  H HG23 . VAL B 1 273 ? 1.616   3.818   -55.447 1.00 36.50 ? 273 VAL B HG23 1 
ATOM   9037  N N    . ALA B 1 274 ? -2.580  2.128   -53.767 1.00 23.37 ? 274 ALA B N    1 
ATOM   9038  C CA   . ALA B 1 274 ? -3.943  1.638   -53.577 1.00 22.90 ? 274 ALA B CA   1 
ATOM   9039  C C    . ALA B 1 274 ? -4.739  2.525   -52.620 1.00 22.95 ? 274 ALA B C    1 
ATOM   9040  O O    . ALA B 1 274 ? -5.922  2.811   -52.868 1.00 21.07 ? 274 ALA B O    1 
ATOM   9041  C CB   . ALA B 1 274 ? -3.907  0.179   -53.084 1.00 21.66 ? 274 ALA B CB   1 
ATOM   9042  H H    . ALA B 1 274 ? -1.970  1.598   -53.475 1.00 28.02 ? 274 ALA B H    1 
ATOM   9043  H HA   . ALA B 1 274 ? -4.398  1.648   -54.434 1.00 27.45 ? 274 ALA B HA   1 
ATOM   9044  H HB1  . ALA B 1 274 ? -4.817  -0.134  -52.962 1.00 25.97 ? 274 ALA B HB1  1 
ATOM   9045  H HB2  . ALA B 1 274 ? -3.455  -0.366  -53.745 1.00 25.97 ? 274 ALA B HB2  1 
ATOM   9046  H HB3  . ALA B 1 274 ? -3.428  0.143   -52.241 1.00 25.97 ? 274 ALA B HB3  1 
ATOM   9047  N N    . GLU B 1 275 ? -4.123  2.977   -51.518 1.00 19.06 ? 275 GLU B N    1 
ATOM   9048  C CA   . GLU B 1 275 ? -4.836  3.870   -50.612 1.00 20.82 ? 275 GLU B CA   1 
ATOM   9049  C C    . GLU B 1 275 ? -5.250  5.151   -51.342 1.00 28.46 ? 275 GLU B C    1 
ATOM   9050  O O    . GLU B 1 275 ? -6.399  5.605   -51.223 1.00 28.83 ? 275 GLU B O    1 
ATOM   9051  C CB   . GLU B 1 275 ? -3.979  4.192   -49.380 1.00 27.65 ? 275 GLU B CB   1 
ATOM   9052  C CG   . GLU B 1 275 ? -4.660  5.017   -48.292 1.00 22.24 ? 275 GLU B CG   1 
ATOM   9053  C CD   . GLU B 1 275 ? -3.832  5.162   -47.014 1.00 25.21 ? 275 GLU B CD   1 
ATOM   9054  O OE1  . GLU B 1 275 ? -2.621  5.400   -47.108 1.00 31.73 ? 275 GLU B OE1  1 
ATOM   9055  O OE2  . GLU B 1 275 ? -4.400  5.064   -45.905 1.00 40.82 ? 275 GLU B OE2  1 
ATOM   9056  H H    . GLU B 1 275 ? -3.319  2.785   -51.283 1.00 22.86 ? 275 GLU B H    1 
ATOM   9057  H HA   . GLU B 1 275 ? -5.643  3.428   -50.305 1.00 24.96 ? 275 GLU B HA   1 
ATOM   9058  H HB2  . GLU B 1 275 ? -3.697  3.356   -48.976 1.00 33.16 ? 275 GLU B HB2  1 
ATOM   9059  H HB3  . GLU B 1 275 ? -3.198  4.688   -49.672 1.00 33.16 ? 275 GLU B HB3  1 
ATOM   9060  H HG2  . GLU B 1 275 ? -4.831  5.907   -48.636 1.00 26.67 ? 275 GLU B HG2  1 
ATOM   9061  H HG3  . GLU B 1 275 ? -5.498  4.589   -48.055 1.00 26.67 ? 275 GLU B HG3  1 
ATOM   9062  N N    . ALA B 1 276 ? -4.333  5.729   -52.129 1.00 25.35 ? 276 ALA B N    1 
ATOM   9063  C CA   . ALA B 1 276 ? -4.645  6.964   -52.853 1.00 31.91 ? 276 ALA B CA   1 
ATOM   9064  C C    . ALA B 1 276 ? -5.706  6.746   -53.937 1.00 32.91 ? 276 ALA B C    1 
ATOM   9065  O O    . ALA B 1 276 ? -6.530  7.629   -54.184 1.00 32.34 ? 276 ALA B O    1 
ATOM   9066  C CB   . ALA B 1 276 ? -3.375  7.532   -53.461 1.00 31.76 ? 276 ALA B CB   1 
ATOM   9067  H H    . ALA B 1 276 ? -3.536  5.431   -52.258 1.00 30.40 ? 276 ALA B H    1 
ATOM   9068  H HA   . ALA B 1 276 ? -4.991  7.616   -52.224 1.00 38.28 ? 276 ALA B HA   1 
ATOM   9069  H HB1  . ALA B 1 276 ? -3.592  8.349   -53.937 1.00 38.09 ? 276 ALA B HB1  1 
ATOM   9070  H HB2  . ALA B 1 276 ? -2.743  7.722   -52.750 1.00 38.09 ? 276 ALA B HB2  1 
ATOM   9071  H HB3  . ALA B 1 276 ? -3.000  6.881   -54.074 1.00 38.09 ? 276 ALA B HB3  1 
ATOM   9072  N N    . PHE B 1 277 ? -5.672  5.605   -54.629 1.00 33.22 ? 277 PHE B N    1 
ATOM   9073  C CA   . PHE B 1 277 ? -6.733  5.264   -55.584 1.00 29.88 ? 277 PHE B CA   1 
ATOM   9074  C C    . PHE B 1 277 ? -8.094  5.248   -54.900 1.00 33.93 ? 277 PHE B C    1 
ATOM   9075  O O    . PHE B 1 277 ? -9.071  5.792   -55.429 1.00 37.93 ? 277 PHE B O    1 
ATOM   9076  C CB   . PHE B 1 277 ? -6.413  3.919   -56.233 1.00 30.20 ? 277 PHE B CB   1 
ATOM   9077  C CG   . PHE B 1 277 ? -7.470  3.392   -57.162 1.00 35.51 ? 277 PHE B CG   1 
ATOM   9078  C CD1  . PHE B 1 277 ? -8.632  2.815   -56.669 1.00 31.88 ? 277 PHE B CD1  1 
ATOM   9079  C CD2  . PHE B 1 277 ? -7.266  3.395   -58.537 1.00 37.65 ? 277 PHE B CD2  1 
ATOM   9080  C CE1  . PHE B 1 277 ? -9.602  2.306   -57.533 1.00 32.20 ? 277 PHE B CE1  1 
ATOM   9081  C CE2  . PHE B 1 277 ? -8.231  2.878   -59.406 1.00 35.92 ? 277 PHE B CE2  1 
ATOM   9082  C CZ   . PHE B 1 277 ? -9.393  2.326   -58.899 1.00 32.15 ? 277 PHE B CZ   1 
ATOM   9083  H H    . PHE B 1 277 ? -5.050  5.014   -54.566 1.00 39.84 ? 277 PHE B H    1 
ATOM   9084  H HA   . PHE B 1 277 ? -6.757  5.937   -56.283 1.00 35.83 ? 277 PHE B HA   1 
ATOM   9085  H HB2  . PHE B 1 277 ? -5.595  4.010   -56.745 1.00 36.22 ? 277 PHE B HB2  1 
ATOM   9086  H HB3  . PHE B 1 277 ? -6.286  3.261   -55.532 1.00 36.22 ? 277 PHE B HB3  1 
ATOM   9087  H HD1  . PHE B 1 277 ? -8.780  2.796   -55.751 1.00 38.23 ? 277 PHE B HD1  1 
ATOM   9088  H HD2  . PHE B 1 277 ? -6.485  3.763   -58.884 1.00 45.16 ? 277 PHE B HD2  1 
ATOM   9089  H HE1  . PHE B 1 277 ? -10.382 1.934   -57.189 1.00 38.62 ? 277 PHE B HE1  1 
ATOM   9090  H HE2  . PHE B 1 277 ? -8.089  2.899   -60.325 1.00 43.08 ? 277 PHE B HE2  1 
ATOM   9091  H HZ   . PHE B 1 277 ? -10.039 1.987   -59.475 1.00 38.56 ? 277 PHE B HZ   1 
ATOM   9092  N N    . ALA B 1 278 ? -8.179  4.640   -53.708 1.00 31.89 ? 278 ALA B N    1 
ATOM   9093  C CA   . ALA B 1 278 ? -9.453  4.553   -53.001 1.00 30.91 ? 278 ALA B CA   1 
ATOM   9094  C C    . ALA B 1 278 ? -9.857  5.873   -52.390 1.00 34.34 ? 278 ALA B C    1 
ATOM   9095  O O    . ALA B 1 278 ? -11.041 6.076   -52.114 1.00 33.23 ? 278 ALA B O    1 
ATOM   9096  C CB   . ALA B 1 278 ? -9.407  3.493   -51.896 1.00 28.74 ? 278 ALA B CB   1 
ATOM   9097  H H    . ALA B 1 278 ? -7.518  4.276   -53.296 1.00 38.24 ? 278 ALA B H    1 
ATOM   9098  H HA   . ALA B 1 278 ? -10.143 4.294   -53.632 1.00 37.07 ? 278 ALA B HA   1 
ATOM   9099  H HB1  . ALA B 1 278 ? -10.268 3.464   -51.451 1.00 34.47 ? 278 ALA B HB1  1 
ATOM   9100  H HB2  . ALA B 1 278 ? -9.211  2.630   -52.295 1.00 34.47 ? 278 ALA B HB2  1 
ATOM   9101  H HB3  . ALA B 1 278 ? -8.713  3.729   -51.261 1.00 34.47 ? 278 ALA B HB3  1 
ATOM   9102  N N    . ARG B 1 279 ? -8.910  6.774   -52.162 1.00 35.23 ? 279 ARG B N    1 
ATOM   9103  C CA   . ARG B 1 279 ? -9.245  8.047   -51.547 1.00 38.60 ? 279 ARG B CA   1 
ATOM   9104  C C    . ARG B 1 279 ? -9.345  9.195   -52.541 1.00 39.78 ? 279 ARG B C    1 
ATOM   9105  O O    . ARG B 1 279 ? -10.139 10.107  -52.323 1.00 39.26 ? 279 ARG B O    1 
ATOM   9106  C CB   . ARG B 1 279 ? -8.224  8.391   -50.459 1.00 38.63 ? 279 ARG B CB   1 
ATOM   9107  C CG   . ARG B 1 279 ? -8.522  7.662   -49.150 1.00 37.73 ? 279 ARG B CG   1 
ATOM   9108  C CD   . ARG B 1 279 ? -7.872  8.330   -48.000 1.00 38.97 ? 279 ARG B CD   1 
ATOM   9109  N NE   . ARG B 1 279 ? -7.731  7.452   -46.838 1.00 29.35 ? 279 ARG B NE   1 
ATOM   9110  C CZ   . ARG B 1 279 ? -8.663  7.309   -45.908 1.00 32.67 ? 279 ARG B CZ   1 
ATOM   9111  N NH1  . ARG B 1 279 ? -9.810  7.970   -46.016 1.00 35.09 ? 279 ARG B NH1  1 
ATOM   9112  N NH2  . ARG B 1 279 ? -8.457  6.507   -44.885 1.00 31.85 ? 279 ARG B NH2  1 
ATOM   9113  H H    . ARG B 1 279 ? -8.077  6.673   -52.350 1.00 42.25 ? 279 ARG B H    1 
ATOM   9114  H HA   . ARG B 1 279 ? -10.110 7.960   -51.117 1.00 46.30 ? 279 ARG B HA   1 
ATOM   9115  H HB2  . ARG B 1 279 ? -7.339  8.128   -50.758 1.00 46.34 ? 279 ARG B HB2  1 
ATOM   9116  H HB3  . ARG B 1 279 ? -8.249  9.345   -50.288 1.00 46.34 ? 279 ARG B HB3  1 
ATOM   9117  H HG2  . ARG B 1 279 ? -9.480  7.657   -48.997 1.00 45.25 ? 279 ARG B HG2  1 
ATOM   9118  H HG3  . ARG B 1 279 ? -8.185  6.754   -49.205 1.00 45.25 ? 279 ARG B HG3  1 
ATOM   9119  H HD2  . ARG B 1 279 ? -6.985  8.621   -48.264 1.00 46.75 ? 279 ARG B HD2  1 
ATOM   9120  H HD3  . ARG B 1 279 ? -8.407  9.094   -47.735 1.00 46.75 ? 279 ARG B HD3  1 
ATOM   9121  H HE   . ARG B 1 279 ? -7.054  6.923   -46.813 1.00 35.20 ? 279 ARG B HE   1 
ATOM   9122  H HH11 . ARG B 1 279 ? -9.942  8.496   -46.684 1.00 42.09 ? 279 ARG B HH11 1 
ATOM   9123  H HH12 . ARG B 1 279 ? -10.418 7.878   -45.415 1.00 42.09 ? 279 ARG B HH12 1 
ATOM   9124  H HH21 . ARG B 1 279 ? -7.716  6.076   -44.819 1.00 38.19 ? 279 ARG B HH21 1 
ATOM   9125  H HH22 . ARG B 1 279 ? -9.066  6.409   -44.285 1.00 38.19 ? 279 ARG B HH22 1 
ATOM   9126  N N    . THR B 1 280 ? -8.582  9.184   -53.631 1.00 43.16 ? 280 THR B N    1 
ATOM   9127  C CA   . THR B 1 280 ? -8.534  10.350  -54.510 1.00 48.30 ? 280 THR B CA   1 
ATOM   9128  C C    . THR B 1 280 ? -9.426  10.219  -55.731 1.00 40.73 ? 280 THR B C    1 
ATOM   9129  O O    . THR B 1 280 ? -9.959  11.223  -56.198 1.00 58.54 ? 280 THR B O    1 
ATOM   9130  C CB   . THR B 1 280 ? -7.106  10.628  -54.990 1.00 39.79 ? 280 THR B CB   1 
ATOM   9131  O OG1  . THR B 1 280 ? -6.709  9.638   -55.956 1.00 41.46 ? 280 THR B OG1  1 
ATOM   9132  C CG2  . THR B 1 280 ? -6.128  10.670  -53.829 1.00 47.71 ? 280 THR B CG2  1 
ATOM   9133  H H    . THR B 1 280 ? -8.089  8.524   -53.881 1.00 51.77 ? 280 THR B H    1 
ATOM   9134  H HA   . THR B 1 280 ? -8.833  11.126  -54.010 1.00 57.94 ? 280 THR B HA   1 
ATOM   9135  H HB   . THR B 1 280 ? -7.089  11.499  -55.417 1.00 47.73 ? 280 THR B HB   1 
ATOM   9136  H HG1  . THR B 1 280 ? -6.736  8.872   -55.611 1.00 49.73 ? 280 THR B HG1  1 
ATOM   9137  H HG21 . THR B 1 280 ? -5.232  10.847  -54.156 1.00 57.23 ? 280 THR B HG21 1 
ATOM   9138  H HG22 . THR B 1 280 ? -6.381  11.371  -53.208 1.00 57.23 ? 280 THR B HG22 1 
ATOM   9139  H HG23 . THR B 1 280 ? -6.131  9.820   -53.362 1.00 57.23 ? 280 THR B HG23 1 
ATOM   9140  N N    . GLY B 1 281 ? -9.592  9.016   -56.269 1.00 38.43 ? 281 GLY B N    1 
ATOM   9141  C CA   . GLY B 1 281 ? -10.268 8.824   -57.531 1.00 40.57 ? 281 GLY B CA   1 
ATOM   9142  C C    . GLY B 1 281 ? -9.350  8.682   -58.735 1.00 45.09 ? 281 GLY B C    1 
ATOM   9143  O O    . GLY B 1 281 ? -9.832  8.357   -59.835 1.00 36.83 ? 281 GLY B O    1 
ATOM   9144  H H    . GLY B 1 281 ? -9.314  8.286   -55.910 1.00 46.10 ? 281 GLY B H    1 
ATOM   9145  H HA2  . GLY B 1 281 ? -10.815 8.024   -57.477 1.00 48.66 ? 281 GLY B HA2  1 
ATOM   9146  H HA3  . GLY B 1 281 ? -10.856 9.579   -57.691 1.00 48.66 ? 281 GLY B HA3  1 
ATOM   9147  N N    . LYS B 1 282 ? -8.049  8.898   -58.561 1.00 38.47 ? 282 LYS B N    1 
ATOM   9148  C CA   . LYS B 1 282 ? -7.110  8.830   -59.671 1.00 39.82 ? 282 LYS B CA   1 
ATOM   9149  C C    . LYS B 1 282 ? -6.933  7.389   -60.153 1.00 45.00 ? 282 LYS B C    1 
ATOM   9150  O O    . LYS B 1 282 ? -7.008  6.431   -59.379 1.00 41.80 ? 282 LYS B O    1 
ATOM   9151  C CB   . LYS B 1 282 ? -5.763  9.407   -59.243 1.00 37.34 ? 282 LYS B CB   1 
ATOM   9152  C CG   . LYS B 1 282 ? -5.826  10.856  -58.756 1.00 34.49 ? 282 LYS B CG   1 
ATOM   9153  C CD   . LYS B 1 282 ? -4.660  11.160  -57.816 1.00 43.11 ? 282 LYS B CD   1 
ATOM   9154  C CE   . LYS B 1 282 ? -4.502  12.638  -57.512 1.00 37.97 ? 282 LYS B CE   1 
ATOM   9155  N NZ   . LYS B 1 282 ? -3.108  12.955  -57.093 1.00 43.15 ? 282 LYS B NZ   1 
ATOM   9156  H H    . LYS B 1 282 ? -7.685  9.087   -57.805 1.00 46.15 ? 282 LYS B H    1 
ATOM   9157  H HA   . LYS B 1 282 ? -7.448  9.359   -60.410 1.00 47.76 ? 282 LYS B HA   1 
ATOM   9158  H HB2  . LYS B 1 282 ? -5.410  8.868   -58.518 1.00 44.78 ? 282 LYS B HB2  1 
ATOM   9159  H HB3  . LYS B 1 282 ? -5.157  9.376   -59.999 1.00 44.78 ? 282 LYS B HB3  1 
ATOM   9160  H HG2  . LYS B 1 282 ? -5.771  11.455  -59.517 1.00 41.37 ? 282 LYS B HG2  1 
ATOM   9161  H HG3  . LYS B 1 282 ? -6.655  10.999  -58.273 1.00 41.37 ? 282 LYS B HG3  1 
ATOM   9162  H HD2  . LYS B 1 282 ? -4.804  10.697  -56.976 1.00 51.71 ? 282 LYS B HD2  1 
ATOM   9163  H HD3  . LYS B 1 282 ? -3.837  10.851  -58.227 1.00 51.71 ? 282 LYS B HD3  1 
ATOM   9164  H HE2  . LYS B 1 282 ? -4.706  13.153  -58.308 1.00 45.55 ? 282 LYS B HE2  1 
ATOM   9165  H HE3  . LYS B 1 282 ? -5.101  12.883  -56.789 1.00 45.55 ? 282 LYS B HE3  1 
ATOM   9166  H HZ1  . LYS B 1 282 ? -3.033  13.824  -56.919 1.00 51.76 ? 282 LYS B HZ1  1 
ATOM   9167  H HZ2  . LYS B 1 282 ? -2.898  12.494  -56.361 1.00 51.76 ? 282 LYS B HZ2  1 
ATOM   9168  H HZ3  . LYS B 1 282 ? -2.539  12.740  -57.743 1.00 51.76 ? 282 LYS B HZ3  1 
ATOM   9169  N N    . SER B 1 283 ? -6.699  7.237   -61.452 1.00 38.68 ? 283 SER B N    1 
ATOM   9170  C CA   . SER B 1 283 ? -6.452  5.912   -61.993 1.00 40.37 ? 283 SER B CA   1 
ATOM   9171  C C    . SER B 1 283 ? -5.094  5.391   -61.518 1.00 40.37 ? 283 SER B C    1 
ATOM   9172  O O    . SER B 1 283 ? -4.244  6.143   -61.022 1.00 34.76 ? 283 SER B O    1 
ATOM   9173  C CB   . SER B 1 283 ? -6.496  5.945   -63.517 1.00 37.09 ? 283 SER B CB   1 
ATOM   9174  O OG   . SER B 1 283 ? -5.383  6.646   -64.021 1.00 38.01 ? 283 SER B OG   1 
ATOM   9175  H H    . SER B 1 283 ? -6.678  7.873   -62.030 1.00 46.40 ? 283 SER B H    1 
ATOM   9176  H HA   . SER B 1 283 ? -7.139  5.303   -61.680 1.00 48.43 ? 283 SER B HA   1 
ATOM   9177  H HB2  . SER B 1 283 ? -6.478  5.036   -63.856 1.00 44.49 ? 283 SER B HB2  1 
ATOM   9178  H HB3  . SER B 1 283 ? -7.308  6.392   -63.802 1.00 44.49 ? 283 SER B HB3  1 
ATOM   9179  H HG   . SER B 1 283 ? -5.410  6.663   -64.861 1.00 45.60 ? 283 SER B HG   1 
ATOM   9180  N N    . ILE B 1 284 ? -4.897  4.078   -61.666 1.00 36.44 ? 284 ILE B N    1 
ATOM   9181  C CA   . ILE B 1 284 ? -3.575  3.505   -61.417 1.00 43.92 ? 284 ILE B CA   1 
ATOM   9182  C C    . ILE B 1 284 ? -2.532  4.228   -62.261 1.00 44.62 ? 284 ILE B C    1 
ATOM   9183  O O    . ILE B 1 284 ? -1.523  4.723   -61.744 1.00 39.69 ? 284 ILE B O    1 
ATOM   9184  C CB   . ILE B 1 284 ? -3.574  1.986   -61.695 1.00 43.01 ? 284 ILE B CB   1 
ATOM   9185  C CG1  . ILE B 1 284 ? -4.387  1.224   -60.635 1.00 39.26 ? 284 ILE B CG1  1 
ATOM   9186  C CG2  . ILE B 1 284 ? -2.141  1.434   -61.734 1.00 42.35 ? 284 ILE B CG2  1 
ATOM   9187  C CD1  . ILE B 1 284 ? -3.998  1.506   -59.192 1.00 34.68 ? 284 ILE B CD1  1 
ATOM   9188  H H    . ILE B 1 284 ? -5.498  3.511   -61.903 1.00 43.71 ? 284 ILE B H    1 
ATOM   9189  H HA   . ILE B 1 284 ? -3.346  3.637   -60.484 1.00 52.68 ? 284 ILE B HA   1 
ATOM   9190  H HB   . ILE B 1 284 ? -3.984  1.834   -62.561 1.00 51.59 ? 284 ILE B HB   1 
ATOM   9191  H HG12 . ILE B 1 284 ? -5.322  1.461   -60.737 1.00 47.09 ? 284 ILE B HG12 1 
ATOM   9192  H HG13 . ILE B 1 284 ? -4.275  0.273   -60.787 1.00 47.09 ? 284 ILE B HG13 1 
ATOM   9193  H HG21 . ILE B 1 284 ? -2.175  0.480   -61.910 1.00 50.80 ? 284 ILE B HG21 1 
ATOM   9194  H HG22 . ILE B 1 284 ? -1.650  1.883   -62.439 1.00 50.80 ? 284 ILE B HG22 1 
ATOM   9195  H HG23 . ILE B 1 284 ? -1.716  1.598   -60.878 1.00 50.80 ? 284 ILE B HG23 1 
ATOM   9196  H HD11 . ILE B 1 284 ? -4.565  0.982   -58.605 1.00 41.60 ? 284 ILE B HD11 1 
ATOM   9197  H HD12 . ILE B 1 284 ? -3.069  1.261   -59.062 1.00 41.60 ? 284 ILE B HD12 1 
ATOM   9198  H HD13 . ILE B 1 284 ? -4.119  2.452   -59.012 1.00 41.60 ? 284 ILE B HD13 1 
ATOM   9199  N N    . GLU B 1 285 ? -2.772  4.313   -63.574 1.00 40.31 ? 285 GLU B N    1 
ATOM   9200  C CA   . GLU B 1 285 ? -1.796  4.923   -64.475 1.00 49.31 ? 285 GLU B CA   1 
ATOM   9201  C C    . GLU B 1 285 ? -1.427  6.333   -64.025 1.00 45.13 ? 285 GLU B C    1 
ATOM   9202  O O    . GLU B 1 285 ? -0.245  6.690   -63.965 1.00 44.30 ? 285 GLU B O    1 
ATOM   9203  C CB   . GLU B 1 285 ? -2.348  4.944   -65.901 1.00 48.47 ? 285 GLU B CB   1 
ATOM   9204  C CG   . GLU B 1 285 ? -1.456  5.669   -66.890 1.00 52.56 ? 285 GLU B CG   1 
ATOM   9205  C CD   . GLU B 1 285 ? -1.967  5.590   -68.315 1.00 58.63 ? 285 GLU B CD   1 
ATOM   9206  O OE1  . GLU B 1 285 ? -3.175  5.327   -68.508 1.00 61.79 ? 285 GLU B OE1  1 
ATOM   9207  O OE2  . GLU B 1 285 ? -1.154  5.793   -69.242 1.00 62.06 ? 285 GLU B OE2  1 
ATOM   9208  H H    . GLU B 1 285 ? -3.485  4.029   -63.962 1.00 48.35 ? 285 GLU B H    1 
ATOM   9209  H HA   . GLU B 1 285 ? -0.987  4.387   -64.474 1.00 59.15 ? 285 GLU B HA   1 
ATOM   9210  H HB2  . GLU B 1 285 ? -2.451  4.030   -66.210 1.00 58.14 ? 285 GLU B HB2  1 
ATOM   9211  H HB3  . GLU B 1 285 ? -3.209  5.389   -65.897 1.00 58.14 ? 285 GLU B HB3  1 
ATOM   9212  H HG2  . GLU B 1 285 ? -1.406  6.605   -66.642 1.00 63.05 ? 285 GLU B HG2  1 
ATOM   9213  H HG3  . GLU B 1 285 ? -0.571  5.272   -66.867 1.00 63.05 ? 285 GLU B HG3  1 
ATOM   9214  N N    . GLN B 1 286 ? -2.430  7.159   -63.717 1.00 44.14 ? 286 GLN B N    1 
ATOM   9215  C CA   . GLN B 1 286 ? -2.145  8.503   -63.239 1.00 37.46 ? 286 GLN B CA   1 
ATOM   9216  C C    . GLN B 1 286 ? -1.286  8.449   -61.994 1.00 36.24 ? 286 GLN B C    1 
ATOM   9217  O O    . GLN B 1 286 ? -0.361  9.251   -61.831 1.00 33.23 ? 286 GLN B O    1 
ATOM   9218  C CB   . GLN B 1 286 ? -3.447  9.264   -62.956 1.00 40.70 ? 286 GLN B CB   1 
ATOM   9219  C CG   . GLN B 1 286 ? -3.237  10.586  -62.184 1.00 42.53 ? 286 GLN B CG   1 
ATOM   9220  C CD   . GLN B 1 286 ? -4.391  11.588  -62.323 1.00 37.36 ? 286 GLN B CD   1 
ATOM   9221  O OE1  . GLN B 1 286 ? -5.444  11.299  -62.914 1.00 35.17 ? 286 GLN B OE1  1 
ATOM   9222  N NE2  . GLN B 1 286 ? -4.188  12.771  -61.772 1.00 33.18 ? 286 GLN B NE2  1 
ATOM   9223  H H    . GLN B 1 286 ? -3.266  6.966   -63.775 1.00 52.95 ? 286 GLN B H    1 
ATOM   9224  H HA   . GLN B 1 286 ? -1.655  8.987   -63.923 1.00 44.93 ? 286 GLN B HA   1 
ATOM   9225  H HB2  . GLN B 1 286 ? -3.874  9.477   -63.801 1.00 48.82 ? 286 GLN B HB2  1 
ATOM   9226  H HB3  . GLN B 1 286 ? -4.030  8.699   -62.426 1.00 48.82 ? 286 GLN B HB3  1 
ATOM   9227  H HG2  . GLN B 1 286 ? -3.135  10.382  -61.241 1.00 51.01 ? 286 GLN B HG2  1 
ATOM   9228  H HG3  . GLN B 1 286 ? -2.432  11.015  -62.515 1.00 51.01 ? 286 GLN B HG3  1 
ATOM   9229  H HE21 . GLN B 1 286 ? -3.446  12.937  -61.370 1.00 39.80 ? 286 GLN B HE21 1 
ATOM   9230  H HE22 . GLN B 1 286 ? -4.798  13.376  -61.816 1.00 39.80 ? 286 GLN B HE22 1 
ATOM   9231  N N    . LEU B 1 287 ? -1.562  7.495   -61.106 1.00 38.10 ? 287 LEU B N    1 
ATOM   9232  C CA   . LEU B 1 287 ? -0.791  7.416   -59.871 1.00 39.59 ? 287 LEU B CA   1 
ATOM   9233  C C    . LEU B 1 287 ? 0.615   6.867   -60.108 1.00 35.63 ? 287 LEU B C    1 
ATOM   9234  O O    . LEU B 1 287 ? 1.553   7.257   -59.404 1.00 38.44 ? 287 LEU B O    1 
ATOM   9235  C CB   . LEU B 1 287 ? -1.555  6.573   -58.855 1.00 36.59 ? 287 LEU B CB   1 
ATOM   9236  C CG   . LEU B 1 287 ? -2.722  7.296   -58.170 1.00 32.22 ? 287 LEU B CG   1 
ATOM   9237  C CD1  . LEU B 1 287 ? -3.671  6.259   -57.586 1.00 33.04 ? 287 LEU B CD1  1 
ATOM   9238  C CD2  . LEU B 1 287 ? -2.251  8.251   -57.081 1.00 28.50 ? 287 LEU B CD2  1 
ATOM   9239  H H    . LEU B 1 287 ? -2.174  6.898   -61.192 1.00 45.70 ? 287 LEU B H    1 
ATOM   9240  H HA   . LEU B 1 287 ? -0.700  8.309   -59.504 1.00 47.48 ? 287 LEU B HA   1 
ATOM   9241  H HB2  . LEU B 1 287 ? -1.916  5.795   -59.308 1.00 43.89 ? 287 LEU B HB2  1 
ATOM   9242  H HB3  . LEU B 1 287 ? -0.938  6.290   -58.162 1.00 43.89 ? 287 LEU B HB3  1 
ATOM   9243  H HG   . LEU B 1 287 ? -3.209  7.811   -58.833 1.00 38.64 ? 287 LEU B HG   1 
ATOM   9244  H HD11 . LEU B 1 287 ? -4.409  6.715   -57.153 1.00 39.63 ? 287 LEU B HD11 1 
ATOM   9245  H HD12 . LEU B 1 287 ? -4.004  5.697   -58.303 1.00 39.63 ? 287 LEU B HD12 1 
ATOM   9246  H HD13 . LEU B 1 287 ? -3.190  5.720   -56.939 1.00 39.63 ? 287 LEU B HD13 1 
ATOM   9247  H HD21 . LEU B 1 287 ? -3.023  8.680   -56.682 1.00 34.17 ? 287 LEU B HD21 1 
ATOM   9248  H HD22 . LEU B 1 287 ? -1.767  7.747   -56.408 1.00 34.17 ? 287 LEU B HD22 1 
ATOM   9249  H HD23 . LEU B 1 287 ? -1.668  8.919   -57.476 1.00 34.17 ? 287 LEU B HD23 1 
ATOM   9250  N N    . GLU B 1 288 ? 0.791   5.983   -61.094 1.00 37.19 ? 288 GLU B N    1 
ATOM   9251  C CA   . GLU B 1 288 ? 2.141   5.585   -61.486 1.00 43.81 ? 288 GLU B CA   1 
ATOM   9252  C C    . GLU B 1 288 ? 2.944   6.793   -61.973 1.00 49.13 ? 288 GLU B C    1 
ATOM   9253  O O    . GLU B 1 288 ? 4.135   6.925   -61.666 1.00 42.73 ? 288 GLU B O    1 
ATOM   9254  C CB   . GLU B 1 288 ? 2.073   4.512   -62.570 1.00 42.48 ? 288 GLU B CB   1 
ATOM   9255  C CG   . GLU B 1 288 ? 1.536   3.173   -62.080 1.00 41.68 ? 288 GLU B CG   1 
ATOM   9256  C CD   . GLU B 1 288 ? 1.086   2.256   -63.223 1.00 47.87 ? 288 GLU B CD   1 
ATOM   9257  O OE1  . GLU B 1 288 ? 1.005   1.026   -62.997 1.00 50.00 ? 288 GLU B OE1  1 
ATOM   9258  O OE2  . GLU B 1 288 ? 0.809   2.753   -64.341 1.00 46.55 ? 288 GLU B OE2  1 
ATOM   9259  H H    . GLU B 1 288 ? 0.160   5.607   -61.540 1.00 44.60 ? 288 GLU B H    1 
ATOM   9260  H HA   . GLU B 1 288 ? 2.598   5.208   -60.718 1.00 52.55 ? 288 GLU B HA   1 
ATOM   9261  H HB2  . GLU B 1 288 ? 1.490   4.822   -63.280 1.00 50.95 ? 288 GLU B HB2  1 
ATOM   9262  H HB3  . GLU B 1 288 ? 2.965   4.363   -62.919 1.00 50.95 ? 288 GLU B HB3  1 
ATOM   9263  H HG2  . GLU B 1 288 ? 2.234   2.716   -61.586 1.00 49.99 ? 288 GLU B HG2  1 
ATOM   9264  H HG3  . GLU B 1 288 ? 0.771   3.332   -61.505 1.00 49.99 ? 288 GLU B HG3  1 
ATOM   9265  N N    . LYS B 1 289 ? 2.299   7.689   -62.726 1.00 45.31 ? 289 LYS B N    1 
ATOM   9266  C CA   . LYS B 1 289 ? 2.952   8.918   -63.170 1.00 46.82 ? 289 LYS B CA   1 
ATOM   9267  C C    . LYS B 1 289 ? 3.351   9.796   -61.981 1.00 42.73 ? 289 LYS B C    1 
ATOM   9268  O O    . LYS B 1 289 ? 4.497   10.245  -61.887 1.00 45.79 ? 289 LYS B O    1 
ATOM   9269  C CB   . LYS B 1 289 ? 2.023   9.678   -64.136 1.00 34.76 ? 289 LYS B CB   1 
ATOM   9270  H H    . LYS B 1 289 ? 1.485   7.606   -62.992 1.00 54.35 ? 289 LYS B H    1 
ATOM   9271  H HA   . LYS B 1 289 ? 3.760   8.687   -63.654 1.00 56.16 ? 289 LYS B HA   1 
ATOM   9272  N N    . GLU B 1 290 ? 2.428   10.036  -61.044 1.00 38.74 ? 290 GLU B N    1 
ATOM   9273  C CA   . GLU B 1 290 ? 2.699   11.042  -60.024 1.00 38.03 ? 290 GLU B CA   1 
ATOM   9274  C C    . GLU B 1 290 ? 3.724   10.581  -59.002 1.00 45.87 ? 290 GLU B C    1 
ATOM   9275  O O    . GLU B 1 290 ? 4.490   11.409  -58.489 1.00 40.04 ? 290 GLU B O    1 
ATOM   9276  C CB   . GLU B 1 290 ? 1.409   11.442  -59.323 1.00 41.87 ? 290 GLU B CB   1 
ATOM   9277  C CG   . GLU B 1 290 ? 0.431   12.108  -60.273 1.00 46.95 ? 290 GLU B CG   1 
ATOM   9278  C CD   . GLU B 1 290 ? -0.950  12.241  -59.692 1.00 41.63 ? 290 GLU B CD   1 
ATOM   9279  O OE1  . GLU B 1 290 ? -1.878  12.610  -60.453 1.00 35.24 ? 290 GLU B OE1  1 
ATOM   9280  O OE2  . GLU B 1 290 ? -1.098  11.977  -58.479 1.00 37.50 ? 290 GLU B OE2  1 
ATOM   9281  H H    . GLU B 1 290 ? 1.665   9.644   -60.980 1.00 46.46 ? 290 GLU B H    1 
ATOM   9282  H HA   . GLU B 1 290 ? 3.054   11.833  -60.458 1.00 45.61 ? 290 GLU B HA   1 
ATOM   9283  H HB2  . GLU B 1 290 ? 0.985   10.649  -58.959 1.00 50.22 ? 290 GLU B HB2  1 
ATOM   9284  H HB3  . GLU B 1 290 ? 1.614   12.068  -58.611 1.00 50.22 ? 290 GLU B HB3  1 
ATOM   9285  H HG2  . GLU B 1 290 ? 0.753   12.998  -60.486 1.00 56.32 ? 290 GLU B HG2  1 
ATOM   9286  H HG3  . GLU B 1 290 ? 0.365   11.577  -61.082 1.00 56.32 ? 290 GLU B HG3  1 
ATOM   9287  N N    . LEU B 1 291 ? 3.759   9.280   -58.683 1.00 46.84 ? 291 LEU B N    1 
ATOM   9288  C CA   . LEU B 1 291 ? 4.560   8.791   -57.565 1.00 52.08 ? 291 LEU B CA   1 
ATOM   9289  C C    . LEU B 1 291 ? 5.674   7.823   -57.959 1.00 52.50 ? 291 LEU B C    1 
ATOM   9290  O O    . LEU B 1 291 ? 6.594   7.623   -57.161 1.00 48.95 ? 291 LEU B O    1 
ATOM   9291  C CB   . LEU B 1 291 ? 3.647   8.126   -56.520 1.00 48.84 ? 291 LEU B CB   1 
ATOM   9292  C CG   . LEU B 1 291 ? 2.557   9.090   -56.021 1.00 46.47 ? 291 LEU B CG   1 
ATOM   9293  C CD1  . LEU B 1 291 ? 1.206   8.727   -56.616 1.00 51.22 ? 291 LEU B CD1  1 
ATOM   9294  C CD2  . LEU B 1 291 ? 2.466   9.161   -54.500 1.00 42.36 ? 291 LEU B CD2  1 
ATOM   9295  H H    . LEU B 1 291 ? 3.326   8.666   -59.102 1.00 56.18 ? 291 LEU B H    1 
ATOM   9296  H HA   . LEU B 1 291 ? 4.980   9.553   -57.138 1.00 62.47 ? 291 LEU B HA   1 
ATOM   9297  H HB2  . LEU B 1 291 ? 3.212   7.357   -56.919 1.00 58.58 ? 291 LEU B HB2  1 
ATOM   9298  H HB3  . LEU B 1 291 ? 4.181   7.852   -55.758 1.00 58.58 ? 291 LEU B HB3  1 
ATOM   9299  H HG   . LEU B 1 291 ? 2.777   9.981   -56.335 1.00 55.75 ? 291 LEU B HG   1 
ATOM   9300  H HD11 . LEU B 1 291 ? 0.539   9.349   -56.286 1.00 61.44 ? 291 LEU B HD11 1 
ATOM   9301  H HD12 . LEU B 1 291 ? 1.262   8.783   -57.583 1.00 61.44 ? 291 LEU B HD12 1 
ATOM   9302  H HD13 . LEU B 1 291 ? 0.977   7.823   -56.350 1.00 61.44 ? 291 LEU B HD13 1 
ATOM   9303  H HD21 . LEU B 1 291 ? 1.763   9.784   -54.256 1.00 50.81 ? 291 LEU B HD21 1 
ATOM   9304  H HD22 . LEU B 1 291 ? 2.262   8.278   -54.155 1.00 50.81 ? 291 LEU B HD22 1 
ATOM   9305  H HD23 . LEU B 1 291 ? 3.316   9.467   -54.147 1.00 50.81 ? 291 LEU B HD23 1 
ATOM   9306  N N    . LEU B 1 292 ? 5.650   7.264   -59.176 1.00 53.81 ? 292 LEU B N    1 
ATOM   9307  C CA   . LEU B 1 292 ? 6.586   6.226   -59.600 1.00 51.16 ? 292 LEU B CA   1 
ATOM   9308  C C    . LEU B 1 292 ? 7.265   6.560   -60.924 1.00 58.77 ? 292 LEU B C    1 
ATOM   9309  O O    . LEU B 1 292 ? 7.709   5.641   -61.624 1.00 56.53 ? 292 LEU B O    1 
ATOM   9310  C CB   . LEU B 1 292 ? 5.870   4.878   -59.743 1.00 50.00 ? 292 LEU B CB   1 
ATOM   9311  C CG   . LEU B 1 292 ? 5.538   4.017   -58.524 1.00 57.71 ? 292 LEU B CG   1 
ATOM   9312  C CD1  . LEU B 1 292 ? 5.276   4.801   -57.237 1.00 51.39 ? 292 LEU B CD1  1 
ATOM   9313  C CD2  . LEU B 1 292 ? 4.336   3.166   -58.889 1.00 51.84 ? 292 LEU B CD2  1 
ATOM   9314  H H    . LEU B 1 292 ? 5.083   7.478   -59.786 1.00 64.56 ? 292 LEU B H    1 
ATOM   9315  H HA   . LEU B 1 292 ? 7.276   6.129   -58.925 1.00 61.38 ? 292 LEU B HA   1 
ATOM   9316  H HB2  . LEU B 1 292 ? 5.027   5.050   -60.190 1.00 59.98 ? 292 LEU B HB2  1 
ATOM   9317  H HB3  . LEU B 1 292 ? 6.417   4.325   -60.322 1.00 59.98 ? 292 LEU B HB3  1 
ATOM   9318  H HG   . LEU B 1 292 ? 6.282   3.418   -58.357 1.00 69.23 ? 292 LEU B HG   1 
ATOM   9319  H HD11 . LEU B 1 292 ? 5.075   4.176   -56.523 1.00 61.64 ? 292 LEU B HD11 1 
ATOM   9320  H HD12 . LEU B 1 292 ? 6.068   5.315   -57.014 1.00 61.64 ? 292 LEU B HD12 1 
ATOM   9321  H HD13 . LEU B 1 292 ? 4.524   5.397   -57.378 1.00 61.64 ? 292 LEU B HD13 1 
ATOM   9322  H HD21 . LEU B 1 292 ? 4.103   2.608   -58.131 1.00 62.18 ? 292 LEU B HD21 1 
ATOM   9323  H HD22 . LEU B 1 292 ? 3.593   3.748   -59.113 1.00 62.18 ? 292 LEU B HD22 1 
ATOM   9324  H HD23 . LEU B 1 292 ? 4.562   2.611   -59.652 1.00 62.18 ? 292 LEU B HD23 1 
ATOM   9325  N N    . ASN B 1 293 ? 7.333   7.843   -61.292 1.00 61.48 ? 293 ASN B N    1 
ATOM   9326  C CA   . ASN B 1 293 ? 7.896   8.268   -62.580 1.00 59.10 ? 293 ASN B CA   1 
ATOM   9327  C C    . ASN B 1 293 ? 7.524   7.315   -63.721 1.00 56.36 ? 293 ASN B C    1 
ATOM   9328  O O    . ASN B 1 293 ? 6.408   6.778   -63.767 1.00 53.94 ? 293 ASN B O    1 
ATOM   9329  C CB   . ASN B 1 293 ? 9.421   8.396   -62.483 1.00 52.85 ? 293 ASN B CB   1 
ATOM   9330  H H    . ASN B 1 293 ? 7.056   8.496   -60.806 1.00 73.76 ? 293 ASN B H    1 
ATOM   9331  H HA   . ASN B 1 293 ? 7.541   9.143   -62.800 1.00 70.90 ? 293 ASN B HA   1 
ATOM   9332  N N    . LYS B 1 296 ? 5.356   1.193   -63.901 1.00 36.37 ? 296 LYS B N    1 
ATOM   9333  C CA   . LYS B 1 296 ? 4.235   0.274   -63.845 1.00 42.60 ? 296 LYS B CA   1 
ATOM   9334  C C    . LYS B 1 296 ? 4.200   -0.403  -62.476 1.00 52.38 ? 296 LYS B C    1 
ATOM   9335  O O    . LYS B 1 296 ? 5.204   -0.944  -62.008 1.00 48.90 ? 296 LYS B O    1 
ATOM   9336  C CB   . LYS B 1 296 ? 4.323   -0.775  -64.956 1.00 43.53 ? 296 LYS B CB   1 
ATOM   9337  H HA   . LYS B 1 296 ? 3.410   0.770   -63.960 1.00 51.10 ? 296 LYS B HA   1 
ATOM   9338  N N    . LEU B 1 297 ? 3.033   -0.342  -61.834 1.00 51.20 ? 297 LEU B N    1 
ATOM   9339  C CA   . LEU B 1 297 ? 2.804   -1.019  -60.564 1.00 43.75 ? 297 LEU B CA   1 
ATOM   9340  C C    . LEU B 1 297 ? 2.568   -2.504  -60.827 1.00 44.37 ? 297 LEU B C    1 
ATOM   9341  O O    . LEU B 1 297 ? 1.752   -2.871  -61.685 1.00 41.24 ? 297 LEU B O    1 
ATOM   9342  C CB   . LEU B 1 297 ? 1.598   -0.402  -59.852 1.00 38.15 ? 297 LEU B CB   1 
ATOM   9343  C CG   . LEU B 1 297 ? 1.533   -0.543  -58.343 1.00 36.00 ? 297 LEU B CG   1 
ATOM   9344  C CD1  . LEU B 1 297 ? 2.665   0.214   -57.708 1.00 37.80 ? 297 LEU B CD1  1 
ATOM   9345  C CD2  . LEU B 1 297 ? 0.209   -0.019  -57.842 1.00 29.76 ? 297 LEU B CD2  1 
ATOM   9346  H H    . LEU B 1 297 ? 2.349   0.093   -62.122 1.00 61.42 ? 297 LEU B H    1 
ATOM   9347  H HA   . LEU B 1 297 ? 3.584   -0.923  -59.996 1.00 52.48 ? 297 LEU B HA   1 
ATOM   9348  H HB2  . LEU B 1 297 ? 1.587   0.548   -60.049 1.00 45.76 ? 297 LEU B HB2  1 
ATOM   9349  H HB3  . LEU B 1 297 ? 0.796   -0.811  -60.210 1.00 45.76 ? 297 LEU B HB3  1 
ATOM   9350  H HG   . LEU B 1 297 ? 1.610   -1.478  -58.099 1.00 43.18 ? 297 LEU B HG   1 
ATOM   9351  H HD11 . LEU B 1 297 ? 2.609   0.114   -56.745 1.00 45.34 ? 297 LEU B HD11 1 
ATOM   9352  H HD12 . LEU B 1 297 ? 3.505   -0.146  -58.030 1.00 45.34 ? 297 LEU B HD12 1 
ATOM   9353  H HD13 . LEU B 1 297 ? 2.592   1.151   -57.948 1.00 45.34 ? 297 LEU B HD13 1 
ATOM   9354  H HD21 . LEU B 1 297 ? 0.177   -0.114  -56.877 1.00 35.69 ? 297 LEU B HD21 1 
ATOM   9355  H HD22 . LEU B 1 297 ? 0.127   0.916   -58.086 1.00 35.69 ? 297 LEU B HD22 1 
ATOM   9356  H HD23 . LEU B 1 297 ? -0.507  -0.532  -58.249 1.00 35.69 ? 297 LEU B HD23 1 
ATOM   9357  N N    . GLN B 1 298 ? 3.283   -3.357  -60.084 1.00 42.37 ? 298 GLN B N    1 
ATOM   9358  C CA   . GLN B 1 298 ? 3.263   -4.791  -60.364 1.00 38.59 ? 298 GLN B CA   1 
ATOM   9359  C C    . GLN B 1 298 ? 2.035   -5.505  -59.811 1.00 31.22 ? 298 GLN B C    1 
ATOM   9360  O O    . GLN B 1 298 ? 1.608   -6.493  -60.405 1.00 30.24 ? 298 GLN B O    1 
ATOM   9361  C CB   . GLN B 1 298 ? 4.526   -5.454  -59.819 1.00 41.69 ? 298 GLN B CB   1 
ATOM   9362  C CG   . GLN B 1 298 ? 5.776   -5.169  -60.630 1.00 51.09 ? 298 GLN B CG   1 
ATOM   9363  C CD   . GLN B 1 298 ? 5.649   -5.611  -62.081 1.00 58.61 ? 298 GLN B CD   1 
ATOM   9364  O OE1  . GLN B 1 298 ? 4.965   -4.960  -62.882 1.00 60.39 ? 298 GLN B OE1  1 
ATOM   9365  N NE2  . GLN B 1 298 ? 6.308   -6.727  -62.431 1.00 65.90 ? 298 GLN B NE2  1 
ATOM   9366  H H    . GLN B 1 298 ? 3.781   -3.131  -59.420 1.00 50.83 ? 298 GLN B H    1 
ATOM   9367  H HA   . GLN B 1 298 ? 3.262   -4.915  -61.326 1.00 46.29 ? 298 GLN B HA   1 
ATOM   9368  H HB2  . GLN B 1 298 ? 4.680   -5.135  -58.916 1.00 50.01 ? 298 GLN B HB2  1 
ATOM   9369  H HB3  . GLN B 1 298 ? 4.393   -6.415  -59.808 1.00 50.01 ? 298 GLN B HB3  1 
ATOM   9370  H HG2  . GLN B 1 298 ? 5.948   -4.214  -60.621 1.00 61.28 ? 298 GLN B HG2  1 
ATOM   9371  H HG3  . GLN B 1 298 ? 6.524   -5.645  -60.236 1.00 61.28 ? 298 GLN B HG3  1 
ATOM   9372  H HE21 . GLN B 1 298 ? 6.773   -7.153  -61.846 1.00 79.06 ? 298 GLN B HE21 1 
ATOM   9373  H HE22 . GLN B 1 298 ? 6.266   -7.015  -63.240 1.00 79.06 ? 298 GLN B HE22 1 
ATOM   9374  N N    . GLY B 1 299 ? 1.441   -5.032  -58.708 1.00 28.55 ? 299 GLY B N    1 
ATOM   9375  C CA   . GLY B 1 299 ? 0.281   -5.685  -58.138 1.00 23.38 ? 299 GLY B CA   1 
ATOM   9376  C C    . GLY B 1 299 ? -0.905  -5.822  -59.094 1.00 24.70 ? 299 GLY B C    1 
ATOM   9377  O O    . GLY B 1 299 ? -1.464  -6.905  -59.268 1.00 21.73 ? 299 GLY B O    1 
ATOM   9378  H H    . GLY B 1 299 ? 1.699   -4.333  -58.278 1.00 34.24 ? 299 GLY B H    1 
ATOM   9379  H HA2  . GLY B 1 299 ? 0.532   -6.574  -57.843 1.00 28.03 ? 299 GLY B HA2  1 
ATOM   9380  H HA3  . GLY B 1 299 ? -0.016  -5.183  -57.363 1.00 28.03 ? 299 GLY B HA3  1 
ATOM   9381  N N    . PRO B 1 300 ? -1.332  -4.715  -59.701 1.00 26.62 ? 300 PRO B N    1 
ATOM   9382  C CA   . PRO B 1 300 ? -2.463  -4.799  -60.644 1.00 27.30 ? 300 PRO B CA   1 
ATOM   9383  C C    . PRO B 1 300 ? -2.160  -5.637  -61.874 1.00 27.24 ? 300 PRO B C    1 
ATOM   9384  O O    . PRO B 1 300 ? -3.040  -6.358  -62.351 1.00 28.05 ? 300 PRO B O    1 
ATOM   9385  C CB   . PRO B 1 300 ? -2.727  -3.331  -61.002 1.00 25.99 ? 300 PRO B CB   1 
ATOM   9386  C CG   . PRO B 1 300 ? -2.206  -2.556  -59.825 1.00 30.68 ? 300 PRO B CG   1 
ATOM   9387  C CD   . PRO B 1 300 ? -0.967  -3.321  -59.407 1.00 29.30 ? 300 PRO B CD   1 
ATOM   9388  H HA   . PRO B 1 300 ? -3.244  -5.162  -60.197 1.00 32.74 ? 300 PRO B HA   1 
ATOM   9389  H HB2  . PRO B 1 300 ? -2.243  -3.098  -61.809 1.00 31.16 ? 300 PRO B HB2  1 
ATOM   9390  H HB3  . PRO B 1 300 ? -3.679  -3.186  -61.116 1.00 31.16 ? 300 PRO B HB3  1 
ATOM   9391  H HG2  . PRO B 1 300 ? -1.980  -1.652  -60.097 1.00 36.80 ? 300 PRO B HG2  1 
ATOM   9392  H HG3  . PRO B 1 300 ? -2.866  -2.550  -59.114 1.00 36.80 ? 300 PRO B HG3  1 
ATOM   9393  H HD2  . PRO B 1 300 ? -0.203  -3.049  -59.941 1.00 35.14 ? 300 PRO B HD2  1 
ATOM   9394  H HD3  . PRO B 1 300 ? -0.800  -3.205  -58.459 1.00 35.14 ? 300 PRO B HD3  1 
ATOM   9395  N N    . GLU B 1 301 ? -0.940  -5.556  -62.414 1.00 29.07 ? 301 GLU B N    1 
ATOM   9396  C CA   . GLU B 1 301 ? -0.615  -6.344  -63.595 1.00 33.70 ? 301 GLU B CA   1 
ATOM   9397  C C    . GLU B 1 301 ? -0.642  -7.821  -63.264 1.00 31.56 ? 301 GLU B C    1 
ATOM   9398  O O    . GLU B 1 301 ? -1.107  -8.644  -64.064 1.00 26.86 ? 301 GLU B O    1 
ATOM   9399  C CB   . GLU B 1 301 ? 0.755   -5.942  -64.153 1.00 36.07 ? 301 GLU B CB   1 
ATOM   9400  C CG   . GLU B 1 301 ? 0.764   -4.618  -64.912 1.00 47.35 ? 301 GLU B CG   1 
ATOM   9401  C CD   . GLU B 1 301 ? 2.121   -4.300  -65.526 1.00 59.34 ? 301 GLU B CD   1 
ATOM   9402  O OE1  . GLU B 1 301 ? 3.122   -4.985  -65.192 1.00 54.67 ? 301 GLU B OE1  1 
ATOM   9403  O OE2  . GLU B 1 301 ? 2.178   -3.362  -66.348 1.00 58.97 ? 301 GLU B OE2  1 
ATOM   9404  H H    . GLU B 1 301 ? -0.300  -5.063  -62.121 1.00 34.86 ? 301 GLU B H    1 
ATOM   9405  H HA   . GLU B 1 301 ? -1.280  -6.177  -64.281 1.00 40.42 ? 301 GLU B HA   1 
ATOM   9406  H HB2  . GLU B 1 301 ? 1.379   -5.862  -63.415 1.00 43.26 ? 301 GLU B HB2  1 
ATOM   9407  H HB3  . GLU B 1 301 ? 1.057   -6.633  -64.763 1.00 43.26 ? 301 GLU B HB3  1 
ATOM   9408  H HG2  . GLU B 1 301 ? 0.112   -4.661  -65.629 1.00 56.80 ? 301 GLU B HG2  1 
ATOM   9409  H HG3  . GLU B 1 301 ? 0.536   -3.901  -64.299 1.00 56.80 ? 301 GLU B HG3  1 
ATOM   9410  N N    . THR B 1 302 ? -0.151  -8.182  -62.075 1.00 28.54 ? 302 THR B N    1 
ATOM   9411  C CA   . THR B 1 302 ? -0.196  -9.577  -61.671 1.00 27.05 ? 302 THR B CA   1 
ATOM   9412  C C    . THR B 1 302 ? -1.640  -10.031 -61.517 1.00 25.73 ? 302 THR B C    1 
ATOM   9413  O O    . THR B 1 302 ? -1.992  -11.138 -61.926 1.00 26.15 ? 302 THR B O    1 
ATOM   9414  C CB   . THR B 1 302 ? 0.598   -9.764  -60.373 1.00 24.59 ? 302 THR B CB   1 
ATOM   9415  O OG1  . THR B 1 302 ? 1.954   -9.403  -60.615 1.00 26.92 ? 302 THR B OG1  1 
ATOM   9416  C CG2  . THR B 1 302 ? 0.520   -11.222 -59.862 1.00 25.08 ? 302 THR B CG2  1 
ATOM   9417  H H    . THR B 1 302 ? 0.204   -7.648  -61.502 1.00 34.23 ? 302 THR B H    1 
ATOM   9418  H HA   . THR B 1 302 ? 0.218   -10.120 -62.359 1.00 32.44 ? 302 THR B HA   1 
ATOM   9419  H HB   . THR B 1 302 ? 0.232   -9.184  -59.689 1.00 29.48 ? 302 THR B HB   1 
ATOM   9420  H HG1  . THR B 1 302 ? 1.998   -8.601  -60.860 1.00 32.28 ? 302 THR B HG1  1 
ATOM   9421  H HG21 . THR B 1 302 ? 1.030   -11.313 -59.042 1.00 30.08 ? 302 THR B HG21 1 
ATOM   9422  H HG22 . THR B 1 302 ? -0.404  -11.462 -59.688 1.00 30.08 ? 302 THR B HG22 1 
ATOM   9423  H HG23 . THR B 1 302 ? 0.883   -11.826 -60.528 1.00 30.08 ? 302 THR B HG23 1 
ATOM   9424  N N    . ALA B 1 303 ? -2.500  -9.179  -60.959 1.00 23.22 ? 303 ALA B N    1 
ATOM   9425  C CA   . ALA B 1 303 ? -3.896  -9.560  -60.823 1.00 20.20 ? 303 ALA B CA   1 
ATOM   9426  C C    . ALA B 1 303 ? -4.500  -9.861  -62.192 1.00 26.24 ? 303 ALA B C    1 
ATOM   9427  O O    . ALA B 1 303 ? -5.203  -10.859 -62.371 1.00 24.85 ? 303 ALA B O    1 
ATOM   9428  C CB   . ALA B 1 303 ? -4.676  -8.448  -60.129 1.00 23.21 ? 303 ALA B CB   1 
ATOM   9429  H H    . ALA B 1 303 ? -2.304  -8.397  -60.660 1.00 27.85 ? 303 ALA B H    1 
ATOM   9430  H HA   . ALA B 1 303 ? -3.958  -10.361 -60.280 1.00 24.22 ? 303 ALA B HA   1 
ATOM   9431  H HB1  . ALA B 1 303 ? -5.604  -8.718  -60.047 1.00 27.83 ? 303 ALA B HB1  1 
ATOM   9432  H HB2  . ALA B 1 303 ? -4.295  -8.298  -59.250 1.00 27.83 ? 303 ALA B HB2  1 
ATOM   9433  H HB3  . ALA B 1 303 ? -4.612  -7.639  -60.660 1.00 27.83 ? 303 ALA B HB3  1 
ATOM   9434  N N    . ARG B 1 304 ? -4.170  -9.033  -63.172 1.00 22.12 ? 304 ARG B N    1 
ATOM   9435  C CA   . ARG B 1 304 ? -4.662  -9.208  -64.555 1.00 29.35 ? 304 ARG B CA   1 
ATOM   9436  C C    . ARG B 1 304 ? -4.248  -10.604 -65.036 1.00 28.89 ? 304 ARG B C    1 
ATOM   9437  O O    . ARG B 1 304 ? -5.090  -11.340 -65.486 1.00 33.35 ? 304 ARG B O    1 
ATOM   9438  C CB   . ARG B 1 304 ? -4.159  -8.100  -65.482 1.00 33.08 ? 304 ARG B CB   1 
ATOM   9439  C CG   . ARG B 1 304 ? -4.491  -8.362  -66.947 1.00 40.10 ? 304 ARG B CG   1 
ATOM   9440  C CD   . ARG B 1 304 ? -4.451  -7.158  -67.858 1.00 42.07 ? 304 ARG B CD   1 
ATOM   9441  N NE   . ARG B 1 304 ? -3.181  -6.465  -67.795 1.00 46.76 ? 304 ARG B NE   1 
ATOM   9442  C CZ   . ARG B 1 304 ? -2.835  -5.476  -68.590 1.00 50.36 ? 304 ARG B CZ   1 
ATOM   9443  N NH1  . ARG B 1 304 ? -1.571  -5.322  -68.931 1.00 51.46 ? 304 ARG B NH1  1 
ATOM   9444  N NH2  . ARG B 1 304 ? -3.756  -4.656  -69.056 1.00 51.27 ? 304 ARG B NH2  1 
ATOM   9445  H H    . ARG B 1 304 ? -3.625  -8.313  -63.053 1.00 26.53 ? 304 ARG B H    1 
ATOM   9446  H HA   . ARG B 1 304 ? -5.646  -9.169  -64.532 1.00 35.20 ? 304 ARG B HA   1 
ATOM   9447  H HB2  . ARG B 1 304 ? -4.562  -7.250  -65.208 1.00 39.67 ? 304 ARG B HB2  1 
ATOM   9448  H HB3  . ARG B 1 304 ? -3.187  -8.022  -65.383 1.00 39.67 ? 304 ARG B HB3  1 
ATOM   9449  H HG2  . ARG B 1 304 ? -3.862  -9.030  -67.295 1.00 48.10 ? 304 ARG B HG2  1 
ATOM   9450  H HG3  . ARG B 1 304 ? -5.388  -8.754  -66.998 1.00 48.10 ? 304 ARG B HG3  1 
ATOM   9451  H HD2  . ARG B 1 304 ? -4.615  -7.446  -68.781 1.00 50.46 ? 304 ARG B HD2  1 
ATOM   9452  H HD3  . ARG B 1 304 ? -5.168  -6.538  -67.604 1.00 50.46 ? 304 ARG B HD3  1 
ATOM   9453  H HE   . ARG B 1 304 ? -2.606  -6.719  -67.191 1.00 56.10 ? 304 ARG B HE   1 
ATOM   9454  H HH11 . ARG B 1 304 ? -1.062  -6.027  -69.055 1.00 61.73 ? 304 ARG B HH11 1 
ATOM   9455  H HH12 . ARG B 1 304 ? -1.242  -4.514  -69.034 1.00 61.73 ? 304 ARG B HH12 1 
ATOM   9456  H HH21 . ARG B 1 304 ? -4.365  -4.954  -69.618 1.00 61.50 ? 304 ARG B HH21 1 
ATOM   9457  H HH22 . ARG B 1 304 ? -3.760  -3.812  -68.803 1.00 61.50 ? 304 ARG B HH22 1 
ATOM   9458  N N    . GLU B 1 305 ? -2.988  -10.975 -64.899 1.00 27.35 ? 305 GLU B N    1 
ATOM   9459  C CA   . GLU B 1 305 ? -2.527  -12.285 -65.335 1.00 28.22 ? 305 GLU B CA   1 
ATOM   9460  C C    . GLU B 1 305 ? -3.233  -13.398 -64.573 1.00 29.96 ? 305 GLU B C    1 
ATOM   9461  O O    . GLU B 1 305 ? -3.549  -14.446 -65.146 1.00 26.90 ? 305 GLU B O    1 
ATOM   9462  C CB   . GLU B 1 305 ? -1.013  -12.392 -65.152 1.00 30.90 ? 305 GLU B CB   1 
ATOM   9463  C CG   . GLU B 1 305 ? -0.229  -11.341 -65.885 1.00 34.94 ? 305 GLU B CG   1 
ATOM   9464  C CD   . GLU B 1 305 ? -0.305  -11.509 -67.390 1.00 43.03 ? 305 GLU B CD   1 
ATOM   9465  O OE1  . GLU B 1 305 ? -0.781  -12.577 -67.842 1.00 38.18 ? 305 GLU B OE1  1 
ATOM   9466  O OE2  . GLU B 1 305 ? 0.129   -10.586 -68.114 1.00 47.31 ? 305 GLU B OE2  1 
ATOM   9467  H H    . GLU B 1 305 ? -2.380  -10.479 -64.546 1.00 32.80 ? 305 GLU B H    1 
ATOM   9468  H HA   . GLU B 1 305 ? -2.725  -12.394 -66.278 1.00 33.84 ? 305 GLU B HA   1 
ATOM   9469  H HB2  . GLU B 1 305 ? -0.806  -12.309 -64.208 1.00 37.05 ? 305 GLU B HB2  1 
ATOM   9470  H HB3  . GLU B 1 305 ? -0.720  -13.258 -65.477 1.00 37.05 ? 305 GLU B HB3  1 
ATOM   9471  H HG2  . GLU B 1 305 ? -0.584  -10.467 -65.660 1.00 41.91 ? 305 GLU B HG2  1 
ATOM   9472  H HG3  . GLU B 1 305 ? 0.703   -11.400 -65.622 1.00 41.91 ? 305 GLU B HG3  1 
ATOM   9473  N N    . LEU B 1 306 ? -3.488  -13.193 -63.276 1.00 25.57 ? 306 LEU B N    1 
ATOM   9474  C CA   . LEU B 1 306 ? -4.224  -14.187 -62.506 1.00 26.40 ? 306 LEU B CA   1 
ATOM   9475  C C    . LEU B 1 306 ? -5.635  -14.370 -63.049 1.00 27.15 ? 306 LEU B C    1 
ATOM   9476  O O    . LEU B 1 306 ? -6.146  -15.491 -63.099 1.00 28.42 ? 306 LEU B O    1 
ATOM   9477  C CB   . LEU B 1 306 ? -4.287  -13.775 -61.036 1.00 26.94 ? 306 LEU B CB   1 
ATOM   9478  C CG   . LEU B 1 306 ? -2.937  -13.753 -60.314 1.00 21.73 ? 306 LEU B CG   1 
ATOM   9479  C CD1  . LEU B 1 306 ? -3.077  -13.156 -58.940 1.00 23.95 ? 306 LEU B CD1  1 
ATOM   9480  C CD2  . LEU B 1 306 ? -2.341  -15.135 -60.209 1.00 28.50 ? 306 LEU B CD2  1 
ATOM   9481  H H    . LEU B 1 306 ? -3.249  -12.497 -62.830 1.00 30.66 ? 306 LEU B H    1 
ATOM   9482  H HA   . LEU B 1 306 ? -3.764  -15.039 -62.563 1.00 31.66 ? 306 LEU B HA   1 
ATOM   9483  H HB2  . LEU B 1 306 ? -4.663  -12.883 -60.981 1.00 32.30 ? 306 LEU B HB2  1 
ATOM   9484  H HB3  . LEU B 1 306 ? -4.861  -14.399 -60.565 1.00 32.30 ? 306 LEU B HB3  1 
ATOM   9485  H HG   . LEU B 1 306 ? -2.320  -13.200 -60.818 1.00 26.06 ? 306 LEU B HG   1 
ATOM   9486  H HD11 . LEU B 1 306 ? -2.209  -13.155 -58.507 1.00 28.72 ? 306 LEU B HD11 1 
ATOM   9487  H HD12 . LEU B 1 306 ? -3.408  -12.248 -59.023 1.00 28.72 ? 306 LEU B HD12 1 
ATOM   9488  H HD13 . LEU B 1 306 ? -3.703  -13.691 -58.426 1.00 28.72 ? 306 LEU B HD13 1 
ATOM   9489  H HD21 . LEU B 1 306 ? -1.490  -15.077 -59.747 1.00 34.17 ? 306 LEU B HD21 1 
ATOM   9490  H HD22 . LEU B 1 306 ? -2.949  -15.704 -59.712 1.00 34.17 ? 306 LEU B HD22 1 
ATOM   9491  H HD23 . LEU B 1 306 ? -2.209  -15.490 -61.102 1.00 34.17 ? 306 LEU B HD23 1 
ATOM   9492  N N    . TYR B 1 307 ? -6.300  -13.274 -63.399 1.00 26.87 ? 307 TYR B N    1 
ATOM   9493  C CA   . TYR B 1 307 ? -7.629  -13.379 -63.990 1.00 28.40 ? 307 TYR B CA   1 
ATOM   9494  C C    . TYR B 1 307 ? -7.586  -14.300 -65.192 1.00 30.98 ? 307 TYR B C    1 
ATOM   9495  O O    . TYR B 1 307 ? -8.430  -15.194 -65.342 1.00 30.11 ? 307 TYR B O    1 
ATOM   9496  C CB   . TYR B 1 307 ? -8.130  -11.997 -64.404 1.00 30.81 ? 307 TYR B CB   1 
ATOM   9497  C CG   . TYR B 1 307 ? -9.505  -11.972 -65.068 1.00 35.30 ? 307 TYR B CG   1 
ATOM   9498  C CD1  . TYR B 1 307 ? -10.609 -12.591 -64.475 1.00 35.93 ? 307 TYR B CD1  1 
ATOM   9499  C CD2  . TYR B 1 307 ? -9.702  -11.301 -66.271 1.00 45.90 ? 307 TYR B CD2  1 
ATOM   9500  C CE1  . TYR B 1 307 ? -11.889 -12.546 -65.078 1.00 36.85 ? 307 TYR B CE1  1 
ATOM   9501  C CE2  . TYR B 1 307 ? -10.976 -11.246 -66.877 1.00 49.28 ? 307 TYR B CE2  1 
ATOM   9502  C CZ   . TYR B 1 307 ? -12.058 -11.872 -66.272 1.00 44.09 ? 307 TYR B CZ   1 
ATOM   9503  O OH   . TYR B 1 307 ? -13.310 -11.826 -66.860 1.00 46.06 ? 307 TYR B OH   1 
ATOM   9504  H H    . TYR B 1 307 ? -6.010  -12.469 -63.306 1.00 32.22 ? 307 TYR B H    1 
ATOM   9505  H HA   . TYR B 1 307 ? -8.245  -13.749 -63.340 1.00 34.06 ? 307 TYR B HA   1 
ATOM   9506  H HB2  . TYR B 1 307 ? -8.180  -11.439 -63.612 1.00 36.95 ? 307 TYR B HB2  1 
ATOM   9507  H HB3  . TYR B 1 307 ? -7.497  -11.615 -65.031 1.00 36.95 ? 307 TYR B HB3  1 
ATOM   9508  H HD1  . TYR B 1 307 ? -10.501 -13.040 -63.668 1.00 43.10 ? 307 TYR B HD1  1 
ATOM   9509  H HD2  . TYR B 1 307 ? -8.984  -10.874 -66.679 1.00 55.06 ? 307 TYR B HD2  1 
ATOM   9510  H HE1  . TYR B 1 307 ? -12.613 -12.964 -64.671 1.00 44.20 ? 307 TYR B HE1  1 
ATOM   9511  H HE2  . TYR B 1 307 ? -11.090 -10.795 -67.683 1.00 59.12 ? 307 TYR B HE2  1 
ATOM   9512  H HH   . TYR B 1 307 ? -13.274 -11.388 -67.577 1.00 55.25 ? 307 TYR B HH   1 
ATOM   9513  N N    . SER B 1 308 ? -6.583  -14.100 -66.050 1.00 27.42 ? 308 SER B N    1 
ATOM   9514  C CA   . SER B 1 308 ? -6.474  -14.870 -67.286 1.00 32.57 ? 308 SER B CA   1 
ATOM   9515  C C    . SER B 1 308 ? -6.266  -16.355 -67.015 1.00 32.65 ? 308 SER B C    1 
ATOM   9516  O O    . SER B 1 308 ? -6.895  -17.202 -67.659 1.00 27.97 ? 308 SER B O    1 
ATOM   9517  C CB   . SER B 1 308 ? -5.340  -14.323 -68.140 1.00 36.96 ? 308 SER B CB   1 
ATOM   9518  O OG   . SER B 1 308 ? -4.990  -15.250 -69.155 1.00 38.39 ? 308 SER B OG   1 
ATOM   9519  H H    . SER B 1 308 ? -5.954  -13.524 -65.937 1.00 32.88 ? 308 SER B H    1 
ATOM   9520  H HA   . SER B 1 308 ? -7.298  -14.773 -67.789 1.00 39.07 ? 308 SER B HA   1 
ATOM   9521  H HB2  . SER B 1 308 ? -5.626  -13.493 -68.554 1.00 44.33 ? 308 SER B HB2  1 
ATOM   9522  H HB3  . SER B 1 308 ? -4.567  -14.164 -67.576 1.00 44.33 ? 308 SER B HB3  1 
ATOM   9523  H HG   . SER B 1 308 ? -4.364  -14.941 -69.622 1.00 46.05 ? 308 SER B HG   1 
ATOM   9524  N N    . ILE B 1 309 ? -5.406  -16.696 -66.056 1.00 26.02 ? 309 ILE B N    1 
ATOM   9525  C CA   . ILE B 1 309 ? -5.195  -18.092 -65.699 1.00 25.36 ? 309 ILE B CA   1 
ATOM   9526  C C    . ILE B 1 309 ? -6.449  -18.682 -65.080 1.00 25.99 ? 309 ILE B C    1 
ATOM   9527  O O    . ILE B 1 309 ? -6.824  -19.829 -65.364 1.00 26.24 ? 309 ILE B O    1 
ATOM   9528  C CB   . ILE B 1 309 ? -3.988  -18.212 -64.743 1.00 29.03 ? 309 ILE B CB   1 
ATOM   9529  C CG1  . ILE B 1 309 ? -2.705  -17.874 -65.489 1.00 29.05 ? 309 ILE B CG1  1 
ATOM   9530  C CG2  . ILE B 1 309 ? -3.896  -19.608 -64.169 1.00 31.74 ? 309 ILE B CG2  1 
ATOM   9531  C CD1  . ILE B 1 309 ? -1.499  -17.572 -64.591 1.00 39.14 ? 309 ILE B CD1  1 
ATOM   9532  H H    . ILE B 1 309 ? -4.934  -16.138 -65.601 1.00 31.20 ? 309 ILE B H    1 
ATOM   9533  H HA   . ILE B 1 309 ? -4.992  -18.596 -66.502 1.00 30.41 ? 309 ILE B HA   1 
ATOM   9534  H HB   . ILE B 1 309 ? -4.103  -17.581 -64.014 1.00 34.81 ? 309 ILE B HB   1 
ATOM   9535  H HG12 . ILE B 1 309 ? -2.468  -18.626 -66.054 1.00 34.84 ? 309 ILE B HG12 1 
ATOM   9536  H HG13 . ILE B 1 309 ? -2.864  -17.090 -66.038 1.00 34.84 ? 309 ILE B HG13 1 
ATOM   9537  H HG21 . ILE B 1 309 ? -3.131  -19.655 -63.574 1.00 38.06 ? 309 ILE B HG21 1 
ATOM   9538  H HG22 . ILE B 1 309 ? -4.710  -19.802 -63.678 1.00 38.06 ? 309 ILE B HG22 1 
ATOM   9539  H HG23 . ILE B 1 309 ? -3.789  -20.242 -64.896 1.00 38.06 ? 309 ILE B HG23 1 
ATOM   9540  H HD11 . ILE B 1 309 ? -0.733  -17.369 -65.150 1.00 46.95 ? 309 ILE B HD11 1 
ATOM   9541  H HD12 . ILE B 1 309 ? -1.709  -16.811 -64.027 1.00 46.95 ? 309 ILE B HD12 1 
ATOM   9542  H HD13 . ILE B 1 309 ? -1.313  -18.350 -64.043 1.00 46.95 ? 309 ILE B HD13 1 
ATOM   9543  N N    . LEU B 1 310 ? -7.085  -17.940 -64.179 1.00 26.74 ? 310 LEU B N    1 
ATOM   9544  C CA   . LEU B 1 310 ? -8.226  -18.497 -63.480 1.00 30.20 ? 310 LEU B CA   1 
ATOM   9545  C C    . LEU B 1 310 ? -9.392  -18.724 -64.431 1.00 30.51 ? 310 LEU B C    1 
ATOM   9546  O O    . LEU B 1 310 ? -10.124 -19.700 -64.271 1.00 26.30 ? 310 LEU B O    1 
ATOM   9547  C CB   . LEU B 1 310 ? -8.624  -17.594 -62.322 1.00 32.31 ? 310 LEU B CB   1 
ATOM   9548  C CG   . LEU B 1 310 ? -7.521  -17.511 -61.236 1.00 26.95 ? 310 LEU B CG   1 
ATOM   9549  C CD1  . LEU B 1 310 ? -7.905  -16.492 -60.171 1.00 27.14 ? 310 LEU B CD1  1 
ATOM   9550  C CD2  . LEU B 1 310 ? -7.246  -18.891 -60.619 1.00 29.65 ? 310 LEU B CD2  1 
ATOM   9551  H H    . LEU B 1 310 ? -6.881  -17.133 -63.961 1.00 32.06 ? 310 LEU B H    1 
ATOM   9552  H HA   . LEU B 1 310 ? -7.974  -19.358 -63.110 1.00 36.22 ? 310 LEU B HA   1 
ATOM   9553  H HB2  . LEU B 1 310 ? -8.783  -16.698 -62.659 1.00 38.75 ? 310 LEU B HB2  1 
ATOM   9554  H HB3  . LEU B 1 310 ? -9.429  -17.943 -61.909 1.00 38.75 ? 310 LEU B HB3  1 
ATOM   9555  H HG   . LEU B 1 310 ? -6.699  -17.207 -61.651 1.00 32.32 ? 310 LEU B HG   1 
ATOM   9556  H HD11 . LEU B 1 310 ? -7.204  -16.455 -59.502 1.00 32.54 ? 310 LEU B HD11 1 
ATOM   9557  H HD12 . LEU B 1 310 ? -8.009  -15.623 -60.590 1.00 32.54 ? 310 LEU B HD12 1 
ATOM   9558  H HD13 . LEU B 1 310 ? -8.741  -16.764 -59.761 1.00 32.54 ? 310 LEU B HD13 1 
ATOM   9559  H HD21 . LEU B 1 310 ? -6.554  -18.803 -59.945 1.00 35.56 ? 310 LEU B HD21 1 
ATOM   9560  H HD22 . LEU B 1 310 ? -8.063  -19.223 -60.213 1.00 35.56 ? 310 LEU B HD22 1 
ATOM   9561  H HD23 . LEU B 1 310 ? -6.954  -19.496 -61.318 1.00 35.56 ? 310 LEU B HD23 1 
ATOM   9562  N N    . GLN B 1 311 ? -9.559  -17.872 -65.439 1.00 29.95 ? 311 GLN B N    1 
ATOM   9563  C CA   . GLN B 1 311 ? -10.591 -18.145 -66.438 1.00 32.29 ? 311 GLN B CA   1 
ATOM   9564  C C    . GLN B 1 311 ? -10.323 -19.475 -67.125 1.00 25.75 ? 311 GLN B C    1 
ATOM   9565  O O    . GLN B 1 311 ? -11.218 -20.317 -67.250 1.00 30.21 ? 311 GLN B O    1 
ATOM   9566  C CB   . GLN B 1 311 ? -10.663 -17.014 -67.470 1.00 40.68 ? 311 GLN B CB   1 
ATOM   9567  C CG   . GLN B 1 311 ? -11.296 -15.735 -66.948 1.00 44.18 ? 311 GLN B CG   1 
ATOM   9568  C CD   . GLN B 1 311 ? -11.290 -14.600 -67.967 1.00 46.79 ? 311 GLN B CD   1 
ATOM   9569  O OE1  . GLN B 1 311 ? -10.290 -13.900 -68.134 1.00 47.26 ? 311 GLN B OE1  1 
ATOM   9570  N NE2  . GLN B 1 311 ? -12.419 -14.397 -68.630 1.00 42.97 ? 311 GLN B NE2  1 
ATOM   9571  H H    . GLN B 1 311 ? -9.105  -17.153 -65.567 1.00 35.91 ? 311 GLN B H    1 
ATOM   9572  H HA   . GLN B 1 311 ? -11.452 -18.203 -65.995 1.00 38.72 ? 311 GLN B HA   1 
ATOM   9573  H HB2  . GLN B 1 311 ? -9.762  -16.801 -67.760 1.00 48.79 ? 311 GLN B HB2  1 
ATOM   9574  H HB3  . GLN B 1 311 ? -11.188 -17.317 -68.227 1.00 48.79 ? 311 GLN B HB3  1 
ATOM   9575  H HG2  . GLN B 1 311 ? -12.218 -15.916 -66.708 1.00 52.99 ? 311 GLN B HG2  1 
ATOM   9576  H HG3  . GLN B 1 311 ? -10.804 -15.437 -66.167 1.00 52.99 ? 311 GLN B HG3  1 
ATOM   9577  H HE21 . GLN B 1 311 ? -13.100 -14.902 -68.485 1.00 51.54 ? 311 GLN B HE21 1 
ATOM   9578  H HE22 . GLN B 1 311 ? -12.468 -13.768 -69.214 1.00 51.54 ? 311 GLN B HE22 1 
ATOM   9579  N N    . HIS B 1 312 ? -9.094  -19.676 -67.591 1.00 31.04 ? 312 HIS B N    1 
ATOM   9580  C CA   . HIS B 1 312 ? -8.744  -20.928 -68.254 1.00 28.80 ? 312 HIS B CA   1 
ATOM   9581  C C    . HIS B 1 312 ? -9.104  -22.127 -67.389 1.00 34.87 ? 312 HIS B C    1 
ATOM   9582  O O    . HIS B 1 312 ? -9.727  -23.086 -67.850 1.00 34.35 ? 312 HIS B O    1 
ATOM   9583  C CB   . HIS B 1 312 ? -7.270  -20.925 -68.570 1.00 26.23 ? 312 HIS B CB   1 
ATOM   9584  C CG   . HIS B 1 312 ? -6.782  -22.164 -69.248 1.00 35.94 ? 312 HIS B CG   1 
ATOM   9585  N ND1  . HIS B 1 312 ? -7.247  -22.576 -70.480 1.00 30.05 ? 312 HIS B ND1  1 
ATOM   9586  C CD2  . HIS B 1 312 ? -5.833  -23.059 -68.886 1.00 34.05 ? 312 HIS B CD2  1 
ATOM   9587  C CE1  . HIS B 1 312 ? -6.619  -23.683 -70.838 1.00 39.49 ? 312 HIS B CE1  1 
ATOM   9588  N NE2  . HIS B 1 312 ? -5.752  -23.994 -69.892 1.00 41.26 ? 312 HIS B NE2  1 
ATOM   9589  H H    . HIS B 1 312 ? -8.449  -19.109 -67.536 1.00 37.22 ? 312 HIS B H    1 
ATOM   9590  H HA   . HIS B 1 312 ? -9.235  -20.996 -69.089 1.00 34.54 ? 312 HIS B HA   1 
ATOM   9591  H HB2  . HIS B 1 312 ? -7.079  -20.175 -69.155 1.00 31.46 ? 312 HIS B HB2  1 
ATOM   9592  H HB3  . HIS B 1 312 ? -6.775  -20.828 -67.741 1.00 31.46 ? 312 HIS B HB3  1 
ATOM   9593  H HD2  . HIS B 1 312 ? -5.331  -23.045 -68.103 1.00 40.84 ? 312 HIS B HD2  1 
ATOM   9594  H HE1  . HIS B 1 312 ? -6.761  -24.159 -71.624 1.00 47.37 ? 312 HIS B HE1  1 
ATOM   9595  H HE2  . HIS B 1 312 ? -5.230  -24.678 -69.898 1.00 49.49 ? 312 HIS B HE2  1 
ATOM   9596  N N    . LYS B 1 313 ? -8.741  -22.078 -66.119 1.00 30.12 ? 313 LYS B N    1 
ATOM   9597  C CA   . LYS B 1 313 ? -9.041  -23.166 -65.205 1.00 30.50 ? 313 LYS B CA   1 
ATOM   9598  C C    . LYS B 1 313 ? -10.492 -23.186 -64.727 1.00 31.36 ? 313 LYS B C    1 
ATOM   9599  O O    . LYS B 1 313 ? -10.887 -24.146 -64.051 1.00 33.11 ? 313 LYS B O    1 
ATOM   9600  C CB   . LYS B 1 313 ? -8.081  -23.069 -64.013 1.00 30.60 ? 313 LYS B CB   1 
ATOM   9601  C CG   . LYS B 1 313 ? -6.640  -23.203 -64.467 1.00 32.47 ? 313 LYS B CG   1 
ATOM   9602  C CD   . LYS B 1 313 ? -5.652  -22.932 -63.360 1.00 43.16 ? 313 LYS B CD   1 
ATOM   9603  C CE   . LYS B 1 313 ? -4.254  -23.366 -63.755 1.00 47.52 ? 313 LYS B CE   1 
ATOM   9604  N NZ   . LYS B 1 313 ? -4.188  -24.831 -64.066 1.00 49.23 ? 313 LYS B NZ   1 
ATOM   9605  H H    . LYS B 1 313 ? -8.319  -21.422 -65.759 1.00 36.13 ? 313 LYS B H    1 
ATOM   9606  H HA   . LYS B 1 313 ? -8.868  -24.008 -65.656 1.00 36.57 ? 313 LYS B HA   1 
ATOM   9607  H HB2  . LYS B 1 313 ? -8.188  -22.206 -63.583 1.00 36.70 ? 313 LYS B HB2  1 
ATOM   9608  H HB3  . LYS B 1 313 ? -8.272  -23.785 -63.386 1.00 36.70 ? 313 LYS B HB3  1 
ATOM   9609  H HG2  . LYS B 1 313 ? -6.492  -24.106 -64.787 1.00 38.94 ? 313 LYS B HG2  1 
ATOM   9610  H HG3  . LYS B 1 313 ? -6.473  -22.567 -65.180 1.00 38.94 ? 313 LYS B HG3  1 
ATOM   9611  H HD2  . LYS B 1 313 ? -5.634  -21.981 -63.171 1.00 51.77 ? 313 LYS B HD2  1 
ATOM   9612  H HD3  . LYS B 1 313 ? -5.914  -23.428 -62.568 1.00 51.77 ? 313 LYS B HD3  1 
ATOM   9613  H HE2  . LYS B 1 313 ? -3.979  -22.876 -64.545 1.00 57.00 ? 313 LYS B HE2  1 
ATOM   9614  H HE3  . LYS B 1 313 ? -3.645  -23.186 -63.021 1.00 57.00 ? 313 LYS B HE3  1 
ATOM   9615  H HZ1  . LYS B 1 313 ? -3.358  -25.056 -64.294 1.00 59.05 ? 313 LYS B HZ1  1 
ATOM   9616  H HZ2  . LYS B 1 313 ? -4.431  -25.305 -63.353 1.00 59.05 ? 313 LYS B HZ2  1 
ATOM   9617  H HZ3  . LYS B 1 313 ? -4.735  -25.023 -64.741 1.00 59.05 ? 313 LYS B HZ3  1 
ATOM   9618  N N    . GLY B 1 314 ? -11.290 -22.168 -65.045 1.00 32.81 ? 314 GLY B N    1 
ATOM   9619  C CA   . GLY B 1 314 ? -12.666 -22.115 -64.572 1.00 29.26 ? 314 GLY B CA   1 
ATOM   9620  C C    . GLY B 1 314 ? -12.814 -21.878 -63.092 1.00 35.38 ? 314 GLY B C    1 
ATOM   9621  O O    . GLY B 1 314 ? -13.804 -22.328 -62.481 1.00 29.85 ? 314 GLY B O    1 
ATOM   9622  H H    . GLY B 1 314 ? -11.057 -21.499 -65.532 1.00 39.35 ? 314 GLY B H    1 
ATOM   9623  H HA2  . GLY B 1 314 ? -13.132 -21.403 -65.037 1.00 35.08 ? 314 GLY B HA2  1 
ATOM   9624  H HA3  . GLY B 1 314 ? -13.106 -22.952 -64.787 1.00 35.08 ? 314 GLY B HA3  1 
ATOM   9625  N N    . LEU B 1 315 ? -11.862 -21.160 -62.495 1.00 32.64 ? 315 LEU B N    1 
ATOM   9626  C CA   . LEU B 1 315 ? -11.792 -20.992 -61.048 1.00 34.97 ? 315 LEU B CA   1 
ATOM   9627  C C    . LEU B 1 315 ? -11.867 -19.532 -60.617 1.00 35.22 ? 315 LEU B C    1 
ATOM   9628  O O    . LEU B 1 315 ? -11.510 -19.218 -59.474 1.00 29.54 ? 315 LEU B O    1 
ATOM   9629  C CB   . LEU B 1 315 ? -10.505 -21.640 -60.520 1.00 29.92 ? 315 LEU B CB   1 
ATOM   9630  C CG   . LEU B 1 315 ? -10.522 -23.166 -60.627 1.00 32.35 ? 315 LEU B CG   1 
ATOM   9631  C CD1  . LEU B 1 315 ? -9.169  -23.746 -60.302 1.00 27.79 ? 315 LEU B CD1  1 
ATOM   9632  C CD2  . LEU B 1 315 ? -11.618 -23.765 -59.703 1.00 32.51 ? 315 LEU B CD2  1 
ATOM   9633  H H    . LEU B 1 315 ? -11.233 -20.753 -62.918 1.00 39.15 ? 315 LEU B H    1 
ATOM   9634  H HA   . LEU B 1 315 ? -12.543 -21.456 -60.645 1.00 41.95 ? 315 LEU B HA   1 
ATOM   9635  H HB2  . LEU B 1 315 ? -9.752  -21.312 -61.036 1.00 35.88 ? 315 LEU B HB2  1 
ATOM   9636  H HB3  . LEU B 1 315 ? -10.394 -21.406 -59.586 1.00 35.88 ? 315 LEU B HB3  1 
ATOM   9637  H HG   . LEU B 1 315 ? -10.738 -23.412 -61.540 1.00 38.80 ? 315 LEU B HG   1 
ATOM   9638  H HD11 . LEU B 1 315 ? -9.213  -24.712 -60.379 1.00 33.32 ? 315 LEU B HD11 1 
ATOM   9639  H HD12 . LEU B 1 315 ? -8.516  -23.393 -60.928 1.00 33.32 ? 315 LEU B HD12 1 
ATOM   9640  H HD13 . LEU B 1 315 ? -8.927  -23.496 -59.397 1.00 33.32 ? 315 LEU B HD13 1 
ATOM   9641  H HD21 . LEU B 1 315 ? -11.609 -24.731 -59.788 1.00 38.98 ? 315 LEU B HD21 1 
ATOM   9642  H HD22 . LEU B 1 315 ? -11.431 -23.511 -58.786 1.00 38.98 ? 315 LEU B HD22 1 
ATOM   9643  H HD23 . LEU B 1 315 ? -12.483 -23.417 -59.973 1.00 38.98 ? 315 LEU B HD23 1 
ATOM   9644  N N    . VAL B 1 316 ? -12.326 -18.630 -61.499 1.00 29.25 ? 316 VAL B N    1 
ATOM   9645  C CA   . VAL B 1 316 ? -12.427 -17.221 -61.117 1.00 31.34 ? 316 VAL B CA   1 
ATOM   9646  C C    . VAL B 1 316 ? -13.101 -17.077 -59.759 1.00 32.91 ? 316 VAL B C    1 
ATOM   9647  O O    . VAL B 1 316 ? -12.641 -16.313 -58.898 1.00 33.16 ? 316 VAL B O    1 
ATOM   9648  C CB   . VAL B 1 316 ? -13.157 -16.409 -62.202 1.00 27.80 ? 316 VAL B CB   1 
ATOM   9649  C CG1  . VAL B 1 316 ? -13.491 -14.992 -61.722 1.00 36.16 ? 316 VAL B CG1  1 
ATOM   9650  C CG2  . VAL B 1 316 ? -12.294 -16.323 -63.427 1.00 29.81 ? 316 VAL B CG2  1 
ATOM   9651  H H    . VAL B 1 316 ? -12.578 -18.806 -62.302 1.00 35.08 ? 316 VAL B H    1 
ATOM   9652  H HA   . VAL B 1 316 ? -11.531 -16.860 -61.037 1.00 37.59 ? 316 VAL B HA   1 
ATOM   9653  H HB   . VAL B 1 316 ? -13.984 -16.856 -62.440 1.00 33.34 ? 316 VAL B HB   1 
ATOM   9654  H HG11 . VAL B 1 316 ? -13.948 -14.517 -62.434 1.00 43.36 ? 316 VAL B HG11 1 
ATOM   9655  H HG12 . VAL B 1 316 ? -14.064 -15.051 -60.942 1.00 43.36 ? 316 VAL B HG12 1 
ATOM   9656  H HG13 . VAL B 1 316 ? -12.667 -14.534 -61.494 1.00 43.36 ? 316 VAL B HG13 1 
ATOM   9657  H HG21 . VAL B 1 316 ? -12.759 -15.810 -64.106 1.00 35.75 ? 316 VAL B HG21 1 
ATOM   9658  H HG22 . VAL B 1 316 ? -11.460 -15.885 -63.195 1.00 35.75 ? 316 VAL B HG22 1 
ATOM   9659  H HG23 . VAL B 1 316 ? -12.118 -17.220 -63.752 1.00 35.75 ? 316 VAL B HG23 1 
ATOM   9660  N N    . ASP B 1 317 ? -14.201 -17.796 -59.540 1.00 29.44 ? 317 ASP B N    1 
ATOM   9661  C CA   . ASP B 1 317 ? -14.996 -17.547 -58.346 1.00 31.29 ? 317 ASP B CA   1 
ATOM   9662  C C    . ASP B 1 317 ? -14.353 -18.121 -57.086 1.00 27.57 ? 317 ASP B C    1 
ATOM   9663  O O    . ASP B 1 317 ? -14.879 -17.934 -55.990 1.00 35.94 ? 317 ASP B O    1 
ATOM   9664  C CB   . ASP B 1 317 ? -16.442 -18.070 -58.530 1.00 41.73 ? 317 ASP B CB   1 
ATOM   9665  C CG   . ASP B 1 317 ? -16.540 -19.599 -58.714 1.00 56.45 ? 317 ASP B CG   1 
ATOM   9666  O OD1  . ASP B 1 317 ? -15.524 -20.329 -58.660 1.00 52.26 ? 317 ASP B OD1  1 
ATOM   9667  O OD2  . ASP B 1 317 ? -17.679 -20.079 -58.921 1.00 66.03 ? 317 ASP B OD2  1 
ATOM   9668  H H    . ASP B 1 317 ? -14.499 -18.418 -60.054 1.00 35.31 ? 317 ASP B H    1 
ATOM   9669  H HA   . ASP B 1 317 ? -15.055 -16.587 -58.221 1.00 37.53 ? 317 ASP B HA   1 
ATOM   9670  H HB2  . ASP B 1 317 ? -16.961 -17.832 -57.746 1.00 50.06 ? 317 ASP B HB2  1 
ATOM   9671  H HB3  . ASP B 1 317 ? -16.826 -17.653 -59.317 1.00 50.06 ? 317 ASP B HB3  1 
ATOM   9672  N N    . LYS B 1 318 ? -13.227 -18.790 -57.205 1.00 30.48 ? 318 LYS B N    1 
ATOM   9673  C CA   . LYS B 1 318 ? -12.521 -19.287 -56.040 1.00 29.46 ? 318 LYS B CA   1 
ATOM   9674  C C    . LYS B 1 318 ? -11.590 -18.251 -55.435 1.00 23.98 ? 318 LYS B C    1 
ATOM   9675  O O    . LYS B 1 318 ? -11.098 -18.471 -54.325 1.00 25.58 ? 318 LYS B O    1 
ATOM   9676  C CB   . LYS B 1 318 ? -11.703 -20.523 -56.407 1.00 31.73 ? 318 LYS B CB   1 
ATOM   9677  C CG   . LYS B 1 318 ? -12.257 -21.809 -55.837 1.00 46.82 ? 318 LYS B CG   1 
ATOM   9678  C CD   . LYS B 1 318 ? -13.662 -22.085 -56.354 1.00 47.86 ? 318 LYS B CD   1 
ATOM   9679  C CE   . LYS B 1 318 ? -14.094 -23.515 -56.062 1.00 63.53 ? 318 LYS B CE   1 
ATOM   9680  N NZ   . LYS B 1 318 ? -13.141 -24.527 -56.639 1.00 68.19 ? 318 LYS B NZ   1 
ATOM   9681  H H    . LYS B 1 318 ? -12.844 -18.973 -57.954 1.00 36.56 ? 318 LYS B H    1 
ATOM   9682  H HA   . LYS B 1 318 ? -13.167 -19.543 -55.363 1.00 35.33 ? 318 LYS B HA   1 
ATOM   9683  H HB2  . LYS B 1 318 ? -11.684 -20.610 -57.373 1.00 38.05 ? 318 LYS B HB2  1 
ATOM   9684  H HB3  . LYS B 1 318 ? -10.801 -20.413 -56.068 1.00 38.05 ? 318 LYS B HB3  1 
ATOM   9685  H HG2  . LYS B 1 318 ? -11.686 -22.548 -56.100 1.00 56.16 ? 318 LYS B HG2  1 
ATOM   9686  H HG3  . LYS B 1 318 ? -12.296 -21.741 -54.871 1.00 56.16 ? 318 LYS B HG3  1 
ATOM   9687  H HD2  . LYS B 1 318 ? -14.287 -21.484 -55.919 1.00 57.41 ? 318 LYS B HD2  1 
ATOM   9688  H HD3  . LYS B 1 318 ? -13.682 -21.951 -57.315 1.00 57.41 ? 318 LYS B HD3  1 
ATOM   9689  H HE2  . LYS B 1 318 ? -14.128 -23.646 -55.102 1.00 76.21 ? 318 LYS B HE2  1 
ATOM   9690  H HE3  . LYS B 1 318 ? -14.969 -23.668 -56.452 1.00 76.21 ? 318 LYS B HE3  1 
ATOM   9691  H HZ1  . LYS B 1 318 ? -13.422 -25.350 -56.451 1.00 81.81 ? 318 LYS B HZ1  1 
ATOM   9692  H HZ2  . LYS B 1 318 ? -13.095 -24.432 -57.523 1.00 81.81 ? 318 LYS B HZ2  1 
ATOM   9693  H HZ3  . LYS B 1 318 ? -12.330 -24.412 -56.293 1.00 81.81 ? 318 LYS B HZ3  1 
ATOM   9694  N N    . PHE B 1 319 ? -11.321 -17.155 -56.148 1.00 23.29 ? 319 PHE B N    1 
ATOM   9695  C CA   . PHE B 1 319 ? -10.329 -16.156 -55.743 1.00 24.74 ? 319 PHE B CA   1 
ATOM   9696  C C    . PHE B 1 319 ? -10.932 -14.752 -55.747 1.00 21.27 ? 319 PHE B C    1 
ATOM   9697  O O    . PHE B 1 319 ? -10.493 -13.875 -56.491 1.00 21.07 ? 319 PHE B O    1 
ATOM   9698  C CB   . PHE B 1 319 ? -9.108  -16.238 -56.661 1.00 20.90 ? 319 PHE B CB   1 
ATOM   9699  C CG   . PHE B 1 319 ? -8.376  -17.544 -56.546 1.00 23.11 ? 319 PHE B CG   1 
ATOM   9700  C CD1  . PHE B 1 319 ? -8.839  -18.684 -57.177 1.00 19.45 ? 319 PHE B CD1  1 
ATOM   9701  C CD2  . PHE B 1 319 ? -7.253  -17.636 -55.764 1.00 23.38 ? 319 PHE B CD2  1 
ATOM   9702  C CE1  . PHE B 1 319 ? -8.189  -19.879 -57.046 1.00 23.35 ? 319 PHE B CE1  1 
ATOM   9703  C CE2  . PHE B 1 319 ? -6.595  -18.826 -55.622 1.00 22.58 ? 319 PHE B CE2  1 
ATOM   9704  C CZ   . PHE B 1 319 ? -7.057  -19.960 -56.248 1.00 20.58 ? 319 PHE B CZ   1 
ATOM   9705  H H    . PHE B 1 319 ? -11.712 -16.964 -56.890 1.00 27.92 ? 319 PHE B H    1 
ATOM   9706  H HA   . PHE B 1 319 ? -10.037 -16.352 -54.839 1.00 29.67 ? 319 PHE B HA   1 
ATOM   9707  H HB2  . PHE B 1 319 ? -9.397  -16.137 -57.582 1.00 25.05 ? 319 PHE B HB2  1 
ATOM   9708  H HB3  . PHE B 1 319 ? -8.490  -15.527 -56.429 1.00 25.05 ? 319 PHE B HB3  1 
ATOM   9709  H HD1  . PHE B 1 319 ? -9.605  -18.636 -57.702 1.00 23.32 ? 319 PHE B HD1  1 
ATOM   9710  H HD2  . PHE B 1 319 ? -6.936  -16.880 -55.324 1.00 28.03 ? 319 PHE B HD2  1 
ATOM   9711  H HE1  . PHE B 1 319 ? -8.510  -20.636 -57.481 1.00 28.00 ? 319 PHE B HE1  1 
ATOM   9712  H HE2  . PHE B 1 319 ? -5.832  -18.870 -55.092 1.00 27.07 ? 319 PHE B HE2  1 
ATOM   9713  H HZ   . PHE B 1 319 ? -6.600  -20.765 -56.162 1.00 24.67 ? 319 PHE B HZ   1 
ATOM   9714  N N    . PRO B 1 320 ? -11.903 -14.483 -54.874 1.00 21.81 ? 320 PRO B N    1 
ATOM   9715  C CA   . PRO B 1 320 ? -12.573 -13.163 -54.941 1.00 23.16 ? 320 PRO B CA   1 
ATOM   9716  C C    . PRO B 1 320 ? -11.692 -11.991 -54.554 1.00 21.03 ? 320 PRO B C    1 
ATOM   9717  O O    . PRO B 1 320 ? -11.921 -10.880 -55.041 1.00 19.68 ? 320 PRO B O    1 
ATOM   9718  C CB   . PRO B 1 320 ? -13.763 -13.304 -53.982 1.00 23.81 ? 320 PRO B CB   1 
ATOM   9719  C CG   . PRO B 1 320 ? -13.484 -14.504 -53.152 1.00 24.73 ? 320 PRO B CG   1 
ATOM   9720  C CD   . PRO B 1 320 ? -12.585 -15.406 -53.946 1.00 21.67 ? 320 PRO B CD   1 
ATOM   9721  H HA   . PRO B 1 320 ? -12.912 -13.014 -55.838 1.00 27.77 ? 320 PRO B HA   1 
ATOM   9722  H HB2  . PRO B 1 320 ? -13.826 -12.512 -53.424 1.00 28.55 ? 320 PRO B HB2  1 
ATOM   9723  H HB3  . PRO B 1 320 ? -14.578 -13.426 -54.493 1.00 28.55 ? 320 PRO B HB3  1 
ATOM   9724  H HG2  . PRO B 1 320 ? -13.045 -14.230 -52.332 1.00 29.65 ? 320 PRO B HG2  1 
ATOM   9725  H HG3  . PRO B 1 320 ? -14.319 -14.955 -52.952 1.00 29.65 ? 320 PRO B HG3  1 
ATOM   9726  H HD2  . PRO B 1 320 ? -11.940 -15.837 -53.364 1.00 25.99 ? 320 PRO B HD2  1 
ATOM   9727  H HD3  . PRO B 1 320 ? -13.109 -16.055 -54.441 1.00 25.99 ? 320 PRO B HD3  1 
ATOM   9728  N N    . LEU B 1 321 ? -10.704 -12.174 -53.680 1.00 23.03 ? 321 LEU B N    1 
ATOM   9729  C CA   . LEU B 1 321 ? -9.836  -11.043 -53.345 1.00 21.64 ? 321 LEU B CA   1 
ATOM   9730  C C    . LEU B 1 321 ? -8.957  -10.673 -54.541 1.00 18.74 ? 321 LEU B C    1 
ATOM   9731  O O    . LEU B 1 321 ? -8.923  -9.510  -54.967 1.00 20.01 ? 321 LEU B O    1 
ATOM   9732  C CB   . LEU B 1 321 ? -8.991  -11.375 -52.111 1.00 20.35 ? 321 LEU B CB   1 
ATOM   9733  C CG   . LEU B 1 321 ? -8.230  -10.229 -51.433 1.00 22.25 ? 321 LEU B CG   1 
ATOM   9734  C CD1  . LEU B 1 321 ? -7.973  -10.539 -49.967 1.00 22.95 ? 321 LEU B CD1  1 
ATOM   9735  C CD2  . LEU B 1 321 ? -6.916  -9.946  -52.130 1.00 22.71 ? 321 LEU B CD2  1 
ATOM   9736  H H    . LEU B 1 321 ? -10.518 -12.912 -53.280 1.00 27.62 ? 321 LEU B H    1 
ATOM   9737  H HA   . LEU B 1 321 ? -10.388 -10.274 -53.132 1.00 25.95 ? 321 LEU B HA   1 
ATOM   9738  H HB2  . LEU B 1 321 ? -9.578  -11.759 -51.442 1.00 24.40 ? 321 LEU B HB2  1 
ATOM   9739  H HB3  . LEU B 1 321 ? -8.331  -12.037 -52.371 1.00 24.40 ? 321 LEU B HB3  1 
ATOM   9740  H HG   . LEU B 1 321 ? -8.770  -9.424  -51.477 1.00 26.68 ? 321 LEU B HG   1 
ATOM   9741  H HD11 . LEU B 1 321 ? -7.492  -9.798  -49.567 1.00 27.51 ? 321 LEU B HD11 1 
ATOM   9742  H HD12 . LEU B 1 321 ? -8.823  -10.663 -49.517 1.00 27.51 ? 321 LEU B HD12 1 
ATOM   9743  H HD13 . LEU B 1 321 ? -7.444  -11.350 -49.904 1.00 27.51 ? 321 LEU B HD13 1 
ATOM   9744  H HD21 . LEU B 1 321 ? -6.467  -9.218  -51.673 1.00 27.23 ? 321 LEU B HD21 1 
ATOM   9745  H HD22 . LEU B 1 321 ? -6.366  -10.745 -52.102 1.00 27.23 ? 321 LEU B HD22 1 
ATOM   9746  H HD23 . LEU B 1 321 ? -7.094  -9.700  -53.051 1.00 27.23 ? 321 LEU B HD23 1 
ATOM   9747  N N    . PHE B 1 322 ? -8.243  -11.656 -55.105 1.00 17.96 ? 322 PHE B N    1 
ATOM   9748  C CA   . PHE B 1 322 ? -7.474  -11.415 -56.326 1.00 18.50 ? 322 PHE B CA   1 
ATOM   9749  C C    . PHE B 1 322 ? -8.354  -10.812 -57.425 1.00 21.97 ? 322 PHE B C    1 
ATOM   9750  O O    . PHE B 1 322 ? -7.956  -9.879  -58.141 1.00 20.62 ? 322 PHE B O    1 
ATOM   9751  C CB   . PHE B 1 322 ? -6.865  -12.716 -56.867 1.00 18.18 ? 322 PHE B CB   1 
ATOM   9752  C CG   . PHE B 1 322 ? -5.726  -13.283 -56.054 1.00 16.19 ? 322 PHE B CG   1 
ATOM   9753  C CD1  . PHE B 1 322 ? -5.087  -12.561 -55.049 1.00 19.25 ? 322 PHE B CD1  1 
ATOM   9754  C CD2  . PHE B 1 322 ? -5.317  -14.572 -56.294 1.00 18.29 ? 322 PHE B CD2  1 
ATOM   9755  C CE1  . PHE B 1 322 ? -4.052  -13.140 -54.319 1.00 16.58 ? 322 PHE B CE1  1 
ATOM   9756  C CE2  . PHE B 1 322 ? -4.265  -15.141 -55.598 1.00 18.28 ? 322 PHE B CE2  1 
ATOM   9757  C CZ   . PHE B 1 322 ? -3.635  -14.434 -54.602 1.00 16.93 ? 322 PHE B CZ   1 
ATOM   9758  H H    . PHE B 1 322 ? -8.189  -12.460 -54.804 1.00 21.53 ? 322 PHE B H    1 
ATOM   9759  H HA   . PHE B 1 322 ? -6.753  -10.794 -56.136 1.00 22.17 ? 322 PHE B HA   1 
ATOM   9760  H HB2  . PHE B 1 322 ? -7.562  -13.390 -56.903 1.00 21.79 ? 322 PHE B HB2  1 
ATOM   9761  H HB3  . PHE B 1 322 ? -6.529  -12.549 -57.762 1.00 21.79 ? 322 PHE B HB3  1 
ATOM   9762  H HD1  . PHE B 1 322 ? -5.358  -11.692 -54.859 1.00 23.08 ? 322 PHE B HD1  1 
ATOM   9763  H HD2  . PHE B 1 322 ? -5.729  -15.060 -56.971 1.00 21.92 ? 322 PHE B HD2  1 
ATOM   9764  H HE1  . PHE B 1 322 ? -3.623  -12.650 -53.655 1.00 19.88 ? 322 PHE B HE1  1 
ATOM   9765  H HE2  . PHE B 1 322 ? -4.006  -16.014 -55.782 1.00 21.92 ? 322 PHE B HE2  1 
ATOM   9766  H HZ   . PHE B 1 322 ? -2.941  -14.821 -54.118 1.00 20.29 ? 322 PHE B HZ   1 
ATOM   9767  N N    . MET B 1 323 ? -9.542  -11.370 -57.609 1.00 19.11 ? 323 MET B N    1 
ATOM   9768  C CA   . MET B 1 323 ? -10.364 -10.900 -58.725 1.00 22.02 ? 323 MET B CA   1 
ATOM   9769  C C    . MET B 1 323 ? -10.937 -9.513  -58.468 1.00 22.16 ? 323 MET B C    1 
ATOM   9770  O O    . MET B 1 323 ? -11.051 -8.718  -59.408 1.00 23.47 ? 323 MET B O    1 
ATOM   9771  C CB   . MET B 1 323 ? -11.452 -11.930 -59.032 1.00 25.30 ? 323 MET B CB   1 
ATOM   9772  C CG   . MET B 1 323 ? -10.840 -13.219 -59.579 1.00 27.22 ? 323 MET B CG   1 
ATOM   9773  S SD   . MET B 1 323 ? -9.775  -13.015 -61.038 1.00 29.15 ? 323 MET B SD   1 
ATOM   9774  C CE   . MET B 1 323 ? -8.092  -12.801 -60.407 1.00 26.15 ? 323 MET B CE   1 
ATOM   9775  H H    . MET B 1 323 ? -9.887  -11.994 -57.129 1.00 22.91 ? 323 MET B H    1 
ATOM   9776  H HA   . MET B 1 323 ? -9.797  -10.847 -59.510 1.00 26.41 ? 323 MET B HA   1 
ATOM   9777  H HB2  . MET B 1 323 ? -11.935 -12.142 -58.217 1.00 30.33 ? 323 MET B HB2  1 
ATOM   9778  H HB3  . MET B 1 323 ? -12.057 -11.570 -59.700 1.00 30.33 ? 323 MET B HB3  1 
ATOM   9779  H HG2  . MET B 1 323 ? -10.302 -13.624 -58.880 1.00 32.65 ? 323 MET B HG2  1 
ATOM   9780  H HG3  . MET B 1 323 ? -11.559 -13.821 -59.825 1.00 32.65 ? 323 MET B HG3  1 
ATOM   9781  H HE1  . MET B 1 323 ? -7.486  -12.688 -61.157 1.00 31.36 ? 323 MET B HE1  1 
ATOM   9782  H HE2  . MET B 1 323 ? -8.066  -12.016 -59.839 1.00 31.36 ? 323 MET B HE2  1 
ATOM   9783  H HE3  . MET B 1 323 ? -7.844  -13.588 -59.897 1.00 31.36 ? 323 MET B HE3  1 
ATOM   9784  N N    . ALA B 1 324 ? -11.262 -9.186  -57.216 1.00 19.67 ? 324 ALA B N    1 
ATOM   9785  C CA   . ALA B 1 324 ? -11.712 -7.829  -56.911 1.00 21.04 ? 324 ALA B CA   1 
ATOM   9786  C C    . ALA B 1 324 ? -10.606 -6.821  -57.146 1.00 27.03 ? 324 ALA B C    1 
ATOM   9787  O O    . ALA B 1 324 ? -10.874 -5.700  -57.580 1.00 20.37 ? 324 ALA B O    1 
ATOM   9788  C CB   . ALA B 1 324 ? -12.233 -7.716  -55.479 1.00 21.58 ? 324 ALA B CB   1 
ATOM   9789  H H    . ALA B 1 324 ? -11.232 -9.718  -56.541 1.00 23.59 ? 324 ALA B H    1 
ATOM   9790  H HA   . ALA B 1 324 ? -12.444 -7.605  -57.507 1.00 25.23 ? 324 ALA B HA   1 
ATOM   9791  H HB1  . ALA B 1 324 ? -12.520 -6.803  -55.318 1.00 25.87 ? 324 ALA B HB1  1 
ATOM   9792  H HB2  . ALA B 1 324 ? -12.981 -8.323  -55.367 1.00 25.87 ? 324 ALA B HB2  1 
ATOM   9793  H HB3  . ALA B 1 324 ? -11.520 -7.952  -54.864 1.00 25.87 ? 324 ALA B HB3  1 
ATOM   9794  N N    . VAL B 1 325 ? -9.353  -7.196  -56.901 1.00 20.17 ? 325 VAL B N    1 
ATOM   9795  C CA   . VAL B 1 325 ? -8.269  -6.280  -57.218 1.00 18.15 ? 325 VAL B CA   1 
ATOM   9796  C C    . VAL B 1 325 ? -8.187  -6.074  -58.729 1.00 25.39 ? 325 VAL B C    1 
ATOM   9797  O O    . VAL B 1 325 ? -8.028  -4.945  -59.216 1.00 24.43 ? 325 VAL B O    1 
ATOM   9798  C CB   . VAL B 1 325 ? -6.934  -6.796  -56.646 1.00 20.75 ? 325 VAL B CB   1 
ATOM   9799  C CG1  . VAL B 1 325 ? -5.782  -6.022  -57.251 1.00 22.76 ? 325 VAL B CG1  1 
ATOM   9800  C CG2  . VAL B 1 325 ? -6.923  -6.622  -55.130 1.00 20.54 ? 325 VAL B CG2  1 
ATOM   9801  H H    . VAL B 1 325 ? -9.111  -7.950  -56.565 1.00 24.18 ? 325 VAL B H    1 
ATOM   9802  H HA   . VAL B 1 325 ? -8.455  -5.420  -56.809 1.00 21.75 ? 325 VAL B HA   1 
ATOM   9803  H HB   . VAL B 1 325 ? -6.826  -7.737  -56.855 1.00 24.87 ? 325 VAL B HB   1 
ATOM   9804  H HG11 . VAL B 1 325 ? -4.950  -6.356  -56.883 1.00 27.29 ? 325 VAL B HG11 1 
ATOM   9805  H HG12 . VAL B 1 325 ? -5.792  -6.144  -58.214 1.00 27.29 ? 325 VAL B HG12 1 
ATOM   9806  H HG13 . VAL B 1 325 ? -5.886  -5.082  -57.036 1.00 27.29 ? 325 VAL B HG13 1 
ATOM   9807  H HG21 . VAL B 1 325 ? -6.079  -6.950  -54.782 1.00 24.63 ? 325 VAL B HG21 1 
ATOM   9808  H HG22 . VAL B 1 325 ? -7.025  -5.680  -54.920 1.00 24.63 ? 325 VAL B HG22 1 
ATOM   9809  H HG23 . VAL B 1 325 ? -7.657  -7.128  -54.749 1.00 24.63 ? 325 VAL B HG23 1 
ATOM   9810  N N    . TYR B 1 326 ? -8.303  -7.154  -59.490 1.00 21.73 ? 326 TYR B N    1 
ATOM   9811  C CA   . TYR B 1 326 ? -8.312  -7.012  -60.938 1.00 26.27 ? 326 TYR B CA   1 
ATOM   9812  C C    . TYR B 1 326 ? -9.505  -6.169  -61.394 1.00 30.15 ? 326 TYR B C    1 
ATOM   9813  O O    . TYR B 1 326 ? -9.334  -5.172  -62.104 1.00 26.02 ? 326 TYR B O    1 
ATOM   9814  C CB   . TYR B 1 326 ? -8.316  -8.386  -61.618 1.00 27.30 ? 326 TYR B CB   1 
ATOM   9815  C CG   . TYR B 1 326 ? -8.721  -8.244  -63.078 1.00 29.83 ? 326 TYR B CG   1 
ATOM   9816  C CD1  . TYR B 1 326 ? -7.858  -7.664  -63.994 1.00 32.47 ? 326 TYR B CD1  1 
ATOM   9817  C CD2  . TYR B 1 326 ? -9.986  -8.615  -63.515 1.00 36.10 ? 326 TYR B CD2  1 
ATOM   9818  C CE1  . TYR B 1 326 ? -8.221  -7.486  -65.327 1.00 37.30 ? 326 TYR B CE1  1 
ATOM   9819  C CE2  . TYR B 1 326 ? -10.364 -8.433  -64.855 1.00 39.95 ? 326 TYR B CE2  1 
ATOM   9820  C CZ   . TYR B 1 326 ? -9.469  -7.872  -65.750 1.00 37.93 ? 326 TYR B CZ   1 
ATOM   9821  O OH   . TYR B 1 326 ? -9.805  -7.683  -67.077 1.00 41.99 ? 326 TYR B OH   1 
ATOM   9822  H H    . TYR B 1 326 ? -8.377  -7.961  -59.202 1.00 26.05 ? 326 TYR B H    1 
ATOM   9823  H HA   . TYR B 1 326 ? -7.504  -6.550  -61.211 1.00 31.50 ? 326 TYR B HA   1 
ATOM   9824  H HB2  . TYR B 1 326 ? -7.425  -8.769  -61.581 1.00 32.74 ? 326 TYR B HB2  1 
ATOM   9825  H HB3  . TYR B 1 326 ? -8.955  -8.966  -61.176 1.00 32.74 ? 326 TYR B HB3  1 
ATOM   9826  H HD1  . TYR B 1 326 ? -7.011  -7.398  -63.714 1.00 38.94 ? 326 TYR B HD1  1 
ATOM   9827  H HD2  . TYR B 1 326 ? -10.588 -8.990  -62.914 1.00 43.29 ? 326 TYR B HD2  1 
ATOM   9828  H HE1  . TYR B 1 326 ? -7.621  -7.106  -65.927 1.00 44.73 ? 326 TYR B HE1  1 
ATOM   9829  H HE2  . TYR B 1 326 ? -11.208 -8.698  -65.143 1.00 47.92 ? 326 TYR B HE2  1 
ATOM   9830  H HH   . TYR B 1 326 ? -10.587 -7.955  -67.217 1.00 50.36 ? 326 TYR B HH   1 
ATOM   9831  N N    . LYS B 1 327 ? -10.722 -6.540  -60.981 1.00 24.08 ? 327 LYS B N    1 
ATOM   9832  C CA   . LYS B 1 327 ? -11.905 -5.812  -61.461 1.00 29.55 ? 327 LYS B CA   1 
ATOM   9833  C C    . LYS B 1 327 ? -11.831 -4.333  -61.104 1.00 32.18 ? 327 LYS B C    1 
ATOM   9834  O O    . LYS B 1 327 ? -12.207 -3.469  -61.907 1.00 32.48 ? 327 LYS B O    1 
ATOM   9835  C CB   . LYS B 1 327 ? -13.184 -6.392  -60.874 1.00 29.61 ? 327 LYS B CB   1 
ATOM   9836  C CG   . LYS B 1 327 ? -13.495 -7.807  -61.229 1.00 36.48 ? 327 LYS B CG   1 
ATOM   9837  C CD   . LYS B 1 327 ? -13.844 -7.994  -62.681 1.00 41.67 ? 327 LYS B CD   1 
ATOM   9838  C CE   . LYS B 1 327 ? -14.351 -9.428  -62.923 1.00 51.37 ? 327 LYS B CE   1 
ATOM   9839  N NZ   . LYS B 1 327 ? -14.687 -9.689  -64.349 1.00 54.60 ? 327 LYS B NZ   1 
ATOM   9840  H H    . LYS B 1 327 ? -10.888 -7.188  -60.440 1.00 28.88 ? 327 LYS B H    1 
ATOM   9841  H HA   . LYS B 1 327 ? -11.954 -5.888  -62.426 1.00 35.44 ? 327 LYS B HA   1 
ATOM   9842  H HB2  . LYS B 1 327 ? -13.123 -6.345  -59.907 1.00 35.51 ? 327 LYS B HB2  1 
ATOM   9843  H HB3  . LYS B 1 327 ? -13.929 -5.849  -61.175 1.00 35.51 ? 327 LYS B HB3  1 
ATOM   9844  H HG2  . LYS B 1 327 ? -12.719 -8.357  -61.036 1.00 43.76 ? 327 LYS B HG2  1 
ATOM   9845  H HG3  . LYS B 1 327 ? -14.251 -8.104  -60.700 1.00 43.76 ? 327 LYS B HG3  1 
ATOM   9846  H HD2  . LYS B 1 327 ? -14.546 -7.373  -62.928 1.00 49.99 ? 327 LYS B HD2  1 
ATOM   9847  H HD3  . LYS B 1 327 ? -13.054 -7.850  -63.226 1.00 49.99 ? 327 LYS B HD3  1 
ATOM   9848  H HE2  . LYS B 1 327 ? -13.660 -10.056 -62.658 1.00 61.62 ? 327 LYS B HE2  1 
ATOM   9849  H HE3  . LYS B 1 327 ? -15.151 -9.574  -62.395 1.00 61.62 ? 327 LYS B HE3  1 
ATOM   9850  H HZ1  . LYS B 1 327 ? -14.975 -10.525 -64.445 1.00 65.50 ? 327 LYS B HZ1  1 
ATOM   9851  H HZ2  . LYS B 1 327 ? -15.326 -9.130  -64.617 1.00 65.50 ? 327 LYS B HZ2  1 
ATOM   9852  H HZ3  . LYS B 1 327 ? -13.967 -9.570  -64.858 1.00 65.50 ? 327 LYS B HZ3  1 
ATOM   9853  N N    . VAL B 1 328 ? -11.385 -4.016  -59.890 1.00 24.63 ? 328 VAL B N    1 
ATOM   9854  C CA   . VAL B 1 328 ? -11.342 -2.617  -59.488 1.00 26.62 ? 328 VAL B CA   1 
ATOM   9855  C C    . VAL B 1 328 ? -10.310 -1.860  -60.308 1.00 30.04 ? 328 VAL B C    1 
ATOM   9856  O O    . VAL B 1 328 ? -10.551 -0.720  -60.708 1.00 31.32 ? 328 VAL B O    1 
ATOM   9857  C CB   . VAL B 1 328 ? -11.091 -2.499  -57.978 1.00 24.39 ? 328 VAL B CB   1 
ATOM   9858  C CG1  . VAL B 1 328 ? -10.743 -1.047  -57.586 1.00 27.81 ? 328 VAL B CG1  1 
ATOM   9859  C CG2  . VAL B 1 328 ? -12.319 -2.928  -57.235 1.00 25.70 ? 328 VAL B CG2  1 
ATOM   9860  H H    . VAL B 1 328 ? -11.110 -4.575  -59.298 1.00 29.54 ? 328 VAL B H    1 
ATOM   9861  H HA   . VAL B 1 328 ? -12.207 -2.219  -59.671 1.00 31.92 ? 328 VAL B HA   1 
ATOM   9862  H HB   . VAL B 1 328 ? -10.355 -3.075  -57.722 1.00 29.25 ? 328 VAL B HB   1 
ATOM   9863  H HG11 . VAL B 1 328 ? -10.591 -1.006  -56.629 1.00 33.35 ? 328 VAL B HG11 1 
ATOM   9864  H HG12 . VAL B 1 328 ? -9.942  -0.775  -58.061 1.00 33.35 ? 328 VAL B HG12 1 
ATOM   9865  H HG13 . VAL B 1 328 ? -11.483 -0.469  -57.829 1.00 33.35 ? 328 VAL B HG13 1 
ATOM   9866  H HG21 . VAL B 1 328 ? -12.155 -2.850  -56.282 1.00 30.81 ? 328 VAL B HG21 1 
ATOM   9867  H HG22 . VAL B 1 328 ? -13.059 -2.355  -57.491 1.00 30.81 ? 328 VAL B HG22 1 
ATOM   9868  H HG23 . VAL B 1 328 ? -12.520 -3.849  -57.463 1.00 30.81 ? 328 VAL B HG23 1 
ATOM   9869  N N    . CYS B 1 329 ? -9.164  -2.484  -60.609 1.00 32.49 ? 329 CYS B N    1 
ATOM   9870  C CA   . CYS B 1 329 ? -8.092  -1.785  -61.322 1.00 33.56 ? 329 CYS B CA   1 
ATOM   9871  C C    . CYS B 1 329 ? -8.317  -1.682  -62.825 1.00 34.92 ? 329 CYS B C    1 
ATOM   9872  O O    . CYS B 1 329 ? -7.715  -0.802  -63.453 1.00 33.23 ? 329 CYS B O    1 
ATOM   9873  C CB   . CYS B 1 329 ? -6.743  -2.475  -61.116 1.00 28.74 ? 329 CYS B CB   1 
ATOM   9874  S SG   . CYS B 1 329 ? -6.118  -2.323  -59.461 1.00 27.31 ? 329 CYS B SG   1 
ATOM   9875  H H    . CYS B 1 329 ? -8.985  -3.303  -60.413 1.00 38.97 ? 329 CYS B H    1 
ATOM   9876  H HA   . CYS B 1 329 ? -8.021  -0.883  -60.971 1.00 40.25 ? 329 CYS B HA   1 
ATOM   9877  H HB2  . CYS B 1 329 ? -6.841  -3.420  -61.311 1.00 34.46 ? 329 CYS B HB2  1 
ATOM   9878  H HB3  . CYS B 1 329 ? -6.093  -2.079  -61.717 1.00 34.46 ? 329 CYS B HB3  1 
ATOM   9879  H HG   . CYS B 1 329 ? -6.902  -2.819  -58.700 1.00 32.76 ? 329 CYS B HG   1 
ATOM   9880  N N    . TYR B 1 330 ? -9.120  -2.570  -63.421 1.00 32.15 ? 330 TYR B N    1 
ATOM   9881  C CA   . TYR B 1 330 ? -9.186  -2.663  -64.882 1.00 34.31 ? 330 TYR B CA   1 
ATOM   9882  C C    . TYR B 1 330 ? -10.587 -2.548  -65.458 1.00 37.60 ? 330 TYR B C    1 
ATOM   9883  O O    . TYR B 1 330 ? -10.749 -2.044  -66.572 1.00 40.31 ? 330 TYR B O    1 
ATOM   9884  C CB   . TYR B 1 330 ? -8.585  -3.982  -65.374 1.00 30.36 ? 330 TYR B CB   1 
ATOM   9885  C CG   . TYR B 1 330 ? -7.106  -3.981  -65.215 1.00 34.44 ? 330 TYR B CG   1 
ATOM   9886  C CD1  . TYR B 1 330 ? -6.525  -4.438  -64.043 1.00 32.54 ? 330 TYR B CD1  1 
ATOM   9887  C CD2  . TYR B 1 330 ? -6.286  -3.473  -66.204 1.00 34.53 ? 330 TYR B CD2  1 
ATOM   9888  C CE1  . TYR B 1 330 ? -5.167  -4.417  -63.870 1.00 26.30 ? 330 TYR B CE1  1 
ATOM   9889  C CE2  . TYR B 1 330 ? -4.906  -3.447  -66.040 1.00 35.25 ? 330 TYR B CE2  1 
ATOM   9890  C CZ   . TYR B 1 330 ? -4.359  -3.929  -64.863 1.00 35.06 ? 330 TYR B CZ   1 
ATOM   9891  O OH   . TYR B 1 330 ? -2.997  -3.923  -64.668 1.00 30.51 ? 330 TYR B OH   1 
ATOM   9892  H H    . TYR B 1 330 ? -9.631  -3.124  -63.006 1.00 38.55 ? 330 TYR B H    1 
ATOM   9893  H HA   . TYR B 1 330 ? -8.657  -1.942  -65.258 1.00 41.15 ? 330 TYR B HA   1 
ATOM   9894  H HB2  . TYR B 1 330 ? -8.949  -4.716  -64.855 1.00 36.41 ? 330 TYR B HB2  1 
ATOM   9895  H HB3  . TYR B 1 330 ? -8.792  -4.098  -66.315 1.00 36.41 ? 330 TYR B HB3  1 
ATOM   9896  H HD1  . TYR B 1 330 ? -7.067  -4.773  -63.365 1.00 39.02 ? 330 TYR B HD1  1 
ATOM   9897  H HD2  . TYR B 1 330 ? -6.661  -3.153  -66.993 1.00 41.41 ? 330 TYR B HD2  1 
ATOM   9898  H HE1  . TYR B 1 330 ? -4.793  -4.740  -63.082 1.00 31.54 ? 330 TYR B HE1  1 
ATOM   9899  H HE2  . TYR B 1 330 ? -4.357  -3.116  -66.714 1.00 42.28 ? 330 TYR B HE2  1 
ATOM   9900  H HH   . TYR B 1 330 ? -2.611  -3.603  -65.342 1.00 36.59 ? 330 TYR B HH   1 
ATOM   9901  N N    . GLU B 1 331 ? -11.599 -3.024  -64.740 1.00 34.39 ? 331 GLU B N    1 
ATOM   9902  C CA   . GLU B 1 331 ? -12.938 -3.122  -65.299 1.00 34.11 ? 331 GLU B CA   1 
ATOM   9903  C C    . GLU B 1 331 ? -13.915 -2.171  -64.622 1.00 31.70 ? 331 GLU B C    1 
ATOM   9904  O O    . GLU B 1 331 ? -15.128 -2.352  -64.725 1.00 36.98 ? 331 GLU B O    1 
ATOM   9905  C CB   . GLU B 1 331 ? -13.423 -4.568  -65.220 1.00 38.30 ? 331 GLU B CB   1 
ATOM   9906  C CG   . GLU B 1 331 ? -12.584 -5.498  -66.101 1.00 43.42 ? 331 GLU B CG   1 
ATOM   9907  C CD   . GLU B 1 331 ? -13.217 -6.859  -66.344 1.00 42.99 ? 331 GLU B CD   1 
ATOM   9908  O OE1  . GLU B 1 331 ? -14.203 -7.214  -65.648 1.00 49.75 ? 331 GLU B OE1  1 
ATOM   9909  O OE2  . GLU B 1 331 ? -12.720 -7.578  -67.237 1.00 39.66 ? 331 GLU B OE2  1 
ATOM   9910  H H    . GLU B 1 331 ? -11.535 -3.295  -63.927 1.00 41.24 ? 331 GLU B H    1 
ATOM   9911  H HA   . GLU B 1 331 ? -12.898 -2.878  -66.237 1.00 40.91 ? 331 GLU B HA   1 
ATOM   9912  H HB2  . GLU B 1 331 ? -13.357 -4.878  -64.303 1.00 45.94 ? 331 GLU B HB2  1 
ATOM   9913  H HB3  . GLU B 1 331 ? -14.343 -4.613  -65.523 1.00 45.94 ? 331 GLU B HB3  1 
ATOM   9914  H HG2  . GLU B 1 331 ? -12.451 -5.075  -66.964 1.00 52.09 ? 331 GLU B HG2  1 
ATOM   9915  H HG3  . GLU B 1 331 ? -11.726 -5.644  -65.672 1.00 52.09 ? 331 GLU B HG3  1 
ATOM   9916  N N    . GLY B 1 332 ? -13.407 -1.176  -63.905 1.00 32.08 ? 332 GLY B N    1 
ATOM   9917  C CA   . GLY B 1 332 ? -14.259 -0.156  -63.331 1.00 34.29 ? 332 GLY B CA   1 
ATOM   9918  C C    . GLY B 1 332 ? -15.141 -0.579  -62.183 1.00 33.93 ? 332 GLY B C    1 
ATOM   9919  O O    . GLY B 1 332 ? -16.062 0.162   -61.832 1.00 35.78 ? 332 GLY B O    1 
ATOM   9920  H H    . GLY B 1 332 ? -12.569 -1.072  -63.739 1.00 38.47 ? 332 GLY B H    1 
ATOM   9921  H HA2  . GLY B 1 332 ? -13.700 0.572   -63.018 1.00 41.13 ? 332 GLY B HA2  1 
ATOM   9922  H HA3  . GLY B 1 332 ? -14.835 0.193   -64.029 1.00 41.13 ? 332 GLY B HA3  1 
ATOM   9923  N N    . GLN B 1 333 ? -14.917 -1.735  -61.577 1.00 33.44 ? 333 GLN B N    1 
ATOM   9924  C CA   . GLN B 1 333 ? -15.687 -2.056  -60.389 1.00 27.69 ? 333 GLN B CA   1 
ATOM   9925  C C    . GLN B 1 333 ? -15.402 -0.988  -59.336 1.00 31.63 ? 333 GLN B C    1 
ATOM   9926  O O    . GLN B 1 333 ? -14.234 -0.622  -59.140 1.00 28.81 ? 333 GLN B O    1 
ATOM   9927  C CB   . GLN B 1 333 ? -15.350 -3.448  -59.855 1.00 29.22 ? 333 GLN B CB   1 
ATOM   9928  C CG   . GLN B 1 333 ? -15.772 -3.688  -58.413 1.00 35.91 ? 333 GLN B CG   1 
ATOM   9929  C CD   . GLN B 1 333 ? -15.711 -5.171  -58.022 1.00 42.90 ? 333 GLN B CD   1 
ATOM   9930  O OE1  . GLN B 1 333 ? -15.126 -5.987  -58.732 1.00 43.63 ? 333 GLN B OE1  1 
ATOM   9931  N NE2  . GLN B 1 333 ? -16.333 -5.519  -56.903 1.00 48.27 ? 333 GLN B NE2  1 
ATOM   9932  H H    . GLN B 1 333 ? -14.347 -2.331  -61.822 1.00 40.11 ? 333 GLN B H    1 
ATOM   9933  H HA   . GLN B 1 333 ? -16.633 -2.032  -60.602 1.00 33.20 ? 333 GLN B HA   1 
ATOM   9934  H HB2  . GLN B 1 333 ? -15.797 -4.109  -60.406 1.00 35.05 ? 333 GLN B HB2  1 
ATOM   9935  H HB3  . GLN B 1 333 ? -14.390 -3.575  -59.905 1.00 35.05 ? 333 GLN B HB3  1 
ATOM   9936  H HG2  . GLN B 1 333 ? -15.179 -3.197  -57.823 1.00 43.07 ? 333 GLN B HG2  1 
ATOM   9937  H HG3  . GLN B 1 333 ? -16.685 -3.383  -58.296 1.00 43.07 ? 333 GLN B HG3  1 
ATOM   9938  H HE21 . GLN B 1 333 ? -16.736 -4.923  -56.432 1.00 57.90 ? 333 GLN B HE21 1 
ATOM   9939  H HE22 . GLN B 1 333 ? -16.328 -6.339  -56.644 1.00 57.90 ? 333 GLN B HE22 1 
ATOM   9940  N N    . PRO B 1 334 ? -16.425 -0.439  -58.679 1.00 29.57 ? 334 PRO B N    1 
ATOM   9941  C CA   . PRO B 1 334 ? -16.187 0.606   -57.677 1.00 27.88 ? 334 PRO B CA   1 
ATOM   9942  C C    . PRO B 1 334 ? -15.355 0.070   -56.524 1.00 27.80 ? 334 PRO B C    1 
ATOM   9943  O O    . PRO B 1 334 ? -15.680 -0.966  -55.939 1.00 26.08 ? 334 PRO B O    1 
ATOM   9944  C CB   . PRO B 1 334 ? -17.593 0.987   -57.207 1.00 30.10 ? 334 PRO B CB   1 
ATOM   9945  C CG   . PRO B 1 334 ? -18.512 0.428   -58.220 1.00 31.52 ? 334 PRO B CG   1 
ATOM   9946  C CD   . PRO B 1 334 ? -17.856 -0.757  -58.807 1.00 31.97 ? 334 PRO B CD   1 
ATOM   9947  H HA   . PRO B 1 334 ? -15.750 1.376   -58.073 1.00 33.43 ? 334 PRO B HA   1 
ATOM   9948  H HB2  . PRO B 1 334 ? -17.763 0.594   -56.337 1.00 36.09 ? 334 PRO B HB2  1 
ATOM   9949  H HB3  . PRO B 1 334 ? -17.673 1.953   -57.169 1.00 36.09 ? 334 PRO B HB3  1 
ATOM   9950  H HG2  . PRO B 1 334 ? -19.344 0.174   -57.791 1.00 37.81 ? 334 PRO B HG2  1 
ATOM   9951  H HG3  . PRO B 1 334 ? -18.677 1.095   -58.905 1.00 37.81 ? 334 PRO B HG3  1 
ATOM   9952  H HD2  . PRO B 1 334 ? -18.074 -1.553  -58.298 1.00 38.34 ? 334 PRO B HD2  1 
ATOM   9953  H HD3  . PRO B 1 334 ? -18.100 -0.853  -59.741 1.00 38.34 ? 334 PRO B HD3  1 
ATOM   9954  N N    . VAL B 1 335 ? -14.276 0.788   -56.197 1.00 25.97 ? 335 VAL B N    1 
ATOM   9955  C CA   . VAL B 1 335 ? -13.402 0.342   -55.115 1.00 25.21 ? 335 VAL B CA   1 
ATOM   9956  C C    . VAL B 1 335 ? -14.226 0.129   -53.876 1.00 24.24 ? 335 VAL B C    1 
ATOM   9957  O O    . VAL B 1 335 ? -13.909 -0.717  -53.026 1.00 21.69 ? 335 VAL B O    1 
ATOM   9958  C CB   . VAL B 1 335 ? -12.287 1.381   -54.852 1.00 28.76 ? 335 VAL B CB   1 
ATOM   9959  C CG1  . VAL B 1 335 ? -12.875 2.643   -54.209 1.00 23.52 ? 335 VAL B CG1  1 
ATOM   9960  C CG2  . VAL B 1 335 ? -11.189 0.798   -53.947 1.00 25.17 ? 335 VAL B CG2  1 
ATOM   9961  H H    . VAL B 1 335 ? -14.034 1.519   -56.579 1.00 31.14 ? 335 VAL B H    1 
ATOM   9962  H HA   . VAL B 1 335 ? -12.988 -0.500  -55.358 1.00 30.23 ? 335 VAL B HA   1 
ATOM   9963  H HB   . VAL B 1 335 ? -11.881 1.633   -55.696 1.00 34.49 ? 335 VAL B HB   1 
ATOM   9964  H HG11 . VAL B 1 335 ? -12.160 3.280   -54.053 1.00 28.21 ? 335 VAL B HG11 1 
ATOM   9965  H HG12 . VAL B 1 335 ? -13.534 3.025   -54.809 1.00 28.21 ? 335 VAL B HG12 1 
ATOM   9966  H HG13 . VAL B 1 335 ? -13.293 2.403   -53.367 1.00 28.21 ? 335 VAL B HG13 1 
ATOM   9967  H HG21 . VAL B 1 335 ? -10.508 1.473   -53.802 1.00 30.19 ? 335 VAL B HG21 1 
ATOM   9968  H HG22 . VAL B 1 335 ? -11.584 0.539   -53.099 1.00 30.19 ? 335 VAL B HG22 1 
ATOM   9969  H HG23 . VAL B 1 335 ? -10.801 0.023   -54.382 1.00 30.19 ? 335 VAL B HG23 1 
ATOM   9970  N N    . GLY B 1 336 ? -15.299 0.908   -53.741 1.00 25.43 ? 336 GLY B N    1 
ATOM   9971  C CA   . GLY B 1 336 ? -16.127 0.828   -52.555 1.00 26.73 ? 336 GLY B CA   1 
ATOM   9972  C C    . GLY B 1 336 ? -16.801 -0.510  -52.368 1.00 24.54 ? 336 GLY B C    1 
ATOM   9973  O O    . GLY B 1 336 ? -17.321 -0.763  -51.279 1.00 28.33 ? 336 GLY B O    1 
ATOM   9974  H H    . GLY B 1 336 ? -15.563 1.485   -54.322 1.00 30.49 ? 336 GLY B H    1 
ATOM   9975  H HA2  . GLY B 1 336 ? -15.580 1.003   -51.773 1.00 32.06 ? 336 GLY B HA2  1 
ATOM   9976  H HA3  . GLY B 1 336 ? -16.816 1.510   -52.602 1.00 32.06 ? 336 GLY B HA3  1 
ATOM   9977  N N    . GLU B 1 337 ? -16.785 -1.371  -53.388 1.00 27.16 ? 337 GLU B N    1 
ATOM   9978  C CA   . GLU B 1 337 ? -17.308 -2.739  -53.308 1.00 25.42 ? 337 GLU B CA   1 
ATOM   9979  C C    . GLU B 1 337 ? -16.269 -3.776  -52.873 1.00 27.96 ? 337 GLU B C    1 
ATOM   9980  O O    . GLU B 1 337 ? -16.593 -4.976  -52.829 1.00 24.01 ? 337 GLU B O    1 
ATOM   9981  C CB   . GLU B 1 337 ? -17.887 -3.162  -54.675 1.00 26.34 ? 337 GLU B CB   1 
ATOM   9982  C CG   . GLU B 1 337 ? -19.090 -2.341  -55.113 1.00 26.88 ? 337 GLU B CG   1 
ATOM   9983  C CD   . GLU B 1 337 ? -20.202 -2.444  -54.107 1.00 25.58 ? 337 GLU B CD   1 
ATOM   9984  O OE1  . GLU B 1 337 ? -20.540 -3.576  -53.756 1.00 31.47 ? 337 GLU B OE1  1 
ATOM   9985  O OE2  . GLU B 1 337 ? -20.695 -1.415  -53.631 1.00 28.92 ? 337 GLU B OE2  1 
ATOM   9986  H H    . GLU B 1 337 ? -16.466 -1.178  -54.163 1.00 32.58 ? 337 GLU B H    1 
ATOM   9987  H HA   . GLU B 1 337 ? -18.031 -2.757  -52.662 1.00 30.48 ? 337 GLU B HA   1 
ATOM   9988  H HB2  . GLU B 1 337 ? -17.198 -3.062  -55.351 1.00 31.58 ? 337 GLU B HB2  1 
ATOM   9989  H HB3  . GLU B 1 337 ? -18.164 -4.090  -54.624 1.00 31.58 ? 337 GLU B HB3  1 
ATOM   9990  H HG2  . GLU B 1 337 ? -18.833 -1.409  -55.192 1.00 32.23 ? 337 GLU B HG2  1 
ATOM   9991  H HG3  . GLU B 1 337 ? -19.415 -2.675  -55.964 1.00 32.23 ? 337 GLU B HG3  1 
ATOM   9992  N N    . PHE B 1 338 ? -15.040 -3.364  -52.533 1.00 24.82 ? 338 PHE B N    1 
ATOM   9993  C CA   . PHE B 1 338 ? -13.975 -4.345  -52.318 1.00 23.45 ? 338 PHE B CA   1 
ATOM   9994  C C    . PHE B 1 338 ? -14.262 -5.248  -51.122 1.00 21.48 ? 338 PHE B C    1 
ATOM   9995  O O    . PHE B 1 338 ? -14.000 -6.453  -51.172 1.00 25.28 ? 338 PHE B O    1 
ATOM   9996  C CB   . PHE B 1 338 ? -12.622 -3.650  -52.136 1.00 17.85 ? 338 PHE B CB   1 
ATOM   9997  C CG   . PHE B 1 338 ? -11.523 -4.589  -51.769 1.00 18.12 ? 338 PHE B CG   1 
ATOM   9998  C CD1  . PHE B 1 338 ? -10.983 -5.412  -52.715 1.00 22.15 ? 338 PHE B CD1  1 
ATOM   9999  C CD2  . PHE B 1 338 ? -11.046 -4.655  -50.467 1.00 23.48 ? 338 PHE B CD2  1 
ATOM   10000 C CE1  . PHE B 1 338 ? -9.946  -6.297  -52.378 1.00 22.10 ? 338 PHE B CE1  1 
ATOM   10001 C CE2  . PHE B 1 338 ? -10.022 -5.520  -50.126 1.00 21.11 ? 338 PHE B CE2  1 
ATOM   10002 C CZ   . PHE B 1 338 ? -9.481  -6.343  -51.084 1.00 20.42 ? 338 PHE B CZ   1 
ATOM   10003 H H    . PHE B 1 338 ? -14.804 -2.544  -52.424 1.00 29.76 ? 338 PHE B H    1 
ATOM   10004 H HA   . PHE B 1 338 ? -13.912 -4.910  -53.104 1.00 28.12 ? 338 PHE B HA   1 
ATOM   10005 H HB2  . PHE B 1 338 ? -12.377 -3.215  -52.968 1.00 21.40 ? 338 PHE B HB2  1 
ATOM   10006 H HB3  . PHE B 1 338 ? -12.700 -2.991  -51.429 1.00 21.40 ? 338 PHE B HB3  1 
ATOM   10007 H HD1  . PHE B 1 338 ? -11.296 -5.378  -53.590 1.00 26.56 ? 338 PHE B HD1  1 
ATOM   10008 H HD2  . PHE B 1 338 ? -11.409 -4.097  -49.817 1.00 28.15 ? 338 PHE B HD2  1 
ATOM   10009 H HE1  . PHE B 1 338 ? -9.579  -6.853  -53.026 1.00 26.50 ? 338 PHE B HE1  1 
ATOM   10010 H HE2  . PHE B 1 338 ? -9.710  -5.553  -49.251 1.00 25.31 ? 338 PHE B HE2  1 
ATOM   10011 H HZ   . PHE B 1 338 ? -8.796  -6.930  -50.857 1.00 24.48 ? 338 PHE B HZ   1 
ATOM   10012 N N    . ILE B 1 339 ? -14.783 -4.689  -50.032 1.00 20.89 ? 339 ILE B N    1 
ATOM   10013 C CA   . ILE B 1 339 ? -15.039 -5.502  -48.849 1.00 20.95 ? 339 ILE B CA   1 
ATOM   10014 C C    . ILE B 1 339 ? -16.223 -6.430  -49.093 1.00 21.15 ? 339 ILE B C    1 
ATOM   10015 O O    . ILE B 1 339 ? -16.222 -7.594  -48.666 1.00 21.73 ? 339 ILE B O    1 
ATOM   10016 C CB   . ILE B 1 339 ? -15.252 -4.596  -47.621 1.00 27.39 ? 339 ILE B CB   1 
ATOM   10017 C CG1  . ILE B 1 339 ? -13.909 -3.971  -47.182 1.00 33.33 ? 339 ILE B CG1  1 
ATOM   10018 C CG2  . ILE B 1 339 ? -15.917 -5.358  -46.477 1.00 30.09 ? 339 ILE B CG2  1 
ATOM   10019 C CD1  . ILE B 1 339 ? -12.792 -4.970  -46.852 1.00 31.36 ? 339 ILE B CD1  1 
ATOM   10020 H H    . ILE B 1 339 ? -14.993 -3.858  -49.953 1.00 25.05 ? 339 ILE B H    1 
ATOM   10021 H HA   . ILE B 1 339 ? -14.261 -6.055  -48.676 1.00 25.12 ? 339 ILE B HA   1 
ATOM   10022 H HB   . ILE B 1 339 ? -15.845 -3.875  -47.883 1.00 32.85 ? 339 ILE B HB   1 
ATOM   10023 H HG12 . ILE B 1 339 ? -13.587 -3.401  -47.897 1.00 39.98 ? 339 ILE B HG12 1 
ATOM   10024 H HG13 . ILE B 1 339 ? -14.065 -3.437  -46.387 1.00 39.98 ? 339 ILE B HG13 1 
ATOM   10025 H HG21 . ILE B 1 339 ? -16.034 -4.757  -45.725 1.00 36.09 ? 339 ILE B HG21 1 
ATOM   10026 H HG22 . ILE B 1 339 ? -16.779 -5.687  -46.776 1.00 36.09 ? 339 ILE B HG22 1 
ATOM   10027 H HG23 . ILE B 1 339 ? -15.349 -6.101  -46.222 1.00 36.09 ? 339 ILE B HG23 1 
ATOM   10028 H HD11 . ILE B 1 339 ? -11.998 -4.480  -46.589 1.00 37.61 ? 339 ILE B HD11 1 
ATOM   10029 H HD12 . ILE B 1 339 ? -13.085 -5.542  -46.124 1.00 37.61 ? 339 ILE B HD12 1 
ATOM   10030 H HD13 . ILE B 1 339 ? -12.606 -5.506  -47.639 1.00 37.61 ? 339 ILE B HD13 1 
ATOM   10031 N N    . HIS B 1 340 ? -17.245 -5.940  -49.801 1.00 23.54 ? 340 HIS B N    1 
ATOM   10032 C CA   . HIS B 1 340 ? -18.385 -6.792  -50.120 1.00 24.06 ? 340 HIS B CA   1 
ATOM   10033 C C    . HIS B 1 340 ? -17.955 -8.032  -50.882 1.00 25.66 ? 340 HIS B C    1 
ATOM   10034 O O    . HIS B 1 340 ? -18.552 -9.103  -50.714 1.00 25.49 ? 340 HIS B O    1 
ATOM   10035 C CB   . HIS B 1 340 ? -19.429 -6.005  -50.937 1.00 24.24 ? 340 HIS B CB   1 
ATOM   10036 C CG   . HIS B 1 340 ? -20.011 -4.827  -50.208 1.00 23.82 ? 340 HIS B CG   1 
ATOM   10037 N ND1  . HIS B 1 340 ? -20.474 -3.703  -50.859 1.00 21.58 ? 340 HIS B ND1  1 
ATOM   10038 C CD2  . HIS B 1 340 ? -20.183 -4.587  -48.885 1.00 20.82 ? 340 HIS B CD2  1 
ATOM   10039 C CE1  . HIS B 1 340 ? -20.912 -2.831  -49.969 1.00 23.64 ? 340 HIS B CE1  1 
ATOM   10040 N NE2  . HIS B 1 340 ? -20.753 -3.345  -48.764 1.00 22.40 ? 340 HIS B NE2  1 
ATOM   10041 H H    . HIS B 1 340 ? -17.299 -5.136  -50.100 1.00 28.22 ? 340 HIS B H    1 
ATOM   10042 H HA   . HIS B 1 340 ? -18.806 -7.079  -49.294 1.00 28.85 ? 340 HIS B HA   1 
ATOM   10043 H HB2  . HIS B 1 340 ? -19.008 -5.674  -51.746 1.00 29.07 ? 340 HIS B HB2  1 
ATOM   10044 H HB3  . HIS B 1 340 ? -20.159 -6.601  -51.168 1.00 29.07 ? 340 HIS B HB3  1 
ATOM   10045 H HD1  . HIS B 1 340 ? -20.478 -3.588  -51.711 1.00 25.87 ? 340 HIS B HD1  1 
ATOM   10046 H HD2  . HIS B 1 340 ? -19.965 -5.164  -48.188 1.00 24.96 ? 340 HIS B HD2  1 
ATOM   10047 H HE1  . HIS B 1 340 ? -21.279 -1.998  -50.160 1.00 28.34 ? 340 HIS B HE1  1 
ATOM   10048 N N    . CYS B 1 341 ? -16.929 -7.913  -51.726 1.00 24.36 ? 341 CYS B N    1 
ATOM   10049 C CA   . CYS B 1 341 ? -16.412 -9.058  -52.456 1.00 26.72 ? 341 CYS B CA   1 
ATOM   10050 C C    . CYS B 1 341 ? -15.840 -10.137 -51.548 1.00 26.21 ? 341 CYS B C    1 
ATOM   10051 O O    . CYS B 1 341 ? -15.612 -11.246 -52.020 1.00 30.10 ? 341 CYS B O    1 
ATOM   10052 C CB   . CYS B 1 341 ? -15.337 -8.589  -53.446 1.00 32.47 ? 341 CYS B CB   1 
ATOM   10053 S SG   . CYS B 1 341 ? -16.045 -7.630  -54.832 1.00 35.02 ? 341 CYS B SG   1 
ATOM   10054 H H    . CYS B 1 341 ? -16.518 -7.176  -51.891 1.00 29.21 ? 341 CYS B H    1 
ATOM   10055 H HA   . CYS B 1 341 ? -17.134 -9.454  -52.968 1.00 32.04 ? 341 CYS B HA   1 
ATOM   10056 H HB2  . CYS B 1 341 ? -14.702 -8.023  -52.980 1.00 38.94 ? 341 CYS B HB2  1 
ATOM   10057 H HB3  . CYS B 1 341 ? -14.885 -9.364  -53.815 1.00 38.94 ? 341 CYS B HB3  1 
ATOM   10058 H HG   . CYS B 1 341 ? -16.602 -6.662  -54.394 1.00 42.01 ? 341 CYS B HG   1 
ATOM   10059 N N    . LEU B 1 342 ? -15.598 -9.849  -50.276 1.00 21.81 ? 342 LEU B N    1 
ATOM   10060 C CA   . LEU B 1 342 ? -15.022 -10.824 -49.359 1.00 22.80 ? 342 LEU B CA   1 
ATOM   10061 C C    . LEU B 1 342 ? -16.032 -11.444 -48.420 1.00 25.37 ? 342 LEU B C    1 
ATOM   10062 O O    . LEU B 1 342 ? -15.642 -12.219 -47.538 1.00 18.99 ? 342 LEU B O    1 
ATOM   10063 C CB   . LEU B 1 342 ? -13.923 -10.171 -48.531 1.00 19.03 ? 342 LEU B CB   1 
ATOM   10064 C CG   . LEU B 1 342 ? -12.884 -9.499  -49.412 1.00 23.10 ? 342 LEU B CG   1 
ATOM   10065 C CD1  . LEU B 1 342 ? -11.823 -8.855  -48.499 1.00 25.01 ? 342 LEU B CD1  1 
ATOM   10066 C CD2  . LEU B 1 342 ? -12.270 -10.472 -50.425 1.00 23.72 ? 342 LEU B CD2  1 
ATOM   10067 H H    . LEU B 1 342 ? -15.760 -9.086  -49.915 1.00 26.15 ? 342 LEU B H    1 
ATOM   10068 H HA   . LEU B 1 342 ? -14.619 -11.540 -49.876 1.00 27.34 ? 342 LEU B HA   1 
ATOM   10069 H HB2  . LEU B 1 342 ? -14.315 -9.497  -47.954 1.00 22.82 ? 342 LEU B HB2  1 
ATOM   10070 H HB3  . LEU B 1 342 ? -13.477 -10.849 -47.999 1.00 22.82 ? 342 LEU B HB3  1 
ATOM   10071 H HG   . LEU B 1 342 ? -13.314 -8.787  -49.911 1.00 27.70 ? 342 LEU B HG   1 
ATOM   10072 H HD11 . LEU B 1 342 ? -11.153 -8.422  -49.051 1.00 29.99 ? 342 LEU B HD11 1 
ATOM   10073 H HD12 . LEU B 1 342 ? -12.253 -8.201  -47.926 1.00 29.99 ? 342 LEU B HD12 1 
ATOM   10074 H HD13 . LEU B 1 342 ? -11.410 -9.547  -47.959 1.00 29.99 ? 342 LEU B HD13 1 
ATOM   10075 H HD21 . LEU B 1 342 ? -11.616 -9.997  -50.962 1.00 28.44 ? 342 LEU B HD21 1 
ATOM   10076 H HD22 . LEU B 1 342 ? -11.840 -11.197 -49.945 1.00 28.44 ? 342 LEU B HD22 1 
ATOM   10077 H HD23 . LEU B 1 342 ? -12.974 -10.822 -50.994 1.00 28.44 ? 342 LEU B HD23 1 
ATOM   10078 N N    . GLN B 1 343 ? -17.316 -11.133 -48.584 1.00 23.65 ? 343 GLN B N    1 
ATOM   10079 C CA   . GLN B 1 343 ? -18.319 -11.478 -47.595 1.00 22.92 ? 343 GLN B CA   1 
ATOM   10080 C C    . GLN B 1 343 ? -18.895 -12.860 -47.825 1.00 22.40 ? 343 GLN B C    1 
ATOM   10081 O O    . GLN B 1 343 ? -19.693 -13.332 -47.005 1.00 27.01 ? 343 GLN B O    1 
ATOM   10082 C CB   . GLN B 1 343 ? -19.438 -10.424 -47.600 1.00 19.71 ? 343 GLN B CB   1 
ATOM   10083 C CG   . GLN B 1 343 ? -19.106 -9.166  -46.831 1.00 24.68 ? 343 GLN B CG   1 
ATOM   10084 C CD   . GLN B 1 343 ? -20.228 -8.148  -46.901 1.00 24.77 ? 343 GLN B CD   1 
ATOM   10085 O OE1  . GLN B 1 343 ? -20.979 -8.136  -47.863 1.00 30.03 ? 343 GLN B OE1  1 
ATOM   10086 N NE2  . GLN B 1 343 ? -20.335 -7.290  -45.890 1.00 24.97 ? 343 GLN B NE2  1 
ATOM   10087 H H    . GLN B 1 343 ? -17.630 -10.717 -49.268 1.00 28.36 ? 343 GLN B H    1 
ATOM   10088 H HA   . GLN B 1 343 ? -17.908 -11.471 -46.716 1.00 27.48 ? 343 GLN B HA   1 
ATOM   10089 H HB2  . GLN B 1 343 ? -19.621 -10.169 -48.518 1.00 23.64 ? 343 GLN B HB2  1 
ATOM   10090 H HB3  . GLN B 1 343 ? -20.233 -10.812 -47.203 1.00 23.64 ? 343 GLN B HB3  1 
ATOM   10091 H HG2  . GLN B 1 343 ? -18.960 -9.391  -45.899 1.00 29.59 ? 343 GLN B HG2  1 
ATOM   10092 H HG3  . GLN B 1 343 ? -18.308 -8.763  -47.207 1.00 29.59 ? 343 GLN B HG3  1 
ATOM   10093 H HE21 . GLN B 1 343 ? -19.784 -7.331  -45.231 1.00 29.94 ? 343 GLN B HE21 1 
ATOM   10094 H HE22 . GLN B 1 343 ? -20.958 -6.697  -45.893 1.00 29.94 ? 343 GLN B HE22 1 
ATOM   10095 N N    . ASN B 1 344 ? -18.493 -13.522 -48.902 1.00 24.46 ? 344 ASN B N    1 
ATOM   10096 C CA   . ASN B 1 344 ? -18.889 -14.897 -49.186 1.00 25.77 ? 344 ASN B CA   1 
ATOM   10097 C C    . ASN B 1 344 ? -17.678 -15.662 -49.711 1.00 20.53 ? 344 ASN B C    1 
ATOM   10098 O O    . ASN B 1 344 ? -17.710 -16.309 -50.764 1.00 19.56 ? 344 ASN B O    1 
ATOM   10099 C CB   . ASN B 1 344 ? -20.080 -14.901 -50.151 1.00 26.69 ? 344 ASN B CB   1 
ATOM   10100 C CG   . ASN B 1 344 ? -21.313 -14.172 -49.564 1.00 29.93 ? 344 ASN B CG   1 
ATOM   10101 O OD1  . ASN B 1 344 ? -22.022 -14.698 -48.694 1.00 29.77 ? 344 ASN B OD1  1 
ATOM   10102 N ND2  . ASN B 1 344 ? -21.542 -12.940 -50.015 1.00 29.79 ? 344 ASN B ND2  1 
ATOM   10103 H H    . ASN B 1 344 ? -17.976 -13.186 -49.502 1.00 29.33 ? 344 ASN B H    1 
ATOM   10104 H HA   . ASN B 1 344 ? -19.173 -15.319 -48.360 1.00 30.90 ? 344 ASN B HA   1 
ATOM   10105 H HB2  . ASN B 1 344 ? -19.826 -14.450 -50.972 1.00 32.01 ? 344 ASN B HB2  1 
ATOM   10106 H HB3  . ASN B 1 344 ? -20.333 -15.818 -50.340 1.00 32.01 ? 344 ASN B HB3  1 
ATOM   10107 H HD21 . ASN B 1 344 ? -22.213 -12.491 -49.718 1.00 35.72 ? 344 ASN B HD21 1 
ATOM   10108 H HD22 . ASN B 1 344 ? -21.028 -12.599 -50.614 1.00 35.72 ? 344 ASN B HD22 1 
ATOM   10109 N N    . HIS B 1 345 ? -16.570 -15.629 -48.912 1.00 19.49 ? 345 HIS B N    1 
ATOM   10110 C CA   . HIS B 1 345 ? -15.305 -16.159 -49.349 1.00 17.61 ? 345 HIS B CA   1 
ATOM   10111 C C    . HIS B 1 345 ? -15.274 -17.686 -49.233 1.00 16.20 ? 345 HIS B C    1 
ATOM   10112 O O    . HIS B 1 345 ? -15.800 -18.249 -48.268 1.00 19.80 ? 345 HIS B O    1 
ATOM   10113 C CB   . HIS B 1 345 ? -14.174 -15.572 -48.520 1.00 18.78 ? 345 HIS B CB   1 
ATOM   10114 C CG   . HIS B 1 345 ? -12.843 -15.734 -49.166 1.00 18.28 ? 345 HIS B CG   1 
ATOM   10115 N ND1  . HIS B 1 345 ? -12.130 -16.905 -49.112 1.00 19.95 ? 345 HIS B ND1  1 
ATOM   10116 C CD2  . HIS B 1 345 ? -12.110 -14.878 -49.909 1.00 17.29 ? 345 HIS B CD2  1 
ATOM   10117 C CE1  . HIS B 1 345 ? -11.010 -16.767 -49.797 1.00 18.02 ? 345 HIS B CE1  1 
ATOM   10118 N NE2  . HIS B 1 345 ? -10.974 -15.545 -50.289 1.00 19.06 ? 345 HIS B NE2  1 
ATOM   10119 H H    . HIS B 1 345 ? -16.556 -15.299 -48.118 1.00 23.36 ? 345 HIS B H    1 
ATOM   10120 H HA   . HIS B 1 345 ? -15.160 -15.920 -50.278 1.00 21.11 ? 345 HIS B HA   1 
ATOM   10121 H HB2  . HIS B 1 345 ? -14.333 -14.623 -48.395 1.00 22.51 ? 345 HIS B HB2  1 
ATOM   10122 H HB3  . HIS B 1 345 ? -14.147 -16.020 -47.660 1.00 22.51 ? 345 HIS B HB3  1 
ATOM   10123 H HD2  . HIS B 1 345 ? -12.335 -14.002 -50.128 1.00 20.72 ? 345 HIS B HD2  1 
ATOM   10124 H HE1  . HIS B 1 345 ? -10.353 -17.417 -49.904 1.00 21.60 ? 345 HIS B HE1  1 
ATOM   10125 H HE2  . HIS B 1 345 ? -10.337 -15.216 -50.764 1.00 22.85 ? 345 HIS B HE2  1 
ATOM   10126 N N    . PRO B 1 346 ? -14.630 -18.371 -50.168 1.00 17.23 ? 346 PRO B N    1 
ATOM   10127 C CA   . PRO B 1 346 ? -14.522 -19.833 -50.054 1.00 22.24 ? 346 PRO B CA   1 
ATOM   10128 C C    . PRO B 1 346 ? -13.978 -20.322 -48.718 1.00 23.88 ? 346 PRO B C    1 
ATOM   10129 O O    . PRO B 1 346 ? -14.352 -21.415 -48.261 1.00 21.11 ? 346 PRO B O    1 
ATOM   10130 C CB   . PRO B 1 346 ? -13.591 -20.191 -51.221 1.00 26.98 ? 346 PRO B CB   1 
ATOM   10131 C CG   . PRO B 1 346 ? -13.844 -19.138 -52.223 1.00 24.32 ? 346 PRO B CG   1 
ATOM   10132 C CD   . PRO B 1 346 ? -14.143 -17.885 -51.474 1.00 21.65 ? 346 PRO B CD   1 
ATOM   10133 H HA   . PRO B 1 346 ? -15.388 -20.241 -50.208 1.00 26.67 ? 346 PRO B HA   1 
ATOM   10134 H HB2  . PRO B 1 346 ? -12.668 -20.171 -50.924 1.00 32.35 ? 346 PRO B HB2  1 
ATOM   10135 H HB3  . PRO B 1 346 ? -13.823 -21.065 -51.572 1.00 32.35 ? 346 PRO B HB3  1 
ATOM   10136 H HG2  . PRO B 1 346 ? -13.053 -19.021 -52.773 1.00 29.16 ? 346 PRO B HG2  1 
ATOM   10137 H HG3  . PRO B 1 346 ? -14.602 -19.392 -52.772 1.00 29.16 ? 346 PRO B HG3  1 
ATOM   10138 H HD2  . PRO B 1 346 ? -13.336 -17.359 -51.359 1.00 25.96 ? 346 PRO B HD2  1 
ATOM   10139 H HD3  . PRO B 1 346 ? -14.836 -17.378 -51.925 1.00 25.96 ? 346 PRO B HD3  1 
ATOM   10140 N N    . GLU B 1 347 ? -13.096 -19.558 -48.067 1.00 21.01 ? 347 GLU B N    1 
ATOM   10141 C CA   . GLU B 1 347 ? -12.525 -20.023 -46.806 1.00 25.28 ? 347 GLU B CA   1 
ATOM   10142 C C    . GLU B 1 347 ? -13.571 -20.151 -45.702 1.00 19.31 ? 347 GLU B C    1 
ATOM   10143 O O    . GLU B 1 347 ? -13.293 -20.823 -44.706 1.00 20.62 ? 347 GLU B O    1 
ATOM   10144 C CB   . GLU B 1 347 ? -11.391 -19.067 -46.357 1.00 21.51 ? 347 GLU B CB   1 
ATOM   10145 C CG   . GLU B 1 347 ? -10.160 -19.139 -47.218 1.00 23.08 ? 347 GLU B CG   1 
ATOM   10146 C CD   . GLU B 1 347 ? -9.492  -20.492 -47.136 1.00 24.98 ? 347 GLU B CD   1 
ATOM   10147 O OE1  . GLU B 1 347 ? -9.501  -21.091 -46.036 1.00 30.42 ? 347 GLU B OE1  1 
ATOM   10148 O OE2  . GLU B 1 347 ? -8.967  -20.945 -48.161 1.00 26.88 ? 347 GLU B OE2  1 
ATOM   10149 H H    . GLU B 1 347 ? -12.819 -18.787 -48.328 1.00 25.19 ? 347 GLU B H    1 
ATOM   10150 H HA   . GLU B 1 347 ? -12.134 -20.900 -46.946 1.00 30.31 ? 347 GLU B HA   1 
ATOM   10151 H HB2  . GLU B 1 347 ? -11.721 -18.155 -46.387 1.00 25.79 ? 347 GLU B HB2  1 
ATOM   10152 H HB3  . GLU B 1 347 ? -11.132 -19.293 -45.450 1.00 25.79 ? 347 GLU B HB3  1 
ATOM   10153 H HG2  . GLU B 1 347 ? -10.407 -18.979 -48.142 1.00 27.67 ? 347 GLU B HG2  1 
ATOM   10154 H HG3  . GLU B 1 347 ? -9.524  -18.470 -46.921 1.00 27.67 ? 347 GLU B HG3  1 
ATOM   10155 N N    . HIS B 1 348 ? -14.725 -19.468 -45.816 1.00 19.27 ? 348 HIS B N    1 
ATOM   10156 C CA   . HIS B 1 348 ? -15.802 -19.505 -44.829 1.00 19.34 ? 348 HIS B CA   1 
ATOM   10157 C C    . HIS B 1 348 ? -16.999 -20.372 -45.263 1.00 19.12 ? 348 HIS B C    1 
ATOM   10158 O O    . HIS B 1 348 ? -18.024 -20.380 -44.573 1.00 20.68 ? 348 HIS B O    1 
ATOM   10159 C CB   . HIS B 1 348 ? -16.290 -18.079 -44.515 1.00 24.24 ? 348 HIS B CB   1 
ATOM   10160 C CG   . HIS B 1 348 ? -15.191 -17.159 -44.104 1.00 18.62 ? 348 HIS B CG   1 
ATOM   10161 N ND1  . HIS B 1 348 ? -14.832 -16.060 -44.847 1.00 15.61 ? 348 HIS B ND1  1 
ATOM   10162 C CD2  . HIS B 1 348 ? -14.323 -17.217 -43.062 1.00 18.23 ? 348 HIS B CD2  1 
ATOM   10163 C CE1  . HIS B 1 348 ? -13.785 -15.475 -44.287 1.00 23.68 ? 348 HIS B CE1  1 
ATOM   10164 N NE2  . HIS B 1 348 ? -13.467 -16.146 -43.193 1.00 19.74 ? 348 HIS B NE2  1 
ATOM   10165 H H    . HIS B 1 348 ? -14.905 -18.959 -46.485 1.00 23.10 ? 348 HIS B H    1 
ATOM   10166 H HA   . HIS B 1 348 ? -15.453 -19.882 -44.006 1.00 23.19 ? 348 HIS B HA   1 
ATOM   10167 H HB2  . HIS B 1 348 ? -16.708 -17.708 -45.307 1.00 29.07 ? 348 HIS B HB2  1 
ATOM   10168 H HB3  . HIS B 1 348 ? -16.933 -18.119 -43.790 1.00 29.07 ? 348 HIS B HB3  1 
ATOM   10169 H HD2  . HIS B 1 348 ? -14.311 -17.857 -42.387 1.00 21.85 ? 348 HIS B HD2  1 
ATOM   10170 H HE1  . HIS B 1 348 ? -13.371 -14.700 -44.589 1.00 28.39 ? 348 HIS B HE1  1 
ATOM   10171 H HE2  . HIS B 1 348 ? -12.830 -15.946 -42.651 1.00 23.66 ? 348 HIS B HE2  1 
ATOM   10172 N N    . MET B 1 349 ? -16.870 -21.100 -46.360 1.00 22.51 ? 349 MET B N    1 
ATOM   10173 C CA   . MET B 1 349 ? -17.926 -22.019 -46.864 1.00 21.88 ? 349 MET B CA   1 
ATOM   10174 C C    . MET B 1 349 ? -17.826 -23.354 -46.122 1.00 30.12 ? 349 MET B C    1 
ATOM   10175 O O    . MET B 1 349 ? -18.763 -24.073 -46.118 1.00 34.56 ? 349 MET B O    1 
ATOM   10176 C CB   . MET B 1 349 ? -17.813 -22.264 -48.371 1.00 19.12 ? 349 MET B CB   1 
ATOM   10177 C CG   . MET B 1 349 ? -17.801 -21.002 -49.164 1.00 23.96 ? 349 MET B CG   1 
ATOM   10178 S SD   . MET B 1 349 ? -18.195 -21.157 -50.930 1.00 43.58 ? 349 MET B SD   1 
ATOM   10179 C CE   . MET B 1 349 ? -16.792 -21.987 -51.639 1.00 36.59 ? 349 MET B CE   1 
ATOM   10180 O OXT  . MET B 1 349 ? -16.784 -23.633 -45.572 1.00 28.29 ? 349 MET B OXT  1 
ATOM   10181 H H    . MET B 1 349 ? -16.119 -21.081 -46.876 1.00 26.99 ? 349 MET B H    1 
ATOM   10182 H HA   . MET B 1 349 ? -18.802 -21.616 -46.665 1.00 26.24 ? 349 MET B HA   1 
ATOM   10183 H HB2  . MET B 1 349 ? -16.991 -22.763 -48.550 1.00 22.92 ? 349 MET B HB2  1 
ATOM   10184 H HB3  . MET B 1 349 ? -18.568 -22.816 -48.659 1.00 22.92 ? 349 MET B HB3  1 
ATOM   10185 H HG2  . MET B 1 349 ? -18.443 -20.378 -48.763 1.00 28.73 ? 349 MET B HG2  1 
ATOM   10186 H HG3  . MET B 1 349 ? -16.912 -20.595 -49.085 1.00 28.73 ? 349 MET B HG3  1 
ATOM   10187 H HE1  . MET B 1 349 ? -16.895 -22.029 -52.598 1.00 43.89 ? 349 MET B HE1  1 
ATOM   10188 H HE2  . MET B 1 349 ? -15.988 -21.500 -51.422 1.00 43.89 ? 349 MET B HE2  1 
ATOM   10189 H HE3  . MET B 1 349 ? -16.734 -22.881 -51.282 1.00 43.89 ? 349 MET B HE3  1 
HETATM 10190 P P    . PO4 C 2 .   ? 0.436   -33.003 -29.522 1.00 83.25 ? 401 PO4 A P    1 
HETATM 10191 O O1   . PO4 C 2 .   ? -0.355  -33.778 -30.553 1.00 59.62 ? 401 PO4 A O1   1 
HETATM 10192 O O2   . PO4 C 2 .   ? 1.402   -33.929 -28.810 1.00 75.60 ? 401 PO4 A O2   1 
HETATM 10193 O O3   . PO4 C 2 .   ? 1.230   -31.919 -30.224 1.00 55.38 ? 401 PO4 A O3   1 
HETATM 10194 O O4   . PO4 C 2 .   ? -0.554  -32.417 -28.527 1.00 61.58 ? 401 PO4 A O4   1 
HETATM 10195 O O7   . 3SY D 3 .   ? -1.835  -29.565 -22.263 1.00 37.16 ? 402 3SY A O7   1 
HETATM 10196 C C3   . 3SY D 3 .   ? -1.835  -28.443 -21.434 1.00 32.00 ? 402 3SY A C3   1 
HETATM 10197 C C1   . 3SY D 3 .   ? -3.251  -27.895 -21.489 1.00 38.12 ? 402 3SY A C1   1 
HETATM 10198 C C2   . 3SY D 3 .   ? -3.467  -27.024 -20.257 1.00 36.32 ? 402 3SY A C2   1 
HETATM 10199 O O6   . 3SY D 3 .   ? -4.753  -26.486 -20.296 1.00 30.78 ? 402 3SY A O6   1 
HETATM 10200 C C4   . 3SY D 3 .   ? -4.255  -29.040 -21.529 1.00 35.97 ? 402 3SY A C4   1 
HETATM 10201 O O8   . 3SY D 3 .   ? -4.335  -29.787 -20.343 1.00 40.85 ? 402 3SY A O8   1 
HETATM 10202 C C5   . 3SY D 3 .   ? -3.451  -27.105 -22.792 1.00 35.95 ? 402 3SY A C5   1 
HETATM 10203 O O9   . 3SY D 3 .   ? -3.566  -27.993 -23.881 1.00 31.94 ? 402 3SY A O9   1 
HETATM 10204 H H1   . 3SY D 3 .   ? -1.187  -30.073 -22.052 1.00 44.57 ? 402 3SY A H1   1 
HETATM 10205 H H2   . 3SY D 3 .   ? -1.207  -27.782 -21.765 1.00 38.37 ? 402 3SY A H2   1 
HETATM 10206 H H3   . 3SY D 3 .   ? -1.609  -28.697 -20.526 1.00 38.37 ? 402 3SY A H3   1 
HETATM 10207 H H4   . 3SY D 3 .   ? -2.815  -26.306 -20.249 1.00 43.56 ? 402 3SY A H4   1 
HETATM 10208 H H5   . 3SY D 3 .   ? -3.366  -27.563 -19.457 1.00 43.56 ? 402 3SY A H5   1 
HETATM 10209 H H6   . 3SY D 3 .   ? -4.766  -25.823 -20.828 1.00 36.92 ? 402 3SY A H6   1 
HETATM 10210 H H7   . 3SY D 3 .   ? -5.132  -28.672 -21.719 1.00 43.14 ? 402 3SY A H7   1 
HETATM 10211 H H8   . 3SY D 3 .   ? -4.010  -29.638 -22.252 1.00 43.14 ? 402 3SY A H8   1 
HETATM 10212 H H9   . 3SY D 3 .   ? -5.025  -30.283 -20.366 1.00 49.00 ? 402 3SY A H9   1 
HETATM 10213 H H10  . 3SY D 3 .   ? -4.259  -26.573 -22.724 1.00 43.12 ? 402 3SY A H10  1 
HETATM 10214 H H11  . 3SY D 3 .   ? -2.691  -26.520 -22.933 1.00 43.12 ? 402 3SY A H11  1 
HETATM 10215 H H12  . 3SY D 3 .   ? -3.506  -27.558 -24.609 1.00 38.30 ? 402 3SY A H12  1 
HETATM 10216 K K    . K   E 4 .   ? -35.710 -18.572 -34.278 1.00 29.64 ? 403 K   A K    1 
HETATM 10217 K K    . K   F 4 .   ? 37.961  -18.490 -48.819 1.00 25.17 ? 401 K   B K    1 
HETATM 10218 O O    . HOH G 5 .   ? -7.366  -19.661 -22.174 1.00 17.88 ? 501 HOH A O    1 
HETATM 10219 O O    . HOH G 5 .   ? -19.116 -26.268 -39.653 1.00 35.81 ? 502 HOH A O    1 
HETATM 10220 O O    . HOH G 5 .   ? -24.148 -35.391 -22.990 1.00 37.36 ? 503 HOH A O    1 
HETATM 10221 O O    . HOH G 5 .   ? 19.418  -5.672  -29.846 1.00 36.87 ? 504 HOH A O    1 
HETATM 10222 O O    . HOH G 5 .   ? 2.734   -7.072  -16.263 1.00 25.62 ? 505 HOH A O    1 
HETATM 10223 O O    . HOH G 5 .   ? -36.694 -24.029 -27.263 1.00 36.28 ? 506 HOH A O    1 
HETATM 10224 O O    . HOH G 5 .   ? -26.154 -1.593  -26.022 1.00 40.96 ? 507 HOH A O    1 
HETATM 10225 O O    . HOH G 5 .   ? -8.592  -28.551 -23.834 1.00 23.33 ? 508 HOH A O    1 
HETATM 10226 O O    . HOH G 5 .   ? 18.834  -16.324 -30.936 1.00 21.88 ? 509 HOH A O    1 
HETATM 10227 O O    . HOH G 5 .   ? -19.227 -26.665 -27.812 1.00 19.90 ? 510 HOH A O    1 
HETATM 10228 O O    . HOH G 5 .   ? -31.862 -22.365 -40.593 1.00 31.23 ? 511 HOH A O    1 
HETATM 10229 O O    . HOH G 5 .   ? 7.114   10.359  -16.590 1.00 40.17 ? 512 HOH A O    1 
HETATM 10230 O O    . HOH G 5 .   ? -8.513  -30.494 -26.683 1.00 37.59 ? 513 HOH A O    1 
HETATM 10231 O O    . HOH G 5 .   ? -32.240 -19.175 -27.509 1.00 22.85 ? 514 HOH A O    1 
HETATM 10232 O O    . HOH G 5 .   ? -20.743 -7.488  -36.831 1.00 26.20 ? 515 HOH A O    1 
HETATM 10233 O O    . HOH G 5 .   ? -6.684  -30.951 -36.833 1.00 21.96 ? 516 HOH A O    1 
HETATM 10234 O O    . HOH G 5 .   ? -5.371  -22.670 -42.112 1.00 34.81 ? 517 HOH A O    1 
HETATM 10235 O O    . HOH G 5 .   ? -11.301 -19.246 -23.416 1.00 18.89 ? 518 HOH A O    1 
HETATM 10236 O O    . HOH G 5 .   ? 3.600   -21.854 -15.878 1.00 33.33 ? 519 HOH A O    1 
HETATM 10237 O O    . HOH G 5 .   ? 13.593  -23.571 -39.776 1.00 32.88 ? 520 HOH A O    1 
HETATM 10238 O O    . HOH G 5 .   ? -22.933 -9.578  -16.721 1.00 34.61 ? 521 HOH A O    1 
HETATM 10239 O O    . HOH G 5 .   ? -19.857 0.274   -31.615 1.00 44.94 ? 522 HOH A O    1 
HETATM 10240 O O    . HOH G 5 .   ? -23.128 -31.882 -21.652 1.00 30.49 ? 523 HOH A O    1 
HETATM 10241 O O    . HOH G 5 .   ? -18.141 -7.524  -37.598 1.00 25.07 ? 524 HOH A O    1 
HETATM 10242 O O    . HOH G 5 .   ? -25.384 -17.339 -39.479 1.00 24.74 ? 525 HOH A O    1 
HETATM 10243 O O    . HOH G 5 .   ? -12.983 -14.245 -28.386 1.00 21.62 ? 526 HOH A O    1 
HETATM 10244 O O    . HOH G 5 .   ? -15.373 -28.646 -28.699 1.00 26.22 ? 527 HOH A O    1 
HETATM 10245 O O    . HOH G 5 .   ? -11.124 -27.214 -23.628 1.00 24.39 ? 528 HOH A O    1 
HETATM 10246 O O    . HOH G 5 .   ? -25.455 -28.523 -26.962 1.00 41.24 ? 529 HOH A O    1 
HETATM 10247 O O    . HOH G 5 .   ? 15.176  -4.587  -18.684 1.00 20.13 ? 530 HOH A O    1 
HETATM 10248 O O    . HOH G 5 .   ? 24.519  -14.957 -35.345 1.00 20.56 ? 531 HOH A O    1 
HETATM 10249 O O    . HOH G 5 .   ? 1.909   -31.374 -34.422 1.00 24.06 ? 532 HOH A O    1 
HETATM 10250 O O    . HOH G 5 .   ? -25.038 -29.090 -36.994 1.00 28.09 ? 533 HOH A O    1 
HETATM 10251 O O    . HOH G 5 .   ? -23.247 -24.644 -7.946  1.00 24.34 ? 534 HOH A O    1 
HETATM 10252 O O    . HOH G 5 .   ? 1.422   -29.752 -21.173 1.00 30.36 ? 535 HOH A O    1 
HETATM 10253 O O    . HOH G 5 .   ? -0.656  -5.196  -28.277 1.00 17.68 ? 536 HOH A O    1 
HETATM 10254 O O    . HOH G 5 .   ? -8.857  -12.198 -39.488 1.00 15.77 ? 537 HOH A O    1 
HETATM 10255 O O    . HOH G 5 .   ? -6.594  -26.712 -38.475 1.00 25.58 ? 538 HOH A O    1 
HETATM 10256 O O    . HOH G 5 .   ? -10.104 -18.235 -39.175 1.00 16.14 ? 539 HOH A O    1 
HETATM 10257 O O    . HOH G 5 .   ? -6.875  -17.206 -28.991 1.00 23.76 ? 540 HOH A O    1 
HETATM 10258 O O    . HOH G 5 .   ? -23.144 -32.605 -30.961 1.00 40.58 ? 541 HOH A O    1 
HETATM 10259 O O    . HOH G 5 .   ? -9.574  -23.772 -42.732 1.00 27.14 ? 542 HOH A O    1 
HETATM 10260 O O    . HOH G 5 .   ? 2.116   -34.523 -31.351 1.00 30.45 ? 543 HOH A O    1 
HETATM 10261 O O    . HOH G 5 .   ? -11.529 -12.838 -30.555 1.00 17.37 ? 544 HOH A O    1 
HETATM 10262 O O    . HOH G 5 .   ? -12.706 -28.528 -25.278 1.00 25.04 ? 545 HOH A O    1 
HETATM 10263 O O    . HOH G 5 .   ? 17.204  -23.275 -40.701 1.00 23.02 ? 546 HOH A O    1 
HETATM 10264 O O    . HOH G 5 .   ? -21.236 -33.713 -20.058 1.00 29.17 ? 547 HOH A O    1 
HETATM 10265 O O    . HOH G 5 .   ? -13.692 -15.542 -10.412 1.00 34.48 ? 548 HOH A O    1 
HETATM 10266 O O    . HOH G 5 .   ? -12.211 -17.160 -40.294 1.00 15.81 ? 549 HOH A O    1 
HETATM 10267 O O    . HOH G 5 .   ? 5.719   -32.364 -25.725 1.00 38.94 ? 550 HOH A O    1 
HETATM 10268 O O    . HOH G 5 .   ? -23.604 -5.619  -18.111 1.00 39.91 ? 551 HOH A O    1 
HETATM 10269 O O    . HOH G 5 .   ? -6.381  -15.390 -31.022 1.00 16.68 ? 552 HOH A O    1 
HETATM 10270 O O    . HOH G 5 .   ? 14.410  4.654   -28.058 1.00 33.80 ? 553 HOH A O    1 
HETATM 10271 O O    . HOH G 5 .   ? 9.185   -1.536  -35.798 1.00 26.65 ? 554 HOH A O    1 
HETATM 10272 O O    . HOH G 5 .   ? -16.276 -28.855 -35.456 1.00 33.46 ? 555 HOH A O    1 
HETATM 10273 O O    . HOH G 5 .   ? 18.773  -16.188 -35.992 1.00 15.81 ? 556 HOH A O    1 
HETATM 10274 O O    . HOH G 5 .   ? -26.842 -27.183 -38.186 1.00 35.52 ? 557 HOH A O    1 
HETATM 10275 O O    . HOH G 5 .   ? 4.779   -0.404  -36.530 1.00 27.10 ? 558 HOH A O    1 
HETATM 10276 O O    . HOH G 5 .   ? -32.186 -20.798 -19.801 1.00 36.14 ? 559 HOH A O    1 
HETATM 10277 O O    . HOH G 5 .   ? -25.632 -21.784 -7.325  1.00 40.07 ? 560 HOH A O    1 
HETATM 10278 O O    . HOH G 5 .   ? -7.520  -17.234 -26.007 1.00 27.03 ? 561 HOH A O    1 
HETATM 10279 O O    . HOH G 5 .   ? -33.339 -11.102 -39.436 1.00 36.37 ? 562 HOH A O    1 
HETATM 10280 O O    . HOH G 5 .   ? 6.756   -27.492 -37.104 1.00 36.66 ? 563 HOH A O    1 
HETATM 10281 O O    . HOH G 5 .   ? -28.114 -30.246 -13.552 1.00 19.89 ? 564 HOH A O    1 
HETATM 10282 O O    . HOH G 5 .   ? -2.436  -26.475 -16.143 1.00 38.66 ? 565 HOH A O    1 
HETATM 10283 O O    . HOH G 5 .   ? -0.956  -13.102 -22.568 1.00 21.90 ? 566 HOH A O    1 
HETATM 10284 O O    . HOH G 5 .   ? -27.871 -25.400 -19.096 1.00 20.17 ? 567 HOH A O    1 
HETATM 10285 O O    . HOH G 5 .   ? 9.930   -24.242 -38.673 1.00 39.99 ? 568 HOH A O    1 
HETATM 10286 O O    . HOH G 5 .   ? -37.172 -18.680 -39.484 1.00 24.28 ? 569 HOH A O    1 
HETATM 10287 O O    . HOH G 5 .   ? -15.216 -32.430 -14.641 1.00 40.77 ? 570 HOH A O    1 
HETATM 10288 O O    . HOH G 5 .   ? -1.217  -14.617 -18.334 1.00 37.75 ? 571 HOH A O    1 
HETATM 10289 O O    . HOH G 5 .   ? -11.725 -25.537 -41.557 1.00 30.12 ? 572 HOH A O    1 
HETATM 10290 O O    . HOH G 5 .   ? 25.040  -18.009 -34.653 1.00 30.97 ? 573 HOH A O    1 
HETATM 10291 O O    . HOH G 5 .   ? 7.731   -23.617 -35.172 1.00 26.26 ? 574 HOH A O    1 
HETATM 10292 O O    . HOH G 5 .   ? -5.814  -28.555 -30.131 1.00 26.54 ? 575 HOH A O    1 
HETATM 10293 O O    . HOH G 5 .   ? -22.728 -28.508 -14.232 1.00 19.35 ? 576 HOH A O    1 
HETATM 10294 O O    . HOH G 5 .   ? -24.697 -27.815 -7.394  1.00 22.16 ? 577 HOH A O    1 
HETATM 10295 O O    . HOH G 5 .   ? 15.809  -2.252  -20.560 1.00 25.68 ? 578 HOH A O    1 
HETATM 10296 O O    . HOH G 5 .   ? -18.599 -9.010  -21.575 1.00 28.85 ? 579 HOH A O    1 
HETATM 10297 O O    . HOH G 5 .   ? 7.409   1.997   -35.264 1.00 33.59 ? 580 HOH A O    1 
HETATM 10298 O O    . HOH G 5 .   ? -33.262 -11.132 -36.612 1.00 27.18 ? 581 HOH A O    1 
HETATM 10299 O O    . HOH G 5 .   ? -25.366 -30.462 -17.565 1.00 23.43 ? 582 HOH A O    1 
HETATM 10300 O O    . HOH G 5 .   ? 10.392  2.468   -34.784 1.00 26.25 ? 583 HOH A O    1 
HETATM 10301 O O    . HOH G 5 .   ? 6.004   -26.785 -15.340 1.00 37.12 ? 584 HOH A O    1 
HETATM 10302 O O    . HOH G 5 .   ? -16.983 -4.291  -20.994 1.00 38.17 ? 585 HOH A O    1 
HETATM 10303 O O    . HOH G 5 .   ? -27.323 -11.306 -36.435 1.00 31.54 ? 586 HOH A O    1 
HETATM 10304 O O    . HOH G 5 .   ? -19.693 -24.630 -6.689  1.00 30.76 ? 587 HOH A O    1 
HETATM 10305 O O    . HOH G 5 .   ? -14.574 -30.130 -24.009 1.00 28.48 ? 588 HOH A O    1 
HETATM 10306 O O    . HOH G 5 .   ? 7.771   -28.202 -30.582 1.00 26.45 ? 589 HOH A O    1 
HETATM 10307 O O    . HOH G 5 .   ? -9.578  -32.033 -31.592 1.00 40.60 ? 590 HOH A O    1 
HETATM 10308 O O    . HOH G 5 .   ? -16.308 -22.853 -41.204 1.00 19.68 ? 591 HOH A O    1 
HETATM 10309 O O    . HOH G 5 .   ? -2.424  -14.937 -32.364 1.00 19.43 ? 592 HOH A O    1 
HETATM 10310 O O    . HOH G 5 .   ? -11.098 -11.235 -20.077 1.00 32.40 ? 593 HOH A O    1 
HETATM 10311 O O    . HOH G 5 .   ? -5.317  -3.525  -33.298 1.00 34.76 ? 594 HOH A O    1 
HETATM 10312 O O    . HOH G 5 .   ? 20.099  -1.534  -29.544 1.00 47.87 ? 595 HOH A O    1 
HETATM 10313 O O    . HOH G 5 .   ? 2.860   -14.948 -14.305 1.00 36.25 ? 596 HOH A O    1 
HETATM 10314 O O    . HOH G 5 .   ? -22.925 -8.261  -38.024 1.00 24.93 ? 597 HOH A O    1 
HETATM 10315 O O    . HOH G 5 .   ? 13.509  -6.206  -15.720 1.00 27.06 ? 598 HOH A O    1 
HETATM 10316 O O    . HOH G 5 .   ? -11.638 -16.326 -12.625 1.00 39.29 ? 599 HOH A O    1 
HETATM 10317 O O    . HOH G 5 .   ? 14.934  1.809   -22.287 1.00 31.60 ? 600 HOH A O    1 
HETATM 10318 O O    . HOH G 5 .   ? -13.262 -6.473  -35.194 1.00 20.08 ? 601 HOH A O    1 
HETATM 10319 O O    . HOH G 5 .   ? 16.848  -14.775 -25.336 1.00 22.59 ? 602 HOH A O    1 
HETATM 10320 O O    . HOH G 5 .   ? -31.514 -27.401 -15.339 1.00 38.50 ? 603 HOH A O    1 
HETATM 10321 O O    . HOH G 5 .   ? 10.700  -21.655 -33.048 1.00 27.03 ? 604 HOH A O    1 
HETATM 10322 O O    . HOH G 5 .   ? -14.374 -11.509 -22.120 1.00 32.94 ? 605 HOH A O    1 
HETATM 10323 O O    . HOH G 5 .   ? 22.022  -14.671 -30.242 1.00 35.91 ? 606 HOH A O    1 
HETATM 10324 O O    . HOH G 5 .   ? 23.540  -21.024 -36.144 1.00 30.77 ? 607 HOH A O    1 
HETATM 10325 O O    . HOH G 5 .   ? -8.188  -29.626 -29.400 1.00 23.13 ? 608 HOH A O    1 
HETATM 10326 O O    . HOH G 5 .   ? 18.820  -0.711  -23.541 1.00 30.14 ? 609 HOH A O    1 
HETATM 10327 O O    . HOH G 5 .   ? -31.981 -31.631 -17.890 1.00 27.92 ? 610 HOH A O    1 
HETATM 10328 O O    . HOH G 5 .   ? 15.553  3.950   -26.036 1.00 36.05 ? 611 HOH A O    1 
HETATM 10329 O O    . HOH G 5 .   ? 16.633  -18.274 -24.492 1.00 24.98 ? 612 HOH A O    1 
HETATM 10330 O O    . HOH G 5 .   ? -7.159  -24.945 -40.477 1.00 32.92 ? 613 HOH A O    1 
HETATM 10331 O O    . HOH G 5 .   ? 2.346   5.345   -24.895 1.00 32.59 ? 614 HOH A O    1 
HETATM 10332 O O    . HOH G 5 .   ? -33.101 -28.443 -27.304 1.00 39.69 ? 615 HOH A O    1 
HETATM 10333 O O    . HOH G 5 .   ? 2.459   4.287   -28.898 1.00 32.69 ? 616 HOH A O    1 
HETATM 10334 O O    . HOH G 5 .   ? 9.680   -4.161  -15.653 1.00 30.71 ? 617 HOH A O    1 
HETATM 10335 O O    . HOH G 5 .   ? -5.189  -6.383  -13.352 1.00 46.76 ? 618 HOH A O    1 
HETATM 10336 O O    . HOH G 5 .   ? -36.157 -21.168 -11.441 1.00 38.13 ? 619 HOH A O    1 
HETATM 10337 O O    . HOH G 5 .   ? 7.609   -0.871  -37.839 1.00 32.82 ? 620 HOH A O    1 
HETATM 10338 O O    . HOH G 5 .   ? -34.008 -20.683 -40.942 1.00 26.87 ? 621 HOH A O    1 
HETATM 10339 O O    . HOH G 5 .   ? 9.986   3.028   -13.450 1.00 46.32 ? 622 HOH A O    1 
HETATM 10340 O O    . HOH G 5 .   ? 2.343   -0.137  -34.680 1.00 40.18 ? 623 HOH A O    1 
HETATM 10341 O O    . HOH G 5 .   ? -4.071  -28.862 -16.767 1.00 23.26 ? 624 HOH A O    1 
HETATM 10342 O O    . HOH G 5 .   ? -5.157  -28.749 -39.962 1.00 36.26 ? 625 HOH A O    1 
HETATM 10343 O O    . HOH G 5 .   ? -20.247 -9.373  -17.970 1.00 32.97 ? 626 HOH A O    1 
HETATM 10344 O O    . HOH G 5 .   ? -31.175 -25.850 -12.319 1.00 37.00 ? 627 HOH A O    1 
HETATM 10345 O O    . HOH G 5 .   ? -0.579  -28.122 -40.690 1.00 19.78 ? 628 HOH A O    1 
HETATM 10346 O O    . HOH G 5 .   ? 1.956   -29.081 -38.473 1.00 19.79 ? 629 HOH A O    1 
HETATM 10347 O O    . HOH G 5 .   ? -31.838 -19.893 -22.579 1.00 37.06 ? 630 HOH A O    1 
HETATM 10348 O O    . HOH G 5 .   ? 18.044  1.880   -30.705 1.00 40.32 ? 631 HOH A O    1 
HETATM 10349 O O    . HOH G 5 .   ? 6.958   -30.557 -17.965 1.00 33.41 ? 632 HOH A O    1 
HETATM 10350 O O    . HOH G 5 .   ? -14.053 -2.470  -28.117 1.00 38.92 ? 633 HOH A O    1 
HETATM 10351 O O    . HOH G 5 .   ? -5.538  -3.647  -26.436 1.00 31.37 ? 634 HOH A O    1 
HETATM 10352 O O    . HOH G 5 .   ? 8.007   -3.998  -13.432 1.00 31.74 ? 635 HOH A O    1 
HETATM 10353 O O    . HOH G 5 .   ? -3.371  -12.964 -22.209 1.00 32.74 ? 636 HOH A O    1 
HETATM 10354 O O    . HOH G 5 .   ? -20.604 -34.748 -35.598 1.00 40.02 ? 637 HOH A O    1 
HETATM 10355 O O    . HOH G 5 .   ? 10.408  -1.748  -46.172 1.00 38.15 ? 638 HOH A O    1 
HETATM 10356 O O    . HOH G 5 .   ? -2.826  -6.241  -26.506 1.00 18.76 ? 639 HOH A O    1 
HETATM 10357 O O    . HOH G 5 .   ? -12.577 -28.281 -21.639 1.00 36.70 ? 640 HOH A O    1 
HETATM 10358 O O    . HOH G 5 .   ? -0.913  0.680   -29.863 1.00 20.54 ? 641 HOH A O    1 
HETATM 10359 O O    . HOH G 5 .   ? -12.261 -11.594 -23.214 1.00 34.30 ? 642 HOH A O    1 
HETATM 10360 O O    . HOH G 5 .   ? -17.325 -30.415 -29.077 1.00 29.44 ? 643 HOH A O    1 
HETATM 10361 O O    . HOH G 5 .   ? 14.067  -0.224  -20.618 1.00 33.77 ? 644 HOH A O    1 
HETATM 10362 O O    . HOH G 5 .   ? -15.369 -9.010  -21.041 1.00 42.77 ? 645 HOH A O    1 
HETATM 10363 O O    . HOH G 5 .   ? 18.962  -15.707 -26.667 1.00 33.14 ? 646 HOH A O    1 
HETATM 10364 O O    . HOH G 5 .   ? -21.305 -20.358 -5.537  1.00 45.09 ? 647 HOH A O    1 
HETATM 10365 O O    . HOH G 5 .   ? 23.908  -23.281 -40.044 1.00 27.98 ? 648 HOH A O    1 
HETATM 10366 O O    . HOH G 5 .   ? -17.460 0.983   -22.987 1.00 48.26 ? 649 HOH A O    1 
HETATM 10367 O O    . HOH G 5 .   ? 7.101   -30.970 -29.693 1.00 42.80 ? 650 HOH A O    1 
HETATM 10368 O O    . HOH G 5 .   ? 7.492   -26.133 -34.601 1.00 33.32 ? 651 HOH A O    1 
HETATM 10369 O O    . HOH G 5 .   ? 13.863  -25.445 -37.698 1.00 41.48 ? 652 HOH A O    1 
HETATM 10370 O O    . HOH G 5 .   ? 4.024   -36.548 -27.752 1.00 46.33 ? 653 HOH A O    1 
HETATM 10371 O O    . HOH G 5 .   ? 25.178  -13.514 -33.118 1.00 34.62 ? 654 HOH A O    1 
HETATM 10372 O O    . HOH G 5 .   ? -21.007 -19.025 -47.698 1.00 37.56 ? 655 HOH A O    1 
HETATM 10373 O O    . HOH G 5 .   ? -19.242 -29.373 -28.202 1.00 36.17 ? 656 HOH A O    1 
HETATM 10374 O O    . HOH G 5 .   ? 5.024   -24.278 -14.207 1.00 37.62 ? 657 HOH A O    1 
HETATM 10375 O O    . HOH G 5 .   ? -33.296 0.542   -13.539 1.00 51.01 ? 658 HOH A O    1 
HETATM 10376 O O    . HOH G 5 .   ? -21.141 -31.608 -28.254 1.00 45.76 ? 659 HOH A O    1 
HETATM 10377 O O    . HOH G 5 .   ? 15.036  -3.205  -16.275 1.00 40.81 ? 660 HOH A O    1 
HETATM 10378 O O    . HOH G 5 .   ? -23.886 -20.778 -5.557  1.00 44.44 ? 661 HOH A O    1 
HETATM 10379 O O    . HOH G 5 .   ? -19.192 -6.844  -16.982 1.00 47.46 ? 662 HOH A O    1 
HETATM 10380 O O    . HOH G 5 .   ? -22.370 -21.582 -44.855 1.00 35.10 ? 663 HOH A O    1 
HETATM 10381 O O    . HOH G 5 .   ? 11.816  9.754   -21.592 1.00 32.21 ? 664 HOH A O    1 
HETATM 10382 O O    . HOH G 5 .   ? 17.818  1.997   -25.616 1.00 50.65 ? 665 HOH A O    1 
HETATM 10383 O O    . HOH G 5 .   ? -16.821 -32.554 -27.788 1.00 27.35 ? 666 HOH A O    1 
HETATM 10384 O O    . HOH G 5 .   ? -15.744 -29.219 -38.201 1.00 27.59 ? 667 HOH A O    1 
HETATM 10385 O O    . HOH G 5 .   ? 5.072   -23.173 -11.800 1.00 44.88 ? 668 HOH A O    1 
HETATM 10386 O O    . HOH G 5 .   ? -7.290  -3.270  -28.805 1.00 45.13 ? 669 HOH A O    1 
HETATM 10387 O O    . HOH G 5 .   ? -10.936 -31.239 -26.781 1.00 39.83 ? 670 HOH A O    1 
HETATM 10388 O O    . HOH G 5 .   ? -8.215  -25.518 -44.341 1.00 39.37 ? 671 HOH A O    1 
HETATM 10389 O O    . HOH G 5 .   ? -25.406 -8.460  -36.858 1.00 42.55 ? 672 HOH A O    1 
HETATM 10390 O O    . HOH G 5 .   ? -33.530 3.016   -12.813 1.00 45.11 ? 673 HOH A O    1 
HETATM 10391 O O    . HOH G 5 .   ? 12.401  -2.679  -15.300 1.00 48.61 ? 674 HOH A O    1 
HETATM 10392 O O    . HOH G 5 .   ? 8.290   -27.916 -33.368 1.00 34.68 ? 675 HOH A O    1 
HETATM 10393 O O    . HOH H 5 .   ? 9.448   -14.623 -60.511 1.00 26.32 ? 501 HOH B O    1 
HETATM 10394 O O    . HOH H 5 .   ? -7.034  -0.721  -42.793 1.00 29.31 ? 502 HOH B O    1 
HETATM 10395 O O    . HOH H 5 .   ? 6.833   -20.608 -64.290 1.00 42.56 ? 503 HOH B O    1 
HETATM 10396 O O    . HOH H 5 .   ? -20.090 0.925   -53.846 1.00 35.19 ? 504 HOH B O    1 
HETATM 10397 O O    . HOH H 5 .   ? 0.027   -1.204  -62.937 1.00 46.28 ? 505 HOH B O    1 
HETATM 10398 O O    . HOH H 5 .   ? -16.899 -13.219 -51.381 1.00 28.60 ? 506 HOH B O    1 
HETATM 10399 O O    . HOH H 5 .   ? 7.378   -1.882  -45.665 1.00 35.48 ? 507 HOH B O    1 
HETATM 10400 O O    . HOH H 5 .   ? -7.128  9.548   -63.254 1.00 32.00 ? 508 HOH B O    1 
HETATM 10401 O O    . HOH H 5 .   ? -12.501 0.775   -60.390 1.00 29.39 ? 509 HOH B O    1 
HETATM 10402 O O    . HOH H 5 .   ? 26.555  0.750   -63.304 1.00 21.77 ? 510 HOH B O    1 
HETATM 10403 O O    . HOH H 5 .   ? 20.572  -27.770 -47.076 1.00 34.11 ? 511 HOH B O    1 
HETATM 10404 O O    . HOH H 5 .   ? 32.972  -20.524 -69.220 1.00 36.82 ? 512 HOH B O    1 
HETATM 10405 O O    . HOH H 5 .   ? 19.562  -5.675  -76.952 1.00 40.94 ? 513 HOH B O    1 
HETATM 10406 O O    . HOH H 5 .   ? 37.957  -9.584  -47.746 1.00 29.79 ? 514 HOH B O    1 
HETATM 10407 O O    . HOH H 5 .   ? 35.691  -24.089 -58.730 1.00 33.10 ? 515 HOH B O    1 
HETATM 10408 O O    . HOH H 5 .   ? -11.081 -22.448 -44.527 1.00 31.68 ? 516 HOH B O    1 
HETATM 10409 O O    . HOH H 5 .   ? 13.513  -14.583 -59.019 1.00 22.87 ? 517 HOH B O    1 
HETATM 10410 O O    . HOH H 5 .   ? 12.723  -9.675  -42.228 1.00 12.72 ? 518 HOH B O    1 
HETATM 10411 O O    . HOH H 5 .   ? 28.750  -26.339 -47.346 1.00 30.35 ? 519 HOH B O    1 
HETATM 10412 O O    . HOH H 5 .   ? 34.266  -15.257 -63.503 1.00 29.68 ? 520 HOH B O    1 
HETATM 10413 O O    . HOH H 5 .   ? -22.149 -9.199  -49.912 1.00 29.22 ? 521 HOH B O    1 
HETATM 10414 O O    . HOH H 5 .   ? 8.470   -12.728 -50.776 1.00 19.95 ? 522 HOH B O    1 
HETATM 10415 O O    . HOH H 5 .   ? -12.709 6.490   -48.293 1.00 39.68 ? 523 HOH B O    1 
HETATM 10416 O O    . HOH H 5 .   ? 26.625  -0.185  -60.626 1.00 23.13 ? 524 HOH B O    1 
HETATM 10417 O O    . HOH H 5 .   ? 35.950  -6.451  -68.751 1.00 32.74 ? 525 HOH B O    1 
HETATM 10418 O O    . HOH H 5 .   ? 25.287  -8.351  -42.289 1.00 20.21 ? 526 HOH B O    1 
HETATM 10419 O O    . HOH H 5 .   ? 37.008  -2.287  -48.317 1.00 22.52 ? 527 HOH B O    1 
HETATM 10420 O O    . HOH H 5 .   ? 21.163  -25.881 -45.606 1.00 30.65 ? 528 HOH B O    1 
HETATM 10421 O O    . HOH H 5 .   ? 36.480  -15.385 -59.291 1.00 32.06 ? 529 HOH B O    1 
HETATM 10422 O O    . HOH H 5 .   ? 39.536  5.915   -57.397 1.00 39.57 ? 530 HOH B O    1 
HETATM 10423 O O    . HOH H 5 .   ? 14.558  -24.032 -59.734 1.00 33.04 ? 531 HOH B O    1 
HETATM 10424 O O    . HOH H 5 .   ? 38.039  -5.511  -63.576 1.00 30.32 ? 532 HOH B O    1 
HETATM 10425 O O    . HOH H 5 .   ? 23.139  -6.982  -43.457 1.00 22.43 ? 533 HOH B O    1 
HETATM 10426 O O    . HOH H 5 .   ? 37.998  -1.298  -64.897 1.00 36.64 ? 534 HOH B O    1 
HETATM 10427 O O    . HOH H 5 .   ? -22.961 -17.170 -48.639 1.00 26.33 ? 535 HOH B O    1 
HETATM 10428 O O    . HOH H 5 .   ? 35.893  -3.977  -53.633 1.00 20.68 ? 536 HOH B O    1 
HETATM 10429 O O    . HOH H 5 .   ? 24.970  -23.448 -69.069 1.00 32.30 ? 537 HOH B O    1 
HETATM 10430 O O    . HOH H 5 .   ? -16.585 -14.695 -46.287 1.00 19.51 ? 538 HOH B O    1 
HETATM 10431 O O    . HOH H 5 .   ? 24.562  -21.419 -70.983 1.00 44.25 ? 539 HOH B O    1 
HETATM 10432 O O    . HOH H 5 .   ? -16.920 -2.886  -49.723 1.00 27.86 ? 540 HOH B O    1 
HETATM 10433 O O    . HOH H 5 .   ? 27.423  -17.702 -43.485 1.00 18.30 ? 541 HOH B O    1 
HETATM 10434 O O    . HOH H 5 .   ? -5.295  -1.272  -34.399 1.00 36.53 ? 542 HOH B O    1 
HETATM 10435 O O    . HOH H 5 .   ? 18.197  -9.406  -75.454 1.00 33.52 ? 543 HOH B O    1 
HETATM 10436 O O    . HOH H 5 .   ? 24.379  4.324   -49.610 1.00 21.82 ? 544 HOH B O    1 
HETATM 10437 O O    . HOH H 5 .   ? 29.852  -19.645 -65.209 1.00 21.33 ? 545 HOH B O    1 
HETATM 10438 O O    . HOH H 5 .   ? -15.049 -22.827 -43.688 1.00 19.62 ? 546 HOH B O    1 
HETATM 10439 O O    . HOH H 5 .   ? -22.478 -13.097 -46.586 1.00 27.33 ? 547 HOH B O    1 
HETATM 10440 O O    . HOH H 5 .   ? 28.936  9.132   -57.184 1.00 29.04 ? 548 HOH B O    1 
HETATM 10441 O O    . HOH H 5 .   ? 18.316  -23.020 -43.093 1.00 23.20 ? 549 HOH B O    1 
HETATM 10442 O O    . HOH H 5 .   ? 0.427   12.461  -56.299 1.00 41.73 ? 550 HOH B O    1 
HETATM 10443 O O    . HOH H 5 .   ? 30.158  -12.276 -43.004 1.00 35.48 ? 551 HOH B O    1 
HETATM 10444 O O    . HOH H 5 .   ? -9.715  -20.251 -52.827 1.00 33.48 ? 552 HOH B O    1 
HETATM 10445 O O    . HOH H 5 .   ? -1.501  6.831   -50.349 1.00 26.39 ? 553 HOH B O    1 
HETATM 10446 O O    . HOH H 5 .   ? -8.058  -17.012 -70.105 1.00 32.70 ? 554 HOH B O    1 
HETATM 10447 O O    . HOH H 5 .   ? 15.033  -10.934 -53.242 1.00 21.43 ? 555 HOH B O    1 
HETATM 10448 O O    . HOH H 5 .   ? 11.723  -24.003 -41.739 1.00 27.27 ? 556 HOH B O    1 
HETATM 10449 O O    . HOH H 5 .   ? -8.393  3.347   -42.425 1.00 24.07 ? 557 HOH B O    1 
HETATM 10450 O O    . HOH H 5 .   ? -10.364 -9.954  -38.764 1.00 16.52 ? 558 HOH B O    1 
HETATM 10451 O O    . HOH H 5 .   ? 21.275  -22.888 -57.174 1.00 21.98 ? 559 HOH B O    1 
HETATM 10452 O O    . HOH H 5 .   ? 11.106  -11.926 -42.008 1.00 14.65 ? 560 HOH B O    1 
HETATM 10453 O O    . HOH H 5 .   ? 29.619  0.870   -51.820 1.00 18.62 ? 561 HOH B O    1 
HETATM 10454 O O    . HOH H 5 .   ? 10.425  -6.983  -49.267 1.00 37.91 ? 562 HOH B O    1 
HETATM 10455 O O    . HOH H 5 .   ? 34.415  -16.276 -55.646 1.00 19.10 ? 563 HOH B O    1 
HETATM 10456 O O    . HOH H 5 .   ? 22.350  -32.779 -51.914 1.00 39.02 ? 564 HOH B O    1 
HETATM 10457 O O    . HOH H 5 .   ? 16.119  -27.124 -45.806 1.00 39.26 ? 565 HOH B O    1 
HETATM 10458 O O    . HOH H 5 .   ? 38.483  -4.747  -56.062 1.00 24.01 ? 566 HOH B O    1 
HETATM 10459 O O    . HOH H 5 .   ? 9.228   -14.051 -53.336 1.00 32.33 ? 567 HOH B O    1 
HETATM 10460 O O    . HOH H 5 .   ? -11.383 -2.913  -38.573 1.00 33.42 ? 568 HOH B O    1 
HETATM 10461 O O    . HOH H 5 .   ? 20.600  -7.230  -42.764 1.00 16.96 ? 569 HOH B O    1 
HETATM 10462 O O    . HOH H 5 .   ? 27.180  -27.934 -49.013 1.00 28.12 ? 570 HOH B O    1 
HETATM 10463 O O    . HOH H 5 .   ? 21.326  -4.419  -58.167 1.00 20.88 ? 571 HOH B O    1 
HETATM 10464 O O    . HOH H 5 .   ? 7.350   -25.127 -55.222 1.00 37.15 ? 572 HOH B O    1 
HETATM 10465 O O    . HOH H 5 .   ? 3.210   -8.400  -58.366 1.00 31.71 ? 573 HOH B O    1 
HETATM 10466 O O    . HOH H 5 .   ? 12.292  -17.826 -43.912 1.00 15.07 ? 574 HOH B O    1 
HETATM 10467 O O    . HOH H 5 .   ? 34.707  10.875  -59.950 1.00 37.07 ? 575 HOH B O    1 
HETATM 10468 O O    . HOH H 5 .   ? 16.873  -24.037 -63.568 1.00 37.14 ? 576 HOH B O    1 
HETATM 10469 O O    . HOH H 5 .   ? 38.695  -21.455 -57.235 1.00 33.02 ? 577 HOH B O    1 
HETATM 10470 O O    . HOH H 5 .   ? 2.870   -2.197  -50.799 1.00 26.11 ? 578 HOH B O    1 
HETATM 10471 O O    . HOH H 5 .   ? -7.321  -0.520  -35.994 1.00 31.30 ? 579 HOH B O    1 
HETATM 10472 O O    . HOH H 5 .   ? 32.045  8.489   -49.499 1.00 21.01 ? 580 HOH B O    1 
HETATM 10473 O O    . HOH H 5 .   ? -5.720  -21.751 -48.985 1.00 19.52 ? 581 HOH B O    1 
HETATM 10474 O O    . HOH H 5 .   ? 23.789  -4.060  -36.814 1.00 39.63 ? 582 HOH B O    1 
HETATM 10475 O O    . HOH H 5 .   ? 5.602   -2.886  -57.844 1.00 25.12 ? 583 HOH B O    1 
HETATM 10476 O O    . HOH H 5 .   ? 29.687  -2.297  -69.115 1.00 26.87 ? 584 HOH B O    1 
HETATM 10477 O O    . HOH H 5 .   ? 37.018  6.597   -48.769 1.00 32.76 ? 585 HOH B O    1 
HETATM 10478 O O    . HOH H 5 .   ? 30.387  -25.185 -62.039 1.00 45.08 ? 586 HOH B O    1 
HETATM 10479 O O    . HOH H 5 .   ? 27.732  -24.512 -58.383 1.00 35.39 ? 587 HOH B O    1 
HETATM 10480 O O    . HOH H 5 .   ? 18.378  -26.842 -50.235 1.00 24.07 ? 588 HOH B O    1 
HETATM 10481 O O    . HOH H 5 .   ? -12.415 -23.097 -68.678 1.00 43.52 ? 589 HOH B O    1 
HETATM 10482 O O    . HOH H 5 .   ? 25.658  -3.797  -63.376 1.00 29.13 ? 590 HOH B O    1 
HETATM 10483 O O    . HOH H 5 .   ? 18.471  1.403   -43.634 1.00 38.07 ? 591 HOH B O    1 
HETATM 10484 O O    . HOH H 5 .   ? 25.051  -26.013 -65.192 1.00 27.33 ? 592 HOH B O    1 
HETATM 10485 O O    . HOH H 5 .   ? -9.761  -26.592 -63.200 1.00 45.35 ? 593 HOH B O    1 
HETATM 10486 O O    . HOH H 5 .   ? 35.952  -12.177 -44.118 1.00 32.01 ? 594 HOH B O    1 
HETATM 10487 O O    . HOH H 5 .   ? 21.672  -5.620  -34.891 1.00 41.33 ? 595 HOH B O    1 
HETATM 10488 O O    . HOH H 5 .   ? 13.826  -25.492 -43.419 1.00 37.49 ? 596 HOH B O    1 
HETATM 10489 O O    . HOH H 5 .   ? 14.436  -16.905 -42.495 1.00 15.52 ? 597 HOH B O    1 
HETATM 10490 O O    . HOH H 5 .   ? 16.941  -25.393 -56.900 1.00 28.13 ? 598 HOH B O    1 
HETATM 10491 O O    . HOH H 5 .   ? 26.333  -4.339  -37.184 1.00 38.57 ? 599 HOH B O    1 
HETATM 10492 O O    . HOH H 5 .   ? -1.822  -15.177 -67.416 1.00 40.66 ? 600 HOH B O    1 
HETATM 10493 O O    . HOH H 5 .   ? 31.621  -16.561 -42.892 1.00 25.75 ? 601 HOH B O    1 
HETATM 10494 O O    . HOH H 5 .   ? 15.617  -7.596  -70.784 1.00 27.99 ? 602 HOH B O    1 
HETATM 10495 O O    . HOH H 5 .   ? 35.334  -0.211  -68.966 1.00 29.04 ? 603 HOH B O    1 
HETATM 10496 O O    . HOH H 5 .   ? 15.612  -5.307  -44.578 1.00 18.22 ? 604 HOH B O    1 
HETATM 10497 O O    . HOH H 5 .   ? 40.362  -20.711 -52.566 1.00 30.08 ? 605 HOH B O    1 
HETATM 10498 O O    . HOH H 5 .   ? 4.533   -12.794 -49.331 1.00 21.65 ? 606 HOH B O    1 
HETATM 10499 O O    . HOH H 5 .   ? 15.135  1.924   -49.190 1.00 45.68 ? 607 HOH B O    1 
HETATM 10500 O O    . HOH H 5 .   ? 13.781  -10.319 -50.856 1.00 17.90 ? 608 HOH B O    1 
HETATM 10501 O O    . HOH H 5 .   ? 13.711  -9.169  -68.902 1.00 35.85 ? 609 HOH B O    1 
HETATM 10502 O O    . HOH H 5 .   ? -5.804  -24.923 -54.786 1.00 24.04 ? 610 HOH B O    1 
HETATM 10503 O O    . HOH H 5 .   ? 23.404  4.240   -45.239 1.00 33.10 ? 611 HOH B O    1 
HETATM 10504 O O    . HOH H 5 .   ? 0.051   0.762   -43.036 1.00 28.57 ? 612 HOH B O    1 
HETATM 10505 O O    . HOH H 5 .   ? 39.300  -20.537 -49.806 1.00 31.18 ? 613 HOH B O    1 
HETATM 10506 O O    . HOH H 5 .   ? 16.405  -25.335 -61.436 1.00 27.54 ? 614 HOH B O    1 
HETATM 10507 O O    . HOH H 5 .   ? -8.078  -23.626 -46.105 1.00 41.59 ? 615 HOH B O    1 
HETATM 10508 O O    . HOH H 5 .   ? 30.704  6.597   -44.743 1.00 36.72 ? 616 HOH B O    1 
HETATM 10509 O O    . HOH H 5 .   ? -16.355 3.310   -55.023 1.00 34.15 ? 617 HOH B O    1 
HETATM 10510 O O    . HOH H 5 .   ? 20.198  -4.560  -36.460 1.00 34.05 ? 618 HOH B O    1 
HETATM 10511 O O    . HOH H 5 .   ? 27.455  4.498   -69.260 1.00 35.81 ? 619 HOH B O    1 
HETATM 10512 O O    . HOH H 5 .   ? 9.603   -13.203 -56.217 1.00 33.44 ? 620 HOH B O    1 
HETATM 10513 O O    . HOH H 5 .   ? 11.935  -27.686 -47.347 1.00 37.54 ? 621 HOH B O    1 
HETATM 10514 O O    . HOH H 5 .   ? -14.506 -10.669 -56.422 1.00 32.99 ? 622 HOH B O    1 
HETATM 10515 O O    . HOH H 5 .   ? -10.752 0.054   -63.600 1.00 35.46 ? 623 HOH B O    1 
HETATM 10516 O O    . HOH H 5 .   ? 26.617  -27.798 -67.406 1.00 38.24 ? 624 HOH B O    1 
HETATM 10517 O O    . HOH H 5 .   ? 16.683  -0.144  -50.466 1.00 31.09 ? 625 HOH B O    1 
HETATM 10518 O O    . HOH H 5 .   ? 13.776  -2.821  -40.585 1.00 31.74 ? 626 HOH B O    1 
HETATM 10519 O O    . HOH H 5 .   ? -21.528 -23.231 -46.734 1.00 38.86 ? 627 HOH B O    1 
HETATM 10520 O O    . HOH H 5 .   ? 30.234  -10.692 -44.707 1.00 30.15 ? 628 HOH B O    1 
HETATM 10521 O O    . HOH H 5 .   ? 2.158   -27.599 -44.989 1.00 37.26 ? 629 HOH B O    1 
HETATM 10522 O O    . HOH H 5 .   ? -23.604 -7.551  -46.617 1.00 35.94 ? 630 HOH B O    1 
HETATM 10523 O O    . HOH H 5 .   ? 26.233  -24.855 -67.252 1.00 41.03 ? 631 HOH B O    1 
HETATM 10524 O O    . HOH H 5 .   ? 31.085  0.295   -44.841 1.00 34.91 ? 632 HOH B O    1 
HETATM 10525 O O    . HOH H 5 .   ? 22.923  -3.511  -61.761 1.00 33.13 ? 633 HOH B O    1 
HETATM 10526 O O    . HOH H 5 .   ? 32.443  3.751   -45.028 1.00 32.00 ? 634 HOH B O    1 
HETATM 10527 O O    . HOH H 5 .   ? 33.868  -15.519 -60.375 1.00 28.24 ? 635 HOH B O    1 
HETATM 10528 O O    . HOH H 5 .   ? 25.713  -22.551 -41.934 1.00 35.09 ? 636 HOH B O    1 
HETATM 10529 O O    . HOH H 5 .   ? 39.003  -17.586 -42.040 1.00 27.91 ? 637 HOH B O    1 
HETATM 10530 O O    . HOH H 5 .   ? 16.511  -6.770  -58.279 1.00 41.86 ? 638 HOH B O    1 
HETATM 10531 O O    . HOH H 5 .   ? -6.722  2.115   -63.054 1.00 39.58 ? 639 HOH B O    1 
HETATM 10532 O O    . HOH H 5 .   ? 33.176  -18.231 -71.725 1.00 34.51 ? 640 HOH B O    1 
HETATM 10533 O O    . HOH H 5 .   ? 26.965  -22.104 -71.021 1.00 28.96 ? 641 HOH B O    1 
HETATM 10534 O O    . HOH H 5 .   ? -8.531  -19.358 -50.697 1.00 28.67 ? 642 HOH B O    1 
HETATM 10535 O O    . HOH H 5 .   ? 28.079  6.955   -68.319 1.00 38.45 ? 643 HOH B O    1 
HETATM 10536 O O    . HOH H 5 .   ? 19.843  0.480   -57.701 1.00 31.95 ? 644 HOH B O    1 
HETATM 10537 O O    . HOH H 5 .   ? -7.872  -3.573  -32.848 1.00 32.41 ? 645 HOH B O    1 
HETATM 10538 O O    . HOH H 5 .   ? 39.905  -10.749 -55.322 1.00 27.86 ? 646 HOH B O    1 
HETATM 10539 O O    . HOH H 5 .   ? 5.552   -8.301  -58.582 1.00 37.84 ? 647 HOH B O    1 
HETATM 10540 O O    . HOH H 5 .   ? 19.154  -26.972 -56.578 1.00 34.53 ? 648 HOH B O    1 
HETATM 10541 O O    . HOH H 5 .   ? 29.101  1.093   -70.659 1.00 29.83 ? 649 HOH B O    1 
HETATM 10542 O O    . HOH H 5 .   ? -13.076 2.688   -58.354 1.00 30.99 ? 650 HOH B O    1 
HETATM 10543 O O    . HOH H 5 .   ? 39.303  -19.299 -46.158 1.00 35.70 ? 651 HOH B O    1 
HETATM 10544 O O    . HOH H 5 .   ? 28.486  -6.465  -70.793 1.00 28.81 ? 652 HOH B O    1 
HETATM 10545 O O    . HOH H 5 .   ? 12.835  -5.992  -60.206 1.00 37.27 ? 653 HOH B O    1 
HETATM 10546 O O    . HOH H 5 .   ? 33.340  -25.403 -68.552 1.00 36.64 ? 654 HOH B O    1 
HETATM 10547 O O    . HOH H 5 .   ? 32.928  -12.173 -41.932 1.00 35.25 ? 655 HOH B O    1 
HETATM 10548 O O    . HOH H 5 .   ? 2.992   2.959   -47.626 1.00 22.39 ? 656 HOH B O    1 
HETATM 10549 O O    . HOH H 5 .   ? -14.433 -13.880 -57.930 1.00 36.59 ? 657 HOH B O    1 
HETATM 10550 O O    . HOH H 5 .   ? 32.909  5.042   -47.384 1.00 31.71 ? 658 HOH B O    1 
HETATM 10551 O O    . HOH H 5 .   ? -23.397 -11.045 -48.229 1.00 25.98 ? 659 HOH B O    1 
HETATM 10552 O O    . HOH H 5 .   ? 9.760   -26.105 -56.907 1.00 39.38 ? 660 HOH B O    1 
HETATM 10553 O O    . HOH H 5 .   ? -5.818  0.051   -40.739 1.00 33.64 ? 661 HOH B O    1 
HETATM 10554 O O    . HOH H 5 .   ? 23.122  -27.783 -65.583 1.00 31.16 ? 662 HOH B O    1 
HETATM 10555 O O    . HOH H 5 .   ? -21.398 -9.134  -52.250 1.00 41.76 ? 663 HOH B O    1 
HETATM 10556 O O    . HOH H 5 .   ? -18.487 -2.267  -46.664 1.00 42.49 ? 664 HOH B O    1 
HETATM 10557 O O    . HOH H 5 .   ? -20.467 -17.720 -49.682 1.00 52.29 ? 665 HOH B O    1 
HETATM 10558 O O    . HOH H 5 .   ? 37.520  8.694   -51.226 1.00 41.07 ? 666 HOH B O    1 
HETATM 10559 O O    . HOH H 5 .   ? 5.178   -2.849  -52.492 1.00 30.60 ? 667 HOH B O    1 
HETATM 10560 O O    . HOH H 5 .   ? 23.673  -0.483  -61.222 1.00 28.53 ? 668 HOH B O    1 
HETATM 10561 O O    . HOH H 5 .   ? -0.849  14.084  -54.801 1.00 44.50 ? 669 HOH B O    1 
HETATM 10562 O O    . HOH H 5 .   ? 40.661  -4.938  -57.236 1.00 36.53 ? 670 HOH B O    1 
HETATM 10563 O O    . HOH H 5 .   ? 27.468  -3.820  -70.070 1.00 35.89 ? 671 HOH B O    1 
HETATM 10564 O O    . HOH H 5 .   ? 26.494  -19.961 -41.978 1.00 29.37 ? 672 HOH B O    1 
HETATM 10565 O O    . HOH H 5 .   ? 18.314  -4.045  -58.740 1.00 31.97 ? 673 HOH B O    1 
HETATM 10566 O O    . HOH H 5 .   ? -5.322  -24.165 -50.245 1.00 28.28 ? 674 HOH B O    1 
HETATM 10567 O O    . HOH H 5 .   ? 33.974  9.097   -57.514 1.00 33.61 ? 675 HOH B O    1 
HETATM 10568 O O    . HOH H 5 .   ? 21.412  -25.820 -57.549 1.00 39.85 ? 676 HOH B O    1 
HETATM 10569 O O    . HOH H 5 .   ? 20.150  -2.585  -60.421 1.00 42.04 ? 677 HOH B O    1 
HETATM 10570 O O    . HOH H 5 .   ? 14.844  -29.265 -45.141 1.00 43.40 ? 678 HOH B O    1 
HETATM 10571 O O    . HOH H 5 .   ? 22.805  -28.145 -57.741 1.00 33.59 ? 679 HOH B O    1 
HETATM 10572 O O    . HOH H 5 .   ? 35.915  -9.697  -45.256 1.00 29.30 ? 680 HOH B O    1 
HETATM 10573 O O    . HOH H 5 .   ? 19.310  -25.444 -43.538 1.00 27.40 ? 681 HOH B O    1 
HETATM 10574 O O    . HOH H 5 .   ? -5.336  -27.455 -55.871 1.00 37.31 ? 682 HOH B O    1 
HETATM 10575 O O    . HOH H 5 .   ? 18.628  -29.140 -58.361 1.00 40.68 ? 683 HOH B O    1 
HETATM 10576 O O    . HOH H 5 .   ? 34.083  -23.015 -69.505 1.00 37.65 ? 684 HOH B O    1 
HETATM 10577 O O    . HOH H 5 .   ? 15.533  -25.802 -41.595 1.00 30.58 ? 685 HOH B O    1 
HETATM 10578 O O    . HOH H 5 .   ? 26.376  -30.008 -47.419 1.00 35.60 ? 686 HOH B O    1 
HETATM 10579 O O    . HOH H 5 .   ? -13.330 -25.495 -43.611 1.00 31.68 ? 687 HOH B O    1 
HETATM 10580 O O    . HOH H 5 .   ? 38.708  -0.107  -48.296 1.00 37.52 ? 688 HOH B O    1 
HETATM 10581 O O    . HOH H 5 .   ? -6.794  -25.034 -52.507 1.00 41.56 ? 689 HOH B O    1 
HETATM 10582 O O    . HOH H 5 .   ? 34.122  -8.011  -44.496 1.00 34.27 ? 690 HOH B O    1 
HETATM 10583 O O    . HOH H 5 .   ? -9.720  -23.037 -53.468 1.00 44.49 ? 691 HOH B O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   2   ALA ALA A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   LYS 5   5   5   LYS LYS A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   CYS 7   7   7   CYS CYS A . n 
A 1 8   ILE 8   8   8   ILE ILE A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  TRP 14  14  14  TRP TRP A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  ILE 18  18  18  ILE ILE A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  ILE 21  21  21  ILE ILE A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  ASN 25  25  25  ASN ASN A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  GLN 28  28  28  GLN GLN A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  GLN 31  31  31  GLN GLN A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  ARG 35  35  35  ARG ARG A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  MET 38  38  38  MET MET A . n 
A 1 39  TRP 39  39  39  TRP TRP A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  PHE 41  41  41  PHE PHE A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  ASP 44  44  44  ASP ASP A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  GLY 46  46  ?   ?   ?   A . n 
A 1 47  GLY 47  47  ?   ?   ?   A . n 
A 1 48  LYS 48  48  ?   ?   ?   A . n 
A 1 49  LYS 49  49  ?   ?   ?   A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  GLU 52  52  52  GLU GLU A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  ASN 55  55  55  ASN ASN A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  GLN 57  57  57  GLN GLN A . n 
A 1 58  HIS 58  58  58  HIS HIS A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  ASN 60  60  60  ASN ASN A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  HIS 67  67  67  HIS HIS A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  PRO 71  71  71  PRO PRO A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  PRO 77  77  77  PRO PRO A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  GLN 81  81  81  GLN GLN A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  ILE 88  88  88  ILE ILE A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  PHE 91  91  91  PHE PHE A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  PRO 94  94  94  PRO PRO A . n 
A 1 95  HIS 95  95  95  HIS HIS A . n 
A 1 96  GLN 96  96  96  GLN GLN A . n 
A 1 97  PHE 97  97  97  PHE PHE A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 CYS 102 102 102 CYS CYS A . n 
A 1 103 ASP 103 103 103 ASP ASP A . n 
A 1 104 GLN 104 104 104 GLN GLN A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 HIS 108 108 108 HIS HIS A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 ASN 112 112 112 ASN ASN A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 GLY 115 115 115 GLY GLY A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 ILE 119 119 119 ILE ILE A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 GLU 124 124 124 GLU GLU A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 PRO 126 126 126 PRO PRO A . n 
A 1 127 ASN 127 127 127 ASN ASN A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 SER 133 133 133 SER SER A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 GLY 137 137 137 GLY GLY A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 ARG 139 139 139 ARG ARG A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 PRO 143 143 143 PRO PRO A . n 
A 1 144 MET 144 144 144 MET MET A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 VAL 146 146 146 VAL VAL A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 MET 148 148 148 MET MET A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 ASN 151 151 151 ASN ASN A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 SER 154 154 154 SER SER A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 VAL 156 156 156 VAL VAL A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 GLU 159 159 159 GLU GLU A . n 
A 1 160 LYS 160 160 160 LYS LYS A . n 
A 1 161 PHE 161 161 161 PHE PHE A . n 
A 1 162 CYS 162 162 162 CYS CYS A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 THR 164 164 164 THR THR A . n 
A 1 165 THR 165 165 165 THR THR A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 GLY 167 167 167 GLY GLY A . n 
A 1 168 CYS 168 168 168 CYS CYS A . n 
A 1 169 LYS 169 169 169 LYS LYS A . n 
A 1 170 ASP 170 170 170 ASP ASP A . n 
A 1 171 PRO 171 171 171 PRO PRO A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 GLN 175 175 175 GLN GLN A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 LYS 178 178 178 LYS LYS A . n 
A 1 179 GLU 179 179 179 GLU GLU A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 MET 181 181 181 MET MET A . n 
A 1 182 GLN 182 182 182 GLN GLN A . n 
A 1 183 THR 183 183 183 THR THR A . n 
A 1 184 PRO 184 184 184 PRO PRO A . n 
A 1 185 ASN 185 185 185 ASN ASN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 ARG 187 187 187 ARG ARG A . n 
A 1 188 ILE 188 188 188 ILE ILE A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 VAL 190 190 190 VAL VAL A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 GLN 192 192 192 GLN GLN A . n 
A 1 193 GLU 193 193 193 GLU GLU A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 ASP 195 195 195 ASP ASP A . n 
A 1 196 THR 196 196 196 THR THR A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 GLU 198 198 198 GLU GLU A . n 
A 1 199 ILE 199 199 199 ILE ILE A . n 
A 1 200 CYS 200 200 200 CYS CYS A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 LYS 204 204 204 LYS LYS A . n 
A 1 205 ASN 205 205 205 ASN ASN A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 VAL 207 207 207 VAL VAL A . n 
A 1 208 ALA 208 208 208 ALA ALA A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 GLY 212 212 212 GLY GLY A . n 
A 1 213 PHE 213 213 213 PHE PHE A . n 
A 1 214 CYS 214 214 214 CYS CYS A . n 
A 1 215 ASP 215 215 215 ASP ASP A . n 
A 1 216 GLY 216 216 216 GLY GLY A . n 
A 1 217 LEU 217 217 217 LEU LEU A . n 
A 1 218 GLY 218 218 218 GLY GLY A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 GLY 220 220 220 GLY GLY A . n 
A 1 221 ASP 221 221 221 ASP ASP A . n 
A 1 222 ASN 222 222 222 ASN ASN A . n 
A 1 223 THR 223 223 223 THR THR A . n 
A 1 224 LYS 224 224 224 LYS LYS A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 ALA 226 226 226 ALA ALA A . n 
A 1 227 VAL 227 227 227 VAL VAL A . n 
A 1 228 ILE 228 228 228 ILE ILE A . n 
A 1 229 ARG 229 229 229 ARG ARG A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 LEU 232 232 232 LEU LEU A . n 
A 1 233 MET 233 233 233 MET MET A . n 
A 1 234 GLU 234 234 234 GLU GLU A . n 
A 1 235 MET 235 235 235 MET MET A . n 
A 1 236 ILE 236 236 236 ILE ILE A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 PHE 238 238 238 PHE PHE A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 LYS 240 240 240 LYS LYS A . n 
A 1 241 LEU 241 241 241 LEU LEU A . n 
A 1 242 PHE 242 242 242 PHE PHE A . n 
A 1 243 CYS 243 243 243 CYS CYS A . n 
A 1 244 SER 244 244 244 SER SER A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 PRO 246 246 246 PRO PRO A . n 
A 1 247 VAL 247 247 247 VAL VAL A . n 
A 1 248 SER 248 248 248 SER SER A . n 
A 1 249 SER 249 249 249 SER SER A . n 
A 1 250 ALA 250 250 250 ALA ALA A . n 
A 1 251 THR 251 251 251 THR THR A . n 
A 1 252 PHE 252 252 252 PHE PHE A . n 
A 1 253 LEU 253 253 253 LEU LEU A . n 
A 1 254 GLU 254 254 254 GLU GLU A . n 
A 1 255 SER 255 255 255 SER SER A . n 
A 1 256 CYS 256 256 256 CYS CYS A . n 
A 1 257 GLY 257 257 257 GLY GLY A . n 
A 1 258 VAL 258 258 258 VAL VAL A . n 
A 1 259 ALA 259 259 259 ALA ALA A . n 
A 1 260 ASP 260 260 260 ASP ASP A . n 
A 1 261 LEU 261 261 261 LEU LEU A . n 
A 1 262 ILE 262 262 262 ILE ILE A . n 
A 1 263 THR 263 263 263 THR THR A . n 
A 1 264 THR 264 264 264 THR THR A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 TYR 266 266 266 TYR TYR A . n 
A 1 267 GLY 267 267 267 GLY GLY A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 ARG 269 269 269 ARG ARG A . n 
A 1 270 ASN 270 270 270 ASN ASN A . n 
A 1 271 ARG 271 271 271 ARG ARG A . n 
A 1 272 LYS 272 272 272 LYS LYS A . n 
A 1 273 VAL 273 273 273 VAL VAL A . n 
A 1 274 ALA 274 274 274 ALA ALA A . n 
A 1 275 GLU 275 275 275 GLU GLU A . n 
A 1 276 ALA 276 276 276 ALA ALA A . n 
A 1 277 PHE 277 277 277 PHE PHE A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 ARG 279 279 279 ARG ARG A . n 
A 1 280 THR 280 280 280 THR THR A . n 
A 1 281 GLY 281 281 281 GLY GLY A . n 
A 1 282 LYS 282 282 282 LYS LYS A . n 
A 1 283 SER 283 283 283 SER SER A . n 
A 1 284 ILE 284 284 284 ILE ILE A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 GLN 286 286 286 GLN GLN A . n 
A 1 287 LEU 287 287 287 LEU LEU A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 LYS 289 289 289 LYS LYS A . n 
A 1 290 GLU 290 290 290 GLU GLU A . n 
A 1 291 LEU 291 291 291 LEU LEU A . n 
A 1 292 LEU 292 292 292 LEU LEU A . n 
A 1 293 ASN 293 293 293 ASN ASN A . n 
A 1 294 GLY 294 294 294 GLY GLY A . n 
A 1 295 GLN 295 295 295 GLN GLN A . n 
A 1 296 LYS 296 296 296 LYS LYS A . n 
A 1 297 LEU 297 297 297 LEU LEU A . n 
A 1 298 GLN 298 298 298 GLN GLN A . n 
A 1 299 GLY 299 299 299 GLY GLY A . n 
A 1 300 PRO 300 300 300 PRO PRO A . n 
A 1 301 GLU 301 301 301 GLU GLU A . n 
A 1 302 THR 302 302 302 THR THR A . n 
A 1 303 ALA 303 303 303 ALA ALA A . n 
A 1 304 ARG 304 304 304 ARG ARG A . n 
A 1 305 GLU 305 305 305 GLU GLU A . n 
A 1 306 LEU 306 306 306 LEU LEU A . n 
A 1 307 TYR 307 307 307 TYR TYR A . n 
A 1 308 SER 308 308 308 SER SER A . n 
A 1 309 ILE 309 309 309 ILE ILE A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 GLN 311 311 311 GLN GLN A . n 
A 1 312 HIS 312 312 312 HIS HIS A . n 
A 1 313 LYS 313 313 313 LYS LYS A . n 
A 1 314 GLY 314 314 314 GLY GLY A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 VAL 316 316 316 VAL VAL A . n 
A 1 317 ASP 317 317 317 ASP ASP A . n 
A 1 318 LYS 318 318 318 LYS LYS A . n 
A 1 319 PHE 319 319 319 PHE PHE A . n 
A 1 320 PRO 320 320 320 PRO PRO A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 PHE 322 322 322 PHE PHE A . n 
A 1 323 MET 323 323 323 MET MET A . n 
A 1 324 ALA 324 324 324 ALA ALA A . n 
A 1 325 VAL 325 325 325 VAL VAL A . n 
A 1 326 TYR 326 326 326 TYR TYR A . n 
A 1 327 LYS 327 327 327 LYS LYS A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 CYS 329 329 329 CYS CYS A . n 
A 1 330 TYR 330 330 330 TYR TYR A . n 
A 1 331 GLU 331 331 331 GLU GLU A . n 
A 1 332 GLY 332 332 332 GLY GLY A . n 
A 1 333 GLN 333 333 333 GLN GLN A . n 
A 1 334 PRO 334 334 334 PRO PRO A . n 
A 1 335 VAL 335 335 335 VAL VAL A . n 
A 1 336 GLY 336 336 336 GLY GLY A . n 
A 1 337 GLU 337 337 337 GLU GLU A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 ILE 339 339 339 ILE ILE A . n 
A 1 340 HIS 340 340 340 HIS HIS A . n 
A 1 341 CYS 341 341 341 CYS CYS A . n 
A 1 342 LEU 342 342 342 LEU LEU A . n 
A 1 343 GLN 343 343 343 GLN GLN A . n 
A 1 344 ASN 344 344 344 ASN ASN A . n 
A 1 345 HIS 345 345 345 HIS HIS A . n 
A 1 346 PRO 346 346 346 PRO PRO A . n 
A 1 347 GLU 347 347 347 GLU GLU A . n 
A 1 348 HIS 348 348 348 HIS HIS A . n 
A 1 349 MET 349 349 349 MET MET A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   ALA 2   2   2   ALA ALA B . n 
B 1 3   SER 3   3   3   SER SER B . n 
B 1 4   LYS 4   4   4   LYS LYS B . n 
B 1 5   LYS 5   5   5   LYS LYS B . n 
B 1 6   VAL 6   6   6   VAL VAL B . n 
B 1 7   CYS 7   7   7   CYS CYS B . n 
B 1 8   ILE 8   8   8   ILE ILE B . n 
B 1 9   VAL 9   9   9   VAL VAL B . n 
B 1 10  GLY 10  10  10  GLY GLY B . n 
B 1 11  SER 11  11  11  SER SER B . n 
B 1 12  GLY 12  12  12  GLY GLY B . n 
B 1 13  ASN 13  13  13  ASN ASN B . n 
B 1 14  TRP 14  14  14  TRP TRP B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  SER 16  16  16  SER SER B . n 
B 1 17  ALA 17  17  17  ALA ALA B . n 
B 1 18  ILE 18  18  18  ILE ILE B . n 
B 1 19  ALA 19  19  19  ALA ALA B . n 
B 1 20  LYS 20  20  20  LYS LYS B . n 
B 1 21  ILE 21  21  21  ILE ILE B . n 
B 1 22  VAL 22  22  22  VAL VAL B . n 
B 1 23  GLY 23  23  23  GLY GLY B . n 
B 1 24  GLY 24  24  24  GLY GLY B . n 
B 1 25  ASN 25  25  25  ASN ASN B . n 
B 1 26  ALA 26  26  26  ALA ALA B . n 
B 1 27  ALA 27  27  27  ALA ALA B . n 
B 1 28  GLN 28  28  28  GLN GLN B . n 
B 1 29  LEU 29  29  29  LEU LEU B . n 
B 1 30  ALA 30  30  30  ALA ALA B . n 
B 1 31  GLN 31  31  31  GLN GLN B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  ASP 33  33  33  ASP ASP B . n 
B 1 34  PRO 34  34  34  PRO PRO B . n 
B 1 35  ARG 35  35  35  ARG ARG B . n 
B 1 36  VAL 36  36  36  VAL VAL B . n 
B 1 37  THR 37  37  37  THR THR B . n 
B 1 38  MET 38  38  38  MET MET B . n 
B 1 39  TRP 39  39  39  TRP TRP B . n 
B 1 40  VAL 40  40  40  VAL VAL B . n 
B 1 41  PHE 41  41  41  PHE PHE B . n 
B 1 42  GLU 42  42  42  GLU GLU B . n 
B 1 43  GLU 43  43  43  GLU GLU B . n 
B 1 44  ASP 44  44  44  ASP ASP B . n 
B 1 45  ILE 45  45  45  ILE ILE B . n 
B 1 46  GLY 46  46  46  GLY GLY B . n 
B 1 47  GLY 47  47  47  GLY GLY B . n 
B 1 48  LYS 48  48  48  LYS LYS B . n 
B 1 49  LYS 49  49  49  LYS LYS B . n 
B 1 50  LEU 50  50  50  LEU LEU B . n 
B 1 51  THR 51  51  51  THR THR B . n 
B 1 52  GLU 52  52  52  GLU GLU B . n 
B 1 53  ILE 53  53  53  ILE ILE B . n 
B 1 54  ILE 54  54  54  ILE ILE B . n 
B 1 55  ASN 55  55  55  ASN ASN B . n 
B 1 56  THR 56  56  56  THR THR B . n 
B 1 57  GLN 57  57  57  GLN GLN B . n 
B 1 58  HIS 58  58  58  HIS HIS B . n 
B 1 59  GLU 59  59  59  GLU GLU B . n 
B 1 60  ASN 60  60  60  ASN ASN B . n 
B 1 61  VAL 61  61  61  VAL VAL B . n 
B 1 62  LYS 62  62  62  LYS LYS B . n 
B 1 63  TYR 63  63  63  TYR TYR B . n 
B 1 64  LEU 64  64  64  LEU LEU B . n 
B 1 65  PRO 65  65  65  PRO PRO B . n 
B 1 66  GLY 66  66  66  GLY GLY B . n 
B 1 67  HIS 67  67  67  HIS HIS B . n 
B 1 68  LYS 68  68  68  LYS LYS B . n 
B 1 69  LEU 69  69  69  LEU LEU B . n 
B 1 70  PRO 70  70  70  PRO PRO B . n 
B 1 71  PRO 71  71  71  PRO PRO B . n 
B 1 72  ASN 72  72  72  ASN ASN B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  VAL 74  74  74  VAL VAL B . n 
B 1 75  ALA 75  75  75  ALA ALA B . n 
B 1 76  VAL 76  76  76  VAL VAL B . n 
B 1 77  PRO 77  77  77  PRO PRO B . n 
B 1 78  ASP 78  78  78  ASP ASP B . n 
B 1 79  VAL 79  79  79  VAL VAL B . n 
B 1 80  VAL 80  80  80  VAL VAL B . n 
B 1 81  GLN 81  81  81  GLN GLN B . n 
B 1 82  ALA 82  82  82  ALA ALA B . n 
B 1 83  ALA 83  83  83  ALA ALA B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  ASP 85  85  85  ASP ASP B . n 
B 1 86  ALA 86  86  86  ALA ALA B . n 
B 1 87  ASP 87  87  87  ASP ASP B . n 
B 1 88  ILE 88  88  88  ILE ILE B . n 
B 1 89  LEU 89  89  89  LEU LEU B . n 
B 1 90  ILE 90  90  90  ILE ILE B . n 
B 1 91  PHE 91  91  91  PHE PHE B . n 
B 1 92  VAL 92  92  92  VAL VAL B . n 
B 1 93  VAL 93  93  93  VAL VAL B . n 
B 1 94  PRO 94  94  94  PRO PRO B . n 
B 1 95  HIS 95  95  95  HIS HIS B . n 
B 1 96  GLN 96  96  96  GLN GLN B . n 
B 1 97  PHE 97  97  97  PHE PHE B . n 
B 1 98  ILE 98  98  98  ILE ILE B . n 
B 1 99  GLY 99  99  99  GLY GLY B . n 
B 1 100 LYS 100 100 100 LYS LYS B . n 
B 1 101 ILE 101 101 101 ILE ILE B . n 
B 1 102 CYS 102 102 102 CYS CYS B . n 
B 1 103 ASP 103 103 103 ASP ASP B . n 
B 1 104 GLN 104 104 104 GLN GLN B . n 
B 1 105 LEU 105 105 105 LEU LEU B . n 
B 1 106 LYS 106 106 106 LYS LYS B . n 
B 1 107 GLY 107 107 107 GLY GLY B . n 
B 1 108 HIS 108 108 108 HIS HIS B . n 
B 1 109 LEU 109 109 109 LEU LEU B . n 
B 1 110 LYS 110 110 110 LYS LYS B . n 
B 1 111 ALA 111 111 111 ALA ALA B . n 
B 1 112 ASN 112 112 112 ASN ASN B . n 
B 1 113 ALA 113 113 113 ALA ALA B . n 
B 1 114 THR 114 114 114 THR THR B . n 
B 1 115 GLY 115 115 115 GLY GLY B . n 
B 1 116 ILE 116 116 116 ILE ILE B . n 
B 1 117 SER 117 117 117 SER SER B . n 
B 1 118 LEU 118 118 118 LEU LEU B . n 
B 1 119 ILE 119 119 119 ILE ILE B . n 
B 1 120 LYS 120 120 120 LYS LYS B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 VAL 122 122 122 VAL VAL B . n 
B 1 123 ASP 123 123 ?   ?   ?   B . n 
B 1 124 GLU 124 124 ?   ?   ?   B . n 
B 1 125 GLY 125 125 ?   ?   ?   B . n 
B 1 126 PRO 126 126 ?   ?   ?   B . n 
B 1 127 ASN 127 127 ?   ?   ?   B . n 
B 1 128 GLY 128 128 ?   ?   ?   B . n 
B 1 129 LEU 129 129 129 LEU LEU B . n 
B 1 130 LYS 130 130 130 LYS LYS B . n 
B 1 131 LEU 131 131 131 LEU LEU B . n 
B 1 132 ILE 132 132 132 ILE ILE B . n 
B 1 133 SER 133 133 133 SER SER B . n 
B 1 134 GLU 134 134 134 GLU GLU B . n 
B 1 135 VAL 135 135 135 VAL VAL B . n 
B 1 136 ILE 136 136 136 ILE ILE B . n 
B 1 137 GLY 137 137 137 GLY GLY B . n 
B 1 138 GLU 138 138 138 GLU GLU B . n 
B 1 139 ARG 139 139 139 ARG ARG B . n 
B 1 140 LEU 140 140 140 LEU LEU B . n 
B 1 141 GLY 141 141 141 GLY GLY B . n 
B 1 142 ILE 142 142 142 ILE ILE B . n 
B 1 143 PRO 143 143 143 PRO PRO B . n 
B 1 144 MET 144 144 144 MET MET B . n 
B 1 145 SER 145 145 145 SER SER B . n 
B 1 146 VAL 146 146 146 VAL VAL B . n 
B 1 147 LEU 147 147 147 LEU LEU B . n 
B 1 148 MET 148 148 148 MET MET B . n 
B 1 149 GLY 149 149 149 GLY GLY B . n 
B 1 150 ALA 150 150 150 ALA ALA B . n 
B 1 151 ASN 151 151 151 ASN ASN B . n 
B 1 152 ILE 152 152 152 ILE ILE B . n 
B 1 153 ALA 153 153 153 ALA ALA B . n 
B 1 154 SER 154 154 154 SER SER B . n 
B 1 155 GLU 155 155 155 GLU GLU B . n 
B 1 156 VAL 156 156 156 VAL VAL B . n 
B 1 157 ALA 157 157 157 ALA ALA B . n 
B 1 158 ASP 158 158 158 ASP ASP B . n 
B 1 159 GLU 159 159 159 GLU GLU B . n 
B 1 160 LYS 160 160 160 LYS LYS B . n 
B 1 161 PHE 161 161 161 PHE PHE B . n 
B 1 162 CYS 162 162 162 CYS CYS B . n 
B 1 163 GLU 163 163 163 GLU GLU B . n 
B 1 164 THR 164 164 164 THR THR B . n 
B 1 165 THR 165 165 165 THR THR B . n 
B 1 166 ILE 166 166 166 ILE ILE B . n 
B 1 167 GLY 167 167 167 GLY GLY B . n 
B 1 168 CYS 168 168 168 CYS CYS B . n 
B 1 169 LYS 169 169 169 LYS LYS B . n 
B 1 170 ASP 170 170 170 ASP ASP B . n 
B 1 171 PRO 171 171 171 PRO PRO B . n 
B 1 172 ALA 172 172 172 ALA ALA B . n 
B 1 173 GLN 173 173 173 GLN GLN B . n 
B 1 174 GLY 174 174 174 GLY GLY B . n 
B 1 175 GLN 175 175 175 GLN GLN B . n 
B 1 176 LEU 176 176 176 LEU LEU B . n 
B 1 177 LEU 177 177 177 LEU LEU B . n 
B 1 178 LYS 178 178 178 LYS LYS B . n 
B 1 179 GLU 179 179 179 GLU GLU B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 MET 181 181 181 MET MET B . n 
B 1 182 GLN 182 182 182 GLN GLN B . n 
B 1 183 THR 183 183 183 THR THR B . n 
B 1 184 PRO 184 184 184 PRO PRO B . n 
B 1 185 ASN 185 185 185 ASN ASN B . n 
B 1 186 PHE 186 186 186 PHE PHE B . n 
B 1 187 ARG 187 187 187 ARG ARG B . n 
B 1 188 ILE 188 188 188 ILE ILE B . n 
B 1 189 THR 189 189 189 THR THR B . n 
B 1 190 VAL 190 190 190 VAL VAL B . n 
B 1 191 VAL 191 191 191 VAL VAL B . n 
B 1 192 GLN 192 192 192 GLN GLN B . n 
B 1 193 GLU 193 193 193 GLU GLU B . n 
B 1 194 VAL 194 194 194 VAL VAL B . n 
B 1 195 ASP 195 195 195 ASP ASP B . n 
B 1 196 THR 196 196 196 THR THR B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 GLU 198 198 198 GLU GLU B . n 
B 1 199 ILE 199 199 199 ILE ILE B . n 
B 1 200 CYS 200 200 200 CYS CYS B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 ALA 202 202 202 ALA ALA B . n 
B 1 203 LEU 203 203 203 LEU LEU B . n 
B 1 204 LYS 204 204 204 LYS LYS B . n 
B 1 205 ASN 205 205 205 ASN ASN B . n 
B 1 206 VAL 206 206 206 VAL VAL B . n 
B 1 207 VAL 207 207 207 VAL VAL B . n 
B 1 208 ALA 208 208 208 ALA ALA B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 ALA 211 211 211 ALA ALA B . n 
B 1 212 GLY 212 212 212 GLY GLY B . n 
B 1 213 PHE 213 213 213 PHE PHE B . n 
B 1 214 CYS 214 214 214 CYS CYS B . n 
B 1 215 ASP 215 215 215 ASP ASP B . n 
B 1 216 GLY 216 216 216 GLY GLY B . n 
B 1 217 LEU 217 217 217 LEU LEU B . n 
B 1 218 GLY 218 218 218 GLY GLY B . n 
B 1 219 PHE 219 219 219 PHE PHE B . n 
B 1 220 GLY 220 220 220 GLY GLY B . n 
B 1 221 ASP 221 221 221 ASP ASP B . n 
B 1 222 ASN 222 222 222 ASN ASN B . n 
B 1 223 THR 223 223 223 THR THR B . n 
B 1 224 LYS 224 224 224 LYS LYS B . n 
B 1 225 ALA 225 225 225 ALA ALA B . n 
B 1 226 ALA 226 226 226 ALA ALA B . n 
B 1 227 VAL 227 227 227 VAL VAL B . n 
B 1 228 ILE 228 228 228 ILE ILE B . n 
B 1 229 ARG 229 229 229 ARG ARG B . n 
B 1 230 LEU 230 230 230 LEU LEU B . n 
B 1 231 GLY 231 231 231 GLY GLY B . n 
B 1 232 LEU 232 232 232 LEU LEU B . n 
B 1 233 MET 233 233 233 MET MET B . n 
B 1 234 GLU 234 234 234 GLU GLU B . n 
B 1 235 MET 235 235 235 MET MET B . n 
B 1 236 ILE 236 236 236 ILE ILE B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 PHE 238 238 238 PHE PHE B . n 
B 1 239 ALA 239 239 239 ALA ALA B . n 
B 1 240 LYS 240 240 240 LYS LYS B . n 
B 1 241 LEU 241 241 241 LEU LEU B . n 
B 1 242 PHE 242 242 242 PHE PHE B . n 
B 1 243 CYS 243 243 243 CYS CYS B . n 
B 1 244 SER 244 244 244 SER SER B . n 
B 1 245 GLY 245 245 245 GLY GLY B . n 
B 1 246 PRO 246 246 246 PRO PRO B . n 
B 1 247 VAL 247 247 247 VAL VAL B . n 
B 1 248 SER 248 248 248 SER SER B . n 
B 1 249 SER 249 249 249 SER SER B . n 
B 1 250 ALA 250 250 250 ALA ALA B . n 
B 1 251 THR 251 251 251 THR THR B . n 
B 1 252 PHE 252 252 252 PHE PHE B . n 
B 1 253 LEU 253 253 253 LEU LEU B . n 
B 1 254 GLU 254 254 254 GLU GLU B . n 
B 1 255 SER 255 255 255 SER SER B . n 
B 1 256 CYS 256 256 256 CYS CYS B . n 
B 1 257 GLY 257 257 257 GLY GLY B . n 
B 1 258 VAL 258 258 258 VAL VAL B . n 
B 1 259 ALA 259 259 259 ALA ALA B . n 
B 1 260 ASP 260 260 260 ASP ASP B . n 
B 1 261 LEU 261 261 261 LEU LEU B . n 
B 1 262 ILE 262 262 262 ILE ILE B . n 
B 1 263 THR 263 263 263 THR THR B . n 
B 1 264 THR 264 264 264 THR THR B . n 
B 1 265 CYS 265 265 265 CYS CYS B . n 
B 1 266 TYR 266 266 266 TYR TYR B . n 
B 1 267 GLY 267 267 267 GLY GLY B . n 
B 1 268 GLY 268 268 268 GLY GLY B . n 
B 1 269 ARG 269 269 269 ARG ARG B . n 
B 1 270 ASN 270 270 270 ASN ASN B . n 
B 1 271 ARG 271 271 271 ARG ARG B . n 
B 1 272 LYS 272 272 272 LYS LYS B . n 
B 1 273 VAL 273 273 273 VAL VAL B . n 
B 1 274 ALA 274 274 274 ALA ALA B . n 
B 1 275 GLU 275 275 275 GLU GLU B . n 
B 1 276 ALA 276 276 276 ALA ALA B . n 
B 1 277 PHE 277 277 277 PHE PHE B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 ARG 279 279 279 ARG ARG B . n 
B 1 280 THR 280 280 280 THR THR B . n 
B 1 281 GLY 281 281 281 GLY GLY B . n 
B 1 282 LYS 282 282 282 LYS LYS B . n 
B 1 283 SER 283 283 283 SER SER B . n 
B 1 284 ILE 284 284 284 ILE ILE B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 GLN 286 286 286 GLN GLN B . n 
B 1 287 LEU 287 287 287 LEU LEU B . n 
B 1 288 GLU 288 288 288 GLU GLU B . n 
B 1 289 LYS 289 289 289 LYS LYS B . n 
B 1 290 GLU 290 290 290 GLU GLU B . n 
B 1 291 LEU 291 291 291 LEU LEU B . n 
B 1 292 LEU 292 292 292 LEU LEU B . n 
B 1 293 ASN 293 293 293 ASN ASN B . n 
B 1 294 GLY 294 294 ?   ?   ?   B . n 
B 1 295 GLN 295 295 ?   ?   ?   B . n 
B 1 296 LYS 296 296 296 LYS LYS B . n 
B 1 297 LEU 297 297 297 LEU LEU B . n 
B 1 298 GLN 298 298 298 GLN GLN B . n 
B 1 299 GLY 299 299 299 GLY GLY B . n 
B 1 300 PRO 300 300 300 PRO PRO B . n 
B 1 301 GLU 301 301 301 GLU GLU B . n 
B 1 302 THR 302 302 302 THR THR B . n 
B 1 303 ALA 303 303 303 ALA ALA B . n 
B 1 304 ARG 304 304 304 ARG ARG B . n 
B 1 305 GLU 305 305 305 GLU GLU B . n 
B 1 306 LEU 306 306 306 LEU LEU B . n 
B 1 307 TYR 307 307 307 TYR TYR B . n 
B 1 308 SER 308 308 308 SER SER B . n 
B 1 309 ILE 309 309 309 ILE ILE B . n 
B 1 310 LEU 310 310 310 LEU LEU B . n 
B 1 311 GLN 311 311 311 GLN GLN B . n 
B 1 312 HIS 312 312 312 HIS HIS B . n 
B 1 313 LYS 313 313 313 LYS LYS B . n 
B 1 314 GLY 314 314 314 GLY GLY B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 VAL 316 316 316 VAL VAL B . n 
B 1 317 ASP 317 317 317 ASP ASP B . n 
B 1 318 LYS 318 318 318 LYS LYS B . n 
B 1 319 PHE 319 319 319 PHE PHE B . n 
B 1 320 PRO 320 320 320 PRO PRO B . n 
B 1 321 LEU 321 321 321 LEU LEU B . n 
B 1 322 PHE 322 322 322 PHE PHE B . n 
B 1 323 MET 323 323 323 MET MET B . n 
B 1 324 ALA 324 324 324 ALA ALA B . n 
B 1 325 VAL 325 325 325 VAL VAL B . n 
B 1 326 TYR 326 326 326 TYR TYR B . n 
B 1 327 LYS 327 327 327 LYS LYS B . n 
B 1 328 VAL 328 328 328 VAL VAL B . n 
B 1 329 CYS 329 329 329 CYS CYS B . n 
B 1 330 TYR 330 330 330 TYR TYR B . n 
B 1 331 GLU 331 331 331 GLU GLU B . n 
B 1 332 GLY 332 332 332 GLY GLY B . n 
B 1 333 GLN 333 333 333 GLN GLN B . n 
B 1 334 PRO 334 334 334 PRO PRO B . n 
B 1 335 VAL 335 335 335 VAL VAL B . n 
B 1 336 GLY 336 336 336 GLY GLY B . n 
B 1 337 GLU 337 337 337 GLU GLU B . n 
B 1 338 PHE 338 338 338 PHE PHE B . n 
B 1 339 ILE 339 339 339 ILE ILE B . n 
B 1 340 HIS 340 340 340 HIS HIS B . n 
B 1 341 CYS 341 341 341 CYS CYS B . n 
B 1 342 LEU 342 342 342 LEU LEU B . n 
B 1 343 GLN 343 343 343 GLN GLN B . n 
B 1 344 ASN 344 344 344 ASN ASN B . n 
B 1 345 HIS 345 345 345 HIS HIS B . n 
B 1 346 PRO 346 346 346 PRO PRO B . n 
B 1 347 GLU 347 347 347 GLU GLU B . n 
B 1 348 HIS 348 348 348 HIS HIS B . n 
B 1 349 MET 349 349 349 MET MET B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 PO4 1   401 3   PO4 PO4 A . 
D 3 3SY 1   402 1   3SY 3SY A . 
E 4 K   1   403 2   K   K   A . 
F 4 K   1   401 1   K   K   B . 
G 5 HOH 1   501 7   HOH HOH A . 
G 5 HOH 2   502 299 HOH HOH A . 
G 5 HOH 3   503 201 HOH HOH A . 
G 5 HOH 4   504 168 HOH HOH A . 
G 5 HOH 5   505 51  HOH HOH A . 
G 5 HOH 6   506 198 HOH HOH A . 
G 5 HOH 7   507 176 HOH HOH A . 
G 5 HOH 8   508 117 HOH HOH A . 
G 5 HOH 9   509 81  HOH HOH A . 
G 5 HOH 10  510 25  HOH HOH A . 
G 5 HOH 11  511 188 HOH HOH A . 
G 5 HOH 12  512 169 HOH HOH A . 
G 5 HOH 13  513 205 HOH HOH A . 
G 5 HOH 14  514 34  HOH HOH A . 
G 5 HOH 15  515 109 HOH HOH A . 
G 5 HOH 16  516 59  HOH HOH A . 
G 5 HOH 17  517 200 HOH HOH A . 
G 5 HOH 18  518 8   HOH HOH A . 
G 5 HOH 19  519 131 HOH HOH A . 
G 5 HOH 20  520 202 HOH HOH A . 
G 5 HOH 21  521 142 HOH HOH A . 
G 5 HOH 22  522 351 HOH HOH A . 
G 5 HOH 23  523 374 HOH HOH A . 
G 5 HOH 24  524 71  HOH HOH A . 
G 5 HOH 25  525 39  HOH HOH A . 
G 5 HOH 26  526 46  HOH HOH A . 
G 5 HOH 27  527 111 HOH HOH A . 
G 5 HOH 28  528 68  HOH HOH A . 
G 5 HOH 29  529 376 HOH HOH A . 
G 5 HOH 30  530 10  HOH HOH A . 
G 5 HOH 31  531 70  HOH HOH A . 
G 5 HOH 32  532 55  HOH HOH A . 
G 5 HOH 33  533 232 HOH HOH A . 
G 5 HOH 34  534 274 HOH HOH A . 
G 5 HOH 35  535 197 HOH HOH A . 
G 5 HOH 36  536 22  HOH HOH A . 
G 5 HOH 37  537 5   HOH HOH A . 
G 5 HOH 38  538 208 HOH HOH A . 
G 5 HOH 39  539 18  HOH HOH A . 
G 5 HOH 40  540 40  HOH HOH A . 
G 5 HOH 41  541 287 HOH HOH A . 
G 5 HOH 42  542 193 HOH HOH A . 
G 5 HOH 43  543 361 HOH HOH A . 
G 5 HOH 44  544 32  HOH HOH A . 
G 5 HOH 45  545 107 HOH HOH A . 
G 5 HOH 46  546 53  HOH HOH A . 
G 5 HOH 47  547 122 HOH HOH A . 
G 5 HOH 48  548 133 HOH HOH A . 
G 5 HOH 49  549 14  HOH HOH A . 
G 5 HOH 50  550 294 HOH HOH A . 
G 5 HOH 51  551 167 HOH HOH A . 
G 5 HOH 52  552 27  HOH HOH A . 
G 5 HOH 53  553 215 HOH HOH A . 
G 5 HOH 54  554 58  HOH HOH A . 
G 5 HOH 55  555 227 HOH HOH A . 
G 5 HOH 56  556 9   HOH HOH A . 
G 5 HOH 57  557 231 HOH HOH A . 
G 5 HOH 58  558 74  HOH HOH A . 
G 5 HOH 59  559 290 HOH HOH A . 
G 5 HOH 60  560 395 HOH HOH A . 
G 5 HOH 61  561 161 HOH HOH A . 
G 5 HOH 62  562 191 HOH HOH A . 
G 5 HOH 63  563 246 HOH HOH A . 
G 5 HOH 64  564 13  HOH HOH A . 
G 5 HOH 65  565 377 HOH HOH A . 
G 5 HOH 66  566 61  HOH HOH A . 
G 5 HOH 67  567 54  HOH HOH A . 
G 5 HOH 68  568 307 HOH HOH A . 
G 5 HOH 69  569 247 HOH HOH A . 
G 5 HOH 70  570 319 HOH HOH A . 
G 5 HOH 71  571 341 HOH HOH A . 
G 5 HOH 72  572 149 HOH HOH A . 
G 5 HOH 73  573 242 HOH HOH A . 
G 5 HOH 74  574 148 HOH HOH A . 
G 5 HOH 75  575 52  HOH HOH A . 
G 5 HOH 76  576 47  HOH HOH A . 
G 5 HOH 77  577 33  HOH HOH A . 
G 5 HOH 78  578 57  HOH HOH A . 
G 5 HOH 79  579 87  HOH HOH A . 
G 5 HOH 80  580 194 HOH HOH A . 
G 5 HOH 81  581 217 HOH HOH A . 
G 5 HOH 82  582 92  HOH HOH A . 
G 5 HOH 83  583 272 HOH HOH A . 
G 5 HOH 84  584 255 HOH HOH A . 
G 5 HOH 85  585 324 HOH HOH A . 
G 5 HOH 86  586 240 HOH HOH A . 
G 5 HOH 87  587 223 HOH HOH A . 
G 5 HOH 88  588 72  HOH HOH A . 
G 5 HOH 89  589 84  HOH HOH A . 
G 5 HOH 90  590 412 HOH HOH A . 
G 5 HOH 91  591 42  HOH HOH A . 
G 5 HOH 92  592 67  HOH HOH A . 
G 5 HOH 93  593 252 HOH HOH A . 
G 5 HOH 94  594 380 HOH HOH A . 
G 5 HOH 95  595 465 HOH HOH A . 
G 5 HOH 96  596 179 HOH HOH A . 
G 5 HOH 97  597 121 HOH HOH A . 
G 5 HOH 98  598 118 HOH HOH A . 
G 5 HOH 99  599 328 HOH HOH A . 
G 5 HOH 100 600 236 HOH HOH A . 
G 5 HOH 101 601 41  HOH HOH A . 
G 5 HOH 102 602 77  HOH HOH A . 
G 5 HOH 103 603 180 HOH HOH A . 
G 5 HOH 104 604 182 HOH HOH A . 
G 5 HOH 105 605 173 HOH HOH A . 
G 5 HOH 106 606 207 HOH HOH A . 
G 5 HOH 107 607 119 HOH HOH A . 
G 5 HOH 108 608 44  HOH HOH A . 
G 5 HOH 109 609 237 HOH HOH A . 
G 5 HOH 110 610 79  HOH HOH A . 
G 5 HOH 111 611 298 HOH HOH A . 
G 5 HOH 112 612 172 HOH HOH A . 
G 5 HOH 113 613 315 HOH HOH A . 
G 5 HOH 114 614 291 HOH HOH A . 
G 5 HOH 115 615 350 HOH HOH A . 
G 5 HOH 116 616 187 HOH HOH A . 
G 5 HOH 117 617 235 HOH HOH A . 
G 5 HOH 118 618 414 HOH HOH A . 
G 5 HOH 119 619 309 HOH HOH A . 
G 5 HOH 120 620 224 HOH HOH A . 
G 5 HOH 121 621 264 HOH HOH A . 
G 5 HOH 122 622 391 HOH HOH A . 
G 5 HOH 123 623 445 HOH HOH A . 
G 5 HOH 124 624 347 HOH HOH A . 
G 5 HOH 125 625 352 HOH HOH A . 
G 5 HOH 126 626 190 HOH HOH A . 
G 5 HOH 127 627 186 HOH HOH A . 
G 5 HOH 128 628 36  HOH HOH A . 
G 5 HOH 129 629 28  HOH HOH A . 
G 5 HOH 130 630 266 HOH HOH A . 
G 5 HOH 131 631 326 HOH HOH A . 
G 5 HOH 132 632 370 HOH HOH A . 
G 5 HOH 133 633 228 HOH HOH A . 
G 5 HOH 134 634 390 HOH HOH A . 
G 5 HOH 135 635 320 HOH HOH A . 
G 5 HOH 136 636 279 HOH HOH A . 
G 5 HOH 137 637 306 HOH HOH A . 
G 5 HOH 138 638 289 HOH HOH A . 
G 5 HOH 139 639 23  HOH HOH A . 
G 5 HOH 140 640 260 HOH HOH A . 
G 5 HOH 141 641 444 HOH HOH A . 
G 5 HOH 142 642 135 HOH HOH A . 
G 5 HOH 143 643 177 HOH HOH A . 
G 5 HOH 144 644 308 HOH HOH A . 
G 5 HOH 145 645 344 HOH HOH A . 
G 5 HOH 146 646 336 HOH HOH A . 
G 5 HOH 147 647 403 HOH HOH A . 
G 5 HOH 148 648 269 HOH HOH A . 
G 5 HOH 149 649 421 HOH HOH A . 
G 5 HOH 150 650 354 HOH HOH A . 
G 5 HOH 151 651 248 HOH HOH A . 
G 5 HOH 152 652 286 HOH HOH A . 
G 5 HOH 153 653 418 HOH HOH A . 
G 5 HOH 154 654 270 HOH HOH A . 
G 5 HOH 155 655 147 HOH HOH A . 
G 5 HOH 156 656 268 HOH HOH A . 
G 5 HOH 157 657 259 HOH HOH A . 
G 5 HOH 158 658 382 HOH HOH A .