data_6E8Z
# 
_entry.id   6E8Z 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6E8Z         
WWPDB D_1000235793 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6E8Z 
_pdbx_database_status.recvd_initial_deposition_date   2018-07-31 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Mydy, L.S.'   1 0000-0002-6976-4426 
'Gulick, A.M.' 2 0000-0003-4238-7453 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Biochemistry 
_citation.journal_id_ASTM           BICHAW 
_citation.journal_id_CSD            0033 
_citation.journal_id_ISSN           1520-4995 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            58 
_citation.language                  ? 
_citation.page_first                1061 
_citation.page_last                 1073 
_citation.title                     
'Human Glycerol 3-Phosphate Dehydrogenase: X-ray Crystal Structures That Guide the Interpretation of Mutagenesis Studies.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.biochem.8b01103 
_citation.pdbx_database_id_PubMed   30640445 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Mydy, L.S.'       1 ? 
primary 'Cristobal, J.R.'  2 ? 
primary 'Katigbak, R.D.'   3 ? 
primary 'Bauer, P.'        4 ? 
primary 'Reyes, A.C.'      5 ? 
primary 'Kamerlin, S.C.L.' 6 ? 
primary 'Richard, J.P.'    7 ? 
primary 'Gulick, A.M.'     8 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   104.32 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6E8Z 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     63.580 
_cell.length_a_esd                 ? 
_cell.length_b                     78.780 
_cell.length_b_esd                 ? 
_cell.length_c                     69.179 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6E8Z 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic' 37608.551 2   1.1.1.8 ? ? ? 
2 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE                          663.425   2   ?       ? ? ? 
3 non-polymer syn 'PHOSPHATE ION'                                            94.971    2   ?       ? ? ? 
4 non-polymer syn 1,2-ETHANEDIOL                                             62.068    4   ?       ? ? ? 
5 non-polymer syn 'POTASSIUM ION'                                            39.098    2   ?       ? ? ? 
6 water       nat water                                                      18.015    230 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        GPDH-C 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLPGHKLPPNVVAVPDVV
QAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERLGIPMSVLMGANIASEVADEK
FCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAK
LFCSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGPETARELYSILQHKGLVDKFP
LFMAVYKVCYEGQPVGEFIHCLQNHPEHM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLPGHKLPPNVVAVPDVV
QAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERLGIPMSVLMGANIASEVADEK
FCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAK
LFCSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGPETARELYSILQHKGLVDKFP
LFMAVYKVCYEGQPVGEFIHCLQNHPEHM
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   LYS n 
1 5   LYS n 
1 6   VAL n 
1 7   CYS n 
1 8   ILE n 
1 9   VAL n 
1 10  GLY n 
1 11  SER n 
1 12  GLY n 
1 13  ASN n 
1 14  TRP n 
1 15  GLY n 
1 16  SER n 
1 17  ALA n 
1 18  ILE n 
1 19  ALA n 
1 20  LYS n 
1 21  ILE n 
1 22  VAL n 
1 23  GLY n 
1 24  GLY n 
1 25  ASN n 
1 26  ALA n 
1 27  ALA n 
1 28  GLN n 
1 29  LEU n 
1 30  ALA n 
1 31  GLN n 
1 32  PHE n 
1 33  ASP n 
1 34  PRO n 
1 35  ARG n 
1 36  VAL n 
1 37  THR n 
1 38  MET n 
1 39  TRP n 
1 40  VAL n 
1 41  PHE n 
1 42  GLU n 
1 43  GLU n 
1 44  ASP n 
1 45  ILE n 
1 46  GLY n 
1 47  GLY n 
1 48  LYS n 
1 49  LYS n 
1 50  LEU n 
1 51  THR n 
1 52  GLU n 
1 53  ILE n 
1 54  ILE n 
1 55  ASN n 
1 56  THR n 
1 57  GLN n 
1 58  HIS n 
1 59  GLU n 
1 60  ASN n 
1 61  VAL n 
1 62  LYS n 
1 63  TYR n 
1 64  LEU n 
1 65  PRO n 
1 66  GLY n 
1 67  HIS n 
1 68  LYS n 
1 69  LEU n 
1 70  PRO n 
1 71  PRO n 
1 72  ASN n 
1 73  VAL n 
1 74  VAL n 
1 75  ALA n 
1 76  VAL n 
1 77  PRO n 
1 78  ASP n 
1 79  VAL n 
1 80  VAL n 
1 81  GLN n 
1 82  ALA n 
1 83  ALA n 
1 84  GLU n 
1 85  ASP n 
1 86  ALA n 
1 87  ASP n 
1 88  ILE n 
1 89  LEU n 
1 90  ILE n 
1 91  PHE n 
1 92  VAL n 
1 93  VAL n 
1 94  PRO n 
1 95  HIS n 
1 96  GLN n 
1 97  PHE n 
1 98  ILE n 
1 99  GLY n 
1 100 LYS n 
1 101 ILE n 
1 102 CYS n 
1 103 ASP n 
1 104 GLN n 
1 105 LEU n 
1 106 LYS n 
1 107 GLY n 
1 108 HIS n 
1 109 LEU n 
1 110 LYS n 
1 111 ALA n 
1 112 ASN n 
1 113 ALA n 
1 114 THR n 
1 115 GLY n 
1 116 ILE n 
1 117 SER n 
1 118 LEU n 
1 119 ILE n 
1 120 LYS n 
1 121 GLY n 
1 122 VAL n 
1 123 ASP n 
1 124 GLU n 
1 125 GLY n 
1 126 PRO n 
1 127 ASN n 
1 128 GLY n 
1 129 LEU n 
1 130 LYS n 
1 131 LEU n 
1 132 ILE n 
1 133 SER n 
1 134 GLU n 
1 135 VAL n 
1 136 ILE n 
1 137 GLY n 
1 138 GLU n 
1 139 ARG n 
1 140 LEU n 
1 141 GLY n 
1 142 ILE n 
1 143 PRO n 
1 144 MET n 
1 145 SER n 
1 146 VAL n 
1 147 LEU n 
1 148 MET n 
1 149 GLY n 
1 150 ALA n 
1 151 ASN n 
1 152 ILE n 
1 153 ALA n 
1 154 SER n 
1 155 GLU n 
1 156 VAL n 
1 157 ALA n 
1 158 ASP n 
1 159 GLU n 
1 160 LYS n 
1 161 PHE n 
1 162 CYS n 
1 163 GLU n 
1 164 THR n 
1 165 THR n 
1 166 ILE n 
1 167 GLY n 
1 168 CYS n 
1 169 LYS n 
1 170 ASP n 
1 171 PRO n 
1 172 ALA n 
1 173 GLN n 
1 174 GLY n 
1 175 GLN n 
1 176 LEU n 
1 177 LEU n 
1 178 LYS n 
1 179 GLU n 
1 180 LEU n 
1 181 MET n 
1 182 GLN n 
1 183 THR n 
1 184 PRO n 
1 185 ASN n 
1 186 PHE n 
1 187 ARG n 
1 188 ILE n 
1 189 THR n 
1 190 VAL n 
1 191 VAL n 
1 192 GLN n 
1 193 GLU n 
1 194 VAL n 
1 195 ASP n 
1 196 THR n 
1 197 VAL n 
1 198 GLU n 
1 199 ILE n 
1 200 CYS n 
1 201 GLY n 
1 202 ALA n 
1 203 LEU n 
1 204 LYS n 
1 205 ASN n 
1 206 VAL n 
1 207 VAL n 
1 208 ALA n 
1 209 VAL n 
1 210 GLY n 
1 211 ALA n 
1 212 GLY n 
1 213 PHE n 
1 214 CYS n 
1 215 ASP n 
1 216 GLY n 
1 217 LEU n 
1 218 GLY n 
1 219 PHE n 
1 220 GLY n 
1 221 ASP n 
1 222 ASN n 
1 223 THR n 
1 224 LYS n 
1 225 ALA n 
1 226 ALA n 
1 227 VAL n 
1 228 ILE n 
1 229 ARG n 
1 230 LEU n 
1 231 GLY n 
1 232 LEU n 
1 233 MET n 
1 234 GLU n 
1 235 MET n 
1 236 ILE n 
1 237 ALA n 
1 238 PHE n 
1 239 ALA n 
1 240 LYS n 
1 241 LEU n 
1 242 PHE n 
1 243 CYS n 
1 244 SER n 
1 245 GLY n 
1 246 PRO n 
1 247 VAL n 
1 248 SER n 
1 249 SER n 
1 250 ALA n 
1 251 THR n 
1 252 PHE n 
1 253 LEU n 
1 254 GLU n 
1 255 SER n 
1 256 CYS n 
1 257 GLY n 
1 258 VAL n 
1 259 ALA n 
1 260 ASP n 
1 261 LEU n 
1 262 ILE n 
1 263 THR n 
1 264 THR n 
1 265 CYS n 
1 266 TYR n 
1 267 GLY n 
1 268 GLY n 
1 269 ARG n 
1 270 ASN n 
1 271 ARG n 
1 272 LYS n 
1 273 VAL n 
1 274 ALA n 
1 275 GLU n 
1 276 ALA n 
1 277 PHE n 
1 278 ALA n 
1 279 ARG n 
1 280 THR n 
1 281 GLY n 
1 282 LYS n 
1 283 SER n 
1 284 ILE n 
1 285 GLU n 
1 286 GLN n 
1 287 LEU n 
1 288 GLU n 
1 289 LYS n 
1 290 GLU n 
1 291 LEU n 
1 292 LEU n 
1 293 ASN n 
1 294 GLY n 
1 295 GLN n 
1 296 LYS n 
1 297 LEU n 
1 298 GLN n 
1 299 GLY n 
1 300 PRO n 
1 301 GLU n 
1 302 THR n 
1 303 ALA n 
1 304 ARG n 
1 305 GLU n 
1 306 LEU n 
1 307 TYR n 
1 308 SER n 
1 309 ILE n 
1 310 LEU n 
1 311 GLN n 
1 312 HIS n 
1 313 LYS n 
1 314 GLY n 
1 315 LEU n 
1 316 VAL n 
1 317 ASP n 
1 318 LYS n 
1 319 PHE n 
1 320 PRO n 
1 321 LEU n 
1 322 PHE n 
1 323 MET n 
1 324 ALA n 
1 325 VAL n 
1 326 TYR n 
1 327 LYS n 
1 328 VAL n 
1 329 CYS n 
1 330 TYR n 
1 331 GLU n 
1 332 GLY n 
1 333 GLN n 
1 334 PRO n 
1 335 VAL n 
1 336 GLY n 
1 337 GLU n 
1 338 PHE n 
1 339 ILE n 
1 340 HIS n 
1 341 CYS n 
1 342 LEU n 
1 343 GLN n 
1 344 ASN n 
1 345 HIS n 
1 346 PRO n 
1 347 GLU n 
1 348 HIS n 
1 349 MET n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   349 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 GPD1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GPDA_HUMAN 
_struct_ref.pdbx_db_accession          P21695 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MASKKVCIVGSGNWGSAIAKIVGGNAAQLAQFDPRVTMWVFEEDIGGKKLTEIINTQHENVKYLPGHKLPPNVVAVPDVV
QAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERLGIPMSVLMGANIASEVADEK
FCETTIGCKDPAQGQLLKELMQTPNFRITVVQEVDTVEICGALKNVVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAK
LFCSGPVSSATFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGPETARELYSILQHKGLVDKFP
LFMAVYKVCYEGQPVGEFIHCLQNHPEHM
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6E8Z A 1 ? 349 ? P21695 1 ? 349 ? 1 349 
2 1 6E8Z B 1 ? 349 ? P21695 1 ? 349 ? 1 349 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?                 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                          ?                 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?                 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?                 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                          ?                 'C3 H7 N O2 S'      121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                    'ETHYLENE GLYCOL' 'C2 H6 O2'          62.068  
GLN 'L-peptide linking' y GLUTAMINE                         ?                 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?                 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                           ?                 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                         ?                 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                             ?                 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ?                 'C6 H13 N O2'       131.173 
K   non-polymer         . 'POTASSIUM ION'                   ?                 'K 1'               39.098  
LEU 'L-peptide linking' y LEUCINE                           ?                 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                            ?                 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                        ?                 'C5 H11 N O2 S'     149.211 
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ?                 'C21 H27 N7 O14 P2' 663.425 
PHE 'L-peptide linking' y PHENYLALANINE                     ?                 'C9 H11 N O2'       165.189 
PO4 non-polymer         . 'PHOSPHATE ION'                   ?                 'O4 P -3'           94.971  
PRO 'L-peptide linking' y PROLINE                           ?                 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                            ?                 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                         ?                 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?                 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                          ?                 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                            ?                 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6E8Z 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.23 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         44.89 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            287 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '200 mM potassium chloride, 23% PEG 20000, 0.1 M bis-tris propane pH 7.0, 10 mM NAD; 10 mg/mL' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-03-05 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97946 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRL BEAMLINE BL12-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97946 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL12-2 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.B_iso_Wilson_estimate            31.21 
_reflns.entry_id                         6E8Z 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.10 
_reflns.d_resolution_low                 33.96 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       37384 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.2 
_reflns.pdbx_Rmerge_I_obs                0.047 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13.5 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.056 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.10 
_reflns_shell.d_res_low                   2.175 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           3740 
_reflns_shell.percent_possible_all        98.1 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.195 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.2 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.234 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.966 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               37.92 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6E8Z 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.100 
_refine.ls_d_res_low                             33.96 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     37372 
_refine.ls_number_reflns_R_free                  3284 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    93.08 
_refine.ls_percent_reflns_R_free                 4.65 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1717 
_refine.ls_R_factor_R_free                       0.2247 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1690 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.07 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1X0X 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 25.73 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.27 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5013 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         116 
_refine_hist.number_atoms_solvent             230 
_refine_hist.number_atoms_total               5359 
_refine_hist.d_res_high                       2.100 
_refine_hist.d_res_low                        33.96 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.012  ? 5258 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.160  ? 7140 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 13.342 ? 3086 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.058  ? 832  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.008  ? 915  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.1000 2.1314  . . 119 2855 91.00 . . . 0.3596 . 0.2510 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1314 2.1647  . . 163 2929 94.00 . . . 0.3080 . 0.2357 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1647 2.2002  . . 137 2974 93.00 . . . 0.3559 . 0.2312 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2002 2.2381  . . 112 2943 93.00 . . . 0.3265 . 0.2205 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2381 2.2788  . . 148 2891 92.00 . . . 0.2665 . 0.2127 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2788 2.3226  . . 153 2956 93.00 . . . 0.3091 . 0.2074 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3226 2.3700  . . 111 2846 90.00 . . . 0.2875 . 0.1999 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3700 2.4215  . . 149 2740 88.00 . . . 0.2604 . 0.1922 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4215 2.4778  . . 162 2823 91.00 . . . 0.2729 . 0.1824 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4778 2.5398  . . 136 2994 94.00 . . . 0.2323 . 0.1723 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5398 2.6084  . . 168 2937 94.00 . . . 0.2371 . 0.1854 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6084 2.6852  . . 136 2969 94.00 . . . 0.2703 . 0.1783 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6852 2.7718  . . 126 2974 94.00 . . . 0.2353 . 0.1861 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7718 2.8708  . . 150 2862 92.00 . . . 0.2576 . 0.1802 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8708 2.9857  . . 145 2785 88.00 . . . 0.2681 . 0.1783 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9857 3.1215  . . 167 2929 94.00 . . . 0.2218 . 0.1725 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1215 3.2860  . . 159 3049 96.00 . . . 0.2482 . 0.1819 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2860 3.4917  . . 115 2982 95.00 . . . 0.2179 . 0.1713 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4917 3.7611  . . 135 3017 95.00 . . . 0.2374 . 0.1526 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7611 4.1391  . . 117 2903 92.00 . . . 0.1447 . 0.1454 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1391 4.7369  . . 174 3033 97.00 . . . 0.1673 . 0.1236 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7369 5.9636  . . 104 2978 93.00 . . . 0.1990 . 0.1437 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.9636 36.1136 . . 198 2975 96.00 . . . 0.1846 . 0.1649 . . . . . . . . . . 
# 
_struct.entry_id                     6E8Z 
_struct.title                        'Binary complex of Human glycerol 3-phosphate dehydrogenase with NAD' 
_struct.pdbx_descriptor              'Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic (E.C.1.1.1.8)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6E8Z 
_struct_keywords.text            Oxidoreductase 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 5 ? 
I N N 2 ? 
J N N 3 ? 
K N N 4 ? 
L N N 5 ? 
M N N 6 ? 
N N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 12  ? LEU A 29  ? GLY A 12  LEU A 29  1 ? 18 
HELX_P HELX_P2  AA2 LYS A 49  ? HIS A 58  ? LYS A 49  HIS A 58  1 ? 10 
HELX_P HELX_P3  AA3 ASP A 78  ? GLU A 84  ? ASP A 78  GLU A 84  1 ? 7  
HELX_P HELX_P4  AA4 PRO A 94  ? GLN A 96  ? PRO A 94  GLN A 96  5 ? 3  
HELX_P HELX_P5  AA5 PHE A 97  ? LYS A 106 ? PHE A 97  LYS A 106 1 ? 10 
HELX_P HELX_P6  AA6 LEU A 131 ? GLY A 141 ? LEU A 131 GLY A 141 1 ? 11 
HELX_P HELX_P7  AA7 ILE A 152 ? ASP A 158 ? ILE A 152 ASP A 158 1 ? 7  
HELX_P HELX_P8  AA8 ASP A 170 ? GLN A 182 ? ASP A 170 GLN A 182 1 ? 13 
HELX_P HELX_P9  AA9 GLU A 193 ? GLY A 218 ? GLU A 193 GLY A 218 1 ? 26 
HELX_P HELX_P10 AB1 GLY A 220 ? CYS A 243 ? GLY A 220 CYS A 243 1 ? 24 
HELX_P HELX_P11 AB2 SER A 248 ? GLU A 254 ? SER A 248 GLU A 254 5 ? 7  
HELX_P HELX_P12 AB3 GLY A 257 ? GLY A 268 ? GLY A 257 GLY A 268 1 ? 12 
HELX_P HELX_P13 AB4 GLY A 268 ? GLY A 281 ? GLY A 268 GLY A 281 1 ? 14 
HELX_P HELX_P14 AB5 SER A 283 ? LEU A 292 ? SER A 283 LEU A 292 1 ? 10 
HELX_P HELX_P15 AB6 LEU A 297 ? GLY A 314 ? LEU A 297 GLY A 314 1 ? 18 
HELX_P HELX_P16 AB7 LEU A 315 ? LYS A 318 ? LEU A 315 LYS A 318 5 ? 4  
HELX_P HELX_P17 AB8 PHE A 319 ? GLU A 331 ? PHE A 319 GLU A 331 1 ? 13 
HELX_P HELX_P18 AB9 PRO A 334 ? GLN A 343 ? PRO A 334 GLN A 343 5 ? 10 
HELX_P HELX_P19 AC1 HIS A 345 ? MET A 349 ? HIS A 345 MET A 349 5 ? 5  
HELX_P HELX_P20 AC2 GLY B 12  ? LEU B 29  ? GLY B 12  LEU B 29  1 ? 18 
HELX_P HELX_P21 AC3 LYS B 49  ? HIS B 58  ? LYS B 49  HIS B 58  1 ? 10 
HELX_P HELX_P22 AC4 ASP B 78  ? GLU B 84  ? ASP B 78  GLU B 84  1 ? 7  
HELX_P HELX_P23 AC5 PRO B 94  ? GLN B 96  ? PRO B 94  GLN B 96  5 ? 3  
HELX_P HELX_P24 AC6 PHE B 97  ? LYS B 106 ? PHE B 97  LYS B 106 1 ? 10 
HELX_P HELX_P25 AC7 LEU B 131 ? GLY B 141 ? LEU B 131 GLY B 141 1 ? 11 
HELX_P HELX_P26 AC8 ILE B 152 ? ASP B 158 ? ILE B 152 ASP B 158 1 ? 7  
HELX_P HELX_P27 AC9 ASP B 170 ? GLN B 182 ? ASP B 170 GLN B 182 1 ? 13 
HELX_P HELX_P28 AD1 GLU B 193 ? LEU B 217 ? GLU B 193 LEU B 217 1 ? 25 
HELX_P HELX_P29 AD2 GLY B 220 ? CYS B 243 ? GLY B 220 CYS B 243 1 ? 24 
HELX_P HELX_P30 AD3 SER B 248 ? GLU B 254 ? SER B 248 GLU B 254 5 ? 7  
HELX_P HELX_P31 AD4 GLY B 257 ? GLY B 268 ? GLY B 257 GLY B 268 1 ? 12 
HELX_P HELX_P32 AD5 GLY B 268 ? GLY B 281 ? GLY B 268 GLY B 281 1 ? 14 
HELX_P HELX_P33 AD6 SER B 283 ? LEU B 291 ? SER B 283 LEU B 291 1 ? 9  
HELX_P HELX_P34 AD7 LEU B 297 ? LYS B 313 ? LEU B 297 LYS B 313 1 ? 17 
HELX_P HELX_P35 AD8 GLY B 314 ? LYS B 318 ? GLY B 314 LYS B 318 5 ? 5  
HELX_P HELX_P36 AD9 PHE B 319 ? GLU B 331 ? PHE B 319 GLU B 331 1 ? 13 
HELX_P HELX_P37 AE1 PRO B 334 ? PHE B 338 ? PRO B 334 PHE B 338 5 ? 5  
HELX_P HELX_P38 AE2 ILE B 339 ? GLN B 343 ? ILE B 339 GLN B 343 5 ? 5  
HELX_P HELX_P39 AE3 HIS B 345 ? MET B 349 ? HIS B 345 MET B 349 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ALA 26 O ? ? ? 1_555 H K   . K ? ? A ALA 26  A K   406 1_555 ? ? ? ? ? ? ? 2.641 ? 
metalc2  metalc ? ? A ALA 27 O ? ? ? 1_555 H K   . K ? ? A ALA 27  A K   406 1_555 ? ? ? ? ? ? ? 3.177 ? 
metalc3  metalc ? ? A LEU 29 O ? ? ? 1_555 H K   . K ? ? A LEU 29  A K   406 1_555 ? ? ? ? ? ? ? 2.638 ? 
metalc4  metalc ? ? A PHE 32 O ? ? ? 1_555 H K   . K ? ? A PHE 32  A K   406 1_555 ? ? ? ? ? ? ? 2.771 ? 
metalc5  metalc ? ? B ALA 26 O ? ? ? 1_555 L K   . K ? ? B ALA 26  B K   404 1_555 ? ? ? ? ? ? ? 2.731 ? 
metalc6  metalc ? ? B ALA 27 O ? ? ? 1_555 L K   . K ? ? B ALA 27  B K   404 1_555 ? ? ? ? ? ? ? 3.019 ? 
metalc7  metalc ? ? B LEU 29 O ? ? ? 1_555 L K   . K ? ? B LEU 29  B K   404 1_555 ? ? ? ? ? ? ? 2.504 ? 
metalc8  metalc ? ? B PHE 32 O ? ? ? 1_555 L K   . K ? ? B PHE 32  B K   404 1_555 ? ? ? ? ? ? ? 2.651 ? 
metalc9  metalc ? ? L K   .  K ? ? ? 1_555 N HOH . O ? ? B K   404 B HOH 584 1_555 ? ? ? ? ? ? ? 2.829 ? 
metalc10 metalc ? ? L K   .  K ? ? ? 1_555 N HOH . O ? ? B K   404 B HOH 598 1_555 ? ? ? ? ? ? ? 3.410 ? 
metalc11 metalc ? ? L K   .  K ? ? ? 1_555 N HOH . O ? ? B K   404 B HOH 507 1_655 ? ? ? ? ? ? ? 2.858 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? anti-parallel 
AA1 7 8 ? parallel      
AA2 1 2 ? parallel      
AA2 2 3 ? parallel      
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
AA2 5 6 ? parallel      
AA2 6 7 ? anti-parallel 
AA2 7 8 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 73  ? VAL A 76  ? VAL A 73  VAL A 76  
AA1 2 PHE A 32  ? TRP A 39  ? PHE A 32  TRP A 39  
AA1 3 LYS A 4   ? VAL A 9   ? LYS A 4   VAL A 9   
AA1 4 ILE A 88  ? PHE A 91  ? ILE A 88  PHE A 91  
AA1 5 THR A 114 ? SER A 117 ? THR A 114 SER A 117 
AA1 6 MET A 144 ? MET A 148 ? MET A 144 MET A 148 
AA1 7 CYS A 162 ? GLY A 167 ? CYS A 162 GLY A 167 
AA1 8 PHE A 186 ? VAL A 191 ? PHE A 186 VAL A 191 
AA2 1 VAL B 73  ? VAL B 76  ? VAL B 73  VAL B 76  
AA2 2 PHE B 32  ? TRP B 39  ? PHE B 32  TRP B 39  
AA2 3 LYS B 4   ? VAL B 9   ? LYS B 4   VAL B 9   
AA2 4 ILE B 88  ? PHE B 91  ? ILE B 88  PHE B 91  
AA2 5 THR B 114 ? SER B 117 ? THR B 114 SER B 117 
AA2 6 MET B 144 ? MET B 148 ? MET B 144 MET B 148 
AA2 7 CYS B 162 ? GLY B 167 ? CYS B 162 GLY B 167 
AA2 8 PHE B 186 ? VAL B 191 ? PHE B 186 VAL B 191 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O VAL A 74  ? O VAL A 74  N VAL A 36  ? N VAL A 36  
AA1 2 3 O ASP A 33  ? O ASP A 33  N LYS A 4   ? N LYS A 4   
AA1 3 4 N VAL A 9   ? N VAL A 9   O ILE A 90  ? O ILE A 90  
AA1 4 5 N PHE A 91  ? N PHE A 91  O ILE A 116 ? O ILE A 116 
AA1 5 6 N SER A 117 ? N SER A 117 O SER A 145 ? O SER A 145 
AA1 6 7 N VAL A 146 ? N VAL A 146 O GLY A 167 ? O GLY A 167 
AA1 7 8 N ILE A 166 ? N ILE A 166 O THR A 189 ? O THR A 189 
AA2 1 2 O VAL B 74  ? O VAL B 74  N VAL B 36  ? N VAL B 36  
AA2 2 3 O ASP B 33  ? O ASP B 33  N LYS B 4   ? N LYS B 4   
AA2 3 4 N CYS B 7   ? N CYS B 7   O ILE B 88  ? O ILE B 88  
AA2 4 5 N PHE B 91  ? N PHE B 91  O ILE B 116 ? O ILE B 116 
AA2 5 6 N SER B 117 ? N SER B 117 O SER B 145 ? O SER B 145 
AA2 6 7 N MET B 148 ? N MET B 148 O THR B 165 ? O THR B 165 
AA2 7 8 N ILE B 166 ? N ILE B 166 O VAL B 191 ? O VAL B 191 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A NAD 401 ? 20 'binding site for residue NAD A 401' 
AC2 Software A PO4 402 ? 5  'binding site for residue PO4 A 402' 
AC3 Software A EDO 403 ? 4  'binding site for residue EDO A 403' 
AC4 Software A EDO 404 ? 4  'binding site for residue EDO A 404' 
AC5 Software A EDO 405 ? 7  'binding site for residue EDO A 405' 
AC6 Software A K   406 ? 6  'binding site for residue K A 406'   
AC7 Software B NAD 401 ? 21 'binding site for residue NAD B 401' 
AC8 Software B PO4 402 ? 4  'binding site for residue PO4 B 402' 
AC9 Software B EDO 403 ? 4  'binding site for residue EDO B 403' 
AD1 Software B K   404 ? 6  'binding site for residue K B 404'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 20 SER A 11  ? SER A 11  . ? 1_555 ? 
2  AC1 20 GLY A 12  ? GLY A 12  . ? 1_555 ? 
3  AC1 20 ASN A 13  ? ASN A 13  . ? 1_555 ? 
4  AC1 20 TRP A 14  ? TRP A 14  . ? 1_555 ? 
5  AC1 20 TRP A 39  ? TRP A 39  . ? 1_555 ? 
6  AC1 20 PHE A 41  ? PHE A 41  . ? 1_555 ? 
7  AC1 20 VAL A 93  ? VAL A 93  . ? 1_555 ? 
8  AC1 20 PRO A 94  ? PRO A 94  . ? 1_555 ? 
9  AC1 20 PHE A 97  ? PHE A 97  . ? 1_555 ? 
10 AC1 20 ILE A 119 ? ILE A 119 . ? 1_555 ? 
11 AC1 20 LYS A 120 ? LYS A 120 . ? 1_555 ? 
12 AC1 20 ASN A 151 ? ASN A 151 . ? 1_555 ? 
13 AC1 20 ILE A 152 ? ILE A 152 . ? 1_555 ? 
14 AC1 20 ALA A 153 ? ALA A 153 . ? 1_555 ? 
15 AC1 20 HOH M .   ? HOH A 505 . ? 1_555 ? 
16 AC1 20 HOH M .   ? HOH A 527 . ? 1_555 ? 
17 AC1 20 HOH M .   ? HOH A 538 . ? 1_555 ? 
18 AC1 20 HOH M .   ? HOH A 547 . ? 1_555 ? 
19 AC1 20 HOH M .   ? HOH A 553 . ? 1_555 ? 
20 AC1 20 HOH M .   ? HOH A 554 . ? 1_555 ? 
21 AC2 5  LEU A 131 ? LEU A 131 . ? 1_555 ? 
22 AC2 5  GLU A 134 ? GLU A 134 . ? 1_555 ? 
23 AC2 5  ASP A 195 ? ASP A 195 . ? 1_555 ? 
24 AC2 5  PHE A 242 ? PHE A 242 . ? 1_555 ? 
25 AC2 5  SER A 244 ? SER A 244 . ? 1_555 ? 
26 AC3 4  ALA A 237 ? ALA A 237 . ? 1_555 ? 
27 AC3 4  LYS A 318 ? LYS A 318 . ? 1_555 ? 
28 AC3 4  PRO A 346 ? PRO A 346 . ? 1_555 ? 
29 AC3 4  GLU A 347 ? GLU A 347 . ? 1_555 ? 
30 AC4 4  LYS A 240 ? LYS A 240 . ? 1_555 ? 
31 AC4 4  PRO A 246 ? PRO A 246 . ? 1_555 ? 
32 AC4 4  VAL A 247 ? VAL A 247 . ? 1_555 ? 
33 AC4 4  HOH M .   ? HOH A 511 . ? 1_555 ? 
34 AC5 7  LYS A 120 ? LYS A 120 . ? 1_555 ? 
35 AC5 7  GLY A 149 ? GLY A 149 . ? 1_555 ? 
36 AC5 7  ASN A 151 ? ASN A 151 . ? 1_555 ? 
37 AC5 7  LYS A 204 ? LYS A 204 . ? 1_555 ? 
38 AC5 7  ASP A 260 ? ASP A 260 . ? 1_555 ? 
39 AC5 7  THR A 263 ? THR A 263 . ? 1_555 ? 
40 AC5 7  THR A 264 ? THR A 264 . ? 1_555 ? 
41 AC6 6  ALA A 26  ? ALA A 26  . ? 1_555 ? 
42 AC6 6  ALA A 27  ? ALA A 27  . ? 1_555 ? 
43 AC6 6  LEU A 29  ? LEU A 29  . ? 1_555 ? 
44 AC6 6  PHE A 32  ? PHE A 32  . ? 1_555 ? 
45 AC6 6  PRO A 34  ? PRO A 34  . ? 1_555 ? 
46 AC6 6  ASN A 344 ? ASN A 344 . ? 1_455 ? 
47 AC7 21 SER B 11  ? SER B 11  . ? 1_555 ? 
48 AC7 21 GLY B 12  ? GLY B 12  . ? 1_555 ? 
49 AC7 21 ASN B 13  ? ASN B 13  . ? 1_555 ? 
50 AC7 21 TRP B 14  ? TRP B 14  . ? 1_555 ? 
51 AC7 21 TRP B 39  ? TRP B 39  . ? 1_555 ? 
52 AC7 21 PHE B 41  ? PHE B 41  . ? 1_555 ? 
53 AC7 21 TYR B 63  ? TYR B 63  . ? 1_555 ? 
54 AC7 21 VAL B 93  ? VAL B 93  . ? 1_555 ? 
55 AC7 21 PRO B 94  ? PRO B 94  . ? 1_555 ? 
56 AC7 21 PHE B 97  ? PHE B 97  . ? 1_555 ? 
57 AC7 21 ILE B 119 ? ILE B 119 . ? 1_555 ? 
58 AC7 21 LYS B 120 ? LYS B 120 . ? 1_555 ? 
59 AC7 21 ASN B 151 ? ASN B 151 . ? 1_555 ? 
60 AC7 21 ILE B 152 ? ILE B 152 . ? 1_555 ? 
61 AC7 21 ALA B 153 ? ALA B 153 . ? 1_555 ? 
62 AC7 21 HOH N .   ? HOH B 505 . ? 1_555 ? 
63 AC7 21 HOH N .   ? HOH B 511 . ? 1_555 ? 
64 AC7 21 HOH N .   ? HOH B 517 . ? 1_555 ? 
65 AC7 21 HOH N .   ? HOH B 533 . ? 1_555 ? 
66 AC7 21 HOH N .   ? HOH B 545 . ? 1_555 ? 
67 AC7 21 HOH N .   ? HOH B 586 . ? 1_555 ? 
68 AC8 4  GLU B 134 ? GLU B 134 . ? 1_555 ? 
69 AC8 4  ASP B 195 ? ASP B 195 . ? 1_555 ? 
70 AC8 4  PHE B 242 ? PHE B 242 . ? 1_555 ? 
71 AC8 4  SER B 244 ? SER B 244 . ? 1_555 ? 
72 AC9 4  LYS B 318 ? LYS B 318 . ? 1_555 ? 
73 AC9 4  HIS B 345 ? HIS B 345 . ? 1_555 ? 
74 AC9 4  PRO B 346 ? PRO B 346 . ? 1_555 ? 
75 AC9 4  GLU B 347 ? GLU B 347 . ? 1_555 ? 
76 AD1 6  ALA B 26  ? ALA B 26  . ? 1_555 ? 
77 AD1 6  ALA B 27  ? ALA B 27  . ? 1_555 ? 
78 AD1 6  LEU B 29  ? LEU B 29  . ? 1_555 ? 
79 AD1 6  PHE B 32  ? PHE B 32  . ? 1_555 ? 
80 AD1 6  HOH N .   ? HOH B 507 . ? 1_655 ? 
81 AD1 6  HOH N .   ? HOH B 584 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6E8Z 
_atom_sites.fract_transf_matrix[1][1]   0.015728 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004015 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012694 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014919 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
K 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . ALA A 1 2   ? -30.943 -28.225 -30.318 1.00 56.98  ? 2   ALA A N    1 
ATOM   2     C CA   . ALA A 1 2   ? -30.407 -28.135 -31.680 1.00 69.28  ? 2   ALA A CA   1 
ATOM   3     C C    . ALA A 1 2   ? -29.697 -26.797 -31.920 1.00 71.25  ? 2   ALA A C    1 
ATOM   4     O O    . ALA A 1 2   ? -28.520 -26.768 -32.287 1.00 74.87  ? 2   ALA A O    1 
ATOM   5     C CB   . ALA A 1 2   ? -31.516 -28.323 -32.696 1.00 74.18  ? 2   ALA A CB   1 
ATOM   6     H HA   . ALA A 1 2   ? -29.759 -28.845 -31.810 1.00 83.10  ? 2   ALA A HA   1 
ATOM   7     H HB1  . ALA A 1 2   ? -31.140 -28.260 -33.588 1.00 88.98  ? 2   ALA A HB1  1 
ATOM   8     H HB2  . ALA A 1 2   ? -31.917 -29.196 -32.566 1.00 88.98  ? 2   ALA A HB2  1 
ATOM   9     H HB3  . ALA A 1 2   ? -32.182 -27.629 -32.567 1.00 88.98  ? 2   ALA A HB3  1 
ATOM   10    N N    . SER A 1 3   ? -30.425 -25.699 -31.719 1.00 60.15  ? 3   SER A N    1 
ATOM   11    C CA   . SER A 1 3   ? -29.878 -24.361 -31.930 1.00 54.45  ? 3   SER A CA   1 
ATOM   12    C C    . SER A 1 3   ? -28.857 -24.010 -30.842 1.00 53.93  ? 3   SER A C    1 
ATOM   13    O O    . SER A 1 3   ? -29.166 -24.065 -29.650 1.00 53.97  ? 3   SER A O    1 
ATOM   14    C CB   . SER A 1 3   ? -31.017 -23.349 -31.947 1.00 51.23  ? 3   SER A CB   1 
ATOM   15    O OG   . SER A 1 3   ? -30.588 -22.051 -31.567 1.00 58.66  ? 3   SER A OG   1 
ATOM   16    H H    . SER A 1 3   ? -31.245 -25.703 -31.459 1.00 72.14  ? 3   SER A H    1 
ATOM   17    H HA   . SER A 1 3   ? -29.429 -24.330 -32.790 1.00 65.30  ? 3   SER A HA   1 
ATOM   18    H HB2  . SER A 1 3   ? -31.382 -23.306 -32.844 1.00 61.44  ? 3   SER A HB2  1 
ATOM   19    H HB3  . SER A 1 3   ? -31.704 -23.643 -31.328 1.00 61.44  ? 3   SER A HB3  1 
ATOM   20    H HG   . SER A 1 3   ? -31.236 -21.517 -31.586 1.00 70.35  ? 3   SER A HG   1 
ATOM   21    N N    . LYS A 1 4   ? -27.647 -23.621 -31.254 1.00 54.09  ? 4   LYS A N    1 
ATOM   22    C CA   . LYS A 1 4   ? -26.523 -23.476 -30.328 1.00 34.94  ? 4   LYS A CA   1 
ATOM   23    C C    . LYS A 1 4   ? -26.563 -22.133 -29.621 1.00 31.20  ? 4   LYS A C    1 
ATOM   24    O O    . LYS A 1 4   ? -26.726 -21.086 -30.255 1.00 40.55  ? 4   LYS A O    1 
ATOM   25    C CB   . LYS A 1 4   ? -25.198 -23.628 -31.075 1.00 41.60  ? 4   LYS A CB   1 
ATOM   26    C CG   . LYS A 1 4   ? -24.954 -25.021 -31.634 1.00 43.82  ? 4   LYS A CG   1 
ATOM   27    C CD   . LYS A 1 4   ? -24.745 -26.033 -30.530 1.00 50.74  ? 4   LYS A CD   1 
ATOM   28    C CE   . LYS A 1 4   ? -24.013 -27.274 -31.048 1.00 46.71  ? 4   LYS A CE   1 
ATOM   29    N NZ   . LYS A 1 4   ? -24.621 -27.808 -32.303 1.00 60.20  ? 4   LYS A NZ   1 
ATOM   30    H H    . LYS A 1 4   ? -27.452 -23.434 -32.071 1.00 64.86  ? 4   LYS A H    1 
ATOM   31    H HA   . LYS A 1 4   ? -26.573 -24.173 -29.655 1.00 41.89  ? 4   LYS A HA   1 
ATOM   32    H HB2  . LYS A 1 4   ? -25.186 -23.005 -31.818 1.00 49.88  ? 4   LYS A HB2  1 
ATOM   33    H HB3  . LYS A 1 4   ? -24.472 -23.423 -30.465 1.00 49.88  ? 4   LYS A HB3  1 
ATOM   34    H HG2  . LYS A 1 4   ? -25.724 -25.296 -32.156 1.00 52.55  ? 4   LYS A HG2  1 
ATOM   35    H HG3  . LYS A 1 4   ? -24.159 -25.009 -32.190 1.00 52.55  ? 4   LYS A HG3  1 
ATOM   36    H HD2  . LYS A 1 4   ? -24.209 -25.635 -29.826 1.00 60.85  ? 4   LYS A HD2  1 
ATOM   37    H HD3  . LYS A 1 4   ? -25.606 -26.311 -30.181 1.00 60.85  ? 4   LYS A HD3  1 
ATOM   38    H HE2  . LYS A 1 4   ? -23.089 -27.043 -31.235 1.00 56.00  ? 4   LYS A HE2  1 
ATOM   39    H HE3  . LYS A 1 4   ? -24.052 -27.971 -30.374 1.00 56.00  ? 4   LYS A HE3  1 
ATOM   40    H HZ1  . LYS A 1 4   ? -24.172 -28.527 -32.576 1.00 72.19  ? 4   LYS A HZ1  1 
ATOM   41    H HZ2  . LYS A 1 4   ? -25.469 -28.034 -32.157 1.00 72.19  ? 4   LYS A HZ2  1 
ATOM   42    H HZ3  . LYS A 1 4   ? -24.592 -27.189 -32.942 1.00 72.19  ? 4   LYS A HZ3  1 
ATOM   43    N N    . LYS A 1 5   ? -26.378 -22.159 -28.307 1.00 30.45  ? 5   LYS A N    1 
ATOM   44    C CA   . LYS A 1 5   ? -26.430 -20.962 -27.492 1.00 34.85  ? 5   LYS A CA   1 
ATOM   45    C C    . LYS A 1 5   ? -25.027 -20.489 -27.123 1.00 33.70  ? 5   LYS A C    1 
ATOM   46    O O    . LYS A 1 5   ? -24.139 -21.280 -26.802 1.00 26.40  ? 5   LYS A O    1 
ATOM   47    C CB   . LYS A 1 5   ? -27.252 -21.211 -26.214 1.00 44.23  ? 5   LYS A CB   1 
ATOM   48    C CG   . LYS A 1 5   ? -28.513 -22.057 -26.468 1.00 53.08  ? 5   LYS A CG   1 
ATOM   49    C CD   . LYS A 1 5   ? -29.267 -22.424 -25.181 1.00 66.65  ? 5   LYS A CD   1 
ATOM   50    C CE   . LYS A 1 5   ? -30.596 -21.683 -25.039 1.00 66.00  ? 5   LYS A CE   1 
ATOM   51    N NZ   . LYS A 1 5   ? -30.429 -20.283 -24.509 1.00 69.18  ? 5   LYS A NZ   1 
ATOM   52    H H    . LYS A 1 5   ? -26.218 -22.875 -27.859 1.00 36.50  ? 5   LYS A H    1 
ATOM   53    H HA   . LYS A 1 5   ? -26.863 -20.255 -27.995 1.00 41.77  ? 5   LYS A HA   1 
ATOM   54    H HB2  . LYS A 1 5   ? -26.700 -21.683 -25.571 1.00 53.03  ? 5   LYS A HB2  1 
ATOM   55    H HB3  . LYS A 1 5   ? -27.532 -20.358 -25.848 1.00 53.03  ? 5   LYS A HB3  1 
ATOM   56    H HG2  . LYS A 1 5   ? -29.118 -21.555 -27.036 1.00 63.65  ? 5   LYS A HG2  1 
ATOM   57    H HG3  . LYS A 1 5   ? -28.254 -22.881 -26.909 1.00 63.65  ? 5   LYS A HG3  1 
ATOM   58    H HD2  . LYS A 1 5   ? -29.454 -23.376 -25.186 1.00 79.93  ? 5   LYS A HD2  1 
ATOM   59    H HD3  . LYS A 1 5   ? -28.715 -22.199 -24.416 1.00 79.93  ? 5   LYS A HD3  1 
ATOM   60    H HE2  . LYS A 1 5   ? -31.020 -21.626 -25.909 1.00 79.16  ? 5   LYS A HE2  1 
ATOM   61    H HE3  . LYS A 1 5   ? -31.165 -22.171 -24.424 1.00 79.16  ? 5   LYS A HE3  1 
ATOM   62    H HZ1  . LYS A 1 5   ? -31.223 -19.887 -24.441 1.00 82.97  ? 5   LYS A HZ1  1 
ATOM   63    H HZ2  . LYS A 1 5   ? -30.047 -20.305 -23.705 1.00 82.97  ? 5   LYS A HZ2  1 
ATOM   64    H HZ3  . LYS A 1 5   ? -29.915 -19.809 -25.060 1.00 82.97  ? 5   LYS A HZ3  1 
ATOM   65    N N    . VAL A 1 6   ? -24.865 -19.185 -27.075 1.00 35.38  ? 6   VAL A N    1 
ATOM   66    C CA   . VAL A 1 6   ? -23.569 -18.578 -26.858 1.00 36.81  ? 6   VAL A CA   1 
ATOM   67    C C    . VAL A 1 6   ? -23.610 -17.756 -25.596 1.00 35.25  ? 6   VAL A C    1 
ATOM   68    O O    . VAL A 1 6   ? -24.544 -16.980 -25.372 1.00 34.04  ? 6   VAL A O    1 
ATOM   69    C CB   . VAL A 1 6   ? -23.176 -17.676 -28.032 1.00 29.84  ? 6   VAL A CB   1 
ATOM   70    C CG1  . VAL A 1 6   ? -21.848 -16.998 -27.729 1.00 28.12  ? 6   VAL A CG1  1 
ATOM   71    C CG2  . VAL A 1 6   ? -23.137 -18.502 -29.281 1.00 32.99  ? 6   VAL A CG2  1 
ATOM   72    H H    . VAL A 1 6   ? -25.504 -18.616 -27.167 1.00 42.41  ? 6   VAL A H    1 
ATOM   73    H HA   . VAL A 1 6   ? -22.896 -19.269 -26.757 1.00 44.14  ? 6   VAL A HA   1 
ATOM   74    H HB   . VAL A 1 6   ? -23.849 -16.987 -28.144 1.00 35.76  ? 6   VAL A HB   1 
ATOM   75    H HG11 . VAL A 1 6   ? -21.607 -16.430 -28.477 1.00 33.70  ? 6   VAL A HG11 1 
ATOM   76    H HG12 . VAL A 1 6   ? -21.942 -16.465 -26.925 1.00 33.70  ? 6   VAL A HG12 1 
ATOM   77    H HG13 . VAL A 1 6   ? -21.169 -17.679 -27.598 1.00 33.70  ? 6   VAL A HG13 1 
ATOM   78    H HG21 . VAL A 1 6   ? -22.888 -17.934 -30.027 1.00 39.55  ? 6   VAL A HG21 1 
ATOM   79    H HG22 . VAL A 1 6   ? -22.482 -19.209 -29.171 1.00 39.55  ? 6   VAL A HG22 1 
ATOM   80    H HG23 . VAL A 1 6   ? -24.015 -18.884 -29.434 1.00 39.55  ? 6   VAL A HG23 1 
ATOM   81    N N    . CYS A 1 7   ? -22.530 -17.845 -24.868 1.00 31.92  ? 7   CYS A N    1 
ATOM   82    C CA   . CYS A 1 7   ? -22.299 -17.004 -23.705 1.00 28.02  ? 7   CYS A CA   1 
ATOM   83    C C    . CYS A 1 7   ? -20.928 -16.357 -23.863 1.00 27.11  ? 7   CYS A C    1 
ATOM   84    O O    . CYS A 1 7   ? -19.989 -17.051 -24.113 1.00 28.70  ? 7   CYS A O    1 
ATOM   85    C CB   . CYS A 1 7   ? -22.411 -17.817 -22.438 1.00 30.69  ? 7   CYS A CB   1 
ATOM   86    S SG   . CYS A 1 7   ? -21.845 -16.873 -21.027 1.00 32.74  ? 7   CYS A SG   1 
ATOM   87    H H    . CYS A 1 7   ? -21.850 -18.430 -25.029 1.00 38.26  ? 7   CYS A H    1 
ATOM   88    H HA   . CYS A 1 7   ? -22.986 -16.299 -23.691 1.00 33.58  ? 7   CYS A HA   1 
ATOM   89    H HB2  . CYS A 1 7   ? -23.344 -18.078 -22.296 1.00 36.79  ? 7   CYS A HB2  1 
ATOM   90    H HB3  . CYS A 1 7   ? -21.871 -18.629 -22.518 1.00 36.79  ? 7   CYS A HB3  1 
ATOM   91    H HG   . CYS A 1 7   ? -22.039 -17.718 -20.193 1.00 39.25  ? 7   CYS A HG   1 
ATOM   92    N N    . ILE A 1 8   ? -20.865 -15.048 -23.772 1.00 27.29  ? 8   ILE A N    1 
ATOM   93    C CA   . ILE A 1 8   ? -19.621 -14.307 -23.819 1.00 31.73  ? 8   ILE A CA   1 
ATOM   94    C C    . ILE A 1 8   ? -19.216 -14.025 -22.386 1.00 34.64  ? 8   ILE A C    1 
ATOM   95    O O    . ILE A 1 8   ? -19.863 -13.246 -21.674 1.00 30.55  ? 8   ILE A O    1 
ATOM   96    C CB   . ILE A 1 8   ? -19.744 -13.007 -24.630 1.00 24.98  ? 8   ILE A CB   1 
ATOM   97    C CG1  . ILE A 1 8   ? -20.134 -13.298 -26.069 1.00 30.80  ? 8   ILE A CG1  1 
ATOM   98    C CG2  . ILE A 1 8   ? -18.407 -12.300 -24.614 1.00 25.45  ? 8   ILE A CG2  1 
ATOM   99    C CD1  . ILE A 1 8   ? -20.538 -12.042 -26.857 1.00 32.77  ? 8   ILE A CD1  1 
ATOM   100   H H    . ILE A 1 8   ? -21.553 -14.547 -23.649 1.00 32.70  ? 8   ILE A H    1 
ATOM   101   H HA   . ILE A 1 8   ? -18.935 -14.858 -24.228 1.00 38.04  ? 8   ILE A HA   1 
ATOM   102   H HB   . ILE A 1 8   ? -20.414 -12.436 -24.223 1.00 29.93  ? 8   ILE A HB   1 
ATOM   103   H HG12 . ILE A 1 8   ? -19.380 -13.704 -26.523 1.00 36.92  ? 8   ILE A HG12 1 
ATOM   104   H HG13 . ILE A 1 8   ? -20.889 -13.907 -26.072 1.00 36.92  ? 8   ILE A HG13 1 
ATOM   105   H HG21 . ILE A 1 8   ? -18.478 -11.478 -25.124 1.00 30.49  ? 8   ILE A HG21 1 
ATOM   106   H HG22 . ILE A 1 8   ? -18.167 -12.100 -23.695 1.00 30.49  ? 8   ILE A HG22 1 
ATOM   107   H HG23 . ILE A 1 8   ? -17.739 -12.880 -25.012 1.00 30.49  ? 8   ILE A HG23 1 
ATOM   108   H HD11 . ILE A 1 8   ? -20.774 -12.300 -27.762 1.00 39.28  ? 8   ILE A HD11 1 
ATOM   109   H HD12 . ILE A 1 8   ? -21.300 -11.628 -26.421 1.00 39.28  ? 8   ILE A HD12 1 
ATOM   110   H HD13 . ILE A 1 8   ? -19.790 -11.425 -26.872 1.00 39.28  ? 8   ILE A HD13 1 
ATOM   111   N N    . VAL A 1 9   ? -18.162 -14.683 -21.955 1.00 32.20  ? 9   VAL A N    1 
ATOM   112   C CA   . VAL A 1 9   ? -17.602 -14.526 -20.597 1.00 24.86  ? 9   VAL A CA   1 
ATOM   113   C C    . VAL A 1 9   ? -16.658 -13.341 -20.639 1.00 34.60  ? 9   VAL A C    1 
ATOM   114   O O    . VAL A 1 9   ? -15.508 -13.520 -20.954 1.00 37.19  ? 9   VAL A O    1 
ATOM   115   C CB   . VAL A 1 9   ? -16.923 -15.819 -20.138 1.00 26.48  ? 9   VAL A CB   1 
ATOM   116   C CG1  . VAL A 1 9   ? -16.515 -15.774 -18.690 1.00 34.26  ? 9   VAL A CG1  1 
ATOM   117   C CG2  . VAL A 1 9   ? -17.814 -17.004 -20.401 1.00 28.64  ? 9   VAL A CG2  1 
ATOM   118   H H    . VAL A 1 9   ? -17.709 -15.281 -22.471 1.00 38.60  ? 9   VAL A H    1 
ATOM   119   H HA   . VAL A 1 9   ? -18.331 -14.322 -19.984 1.00 29.80  ? 9   VAL A HA   1 
ATOM   120   H HB   . VAL A 1 9   ? -16.103 -15.931 -20.680 1.00 31.74  ? 9   VAL A HB   1 
ATOM   121   H HG11 . VAL A 1 9   ? -16.083 -16.611 -18.447 1.00 41.07  ? 9   VAL A HG11 1 
ATOM   122   H HG12 . VAL A 1 9   ? -15.895 -15.037 -18.550 1.00 41.07  ? 9   VAL A HG12 1 
ATOM   123   H HG13 . VAL A 1 9   ? -17.303 -15.644 -18.134 1.00 41.07  ? 9   VAL A HG13 1 
ATOM   124   H HG21 . VAL A 1 9   ? -17.381 -17.813 -20.078 1.00 34.33  ? 9   VAL A HG21 1 
ATOM   125   H HG22 . VAL A 1 9   ? -18.661 -16.882 -19.938 1.00 34.33  ? 9   VAL A HG22 1 
ATOM   126   H HG23 . VAL A 1 9   ? -17.976 -17.083 -21.357 1.00 34.33  ? 9   VAL A HG23 1 
ATOM   127   N N    . GLY A 1 10  ? -17.169 -12.156 -20.344 1.00 38.43  ? 10  GLY A N    1 
ATOM   128   C CA   . GLY A 1 10  ? -16.371 -10.940 -20.302 1.00 42.82  ? 10  GLY A CA   1 
ATOM   129   C C    . GLY A 1 10  ? -17.119 -9.853  -21.042 1.00 37.01  ? 10  GLY A C    1 
ATOM   130   O O    . GLY A 1 10  ? -17.882 -10.116 -21.970 1.00 34.58  ? 10  GLY A O    1 
ATOM   131   H H    . GLY A 1 10  ? -17.995 -12.037 -20.138 1.00 46.08  ? 10  GLY A H    1 
ATOM   132   H HA2  . GLY A 1 10  ? -16.229 -10.662 -19.384 1.00 51.34  ? 10  GLY A HA2  1 
ATOM   133   H HA3  . GLY A 1 10  ? -15.513 -11.085 -20.730 1.00 51.34  ? 10  GLY A HA3  1 
ATOM   134   N N    . SER A 1 11  ? -16.890 -8.610  -20.629 1.00 42.26  ? 11  SER A N    1 
ATOM   135   C CA   . SER A 1 11  ? -17.688 -7.510  -21.148 1.00 40.70  ? 11  SER A CA   1 
ATOM   136   C C    . SER A 1 11  ? -16.873 -6.239  -21.274 1.00 40.71  ? 11  SER A C    1 
ATOM   137   O O    . SER A 1 11  ? -17.418 -5.134  -21.161 1.00 40.44  ? 11  SER A O    1 
ATOM   138   C CB   . SER A 1 11  ? -18.892 -7.250  -20.233 1.00 40.83  ? 11  SER A CB   1 
ATOM   139   O OG   . SER A 1 11  ? -18.463 -6.732  -18.991 1.00 35.58  ? 11  SER A OG   1 
ATOM   140   H H    . SER A 1 11  ? -16.289 -8.381  -20.058 1.00 50.67  ? 11  SER A H    1 
ATOM   141   H HA   . SER A 1 11  ? -18.020 -7.746  -22.028 1.00 48.80  ? 11  SER A HA   1 
ATOM   142   H HB2  . SER A 1 11  ? -19.481 -6.606  -20.659 1.00 48.96  ? 11  SER A HB2  1 
ATOM   143   H HB3  . SER A 1 11  ? -19.364 -8.084  -20.083 1.00 48.96  ? 11  SER A HB3  1 
ATOM   144   H HG   . SER A 1 11  ? -17.951 -7.280  -18.613 1.00 42.65  ? 11  SER A HG   1 
ATOM   145   N N    . GLY A 1 12  ? -15.583 -6.371  -21.478 1.00 31.72  ? 12  GLY A N    1 
ATOM   146   C CA   . GLY A 1 12  ? -14.691 -5.234  -21.556 1.00 37.74  ? 12  GLY A CA   1 
ATOM   147   C C    . GLY A 1 12  ? -14.595 -4.689  -22.963 1.00 42.45  ? 12  GLY A C    1 
ATOM   148   O O    . GLY A 1 12  ? -15.528 -4.788  -23.768 1.00 38.58  ? 12  GLY A O    1 
ATOM   149   H H    . GLY A 1 12  ? -15.187 -7.128  -21.577 1.00 38.03  ? 12  GLY A H    1 
ATOM   150   H HA2  . GLY A 1 12  ? -15.012 -4.529  -20.973 1.00 45.25  ? 12  GLY A HA2  1 
ATOM   151   H HA3  . GLY A 1 12  ? -13.804 -5.497  -21.265 1.00 45.25  ? 12  GLY A HA3  1 
ATOM   152   N N    . ASN A 1 13  ? -13.434 -4.118  -23.264 1.00 39.32  ? 13  ASN A N    1 
ATOM   153   C CA   . ASN A 1 13  ? -13.216 -3.528  -24.576 1.00 35.06  ? 13  ASN A CA   1 
ATOM   154   C C    . ASN A 1 13  ? -13.359 -4.583  -25.680 1.00 40.50  ? 13  ASN A C    1 
ATOM   155   O O    . ASN A 1 13  ? -14.116 -4.400  -26.643 1.00 35.56  ? 13  ASN A O    1 
ATOM   156   C CB   . ASN A 1 13  ? -11.834 -2.849  -24.575 1.00 33.82  ? 13  ASN A CB   1 
ATOM   157   C CG   . ASN A 1 13  ? -11.542 -2.083  -25.842 1.00 41.64  ? 13  ASN A CG   1 
ATOM   158   O OD1  . ASN A 1 13  ? -10.397 -2.052  -26.317 1.00 42.07  ? 13  ASN A OD1  1 
ATOM   159   N ND2  . ASN A 1 13  ? -12.575 -1.471  -26.418 1.00 47.63  ? 13  ASN A ND2  1 
ATOM   160   H H    . ASN A 1 13  ? -12.762 -4.059  -22.730 1.00 47.14  ? 13  ASN A H    1 
ATOM   161   H HA   . ASN A 1 13  ? -13.885 -2.843  -24.729 1.00 42.03  ? 13  ASN A HA   1 
ATOM   162   H HB2  . ASN A 1 13  ? -11.791 -2.225  -23.834 1.00 40.54  ? 13  ASN A HB2  1 
ATOM   163   H HB3  . ASN A 1 13  ? -11.150 -3.529  -24.474 1.00 40.54  ? 13  ASN A HB3  1 
ATOM   164   H HD21 . ASN A 1 13  ? -12.460 -1.022  -27.143 1.00 57.11  ? 13  ASN A HD21 1 
ATOM   165   H HD22 . ASN A 1 13  ? -13.356 -1.517  -26.060 1.00 57.11  ? 13  ASN A HD22 1 
ATOM   166   N N    . TRP A 1 14  ? -12.689 -5.727  -25.526 1.00 32.42  ? 14  TRP A N    1 
ATOM   167   C CA   . TRP A 1 14  ? -12.722 -6.756  -26.562 1.00 32.28  ? 14  TRP A CA   1 
ATOM   168   C C    . TRP A 1 14  ? -14.012 -7.544  -26.493 1.00 32.79  ? 14  TRP A C    1 
ATOM   169   O O    . TRP A 1 14  ? -14.621 -7.849  -27.523 1.00 29.55  ? 14  TRP A O    1 
ATOM   170   C CB   . TRP A 1 14  ? -11.505 -7.679  -26.415 1.00 38.23  ? 14  TRP A CB   1 
ATOM   171   C CG   . TRP A 1 14  ? -11.096 -8.604  -27.539 1.00 35.54  ? 14  TRP A CG   1 
ATOM   172   C CD1  . TRP A 1 14  ? -10.399 -9.766  -27.389 1.00 34.76  ? 14  TRP A CD1  1 
ATOM   173   C CD2  . TRP A 1 14  ? -11.314 -8.453  -28.954 1.00 32.94  ? 14  TRP A CD2  1 
ATOM   174   N NE1  . TRP A 1 14  ? -10.169 -10.349 -28.607 1.00 31.38  ? 14  TRP A NE1  1 
ATOM   175   C CE2  . TRP A 1 14  ? -10.718 -9.565  -29.586 1.00 30.22  ? 14  TRP A CE2  1 
ATOM   176   C CE3  . TRP A 1 14  ? -11.949 -7.494  -29.743 1.00 38.56  ? 14  TRP A CE3  1 
ATOM   177   C CZ2  . TRP A 1 14  ? -10.751 -9.751  -30.975 1.00 39.60  ? 14  TRP A CZ2  1 
ATOM   178   C CZ3  . TRP A 1 14  ? -11.978 -7.673  -31.114 1.00 45.41  ? 14  TRP A CZ3  1 
ATOM   179   C CH2  . TRP A 1 14  ? -11.385 -8.798  -31.719 1.00 39.21  ? 14  TRP A CH2  1 
ATOM   180   H H    . TRP A 1 14  ? -12.213 -5.928  -24.839 1.00 38.86  ? 14  TRP A H    1 
ATOM   181   H HA   . TRP A 1 14  ? -12.674 -6.331  -27.433 1.00 38.70  ? 14  TRP A HA   1 
ATOM   182   H HB2  . TRP A 1 14  ? -10.736 -7.116  -26.233 1.00 45.83  ? 14  TRP A HB2  1 
ATOM   183   H HB3  . TRP A 1 14  ? -11.663 -8.244  -25.642 1.00 45.83  ? 14  TRP A HB3  1 
ATOM   184   H HD1  . TRP A 1 14  ? -10.111 -10.110 -26.575 1.00 41.67  ? 14  TRP A HD1  1 
ATOM   185   H HE1  . TRP A 1 14  ? -9.751  -11.089 -28.735 1.00 37.61  ? 14  TRP A HE1  1 
ATOM   186   H HE3  . TRP A 1 14  ? -12.346 -6.748  -29.355 1.00 46.22  ? 14  TRP A HE3  1 
ATOM   187   H HZ2  . TRP A 1 14  ? -10.358 -10.494 -31.374 1.00 47.48  ? 14  TRP A HZ2  1 
ATOM   188   H HZ3  . TRP A 1 14  ? -12.401 -7.039  -31.647 1.00 54.46  ? 14  TRP A HZ3  1 
ATOM   189   H HH2  . TRP A 1 14  ? -11.419 -8.890  -32.644 1.00 47.01  ? 14  TRP A HH2  1 
ATOM   190   N N    . GLY A 1 15  ? -14.462 -7.861  -25.289 1.00 31.31  ? 15  GLY A N    1 
ATOM   191   C CA   . GLY A 1 15  ? -15.717 -8.587  -25.163 1.00 38.29  ? 15  GLY A CA   1 
ATOM   192   C C    . GLY A 1 15  ? -16.886 -7.815  -25.744 1.00 33.83  ? 15  GLY A C    1 
ATOM   193   O O    . GLY A 1 15  ? -17.764 -8.392  -26.399 1.00 36.56  ? 15  GLY A O    1 
ATOM   194   H H    . GLY A 1 15  ? -14.072 -7.673  -24.546 1.00 37.53  ? 15  GLY A H    1 
ATOM   195   H HA2  . GLY A 1 15  ? -15.648 -9.436  -25.626 1.00 45.91  ? 15  GLY A HA2  1 
ATOM   196   H HA3  . GLY A 1 15  ? -15.898 -8.760  -24.225 1.00 45.91  ? 15  GLY A HA3  1 
ATOM   197   N N    . SER A 1 16  ? -16.927 -6.499  -25.506 1.00 37.84  ? 16  SER A N    1 
ATOM   198   C CA   . SER A 1 16  ? -18.040 -5.717  -26.039 1.00 40.86  ? 16  SER A CA   1 
ATOM   199   C C    . SER A 1 16  ? -17.982 -5.664  -27.562 1.00 35.97  ? 16  SER A C    1 
ATOM   200   O O    . SER A 1 16  ? -18.999 -5.855  -28.232 1.00 42.93  ? 16  SER A O    1 
ATOM   201   C CB   . SER A 1 16  ? -18.030 -4.317  -25.436 1.00 46.82  ? 16  SER A CB   1 
ATOM   202   O OG   . SER A 1 16  ? -18.042 -4.365  -24.004 1.00 43.23  ? 16  SER A OG   1 
ATOM   203   H H    . SER A 1 16  ? -16.345 -6.053  -25.057 1.00 45.37  ? 16  SER A H    1 
ATOM   204   H HA   . SER A 1 16  ? -18.874 -6.145  -25.787 1.00 48.99  ? 16  SER A HA   1 
ATOM   205   H HB2  . SER A 1 16  ? -17.228 -3.856  -25.728 1.00 56.14  ? 16  SER A HB2  1 
ATOM   206   H HB3  . SER A 1 16  ? -18.816 -3.838  -25.742 1.00 56.14  ? 16  SER A HB3  1 
ATOM   207   H HG   . SER A 1 16  ? -17.366 -4.777  -23.724 1.00 51.84  ? 16  SER A HG   1 
ATOM   208   N N    . ALA A 1 17  ? -16.798 -5.429  -28.132 1.00 33.46  ? 17  ALA A N    1 
ATOM   209   C CA   . ALA A 1 17  ? -16.672 -5.477  -29.591 1.00 38.57  ? 17  ALA A CA   1 
ATOM   210   C C    . ALA A 1 17  ? -17.026 -6.860  -30.119 1.00 38.14  ? 17  ALA A C    1 
ATOM   211   O O    . ALA A 1 17  ? -17.694 -6.989  -31.151 1.00 40.22  ? 17  ALA A O    1 
ATOM   212   C CB   . ALA A 1 17  ? -15.266 -5.079  -30.037 1.00 35.39  ? 17  ALA A CB   1 
ATOM   213   H H    . ALA A 1 17  ? -16.071 -5.245  -27.711 1.00 40.10  ? 17  ALA A H    1 
ATOM   214   H HA   . ALA A 1 17  ? -17.296 -4.843  -29.978 1.00 46.24  ? 17  ALA A HA   1 
ATOM   215   H HB1  . ALA A 1 17  ? -15.219 -5.121  -31.005 1.00 42.43  ? 17  ALA A HB1  1 
ATOM   216   H HB2  . ALA A 1 17  ? -15.084 -4.175  -29.736 1.00 42.43  ? 17  ALA A HB2  1 
ATOM   217   H HB3  . ALA A 1 17  ? -14.626 -5.694  -29.647 1.00 42.43  ? 17  ALA A HB3  1 
ATOM   218   N N    . ILE A 1 18  ? -16.618 -7.916  -29.412 1.00 34.32  ? 18  ILE A N    1 
ATOM   219   C CA   . ILE A 1 18  ? -16.963 -9.248  -29.896 1.00 32.52  ? 18  ILE A CA   1 
ATOM   220   C C    . ILE A 1 18  ? -18.464 -9.469  -29.772 1.00 33.36  ? 18  ILE A C    1 
ATOM   221   O O    . ILE A 1 18  ? -19.061 -10.222 -30.551 1.00 34.40  ? 18  ILE A O    1 
ATOM   222   C CB   . ILE A 1 18  ? -16.161 -10.331 -29.144 1.00 42.90  ? 18  ILE A CB   1 
ATOM   223   C CG1  . ILE A 1 18  ? -14.659 -10.225 -29.490 1.00 45.04  ? 18  ILE A CG1  1 
ATOM   224   C CG2  . ILE A 1 18  ? -16.668 -11.718 -29.507 1.00 34.82  ? 18  ILE A CG2  1 
ATOM   225   C CD1  . ILE A 1 18  ? -14.291 -10.688 -30.889 1.00 43.73  ? 18  ILE A CD1  1 
ATOM   226   H H    . ILE A 1 18  ? -16.162 -7.890  -28.683 1.00 41.14  ? 18  ILE A H    1 
ATOM   227   H HA   . ILE A 1 18  ? -16.732 -9.308  -30.836 1.00 38.98  ? 18  ILE A HA   1 
ATOM   228   H HB   . ILE A 1 18  ? -16.272 -10.197 -28.190 1.00 51.44  ? 18  ILE A HB   1 
ATOM   229   H HG12 . ILE A 1 18  ? -14.388 -9.298  -29.408 1.00 54.01  ? 18  ILE A HG12 1 
ATOM   230   H HG13 . ILE A 1 18  ? -14.158 -10.768 -28.861 1.00 54.01  ? 18  ILE A HG13 1 
ATOM   231   H HG21 . ILE A 1 18  ? -16.149 -12.380 -29.024 1.00 41.74  ? 18  ILE A HG21 1 
ATOM   232   H HG22 . ILE A 1 18  ? -17.603 -11.787 -29.262 1.00 41.74  ? 18  ILE A HG22 1 
ATOM   233   H HG23 . ILE A 1 18  ? -16.566 -11.851 -30.463 1.00 41.74  ? 18  ILE A HG23 1 
ATOM   234   H HD11 . ILE A 1 18  ? -13.335 -10.585 -31.014 1.00 52.43  ? 18  ILE A HD11 1 
ATOM   235   H HD12 . ILE A 1 18  ? -14.540 -11.620 -30.988 1.00 52.43  ? 18  ILE A HD12 1 
ATOM   236   H HD13 . ILE A 1 18  ? -14.770 -10.147 -31.536 1.00 52.43  ? 18  ILE A HD13 1 
ATOM   237   N N    . ALA A 1 19  ? -19.095 -8.828  -28.790 1.00 32.19  ? 19  ALA A N    1 
ATOM   238   C CA   . ALA A 1 19  ? -20.548 -8.912  -28.673 1.00 36.46  ? 19  ALA A CA   1 
ATOM   239   C C    . ALA A 1 19  ? -21.217 -8.354  -29.926 1.00 43.03  ? 19  ALA A C    1 
ATOM   240   O O    . ALA A 1 19  ? -22.119 -8.983  -30.496 1.00 40.89  ? 19  ALA A O    1 
ATOM   241   C CB   . ALA A 1 19  ? -21.003 -8.176  -27.409 1.00 32.15  ? 19  ALA A CB   1 
ATOM   242   H H    . ALA A 1 19  ? -18.713 -8.346  -28.189 1.00 38.58  ? 19  ALA A H    1 
ATOM   243   H HA   . ALA A 1 19  ? -20.804 -9.844  -28.586 1.00 43.71  ? 19  ALA A HA   1 
ATOM   244   H HB1  . ALA A 1 19  ? -21.969 -8.237  -27.339 1.00 38.53  ? 19  ALA A HB1  1 
ATOM   245   H HB2  . ALA A 1 19  ? -20.588 -8.591  -26.636 1.00 38.53  ? 19  ALA A HB2  1 
ATOM   246   H HB3  . ALA A 1 19  ? -20.733 -7.247  -27.471 1.00 38.53  ? 19  ALA A HB3  1 
ATOM   247   N N    . LYS A 1 20  ? -20.749 -7.195  -30.406 1.00 37.28  ? 20  LYS A N    1 
ATOM   248   C CA   . LYS A 1 20  ? -21.308 -6.633  -31.640 1.00 39.22  ? 20  LYS A CA   1 
ATOM   249   C C    . LYS A 1 20  ? -21.303 -7.658  -32.756 1.00 37.43  ? 20  LYS A C    1 
ATOM   250   O O    . LYS A 1 20  ? -22.313 -7.865  -33.430 1.00 33.17  ? 20  LYS A O    1 
ATOM   251   C CB   . LYS A 1 20  ? -20.532 -5.382  -32.070 1.00 35.28  ? 20  LYS A CB   1 
ATOM   252   C CG   . LYS A 1 20  ? -20.569 -4.247  -31.037 1.00 49.48  ? 20  LYS A CG   1 
ATOM   253   C CD   . LYS A 1 20  ? -19.706 -3.051  -31.435 1.00 42.27  ? 20  LYS A CD   1 
ATOM   254   C CE   . LYS A 1 20  ? -20.083 -2.473  -32.790 1.00 43.37  ? 20  LYS A CE   1 
ATOM   255   N NZ   . LYS A 1 20  ? -21.399 -1.827  -32.777 1.00 44.99  ? 20  LYS A NZ   1 
ATOM   256   H H    . LYS A 1 20  ? -20.125 -6.726  -30.046 1.00 44.70  ? 20  LYS A H    1 
ATOM   257   H HA   . LYS A 1 20  ? -22.229 -6.373  -31.479 1.00 47.02  ? 20  LYS A HA   1 
ATOM   258   H HB2  . LYS A 1 20  ? -19.604 -5.623  -32.213 1.00 42.29  ? 20  LYS A HB2  1 
ATOM   259   H HB3  . LYS A 1 20  ? -20.915 -5.044  -32.895 1.00 42.29  ? 20  LYS A HB3  1 
ATOM   260   H HG2  . LYS A 1 20  ? -21.483 -3.938  -30.941 1.00 59.34  ? 20  LYS A HG2  1 
ATOM   261   H HG3  . LYS A 1 20  ? -20.242 -4.584  -30.188 1.00 59.34  ? 20  LYS A HG3  1 
ATOM   262   H HD2  . LYS A 1 20  ? -19.811 -2.352  -30.771 1.00 50.68  ? 20  LYS A HD2  1 
ATOM   263   H HD3  . LYS A 1 20  ? -18.778 -3.332  -31.476 1.00 50.68  ? 20  LYS A HD3  1 
ATOM   264   H HE2  . LYS A 1 20  ? -19.424 -1.808  -33.045 1.00 52.00  ? 20  LYS A HE2  1 
ATOM   265   H HE3  . LYS A 1 20  ? -20.105 -3.188  -33.444 1.00 52.00  ? 20  LYS A HE3  1 
ATOM   266   H HZ1  . LYS A 1 20  ? -22.025 -2.418  -32.552 1.00 53.95  ? 20  LYS A HZ1  1 
ATOM   267   H HZ2  . LYS A 1 20  ? -21.405 -1.160  -32.188 1.00 53.95  ? 20  LYS A HZ2  1 
ATOM   268   H HZ3  . LYS A 1 20  ? -21.585 -1.502  -33.585 1.00 53.95  ? 20  LYS A HZ3  1 
ATOM   269   N N    . ILE A 1 21  ? -20.165 -8.318  -32.973 1.00 34.60  ? 21  ILE A N    1 
ATOM   270   C CA   . ILE A 1 21  ? -20.102 -9.296  -34.052 1.00 25.59  ? 21  ILE A CA   1 
ATOM   271   C C    . ILE A 1 21  ? -20.958 -10.503 -33.727 1.00 32.73  ? 21  ILE A C    1 
ATOM   272   O O    . ILE A 1 21  ? -21.752 -10.963 -34.554 1.00 35.04  ? 21  ILE A O    1 
ATOM   273   C CB   . ILE A 1 21  ? -18.645 -9.713  -34.336 1.00 29.62  ? 21  ILE A CB   1 
ATOM   274   C CG1  . ILE A 1 21  ? -17.829 -8.491  -34.757 1.00 34.02  ? 21  ILE A CG1  1 
ATOM   275   C CG2  . ILE A 1 21  ? -18.638 -10.839 -35.367 1.00 31.97  ? 21  ILE A CG2  1 
ATOM   276   C CD1  . ILE A 1 21  ? -16.480 -8.790  -35.325 1.00 40.44  ? 21  ILE A CD1  1 
ATOM   277   H H    . ILE A 1 21  ? -19.437 -8.222  -32.524 1.00 41.48  ? 21  ILE A H    1 
ATOM   278   H HA   . ILE A 1 21  ? -20.456 -8.892  -34.860 1.00 30.67  ? 21  ILE A HA   1 
ATOM   279   H HB   . ILE A 1 21  ? -18.265 -10.058 -33.513 1.00 35.51  ? 21  ILE A HB   1 
ATOM   280   H HG12 . ILE A 1 21  ? -18.328 -8.005  -35.432 1.00 40.78  ? 21  ILE A HG12 1 
ATOM   281   H HG13 . ILE A 1 21  ? -17.699 -7.925  -33.980 1.00 40.78  ? 21  ILE A HG13 1 
ATOM   282   H HG21 . ILE A 1 21  ? -17.720 -11.099 -35.544 1.00 38.32  ? 21  ILE A HG21 1 
ATOM   283   H HG22 . ILE A 1 21  ? -19.134 -11.593 -35.014 1.00 38.32  ? 21  ILE A HG22 1 
ATOM   284   H HG23 . ILE A 1 21  ? -19.055 -10.521 -36.183 1.00 38.32  ? 21  ILE A HG23 1 
ATOM   285   H HD11 . ILE A 1 21  ? -16.044 -7.955  -35.559 1.00 48.49  ? 21  ILE A HD11 1 
ATOM   286   H HD12 . ILE A 1 21  ? -15.955 -9.262  -34.660 1.00 48.49  ? 21  ILE A HD12 1 
ATOM   287   H HD13 . ILE A 1 21  ? -16.586 -9.342  -36.116 1.00 48.49  ? 21  ILE A HD13 1 
ATOM   288   N N    . VAL A 1 22  ? -20.761 -11.075 -32.539 1.00 33.62  ? 22  VAL A N    1 
ATOM   289   C CA   . VAL A 1 22  ? -21.491 -12.277 -32.169 1.00 36.62  ? 22  VAL A CA   1 
ATOM   290   C C    . VAL A 1 22  ? -22.994 -11.984 -32.080 1.00 39.19  ? 22  VAL A C    1 
ATOM   291   O O    . VAL A 1 22  ? -23.826 -12.786 -32.512 1.00 30.43  ? 22  VAL A O    1 
ATOM   292   C CB   . VAL A 1 22  ? -20.920 -12.836 -30.846 1.00 32.41  ? 22  VAL A CB   1 
ATOM   293   C CG1  . VAL A 1 22  ? -21.810 -13.918 -30.253 1.00 38.21  ? 22  VAL A CG1  1 
ATOM   294   C CG2  . VAL A 1 22  ? -19.502 -13.351 -31.084 1.00 38.75  ? 22  VAL A CG2  1 
ATOM   295   H H    . VAL A 1 22  ? -20.216 -10.788 -31.938 1.00 40.30  ? 22  VAL A H    1 
ATOM   296   H HA   . VAL A 1 22  ? -21.359 -12.948 -32.857 1.00 43.91  ? 22  VAL A HA   1 
ATOM   297   H HB   . VAL A 1 22  ? -20.866 -12.113 -30.201 1.00 38.85  ? 22  VAL A HB   1 
ATOM   298   H HG11 . VAL A 1 22  ? -21.412 -14.236 -29.428 1.00 45.82  ? 22  VAL A HG11 1 
ATOM   299   H HG12 . VAL A 1 22  ? -22.687 -13.543 -30.075 1.00 45.82  ? 22  VAL A HG12 1 
ATOM   300   H HG13 . VAL A 1 22  ? -21.884 -14.648 -30.888 1.00 45.82  ? 22  VAL A HG13 1 
ATOM   301   H HG21 . VAL A 1 22  ? -19.149 -13.700 -30.251 1.00 46.46  ? 22  VAL A HG21 1 
ATOM   302   H HG22 . VAL A 1 22  ? -19.530 -14.054 -31.752 1.00 46.46  ? 22  VAL A HG22 1 
ATOM   303   H HG23 . VAL A 1 22  ? -18.948 -12.618 -31.397 1.00 46.46  ? 22  VAL A HG23 1 
ATOM   304   N N    . GLY A 1 23  ? -23.369 -10.839 -31.517 1.00 35.68  ? 23  GLY A N    1 
ATOM   305   C CA   . GLY A 1 23  ? -24.790 -10.529 -31.435 1.00 40.47  ? 23  GLY A CA   1 
ATOM   306   C C    . GLY A 1 23  ? -25.399 -10.406 -32.814 1.00 42.31  ? 23  GLY A C    1 
ATOM   307   O O    . GLY A 1 23  ? -26.399 -11.057 -33.133 1.00 40.46  ? 23  GLY A O    1 
ATOM   308   H H    . GLY A 1 23  ? -22.842 -10.246 -31.186 1.00 42.77  ? 23  GLY A H    1 
ATOM   309   H HA2  . GLY A 1 23  ? -25.252 -11.231 -30.951 1.00 48.52  ? 23  GLY A HA2  1 
ATOM   310   H HA3  . GLY A 1 23  ? -24.916 -9.691  -30.963 1.00 48.52  ? 23  GLY A HA3  1 
ATOM   311   N N    . GLY A 1 24  ? -24.781 -9.578  -33.657 1.00 41.45  ? 24  GLY A N    1 
ATOM   312   C CA   . GLY A 1 24  ? -25.200 -9.498  -35.045 1.00 37.11  ? 24  GLY A CA   1 
ATOM   313   C C    . GLY A 1 24  ? -25.361 -10.863 -35.679 1.00 25.58  ? 24  GLY A C    1 
ATOM   314   O O    . GLY A 1 24  ? -26.387 -11.163 -36.287 1.00 35.31  ? 24  GLY A O    1 
ATOM   315   H H    . GLY A 1 24  ? -24.126 -9.061  -33.449 1.00 49.69  ? 24  GLY A H    1 
ATOM   316   H HA2  . GLY A 1 24  ? -26.048 -9.031  -35.100 1.00 44.49  ? 24  GLY A HA2  1 
ATOM   317   H HA3  . GLY A 1 24  ? -24.541 -8.999  -35.553 1.00 44.49  ? 24  GLY A HA3  1 
ATOM   318   N N    . ASN A 1 25  ? -24.324 -11.676 -35.631 1.00 41.14  ? 25  ASN A N    1 
ATOM   319   C CA   . ASN A 1 25  ? -24.299 -12.988 -36.328 1.00 40.96  ? 25  ASN A CA   1 
ATOM   320   C C    . ASN A 1 25  ? -25.246 -13.981 -35.662 1.00 45.10  ? 25  ASN A C    1 
ATOM   321   O O    . ASN A 1 25  ? -25.883 -14.709 -36.379 1.00 37.73  ? 25  ASN A O    1 
ATOM   322   C CB   . ASN A 1 25  ? -22.890 -13.553 -36.436 1.00 47.10  ? 25  ASN A CB   1 
ATOM   323   C CG   . ASN A 1 25  ? -22.062 -12.943 -37.548 1.00 47.14  ? 25  ASN A CG   1 
ATOM   324   O OD1  . ASN A 1 25  ? -22.563 -12.281 -38.437 1.00 53.16  ? 25  ASN A OD1  1 
ATOM   325   N ND2  . ASN A 1 25  ? -20.764 -13.139 -37.469 1.00 36.81  ? 25  ASN A ND2  1 
ATOM   326   H H    . ASN A 1 25  ? -23.563 -11.482 -35.170 1.00 49.32  ? 25  ASN A H    1 
ATOM   327   H HA   . ASN A 1 25  ? -24.619 -12.838 -37.249 1.00 49.11  ? 25  ASN A HA   1 
ATOM   328   H HB2  . ASN A 1 25  ? -22.430 -13.409 -35.584 1.00 56.48  ? 25  ASN A HB2  1 
ATOM   329   H HB3  . ASN A 1 25  ? -22.952 -14.519 -36.583 1.00 56.48  ? 25  ASN A HB3  1 
ATOM   330   H HD21 . ASN A 1 25  ? -20.378 -13.754 -37.974 1.00 44.13  ? 25  ASN A HD21 1 
ATOM   331   H HD22 . ASN A 1 25  ? -20.277 -12.658 -36.910 1.00 44.13  ? 25  ASN A HD22 1 
ATOM   332   N N    . ALA A 1 26  ? -25.275 -14.077 -34.341 1.00 33.24  ? 26  ALA A N    1 
ATOM   333   C CA   . ALA A 1 26  ? -26.228 -14.989 -33.718 1.00 45.70  ? 26  ALA A CA   1 
ATOM   334   C C    . ALA A 1 26  ? -27.663 -14.631 -34.120 1.00 46.51  ? 26  ALA A C    1 
ATOM   335   O O    . ALA A 1 26  ? -28.459 -15.512 -34.457 1.00 35.45  ? 26  ALA A O    1 
ATOM   336   C CB   . ALA A 1 26  ? -26.049 -14.980 -32.205 1.00 37.92  ? 26  ALA A CB   1 
ATOM   337   H H    . ALA A 1 26  ? -24.777 -13.630 -33.801 1.00 39.85  ? 26  ALA A H    1 
ATOM   338   H HA   . ALA A 1 26  ? -26.049 -15.890 -34.031 1.00 54.80  ? 26  ALA A HA   1 
ATOM   339   H HB1  . ALA A 1 26  ? -26.689 -15.591 -31.808 1.00 45.46  ? 26  ALA A HB1  1 
ATOM   340   H HB2  . ALA A 1 26  ? -25.145 -15.264 -31.993 1.00 45.46  ? 26  ALA A HB2  1 
ATOM   341   H HB3  . ALA A 1 26  ? -26.200 -14.081 -31.875 1.00 45.46  ? 26  ALA A HB3  1 
ATOM   342   N N    . ALA A 1 27  ? -28.011 -13.339 -34.137 1.00 40.99  ? 27  ALA A N    1 
ATOM   343   C CA   . ALA A 1 27  ? -29.371 -12.985 -34.569 1.00 34.85  ? 27  ALA A CA   1 
ATOM   344   C C    . ALA A 1 27  ? -29.637 -13.438 -35.999 1.00 40.95  ? 27  ALA A C    1 
ATOM   345   O O    . ALA A 1 27  ? -30.725 -13.934 -36.300 1.00 38.25  ? 27  ALA A O    1 
ATOM   346   C CB   . ALA A 1 27  ? -29.602 -11.475 -34.447 1.00 33.15  ? 27  ALA A CB   1 
ATOM   347   H H    . ALA A 1 27  ? -27.507 -12.679 -33.915 1.00 49.14  ? 27  ALA A H    1 
ATOM   348   H HA   . ALA A 1 27  ? -30.010 -13.431 -33.991 1.00 41.78  ? 27  ALA A HA   1 
ATOM   349   H HB1  . ALA A 1 27  ? -30.505 -11.269 -34.738 1.00 39.73  ? 27  ALA A HB1  1 
ATOM   350   H HB2  . ALA A 1 27  ? -29.485 -11.211 -33.521 1.00 39.73  ? 27  ALA A HB2  1 
ATOM   351   H HB3  . ALA A 1 27  ? -28.960 -11.011 -35.007 1.00 39.73  ? 27  ALA A HB3  1 
ATOM   352   N N    . GLN A 1 28  ? -28.647 -13.275 -36.897 1.00 47.42  ? 28  GLN A N    1 
ATOM   353   C CA   . GLN A 1 28  ? -28.864 -13.444 -38.335 1.00 40.64  ? 28  GLN A CA   1 
ATOM   354   C C    . GLN A 1 28  ? -28.904 -14.907 -38.767 1.00 32.67  ? 28  GLN A C    1 
ATOM   355   O O    . GLN A 1 28  ? -29.681 -15.271 -39.653 1.00 35.27  ? 28  GLN A O    1 
ATOM   356   C CB   . GLN A 1 28  ? -27.762 -12.719 -39.107 1.00 37.10  ? 28  GLN A CB   1 
ATOM   357   C CG   . GLN A 1 28  ? -27.640 -13.116 -40.651 1.00 39.41  ? 28  GLN A CG   1 
ATOM   358   C CD   . GLN A 1 28  ? -28.859 -12.685 -41.451 1.00 36.73  ? 28  GLN A CD   1 
ATOM   359   O OE1  . GLN A 1 28  ? -29.359 -11.573 -41.277 1.00 35.99  ? 28  GLN A OE1  1 
ATOM   360   N NE2  . GLN A 1 28  ? -29.341 -13.558 -42.325 1.00 36.14  ? 28  GLN A NE2  1 
ATOM   361   H H    . GLN A 1 28  ? -27.839 -13.065 -36.690 1.00 56.86  ? 28  GLN A H    1 
ATOM   362   H HA   . GLN A 1 28  ? -29.712 -13.039 -38.574 1.00 48.72  ? 28  GLN A HA   1 
ATOM   363   H HB2  . GLN A 1 28  ? -27.931 -11.765 -39.063 1.00 44.48  ? 28  GLN A HB2  1 
ATOM   364   H HB3  . GLN A 1 28  ? -26.910 -12.917 -38.687 1.00 44.48  ? 28  GLN A HB3  1 
ATOM   365   H HG2  . GLN A 1 28  ? -26.861 -12.681 -41.031 1.00 47.26  ? 28  GLN A HG2  1 
ATOM   366   H HG3  . GLN A 1 28  ? -27.556 -14.079 -40.726 1.00 47.26  ? 28  GLN A HG3  1 
ATOM   367   H HE21 . GLN A 1 28  ? -28.965 -14.326 -42.418 1.00 43.33  ? 28  GLN A HE21 1 
ATOM   368   H HE22 . GLN A 1 28  ? -30.030 -13.357 -42.799 1.00 43.33  ? 28  GLN A HE22 1 
ATOM   369   N N    . LEU A 1 29  ? -28.046 -15.741 -38.207 1.00 39.26  ? 29  LEU A N    1 
ATOM   370   C CA   . LEU A 1 29  ? -27.808 -17.079 -38.739 1.00 39.00  ? 29  LEU A CA   1 
ATOM   371   C C    . LEU A 1 29  ? -28.704 -18.053 -38.013 1.00 43.53  ? 29  LEU A C    1 
ATOM   372   O O    . LEU A 1 29  ? -28.897 -17.944 -36.795 1.00 45.90  ? 29  LEU A O    1 
ATOM   373   C CB   . LEU A 1 29  ? -26.342 -17.502 -38.552 1.00 43.01  ? 29  LEU A CB   1 
ATOM   374   C CG   . LEU A 1 29  ? -25.211 -16.651 -39.143 1.00 45.84  ? 29  LEU A CG   1 
ATOM   375   C CD1  . LEU A 1 29  ? -23.847 -17.267 -38.808 1.00 38.46  ? 29  LEU A CD1  1 
ATOM   376   C CD2  . LEU A 1 29  ? -25.340 -16.519 -40.652 1.00 42.29  ? 29  LEU A CD2  1 
ATOM   377   H H    . LEU A 1 29  ? -27.581 -15.558 -37.508 1.00 47.07  ? 29  LEU A H    1 
ATOM   378   H HA   . LEU A 1 29  ? -28.022 -17.101 -39.684 1.00 46.76  ? 29  LEU A HA   1 
ATOM   379   H HB2  . LEU A 1 29  ? -26.175 -17.555 -37.597 1.00 51.57  ? 29  LEU A HB2  1 
ATOM   380   H HB3  . LEU A 1 29  ? -26.246 -18.389 -38.932 1.00 51.57  ? 29  LEU A HB3  1 
ATOM   381   H HG   . LEU A 1 29  ? -25.245 -15.762 -38.757 1.00 54.96  ? 29  LEU A HG   1 
ATOM   382   H HD11 . LEU A 1 29  ? -23.149 -16.713 -39.191 1.00 46.11  ? 29  LEU A HD11 1 
ATOM   383   H HD12 . LEU A 1 29  ? -23.747 -17.306 -37.844 1.00 46.11  ? 29  LEU A HD12 1 
ATOM   384   H HD13 . LEU A 1 29  ? -23.804 -18.161 -39.182 1.00 46.11  ? 29  LEU A HD13 1 
ATOM   385   H HD21 . LEU A 1 29  ? -24.608 -15.976 -40.984 1.00 50.70  ? 29  LEU A HD21 1 
ATOM   386   H HD22 . LEU A 1 29  ? -25.304 -17.403 -41.050 1.00 50.70  ? 29  LEU A HD22 1 
ATOM   387   H HD23 . LEU A 1 29  ? -26.188 -16.096 -40.860 1.00 50.70  ? 29  LEU A HD23 1 
ATOM   388   N N    . ALA A 1 30  ? -29.228 -19.021 -38.756 1.00 39.99  ? 30  ALA A N    1 
ATOM   389   C CA   . ALA A 1 30  ? -30.289 -19.854 -38.205 1.00 46.55  ? 30  ALA A CA   1 
ATOM   390   C C    . ALA A 1 30  ? -29.747 -20.802 -37.150 1.00 57.40  ? 30  ALA A C    1 
ATOM   391   O O    . ALA A 1 30  ? -30.498 -21.253 -36.272 1.00 50.64  ? 30  ALA A O    1 
ATOM   392   C CB   . ALA A 1 30  ? -30.981 -20.642 -39.316 1.00 49.37  ? 30  ALA A CB   1 
ATOM   393   H H    . ALA A 1 30  ? -28.996 -19.212 -39.562 1.00 47.95  ? 30  ALA A H    1 
ATOM   394   H HA   . ALA A 1 30  ? -30.951 -19.285 -37.784 1.00 55.82  ? 30  ALA A HA   1 
ATOM   395   H HB1  . ALA A 1 30  ? -31.681 -21.188 -38.925 1.00 59.21  ? 30  ALA A HB1  1 
ATOM   396   H HB2  . ALA A 1 30  ? -31.363 -20.018 -39.953 1.00 59.21  ? 30  ALA A HB2  1 
ATOM   397   H HB3  . ALA A 1 30  ? -30.327 -21.207 -39.756 1.00 59.21  ? 30  ALA A HB3  1 
ATOM   398   N N    . GLN A 1 31  ? -28.458 -21.120 -37.210 1.00 39.86  ? 31  GLN A N    1 
ATOM   399   C CA   . GLN A 1 31  ? -27.974 -22.225 -36.394 1.00 35.87  ? 31  GLN A CA   1 
ATOM   400   C C    . GLN A 1 31  ? -27.564 -21.772 -34.995 1.00 33.71  ? 31  GLN A C    1 
ATOM   401   O O    . GLN A 1 31  ? -27.175 -22.606 -34.180 1.00 36.18  ? 31  GLN A O    1 
ATOM   402   C CB   . GLN A 1 31  ? -26.834 -22.960 -37.111 1.00 38.42  ? 31  GLN A CB   1 
ATOM   403   C CG   . GLN A 1 31  ? -25.499 -22.183 -37.241 1.00 41.21  ? 31  GLN A CG   1 
ATOM   404   C CD   . GLN A 1 31  ? -25.386 -21.298 -38.506 1.00 42.19  ? 31  GLN A CD   1 
ATOM   405   O OE1  . GLN A 1 31  ? -26.367 -20.694 -38.971 1.00 41.35  ? 31  GLN A OE1  1 
ATOM   406   N NE2  . GLN A 1 31  ? -24.164 -21.206 -39.050 1.00 39.63  ? 31  GLN A NE2  1 
ATOM   407   H H    . GLN A 1 31  ? -27.865 -20.730 -37.695 1.00 47.79  ? 31  GLN A H    1 
ATOM   408   H HA   . GLN A 1 31  ? -28.699 -22.860 -36.287 1.00 43.01  ? 31  GLN A HA   1 
ATOM   409   H HB2  . GLN A 1 31  ? -26.646 -23.778 -36.625 1.00 46.07  ? 31  GLN A HB2  1 
ATOM   410   H HB3  . GLN A 1 31  ? -27.129 -23.179 -38.009 1.00 46.07  ? 31  GLN A HB3  1 
ATOM   411   H HG2  . GLN A 1 31  ? -25.401 -21.605 -36.469 1.00 49.41  ? 31  GLN A HG2  1 
ATOM   412   H HG3  . GLN A 1 31  ? -24.770 -22.822 -37.265 1.00 49.41  ? 31  GLN A HG3  1 
ATOM   413   H HE21 . GLN A 1 31  ? -23.505 -21.634 -38.702 1.00 47.52  ? 31  GLN A HE21 1 
ATOM   414   H HE22 . GLN A 1 31  ? -24.042 -20.726 -39.754 1.00 47.52  ? 31  GLN A HE22 1 
ATOM   415   N N    . PHE A 1 32  ? -27.679 -20.484 -34.696 1.00 36.20  ? 32  PHE A N    1 
ATOM   416   C CA   . PHE A 1 32  ? -27.387 -19.946 -33.379 1.00 37.51  ? 32  PHE A CA   1 
ATOM   417   C C    . PHE A 1 32  ? -28.654 -19.361 -32.758 1.00 50.80  ? 32  PHE A C    1 
ATOM   418   O O    . PHE A 1 32  ? -29.509 -18.796 -33.448 1.00 50.91  ? 32  PHE A O    1 
ATOM   419   C CB   . PHE A 1 32  ? -26.285 -18.845 -33.433 1.00 41.25  ? 32  PHE A CB   1 
ATOM   420   C CG   . PHE A 1 32  ? -24.966 -19.355 -33.984 1.00 39.32  ? 32  PHE A CG   1 
ATOM   421   C CD1  . PHE A 1 32  ? -24.208 -20.239 -33.243 1.00 32.53  ? 32  PHE A CD1  1 
ATOM   422   C CD2  . PHE A 1 32  ? -24.520 -18.979 -35.235 1.00 39.22  ? 32  PHE A CD2  1 
ATOM   423   C CE1  . PHE A 1 32  ? -23.044 -20.776 -33.727 1.00 40.28  ? 32  PHE A CE1  1 
ATOM   424   C CE2  . PHE A 1 32  ? -23.332 -19.507 -35.754 1.00 39.67  ? 32  PHE A CE2  1 
ATOM   425   C CZ   . PHE A 1 32  ? -22.582 -20.405 -34.989 1.00 44.07  ? 32  PHE A CZ   1 
ATOM   426   H H    . PHE A 1 32  ? -27.933 -19.886 -35.259 1.00 43.40  ? 32  PHE A H    1 
ATOM   427   H HA   . PHE A 1 32  ? -27.071 -20.662 -32.805 1.00 44.97  ? 32  PHE A HA   1 
ATOM   428   H HB2  . PHE A 1 32  ? -26.589 -18.123 -34.005 1.00 49.46  ? 32  PHE A HB2  1 
ATOM   429   H HB3  . PHE A 1 32  ? -26.126 -18.513 -32.536 1.00 49.46  ? 32  PHE A HB3  1 
ATOM   430   H HD1  . PHE A 1 32  ? -24.516 -20.507 -32.407 1.00 39.00  ? 32  PHE A HD1  1 
ATOM   431   H HD2  . PHE A 1 32  ? -25.029 -18.394 -35.749 1.00 47.02  ? 32  PHE A HD2  1 
ATOM   432   H HE1  . PHE A 1 32  ? -22.550 -21.365 -33.204 1.00 48.30  ? 32  PHE A HE1  1 
ATOM   433   H HE2  . PHE A 1 32  ? -23.033 -19.247 -36.595 1.00 47.56  ? 32  PHE A HE2  1 
ATOM   434   H HZ   . PHE A 1 32  ? -21.780 -20.745 -35.315 1.00 52.85  ? 32  PHE A HZ   1 
ATOM   435   N N    . ASP A 1 33  ? -28.764 -19.459 -31.444 1.00 36.36  ? 33  ASP A N    1 
ATOM   436   C CA   . ASP A 1 33  ? -29.889 -18.872 -30.698 1.00 33.84  ? 33  ASP A CA   1 
ATOM   437   C C    . ASP A 1 33  ? -29.617 -17.384 -30.628 1.00 37.11  ? 33  ASP A C    1 
ATOM   438   O O    . ASP A 1 33  ? -28.534 -17.017 -30.256 1.00 33.05  ? 33  ASP A O    1 
ATOM   439   C CB   . ASP A 1 33  ? -30.038 -19.485 -29.311 1.00 50.44  ? 33  ASP A CB   1 
ATOM   440   C CG   . ASP A 1 33  ? -31.226 -18.974 -28.527 1.00 42.03  ? 33  ASP A CG   1 
ATOM   441   O OD1  . ASP A 1 33  ? -31.363 -17.770 -28.396 1.00 37.03  ? 33  ASP A OD1  1 
ATOM   442   O OD2  . ASP A 1 33  ? -31.967 -19.801 -28.055 1.00 39.91  ? 33  ASP A OD2  1 
ATOM   443   H H    . ASP A 1 33  ? -28.153 -19.893 -30.926 1.00 43.59  ? 33  ASP A H    1 
ATOM   444   H HA   . ASP A 1 33  ? -30.720 -19.024 -31.206 1.00 40.57  ? 33  ASP A HA   1 
ATOM   445   H HB2  . ASP A 1 33  ? -30.126 -20.456 -29.402 1.00 60.48  ? 33  ASP A HB2  1 
ATOM   446   H HB3  . ASP A 1 33  ? -29.227 -19.300 -28.795 1.00 60.48  ? 33  ASP A HB3  1 
ATOM   447   N N    . PRO A 1 34  ? -30.534 -16.517 -31.067 1.00 37.89  ? 34  PRO A N    1 
ATOM   448   C CA   . PRO A 1 34  ? -30.297 -15.070 -31.004 1.00 30.32  ? 34  PRO A CA   1 
ATOM   449   C C    . PRO A 1 34  ? -30.053 -14.580 -29.621 1.00 35.69  ? 34  PRO A C    1 
ATOM   450   O O    . PRO A 1 34  ? -29.490 -13.484 -29.459 1.00 41.47  ? 34  PRO A O    1 
ATOM   451   C CB   . PRO A 1 34  ? -31.585 -14.474 -31.590 1.00 30.32  ? 34  PRO A CB   1 
ATOM   452   C CG   . PRO A 1 34  ? -32.594 -15.587 -31.464 1.00 44.76  ? 34  PRO A CG   1 
ATOM   453   C CD   . PRO A 1 34  ? -31.802 -16.814 -31.759 1.00 41.22  ? 34  PRO A CD   1 
ATOM   454   H HA   . PRO A 1 34  ? -29.546 -14.827 -31.567 1.00 36.34  ? 34  PRO A HA   1 
ATOM   455   H HB2  . PRO A 1 34  ? -31.857 -13.700 -31.071 1.00 36.34  ? 34  PRO A HB2  1 
ATOM   456   H HB3  . PRO A 1 34  ? -31.446 -14.237 -32.520 1.00 36.34  ? 34  PRO A HB3  1 
ATOM   457   H HG2  . PRO A 1 34  ? -32.949 -15.611 -30.561 1.00 53.67  ? 34  PRO A HG2  1 
ATOM   458   H HG3  . PRO A 1 34  ? -33.303 -15.466 -32.114 1.00 53.67  ? 34  PRO A HG3  1 
ATOM   459   H HD2  . PRO A 1 34  ? -32.227 -17.598 -31.377 1.00 49.43  ? 34  PRO A HD2  1 
ATOM   460   H HD3  . PRO A 1 34  ? -31.658 -16.908 -32.714 1.00 49.43  ? 34  PRO A HD3  1 
ATOM   461   N N    . ARG A 1 35  ? -30.468 -15.335 -28.598 1.00 35.68  ? 35  ARG A N    1 
ATOM   462   C CA   . ARG A 1 35  ? -30.290 -14.853 -27.239 1.00 41.53  ? 35  ARG A CA   1 
ATOM   463   C C    . ARG A 1 35  ? -28.845 -15.139 -26.863 1.00 35.84  ? 35  ARG A C    1 
ATOM   464   O O    . ARG A 1 35  ? -28.431 -16.303 -26.782 1.00 33.98  ? 35  ARG A O    1 
ATOM   465   C CB   . ARG A 1 35  ? -31.278 -15.486 -26.253 1.00 35.73  ? 35  ARG A CB   1 
ATOM   466   C CG   . ARG A 1 35  ? -31.142 -14.826 -24.895 1.00 39.95  ? 35  ARG A CG   1 
ATOM   467   C CD   . ARG A 1 35  ? -32.304 -15.114 -23.937 1.00 56.09  ? 35  ARG A CD   1 
ATOM   468   N NE   . ARG A 1 35  ? -32.052 -14.457 -22.652 1.00 55.60  ? 35  ARG A NE   1 
ATOM   469   C CZ   . ARG A 1 35  ? -31.311 -14.983 -21.683 1.00 57.98  ? 35  ARG A CZ   1 
ATOM   470   N NH1  . ARG A 1 35  ? -30.772 -16.187 -21.838 1.00 44.93  ? 35  ARG A NH1  1 
ATOM   471   N NH2  . ARG A 1 35  ? -31.119 -14.317 -20.552 1.00 59.87  ? 35  ARG A NH2  1 
ATOM   472   H H    . ARG A 1 35  ? -30.844 -16.105 -28.666 1.00 42.77  ? 35  ARG A H    1 
ATOM   473   H HA   . ARG A 1 35  ? -30.421 -13.893 -27.222 1.00 49.80  ? 35  ARG A HA   1 
ATOM   474   H HB2  . ARG A 1 35  ? -32.185 -15.356 -26.572 1.00 42.83  ? 35  ARG A HB2  1 
ATOM   475   H HB3  . ARG A 1 35  ? -31.082 -16.432 -26.158 1.00 42.83  ? 35  ARG A HB3  1 
ATOM   476   H HG2  . ARG A 1 35  ? -30.327 -15.142 -24.475 1.00 47.90  ? 35  ARG A HG2  1 
ATOM   477   H HG3  . ARG A 1 35  ? -31.094 -13.865 -25.020 1.00 47.90  ? 35  ARG A HG3  1 
ATOM   478   H HD2  . ARG A 1 35  ? -33.128 -14.763 -24.308 1.00 67.26  ? 35  ARG A HD2  1 
ATOM   479   H HD3  . ARG A 1 35  ? -32.375 -16.070 -23.788 1.00 67.26  ? 35  ARG A HD3  1 
ATOM   480   H HE   . ARG A 1 35  ? -32.341 -13.654 -22.547 1.00 66.67  ? 35  ARG A HE   1 
ATOM   481   H HH11 . ARG A 1 35  ? -30.891 -16.620 -22.571 1.00 53.87  ? 35  ARG A HH11 1 
ATOM   482   H HH12 . ARG A 1 35  ? -30.295 -16.529 -21.209 1.00 53.87  ? 35  ARG A HH12 1 
ATOM   483   H HH21 . ARG A 1 35  ? -31.472 -13.540 -20.446 1.00 71.80  ? 35  ARG A HH21 1 
ATOM   484   H HH22 . ARG A 1 35  ? -30.647 -14.665 -19.923 1.00 71.80  ? 35  ARG A HH22 1 
ATOM   485   N N    . VAL A 1 36  ? -28.075 -14.073 -26.700 1.00 34.51  ? 36  VAL A N    1 
ATOM   486   C CA   . VAL A 1 36  ? -26.662 -14.159 -26.421 1.00 33.37  ? 36  VAL A CA   1 
ATOM   487   C C    . VAL A 1 36  ? -26.501 -13.557 -25.044 1.00 46.74  ? 36  VAL A C    1 
ATOM   488   O O    . VAL A 1 36  ? -26.747 -12.357 -24.856 1.00 44.41  ? 36  VAL A O    1 
ATOM   489   C CB   . VAL A 1 36  ? -25.811 -13.411 -27.460 1.00 34.47  ? 36  VAL A CB   1 
ATOM   490   C CG1  . VAL A 1 36  ? -24.388 -13.312 -26.999 1.00 27.68  ? 36  VAL A CG1  1 
ATOM   491   C CG2  . VAL A 1 36  ? -25.878 -14.102 -28.836 1.00 32.83  ? 36  VAL A CG2  1 
ATOM   492   H H    . VAL A 1 36  ? -28.364 -13.265 -26.750 1.00 41.37  ? 36  VAL A H    1 
ATOM   493   H HA   . VAL A 1 36  ? -26.385 -15.088 -26.395 1.00 40.00  ? 36  VAL A HA   1 
ATOM   494   H HB   . VAL A 1 36  ? -26.156 -12.510 -27.561 1.00 41.33  ? 36  VAL A HB   1 
ATOM   495   H HG11 . VAL A 1 36  ? -23.871 -12.838 -27.669 1.00 33.18  ? 36  VAL A HG11 1 
ATOM   496   H HG12 . VAL A 1 36  ? -24.362 -12.830 -26.158 1.00 33.18  ? 36  VAL A HG12 1 
ATOM   497   H HG13 . VAL A 1 36  ? -24.032 -14.207 -26.879 1.00 33.18  ? 36  VAL A HG13 1 
ATOM   498   H HG21 . VAL A 1 36  ? -25.331 -13.605 -29.465 1.00 39.35  ? 36  VAL A HG21 1 
ATOM   499   H HG22 . VAL A 1 36  ? -25.544 -15.008 -28.751 1.00 39.35  ? 36  VAL A HG22 1 
ATOM   500   H HG23 . VAL A 1 36  ? -26.800 -14.115 -29.137 1.00 39.35  ? 36  VAL A HG23 1 
ATOM   501   N N    . THR A 1 37  ? -26.101 -14.378 -24.078 1.00 38.24  ? 37  THR A N    1 
ATOM   502   C CA   . THR A 1 37  ? -25.823 -13.836 -22.764 1.00 33.28  ? 37  THR A CA   1 
ATOM   503   C C    . THR A 1 37  ? -24.399 -13.296 -22.726 1.00 37.56  ? 37  THR A C    1 
ATOM   504   O O    . THR A 1 37  ? -23.507 -13.775 -23.438 1.00 35.51  ? 37  THR A O    1 
ATOM   505   C CB   . THR A 1 37  ? -26.037 -14.898 -21.687 1.00 42.88  ? 37  THR A CB   1 
ATOM   506   O OG1  . THR A 1 37  ? -25.111 -15.971 -21.879 1.00 43.27  ? 37  THR A OG1  1 
ATOM   507   C CG2  . THR A 1 37  ? -27.474 -15.479 -21.768 1.00 35.77  ? 37  THR A CG2  1 
ATOM   508   H H    . THR A 1 37  ? -25.987 -15.226 -24.156 1.00 45.84  ? 37  THR A H    1 
ATOM   509   H HA   . THR A 1 37  ? -26.430 -13.100 -22.588 1.00 39.90  ? 37  THR A HA   1 
ATOM   510   H HB   . THR A 1 37  ? -25.908 -14.506 -20.809 1.00 51.41  ? 37  THR A HB   1 
ATOM   511   H HG1  . THR A 1 37  ? -25.225 -16.557 -21.288 1.00 51.88  ? 37  THR A HG1  1 
ATOM   512   H HG21 . THR A 1 37  ? -27.598 -16.152 -21.080 1.00 42.88  ? 37  THR A HG21 1 
ATOM   513   H HG22 . THR A 1 37  ? -28.125 -14.772 -21.639 1.00 42.88  ? 37  THR A HG22 1 
ATOM   514   H HG23 . THR A 1 37  ? -27.618 -15.886 -22.637 1.00 42.88  ? 37  THR A HG23 1 
ATOM   515   N N    . MET A 1 38  ? -24.189 -12.293 -21.880 1.00 39.59  ? 38  MET A N    1 
ATOM   516   C CA   . MET A 1 38  ? -22.868 -11.723 -21.704 1.00 42.66  ? 38  MET A CA   1 
ATOM   517   C C    . MET A 1 38  ? -22.654 -11.445 -20.228 1.00 47.04  ? 38  MET A C    1 
ATOM   518   O O    . MET A 1 38  ? -23.298 -10.562 -19.650 1.00 40.54  ? 38  MET A O    1 
ATOM   519   C CB   . MET A 1 38  ? -22.701 -10.457 -22.526 1.00 41.29  ? 38  MET A CB   1 
ATOM   520   C CG   . MET A 1 38  ? -21.468 -9.703  -22.218 1.00 31.80  ? 38  MET A CG   1 
ATOM   521   S SD   . MET A 1 38  ? -21.267 -8.701  -23.689 1.00 46.53  ? 38  MET A SD   1 
ATOM   522   C CE   . MET A 1 38  ? -20.704 -7.198  -23.002 1.00 46.05  ? 38  MET A CE   1 
ATOM   523   H H    . MET A 1 38  ? -24.799 -11.927 -21.397 1.00 47.46  ? 38  MET A H    1 
ATOM   524   H HA   . MET A 1 38  ? -22.205 -12.364 -22.004 1.00 51.15  ? 38  MET A HA   1 
ATOM   525   H HB2  . MET A 1 38  ? -22.675 -10.696 -23.465 1.00 49.50  ? 38  MET A HB2  1 
ATOM   526   H HB3  . MET A 1 38  ? -23.456 -9.873  -22.356 1.00 49.50  ? 38  MET A HB3  1 
ATOM   527   H HG2  . MET A 1 38  ? -21.593 -9.134  -21.442 1.00 38.12  ? 38  MET A HG2  1 
ATOM   528   H HG3  . MET A 1 38  ? -20.710 -10.301 -22.117 1.00 38.12  ? 38  MET A HG3  1 
ATOM   529   H HE1  . MET A 1 38  ? -19.874 -7.360  -22.526 1.00 55.22  ? 38  MET A HE1  1 
ATOM   530   H HE2  . MET A 1 38  ? -20.556 -6.560  -23.718 1.00 55.22  ? 38  MET A HE2  1 
ATOM   531   H HE3  . MET A 1 38  ? -21.376 -6.859  -22.390 1.00 55.22  ? 38  MET A HE3  1 
ATOM   532   N N    . TRP A 1 39  ? -21.748 -12.199 -19.625 1.00 36.30  ? 39  TRP A N    1 
ATOM   533   C CA   . TRP A 1 39  ? -21.411 -11.991 -18.234 1.00 35.74  ? 39  TRP A CA   1 
ATOM   534   C C    . TRP A 1 39  ? -20.748 -10.637 -18.060 1.00 46.12  ? 39  TRP A C    1 
ATOM   535   O O    . TRP A 1 39  ? -19.676 -10.388 -18.640 1.00 35.06  ? 39  TRP A O    1 
ATOM   536   C CB   . TRP A 1 39  ? -20.465 -13.074 -17.724 1.00 44.33  ? 39  TRP A CB   1 
ATOM   537   C CG   . TRP A 1 39  ? -20.077 -12.734 -16.328 1.00 38.65  ? 39  TRP A CG   1 
ATOM   538   C CD1  . TRP A 1 39  ? -20.903 -12.726 -15.246 1.00 37.23  ? 39  TRP A CD1  1 
ATOM   539   C CD2  . TRP A 1 39  ? -18.796 -12.302 -15.861 1.00 42.60  ? 39  TRP A CD2  1 
ATOM   540   N NE1  . TRP A 1 39  ? -20.219 -12.338 -14.136 1.00 37.81  ? 39  TRP A NE1  1 
ATOM   541   C CE2  . TRP A 1 39  ? -18.925 -12.050 -14.481 1.00 35.02  ? 39  TRP A CE2  1 
ATOM   542   C CE3  . TRP A 1 39  ? -17.555 -12.108 -16.471 1.00 38.45  ? 39  TRP A CE3  1 
ATOM   543   C CZ2  . TRP A 1 39  ? -17.857 -11.638 -13.693 1.00 37.72  ? 39  TRP A CZ2  1 
ATOM   544   C CZ3  . TRP A 1 39  ? -16.495 -11.677 -15.688 1.00 36.49  ? 39  TRP A CZ3  1 
ATOM   545   C CH2  . TRP A 1 39  ? -16.651 -11.445 -14.314 1.00 46.54  ? 39  TRP A CH2  1 
ATOM   546   H H    . TRP A 1 39  ? -21.314 -12.839 -20.003 1.00 43.52  ? 39  TRP A H    1 
ATOM   547   H HA   . TRP A 1 39  ? -22.220 -12.010 -17.698 1.00 42.85  ? 39  TRP A HA   1 
ATOM   548   H HB2  . TRP A 1 39  ? -20.916 -13.933 -17.724 1.00 53.15  ? 39  TRP A HB2  1 
ATOM   549   H HB3  . TRP A 1 39  ? -19.667 -13.102 -18.274 1.00 53.15  ? 39  TRP A HB3  1 
ATOM   550   H HD1  . TRP A 1 39  ? -21.805 -12.954 -15.262 1.00 44.63  ? 39  TRP A HD1  1 
ATOM   551   H HE1  . TRP A 1 39  ? -20.552 -12.263 -13.347 1.00 45.33  ? 39  TRP A HE1  1 
ATOM   552   H HE3  . TRP A 1 39  ? -17.445 -12.251 -17.383 1.00 46.10  ? 39  TRP A HE3  1 
ATOM   553   H HZ2  . TRP A 1 39  ? -17.960 -11.487 -12.782 1.00 45.22  ? 39  TRP A HZ2  1 
ATOM   554   H HZ3  . TRP A 1 39  ? -15.664 -11.540 -16.083 1.00 43.75  ? 39  TRP A HZ3  1 
ATOM   555   H HH2  . TRP A 1 39  ? -15.920 -11.164 -13.813 1.00 55.81  ? 39  TRP A HH2  1 
ATOM   556   N N    . VAL A 1 40  ? -21.355 -9.807  -17.200 1.00 42.41  ? 40  VAL A N    1 
ATOM   557   C CA   . VAL A 1 40  ? -20.927 -8.441  -16.903 1.00 41.90  ? 40  VAL A CA   1 
ATOM   558   C C    . VAL A 1 40  ? -20.668 -8.351  -15.406 1.00 45.89  ? 40  VAL A C    1 
ATOM   559   O O    . VAL A 1 40  ? -21.604 -8.409  -14.600 1.00 49.94  ? 40  VAL A O    1 
ATOM   560   C CB   . VAL A 1 40  ? -21.986 -7.409  -17.324 1.00 46.74  ? 40  VAL A CB   1 
ATOM   561   C CG1  . VAL A 1 40  ? -21.453 -5.983  -17.131 1.00 54.76  ? 40  VAL A CG1  1 
ATOM   562   C CG2  . VAL A 1 40  ? -22.441 -7.644  -18.767 1.00 42.50  ? 40  VAL A CG2  1 
ATOM   563   H H    . VAL A 1 40  ? -22.055 -10.033 -16.755 1.00 50.85  ? 40  VAL A H    1 
ATOM   564   H HA   . VAL A 1 40  ? -20.101 -8.248  -17.373 1.00 50.24  ? 40  VAL A HA   1 
ATOM   565   H HB   . VAL A 1 40  ? -22.762 -7.512  -16.752 1.00 56.05  ? 40  VAL A HB   1 
ATOM   566   H HG11 . VAL A 1 40  ? -22.137 -5.352  -17.402 1.00 65.67  ? 40  VAL A HG11 1 
ATOM   567   H HG12 . VAL A 1 40  ? -21.234 -5.853  -16.195 1.00 65.67  ? 40  VAL A HG12 1 
ATOM   568   H HG13 . VAL A 1 40  ? -20.659 -5.867  -17.676 1.00 65.67  ? 40  VAL A HG13 1 
ATOM   569   H HG21 . VAL A 1 40  ? -23.107 -6.978  -19.000 1.00 50.96  ? 40  VAL A HG21 1 
ATOM   570   H HG22 . VAL A 1 40  ? -21.675 -7.566  -19.356 1.00 50.96  ? 40  VAL A HG22 1 
ATOM   571   H HG23 . VAL A 1 40  ? -22.824 -8.532  -18.836 1.00 50.96  ? 40  VAL A HG23 1 
ATOM   572   N N    . PHE A 1 41  ? -19.413 -8.185  -15.027 1.00 31.63  ? 41  PHE A N    1 
ATOM   573   C CA   . PHE A 1 41  ? -19.093 -7.871  -13.645 1.00 49.86  ? 41  PHE A CA   1 
ATOM   574   C C    . PHE A 1 41  ? -19.757 -6.552  -13.253 1.00 53.93  ? 41  PHE A C    1 
ATOM   575   O O    . PHE A 1 41  ? -19.564 -5.529  -13.920 1.00 55.47  ? 41  PHE A O    1 
ATOM   576   C CB   . PHE A 1 41  ? -17.586 -7.799  -13.506 1.00 50.15  ? 41  PHE A CB   1 
ATOM   577   C CG   . PHE A 1 41  ? -17.114 -7.415  -12.152 1.00 54.16  ? 41  PHE A CG   1 
ATOM   578   C CD1  . PHE A 1 41  ? -16.916 -8.379  -11.174 1.00 53.91  ? 41  PHE A CD1  1 
ATOM   579   C CD2  . PHE A 1 41  ? -16.821 -6.097  -11.866 1.00 54.28  ? 41  PHE A CD2  1 
ATOM   580   C CE1  . PHE A 1 41  ? -16.458 -8.025  -9.916  1.00 54.81  ? 41  PHE A CE1  1 
ATOM   581   C CE2  . PHE A 1 41  ? -16.359 -5.734  -10.615 1.00 63.31  ? 41  PHE A CE2  1 
ATOM   582   C CZ   . PHE A 1 41  ? -16.179 -6.699  -9.637  1.00 65.39  ? 41  PHE A CZ   1 
ATOM   583   H H    . PHE A 1 41  ? -18.731 -8.247  -15.547 1.00 37.92  ? 41  PHE A H    1 
ATOM   584   H HA   . PHE A 1 41  ? -19.426 -8.573  -13.064 1.00 59.79  ? 41  PHE A HA   1 
ATOM   585   H HB2  . PHE A 1 41  ? -17.212 -8.671  -13.712 1.00 60.14  ? 41  PHE A HB2  1 
ATOM   586   H HB3  . PHE A 1 41  ? -17.247 -7.142  -14.133 1.00 60.14  ? 41  PHE A HB3  1 
ATOM   587   H HD1  . PHE A 1 41  ? -17.105 -9.270  -11.361 1.00 64.64  ? 41  PHE A HD1  1 
ATOM   588   H HD2  . PHE A 1 41  ? -16.942 -5.446  -12.519 1.00 65.10  ? 41  PHE A HD2  1 
ATOM   589   H HE1  . PHE A 1 41  ? -16.337 -8.676  -9.262  1.00 65.74  ? 41  PHE A HE1  1 
ATOM   590   H HE2  . PHE A 1 41  ? -16.174 -4.842  -10.429 1.00 75.93  ? 41  PHE A HE2  1 
ATOM   591   H HZ   . PHE A 1 41  ? -15.871 -6.455  -8.794  1.00 78.43  ? 41  PHE A HZ   1 
ATOM   592   N N    . GLU A 1 42  ? -20.548 -6.575  -12.178 1.00 53.84  ? 42  GLU A N    1 
ATOM   593   C CA   . GLU A 1 42  ? -21.397 -5.435  -11.856 1.00 50.31  ? 42  GLU A CA   1 
ATOM   594   C C    . GLU A 1 42  ? -20.579 -4.228  -11.409 1.00 58.65  ? 42  GLU A C    1 
ATOM   595   O O    . GLU A 1 42  ? -19.574 -4.358  -10.698 1.00 46.25  ? 42  GLU A O    1 
ATOM   596   C CB   . GLU A 1 42  ? -22.403 -5.809  -10.772 1.00 51.95  ? 42  GLU A CB   1 
ATOM   597   C CG   . GLU A 1 42  ? -23.542 -4.807  -10.647 1.00 58.84  ? 42  GLU A CG   1 
ATOM   598   C CD   . GLU A 1 42  ? -24.380 -4.718  -11.912 1.00 60.07  ? 42  GLU A CD   1 
ATOM   599   O OE1  . GLU A 1 42  ? -25.321 -5.528  -12.073 1.00 54.92  ? 42  GLU A OE1  1 
ATOM   600   O OE2  . GLU A 1 42  ? -24.086 -3.837  -12.752 1.00 59.61  ? 42  GLU A OE2  1 
ATOM   601   H H    . GLU A 1 42  ? -20.609 -7.232  -11.626 1.00 64.56  ? 42  GLU A H    1 
ATOM   602   H HA   . GLU A 1 42  ? -21.894 -5.180  -12.649 1.00 60.33  ? 42  GLU A HA   1 
ATOM   603   H HB2  . GLU A 1 42  ? -22.788 -6.674  -10.983 1.00 62.29  ? 42  GLU A HB2  1 
ATOM   604   H HB3  . GLU A 1 42  ? -21.945 -5.850  -9.918  1.00 62.29  ? 42  GLU A HB3  1 
ATOM   605   H HG2  . GLU A 1 42  ? -24.123 -5.077  -9.919  1.00 70.57  ? 42  GLU A HG2  1 
ATOM   606   H HG3  . GLU A 1 42  ? -23.172 -3.928  -10.468 1.00 70.57  ? 42  GLU A HG3  1 
ATOM   607   N N    . GLU A 1 43  ? -21.000 -3.048  -11.832 1.00 68.19  ? 43  GLU A N    1 
ATOM   608   C CA   . GLU A 1 43  ? -20.343 -1.764  -11.496 1.00 62.02  ? 43  GLU A CA   1 
ATOM   609   C C    . GLU A 1 43  ? -21.423 -0.705  -11.323 1.00 61.27  ? 43  GLU A C    1 
ATOM   610   O O    . GLU A 1 43  ? -22.500 -0.894  -11.827 1.00 67.06  ? 43  GLU A O    1 
ATOM   611   C CB   . GLU A 1 43  ? -19.385 -1.348  -12.610 1.00 60.97  ? 43  GLU A CB   1 
ATOM   612   C CG   . GLU A 1 43  ? -18.042 -2.049  -12.582 1.00 60.09  ? 43  GLU A CG   1 
ATOM   613   C CD   . GLU A 1 43  ? -17.199 -1.816  -13.823 1.00 59.72  ? 43  GLU A CD   1 
ATOM   614   O OE1  . GLU A 1 43  ? -16.944 -2.768  -14.562 1.00 61.54  ? 43  GLU A OE1  1 
ATOM   615   O OE2  . GLU A 1 43  ? -16.828 -0.683  -14.052 1.00 57.20  ? 43  GLU A OE2  1 
ATOM   616   H H    . GLU A 1 43  ? -21.733 -2.955  -12.365 1.00 81.78  ? 43  GLU A H    1 
ATOM   617   H HA   . GLU A 1 43  ? -19.845 -1.867  -10.652 1.00 74.38  ? 43  GLU A HA   1 
ATOM   618   H HB2  . GLU A 1 43  ? -19.816 -1.527  -13.472 1.00 73.12  ? 43  GLU A HB2  1 
ATOM   619   H HB3  . GLU A 1 43  ? -19.237 -0.381  -12.546 1.00 73.12  ? 43  GLU A HB3  1 
ATOM   620   H HG2  . GLU A 1 43  ? -17.536 -1.742  -11.800 1.00 72.06  ? 43  GLU A HG2  1 
ATOM   621   H HG3  . GLU A 1 43  ? -18.187 -3.014  -12.481 1.00 72.06  ? 43  GLU A HG3  1 
ATOM   622   N N    . ASP A 1 44  ? -21.125 0.371   -10.616 1.00 68.29  ? 44  ASP A N    1 
ATOM   623   C CA   . ASP A 1 44  ? -22.036 1.512   -10.436 1.00 72.63  ? 44  ASP A CA   1 
ATOM   624   C C    . ASP A 1 44  ? -21.598 2.636   -11.375 1.00 57.85  ? 44  ASP A C    1 
ATOM   625   O O    . ASP A 1 44  ? -20.791 3.491   -11.023 1.00 58.48  ? 44  ASP A O    1 
ATOM   626   C CB   . ASP A 1 44  ? -22.067 1.981   -8.983  1.00 68.45  ? 44  ASP A CB   1 
ATOM   627   H H    . ASP A 1 44  ? -20.361 0.472   -10.234 1.00 81.91  ? 44  ASP A H    1 
ATOM   628   H HA   . ASP A 1 44  ? -22.934 1.244   -10.685 1.00 87.11  ? 44  ASP A HA   1 
ATOM   629   N N    . ILE A 1 45  ? -22.148 2.634   -12.581 1.00 58.49  ? 45  ILE A N    1 
ATOM   630   C CA   . ILE A 1 45  ? -21.861 3.680   -13.542 1.00 56.83  ? 45  ILE A CA   1 
ATOM   631   C C    . ILE A 1 45  ? -22.871 4.809   -13.370 1.00 71.23  ? 45  ILE A C    1 
ATOM   632   O O    . ILE A 1 45  ? -23.998 4.579   -12.919 1.00 76.42  ? 45  ILE A O    1 
ATOM   633   C CB   . ILE A 1 45  ? -21.885 3.128   -14.968 1.00 61.08  ? 45  ILE A CB   1 
ATOM   634   H H    . ILE A 1 45  ? -22.693 2.033   -12.866 1.00 70.14  ? 45  ILE A H    1 
ATOM   635   H HA   . ILE A 1 45  ? -20.976 4.037   -13.371 1.00 68.16  ? 45  ILE A HA   1 
ATOM   636   N N    . LYS A 1 48  ? -25.913 4.319   -11.824 1.00 65.01  ? 48  LYS A N    1 
ATOM   637   C CA   . LYS A 1 48  ? -26.838 3.208   -12.066 1.00 67.58  ? 48  LYS A CA   1 
ATOM   638   C C    . LYS A 1 48  ? -26.077 1.882   -12.039 1.00 67.20  ? 48  LYS A C    1 
ATOM   639   O O    . LYS A 1 48  ? -24.864 1.868   -11.812 1.00 65.60  ? 48  LYS A O    1 
ATOM   640   C CB   . LYS A 1 48  ? -27.568 3.383   -13.407 1.00 49.11  ? 48  LYS A CB   1 
ATOM   641   H HA   . LYS A 1 48  ? -27.503 3.189   -11.360 1.00 81.05  ? 48  LYS A HA   1 
ATOM   642   N N    . LYS A 1 49  ? -26.802 0.779   -12.240 1.00 69.28  ? 49  LYS A N    1 
ATOM   643   C CA   . LYS A 1 49  ? -26.204 -0.551  -12.346 1.00 69.03  ? 49  LYS A CA   1 
ATOM   644   C C    . LYS A 1 49  ? -25.703 -0.777  -13.774 1.00 63.86  ? 49  LYS A C    1 
ATOM   645   O O    . LYS A 1 49  ? -26.481 -0.689  -14.733 1.00 52.53  ? 49  LYS A O    1 
ATOM   646   C CB   . LYS A 1 49  ? -27.224 -1.626  -11.970 1.00 63.22  ? 49  LYS A CB   1 
ATOM   647   C CG   . LYS A 1 49  ? -26.947 -2.366  -10.673 1.00 62.79  ? 49  LYS A CG   1 
ATOM   648   C CD   . LYS A 1 49  ? -28.204 -3.087  -10.176 1.00 69.49  ? 49  LYS A CD   1 
ATOM   649   C CE   . LYS A 1 49  ? -27.944 -3.907  -8.911  1.00 77.01  ? 49  LYS A CE   1 
ATOM   650   N NZ   . LYS A 1 49  ? -26.879 -3.313  -8.049  1.00 77.28  ? 49  LYS A NZ   1 
ATOM   651   H H    . LYS A 1 49  ? -27.658 0.777   -12.319 1.00 83.10  ? 49  LYS A H    1 
ATOM   652   H HA   . LYS A 1 49  ? -25.449 -0.617  -11.741 1.00 82.79  ? 49  LYS A HA   1 
ATOM   653   H HB2  . LYS A 1 49  ? -28.094 -1.206  -11.885 1.00 75.82  ? 49  LYS A HB2  1 
ATOM   654   H HB3  . LYS A 1 49  ? -27.251 -2.285  -12.681 1.00 75.82  ? 49  LYS A HB3  1 
ATOM   655   H HG2  . LYS A 1 49  ? -26.254 -3.028  -10.821 1.00 75.31  ? 49  LYS A HG2  1 
ATOM   656   H HG3  . LYS A 1 49  ? -26.669 -1.732  -9.993  1.00 75.31  ? 49  LYS A HG3  1 
ATOM   657   H HD2  . LYS A 1 49  ? -28.887 -2.429  -9.973  1.00 83.34  ? 49  LYS A HD2  1 
ATOM   658   H HD3  . LYS A 1 49  ? -28.518 -3.690  -10.867 1.00 83.34  ? 49  LYS A HD3  1 
ATOM   659   H HE2  . LYS A 1 49  ? -28.761 -3.952  -8.390  1.00 92.37  ? 49  LYS A HE2  1 
ATOM   660   H HE3  . LYS A 1 49  ? -27.662 -4.799  -9.165  1.00 92.37  ? 49  LYS A HE3  1 
ATOM   661   H HZ1  . LYS A 1 49  ? -26.113 -3.266  -8.500  1.00 92.70  ? 49  LYS A HZ1  1 
ATOM   662   H HZ2  . LYS A 1 49  ? -27.115 -2.494  -7.794  1.00 92.70  ? 49  LYS A HZ2  1 
ATOM   663   H HZ3  . LYS A 1 49  ? -26.757 -3.818  -7.325  1.00 92.70  ? 49  LYS A HZ3  1 
ATOM   664   N N    . LEU A 1 50  ? -24.410 -1.087  -13.915 1.00 57.45  ? 50  LEU A N    1 
ATOM   665   C CA   . LEU A 1 50  ? -23.837 -1.282  -15.244 1.00 67.69  ? 50  LEU A CA   1 
ATOM   666   C C    . LEU A 1 50  ? -24.675 -2.252  -16.075 1.00 58.21  ? 50  LEU A C    1 
ATOM   667   O O    . LEU A 1 50  ? -25.015 -1.967  -17.228 1.00 43.66  ? 50  LEU A O    1 
ATOM   668   C CB   . LEU A 1 50  ? -22.394 -1.781  -15.130 1.00 78.37  ? 50  LEU A CB   1 
ATOM   669   H H    . LEU A 1 50  ? -23.854 -1.189  -13.267 1.00 68.90  ? 50  LEU A H    1 
ATOM   670   H HA   . LEU A 1 50  ? -23.822 -0.430  -15.707 1.00 81.19  ? 50  LEU A HA   1 
ATOM   671   N N    . THR A 1 51  ? -25.017 -3.410  -15.502 1.00 53.92  ? 51  THR A N    1 
ATOM   672   C CA   . THR A 1 51  ? -25.858 -4.369  -16.215 1.00 52.29  ? 51  THR A CA   1 
ATOM   673   C C    . THR A 1 51  ? -27.160 -3.718  -16.668 1.00 56.22  ? 51  THR A C    1 
ATOM   674   O O    . THR A 1 51  ? -27.618 -3.933  -17.808 1.00 35.85  ? 51  THR A O    1 
ATOM   675   C CB   . THR A 1 51  ? -26.129 -5.587  -15.324 1.00 54.47  ? 51  THR A CB   1 
ATOM   676   O OG1  . THR A 1 51  ? -26.693 -5.182  -14.075 1.00 50.63  ? 51  THR A OG1  1 
ATOM   677   C CG2  . THR A 1 51  ? -24.831 -6.313  -15.032 1.00 54.80  ? 51  THR A CG2  1 
ATOM   678   H H    . THR A 1 51  ? -24.779 -3.659  -14.714 1.00 64.66  ? 51  THR A H    1 
ATOM   679   H HA   . THR A 1 51  ? -25.387 -4.675  -17.005 1.00 62.71  ? 51  THR A HA   1 
ATOM   680   H HB   . THR A 1 51  ? -26.734 -6.197  -15.775 1.00 65.32  ? 51  THR A HB   1 
ATOM   681   H HG1  . THR A 1 51  ? -26.164 -4.669  -13.674 1.00 60.71  ? 51  THR A HG1  1 
ATOM   682   H HG21 . THR A 1 51  ? -25.001 -7.084  -14.469 1.00 65.72  ? 51  THR A HG21 1 
ATOM   683   H HG22 . THR A 1 51  ? -24.425 -6.612  -15.861 1.00 65.72  ? 51  THR A HG22 1 
ATOM   684   H HG23 . THR A 1 51  ? -24.214 -5.719  -14.576 1.00 65.72  ? 51  THR A HG23 1 
ATOM   685   N N    . GLU A 1 52  ? -27.746 -2.889  -15.786 1.00 59.54  ? 52  GLU A N    1 
ATOM   686   C CA   . GLU A 1 52  ? -28.945 -2.122  -16.117 1.00 59.12  ? 52  GLU A CA   1 
ATOM   687   C C    . GLU A 1 52  ? -28.689 -1.198  -17.295 1.00 52.60  ? 52  GLU A C    1 
ATOM   688   O O    . GLU A 1 52  ? -29.425 -1.222  -18.287 1.00 46.35  ? 52  GLU A O    1 
ATOM   689   C CB   . GLU A 1 52  ? -29.397 -1.310  -14.901 1.00 53.92  ? 52  GLU A CB   1 
ATOM   690   C CG   . GLU A 1 52  ? -30.738 -1.699  -14.354 1.00 63.40  ? 52  GLU A CG   1 
ATOM   691   C CD   . GLU A 1 52  ? -30.851 -1.402  -12.876 1.00 76.37  ? 52  GLU A CD   1 
ATOM   692   O OE1  . GLU A 1 52  ? -30.349 -0.340  -12.422 1.00 68.23  ? 52  GLU A OE1  1 
ATOM   693   O OE2  . GLU A 1 52  ? -31.426 -2.256  -12.169 1.00 77.53  ? 52  GLU A OE2  1 
ATOM   694   H H    . GLU A 1 52  ? -27.460 -2.756  -14.986 1.00 71.40  ? 52  GLU A H    1 
ATOM   695   H HA   . GLU A 1 52  ? -29.659 -2.733  -16.358 1.00 70.90  ? 52  GLU A HA   1 
ATOM   696   H HB2  . GLU A 1 52  ? -28.746 -1.425  -14.192 1.00 64.66  ? 52  GLU A HB2  1 
ATOM   697   H HB3  . GLU A 1 52  ? -29.443 -0.374  -15.153 1.00 64.66  ? 52  GLU A HB3  1 
ATOM   698   H HG2  . GLU A 1 52  ? -31.429 -1.200  -14.817 1.00 76.04  ? 52  GLU A HG2  1 
ATOM   699   H HG3  . GLU A 1 52  ? -30.870 -2.652  -14.483 1.00 76.04  ? 52  GLU A HG3  1 
ATOM   700   N N    . ILE A 1 53  ? -27.644 -0.370  -17.202 1.00 52.21  ? 53  ILE A N    1 
ATOM   701   C CA   . ILE A 1 53  ? -27.320 0.531   -18.309 1.00 58.30  ? 53  ILE A CA   1 
ATOM   702   C C    . ILE A 1 53  ? -27.286 -0.246  -19.615 1.00 48.95  ? 53  ILE A C    1 
ATOM   703   O O    . ILE A 1 53  ? -27.981 0.087   -20.580 1.00 48.87  ? 53  ILE A O    1 
ATOM   704   C CB   . ILE A 1 53  ? -25.985 1.252   -18.059 1.00 56.41  ? 53  ILE A CB   1 
ATOM   705   C CG1  . ILE A 1 53  ? -25.991 1.997   -16.714 1.00 63.13  ? 53  ILE A CG1  1 
ATOM   706   C CG2  . ILE A 1 53  ? -25.710 2.221   -19.199 1.00 57.44  ? 53  ILE A CG2  1 
ATOM   707   C CD1  . ILE A 1 53  ? -24.604 2.516   -16.301 1.00 63.53  ? 53  ILE A CD1  1 
ATOM   708   H H    . ILE A 1 53  ? -27.118 -0.312  -16.524 1.00 62.61  ? 53  ILE A H    1 
ATOM   709   H HA   . ILE A 1 53  ? -28.014 1.205   -18.380 1.00 69.92  ? 53  ILE A HA   1 
ATOM   710   H HB   . ILE A 1 53  ? -25.276 0.589   -18.041 1.00 67.65  ? 53  ILE A HB   1 
ATOM   711   H HG12 . ILE A 1 53  ? -26.587 2.759   -16.780 1.00 75.72  ? 53  ILE A HG12 1 
ATOM   712   H HG13 . ILE A 1 53  ? -26.302 1.393   -16.021 1.00 75.72  ? 53  ILE A HG13 1 
ATOM   713   H HG21 . ILE A 1 53  ? -24.867 2.671   -19.035 1.00 68.89  ? 53  ILE A HG21 1 
ATOM   714   H HG22 . ILE A 1 53  ? -25.664 1.725   -20.031 1.00 68.89  ? 53  ILE A HG22 1 
ATOM   715   H HG23 . ILE A 1 53  ? -26.430 2.870   -19.241 1.00 68.89  ? 53  ILE A HG23 1 
ATOM   716   H HD11 . ILE A 1 53  ? -24.679 2.974   -15.449 1.00 76.19  ? 53  ILE A HD11 1 
ATOM   717   H HD12 . ILE A 1 53  ? -23.997 1.764   -16.221 1.00 76.19  ? 53  ILE A HD12 1 
ATOM   718   H HD13 . ILE A 1 53  ? -24.282 3.131   -16.979 1.00 76.19  ? 53  ILE A HD13 1 
ATOM   719   N N    . ILE A 1 54  ? -26.502 -1.323  -19.654 1.00 54.16  ? 54  ILE A N    1 
ATOM   720   C CA   . ILE A 1 54  ? -26.372 -2.088  -20.893 1.00 52.21  ? 54  ILE A CA   1 
ATOM   721   C C    . ILE A 1 54  ? -27.739 -2.533  -21.373 1.00 43.85  ? 54  ILE A C    1 
ATOM   722   O O    . ILE A 1 54  ? -28.146 -2.235  -22.499 1.00 51.46  ? 54  ILE A O    1 
ATOM   723   C CB   . ILE A 1 54  ? -25.422 -3.284  -20.697 1.00 55.04  ? 54  ILE A CB   1 
ATOM   724   C CG1  . ILE A 1 54  ? -23.975 -2.787  -20.534 1.00 52.80  ? 54  ILE A CG1  1 
ATOM   725   C CG2  . ILE A 1 54  ? -25.559 -4.293  -21.871 1.00 42.31  ? 54  ILE A CG2  1 
ATOM   726   C CD1  . ILE A 1 54  ? -23.062 -3.715  -19.742 1.00 50.98  ? 54  ILE A CD1  1 
ATOM   727   H H    . ILE A 1 54  ? -26.045 -1.627  -18.992 1.00 64.95  ? 54  ILE A H    1 
ATOM   728   H HA   . ILE A 1 54  ? -25.990 -1.514  -21.576 1.00 62.62  ? 54  ILE A HA   1 
ATOM   729   H HB   . ILE A 1 54  ? -25.677 -3.739  -19.879 1.00 66.01  ? 54  ILE A HB   1 
ATOM   730   H HG12 . ILE A 1 54  ? -23.585 -2.676  -21.416 1.00 63.31  ? 54  ILE A HG12 1 
ATOM   731   H HG13 . ILE A 1 54  ? -23.992 -1.932  -20.076 1.00 63.31  ? 54  ILE A HG13 1 
ATOM   732   H HG21 . ILE A 1 54  ? -24.952 -5.035  -21.723 1.00 50.73  ? 54  ILE A HG21 1 
ATOM   733   H HG22 . ILE A 1 54  ? -26.474 -4.616  -21.905 1.00 50.73  ? 54  ILE A HG22 1 
ATOM   734   H HG23 . ILE A 1 54  ? -25.336 -3.844  -22.701 1.00 50.73  ? 54  ILE A HG23 1 
ATOM   735   H HD11 . ILE A 1 54  ? -22.177 -3.321  -19.693 1.00 61.13  ? 54  ILE A HD11 1 
ATOM   736   H HD12 . ILE A 1 54  ? -23.424 -3.828  -18.849 1.00 61.13  ? 54  ILE A HD12 1 
ATOM   737   H HD13 . ILE A 1 54  ? -23.017 -4.573  -20.192 1.00 61.13  ? 54  ILE A HD13 1 
ATOM   738   N N    . ASN A 1 55  ? -28.482 -3.238  -20.510 1.00 52.15  ? 55  ASN A N    1 
ATOM   739   C CA   . ASN A 1 55  ? -29.737 -3.853  -20.940 1.00 48.49  ? 55  ASN A CA   1 
ATOM   740   C C    . ASN A 1 55  ? -30.782 -2.809  -21.325 1.00 56.62  ? 55  ASN A C    1 
ATOM   741   O O    . ASN A 1 55  ? -31.617 -3.063  -22.210 1.00 43.85  ? 55  ASN A O    1 
ATOM   742   C CB   . ASN A 1 55  ? -30.262 -4.777  -19.839 1.00 47.60  ? 55  ASN A CB   1 
ATOM   743   C CG   . ASN A 1 55  ? -29.427 -6.048  -19.694 1.00 50.05  ? 55  ASN A CG   1 
ATOM   744   O OD1  . ASN A 1 55  ? -29.171 -6.770  -20.669 1.00 50.86  ? 55  ASN A OD1  1 
ATOM   745   N ND2  . ASN A 1 55  ? -29.008 -6.328  -18.473 1.00 52.64  ? 55  ASN A ND2  1 
ATOM   746   H H    . ASN A 1 55  ? -28.283 -3.373  -19.684 1.00 62.54  ? 55  ASN A H    1 
ATOM   747   H HA   . ASN A 1 55  ? -29.563 -4.397  -21.724 1.00 58.15  ? 55  ASN A HA   1 
ATOM   748   H HB2  . ASN A 1 55  ? -30.241 -4.304  -18.992 1.00 57.08  ? 55  ASN A HB2  1 
ATOM   749   H HB3  . ASN A 1 55  ? -31.172 -5.037  -20.052 1.00 57.08  ? 55  ASN A HB3  1 
ATOM   750   H HD21 . ASN A 1 55  ? -28.534 -7.031  -18.332 1.00 63.13  ? 55  ASN A HD21 1 
ATOM   751   H HD22 . ASN A 1 55  ? -29.206 -5.804  -17.820 1.00 63.13  ? 55  ASN A HD22 1 
ATOM   752   N N    . THR A 1 56  ? -30.750 -1.626  -20.696 1.00 57.35  ? 56  THR A N    1 
ATOM   753   C CA   . THR A 1 56  ? -31.711 -0.582  -21.069 1.00 60.38  ? 56  THR A CA   1 
ATOM   754   C C    . THR A 1 56  ? -31.227 0.218   -22.275 1.00 63.72  ? 56  THR A C    1 
ATOM   755   O O    . THR A 1 56  ? -31.960 0.363   -23.257 1.00 63.29  ? 56  THR A O    1 
ATOM   756   C CB   . THR A 1 56  ? -31.989 0.366   -19.895 1.00 68.00  ? 56  THR A CB   1 
ATOM   757   O OG1  . THR A 1 56  ? -30.854 1.215   -19.658 1.00 66.66  ? 56  THR A OG1  1 
ATOM   758   C CG2  . THR A 1 56  ? -32.322 -0.411  -18.629 1.00 74.19  ? 56  THR A CG2  1 
ATOM   759   H H    . THR A 1 56  ? -30.201 -1.410  -20.071 1.00 68.77  ? 56  THR A H    1 
ATOM   760   H HA   . THR A 1 56  ? -32.550 -1.004  -21.313 1.00 72.41  ? 56  THR A HA   1 
ATOM   761   H HB   . THR A 1 56  ? -32.755 0.920   -20.114 1.00 81.56  ? 56  THR A HB   1 
ATOM   762   H HG1  . THR A 1 56  ? -31.012 1.732   -19.015 1.00 79.95  ? 56  THR A HG1  1 
ATOM   763   H HG21 . THR A 1 56  ? -32.494 0.203   -17.898 1.00 88.99  ? 56  THR A HG21 1 
ATOM   764   H HG22 . THR A 1 56  ? -33.109 -0.958  -18.773 1.00 88.99  ? 56  THR A HG22 1 
ATOM   765   H HG23 . THR A 1 56  ? -31.578 -0.986  -18.388 1.00 88.99  ? 56  THR A HG23 1 
ATOM   766   N N    . GLN A 1 57  ? -30.033 0.797   -22.176 1.00 64.53  ? 57  GLN A N    1 
ATOM   767   C CA   . GLN A 1 57  ? -29.456 1.613   -23.239 1.00 58.36  ? 57  GLN A CA   1 
ATOM   768   C C    . GLN A 1 57  ? -28.617 0.896   -24.315 1.00 57.10  ? 57  GLN A C    1 
ATOM   769   O O    . GLN A 1 57  ? -28.270 1.510   -25.270 1.00 55.35  ? 57  GLN A O    1 
ATOM   770   C CB   . GLN A 1 57  ? -28.666 2.780   -22.637 1.00 60.83  ? 57  GLN A CB   1 
ATOM   771   C CG   . GLN A 1 57  ? -29.269 3.378   -21.372 1.00 71.41  ? 57  GLN A CG   1 
ATOM   772   C CD   . GLN A 1 57  ? -28.462 4.527   -20.776 1.00 90.31  ? 57  GLN A CD   1 
ATOM   773   O OE1  . GLN A 1 57  ? -27.887 5.336   -21.490 1.00 84.52  ? 57  GLN A OE1  1 
ATOM   774   N NE2  . GLN A 1 57  ? -28.436 4.610   -19.456 1.00 96.96  ? 57  GLN A NE2  1 
ATOM   775   H H    . GLN A 1 57  ? -29.526 0.730   -21.484 1.00 77.39  ? 57  GLN A H    1 
ATOM   776   H HA   . GLN A 1 57  ? -30.207 2.019   -23.720 1.00 69.99  ? 57  GLN A HA   1 
ATOM   777   H HB2  . GLN A 1 57  ? -27.775 2.468   -22.417 1.00 72.96  ? 57  GLN A HB2  1 
ATOM   778   H HB3  . GLN A 1 57  ? -28.609 3.488   -23.298 1.00 72.96  ? 57  GLN A HB3  1 
ATOM   779   H HG2  . GLN A 1 57  ? -30.155 3.716   -21.579 1.00 85.64  ? 57  GLN A HG2  1 
ATOM   780   H HG3  . GLN A 1 57  ? -29.334 2.682   -20.699 1.00 85.64  ? 57  GLN A HG3  1 
ATOM   781   H HE21 . GLN A 1 57  ? -28.592 5.362   -19.069 1.00 116.31 ? 57  GLN A HE21 1 
ATOM   782   H HE22 . GLN A 1 57  ? -28.262 3.912   -18.984 1.00 116.31 ? 57  GLN A HE22 1 
ATOM   783   N N    . HIS A 1 58  ? -28.300 -0.391  -24.154 1.00 61.81  ? 58  HIS A N    1 
ATOM   784   C CA   . HIS A 1 58  ? -27.544 -1.198  -25.139 1.00 60.69  ? 58  HIS A CA   1 
ATOM   785   C C    . HIS A 1 58  ? -26.259 -0.517  -25.610 1.00 54.66  ? 58  HIS A C    1 
ATOM   786   O O    . HIS A 1 58  ? -25.957 -0.459  -26.807 1.00 44.18  ? 58  HIS A O    1 
ATOM   787   C CB   . HIS A 1 58  ? -28.423 -1.563  -26.332 1.00 50.48  ? 58  HIS A CB   1 
ATOM   788   C CG   . HIS A 1 58  ? -29.679 -2.252  -25.934 1.00 58.68  ? 58  HIS A CG   1 
ATOM   789   N ND1  . HIS A 1 58  ? -29.684 -3.492  -25.331 1.00 60.47  ? 58  HIS A ND1  1 
ATOM   790   C CD2  . HIS A 1 58  ? -30.972 -1.858  -26.006 1.00 63.16  ? 58  HIS A CD2  1 
ATOM   791   C CE1  . HIS A 1 58  ? -30.930 -3.844  -25.072 1.00 66.56  ? 58  HIS A CE1  1 
ATOM   792   N NE2  . HIS A 1 58  ? -31.731 -2.873  -25.476 1.00 71.84  ? 58  HIS A NE2  1 
ATOM   793   H H    . HIS A 1 58  ? -28.530 -0.843  -23.459 1.00 74.13  ? 58  HIS A H    1 
ATOM   794   H HA   . HIS A 1 58  ? -27.285 -2.029  -24.710 1.00 72.79  ? 58  HIS A HA   1 
ATOM   795   H HB2  . HIS A 1 58  ? -28.664 -0.752  -26.806 1.00 60.53  ? 58  HIS A HB2  1 
ATOM   796   H HB3  . HIS A 1 58  ? -27.929 -2.157  -26.918 1.00 60.53  ? 58  HIS A HB3  1 
ATOM   797   H HD2  . HIS A 1 58  ? -31.288 -1.061  -26.365 1.00 75.75  ? 58  HIS A HD2  1 
ATOM   798   H HE1  . HIS A 1 58  ? -31.199 -4.641  -24.676 1.00 79.83  ? 58  HIS A HE1  1 
ATOM   799   H HE2  . HIS A 1 58  ? -32.589 -2.873  -25.411 1.00 86.17  ? 58  HIS A HE2  1 
ATOM   800   N N    . GLU A 1 59  ? -25.480 -0.044  -24.642 1.00 40.71  ? 59  GLU A N    1 
ATOM   801   C CA   . GLU A 1 59  ? -24.183 0.561   -24.896 1.00 53.00  ? 59  GLU A CA   1 
ATOM   802   C C    . GLU A 1 59  ? -23.339 0.279   -23.670 1.00 52.75  ? 59  GLU A C    1 
ATOM   803   O O    . GLU A 1 59  ? -23.796 0.505   -22.547 1.00 54.13  ? 59  GLU A O    1 
ATOM   804   C CB   . GLU A 1 59  ? -24.288 2.072   -25.142 1.00 46.06  ? 59  GLU A CB   1 
ATOM   805   H H    . GLU A 1 59  ? -25.690 -0.063  -23.809 1.00 48.81  ? 59  GLU A H    1 
ATOM   806   H HA   . GLU A 1 59  ? -23.768 0.143   -25.667 1.00 63.55  ? 59  GLU A HA   1 
ATOM   807   N N    . ASN A 1 60  ? -22.137 -0.249  -23.869 1.00 49.26  ? 60  ASN A N    1 
ATOM   808   C CA   . ASN A 1 60  ? -21.230 -0.421  -22.746 1.00 44.69  ? 60  ASN A CA   1 
ATOM   809   C C    . ASN A 1 60  ? -20.401 0.853   -22.679 1.00 62.39  ? 60  ASN A C    1 
ATOM   810   O O    . ASN A 1 60  ? -19.233 0.916   -23.079 1.00 61.91  ? 60  ASN A O    1 
ATOM   811   C CB   . ASN A 1 60  ? -20.390 -1.680  -22.885 1.00 53.11  ? 60  ASN A CB   1 
ATOM   812   C CG   . ASN A 1 60  ? -19.785 -2.108  -21.561 1.00 54.03  ? 60  ASN A CG   1 
ATOM   813   O OD1  . ASN A 1 60  ? -19.790 -1.346  -20.598 1.00 59.66  ? 60  ASN A OD1  1 
ATOM   814   N ND2  . ASN A 1 60  ? -19.253 -3.323  -21.508 1.00 55.63  ? 60  ASN A ND2  1 
ATOM   815   H H    . ASN A 1 60  ? -21.828 -0.510  -24.628 1.00 59.07  ? 60  ASN A H    1 
ATOM   816   H HA   . ASN A 1 60  ? -21.745 -0.490  -21.927 1.00 53.59  ? 60  ASN A HA   1 
ATOM   817   H HB2  . ASN A 1 60  ? -20.950 -2.402  -23.209 1.00 63.69  ? 60  ASN A HB2  1 
ATOM   818   H HB3  . ASN A 1 60  ? -19.665 -1.512  -23.508 1.00 63.69  ? 60  ASN A HB3  1 
ATOM   819   H HD21 . ASN A 1 60  ? -18.898 -3.606  -20.777 1.00 66.72  ? 60  ASN A HD21 1 
ATOM   820   H HD22 . ASN A 1 60  ? -19.266 -3.829  -22.203 1.00 66.72  ? 60  ASN A HD22 1 
ATOM   821   N N    . VAL A 1 61  ? -21.040 1.897   -22.225 1.00 62.96  ? 61  VAL A N    1 
ATOM   822   C CA   . VAL A 1 61  ? -20.440 3.191   -22.196 1.00 67.01  ? 61  VAL A CA   1 
ATOM   823   C C    . VAL A 1 61  ? -19.035 3.218   -21.643 1.00 68.32  ? 61  VAL A C    1 
ATOM   824   O O    . VAL A 1 61  ? -18.204 3.961   -22.095 1.00 68.91  ? 61  VAL A O    1 
ATOM   825   C CB   . VAL A 1 61  ? -21.307 4.144   -21.370 1.00 30.00  ? 61  VAL A CB   1 
ATOM   826   H H    . VAL A 1 61  ? -21.845 1.878   -21.921 1.00 75.51  ? 61  VAL A H    1 
ATOM   827   H HA   . VAL A 1 61  ? -20.404 3.538   -23.112 1.00 80.38  ? 61  VAL A HA   1 
ATOM   828   N N    . LYS A 1 62  ? -18.743 2.391   -20.681 1.00 54.46  ? 62  LYS A N    1 
ATOM   829   C CA   . LYS A 1 62  ? -17.415 2.470   -20.087 1.00 49.35  ? 62  LYS A CA   1 
ATOM   830   C C    . LYS A 1 62  ? -16.337 1.756   -20.906 1.00 60.82  ? 62  LYS A C    1 
ATOM   831   O O    . LYS A 1 62  ? -15.171 2.166   -20.864 1.00 57.47  ? 62  LYS A O    1 
ATOM   832   C CB   . LYS A 1 62  ? -17.443 1.888   -18.675 1.00 56.51  ? 62  LYS A CB   1 
ATOM   833   C CG   . LYS A 1 62  ? -16.189 2.217   -17.866 1.00 55.92  ? 62  LYS A CG   1 
ATOM   834   C CD   . LYS A 1 62  ? -16.210 1.585   -16.485 1.00 55.13  ? 62  LYS A CD   1 
ATOM   835   C CE   . LYS A 1 62  ? -14.881 1.819   -15.767 1.00 63.18  ? 62  LYS A CE   1 
ATOM   836   N NZ   . LYS A 1 62  ? -14.624 0.788   -14.719 1.00 68.12  ? 62  LYS A NZ   1 
ATOM   837   H H    . LYS A 1 62  ? -19.253 1.782   -20.353 1.00 65.31  ? 62  LYS A H    1 
ATOM   838   H HA   . LYS A 1 62  ? -17.162 3.404   -20.017 1.00 59.18  ? 62  LYS A HA   1 
ATOM   839   H HB2  . LYS A 1 62  ? -18.208 2.250   -18.200 1.00 67.77  ? 62  LYS A HB2  1 
ATOM   840   H HB3  . LYS A 1 62  ? -17.517 0.923   -18.733 1.00 67.77  ? 62  LYS A HB3  1 
ATOM   841   H HG2  . LYS A 1 62  ? -15.410 1.883   -18.338 1.00 67.07  ? 62  LYS A HG2  1 
ATOM   842   H HG3  . LYS A 1 62  ? -16.124 3.178   -17.756 1.00 67.07  ? 62  LYS A HG3  1 
ATOM   843   H HD2  . LYS A 1 62  ? -16.918 1.986   -15.957 1.00 66.12  ? 62  LYS A HD2  1 
ATOM   844   H HD3  . LYS A 1 62  ? -16.349 0.629   -16.569 1.00 66.12  ? 62  LYS A HD3  1 
ATOM   845   H HE2  . LYS A 1 62  ? -14.158 1.780   -16.413 1.00 75.77  ? 62  LYS A HE2  1 
ATOM   846   H HE3  . LYS A 1 62  ? -14.899 2.688   -15.337 1.00 75.77  ? 62  LYS A HE3  1 
ATOM   847   H HZ1  . LYS A 1 62  ? -15.272 0.807   -14.109 1.00 81.71  ? 62  LYS A HZ1  1 
ATOM   848   H HZ2  . LYS A 1 62  ? -14.597 -0.021  -15.089 1.00 81.71  ? 62  LYS A HZ2  1 
ATOM   849   H HZ3  . LYS A 1 62  ? -13.845 0.949   -14.319 1.00 81.71  ? 62  LYS A HZ3  1 
ATOM   850   N N    . TYR A 1 63  ? -16.674 0.694   -21.636 1.00 61.62  ? 63  TYR A N    1 
ATOM   851   C CA   . TYR A 1 63  ? -15.649 -0.164  -22.228 1.00 58.54  ? 63  TYR A CA   1 
ATOM   852   C C    . TYR A 1 63  ? -15.564 -0.087  -23.747 1.00 54.97  ? 63  TYR A C    1 
ATOM   853   O O    . TYR A 1 63  ? -14.456 -0.117  -24.298 1.00 49.79  ? 63  TYR A O    1 
ATOM   854   C CB   . TYR A 1 63  ? -15.890 -1.612  -21.795 1.00 42.93  ? 63  TYR A CB   1 
ATOM   855   C CG   . TYR A 1 63  ? -15.684 -1.781  -20.320 1.00 44.74  ? 63  TYR A CG   1 
ATOM   856   C CD1  . TYR A 1 63  ? -14.412 -1.778  -19.776 1.00 43.06  ? 63  TYR A CD1  1 
ATOM   857   C CD2  . TYR A 1 63  ? -16.763 -1.919  -19.463 1.00 59.15  ? 63  TYR A CD2  1 
ATOM   858   C CE1  . TYR A 1 63  ? -14.222 -1.927  -18.428 1.00 51.04  ? 63  TYR A CE1  1 
ATOM   859   C CE2  . TYR A 1 63  ? -16.580 -2.059  -18.108 1.00 49.70  ? 63  TYR A CE2  1 
ATOM   860   C CZ   . TYR A 1 63  ? -15.311 -2.068  -17.603 1.00 48.38  ? 63  TYR A CZ   1 
ATOM   861   O OH   . TYR A 1 63  ? -15.119 -2.204  -16.264 1.00 57.47  ? 63  TYR A OH   1 
ATOM   862   H H    . TYR A 1 63  ? -17.482 0.450   -21.803 1.00 73.91  ? 63  TYR A H    1 
ATOM   863   H HA   . TYR A 1 63  ? -14.786 0.104   -21.876 1.00 70.21  ? 63  TYR A HA   1 
ATOM   864   H HB2  . TYR A 1 63  ? -16.804 -1.861  -22.006 1.00 51.47  ? 63  TYR A HB2  1 
ATOM   865   H HB3  . TYR A 1 63  ? -15.267 -2.193  -22.259 1.00 51.47  ? 63  TYR A HB3  1 
ATOM   866   H HD1  . TYR A 1 63  ? -13.675 -1.686  -20.335 1.00 51.63  ? 63  TYR A HD1  1 
ATOM   867   H HD2  . TYR A 1 63  ? -17.626 -1.916  -19.809 1.00 70.94  ? 63  TYR A HD2  1 
ATOM   868   H HE1  . TYR A 1 63  ? -13.362 -1.927  -18.073 1.00 61.21  ? 63  TYR A HE1  1 
ATOM   869   H HE2  . TYR A 1 63  ? -17.311 -2.157  -17.542 1.00 59.60  ? 63  TYR A HE2  1 
ATOM   870   H HH   . TYR A 1 63  ? -15.859 -2.282  -15.874 1.00 68.92  ? 63  TYR A HH   1 
ATOM   871   N N    . LEU A 1 64  ? -16.703 -0.018  -24.437 1.00 58.94  ? 64  LEU A N    1 
ATOM   872   C CA   . LEU A 1 64  ? -16.767 0.198   -25.881 1.00 59.37  ? 64  LEU A CA   1 
ATOM   873   C C    . LEU A 1 64  ? -17.461 1.533   -26.141 1.00 56.23  ? 64  LEU A C    1 
ATOM   874   O O    . LEU A 1 64  ? -18.609 1.584   -26.614 1.00 48.13  ? 64  LEU A O    1 
ATOM   875   C CB   . LEU A 1 64  ? -17.496 -0.944  -26.582 1.00 46.65  ? 64  LEU A CB   1 
ATOM   876   C CG   . LEU A 1 64  ? -17.324 -0.944  -28.090 1.00 43.40  ? 64  LEU A CG   1 
ATOM   877   C CD1  . LEU A 1 64  ? -15.839 -1.130  -28.495 1.00 47.35  ? 64  LEU A CD1  1 
ATOM   878   C CD2  . LEU A 1 64  ? -18.183 -2.025  -28.686 1.00 40.61  ? 64  LEU A CD2  1 
ATOM   879   H H    . LEU A 1 64  ? -17.480 -0.096  -24.075 1.00 70.69  ? 64  LEU A H    1 
ATOM   880   H HA   . LEU A 1 64  ? -15.866 0.248   -26.237 1.00 71.20  ? 64  LEU A HA   1 
ATOM   881   H HB2  . LEU A 1 64  ? -17.155 -1.787  -26.244 1.00 55.94  ? 64  LEU A HB2  1 
ATOM   882   H HB3  . LEU A 1 64  ? -18.445 -0.873  -26.391 1.00 55.94  ? 64  LEU A HB3  1 
ATOM   883   H HG   . LEU A 1 64  ? -17.627 -0.093  -28.442 1.00 52.04  ? 64  LEU A HG   1 
ATOM   884   H HD11 . LEU A 1 64  ? -15.774 -1.124  -29.463 1.00 56.78  ? 64  LEU A HD11 1 
ATOM   885   H HD12 . LEU A 1 64  ? -15.318 -0.402  -28.124 1.00 56.78  ? 64  LEU A HD12 1 
ATOM   886   H HD13 . LEU A 1 64  ? -15.521 -1.977  -28.147 1.00 56.78  ? 64  LEU A HD13 1 
ATOM   887   H HD21 . LEU A 1 64  ? -18.070 -2.022  -29.650 1.00 48.69  ? 64  LEU A HD21 1 
ATOM   888   H HD22 . LEU A 1 64  ? -17.908 -2.882  -28.323 1.00 48.69  ? 64  LEU A HD22 1 
ATOM   889   H HD23 . LEU A 1 64  ? -19.110 -1.852  -28.460 1.00 48.69  ? 64  LEU A HD23 1 
ATOM   890   N N    . PRO A 1 65  ? -16.784 2.636   -25.852 1.00 57.15  ? 65  PRO A N    1 
ATOM   891   C CA   . PRO A 1 65  ? -17.462 3.934   -25.866 1.00 64.91  ? 65  PRO A CA   1 
ATOM   892   C C    . PRO A 1 65  ? -17.769 4.386   -27.284 1.00 64.19  ? 65  PRO A C    1 
ATOM   893   O O    . PRO A 1 65  ? -16.995 4.157   -28.220 1.00 53.96  ? 65  PRO A O    1 
ATOM   894   C CB   . PRO A 1 65  ? -16.460 4.873   -25.179 1.00 75.33  ? 65  PRO A CB   1 
ATOM   895   C CG   . PRO A 1 65  ? -15.184 4.047   -24.935 1.00 68.26  ? 65  PRO A CG   1 
ATOM   896   C CD   . PRO A 1 65  ? -15.325 2.780   -25.711 1.00 72.27  ? 65  PRO A CD   1 
ATOM   897   H HA   . PRO A 1 65  ? -18.282 3.898   -25.349 1.00 77.85  ? 65  PRO A HA   1 
ATOM   898   H HB2  . PRO A 1 65  ? -16.271 5.625   -25.761 1.00 90.36  ? 65  PRO A HB2  1 
ATOM   899   H HB3  . PRO A 1 65  ? -16.830 5.181   -24.337 1.00 90.36  ? 65  PRO A HB3  1 
ATOM   900   H HG2  . PRO A 1 65  ? -14.413 4.548   -25.245 1.00 81.87  ? 65  PRO A HG2  1 
ATOM   901   H HG3  . PRO A 1 65  ? -15.102 3.855   -23.988 1.00 81.87  ? 65  PRO A HG3  1 
ATOM   902   H HD2  . PRO A 1 65  ? -14.908 2.868   -26.582 1.00 86.68  ? 65  PRO A HD2  1 
ATOM   903   H HD3  . PRO A 1 65  ? -14.958 2.034   -25.212 1.00 86.68  ? 65  PRO A HD3  1 
ATOM   904   N N    . GLY A 1 66  ? -18.924 5.021   -27.437 1.00 69.71  ? 66  GLY A N    1 
ATOM   905   C CA   . GLY A 1 66  ? -19.346 5.465   -28.748 1.00 64.68  ? 66  GLY A CA   1 
ATOM   906   C C    . GLY A 1 66  ? -19.869 4.366   -29.637 1.00 52.23  ? 66  GLY A C    1 
ATOM   907   O O    . GLY A 1 66  ? -19.762 4.476   -30.856 1.00 52.99  ? 66  GLY A O    1 
ATOM   908   H H    . GLY A 1 66  ? -19.475 5.203   -26.802 1.00 83.61  ? 66  GLY A H    1 
ATOM   909   H HA2  . GLY A 1 66  ? -20.045 6.129   -28.647 1.00 77.57  ? 66  GLY A HA2  1 
ATOM   910   H HA3  . GLY A 1 66  ? -18.594 5.883   -29.197 1.00 77.57  ? 66  GLY A HA3  1 
ATOM   911   N N    . HIS A 1 67  ? -20.425 3.298   -29.069 1.00 43.58  ? 67  HIS A N    1 
ATOM   912   C CA   . HIS A 1 67  ? -20.973 2.216   -29.876 1.00 39.30  ? 67  HIS A CA   1 
ATOM   913   C C    . HIS A 1 67  ? -22.240 1.684   -29.235 1.00 57.24  ? 67  HIS A C    1 
ATOM   914   O O    . HIS A 1 67  ? -22.393 1.687   -28.013 1.00 62.06  ? 67  HIS A O    1 
ATOM   915   C CB   . HIS A 1 67  ? -19.983 1.051   -30.050 1.00 50.98  ? 67  HIS A CB   1 
ATOM   916   C CG   . HIS A 1 67  ? -18.939 1.303   -31.094 1.00 41.54  ? 67  HIS A CG   1 
ATOM   917   N ND1  . HIS A 1 67  ? -19.131 0.991   -32.420 1.00 39.80  ? 67  HIS A ND1  1 
ATOM   918   C CD2  . HIS A 1 67  ? -17.714 1.871   -31.012 1.00 37.70  ? 67  HIS A CD2  1 
ATOM   919   C CE1  . HIS A 1 67  ? -18.066 1.347   -33.111 1.00 40.55  ? 67  HIS A CE1  1 
ATOM   920   N NE2  . HIS A 1 67  ? -17.193 1.889   -32.281 1.00 33.63  ? 67  HIS A NE2  1 
ATOM   921   H H    . HIS A 1 67  ? -20.496 3.178   -28.221 1.00 52.25  ? 67  HIS A H    1 
ATOM   922   H HA   . HIS A 1 67  ? -21.197 2.557   -30.755 1.00 47.12  ? 67  HIS A HA   1 
ATOM   923   H HB2  . HIS A 1 67  ? -19.529 0.897   -29.207 1.00 61.13  ? 67  HIS A HB2  1 
ATOM   924   H HB3  . HIS A 1 67  ? -20.476 0.257   -30.309 1.00 61.13  ? 67  HIS A HB3  1 
ATOM   925   H HD1  . HIS A 1 67  ? -19.836 0.622   -32.747 1.00 47.72  ? 67  HIS A HD1  1 
ATOM   926   H HD2  . HIS A 1 67  ? -17.305 2.194   -30.242 1.00 45.20  ? 67  HIS A HD2  1 
ATOM   927   H HE1  . HIS A 1 67  ? -17.948 1.233   -34.027 1.00 48.62  ? 67  HIS A HE1  1 
ATOM   928   N N    . LYS A 1 68  ? -23.145 1.223   -30.079 1.00 54.49  ? 68  LYS A N    1 
ATOM   929   C CA   . LYS A 1 68  ? -24.321 0.515   -29.628 1.00 54.02  ? 68  LYS A CA   1 
ATOM   930   C C    . LYS A 1 68  ? -24.038 -0.974  -29.731 1.00 62.23  ? 68  LYS A C    1 
ATOM   931   O O    . LYS A 1 68  ? -23.488 -1.437  -30.735 1.00 57.37  ? 68  LYS A O    1 
ATOM   932   C CB   . LYS A 1 68  ? -25.553 0.887   -30.461 1.00 55.88  ? 68  LYS A CB   1 
ATOM   933   H H    . LYS A 1 68  ? -23.098 1.311   -30.933 1.00 65.35  ? 68  LYS A H    1 
ATOM   934   H HA   . LYS A 1 68  ? -24.498 0.733   -28.700 1.00 64.79  ? 68  LYS A HA   1 
ATOM   935   N N    . LEU A 1 69  ? -24.405 -1.711  -28.695 1.00 59.91  ? 69  LEU A N    1 
ATOM   936   C CA   . LEU A 1 69  ? -24.397 -3.159  -28.752 1.00 50.25  ? 69  LEU A CA   1 
ATOM   937   C C    . LEU A 1 69  ? -25.736 -3.666  -29.287 1.00 51.10  ? 69  LEU A C    1 
ATOM   938   O O    . LEU A 1 69  ? -26.764 -3.005  -29.104 1.00 50.82  ? 69  LEU A O    1 
ATOM   939   C CB   . LEU A 1 69  ? -24.162 -3.728  -27.367 1.00 40.75  ? 69  LEU A CB   1 
ATOM   940   C CG   . LEU A 1 69  ? -22.778 -3.614  -26.738 1.00 51.97  ? 69  LEU A CG   1 
ATOM   941   C CD1  . LEU A 1 69  ? -22.169 -2.203  -26.802 1.00 56.35  ? 69  LEU A CD1  1 
ATOM   942   C CD2  . LEU A 1 69  ? -22.923 -4.079  -25.323 1.00 39.40  ? 69  LEU A CD2  1 
ATOM   943   H H    . LEU A 1 69  ? -24.666 -1.392  -27.940 1.00 71.85  ? 69  LEU A H    1 
ATOM   944   H HA   . LEU A 1 69  ? -23.689 -3.462  -29.341 1.00 60.26  ? 69  LEU A HA   1 
ATOM   945   H HB2  . LEU A 1 69  ? -24.779 -3.289  -26.761 1.00 48.86  ? 69  LEU A HB2  1 
ATOM   946   H HB3  . LEU A 1 69  ? -24.375 -4.674  -27.399 1.00 48.86  ? 69  LEU A HB3  1 
ATOM   947   H HG   . LEU A 1 69  ? -22.174 -4.222  -27.192 1.00 62.32  ? 69  LEU A HG   1 
ATOM   948   H HD11 . LEU A 1 69  ? -21.294 -2.217  -26.383 1.00 67.58  ? 69  LEU A HD11 1 
ATOM   949   H HD12 . LEU A 1 69  ? -22.086 -1.937  -27.732 1.00 67.58  ? 69  LEU A HD12 1 
ATOM   950   H HD13 . LEU A 1 69  ? -22.752 -1.586  -26.332 1.00 67.58  ? 69  LEU A HD13 1 
ATOM   951   H HD21 . LEU A 1 69  ? -22.061 -4.023  -24.882 1.00 47.24  ? 69  LEU A HD21 1 
ATOM   952   H HD22 . LEU A 1 69  ? -23.565 -3.512  -24.869 1.00 47.24  ? 69  LEU A HD22 1 
ATOM   953   H HD23 . LEU A 1 69  ? -23.236 -4.998  -25.324 1.00 47.24  ? 69  LEU A HD23 1 
ATOM   954   N N    . PRO A 1 70  ? -25.783 -4.836  -29.925 1.00 48.26  ? 70  PRO A N    1 
ATOM   955   C CA   . PRO A 1 70  ? -27.074 -5.358  -30.388 1.00 37.50  ? 70  PRO A CA   1 
ATOM   956   C C    . PRO A 1 70  ? -28.015 -5.590  -29.227 1.00 48.22  ? 70  PRO A C    1 
ATOM   957   O O    . PRO A 1 70  ? -27.582 -5.934  -28.108 1.00 45.22  ? 70  PRO A O    1 
ATOM   958   C CB   . PRO A 1 70  ? -26.701 -6.680  -31.075 1.00 43.43  ? 70  PRO A CB   1 
ATOM   959   C CG   . PRO A 1 70  ? -25.254 -6.611  -31.365 1.00 37.89  ? 70  PRO A CG   1 
ATOM   960   C CD   . PRO A 1 70  ? -24.667 -5.724  -30.284 1.00 55.29  ? 70  PRO A CD   1 
ATOM   961   H HA   . PRO A 1 70  ? -27.481 -4.755  -31.029 1.00 44.95  ? 70  PRO A HA   1 
ATOM   962   H HB2  . PRO A 1 70  ? -26.892 -7.420  -30.477 1.00 52.07  ? 70  PRO A HB2  1 
ATOM   963   H HB3  . PRO A 1 70  ? -27.208 -6.770  -31.898 1.00 52.07  ? 70  PRO A HB3  1 
ATOM   964   H HG2  . PRO A 1 70  ? -24.870 -7.501  -31.323 1.00 45.42  ? 70  PRO A HG2  1 
ATOM   965   H HG3  . PRO A 1 70  ? -25.115 -6.219  -32.241 1.00 45.42  ? 70  PRO A HG3  1 
ATOM   966   H HD2  . PRO A 1 70  ? -24.399 -6.257  -29.519 1.00 66.31  ? 70  PRO A HD2  1 
ATOM   967   H HD3  . PRO A 1 70  ? -23.925 -5.208  -30.637 1.00 66.31  ? 70  PRO A HD3  1 
ATOM   968   N N    . PRO A 1 71  ? -29.330 -5.512  -29.465 1.00 58.94  ? 71  PRO A N    1 
ATOM   969   C CA   . PRO A 1 71  ? -30.285 -5.622  -28.353 1.00 58.35  ? 71  PRO A CA   1 
ATOM   970   C C    . PRO A 1 71  ? -30.522 -7.051  -27.878 1.00 59.76  ? 71  PRO A C    1 
ATOM   971   O O    . PRO A 1 71  ? -30.967 -7.223  -26.731 1.00 52.35  ? 71  PRO A O    1 
ATOM   972   C CB   . PRO A 1 71  ? -31.569 -5.018  -28.940 1.00 65.84  ? 71  PRO A CB   1 
ATOM   973   C CG   . PRO A 1 71  ? -31.335 -4.956  -30.476 1.00 47.42  ? 71  PRO A CG   1 
ATOM   974   C CD   . PRO A 1 71  ? -30.024 -5.628  -30.756 1.00 54.02  ? 71  PRO A CD   1 
ATOM   975   H HA   . PRO A 1 71  ? -29.991 -5.080  -27.604 1.00 69.97  ? 71  PRO A HA   1 
ATOM   976   H HB2  . PRO A 1 71  ? -32.323 -5.591  -28.732 1.00 78.97  ? 71  PRO A HB2  1 
ATOM   977   H HB3  . PRO A 1 71  ? -31.705 -4.128  -28.579 1.00 78.97  ? 71  PRO A HB3  1 
ATOM   978   H HG2  . PRO A 1 71  ? -32.055 -5.422  -30.929 1.00 56.86  ? 71  PRO A HG2  1 
ATOM   979   H HG3  . PRO A 1 71  ? -31.305 -4.028  -30.758 1.00 56.86  ? 71  PRO A HG3  1 
ATOM   980   H HD2  . PRO A 1 71  ? -30.160 -6.560  -30.987 1.00 64.78  ? 71  PRO A HD2  1 
ATOM   981   H HD3  . PRO A 1 71  ? -29.538 -5.153  -31.448 1.00 64.78  ? 71  PRO A HD3  1 
ATOM   982   N N    . ASN A 1 72  ? -30.259 -8.070  -28.725 1.00 39.67  ? 72  ASN A N    1 
ATOM   983   C CA   . ASN A 1 72  ? -30.329 -9.487  -28.356 1.00 43.41  ? 72  ASN A CA   1 
ATOM   984   C C    . ASN A 1 72  ? -29.127 -9.963  -27.526 1.00 46.27  ? 72  ASN A C    1 
ATOM   985   O O    . ASN A 1 72  ? -28.963 -11.172 -27.328 1.00 47.40  ? 72  ASN A O    1 
ATOM   986   C CB   . ASN A 1 72  ? -30.415 -10.368 -29.603 1.00 29.97  ? 72  ASN A CB   1 
ATOM   987   C CG   . ASN A 1 72  ? -29.331 -10.019 -30.626 1.00 42.53  ? 72  ASN A CG   1 
ATOM   988   O OD1  . ASN A 1 72  ? -28.978 -8.854  -30.803 1.00 45.10  ? 72  ASN A OD1  1 
ATOM   989   N ND2  . ASN A 1 72  ? -28.778 -11.028 -31.274 1.00 38.03  ? 72  ASN A ND2  1 
ATOM   990   H H    . ASN A 1 72  ? -30.030 -7.951  -29.545 1.00 47.56  ? 72  ASN A H    1 
ATOM   991   H HA   . ASN A 1 72  ? -31.131 -9.634  -27.831 1.00 52.05  ? 72  ASN A HA   1 
ATOM   992   H HB2  . ASN A 1 72  ? -30.301 -11.296 -29.346 1.00 35.92  ? 72  ASN A HB2  1 
ATOM   993   H HB3  . ASN A 1 72  ? -31.280 -10.241 -30.023 1.00 35.92  ? 72  ASN A HB3  1 
ATOM   994   H HD21 . ASN A 1 72  ? -28.163 -10.880 -31.856 1.00 45.60  ? 72  ASN A HD21 1 
ATOM   995   H HD22 . ASN A 1 72  ? -29.043 -11.832 -31.124 1.00 45.60  ? 72  ASN A HD22 1 
ATOM   996   N N    . VAL A 1 73  ? -28.272 -9.069  -27.059 1.00 34.60  ? 73  VAL A N    1 
ATOM   997   C CA   . VAL A 1 73  ? -27.190 -9.438  -26.155 1.00 40.88  ? 73  VAL A CA   1 
ATOM   998   C C    . VAL A 1 73  ? -27.563 -8.974  -24.755 1.00 42.31  ? 73  VAL A C    1 
ATOM   999   O O    . VAL A 1 73  ? -27.739 -7.772  -24.515 1.00 36.26  ? 73  VAL A O    1 
ATOM   1000  C CB   . VAL A 1 73  ? -25.848 -8.830  -26.593 1.00 38.25  ? 73  VAL A CB   1 
ATOM   1001  C CG1  . VAL A 1 73  ? -24.788 -9.107  -25.550 1.00 48.52  ? 73  VAL A CG1  1 
ATOM   1002  C CG2  . VAL A 1 73  ? -25.405 -9.421  -27.948 1.00 45.94  ? 73  VAL A CG2  1 
ATOM   1003  H H    . VAL A 1 73  ? -28.295 -8.231  -27.252 1.00 41.48  ? 73  VAL A H    1 
ATOM   1004  H HA   . VAL A 1 73  ? -27.097 -10.404 -26.142 1.00 49.01  ? 73  VAL A HA   1 
ATOM   1005  H HB   . VAL A 1 73  ? -25.943 -7.870  -26.690 1.00 45.86  ? 73  VAL A HB   1 
ATOM   1006  H HG11 . VAL A 1 73  ? -23.949 -8.717  -25.842 1.00 58.19  ? 73  VAL A HG11 1 
ATOM   1007  H HG12 . VAL A 1 73  ? -25.063 -8.711  -24.708 1.00 58.19  ? 73  VAL A HG12 1 
ATOM   1008  H HG13 . VAL A 1 73  ? -24.689 -10.067 -25.448 1.00 58.19  ? 73  VAL A HG13 1 
ATOM   1009  H HG21 . VAL A 1 73  ? -24.558 -9.024  -28.203 1.00 55.08  ? 73  VAL A HG21 1 
ATOM   1010  H HG22 . VAL A 1 73  ? -25.305 -10.382 -27.855 1.00 55.08  ? 73  VAL A HG22 1 
ATOM   1011  H HG23 . VAL A 1 73  ? -26.079 -9.221  -28.615 1.00 55.08  ? 73  VAL A HG23 1 
ATOM   1012  N N    . VAL A 1 74  ? -27.602 -9.912  -23.814 1.00 46.63  ? 74  VAL A N    1 
ATOM   1013  C CA   . VAL A 1 74  ? -28.196 -9.703  -22.496 1.00 40.96  ? 74  VAL A CA   1 
ATOM   1014  C C    . VAL A 1 74  ? -27.073 -9.670  -21.461 1.00 42.51  ? 74  VAL A C    1 
ATOM   1015  O O    . VAL A 1 74  ? -26.406 -10.681 -21.230 1.00 46.32  ? 74  VAL A O    1 
ATOM   1016  C CB   . VAL A 1 74  ? -29.219 -10.804 -22.192 1.00 45.93  ? 74  VAL A CB   1 
ATOM   1017  C CG1  . VAL A 1 74  ? -29.969 -10.538 -20.880 1.00 49.14  ? 74  VAL A CG1  1 
ATOM   1018  C CG2  . VAL A 1 74  ? -30.182 -10.946 -23.335 1.00 45.00  ? 74  VAL A CG2  1 
ATOM   1019  H H    . VAL A 1 74  ? -27.280 -10.702 -23.919 1.00 55.91  ? 74  VAL A H    1 
ATOM   1020  H HA   . VAL A 1 74  ? -28.653 -8.847  -22.480 1.00 49.11  ? 74  VAL A HA   1 
ATOM   1021  H HB   . VAL A 1 74  ? -28.749 -11.648 -22.097 1.00 55.07  ? 74  VAL A HB   1 
ATOM   1022  H HG11 . VAL A 1 74  ? -30.603 -11.256 -20.727 1.00 58.93  ? 74  VAL A HG11 1 
ATOM   1023  H HG12 . VAL A 1 74  ? -29.329 -10.501 -20.152 1.00 58.93  ? 74  VAL A HG12 1 
ATOM   1024  H HG13 . VAL A 1 74  ? -30.438 -9.691  -20.951 1.00 58.93  ? 74  VAL A HG13 1 
ATOM   1025  H HG21 . VAL A 1 74  ? -30.820 -11.645 -23.124 1.00 53.96  ? 74  VAL A HG21 1 
ATOM   1026  H HG22 . VAL A 1 74  ? -30.646 -10.103 -23.462 1.00 53.96  ? 74  VAL A HG22 1 
ATOM   1027  H HG23 . VAL A 1 74  ? -29.689 -11.177 -24.137 1.00 53.96  ? 74  VAL A HG23 1 
ATOM   1028  N N    . ALA A 1 75  ? -26.831 -8.510  -20.857 1.00 34.15  ? 75  ALA A N    1 
ATOM   1029  C CA   . ALA A 1 75  ? -25.951 -8.457  -19.706 1.00 42.53  ? 75  ALA A CA   1 
ATOM   1030  C C    . ALA A 1 75  ? -26.523 -9.314  -18.577 1.00 56.14  ? 75  ALA A C    1 
ATOM   1031  O O    . ALA A 1 75  ? -27.727 -9.303  -18.312 1.00 56.00  ? 75  ALA A O    1 
ATOM   1032  C CB   . ALA A 1 75  ? -25.761 -7.010  -19.242 1.00 50.39  ? 75  ALA A CB   1 
ATOM   1033  H H    . ALA A 1 75  ? -27.161 -7.752  -21.093 1.00 40.94  ? 75  ALA A H    1 
ATOM   1034  H HA   . ALA A 1 75  ? -25.083 -8.815  -19.949 1.00 50.99  ? 75  ALA A HA   1 
ATOM   1035  H HB1  . ALA A 1 75  ? -25.170 -7.000  -18.472 1.00 60.43  ? 75  ALA A HB1  1 
ATOM   1036  H HB2  . ALA A 1 75  ? -25.371 -6.496  -19.965 1.00 60.43  ? 75  ALA A HB2  1 
ATOM   1037  H HB3  . ALA A 1 75  ? -26.625 -6.640  -19.000 1.00 60.43  ? 75  ALA A HB3  1 
ATOM   1038  N N    . VAL A 1 76  ? -25.650 -10.069 -17.919 1.00 54.11  ? 76  VAL A N    1 
ATOM   1039  C CA   . VAL A 1 76  ? -26.023 -10.945 -16.806 1.00 44.98  ? 76  VAL A CA   1 
ATOM   1040  C C    . VAL A 1 76  ? -24.935 -10.815 -15.750 1.00 47.53  ? 76  VAL A C    1 
ATOM   1041  O O    . VAL A 1 76  ? -23.751 -11.044 -16.055 1.00 45.10  ? 76  VAL A O    1 
ATOM   1042  C CB   . VAL A 1 76  ? -26.186 -12.403 -17.257 1.00 42.74  ? 76  VAL A CB   1 
ATOM   1043  C CG1  . VAL A 1 76  ? -26.353 -13.341 -16.047 1.00 52.42  ? 76  VAL A CG1  1 
ATOM   1044  C CG2  . VAL A 1 76  ? -27.379 -12.534 -18.213 1.00 41.96  ? 76  VAL A CG2  1 
ATOM   1045  H H    . VAL A 1 76  ? -24.810 -10.094 -18.103 1.00 64.89  ? 76  VAL A H    1 
ATOM   1046  H HA   . VAL A 1 76  ? -26.862 -10.645 -16.423 1.00 53.93  ? 76  VAL A HA   1 
ATOM   1047  H HB   . VAL A 1 76  ? -25.388 -12.675 -17.737 1.00 51.25  ? 76  VAL A HB   1 
ATOM   1048  H HG11 . VAL A 1 76  ? -26.453 -14.252 -16.365 1.00 62.86  ? 76  VAL A HG11 1 
ATOM   1049  H HG12 . VAL A 1 76  ? -25.566 -13.272 -15.483 1.00 62.86  ? 76  VAL A HG12 1 
ATOM   1050  H HG13 . VAL A 1 76  ? -27.142 -13.076 -15.548 1.00 62.86  ? 76  VAL A HG13 1 
ATOM   1051  H HG21 . VAL A 1 76  ? -27.465 -13.461 -18.485 1.00 50.32  ? 76  VAL A HG21 1 
ATOM   1052  H HG22 . VAL A 1 76  ? -28.184 -12.248 -17.753 1.00 50.32  ? 76  VAL A HG22 1 
ATOM   1053  H HG23 . VAL A 1 76  ? -27.224 -11.973 -18.989 1.00 50.32  ? 76  VAL A HG23 1 
ATOM   1054  N N    . PRO A 1 77  ? -25.271 -10.464 -14.506 1.00 37.74  ? 77  PRO A N    1 
ATOM   1055  C CA   . PRO A 1 77  ? -24.218 -10.132 -13.545 1.00 40.24  ? 77  PRO A CA   1 
ATOM   1056  C C    . PRO A 1 77  ? -23.600 -11.325 -12.865 1.00 37.32  ? 77  PRO A C    1 
ATOM   1057  O O    . PRO A 1 77  ? -22.543 -11.154 -12.248 1.00 39.06  ? 77  PRO A O    1 
ATOM   1058  C CB   . PRO A 1 77  ? -24.938 -9.233  -12.522 1.00 57.69  ? 77  PRO A CB   1 
ATOM   1059  C CG   . PRO A 1 77  ? -26.383 -9.633  -12.613 1.00 45.76  ? 77  PRO A CG   1 
ATOM   1060  C CD   . PRO A 1 77  ? -26.616 -10.089 -14.024 1.00 45.00  ? 77  PRO A CD   1 
ATOM   1061  H HA   . PRO A 1 77  ? -23.519 -9.619  -13.981 1.00 48.25  ? 77  PRO A HA   1 
ATOM   1062  H HB2  . PRO A 1 77  ? -24.589 -9.403  -11.633 1.00 69.18  ? 77  PRO A HB2  1 
ATOM   1063  H HB3  . PRO A 1 77  ? -24.823 -8.301  -12.765 1.00 69.18  ? 77  PRO A HB3  1 
ATOM   1064  H HG2  . PRO A 1 77  ? -26.557 -10.356 -11.991 1.00 54.87  ? 77  PRO A HG2  1 
ATOM   1065  H HG3  . PRO A 1 77  ? -26.943 -8.868  -12.408 1.00 54.87  ? 77  PRO A HG3  1 
ATOM   1066  H HD2  . PRO A 1 77  ? -27.205 -10.860 -14.036 1.00 53.96  ? 77  PRO A HD2  1 
ATOM   1067  H HD3  . PRO A 1 77  ? -26.974 -9.362  -14.558 1.00 53.96  ? 77  PRO A HD3  1 
ATOM   1068  N N    . ASP A 1 78  ? -24.240 -12.494 -12.903 1.00 42.18  ? 78  ASP A N    1 
ATOM   1069  C CA   . ASP A 1 78  ? -23.718 -13.714 -12.288 1.00 45.83  ? 78  ASP A CA   1 
ATOM   1070  C C    . ASP A 1 78  ? -23.270 -14.695 -13.366 1.00 40.31  ? 78  ASP A C    1 
ATOM   1071  O O    . ASP A 1 78  ? -24.056 -15.073 -14.245 1.00 34.26  ? 78  ASP A O    1 
ATOM   1072  C CB   . ASP A 1 78  ? -24.746 -14.413 -11.392 1.00 49.16  ? 78  ASP A CB   1 
ATOM   1073  C CG   . ASP A 1 78  ? -24.248 -15.795 -10.900 1.00 55.08  ? 78  ASP A CG   1 
ATOM   1074  O OD1  . ASP A 1 78  ? -23.214 -15.864 -10.183 1.00 64.96  ? 78  ASP A OD1  1 
ATOM   1075  O OD2  . ASP A 1 78  ? -24.873 -16.819 -11.245 1.00 46.39  ? 78  ASP A OD2  1 
ATOM   1076  H H    . ASP A 1 78  ? -24.999 -12.608 -13.291 1.00 50.57  ? 78  ASP A H    1 
ATOM   1077  H HA   . ASP A 1 78  ? -22.947 -13.490 -11.744 1.00 54.95  ? 78  ASP A HA   1 
ATOM   1078  H HB2  . ASP A 1 78  ? -24.918 -13.860 -10.614 1.00 58.95  ? 78  ASP A HB2  1 
ATOM   1079  H HB3  . ASP A 1 78  ? -25.566 -14.548 -11.893 1.00 58.95  ? 78  ASP A HB3  1 
ATOM   1080  N N    . VAL A 1 79  ? -22.031 -15.168 -13.244 1.00 37.72  ? 79  VAL A N    1 
ATOM   1081  C CA   . VAL A 1 79  ? -21.409 -15.877 -14.351 1.00 38.40  ? 79  VAL A CA   1 
ATOM   1082  C C    . VAL A 1 79  ? -22.013 -17.280 -14.528 1.00 40.79  ? 79  VAL A C    1 
ATOM   1083  O O    . VAL A 1 79  ? -22.195 -17.752 -15.662 1.00 33.03  ? 79  VAL A O    1 
ATOM   1084  C CB   . VAL A 1 79  ? -19.881 -15.874 -14.134 1.00 43.88  ? 79  VAL A CB   1 
ATOM   1085  C CG1  . VAL A 1 79  ? -19.510 -16.624 -12.861 1.00 36.80  ? 79  VAL A CG1  1 
ATOM   1086  C CG2  . VAL A 1 79  ? -19.150 -16.425 -15.346 1.00 39.06  ? 79  VAL A CG2  1 
ATOM   1087  H H    . VAL A 1 79  ? -21.539 -15.092 -12.543 1.00 45.22  ? 79  VAL A H    1 
ATOM   1088  H HA   . VAL A 1 79  ? -21.585 -15.383 -15.167 1.00 46.04  ? 79  VAL A HA   1 
ATOM   1089  H HB   . VAL A 1 79  ? -19.593 -14.955 -14.019 1.00 52.62  ? 79  VAL A HB   1 
ATOM   1090  H HG11 . VAL A 1 79  ? -18.546 -16.605 -12.754 1.00 44.12  ? 79  VAL A HG11 1 
ATOM   1091  H HG12 . VAL A 1 79  ? -19.937 -16.192 -12.105 1.00 44.12  ? 79  VAL A HG12 1 
ATOM   1092  H HG13 . VAL A 1 79  ? -19.816 -17.542 -12.935 1.00 44.12  ? 79  VAL A HG13 1 
ATOM   1093  H HG21 . VAL A 1 79  ? -18.195 -16.408 -15.173 1.00 46.83  ? 79  VAL A HG21 1 
ATOM   1094  H HG22 . VAL A 1 79  ? -19.441 -17.337 -15.503 1.00 46.83  ? 79  VAL A HG22 1 
ATOM   1095  H HG23 . VAL A 1 79  ? -19.357 -15.874 -16.117 1.00 46.83  ? 79  VAL A HG23 1 
ATOM   1096  N N    . VAL A 1 80  ? -22.384 -17.959 -13.434 1.00 36.66  ? 80  VAL A N    1 
ATOM   1097  C CA   . VAL A 1 80  ? -22.998 -19.280 -13.594 1.00 34.55  ? 80  VAL A CA   1 
ATOM   1098  C C    . VAL A 1 80  ? -24.297 -19.169 -14.379 1.00 32.41  ? 80  VAL A C    1 
ATOM   1099  O O    . VAL A 1 80  ? -24.536 -19.934 -15.325 1.00 35.39  ? 80  VAL A O    1 
ATOM   1100  C CB   . VAL A 1 80  ? -23.213 -19.975 -12.238 1.00 34.45  ? 80  VAL A CB   1 
ATOM   1101  C CG1  . VAL A 1 80  ? -24.006 -21.269 -12.447 1.00 32.77  ? 80  VAL A CG1  1 
ATOM   1102  C CG2  . VAL A 1 80  ? -21.862 -20.276 -11.582 1.00 33.74  ? 80  VAL A CG2  1 
ATOM   1103  H H    . VAL A 1 80  ? -22.296 -17.689 -12.622 1.00 43.94  ? 80  VAL A H    1 
ATOM   1104  H HA   . VAL A 1 80  ? -22.394 -19.836 -14.111 1.00 41.41  ? 80  VAL A HA   1 
ATOM   1105  H HB   . VAL A 1 80  ? -23.720 -19.393 -11.651 1.00 41.29  ? 80  VAL A HB   1 
ATOM   1106  H HG11 . VAL A 1 80  ? -24.138 -21.700 -11.588 1.00 39.29  ? 80  VAL A HG11 1 
ATOM   1107  H HG12 . VAL A 1 80  ? -24.865 -21.052 -12.843 1.00 39.29  ? 80  VAL A HG12 1 
ATOM   1108  H HG13 . VAL A 1 80  ? -23.506 -21.853 -13.038 1.00 39.29  ? 80  VAL A HG13 1 
ATOM   1109  H HG21 . VAL A 1 80  ? -22.015 -20.713 -10.730 1.00 40.44  ? 80  VAL A HG21 1 
ATOM   1110  H HG22 . VAL A 1 80  ? -21.350 -20.858 -12.165 1.00 40.44  ? 80  VAL A HG22 1 
ATOM   1111  H HG23 . VAL A 1 80  ? -21.385 -19.442 -11.445 1.00 40.44  ? 80  VAL A HG23 1 
ATOM   1112  N N    . GLN A 1 81  ? -25.162 -18.215 -14.010 1.00 36.69  ? 81  GLN A N    1 
ATOM   1113  C CA   . GLN A 1 81  ? -26.407 -18.008 -14.762 1.00 49.47  ? 81  GLN A CA   1 
ATOM   1114  C C    . GLN A 1 81  ? -26.135 -17.669 -16.234 1.00 41.82  ? 81  GLN A C    1 
ATOM   1115  O O    . GLN A 1 81  ? -26.825 -18.169 -17.130 1.00 34.74  ? 81  GLN A O    1 
ATOM   1116  C CB   . GLN A 1 81  ? -27.250 -16.882 -14.150 1.00 47.10  ? 81  GLN A CB   1 
ATOM   1117  C CG   . GLN A 1 81  ? -27.715 -17.048 -12.731 1.00 52.88  ? 81  GLN A CG   1 
ATOM   1118  C CD   . GLN A 1 81  ? -28.928 -16.188 -12.468 1.00 62.64  ? 81  GLN A CD   1 
ATOM   1119  O OE1  . GLN A 1 81  ? -29.177 -15.201 -13.178 1.00 63.37  ? 81  GLN A OE1  1 
ATOM   1120  N NE2  . GLN A 1 81  ? -29.703 -16.561 -11.466 1.00 68.08  ? 81  GLN A NE2  1 
ATOM   1121  H H    . GLN A 1 81  ? -25.054 -17.685 -13.341 1.00 43.98  ? 81  GLN A H    1 
ATOM   1122  H HA   . GLN A 1 81  ? -26.931 -18.824 -14.734 1.00 59.33  ? 81  GLN A HA   1 
ATOM   1123  H HB2  . GLN A 1 81  ? -26.727 -16.066 -14.183 1.00 56.48  ? 81  GLN A HB2  1 
ATOM   1124  H HB3  . GLN A 1 81  ? -28.043 -16.772 -14.697 1.00 56.48  ? 81  GLN A HB3  1 
ATOM   1125  H HG2  . GLN A 1 81  ? -27.956 -17.975 -12.577 1.00 63.41  ? 81  GLN A HG2  1 
ATOM   1126  H HG3  . GLN A 1 81  ? -27.008 -16.776 -12.125 1.00 63.41  ? 81  GLN A HG3  1 
ATOM   1127  H HE21 . GLN A 1 81  ? -29.498 -17.253 -10.999 1.00 81.65  ? 81  GLN A HE21 1 
ATOM   1128  H HE22 . GLN A 1 81  ? -30.407 -16.106 -11.274 1.00 81.65  ? 81  GLN A HE22 1 
ATOM   1129  N N    . ALA A 1 82  ? -25.168 -16.788 -16.505 1.00 38.42  ? 82  ALA A N    1 
ATOM   1130  C CA   . ALA A 1 82  ? -24.874 -16.438 -17.900 1.00 43.36  ? 82  ALA A CA   1 
ATOM   1131  C C    . ALA A 1 82  ? -24.541 -17.675 -18.717 1.00 36.07  ? 82  ALA A C    1 
ATOM   1132  O O    . ALA A 1 82  ? -25.111 -17.884 -19.795 1.00 39.11  ? 82  ALA A O    1 
ATOM   1133  C CB   . ALA A 1 82  ? -23.741 -15.427 -17.962 1.00 36.34  ? 82  ALA A CB   1 
ATOM   1134  H H    . ALA A 1 82  ? -24.680 -16.389 -15.919 1.00 46.06  ? 82  ALA A H    1 
ATOM   1135  H HA   . ALA A 1 82  ? -25.661 -16.027 -18.292 1.00 51.99  ? 82  ALA A HA   1 
ATOM   1136  H HB1  . ALA A 1 82  ? -23.563 -15.210 -18.890 1.00 43.57  ? 82  ALA A HB1  1 
ATOM   1137  H HB2  . ALA A 1 82  ? -24.004 -14.628 -17.479 1.00 43.57  ? 82  ALA A HB2  1 
ATOM   1138  H HB3  . ALA A 1 82  ? -22.950 -15.815 -17.555 1.00 43.57  ? 82  ALA A HB3  1 
ATOM   1139  N N    . ALA A 1 83  ? -23.732 -18.572 -18.150 1.00 32.79  ? 83  ALA A N    1 
ATOM   1140  C CA   . ALA A 1 83  ? -23.104 -19.666 -18.887 1.00 32.30  ? 83  ALA A CA   1 
ATOM   1141  C C    . ALA A 1 83  ? -23.855 -20.981 -18.882 1.00 38.79  ? 83  ALA A C    1 
ATOM   1142  O O    . ALA A 1 83  ? -23.629 -21.808 -19.776 1.00 37.39  ? 83  ALA A O    1 
ATOM   1143  C CB   . ALA A 1 83  ? -21.709 -19.950 -18.314 1.00 44.99  ? 83  ALA A CB   1 
ATOM   1144  H H    . ALA A 1 83  ? -23.528 -18.566 -17.315 1.00 39.31  ? 83  ALA A H    1 
ATOM   1145  H HA   . ALA A 1 83  ? -22.994 -19.394 -19.812 1.00 38.71  ? 83  ALA A HA   1 
ATOM   1146  H HB1  . ALA A 1 83  ? -21.305 -20.677 -18.812 1.00 53.95  ? 83  ALA A HB1  1 
ATOM   1147  H HB2  . ALA A 1 83  ? -21.166 -19.150 -18.395 1.00 53.95  ? 83  ALA A HB2  1 
ATOM   1148  H HB3  . ALA A 1 83  ? -21.796 -20.197 -17.380 1.00 53.95  ? 83  ALA A HB3  1 
ATOM   1149  N N    . GLU A 1 84  ? -24.724 -21.215 -17.912 1.00 37.33  ? 84  GLU A N    1 
ATOM   1150  C CA   . GLU A 1 84  ? -25.055 -22.598 -17.578 1.00 37.62  ? 84  GLU A CA   1 
ATOM   1151  C C    . GLU A 1 84  ? -25.861 -23.269 -18.676 1.00 30.90  ? 84  GLU A C    1 
ATOM   1152  O O    . GLU A 1 84  ? -25.823 -24.501 -18.794 1.00 35.02  ? 84  GLU A O    1 
ATOM   1153  C CB   . GLU A 1 84  ? -25.819 -22.661 -16.250 1.00 41.74  ? 84  GLU A CB   1 
ATOM   1154  C CG   . GLU A 1 84  ? -27.218 -22.078 -16.361 1.00 41.56  ? 84  GLU A CG   1 
ATOM   1155  C CD   . GLU A 1 84  ? -27.841 -21.813 -15.000 1.00 60.32  ? 84  GLU A CD   1 
ATOM   1156  O OE1  . GLU A 1 84  ? -27.330 -22.369 -13.996 1.00 47.02  ? 84  GLU A OE1  1 
ATOM   1157  O OE2  . GLU A 1 84  ? -28.833 -21.044 -14.944 1.00 57.50  ? 84  GLU A OE2  1 
ATOM   1158  H H    . GLU A 1 84  ? -25.127 -20.616 -17.444 1.00 44.75  ? 84  GLU A H    1 
ATOM   1159  H HA   . GLU A 1 84  ? -24.230 -23.097 -17.469 1.00 45.11  ? 84  GLU A HA   1 
ATOM   1160  H HB2  . GLU A 1 84  ? -25.899 -23.587 -15.974 1.00 50.05  ? 84  GLU A HB2  1 
ATOM   1161  H HB3  . GLU A 1 84  ? -25.334 -22.154 -15.580 1.00 50.05  ? 84  GLU A HB3  1 
ATOM   1162  H HG2  . GLU A 1 84  ? -27.175 -21.237 -16.842 1.00 49.83  ? 84  GLU A HG2  1 
ATOM   1163  H HG3  . GLU A 1 84  ? -27.786 -22.705 -16.836 1.00 49.83  ? 84  GLU A HG3  1 
ATOM   1164  N N    . ASP A 1 85  ? -26.608 -22.501 -19.469 1.00 33.77  ? 85  ASP A N    1 
ATOM   1165  C CA   . ASP A 1 85  ? -27.302 -23.051 -20.630 1.00 28.06  ? 85  ASP A CA   1 
ATOM   1166  C C    . ASP A 1 85  ? -26.489 -22.980 -21.932 1.00 44.68  ? 85  ASP A C    1 
ATOM   1167  O O    . ASP A 1 85  ? -27.007 -23.365 -22.987 1.00 41.15  ? 85  ASP A O    1 
ATOM   1168  C CB   . ASP A 1 85  ? -28.629 -22.316 -20.840 1.00 36.44  ? 85  ASP A CB   1 
ATOM   1169  H H    . ASP A 1 85  ? -26.728 -21.657 -19.356 1.00 40.49  ? 85  ASP A H    1 
ATOM   1170  H HA   . ASP A 1 85  ? -27.504 -23.984 -20.458 1.00 33.63  ? 85  ASP A HA   1 
ATOM   1171  N N    . ALA A 1 86  ? -25.240 -22.519 -21.897 1.00 28.60  ? 86  ALA A N    1 
ATOM   1172  C CA   . ALA A 1 86  ? -24.490 -22.236 -23.129 1.00 26.47  ? 86  ALA A CA   1 
ATOM   1173  C C    . ALA A 1 86  ? -23.802 -23.473 -23.688 1.00 35.58  ? 86  ALA A C    1 
ATOM   1174  O O    . ALA A 1 86  ? -23.215 -24.270 -22.952 1.00 31.26  ? 86  ALA A O    1 
ATOM   1175  C CB   . ALA A 1 86  ? -23.460 -21.141 -22.881 1.00 29.66  ? 86  ALA A CB   1 
ATOM   1176  H H    . ALA A 1 86  ? -24.801 -22.361 -21.175 1.00 34.27  ? 86  ALA A H    1 
ATOM   1177  H HA   . ALA A 1 86  ? -25.109 -21.913 -23.802 1.00 31.72  ? 86  ALA A HA   1 
ATOM   1178  H HB1  . ALA A 1 86  ? -22.978 -20.970 -23.705 1.00 35.54  ? 86  ALA A HB1  1 
ATOM   1179  H HB2  . ALA A 1 86  ? -23.919 -20.336 -22.592 1.00 35.54  ? 86  ALA A HB2  1 
ATOM   1180  H HB3  . ALA A 1 86  ? -22.845 -21.437 -22.192 1.00 35.54  ? 86  ALA A HB3  1 
ATOM   1181  N N    . ASP A 1 87  ? -23.875 -23.614 -25.010 1.00 34.30  ? 87  ASP A N    1 
ATOM   1182  C CA   . ASP A 1 87  ? -23.098 -24.597 -25.753 1.00 36.16  ? 87  ASP A CA   1 
ATOM   1183  C C    . ASP A 1 87  ? -21.727 -24.084 -26.140 1.00 33.21  ? 87  ASP A C    1 
ATOM   1184  O O    . ASP A 1 87  ? -20.798 -24.884 -26.344 1.00 34.63  ? 87  ASP A O    1 
ATOM   1185  C CB   . ASP A 1 87  ? -23.841 -24.985 -27.031 1.00 34.61  ? 87  ASP A CB   1 
ATOM   1186  C CG   . ASP A 1 87  ? -25.260 -25.417 -26.749 1.00 44.84  ? 87  ASP A CG   1 
ATOM   1187  O OD1  . ASP A 1 87  ? -25.433 -26.526 -26.182 1.00 36.88  ? 87  ASP A OD1  1 
ATOM   1188  O OD2  . ASP A 1 87  ? -26.172 -24.623 -27.062 1.00 33.59  ? 87  ASP A OD2  1 
ATOM   1189  H H    . ASP A 1 87  ? -24.385 -23.136 -25.511 1.00 41.11  ? 87  ASP A H    1 
ATOM   1190  H HA   . ASP A 1 87  ? -22.984 -25.394 -25.212 1.00 43.35  ? 87  ASP A HA   1 
ATOM   1191  H HB2  . ASP A 1 87  ? -23.870 -24.220 -27.627 1.00 41.49  ? 87  ASP A HB2  1 
ATOM   1192  H HB3  . ASP A 1 87  ? -23.379 -25.723 -27.457 1.00 41.49  ? 87  ASP A HB3  1 
ATOM   1193  N N    . ILE A 1 88  ? -21.592 -22.772 -26.294 1.00 32.97  ? 88  ILE A N    1 
ATOM   1194  C CA   . ILE A 1 88  ? -20.340 -22.161 -26.719 1.00 27.94  ? 88  ILE A CA   1 
ATOM   1195  C C    . ILE A 1 88  ? -20.046 -21.034 -25.766 1.00 24.11  ? 88  ILE A C    1 
ATOM   1196  O O    . ILE A 1 88  ? -20.858 -20.117 -25.627 1.00 30.89  ? 88  ILE A O    1 
ATOM   1197  C CB   . ILE A 1 88  ? -20.401 -21.634 -28.155 1.00 32.16  ? 88  ILE A CB   1 
ATOM   1198  C CG1  . ILE A 1 88  ? -20.569 -22.796 -29.137 1.00 36.33  ? 88  ILE A CG1  1 
ATOM   1199  C CG2  . ILE A 1 88  ? -19.143 -20.839 -28.434 1.00 34.31  ? 88  ILE A CG2  1 
ATOM   1200  C CD1  . ILE A 1 88  ? -21.225 -22.353 -30.479 1.00 39.61  ? 88  ILE A CD1  1 
ATOM   1201  H H    . ILE A 1 88  ? -22.223 -22.204 -26.155 1.00 39.52  ? 88  ILE A H    1 
ATOM   1202  H HA   . ILE A 1 88  ? -19.623 -22.812 -26.659 1.00 33.48  ? 88  ILE A HA   1 
ATOM   1203  H HB   . ILE A 1 88  ? -21.167 -21.044 -28.238 1.00 38.56  ? 88  ILE A HB   1 
ATOM   1204  H HG12 . ILE A 1 88  ? -19.697 -23.170 -29.337 1.00 43.55  ? 88  ILE A HG12 1 
ATOM   1205  H HG13 . ILE A 1 88  ? -21.136 -23.472 -28.734 1.00 43.55  ? 88  ILE A HG13 1 
ATOM   1206  H HG21 . ILE A 1 88  ? -19.177 -20.503 -29.343 1.00 41.13  ? 88  ILE A HG21 1 
ATOM   1207  H HG22 . ILE A 1 88  ? -19.093 -20.099 -27.808 1.00 41.13  ? 88  ILE A HG22 1 
ATOM   1208  H HG23 . ILE A 1 88  ? -18.373 -21.419 -28.323 1.00 41.13  ? 88  ILE A HG23 1 
ATOM   1209  H HD11 . ILE A 1 88  ? -21.307 -23.125 -31.060 1.00 47.49  ? 88  ILE A HD11 1 
ATOM   1210  H HD12 . ILE A 1 88  ? -22.103 -21.983 -30.294 1.00 47.49  ? 88  ILE A HD12 1 
ATOM   1211  H HD13 . ILE A 1 88  ? -20.664 -21.681 -30.898 1.00 47.49  ? 88  ILE A HD13 1 
ATOM   1212  N N    . LEU A 1 89  ? -18.888 -21.089 -25.131 1.00 25.80  ? 89  LEU A N    1 
ATOM   1213  C CA   . LEU A 1 89  ? -18.421 -20.065 -24.177 1.00 27.69  ? 89  LEU A CA   1 
ATOM   1214  C C    . LEU A 1 89  ? -17.223 -19.315 -24.750 1.00 28.73  ? 89  LEU A C    1 
ATOM   1215  O O    . LEU A 1 89  ? -16.252 -19.929 -25.140 1.00 25.23  ? 89  LEU A O    1 
ATOM   1216  C CB   . LEU A 1 89  ? -18.110 -20.735 -22.846 1.00 28.69  ? 89  LEU A CB   1 
ATOM   1217  C CG   . LEU A 1 89  ? -19.267 -21.558 -22.301 1.00 34.13  ? 89  LEU A CG   1 
ATOM   1218  C CD1  . LEU A 1 89  ? -18.775 -22.862 -21.728 1.00 40.64  ? 89  LEU A CD1  1 
ATOM   1219  C CD2  . LEU A 1 89  ? -20.039 -20.782 -21.272 1.00 39.57  ? 89  LEU A CD2  1 
ATOM   1220  H H    . LEU A 1 89  ? -18.300 -21.774 -25.248 1.00 30.92  ? 89  LEU A H    1 
ATOM   1221  H HA   . LEU A 1 89  ? -19.152 -19.419 -24.046 1.00 33.19  ? 89  LEU A HA   1 
ATOM   1222  H HB2  . LEU A 1 89  ? -17.333 -21.317 -22.961 1.00 34.38  ? 89  LEU A HB2  1 
ATOM   1223  H HB3  . LEU A 1 89  ? -17.876 -20.045 -22.194 1.00 34.38  ? 89  LEU A HB3  1 
ATOM   1224  H HG   . LEU A 1 89  ? -19.877 -21.764 -23.051 1.00 40.92  ? 89  LEU A HG   1 
ATOM   1225  H HD11 . LEU A 1 89  ? -19.528 -23.366 -21.373 1.00 48.73  ? 89  LEU A HD11 1 
ATOM   1226  H HD12 . LEU A 1 89  ? -18.339 -23.380 -22.426 1.00 48.73  ? 89  LEU A HD12 1 
ATOM   1227  H HD13 . LEU A 1 89  ? -18.139 -22.683 -21.013 1.00 48.73  ? 89  LEU A HD13 1 
ATOM   1228  H HD21 . LEU A 1 89  ? -20.804 -21.306 -20.977 1.00 47.44  ? 89  LEU A HD21 1 
ATOM   1229  H HD22 . LEU A 1 89  ? -19.465 -20.590 -20.511 1.00 47.44  ? 89  LEU A HD22 1 
ATOM   1230  H HD23 . LEU A 1 89  ? -20.351 -19.946 -21.662 1.00 47.44  ? 89  LEU A HD23 1 
ATOM   1231  N N    . ILE A 1 90  ? -17.331 -18.003 -24.787 1.00 25.45  ? 90  ILE A N    1 
ATOM   1232  C CA   . ILE A 1 90  ? -16.293 -17.144 -25.320 1.00 32.20  ? 90  ILE A CA   1 
ATOM   1233  C C    . ILE A 1 90  ? -15.619 -16.478 -24.142 1.00 25.92  ? 90  ILE A C    1 
ATOM   1234  O O    . ILE A 1 90  ? -16.172 -15.567 -23.522 1.00 30.34  ? 90  ILE A O    1 
ATOM   1235  C CB   . ILE A 1 90  ? -16.836 -16.103 -26.309 1.00 26.67  ? 90  ILE A CB   1 
ATOM   1236  C CG1  . ILE A 1 90  ? -17.409 -16.798 -27.530 1.00 26.31  ? 90  ILE A CG1  1 
ATOM   1237  C CG2  . ILE A 1 90  ? -15.711 -15.204 -26.792 1.00 28.10  ? 90  ILE A CG2  1 
ATOM   1238  C CD1  . ILE A 1 90  ? -18.430 -15.963 -28.264 1.00 35.24  ? 90  ILE A CD1  1 
ATOM   1239  H H    . ILE A 1 90  ? -18.011 -17.571 -24.485 1.00 30.49  ? 90  ILE A H    1 
ATOM   1240  H HA   . ILE A 1 90  ? -15.633 -17.686 -25.781 1.00 38.60  ? 90  ILE A HA   1 
ATOM   1241  H HB   . ILE A 1 90  ? -17.523 -15.569 -25.881 1.00 31.96  ? 90  ILE A HB   1 
ATOM   1242  H HG12 . ILE A 1 90  ? -16.688 -16.997 -28.146 1.00 31.52  ? 90  ILE A HG12 1 
ATOM   1243  H HG13 . ILE A 1 90  ? -17.842 -17.620 -27.249 1.00 31.52  ? 90  ILE A HG13 1 
ATOM   1244  H HG21 . ILE A 1 90  ? -16.072 -14.554 -27.414 1.00 33.68  ? 90  ILE A HG21 1 
ATOM   1245  H HG22 . ILE A 1 90  ? -15.320 -14.750 -26.028 1.00 33.68  ? 90  ILE A HG22 1 
ATOM   1246  H HG23 . ILE A 1 90  ? -15.039 -15.748 -27.232 1.00 33.68  ? 90  ILE A HG23 1 
ATOM   1247  H HD11 . ILE A 1 90  ? -18.755 -16.463 -29.029 1.00 42.24  ? 90  ILE A HD11 1 
ATOM   1248  H HD12 . ILE A 1 90  ? -19.165 -15.763 -27.663 1.00 42.24  ? 90  ILE A HD12 1 
ATOM   1249  H HD13 . ILE A 1 90  ? -18.011 -15.140 -28.560 1.00 42.24  ? 90  ILE A HD13 1 
ATOM   1250  N N    . PHE A 1 91  ? -14.409 -16.907 -23.849 1.00 23.05  ? 91  PHE A N    1 
ATOM   1251  C CA   . PHE A 1 91  ? -13.613 -16.388 -22.717 1.00 22.23  ? 91  PHE A CA   1 
ATOM   1252  C C    . PHE A 1 91  ? -12.844 -15.151 -23.169 1.00 29.36  ? 91  PHE A C    1 
ATOM   1253  O O    . PHE A 1 91  ? -11.952 -15.273 -23.979 1.00 25.10  ? 91  PHE A O    1 
ATOM   1254  C CB   . PHE A 1 91  ? -12.741 -17.507 -22.165 1.00 23.18  ? 91  PHE A CB   1 
ATOM   1255  C CG   . PHE A 1 91  ? -13.523 -18.633 -21.559 1.00 29.17  ? 91  PHE A CG   1 
ATOM   1256  C CD1  . PHE A 1 91  ? -14.053 -18.522 -20.288 1.00 29.50  ? 91  PHE A CD1  1 
ATOM   1257  C CD2  . PHE A 1 91  ? -13.757 -19.789 -22.270 1.00 22.19  ? 91  PHE A CD2  1 
ATOM   1258  C CE1  . PHE A 1 91  ? -14.781 -19.558 -19.741 1.00 29.01  ? 91  PHE A CE1  1 
ATOM   1259  C CE2  . PHE A 1 91  ? -14.484 -20.820 -21.715 1.00 25.07  ? 91  PHE A CE2  1 
ATOM   1260  C CZ   . PHE A 1 91  ? -14.989 -20.706 -20.454 1.00 24.55  ? 91  PHE A CZ   1 
ATOM   1261  H H    . PHE A 1 91  ? -13.974 -17.553 -24.320 1.00 27.61  ? 91  PHE A H    1 
ATOM   1262  H HA   . PHE A 1 91  ? -14.242 -16.109 -22.003 1.00 26.63  ? 91  PHE A HA   1 
ATOM   1263  H HB2  . PHE A 1 91  ? -12.187 -17.859 -22.893 1.00 27.78  ? 91  PHE A HB2  1 
ATOM   1264  H HB3  . PHE A 1 91  ? -12.143 -17.131 -21.486 1.00 27.78  ? 91  PHE A HB3  1 
ATOM   1265  H HD1  . PHE A 1 91  ? -13.908 -17.734 -19.788 1.00 35.36  ? 91  PHE A HD1  1 
ATOM   1266  H HD2  . PHE A 1 91  ? -13.406 -19.879 -23.141 1.00 26.59  ? 91  PHE A HD2  1 
ATOM   1267  H HE1  . PHE A 1 91  ? -15.131 -19.477 -18.868 1.00 34.77  ? 91  PHE A HE1  1 
ATOM   1268  H HE2  . PHE A 1 91  ? -14.629 -21.611 -22.210 1.00 30.04  ? 91  PHE A HE2  1 
ATOM   1269  H HZ   . PHE A 1 91  ? -15.490 -21.413 -20.079 1.00 29.42  ? 91  PHE A HZ   1 
ATOM   1270  N N    . VAL A 1 92  ? -13.186 -13.993 -22.643 1.00 25.85  ? 92  VAL A N    1 
ATOM   1271  C CA   . VAL A 1 92  ? -12.565 -12.722 -23.068 1.00 26.32  ? 92  VAL A CA   1 
ATOM   1272  C C    . VAL A 1 92  ? -12.438 -11.771 -21.878 1.00 34.80  ? 92  VAL A C    1 
ATOM   1273  O O    . VAL A 1 92  ? -13.153 -10.797 -21.830 1.00 34.06  ? 92  VAL A O    1 
ATOM   1274  C CB   . VAL A 1 92  ? -13.357 -12.135 -24.250 1.00 28.47  ? 92  VAL A CB   1 
ATOM   1275  C CG1  . VAL A 1 92  ? -14.736 -11.647 -23.850 1.00 38.91  ? 92  VAL A CG1  1 
ATOM   1276  C CG2  . VAL A 1 92  ? -12.584 -11.054 -24.962 1.00 33.21  ? 92  VAL A CG2  1 
ATOM   1277  H H    . VAL A 1 92  ? -13.817 -13.904 -21.993 1.00 30.98  ? 92  VAL A H    1 
ATOM   1278  H HA   . VAL A 1 92  ? -11.666 -12.924 -23.383 1.00 31.55  ? 92  VAL A HA   1 
ATOM   1279  H HB   . VAL A 1 92  ? -13.487 -12.871 -24.897 1.00 34.12  ? 92  VAL A HB   1 
ATOM   1280  H HG11 . VAL A 1 92  ? -15.174 -11.243 -24.619 1.00 46.65  ? 92  VAL A HG11 1 
ATOM   1281  H HG12 . VAL A 1 92  ? -15.268 -12.398 -23.533 1.00 46.65  ? 92  VAL A HG12 1 
ATOM   1282  H HG13 . VAL A 1 92  ? -14.655 -10.987 -23.140 1.00 46.65  ? 92  VAL A HG13 1 
ATOM   1283  H HG21 . VAL A 1 92  ? -13.110 -10.714 -25.706 1.00 39.81  ? 92  VAL A HG21 1 
ATOM   1284  H HG22 . VAL A 1 92  ? -12.393 -10.329 -24.342 1.00 39.81  ? 92  VAL A HG22 1 
ATOM   1285  H HG23 . VAL A 1 92  ? -11.747 -11.421 -25.298 1.00 39.81  ? 92  VAL A HG23 1 
ATOM   1286  N N    . VAL A 1 93  ? -11.559 -12.084 -20.936 1.00 33.56  ? 93  VAL A N    1 
ATOM   1287  C CA   . VAL A 1 93  ? -11.302 -11.216 -19.792 1.00 29.03  ? 93  VAL A CA   1 
ATOM   1288  C C    . VAL A 1 93  ? -9.802  -11.047 -19.665 1.00 32.14  ? 93  VAL A C    1 
ATOM   1289  O O    . VAL A 1 93  ? -9.021  -11.835 -20.227 1.00 41.08  ? 93  VAL A O    1 
ATOM   1290  C CB   . VAL A 1 93  ? -11.882 -11.799 -18.491 1.00 39.89  ? 93  VAL A CB   1 
ATOM   1291  C CG1  . VAL A 1 93  ? -13.380 -11.812 -18.559 1.00 32.52  ? 93  VAL A CG1  1 
ATOM   1292  C CG2  . VAL A 1 93  ? -11.334 -13.184 -18.267 1.00 43.29  ? 93  VAL A CG2  1 
ATOM   1293  H H    . VAL A 1 93  ? -11.097 -12.809 -20.931 1.00 40.23  ? 93  VAL A H    1 
ATOM   1294  H HA   . VAL A 1 93  ? -11.701 -10.346 -19.947 1.00 34.79  ? 93  VAL A HA   1 
ATOM   1295  H HB   . VAL A 1 93  ? -11.616 -11.241 -17.744 1.00 47.82  ? 93  VAL A HB   1 
ATOM   1296  H HG11 . VAL A 1 93  ? -13.730 -12.181 -17.734 1.00 38.99  ? 93  VAL A HG11 1 
ATOM   1297  H HG12 . VAL A 1 93  ? -13.698 -10.903 -18.677 1.00 38.99  ? 93  VAL A HG12 1 
ATOM   1298  H HG13 . VAL A 1 93  ? -13.657 -12.359 -19.311 1.00 38.99  ? 93  VAL A HG13 1 
ATOM   1299  H HG21 . VAL A 1 93  ? -11.706 -13.541 -17.445 1.00 51.90  ? 93  VAL A HG21 1 
ATOM   1300  H HG22 . VAL A 1 93  ? -11.584 -13.747 -19.016 1.00 51.90  ? 93  VAL A HG22 1 
ATOM   1301  H HG23 . VAL A 1 93  ? -10.368 -13.133 -18.198 1.00 51.90  ? 93  VAL A HG23 1 
ATOM   1302  N N    . PRO A 1 94  ? -9.361  -10.031 -18.934 1.00 29.81  ? 94  PRO A N    1 
ATOM   1303  C CA   . PRO A 1 94  ? -7.927  -9.914  -18.673 1.00 42.70  ? 94  PRO A CA   1 
ATOM   1304  C C    . PRO A 1 94  ? -7.432  -11.161 -17.958 1.00 43.31  ? 94  PRO A C    1 
ATOM   1305  O O    . PRO A 1 94  ? -8.160  -11.811 -17.203 1.00 35.16  ? 94  PRO A O    1 
ATOM   1306  C CB   . PRO A 1 94  ? -7.824  -8.655  -17.805 1.00 43.36  ? 94  PRO A CB   1 
ATOM   1307  C CG   . PRO A 1 94  ? -9.017  -7.847  -18.221 1.00 36.73  ? 94  PRO A CG   1 
ATOM   1308  C CD   . PRO A 1 94  ? -10.106 -8.872  -18.421 1.00 36.75  ? 94  PRO A CD   1 
ATOM   1309  H HA   . PRO A 1 94  ? -7.434  -9.787  -19.499 1.00 51.19  ? 94  PRO A HA   1 
ATOM   1310  H HB2  . PRO A 1 94  ? -7.875  -8.894  -16.867 1.00 51.99  ? 94  PRO A HB2  1 
ATOM   1311  H HB3  . PRO A 1 94  ? -6.999  -8.184  -18.001 1.00 51.99  ? 94  PRO A HB3  1 
ATOM   1312  H HG2  . PRO A 1 94  ? -9.254  -7.224  -17.516 1.00 44.04  ? 94  PRO A HG2  1 
ATOM   1313  H HG3  . PRO A 1 94  ? -8.826  -7.379  -19.048 1.00 44.04  ? 94  PRO A HG3  1 
ATOM   1314  H HD2  . PRO A 1 94  ? -10.531 -9.087  -17.577 1.00 44.06  ? 94  PRO A HD2  1 
ATOM   1315  H HD3  . PRO A 1 94  ? -10.749 -8.562  -19.078 1.00 44.06  ? 94  PRO A HD3  1 
ATOM   1316  N N    . HIS A 1 95  ? -6.240  -11.537 -18.272 1.00 42.70  ? 95  HIS A N    1 
ATOM   1317  C CA   . HIS A 1 95  ? -5.627  -12.666 -17.661 1.00 48.88  ? 95  HIS A CA   1 
ATOM   1318  C C    . HIS A 1 95  ? -5.856  -12.787 -16.140 1.00 36.41  ? 95  HIS A C    1 
ATOM   1319  O O    . HIS A 1 95  ? -6.246  -13.800 -15.672 1.00 32.02  ? 95  HIS A O    1 
ATOM   1320  C CB   . HIS A 1 95  ? -4.149  -12.511 -17.926 1.00 50.79  ? 95  HIS A CB   1 
ATOM   1321  C CG   . HIS A 1 95  ? -3.339  -13.734 -17.687 1.00 72.34  ? 95  HIS A CG   1 
ATOM   1322  N ND1  . HIS A 1 95  ? -3.865  -14.902 -17.196 1.00 84.39  ? 95  HIS A ND1  1 
ATOM   1323  C CD2  . HIS A 1 95  ? -2.022  -13.966 -17.869 1.00 73.12  ? 95  HIS A CD2  1 
ATOM   1324  C CE1  . HIS A 1 95  ? -2.909  -15.803 -17.083 1.00 88.06  ? 95  HIS A CE1  1 
ATOM   1325  N NE2  . HIS A 1 95  ? -1.779  -15.258 -17.478 1.00 82.02  ? 95  HIS A NE2  1 
ATOM   1326  H H    . HIS A 1 95  ? -5.746  -11.144 -18.856 1.00 51.20  ? 95  HIS A H    1 
ATOM   1327  H HA   . HIS A 1 95  ? -5.941  -13.487 -18.093 1.00 58.61  ? 95  HIS A HA   1 
ATOM   1328  H HB2  . HIS A 1 95  ? -4.027  -12.256 -18.854 1.00 60.91  ? 95  HIS A HB2  1 
ATOM   1329  H HB3  . HIS A 1 95  ? -3.803  -11.813 -17.348 1.00 60.91  ? 95  HIS A HB3  1 
ATOM   1330  H HD1  . HIS A 1 95  ? -4.691  -15.027 -16.991 1.00 101.23 ? 95  HIS A HD1  1 
ATOM   1331  H HD2  . HIS A 1 95  ? -1.394  -13.358 -18.188 1.00 87.70  ? 95  HIS A HD2  1 
ATOM   1332  H HE1  . HIS A 1 95  ? -3.014  -16.673 -16.774 1.00 105.63 ? 95  HIS A HE1  1 
ATOM   1333  N N    . GLN A 1 96  ? -5.705  -11.723 -15.391 1.00 39.36  ? 96  GLN A N    1 
ATOM   1334  C CA   . GLN A 1 96  ? -5.702  -11.872 -13.939 1.00 44.07  ? 96  GLN A CA   1 
ATOM   1335  C C    . GLN A 1 96  ? -7.034  -12.390 -13.389 1.00 43.39  ? 96  GLN A C    1 
ATOM   1336  O O    . GLN A 1 96  ? -7.057  -12.879 -12.261 1.00 42.03  ? 96  GLN A O    1 
ATOM   1337  C CB   . GLN A 1 96  ? -5.311  -10.553 -13.249 1.00 47.93  ? 96  GLN A CB   1 
ATOM   1338  C CG   . GLN A 1 96  ? -6.153  -9.333  -13.562 1.00 50.56  ? 96  GLN A CG   1 
ATOM   1339  C CD   . GLN A 1 96  ? -5.716  -8.623  -14.838 1.00 65.17  ? 96  GLN A CD   1 
ATOM   1340  O OE1  . GLN A 1 96  ? -5.047  -9.209  -15.698 1.00 57.40  ? 96  GLN A OE1  1 
ATOM   1341  N NE2  . GLN A 1 96  ? -6.083  -7.351  -14.961 1.00 74.12  ? 96  GLN A NE2  1 
ATOM   1342  H H    . GLN A 1 96  ? -5.582  -10.922 -15.680 1.00 47.19  ? 96  GLN A H    1 
ATOM   1343  H HA   . GLN A 1 96  ? -5.025  -12.527 -13.707 1.00 52.85  ? 96  GLN A HA   1 
ATOM   1344  H HB2  . GLN A 1 96  ? -5.355  -10.690 -12.290 1.00 57.47  ? 96  GLN A HB2  1 
ATOM   1345  H HB3  . GLN A 1 96  ? -4.399  -10.341 -13.500 1.00 57.47  ? 96  GLN A HB3  1 
ATOM   1346  H HG2  . GLN A 1 96  ? -7.076  -9.607  -13.672 1.00 60.63  ? 96  GLN A HG2  1 
ATOM   1347  H HG3  . GLN A 1 96  ? -6.079  -8.703  -12.828 1.00 60.63  ? 96  GLN A HG3  1 
ATOM   1348  H HE21 . GLN A 1 96  ? -6.546  -6.976  -14.341 1.00 88.90  ? 96  GLN A HE21 1 
ATOM   1349  H HE22 . GLN A 1 96  ? -5.861  -6.906  -15.662 1.00 88.90  ? 96  GLN A HE22 1 
ATOM   1350  N N    . PHE A 1 97  ? -8.112  -12.373 -14.166 1.00 39.65  ? 97  PHE A N    1 
ATOM   1351  C CA   . PHE A 1 97  ? -9.422  -12.744 -13.663 1.00 38.04  ? 97  PHE A CA   1 
ATOM   1352  C C    . PHE A 1 97  ? -9.876  -14.152 -14.056 1.00 39.14  ? 97  PHE A C    1 
ATOM   1353  O O    . PHE A 1 97  ? -10.814 -14.678 -13.437 1.00 37.91  ? 97  PHE A O    1 
ATOM   1354  C CB   . PHE A 1 97  ? -10.443 -11.719 -14.135 1.00 42.61  ? 97  PHE A CB   1 
ATOM   1355  C CG   . PHE A 1 97  ? -10.111 -10.306 -13.708 1.00 53.99  ? 97  PHE A CG   1 
ATOM   1356  C CD1  . PHE A 1 97  ? -9.763  -10.021 -12.388 1.00 46.10  ? 97  PHE A CD1  1 
ATOM   1357  C CD2  . PHE A 1 97  ? -10.133 -9.262  -14.630 1.00 56.11  ? 97  PHE A CD2  1 
ATOM   1358  C CE1  . PHE A 1 97  ? -9.454  -8.730  -12.001 1.00 54.29  ? 97  PHE A CE1  1 
ATOM   1359  C CE2  . PHE A 1 97  ? -9.826  -7.964  -14.243 1.00 52.99  ? 97  PHE A CE2  1 
ATOM   1360  C CZ   . PHE A 1 97  ? -9.484  -7.698  -12.932 1.00 54.72  ? 97  PHE A CZ   1 
ATOM   1361  H H    . PHE A 1 97  ? -8.107  -12.149 -14.996 1.00 47.53  ? 97  PHE A H    1 
ATOM   1362  H HA   . PHE A 1 97  ? -9.399  -12.708 -12.694 1.00 45.61  ? 97  PHE A HA   1 
ATOM   1363  H HB2  . PHE A 1 97  ? -10.482 -11.737 -15.104 1.00 51.09  ? 97  PHE A HB2  1 
ATOM   1364  H HB3  . PHE A 1 97  ? -11.311 -11.946 -13.765 1.00 51.09  ? 97  PHE A HB3  1 
ATOM   1365  H HD1  . PHE A 1 97  ? -9.740  -10.706 -11.760 1.00 55.28  ? 97  PHE A HD1  1 
ATOM   1366  H HD2  . PHE A 1 97  ? -10.362 -9.435  -15.515 1.00 67.29  ? 97  PHE A HD2  1 
ATOM   1367  H HE1  . PHE A 1 97  ? -9.226  -8.552  -11.117 1.00 65.11  ? 97  PHE A HE1  1 
ATOM   1368  H HE2  . PHE A 1 97  ? -9.846  -7.275  -14.868 1.00 63.54  ? 97  PHE A HE2  1 
ATOM   1369  H HZ   . PHE A 1 97  ? -9.278  -6.830  -12.671 1.00 65.63  ? 97  PHE A HZ   1 
ATOM   1370  N N    . ILE A 1 98  ? -9.231  -14.795 -15.032 1.00 39.21  ? 98  ILE A N    1 
ATOM   1371  C CA   . ILE A 1 98  ? -9.803  -16.018 -15.597 1.00 33.35  ? 98  ILE A CA   1 
ATOM   1372  C C    . ILE A 1 98  ? -9.785  -17.151 -14.572 1.00 39.33  ? 98  ILE A C    1 
ATOM   1373  O O    . ILE A 1 98  ? -10.650 -18.036 -14.588 1.00 39.46  ? 98  ILE A O    1 
ATOM   1374  C CB   . ILE A 1 98  ? -9.059  -16.407 -16.894 1.00 39.00  ? 98  ILE A CB   1 
ATOM   1375  C CG1  . ILE A 1 98  ? -9.780  -17.556 -17.617 1.00 31.73  ? 98  ILE A CG1  1 
ATOM   1376  C CG2  . ILE A 1 98  ? -7.622  -16.823 -16.601 1.00 41.73  ? 98  ILE A CG2  1 
ATOM   1377  C CD1  . ILE A 1 98  ? -11.143 -17.235 -18.157 1.00 28.90  ? 98  ILE A CD1  1 
ATOM   1378  H H    . ILE A 1 98  ? -8.482  -14.552 -15.377 1.00 47.01  ? 98  ILE A H    1 
ATOM   1379  H HA   . ILE A 1 98  ? -10.729 -15.848 -15.830 1.00 39.97  ? 98  ILE A HA   1 
ATOM   1380  H HB   . ILE A 1 98  ? -9.042  -15.636 -17.482 1.00 46.76  ? 98  ILE A HB   1 
ATOM   1381  H HG12 . ILE A 1 98  ? -9.232  -17.839 -18.366 1.00 38.03  ? 98  ILE A HG12 1 
ATOM   1382  H HG13 . ILE A 1 98  ? -9.882  -18.294 -16.995 1.00 38.03  ? 98  ILE A HG13 1 
ATOM   1383  H HG21 . ILE A 1 98  ? -7.186  -17.060 -17.434 1.00 50.03  ? 98  ILE A HG21 1 
ATOM   1384  H HG22 . ILE A 1 98  ? -7.158  -16.081 -16.183 1.00 50.03  ? 98  ILE A HG22 1 
ATOM   1385  H HG23 . ILE A 1 98  ? -7.631  -17.587 -16.003 1.00 50.03  ? 98  ILE A HG23 1 
ATOM   1386  H HD11 . ILE A 1 98  ? -11.504 -18.024 -18.591 1.00 34.64  ? 98  ILE A HD11 1 
ATOM   1387  H HD12 . ILE A 1 98  ? -11.718 -16.967 -17.423 1.00 34.64  ? 98  ILE A HD12 1 
ATOM   1388  H HD13 . ILE A 1 98  ? -11.065 -16.511 -18.798 1.00 34.64  ? 98  ILE A HD13 1 
ATOM   1389  N N    . GLY A 1 99  ? -8.824  -17.144 -13.663 1.00 47.74  ? 99  GLY A N    1 
ATOM   1390  C CA   . GLY A 1 99  ? -8.769  -18.171 -12.642 1.00 45.66  ? 99  GLY A CA   1 
ATOM   1391  C C    . GLY A 1 99  ? -10.008 -18.233 -11.780 1.00 34.47  ? 99  GLY A C    1 
ATOM   1392  O O    . GLY A 1 99  ? -10.659 -19.282 -11.680 1.00 38.83  ? 99  GLY A O    1 
ATOM   1393  H H    . GLY A 1 99  ? -8.195  -16.559 -13.616 1.00 57.24  ? 99  GLY A H    1 
ATOM   1394  H HA2  . GLY A 1 99  ? -8.650  -19.035 -13.066 1.00 54.75  ? 99  GLY A HA2  1 
ATOM   1395  H HA3  . GLY A 1 99  ? -8.006  -18.007 -12.066 1.00 54.75  ? 99  GLY A HA3  1 
ATOM   1396  N N    . LYS A 1 100 ? -10.350 -17.104 -11.154 1.00 39.33  ? 100 LYS A N    1 
ATOM   1397  C CA   . LYS A 1 100 ? -11.495 -17.064 -10.257 1.00 40.29  ? 100 LYS A CA   1 
ATOM   1398  C C    . LYS A 1 100 ? -12.777 -17.356 -11.010 1.00 41.43  ? 100 LYS A C    1 
ATOM   1399  O O    . LYS A 1 100 ? -13.667 -18.020 -10.477 1.00 37.80  ? 100 LYS A O    1 
ATOM   1400  C CB   . LYS A 1 100 ? -11.588 -15.702 -9.567  1.00 49.13  ? 100 LYS A CB   1 
ATOM   1401  H H    . LYS A 1 100 ? -9.935  -16.355 -11.234 1.00 47.16  ? 100 LYS A H    1 
ATOM   1402  H HA   . LYS A 1 100 ? -11.386 -17.743 -9.573  1.00 48.31  ? 100 LYS A HA   1 
ATOM   1403  N N    . ILE A 1 101 ? -12.869 -16.907 -12.265 1.00 38.14  ? 101 ILE A N    1 
ATOM   1404  C CA   . ILE A 1 101 ? -14.076 -17.148 -13.052 1.00 46.04  ? 101 ILE A CA   1 
ATOM   1405  C C    . ILE A 1 101 ? -14.224 -18.635 -13.339 1.00 39.70  ? 101 ILE A C    1 
ATOM   1406  O O    . ILE A 1 101 ? -15.301 -19.204 -13.179 1.00 33.45  ? 101 ILE A O    1 
ATOM   1407  C CB   . ILE A 1 101 ? -14.060 -16.322 -14.349 1.00 39.82  ? 101 ILE A CB   1 
ATOM   1408  C CG1  . ILE A 1 101 ? -14.339 -14.855 -14.026 1.00 37.41  ? 101 ILE A CG1  1 
ATOM   1409  C CG2  . ILE A 1 101 ? -15.089 -16.871 -15.343 1.00 28.44  ? 101 ILE A CG2  1 
ATOM   1410  C CD1  . ILE A 1 101 ? -13.950 -13.883 -15.166 1.00 42.82  ? 101 ILE A CD1  1 
ATOM   1411  H H    . ILE A 1 101 ? -12.255 -16.468 -12.676 1.00 45.72  ? 101 ILE A H    1 
ATOM   1412  H HA   . ILE A 1 101 ? -14.847 -16.869 -12.534 1.00 55.21  ? 101 ILE A HA   1 
ATOM   1413  H HB   . ILE A 1 101 ? -13.178 -16.389 -14.748 1.00 47.74  ? 101 ILE A HB   1 
ATOM   1414  H HG12 . ILE A 1 101 ? -15.288 -14.747 -13.854 1.00 44.85  ? 101 ILE A HG12 1 
ATOM   1415  H HG13 . ILE A 1 101 ? -13.832 -14.606 -13.237 1.00 44.85  ? 101 ILE A HG13 1 
ATOM   1416  H HG21 . ILE A 1 101 ? -15.063 -16.337 -16.152 1.00 34.08  ? 101 ILE A HG21 1 
ATOM   1417  H HG22 . ILE A 1 101 ? -14.870 -17.793 -15.547 1.00 34.08  ? 101 ILE A HG22 1 
ATOM   1418  H HG23 . ILE A 1 101 ? -15.972 -16.822 -14.942 1.00 34.08  ? 101 ILE A HG23 1 
ATOM   1419  H HD11 . ILE A 1 101 ? -14.155 -12.975 -14.891 1.00 51.34  ? 101 ILE A HD11 1 
ATOM   1420  H HD12 . ILE A 1 101 ? -13.000 -13.968 -15.344 1.00 51.34  ? 101 ILE A HD12 1 
ATOM   1421  H HD13 . ILE A 1 101 ? -14.458 -14.110 -15.961 1.00 51.34  ? 101 ILE A HD13 1 
ATOM   1422  N N    . CYS A 1 102 ? -13.142 -19.295 -13.747 1.00 31.21  ? 102 CYS A N    1 
ATOM   1423  C CA   . CYS A 1 102 ? -13.213 -20.740 -13.892 1.00 31.13  ? 102 CYS A CA   1 
ATOM   1424  C C    . CYS A 1 102 ? -13.584 -21.428 -12.575 1.00 35.24  ? 102 CYS A C    1 
ATOM   1425  O O    . CYS A 1 102 ? -14.454 -22.301 -12.556 1.00 33.20  ? 102 CYS A O    1 
ATOM   1426  C CB   . CYS A 1 102 ? -11.894 -21.263 -14.445 1.00 35.35  ? 102 CYS A CB   1 
ATOM   1427  S SG   . CYS A 1 102 ? -11.747 -20.793 -16.186 1.00 40.65  ? 102 CYS A SG   1 
ATOM   1428  H H    . CYS A 1 102 ? -12.381 -18.942 -13.938 1.00 37.41  ? 102 CYS A H    1 
ATOM   1429  H HA   . CYS A 1 102 ? -13.905 -20.951 -14.537 1.00 37.31  ? 102 CYS A HA   1 
ATOM   1430  H HB2  . CYS A 1 102 ? -11.155 -20.872 -13.954 1.00 42.38  ? 102 CYS A HB2  1 
ATOM   1431  H HB3  . CYS A 1 102 ? -11.873 -22.231 -14.381 1.00 42.38  ? 102 CYS A HB3  1 
ATOM   1432  H HG   . CYS A 1 102 ? -10.706 -21.208 -16.616 1.00 48.74  ? 102 CYS A HG   1 
ATOM   1433  N N    . ASP A 1 103 ? -12.940 -21.058 -11.461 1.00 39.82  ? 103 ASP A N    1 
ATOM   1434  C CA   . ASP A 1 103 ? -13.342 -21.607 -10.157 1.00 39.38  ? 103 ASP A CA   1 
ATOM   1435  C C    . ASP A 1 103 ? -14.855 -21.519 -9.931  1.00 38.03  ? 103 ASP A C    1 
ATOM   1436  O O    . ASP A 1 103 ? -15.471 -22.452 -9.406  1.00 42.39  ? 103 ASP A O    1 
ATOM   1437  C CB   . ASP A 1 103 ? -12.606 -20.889 -9.020  1.00 38.12  ? 103 ASP A CB   1 
ATOM   1438  C CG   . ASP A 1 103 ? -11.106 -21.117 -9.057  1.00 35.62  ? 103 ASP A CG   1 
ATOM   1439  O OD1  . ASP A 1 103 ? -10.676 -22.175 -9.572  1.00 36.90  ? 103 ASP A OD1  1 
ATOM   1440  O OD2  . ASP A 1 103 ? -10.360 -20.218 -8.598  1.00 45.84  ? 103 ASP A OD2  1 
ATOM   1441  H H    . ASP A 1 103 ? -12.283 -20.504 -11.431 1.00 47.75  ? 103 ASP A H    1 
ATOM   1442  H HA   . ASP A 1 103 ? -13.093 -22.544 -10.124 1.00 47.22  ? 103 ASP A HA   1 
ATOM   1443  H HB2  . ASP A 1 103 ? -12.767 -19.935 -9.093  1.00 45.70  ? 103 ASP A HB2  1 
ATOM   1444  H HB3  . ASP A 1 103 ? -12.939 -21.218 -8.171  1.00 45.70  ? 103 ASP A HB3  1 
ATOM   1445  N N    . GLN A 1 104 ? -15.475 -20.413 -10.321 1.00 40.73  ? 104 GLN A N    1 
ATOM   1446  C CA   . GLN A 1 104 ? -16.922 -20.302 -10.155 1.00 35.74  ? 104 GLN A CA   1 
ATOM   1447  C C    . GLN A 1 104 ? -17.706 -21.164 -11.147 1.00 40.71  ? 104 GLN A C    1 
ATOM   1448  O O    . GLN A 1 104 ? -18.827 -21.571 -10.842 1.00 32.06  ? 104 GLN A O    1 
ATOM   1449  C CB   . GLN A 1 104 ? -17.348 -18.849 -10.299 1.00 41.46  ? 104 GLN A CB   1 
ATOM   1450  C CG   . GLN A 1 104 ? -17.156 -18.002 -9.034  1.00 48.60  ? 104 GLN A CG   1 
ATOM   1451  C CD   . GLN A 1 104 ? -17.843 -16.657 -9.153  1.00 61.55  ? 104 GLN A CD   1 
ATOM   1452  O OE1  . GLN A 1 104 ? -17.197 -15.612 -9.103  1.00 65.93  ? 104 GLN A OE1  1 
ATOM   1453  N NE2  . GLN A 1 104 ? -19.167 -16.680 -9.328  1.00 73.61  ? 104 GLN A NE2  1 
ATOM   1454  H H    . GLN A 1 104 ? -15.095 -19.728 -10.675 1.00 48.84  ? 104 GLN A H    1 
ATOM   1455  H HA   . GLN A 1 104 ? -17.156 -20.593 -9.260  1.00 42.85  ? 104 GLN A HA   1 
ATOM   1456  H HB2  . GLN A 1 104 ? -16.827 -18.442 -11.008 1.00 49.71  ? 104 GLN A HB2  1 
ATOM   1457  H HB3  . GLN A 1 104 ? -18.290 -18.824 -10.530 1.00 49.71  ? 104 GLN A HB3  1 
ATOM   1458  H HG2  . GLN A 1 104 ? -17.536 -18.471 -8.274  1.00 58.28  ? 104 GLN A HG2  1 
ATOM   1459  H HG3  . GLN A 1 104 ? -16.209 -17.848 -8.893  1.00 58.28  ? 104 GLN A HG3  1 
ATOM   1460  H HE21 . GLN A 1 104 ? -19.584 -17.431 -9.360  1.00 88.29  ? 104 GLN A HE21 1 
ATOM   1461  H HE22 . GLN A 1 104 ? -19.604 -15.942 -9.402  1.00 88.29  ? 104 GLN A HE22 1 
ATOM   1462  N N    . LEU A 1 105 ? -17.181 -21.415 -12.336 1.00 27.86  ? 105 LEU A N    1 
ATOM   1463  C CA   . LEU A 1 105 ? -17.930 -22.137 -13.385 1.00 27.56  ? 105 LEU A CA   1 
ATOM   1464  C C    . LEU A 1 105 ? -17.765 -23.642 -13.262 1.00 29.03  ? 105 LEU A C    1 
ATOM   1465  O O    . LEU A 1 105 ? -18.641 -24.332 -13.729 1.00 26.07  ? 105 LEU A O    1 
ATOM   1466  C CB   . LEU A 1 105 ? -17.460 -21.656 -14.760 1.00 34.26  ? 105 LEU A CB   1 
ATOM   1467  C CG   . LEU A 1 105 ? -17.994 -20.292 -15.180 1.00 33.18  ? 105 LEU A CG   1 
ATOM   1468  C CD1  . LEU A 1 105 ? -17.507 -19.908 -16.550 1.00 31.31  ? 105 LEU A CD1  1 
ATOM   1469  C CD2  . LEU A 1 105 ? -19.502 -20.275 -15.121 1.00 38.79  ? 105 LEU A CD2  1 
ATOM   1470  H H    . LEU A 1 105 ? -16.339 -21.162 -12.575 1.00 33.39  ? 105 LEU A H    1 
ATOM   1471  H HA   . LEU A 1 105 ? -18.885 -21.921 -13.280 1.00 33.03  ? 105 LEU A HA   1 
ATOM   1472  H HB2  . LEU A 1 105 ? -16.482 -21.620 -14.758 1.00 41.07  ? 105 LEU A HB2  1 
ATOM   1473  H HB3  . LEU A 1 105 ? -17.732 -22.316 -15.429 1.00 41.07  ? 105 LEU A HB3  1 
ATOM   1474  H HG   . LEU A 1 105 ? -17.656 -19.620 -14.537 1.00 39.77  ? 105 LEU A HG   1 
ATOM   1475  H HD11 . LEU A 1 105 ? -17.860 -19.033 -16.787 1.00 37.54  ? 105 LEU A HD11 1 
ATOM   1476  H HD12 . LEU A 1 105 ? -16.535 -19.877 -16.553 1.00 37.54  ? 105 LEU A HD12 1 
ATOM   1477  H HD13 . LEU A 1 105 ? -17.812 -20.566 -17.199 1.00 37.54  ? 105 LEU A HD13 1 
ATOM   1478  H HD21 . LEU A 1 105 ? -19.828 -19.400 -15.392 1.00 46.50  ? 105 LEU A HD21 1 
ATOM   1479  H HD22 . LEU A 1 105 ? -19.858 -20.953 -15.721 1.00 46.50  ? 105 LEU A HD22 1 
ATOM   1480  H HD23 . LEU A 1 105 ? -19.794 -20.463 -14.212 1.00 46.50  ? 105 LEU A HD23 1 
ATOM   1481  N N    . LYS A 1 106 ? -16.709 -24.112 -12.605 1.00 31.44  ? 106 LYS A N    1 
ATOM   1482  C CA   . LYS A 1 106 ? -16.383 -25.535 -12.542 1.00 28.85  ? 106 LYS A CA   1 
ATOM   1483  C C    . LYS A 1 106 ? -17.587 -26.343 -12.089 1.00 39.28  ? 106 LYS A C    1 
ATOM   1484  O O    . LYS A 1 106 ? -18.167 -26.068 -11.035 1.00 32.79  ? 106 LYS A O    1 
ATOM   1485  C CB   . LYS A 1 106 ? -15.206 -25.758 -11.581 1.00 36.26  ? 106 LYS A CB   1 
ATOM   1486  C CG   . LYS A 1 106 ? -14.683 -27.207 -11.536 1.00 32.78  ? 106 LYS A CG   1 
ATOM   1487  C CD   . LYS A 1 106 ? -13.492 -27.347 -10.570 1.00 33.90  ? 106 LYS A CD   1 
ATOM   1488  C CE   . LYS A 1 106 ? -12.702 -28.607 -10.908 1.00 41.35  ? 106 LYS A CE   1 
ATOM   1489  N NZ   . LYS A 1 106 ? -11.950 -29.263 -9.749  1.00 35.40  ? 106 LYS A NZ   1 
ATOM   1490  H H    . LYS A 1 106 ? -16.148 -23.612 -12.188 1.00 37.69  ? 106 LYS A H    1 
ATOM   1491  H HA   . LYS A 1 106 ? -16.121 -25.844 -13.423 1.00 34.57  ? 106 LYS A HA   1 
ATOM   1492  H HB2  . LYS A 1 106 ? -14.470 -25.188 -11.855 1.00 43.47  ? 106 LYS A HB2  1 
ATOM   1493  H HB3  . LYS A 1 106 ? -15.488 -25.519 -10.684 1.00 43.47  ? 106 LYS A HB3  1 
ATOM   1494  H HG2  . LYS A 1 106 ? -15.392 -27.794 -11.231 1.00 39.29  ? 106 LYS A HG2  1 
ATOM   1495  H HG3  . LYS A 1 106 ? -14.388 -27.469 -12.422 1.00 39.29  ? 106 LYS A HG3  1 
ATOM   1496  H HD2  . LYS A 1 106 ? -12.906 -26.579 -10.663 1.00 40.64  ? 106 LYS A HD2  1 
ATOM   1497  H HD3  . LYS A 1 106 ? -13.818 -27.420 -9.659  1.00 40.64  ? 106 LYS A HD3  1 
ATOM   1498  H HE2  . LYS A 1 106 ? -13.319 -29.267 -11.262 1.00 49.58  ? 106 LYS A HE2  1 
ATOM   1499  H HE3  . LYS A 1 106 ? -12.047 -28.383 -11.587 1.00 49.58  ? 106 LYS A HE3  1 
ATOM   1500  H HZ1  . LYS A 1 106 ? -11.520 -29.987 -10.036 1.00 42.44  ? 106 LYS A HZ1  1 
ATOM   1501  H HZ2  . LYS A 1 106 ? -11.359 -28.691 -9.409  1.00 42.44  ? 106 LYS A HZ2  1 
ATOM   1502  H HZ3  . LYS A 1 106 ? -12.523 -29.500 -9.111  1.00 42.44  ? 106 LYS A HZ3  1 
ATOM   1503  N N    . GLY A 1 107 ? -17.970 -27.321 -12.909 1.00 33.35  ? 107 GLY A N    1 
ATOM   1504  C CA   . GLY A 1 107 ? -19.095 -28.192 -12.623 1.00 34.44  ? 107 GLY A CA   1 
ATOM   1505  C C    . GLY A 1 107 ? -20.459 -27.648 -12.971 1.00 40.73  ? 107 GLY A C    1 
ATOM   1506  O O    . GLY A 1 107 ? -21.449 -28.363 -12.782 1.00 44.00  ? 107 GLY A O    1 
ATOM   1507  H H    . GLY A 1 107 ? -17.580 -27.499 -13.654 1.00 39.98  ? 107 GLY A H    1 
ATOM   1508  H HA2  . GLY A 1 107 ? -18.976 -29.023 -13.111 1.00 41.28  ? 107 GLY A HA2  1 
ATOM   1509  H HA3  . GLY A 1 107 ? -19.093 -28.402 -11.676 1.00 41.28  ? 107 GLY A HA3  1 
ATOM   1510  N N    . HIS A 1 108 ? -20.553 -26.423 -13.480 1.00 32.59  ? 108 HIS A N    1 
ATOM   1511  C CA   . HIS A 1 108 ? -21.849 -25.777 -13.675 1.00 37.29  ? 108 HIS A CA   1 
ATOM   1512  C C    . HIS A 1 108 ? -22.247 -25.614 -15.132 1.00 40.28  ? 108 HIS A C    1 
ATOM   1513  O O    . HIS A 1 108 ? -23.214 -24.901 -15.425 1.00 30.29  ? 108 HIS A O    1 
ATOM   1514  C CB   . HIS A 1 108 ? -21.840 -24.418 -13.007 1.00 36.75  ? 108 HIS A CB   1 
ATOM   1515  C CG   . HIS A 1 108 ? -21.919 -24.515 -11.531 1.00 42.20  ? 108 HIS A CG   1 
ATOM   1516  N ND1  . HIS A 1 108 ? -20.848 -24.243 -10.711 1.00 48.04  ? 108 HIS A ND1  1 
ATOM   1517  C CD2  . HIS A 1 108 ? -22.927 -24.905 -10.728 1.00 40.99  ? 108 HIS A CD2  1 
ATOM   1518  C CE1  . HIS A 1 108 ? -21.208 -24.435 -9.456  1.00 39.58  ? 108 HIS A CE1  1 
ATOM   1519  N NE2  . HIS A 1 108 ? -22.462 -24.840 -9.440  1.00 38.50  ? 108 HIS A NE2  1 
ATOM   1520  H H    . HIS A 1 108 ? -19.882 -25.943 -13.722 1.00 39.07  ? 108 HIS A H    1 
ATOM   1521  H HA   . HIS A 1 108 ? -22.531 -26.314 -13.242 1.00 44.70  ? 108 HIS A HA   1 
ATOM   1522  H HB2  . HIS A 1 108 ? -21.018 -23.957 -13.235 1.00 44.06  ? 108 HIS A HB2  1 
ATOM   1523  H HB3  . HIS A 1 108 ? -22.605 -23.908 -13.316 1.00 44.06  ? 108 HIS A HB3  1 
ATOM   1524  H HD2  . HIS A 1 108 ? -23.781 -25.159 -10.996 1.00 49.15  ? 108 HIS A HD2  1 
ATOM   1525  H HE1  . HIS A 1 108 ? -20.666 -24.311 -8.710  1.00 47.46  ? 108 HIS A HE1  1 
ATOM   1526  H HE2  . HIS A 1 108 ? -22.917 -25.029 -8.735  1.00 46.16  ? 108 HIS A HE2  1 
ATOM   1527  N N    . LEU A 1 109 ? -21.560 -26.273 -16.036 1.00 30.67  ? 109 LEU A N    1 
ATOM   1528  C CA   . LEU A 1 109 ? -21.701 -26.014 -17.452 1.00 31.29  ? 109 LEU A CA   1 
ATOM   1529  C C    . LEU A 1 109 ? -22.539 -27.107 -18.089 1.00 29.75  ? 109 LEU A C    1 
ATOM   1530  O O    . LEU A 1 109 ? -22.630 -28.229 -17.596 1.00 35.19  ? 109 LEU A O    1 
ATOM   1531  C CB   . LEU A 1 109 ? -20.319 -25.972 -18.114 1.00 33.60  ? 109 LEU A CB   1 
ATOM   1532  C CG   . LEU A 1 109 ? -19.334 -24.895 -17.673 1.00 27.30  ? 109 LEU A CG   1 
ATOM   1533  C CD1  . LEU A 1 109 ? -18.124 -24.924 -18.616 1.00 34.77  ? 109 LEU A CD1  1 
ATOM   1534  C CD2  . LEU A 1 109 ? -19.999 -23.495 -17.677 1.00 33.87  ? 109 LEU A CD2  1 
ATOM   1535  H H    . LEU A 1 109 ? -20.991 -26.892 -15.852 1.00 36.76  ? 109 LEU A H    1 
ATOM   1536  H HA   . LEU A 1 109 ? -22.141 -25.161 -17.589 1.00 37.51  ? 109 LEU A HA   1 
ATOM   1537  H HB2  . LEU A 1 109 ? -19.888 -26.827 -17.957 1.00 40.27  ? 109 LEU A HB2  1 
ATOM   1538  H HB3  . LEU A 1 109 ? -20.451 -25.857 -19.068 1.00 40.27  ? 109 LEU A HB3  1 
ATOM   1539  H HG   . LEU A 1 109 ? -19.027 -25.087 -16.773 1.00 32.72  ? 109 LEU A HG   1 
ATOM   1540  H HD11 . LEU A 1 109 ? -17.493 -24.240 -18.340 1.00 41.68  ? 109 LEU A HD11 1 
ATOM   1541  H HD12 . LEU A 1 109 ? -17.707 -25.798 -18.567 1.00 41.68  ? 109 LEU A HD12 1 
ATOM   1542  H HD13 . LEU A 1 109 ? -18.426 -24.751 -19.521 1.00 41.68  ? 109 LEU A HD13 1 
ATOM   1543  H HD21 . LEU A 1 109 ? -19.347 -22.836 -17.392 1.00 40.60  ? 109 LEU A HD21 1 
ATOM   1544  H HD22 . LEU A 1 109 ? -20.303 -23.293 -18.575 1.00 40.60  ? 109 LEU A HD22 1 
ATOM   1545  H HD23 . LEU A 1 109 ? -20.752 -23.502 -17.065 1.00 40.60  ? 109 LEU A HD23 1 
ATOM   1546  N N    . LYS A 1 110 ? -23.136 -26.776 -19.218 1.00 32.13  ? 110 LYS A N    1 
ATOM   1547  C CA   . LYS A 1 110 ? -23.949 -27.747 -19.931 1.00 35.55  ? 110 LYS A CA   1 
ATOM   1548  C C    . LYS A 1 110 ? -23.090 -28.911 -20.416 1.00 38.06  ? 110 LYS A C    1 
ATOM   1549  O O    . LYS A 1 110 ? -21.895 -28.760 -20.718 1.00 38.86  ? 110 LYS A O    1 
ATOM   1550  C CB   . LYS A 1 110 ? -24.655 -27.038 -21.090 1.00 34.72  ? 110 LYS A CB   1 
ATOM   1551  C CG   . LYS A 1 110 ? -25.530 -27.879 -21.969 1.00 35.98  ? 110 LYS A CG   1 
ATOM   1552  C CD   . LYS A 1 110 ? -26.390 -26.936 -22.820 1.00 40.86  ? 110 LYS A CD   1 
ATOM   1553  C CE   . LYS A 1 110 ? -27.147 -27.669 -23.901 1.00 41.48  ? 110 LYS A CE   1 
ATOM   1554  N NZ   . LYS A 1 110 ? -28.009 -26.755 -24.737 1.00 45.63  ? 110 LYS A NZ   1 
ATOM   1555  H H    . LYS A 1 110 ? -23.089 -26.003 -19.592 1.00 38.51  ? 110 LYS A H    1 
ATOM   1556  H HA   . LYS A 1 110 ? -24.627 -28.099 -19.333 1.00 42.62  ? 110 LYS A HA   1 
ATOM   1557  H HB2  . LYS A 1 110 ? -25.212 -26.336 -20.719 1.00 41.63  ? 110 LYS A HB2  1 
ATOM   1558  H HB3  . LYS A 1 110 ? -23.977 -26.640 -21.658 1.00 41.63  ? 110 LYS A HB3  1 
ATOM   1559  H HG2  . LYS A 1 110 ? -24.983 -28.424 -22.556 1.00 43.14  ? 110 LYS A HG2  1 
ATOM   1560  H HG3  . LYS A 1 110 ? -26.113 -28.431 -21.424 1.00 43.14  ? 110 LYS A HG3  1 
ATOM   1561  H HD2  . LYS A 1 110 ? -27.035 -26.492 -22.248 1.00 48.99  ? 110 LYS A HD2  1 
ATOM   1562  H HD3  . LYS A 1 110 ? -25.815 -26.280 -23.246 1.00 48.99  ? 110 LYS A HD3  1 
ATOM   1563  H HE2  . LYS A 1 110 ? -26.512 -28.105 -24.491 1.00 49.73  ? 110 LYS A HE2  1 
ATOM   1564  H HE3  . LYS A 1 110 ? -27.725 -28.331 -23.489 1.00 49.73  ? 110 LYS A HE3  1 
ATOM   1565  H HZ1  . LYS A 1 110 ? -28.608 -26.346 -24.222 1.00 54.72  ? 110 LYS A HZ1  1 
ATOM   1566  H HZ2  . LYS A 1 110 ? -27.503 -26.140 -25.135 1.00 54.72  ? 110 LYS A HZ2  1 
ATOM   1567  H HZ3  . LYS A 1 110 ? -28.436 -27.225 -25.360 1.00 54.72  ? 110 LYS A HZ3  1 
ATOM   1568  N N    . ALA A 1 111 ? -23.700 -30.095 -20.463 1.00 33.63  ? 111 ALA A N    1 
ATOM   1569  C CA   . ALA A 1 111 ? -23.020 -31.259 -21.021 1.00 35.03  ? 111 ALA A CA   1 
ATOM   1570  C C    . ALA A 1 111 ? -22.484 -30.898 -22.406 1.00 40.27  ? 111 ALA A C    1 
ATOM   1571  O O    . ALA A 1 111 ? -23.146 -30.192 -23.167 1.00 36.39  ? 111 ALA A O    1 
ATOM   1572  C CB   . ALA A 1 111 ? -23.982 -32.451 -21.118 1.00 28.03  ? 111 ALA A CB   1 
ATOM   1573  H H    . ALA A 1 111 ? -24.498 -30.249 -20.181 1.00 40.32  ? 111 ALA A H    1 
ATOM   1574  H HA   . ALA A 1 111 ? -22.274 -31.507 -20.453 1.00 41.99  ? 111 ALA A HA   1 
ATOM   1575  H HB1  . ALA A 1 111 ? -23.507 -33.210 -21.491 1.00 33.59  ? 111 ALA A HB1  1 
ATOM   1576  H HB2  . ALA A 1 111 ? -24.307 -32.667 -20.230 1.00 33.59  ? 111 ALA A HB2  1 
ATOM   1577  H HB3  . ALA A 1 111 ? -24.725 -32.210 -21.693 1.00 33.59  ? 111 ALA A HB3  1 
ATOM   1578  N N    . ASN A 1 112 ? -21.269 -31.347 -22.718 1.00 43.05  ? 112 ASN A N    1 
ATOM   1579  C CA   . ASN A 1 112 ? -20.666 -31.166 -24.039 1.00 43.30  ? 112 ASN A CA   1 
ATOM   1580  C C    . ASN A 1 112 ? -20.417 -29.697 -24.395 1.00 40.01  ? 112 ASN A C    1 
ATOM   1581  O O    . ASN A 1 112 ? -20.161 -29.383 -25.560 1.00 45.67  ? 112 ASN A O    1 
ATOM   1582  C CB   . ASN A 1 112 ? -21.537 -31.809 -25.133 1.00 42.81  ? 112 ASN A CB   1 
ATOM   1583  C CG   . ASN A 1 112 ? -21.917 -33.257 -24.818 1.00 38.41  ? 112 ASN A CG   1 
ATOM   1584  O OD1  . ASN A 1 112 ? -21.071 -34.086 -24.484 1.00 44.79  ? 112 ASN A OD1  1 
ATOM   1585  N ND2  . ASN A 1 112 ? -23.203 -33.570 -24.958 1.00 46.17  ? 112 ASN A ND2  1 
ATOM   1586  H H    . ASN A 1 112 ? -20.762 -31.770 -22.167 1.00 51.62  ? 112 ASN A H    1 
ATOM   1587  H HA   . ASN A 1 112 ? -19.807 -31.617 -24.048 1.00 51.91  ? 112 ASN A HA   1 
ATOM   1588  H HB2  . ASN A 1 112 ? -22.357 -31.298 -25.224 1.00 51.34  ? 112 ASN A HB2  1 
ATOM   1589  H HB3  . ASN A 1 112 ? -21.048 -31.804 -25.970 1.00 51.34  ? 112 ASN A HB3  1 
ATOM   1590  H HD21 . ASN A 1 112 ? -23.470 -34.371 -24.797 1.00 55.36  ? 112 ASN A HD21 1 
ATOM   1591  H HD22 . ASN A 1 112 ? -23.768 -32.968 -25.199 1.00 55.36  ? 112 ASN A HD22 1 
ATOM   1592  N N    . ALA A 1 113 ? -20.513 -28.775 -23.438 1.00 32.35  ? 113 ALA A N    1 
ATOM   1593  C CA   . ALA A 1 113 ? -20.111 -27.398 -23.695 1.00 31.85  ? 113 ALA A CA   1 
ATOM   1594  C C    . ALA A 1 113 ? -18.701 -27.332 -24.290 1.00 29.00  ? 113 ALA A C    1 
ATOM   1595  O O    . ALA A 1 113 ? -17.844 -28.166 -23.994 1.00 31.90  ? 113 ALA A O    1 
ATOM   1596  C CB   . ALA A 1 113 ? -20.131 -26.600 -22.412 1.00 27.88  ? 113 ALA A CB   1 
ATOM   1597  H H    . ALA A 1 113 ? -20.803 -28.920 -22.642 1.00 38.78  ? 113 ALA A H    1 
ATOM   1598  H HA   . ALA A 1 113 ? -20.729 -26.991 -24.322 1.00 38.18  ? 113 ALA A HA   1 
ATOM   1599  H HB1  . ALA A 1 113 ? -19.862 -25.688 -22.604 1.00 33.41  ? 113 ALA A HB1  1 
ATOM   1600  H HB2  . ALA A 1 113 ? -21.031 -26.610 -22.049 1.00 33.41  ? 113 ALA A HB2  1 
ATOM   1601  H HB3  . ALA A 1 113 ? -19.514 -27.002 -21.781 1.00 33.41  ? 113 ALA A HB3  1 
ATOM   1602  N N    . THR A 1 114 ? -18.454 -26.290 -25.076 1.00 32.25  ? 114 THR A N    1 
ATOM   1603  C CA   . THR A 1 114 ? -17.141 -26.009 -25.666 1.00 35.60  ? 114 THR A CA   1 
ATOM   1604  C C    . THR A 1 114 ? -16.767 -24.565 -25.377 1.00 31.49  ? 114 THR A C    1 
ATOM   1605  O O    . THR A 1 114 ? -17.627 -23.737 -25.082 1.00 32.74  ? 114 THR A O    1 
ATOM   1606  C CB   . THR A 1 114 ? -17.147 -26.192 -27.174 1.00 35.58  ? 114 THR A CB   1 
ATOM   1607  O OG1  . THR A 1 114 ? -18.023 -25.201 -27.746 1.00 40.57  ? 114 THR A OG1  1 
ATOM   1608  C CG2  . THR A 1 114 ? -17.626 -27.597 -27.550 1.00 33.49  ? 114 THR A CG2  1 
ATOM   1609  H H    . THR A 1 114 ? -19.050 -25.709 -25.291 1.00 38.66  ? 114 THR A H    1 
ATOM   1610  H HA   . THR A 1 114 ? -16.471 -26.593 -25.278 1.00 42.67  ? 114 THR A HA   1 
ATOM   1611  H HB   . THR A 1 114 ? -16.249 -26.070 -27.520 1.00 42.65  ? 114 THR A HB   1 
ATOM   1612  H HG1  . THR A 1 114 ? -18.801 -25.297 -27.445 1.00 48.64  ? 114 THR A HG1  1 
ATOM   1613  H HG21 . THR A 1 114 ? -17.625 -27.701 -28.514 1.00 40.14  ? 114 THR A HG21 1 
ATOM   1614  H HG22 . THR A 1 114 ? -17.038 -28.263 -27.160 1.00 40.14  ? 114 THR A HG22 1 
ATOM   1615  H HG23 . THR A 1 114 ? -18.527 -27.740 -27.218 1.00 40.14  ? 114 THR A HG23 1 
ATOM   1616  N N    . GLY A 1 115 ? -15.476 -24.248 -25.506 1.00 28.86  ? 115 GLY A N    1 
ATOM   1617  C CA   . GLY A 1 115 ? -15.028 -22.894 -25.275 1.00 30.25  ? 115 GLY A CA   1 
ATOM   1618  C C    . GLY A 1 115 ? -13.993 -22.439 -26.288 1.00 30.36  ? 115 GLY A C    1 
ATOM   1619  O O    . GLY A 1 115 ? -13.344 -23.239 -26.965 1.00 26.00  ? 115 GLY A O    1 
ATOM   1620  H H    . GLY A 1 115 ? -14.853 -24.799 -25.724 1.00 34.59  ? 115 GLY A H    1 
ATOM   1621  H HA2  . GLY A 1 115 ? -15.787 -22.292 -25.321 1.00 36.26  ? 115 GLY A HA2  1 
ATOM   1622  H HA3  . GLY A 1 115 ? -14.639 -22.830 -24.389 1.00 36.26  ? 115 GLY A HA3  1 
ATOM   1623  N N    . ILE A 1 116 ? -13.855 -21.114 -26.371 1.00 27.84  ? 116 ILE A N    1 
ATOM   1624  C CA   . ILE A 1 116 ? -12.807 -20.477 -27.153 1.00 32.50  ? 116 ILE A CA   1 
ATOM   1625  C C    . ILE A 1 116 ? -12.247 -19.331 -26.327 1.00 26.17  ? 116 ILE A C    1 
ATOM   1626  O O    . ILE A 1 116 ? -13.005 -18.511 -25.799 1.00 31.44  ? 116 ILE A O    1 
ATOM   1627  C CB   . ILE A 1 116 ? -13.341 -19.985 -28.519 1.00 31.16  ? 116 ILE A CB   1 
ATOM   1628  C CG1  . ILE A 1 116 ? -12.230 -19.293 -29.342 1.00 25.64  ? 116 ILE A CG1  1 
ATOM   1629  C CG2  . ILE A 1 116 ? -14.553 -19.080 -28.346 1.00 31.52  ? 116 ILE A CG2  1 
ATOM   1630  C CD1  . ILE A 1 116 ? -12.552 -19.302 -30.840 1.00 21.77  ? 116 ILE A CD1  1 
ATOM   1631  H H    . ILE A 1 116 ? -14.372 -20.555 -25.972 1.00 33.37  ? 116 ILE A H    1 
ATOM   1632  H HA   . ILE A 1 116 ? -12.093 -21.114 -27.315 1.00 38.96  ? 116 ILE A HA   1 
ATOM   1633  H HB   . ILE A 1 116 ? -13.630 -20.766 -29.017 1.00 37.35  ? 116 ILE A HB   1 
ATOM   1634  H HG12 . ILE A 1 116 ? -12.147 -18.371 -29.054 1.00 30.73  ? 116 ILE A HG12 1 
ATOM   1635  H HG13 . ILE A 1 116 ? -11.393 -19.764 -29.208 1.00 30.73  ? 116 ILE A HG13 1 
ATOM   1636  H HG21 . ILE A 1 116 ? -14.859 -18.792 -29.220 1.00 37.78  ? 116 ILE A HG21 1 
ATOM   1637  H HG22 . ILE A 1 116 ? -15.255 -19.575 -27.896 1.00 37.78  ? 116 ILE A HG22 1 
ATOM   1638  H HG23 . ILE A 1 116 ? -14.298 -18.309 -27.815 1.00 37.78  ? 116 ILE A HG23 1 
ATOM   1639  H HD11 . ILE A 1 116 ? -11.833 -18.861 -31.320 1.00 26.09  ? 116 ILE A HD11 1 
ATOM   1640  H HD12 . ILE A 1 116 ? -12.634 -20.221 -31.140 1.00 26.09  ? 116 ILE A HD12 1 
ATOM   1641  H HD13 . ILE A 1 116 ? -13.387 -18.831 -30.987 1.00 26.09  ? 116 ILE A HD13 1 
ATOM   1642  N N    . SER A 1 117 ? -10.927 -19.287 -26.193 1.00 22.19  ? 117 SER A N    1 
ATOM   1643  C CA   . SER A 1 117 ? -10.247 -18.210 -25.480 1.00 29.75  ? 117 SER A CA   1 
ATOM   1644  C C    . SER A 1 117 ? -9.761  -17.138 -26.450 1.00 24.94  ? 117 SER A C    1 
ATOM   1645  O O    . SER A 1 117 ? -9.083  -17.453 -27.429 1.00 25.74  ? 117 SER A O    1 
ATOM   1646  C CB   . SER A 1 117 ? -9.052  -18.745 -24.683 1.00 27.71  ? 117 SER A CB   1 
ATOM   1647  O OG   . SER A 1 117 ? -8.435  -17.692 -23.973 1.00 30.14  ? 117 SER A OG   1 
ATOM   1648  H H    . SER A 1 117 ? -10.392 -19.880 -26.512 1.00 26.59  ? 117 SER A H    1 
ATOM   1649  H HA   . SER A 1 117 ? -10.867 -17.798 -24.858 1.00 35.65  ? 117 SER A HA   1 
ATOM   1650  H HB2  . SER A 1 117 ? -9.363  -19.414 -24.054 1.00 33.20  ? 117 SER A HB2  1 
ATOM   1651  H HB3  . SER A 1 117 ? -8.409  -19.135 -25.296 1.00 33.20  ? 117 SER A HB3  1 
ATOM   1652  H HG   . SER A 1 117 ? -7.780  -17.986 -23.536 1.00 36.12  ? 117 SER A HG   1 
ATOM   1653  N N    . LEU A 1 118 ? -10.090 -15.881 -26.150 1.00 24.05  ? 118 LEU A N    1 
ATOM   1654  C CA   . LEU A 1 118 ? -9.542  -14.691 -26.800 1.00 29.01  ? 118 LEU A CA   1 
ATOM   1655  C C    . LEU A 1 118 ? -8.474  -14.022 -25.948 1.00 30.91  ? 118 LEU A C    1 
ATOM   1656  O O    . LEU A 1 118 ? -7.945  -12.970 -26.334 1.00 32.91  ? 118 LEU A O    1 
ATOM   1657  C CB   . LEU A 1 118 ? -10.667 -13.684 -27.090 1.00 21.98  ? 118 LEU A CB   1 
ATOM   1658  C CG   . LEU A 1 118 ? -11.606 -14.022 -28.251 1.00 25.41  ? 118 LEU A CG   1 
ATOM   1659  C CD1  . LEU A 1 118 ? -12.086 -15.444 -28.249 1.00 27.99  ? 118 LEU A CD1  1 
ATOM   1660  C CD2  . LEU A 1 118 ? -12.801 -13.086 -28.236 1.00 32.39  ? 118 LEU A CD2  1 
ATOM   1661  H H    . LEU A 1 118 ? -10.662 -15.685 -25.539 1.00 28.82  ? 118 LEU A H    1 
ATOM   1662  H HA   . LEU A 1 118 ? -9.140  -14.946 -27.645 1.00 34.77  ? 118 LEU A HA   1 
ATOM   1663  H HB2  . LEU A 1 118 ? -11.214 -13.602 -26.293 1.00 26.34  ? 118 LEU A HB2  1 
ATOM   1664  H HB3  . LEU A 1 118 ? -10.262 -12.825 -27.290 1.00 26.34  ? 118 LEU A HB3  1 
ATOM   1665  H HG   . LEU A 1 118 ? -11.130 -13.876 -29.084 1.00 30.45  ? 118 LEU A HG   1 
ATOM   1666  H HD11 . LEU A 1 118 ? -12.672 -15.580 -29.010 1.00 33.54  ? 118 LEU A HD11 1 
ATOM   1667  H HD12 . LEU A 1 118 ? -11.319 -16.035 -28.311 1.00 33.54  ? 118 LEU A HD12 1 
ATOM   1668  H HD13 . LEU A 1 118 ? -12.568 -15.612 -27.424 1.00 33.54  ? 118 LEU A HD13 1 
ATOM   1669  H HD21 . LEU A 1 118 ? -13.387 -13.312 -28.976 1.00 38.82  ? 118 LEU A HD21 1 
ATOM   1670  H HD22 . LEU A 1 118 ? -13.273 -13.191 -27.395 1.00 38.82  ? 118 LEU A HD22 1 
ATOM   1671  H HD23 . LEU A 1 118 ? -12.487 -12.173 -28.328 1.00 38.82  ? 118 LEU A HD23 1 
ATOM   1672  N N    . ILE A 1 119 ? -8.167  -14.604 -24.784 1.00 25.00  ? 119 ILE A N    1 
ATOM   1673  C CA   . ILE A 1 119 ? -7.239  -14.037 -23.815 1.00 26.75  ? 119 ILE A CA   1 
ATOM   1674  C C    . ILE A 1 119 ? -5.822  -14.201 -24.346 1.00 24.14  ? 119 ILE A C    1 
ATOM   1675  O O    . ILE A 1 119 ? -5.350  -15.329 -24.523 1.00 27.71  ? 119 ILE A O    1 
ATOM   1676  C CB   . ILE A 1 119 ? -7.398  -14.731 -22.450 1.00 26.33  ? 119 ILE A CB   1 
ATOM   1677  C CG1  . ILE A 1 119 ? -8.842  -14.598 -21.943 1.00 30.27  ? 119 ILE A CG1  1 
ATOM   1678  C CG2  . ILE A 1 119 ? -6.376  -14.163 -21.456 1.00 28.38  ? 119 ILE A CG2  1 
ATOM   1679  C CD1  . ILE A 1 119 ? -9.172  -15.475 -20.711 1.00 35.55  ? 119 ILE A CD1  1 
ATOM   1680  H H    . ILE A 1 119 ? -8.500  -15.355 -24.530 1.00 29.95  ? 119 ILE A H    1 
ATOM   1681  H HA   . ILE A 1 119 ? -7.421  -13.090 -23.704 1.00 32.06  ? 119 ILE A HA   1 
ATOM   1682  H HB   . ILE A 1 119 ? -7.207  -15.675 -22.569 1.00 31.56  ? 119 ILE A HB   1 
ATOM   1683  H HG12 . ILE A 1 119 ? -9.000  -13.673 -21.697 1.00 36.28  ? 119 ILE A HG12 1 
ATOM   1684  H HG13 . ILE A 1 119 ? -9.446  -14.854 -22.657 1.00 36.28  ? 119 ILE A HG13 1 
ATOM   1685  H HG21 . ILE A 1 119 ? -6.486  -14.608 -20.601 1.00 34.01  ? 119 ILE A HG21 1 
ATOM   1686  H HG22 . ILE A 1 119 ? -5.482  -14.319 -21.798 1.00 34.01  ? 119 ILE A HG22 1 
ATOM   1687  H HG23 . ILE A 1 119 ? -6.530  -13.210 -21.355 1.00 34.01  ? 119 ILE A HG23 1 
ATOM   1688  H HD11 . ILE A 1 119 ? -10.097 -15.329 -20.460 1.00 42.62  ? 119 ILE A HD11 1 
ATOM   1689  H HD12 . ILE A 1 119 ? -9.033  -16.407 -20.942 1.00 42.62  ? 119 ILE A HD12 1 
ATOM   1690  H HD13 . ILE A 1 119 ? -8.586  -15.224 -19.980 1.00 42.62  ? 119 ILE A HD13 1 
ATOM   1691  N N    . LYS A 1 120 ? -5.116  -13.085 -24.542 1.00 35.45  ? 120 LYS A N    1 
ATOM   1692  C CA   . LYS A 1 120 ? -3.824  -13.074 -25.234 1.00 36.50  ? 120 LYS A CA   1 
ATOM   1693  C C    . LYS A 1 120 ? -2.745  -12.637 -24.255 1.00 42.34  ? 120 LYS A C    1 
ATOM   1694  O O    . LYS A 1 120 ? -2.854  -11.566 -23.652 1.00 55.78  ? 120 LYS A O    1 
ATOM   1695  C CB   . LYS A 1 120 ? -3.876  -12.145 -26.463 1.00 31.49  ? 120 LYS A CB   1 
ATOM   1696  C CG   . LYS A 1 120 ? -2.735  -12.340 -27.448 1.00 39.20  ? 120 LYS A CG   1 
ATOM   1697  C CD   . LYS A 1 120 ? -3.103  -11.981 -28.908 1.00 39.54  ? 120 LYS A CD   1 
ATOM   1698  C CE   . LYS A 1 120 ? -3.326  -10.508 -29.133 1.00 41.14  ? 120 LYS A CE   1 
ATOM   1699  N NZ   . LYS A 1 120 ? -3.596  -10.227 -30.596 1.00 30.38  ? 120 LYS A NZ   1 
ATOM   1700  H H    . LYS A 1 120 ? -5.370  -12.307 -24.277 1.00 42.50  ? 120 LYS A H    1 
ATOM   1701  H HA   . LYS A 1 120 ? -3.615  -13.971 -25.539 1.00 43.76  ? 120 LYS A HA   1 
ATOM   1702  H HB2  . LYS A 1 120 ? -4.706  -12.306 -26.939 1.00 37.75  ? 120 LYS A HB2  1 
ATOM   1703  H HB3  . LYS A 1 120 ? -3.847  -11.225 -26.158 1.00 37.75  ? 120 LYS A HB3  1 
ATOM   1704  H HG2  . LYS A 1 120 ? -1.992  -11.776 -27.182 1.00 47.00  ? 120 LYS A HG2  1 
ATOM   1705  H HG3  . LYS A 1 120 ? -2.464  -13.271 -27.431 1.00 47.00  ? 120 LYS A HG3  1 
ATOM   1706  H HD2  . LYS A 1 120 ? -2.382  -12.264 -29.491 1.00 47.40  ? 120 LYS A HD2  1 
ATOM   1707  H HD3  . LYS A 1 120 ? -3.921  -12.444 -29.148 1.00 47.40  ? 120 LYS A HD3  1 
ATOM   1708  H HE2  . LYS A 1 120 ? -4.093  -10.214 -28.618 1.00 49.33  ? 120 LYS A HE2  1 
ATOM   1709  H HE3  . LYS A 1 120 ? -2.532  -10.017 -28.869 1.00 49.33  ? 120 LYS A HE3  1 
ATOM   1710  H HZ1  . LYS A 1 120 ? -2.903  -10.489 -31.089 1.00 36.41  ? 120 LYS A HZ1  1 
ATOM   1711  H HZ2  . LYS A 1 120 ? -4.323  -10.668 -30.861 1.00 36.41  ? 120 LYS A HZ2  1 
ATOM   1712  H HZ3  . LYS A 1 120 ? -3.727  -9.355  -30.719 1.00 36.41  ? 120 LYS A HZ3  1 
ATOM   1713  N N    . GLY A 1 121 ? -1.756  -13.466 -24.084 1.00 48.02  ? 121 GLY A N    1 
ATOM   1714  C CA   . GLY A 1 121 ? -0.718  -13.182 -23.138 1.00 60.81  ? 121 GLY A CA   1 
ATOM   1715  C C    . GLY A 1 121 ? -0.300  -14.452 -22.423 1.00 61.41  ? 121 GLY A C    1 
ATOM   1716  O O    . GLY A 1 121 ? -0.641  -15.521 -22.858 1.00 59.75  ? 121 GLY A O    1 
ATOM   1717  H H    . GLY A 1 121 ? -1.659  -14.209 -24.507 1.00 57.58  ? 121 GLY A H    1 
ATOM   1718  H HA2  . GLY A 1 121 ? 0.052   -12.809 -23.595 1.00 72.94  ? 121 GLY A HA2  1 
ATOM   1719  H HA3  . GLY A 1 121 ? -1.035  -12.541 -22.482 1.00 72.94  ? 121 GLY A HA3  1 
ATOM   1720  N N    . LEU A 1 129 ? 5.655   -21.269 -18.468 1.00 50.48  ? 129 LEU A N    1 
ATOM   1721  C CA   . LEU A 1 129 ? 4.645   -20.684 -19.323 1.00 49.08  ? 129 LEU A CA   1 
ATOM   1722  C C    . LEU A 1 129 ? 3.536   -21.726 -19.405 1.00 49.90  ? 129 LEU A C    1 
ATOM   1723  O O    . LEU A 1 129 ? 3.811   -22.883 -19.580 1.00 59.18  ? 129 LEU A O    1 
ATOM   1724  C CB   . LEU A 1 129 ? 5.178   -20.400 -20.736 1.00 46.92  ? 129 LEU A CB   1 
ATOM   1725  C CG   . LEU A 1 129 ? 6.354   -19.468 -21.029 1.00 50.10  ? 129 LEU A CG   1 
ATOM   1726  C CD1  . LEU A 1 129 ? 7.062   -19.775 -22.311 1.00 50.47  ? 129 LEU A CD1  1 
ATOM   1727  C CD2  . LEU A 1 129 ? 5.918   -18.048 -21.133 1.00 52.56  ? 129 LEU A CD2  1 
ATOM   1728  H H    . LEU A 1 129 ? 5.347   -21.842 -17.905 1.00 60.54  ? 129 LEU A H    1 
ATOM   1729  H HA   . LEU A 1 129 ? 4.325   -19.847 -18.928 1.00 58.86  ? 129 LEU A HA   1 
ATOM   1730  H HB2  . LEU A 1 129 ? 5.425   -21.258 -21.116 1.00 56.26  ? 129 LEU A HB2  1 
ATOM   1731  H HB3  . LEU A 1 129 ? 4.433   -20.047 -21.247 1.00 56.26  ? 129 LEU A HB3  1 
ATOM   1732  H HG   . LEU A 1 129 ? 6.998   -19.533 -20.306 1.00 60.08  ? 129 LEU A HG   1 
ATOM   1733  H HD11 . LEU A 1 129 ? 7.706   -19.085 -22.485 1.00 60.52  ? 129 LEU A HD11 1 
ATOM   1734  H HD12 . LEU A 1 129 ? 7.505   -20.623 -22.227 1.00 60.52  ? 129 LEU A HD12 1 
ATOM   1735  H HD13 . LEU A 1 129 ? 6.418   -19.811 -23.022 1.00 60.52  ? 129 LEU A HD13 1 
ATOM   1736  H HD21 . LEU A 1 129 ? 6.683   -17.499 -21.315 1.00 63.03  ? 129 LEU A HD21 1 
ATOM   1737  H HD22 . LEU A 1 129 ? 5.280   -17.969 -21.846 1.00 63.03  ? 129 LEU A HD22 1 
ATOM   1738  H HD23 . LEU A 1 129 ? 5.515   -17.784 -20.303 1.00 63.03  ? 129 LEU A HD23 1 
ATOM   1739  N N    . LYS A 1 130 ? 2.314   -21.362 -19.177 1.00 39.16  ? 130 LYS A N    1 
ATOM   1740  C CA   . LYS A 1 130 ? 1.264   -22.304 -19.330 1.00 32.29  ? 130 LYS A CA   1 
ATOM   1741  C C    . LYS A 1 130 ? 0.231   -21.568 -20.077 1.00 24.59  ? 130 LYS A C    1 
ATOM   1742  O O    . LYS A 1 130 ? -0.095  -20.480 -19.749 1.00 24.01  ? 130 LYS A O    1 
ATOM   1743  C CB   . LYS A 1 130 ? 0.710   -22.838 -18.019 1.00 39.12  ? 130 LYS A CB   1 
ATOM   1744  C CG   . LYS A 1 130 ? -0.508  -23.702 -18.261 1.00 42.50  ? 130 LYS A CG   1 
ATOM   1745  C CD   . LYS A 1 130 ? -0.701  -24.747 -17.204 1.00 49.14  ? 130 LYS A CD   1 
ATOM   1746  C CE   . LYS A 1 130 ? -1.811  -25.687 -17.558 1.00 45.70  ? 130 LYS A CE   1 
ATOM   1747  N NZ   . LYS A 1 130 ? -1.379  -26.772 -18.451 1.00 46.47  ? 130 LYS A NZ   1 
ATOM   1748  H H    . LYS A 1 130 ? 2.048   -20.581 -18.932 1.00 46.95  ? 130 LYS A H    1 
ATOM   1749  H HA   . LYS A 1 130 ? 1.571   -23.059 -19.874 1.00 38.70  ? 130 LYS A HA   1 
ATOM   1750  H HB2  . LYS A 1 130 ? 1.385   -23.378 -17.579 1.00 46.90  ? 130 LYS A HB2  1 
ATOM   1751  H HB3  . LYS A 1 130 ? 0.450   -22.095 -17.452 1.00 46.90  ? 130 LYS A HB3  1 
ATOM   1752  H HG2  . LYS A 1 130 ? -1.297  -23.138 -18.272 1.00 50.96  ? 130 LYS A HG2  1 
ATOM   1753  H HG3  . LYS A 1 130 ? -0.410  -24.153 -19.114 1.00 50.96  ? 130 LYS A HG3  1 
ATOM   1754  H HD2  . LYS A 1 130 ? 0.115   -25.263 -17.111 1.00 58.93  ? 130 LYS A HD2  1 
ATOM   1755  H HD3  . LYS A 1 130 ? -0.924  -24.316 -16.364 1.00 58.93  ? 130 LYS A HD3  1 
ATOM   1756  H HE2  . LYS A 1 130 ? -2.157  -26.088 -16.745 1.00 54.80  ? 130 LYS A HE2  1 
ATOM   1757  H HE3  . LYS A 1 130 ? -2.513  -25.191 -18.008 1.00 54.80  ? 130 LYS A HE3  1 
ATOM   1758  H HZ1  . LYS A 1 130 ? -2.114  -27.362 -18.631 1.00 55.72  ? 130 LYS A HZ1  1 
ATOM   1759  H HZ2  . LYS A 1 130 ? -1.061  -26.407 -19.280 1.00 55.72  ? 130 LYS A HZ2  1 
ATOM   1760  H HZ3  . LYS A 1 130 ? -0.671  -27.273 -18.039 1.00 55.72  ? 130 LYS A HZ3  1 
ATOM   1761  N N    . LEU A 1 131 ? -0.278  -22.217 -21.084 1.00 26.95  ? 131 LEU A N    1 
ATOM   1762  C CA   . LEU A 1 131 ? -1.286  -21.610 -21.948 1.00 26.25  ? 131 LEU A CA   1 
ATOM   1763  C C    . LEU A 1 131 ? -2.620  -21.416 -21.247 1.00 32.56  ? 131 LEU A C    1 
ATOM   1764  O O    . LEU A 1 131 ? -3.157  -22.347 -20.641 1.00 25.39  ? 131 LEU A O    1 
ATOM   1765  C CB   . LEU A 1 131 ? -1.516  -22.491 -23.156 1.00 23.42  ? 131 LEU A CB   1 
ATOM   1766  C CG   . LEU A 1 131 ? -0.336  -22.579 -24.114 1.00 34.75  ? 131 LEU A CG   1 
ATOM   1767  C CD1  . LEU A 1 131 ? -0.688  -23.513 -25.279 1.00 35.34  ? 131 LEU A CD1  1 
ATOM   1768  C CD2  . LEU A 1 131 ? 0.065   -21.190 -24.604 1.00 32.65  ? 131 LEU A CD2  1 
ATOM   1769  H H    . LEU A 1 131 ? -0.086  -23.026 -21.302 1.00 32.30  ? 131 LEU A H    1 
ATOM   1770  H HA   . LEU A 1 131 ? -0.971  -20.745 -22.254 1.00 31.45  ? 131 LEU A HA   1 
ATOM   1771  H HB2  . LEU A 1 131 ? -1.712  -23.391 -22.850 1.00 28.07  ? 131 LEU A HB2  1 
ATOM   1772  H HB3  . LEU A 1 131 ? -2.273  -22.144 -23.653 1.00 28.07  ? 131 LEU A HB3  1 
ATOM   1773  H HG   . LEU A 1 131 ? 0.423   -22.960 -23.645 1.00 41.66  ? 131 LEU A HG   1 
ATOM   1774  H HD11 . LEU A 1 131 ? 0.069   -23.562 -25.884 1.00 42.37  ? 131 LEU A HD11 1 
ATOM   1775  H HD12 . LEU A 1 131 ? -0.889  -24.394 -24.927 1.00 42.37  ? 131 LEU A HD12 1 
ATOM   1776  H HD13 . LEU A 1 131 ? -1.461  -23.158 -25.745 1.00 42.37  ? 131 LEU A HD13 1 
ATOM   1777  H HD21 . LEU A 1 131 ? 0.817   -21.275 -25.211 1.00 39.14  ? 131 LEU A HD21 1 
ATOM   1778  H HD22 . LEU A 1 131 ? -0.688  -20.788 -25.064 1.00 39.14  ? 131 LEU A HD22 1 
ATOM   1779  H HD23 . LEU A 1 131 ? 0.316   -20.647 -23.841 1.00 39.14  ? 131 LEU A HD23 1 
ATOM   1780  N N    . ILE A 1 132 ? -3.203  -20.226 -21.414 1.00 34.08  ? 132 ILE A N    1 
ATOM   1781  C CA   . ILE A 1 132 ? -4.456  -19.913 -20.727 1.00 36.80  ? 132 ILE A CA   1 
ATOM   1782  C C    . ILE A 1 132 ? -5.576  -20.862 -21.149 1.00 30.02  ? 132 ILE A C    1 
ATOM   1783  O O    . ILE A 1 132 ? -6.431  -21.225 -20.336 1.00 32.19  ? 132 ILE A O    1 
ATOM   1784  C CB   . ILE A 1 132 ? -4.869  -18.446 -20.957 1.00 36.43  ? 132 ILE A CB   1 
ATOM   1785  C CG1  . ILE A 1 132 ? -3.752  -17.494 -20.529 1.00 41.33  ? 132 ILE A CG1  1 
ATOM   1786  C CG2  . ILE A 1 132 ? -6.178  -18.153 -20.186 1.00 34.43  ? 132 ILE A CG2  1 
ATOM   1787  C CD1  . ILE A 1 132 ? -3.368  -17.633 -19.124 1.00 57.30  ? 132 ILE A CD1  1 
ATOM   1788  H H    . ILE A 1 132 ? -2.898  -19.593 -21.911 1.00 40.86  ? 132 ILE A H    1 
ATOM   1789  H HA   . ILE A 1 132 ? -4.320  -20.031 -19.773 1.00 44.12  ? 132 ILE A HA   1 
ATOM   1790  H HB   . ILE A 1 132 ? -5.035  -18.318 -21.904 1.00 43.67  ? 132 ILE A HB   1 
ATOM   1791  H HG12 . ILE A 1 132 ? -2.967  -17.669 -21.070 1.00 49.55  ? 132 ILE A HG12 1 
ATOM   1792  H HG13 . ILE A 1 132 ? -4.049  -16.581 -20.667 1.00 49.55  ? 132 ILE A HG13 1 
ATOM   1793  H HG21 . ILE A 1 132 ? -6.432  -17.229 -20.335 1.00 41.28  ? 132 ILE A HG21 1 
ATOM   1794  H HG22 . ILE A 1 132 ? -6.874  -18.745 -20.511 1.00 41.28  ? 132 ILE A HG22 1 
ATOM   1795  H HG23 . ILE A 1 132 ? -6.027  -18.307 -19.240 1.00 41.28  ? 132 ILE A HG23 1 
ATOM   1796  H HD11 . ILE A 1 132 ? -2.659  -17.001 -18.927 1.00 68.72  ? 132 ILE A HD11 1 
ATOM   1797  H HD12 . ILE A 1 132 ? -4.140  -17.449 -18.566 1.00 68.72  ? 132 ILE A HD12 1 
ATOM   1798  H HD13 . ILE A 1 132 ? -3.056  -18.539 -18.970 1.00 68.72  ? 132 ILE A HD13 1 
ATOM   1799  N N    . SER A 1 133 ? -5.631  -21.230 -22.428 1.00 26.36  ? 133 SER A N    1 
ATOM   1800  C CA   . SER A 1 133 ? -6.674  -22.161 -22.871 1.00 30.29  ? 133 SER A CA   1 
ATOM   1801  C C    . SER A 1 133 ? -6.601  -23.485 -22.119 1.00 35.75  ? 133 SER A C    1 
ATOM   1802  O O    . SER A 1 133 ? -7.639  -24.135 -21.881 1.00 34.06  ? 133 SER A O    1 
ATOM   1803  C CB   . SER A 1 133 ? -6.554  -22.414 -24.383 1.00 30.08  ? 133 SER A CB   1 
ATOM   1804  O OG   . SER A 1 133 ? -5.415  -23.184 -24.683 1.00 30.04  ? 133 SER A OG   1 
ATOM   1805  H H    . SER A 1 133 ? -5.094  -20.965 -23.045 1.00 31.59  ? 133 SER A H    1 
ATOM   1806  H HA   . SER A 1 133 ? -7.544  -21.766 -22.700 1.00 36.30  ? 133 SER A HA   1 
ATOM   1807  H HB2  . SER A 1 133 ? -7.344  -22.889 -24.686 1.00 36.05  ? 133 SER A HB2  1 
ATOM   1808  H HB3  . SER A 1 133 ? -6.487  -21.561 -24.840 1.00 36.05  ? 133 SER A HB3  1 
ATOM   1809  H HG   . SER A 1 133 ? -4.723  -22.784 -24.427 1.00 36.01  ? 133 SER A HG   1 
ATOM   1810  N N    . GLU A 1 134 ? -5.385  -23.907 -21.754 1.00 36.04  ? 134 GLU A N    1 
ATOM   1811  C CA   . GLU A 1 134 ? -5.204  -25.126 -20.968 1.00 32.31  ? 134 GLU A CA   1 
ATOM   1812  C C    . GLU A 1 134 ? -5.610  -24.912 -19.529 1.00 32.54  ? 134 GLU A C    1 
ATOM   1813  O O    . GLU A 1 134 ? -6.143  -25.825 -18.895 1.00 33.85  ? 134 GLU A O    1 
ATOM   1814  C CB   . GLU A 1 134 ? -3.753  -25.611 -21.020 1.00 39.17  ? 134 GLU A CB   1 
ATOM   1815  C CG   . GLU A 1 134 ? -3.389  -26.402 -22.294 1.00 40.62  ? 134 GLU A CG   1 
ATOM   1816  C CD   . GLU A 1 134 ? -1.899  -26.697 -22.372 1.00 45.02  ? 134 GLU A CD   1 
ATOM   1817  O OE1  . GLU A 1 134 ? -1.229  -26.564 -21.309 1.00 30.60  ? 134 GLU A OE1  1 
ATOM   1818  O OE2  . GLU A 1 134 ? -1.415  -27.051 -23.477 1.00 38.14  ? 134 GLU A OE2  1 
ATOM   1819  H H    . GLU A 1 134 ? -4.651  -23.504 -21.950 1.00 43.21  ? 134 GLU A H    1 
ATOM   1820  H HA   . GLU A 1 134 ? -5.766  -25.824 -21.337 1.00 38.73  ? 134 GLU A HA   1 
ATOM   1821  H HB2  . GLU A 1 134 ? -3.166  -24.840 -20.974 1.00 46.96  ? 134 GLU A HB2  1 
ATOM   1822  H HB3  . GLU A 1 134 ? -3.592  -26.190 -20.258 1.00 46.96  ? 134 GLU A HB3  1 
ATOM   1823  H HG2  . GLU A 1 134 ? -3.865  -27.247 -22.291 1.00 48.70  ? 134 GLU A HG2  1 
ATOM   1824  H HG3  . GLU A 1 134 ? -3.636  -25.881 -23.074 1.00 48.70  ? 134 GLU A HG3  1 
ATOM   1825  N N    . VAL A 1 135 ? -5.331  -23.742 -18.970 1.00 34.67  ? 135 VAL A N    1 
ATOM   1826  C CA   . VAL A 1 135 ? -5.819  -23.503 -17.621 1.00 30.66  ? 135 VAL A CA   1 
ATOM   1827  C C    . VAL A 1 135 ? -7.342  -23.608 -17.618 1.00 37.94  ? 135 VAL A C    1 
ATOM   1828  O O    . VAL A 1 135 ? -7.927  -24.259 -16.748 1.00 32.86  ? 135 VAL A O    1 
ATOM   1829  C CB   . VAL A 1 135 ? -5.330  -22.143 -17.097 1.00 26.21  ? 135 VAL A CB   1 
ATOM   1830  C CG1  . VAL A 1 135 ? -5.826  -21.900 -15.673 1.00 44.84  ? 135 VAL A CG1  1 
ATOM   1831  C CG2  . VAL A 1 135 ? -3.776  -22.051 -17.174 1.00 33.84  ? 135 VAL A CG2  1 
ATOM   1832  H H    . VAL A 1 135 ? -4.885  -23.100 -19.328 1.00 41.56  ? 135 VAL A H    1 
ATOM   1833  H HA   . VAL A 1 135 ? -5.471  -24.191 -17.033 1.00 36.75  ? 135 VAL A HA   1 
ATOM   1834  H HB   . VAL A 1 135 ? -5.696  -21.443 -17.661 1.00 31.42  ? 135 VAL A HB   1 
ATOM   1835  H HG11 . VAL A 1 135 ? -5.504  -21.037 -15.369 1.00 53.76  ? 135 VAL A HG11 1 
ATOM   1836  H HG12 . VAL A 1 135 ? -6.796  -21.911 -15.670 1.00 53.76  ? 135 VAL A HG12 1 
ATOM   1837  H HG13 . VAL A 1 135 ? -5.486  -22.603 -15.096 1.00 53.76  ? 135 VAL A HG13 1 
ATOM   1838  H HG21 . VAL A 1 135 ? -3.495  -21.185 -16.839 1.00 40.56  ? 135 VAL A HG21 1 
ATOM   1839  H HG22 . VAL A 1 135 ? -3.391  -22.757 -16.632 1.00 40.56  ? 135 VAL A HG22 1 
ATOM   1840  H HG23 . VAL A 1 135 ? -3.499  -22.154 -18.098 1.00 40.56  ? 135 VAL A HG23 1 
ATOM   1841  N N    . ILE A 1 136 ? -7.998  -23.066 -18.656 1.00 32.87  ? 136 ILE A N    1 
ATOM   1842  C CA   . ILE A 1 136 ? -9.464  -23.038 -18.681 1.00 29.17  ? 136 ILE A CA   1 
ATOM   1843  C C    . ILE A 1 136 ? -10.016 -24.432 -18.922 1.00 27.94  ? 136 ILE A C    1 
ATOM   1844  O O    . ILE A 1 136 ? -10.966 -24.863 -18.260 1.00 34.05  ? 136 ILE A O    1 
ATOM   1845  C CB   . ILE A 1 136 ? -9.972  -22.069 -19.763 1.00 31.15  ? 136 ILE A CB   1 
ATOM   1846  C CG1  . ILE A 1 136 ? -9.645  -20.629 -19.416 1.00 33.44  ? 136 ILE A CG1  1 
ATOM   1847  C CG2  . ILE A 1 136 ? -11.525 -22.253 -19.962 1.00 29.02  ? 136 ILE A CG2  1 
ATOM   1848  C CD1  . ILE A 1 136 ? -9.710  -19.745 -20.630 1.00 31.40  ? 136 ILE A CD1  1 
ATOM   1849  H H    . ILE A 1 136 ? -7.623  -22.714 -19.345 1.00 39.40  ? 136 ILE A H    1 
ATOM   1850  H HA   . ILE A 1 136 ? -9.790  -22.729 -17.821 1.00 34.96  ? 136 ILE A HA   1 
ATOM   1851  H HB   . ILE A 1 136 ? -9.531  -22.288 -20.598 1.00 37.34  ? 136 ILE A HB   1 
ATOM   1852  H HG12 . ILE A 1 136 ? -10.286 -20.302 -18.766 1.00 40.08  ? 136 ILE A HG12 1 
ATOM   1853  H HG13 . ILE A 1 136 ? -8.746  -20.582 -19.054 1.00 40.08  ? 136 ILE A HG13 1 
ATOM   1854  H HG21 . ILE A 1 136 ? -11.830 -21.636 -20.645 1.00 34.78  ? 136 ILE A HG21 1 
ATOM   1855  H HG22 . ILE A 1 136 ? -11.701 -23.166 -20.236 1.00 34.78  ? 136 ILE A HG22 1 
ATOM   1856  H HG23 . ILE A 1 136 ? -11.974 -22.066 -19.123 1.00 34.78  ? 136 ILE A HG23 1 
ATOM   1857  H HD11 . ILE A 1 136 ? -9.496  -18.836 -20.370 1.00 37.64  ? 136 ILE A HD11 1 
ATOM   1858  H HD12 . ILE A 1 136 ? -9.070  -20.062 -21.286 1.00 37.64  ? 136 ILE A HD12 1 
ATOM   1859  H HD13 . ILE A 1 136 ? -10.607 -19.782 -20.999 1.00 37.64  ? 136 ILE A HD13 1 
ATOM   1860  N N    . GLY A 1 137 ? -9.464  -25.129 -19.928 1.00 29.04  ? 137 GLY A N    1 
ATOM   1861  C CA   . GLY A 1 137 ? -9.977  -26.428 -20.310 1.00 37.90  ? 137 GLY A CA   1 
ATOM   1862  C C    . GLY A 1 137 ? -9.790  -27.477 -19.229 1.00 38.63  ? 137 GLY A C    1 
ATOM   1863  O O    . GLY A 1 137 ? -10.629 -28.381 -19.086 1.00 26.48  ? 137 GLY A O    1 
ATOM   1864  H H    . GLY A 1 137 ? -8.794  -24.862 -20.396 1.00 34.80  ? 137 GLY A H    1 
ATOM   1865  H HA2  . GLY A 1 137 ? -10.924 -26.355 -20.505 1.00 45.44  ? 137 GLY A HA2  1 
ATOM   1866  H HA3  . GLY A 1 137 ? -9.521  -26.730 -21.111 1.00 45.44  ? 137 GLY A HA3  1 
ATOM   1867  N N    . GLU A 1 138 ? -8.695  -27.370 -18.462 1.00 32.64  ? 138 GLU A N    1 
ATOM   1868  C CA   . GLU A 1 138 ? -8.413  -28.320 -17.388 1.00 34.28  ? 138 GLU A CA   1 
ATOM   1869  C C    . GLU A 1 138 ? -9.324  -28.079 -16.195 1.00 30.42  ? 138 GLU A C    1 
ATOM   1870  O O    . GLU A 1 138 ? -9.929  -29.025 -15.665 1.00 37.10  ? 138 GLU A O    1 
ATOM   1871  C CB   . GLU A 1 138 ? -6.931  -28.239 -16.977 1.00 30.74  ? 138 GLU A CB   1 
ATOM   1872  C CG   . GLU A 1 138 ? -5.984  -28.933 -18.028 1.00 43.11  ? 138 GLU A CG   1 
ATOM   1873  C CD   . GLU A 1 138 ? -4.493  -28.612 -17.881 1.00 40.63  ? 138 GLU A CD   1 
ATOM   1874  O OE1  . GLU A 1 138 ? -4.085  -28.080 -16.822 1.00 44.26  ? 138 GLU A OE1  1 
ATOM   1875  O OE2  . GLU A 1 138 ? -3.729  -28.878 -18.848 1.00 45.44  ? 138 GLU A OE2  1 
ATOM   1876  H H    . GLU A 1 138 ? -8.103  -26.753 -18.548 1.00 39.12  ? 138 GLU A H    1 
ATOM   1877  H HA   . GLU A 1 138 ? -8.582  -29.218 -17.712 1.00 41.09  ? 138 GLU A HA   1 
ATOM   1878  H HB2  . GLU A 1 138 ? -6.671  -27.307 -16.906 1.00 36.84  ? 138 GLU A HB2  1 
ATOM   1879  H HB3  . GLU A 1 138 ? -6.812  -28.684 -16.123 1.00 36.84  ? 138 GLU A HB3  1 
ATOM   1880  H HG2  . GLU A 1 138 ? -6.084  -29.894 -17.945 1.00 51.69  ? 138 GLU A HG2  1 
ATOM   1881  H HG3  . GLU A 1 138 ? -6.255  -28.655 -18.917 1.00 51.69  ? 138 GLU A HG3  1 
ATOM   1882  N N    . ARG A 1 139 ? -9.468  -26.818 -15.771 1.00 32.92  ? 139 ARG A N    1 
ATOM   1883  C CA   . ARG A 1 139 ? -10.351 -26.528 -14.638 1.00 28.96  ? 139 ARG A CA   1 
ATOM   1884  C C    . ARG A 1 139 ? -11.811 -26.866 -14.954 1.00 32.82  ? 139 ARG A C    1 
ATOM   1885  O O    . ARG A 1 139 ? -12.509 -27.455 -14.132 1.00 34.05  ? 139 ARG A O    1 
ATOM   1886  C CB   . ARG A 1 139 ? -10.227 -25.067 -14.237 1.00 38.05  ? 139 ARG A CB   1 
ATOM   1887  C CG   . ARG A 1 139 ? -8.863  -24.689 -13.765 1.00 53.13  ? 139 ARG A CG   1 
ATOM   1888  C CD   . ARG A 1 139 ? -8.922  -23.825 -12.521 1.00 53.24  ? 139 ARG A CD   1 
ATOM   1889  N NE   . ARG A 1 139 ? -7.597  -23.259 -12.264 1.00 53.25  ? 139 ARG A NE   1 
ATOM   1890  C CZ   . ARG A 1 139 ? -7.374  -22.041 -11.789 1.00 55.60  ? 139 ARG A CZ   1 
ATOM   1891  N NH1  . ARG A 1 139 ? -8.387  -21.231 -11.518 1.00 51.64  ? 139 ARG A NH1  1 
ATOM   1892  N NH2  . ARG A 1 139 ? -6.129  -21.621 -11.601 1.00 63.71  ? 139 ARG A NH2  1 
ATOM   1893  H H    . ARG A 1 139 ? -9.078  -26.132 -16.112 1.00 39.46  ? 139 ARG A H    1 
ATOM   1894  H HA   . ARG A 1 139 ? -10.077 -27.069 -13.881 1.00 34.71  ? 139 ARG A HA   1 
ATOM   1895  H HB2  . ARG A 1 139 ? -10.439 -24.513 -15.005 1.00 45.62  ? 139 ARG A HB2  1 
ATOM   1896  H HB3  . ARG A 1 139 ? -10.851 -24.886 -13.518 1.00 45.62  ? 139 ARG A HB3  1 
ATOM   1897  H HG2  . ARG A 1 139 ? -8.364  -25.493 -13.552 1.00 63.71  ? 139 ARG A HG2  1 
ATOM   1898  H HG3  . ARG A 1 139 ? -8.411  -24.187 -14.461 1.00 63.71  ? 139 ARG A HG3  1 
ATOM   1899  H HD2  . ARG A 1 139 ? -9.550  -23.098 -12.656 1.00 63.84  ? 139 ARG A HD2  1 
ATOM   1900  H HD3  . ARG A 1 139 ? -9.182  -24.366 -11.759 1.00 63.84  ? 139 ARG A HD3  1 
ATOM   1901  H HE   . ARG A 1 139 ? -6.913  -23.753 -12.433 1.00 63.86  ? 139 ARG A HE   1 
ATOM   1902  H HH11 . ARG A 1 139 ? -9.196  -21.498 -11.642 1.00 61.92  ? 139 ARG A HH11 1 
ATOM   1903  H HH12 . ARG A 1 139 ? -8.237  -20.442 -11.211 1.00 61.92  ? 139 ARG A HH12 1 
ATOM   1904  H HH21 . ARG A 1 139 ? -5.468  -22.143 -11.777 1.00 76.41  ? 139 ARG A HH21 1 
ATOM   1905  H HH22 . ARG A 1 139 ? -5.983  -20.831 -11.293 1.00 76.41  ? 139 ARG A HH22 1 
ATOM   1906  N N    . LEU A 1 140 ? -12.300 -26.492 -16.136 1.00 30.60  ? 140 LEU A N    1 
ATOM   1907  C CA   . LEU A 1 140 ? -13.695 -26.729 -16.491 1.00 31.36  ? 140 LEU A CA   1 
ATOM   1908  C C    . LEU A 1 140 ? -13.932 -28.067 -17.177 1.00 31.45  ? 140 LEU A C    1 
ATOM   1909  O O    . LEU A 1 140 ? -15.094 -28.482 -17.309 1.00 33.94  ? 140 LEU A O    1 
ATOM   1910  C CB   . LEU A 1 140 ? -14.215 -25.612 -17.409 1.00 29.39  ? 140 LEU A CB   1 
ATOM   1911  C CG   . LEU A 1 140 ? -13.919 -24.196 -16.927 1.00 27.76  ? 140 LEU A CG   1 
ATOM   1912  C CD1  . LEU A 1 140 ? -14.474 -23.184 -17.912 1.00 29.03  ? 140 LEU A CD1  1 
ATOM   1913  C CD2  . LEU A 1 140 ? -14.457 -23.927 -15.497 1.00 30.86  ? 140 LEU A CD2  1 
ATOM   1914  H H    . LEU A 1 140 ? -11.843 -26.099 -16.750 1.00 36.68  ? 140 LEU A H    1 
ATOM   1915  H HA   . LEU A 1 140 ? -14.227 -26.716 -15.680 1.00 37.59  ? 140 LEU A HA   1 
ATOM   1916  H HB2  . LEU A 1 140 ? -13.807 -25.715 -18.283 1.00 35.22  ? 140 LEU A HB2  1 
ATOM   1917  H HB3  . LEU A 1 140 ? -15.178 -25.699 -17.487 1.00 35.22  ? 140 LEU A HB3  1 
ATOM   1918  H HG   . LEU A 1 140 ? -12.956 -24.077 -16.902 1.00 33.28  ? 140 LEU A HG   1 
ATOM   1919  H HD11 . LEU A 1 140 ? -14.277 -22.291 -17.591 1.00 34.80  ? 140 LEU A HD11 1 
ATOM   1920  H HD12 . LEU A 1 140 ? -14.058 -23.325 -18.777 1.00 34.80  ? 140 LEU A HD12 1 
ATOM   1921  H HD13 . LEU A 1 140 ? -15.434 -23.307 -17.983 1.00 34.80  ? 140 LEU A HD13 1 
ATOM   1922  H HD21 . LEU A 1 140 ? -14.241 -23.016 -15.245 1.00 36.99  ? 140 LEU A HD21 1 
ATOM   1923  H HD22 . LEU A 1 140 ? -15.419 -24.052 -15.494 1.00 36.99  ? 140 LEU A HD22 1 
ATOM   1924  H HD23 . LEU A 1 140 ? -14.039 -24.549 -14.881 1.00 36.99  ? 140 LEU A HD23 1 
ATOM   1925  N N    . GLY A 1 141 ? -12.885 -28.735 -17.659 1.00 25.87  ? 141 GLY A N    1 
ATOM   1926  C CA   . GLY A 1 141 ? -13.086 -29.961 -18.419 1.00 28.60  ? 141 GLY A CA   1 
ATOM   1927  C C    . GLY A 1 141 ? -13.920 -29.794 -19.683 1.00 38.28  ? 141 GLY A C    1 
ATOM   1928  O O    . GLY A 1 141 ? -14.859 -30.562 -19.917 1.00 38.79  ? 141 GLY A O    1 
ATOM   1929  H H    . GLY A 1 141 ? -12.063 -28.502 -17.561 1.00 31.01  ? 141 GLY A H    1 
ATOM   1930  H HA2  . GLY A 1 141 ? -12.222 -30.319 -18.675 1.00 34.28  ? 141 GLY A HA2  1 
ATOM   1931  H HA3  . GLY A 1 141 ? -13.527 -30.614 -17.853 1.00 34.28  ? 141 GLY A HA3  1 
ATOM   1932  N N    . ILE A 1 142 ? -13.611 -28.794 -20.501 1.00 32.19  ? 142 ILE A N    1 
ATOM   1933  C CA   . ILE A 1 142 ? -14.297 -28.637 -21.780 1.00 33.34  ? 142 ILE A CA   1 
ATOM   1934  C C    . ILE A 1 142 ? -13.242 -28.521 -22.878 1.00 31.91  ? 142 ILE A C    1 
ATOM   1935  O O    . ILE A 1 142 ? -12.129 -28.072 -22.608 1.00 31.28  ? 142 ILE A O    1 
ATOM   1936  C CB   . ILE A 1 142 ? -15.245 -27.422 -21.770 1.00 36.34  ? 142 ILE A CB   1 
ATOM   1937  C CG1  . ILE A 1 142 ? -14.466 -26.148 -21.621 1.00 25.53  ? 142 ILE A CG1  1 
ATOM   1938  C CG2  . ILE A 1 142 ? -16.273 -27.544 -20.623 1.00 38.04  ? 142 ILE A CG2  1 
ATOM   1939  C CD1  . ILE A 1 142 ? -15.293 -24.910 -21.685 1.00 38.50  ? 142 ILE A CD1  1 
ATOM   1940  H H    . ILE A 1 142 ? -13.013 -28.196 -20.342 1.00 38.59  ? 142 ILE A H    1 
ATOM   1941  H HA   . ILE A 1 142 ? -14.827 -29.430 -21.954 1.00 39.97  ? 142 ILE A HA   1 
ATOM   1942  H HB   . ILE A 1 142 ? -15.723 -27.396 -22.614 1.00 43.56  ? 142 ILE A HB   1 
ATOM   1943  H HG12 . ILE A 1 142 ? -14.016 -26.158 -20.762 1.00 30.59  ? 142 ILE A HG12 1 
ATOM   1944  H HG13 . ILE A 1 142 ? -13.809 -26.101 -22.333 1.00 30.59  ? 142 ILE A HG13 1 
ATOM   1945  H HG21 . ILE A 1 142 ? -16.856 -26.769 -20.639 1.00 45.60  ? 142 ILE A HG21 1 
ATOM   1946  H HG22 . ILE A 1 142 ? -16.794 -28.353 -20.751 1.00 45.60  ? 142 ILE A HG22 1 
ATOM   1947  H HG23 . ILE A 1 142 ? -15.800 -27.585 -19.778 1.00 45.60  ? 142 ILE A HG23 1 
ATOM   1948  H HD11 . ILE A 1 142 ? -14.715 -24.139 -21.580 1.00 46.15  ? 142 ILE A HD11 1 
ATOM   1949  H HD12 . ILE A 1 142 ? -15.742 -24.875 -22.544 1.00 46.15  ? 142 ILE A HD12 1 
ATOM   1950  H HD13 . ILE A 1 142 ? -15.949 -24.932 -20.970 1.00 46.15  ? 142 ILE A HD13 1 
ATOM   1951  N N    . PRO A 1 143 ? -13.534 -28.919 -24.109 1.00 33.70  ? 143 PRO A N    1 
ATOM   1952  C CA   . PRO A 1 143 ? -12.568 -28.715 -25.199 1.00 28.72  ? 143 PRO A CA   1 
ATOM   1953  C C    . PRO A 1 143 ? -12.429 -27.231 -25.478 1.00 35.23  ? 143 PRO A C    1 
ATOM   1954  O O    . PRO A 1 143 ? -13.421 -26.490 -25.460 1.00 27.87  ? 143 PRO A O    1 
ATOM   1955  C CB   . PRO A 1 143 ? -13.208 -29.442 -26.386 1.00 27.71  ? 143 PRO A CB   1 
ATOM   1956  C CG   . PRO A 1 143 ? -14.450 -30.166 -25.791 1.00 35.31  ? 143 PRO A CG   1 
ATOM   1957  C CD   . PRO A 1 143 ? -14.827 -29.399 -24.604 1.00 36.32  ? 143 PRO A CD   1 
ATOM   1958  H HA   . PRO A 1 143 ? -11.706 -29.105 -24.987 1.00 34.43  ? 143 PRO A HA   1 
ATOM   1959  H HB2  . PRO A 1 143 ? -13.476 -28.797 -27.059 1.00 33.21  ? 143 PRO A HB2  1 
ATOM   1960  H HB3  . PRO A 1 143 ? -12.580 -30.083 -26.754 1.00 33.21  ? 143 PRO A HB3  1 
ATOM   1961  H HG2  . PRO A 1 143 ? -15.169 -30.164 -26.442 1.00 42.34  ? 143 PRO A HG2  1 
ATOM   1962  H HG3  . PRO A 1 143 ? -14.211 -31.074 -25.549 1.00 42.34  ? 143 PRO A HG3  1 
ATOM   1963  H HD2  . PRO A 1 143 ? -15.397 -28.652 -24.847 1.00 43.54  ? 143 PRO A HD2  1 
ATOM   1964  H HD3  . PRO A 1 143 ? -15.250 -29.974 -23.947 1.00 43.54  ? 143 PRO A HD3  1 
ATOM   1965  N N    . MET A 1 144 ? -11.195 -26.796 -25.738 1.00 23.18  ? 144 MET A N    1 
ATOM   1966  C CA   . MET A 1 144 ? -10.899 -25.382 -25.927 1.00 26.53  ? 144 MET A CA   1 
ATOM   1967  C C    . MET A 1 144 ? -10.302 -25.081 -27.297 1.00 30.26  ? 144 MET A C    1 
ATOM   1968  O O    . MET A 1 144 ? -9.450  -25.821 -27.799 1.00 27.91  ? 144 MET A O    1 
ATOM   1969  C CB   . MET A 1 144 ? -9.935  -24.886 -24.864 1.00 28.88  ? 144 MET A CB   1 
ATOM   1970  C CG   . MET A 1 144 ? -10.521 -24.814 -23.459 1.00 24.00  ? 144 MET A CG   1 
ATOM   1971  S SD   . MET A 1 144 ? -11.830 -23.600 -23.308 1.00 27.46  ? 144 MET A SD   1 
ATOM   1972  C CE   . MET A 1 144 ? -11.066 -22.084 -23.897 1.00 37.67  ? 144 MET A CE   1 
ATOM   1973  H H    . MET A 1 144 ? -10.508 -27.308 -25.810 1.00 27.78  ? 144 MET A H    1 
ATOM   1974  H HA   . MET A 1 144 ? -11.723 -24.879 -25.833 1.00 31.79  ? 144 MET A HA   1 
ATOM   1975  H HB2  . MET A 1 144 ? -9.173  -25.486 -24.834 1.00 34.61  ? 144 MET A HB2  1 
ATOM   1976  H HB3  . MET A 1 144 ? -9.640  -23.995 -25.105 1.00 34.61  ? 144 MET A HB3  1 
ATOM   1977  H HG2  . MET A 1 144 ? -10.888 -25.680 -23.225 1.00 28.76  ? 144 MET A HG2  1 
ATOM   1978  H HG3  . MET A 1 144 ? -9.817  -24.573 -22.836 1.00 28.76  ? 144 MET A HG3  1 
ATOM   1979  H HE1  . MET A 1 144 ? -11.715 -21.365 -23.848 1.00 45.16  ? 144 MET A HE1  1 
ATOM   1980  H HE2  . MET A 1 144 ? -10.301 -21.878 -23.337 1.00 45.16  ? 144 MET A HE2  1 
ATOM   1981  H HE3  . MET A 1 144 ? -10.781 -22.211 -24.815 1.00 45.16  ? 144 MET A HE3  1 
ATOM   1982  N N    . SER A 1 145 ? -10.721 -23.939 -27.849 1.00 29.84  ? 145 SER A N    1 
ATOM   1983  C CA   . SER A 1 145 ? -10.192 -23.325 -29.057 1.00 36.03  ? 145 SER A CA   1 
ATOM   1984  C C    . SER A 1 145 ? -9.578  -21.974 -28.685 1.00 26.98  ? 145 SER A C    1 
ATOM   1985  O O    . SER A 1 145 ? -9.685  -21.517 -27.549 1.00 21.63  ? 145 SER A O    1 
ATOM   1986  C CB   . SER A 1 145 ? -11.315 -23.170 -30.098 1.00 26.98  ? 145 SER A CB   1 
ATOM   1987  O OG   . SER A 1 145 ? -11.720 -24.461 -30.507 1.00 27.88  ? 145 SER A OG   1 
ATOM   1988  H H    . SER A 1 145 ? -11.359 -23.475 -27.508 1.00 35.76  ? 145 SER A H    1 
ATOM   1989  H HA   . SER A 1 145 ? -9.497  -23.888 -29.432 1.00 43.20  ? 145 SER A HA   1 
ATOM   1990  H HB2  . SER A 1 145 ? -12.067 -22.706 -29.698 1.00 32.33  ? 145 SER A HB2  1 
ATOM   1991  H HB3  . SER A 1 145 ? -10.981 -22.677 -30.864 1.00 32.33  ? 145 SER A HB3  1 
ATOM   1992  H HG   . SER A 1 145 ? -12.334 -24.402 -31.077 1.00 33.42  ? 145 SER A HG   1 
ATOM   1993  N N    . VAL A 1 146 ? -8.912  -21.329 -29.634 1.00 20.07  ? 146 VAL A N    1 
ATOM   1994  C CA   . VAL A 1 146 ? -8.372  -19.991 -29.386 1.00 23.13  ? 146 VAL A CA   1 
ATOM   1995  C C    . VAL A 1 146 ? -8.649  -19.070 -30.570 1.00 24.12  ? 146 VAL A C    1 
ATOM   1996  O O    . VAL A 1 146 ? -8.816  -19.522 -31.703 1.00 22.88  ? 146 VAL A O    1 
ATOM   1997  C CB   . VAL A 1 146 ? -6.866  -20.047 -29.057 1.00 25.56  ? 146 VAL A CB   1 
ATOM   1998  C CG1  . VAL A 1 146 ? -6.613  -20.864 -27.767 1.00 25.66  ? 146 VAL A CG1  1 
ATOM   1999  C CG2  . VAL A 1 146 ? -6.053  -20.646 -30.226 1.00 22.76  ? 146 VAL A CG2  1 
ATOM   2000  H H    . VAL A 1 146 ? -8.757  -21.637 -30.422 1.00 24.04  ? 146 VAL A H    1 
ATOM   2001  H HA   . VAL A 1 146 ? -8.824  -19.617 -28.614 1.00 27.71  ? 146 VAL A HA   1 
ATOM   2002  H HB   . VAL A 1 146 ? -6.546  -19.144 -28.905 1.00 30.62  ? 146 VAL A HB   1 
ATOM   2003  H HG11 . VAL A 1 146 ? -5.660  -20.881 -27.586 1.00 30.75  ? 146 VAL A HG11 1 
ATOM   2004  H HG12 . VAL A 1 146 ? -7.082  -20.443 -27.030 1.00 30.75  ? 146 VAL A HG12 1 
ATOM   2005  H HG13 . VAL A 1 146 ? -6.942  -21.768 -27.896 1.00 30.75  ? 146 VAL A HG13 1 
ATOM   2006  H HG21 . VAL A 1 146 ? -5.115  -20.663 -29.981 1.00 27.27  ? 146 VAL A HG21 1 
ATOM   2007  H HG22 . VAL A 1 146 ? -6.368  -21.547 -30.400 1.00 27.27  ? 146 VAL A HG22 1 
ATOM   2008  H HG23 . VAL A 1 146 ? -6.180  -20.094 -31.014 1.00 27.27  ? 146 VAL A HG23 1 
ATOM   2009  N N    . LEU A 1 147 ? -8.723  -17.764 -30.300 1.00 25.90  ? 147 LEU A N    1 
ATOM   2010  C CA   . LEU A 1 147 ? -8.840  -16.763 -31.366 1.00 26.31  ? 147 LEU A CA   1 
ATOM   2011  C C    . LEU A 1 147 ? -7.810  -15.674 -31.126 1.00 28.45  ? 147 LEU A C    1 
ATOM   2012  O O    . LEU A 1 147 ? -7.869  -14.991 -30.095 1.00 24.47  ? 147 LEU A O    1 
ATOM   2013  C CB   . LEU A 1 147 ? -10.261 -16.161 -31.429 1.00 30.47  ? 147 LEU A CB   1 
ATOM   2014  C CG   . LEU A 1 147 ? -10.595 -15.223 -32.600 1.00 28.86  ? 147 LEU A CG   1 
ATOM   2015  C CD1  . LEU A 1 147 ? -12.089 -15.181 -32.849 1.00 32.90  ? 147 LEU A CD1  1 
ATOM   2016  C CD2  . LEU A 1 147 ? -10.119 -13.824 -32.336 1.00 28.67  ? 147 LEU A CD2  1 
ATOM   2017  H H    . LEU A 1 147 ? -8.708  -17.432 -29.507 1.00 31.03  ? 147 LEU A H    1 
ATOM   2018  H HA   . LEU A 1 147 ? -8.648  -17.181 -32.220 1.00 31.53  ? 147 LEU A HA   1 
ATOM   2019  H HB2  . LEU A 1 147 ? -10.894 -16.895 -31.467 1.00 36.52  ? 147 LEU A HB2  1 
ATOM   2020  H HB3  . LEU A 1 147 ? -10.408 -15.658 -30.613 1.00 36.52  ? 147 LEU A HB3  1 
ATOM   2021  H HG   . LEU A 1 147 ? -10.160 -15.546 -33.404 1.00 34.59  ? 147 LEU A HG   1 
ATOM   2022  H HD11 . LEU A 1 147 ? -12.269 -14.583 -33.591 1.00 39.44  ? 147 LEU A HD11 1 
ATOM   2023  H HD12 . LEU A 1 147 ? -12.398 -16.076 -33.063 1.00 39.44  ? 147 LEU A HD12 1 
ATOM   2024  H HD13 . LEU A 1 147 ? -12.534 -14.860 -32.049 1.00 39.44  ? 147 LEU A HD13 1 
ATOM   2025  H HD21 . LEU A 1 147 ? -10.348 -13.265 -33.096 1.00 34.36  ? 147 LEU A HD21 1 
ATOM   2026  H HD22 . LEU A 1 147 ? -10.553 -13.489 -31.536 1.00 34.36  ? 147 LEU A HD22 1 
ATOM   2027  H HD23 . LEU A 1 147 ? -9.157  -13.836 -32.212 1.00 34.36  ? 147 LEU A HD23 1 
ATOM   2028  N N    . MET A 1 148 ? -6.895  -15.504 -32.094 1.00 21.09  ? 148 MET A N    1 
ATOM   2029  C CA   . MET A 1 148 ? -5.709  -14.663 -31.972 1.00 21.38  ? 148 MET A CA   1 
ATOM   2030  C C    . MET A 1 148 ? -5.333  -14.100 -33.342 1.00 21.90  ? 148 MET A C    1 
ATOM   2031  O O    . MET A 1 148 ? -5.243  -14.857 -34.308 1.00 18.82  ? 148 MET A O    1 
ATOM   2032  C CB   . MET A 1 148 ? -4.514  -15.485 -31.452 1.00 29.63  ? 148 MET A CB   1 
ATOM   2033  C CG   . MET A 1 148 ? -4.769  -16.340 -30.193 1.00 30.40  ? 148 MET A CG   1 
ATOM   2034  S SD   . MET A 1 148 ? -4.863  -15.195 -28.905 1.00 36.29  ? 148 MET A SD   1 
ATOM   2035  C CE   . MET A 1 148 ? -5.908  -16.098 -27.722 1.00 31.47  ? 148 MET A CE   1 
ATOM   2036  H H    . MET A 1 148 ? -6.951  -15.887 -32.862 1.00 25.27  ? 148 MET A H    1 
ATOM   2037  H HA   . MET A 1 148 ? -5.882  -13.937 -31.353 1.00 25.61  ? 148 MET A HA   1 
ATOM   2038  H HB2  . MET A 1 148 ? -4.231  -16.088 -32.157 1.00 35.52  ? 148 MET A HB2  1 
ATOM   2039  H HB3  . MET A 1 148 ? -3.792  -14.873 -31.243 1.00 35.52  ? 148 MET A HB3  1 
ATOM   2040  H HG2  . MET A 1 148 ? -5.612  -16.815 -30.267 1.00 36.43  ? 148 MET A HG2  1 
ATOM   2041  H HG3  . MET A 1 148 ? -4.028  -16.946 -30.035 1.00 36.43  ? 148 MET A HG3  1 
ATOM   2042  H HE1  . MET A 1 148 ? -6.040  -15.548 -26.934 1.00 37.73  ? 148 MET A HE1  1 
ATOM   2043  H HE2  . MET A 1 148 ? -6.763  -16.289 -28.139 1.00 37.73  ? 148 MET A HE2  1 
ATOM   2044  H HE3  . MET A 1 148 ? -5.466  -16.926 -27.479 1.00 37.73  ? 148 MET A HE3  1 
ATOM   2045  N N    . GLY A 1 149 ? -5.065  -12.803 -33.431 1.00 29.55  ? 149 GLY A N    1 
ATOM   2046  C CA   . GLY A 1 149 ? -4.551  -12.259 -34.681 1.00 25.21  ? 149 GLY A CA   1 
ATOM   2047  C C    . GLY A 1 149 ? -4.273  -10.779 -34.552 1.00 23.29  ? 149 GLY A C    1 
ATOM   2048  O O    . GLY A 1 149 ? -4.322  -10.211 -33.468 1.00 21.18  ? 149 GLY A O    1 
ATOM   2049  H H    . GLY A 1 149 ? -5.168  -12.229 -32.799 1.00 35.42  ? 149 GLY A H    1 
ATOM   2050  H HA2  . GLY A 1 149 ? -3.728  -12.712 -34.922 1.00 30.21  ? 149 GLY A HA2  1 
ATOM   2051  H HA3  . GLY A 1 149 ? -5.201  -12.394 -35.389 1.00 30.21  ? 149 GLY A HA3  1 
ATOM   2052  N N    . ALA A 1 150 ? -4.007  -10.139 -35.685 1.00 23.17  ? 150 ALA A N    1 
ATOM   2053  C CA   . ALA A 1 150 ? -3.651  -8.720  -35.667 1.00 25.41  ? 150 ALA A CA   1 
ATOM   2054  C C    . ALA A 1 150 ? -4.956  -7.923  -35.620 1.00 25.50  ? 150 ALA A C    1 
ATOM   2055  O O    . ALA A 1 150 ? -5.500  -7.505  -36.649 1.00 26.06  ? 150 ALA A O    1 
ATOM   2056  C CB   . ALA A 1 150 ? -2.799  -8.362  -36.884 1.00 22.32  ? 150 ALA A CB   1 
ATOM   2057  H H    . ALA A 1 150 ? -4.025  -10.495 -36.468 1.00 27.76  ? 150 ALA A H    1 
ATOM   2058  H HA   . ALA A 1 150 ? -3.141  -8.523  -34.866 1.00 30.45  ? 150 ALA A HA   1 
ATOM   2059  H HB1  . ALA A 1 150 ? -2.577  -7.419  -36.848 1.00 26.74  ? 150 ALA A HB1  1 
ATOM   2060  H HB2  . ALA A 1 150 ? -1.988  -8.894  -36.868 1.00 26.74  ? 150 ALA A HB2  1 
ATOM   2061  H HB3  . ALA A 1 150 ? -3.304  -8.553  -37.690 1.00 26.74  ? 150 ALA A HB3  1 
ATOM   2062  N N    . ASN A 1 151 ? -5.498  -7.758  -34.408 1.00 27.43  ? 151 ASN A N    1 
ATOM   2063  C CA   . ASN A 1 151 ? -6.767  -7.041  -34.272 1.00 28.36  ? 151 ASN A CA   1 
ATOM   2064  C C    . ASN A 1 151 ? -6.858  -6.285  -32.953 1.00 39.42  ? 151 ASN A C    1 
ATOM   2065  O O    . ASN A 1 151 ? -6.153  -6.578  -31.986 1.00 29.25  ? 151 ASN A O    1 
ATOM   2066  C CB   . ASN A 1 151 ? -7.981  -7.954  -34.432 1.00 34.09  ? 151 ASN A CB   1 
ATOM   2067  C CG   . ASN A 1 151 ? -7.754  -9.370  -33.960 1.00 30.56  ? 151 ASN A CG   1 
ATOM   2068  O OD1  . ASN A 1 151 ? -7.633  -10.283 -34.754 1.00 33.79  ? 151 ASN A OD1  1 
ATOM   2069  N ND2  . ASN A 1 151 ? -7.761  -9.561  -32.674 1.00 34.82  ? 151 ASN A ND2  1 
ATOM   2070  H H    . ASN A 1 151 ? -5.160  -8.042  -33.670 1.00 32.87  ? 151 ASN A H    1 
ATOM   2071  H HA   . ASN A 1 151 ? -6.814  -6.381  -34.981 1.00 33.99  ? 151 ASN A HA   1 
ATOM   2072  H HB2  . ASN A 1 151 ? -8.717  -7.586  -33.920 1.00 40.87  ? 151 ASN A HB2  1 
ATOM   2073  H HB3  . ASN A 1 151 ? -8.221  -7.991  -35.372 1.00 40.87  ? 151 ASN A HB3  1 
ATOM   2074  H HD21 . ASN A 1 151 ? -7.641  -10.352 -32.356 1.00 41.75  ? 151 ASN A HD21 1 
ATOM   2075  H HD22 . ASN A 1 151 ? -7.860  -8.894  -32.140 1.00 41.75  ? 151 ASN A HD22 1 
ATOM   2076  N N    . ILE A 1 152 ? -7.702  -5.250  -32.953 1.00 31.34  ? 152 ILE A N    1 
ATOM   2077  C CA   . ILE A 1 152 ? -8.004  -4.490  -31.747 1.00 33.24  ? 152 ILE A CA   1 
ATOM   2078  C C    . ILE A 1 152 ? -9.483  -4.128  -31.784 1.00 34.02  ? 152 ILE A C    1 
ATOM   2079  O O    . ILE A 1 152 ? -10.061 -3.922  -32.856 1.00 28.80  ? 152 ILE A O    1 
ATOM   2080  C CB   . ILE A 1 152 ? -7.146  -3.225  -31.595 1.00 39.01  ? 152 ILE A CB   1 
ATOM   2081  C CG1  . ILE A 1 152 ? -7.370  -2.309  -32.781 1.00 45.02  ? 152 ILE A CG1  1 
ATOM   2082  C CG2  . ILE A 1 152 ? -5.662  -3.603  -31.471 1.00 38.51  ? 152 ILE A CG2  1 
ATOM   2083  C CD1  . ILE A 1 152 ? -6.684  -1.001  -32.671 1.00 47.02  ? 152 ILE A CD1  1 
ATOM   2084  H H    . ILE A 1 152 ? -8.117  -4.968  -33.652 1.00 37.56  ? 152 ILE A H    1 
ATOM   2085  H HA   . ILE A 1 152 ? -7.851  -5.052  -30.971 1.00 39.84  ? 152 ILE A HA   1 
ATOM   2086  H HB   . ILE A 1 152 ? -7.417  -2.760  -30.788 1.00 46.77  ? 152 ILE A HB   1 
ATOM   2087  H HG12 . ILE A 1 152 ? -7.043  -2.749  -33.581 1.00 53.98  ? 152 ILE A HG12 1 
ATOM   2088  H HG13 . ILE A 1 152 ? -8.321  -2.137  -32.868 1.00 53.98  ? 152 ILE A HG13 1 
ATOM   2089  H HG21 . ILE A 1 152 ? -5.137  -2.793  -31.377 1.00 46.17  ? 152 ILE A HG21 1 
ATOM   2090  H HG22 . ILE A 1 152 ? -5.544  -4.167  -30.691 1.00 46.17  ? 152 ILE A HG22 1 
ATOM   2091  H HG23 . ILE A 1 152 ? -5.391  -4.081  -32.270 1.00 46.17  ? 152 ILE A HG23 1 
ATOM   2092  H HD11 . ILE A 1 152 ? -6.875  -0.476  -33.464 1.00 56.39  ? 152 ILE A HD11 1 
ATOM   2093  H HD12 . ILE A 1 152 ? -7.009  -0.539  -31.882 1.00 56.39  ? 152 ILE A HD12 1 
ATOM   2094  H HD13 . ILE A 1 152 ? -5.728  -1.152  -32.597 1.00 56.39  ? 152 ILE A HD13 1 
ATOM   2095  N N    . ALA A 1 153 ? -10.083 -4.040  -30.595 1.00 32.85  ? 153 ALA A N    1 
ATOM   2096  C CA   . ALA A 1 153 ? -11.539 -3.979  -30.476 1.00 38.92  ? 153 ALA A CA   1 
ATOM   2097  C C    . ALA A 1 153 ? -12.111 -2.728  -31.128 1.00 33.61  ? 153 ALA A C    1 
ATOM   2098  O O    . ALA A 1 153 ? -13.108 -2.801  -31.849 1.00 33.36  ? 153 ALA A O    1 
ATOM   2099  C CB   . ALA A 1 153 ? -11.941 -4.039  -28.998 1.00 44.26  ? 153 ALA A CB   1 
ATOM   2100  H H    . ALA A 1 153 ? -9.668  -4.014  -29.842 1.00 39.37  ? 153 ALA A H    1 
ATOM   2101  H HA   . ALA A 1 153 ? -11.924 -4.750  -30.922 1.00 46.67  ? 153 ALA A HA   1 
ATOM   2102  H HB1  . ALA A 1 153 ? -12.908 -3.998  -28.932 1.00 53.06  ? 153 ALA A HB1  1 
ATOM   2103  H HB2  . ALA A 1 153 ? -11.618 -4.870  -28.617 1.00 53.06  ? 153 ALA A HB2  1 
ATOM   2104  H HB3  . ALA A 1 153 ? -11.545 -3.285  -28.533 1.00 53.06  ? 153 ALA A HB3  1 
ATOM   2105  N N    . SER A 1 154 ? -11.502 -1.568  -30.862 1.00 40.55  ? 154 SER A N    1 
ATOM   2106  C CA   . SER A 1 154 ? -11.963 -0.301  -31.429 1.00 37.71  ? 154 SER A CA   1 
ATOM   2107  C C    . SER A 1 154 ? -12.136 -0.398  -32.938 1.00 39.29  ? 154 SER A C    1 
ATOM   2108  O O    . SER A 1 154 ? -13.203 -0.092  -33.479 1.00 40.92  ? 154 SER A O    1 
ATOM   2109  C CB   . SER A 1 154 ? -10.967 0.811   -31.088 1.00 44.69  ? 154 SER A CB   1 
ATOM   2110  O OG   . SER A 1 154 ? -9.745  0.661   -31.834 1.00 46.53  ? 154 SER A OG   1 
ATOM   2111  H H    . SER A 1 154 ? -10.813 -1.491  -30.352 1.00 48.62  ? 154 SER A H    1 
ATOM   2112  H HA   . SER A 1 154 ? -12.821 -0.071  -31.039 1.00 45.21  ? 154 SER A HA   1 
ATOM   2113  H HB2  . SER A 1 154 ? -11.366 1.668   -31.306 1.00 53.58  ? 154 SER A HB2  1 
ATOM   2114  H HB3  . SER A 1 154 ? -10.764 0.772   -30.140 1.00 53.58  ? 154 SER A HB3  1 
ATOM   2115  H HG   . SER A 1 154 ? -9.210  1.278   -31.636 1.00 55.79  ? 154 SER A HG   1 
ATOM   2116  N N    . GLU A 1 155 ? -11.090 -0.831  -33.617 1.00 34.51  ? 155 GLU A N    1 
ATOM   2117  C CA   . GLU A 1 155 ? -11.112 -1.019  -35.081 1.00 36.59  ? 155 GLU A CA   1 
ATOM   2118  C C    . GLU A 1 155 ? -12.165 -2.063  -35.438 1.00 36.08  ? 155 GLU A C    1 
ATOM   2119  O O    . GLU A 1 155 ? -12.843 -1.870  -36.426 1.00 36.88  ? 155 GLU A O    1 
ATOM   2120  C CB   . GLU A 1 155 ? -9.738  -1.412  -35.605 1.00 31.21  ? 155 GLU A CB   1 
ATOM   2121  C CG   . GLU A 1 155 ? -8.799  -0.243  -35.729 1.00 36.75  ? 155 GLU A CG   1 
ATOM   2122  C CD   . GLU A 1 155 ? -7.400  -0.615  -36.181 1.00 51.21  ? 155 GLU A CD   1 
ATOM   2123  O OE1  . GLU A 1 155 ? -7.214  -1.734  -36.621 1.00 39.68  ? 155 GLU A OE1  1 
ATOM   2124  O OE2  . GLU A 1 155 ? -6.527  0.218   -36.084 1.00 39.43  ? 155 GLU A OE2  1 
ATOM   2125  H H    . GLU A 1 155 ? -10.295 -1.040  -33.225 1.00 41.36  ? 155 GLU A H    1 
ATOM   2126  H HA   . GLU A 1 155 ? -11.371 -0.163  -35.494 1.00 43.87  ? 155 GLU A HA   1 
ATOM   2127  H HB2  . GLU A 1 155 ? -9.347  -2.074  -34.997 1.00 37.41  ? 155 GLU A HB2  1 
ATOM   2128  H HB3  . GLU A 1 155 ? -9.844  -1.833  -36.483 1.00 37.41  ? 155 GLU A HB3  1 
ATOM   2129  H HG2  . GLU A 1 155 ? -9.172  0.399   -36.370 1.00 44.06  ? 155 GLU A HG2  1 
ATOM   2130  H HG3  . GLU A 1 155 ? -8.735  0.209   -34.861 1.00 44.06  ? 155 GLU A HG3  1 
ATOM   2131  N N    . VAL A 1 156 ? -12.288 -3.140  -34.675 1.00 32.90  ? 156 VAL A N    1 
ATOM   2132  C CA   . VAL A 1 156 ? -13.268 -4.175  -35.008 1.00 31.97  ? 156 VAL A CA   1 
ATOM   2133  C C    . VAL A 1 156 ? -14.679 -3.648  -34.792 1.00 36.80  ? 156 VAL A C    1 
ATOM   2134  O O    . VAL A 1 156 ? -15.596 -3.977  -35.556 1.00 29.70  ? 156 VAL A O    1 
ATOM   2135  C CB   . VAL A 1 156 ? -13.018 -5.460  -34.201 1.00 36.98  ? 156 VAL A CB   1 
ATOM   2136  C CG1  . VAL A 1 156 ? -14.052 -6.534  -34.538 1.00 32.45  ? 156 VAL A CG1  1 
ATOM   2137  C CG2  . VAL A 1 156 ? -11.621 -5.999  -34.481 1.00 36.28  ? 156 VAL A CG2  1 
ATOM   2138  H H    . VAL A 1 156 ? -11.804 -3.297  -33.982 1.00 39.44  ? 156 VAL A H    1 
ATOM   2139  H HA   . VAL A 1 156 ? -13.177 -4.397  -35.948 1.00 38.32  ? 156 VAL A HA   1 
ATOM   2140  H HB   . VAL A 1 156 ? -13.083 -5.261  -33.254 1.00 44.33  ? 156 VAL A HB   1 
ATOM   2141  H HG11 . VAL A 1 156 ? -13.864 -7.327  -34.012 1.00 38.90  ? 156 VAL A HG11 1 
ATOM   2142  H HG12 . VAL A 1 156 ? -14.936 -6.197  -34.325 1.00 38.90  ? 156 VAL A HG12 1 
ATOM   2143  H HG13 . VAL A 1 156 ? -13.995 -6.741  -35.483 1.00 38.90  ? 156 VAL A HG13 1 
ATOM   2144  H HG21 . VAL A 1 156 ? -11.486 -6.808  -33.963 1.00 43.49  ? 156 VAL A HG21 1 
ATOM   2145  H HG22 . VAL A 1 156 ? -11.543 -6.195  -35.428 1.00 43.49  ? 156 VAL A HG22 1 
ATOM   2146  H HG23 . VAL A 1 156 ? -10.968 -5.329  -34.226 1.00 43.49  ? 156 VAL A HG23 1 
ATOM   2147  N N    . ALA A 1 157 ? -14.875 -2.803  -33.772 1.00 33.80  ? 157 ALA A N    1 
ATOM   2148  C CA   . ALA A 1 157 ? -16.191 -2.214  -33.555 1.00 42.16  ? 157 ALA A CA   1 
ATOM   2149  C C    . ALA A 1 157 ? -16.560 -1.296  -34.713 1.00 42.14  ? 157 ALA A C    1 
ATOM   2150  O O    . ALA A 1 157 ? -17.711 -1.291  -35.155 1.00 44.25  ? 157 ALA A O    1 
ATOM   2151  C CB   . ALA A 1 157 ? -16.226 -1.460  -32.223 1.00 33.50  ? 157 ALA A CB   1 
ATOM   2152  H H    . ALA A 1 157 ? -14.274 -2.563  -33.206 1.00 40.52  ? 157 ALA A H    1 
ATOM   2153  H HA   . ALA A 1 157 ? -16.850 -2.924  -33.515 1.00 50.55  ? 157 ALA A HA   1 
ATOM   2154  H HB1  . ALA A 1 157 ? -17.109 -1.077  -32.101 1.00 40.16  ? 157 ALA A HB1  1 
ATOM   2155  H HB2  . ALA A 1 157 ? -16.032 -2.081  -31.504 1.00 40.16  ? 157 ALA A HB2  1 
ATOM   2156  H HB3  . ALA A 1 157 ? -15.560 -0.755  -32.241 1.00 40.16  ? 157 ALA A HB3  1 
ATOM   2157  N N    . ASP A 1 158 ? -15.589 -0.528  -35.220 1.00 41.54  ? 158 ASP A N    1 
ATOM   2158  C CA   . ASP A 1 158 ? -15.729 0.386   -36.358 1.00 36.05  ? 158 ASP A CA   1 
ATOM   2159  C C    . ASP A 1 158 ? -15.729 -0.318  -37.682 1.00 39.28  ? 158 ASP A C    1 
ATOM   2160  O O    . ASP A 1 158 ? -15.620 0.353   -38.710 1.00 46.38  ? 158 ASP A O    1 
ATOM   2161  C CB   . ASP A 1 158 ? -14.585 1.404   -36.377 1.00 43.80  ? 158 ASP A CB   1 
ATOM   2162  C CG   . ASP A 1 158 ? -14.640 2.381   -35.204 1.00 51.67  ? 158 ASP A CG   1 
ATOM   2163  O OD1  . ASP A 1 158 ? -15.683 2.402   -34.517 1.00 44.20  ? 158 ASP A OD1  1 
ATOM   2164  O OD2  . ASP A 1 158 ? -13.643 3.113   -34.955 1.00 47.65  ? 158 ASP A OD2  1 
ATOM   2165  H H    . ASP A 1 158 ? -14.791 -0.523  -34.898 1.00 49.80  ? 158 ASP A H    1 
ATOM   2166  H HA   . ASP A 1 158 ? -16.565 0.871   -36.275 1.00 43.21  ? 158 ASP A HA   1 
ATOM   2167  H HB2  . ASP A 1 158 ? -13.740 0.930   -36.332 1.00 52.51  ? 158 ASP A HB2  1 
ATOM   2168  H HB3  . ASP A 1 158 ? -14.634 1.918   -37.198 1.00 52.51  ? 158 ASP A HB3  1 
ATOM   2169  N N    . GLU A 1 159 ? -15.794 -1.645  -37.684 1.00 36.93  ? 159 GLU A N    1 
ATOM   2170  C CA   . GLU A 1 159 ? -15.827 -2.430  -38.921 1.00 35.02  ? 159 GLU A CA   1 
ATOM   2171  C C    . GLU A 1 159 ? -14.625 -2.145  -39.849 1.00 36.29  ? 159 GLU A C    1 
ATOM   2172  O O    . GLU A 1 159 ? -14.732 -2.238  -41.069 1.00 35.62  ? 159 GLU A O    1 
ATOM   2173  C CB   . GLU A 1 159 ? -17.148 -2.201  -39.660 1.00 38.35  ? 159 GLU A CB   1 
ATOM   2174  C CG   . GLU A 1 159 ? -18.401 -2.472  -38.771 1.00 52.99  ? 159 GLU A CG   1 
ATOM   2175  C CD   . GLU A 1 159 ? -19.703 -2.520  -39.576 1.00 51.76  ? 159 GLU A CD   1 
ATOM   2176  O OE1  . GLU A 1 159 ? -20.378 -1.474  -39.638 1.00 62.02  ? 159 GLU A OE1  1 
ATOM   2177  O OE2  . GLU A 1 159 ? -20.033 -3.581  -40.157 1.00 44.64  ? 159 GLU A OE2  1 
ATOM   2178  H H    . GLU A 1 159 ? -15.822 -2.126  -36.971 1.00 44.27  ? 159 GLU A H    1 
ATOM   2179  H HA   . GLU A 1 159 ? -15.789 -3.370  -38.684 1.00 41.98  ? 159 GLU A HA   1 
ATOM   2180  H HB2  . GLU A 1 159 ? -17.186 -1.279  -39.958 1.00 45.97  ? 159 GLU A HB2  1 
ATOM   2181  H HB3  . GLU A 1 159 ? -17.188 -2.798  -40.423 1.00 45.97  ? 159 GLU A HB3  1 
ATOM   2182  H HG2  . GLU A 1 159 ? -18.293 -3.326  -38.324 1.00 63.54  ? 159 GLU A HG2  1 
ATOM   2183  H HG3  . GLU A 1 159 ? -18.481 -1.762  -38.114 1.00 63.54  ? 159 GLU A HG3  1 
ATOM   2184  N N    . LYS A 1 160 ? -13.447 -1.845  -39.306 1.00 37.44  ? 160 LYS A N    1 
ATOM   2185  C CA   . LYS A 1 160 ? -12.257 -1.701  -40.151 1.00 31.59  ? 160 LYS A CA   1 
ATOM   2186  C C    . LYS A 1 160 ? -11.609 -3.051  -40.467 1.00 33.39  ? 160 LYS A C    1 
ATOM   2187  O O    . LYS A 1 160 ? -11.381 -3.875  -39.581 1.00 31.81  ? 160 LYS A O    1 
ATOM   2188  C CB   . LYS A 1 160 ? -11.286 -0.771  -39.454 1.00 37.83  ? 160 LYS A CB   1 
ATOM   2189  C CG   . LYS A 1 160 ? -11.960 0.534   -39.037 1.00 36.33  ? 160 LYS A CG   1 
ATOM   2190  C CD   . LYS A 1 160 ? -10.974 1.653   -38.889 1.00 47.86  ? 160 LYS A CD   1 
ATOM   2191  C CE   . LYS A 1 160 ? -11.601 2.928   -38.362 1.00 55.96  ? 160 LYS A CE   1 
ATOM   2192  N NZ   . LYS A 1 160 ? -10.528 3.861   -37.932 1.00 51.25  ? 160 LYS A NZ   1 
ATOM   2193  H H    . LYS A 1 160 ? -13.308 -1.720  -38.466 1.00 44.88  ? 160 LYS A H    1 
ATOM   2194  H HA   . LYS A 1 160 ? -12.515 -1.289  -40.990 1.00 37.87  ? 160 LYS A HA   1 
ATOM   2195  H HB2  . LYS A 1 160 ? -10.944 -1.205  -38.657 1.00 45.36  ? 160 LYS A HB2  1 
ATOM   2196  H HB3  . LYS A 1 160 ? -10.559 -0.557  -40.059 1.00 45.36  ? 160 LYS A HB3  1 
ATOM   2197  H HG2  . LYS A 1 160 ? -12.607 0.789   -39.713 1.00 43.55  ? 160 LYS A HG2  1 
ATOM   2198  H HG3  . LYS A 1 160 ? -12.401 0.405   -38.183 1.00 43.55  ? 160 LYS A HG3  1 
ATOM   2199  H HD2  . LYS A 1 160 ? -10.280 1.382   -38.268 1.00 57.40  ? 160 LYS A HD2  1 
ATOM   2200  H HD3  . LYS A 1 160 ? -10.585 1.847   -39.756 1.00 57.40  ? 160 LYS A HD3  1 
ATOM   2201  H HE2  . LYS A 1 160 ? -12.119 3.353   -39.064 1.00 67.11  ? 160 LYS A HE2  1 
ATOM   2202  H HE3  . LYS A 1 160 ? -12.162 2.726   -37.597 1.00 67.11  ? 160 LYS A HE3  1 
ATOM   2203  H HZ1  . LYS A 1 160 ? -10.886 4.614   -37.621 1.00 61.46  ? 160 LYS A HZ1  1 
ATOM   2204  H HZ2  . LYS A 1 160 ? -10.039 3.486   -37.290 1.00 61.46  ? 160 LYS A HZ2  1 
ATOM   2205  H HZ3  . LYS A 1 160 ? -10.000 4.055   -38.622 1.00 61.46  ? 160 LYS A HZ3  1 
ATOM   2206  N N    . PHE A 1 161 ? -11.280 -3.261  -41.735 1.00 34.65  ? 161 PHE A N    1 
ATOM   2207  C CA   . PHE A 1 161 ? -10.851 -4.574  -42.213 1.00 29.58  ? 161 PHE A CA   1 
ATOM   2208  C C    . PHE A 1 161 ? -9.623  -5.122  -41.468 1.00 31.94  ? 161 PHE A C    1 
ATOM   2209  O O    . PHE A 1 161 ? -8.608  -4.436  -41.327 1.00 26.50  ? 161 PHE A O    1 
ATOM   2210  C CB   . PHE A 1 161 ? -10.539 -4.479  -43.708 1.00 28.11  ? 161 PHE A CB   1 
ATOM   2211  C CG   . PHE A 1 161 ? -10.152 -5.764  -44.304 1.00 29.56  ? 161 PHE A CG   1 
ATOM   2212  C CD1  . PHE A 1 161 ? -11.111 -6.612  -44.797 1.00 25.56  ? 161 PHE A CD1  1 
ATOM   2213  C CD2  . PHE A 1 161 ? -8.819  -6.134  -44.388 1.00 26.15  ? 161 PHE A CD2  1 
ATOM   2214  C CE1  . PHE A 1 161 ? -10.754 -7.832  -45.349 1.00 28.67  ? 161 PHE A CE1  1 
ATOM   2215  C CE2  . PHE A 1 161 ? -8.467  -7.330  -44.939 1.00 27.55  ? 161 PHE A CE2  1 
ATOM   2216  C CZ   . PHE A 1 161 ? -9.443  -8.181  -45.429 1.00 34.69  ? 161 PHE A CZ   1 
ATOM   2217  H H    . PHE A 1 161 ? -11.295 -2.656  -42.346 1.00 41.54  ? 161 PHE A H    1 
ATOM   2218  H HA   . PHE A 1 161 ? -11.579 -5.205  -42.097 1.00 35.45  ? 161 PHE A HA   1 
ATOM   2219  H HB2  . PHE A 1 161 ? -11.327 -4.159  -44.174 1.00 33.69  ? 161 PHE A HB2  1 
ATOM   2220  H HB3  . PHE A 1 161 ? -9.805  -3.857  -43.836 1.00 33.69  ? 161 PHE A HB3  1 
ATOM   2221  H HD1  . PHE A 1 161 ? -12.009 -6.375  -44.742 1.00 30.63  ? 161 PHE A HD1  1 
ATOM   2222  H HD2  . PHE A 1 161 ? -8.161  -5.565  -44.060 1.00 31.34  ? 161 PHE A HD2  1 
ATOM   2223  H HE1  . PHE A 1 161 ? -11.409 -8.402  -45.682 1.00 34.36  ? 161 PHE A HE1  1 
ATOM   2224  H HE2  . PHE A 1 161 ? -7.570  -7.572  -44.991 1.00 33.02  ? 161 PHE A HE2  1 
ATOM   2225  H HZ   . PHE A 1 161 ? -9.201  -8.997  -45.805 1.00 41.59  ? 161 PHE A HZ   1 
ATOM   2226  N N    . CYS A 1 162 ? -9.721  -6.371  -41.001 1.00 27.40  ? 162 CYS A N    1 
ATOM   2227  C CA   . CYS A 1 162 ? -8.600  -7.113  -40.425 1.00 31.85  ? 162 CYS A CA   1 
ATOM   2228  C C    . CYS A 1 162 ? -8.960  -8.600  -40.459 1.00 34.18  ? 162 CYS A C    1 
ATOM   2229  O O    . CYS A 1 162 ? -10.053 -8.993  -40.878 1.00 25.53  ? 162 CYS A O    1 
ATOM   2230  C CB   . CYS A 1 162 ? -8.275  -6.643  -39.001 1.00 27.96  ? 162 CYS A CB   1 
ATOM   2231  S SG   . CYS A 1 162 ? -9.662  -6.897  -37.809 1.00 29.16  ? 162 CYS A SG   1 
ATOM   2232  H H    . CYS A 1 162 ? -10.453 -6.822  -41.009 1.00 32.84  ? 162 CYS A H    1 
ATOM   2233  H HA   . CYS A 1 162 ? -7.812  -6.979  -40.975 1.00 38.18  ? 162 CYS A HA   1 
ATOM   2234  H HB2  . CYS A 1 162 ? -7.508  -7.138  -38.674 1.00 33.51  ? 162 CYS A HB2  1 
ATOM   2235  H HB3  . CYS A 1 162 ? -8.071  -5.695  -39.022 1.00 33.51  ? 162 CYS A HB3  1 
ATOM   2236  H HG   . CYS A 1 162 ? -9.923  -8.067  -37.757 1.00 34.95  ? 162 CYS A HG   1 
ATOM   2237  N N    . GLU A 1 163 ? -8.031  -9.435  -40.011 1.00 24.89  ? 163 GLU A N    1 
ATOM   2238  C CA   . GLU A 1 163 ? -8.228  -10.880 -40.012 1.00 21.34  ? 163 GLU A CA   1 
ATOM   2239  C C    . GLU A 1 163 ? -7.940  -11.424 -38.626 1.00 24.28  ? 163 GLU A C    1 
ATOM   2240  O O    . GLU A 1 163 ? -7.405  -10.726 -37.759 1.00 27.14  ? 163 GLU A O    1 
ATOM   2241  C CB   . GLU A 1 163 ? -7.308  -11.628 -40.983 1.00 30.54  ? 163 GLU A CB   1 
ATOM   2242  C CG   . GLU A 1 163 ? -6.552  -10.844 -41.984 1.00 30.53  ? 163 GLU A CG   1 
ATOM   2243  C CD   . GLU A 1 163 ? -5.459  -11.723 -42.619 1.00 31.21  ? 163 GLU A CD   1 
ATOM   2244  O OE1  . GLU A 1 163 ? -5.745  -12.618 -43.432 1.00 28.82  ? 163 GLU A OE1  1 
ATOM   2245  O OE2  . GLU A 1 163 ? -4.306  -11.573 -42.216 1.00 27.04  ? 163 GLU A OE2  1 
ATOM   2246  H H    . GLU A 1 163 ? -7.269  -9.188  -39.698 1.00 29.83  ? 163 GLU A H    1 
ATOM   2247  H HA   . GLU A 1 163 ? -9.149  -11.083 -40.239 1.00 25.57  ? 163 GLU A HA   1 
ATOM   2248  H HB2  . GLU A 1 163 ? -6.654  -12.115 -40.456 1.00 36.61  ? 163 GLU A HB2  1 
ATOM   2249  H HB3  . GLU A 1 163 ? -7.851  -12.263 -41.476 1.00 36.61  ? 163 GLU A HB3  1 
ATOM   2250  H HG2  . GLU A 1 163 ? -7.153  -10.544 -42.683 1.00 36.59  ? 163 GLU A HG2  1 
ATOM   2251  H HG3  . GLU A 1 163 ? -6.127  -10.087 -41.551 1.00 36.59  ? 163 GLU A HG3  1 
ATOM   2252  N N    . THR A 1 164 ? -8.252  -12.713 -38.439 1.00 23.20  ? 164 THR A N    1 
ATOM   2253  C CA   . THR A 1 164 ? -7.795  -13.409 -37.254 1.00 24.33  ? 164 THR A CA   1 
ATOM   2254  C C    . THR A 1 164 ? -7.619  -14.894 -37.561 1.00 23.15  ? 164 THR A C    1 
ATOM   2255  O O    . THR A 1 164 ? -8.085  -15.417 -38.572 1.00 25.71  ? 164 THR A O    1 
ATOM   2256  C CB   . THR A 1 164 ? -8.762  -13.178 -36.090 1.00 25.95  ? 164 THR A CB   1 
ATOM   2257  O OG1  . THR A 1 164 ? -8.110  -13.455 -34.839 1.00 27.81  ? 164 THR A OG1  1 
ATOM   2258  C CG2  . THR A 1 164 ? -9.985  -14.093 -36.230 1.00 24.24  ? 164 THR A CG2  1 
ATOM   2259  H H    . THR A 1 164 ? -8.720  -13.191 -38.979 1.00 27.80  ? 164 THR A H    1 
ATOM   2260  H HA   . THR A 1 164 ? -6.930  -13.054 -36.996 1.00 29.15  ? 164 THR A HA   1 
ATOM   2261  H HB   . THR A 1 164 ? -9.065  -12.256 -36.100 1.00 31.10  ? 164 THR A HB   1 
ATOM   2262  H HG1  . THR A 1 164 ? -7.446  -12.950 -34.743 1.00 33.33  ? 164 THR A HG1  1 
ATOM   2263  H HG21 . THR A 1 164 ? -10.596 -13.945 -35.491 1.00 29.04  ? 164 THR A HG21 1 
ATOM   2264  H HG22 . THR A 1 164 ? -10.446 -13.906 -37.063 1.00 29.04  ? 164 THR A HG22 1 
ATOM   2265  H HG23 . THR A 1 164 ? -9.705  -15.022 -36.226 1.00 29.04  ? 164 THR A HG23 1 
ATOM   2266  N N    . THR A 1 165 ? -6.960  -15.578 -36.656 1.00 22.38  ? 165 THR A N    1 
ATOM   2267  C CA   . THR A 1 165 ? -6.785  -17.007 -36.769 1.00 18.55  ? 165 THR A CA   1 
ATOM   2268  C C    . THR A 1 165 ? -7.601  -17.655 -35.678 1.00 26.98  ? 165 THR A C    1 
ATOM   2269  O O    . THR A 1 165 ? -7.501  -17.253 -34.518 1.00 22.07  ? 165 THR A O    1 
ATOM   2270  C CB   . THR A 1 165 ? -5.318  -17.409 -36.579 1.00 29.18  ? 165 THR A CB   1 
ATOM   2271  O OG1  . THR A 1 165 ? -4.479  -16.559 -37.366 1.00 23.31  ? 165 THR A OG1  1 
ATOM   2272  C CG2  . THR A 1 165 ? -5.128  -18.829 -36.983 1.00 28.25  ? 165 THR A CG2  1 
ATOM   2273  H H    . THR A 1 165 ? -6.598  -15.235 -35.955 1.00 26.81  ? 165 THR A H    1 
ATOM   2274  H HA   . THR A 1 165 ? -7.096  -17.319 -37.633 1.00 22.22  ? 165 THR A HA   1 
ATOM   2275  H HB   . THR A 1 165 ? -5.079  -17.322 -35.643 1.00 34.98  ? 165 THR A HB   1 
ATOM   2276  H HG1  . THR A 1 165 ? -4.680  -16.629 -38.179 1.00 27.93  ? 165 THR A HG1  1 
ATOM   2277  H HG21 . THR A 1 165 ? -4.200  -19.086 -36.863 1.00 33.86  ? 165 THR A HG21 1 
ATOM   2278  H HG22 . THR A 1 165 ? -5.687  -19.406 -36.439 1.00 33.86  ? 165 THR A HG22 1 
ATOM   2279  H HG23 . THR A 1 165 ? -5.369  -18.943 -37.915 1.00 33.86  ? 165 THR A HG23 1 
ATOM   2280  N N    . ILE A 1 166 ? -8.335  -18.699 -36.020 1.00 27.82  ? 166 ILE A N    1 
ATOM   2281  C CA   . ILE A 1 166 ? -8.866  -19.589 -35.001 1.00 24.81  ? 166 ILE A CA   1 
ATOM   2282  C C    . ILE A 1 166 ? -8.043  -20.859 -35.032 1.00 22.02  ? 166 ILE A C    1 
ATOM   2283  O O    . ILE A 1 166 ? -7.850  -21.451 -36.096 1.00 27.83  ? 166 ILE A O    1 
ATOM   2284  C CB   . ILE A 1 166 ? -10.360 -19.870 -35.208 1.00 24.36  ? 166 ILE A CB   1 
ATOM   2285  C CG1  . ILE A 1 166 ? -11.138 -18.620 -34.833 1.00 30.21  ? 166 ILE A CG1  1 
ATOM   2286  C CG2  . ILE A 1 166 ? -10.775 -21.041 -34.323 1.00 30.91  ? 166 ILE A CG2  1 
ATOM   2287  C CD1  . ILE A 1 166 ? -12.670 -18.674 -35.226 1.00 34.79  ? 166 ILE A CD1  1 
ATOM   2288  H H    . ILE A 1 166 ? -8.540  -18.915 -36.827 1.00 33.34  ? 166 ILE A H    1 
ATOM   2289  H HA   . ILE A 1 166 ? -8.754  -19.178 -34.129 1.00 29.73  ? 166 ILE A HA   1 
ATOM   2290  H HB   . ILE A 1 166 ? -10.524 -20.089 -36.138 1.00 29.19  ? 166 ILE A HB   1 
ATOM   2291  H HG12 . ILE A 1 166 ? -11.084 -18.496 -33.872 1.00 36.21  ? 166 ILE A HG12 1 
ATOM   2292  H HG13 . ILE A 1 166 ? -10.743 -17.859 -35.285 1.00 36.21  ? 166 ILE A HG13 1 
ATOM   2293  H HG21 . ILE A 1 166 ? -11.720 -21.217 -34.455 1.00 37.04  ? 166 ILE A HG21 1 
ATOM   2294  H HG22 . ILE A 1 166 ? -10.255 -21.822 -34.569 1.00 37.04  ? 166 ILE A HG22 1 
ATOM   2295  H HG23 . ILE A 1 166 ? -10.608 -20.811 -33.396 1.00 37.04  ? 166 ILE A HG23 1 
ATOM   2296  H HD11 . ILE A 1 166 ? -13.095 -17.846 -34.955 1.00 41.70  ? 166 ILE A HD11 1 
ATOM   2297  H HD12 . ILE A 1 166 ? -12.745 -18.786 -36.187 1.00 41.70  ? 166 ILE A HD12 1 
ATOM   2298  H HD13 . ILE A 1 166 ? -13.086 -19.424 -34.772 1.00 41.70  ? 166 ILE A HD13 1 
ATOM   2299  N N    . GLY A 1 167 ? -7.562  -21.273 -33.860 1.00 27.90  ? 167 GLY A N    1 
ATOM   2300  C CA   . GLY A 1 167 ? -7.016  -22.593 -33.668 1.00 23.49  ? 167 GLY A CA   1 
ATOM   2301  C C    . GLY A 1 167 ? -8.014  -23.480 -32.945 1.00 24.29  ? 167 GLY A C    1 
ATOM   2302  O O    . GLY A 1 167 ? -8.431  -23.182 -31.824 1.00 27.66  ? 167 GLY A O    1 
ATOM   2303  H H    . GLY A 1 167 ? -7.545  -20.788 -33.150 1.00 33.44  ? 167 GLY A H    1 
ATOM   2304  H HA2  . GLY A 1 167 ? -6.808  -22.992 -34.528 1.00 28.14  ? 167 GLY A HA2  1 
ATOM   2305  H HA3  . GLY A 1 167 ? -6.204  -22.541 -33.141 1.00 28.14  ? 167 GLY A HA3  1 
ATOM   2306  N N    . CYS A 1 168 ? -8.397  -24.573 -33.601 1.00 28.86  ? 168 CYS A N    1 
ATOM   2307  C CA   . CYS A 1 168 ? -9.461  -25.465 -33.132 1.00 26.52  ? 168 CYS A CA   1 
ATOM   2308  C C    . CYS A 1 168 ? -9.160  -26.859 -33.650 1.00 33.91  ? 168 CYS A C    1 
ATOM   2309  O O    . CYS A 1 168 ? -9.040  -27.046 -34.864 1.00 26.52  ? 168 CYS A O    1 
ATOM   2310  C CB   . CYS A 1 168 ? -10.845 -25.018 -33.595 1.00 34.93  ? 168 CYS A CB   1 
ATOM   2311  S SG   . CYS A 1 168 ? -12.197 -26.107 -32.925 1.00 33.41  ? 168 CYS A SG   1 
ATOM   2312  H H    . CYS A 1 168 ? -8.046  -24.828 -34.343 1.00 34.59  ? 168 CYS A H    1 
ATOM   2313  H HA   . CYS A 1 168 ? -9.456  -25.491 -32.162 1.00 31.79  ? 168 CYS A HA   1 
ATOM   2314  H HB2  . CYS A 1 168 ? -11.006 -24.113 -33.288 1.00 41.88  ? 168 CYS A HB2  1 
ATOM   2315  H HB3  . CYS A 1 168 ? -10.883 -25.053 -34.564 1.00 41.88  ? 168 CYS A HB3  1 
ATOM   2316  H HG   . CYS A 1 168 ? -12.017 -27.231 -33.303 1.00 40.05  ? 168 CYS A HG   1 
ATOM   2317  N N    . LYS A 1 169 ? -9.034  -27.825 -32.729 1.00 34.72  ? 169 LYS A N    1 
ATOM   2318  C CA   . LYS A 1 169 ? -8.649  -29.178 -33.117 1.00 36.11  ? 169 LYS A CA   1 
ATOM   2319  C C    . LYS A 1 169 ? -9.760  -29.881 -33.886 1.00 34.09  ? 169 LYS A C    1 
ATOM   2320  O O    . LYS A 1 169 ? -9.474  -30.714 -34.765 1.00 42.59  ? 169 LYS A O    1 
ATOM   2321  C CB   . LYS A 1 169 ? -8.284  -30.037 -31.897 1.00 36.92  ? 169 LYS A CB   1 
ATOM   2322  C CG   . LYS A 1 169 ? -7.044  -29.617 -31.100 1.00 47.39  ? 169 LYS A CG   1 
ATOM   2323  C CD   . LYS A 1 169 ? -6.317  -30.830 -30.455 1.00 47.63  ? 169 LYS A CD   1 
ATOM   2324  C CE   . LYS A 1 169 ? -6.046  -30.645 -28.967 1.00 52.95  ? 169 LYS A CE   1 
ATOM   2325  N NZ   . LYS A 1 169 ? -5.444  -29.327 -28.600 1.00 59.02  ? 169 LYS A NZ   1 
ATOM   2326  H H    . LYS A 1 169 ? -9.164  -27.719 -31.885 1.00 41.62  ? 169 LYS A H    1 
ATOM   2327  H HA   . LYS A 1 169 ? -7.870  -29.130 -33.693 1.00 43.29  ? 169 LYS A HA   1 
ATOM   2328  H HB2  . LYS A 1 169 ? -9.036  -30.026 -31.284 1.00 44.26  ? 169 LYS A HB2  1 
ATOM   2329  H HB3  . LYS A 1 169 ? -8.134  -30.946 -32.202 1.00 44.26  ? 169 LYS A HB3  1 
ATOM   2330  H HG2  . LYS A 1 169 ? -6.420  -29.174 -31.695 1.00 56.82  ? 169 LYS A HG2  1 
ATOM   2331  H HG3  . LYS A 1 169 ? -7.313  -29.014 -30.389 1.00 56.82  ? 169 LYS A HG3  1 
ATOM   2332  H HD2  . LYS A 1 169 ? -6.869  -31.621 -30.562 1.00 57.12  ? 169 LYS A HD2  1 
ATOM   2333  H HD3  . LYS A 1 169 ? -5.465  -30.959 -30.900 1.00 57.12  ? 169 LYS A HD3  1 
ATOM   2334  H HE2  . LYS A 1 169 ? -6.885  -30.728 -28.487 1.00 63.50  ? 169 LYS A HE2  1 
ATOM   2335  H HE3  . LYS A 1 169 ? -5.434  -31.339 -28.675 1.00 63.50  ? 169 LYS A HE3  1 
ATOM   2336  H HZ1  . LYS A 1 169 ? -4.662  -29.225 -29.013 1.00 70.78  ? 169 LYS A HZ1  1 
ATOM   2337  H HZ2  . LYS A 1 169 ? -5.988  -28.666 -28.841 1.00 70.78  ? 169 LYS A HZ2  1 
ATOM   2338  H HZ3  . LYS A 1 169 ? -5.313  -29.288 -27.720 1.00 70.78  ? 169 LYS A HZ3  1 
ATOM   2339  N N    . ASP A 1 170 ? -11.021 -29.598 -33.559 1.00 38.84  ? 170 ASP A N    1 
ATOM   2340  C CA   . ASP A 1 170 ? -12.141 -30.318 -34.176 1.00 33.79  ? 170 ASP A CA   1 
ATOM   2341  C C    . ASP A 1 170 ? -12.642 -29.590 -35.418 1.00 33.28  ? 170 ASP A C    1 
ATOM   2342  O O    . ASP A 1 170 ? -13.071 -28.433 -35.311 1.00 41.32  ? 170 ASP A O    1 
ATOM   2343  C CB   . ASP A 1 170 ? -13.297 -30.492 -33.218 1.00 42.33  ? 170 ASP A CB   1 
ATOM   2344  C CG   . ASP A 1 170 ? -14.459 -31.217 -33.875 1.00 46.42  ? 170 ASP A CG   1 
ATOM   2345  O OD1  . ASP A 1 170 ? -14.374 -32.452 -34.014 1.00 52.67  ? 170 ASP A OD1  1 
ATOM   2346  O OD2  . ASP A 1 170 ? -15.419 -30.553 -34.306 1.00 44.27  ? 170 ASP A OD2  1 
ATOM   2347  H H    . ASP A 1 170 ? -11.255 -28.999 -32.988 1.00 46.57  ? 170 ASP A H    1 
ATOM   2348  H HA   . ASP A 1 170 ? -11.839 -31.199 -34.446 1.00 40.50  ? 170 ASP A HA   1 
ATOM   2349  H HB2  . ASP A 1 170 ? -13.004 -31.014 -32.455 1.00 50.75  ? 170 ASP A HB2  1 
ATOM   2350  H HB3  . ASP A 1 170 ? -13.607 -29.619 -32.928 1.00 50.75  ? 170 ASP A HB3  1 
ATOM   2351  N N    . PRO A 1 171 ? -12.660 -30.238 -36.589 1.00 31.64  ? 171 PRO A N    1 
ATOM   2352  C CA   . PRO A 1 171 ? -13.168 -29.564 -37.805 1.00 36.49  ? 171 PRO A CA   1 
ATOM   2353  C C    . PRO A 1 171 ? -14.575 -28.993 -37.700 1.00 34.82  ? 171 PRO A C    1 
ATOM   2354  O O    . PRO A 1 171 ? -14.788 -27.829 -38.066 1.00 45.80  ? 171 PRO A O    1 
ATOM   2355  C CB   . PRO A 1 171 ? -13.079 -30.682 -38.854 1.00 36.34  ? 171 PRO A CB   1 
ATOM   2356  C CG   . PRO A 1 171 ? -11.920 -31.543 -38.381 1.00 40.15  ? 171 PRO A CG   1 
ATOM   2357  C CD   . PRO A 1 171 ? -12.052 -31.547 -36.893 1.00 37.47  ? 171 PRO A CD   1 
ATOM   2358  H HA   . PRO A 1 171 ? -12.562 -28.851 -38.059 1.00 43.75  ? 171 PRO A HA   1 
ATOM   2359  H HB2  . PRO A 1 171 ? -13.906 -31.190 -38.866 1.00 43.57  ? 171 PRO A HB2  1 
ATOM   2360  H HB3  . PRO A 1 171 ? -12.894 -30.301 -39.727 1.00 43.57  ? 171 PRO A HB3  1 
ATOM   2361  H HG2  . PRO A 1 171 ? -12.008 -32.441 -38.739 1.00 48.14  ? 171 PRO A HG2  1 
ATOM   2362  H HG3  . PRO A 1 171 ? -11.079 -31.143 -38.653 1.00 48.14  ? 171 PRO A HG3  1 
ATOM   2363  H HD2  . PRO A 1 171 ? -12.639 -32.266 -36.609 1.00 44.92  ? 171 PRO A HD2  1 
ATOM   2364  H HD3  . PRO A 1 171 ? -11.178 -31.618 -36.478 1.00 44.92  ? 171 PRO A HD3  1 
ATOM   2365  N N    . ALA A 1 172 ? -15.568 -29.762 -37.242 1.00 44.35  ? 172 ALA A N    1 
ATOM   2366  C CA   . ALA A 1 172 ? -16.924 -29.207 -37.269 1.00 35.61  ? 172 ALA A CA   1 
ATOM   2367  C C    . ALA A 1 172 ? -17.055 -28.057 -36.291 1.00 30.85  ? 172 ALA A C    1 
ATOM   2368  O O    . ALA A 1 172 ? -17.744 -27.073 -36.578 1.00 35.09  ? 172 ALA A O    1 
ATOM   2369  C CB   . ALA A 1 172 ? -17.971 -30.272 -36.974 1.00 37.81  ? 172 ALA A CB   1 
ATOM   2370  H H    . ALA A 1 172 ? -15.492 -30.559 -36.930 1.00 53.18  ? 172 ALA A H    1 
ATOM   2371  H HA   . ALA A 1 172 ? -17.099 -28.860 -38.157 1.00 42.69  ? 172 ALA A HA   1 
ATOM   2372  H HB1  . ALA A 1 172 ? -18.851 -29.864 -37.001 1.00 45.33  ? 172 ALA A HB1  1 
ATOM   2373  H HB2  . ALA A 1 172 ? -17.909 -30.970 -37.644 1.00 45.33  ? 172 ALA A HB2  1 
ATOM   2374  H HB3  . ALA A 1 172 ? -17.805 -30.642 -36.093 1.00 45.33  ? 172 ALA A HB3  1 
ATOM   2375  N N    . GLN A 1 173 ? -16.363 -28.135 -35.175 1.00 36.41  ? 173 GLN A N    1 
ATOM   2376  C CA   . GLN A 1 173 ? -16.382 -27.066 -34.203 1.00 31.56  ? 173 GLN A CA   1 
ATOM   2377  C C    . GLN A 1 173 ? -15.673 -25.818 -34.727 1.00 29.99  ? 173 GLN A C    1 
ATOM   2378  O O    . GLN A 1 173 ? -16.124 -24.760 -34.499 1.00 30.72  ? 173 GLN A O    1 
ATOM   2379  C CB   . GLN A 1 173 ? -15.789 -27.507 -32.885 1.00 40.43  ? 173 GLN A CB   1 
ATOM   2380  C CG   . GLN A 1 173 ? -15.517 -26.385 -31.923 1.00 42.29  ? 173 GLN A CG   1 
ATOM   2381  C CD   . GLN A 1 173 ? -16.754 -25.782 -31.302 1.00 48.59  ? 173 GLN A CD   1 
ATOM   2382  O OE1  . GLN A 1 173 ? -16.662 -25.021 -30.367 1.00 50.34  ? 173 GLN A OE1  1 
ATOM   2383  N NE2  . GLN A 1 173 ? -17.905 -26.112 -31.827 1.00 40.26  ? 173 GLN A NE2  1 
ATOM   2384  H H    . GLN A 1 173 ? -15.870 -28.804 -34.954 1.00 43.66  ? 173 GLN A H    1 
ATOM   2385  H HA   . GLN A 1 173 ? -17.316 -26.821 -34.035 1.00 37.83  ? 173 GLN A HA   1 
ATOM   2386  H HB2  . GLN A 1 173 ? -16.407 -28.120 -32.456 1.00 48.47  ? 173 GLN A HB2  1 
ATOM   2387  H HB3  . GLN A 1 173 ? -14.948 -27.958 -33.057 1.00 48.47  ? 173 GLN A HB3  1 
ATOM   2388  H HG2  . GLN A 1 173 ? -14.969 -26.728 -31.200 1.00 50.70  ? 173 GLN A HG2  1 
ATOM   2389  H HG3  . GLN A 1 173 ? -15.040 -25.677 -32.381 1.00 50.70  ? 173 GLN A HG3  1 
ATOM   2390  H HE21 . GLN A 1 173 ? -18.449 -25.501 -32.090 1.00 48.27  ? 173 GLN A HE21 1 
ATOM   2391  H HE22 . GLN A 1 173 ? -18.118 -26.942 -31.910 1.00 48.27  ? 173 GLN A HE22 1 
ATOM   2392  N N    . GLY A 1 174 ? -14.583 -25.960 -35.449 1.00 29.85  ? 174 GLY A N    1 
ATOM   2393  C CA   . GLY A 1 174 ? -13.925 -24.789 -36.008 1.00 29.40  ? 174 GLY A CA   1 
ATOM   2394  C C    . GLY A 1 174 ? -14.809 -24.049 -36.988 1.00 29.62  ? 174 GLY A C    1 
ATOM   2395  O O    . GLY A 1 174 ? -14.867 -22.819 -36.982 1.00 30.37  ? 174 GLY A O    1 
ATOM   2396  H H    . GLY A 1 174 ? -14.218 -26.713 -35.645 1.00 35.78  ? 174 GLY A H    1 
ATOM   2397  H HA2  . GLY A 1 174 ? -13.684 -24.181 -35.292 1.00 35.24  ? 174 GLY A HA2  1 
ATOM   2398  H HA3  . GLY A 1 174 ? -13.116 -25.061 -36.467 1.00 35.24  ? 174 GLY A HA3  1 
ATOM   2399  N N    . GLN A 1 175 ? -15.483 -24.795 -37.847 1.00 35.87  ? 175 GLN A N    1 
ATOM   2400  C CA   . GLN A 1 175 ? -16.385 -24.238 -38.869 1.00 29.57  ? 175 GLN A CA   1 
ATOM   2401  C C    . GLN A 1 175 ? -17.535 -23.500 -38.179 1.00 36.33  ? 175 GLN A C    1 
ATOM   2402  O O    . GLN A 1 175 ? -17.955 -22.460 -38.656 1.00 29.81  ? 175 GLN A O    1 
ATOM   2403  C CB   . GLN A 1 175 ? -16.841 -25.364 -39.774 1.00 38.96  ? 175 GLN A CB   1 
ATOM   2404  C CG   . GLN A 1 175 ? -17.629 -24.887 -40.974 1.00 55.25  ? 175 GLN A CG   1 
ATOM   2405  C CD   . GLN A 1 175 ? -16.905 -23.885 -41.836 1.00 55.91  ? 175 GLN A CD   1 
ATOM   2406  O OE1  . GLN A 1 175 ? -15.726 -23.997 -42.129 1.00 43.16  ? 175 GLN A OE1  1 
ATOM   2407  N NE2  . GLN A 1 175 ? -17.644 -22.893 -42.274 1.00 62.40  ? 175 GLN A NE2  1 
ATOM   2408  H H    . GLN A 1 175 ? -15.429 -25.704 -37.858 1.00 43.00  ? 175 GLN A H    1 
ATOM   2409  H HA   . GLN A 1 175 ? -15.876 -23.588 -39.407 1.00 35.45  ? 175 GLN A HA   1 
ATOM   2410  H HB2  . GLN A 1 175 ? -16.051 -25.855 -40.082 1.00 46.71  ? 175 GLN A HB2  1 
ATOM   2411  H HB3  . GLN A 1 175 ? -17.394 -25.981 -39.251 1.00 46.71  ? 175 GLN A HB3  1 
ATOM   2412  H HG2  . GLN A 1 175 ? -17.863 -25.664 -41.527 1.00 66.25  ? 175 GLN A HG2  1 
ATOM   2413  H HG3  . GLN A 1 175 ? -18.467 -24.485 -40.662 1.00 66.25  ? 175 GLN A HG3  1 
ATOM   2414  H HE21 . GLN A 1 175 ? -18.490 -22.829 -42.027 1.00 74.84  ? 175 GLN A HE21 1 
ATOM   2415  H HE22 . GLN A 1 175 ? -17.296 -22.289 -42.817 1.00 74.84  ? 175 GLN A HE22 1 
ATOM   2416  N N    . LEU A 1 176 ? -18.025 -24.027 -37.071 1.00 34.20  ? 176 LEU A N    1 
ATOM   2417  C CA   . LEU A 1 176 ? -19.080 -23.385 -36.306 1.00 25.75  ? 176 LEU A CA   1 
ATOM   2418  C C    . LEU A 1 176 ? -18.593 -22.075 -35.700 1.00 27.80  ? 176 LEU A C    1 
ATOM   2419  O O    . LEU A 1 176 ? -19.298 -21.055 -35.710 1.00 29.47  ? 176 LEU A O    1 
ATOM   2420  C CB   . LEU A 1 176 ? -19.531 -24.378 -35.232 1.00 33.81  ? 176 LEU A CB   1 
ATOM   2421  C CG   . LEU A 1 176 ? -20.769 -24.138 -34.404 1.00 45.15  ? 176 LEU A CG   1 
ATOM   2422  C CD1  . LEU A 1 176 ? -21.916 -23.646 -35.281 1.00 40.92  ? 176 LEU A CD1  1 
ATOM   2423  C CD2  . LEU A 1 176 ? -21.088 -25.483 -33.706 1.00 42.24  ? 176 LEU A CD2  1 
ATOM   2424  H H    . LEU A 1 176 ? -17.750 -24.773 -36.744 1.00 41.00  ? 176 LEU A H    1 
ATOM   2425  H HA   . LEU A 1 176 ? -19.833 -23.195 -36.887 1.00 30.86  ? 176 LEU A HA   1 
ATOM   2426  H HB2  . LEU A 1 176 ? -19.663 -25.233 -35.673 1.00 40.53  ? 176 LEU A HB2  1 
ATOM   2427  H HB3  . LEU A 1 176 ? -18.799 -24.469 -34.602 1.00 40.53  ? 176 LEU A HB3  1 
ATOM   2428  H HG   . LEU A 1 176 ? -20.585 -23.470 -33.725 1.00 54.14  ? 176 LEU A HG   1 
ATOM   2429  H HD11 . LEU A 1 176 ? -22.697 -23.500 -34.725 1.00 49.06  ? 176 LEU A HD11 1 
ATOM   2430  H HD12 . LEU A 1 176 ? -21.653 -22.815 -35.707 1.00 49.06  ? 176 LEU A HD12 1 
ATOM   2431  H HD13 . LEU A 1 176 ? -22.109 -24.317 -35.954 1.00 49.06  ? 176 LEU A HD13 1 
ATOM   2432  H HD21 . LEU A 1 176 ? -21.882 -25.374 -33.159 1.00 50.65  ? 176 LEU A HD21 1 
ATOM   2433  H HD22 . LEU A 1 176 ? -21.243 -26.161 -34.383 1.00 50.65  ? 176 LEU A HD22 1 
ATOM   2434  H HD23 . LEU A 1 176 ? -20.335 -25.736 -33.150 1.00 50.65  ? 176 LEU A HD23 1 
ATOM   2435  N N    . LEU A 1 177 ? -17.372 -22.073 -35.185 1.00 25.18  ? 177 LEU A N    1 
ATOM   2436  C CA   . LEU A 1 177 ? -16.866 -20.841 -34.626 1.00 28.05  ? 177 LEU A CA   1 
ATOM   2437  C C    . LEU A 1 177 ? -16.584 -19.823 -35.730 1.00 26.40  ? 177 LEU A C    1 
ATOM   2438  O O    . LEU A 1 177 ? -16.754 -18.619 -35.526 1.00 26.57  ? 177 LEU A O    1 
ATOM   2439  C CB   . LEU A 1 177 ? -15.625 -21.162 -33.785 1.00 37.39  ? 177 LEU A CB   1 
ATOM   2440  C CG   . LEU A 1 177 ? -15.892 -22.059 -32.558 1.00 31.77  ? 177 LEU A CG   1 
ATOM   2441  C CD1  . LEU A 1 177 ? -14.623 -22.729 -32.136 1.00 32.52  ? 177 LEU A CD1  1 
ATOM   2442  C CD2  . LEU A 1 177 ? -16.425 -21.227 -31.393 1.00 22.53  ? 177 LEU A CD2  1 
ATOM   2443  H H    . LEU A 1 177 ? -16.838 -22.746 -35.149 1.00 30.17  ? 177 LEU A H    1 
ATOM   2444  H HA   . LEU A 1 177 ? -17.537 -20.463 -34.036 1.00 33.62  ? 177 LEU A HA   1 
ATOM   2445  H HB2  . LEU A 1 177 ? -14.980 -21.619 -34.348 1.00 44.83  ? 177 LEU A HB2  1 
ATOM   2446  H HB3  . LEU A 1 177 ? -15.245 -20.330 -33.463 1.00 44.83  ? 177 LEU A HB3  1 
ATOM   2447  H HG   . LEU A 1 177 ? -16.546 -22.739 -32.782 1.00 38.08  ? 177 LEU A HG   1 
ATOM   2448  H HD11 . LEU A 1 177 ? -14.803 -23.289 -31.365 1.00 38.98  ? 177 LEU A HD11 1 
ATOM   2449  H HD12 . LEU A 1 177 ? -14.294 -23.272 -32.870 1.00 38.98  ? 177 LEU A HD12 1 
ATOM   2450  H HD13 . LEU A 1 177 ? -13.968 -22.051 -31.907 1.00 38.98  ? 177 LEU A HD13 1 
ATOM   2451  H HD21 . LEU A 1 177 ? -16.585 -21.811 -30.635 1.00 26.99  ? 177 LEU A HD21 1 
ATOM   2452  H HD22 . LEU A 1 177 ? -15.768 -20.553 -31.159 1.00 26.99  ? 177 LEU A HD22 1 
ATOM   2453  H HD23 . LEU A 1 177 ? -17.254 -20.801 -31.663 1.00 26.99  ? 177 LEU A HD23 1 
ATOM   2454  N N    . LYS A 1 178 ? -16.170 -20.288 -36.909 1.00 28.06  ? 178 LYS A N    1 
ATOM   2455  C CA   . LYS A 1 178 ? -15.915 -19.358 -38.008 1.00 33.24  ? 178 LYS A CA   1 
ATOM   2456  C C    . LYS A 1 178 ? -17.194 -18.646 -38.421 1.00 26.89  ? 178 LYS A C    1 
ATOM   2457  O O    . LYS A 1 178 ? -17.207 -17.424 -38.611 1.00 27.89  ? 178 LYS A O    1 
ATOM   2458  C CB   . LYS A 1 178 ? -15.302 -20.103 -39.201 1.00 35.82  ? 178 LYS A CB   1 
ATOM   2459  C CG   . LYS A 1 178 ? -14.964 -19.215 -40.400 1.00 30.04  ? 178 LYS A CG   1 
ATOM   2460  C CD   . LYS A 1 178 ? -14.675 -20.093 -41.600 1.00 35.22  ? 178 LYS A CD   1 
ATOM   2461  C CE   . LYS A 1 178 ? -14.501 -19.279 -42.853 1.00 38.70  ? 178 LYS A CE   1 
ATOM   2462  N NZ   . LYS A 1 178 ? -13.095 -18.910 -42.948 1.00 29.31  ? 178 LYS A NZ   1 
ATOM   2463  H H    . LYS A 1 178 ? -16.032 -21.116 -37.095 1.00 33.63  ? 178 LYS A H    1 
ATOM   2464  H HA   . LYS A 1 178 ? -15.280 -18.687 -37.714 1.00 39.85  ? 178 LYS A HA   1 
ATOM   2465  H HB2  . LYS A 1 178 ? -14.481 -20.530 -38.911 1.00 42.95  ? 178 LYS A HB2  1 
ATOM   2466  H HB3  . LYS A 1 178 ? -15.932 -20.776 -39.502 1.00 42.95  ? 178 LYS A HB3  1 
ATOM   2467  H HG2  . LYS A 1 178 ? -15.719 -18.643 -40.607 1.00 36.00  ? 178 LYS A HG2  1 
ATOM   2468  H HG3  . LYS A 1 178 ? -14.175 -18.686 -40.204 1.00 36.00  ? 178 LYS A HG3  1 
ATOM   2469  H HD2  . LYS A 1 178 ? -13.856 -20.589 -41.443 1.00 42.22  ? 178 LYS A HD2  1 
ATOM   2470  H HD3  . LYS A 1 178 ? -15.416 -20.704 -41.735 1.00 42.22  ? 178 LYS A HD3  1 
ATOM   2471  H HE2  . LYS A 1 178 ? -14.741 -19.809 -43.629 1.00 46.40  ? 178 LYS A HE2  1 
ATOM   2472  H HE3  . LYS A 1 178 ? -15.037 -18.472 -42.803 1.00 46.40  ? 178 LYS A HE3  1 
ATOM   2473  H HZ1  . LYS A 1 178 ? -12.590 -19.642 -42.986 1.00 35.13  ? 178 LYS A HZ1  1 
ATOM   2474  H HZ2  . LYS A 1 178 ? -12.957 -18.425 -43.682 1.00 35.13  ? 178 LYS A HZ2  1 
ATOM   2475  H HZ3  . LYS A 1 178 ? -12.858 -18.431 -42.237 1.00 35.13  ? 178 LYS A HZ3  1 
ATOM   2476  N N    . GLU A 1 179 ? -18.289 -19.399 -38.547 1.00 34.75  ? 179 GLU A N    1 
ATOM   2477  C CA   . GLU A 1 179 ? -19.586 -18.814 -38.889 1.00 30.50  ? 179 GLU A CA   1 
ATOM   2478  C C    . GLU A 1 179 ? -20.063 -17.851 -37.814 1.00 31.55  ? 179 GLU A C    1 
ATOM   2479  O O    . GLU A 1 179 ? -20.637 -16.794 -38.113 1.00 25.61  ? 179 GLU A O    1 
ATOM   2480  C CB   . GLU A 1 179 ? -20.605 -19.930 -39.080 1.00 31.08  ? 179 GLU A CB   1 
ATOM   2481  C CG   . GLU A 1 179 ? -20.265 -20.882 -40.231 1.00 30.42  ? 179 GLU A CG   1 
ATOM   2482  C CD   . GLU A 1 179 ? -20.865 -22.280 -40.039 1.00 32.53  ? 179 GLU A CD   1 
ATOM   2483  O OE1  . GLU A 1 179 ? -21.412 -22.565 -38.951 1.00 39.81  ? 179 GLU A OE1  1 
ATOM   2484  O OE2  . GLU A 1 179 ? -20.762 -23.109 -40.973 1.00 37.13  ? 179 GLU A OE2  1 
ATOM   2485  H H    . GLU A 1 179 ? -18.307 -20.252 -38.438 1.00 41.66  ? 179 GLU A H    1 
ATOM   2486  H HA   . GLU A 1 179 ? -19.508 -18.326 -39.724 1.00 36.56  ? 179 GLU A HA   1 
ATOM   2487  H HB2  . GLU A 1 179 ? -20.652 -20.454 -38.265 1.00 37.25  ? 179 GLU A HB2  1 
ATOM   2488  H HB3  . GLU A 1 179 ? -21.471 -19.535 -39.268 1.00 37.25  ? 179 GLU A HB3  1 
ATOM   2489  H HG2  . GLU A 1 179 ? -20.615 -20.516 -41.058 1.00 36.46  ? 179 GLU A HG2  1 
ATOM   2490  H HG3  . GLU A 1 179 ? -19.301 -20.975 -40.290 1.00 36.46  ? 179 GLU A HG3  1 
ATOM   2491  N N    . LEU A 1 180 ? -19.813 -18.182 -36.552 1.00 35.47  ? 180 LEU A N    1 
ATOM   2492  C CA   . LEU A 1 180 ? -20.294 -17.310 -35.495 1.00 25.85  ? 180 LEU A CA   1 
ATOM   2493  C C    . LEU A 1 180 ? -19.593 -15.964 -35.511 1.00 31.17  ? 180 LEU A C    1 
ATOM   2494  O O    . LEU A 1 180 ? -20.186 -14.947 -35.121 1.00 27.81  ? 180 LEU A O    1 
ATOM   2495  C CB   . LEU A 1 180 ? -20.118 -17.998 -34.138 1.00 36.29  ? 180 LEU A CB   1 
ATOM   2496  C CG   . LEU A 1 180 ? -20.509 -17.150 -32.932 1.00 29.38  ? 180 LEU A CG   1 
ATOM   2497  C CD1  . LEU A 1 180 ? -21.955 -16.839 -32.998 1.00 32.60  ? 180 LEU A CD1  1 
ATOM   2498  C CD2  . LEU A 1 180 ? -20.158 -17.858 -31.627 1.00 26.18  ? 180 LEU A CD2  1 
ATOM   2499  H H    . LEU A 1 180 ? -19.383 -18.879 -36.291 1.00 42.52  ? 180 LEU A H    1 
ATOM   2500  H HA   . LEU A 1 180 ? -21.242 -17.152 -35.627 1.00 30.98  ? 180 LEU A HA   1 
ATOM   2501  H HB2  . LEU A 1 180 ? -20.668 -18.798 -34.124 1.00 43.51  ? 180 LEU A HB2  1 
ATOM   2502  H HB3  . LEU A 1 180 ? -19.185 -18.243 -34.035 1.00 43.51  ? 180 LEU A HB3  1 
ATOM   2503  H HG   . LEU A 1 180 ? -20.019 -16.313 -32.961 1.00 35.21  ? 180 LEU A HG   1 
ATOM   2504  H HD11 . LEU A 1 180 ? -22.197 -16.300 -32.230 1.00 39.08  ? 180 LEU A HD11 1 
ATOM   2505  H HD12 . LEU A 1 180 ? -22.135 -16.349 -33.816 1.00 39.08  ? 180 LEU A HD12 1 
ATOM   2506  H HD13 . LEU A 1 180 ? -22.456 -17.669 -32.992 1.00 39.08  ? 180 LEU A HD13 1 
ATOM   2507  H HD21 . LEU A 1 180 ? -20.418 -17.294 -30.883 1.00 31.38  ? 180 LEU A HD21 1 
ATOM   2508  H HD22 . LEU A 1 180 ? -20.636 -18.701 -31.588 1.00 31.38  ? 180 LEU A HD22 1 
ATOM   2509  H HD23 . LEU A 1 180 ? -19.201 -18.018 -31.603 1.00 31.38  ? 180 LEU A HD23 1 
ATOM   2510  N N    . MET A 1 181 ? -18.335 -15.922 -35.939 1.00 21.49  ? 181 MET A N    1 
ATOM   2511  C CA   . MET A 1 181 ? -17.550 -14.721 -35.707 1.00 31.04  ? 181 MET A CA   1 
ATOM   2512  C C    . MET A 1 181 ? -17.132 -13.992 -36.966 1.00 22.79  ? 181 MET A C    1 
ATOM   2513  O O    . MET A 1 181 ? -16.712 -12.847 -36.870 1.00 31.71  ? 181 MET A O    1 
ATOM   2514  C CB   . MET A 1 181 ? -16.305 -15.080 -34.896 1.00 44.58  ? 181 MET A CB   1 
ATOM   2515  C CG   . MET A 1 181 ? -16.753 -15.777 -33.604 1.00 43.55  ? 181 MET A CG   1 
ATOM   2516  S SD   . MET A 1 181 ? -15.695 -15.421 -32.243 1.00 52.83  ? 181 MET A SD   1 
ATOM   2517  C CE   . MET A 1 181 ? -16.081 -13.716 -32.044 1.00 47.47  ? 181 MET A CE   1 
ATOM   2518  H H    . MET A 1 181 ? -17.926 -16.555 -36.353 1.00 25.75  ? 181 MET A H    1 
ATOM   2519  H HA   . MET A 1 181 ? -18.080 -14.114 -35.167 1.00 37.21  ? 181 MET A HA   1 
ATOM   2520  H HB2  . MET A 1 181 ? -15.745 -15.688 -35.403 1.00 53.45  ? 181 MET A HB2  1 
ATOM   2521  H HB3  . MET A 1 181 ? -15.818 -14.273 -34.664 1.00 53.45  ? 181 MET A HB3  1 
ATOM   2522  H HG2  . MET A 1 181 ? -17.647 -15.478 -33.376 1.00 52.22  ? 181 MET A HG2  1 
ATOM   2523  H HG3  . MET A 1 181 ? -16.749 -16.737 -33.744 1.00 52.22  ? 181 MET A HG3  1 
ATOM   2524  H HE1  . MET A 1 181 ? -15.561 -13.359 -31.306 1.00 56.92  ? 181 MET A HE1  1 
ATOM   2525  H HE2  . MET A 1 181 ? -15.860 -13.245 -32.862 1.00 56.92  ? 181 MET A HE2  1 
ATOM   2526  H HE3  . MET A 1 181 ? -17.028 -13.627 -31.855 1.00 56.92  ? 181 MET A HE3  1 
ATOM   2527  N N    . GLN A 1 182 ? -17.227 -14.617 -38.119 1.00 24.80  ? 182 GLN A N    1 
ATOM   2528  C CA   . GLN A 1 182 ? -16.753 -13.974 -39.342 1.00 31.41  ? 182 GLN A CA   1 
ATOM   2529  C C    . GLN A 1 182 ? -17.749 -12.939 -39.871 1.00 36.10  ? 182 GLN A C    1 
ATOM   2530  O O    . GLN A 1 182 ? -18.965 -13.178 -39.897 1.00 43.02  ? 182 GLN A O    1 
ATOM   2531  C CB   . GLN A 1 182 ? -16.501 -15.014 -40.413 1.00 31.38  ? 182 GLN A CB   1 
ATOM   2532  C CG   . GLN A 1 182 ? -16.043 -14.379 -41.743 1.00 31.42  ? 182 GLN A CG   1 
ATOM   2533  C CD   . GLN A 1 182 ? -15.439 -15.383 -42.641 1.00 28.96  ? 182 GLN A CD   1 
ATOM   2534  O OE1  . GLN A 1 182 ? -14.287 -15.758 -42.467 1.00 29.74  ? 182 GLN A OE1  1 
ATOM   2535  N NE2  . GLN A 1 182 ? -16.195 -15.836 -43.628 1.00 34.38  ? 182 GLN A NE2  1 
ATOM   2536  H H    . GLN A 1 182 ? -17.557 -15.403 -38.229 1.00 29.72  ? 182 GLN A H    1 
ATOM   2537  H HA   . GLN A 1 182 ? -15.915 -13.520 -39.158 1.00 37.65  ? 182 GLN A HA   1 
ATOM   2538  H HB2  . GLN A 1 182 ? -15.804 -15.618 -40.111 1.00 37.61  ? 182 GLN A HB2  1 
ATOM   2539  H HB3  . GLN A 1 182 ? -17.320 -15.505 -40.578 1.00 37.61  ? 182 GLN A HB3  1 
ATOM   2540  H HG2  . GLN A 1 182 ? -16.809 -13.990 -42.193 1.00 37.67  ? 182 GLN A HG2  1 
ATOM   2541  H HG3  . GLN A 1 182 ? -15.379 -13.696 -41.560 1.00 37.67  ? 182 GLN A HG3  1 
ATOM   2542  H HE21 . GLN A 1 182 ? -17.000 -15.547 -43.720 1.00 41.22  ? 182 GLN A HE21 1 
ATOM   2543  H HE22 . GLN A 1 182 ? -15.883 -16.421 -44.176 1.00 41.22  ? 182 GLN A HE22 1 
ATOM   2544  N N    . THR A 1 183 ? -17.216 -11.780 -40.292 1.00 34.25  ? 183 THR A N    1 
ATOM   2545  C CA   . THR A 1 183 ? -17.945 -10.737 -41.015 1.00 23.19  ? 183 THR A CA   1 
ATOM   2546  C C    . THR A 1 183 ? -17.151 -10.320 -42.254 1.00 37.29  ? 183 THR A C    1 
ATOM   2547  O O    . THR A 1 183 ? -16.047 -10.819 -42.498 1.00 30.37  ? 183 THR A O    1 
ATOM   2548  C CB   . THR A 1 183 ? -18.227 -9.509  -40.135 1.00 33.59  ? 183 THR A CB   1 
ATOM   2549  O OG1  . THR A 1 183 ? -17.036 -8.738  -39.947 1.00 30.36  ? 183 THR A OG1  1 
ATOM   2550  C CG2  . THR A 1 183 ? -18.791 -9.908  -38.747 1.00 30.30  ? 183 THR A CG2  1 
ATOM   2551  H H    . THR A 1 183 ? -16.392 -11.572 -40.160 1.00 41.06  ? 183 THR A H    1 
ATOM   2552  H HA   . THR A 1 183 ? -18.796 -11.095 -41.311 1.00 27.79  ? 183 THR A HA   1 
ATOM   2553  H HB   . THR A 1 183 ? -18.891 -8.956  -40.576 1.00 40.26  ? 183 THR A HB   1 
ATOM   2554  H HG1  . THR A 1 183 ? -17.199 -8.070  -39.466 1.00 36.39  ? 183 THR A HG1  1 
ATOM   2555  H HG21 . THR A 1 183 ? -18.958 -9.113  -38.216 1.00 36.32  ? 183 THR A HG21 1 
ATOM   2556  H HG22 . THR A 1 183 ? -19.623 -10.395 -38.854 1.00 36.32  ? 183 THR A HG22 1 
ATOM   2557  H HG23 . THR A 1 183 ? -18.154 -10.470 -38.279 1.00 36.32  ? 183 THR A HG23 1 
ATOM   2558  N N    . PRO A 1 184 ? -17.696 -9.447  -43.093 1.00 37.91  ? 184 PRO A N    1 
ATOM   2559  C CA   . PRO A 1 184 ? -16.932 -9.022  -44.274 1.00 40.82  ? 184 PRO A CA   1 
ATOM   2560  C C    . PRO A 1 184 ? -15.658 -8.272  -43.929 1.00 38.38  ? 184 PRO A C    1 
ATOM   2561  O O    . PRO A 1 184 ? -14.741 -8.240  -44.747 1.00 28.91  ? 184 PRO A O    1 
ATOM   2562  C CB   . PRO A 1 184 ? -17.925 -8.139  -45.030 1.00 34.28  ? 184 PRO A CB   1 
ATOM   2563  C CG   . PRO A 1 184 ? -19.276 -8.749  -44.643 1.00 38.79  ? 184 PRO A CG   1 
ATOM   2564  C CD   . PRO A 1 184 ? -19.110 -9.032  -43.172 1.00 32.50  ? 184 PRO A CD   1 
ATOM   2565  H HA   . PRO A 1 184 ? -16.709 -9.791  -44.823 1.00 48.95  ? 184 PRO A HA   1 
ATOM   2566  H HB2  . PRO A 1 184 ? -17.855 -7.221  -44.724 1.00 41.09  ? 184 PRO A HB2  1 
ATOM   2567  H HB3  . PRO A 1 184 ? -17.771 -8.205  -45.985 1.00 41.09  ? 184 PRO A HB3  1 
ATOM   2568  H HG2  . PRO A 1 184 ? -19.988 -8.108  -44.797 1.00 46.50  ? 184 PRO A HG2  1 
ATOM   2569  H HG3  . PRO A 1 184 ? -19.427 -9.567  -45.142 1.00 46.50  ? 184 PRO A HG3  1 
ATOM   2570  H HD2  . PRO A 1 184 ? -19.259 -8.228  -42.651 1.00 38.95  ? 184 PRO A HD2  1 
ATOM   2571  H HD3  . PRO A 1 184 ? -19.694 -9.755  -42.895 1.00 38.95  ? 184 PRO A HD3  1 
ATOM   2572  N N    . ASN A 1 185 ? -15.574 -7.675  -42.746 1.00 33.26  ? 185 ASN A N    1 
ATOM   2573  C CA   . ASN A 1 185 ? -14.397 -6.945  -42.314 1.00 31.17  ? 185 ASN A CA   1 
ATOM   2574  C C    . ASN A 1 185 ? -13.657 -7.619  -41.160 1.00 28.79  ? 185 ASN A C    1 
ATOM   2575  O O    . ASN A 1 185 ? -12.775 -6.998  -40.549 1.00 28.23  ? 185 ASN A O    1 
ATOM   2576  C CB   . ASN A 1 185 ? -14.812 -5.525  -41.945 1.00 34.36  ? 185 ASN A CB   1 
ATOM   2577  C CG   . ASN A 1 185 ? -15.106 -4.701  -43.182 1.00 39.72  ? 185 ASN A CG   1 
ATOM   2578  O OD1  . ASN A 1 185 ? -14.191 -4.321  -43.908 1.00 33.17  ? 185 ASN A OD1  1 
ATOM   2579  N ND2  . ASN A 1 185 ? -16.387 -4.497  -43.479 1.00 36.96  ? 185 ASN A ND2  1 
ATOM   2580  H H    . ASN A 1 185 ? -16.206 -7.680  -42.163 1.00 39.87  ? 185 ASN A H    1 
ATOM   2581  H HA   . ASN A 1 185 ? -13.780 -6.885  -43.061 1.00 37.37  ? 185 ASN A HA   1 
ATOM   2582  H HB2  . ASN A 1 185 ? -15.614 -5.556  -41.401 1.00 41.18  ? 185 ASN A HB2  1 
ATOM   2583  H HB3  . ASN A 1 185 ? -14.091 -5.096  -41.458 1.00 41.18  ? 185 ASN A HB3  1 
ATOM   2584  H HD21 . ASN A 1 185 ? -16.599 -4.042  -44.177 1.00 44.31  ? 185 ASN A HD21 1 
ATOM   2585  H HD22 . ASN A 1 185 ? -17.002 -4.792  -42.955 1.00 44.31  ? 185 ASN A HD22 1 
ATOM   2586  N N    . PHE A 1 186 ? -13.986 -8.876  -40.859 1.00 32.20  ? 186 PHE A N    1 
ATOM   2587  C CA   . PHE A 1 186 ? -13.309 -9.652  -39.817 1.00 29.08  ? 186 PHE A CA   1 
ATOM   2588  C C    . PHE A 1 186 ? -13.180 -11.074 -40.355 1.00 25.93  ? 186 PHE A C    1 
ATOM   2589  O O    . PHE A 1 186 ? -14.068 -11.911 -40.181 1.00 21.48  ? 186 PHE A O    1 
ATOM   2590  C CB   . PHE A 1 186 ? -14.075 -9.597  -38.523 1.00 25.30  ? 186 PHE A CB   1 
ATOM   2591  C CG   . PHE A 1 186 ? -13.286 -10.087 -37.307 1.00 37.59  ? 186 PHE A CG   1 
ATOM   2592  C CD1  . PHE A 1 186 ? -12.036 -9.555  -37.007 1.00 27.58  ? 186 PHE A CD1  1 
ATOM   2593  C CD2  . PHE A 1 186 ? -13.812 -11.049 -36.467 1.00 37.72  ? 186 PHE A CD2  1 
ATOM   2594  C CE1  . PHE A 1 186 ? -11.318 -9.979  -35.902 1.00 30.74  ? 186 PHE A CE1  1 
ATOM   2595  C CE2  . PHE A 1 186 ? -13.102 -11.494 -35.351 1.00 34.79  ? 186 PHE A CE2  1 
ATOM   2596  C CZ   . PHE A 1 186 ? -11.868 -10.956 -35.063 1.00 28.69  ? 186 PHE A CZ   1 
ATOM   2597  H H    . PHE A 1 186 ? -14.613 -9.311  -41.255 1.00 38.60  ? 186 PHE A H    1 
ATOM   2598  H HA   . PHE A 1 186 ? -12.420 -9.295  -39.667 1.00 34.85  ? 186 PHE A HA   1 
ATOM   2599  H HB2  . PHE A 1 186 ? -14.336 -8.678  -38.355 1.00 30.32  ? 186 PHE A HB2  1 
ATOM   2600  H HB3  . PHE A 1 186 ? -14.866 -10.152 -38.606 1.00 30.32  ? 186 PHE A HB3  1 
ATOM   2601  H HD1  . PHE A 1 186 ? -11.674 -8.901  -37.561 1.00 33.05  ? 186 PHE A HD1  1 
ATOM   2602  H HD2  . PHE A 1 186 ? -14.648 -11.412 -36.652 1.00 45.22  ? 186 PHE A HD2  1 
ATOM   2603  H HE1  . PHE A 1 186 ? -10.482 -9.615  -35.716 1.00 36.85  ? 186 PHE A HE1  1 
ATOM   2604  H HE2  . PHE A 1 186 ? -13.468 -12.144 -34.795 1.00 41.71  ? 186 PHE A HE2  1 
ATOM   2605  H HZ   . PHE A 1 186 ? -11.393 -11.254 -34.321 1.00 34.39  ? 186 PHE A HZ   1 
ATOM   2606  N N    . ARG A 1 187 ? -12.087 -11.328 -41.053 1.00 27.62  ? 187 ARG A N    1 
ATOM   2607  C CA   . ARG A 1 187 ? -11.929 -12.570 -41.781 1.00 20.14  ? 187 ARG A CA   1 
ATOM   2608  C C    . ARG A 1 187 ? -11.135 -13.555 -40.962 1.00 23.40  ? 187 ARG A C    1 
ATOM   2609  O O    . ARG A 1 187 ? -10.118 -13.204 -40.363 1.00 25.86  ? 187 ARG A O    1 
ATOM   2610  C CB   . ARG A 1 187 ? -11.223 -12.358 -43.106 1.00 20.61  ? 187 ARG A CB   1 
ATOM   2611  C CG   . ARG A 1 187 ? -11.712 -11.136 -43.880 1.00 31.95  ? 187 ARG A CG   1 
ATOM   2612  C CD   . ARG A 1 187 ? -13.165 -11.299 -44.263 1.00 29.49  ? 187 ARG A CD   1 
ATOM   2613  N NE   . ARG A 1 187 ? -13.426 -12.459 -45.127 1.00 22.54  ? 187 ARG A NE   1 
ATOM   2614  C CZ   . ARG A 1 187 ? -14.648 -12.989 -45.255 1.00 34.92  ? 187 ARG A CZ   1 
ATOM   2615  N NH1  . ARG A 1 187 ? -15.689 -12.496 -44.557 1.00 26.22  ? 187 ARG A NH1  1 
ATOM   2616  N NH2  . ARG A 1 187 ? -14.840 -14.023 -46.038 1.00 27.06  ? 187 ARG A NH2  1 
ATOM   2617  H H    . ARG A 1 187 ? -11.418 -10.792 -41.122 1.00 33.10  ? 187 ARG A H    1 
ATOM   2618  H HA   . ARG A 1 187 ? -12.803 -12.953 -41.958 1.00 24.13  ? 187 ARG A HA   1 
ATOM   2619  H HB2  . ARG A 1 187 ? -10.274 -12.243 -42.939 1.00 24.68  ? 187 ARG A HB2  1 
ATOM   2620  H HB3  . ARG A 1 187 ? -11.365 -13.139 -43.664 1.00 24.68  ? 187 ARG A HB3  1 
ATOM   2621  H HG2  . ARG A 1 187 ? -11.627 -10.346 -43.324 1.00 38.30  ? 187 ARG A HG2  1 
ATOM   2622  H HG3  . ARG A 1 187 ? -11.189 -11.038 -44.692 1.00 38.30  ? 187 ARG A HG3  1 
ATOM   2623  H HD2  . ARG A 1 187 ? -13.691 -11.407 -43.455 1.00 35.34  ? 187 ARG A HD2  1 
ATOM   2624  H HD3  . ARG A 1 187 ? -13.454 -10.504 -44.739 1.00 35.34  ? 187 ARG A HD3  1 
ATOM   2625  H HE   . ARG A 1 187 ? -12.837 -12.658 -45.722 1.00 27.01  ? 187 ARG A HE   1 
ATOM   2626  H HH11 . ARG A 1 187 ? -15.577 -11.819 -44.039 1.00 31.42  ? 187 ARG A HH11 1 
ATOM   2627  H HH12 . ARG A 1 187 ? -16.469 -12.849 -44.642 1.00 31.42  ? 187 ARG A HH12 1 
ATOM   2628  H HH21 . ARG A 1 187 ? -14.183 -14.353 -46.483 1.00 32.43  ? 187 ARG A HH21 1 
ATOM   2629  H HH22 . ARG A 1 187 ? -15.625 -14.368 -46.110 1.00 32.43  ? 187 ARG A HH22 1 
ATOM   2630  N N    . ILE A 1 188 ? -11.555 -14.801 -41.035 1.00 26.04  ? 188 ILE A N    1 
ATOM   2631  C CA   . ILE A 1 188 ? -11.075 -15.856 -40.163 1.00 20.72  ? 188 ILE A CA   1 
ATOM   2632  C C    . ILE A 1 188 ? -10.448 -16.953 -40.997 1.00 24.05  ? 188 ILE A C    1 
ATOM   2633  O O    . ILE A 1 188 ? -10.996 -17.365 -42.023 1.00 23.45  ? 188 ILE A O    1 
ATOM   2634  C CB   . ILE A 1 188 ? -12.232 -16.421 -39.316 1.00 33.60  ? 188 ILE A CB   1 
ATOM   2635  C CG1  . ILE A 1 188 ? -12.776 -15.313 -38.379 1.00 23.16  ? 188 ILE A CG1  1 
ATOM   2636  C CG2  . ILE A 1 188 ? -11.778 -17.658 -38.594 1.00 30.83  ? 188 ILE A CG2  1 
ATOM   2637  C CD1  . ILE A 1 188 ? -13.725 -15.767 -37.356 1.00 33.36  ? 188 ILE A CD1  1 
ATOM   2638  H H    . ILE A 1 188 ? -12.142 -15.071 -41.603 1.00 31.21  ? 188 ILE A H    1 
ATOM   2639  H HA   . ILE A 1 188 ? -10.400 -15.500 -39.565 1.00 24.82  ? 188 ILE A HA   1 
ATOM   2640  H HB   . ILE A 1 188 ? -12.947 -16.676 -39.920 1.00 40.27  ? 188 ILE A HB   1 
ATOM   2641  H HG12 . ILE A 1 188 ? -12.027 -14.904 -37.919 1.00 27.75  ? 188 ILE A HG12 1 
ATOM   2642  H HG13 . ILE A 1 188 ? -13.228 -14.647 -38.920 1.00 27.75  ? 188 ILE A HG13 1 
ATOM   2643  H HG21 . ILE A 1 188 ? -12.514 -18.003 -38.065 1.00 36.95  ? 188 ILE A HG21 1 
ATOM   2644  H HG22 . ILE A 1 188 ? -11.501 -18.320 -39.247 1.00 36.95  ? 188 ILE A HG22 1 
ATOM   2645  H HG23 . ILE A 1 188 ? -11.033 -17.431 -38.016 1.00 36.95  ? 188 ILE A HG23 1 
ATOM   2646  H HD11 . ILE A 1 188 ? -14.005 -15.005 -36.825 1.00 39.99  ? 188 ILE A HD11 1 
ATOM   2647  H HD12 . ILE A 1 188 ? -14.494 -16.165 -37.794 1.00 39.99  ? 188 ILE A HD12 1 
ATOM   2648  H HD13 . ILE A 1 188 ? -13.289 -16.423 -36.790 1.00 39.99  ? 188 ILE A HD13 1 
ATOM   2649  N N    . THR A 1 189 ? -9.309  -17.453 -40.530 1.00 22.59  ? 189 THR A N    1 
ATOM   2650  C CA   . THR A 1 189 ? -8.777  -18.707 -41.014 1.00 24.36  ? 189 THR A CA   1 
ATOM   2651  C C    . THR A 1 189 ? -8.741  -19.665 -39.838 1.00 26.62  ? 189 THR A C    1 
ATOM   2652  O O    . THR A 1 189 ? -8.266  -19.310 -38.755 1.00 26.73  ? 189 THR A O    1 
ATOM   2653  C CB   . THR A 1 189 ? -7.377  -18.528 -41.615 1.00 25.36  ? 189 THR A CB   1 
ATOM   2654  O OG1  . THR A 1 189 ? -7.408  -17.443 -42.549 1.00 23.63  ? 189 THR A OG1  1 
ATOM   2655  C CG2  . THR A 1 189 ? -6.940  -19.810 -42.300 1.00 25.87  ? 189 THR A CG2  1 
ATOM   2656  H H    . THR A 1 189 ? -8.826  -17.078 -39.926 1.00 27.07  ? 189 THR A H    1 
ATOM   2657  H HA   . THR A 1 189 ? -9.364  -19.071 -41.695 1.00 29.19  ? 189 THR A HA   1 
ATOM   2658  H HB   . THR A 1 189 ? -6.745  -18.327 -40.907 1.00 30.39  ? 189 THR A HB   1 
ATOM   2659  H HG1  . THR A 1 189 ? -6.647  -17.333 -42.887 1.00 28.32  ? 189 THR A HG1  1 
ATOM   2660  H HG21 . THR A 1 189 ? -6.055  -19.698 -42.680 1.00 31.01  ? 189 THR A HG21 1 
ATOM   2661  H HG22 . THR A 1 189 ? -6.917  -20.537 -41.658 1.00 31.01  ? 189 THR A HG22 1 
ATOM   2662  H HG23 . THR A 1 189 ? -7.562  -20.036 -43.009 1.00 31.01  ? 189 THR A HG23 1 
ATOM   2663  N N    . VAL A 1 190 ? -9.257  -20.862 -40.053 1.00 30.55  ? 190 VAL A N    1 
ATOM   2664  C CA   . VAL A 1 190 ? -9.268  -21.915 -39.057 1.00 26.34  ? 190 VAL A CA   1 
ATOM   2665  C C    . VAL A 1 190 ? -8.112  -22.854 -39.333 1.00 27.22  ? 190 VAL A C    1 
ATOM   2666  O O    . VAL A 1 190 ? -7.882  -23.271 -40.473 1.00 25.60  ? 190 VAL A O    1 
ATOM   2667  C CB   . VAL A 1 190 ? -10.605 -22.665 -39.059 1.00 31.60  ? 190 VAL A CB   1 
ATOM   2668  C CG1  . VAL A 1 190 ? -10.661 -23.620 -37.891 1.00 30.48  ? 190 VAL A CG1  1 
ATOM   2669  C CG2  . VAL A 1 190 ? -11.726 -21.678 -38.967 1.00 33.49  ? 190 VAL A CG2  1 
ATOM   2670  H H    . VAL A 1 190 ? -9.621  -21.095 -40.796 1.00 36.61  ? 190 VAL A H    1 
ATOM   2671  H HA   . VAL A 1 190 ? -9.139  -21.525 -38.178 1.00 31.56  ? 190 VAL A HA   1 
ATOM   2672  H HB   . VAL A 1 190 ? -10.699 -23.170 -39.881 1.00 37.88  ? 190 VAL A HB   1 
ATOM   2673  H HG11 . VAL A 1 190 ? -11.511 -24.086 -37.905 1.00 36.54  ? 190 VAL A HG11 1 
ATOM   2674  H HG12 . VAL A 1 190 ? -9.933  -24.256 -37.969 1.00 36.54  ? 190 VAL A HG12 1 
ATOM   2675  H HG13 . VAL A 1 190 ? -10.573 -23.116 -37.066 1.00 36.54  ? 190 VAL A HG13 1 
ATOM   2676  H HG21 . VAL A 1 190 ? -12.569 -22.157 -38.969 1.00 40.14  ? 190 VAL A HG21 1 
ATOM   2677  H HG22 . VAL A 1 190 ? -11.634 -21.172 -38.145 1.00 40.14  ? 190 VAL A HG22 1 
ATOM   2678  H HG23 . VAL A 1 190 ? -11.683 -21.081 -39.731 1.00 40.14  ? 190 VAL A HG23 1 
ATOM   2679  N N    . VAL A 1 191 ? -7.335  -23.121 -38.295 1.00 29.55  ? 191 VAL A N    1 
ATOM   2680  C CA   . VAL A 1 191 ? -6.250  -24.083 -38.350 1.00 29.46  ? 191 VAL A CA   1 
ATOM   2681  C C    . VAL A 1 191 ? -6.387  -24.987 -37.136 1.00 31.78  ? 191 VAL A C    1 
ATOM   2682  O O    . VAL A 1 191 ? -7.121  -24.695 -36.180 1.00 30.95  ? 191 VAL A O    1 
ATOM   2683  C CB   . VAL A 1 191 ? -4.878  -23.383 -38.401 1.00 27.43  ? 191 VAL A CB   1 
ATOM   2684  C CG1  . VAL A 1 191 ? -4.885  -22.339 -39.503 1.00 31.44  ? 191 VAL A CG1  1 
ATOM   2685  C CG2  . VAL A 1 191 ? -4.546  -22.739 -37.147 1.00 30.74  ? 191 VAL A CG2  1 
ATOM   2686  H H    . VAL A 1 191 ? -7.421  -22.746 -37.526 1.00 35.41  ? 191 VAL A H    1 
ATOM   2687  H HA   . VAL A 1 191 ? -6.344  -24.627 -39.148 1.00 35.31  ? 191 VAL A HA   1 
ATOM   2688  H HB   . VAL A 1 191 ? -4.190  -24.036 -38.602 1.00 32.88  ? 191 VAL A HB   1 
ATOM   2689  H HG11 . VAL A 1 191 ? -4.019  -21.903 -39.530 1.00 37.69  ? 191 VAL A HG11 1 
ATOM   2690  H HG12 . VAL A 1 191 ? -5.061  -22.777 -40.351 1.00 37.69  ? 191 VAL A HG12 1 
ATOM   2691  H HG13 . VAL A 1 191 ? -5.579  -21.688 -39.316 1.00 37.69  ? 191 VAL A HG13 1 
ATOM   2692  H HG21 . VAL A 1 191 ? -3.678  -22.315 -37.230 1.00 36.85  ? 191 VAL A HG21 1 
ATOM   2693  H HG22 . VAL A 1 191 ? -5.222  -22.073 -36.946 1.00 36.85  ? 191 VAL A HG22 1 
ATOM   2694  H HG23 . VAL A 1 191 ? -4.522  -23.409 -36.445 1.00 36.85  ? 191 VAL A HG23 1 
ATOM   2695  N N    . GLN A 1 192 ? -5.716  -26.114 -37.197 1.00 29.58  ? 192 GLN A N    1 
ATOM   2696  C CA   . GLN A 1 192 ? -5.955  -27.142 -36.200 1.00 31.93  ? 192 GLN A CA   1 
ATOM   2697  C C    . GLN A 1 192 ? -5.006  -27.073 -35.025 1.00 34.17  ? 192 GLN A C    1 
ATOM   2698  O O    . GLN A 1 192 ? -5.234  -27.765 -34.023 1.00 41.61  ? 192 GLN A O    1 
ATOM   2699  C CB   . GLN A 1 192 ? -5.873  -28.509 -36.854 1.00 44.00  ? 192 GLN A CB   1 
ATOM   2700  C CG   . GLN A 1 192 ? -6.919  -28.665 -37.930 1.00 50.36  ? 192 GLN A CG   1 
ATOM   2701  C CD   . GLN A 1 192 ? -6.713  -29.901 -38.762 1.00 73.69  ? 192 GLN A CD   1 
ATOM   2702  O OE1  . GLN A 1 192 ? -5.693  -30.051 -39.444 1.00 72.98  ? 192 GLN A OE1  1 
ATOM   2703  N NE2  . GLN A 1 192 ? -7.685  -30.800 -38.712 1.00 83.28  ? 192 GLN A NE2  1 
ATOM   2704  H H    . GLN A 1 192 ? -5.126  -26.312 -37.792 1.00 35.45  ? 192 GLN A H    1 
ATOM   2705  H HA   . GLN A 1 192 ? -6.855  -27.034 -35.856 1.00 38.28  ? 192 GLN A HA   1 
ATOM   2706  H HB2  . GLN A 1 192 ? -4.999  -28.618 -37.261 1.00 52.75  ? 192 GLN A HB2  1 
ATOM   2707  H HB3  . GLN A 1 192 ? -6.020  -29.194 -36.184 1.00 52.75  ? 192 GLN A HB3  1 
ATOM   2708  H HG2  . GLN A 1 192 ? -7.794  -28.725 -37.515 1.00 60.39  ? 192 GLN A HG2  1 
ATOM   2709  H HG3  . GLN A 1 192 ? -6.884  -27.896 -38.520 1.00 60.39  ? 192 GLN A HG3  1 
ATOM   2710  H HE21 . GLN A 1 192 ? -8.379  -30.657 -38.225 1.00 99.90  ? 192 GLN A HE21 1 
ATOM   2711  H HE22 . GLN A 1 192 ? -7.622  -31.527 -39.168 1.00 99.90  ? 192 GLN A HE22 1 
ATOM   2712  N N    . GLU A 1 193 ? -3.993  -26.227 -35.095 1.00 36.28  ? 193 GLU A N    1 
ATOM   2713  C CA   . GLU A 1 193 ? -2.914  -26.220 -34.111 1.00 35.46  ? 193 GLU A CA   1 
ATOM   2714  C C    . GLU A 1 193 ? -3.188  -25.159 -33.060 1.00 36.79  ? 193 GLU A C    1 
ATOM   2715  O O    . GLU A 1 193 ? -2.748  -24.014 -33.163 1.00 41.60  ? 193 GLU A O    1 
ATOM   2716  C CB   . GLU A 1 193 ? -1.575  -25.982 -34.785 1.00 27.88  ? 193 GLU A CB   1 
ATOM   2717  C CG   . GLU A 1 193 ? -1.182  -27.125 -35.680 1.00 38.05  ? 193 GLU A CG   1 
ATOM   2718  C CD   . GLU A 1 193 ? 0.127   -26.877 -36.406 1.00 37.33  ? 193 GLU A CD   1 
ATOM   2719  O OE1  . GLU A 1 193 ? 0.795   -25.876 -36.089 1.00 31.16  ? 193 GLU A OE1  1 
ATOM   2720  O OE2  . GLU A 1 193 ? 0.489   -27.699 -37.267 1.00 37.46  ? 193 GLU A OE2  1 
ATOM   2721  H H    . GLU A 1 193 ? -3.903  -25.634 -35.712 1.00 43.50  ? 193 GLU A H    1 
ATOM   2722  H HA   . GLU A 1 193 ? -2.880  -27.083 -33.668 1.00 42.51  ? 193 GLU A HA   1 
ATOM   2723  H HB2  . GLU A 1 193 ? -1.630  -25.179 -35.326 1.00 33.41  ? 193 GLU A HB2  1 
ATOM   2724  H HB3  . GLU A 1 193 ? -0.890  -25.881 -34.106 1.00 33.41  ? 193 GLU A HB3  1 
ATOM   2725  H HG2  . GLU A 1 193 ? -1.081  -27.926 -35.144 1.00 45.62  ? 193 GLU A HG2  1 
ATOM   2726  H HG3  . GLU A 1 193 ? -1.874  -27.256 -36.347 1.00 45.62  ? 193 GLU A HG3  1 
ATOM   2727  N N    . VAL A 1 194 ? -3.849  -25.577 -32.001 1.00 29.62  ? 194 VAL A N    1 
ATOM   2728  C CA   . VAL A 1 194 ? -4.254  -24.645 -30.958 1.00 27.41  ? 194 VAL A CA   1 
ATOM   2729  C C    . VAL A 1 194 ? -3.031  -24.020 -30.288 1.00 32.20  ? 194 VAL A C    1 
ATOM   2730  O O    . VAL A 1 194 ? -2.896  -22.794 -30.203 1.00 31.79  ? 194 VAL A O    1 
ATOM   2731  C CB   . VAL A 1 194 ? -5.143  -25.355 -29.925 1.00 32.33  ? 194 VAL A CB   1 
ATOM   2732  C CG1  . VAL A 1 194 ? -5.427  -24.421 -28.758 1.00 35.49  ? 194 VAL A CG1  1 
ATOM   2733  C CG2  . VAL A 1 194 ? -6.456  -25.794 -30.536 1.00 32.63  ? 194 VAL A CG2  1 
ATOM   2734  H H    . VAL A 1 194 ? -4.077  -26.394 -31.857 1.00 35.51  ? 194 VAL A H    1 
ATOM   2735  H HA   . VAL A 1 194 ? -4.773  -23.930 -31.358 1.00 32.85  ? 194 VAL A HA   1 
ATOM   2736  H HB   . VAL A 1 194 ? -4.684  -26.139 -29.586 1.00 38.75  ? 194 VAL A HB   1 
ATOM   2737  H HG11 . VAL A 1 194 ? -5.989  -24.881 -28.115 1.00 42.55  ? 194 VAL A HG11 1 
ATOM   2738  H HG12 . VAL A 1 194 ? -4.587  -24.169 -28.344 1.00 42.55  ? 194 VAL A HG12 1 
ATOM   2739  H HG13 . VAL A 1 194 ? -5.883  -23.631 -29.090 1.00 42.55  ? 194 VAL A HG13 1 
ATOM   2740  H HG21 . VAL A 1 194 ? -6.988  -26.237 -29.857 1.00 39.11  ? 194 VAL A HG21 1 
ATOM   2741  H HG22 . VAL A 1 194 ? -6.926  -25.013 -30.868 1.00 39.11  ? 194 VAL A HG22 1 
ATOM   2742  H HG23 . VAL A 1 194 ? -6.275  -26.407 -31.266 1.00 39.11  ? 194 VAL A HG23 1 
ATOM   2743  N N    . ASP A 1 195 ? -2.154  -24.858 -29.747 1.00 31.95  ? 195 ASP A N    1 
ATOM   2744  C CA   . ASP A 1 195 ? -1.020  -24.364 -28.968 1.00 27.33  ? 195 ASP A CA   1 
ATOM   2745  C C    . ASP A 1 195 ? -0.168  -23.397 -29.779 1.00 27.24  ? 195 ASP A C    1 
ATOM   2746  O O    . ASP A 1 195 ? 0.312   -22.380 -29.259 1.00 27.56  ? 195 ASP A O    1 
ATOM   2747  C CB   . ASP A 1 195 ? -0.163  -25.546 -28.493 1.00 32.17  ? 195 ASP A CB   1 
ATOM   2748  C CG   . ASP A 1 195 ? -0.907  -26.445 -27.522 1.00 52.12  ? 195 ASP A CG   1 
ATOM   2749  O OD1  . ASP A 1 195 ? -2.030  -26.877 -27.877 1.00 54.25  ? 195 ASP A OD1  1 
ATOM   2750  O OD2  . ASP A 1 195 ? -0.387  -26.698 -26.410 1.00 43.37  ? 195 ASP A OD2  1 
ATOM   2751  H H    . ASP A 1 195 ? -2.191  -25.714 -29.814 1.00 38.29  ? 195 ASP A H    1 
ATOM   2752  H HA   . ASP A 1 195 ? -1.349  -23.895 -28.186 1.00 32.76  ? 195 ASP A HA   1 
ATOM   2753  H HB2  . ASP A 1 195 ? 0.094   -26.080 -29.261 1.00 38.56  ? 195 ASP A HB2  1 
ATOM   2754  H HB3  . ASP A 1 195 ? 0.626   -25.205 -28.044 1.00 38.56  ? 195 ASP A HB3  1 
ATOM   2755  N N    . THR A 1 196 ? 0.072   -23.731 -31.035 1.00 23.79  ? 196 THR A N    1 
ATOM   2756  C CA   . THR A 1 196 ? 0.888   -22.886 -31.894 1.00 26.96  ? 196 THR A CA   1 
ATOM   2757  C C    . THR A 1 196 ? 0.268   -21.507 -32.097 1.00 22.82  ? 196 THR A C    1 
ATOM   2758  O O    . THR A 1 196 ? 0.947   -20.478 -32.000 1.00 25.23  ? 196 THR A O    1 
ATOM   2759  C CB   . THR A 1 196 ? 1.073   -23.577 -33.226 1.00 33.00  ? 196 THR A CB   1 
ATOM   2760  O OG1  . THR A 1 196 ? 1.662   -24.864 -32.986 1.00 32.52  ? 196 THR A OG1  1 
ATOM   2761  C CG2  . THR A 1 196 ? 1.958   -22.715 -34.124 1.00 38.75  ? 196 THR A CG2  1 
ATOM   2762  H H    . THR A 1 196 ? -0.224  -24.443 -31.416 1.00 28.50  ? 196 THR A H    1 
ATOM   2763  H HA   . THR A 1 196 ? 1.762   -22.768 -31.489 1.00 32.31  ? 196 THR A HA   1 
ATOM   2764  H HB   . THR A 1 196 ? 0.211   -23.689 -33.656 1.00 39.56  ? 196 THR A HB   1 
ATOM   2765  H HG1  . THR A 1 196 ? 1.159   -25.323 -32.494 1.00 38.99  ? 196 THR A HG1  1 
ATOM   2766  H HG21 . THR A 1 196 ? 2.083   -23.149 -34.982 1.00 46.46  ? 196 THR A HG21 1 
ATOM   2767  H HG22 . THR A 1 196 ? 1.541   -21.850 -34.267 1.00 46.46  ? 196 THR A HG22 1 
ATOM   2768  H HG23 . THR A 1 196 ? 2.824   -22.583 -33.708 1.00 46.46  ? 196 THR A HG23 1 
ATOM   2769  N N    . VAL A 1 197 ? -1.030  -21.464 -32.374 1.00 25.33  ? 197 VAL A N    1 
ATOM   2770  C CA   . VAL A 1 197 ? -1.709  -20.182 -32.502 1.00 25.34  ? 197 VAL A CA   1 
ATOM   2771  C C    . VAL A 1 197 ? -1.552  -19.373 -31.217 1.00 20.24  ? 197 VAL A C    1 
ATOM   2772  O O    . VAL A 1 197 ? -1.228  -18.179 -31.249 1.00 28.45  ? 197 VAL A O    1 
ATOM   2773  C CB   . VAL A 1 197 ? -3.186  -20.398 -32.874 1.00 25.79  ? 197 VAL A CB   1 
ATOM   2774  C CG1  . VAL A 1 197 ? -3.966  -19.072 -32.748 1.00 30.52  ? 197 VAL A CG1  1 
ATOM   2775  C CG2  . VAL A 1 197 ? -3.285  -20.993 -34.289 1.00 26.85  ? 197 VAL A CG2  1 
ATOM   2776  H H    . VAL A 1 197 ? -1.533  -22.151 -32.492 1.00 30.36  ? 197 VAL A H    1 
ATOM   2777  H HA   . VAL A 1 197 ? -1.293  -19.679 -33.220 1.00 30.37  ? 197 VAL A HA   1 
ATOM   2778  H HB   . VAL A 1 197 ? -3.577  -21.034 -32.255 1.00 30.91  ? 197 VAL A HB   1 
ATOM   2779  H HG11 . VAL A 1 197 ? -4.894  -19.227 -32.986 1.00 36.58  ? 197 VAL A HG11 1 
ATOM   2780  H HG12 . VAL A 1 197 ? -3.908  -18.757 -31.833 1.00 36.58  ? 197 VAL A HG12 1 
ATOM   2781  H HG13 . VAL A 1 197 ? -3.575  -18.418 -33.349 1.00 36.58  ? 197 VAL A HG13 1 
ATOM   2782  H HG21 . VAL A 1 197 ? -4.220  -21.124 -34.511 1.00 32.18  ? 197 VAL A HG21 1 
ATOM   2783  H HG22 . VAL A 1 197 ? -2.878  -20.377 -34.919 1.00 32.18  ? 197 VAL A HG22 1 
ATOM   2784  H HG23 . VAL A 1 197 ? -2.817  -21.843 -34.307 1.00 32.18  ? 197 VAL A HG23 1 
ATOM   2785  N N    . GLU A 1 198 ? -1.753  -20.014 -30.073 1.00 23.59  ? 198 GLU A N    1 
ATOM   2786  C CA   . GLU A 1 198 ? -1.838  -19.280 -28.806 1.00 21.79  ? 198 GLU A CA   1 
ATOM   2787  C C    . GLU A 1 198 ? -0.474  -18.781 -28.296 1.00 21.99  ? 198 GLU A C    1 
ATOM   2788  O O    . GLU A 1 198 ? -0.399  -17.716 -27.676 1.00 24.17  ? 198 GLU A O    1 
ATOM   2789  C CB   . GLU A 1 198 ? -2.475  -20.177 -27.757 1.00 24.89  ? 198 GLU A CB   1 
ATOM   2790  C CG   . GLU A 1 198 ? -2.922  -19.445 -26.495 1.00 26.41  ? 198 GLU A CG   1 
ATOM   2791  C CD   . GLU A 1 198 ? -3.644  -20.369 -25.535 1.00 30.64  ? 198 GLU A CD   1 
ATOM   2792  O OE1  . GLU A 1 198 ? -3.754  -21.591 -25.836 1.00 24.16  ? 198 GLU A OE1  1 
ATOM   2793  O OE2  . GLU A 1 198 ? -4.089  -19.868 -24.483 1.00 28.82  ? 198 GLU A OE2  1 
ATOM   2794  H H    . GLU A 1 198 ? -1.842  -20.866 -29.997 1.00 28.27  ? 198 GLU A H    1 
ATOM   2795  H HA   . GLU A 1 198 ? -2.412  -18.508 -28.928 1.00 26.11  ? 198 GLU A HA   1 
ATOM   2796  H HB2  . GLU A 1 198 ? -3.256  -20.602 -28.144 1.00 29.83  ? 198 GLU A HB2  1 
ATOM   2797  H HB3  . GLU A 1 198 ? -1.831  -20.853 -27.493 1.00 29.83  ? 198 GLU A HB3  1 
ATOM   2798  H HG2  . GLU A 1 198 ? -2.144  -19.086 -26.042 1.00 31.66  ? 198 GLU A HG2  1 
ATOM   2799  H HG3  . GLU A 1 198 ? -3.528  -18.729 -26.740 1.00 31.66  ? 198 GLU A HG3  1 
ATOM   2800  N N    . ILE A 1 199 ? 0.598   -19.552 -28.496 1.00 24.06  ? 199 ILE A N    1 
ATOM   2801  C CA   . ILE A 1 199 ? 1.899   -19.173 -27.927 1.00 25.83  ? 199 ILE A CA   1 
ATOM   2802  C C    . ILE A 1 199 ? 2.442   -17.936 -28.625 1.00 23.25  ? 199 ILE A C    1 
ATOM   2803  O O    . ILE A 1 199 ? 3.242   -17.201 -28.049 1.00 21.41  ? 199 ILE A O    1 
ATOM   2804  C CB   . ILE A 1 199 ? 2.890   -20.360 -28.027 1.00 33.80  ? 199 ILE A CB   1 
ATOM   2805  C CG1  . ILE A 1 199 ? 4.160   -20.135 -27.217 1.00 30.21  ? 199 ILE A CG1  1 
ATOM   2806  C CG2  . ILE A 1 199 ? 3.323   -20.596 -29.451 1.00 19.77  ? 199 ILE A CG2  1 
ATOM   2807  C CD1  . ILE A 1 199 ? 3.948   -20.123 -25.790 1.00 30.48  ? 199 ILE A CD1  1 
ATOM   2808  H H    . ILE A 1 199 ? 0.602   -20.284 -28.946 1.00 28.83  ? 199 ILE A H    1 
ATOM   2809  H HA   . ILE A 1 199 ? 1.782   -18.959 -26.988 1.00 30.96  ? 199 ILE A HA   1 
ATOM   2810  H HB   . ILE A 1 199 ? 2.451   -21.160 -27.699 1.00 40.52  ? 199 ILE A HB   1 
ATOM   2811  H HG12 . ILE A 1 199 ? 4.789   -20.846 -27.417 1.00 36.20  ? 199 ILE A HG12 1 
ATOM   2812  H HG13 . ILE A 1 199 ? 4.543   -19.279 -27.467 1.00 36.20  ? 199 ILE A HG13 1 
ATOM   2813  H HG21 . ILE A 1 199 ? 3.941   -21.344 -29.473 1.00 23.69  ? 199 ILE A HG21 1 
ATOM   2814  H HG22 . ILE A 1 199 ? 2.542   -20.797 -29.989 1.00 23.69  ? 199 ILE A HG22 1 
ATOM   2815  H HG23 . ILE A 1 199 ? 3.759   -19.797 -29.785 1.00 23.69  ? 199 ILE A HG23 1 
ATOM   2816  H HD11 . ILE A 1 199 ? 4.798   -19.975 -25.346 1.00 36.53  ? 199 ILE A HD11 1 
ATOM   2817  H HD12 . ILE A 1 199 ? 3.330   -19.409 -25.569 1.00 36.53  ? 199 ILE A HD12 1 
ATOM   2818  H HD13 . ILE A 1 199 ? 3.577   -20.977 -25.520 1.00 36.53  ? 199 ILE A HD13 1 
ATOM   2819  N N    . CYS A 1 200 ? 2.044   -17.709 -29.881 1.00 21.34  ? 200 CYS A N    1 
ATOM   2820  C CA   . CYS A 1 200 ? 2.496   -16.524 -30.618 1.00 25.64  ? 200 CYS A CA   1 
ATOM   2821  C C    . CYS A 1 200 ? 2.245   -15.247 -29.851 1.00 27.81  ? 200 CYS A C    1 
ATOM   2822  O O    . CYS A 1 200 ? 3.087   -14.338 -29.851 1.00 31.09  ? 200 CYS A O    1 
ATOM   2823  C CB   . CYS A 1 200 ? 1.782   -16.414 -31.955 1.00 32.86  ? 200 CYS A CB   1 
ATOM   2824  S SG   . CYS A 1 200 ? 2.240   -17.616 -33.154 1.00 29.90  ? 200 CYS A SG   1 
ATOM   2825  H H    . CYS A 1 200 ? 1.517   -18.223 -30.326 1.00 25.57  ? 200 CYS A H    1 
ATOM   2826  H HA   . CYS A 1 200 ? 3.449   -16.596 -30.787 1.00 30.73  ? 200 CYS A HA   1 
ATOM   2827  H HB2  . CYS A 1 200 ? 0.828   -16.504 -31.802 1.00 39.39  ? 200 CYS A HB2  1 
ATOM   2828  H HB3  . CYS A 1 200 ? 1.969   -15.540 -32.332 1.00 39.39  ? 200 CYS A HB3  1 
ATOM   2829  H HG   . CYS A 1 200 ? 3.414   -17.514 -33.380 1.00 35.84  ? 200 CYS A HG   1 
ATOM   2830  N N    . GLY A 1 201 ? 1.079   -15.154 -29.201 1.00 27.97  ? 201 GLY A N    1 
ATOM   2831  C CA   . GLY A 1 201 ? 0.690   -13.920 -28.541 1.00 26.12  ? 201 GLY A CA   1 
ATOM   2832  C C    . GLY A 1 201 ? 1.607   -13.523 -27.410 1.00 35.77  ? 201 GLY A C    1 
ATOM   2833  O O    . GLY A 1 201 ? 1.798   -12.333 -27.154 1.00 49.60  ? 201 GLY A O    1 
ATOM   2834  H H    . GLY A 1 201 ? 0.505   -15.791 -29.131 1.00 33.52  ? 201 GLY A H    1 
ATOM   2835  H HA2  . GLY A 1 201 ? 0.682   -13.200 -29.191 1.00 31.30  ? 201 GLY A HA2  1 
ATOM   2836  H HA3  . GLY A 1 201 ? -0.206  -14.018 -28.184 1.00 31.30  ? 201 GLY A HA3  1 
ATOM   2837  N N    . ALA A 1 202 ? 2.186   -14.495 -26.716 1.00 36.45  ? 202 ALA A N    1 
ATOM   2838  C CA   . ALA A 1 202 ? 3.139   -14.171 -25.650 1.00 30.80  ? 202 ALA A CA   1 
ATOM   2839  C C    . ALA A 1 202 ? 4.499   -13.838 -26.229 1.00 35.76  ? 202 ALA A C    1 
ATOM   2840  O O    . ALA A 1 202 ? 5.116   -12.823 -25.874 1.00 39.52  ? 202 ALA A O    1 
ATOM   2841  C CB   . ALA A 1 202 ? 3.255   -15.343 -24.681 1.00 36.46  ? 202 ALA A CB   1 
ATOM   2842  H H    . ALA A 1 202 ? 2.051   -15.336 -26.836 1.00 43.70  ? 202 ALA A H    1 
ATOM   2843  H HA   . ALA A 1 202 ? 2.819   -13.399 -25.158 1.00 36.92  ? 202 ALA A HA   1 
ATOM   2844  H HB1  . ALA A 1 202 ? 3.888   -15.113 -23.982 1.00 43.71  ? 202 ALA A HB1  1 
ATOM   2845  H HB2  . ALA A 1 202 ? 2.383   -15.519 -24.293 1.00 43.71  ? 202 ALA A HB2  1 
ATOM   2846  H HB3  . ALA A 1 202 ? 3.565   -16.124 -25.165 1.00 43.71  ? 202 ALA A HB3  1 
ATOM   2847  N N    . LEU A 1 203 ? 4.965   -14.675 -27.145 1.00 24.19  ? 203 LEU A N    1 
ATOM   2848  C CA   . LEU A 1 203 ? 6.320   -14.536 -27.637 1.00 23.97  ? 203 LEU A CA   1 
ATOM   2849  C C    . LEU A 1 203 ? 6.495   -13.271 -28.478 1.00 28.21  ? 203 LEU A C    1 
ATOM   2850  O O    . LEU A 1 203 ? 7.598   -12.707 -28.541 1.00 24.03  ? 203 LEU A O    1 
ATOM   2851  C CB   . LEU A 1 203 ? 6.680   -15.782 -28.441 1.00 28.91  ? 203 LEU A CB   1 
ATOM   2852  C CG   . LEU A 1 203 ? 6.532   -17.141 -27.733 1.00 27.05  ? 203 LEU A CG   1 
ATOM   2853  C CD1  . LEU A 1 203 ? 6.953   -18.388 -28.613 1.00 25.11  ? 203 LEU A CD1  1 
ATOM   2854  C CD2  . LEU A 1 203 ? 7.298   -17.133 -26.485 1.00 29.04  ? 203 LEU A CD2  1 
ATOM   2855  H H    . LEU A 1 203 ? 4.521   -15.325 -27.492 1.00 28.98  ? 203 LEU A H    1 
ATOM   2856  H HA   . LEU A 1 203 ? 6.926   -14.480 -26.881 1.00 28.73  ? 203 LEU A HA   1 
ATOM   2857  H HB2  . LEU A 1 203 ? 6.112   -15.806 -29.227 1.00 34.65  ? 203 LEU A HB2  1 
ATOM   2858  H HB3  . LEU A 1 203 ? 7.606   -15.704 -28.718 1.00 34.65  ? 203 LEU A HB3  1 
ATOM   2859  H HG   . LEU A 1 203 ? 5.598   -17.260 -27.497 1.00 32.42  ? 203 LEU A HG   1 
ATOM   2860  H HD11 . LEU A 1 203 ? 6.829   -19.197 -28.093 1.00 30.09  ? 203 LEU A HD11 1 
ATOM   2861  H HD12 . LEU A 1 203 ? 6.397   -18.416 -29.407 1.00 30.09  ? 203 LEU A HD12 1 
ATOM   2862  H HD13 . LEU A 1 203 ? 7.885   -18.296 -28.865 1.00 30.09  ? 203 LEU A HD13 1 
ATOM   2863  H HD21 . LEU A 1 203 ? 7.198   -17.993 -26.048 1.00 34.81  ? 203 LEU A HD21 1 
ATOM   2864  H HD22 . LEU A 1 203 ? 8.232   -16.972 -26.690 1.00 34.81  ? 203 LEU A HD22 1 
ATOM   2865  H HD23 . LEU A 1 203 ? 6.958   -16.428 -25.912 1.00 34.81  ? 203 LEU A HD23 1 
ATOM   2866  N N    . LYS A 1 204 ? 5.438   -12.817 -29.144 1.00 24.82  ? 204 LYS A N    1 
ATOM   2867  C CA   . LYS A 1 204 ? 5.576   -11.683 -30.058 1.00 23.66  ? 204 LYS A CA   1 
ATOM   2868  C C    . LYS A 1 204 ? 6.016   -10.434 -29.325 1.00 27.67  ? 204 LYS A C    1 
ATOM   2869  O O    . LYS A 1 204 ? 6.739   -9.608  -29.891 1.00 24.81  ? 204 LYS A O    1 
ATOM   2870  C CB   . LYS A 1 204 ? 4.264   -11.405 -30.805 1.00 25.79  ? 204 LYS A CB   1 
ATOM   2871  C CG   . LYS A 1 204 ? 3.293   -10.544 -30.031 1.00 31.64  ? 204 LYS A CG   1 
ATOM   2872  C CD   . LYS A 1 204 ? 1.920   -10.514 -30.691 1.00 33.32  ? 204 LYS A CD   1 
ATOM   2873  C CE   . LYS A 1 204 ? 0.833   -10.025 -29.729 1.00 26.43  ? 204 LYS A CE   1 
ATOM   2874  N NZ   . LYS A 1 204 ? 1.091   -8.644  -29.348 1.00 26.85  ? 204 LYS A NZ   1 
ATOM   2875  H H    . LYS A 1 204 ? 4.642   -13.139 -29.088 1.00 29.74  ? 204 LYS A H    1 
ATOM   2876  H HA   . LYS A 1 204 ? 6.255   -11.895 -30.718 1.00 28.35  ? 204 LYS A HA   1 
ATOM   2877  H HB2  . LYS A 1 204 ? 4.468   -10.948 -31.636 1.00 30.91  ? 204 LYS A HB2  1 
ATOM   2878  H HB3  . LYS A 1 204 ? 3.826   -12.250 -30.993 1.00 30.91  ? 204 LYS A HB3  1 
ATOM   2879  H HG2  . LYS A 1 204 ? 3.191   -10.902 -29.136 1.00 37.93  ? 204 LYS A HG2  1 
ATOM   2880  H HG3  . LYS A 1 204 ? 3.631   -9.635  -29.993 1.00 37.93  ? 204 LYS A HG3  1 
ATOM   2881  H HD2  . LYS A 1 204 ? 1.945   -9.912  -31.451 1.00 39.94  ? 204 LYS A HD2  1 
ATOM   2882  H HD3  . LYS A 1 204 ? 1.686   -11.410 -30.981 1.00 39.94  ? 204 LYS A HD3  1 
ATOM   2883  H HE2  . LYS A 1 204 ? -0.032  -10.068 -30.166 1.00 31.67  ? 204 LYS A HE2  1 
ATOM   2884  H HE3  . LYS A 1 204 ? 0.838   -10.572 -28.928 1.00 31.67  ? 204 LYS A HE3  1 
ATOM   2885  H HZ1  . LYS A 1 204 ? 1.093   -8.124  -30.071 1.00 32.17  ? 204 LYS A HZ1  1 
ATOM   2886  H HZ2  . LYS A 1 204 ? 0.460   -8.359  -28.789 1.00 32.17  ? 204 LYS A HZ2  1 
ATOM   2887  H HZ3  . LYS A 1 204 ? 1.883   -8.582  -28.946 1.00 32.17  ? 204 LYS A HZ3  1 
ATOM   2888  N N    . ASN A 1 205 ? 5.603   -10.279 -28.061 1.00 22.23  ? 205 ASN A N    1 
ATOM   2889  C CA   . ASN A 1 205 ? 5.931   -9.063  -27.322 1.00 26.04  ? 205 ASN A CA   1 
ATOM   2890  C C    . ASN A 1 205 ? 7.397   -8.995  -26.954 1.00 31.39  ? 205 ASN A C    1 
ATOM   2891  O O    . ASN A 1 205 ? 7.946   -7.896  -26.811 1.00 27.30  ? 205 ASN A O    1 
ATOM   2892  C CB   . ASN A 1 205 ? 5.086   -8.959  -26.065 1.00 27.22  ? 205 ASN A CB   1 
ATOM   2893  C CG   . ASN A 1 205 ? 3.629   -8.790  -26.382 1.00 37.40  ? 205 ASN A CG   1 
ATOM   2894  O OD1  . ASN A 1 205 ? 3.268   -8.277  -27.440 1.00 33.18  ? 205 ASN A OD1  1 
ATOM   2895  N ND2  . ASN A 1 205 ? 2.787   -9.264  -25.500 1.00 39.69  ? 205 ASN A ND2  1 
ATOM   2896  H H    . ASN A 1 205 ? 5.141   -10.854 -27.619 1.00 26.64  ? 205 ASN A H    1 
ATOM   2897  H HA   . ASN A 1 205 ? 5.729   -8.295  -27.879 1.00 31.21  ? 205 ASN A HA   1 
ATOM   2898  H HB2  . ASN A 1 205 ? 5.190   -9.771  -25.543 1.00 32.63  ? 205 ASN A HB2  1 
ATOM   2899  H HB3  . ASN A 1 205 ? 5.375   -8.191  -25.549 1.00 32.63  ? 205 ASN A HB3  1 
ATOM   2900  H HD21 . ASN A 1 205 ? 1.940   -9.197  -25.635 1.00 47.58  ? 205 ASN A HD21 1 
ATOM   2901  H HD22 . ASN A 1 205 ? 3.080   -9.624  -24.776 1.00 47.58  ? 205 ASN A HD22 1 
ATOM   2902  N N    . VAL A 1 206 ? 8.050   -10.141 -26.793 1.00 23.41  ? 206 VAL A N    1 
ATOM   2903  C CA   . VAL A 1 206 ? 9.499   -10.098 -26.604 1.00 26.32  ? 206 VAL A CA   1 
ATOM   2904  C C    . VAL A 1 206 ? 10.168  -9.553  -27.853 1.00 21.24  ? 206 VAL A C    1 
ATOM   2905  O O    . VAL A 1 206 ? 11.128  -8.776  -27.779 1.00 24.76  ? 206 VAL A O    1 
ATOM   2906  C CB   . VAL A 1 206 ? 10.039  -11.487 -26.264 1.00 26.70  ? 206 VAL A CB   1 
ATOM   2907  C CG1  . VAL A 1 206 ? 11.547  -11.398 -26.033 1.00 26.55  ? 206 VAL A CG1  1 
ATOM   2908  C CG2  . VAL A 1 206 ? 9.285   -12.036 -25.028 1.00 25.57  ? 206 VAL A CG2  1 
ATOM   2909  H H    . VAL A 1 206 ? 7.698   -10.926 -26.789 1.00 28.04  ? 206 VAL A H    1 
ATOM   2910  H HA   . VAL A 1 206 ? 9.706   -9.504  -25.866 1.00 31.54  ? 206 VAL A HA   1 
ATOM   2911  H HB   . VAL A 1 206 ? 9.880   -12.086 -27.010 1.00 32.00  ? 206 VAL A HB   1 
ATOM   2912  H HG11 . VAL A 1 206 ? 11.886  -12.281 -25.817 1.00 31.82  ? 206 VAL A HG11 1 
ATOM   2913  H HG12 . VAL A 1 206 ? 11.971  -11.068 -26.840 1.00 31.82  ? 206 VAL A HG12 1 
ATOM   2914  H HG13 . VAL A 1 206 ? 11.718  -10.789 -25.297 1.00 31.82  ? 206 VAL A HG13 1 
ATOM   2915  H HG21 . VAL A 1 206 ? 9.630   -12.917 -24.814 1.00 30.64  ? 206 VAL A HG21 1 
ATOM   2916  H HG22 . VAL A 1 206 ? 9.427   -11.434 -24.280 1.00 30.64  ? 206 VAL A HG22 1 
ATOM   2917  H HG23 . VAL A 1 206 ? 8.339   -12.091 -25.234 1.00 30.64  ? 206 VAL A HG23 1 
ATOM   2918  N N    . VAL A 1 207 ? 9.746   -10.029 -29.007 1.00 17.00  ? 207 VAL A N    1 
ATOM   2919  C CA   . VAL A 1 207 ? 10.380  -9.578  -30.251 1.00 18.11  ? 207 VAL A CA   1 
ATOM   2920  C C    . VAL A 1 207 ? 10.148  -8.090  -30.414 1.00 22.76  ? 207 VAL A C    1 
ATOM   2921  O O    . VAL A 1 207 ? 11.053  -7.333  -30.772 1.00 24.57  ? 207 VAL A O    1 
ATOM   2922  C CB   . VAL A 1 207 ? 9.854   -10.395 -31.452 1.00 16.20  ? 207 VAL A CB   1 
ATOM   2923  C CG1  . VAL A 1 207 ? 10.449  -9.931  -32.742 1.00 22.10  ? 207 VAL A CG1  1 
ATOM   2924  C CG2  . VAL A 1 207 ? 10.199  -11.855 -31.259 1.00 22.06  ? 207 VAL A CG2  1 
ATOM   2925  H H    . VAL A 1 207 ? 9.112   -10.601 -29.108 1.00 20.36  ? 207 VAL A H    1 
ATOM   2926  H HA   . VAL A 1 207 ? 11.337  -9.725  -30.187 1.00 21.69  ? 207 VAL A HA   1 
ATOM   2927  H HB   . VAL A 1 207 ? 8.890   -10.310 -31.507 1.00 19.39  ? 207 VAL A HB   1 
ATOM   2928  H HG11 . VAL A 1 207 ? 10.092  -10.470 -33.466 1.00 26.48  ? 207 VAL A HG11 1 
ATOM   2929  H HG12 . VAL A 1 207 ? 10.218  -8.999  -32.878 1.00 26.48  ? 207 VAL A HG12 1 
ATOM   2930  H HG13 . VAL A 1 207 ? 11.413  -10.031 -32.699 1.00 26.48  ? 207 VAL A HG13 1 
ATOM   2931  H HG21 . VAL A 1 207 ? 9.866   -12.361 -32.017 1.00 26.43  ? 207 VAL A HG21 1 
ATOM   2932  H HG22 . VAL A 1 207 ? 11.163  -11.946 -31.199 1.00 26.43  ? 207 VAL A HG22 1 
ATOM   2933  H HG23 . VAL A 1 207 ? 9.784   -12.172 -30.442 1.00 26.43  ? 207 VAL A HG23 1 
ATOM   2934  N N    . ALA A 1 208 ? 8.959   -7.632  -30.020 1.00 23.76  ? 208 ALA A N    1 
ATOM   2935  C CA   . ALA A 1 208 ? 8.612   -6.214  -30.090 1.00 24.64  ? 208 ALA A CA   1 
ATOM   2936  C C    . ALA A 1 208 ? 9.534   -5.353  -29.240 1.00 25.84  ? 208 ALA A C    1 
ATOM   2937  O O    . ALA A 1 208 ? 9.827   -4.192  -29.585 1.00 25.26  ? 208 ALA A O    1 
ATOM   2938  C CB   . ALA A 1 208 ? 7.144   -6.019  -29.641 1.00 31.03  ? 208 ALA A CB   1 
ATOM   2939  H H    . ALA A 1 208 ? 8.331   -8.128  -29.706 1.00 28.47  ? 208 ALA A H    1 
ATOM   2940  H HA   . ALA A 1 208 ? 8.687   -5.915  -31.010 1.00 29.53  ? 208 ALA A HA   1 
ATOM   2941  H HB1  . ALA A 1 208 ? 6.922   -5.076  -29.690 1.00 37.19  ? 208 ALA A HB1  1 
ATOM   2942  H HB2  . ALA A 1 208 ? 6.564   -6.527  -30.229 1.00 37.19  ? 208 ALA A HB2  1 
ATOM   2943  H HB3  . ALA A 1 208 ? 7.049   -6.334  -28.728 1.00 37.19  ? 208 ALA A HB3  1 
ATOM   2944  N N    . VAL A 1 209 ? 9.935   -5.856  -28.079 1.00 24.00  ? 209 VAL A N    1 
ATOM   2945  C CA   . VAL A 1 209 ? 10.859  -5.087  -27.264 1.00 23.59  ? 209 VAL A CA   1 
ATOM   2946  C C    . VAL A 1 209 ? 12.165  -4.892  -28.028 1.00 24.17  ? 209 VAL A C    1 
ATOM   2947  O O    . VAL A 1 209 ? 12.674  -3.776  -28.158 1.00 26.51  ? 209 VAL A O    1 
ATOM   2948  C CB   . VAL A 1 209 ? 11.049  -5.782  -25.906 1.00 28.63  ? 209 VAL A CB   1 
ATOM   2949  C CG1  . VAL A 1 209 ? 12.151  -5.118  -25.089 1.00 29.62  ? 209 VAL A CG1  1 
ATOM   2950  C CG2  . VAL A 1 209 ? 9.754   -5.746  -25.158 1.00 29.28  ? 209 VAL A CG2  1 
ATOM   2951  H H    . VAL A 1 209 ? 9.696   -6.614  -27.751 1.00 28.76  ? 209 VAL A H    1 
ATOM   2952  H HA   . VAL A 1 209 ? 10.477  -4.211  -27.099 1.00 28.26  ? 209 VAL A HA   1 
ATOM   2953  H HB   . VAL A 1 209 ? 11.293  -6.710  -26.051 1.00 34.32  ? 209 VAL A HB   1 
ATOM   2954  H HG11 . VAL A 1 209 ? 12.240  -5.583  -24.243 1.00 35.50  ? 209 VAL A HG11 1 
ATOM   2955  H HG12 . VAL A 1 209 ? 12.984  -5.167  -25.584 1.00 35.50  ? 209 VAL A HG12 1 
ATOM   2956  H HG13 . VAL A 1 209 ? 11.913  -4.190  -24.934 1.00 35.50  ? 209 VAL A HG13 1 
ATOM   2957  H HG21 . VAL A 1 209 ? 9.873   -6.185  -24.301 1.00 35.10  ? 209 VAL A HG21 1 
ATOM   2958  H HG22 . VAL A 1 209 ? 9.493   -4.822  -25.024 1.00 35.10  ? 209 VAL A HG22 1 
ATOM   2959  H HG23 . VAL A 1 209 ? 9.077   -6.210  -25.676 1.00 35.10  ? 209 VAL A HG23 1 
ATOM   2960  N N    . GLY A 1 210 ? 12.657  -5.951  -28.649 1.00 22.40  ? 210 GLY A N    1 
ATOM   2961  C CA   . GLY A 1 210 ? 13.848  -5.809  -29.457 1.00 19.50  ? 210 GLY A CA   1 
ATOM   2962  C C    . GLY A 1 210 ? 13.652  -4.863  -30.625 1.00 25.71  ? 210 GLY A C    1 
ATOM   2963  O O    . GLY A 1 210 ? 14.509  -4.016  -30.909 1.00 28.37  ? 210 GLY A O    1 
ATOM   2964  H H    . GLY A 1 210 ? 12.328  -6.745  -28.619 1.00 26.84  ? 210 GLY A H    1 
ATOM   2965  H HA2  . GLY A 1 210 ? 14.573  -5.471  -28.907 1.00 23.36  ? 210 GLY A HA2  1 
ATOM   2966  H HA3  . GLY A 1 210 ? 14.106  -6.677  -29.805 1.00 23.36  ? 210 GLY A HA3  1 
ATOM   2967  N N    . ALA A 1 211 ? 12.538  -5.006  -31.341 1.00 31.09  ? 211 ALA A N    1 
ATOM   2968  C CA   . ALA A 1 211 ? 12.248  -4.062  -32.409 1.00 27.81  ? 211 ALA A CA   1 
ATOM   2969  C C    . ALA A 1 211 ? 12.281  -2.631  -31.882 1.00 27.87  ? 211 ALA A C    1 
ATOM   2970  O O    . ALA A 1 211 ? 12.863  -1.743  -32.507 1.00 24.84  ? 211 ALA A O    1 
ATOM   2971  C CB   . ALA A 1 211 ? 10.900  -4.383  -33.037 1.00 30.09  ? 211 ALA A CB   1 
ATOM   2972  H H    . ALA A 1 211 ? 11.950  -5.624  -31.231 1.00 37.27  ? 211 ALA A H    1 
ATOM   2973  H HA   . ALA A 1 211 ? 12.926  -4.144  -33.097 1.00 33.33  ? 211 ALA A HA   1 
ATOM   2974  H HB1  . ALA A 1 211 ? 10.723  -3.745  -33.746 1.00 36.07  ? 211 ALA A HB1  1 
ATOM   2975  H HB2  . ALA A 1 211 ? 10.928  -5.282  -33.399 1.00 36.07  ? 211 ALA A HB2  1 
ATOM   2976  H HB3  . ALA A 1 211 ? 10.213  -4.321  -32.356 1.00 36.07  ? 211 ALA A HB3  1 
ATOM   2977  N N    . GLY A 1 212 ? 11.633  -2.385  -30.738 1.00 27.09  ? 212 GLY A N    1 
ATOM   2978  C CA   . GLY A 1 212 ? 11.664  -1.061  -30.149 1.00 26.26  ? 212 GLY A CA   1 
ATOM   2979  C C    . GLY A 1 212 ? 13.078  -0.558  -29.869 1.00 32.10  ? 212 GLY A C    1 
ATOM   2980  O O    . GLY A 1 212 ? 13.368  0.625   -30.058 1.00 26.58  ? 212 GLY A O    1 
ATOM   2981  H H    . GLY A 1 212 ? 11.177  -2.964  -30.295 1.00 32.47  ? 212 GLY A H    1 
ATOM   2982  H HA2  . GLY A 1 212 ? 11.231  -0.433  -30.749 1.00 31.47  ? 212 GLY A HA2  1 
ATOM   2983  H HA3  . GLY A 1 212 ? 11.173  -1.071  -29.312 1.00 31.47  ? 212 GLY A HA3  1 
ATOM   2984  N N    . PHE A 1 213 ? 13.953  -1.427  -29.345 1.00 27.54  ? 213 PHE A N    1 
ATOM   2985  C CA   . PHE A 1 213 ? 15.354  -1.043  -29.153 1.00 33.59  ? 213 PHE A CA   1 
ATOM   2986  C C    . PHE A 1 213 ? 15.950  -0.508  -30.452 1.00 30.92  ? 213 PHE A C    1 
ATOM   2987  O O    . PHE A 1 213 ? 16.652  0.506   -30.444 1.00 25.47  ? 213 PHE A O    1 
ATOM   2988  C CB   . PHE A 1 213 ? 16.224  -2.211  -28.653 1.00 29.25  ? 213 PHE A CB   1 
ATOM   2989  C CG   . PHE A 1 213 ? 15.900  -2.702  -27.262 1.00 30.20  ? 213 PHE A CG   1 
ATOM   2990  C CD1  . PHE A 1 213 ? 15.175  -1.952  -26.379 1.00 27.73  ? 213 PHE A CD1  1 
ATOM   2991  C CD2  . PHE A 1 213 ? 16.378  -3.917  -26.841 1.00 32.09  ? 213 PHE A CD2  1 
ATOM   2992  C CE1  . PHE A 1 213 ? 14.900  -2.430  -25.094 1.00 29.56  ? 213 PHE A CE1  1 
ATOM   2993  C CE2  . PHE A 1 213 ? 16.099  -4.406  -25.585 1.00 29.27  ? 213 PHE A CE2  1 
ATOM   2994  C CZ   . PHE A 1 213 ? 15.365  -3.661  -24.707 1.00 34.51  ? 213 PHE A CZ   1 
ATOM   2995  H H    . PHE A 1 213 ? 13.763  -2.229  -29.097 1.00 33.01  ? 213 PHE A H    1 
ATOM   2996  H HA   . PHE A 1 213 ? 15.397  -0.335  -28.491 1.00 40.27  ? 213 PHE A HA   1 
ATOM   2997  H HB2  . PHE A 1 213 ? 16.112  -2.960  -29.260 1.00 35.06  ? 213 PHE A HB2  1 
ATOM   2998  H HB3  . PHE A 1 213 ? 17.151  -1.928  -28.655 1.00 35.06  ? 213 PHE A HB3  1 
ATOM   2999  H HD1  . PHE A 1 213 ? 14.850  -1.121  -26.640 1.00 33.23  ? 213 PHE A HD1  1 
ATOM   3000  H HD2  . PHE A 1 213 ? 16.871  -4.439  -27.432 1.00 38.47  ? 213 PHE A HD2  1 
ATOM   3001  H HE1  . PHE A 1 213 ? 14.395  -1.917  -24.505 1.00 35.43  ? 213 PHE A HE1  1 
ATOM   3002  H HE2  . PHE A 1 213 ? 16.428  -5.236  -25.326 1.00 35.08  ? 213 PHE A HE2  1 
ATOM   3003  H HZ   . PHE A 1 213 ? 15.187  -3.982  -23.852 1.00 41.37  ? 213 PHE A HZ   1 
ATOM   3004  N N    . CYS A 1 214 ? 15.659  -1.144  -31.574 1.00 25.30  ? 214 CYS A N    1 
ATOM   3005  C CA   . CYS A 1 214 ? 16.179  -0.720  -32.893 1.00 30.54  ? 214 CYS A CA   1 
ATOM   3006  C C    . CYS A 1 214 ? 15.763  0.719   -33.169 1.00 37.01  ? 214 CYS A C    1 
ATOM   3007  O O    . CYS A 1 214 ? 16.614  1.502   -33.528 1.00 30.06  ? 214 CYS A O    1 
ATOM   3008  C CB   . CYS A 1 214 ? 15.648  -1.560  -34.040 1.00 36.65  ? 214 CYS A CB   1 
ATOM   3009  S SG   . CYS A 1 214 ? 16.345  -3.211  -34.107 1.00 33.30  ? 214 CYS A SG   1 
ATOM   3010  H H    . CYS A 1 214 ? 15.125  -1.881  -31.622 1.00 30.32  ? 214 CYS A H    1 
ATOM   3011  H HA   . CYS A 1 214 ? 17.162  -0.778  -32.878 1.00 36.61  ? 214 CYS A HA   1 
ATOM   3012  H HB2  . CYS A 1 214 ? 14.676  -1.637  -33.957 1.00 43.94  ? 214 CYS A HB2  1 
ATOM   3013  H HB3  . CYS A 1 214 ? 15.843  -1.107  -34.885 1.00 43.94  ? 214 CYS A HB3  1 
ATOM   3014  H HG   . CYS A 1 214 ? 15.779  -3.575  -35.104 1.00 39.92  ? 214 CYS A HG   1 
ATOM   3015  N N    . ASP A 1 215 ? 14.479  1.016   -33.033 1.00 27.08  ? 215 ASP A N    1 
ATOM   3016  C CA   . ASP A 1 215 ? 13.950  2.343   -33.307 1.00 32.95  ? 215 ASP A CA   1 
ATOM   3017  C C    . ASP A 1 215 ? 14.640  3.375   -32.427 1.00 32.31  ? 215 ASP A C    1 
ATOM   3018  O O    . ASP A 1 215 ? 15.080  4.426   -32.903 1.00 32.55  ? 215 ASP A O    1 
ATOM   3019  C CB   . ASP A 1 215 ? 12.424  2.337   -33.089 1.00 26.27  ? 215 ASP A CB   1 
ATOM   3020  C CG   . ASP A 1 215 ? 11.706  1.496   -34.106 1.00 33.03  ? 215 ASP A CG   1 
ATOM   3021  O OD1  . ASP A 1 215 ? 12.238  1.410   -35.235 1.00 35.04  ? 215 ASP A OD1  1 
ATOM   3022  O OD2  . ASP A 1 215 ? 10.608  0.942   -33.812 1.00 35.74  ? 215 ASP A OD2  1 
ATOM   3023  H H    . ASP A 1 215 ? 13.883  0.442   -32.800 1.00 32.46  ? 215 ASP A H    1 
ATOM   3024  H HA   . ASP A 1 215 ? 14.122  2.570   -34.234 1.00 39.50  ? 215 ASP A HA   1 
ATOM   3025  H HB2  . ASP A 1 215 ? 12.230  1.978   -32.210 1.00 31.48  ? 215 ASP A HB2  1 
ATOM   3026  H HB3  . ASP A 1 215 ? 12.090  3.245   -33.159 1.00 31.48  ? 215 ASP A HB3  1 
ATOM   3027  N N    . GLY A 1 216 ? 14.811  3.051   -31.143 1.00 26.31  ? 216 GLY A N    1 
ATOM   3028  C CA   . GLY A 1 216 ? 15.359  4.007   -30.194 1.00 32.24  ? 216 GLY A CA   1 
ATOM   3029  C C    . GLY A 1 216 ? 16.854  4.229   -30.340 1.00 36.51  ? 216 GLY A C    1 
ATOM   3030  O O    . GLY A 1 216 ? 17.373  5.242   -29.876 1.00 31.22  ? 216 GLY A O    1 
ATOM   3031  H H    . GLY A 1 216 ? 14.616  2.286   -30.802 1.00 31.53  ? 216 GLY A H    1 
ATOM   3032  H HA2  . GLY A 1 216 ? 14.914  4.861   -30.309 1.00 38.65  ? 216 GLY A HA2  1 
ATOM   3033  H HA3  . GLY A 1 216 ? 15.186  3.695   -29.292 1.00 38.65  ? 216 GLY A HA3  1 
ATOM   3034  N N    . LEU A 1 217 ? 17.572  3.248   -30.886 1.00 28.01  ? 217 LEU A N    1 
ATOM   3035  C CA   . LEU A 1 217 ? 18.998  3.368   -31.183 1.00 29.18  ? 217 LEU A CA   1 
ATOM   3036  C C    . LEU A 1 217 ? 19.252  3.949   -32.563 1.00 29.97  ? 217 LEU A C    1 
ATOM   3037  O O    . LEU A 1 217 ? 20.405  4.181   -32.928 1.00 28.35  ? 217 LEU A O    1 
ATOM   3038  C CB   . LEU A 1 217 ? 19.673  1.998   -31.062 1.00 27.22  ? 217 LEU A CB   1 
ATOM   3039  C CG   . LEU A 1 217 ? 19.683  1.411   -29.651 1.00 29.09  ? 217 LEU A CG   1 
ATOM   3040  C CD1  . LEU A 1 217 ? 20.327  0.009   -29.627 1.00 33.13  ? 217 LEU A CD1  1 
ATOM   3041  C CD2  . LEU A 1 217 ? 20.422  2.340   -28.628 1.00 34.52  ? 217 LEU A CD2  1 
ATOM   3042  H H    . LEU A 1 217 ? 17.245  2.483   -31.100 1.00 33.57  ? 217 LEU A H    1 
ATOM   3043  H HA   . LEU A 1 217 ? 19.406  3.959   -30.531 1.00 34.97  ? 217 LEU A HA   1 
ATOM   3044  H HB2  . LEU A 1 217 ? 19.205  1.371   -31.636 1.00 32.63  ? 217 LEU A HB2  1 
ATOM   3045  H HB3  . LEU A 1 217 ? 20.594  2.080   -31.352 1.00 32.63  ? 217 LEU A HB3  1 
ATOM   3046  H HG   . LEU A 1 217 ? 18.766  1.317   -29.350 1.00 34.87  ? 217 LEU A HG   1 
ATOM   3047  H HD11 . LEU A 1 217 ? 20.315  -0.328  -28.718 1.00 39.72  ? 217 LEU A HD11 1 
ATOM   3048  H HD12 . LEU A 1 217 ? 19.820  -0.581  -30.206 1.00 39.72  ? 217 LEU A HD12 1 
ATOM   3049  H HD13 . LEU A 1 217 ? 21.242  0.077   -29.943 1.00 39.72  ? 217 LEU A HD13 1 
ATOM   3050  H HD21 . LEU A 1 217 ? 20.400  1.924   -27.752 1.00 41.38  ? 217 LEU A HD21 1 
ATOM   3051  H HD22 . LEU A 1 217 ? 21.340  2.458   -28.916 1.00 41.38  ? 217 LEU A HD22 1 
ATOM   3052  H HD23 . LEU A 1 217 ? 19.971  3.198   -28.598 1.00 41.38  ? 217 LEU A HD23 1 
ATOM   3053  N N    . GLY A 1 218 ? 18.202  4.183   -33.335 1.00 22.94  ? 218 GLY A N    1 
ATOM   3054  C CA   . GLY A 1 218 ? 18.345  4.791   -34.631 1.00 30.42  ? 218 GLY A CA   1 
ATOM   3055  C C    . GLY A 1 218 ? 18.682  3.842   -35.760 1.00 32.53  ? 218 GLY A C    1 
ATOM   3056  O O    . GLY A 1 218 ? 19.098  4.303   -36.823 1.00 29.23  ? 218 GLY A O    1 
ATOM   3057  H H    . GLY A 1 218 ? 17.390  3.994   -33.123 1.00 27.48  ? 218 GLY A H    1 
ATOM   3058  H HA2  . GLY A 1 218 ? 17.517  5.241   -34.859 1.00 36.46  ? 218 GLY A HA2  1 
ATOM   3059  H HA3  . GLY A 1 218 ? 19.046  5.460   -34.587 1.00 36.46  ? 218 GLY A HA3  1 
ATOM   3060  N N    . PHE A 1 219 ? 18.501  2.539   -35.583 1.00 27.47  ? 219 PHE A N    1 
ATOM   3061  C CA   . PHE A 1 219 ? 18.862  1.606   -36.645 1.00 24.10  ? 219 PHE A CA   1 
ATOM   3062  C C    . PHE A 1 219 ? 17.869  1.684   -37.792 1.00 28.69  ? 219 PHE A C    1 
ATOM   3063  O O    . PHE A 1 219 ? 16.698  2.065   -37.610 1.00 26.20  ? 219 PHE A O    1 
ATOM   3064  C CB   . PHE A 1 219 ? 18.953  0.178   -36.091 1.00 36.53  ? 219 PHE A CB   1 
ATOM   3065  C CG   . PHE A 1 219 ? 19.997  0.002   -34.985 1.00 36.76  ? 219 PHE A CG   1 
ATOM   3066  C CD1  . PHE A 1 219 ? 21.065  0.872   -34.852 1.00 32.10  ? 219 PHE A CD1  1 
ATOM   3067  C CD2  . PHE A 1 219 ? 19.891  -1.048  -34.085 1.00 35.67  ? 219 PHE A CD2  1 
ATOM   3068  C CE1  . PHE A 1 219 ? 21.996  0.710   -33.831 1.00 28.21  ? 219 PHE A CE1  1 
ATOM   3069  C CE2  . PHE A 1 219 ? 20.824  -1.215  -33.075 1.00 28.93  ? 219 PHE A CE2  1 
ATOM   3070  C CZ   . PHE A 1 219 ? 21.876  -0.333  -32.953 1.00 27.71  ? 219 PHE A CZ   1 
ATOM   3071  H H    . PHE A 1 219 ? 18.178  2.175   -34.873 1.00 32.93  ? 219 PHE A H    1 
ATOM   3072  H HA   . PHE A 1 219 ? 19.735  1.848   -36.991 1.00 28.87  ? 219 PHE A HA   1 
ATOM   3073  H HB2  . PHE A 1 219 ? 18.090  -0.070  -35.724 1.00 43.80  ? 219 PHE A HB2  1 
ATOM   3074  H HB3  . PHE A 1 219 ? 19.186  -0.423  -36.815 1.00 43.80  ? 219 PHE A HB3  1 
ATOM   3075  H HD1  . PHE A 1 219 ? 21.151  1.586   -35.441 1.00 38.48  ? 219 PHE A HD1  1 
ATOM   3076  H HD2  . PHE A 1 219 ? 19.182  -1.645  -34.157 1.00 42.76  ? 219 PHE A HD2  1 
ATOM   3077  H HE1  . PHE A 1 219 ? 22.709  1.302   -33.753 1.00 33.81  ? 219 PHE A HE1  1 
ATOM   3078  H HE2  . PHE A 1 219 ? 20.740  -1.922  -32.478 1.00 34.67  ? 219 PHE A HE2  1 
ATOM   3079  H HZ   . PHE A 1 219 ? 22.503  -0.447  -32.276 1.00 33.21  ? 219 PHE A HZ   1 
ATOM   3080  N N    . GLY A 1 220 ? 18.349  1.334   -39.010 1.00 23.44  ? 220 GLY A N    1 
ATOM   3081  C CA   . GLY A 1 220 ? 17.493  1.431   -40.182 1.00 25.96  ? 220 GLY A CA   1 
ATOM   3082  C C    . GLY A 1 220 ? 16.443  0.341   -40.294 1.00 34.12  ? 220 GLY A C    1 
ATOM   3083  O O    . GLY A 1 220 ? 16.439  -0.628  -39.539 1.00 30.49  ? 220 GLY A O    1 
ATOM   3084  H H    . GLY A 1 220 ? 19.145  1.048   -39.165 1.00 28.09  ? 220 GLY A H    1 
ATOM   3085  H HA2  . GLY A 1 220 ? 17.036  2.286   -40.169 1.00 31.12  ? 220 GLY A HA2  1 
ATOM   3086  H HA3  . GLY A 1 220 ? 18.045  1.397   -40.979 1.00 31.12  ? 220 GLY A HA3  1 
ATOM   3087  N N    . ASP A 1 221 ? 15.535  0.519   -41.271 1.00 27.39  ? 221 ASP A N    1 
ATOM   3088  C CA   . ASP A 1 221 ? 14.488  -0.465  -41.515 1.00 26.35  ? 221 ASP A CA   1 
ATOM   3089  C C    . ASP A 1 221 ? 15.034  -1.858  -41.818 1.00 35.32  ? 221 ASP A C    1 
ATOM   3090  O O    . ASP A 1 221 ? 14.380  -2.858  -41.490 1.00 27.92  ? 221 ASP A O    1 
ATOM   3091  C CB   . ASP A 1 221 ? 13.607  -0.015  -42.671 1.00 30.42  ? 221 ASP A CB   1 
ATOM   3092  C CG   . ASP A 1 221 ? 12.389  0.776   -42.206 1.00 62.78  ? 221 ASP A CG   1 
ATOM   3093  O OD1  . ASP A 1 221 ? 11.461  0.196   -41.557 1.00 49.28  ? 221 ASP A OD1  1 
ATOM   3094  O OD2  . ASP A 1 221 ? 12.367  1.991   -42.495 1.00 62.32  ? 221 ASP A OD2  1 
ATOM   3095  H H    . ASP A 1 221 ? 15.511  1.199   -41.797 1.00 32.83  ? 221 ASP A H    1 
ATOM   3096  H HA   . ASP A 1 221 ? 13.930  -0.531  -40.724 1.00 31.58  ? 221 ASP A HA   1 
ATOM   3097  H HB2  . ASP A 1 221 ? 14.126  0.553   -43.262 1.00 36.46  ? 221 ASP A HB2  1 
ATOM   3098  H HB3  . ASP A 1 221 ? 13.293  -0.796  -43.152 1.00 36.46  ? 221 ASP A HB3  1 
ATOM   3099  N N    . ASN A 1 222 ? 16.188  -1.961  -42.494 1.00 23.84  ? 222 ASN A N    1 
ATOM   3100  C CA   . ASN A 1 222 ? 16.704  -3.285  -42.841 1.00 24.31  ? 222 ASN A CA   1 
ATOM   3101  C C    . ASN A 1 222 ? 17.294  -4.014  -41.633 1.00 24.37  ? 222 ASN A C    1 
ATOM   3102  O O    . ASN A 1 222 ? 17.187  -5.244  -41.537 1.00 24.15  ? 222 ASN A O    1 
ATOM   3103  C CB   . ASN A 1 222 ? 17.745  -3.180  -43.955 1.00 25.34  ? 222 ASN A CB   1 
ATOM   3104  C CG   . ASN A 1 222 ? 17.124  -2.823  -45.279 1.00 26.91  ? 222 ASN A CG   1 
ATOM   3105  O OD1  . ASN A 1 222 ? 16.072  -3.339  -45.636 1.00 28.72  ? 222 ASN A OD1  1 
ATOM   3106  N ND2  . ASN A 1 222 ? 17.730  -1.891  -45.978 1.00 40.69  ? 222 ASN A ND2  1 
ATOM   3107  H H    . ASN A 1 222 ? 16.674  -1.301  -42.753 1.00 28.57  ? 222 ASN A H    1 
ATOM   3108  H HA   . ASN A 1 222 ? 15.970  -3.823  -43.177 1.00 29.13  ? 222 ASN A HA   1 
ATOM   3109  H HB2  . ASN A 1 222 ? 18.387  -2.489  -43.727 1.00 30.36  ? 222 ASN A HB2  1 
ATOM   3110  H HB3  . ASN A 1 222 ? 18.194  -4.034  -44.053 1.00 30.36  ? 222 ASN A HB3  1 
ATOM   3111  H HD21 . ASN A 1 222 ? 17.411  -1.647  -46.738 1.00 48.79  ? 222 ASN A HD21 1 
ATOM   3112  H HD22 . ASN A 1 222 ? 18.461  -1.543  -45.688 1.00 48.79  ? 222 ASN A HD22 1 
ATOM   3113  N N    . THR A 1 223 ? 17.925  -3.291  -40.715 1.00 28.64  ? 223 THR A N    1 
ATOM   3114  C CA   . THR A 1 223 ? 18.328  -3.905  -39.455 1.00 30.01  ? 223 THR A CA   1 
ATOM   3115  C C    . THR A 1 223 ? 17.108  -4.360  -38.658 1.00 23.68  ? 223 THR A C    1 
ATOM   3116  O O    . THR A 1 223 ? 17.090  -5.462  -38.104 1.00 22.50  ? 223 THR A O    1 
ATOM   3117  C CB   . THR A 1 223 ? 19.172  -2.925  -38.652 1.00 30.69  ? 223 THR A CB   1 
ATOM   3118  O OG1  . THR A 1 223 ? 20.373  -2.620  -39.383 1.00 22.92  ? 223 THR A OG1  1 
ATOM   3119  C CG2  . THR A 1 223 ? 19.539  -3.503  -37.335 1.00 26.34  ? 223 THR A CG2  1 
ATOM   3120  H H    . THR A 1 223 ? 18.128  -2.459  -40.793 1.00 34.33  ? 223 THR A H    1 
ATOM   3121  H HA   . THR A 1 223 ? 18.872  -4.686  -39.643 1.00 35.97  ? 223 THR A HA   1 
ATOM   3122  H HB   . THR A 1 223 ? 18.668  -2.110  -38.501 1.00 36.79  ? 223 THR A HB   1 
ATOM   3123  H HG1  . THR A 1 223 ? 20.814  -3.322  -39.516 1.00 27.46  ? 223 THR A HG1  1 
ATOM   3124  H HG21 . THR A 1 223 ? 20.076  -2.870  -36.833 1.00 31.57  ? 223 THR A HG21 1 
ATOM   3125  H HG22 . THR A 1 223 ? 18.738  -3.708  -36.828 1.00 31.57  ? 223 THR A HG22 1 
ATOM   3126  H HG23 . THR A 1 223 ? 20.049  -4.318  -37.462 1.00 31.57  ? 223 THR A HG23 1 
ATOM   3127  N N    . LYS A 1 224 ? 16.078  -3.519  -38.587 1.00 25.91  ? 224 LYS A N    1 
ATOM   3128  C CA   . LYS A 1 224 ? 14.903  -3.852  -37.786 1.00 31.58  ? 224 LYS A CA   1 
ATOM   3129  C C    . LYS A 1 224 ? 14.189  -5.055  -38.372 1.00 28.57  ? 224 LYS A C    1 
ATOM   3130  O O    . LYS A 1 224 ? 13.685  -5.919  -37.642 1.00 22.87  ? 224 LYS A O    1 
ATOM   3131  C CB   . LYS A 1 224 ? 13.955  -2.647  -37.721 1.00 24.17  ? 224 LYS A CB   1 
ATOM   3132  C CG   . LYS A 1 224 ? 12.768  -2.806  -36.787 1.00 27.44  ? 224 LYS A CG   1 
ATOM   3133  C CD   . LYS A 1 224 ? 11.713  -1.702  -37.041 1.00 35.85  ? 224 LYS A CD   1 
ATOM   3134  C CE   . LYS A 1 224 ? 10.596  -1.761  -36.023 1.00 34.66  ? 224 LYS A CE   1 
ATOM   3135  N NZ   . LYS A 1 224 ? 9.844   -0.457  -35.929 1.00 42.95  ? 224 LYS A NZ   1 
ATOM   3136  H H    . LYS A 1 224 ? 16.034  -2.759  -38.987 1.00 31.05  ? 224 LYS A H    1 
ATOM   3137  H HA   . LYS A 1 224 ? 15.181  -4.072  -36.883 1.00 37.86  ? 224 LYS A HA   1 
ATOM   3138  H HB2  . LYS A 1 224 ? 14.460  -1.874  -37.422 1.00 28.96  ? 224 LYS A HB2  1 
ATOM   3139  H HB3  . LYS A 1 224 ? 13.606  -2.482  -38.611 1.00 28.96  ? 224 LYS A HB3  1 
ATOM   3140  H HG2  . LYS A 1 224 ? 12.351  -3.669  -36.940 1.00 32.88  ? 224 LYS A HG2  1 
ATOM   3141  H HG3  . LYS A 1 224 ? 13.070  -2.735  -35.868 1.00 32.88  ? 224 LYS A HG3  1 
ATOM   3142  H HD2  . LYS A 1 224 ? 12.138  -0.832  -36.976 1.00 42.97  ? 224 LYS A HD2  1 
ATOM   3143  H HD3  . LYS A 1 224 ? 11.328  -1.823  -37.923 1.00 42.97  ? 224 LYS A HD3  1 
ATOM   3144  H HE2  . LYS A 1 224 ? 9.968   -2.453  -36.280 1.00 41.55  ? 224 LYS A HE2  1 
ATOM   3145  H HE3  . LYS A 1 224 ? 10.971  -1.957  -35.150 1.00 41.55  ? 224 LYS A HE3  1 
ATOM   3146  H HZ1  . LYS A 1 224 ? 9.484   -0.256  -36.717 1.00 51.50  ? 224 LYS A HZ1  1 
ATOM   3147  H HZ2  . LYS A 1 224 ? 9.195   -0.524  -35.323 1.00 51.50  ? 224 LYS A HZ2  1 
ATOM   3148  H HZ3  . LYS A 1 224 ? 10.398  0.196   -35.688 1.00 51.50  ? 224 LYS A HZ3  1 
ATOM   3149  N N    . ALA A 1 225 ? 14.125  -5.118  -39.696 1.00 21.77  ? 225 ALA A N    1 
ATOM   3150  C CA   . ALA A 1 225 ? 13.510  -6.268  -40.322 1.00 30.11  ? 225 ALA A CA   1 
ATOM   3151  C C    . ALA A 1 225 ? 14.264  -7.539  -39.974 1.00 22.57  ? 225 ALA A C    1 
ATOM   3152  O O    . ALA A 1 225 ? 13.654  -8.584  -39.763 1.00 23.01  ? 225 ALA A O    1 
ATOM   3153  C CB   . ALA A 1 225 ? 13.442  -6.076  -41.823 1.00 29.63  ? 225 ALA A CB   1 
ATOM   3154  H H    . ALA A 1 225 ? 14.423  -4.522  -40.239 1.00 26.08  ? 225 ALA A H    1 
ATOM   3155  H HA   . ALA A 1 225 ? 12.602  -6.359  -39.991 1.00 36.09  ? 225 ALA A HA   1 
ATOM   3156  H HB1  . ALA A 1 225 ? 13.027  -6.856  -42.222 1.00 35.51  ? 225 ALA A HB1  1 
ATOM   3157  H HB2  . ALA A 1 225 ? 12.914  -5.285  -42.015 1.00 35.51  ? 225 ALA A HB2  1 
ATOM   3158  H HB3  . ALA A 1 225 ? 14.342  -5.966  -42.167 1.00 35.51  ? 225 ALA A HB3  1 
ATOM   3159  N N    . ALA A 1 226 ? 15.594  -7.469  -39.936 1.00 25.15  ? 226 ALA A N    1 
ATOM   3160  C CA   . ALA A 1 226 ? 16.396  -8.610  -39.501 1.00 26.12  ? 226 ALA A CA   1 
ATOM   3161  C C    . ALA A 1 226 ? 16.071  -9.019  -38.067 1.00 24.34  ? 226 ALA A C    1 
ATOM   3162  O O    . ALA A 1 226 ? 15.958  -10.211 -37.765 1.00 22.29  ? 226 ALA A O    1 
ATOM   3163  C CB   . ALA A 1 226 ? 17.884  -8.280  -39.617 1.00 23.31  ? 226 ALA A CB   1 
ATOM   3164  H H    . ALA A 1 226 ? 16.053  -6.776  -40.155 1.00 30.14  ? 226 ALA A H    1 
ATOM   3165  H HA   . ALA A 1 226 ? 16.209  -9.366  -40.079 1.00 31.31  ? 226 ALA A HA   1 
ATOM   3166  H HB1  . ALA A 1 226 ? 18.401  -9.047  -39.324 1.00 27.93  ? 226 ALA A HB1  1 
ATOM   3167  H HB2  . ALA A 1 226 ? 18.090  -8.075  -40.542 1.00 27.93  ? 226 ALA A HB2  1 
ATOM   3168  H HB3  . ALA A 1 226 ? 18.082  -7.514  -39.055 1.00 27.93  ? 226 ALA A HB3  1 
ATOM   3169  N N    . VAL A 1 227 ? 15.910  -8.048  -37.173 1.00 26.04  ? 227 VAL A N    1 
ATOM   3170  C CA   . VAL A 1 227 ? 15.577  -8.376  -35.784 1.00 25.65  ? 227 VAL A CA   1 
ATOM   3171  C C    . VAL A 1 227 ? 14.213  -9.040  -35.707 1.00 23.55  ? 227 VAL A C    1 
ATOM   3172  O O    . VAL A 1 227 ? 14.044  -10.065 -35.035 1.00 24.64  ? 227 VAL A O    1 
ATOM   3173  C CB   . VAL A 1 227 ? 15.655  -7.113  -34.904 1.00 22.80  ? 227 VAL A CB   1 
ATOM   3174  C CG1  . VAL A 1 227 ? 15.099  -7.371  -33.471 1.00 23.00  ? 227 VAL A CG1  1 
ATOM   3175  C CG2  . VAL A 1 227 ? 17.130  -6.666  -34.814 1.00 30.01  ? 227 VAL A CG2  1 
ATOM   3176  H H    . VAL A 1 227 ? 15.986  -7.207  -37.337 1.00 31.21  ? 227 VAL A H    1 
ATOM   3177  H HA   . VAL A 1 227 ? 16.232  -9.008  -35.449 1.00 30.74  ? 227 VAL A HA   1 
ATOM   3178  H HB   . VAL A 1 227 ? 15.140  -6.399  -35.312 1.00 27.31  ? 227 VAL A HB   1 
ATOM   3179  H HG11 . VAL A 1 227 ? 15.167  -6.553  -32.955 1.00 27.55  ? 227 VAL A HG11 1 
ATOM   3180  H HG12 . VAL A 1 227 ? 14.171  -7.644  -33.538 1.00 27.55  ? 227 VAL A HG12 1 
ATOM   3181  H HG13 . VAL A 1 227 ? 15.622  -8.072  -33.052 1.00 27.55  ? 227 VAL A HG13 1 
ATOM   3182  H HG21 . VAL A 1 227 ? 17.186  -5.871  -34.261 1.00 35.98  ? 227 VAL A HG21 1 
ATOM   3183  H HG22 . VAL A 1 227 ? 17.653  -7.382  -34.419 1.00 35.98  ? 227 VAL A HG22 1 
ATOM   3184  H HG23 . VAL A 1 227 ? 17.456  -6.472  -35.707 1.00 35.98  ? 227 VAL A HG23 1 
ATOM   3185  N N    . ILE A 1 228 ? 13.232  -8.502  -36.427 1.00 24.63  ? 228 ILE A N    1 
ATOM   3186  C CA   . ILE A 1 228 ? 11.891  -9.083  -36.404 1.00 29.49  ? 228 ILE A CA   1 
ATOM   3187  C C    . ILE A 1 228 ? 11.924  -10.502 -36.965 1.00 27.18  ? 228 ILE A C    1 
ATOM   3188  O O    . ILE A 1 228 ? 11.354  -11.448 -36.390 1.00 24.07  ? 228 ILE A O    1 
ATOM   3189  C CB   . ILE A 1 228 ? 10.915  -8.180  -37.185 1.00 28.51  ? 228 ILE A CB   1 
ATOM   3190  C CG1  . ILE A 1 228 ? 10.759  -6.824  -36.474 1.00 29.05  ? 228 ILE A CG1  1 
ATOM   3191  C CG2  . ILE A 1 228 ? 9.557   -8.869  -37.361 1.00 25.07  ? 228 ILE A CG2  1 
ATOM   3192  C CD1  . ILE A 1 228 ? 9.829   -5.820  -37.194 1.00 30.52  ? 228 ILE A CD1  1 
ATOM   3193  H H    . ILE A 1 228 ? 13.315  -7.810  -36.931 1.00 29.52  ? 228 ILE A H    1 
ATOM   3194  H HA   . ILE A 1 228 ? 11.583  -9.131  -35.485 1.00 35.35  ? 228 ILE A HA   1 
ATOM   3195  H HB   . ILE A 1 228 ? 11.290  -8.020  -38.066 1.00 34.17  ? 228 ILE A HB   1 
ATOM   3196  H HG12 . ILE A 1 228 ? 10.394  -6.979  -35.589 1.00 34.82  ? 228 ILE A HG12 1 
ATOM   3197  H HG13 . ILE A 1 228 ? 11.634  -6.412  -36.399 1.00 34.82  ? 228 ILE A HG13 1 
ATOM   3198  H HG21 . ILE A 1 228 ? 8.966   -8.279  -37.855 1.00 30.04  ? 228 ILE A HG21 1 
ATOM   3199  H HG22 . ILE A 1 228 ? 9.684   -9.696  -37.851 1.00 30.04  ? 228 ILE A HG22 1 
ATOM   3200  H HG23 . ILE A 1 228 ? 9.183   -9.056  -36.486 1.00 30.04  ? 228 ILE A HG23 1 
ATOM   3201  H HD11 . ILE A 1 228 ? 9.791   -4.999  -36.678 1.00 36.58  ? 228 ILE A HD11 1 
ATOM   3202  H HD12 . ILE A 1 228 ? 10.185  -5.638  -38.078 1.00 36.58  ? 228 ILE A HD12 1 
ATOM   3203  H HD13 . ILE A 1 228 ? 8.943   -6.207  -37.267 1.00 36.58  ? 228 ILE A HD13 1 
ATOM   3204  N N    . ARG A 1 229 ? 12.608  -10.671 -38.090 1.00 18.65  ? 229 ARG A N    1 
ATOM   3205  C CA   . ARG A 1 229 ? 12.695  -11.984 -38.720 1.00 16.89  ? 229 ARG A CA   1 
ATOM   3206  C C    . ARG A 1 229 ? 13.357  -12.983 -37.798 1.00 20.50  ? 229 ARG A C    1 
ATOM   3207  O O    . ARG A 1 229 ? 12.856  -14.102 -37.606 1.00 25.64  ? 229 ARG A O    1 
ATOM   3208  C CB   . ARG A 1 229 ? 13.482  -11.911 -40.033 1.00 24.28  ? 229 ARG A CB   1 
ATOM   3209  C CG   . ARG A 1 229 ? 13.125  -13.053 -40.955 1.00 22.51  ? 229 ARG A CG   1 
ATOM   3210  C CD   . ARG A 1 229 ? 14.142  -13.248 -42.045 1.00 32.08  ? 229 ARG A CD   1 
ATOM   3211  N NE   . ARG A 1 229 ? 15.427  -13.684 -41.530 1.00 27.01  ? 229 ARG A NE   1 
ATOM   3212  C CZ   . ARG A 1 229 ? 15.771  -14.947 -41.299 1.00 33.57  ? 229 ARG A CZ   1 
ATOM   3213  N NH1  . ARG A 1 229 ? 16.985  -15.230 -40.843 1.00 31.50  ? 229 ARG A NH1  1 
ATOM   3214  N NH2  . ARG A 1 229 ? 14.911  -15.929 -41.520 1.00 28.81  ? 229 ARG A NH2  1 
ATOM   3215  H H    . ARG A 1 229 ? 13.028  -10.048 -38.507 1.00 22.34  ? 229 ARG A H    1 
ATOM   3216  H HA   . ARG A 1 229 ? 11.800  -12.302 -38.920 1.00 20.22  ? 229 ARG A HA   1 
ATOM   3217  H HB2  . ARG A 1 229 ? 13.274  -11.078 -40.485 1.00 29.09  ? 229 ARG A HB2  1 
ATOM   3218  H HB3  . ARG A 1 229 ? 14.432  -11.960 -39.840 1.00 29.09  ? 229 ARG A HB3  1 
ATOM   3219  H HG2  . ARG A 1 229 ? 13.075  -13.873 -40.439 1.00 26.97  ? 229 ARG A HG2  1 
ATOM   3220  H HG3  . ARG A 1 229 ? 12.269  -12.868 -41.371 1.00 26.97  ? 229 ARG A HG3  1 
ATOM   3221  H HD2  . ARG A 1 229 ? 13.820  -13.925 -42.662 1.00 38.46  ? 229 ARG A HD2  1 
ATOM   3222  H HD3  . ARG A 1 229 ? 14.274  -12.408 -42.511 1.00 38.46  ? 229 ARG A HD3  1 
ATOM   3223  H HE   . ARG A 1 229 ? 16.012  -13.076 -41.361 1.00 32.37  ? 229 ARG A HE   1 
ATOM   3224  H HH11 . ARG A 1 229 ? 17.546  -14.595 -40.694 1.00 37.76  ? 229 ARG A HH11 1 
ATOM   3225  H HH12 . ARG A 1 229 ? 17.206  -16.046 -40.686 1.00 37.76  ? 229 ARG A HH12 1 
ATOM   3226  H HH21 . ARG A 1 229 ? 14.125  -15.753 -41.820 1.00 34.53  ? 229 ARG A HH21 1 
ATOM   3227  H HH22 . ARG A 1 229 ? 15.140  -16.744 -41.366 1.00 34.53  ? 229 ARG A HH22 1 
ATOM   3228  N N    . LEU A 1 230 ? 14.492  -12.603 -37.215 1.00 21.77  ? 230 LEU A N    1 
ATOM   3229  C CA   . LEU A 1 230 ? 15.153  -13.504 -36.284 1.00 17.25  ? 230 LEU A CA   1 
ATOM   3230  C C    . LEU A 1 230 ? 14.254  -13.789 -35.090 1.00 23.14  ? 230 LEU A C    1 
ATOM   3231  O O    . LEU A 1 230 ? 14.189  -14.926 -34.607 1.00 25.33  ? 230 LEU A O    1 
ATOM   3232  C CB   . LEU A 1 230 ? 16.502  -12.927 -35.878 1.00 18.14  ? 230 LEU A CB   1 
ATOM   3233  C CG   . LEU A 1 230 ? 17.517  -12.909 -37.066 1.00 24.09  ? 230 LEU A CG   1 
ATOM   3234  C CD1  . LEU A 1 230 ? 18.837  -12.179 -36.762 1.00 29.87  ? 230 LEU A CD1  1 
ATOM   3235  C CD2  . LEU A 1 230 ? 17.824  -14.317 -37.536 1.00 22.85  ? 230 LEU A CD2  1 
ATOM   3236  H H    . LEU A 1 230 ? 14.888  -11.849 -37.337 1.00 26.09  ? 230 LEU A H    1 
ATOM   3237  H HA   . LEU A 1 230 ? 15.318  -14.347 -36.735 1.00 20.66  ? 230 LEU A HA   1 
ATOM   3238  H HB2  . LEU A 1 230 ? 16.379  -12.015 -35.573 1.00 21.72  ? 230 LEU A HB2  1 
ATOM   3239  H HB3  . LEU A 1 230 ? 16.879  -13.469 -35.168 1.00 21.72  ? 230 LEU A HB3  1 
ATOM   3240  H HG   . LEU A 1 230 ? 17.100  -12.445 -37.809 1.00 28.86  ? 230 LEU A HG   1 
ATOM   3241  H HD11 . LEU A 1 230 ? 19.405  -12.215 -37.547 1.00 35.80  ? 230 LEU A HD11 1 
ATOM   3242  H HD12 . LEU A 1 230 ? 18.642  -11.256 -36.535 1.00 35.80  ? 230 LEU A HD12 1 
ATOM   3243  H HD13 . LEU A 1 230 ? 19.275  -12.618 -36.016 1.00 35.80  ? 230 LEU A HD13 1 
ATOM   3244  H HD21 . LEU A 1 230 ? 18.455  -14.273 -38.272 1.00 27.38  ? 230 LEU A HD21 1 
ATOM   3245  H HD22 . LEU A 1 230 ? 18.208  -14.818 -36.800 1.00 27.38  ? 230 LEU A HD22 1 
ATOM   3246  H HD23 . LEU A 1 230 ? 17.001  -14.738 -37.830 1.00 27.38  ? 230 LEU A HD23 1 
ATOM   3247  N N    . GLY A 1 231 ? 13.514  -12.787 -34.633 1.00 26.04  ? 231 GLY A N    1 
ATOM   3248  C CA   . GLY A 1 231 ? 12.522  -13.042 -33.604 1.00 28.21  ? 231 GLY A CA   1 
ATOM   3249  C C    . GLY A 1 231 ? 11.523  -14.092 -34.033 1.00 19.36  ? 231 GLY A C    1 
ATOM   3250  O O    . GLY A 1 231 ? 11.203  -15.013 -33.286 1.00 24.97  ? 231 GLY A O    1 
ATOM   3251  H H    . GLY A 1 231 ? 13.565  -11.970 -34.896 1.00 31.20  ? 231 GLY A H    1 
ATOM   3252  H HA2  . GLY A 1 231 ? 12.963  -13.348 -32.796 1.00 33.81  ? 231 GLY A HA2  1 
ATOM   3253  H HA3  . GLY A 1 231 ? 12.043  -12.223 -33.403 1.00 33.81  ? 231 GLY A HA3  1 
ATOM   3254  N N    . LEU A 1 232 ? 11.047  -13.994 -35.261 1.00 24.04  ? 232 LEU A N    1 
ATOM   3255  C CA   . LEU A 1 232 ? 10.091  -14.974 -35.749 1.00 27.61  ? 232 LEU A CA   1 
ATOM   3256  C C    . LEU A 1 232 ? 10.696  -16.387 -35.792 1.00 27.89  ? 232 LEU A C    1 
ATOM   3257  O O    . LEU A 1 232 ? 10.051  -17.366 -35.382 1.00 26.37  ? 232 LEU A O    1 
ATOM   3258  C CB   . LEU A 1 232 ? 9.594   -14.543 -37.128 1.00 26.94  ? 232 LEU A CB   1 
ATOM   3259  C CG   . LEU A 1 232 ? 8.504   -15.410 -37.761 1.00 33.25  ? 232 LEU A CG   1 
ATOM   3260  C CD1  . LEU A 1 232 ? 7.236   -15.413 -36.930 1.00 29.55  ? 232 LEU A CD1  1 
ATOM   3261  C CD2  . LEU A 1 232 ? 8.173   -14.988 -39.190 1.00 29.93  ? 232 LEU A CD2  1 
ATOM   3262  H H    . LEU A 1 232 ? 11.257  -13.380 -35.825 1.00 28.81  ? 232 LEU A H    1 
ATOM   3263  H HA   . LEU A 1 232 ? 9.329   -14.994 -35.150 1.00 33.09  ? 232 LEU A HA   1 
ATOM   3264  H HB2  . LEU A 1 232 ? 9.238   -13.643 -37.055 1.00 32.28  ? 232 LEU A HB2  1 
ATOM   3265  H HB3  . LEU A 1 232 ? 10.349  -14.541 -37.736 1.00 32.28  ? 232 LEU A HB3  1 
ATOM   3266  H HG   . LEU A 1 232 ? 8.827   -16.324 -37.797 1.00 39.86  ? 232 LEU A HG   1 
ATOM   3267  H HD11 . LEU A 1 232 ? 6.575   -15.973 -37.366 1.00 35.42  ? 232 LEU A HD11 1 
ATOM   3268  H HD12 . LEU A 1 232 ? 7.437   -15.764 -36.048 1.00 35.42  ? 232 LEU A HD12 1 
ATOM   3269  H HD13 . LEU A 1 232 ? 6.905   -14.504 -36.858 1.00 35.42  ? 232 LEU A HD13 1 
ATOM   3270  H HD21 . LEU A 1 232 ? 7.480   -15.571 -39.539 1.00 35.88  ? 232 LEU A HD21 1 
ATOM   3271  H HD22 . LEU A 1 232 ? 7.862   -14.070 -39.184 1.00 35.88  ? 232 LEU A HD22 1 
ATOM   3272  H HD23 . LEU A 1 232 ? 8.973   -15.063 -39.734 1.00 35.88  ? 232 LEU A HD23 1 
ATOM   3273  N N    . MET A 1 233 ? 11.935  -16.514 -36.262 1.00 22.62  ? 233 MET A N    1 
ATOM   3274  C CA   . MET A 1 233 ? 12.597  -17.823 -36.249 1.00 21.50  ? 233 MET A CA   1 
ATOM   3275  C C    . MET A 1 233 ? 12.711  -18.340 -34.815 1.00 20.39  ? 233 MET A C    1 
ATOM   3276  O O    . MET A 1 233 ? 12.495  -19.527 -34.552 1.00 21.52  ? 233 MET A O    1 
ATOM   3277  C CB   . MET A 1 233 ? 13.977  -17.730 -36.935 1.00 19.29  ? 233 MET A CB   1 
ATOM   3278  C CG   . MET A 1 233 ? 13.896  -17.216 -38.372 1.00 24.75  ? 233 MET A CG   1 
ATOM   3279  S SD   . MET A 1 233 ? 12.696  -18.065 -39.405 1.00 32.10  ? 233 MET A SD   1 
ATOM   3280  C CE   . MET A 1 233 ? 13.245  -19.765 -39.372 1.00 32.55  ? 233 MET A CE   1 
ATOM   3281  H H    . MET A 1 233 ? 12.408  -15.874 -36.588 1.00 27.10  ? 233 MET A H    1 
ATOM   3282  H HA   . MET A 1 233 ? 12.058  -18.447 -36.760 1.00 25.75  ? 233 MET A HA   1 
ATOM   3283  H HB2  . MET A 1 233 ? 14.540  -17.122 -36.431 1.00 23.11  ? 233 MET A HB2  1 
ATOM   3284  H HB3  . MET A 1 233 ? 14.379  -18.613 -36.956 1.00 23.11  ? 233 MET A HB3  1 
ATOM   3285  H HG2  . MET A 1 233 ? 13.653  -16.277 -38.351 1.00 29.66  ? 233 MET A HG2  1 
ATOM   3286  H HG3  . MET A 1 233 ? 14.766  -17.319 -38.788 1.00 29.66  ? 233 MET A HG3  1 
ATOM   3287  H HE1  . MET A 1 233 ? 12.645  -20.301 -39.913 1.00 39.02  ? 233 MET A HE1  1 
ATOM   3288  H HE2  . MET A 1 233 ? 14.146  -19.812 -39.730 1.00 39.02  ? 233 MET A HE2  1 
ATOM   3289  H HE3  . MET A 1 233 ? 13.237  -20.081 -38.455 1.00 39.02  ? 233 MET A HE3  1 
ATOM   3290  N N    . GLU A 1 234 ? 12.973  -17.450 -33.867 1.00 16.71  ? 234 GLU A N    1 
ATOM   3291  C CA   . GLU A 1 234 ? 13.056  -17.883 -32.478 1.00 22.22  ? 234 GLU A CA   1 
ATOM   3292  C C    . GLU A 1 234 ? 11.691  -18.292 -31.926 1.00 26.81  ? 234 GLU A C    1 
ATOM   3293  O O    . GLU A 1 234 ? 11.587  -19.281 -31.181 1.00 22.13  ? 234 GLU A O    1 
ATOM   3294  C CB   . GLU A 1 234 ? 13.681  -16.779 -31.636 1.00 29.76  ? 234 GLU A CB   1 
ATOM   3295  C CG   . GLU A 1 234 ? 15.206  -16.710 -31.875 1.00 22.88  ? 234 GLU A CG   1 
ATOM   3296  C CD   . GLU A 1 234 ? 15.970  -15.930 -30.828 1.00 25.97  ? 234 GLU A CD   1 
ATOM   3297  O OE1  . GLU A 1 234 ? 15.459  -15.730 -29.692 1.00 22.19  ? 234 GLU A OE1  1 
ATOM   3298  O OE2  . GLU A 1 234 ? 17.134  -15.521 -31.125 1.00 27.84  ? 234 GLU A OE2  1 
ATOM   3299  H H    . GLU A 1 234 ? 13.104  -16.610 -33.995 1.00 20.01  ? 234 GLU A H    1 
ATOM   3300  H HA   . GLU A 1 234 ? 13.638  -18.658 -32.428 1.00 26.62  ? 234 GLU A HA   1 
ATOM   3301  H HB2  . GLU A 1 234 ? 13.293  -15.926 -31.884 1.00 35.68  ? 234 GLU A HB2  1 
ATOM   3302  H HB3  . GLU A 1 234 ? 13.526  -16.962 -30.697 1.00 35.68  ? 234 GLU A HB3  1 
ATOM   3303  H HG2  . GLU A 1 234 ? 15.559  -17.613 -31.886 1.00 27.41  ? 234 GLU A HG2  1 
ATOM   3304  H HG3  . GLU A 1 234 ? 15.366  -16.287 -32.733 1.00 27.41  ? 234 GLU A HG3  1 
ATOM   3305  N N    . MET A 1 235 ? 10.627  -17.592 -32.342 1.00 25.01  ? 235 MET A N    1 
ATOM   3306  C CA   . MET A 1 235 ? 9.274   -17.986 -31.950 1.00 28.18  ? 235 MET A CA   1 
ATOM   3307  C C    . MET A 1 235 ? 8.964   -19.384 -32.447 1.00 24.05  ? 235 MET A C    1 
ATOM   3308  O O    . MET A 1 235 ? 8.454   -20.235 -31.699 1.00 25.19  ? 235 MET A O    1 
ATOM   3309  C CB   . MET A 1 235 ? 8.244   -16.980 -32.495 1.00 22.82  ? 235 MET A CB   1 
ATOM   3310  C CG   . MET A 1 235 ? 8.266   -15.615 -31.787 1.00 24.34  ? 235 MET A CG   1 
ATOM   3311  S SD   . MET A 1 235 ? 7.268   -14.392 -32.661 1.00 25.54  ? 235 MET A SD   1 
ATOM   3312  C CE   . MET A 1 235 ? 5.657   -15.137 -32.733 1.00 28.29  ? 235 MET A CE   1 
ATOM   3313  H H    . MET A 1 235 ? 10.664  -16.896 -32.846 1.00 29.97  ? 235 MET A H    1 
ATOM   3314  H HA   . MET A 1 235 ? 9.214   -17.978 -30.982 1.00 33.78  ? 235 MET A HA   1 
ATOM   3315  H HB2  . MET A 1 235 ? 8.424   -16.828 -33.436 1.00 27.34  ? 235 MET A HB2  1 
ATOM   3316  H HB3  . MET A 1 235 ? 7.356   -17.354 -32.388 1.00 27.34  ? 235 MET A HB3  1 
ATOM   3317  H HG2  . MET A 1 235 ? 7.907   -15.715 -30.891 1.00 29.17  ? 235 MET A HG2  1 
ATOM   3318  H HG3  . MET A 1 235 ? 9.179   -15.290 -31.748 1.00 29.17  ? 235 MET A HG3  1 
ATOM   3319  H HE1  . MET A 1 235 ? 5.052   -14.536 -33.195 1.00 33.91  ? 235 MET A HE1  1 
ATOM   3320  H HE2  . MET A 1 235 ? 5.719   -15.977 -33.214 1.00 33.91  ? 235 MET A HE2  1 
ATOM   3321  H HE3  . MET A 1 235 ? 5.342   -15.295 -31.830 1.00 33.91  ? 235 MET A HE3  1 
ATOM   3322  N N    . ILE A 1 236 ? 9.245   -19.634 -33.725 1.00 24.25  ? 236 ILE A N    1 
ATOM   3323  C CA   . ILE A 1 236 ? 8.968   -20.940 -34.310 1.00 23.09  ? 236 ILE A CA   1 
ATOM   3324  C C    . ILE A 1 236 ? 9.759   -22.021 -33.588 1.00 29.92  ? 236 ILE A C    1 
ATOM   3325  O O    . ILE A 1 236 ? 9.219   -23.075 -33.237 1.00 23.29  ? 236 ILE A O    1 
ATOM   3326  C CB   . ILE A 1 236 ? 9.292   -20.949 -35.807 1.00 25.07  ? 236 ILE A CB   1 
ATOM   3327  C CG1  . ILE A 1 236 ? 8.340   -20.014 -36.600 1.00 20.78  ? 236 ILE A CG1  1 
ATOM   3328  C CG2  . ILE A 1 236 ? 9.272   -22.403 -36.317 1.00 26.87  ? 236 ILE A CG2  1 
ATOM   3329  C CD1  . ILE A 1 236 ? 8.779   -19.826 -38.036 1.00 29.78  ? 236 ILE A CD1  1 
ATOM   3330  H H    . ILE A 1 236 ? 9.594   -19.067 -34.270 1.00 29.06  ? 236 ILE A H    1 
ATOM   3331  H HA   . ILE A 1 236 ? 8.024   -21.139 -34.207 1.00 27.67  ? 236 ILE A HA   1 
ATOM   3332  H HB   . ILE A 1 236 ? 10.195  -20.611 -35.915 1.00 30.05  ? 236 ILE A HB   1 
ATOM   3333  H HG12 . ILE A 1 236 ? 7.450   -20.399 -36.605 1.00 24.90  ? 236 ILE A HG12 1 
ATOM   3334  H HG13 . ILE A 1 236 ? 8.323   -19.143 -36.174 1.00 24.90  ? 236 ILE A HG13 1 
ATOM   3335  H HG21 . ILE A 1 236 ? 9.478   -22.408 -37.265 1.00 32.20  ? 236 ILE A HG21 1 
ATOM   3336  H HG22 . ILE A 1 236 ? 9.937   -22.917 -35.831 1.00 32.20  ? 236 ILE A HG22 1 
ATOM   3337  H HG23 . ILE A 1 236 ? 8.390   -22.778 -36.167 1.00 32.20  ? 236 ILE A HG23 1 
ATOM   3338  H HD11 . ILE A 1 236 ? 8.152   -19.236 -38.483 1.00 35.69  ? 236 ILE A HD11 1 
ATOM   3339  H HD12 . ILE A 1 236 ? 9.666   -19.434 -38.046 1.00 35.69  ? 236 ILE A HD12 1 
ATOM   3340  H HD13 . ILE A 1 236 ? 8.793   -20.690 -38.478 1.00 35.69  ? 236 ILE A HD13 1 
ATOM   3341  N N    . ALA A 1 237 ? 11.066  -21.800 -33.405 1.00 25.08  ? 237 ALA A N    1 
ATOM   3342  C CA   . ALA A 1 237 ? 11.880  -22.832 -32.790 1.00 24.27  ? 237 ALA A CA   1 
ATOM   3343  C C    . ALA A 1 237 ? 11.441  -23.068 -31.359 1.00 26.74  ? 237 ALA A C    1 
ATOM   3344  O O    . ALA A 1 237 ? 11.416  -24.208 -30.894 1.00 30.03  ? 237 ALA A O    1 
ATOM   3345  C CB   . ALA A 1 237 ? 13.362  -22.457 -32.823 1.00 27.47  ? 237 ALA A CB   1 
ATOM   3346  H H    . ALA A 1 237 ? 11.487  -21.082 -33.623 1.00 30.06  ? 237 ALA A H    1 
ATOM   3347  H HA   . ALA A 1 237 ? 11.767  -23.661 -33.282 1.00 29.08  ? 237 ALA A HA   1 
ATOM   3348  H HB1  . ALA A 1 237 ? 13.876  -23.165 -32.406 1.00 32.92  ? 237 ALA A HB1  1 
ATOM   3349  H HB2  . ALA A 1 237 ? 13.639  -22.345 -33.746 1.00 32.92  ? 237 ALA A HB2  1 
ATOM   3350  H HB3  . ALA A 1 237 ? 13.487  -21.626 -32.337 1.00 32.92  ? 237 ALA A HB3  1 
ATOM   3351  N N    . PHE A 1 238 ? 11.101  -22.006 -30.635 1.00 26.17  ? 238 PHE A N    1 
ATOM   3352  C CA   . PHE A 1 238 ? 10.663  -22.218 -29.266 1.00 28.40  ? 238 PHE A CA   1 
ATOM   3353  C C    . PHE A 1 238 ? 9.354   -23.006 -29.222 1.00 24.75  ? 238 PHE A C    1 
ATOM   3354  O O    . PHE A 1 238 ? 9.185   -23.895 -28.389 1.00 30.70  ? 238 PHE A O    1 
ATOM   3355  C CB   . PHE A 1 238 ? 10.509  -20.888 -28.518 1.00 32.00  ? 238 PHE A CB   1 
ATOM   3356  C CG   . PHE A 1 238 ? 10.186  -21.085 -27.060 1.00 33.07  ? 238 PHE A CG   1 
ATOM   3357  C CD1  . PHE A 1 238 ? 8.885   -21.173 -26.637 1.00 30.13  ? 238 PHE A CD1  1 
ATOM   3358  C CD2  . PHE A 1 238 ? 11.194  -21.243 -26.122 1.00 33.66  ? 238 PHE A CD2  1 
ATOM   3359  C CE1  . PHE A 1 238 ? 8.583   -21.417 -25.301 1.00 28.23  ? 238 PHE A CE1  1 
ATOM   3360  C CE2  . PHE A 1 238 ? 10.890  -21.477 -24.799 1.00 32.87  ? 238 PHE A CE2  1 
ATOM   3361  C CZ   . PHE A 1 238 ? 9.590   -21.570 -24.392 1.00 29.85  ? 238 PHE A CZ   1 
ATOM   3362  H H    . PHE A 1 238 ? 11.114  -21.188 -30.901 1.00 31.37  ? 238 PHE A H    1 
ATOM   3363  H HA   . PHE A 1 238 ? 11.336  -22.740 -28.802 1.00 34.04  ? 238 PHE A HA   1 
ATOM   3364  H HB2  . PHE A 1 238 ? 11.341  -20.393 -28.578 1.00 38.36  ? 238 PHE A HB2  1 
ATOM   3365  H HB3  . PHE A 1 238 ? 9.789   -20.379 -28.920 1.00 38.36  ? 238 PHE A HB3  1 
ATOM   3366  H HD1  . PHE A 1 238 ? 8.195   -21.089 -27.255 1.00 36.12  ? 238 PHE A HD1  1 
ATOM   3367  H HD2  . PHE A 1 238 ? 12.083  -21.201 -26.390 1.00 40.35  ? 238 PHE A HD2  1 
ATOM   3368  H HE1  . PHE A 1 238 ? 7.696   -21.467 -25.026 1.00 33.83  ? 238 PHE A HE1  1 
ATOM   3369  H HE2  . PHE A 1 238 ? 11.575  -21.575 -24.178 1.00 39.41  ? 238 PHE A HE2  1 
ATOM   3370  H HZ   . PHE A 1 238 ? 9.391   -21.709 -23.494 1.00 35.77  ? 238 PHE A HZ   1 
ATOM   3371  N N    . ALA A 1 239 ? 8.416   -22.704 -30.111 1.00 23.40  ? 239 ALA A N    1 
ATOM   3372  C CA   . ALA A 1 239 ? 7.164   -23.439 -30.113 1.00 25.39  ? 239 ALA A CA   1 
ATOM   3373  C C    . ALA A 1 239 ? 7.389   -24.917 -30.415 1.00 33.67  ? 239 ALA A C    1 
ATOM   3374  O O    . ALA A 1 239 ? 6.778   -25.789 -29.783 1.00 29.73  ? 239 ALA A O    1 
ATOM   3375  C CB   . ALA A 1 239 ? 6.206   -22.829 -31.133 1.00 23.18  ? 239 ALA A CB   1 
ATOM   3376  H H    . ALA A 1 239 ? 8.479   -22.092 -30.712 1.00 28.04  ? 239 ALA A H    1 
ATOM   3377  H HA   . ALA A 1 239 ? 6.755   -23.370 -29.236 1.00 30.42  ? 239 ALA A HA   1 
ATOM   3378  H HB1  . ALA A 1 239 ? 5.375   -23.328 -31.123 1.00 27.77  ? 239 ALA A HB1  1 
ATOM   3379  H HB2  . ALA A 1 239 ? 6.039   -21.903 -30.894 1.00 27.77  ? 239 ALA A HB2  1 
ATOM   3380  H HB3  . ALA A 1 239 ? 6.611   -22.876 -32.013 1.00 27.77  ? 239 ALA A HB3  1 
ATOM   3381  N N    . LYS A 1 240 ? 8.194   -25.218 -31.443 1.00 29.52  ? 240 LYS A N    1 
ATOM   3382  C CA   . LYS A 1 240 ? 8.434   -26.613 -31.793 1.00 29.38  ? 240 LYS A CA   1 
ATOM   3383  C C    . LYS A 1 240 ? 9.029   -27.383 -30.616 1.00 34.45  ? 240 LYS A C    1 
ATOM   3384  O O    . LYS A 1 240 ? 8.728   -28.560 -30.421 1.00 31.29  ? 240 LYS A O    1 
ATOM   3385  C CB   . LYS A 1 240 ? 9.351   -26.704 -33.018 1.00 32.70  ? 240 LYS A CB   1 
ATOM   3386  C CG   . LYS A 1 240 ? 8.650   -26.362 -34.322 1.00 32.21  ? 240 LYS A CG   1 
ATOM   3387  C CD   . LYS A 1 240 ? 9.531   -26.647 -35.530 1.00 29.65  ? 240 LYS A CD   1 
ATOM   3388  C CE   . LYS A 1 240 ? 8.897   -26.197 -36.802 1.00 29.27  ? 240 LYS A CE   1 
ATOM   3389  N NZ   . LYS A 1 240 ? 9.566   -26.755 -37.996 1.00 45.59  ? 240 LYS A NZ   1 
ATOM   3390  H H    . LYS A 1 240 ? 8.601   -24.644 -31.938 1.00 35.38  ? 240 LYS A H    1 
ATOM   3391  H HA   . LYS A 1 240 ? 7.588   -27.028 -32.023 1.00 35.21  ? 240 LYS A HA   1 
ATOM   3392  H HB2  . LYS A 1 240 ? 10.089  -26.084 -32.904 1.00 39.20  ? 240 LYS A HB2  1 
ATOM   3393  H HB3  . LYS A 1 240 ? 9.689   -27.610 -33.090 1.00 39.20  ? 240 LYS A HB3  1 
ATOM   3394  H HG2  . LYS A 1 240 ? 7.845   -26.897 -34.401 1.00 38.61  ? 240 LYS A HG2  1 
ATOM   3395  H HG3  . LYS A 1 240 ? 8.427   -25.418 -34.326 1.00 38.61  ? 240 LYS A HG3  1 
ATOM   3396  H HD2  . LYS A 1 240 ? 10.373  -26.175 -35.429 1.00 35.54  ? 240 LYS A HD2  1 
ATOM   3397  H HD3  . LYS A 1 240 ? 9.689   -27.602 -35.592 1.00 35.54  ? 240 LYS A HD3  1 
ATOM   3398  H HE2  . LYS A 1 240 ? 7.971   -26.485 -36.814 1.00 35.08  ? 240 LYS A HE2  1 
ATOM   3399  H HE3  . LYS A 1 240 ? 8.945   -25.229 -36.856 1.00 35.08  ? 240 LYS A HE3  1 
ATOM   3400  H HZ1  . LYS A 1 240 ? 9.162   -26.466 -38.734 1.00 54.67  ? 240 LYS A HZ1  1 
ATOM   3401  H HZ2  . LYS A 1 240 ? 10.418  -26.500 -38.014 1.00 54.67  ? 240 LYS A HZ2  1 
ATOM   3402  H HZ3  . LYS A 1 240 ? 9.531   -27.644 -37.976 1.00 54.67  ? 240 LYS A HZ3  1 
ATOM   3403  N N    . LEU A 1 241 ? 9.833   -26.712 -29.812 1.00 35.17  ? 241 LEU A N    1 
ATOM   3404  C CA   . LEU A 1 241 ? 10.543  -27.233 -28.629 1.00 36.07  ? 241 LEU A CA   1 
ATOM   3405  C C    . LEU A 1 241 ? 9.624   -27.332 -27.411 1.00 37.34  ? 241 LEU A C    1 
ATOM   3406  O O    . LEU A 1 241 ? 9.729   -28.312 -26.706 1.00 45.39  ? 241 LEU A O    1 
ATOM   3407  C CB   . LEU A 1 241 ? 11.680  -26.239 -28.404 1.00 37.37  ? 241 LEU A CB   1 
ATOM   3408  C CG   . LEU A 1 241 ? 12.462  -26.244 -27.098 1.00 48.56  ? 241 LEU A CG   1 
ATOM   3409  C CD1  . LEU A 1 241 ? 13.705  -25.392 -27.265 1.00 44.49  ? 241 LEU A CD1  1 
ATOM   3410  C CD2  . LEU A 1 241 ? 11.652  -25.708 -25.948 1.00 49.36  ? 241 LEU A CD2  1 
ATOM   3411  H H    . LEU A 1 241 ? 10.006  -25.829 -29.953 1.00 42.16  ? 241 LEU A H    1 
ATOM   3412  H HA   . LEU A 1 241 ? 10.908  -28.124 -28.839 1.00 43.25  ? 241 LEU A HA   1 
ATOM   3413  H HB2  . LEU A 1 241 ? 12.324  -26.366 -29.130 1.00 44.80  ? 241 LEU A HB2  1 
ATOM   3414  H HB3  . LEU A 1 241 ? 11.306  -25.342 -28.517 1.00 44.80  ? 241 LEU A HB3  1 
ATOM   3415  H HG   . LEU A 1 241 ? 12.736  -27.171 -26.892 1.00 58.23  ? 241 LEU A HG   1 
ATOM   3416  H HD11 . LEU A 1 241 ? 14.141  -25.280 -26.402 1.00 53.35  ? 241 LEU A HD11 1 
ATOM   3417  H HD12 . LEU A 1 241 ? 14.318  -25.828 -27.883 1.00 53.35  ? 241 LEU A HD12 1 
ATOM   3418  H HD13 . LEU A 1 241 ? 13.457  -24.519 -27.617 1.00 53.35  ? 241 LEU A HD13 1 
ATOM   3419  H HD21 . LEU A 1 241 ? 12.249  -25.406 -25.242 1.00 59.19  ? 241 LEU A HD21 1 
ATOM   3420  H HD22 . LEU A 1 241 ? 11.108  -24.961 -26.254 1.00 59.19  ? 241 LEU A HD22 1 
ATOM   3421  H HD23 . LEU A 1 241 ? 11.072  -26.410 -25.604 1.00 59.19  ? 241 LEU A HD23 1 
ATOM   3422  N N    . PHE A 1 242 ? 8.680   -26.415 -27.254 1.00 34.90  ? 242 PHE A N    1 
ATOM   3423  C CA   . PHE A 1 242 ? 7.892   -26.235 -26.031 1.00 31.66  ? 242 PHE A CA   1 
ATOM   3424  C C    . PHE A 1 242 ? 6.488   -26.816 -26.125 1.00 38.95  ? 242 PHE A C    1 
ATOM   3425  O O    . PHE A 1 242 ? 6.020   -27.431 -25.164 1.00 34.53  ? 242 PHE A O    1 
ATOM   3426  C CB   . PHE A 1 242 ? 7.797   -24.746 -25.682 1.00 33.09  ? 242 PHE A CB   1 
ATOM   3427  C CG   . PHE A 1 242 ? 7.035   -24.444 -24.411 1.00 32.50  ? 242 PHE A CG   1 
ATOM   3428  C CD1  . PHE A 1 242 ? 7.634   -24.616 -23.160 1.00 45.32  ? 242 PHE A CD1  1 
ATOM   3429  C CD2  . PHE A 1 242 ? 5.739   -23.947 -24.456 1.00 39.88  ? 242 PHE A CD2  1 
ATOM   3430  C CE1  . PHE A 1 242 ? 6.936   -24.326 -21.989 1.00 39.50  ? 242 PHE A CE1  1 
ATOM   3431  C CE2  . PHE A 1 242 ? 5.049   -23.648 -23.282 1.00 36.27  ? 242 PHE A CE2  1 
ATOM   3432  C CZ   . PHE A 1 242 ? 5.653   -23.844 -22.054 1.00 34.31  ? 242 PHE A CZ   1 
ATOM   3433  H H    . PHE A 1 242 ? 8.503   -25.826 -27.855 1.00 41.83  ? 242 PHE A H    1 
ATOM   3434  H HA   . PHE A 1 242 ? 8.346   -26.681 -25.300 1.00 37.95  ? 242 PHE A HA   1 
ATOM   3435  H HB2  . PHE A 1 242 ? 8.695   -24.395 -25.576 1.00 39.66  ? 242 PHE A HB2  1 
ATOM   3436  H HB3  . PHE A 1 242 ? 7.350   -24.285 -26.409 1.00 39.66  ? 242 PHE A HB3  1 
ATOM   3437  H HD1  . PHE A 1 242 ? 8.503   -24.945 -23.108 1.00 54.34  ? 242 PHE A HD1  1 
ATOM   3438  H HD2  . PHE A 1 242 ? 5.326   -23.815 -25.279 1.00 47.82  ? 242 PHE A HD2  1 
ATOM   3439  H HE1  . PHE A 1 242 ? 7.343   -24.453 -21.163 1.00 47.36  ? 242 PHE A HE1  1 
ATOM   3440  H HE2  . PHE A 1 242 ? 4.178   -23.326 -23.325 1.00 43.48  ? 242 PHE A HE2  1 
ATOM   3441  H HZ   . PHE A 1 242 ? 5.189   -23.648 -21.272 1.00 41.13  ? 242 PHE A HZ   1 
ATOM   3442  N N    . CYS A 1 243 ? 5.814   -26.652 -27.266 1.00 37.82  ? 243 CYS A N    1 
ATOM   3443  C CA   . CYS A 1 243 ? 4.375   -26.873 -27.357 1.00 31.38  ? 243 CYS A CA   1 
ATOM   3444  C C    . CYS A 1 243 ? 4.001   -28.344 -27.504 1.00 39.12  ? 243 CYS A C    1 
ATOM   3445  O O    . CYS A 1 243 ? 4.655   -29.111 -28.213 1.00 35.82  ? 243 CYS A O    1 
ATOM   3446  C CB   . CYS A 1 243 ? 3.811   -26.079 -28.545 1.00 28.84  ? 243 CYS A CB   1 
ATOM   3447  S SG   . CYS A 1 243 ? 3.874   -24.323 -28.215 1.00 32.63  ? 243 CYS A SG   1 
ATOM   3448  H H    . CYS A 1 243 ? 6.175   -26.411 -28.009 1.00 45.34  ? 243 CYS A H    1 
ATOM   3449  H HA   . CYS A 1 243 ? 3.956   -26.539 -26.549 1.00 37.61  ? 243 CYS A HA   1 
ATOM   3450  H HB2  . CYS A 1 243 ? 4.340   -26.262 -29.337 1.00 34.57  ? 243 CYS A HB2  1 
ATOM   3451  H HB3  . CYS A 1 243 ? 2.885   -26.330 -28.691 1.00 34.57  ? 243 CYS A HB3  1 
ATOM   3452  H HG   . CYS A 1 243 ? 3.428   -23.731 -29.158 1.00 39.12  ? 243 CYS A HG   1 
ATOM   3453  N N    . SER A 1 244 ? 2.926   -28.722 -26.816 1.00 41.87  ? 244 SER A N    1 
ATOM   3454  C CA   . SER A 1 244 ? 2.184   -29.941 -27.096 1.00 42.43  ? 244 SER A CA   1 
ATOM   3455  C C    . SER A 1 244 ? 1.532   -29.835 -28.462 1.00 48.04  ? 244 SER A C    1 
ATOM   3456  O O    . SER A 1 244 ? 1.432   -28.761 -29.057 1.00 53.80  ? 244 SER A O    1 
ATOM   3457  C CB   . SER A 1 244 ? 1.069   -30.170 -26.058 1.00 40.48  ? 244 SER A CB   1 
ATOM   3458  O OG   . SER A 1 244 ? 1.515   -30.063 -24.720 1.00 49.18  ? 244 SER A OG   1 
ATOM   3459  H H    . SER A 1 244 ? 2.599   -28.270 -26.161 1.00 50.20  ? 244 SER A H    1 
ATOM   3460  H HA   . SER A 1 244 ? 2.783   -30.703 -27.089 1.00 50.88  ? 244 SER A HA   1 
ATOM   3461  H HB2  . SER A 1 244 ? 0.373   -29.511 -26.204 1.00 48.53  ? 244 SER A HB2  1 
ATOM   3462  H HB3  . SER A 1 244 ? 0.705   -31.060 -26.190 1.00 48.53  ? 244 SER A HB3  1 
ATOM   3463  H HG   . SER A 1 244 ? 1.828   -29.296 -24.582 1.00 58.97  ? 244 SER A HG   1 
ATOM   3464  N N    . GLY A 1 245 ? 1.031   -30.956 -28.943 1.00 46.44  ? 245 GLY A N    1 
ATOM   3465  C CA   . GLY A 1 245 ? 0.325   -30.953 -30.195 1.00 36.45  ? 245 GLY A CA   1 
ATOM   3466  C C    . GLY A 1 245 ? 1.257   -30.617 -31.331 1.00 44.67  ? 245 GLY A C    1 
ATOM   3467  O O    . GLY A 1 245 ? 2.378   -30.129 -31.126 1.00 40.44  ? 245 GLY A O    1 
ATOM   3468  H H    . GLY A 1 245 ? 1.087   -31.725 -28.564 1.00 55.68  ? 245 GLY A H    1 
ATOM   3469  H HA2  . GLY A 1 245 ? -0.062  -31.827 -30.356 1.00 43.70  ? 245 GLY A HA2  1 
ATOM   3470  H HA3  . GLY A 1 245 ? -0.387  -30.295 -30.169 1.00 43.70  ? 245 GLY A HA3  1 
ATOM   3471  N N    . PRO A 1 246 ? 0.811   -30.862 -32.557 1.00 36.12  ? 246 PRO A N    1 
ATOM   3472  C CA   . PRO A 1 246 ? 1.673   -30.592 -33.720 1.00 45.91  ? 246 PRO A CA   1 
ATOM   3473  C C    . PRO A 1 246 ? 1.969   -29.098 -33.884 1.00 42.76  ? 246 PRO A C    1 
ATOM   3474  O O    . PRO A 1 246 ? 1.146   -28.234 -33.568 1.00 34.93  ? 246 PRO A O    1 
ATOM   3475  C CB   . PRO A 1 246 ? 0.860   -31.128 -34.902 1.00 34.43  ? 246 PRO A CB   1 
ATOM   3476  C CG   . PRO A 1 246 ? -0.496  -31.514 -34.343 1.00 44.27  ? 246 PRO A CG   1 
ATOM   3477  C CD   . PRO A 1 246 ? -0.592  -31.019 -32.933 1.00 37.01  ? 246 PRO A CD   1 
ATOM   3478  H HA   . PRO A 1 246 ? 2.506   -31.084 -33.649 1.00 55.05  ? 246 PRO A HA   1 
ATOM   3479  H HB2  . PRO A 1 246 ? 0.765   -30.433 -35.572 1.00 41.27  ? 246 PRO A HB2  1 
ATOM   3480  H HB3  . PRO A 1 246 ? 1.306   -31.903 -35.278 1.00 41.27  ? 246 PRO A HB3  1 
ATOM   3481  H HG2  . PRO A 1 246 ? -1.189  -31.108 -34.885 1.00 53.08  ? 246 PRO A HG2  1 
ATOM   3482  H HG3  . PRO A 1 246 ? -0.582  -32.480 -34.362 1.00 53.08  ? 246 PRO A HG3  1 
ATOM   3483  H HD2  . PRO A 1 246 ? -1.051  -30.165 -32.902 1.00 44.37  ? 246 PRO A HD2  1 
ATOM   3484  H HD3  . PRO A 1 246 ? -1.024  -31.679 -32.369 1.00 44.37  ? 246 PRO A HD3  1 
ATOM   3485  N N    . VAL A 1 247 ? 3.177   -28.803 -34.366 1.00 37.82  ? 247 VAL A N    1 
ATOM   3486  C CA   . VAL A 1 247 ? 3.662   -27.432 -34.556 1.00 39.15  ? 247 VAL A CA   1 
ATOM   3487  C C    . VAL A 1 247 ? 4.246   -27.332 -35.956 1.00 36.38  ? 247 VAL A C    1 
ATOM   3488  O O    . VAL A 1 247 ? 5.211   -28.029 -36.282 1.00 45.68  ? 247 VAL A O    1 
ATOM   3489  C CB   . VAL A 1 247 ? 4.707   -27.019 -33.503 1.00 39.05  ? 247 VAL A CB   1 
ATOM   3490  C CG1  . VAL A 1 247 ? 5.141   -25.566 -33.675 1.00 27.28  ? 247 VAL A CG1  1 
ATOM   3491  C CG2  . VAL A 1 247 ? 4.151   -27.209 -32.122 1.00 39.32  ? 247 VAL A CG2  1 
ATOM   3492  H H    . VAL A 1 247 ? 3.751   -29.399 -34.599 1.00 45.35  ? 247 VAL A H    1 
ATOM   3493  H HA   . VAL A 1 247 ? 2.914   -26.818 -34.495 1.00 46.94  ? 247 VAL A HA   1 
ATOM   3494  H HB   . VAL A 1 247 ? 5.491   -27.582 -33.594 1.00 46.82  ? 247 VAL A HB   1 
ATOM   3495  H HG11 . VAL A 1 247 ? 5.797   -25.350 -32.994 1.00 32.70  ? 247 VAL A HG11 1 
ATOM   3496  H HG12 . VAL A 1 247 ? 5.530   -25.456 -34.557 1.00 32.70  ? 247 VAL A HG12 1 
ATOM   3497  H HG13 . VAL A 1 247 ? 4.365   -24.992 -33.582 1.00 32.70  ? 247 VAL A HG13 1 
ATOM   3498  H HG21 . VAL A 1 247 ? 4.822   -26.944 -31.473 1.00 47.14  ? 247 VAL A HG21 1 
ATOM   3499  H HG22 . VAL A 1 247 ? 3.359   -26.658 -32.023 1.00 47.14  ? 247 VAL A HG22 1 
ATOM   3500  H HG23 . VAL A 1 247 ? 3.923   -28.143 -32.000 1.00 47.14  ? 247 VAL A HG23 1 
ATOM   3501  N N    . SER A 1 248 ? 3.649   -26.476 -36.774 1.00 30.31  ? 248 SER A N    1 
ATOM   3502  C CA   . SER A 1 248 ? 4.002   -26.264 -38.174 1.00 34.17  ? 248 SER A CA   1 
ATOM   3503  C C    . SER A 1 248 ? 4.593   -24.875 -38.342 1.00 38.91  ? 248 SER A C    1 
ATOM   3504  O O    . SER A 1 248 ? 4.021   -23.895 -37.857 1.00 30.57  ? 248 SER A O    1 
ATOM   3505  C CB   . SER A 1 248 ? 2.763   -26.360 -39.065 1.00 31.59  ? 248 SER A CB   1 
ATOM   3506  O OG   . SER A 1 248 ? 2.273   -27.679 -39.138 1.00 36.58  ? 248 SER A OG   1 
ATOM   3507  H H    . SER A 1 248 ? 2.995   -25.976 -36.524 1.00 36.33  ? 248 SER A H    1 
ATOM   3508  H HA   . SER A 1 248 ? 4.653   -26.925 -38.460 1.00 40.96  ? 248 SER A HA   1 
ATOM   3509  H HB2  . SER A 1 248 ? 2.069   -25.789 -38.699 1.00 37.86  ? 248 SER A HB2  1 
ATOM   3510  H HB3  . SER A 1 248 ? 2.996   -26.063 -39.959 1.00 37.86  ? 248 SER A HB3  1 
ATOM   3511  H HG   . SER A 1 248 ? 2.064   -27.951 -38.371 1.00 43.85  ? 248 SER A HG   1 
ATOM   3512  N N    . SER A 1 249 ? 5.705   -24.785 -39.068 1.00 34.52  ? 249 SER A N    1 
ATOM   3513  C CA   . SER A 1 249 ? 6.223   -23.480 -39.436 1.00 28.57  ? 249 SER A CA   1 
ATOM   3514  C C    . SER A 1 249 ? 5.175   -22.639 -40.148 1.00 25.71  ? 249 SER A C    1 
ATOM   3515  O O    . SER A 1 249 ? 5.083   -21.435 -39.920 1.00 26.84  ? 249 SER A O    1 
ATOM   3516  C CB   . SER A 1 249 ? 7.461   -23.639 -40.314 1.00 28.00  ? 249 SER A CB   1 
ATOM   3517  O OG   . SER A 1 249 ? 8.504   -24.128 -39.495 1.00 29.93  ? 249 SER A OG   1 
ATOM   3518  H H    . SER A 1 249 ? 6.167   -25.452 -39.353 1.00 41.38  ? 249 SER A H    1 
ATOM   3519  H HA   . SER A 1 249 ? 6.487   -23.008 -38.630 1.00 34.25  ? 249 SER A HA   1 
ATOM   3520  H HB2  . SER A 1 249 ? 7.278   -24.275 -41.023 1.00 33.56  ? 249 SER A HB2  1 
ATOM   3521  H HB3  . SER A 1 249 ? 7.712   -22.778 -40.683 1.00 33.56  ? 249 SER A HB3  1 
ATOM   3522  H HG   . SER A 1 249 ? 9.204   -24.228 -39.949 1.00 35.88  ? 249 SER A HG   1 
ATOM   3523  N N    . ALA A 1 250 ? 4.420   -23.241 -41.062 1.00 28.63  ? 250 ALA A N    1 
ATOM   3524  C CA   . ALA A 1 250 ? 3.481   -22.470 -41.856 1.00 28.39  ? 250 ALA A CA   1 
ATOM   3525  C C    . ALA A 1 250 ? 2.347   -21.878 -41.016 1.00 27.07  ? 250 ALA A C    1 
ATOM   3526  O O    . ALA A 1 250 ? 1.777   -20.862 -41.408 1.00 35.21  ? 250 ALA A O    1 
ATOM   3527  C CB   . ALA A 1 250 ? 2.914   -23.343 -42.983 1.00 38.12  ? 250 ALA A CB   1 
ATOM   3528  H H    . ALA A 1 250 ? 4.434   -24.083 -41.238 1.00 34.31  ? 250 ALA A H    1 
ATOM   3529  H HA   . ALA A 1 250 ? 3.957   -21.732 -42.268 1.00 34.03  ? 250 ALA A HA   1 
ATOM   3530  H HB1  . ALA A 1 250 ? 2.289   -22.817 -43.506 1.00 45.70  ? 250 ALA A HB1  1 
ATOM   3531  H HB2  . ALA A 1 250 ? 3.644   -23.645 -43.546 1.00 45.70  ? 250 ALA A HB2  1 
ATOM   3532  H HB3  . ALA A 1 250 ? 2.460   -24.106 -42.593 1.00 45.70  ? 250 ALA A HB3  1 
ATOM   3533  N N    . THR A 1 251 ? 2.029   -22.450 -39.849 1.00 33.08  ? 251 THR A N    1 
ATOM   3534  C CA   . THR A 1 251 ? 1.052   -21.800 -38.979 1.00 31.02  ? 251 THR A CA   1 
ATOM   3535  C C    . THR A 1 251 ? 1.457   -20.368 -38.661 1.00 25.27  ? 251 THR A C    1 
ATOM   3536  O O    . THR A 1 251 ? 0.598   -19.522 -38.424 1.00 27.29  ? 251 THR A O    1 
ATOM   3537  C CB   . THR A 1 251 ? 0.896   -22.566 -37.674 1.00 27.54  ? 251 THR A CB   1 
ATOM   3538  O OG1  . THR A 1 251 ? 0.483   -23.894 -37.951 1.00 36.54  ? 251 THR A OG1  1 
ATOM   3539  C CG2  . THR A 1 251 ? -0.132  -21.912 -36.790 1.00 29.07  ? 251 THR A CG2  1 
ATOM   3540  H H    . THR A 1 251 ? 2.354   -23.188 -39.549 1.00 39.65  ? 251 THR A H    1 
ATOM   3541  H HA   . THR A 1 251 ? 0.191   -21.781 -39.425 1.00 37.18  ? 251 THR A HA   1 
ATOM   3542  H HB   . THR A 1 251 ? 1.744   -22.581 -37.203 1.00 33.00  ? 251 THR A HB   1 
ATOM   3543  H HG1  . THR A 1 251 ? 0.394   -24.323 -37.234 1.00 43.81  ? 251 THR A HG1  1 
ATOM   3544  H HG21 . THR A 1 251 ? -0.221  -22.410 -35.962 1.00 34.85  ? 251 THR A HG21 1 
ATOM   3545  H HG22 . THR A 1 251 ? 0.139   -21.004 -36.584 1.00 34.85  ? 251 THR A HG22 1 
ATOM   3546  H HG23 . THR A 1 251 ? -0.991  -21.892 -37.240 1.00 34.85  ? 251 THR A HG23 1 
ATOM   3547  N N    . PHE A 1 252 ? 2.759   -20.090 -38.579 1.00 26.11  ? 252 PHE A N    1 
ATOM   3548  C CA   . PHE A 1 252 ? 3.225   -18.753 -38.215 1.00 27.14  ? 252 PHE A CA   1 
ATOM   3549  C C    . PHE A 1 252 ? 3.088   -17.750 -39.351 1.00 26.46  ? 252 PHE A C    1 
ATOM   3550  O O    . PHE A 1 252 ? 3.381   -16.570 -39.150 1.00 25.78  ? 252 PHE A O    1 
ATOM   3551  C CB   . PHE A 1 252 ? 4.702   -18.801 -37.774 1.00 27.90  ? 252 PHE A CB   1 
ATOM   3552  C CG   . PHE A 1 252 ? 4.893   -19.441 -36.470 1.00 22.02  ? 252 PHE A CG   1 
ATOM   3553  C CD1  . PHE A 1 252 ? 4.988   -20.823 -36.376 1.00 30.39  ? 252 PHE A CD1  1 
ATOM   3554  C CD2  . PHE A 1 252 ? 4.923   -18.685 -35.334 1.00 20.66  ? 252 PHE A CD2  1 
ATOM   3555  C CE1  . PHE A 1 252 ? 5.120   -21.431 -35.141 1.00 24.64  ? 252 PHE A CE1  1 
ATOM   3556  C CE2  . PHE A 1 252 ? 5.070   -19.275 -34.100 1.00 29.19  ? 252 PHE A CE2  1 
ATOM   3557  C CZ   . PHE A 1 252 ? 5.175   -20.655 -33.997 1.00 24.53  ? 252 PHE A CZ   1 
ATOM   3558  H H    . PHE A 1 252 ? 3.389   -20.655 -38.730 1.00 31.29  ? 252 PHE A H    1 
ATOM   3559  H HA   . PHE A 1 252 ? 2.699   -18.430 -37.466 1.00 32.52  ? 252 PHE A HA   1 
ATOM   3560  H HB2  . PHE A 1 252 ? 5.210   -19.302 -38.430 1.00 33.44  ? 252 PHE A HB2  1 
ATOM   3561  H HB3  . PHE A 1 252 ? 5.042   -17.894 -37.714 1.00 33.44  ? 252 PHE A HB3  1 
ATOM   3562  H HD1  . PHE A 1 252 ? 4.950   -21.343 -37.146 1.00 36.43  ? 252 PHE A HD1  1 
ATOM   3563  H HD2  . PHE A 1 252 ? 4.853   -17.760 -35.396 1.00 24.75  ? 252 PHE A HD2  1 
ATOM   3564  H HE1  . PHE A 1 252 ? 5.198   -22.356 -35.082 1.00 29.52  ? 252 PHE A HE1  1 
ATOM   3565  H HE2  . PHE A 1 252 ? 5.100   -18.748 -33.334 1.00 34.99  ? 252 PHE A HE2  1 
ATOM   3566  H HZ   . PHE A 1 252 ? 5.275   -21.056 -33.164 1.00 29.40  ? 252 PHE A HZ   1 
ATOM   3567  N N    . LEU A 1 253 ? 2.704   -18.202 -40.530 1.00 24.53  ? 253 LEU A N    1 
ATOM   3568  C CA   . LEU A 1 253 ? 2.332   -17.323 -41.617 1.00 22.20  ? 253 LEU A CA   1 
ATOM   3569  C C    . LEU A 1 253 ? 0.898   -16.835 -41.492 1.00 29.46  ? 253 LEU A C    1 
ATOM   3570  O O    . LEU A 1 253 ? 0.455   -16.047 -42.329 1.00 23.00  ? 253 LEU A O    1 
ATOM   3571  C CB   . LEU A 1 253 ? 2.498   -18.055 -42.954 1.00 32.23  ? 253 LEU A CB   1 
ATOM   3572  C CG   . LEU A 1 253 ? 3.923   -18.523 -43.348 1.00 40.90  ? 253 LEU A CG   1 
ATOM   3573  C CD1  . LEU A 1 253 ? 3.914   -19.224 -44.702 1.00 42.86  ? 253 LEU A CD1  1 
ATOM   3574  C CD2  . LEU A 1 253 ? 4.888   -17.386 -43.397 1.00 33.04  ? 253 LEU A CD2  1 
ATOM   3575  H H    . LEU A 1 253 ? 2.648   -19.037 -40.728 1.00 29.40  ? 253 LEU A H    1 
ATOM   3576  H HA   . LEU A 1 253 ? 2.918   -16.550 -41.618 1.00 26.59  ? 253 LEU A HA   1 
ATOM   3577  H HB2  . LEU A 1 253 ? 1.937   -18.846 -42.933 1.00 38.63  ? 253 LEU A HB2  1 
ATOM   3578  H HB3  . LEU A 1 253 ? 2.190   -17.464 -43.658 1.00 38.63  ? 253 LEU A HB3  1 
ATOM   3579  H HG   . LEU A 1 253 ? 4.241   -19.156 -42.686 1.00 49.04  ? 253 LEU A HG   1 
ATOM   3580  H HD11 . LEU A 1 253 ? 4.818   -19.503 -44.918 1.00 51.39  ? 253 LEU A HD11 1 
ATOM   3581  H HD12 . LEU A 1 253 ? 3.331   -19.997 -44.653 1.00 51.39  ? 253 LEU A HD12 1 
ATOM   3582  H HD13 . LEU A 1 253 ? 3.589   -18.606 -45.375 1.00 51.39  ? 253 LEU A HD13 1 
ATOM   3583  H HD21 . LEU A 1 253 ? 5.762   -17.725 -43.646 1.00 39.61  ? 253 LEU A HD21 1 
ATOM   3584  H HD22 . LEU A 1 253 ? 4.582   -16.742 -44.054 1.00 39.61  ? 253 LEU A HD22 1 
ATOM   3585  H HD23 . LEU A 1 253 ? 4.931   -16.971 -42.521 1.00 39.61  ? 253 LEU A HD23 1 
ATOM   3586  N N    . GLU A 1 254 ? 0.157   -17.314 -40.500 1.00 23.48  ? 254 GLU A N    1 
ATOM   3587  C CA   . GLU A 1 254 ? -1.209  -16.883 -40.319 1.00 24.80  ? 254 GLU A CA   1 
ATOM   3588  C C    . GLU A 1 254 ? -1.232  -15.557 -39.578 1.00 25.03  ? 254 GLU A C    1 
ATOM   3589  O O    . GLU A 1 254 ? -0.201  -15.038 -39.144 1.00 25.32  ? 254 GLU A O    1 
ATOM   3590  C CB   . GLU A 1 254 ? -1.999  -17.921 -39.540 1.00 22.20  ? 254 GLU A CB   1 
ATOM   3591  C CG   . GLU A 1 254 ? -2.124  -19.254 -40.231 1.00 32.68  ? 254 GLU A CG   1 
ATOM   3592  C CD   . GLU A 1 254 ? -2.977  -19.186 -41.476 1.00 29.02  ? 254 GLU A CD   1 
ATOM   3593  O OE1  . GLU A 1 254 ? -3.827  -18.273 -41.601 1.00 24.28  ? 254 GLU A OE1  1 
ATOM   3594  O OE2  . GLU A 1 254 ? -2.753  -20.034 -42.342 1.00 32.84  ? 254 GLU A OE2  1 
ATOM   3595  H H    . GLU A 1 254 ? 0.427   -17.889 -39.920 1.00 28.13  ? 254 GLU A H    1 
ATOM   3596  H HA   . GLU A 1 254 ? -1.628  -16.760 -41.185 1.00 29.71  ? 254 GLU A HA   1 
ATOM   3597  H HB2  . GLU A 1 254 ? -1.561  -18.071 -38.688 1.00 26.59  ? 254 GLU A HB2  1 
ATOM   3598  H HB3  . GLU A 1 254 ? -2.896  -17.582 -39.391 1.00 26.59  ? 254 GLU A HB3  1 
ATOM   3599  H HG2  . GLU A 1 254 ? -1.240  -19.561 -40.489 1.00 39.18  ? 254 GLU A HG2  1 
ATOM   3600  H HG3  . GLU A 1 254 ? -2.532  -19.890 -39.622 1.00 39.18  ? 254 GLU A HG3  1 
ATOM   3601  N N    . SER A 1 255 ? -2.440  -15.031 -39.349 1.00 22.92  ? 255 SER A N    1 
ATOM   3602  C CA   . SER A 1 255 ? -2.524  -13.716 -38.732 1.00 22.24  ? 255 SER A CA   1 
ATOM   3603  C C    . SER A 1 255 ? -1.954  -13.736 -37.326 1.00 21.01  ? 255 SER A C    1 
ATOM   3604  O O    . SER A 1 255 ? -1.316  -12.767 -36.900 1.00 19.54  ? 255 SER A O    1 
ATOM   3605  C CB   . SER A 1 255 ? -3.958  -13.213 -38.700 1.00 17.86  ? 255 SER A CB   1 
ATOM   3606  O OG   . SER A 1 255 ? -3.996  -11.981 -37.996 1.00 21.00  ? 255 SER A OG   1 
ATOM   3607  H H    . SER A 1 255 ? -3.194  -15.402 -39.535 1.00 27.46  ? 255 SER A H    1 
ATOM   3608  H HA   . SER A 1 255 ? -2.001  -13.090 -39.257 1.00 26.65  ? 255 SER A HA   1 
ATOM   3609  H HB2  . SER A 1 255 ? -4.272  -13.076 -39.607 1.00 21.39  ? 255 SER A HB2  1 
ATOM   3610  H HB3  . SER A 1 255 ? -4.516  -13.862 -38.243 1.00 21.39  ? 255 SER A HB3  1 
ATOM   3611  H HG   . SER A 1 255 ? -4.783  -11.690 -37.970 1.00 25.16  ? 255 SER A HG   1 
ATOM   3612  N N    . CYS A 1 256 ? -2.151  -14.838 -36.599 1.00 22.17  ? 256 CYS A N    1 
ATOM   3613  C CA   . CYS A 1 256 ? -1.676  -14.919 -35.223 1.00 22.07  ? 256 CYS A CA   1 
ATOM   3614  C C    . CYS A 1 256 ? -0.166  -14.829 -35.162 1.00 20.43  ? 256 CYS A C    1 
ATOM   3615  O O    . CYS A 1 256 ? 0.389   -14.463 -34.121 1.00 21.34  ? 256 CYS A O    1 
ATOM   3616  C CB   . CYS A 1 256 ? -2.116  -16.233 -34.605 1.00 24.04  ? 256 CYS A CB   1 
ATOM   3617  S SG   . CYS A 1 256 ? -1.551  -17.655 -35.560 1.00 25.60  ? 256 CYS A SG   1 
ATOM   3618  H H    . CYS A 1 256 ? -2.554  -15.544 -36.879 1.00 26.57  ? 256 CYS A H    1 
ATOM   3619  H HA   . CYS A 1 256 ? -2.052  -14.191 -34.705 1.00 26.44  ? 256 CYS A HA   1 
ATOM   3620  H HB2  . CYS A 1 256 ? -1.747  -16.304 -33.711 1.00 28.81  ? 256 CYS A HB2  1 
ATOM   3621  H HB3  . CYS A 1 256 ? -3.085  -16.259 -34.568 1.00 28.81  ? 256 CYS A HB3  1 
ATOM   3622  H HG   . CYS A 1 256 ? -0.352  -17.642 -35.609 1.00 30.68  ? 256 CYS A HG   1 
ATOM   3623  N N    . GLY A 1 257 ? 0.506   -15.226 -36.236 1.00 29.13  ? 257 GLY A N    1 
ATOM   3624  C CA   . GLY A 1 257 ? 1.954   -15.193 -36.273 1.00 23.47  ? 257 GLY A CA   1 
ATOM   3625  C C    . GLY A 1 257 ? 2.530   -13.945 -36.901 1.00 18.83  ? 257 GLY A C    1 
ATOM   3626  O O    . GLY A 1 257 ? 2.671   -12.914 -36.251 1.00 23.99  ? 257 GLY A O    1 
ATOM   3627  H H    . GLY A 1 257 ? 0.141   -15.519 -36.958 1.00 34.92  ? 257 GLY A H    1 
ATOM   3628  H HA2  . GLY A 1 257 ? 2.295   -15.260 -35.368 1.00 28.12  ? 257 GLY A HA2  1 
ATOM   3629  H HA3  . GLY A 1 257 ? 2.275   -15.959 -36.775 1.00 28.12  ? 257 GLY A HA3  1 
ATOM   3630  N N    . VAL A 1 258 ? 2.855   -14.007 -38.186 1.00 19.36  ? 258 VAL A N    1 
ATOM   3631  C CA   . VAL A 1 258 ? 3.594   -12.898 -38.770 1.00 21.48  ? 258 VAL A CA   1 
ATOM   3632  C C    . VAL A 1 258 ? 2.805   -11.591 -38.675 1.00 21.85  ? 258 VAL A C    1 
ATOM   3633  O O    . VAL A 1 258 ? 3.388   -10.529 -38.453 1.00 20.56  ? 258 VAL A O    1 
ATOM   3634  C CB   . VAL A 1 258 ? 4.012   -13.221 -40.220 1.00 25.35  ? 258 VAL A CB   1 
ATOM   3635  C CG1  . VAL A 1 258 ? 2.849   -13.162 -41.144 1.00 32.18  ? 258 VAL A CG1  1 
ATOM   3636  C CG2  . VAL A 1 258 ? 5.083   -12.240 -40.651 1.00 26.55  ? 258 VAL A CG2  1 
ATOM   3637  H H    . VAL A 1 258 ? 2.668   -14.652 -38.722 1.00 23.19  ? 258 VAL A H    1 
ATOM   3638  H HA   . VAL A 1 258 ? 4.410   -12.776 -38.259 1.00 25.74  ? 258 VAL A HA   1 
ATOM   3639  H HB   . VAL A 1 258 ? 4.385   -14.116 -40.255 1.00 30.38  ? 258 VAL A HB   1 
ATOM   3640  H HG11 . VAL A 1 258 ? 3.150   -13.370 -42.043 1.00 38.58  ? 258 VAL A HG11 1 
ATOM   3641  H HG12 . VAL A 1 258 ? 2.186   -13.810 -40.859 1.00 38.58  ? 258 VAL A HG12 1 
ATOM   3642  H HG13 . VAL A 1 258 ? 2.472   -12.269 -41.120 1.00 38.58  ? 258 VAL A HG13 1 
ATOM   3643  H HG21 . VAL A 1 258 ? 5.347   -12.441 -41.563 1.00 31.82  ? 258 VAL A HG21 1 
ATOM   3644  H HG22 . VAL A 1 258 ? 4.725   -11.340 -40.602 1.00 31.82  ? 258 VAL A HG22 1 
ATOM   3645  H HG23 . VAL A 1 258 ? 5.847   -12.326 -40.059 1.00 31.82  ? 258 VAL A HG23 1 
ATOM   3646  N N    . ALA A 1 259 ? 1.469   -11.620 -38.827 1.00 25.23  ? 259 ALA A N    1 
ATOM   3647  C CA   . ALA A 1 259 ? 0.759   -10.336 -38.903 1.00 23.71  ? 259 ALA A CA   1 
ATOM   3648  C C    . ALA A 1 259 ? 0.684   -9.660  -37.526 1.00 21.87  ? 259 ALA A C    1 
ATOM   3649  O O    . ALA A 1 259 ? 1.011   -8.474  -37.371 1.00 24.28  ? 259 ALA A O    1 
ATOM   3650  C CB   . ALA A 1 259 ? -0.637  -10.523 -39.500 1.00 22.85  ? 259 ALA A CB   1 
ATOM   3651  H H    . ALA A 1 259 ? 0.980   -12.325 -38.885 1.00 30.23  ? 259 ALA A H    1 
ATOM   3652  H HA   . ALA A 1 259 ? 1.252   -9.745  -39.493 1.00 28.41  ? 259 ALA A HA   1 
ATOM   3653  H HB1  . ALA A 1 259 ? -1.082  -9.662  -39.538 1.00 27.37  ? 259 ALA A HB1  1 
ATOM   3654  H HB2  . ALA A 1 259 ? -0.552  -10.892 -40.393 1.00 27.37  ? 259 ALA A HB2  1 
ATOM   3655  H HB3  . ALA A 1 259 ? -1.142  -11.132 -38.937 1.00 27.37  ? 259 ALA A HB3  1 
ATOM   3656  N N    . ASP A 1 260 ? 0.298   -10.409 -36.510 1.00 20.09  ? 260 ASP A N    1 
ATOM   3657  C CA   . ASP A 1 260 ? 0.319   -9.874  -35.156 1.00 18.33  ? 260 ASP A CA   1 
ATOM   3658  C C    . ASP A 1 260 ? 1.734   -9.440  -34.793 1.00 21.17  ? 260 ASP A C    1 
ATOM   3659  O O    . ASP A 1 260 ? 1.925   -8.433  -34.104 1.00 22.89  ? 260 ASP A O    1 
ATOM   3660  C CB   . ASP A 1 260 ? -0.198  -10.937 -34.157 1.00 24.67  ? 260 ASP A CB   1 
ATOM   3661  C CG   . ASP A 1 260 ? -0.880  -10.318 -32.893 1.00 27.85  ? 260 ASP A CG   1 
ATOM   3662  O OD1  . ASP A 1 260 ? -0.993  -9.084  -32.820 1.00 28.39  ? 260 ASP A OD1  1 
ATOM   3663  O OD2  . ASP A 1 260 ? -1.308  -11.088 -31.983 1.00 23.48  ? 260 ASP A OD2  1 
ATOM   3664  H H    . ASP A 1 260 ? 0.022   -11.221 -36.572 1.00 24.07  ? 260 ASP A H    1 
ATOM   3665  H HA   . ASP A 1 260 ? -0.262  -9.099  -35.106 1.00 21.95  ? 260 ASP A HA   1 
ATOM   3666  H HB2  . ASP A 1 260 ? -0.852  -11.496 -34.604 1.00 29.56  ? 260 ASP A HB2  1 
ATOM   3667  H HB3  . ASP A 1 260 ? 0.549   -11.477 -33.858 1.00 29.56  ? 260 ASP A HB3  1 
ATOM   3668  N N    . LEU A 1 261 ? 2.744   -10.171 -35.278 1.00 18.18  ? 261 LEU A N    1 
ATOM   3669  C CA   . LEU A 1 261 ? 4.115   -9.800  -34.927 1.00 23.98  ? 261 LEU A CA   1 
ATOM   3670  C C    . LEU A 1 261 ? 4.489   -8.467  -35.567 1.00 20.43  ? 261 LEU A C    1 
ATOM   3671  O O    . LEU A 1 261 ? 4.994   -7.573  -34.888 1.00 25.51  ? 261 LEU A O    1 
ATOM   3672  C CB   . LEU A 1 261 ? 5.098   -10.901 -35.319 1.00 22.97  ? 261 LEU A CB   1 
ATOM   3673  C CG   . LEU A 1 261 ? 6.594   -10.609 -35.161 1.00 24.88  ? 261 LEU A CG   1 
ATOM   3674  C CD1  . LEU A 1 261 ? 6.981   -10.563 -33.739 1.00 23.45  ? 261 LEU A CD1  1 
ATOM   3675  C CD2  . LEU A 1 261 ? 7.440   -11.676 -35.915 1.00 28.02  ? 261 LEU A CD2  1 
ATOM   3676  H H    . LEU A 1 261 ? 2.667   -10.857 -35.791 1.00 21.77  ? 261 LEU A H    1 
ATOM   3677  H HA   . LEU A 1 261 ? 4.168   -9.688  -33.965 1.00 28.74  ? 261 LEU A HA   1 
ATOM   3678  H HB2  . LEU A 1 261 ? 4.903   -11.682 -34.777 1.00 27.52  ? 261 LEU A HB2  1 
ATOM   3679  H HB3  . LEU A 1 261 ? 4.948   -11.117 -36.252 1.00 27.52  ? 261 LEU A HB3  1 
ATOM   3680  H HG   . LEU A 1 261 ? 6.789   -9.743  -35.552 1.00 29.81  ? 261 LEU A HG   1 
ATOM   3681  H HD11 . LEU A 1 261 ? 7.931   -10.377 -33.677 1.00 28.10  ? 261 LEU A HD11 1 
ATOM   3682  H HD12 . LEU A 1 261 ? 6.477   -9.862  -33.297 1.00 28.10  ? 261 LEU A HD12 1 
ATOM   3683  H HD13 . LEU A 1 261 ? 6.784   -11.420 -33.331 1.00 28.10  ? 261 LEU A HD13 1 
ATOM   3684  H HD21 . LEU A 1 261 ? 8.381   -11.470 -35.801 1.00 33.58  ? 261 LEU A HD21 1 
ATOM   3685  H HD22 . LEU A 1 261 ? 7.245   -12.551 -35.546 1.00 33.58  ? 261 LEU A HD22 1 
ATOM   3686  H HD23 . LEU A 1 261 ? 7.207   -11.654 -36.857 1.00 33.58  ? 261 LEU A HD23 1 
ATOM   3687  N N    . ILE A 1 262 ? 4.197   -8.274  -36.857 1.00 21.55  ? 262 ILE A N    1 
ATOM   3688  C CA   . ILE A 1 262 ? 4.588   -6.994  -37.435 1.00 21.03  ? 262 ILE A CA   1 
ATOM   3689  C C    . ILE A 1 262 ? 3.732   -5.849  -36.877 1.00 23.78  ? 262 ILE A C    1 
ATOM   3690  O O    . ILE A 1 262 ? 4.239   -4.754  -36.620 1.00 28.02  ? 262 ILE A O    1 
ATOM   3691  C CB   . ILE A 1 262 ? 4.612   -7.034  -38.978 1.00 29.73  ? 262 ILE A CB   1 
ATOM   3692  C CG1  . ILE A 1 262 ? 3.276   -7.321  -39.596 1.00 37.42  ? 262 ILE A CG1  1 
ATOM   3693  C CG2  . ILE A 1 262 ? 5.656   -8.060  -39.435 1.00 40.98  ? 262 ILE A CG2  1 
ATOM   3694  C CD1  . ILE A 1 262 ? 3.368   -7.621  -41.125 1.00 41.02  ? 262 ILE A CD1  1 
ATOM   3695  H H    . ILE A 1 262 ? 3.801   -8.827  -37.384 1.00 25.81  ? 262 ILE A H    1 
ATOM   3696  H HA   . ILE A 1 262 ? 5.499   -6.816  -37.153 1.00 25.19  ? 262 ILE A HA   1 
ATOM   3697  H HB   . ILE A 1 262 ? 4.899   -6.162  -39.291 1.00 35.64  ? 262 ILE A HB   1 
ATOM   3698  H HG12 . ILE A 1 262 ? 2.887   -8.096  -39.161 1.00 44.87  ? 262 ILE A HG12 1 
ATOM   3699  H HG13 . ILE A 1 262 ? 2.701   -6.549  -39.476 1.00 44.87  ? 262 ILE A HG13 1 
ATOM   3700  H HG21 . ILE A 1 262 ? 5.671   -8.084  -40.404 1.00 49.14  ? 262 ILE A HG21 1 
ATOM   3701  H HG22 . ILE A 1 262 ? 6.526   -7.795  -39.097 1.00 49.14  ? 262 ILE A HG22 1 
ATOM   3702  H HG23 . ILE A 1 262 ? 5.416   -8.932  -39.085 1.00 49.14  ? 262 ILE A HG23 1 
ATOM   3703  H HD11 . ILE A 1 262 ? 2.477   -7.798  -41.466 1.00 49.19  ? 262 ILE A HD11 1 
ATOM   3704  H HD12 . ILE A 1 262 ? 3.748   -6.851  -41.575 1.00 49.19  ? 262 ILE A HD12 1 
ATOM   3705  H HD13 . ILE A 1 262 ? 3.934   -8.397  -41.261 1.00 49.19  ? 262 ILE A HD13 1 
ATOM   3706  N N    . THR A 1 263 ? 2.442   -6.069  -36.626 1.00 28.21  ? 263 THR A N    1 
ATOM   3707  C CA   . THR A 1 263 ? 1.679   -4.945  -36.117 1.00 23.08  ? 263 THR A CA   1 
ATOM   3708  C C    . THR A 1 263 ? 2.210   -4.518  -34.752 1.00 25.24  ? 263 THR A C    1 
ATOM   3709  O O    . THR A 1 263 ? 2.316   -3.324  -34.466 1.00 26.44  ? 263 THR A O    1 
ATOM   3710  C CB   . THR A 1 263 ? 0.178   -5.283  -36.064 1.00 30.17  ? 263 THR A CB   1 
ATOM   3711  O OG1  . THR A 1 263 ? -0.543  -4.074  -35.950 1.00 34.93  ? 263 THR A OG1  1 
ATOM   3712  C CG2  . THR A 1 263 ? -0.178  -6.088  -34.867 1.00 26.37  ? 263 THR A CG2  1 
ATOM   3713  H H    . THR A 1 263 ? 2.014   -6.807  -36.734 1.00 33.81  ? 263 THR A H    1 
ATOM   3714  H HA   . THR A 1 263 ? 1.790   -4.195  -36.723 1.00 27.66  ? 263 THR A HA   1 
ATOM   3715  H HB   . THR A 1 263 ? -0.090  -5.760  -36.865 1.00 36.16  ? 263 THR A HB   1 
ATOM   3716  H HG1  . THR A 1 263 ? -1.367  -4.233  -35.919 1.00 41.88  ? 263 THR A HG1  1 
ATOM   3717  H HG21 . THR A 1 263 ? -1.129  -6.281  -34.868 1.00 31.60  ? 263 THR A HG21 1 
ATOM   3718  H HG22 . THR A 1 263 ? 0.313   -6.925  -34.872 1.00 31.60  ? 263 THR A HG22 1 
ATOM   3719  H HG23 . THR A 1 263 ? 0.043   -5.598  -34.060 1.00 31.60  ? 263 THR A HG23 1 
ATOM   3720  N N    . THR A 1 264 ? 2.584   -5.483  -33.910 1.00 26.35  ? 264 THR A N    1 
ATOM   3721  C CA   . THR A 1 264 ? 3.099   -5.153  -32.587 1.00 27.87  ? 264 THR A CA   1 
ATOM   3722  C C    . THR A 1 264 ? 4.487   -4.498  -32.661 1.00 24.66  ? 264 THR A C    1 
ATOM   3723  O O    . THR A 1 264 ? 4.802   -3.596  -31.875 1.00 26.50  ? 264 THR A O    1 
ATOM   3724  C CB   . THR A 1 264 ? 3.152   -6.422  -31.754 1.00 24.86  ? 264 THR A CB   1 
ATOM   3725  O OG1  . THR A 1 264 ? 1.883   -7.093  -31.828 1.00 30.24  ? 264 THR A OG1  1 
ATOM   3726  C CG2  . THR A 1 264 ? 3.503   -6.087  -30.310 1.00 29.16  ? 264 THR A CG2  1 
ATOM   3727  H H    . THR A 1 264 ? 2.550   -6.325  -34.080 1.00 31.57  ? 264 THR A H    1 
ATOM   3728  H HA   . THR A 1 264 ? 2.493   -4.531  -32.155 1.00 33.40  ? 264 THR A HA   1 
ATOM   3729  H HB   . THR A 1 264 ? 3.843   -7.005  -32.106 1.00 29.79  ? 264 THR A HB   1 
ATOM   3730  H HG1  . THR A 1 264 ? 1.710   -7.292  -32.626 1.00 36.24  ? 264 THR A HG1  1 
ATOM   3731  H HG21 . THR A 1 264 ? 3.537   -6.899  -29.780 1.00 34.95  ? 264 THR A HG21 1 
ATOM   3732  H HG22 . THR A 1 264 ? 4.368   -5.650  -30.272 1.00 34.95  ? 264 THR A HG22 1 
ATOM   3733  H HG23 . THR A 1 264 ? 2.833   -5.494  -29.936 1.00 34.95  ? 264 THR A HG23 1 
ATOM   3734  N N    . CYS A 1 265 ? 5.311   -4.927  -33.607 1.00 20.35  ? 265 CYS A N    1 
ATOM   3735  C CA   . CYS A 1 265 ? 6.669   -4.403  -33.766 1.00 26.93  ? 265 CYS A CA   1 
ATOM   3736  C C    . CYS A 1 265 ? 6.738   -3.047  -34.453 1.00 30.87  ? 265 CYS A C    1 
ATOM   3737  O O    . CYS A 1 265 ? 7.775   -2.379  -34.353 1.00 38.38  ? 265 CYS A O    1 
ATOM   3738  C CB   . CYS A 1 265 ? 7.515   -5.379  -34.583 1.00 26.88  ? 265 CYS A CB   1 
ATOM   3739  S SG   . CYS A 1 265 ? 7.973   -6.835  -33.669 1.00 25.53  ? 265 CYS A SG   1 
ATOM   3740  H H    . CYS A 1 265 ? 5.106   -5.533  -34.182 1.00 24.38  ? 265 CYS A H    1 
ATOM   3741  H HA   . CYS A 1 265 ? 7.075   -4.315  -32.890 1.00 32.27  ? 265 CYS A HA   1 
ATOM   3742  H HB2  . CYS A 1 265 ? 7.009   -5.660  -35.361 1.00 32.22  ? 265 CYS A HB2  1 
ATOM   3743  H HB3  . CYS A 1 265 ? 8.330   -4.932  -34.862 1.00 32.22  ? 265 CYS A HB3  1 
ATOM   3744  H HG   . CYS A 1 265 ? 6.978   -7.409  -33.323 1.00 30.60  ? 265 CYS A HG   1 
ATOM   3745  N N    . TYR A 1 266 ? 5.706   -2.647  -35.195 1.00 27.39  ? 266 TYR A N    1 
ATOM   3746  C CA   . TYR A 1 266 ? 5.683   -1.334  -35.822 1.00 29.64  ? 266 TYR A CA   1 
ATOM   3747  C C    . TYR A 1 266 ? 4.728   -0.373  -35.138 1.00 38.32  ? 266 TYR A C    1 
ATOM   3748  O O    . TYR A 1 266 ? 4.749   0.814   -35.473 1.00 42.76  ? 266 TYR A O    1 
ATOM   3749  C CB   . TYR A 1 266 ? 5.341   -1.432  -37.318 1.00 27.90  ? 266 TYR A CB   1 
ATOM   3750  C CG   . TYR A 1 266 ? 6.470   -2.006  -38.130 1.00 28.84  ? 266 TYR A CG   1 
ATOM   3751  C CD1  . TYR A 1 266 ? 7.469   -1.199  -38.651 1.00 37.90  ? 266 TYR A CD1  1 
ATOM   3752  C CD2  . TYR A 1 266 ? 6.563   -3.359  -38.342 1.00 39.64  ? 266 TYR A CD2  1 
ATOM   3753  C CE1  . TYR A 1 266 ? 8.535   -1.737  -39.406 1.00 33.88  ? 266 TYR A CE1  1 
ATOM   3754  C CE2  . TYR A 1 266 ? 7.626   -3.913  -39.099 1.00 38.88  ? 266 TYR A CE2  1 
ATOM   3755  C CZ   . TYR A 1 266 ? 8.586   -3.098  -39.624 1.00 35.44  ? 266 TYR A CZ   1 
ATOM   3756  O OH   . TYR A 1 266 ? 9.611   -3.693  -40.332 1.00 41.99  ? 266 TYR A OH   1 
ATOM   3757  H H    . TYR A 1 266 ? 5.006   -3.122  -35.350 1.00 32.83  ? 266 TYR A H    1 
ATOM   3758  H HA   . TYR A 1 266 ? 6.572   -0.952  -35.755 1.00 35.53  ? 266 TYR A HA   1 
ATOM   3759  H HB2  . TYR A 1 266 ? 4.567   -2.006  -37.429 1.00 33.43  ? 266 TYR A HB2  1 
ATOM   3760  H HB3  . TYR A 1 266 ? 5.147   -0.544  -37.657 1.00 33.43  ? 266 TYR A HB3  1 
ATOM   3761  H HD1  . TYR A 1 266 ? 7.427   -0.280  -38.515 1.00 45.44  ? 266 TYR A HD1  1 
ATOM   3762  H HD2  . TYR A 1 266 ? 5.907   -3.921  -37.998 1.00 47.52  ? 266 TYR A HD2  1 
ATOM   3763  H HE1  . TYR A 1 266 ? 9.192   -1.179  -39.756 1.00 40.61  ? 266 TYR A HE1  1 
ATOM   3764  H HE2  . TYR A 1 266 ? 7.668   -4.831  -39.239 1.00 46.61  ? 266 TYR A HE2  1 
ATOM   3765  H HH   . TYR A 1 266 ? 10.145  -3.108  -40.612 1.00 50.35  ? 266 TYR A HH   1 
ATOM   3766  N N    . GLY A 1 267 ? 3.979   -0.834  -34.143 1.00 48.49  ? 267 GLY A N    1 
ATOM   3767  C CA   . GLY A 1 267 ? 3.068   0.002   -33.407 1.00 35.07  ? 267 GLY A CA   1 
ATOM   3768  C C    . GLY A 1 267 ? 2.460   -0.497  -32.110 1.00 41.38  ? 267 GLY A C    1 
ATOM   3769  O O    . GLY A 1 267 ? 1.283   -0.402  -31.938 1.00 55.25  ? 267 GLY A O    1 
ATOM   3770  H H    . GLY A 1 267 ? 3.988   -1.651  -33.875 1.00 58.14  ? 267 GLY A H    1 
ATOM   3771  H HA2  . GLY A 1 267 ? 3.527   0.831   -33.200 1.00 42.04  ? 267 GLY A HA2  1 
ATOM   3772  H HA3  . GLY A 1 267 ? 2.329   0.224   -33.995 1.00 42.04  ? 267 GLY A HA3  1 
ATOM   3773  N N    . GLY A 1 268 ? 3.226   -0.989  -31.179 1.00 40.31  ? 268 GLY A N    1 
ATOM   3774  C CA   . GLY A 1 268 ? 2.650   -1.403  -29.928 1.00 42.52  ? 268 GLY A CA   1 
ATOM   3775  C C    . GLY A 1 268 ? 3.164   -0.630  -28.740 1.00 45.79  ? 268 GLY A C    1 
ATOM   3776  O O    . GLY A 1 268 ? 4.023   0.193   -28.860 1.00 47.07  ? 268 GLY A O    1 
ATOM   3777  H H    . GLY A 1 268 ? 4.077   -1.095  -31.240 1.00 48.33  ? 268 GLY A H    1 
ATOM   3778  H HA2  . GLY A 1 268 ? 1.687   -1.291  -29.968 1.00 50.98  ? 268 GLY A HA2  1 
ATOM   3779  H HA3  . GLY A 1 268 ? 2.841   -2.343  -29.784 1.00 50.98  ? 268 GLY A HA3  1 
ATOM   3780  N N    . ARG A 1 269 ? 2.605   -0.910  -27.588 1.00 39.32  ? 269 ARG A N    1 
ATOM   3781  C CA   . ARG A 1 269 ? 3.068   -0.307  -26.338 1.00 40.41  ? 269 ARG A CA   1 
ATOM   3782  C C    . ARG A 1 269 ? 4.408   -0.882  -25.903 1.00 40.88  ? 269 ARG A C    1 
ATOM   3783  O O    . ARG A 1 269 ? 5.278   -0.150  -25.421 1.00 39.94  ? 269 ARG A O    1 
ATOM   3784  C CB   . ARG A 1 269 ? 2.030   -0.524  -25.229 1.00 47.14  ? 269 ARG A CB   1 
ATOM   3785  H H    . ARG A 1 269 ? 1.959   -1.468  -27.488 1.00 47.14  ? 269 ARG A H    1 
ATOM   3786  H HA   . ARG A 1 269 ? 3.177   0.648   -26.467 1.00 48.45  ? 269 ARG A HA   1 
ATOM   3787  N N    A ASN A 1 270 ? 4.597   -2.201  -26.038 0.54 34.38  ? 270 ASN A N    1 
ATOM   3788  N N    B ASN A 1 270 ? 4.545   -2.202  -25.971 0.46 34.38  ? 270 ASN A N    1 
ATOM   3789  C CA   A ASN A 1 270 ? 5.921   -2.766  -25.789 0.54 39.83  ? 270 ASN A CA   1 
ATOM   3790  C CA   B ASN A 1 270 ? 5.849   -2.850  -25.884 0.46 39.82  ? 270 ASN A CA   1 
ATOM   3791  C C    A ASN A 1 270 ? 6.969   -2.055  -26.647 0.54 36.57  ? 270 ASN A C    1 
ATOM   3792  C C    B ASN A 1 270 ? 6.920   -2.067  -26.645 0.46 36.59  ? 270 ASN A C    1 
ATOM   3793  O O    A ASN A 1 270 ? 8.068   -1.747  -26.172 0.54 35.83  ? 270 ASN A O    1 
ATOM   3794  O O    B ASN A 1 270 ? 7.982   -1.738  -26.107 0.46 35.90  ? 270 ASN A O    1 
ATOM   3795  C CB   A ASN A 1 270 ? 5.943   -4.280  -26.068 0.54 36.85  ? 270 ASN A CB   1 
ATOM   3796  C CB   B ASN A 1 270 ? 5.708   -4.265  -26.447 0.46 37.61  ? 270 ASN A CB   1 
ATOM   3797  C CG   A ASN A 1 270 ? 5.390   -5.123  -24.914 0.54 39.74  ? 270 ASN A CG   1 
ATOM   3798  C CG   B ASN A 1 270 ? 4.623   -4.345  -27.523 0.46 32.61  ? 270 ASN A CG   1 
ATOM   3799  O OD1  A ASN A 1 270 ? 6.140   -5.605  -24.043 0.54 30.22  ? 270 ASN A OD1  1 
ATOM   3800  O OD1  B ASN A 1 270 ? 4.794   -3.841  -28.642 0.46 27.14  ? 270 ASN A OD1  1 
ATOM   3801  N ND2  A ASN A 1 270 ? 4.067   -5.324  -24.918 0.54 31.70  ? 270 ASN A ND2  1 
ATOM   3802  N ND2  B ASN A 1 270 ? 3.477   -4.928  -27.163 0.46 35.93  ? 270 ASN A ND2  1 
ATOM   3803  H H    A ASN A 1 270 ? 3.993   -2.771  -26.265 0.54 41.22  ? 270 ASN A H    1 
ATOM   3804  H H    B ASN A 1 270 ? 3.890   -2.751  -26.068 0.46 41.22  ? 270 ASN A H    1 
ATOM   3805  H HA   A ASN A 1 270 ? 6.153   -2.629  -24.857 0.54 47.75  ? 270 ASN A HA   1 
ATOM   3806  H HA   B ASN A 1 270 ? 6.117   -2.914  -24.954 0.46 47.75  ? 270 ASN A HA   1 
ATOM   3807  H HB2  A ASN A 1 270 ? 5.404   -4.461  -26.853 0.54 44.18  ? 270 ASN A HB2  1 
ATOM   3808  H HB2  B ASN A 1 270 ? 6.550   -4.534  -26.846 0.46 45.09  ? 270 ASN A HB2  1 
ATOM   3809  H HB3  A ASN A 1 270 ? 6.859   -4.556  -26.226 0.54 44.18  ? 270 ASN A HB3  1 
ATOM   3810  H HB3  B ASN A 1 270 ? 5.468   -4.872  -25.730 0.46 45.09  ? 270 ASN A HB3  1 
ATOM   3811  H HD21 A ASN A 1 270 ? 3.702   -5.792  -24.296 0.54 38.00  ? 270 ASN A HD21 1 
ATOM   3812  H HD21 B ASN A 1 270 ? 2.832   -4.995  -27.728 0.46 43.08  ? 270 ASN A HD21 1 
ATOM   3813  H HD22 A ASN A 1 270 ? 3.582   -4.979  -25.538 0.54 38.00  ? 270 ASN A HD22 1 
ATOM   3814  H HD22 B ASN A 1 270 ? 3.392   -5.258  -26.373 0.46 43.08  ? 270 ASN A HD22 1 
ATOM   3815  N N    . ARG A 1 271 ? 6.636   -1.760  -27.910 1.00 32.97  ? 271 ARG A N    1 
ATOM   3816  C CA   . ARG A 1 271 ? 7.612   -1.112  -28.786 1.00 33.04  ? 271 ARG A CA   1 
ATOM   3817  C C    . ARG A 1 271 ? 7.897   0.318   -28.319 1.00 45.70  ? 271 ARG A C    1 
ATOM   3818  O O    . ARG A 1 271 ? 9.061   0.716   -28.175 1.00 35.98  ? 271 ARG A O    1 
ATOM   3819  C CB   . ARG A 1 271 ? 7.110   -1.122  -30.234 1.00 32.29  ? 271 ARG A CB   1 
ATOM   3820  C CG   . ARG A 1 271 ? 8.167   -0.626  -31.301 1.00 30.31  ? 271 ARG A CG   1 
ATOM   3821  C CD   . ARG A 1 271 ? 7.517   0.192   -32.464 1.00 40.16  ? 271 ARG A CD   1 
ATOM   3822  N NE   . ARG A 1 271 ? 7.076   1.480   -31.948 1.00 45.69  ? 271 ARG A NE   1 
ATOM   3823  C CZ   . ARG A 1 271 ? 7.894   2.472   -31.602 1.00 40.86  ? 271 ARG A CZ   1 
ATOM   3824  N NH1  . ARG A 1 271 ? 9.206   2.355   -31.756 1.00 36.68  ? 271 ARG A NH1  1 
ATOM   3825  N NH2  . ARG A 1 271 ? 7.400   3.593   -31.105 1.00 41.54  ? 271 ARG A NH2  1 
ATOM   3826  H H    A ARG A 1 271 ? 5.873   -1.920  -28.273 0.54 39.52  ? 271 ARG A H    1 
ATOM   3827  H H    B ARG A 1 271 ? 5.879   -1.917  -28.288 0.46 39.52  ? 271 ARG A H    1 
ATOM   3828  H HA   . ARG A 1 271 ? 8.444   -1.609  -28.754 1.00 39.60  ? 271 ARG A HA   1 
ATOM   3829  H HB2  . ARG A 1 271 ? 6.860   -2.030  -30.468 1.00 38.71  ? 271 ARG A HB2  1 
ATOM   3830  H HB3  . ARG A 1 271 ? 6.334   -0.543  -30.297 1.00 38.71  ? 271 ARG A HB3  1 
ATOM   3831  H HG2  . ARG A 1 271 ? 8.816   -0.056  -30.860 1.00 36.33  ? 271 ARG A HG2  1 
ATOM   3832  H HG3  . ARG A 1 271 ? 8.610   -1.397  -31.688 1.00 36.33  ? 271 ARG A HG3  1 
ATOM   3833  H HD2  . ARG A 1 271 ? 8.171   0.343   -33.164 1.00 48.15  ? 271 ARG A HD2  1 
ATOM   3834  H HD3  . ARG A 1 271 ? 6.747   -0.286  -32.810 1.00 48.15  ? 271 ARG A HD3  1 
ATOM   3835  H HE   . ARG A 1 271 ? 6.230   1.609   -31.860 1.00 54.78  ? 271 ARG A HE   1 
ATOM   3836  H HH11 . ARG A 1 271 ? 9.539   1.626   -32.068 1.00 43.97  ? 271 ARG A HH11 1 
ATOM   3837  H HH12 . ARG A 1 271 ? 9.724   3.004   -31.535 1.00 43.97  ? 271 ARG A HH12 1 
ATOM   3838  H HH21 . ARG A 1 271 ? 6.550   3.684   -31.011 1.00 49.81  ? 271 ARG A HH21 1 
ATOM   3839  H HH22 . ARG A 1 271 ? 7.927   4.241   -30.899 1.00 49.81  ? 271 ARG A HH22 1 
ATOM   3840  N N    . LYS A 1 272 ? 6.838   1.098   -28.042 1.00 37.05  ? 272 LYS A N    1 
ATOM   3841  C CA   . LYS A 1 272 ? 7.030   2.508   -27.693 1.00 36.32  ? 272 LYS A CA   1 
ATOM   3842  C C    . LYS A 1 272 ? 7.883   2.648   -26.448 1.00 35.34  ? 272 LYS A C    1 
ATOM   3843  O O    . LYS A 1 272 ? 8.766   3.505   -26.388 1.00 42.38  ? 272 LYS A O    1 
ATOM   3844  C CB   . LYS A 1 272 ? 5.680   3.209   -27.484 1.00 45.62  ? 272 LYS A CB   1 
ATOM   3845  H H    . LYS A 1 272 ? 6.018   0.838   -28.049 1.00 44.42  ? 272 LYS A H    1 
ATOM   3846  H HA   . LYS A 1 272 ? 7.489   2.954   -28.422 1.00 43.54  ? 272 LYS A HA   1 
ATOM   3847  N N    . VAL A 1 273 ? 7.625   1.826   -25.437 1.00 31.74  ? 273 VAL A N    1 
ATOM   3848  C CA   . VAL A 1 273 ? 8.415   1.894   -24.213 1.00 32.43  ? 273 VAL A CA   1 
ATOM   3849  C C    . VAL A 1 273 ? 9.828   1.428   -24.465 1.00 31.08  ? 273 VAL A C    1 
ATOM   3850  O O    . VAL A 1 273 ? 10.782  2.011   -23.934 1.00 35.36  ? 273 VAL A O    1 
ATOM   3851  C CB   . VAL A 1 273 ? 7.768   1.057   -23.102 1.00 26.90  ? 273 VAL A CB   1 
ATOM   3852  C CG1  . VAL A 1 273 ? 8.646   1.040   -21.884 1.00 36.23  ? 273 VAL A CG1  1 
ATOM   3853  C CG2  . VAL A 1 273 ? 6.405   1.613   -22.780 1.00 40.16  ? 273 VAL A CG2  1 
ATOM   3854  H H    . VAL A 1 273 ? 7.007   1.228   -25.433 1.00 38.05  ? 273 VAL A H    1 
ATOM   3855  H HA   . VAL A 1 273 ? 8.452   2.815   -23.912 1.00 38.87  ? 273 VAL A HA   1 
ATOM   3856  H HB   . VAL A 1 273 ? 7.658   0.144   -23.411 1.00 32.24  ? 273 VAL A HB   1 
ATOM   3857  H HG11 . VAL A 1 273 ? 8.220   0.507   -21.195 1.00 43.44  ? 273 VAL A HG11 1 
ATOM   3858  H HG12 . VAL A 1 273 ? 9.504   0.653   -22.119 1.00 43.44  ? 273 VAL A HG12 1 
ATOM   3859  H HG13 . VAL A 1 273 ? 8.769   1.950   -21.571 1.00 43.44  ? 273 VAL A HG13 1 
ATOM   3860  H HG21 . VAL A 1 273 ? 6.005   1.078   -22.077 1.00 48.15  ? 273 VAL A HG21 1 
ATOM   3861  H HG22 . VAL A 1 273 ? 6.501   2.531   -22.484 1.00 48.15  ? 273 VAL A HG22 1 
ATOM   3862  H HG23 . VAL A 1 273 ? 5.854   1.578   -23.578 1.00 48.15  ? 273 VAL A HG23 1 
ATOM   3863  N N    . ALA A 1 274 ? 9.994   0.340   -25.227 1.00 34.55  ? 274 ALA A N    1 
ATOM   3864  C CA   . ALA A 1 274 ? 11.344  -0.151  -25.476 1.00 33.25  ? 274 ALA A CA   1 
ATOM   3865  C C    . ALA A 1 274 ? 12.172  0.934   -26.154 1.00 24.70  ? 274 ALA A C    1 
ATOM   3866  O O    . ALA A 1 274 ? 13.323  1.180   -25.768 1.00 26.24  ? 274 ALA A O    1 
ATOM   3867  C CB   . ALA A 1 274 ? 11.312  -1.451  -26.311 1.00 33.92  ? 274 ALA A CB   1 
ATOM   3868  H H    . ALA A 1 274 ? 9.364   -0.113  -25.597 1.00 41.42  ? 274 ALA A H    1 
ATOM   3869  H HA   . ALA A 1 274 ? 11.763  -0.356  -24.626 1.00 39.86  ? 274 ALA A HA   1 
ATOM   3870  H HB1  . ALA A 1 274 ? 12.221  -1.753  -26.460 1.00 40.66  ? 274 ALA A HB1  1 
ATOM   3871  H HB2  . ALA A 1 274 ? 10.814  -2.127  -25.824 1.00 40.66  ? 274 ALA A HB2  1 
ATOM   3872  H HB3  . ALA A 1 274 ? 10.880  -1.270  -27.160 1.00 40.66  ? 274 ALA A HB3  1 
ATOM   3873  N N    . GLU A 1 275 ? 11.590  1.586   -27.182 1.00 28.68  ? 275 GLU A N    1 
ATOM   3874  C CA   . GLU A 1 275 ? 12.271  2.664   -27.897 1.00 27.26  ? 275 GLU A CA   1 
ATOM   3875  C C    . GLU A 1 275 ? 12.657  3.783   -26.945 1.00 34.57  ? 275 GLU A C    1 
ATOM   3876  O O    . GLU A 1 275 ? 13.813  4.215   -26.913 1.00 30.20  ? 275 GLU A O    1 
ATOM   3877  C CB   . GLU A 1 275 ? 11.391  3.243   -29.004 1.00 36.04  ? 275 GLU A CB   1 
ATOM   3878  C CG   . GLU A 1 275 ? 12.122  4.367   -29.794 1.00 40.32  ? 275 GLU A CG   1 
ATOM   3879  C CD   . GLU A 1 275 ? 11.235  5.449   -30.332 1.00 48.58  ? 275 GLU A CD   1 
ATOM   3880  O OE1  . GLU A 1 275 ? 10.612  5.245   -31.409 1.00 49.64  ? 275 GLU A OE1  1 
ATOM   3881  O OE2  . GLU A 1 275 ? 11.178  6.513   -29.673 1.00 53.90  ? 275 GLU A OE2  1 
ATOM   3882  H H    . GLU A 1 275 ? 10.801  1.416   -27.479 1.00 34.37  ? 275 GLU A H    1 
ATOM   3883  H HA   . GLU A 1 275 ? 13.081  2.317   -28.303 1.00 32.67  ? 275 GLU A HA   1 
ATOM   3884  H HB2  . GLU A 1 275 ? 11.157  2.538   -29.628 1.00 43.20  ? 275 GLU A HB2  1 
ATOM   3885  H HB3  . GLU A 1 275 ? 10.590  3.622   -28.610 1.00 43.20  ? 275 GLU A HB3  1 
ATOM   3886  H HG2  . GLU A 1 275 ? 12.770  4.785   -29.205 1.00 48.34  ? 275 GLU A HG2  1 
ATOM   3887  H HG3  . GLU A 1 275 ? 12.582  3.964   -30.548 1.00 48.34  ? 275 GLU A HG3  1 
ATOM   3888  N N    . ALA A 1 276 ? 11.686  4.288   -26.175 1.00 29.36  ? 276 ALA A N    1 
ATOM   3889  C CA   . ALA A 1 276 ? 11.994  5.373   -25.248 1.00 36.25  ? 276 ALA A CA   1 
ATOM   3890  C C    . ALA A 1 276 ? 13.115  4.990   -24.306 1.00 28.54  ? 276 ALA A C    1 
ATOM   3891  O O    . ALA A 1 276 ? 13.976  5.813   -23.993 1.00 36.78  ? 276 ALA A O    1 
ATOM   3892  C CB   . ALA A 1 276 ? 10.754  5.795   -24.457 1.00 31.07  ? 276 ALA A CB   1 
ATOM   3893  H H    . ALA A 1 276 ? 10.867  4.027   -26.171 1.00 35.19  ? 276 ALA A H    1 
ATOM   3894  H HA   . ALA A 1 276 ? 12.290  6.142   -25.760 1.00 43.46  ? 276 ALA A HA   1 
ATOM   3895  H HB1  . ALA A 1 276 ? 10.994  6.515   -23.854 1.00 37.24  ? 276 ALA A HB1  1 
ATOM   3896  H HB2  . ALA A 1 276 ? 10.072  6.096   -25.078 1.00 37.24  ? 276 ALA A HB2  1 
ATOM   3897  H HB3  . ALA A 1 276 ? 10.429  5.033   -23.952 1.00 37.24  ? 276 ALA A HB3  1 
ATOM   3898  N N    . PHE A 1 277 ? 13.122  3.746   -23.838 1.00 38.46  ? 277 PHE A N    1 
ATOM   3899  C CA   . PHE A 1 277 ? 14.192  3.292   -22.966 1.00 38.15  ? 277 PHE A CA   1 
ATOM   3900  C C    . PHE A 1 277 ? 15.543  3.318   -23.684 1.00 41.22  ? 277 PHE A C    1 
ATOM   3901  O O    . PHE A 1 277 ? 16.553  3.723   -23.106 1.00 39.38  ? 277 PHE A O    1 
ATOM   3902  C CB   . PHE A 1 277 ? 13.872  1.880   -22.456 1.00 38.86  ? 277 PHE A CB   1 
ATOM   3903  C CG   . PHE A 1 277 ? 15.077  1.118   -21.961 1.00 41.12  ? 277 PHE A CG   1 
ATOM   3904  C CD1  . PHE A 1 277 ? 15.849  0.368   -22.834 1.00 43.21  ? 277 PHE A CD1  1 
ATOM   3905  C CD2  . PHE A 1 277 ? 15.454  1.170   -20.633 1.00 51.66  ? 277 PHE A CD2  1 
ATOM   3906  C CE1  . PHE A 1 277 ? 16.967  -0.316  -22.382 1.00 42.99  ? 277 PHE A CE1  1 
ATOM   3907  C CE2  . PHE A 1 277 ? 16.569  0.479   -20.182 1.00 56.12  ? 277 PHE A CE2  1 
ATOM   3908  C CZ   . PHE A 1 277 ? 17.322  -0.259  -21.066 1.00 51.73  ? 277 PHE A CZ   1 
ATOM   3909  H H    . PHE A 1 277 ? 12.523  3.153   -24.009 1.00 46.11  ? 277 PHE A H    1 
ATOM   3910  H HA   . PHE A 1 277 ? 14.248  3.883   -22.199 1.00 45.74  ? 277 PHE A HA   1 
ATOM   3911  H HB2  . PHE A 1 277 ? 13.244  1.950   -21.720 1.00 46.59  ? 277 PHE A HB2  1 
ATOM   3912  H HB3  . PHE A 1 277 ? 13.476  1.370   -23.179 1.00 46.59  ? 277 PHE A HB3  1 
ATOM   3913  H HD1  . PHE A 1 277 ? 15.618  0.327   -23.734 1.00 51.81  ? 277 PHE A HD1  1 
ATOM   3914  H HD2  . PHE A 1 277 ? 14.950  1.670   -20.032 1.00 61.96  ? 277 PHE A HD2  1 
ATOM   3915  H HE1  . PHE A 1 277 ? 17.475  -0.819  -22.977 1.00 51.54  ? 277 PHE A HE1  1 
ATOM   3916  H HE2  . PHE A 1 277 ? 16.810  0.519   -19.285 1.00 67.31  ? 277 PHE A HE2  1 
ATOM   3917  H HZ   . PHE A 1 277 ? 18.069  -0.725  -20.765 1.00 62.04  ? 277 PHE A HZ   1 
ATOM   3918  N N    . ALA A 1 278 ? 15.588  2.870   -24.934 1.00 33.77  ? 278 ALA A N    1 
ATOM   3919  C CA   . ALA A 1 278 ? 16.855  2.888   -25.676 1.00 43.79  ? 278 ALA A CA   1 
ATOM   3920  C C    . ALA A 1 278 ? 17.280  4.309   -26.027 1.00 41.01  ? 278 ALA A C    1 
ATOM   3921  O O    . ALA A 1 278 ? 18.474  4.641   -25.982 1.00 36.33  ? 278 ALA A O    1 
ATOM   3922  C CB   . ALA A 1 278 ? 16.719  2.045   -26.946 1.00 35.92  ? 278 ALA A CB   1 
ATOM   3923  H H    . ALA A 1 278 ? 14.918  2.557   -25.372 1.00 40.48  ? 278 ALA A H    1 
ATOM   3924  H HA   . ALA A 1 278 ? 17.550  2.493   -25.126 1.00 52.50  ? 278 ALA A HA   1 
ATOM   3925  H HB1  . ALA A 1 278 ? 17.561  2.063   -27.428 1.00 43.07  ? 278 ALA A HB1  1 
ATOM   3926  H HB2  . ALA A 1 278 ? 16.499  1.134   -26.698 1.00 43.07  ? 278 ALA A HB2  1 
ATOM   3927  H HB3  . ALA A 1 278 ? 16.013  2.418   -27.497 1.00 43.07  ? 278 ALA A HB3  1 
ATOM   3928  N N    . ARG A 1 279 ? 16.306  5.165   -26.348 1.00 41.52  ? 279 ARG A N    1 
ATOM   3929  C CA   . ARG A 1 279 ? 16.550  6.527   -26.827 1.00 37.26  ? 279 ARG A CA   1 
ATOM   3930  C C    . ARG A 1 279 ? 16.803  7.534   -25.699 1.00 41.47  ? 279 ARG A C    1 
ATOM   3931  O O    . ARG A 1 279 ? 17.550  8.495   -25.914 1.00 39.23  ? 279 ARG A O    1 
ATOM   3932  C CB   . ARG A 1 279 ? 15.355  6.961   -27.690 1.00 42.15  ? 279 ARG A CB   1 
ATOM   3933  C CG   . ARG A 1 279 ? 15.209  8.436   -27.972 1.00 42.51  ? 279 ARG A CG   1 
ATOM   3934  C CD   . ARG A 1 279 ? 14.107  8.708   -29.057 1.00 42.03  ? 279 ARG A CD   1 
ATOM   3935  N NE   . ARG A 1 279 ? 12.754  8.312   -28.635 1.00 39.95  ? 279 ARG A NE   1 
ATOM   3936  C CZ   . ARG A 1 279 ? 12.019  8.969   -27.738 1.00 46.91  ? 279 ARG A CZ   1 
ATOM   3937  N NH1  . ARG A 1 279 ? 12.483  10.060  -27.159 1.00 40.85  ? 279 ARG A NH1  1 
ATOM   3938  N NH2  . ARG A 1 279 ? 10.820  8.532   -27.402 1.00 49.52  ? 279 ARG A NH2  1 
ATOM   3939  H H    . ARG A 1 279 ? 15.470  4.972   -26.294 1.00 49.79  ? 279 ARG A H    1 
ATOM   3940  H HA   . ARG A 1 279 ? 17.337  6.519   -27.395 1.00 44.67  ? 279 ARG A HA   1 
ATOM   3941  H HB2  . ARG A 1 279 ? 15.424  6.512   -28.547 1.00 50.53  ? 279 ARG A HB2  1 
ATOM   3942  H HB3  . ARG A 1 279 ? 14.542  6.674   -27.244 1.00 50.53  ? 279 ARG A HB3  1 
ATOM   3943  H HG2  . ARG A 1 279 ? 14.953  8.894   -27.157 1.00 50.96  ? 279 ARG A HG2  1 
ATOM   3944  H HG3  . ARG A 1 279 ? 16.053  8.784   -28.302 1.00 50.96  ? 279 ARG A HG3  1 
ATOM   3945  H HD2  . ARG A 1 279 ? 14.091  9.658   -29.255 1.00 50.39  ? 279 ARG A HD2  1 
ATOM   3946  H HD3  . ARG A 1 279 ? 14.327  8.208   -29.859 1.00 50.39  ? 279 ARG A HD3  1 
ATOM   3947  H HE   . ARG A 1 279 ? 12.414  7.607   -28.992 1.00 47.90  ? 279 ARG A HE   1 
ATOM   3948  H HH11 . ARG A 1 279 ? 13.265  10.355  -27.362 1.00 48.97  ? 279 ARG A HH11 1 
ATOM   3949  H HH12 . ARG A 1 279 ? 12.002  10.478  -26.581 1.00 48.97  ? 279 ARG A HH12 1 
ATOM   3950  H HH21 . ARG A 1 279 ? 10.501  7.824   -27.771 1.00 59.39  ? 279 ARG A HH21 1 
ATOM   3951  H HH22 . ARG A 1 279 ? 10.350  8.966   -26.826 1.00 59.39  ? 279 ARG A HH22 1 
ATOM   3952  N N    . THR A 1 280 ? 16.216  7.341   -24.500 1.00 48.88  ? 280 THR A N    1 
ATOM   3953  C CA   . THR A 1 280 ? 16.352  8.301   -23.394 1.00 52.80  ? 280 THR A CA   1 
ATOM   3954  C C    . THR A 1 280 ? 17.185  7.797   -22.221 1.00 50.35  ? 280 THR A C    1 
ATOM   3955  O O    . THR A 1 280 ? 17.650  8.616   -21.424 1.00 53.71  ? 280 THR A O    1 
ATOM   3956  C CB   . THR A 1 280 ? 14.985  8.713   -22.804 1.00 43.45  ? 280 THR A CB   1 
ATOM   3957  O OG1  . THR A 1 280 ? 14.475  7.657   -21.977 1.00 42.22  ? 280 THR A OG1  1 
ATOM   3958  C CG2  . THR A 1 280 ? 13.934  9.049   -23.876 1.00 46.83  ? 280 THR A CG2  1 
ATOM   3959  H H    . THR A 1 280 ? 15.734  6.656   -24.305 1.00 58.61  ? 280 THR A H    1 
ATOM   3960  H HA   . THR A 1 280 ? 16.779  9.103   -23.734 1.00 63.32  ? 280 THR A HA   1 
ATOM   3961  H HB   . THR A 1 280 ? 15.109  9.504   -22.256 1.00 52.10  ? 280 THR A HB   1 
ATOM   3962  H HG1  . THR A 1 280 ? 14.377  6.958   -22.432 1.00 50.63  ? 280 THR A HG1  1 
ATOM   3963  H HG21 . THR A 1 280 ? 13.098  9.300   -23.454 1.00 56.15  ? 280 THR A HG21 1 
ATOM   3964  H HG22 . THR A 1 280 ? 14.244  9.787   -24.424 1.00 56.15  ? 280 THR A HG22 1 
ATOM   3965  H HG23 . THR A 1 280 ? 13.781  8.277   -24.444 1.00 56.15  ? 280 THR A HG23 1 
ATOM   3966  N N    . GLY A 1 281 ? 17.344  6.488   -22.063 1.00 51.63  ? 281 GLY A N    1 
ATOM   3967  C CA   . GLY A 1 281 ? 17.997  5.939   -20.896 1.00 41.44  ? 281 GLY A CA   1 
ATOM   3968  C C    . GLY A 1 281 ? 17.091  5.722   -19.700 1.00 48.80  ? 281 GLY A C    1 
ATOM   3969  O O    . GLY A 1 281 ? 17.538  5.135   -18.708 1.00 52.44  ? 281 GLY A O    1 
ATOM   3970  H H    . GLY A 1 281 ? 17.078  5.895   -22.626 1.00 61.91  ? 281 GLY A H    1 
ATOM   3971  H HA2  . GLY A 1 281 ? 18.393  5.085   -21.130 1.00 49.69  ? 281 GLY A HA2  1 
ATOM   3972  H HA3  . GLY A 1 281 ? 18.712  6.536   -20.625 1.00 49.69  ? 281 GLY A HA3  1 
ATOM   3973  N N    . LYS A 1 282 ? 15.835  6.171   -19.756 1.00 52.70  ? 282 LYS A N    1 
ATOM   3974  C CA   . LYS A 1 282 ? 14.957  6.087   -18.589 1.00 54.08  ? 282 LYS A CA   1 
ATOM   3975  C C    . LYS A 1 282 ? 14.531  4.642   -18.356 1.00 51.40  ? 282 LYS A C    1 
ATOM   3976  O O    . LYS A 1 282 ? 14.070  3.969   -19.280 1.00 51.05  ? 282 LYS A O    1 
ATOM   3977  C CB   . LYS A 1 282 ? 13.729  6.984   -18.779 1.00 48.19  ? 282 LYS A CB   1 
ATOM   3978  H H    . LYS A 1 282 ? 15.472  6.525   -20.450 1.00 63.20  ? 282 LYS A H    1 
ATOM   3979  H HA   . LYS A 1 282 ? 15.437  6.393   -17.804 1.00 64.85  ? 282 LYS A HA   1 
ATOM   3980  N N    . SER A 1 283 ? 14.686  4.168   -17.119 1.00 51.97  ? 283 SER A N    1 
ATOM   3981  C CA   . SER A 1 283 ? 14.356  2.794   -16.740 1.00 56.88  ? 283 SER A CA   1 
ATOM   3982  C C    . SER A 1 283 ? 12.987  2.338   -17.244 1.00 57.47  ? 283 SER A C    1 
ATOM   3983  O O    . SER A 1 283 ? 12.119  3.161   -17.551 1.00 53.67  ? 283 SER A O    1 
ATOM   3984  C CB   . SER A 1 283 ? 14.403  2.642   -15.211 1.00 58.19  ? 283 SER A CB   1 
ATOM   3985  O OG   . SER A 1 283 ? 14.410  1.272   -14.826 1.00 63.30  ? 283 SER A OG   1 
ATOM   3986  H H    . SER A 1 283 ? 14.988  4.637   -16.465 1.00 62.32  ? 283 SER A H    1 
ATOM   3987  H HA   . SER A 1 283 ? 15.023  2.199   -17.117 1.00 68.22  ? 283 SER A HA   1 
ATOM   3988  H HB2  . SER A 1 283 ? 15.209  3.065   -14.877 1.00 69.79  ? 283 SER A HB2  1 
ATOM   3989  H HB3  . SER A 1 283 ? 13.622  3.071   -14.828 1.00 69.79  ? 283 SER A HB3  1 
ATOM   3990  H HG   . SER A 1 283 ? 14.435  1.209   -13.989 1.00 75.92  ? 283 SER A HG   1 
ATOM   3991  N N    . ILE A 1 284 ? 12.786  1.018   -17.316 1.00 60.91  ? 284 ILE A N    1 
ATOM   3992  C CA   . ILE A 1 284 ? 11.489  0.480   -17.720 1.00 58.94  ? 284 ILE A CA   1 
ATOM   3993  C C    . ILE A 1 284 ? 10.453  0.714   -16.631 1.00 51.40  ? 284 ILE A C    1 
ATOM   3994  O O    . ILE A 1 284 ? 9.312   1.076   -16.930 1.00 50.84  ? 284 ILE A O    1 
ATOM   3995  C CB   . ILE A 1 284 ? 11.586  -1.018  -18.070 1.00 56.32  ? 284 ILE A CB   1 
ATOM   3996  C CG1  . ILE A 1 284 ? 12.446  -1.234  -19.304 1.00 60.57  ? 284 ILE A CG1  1 
ATOM   3997  C CG2  . ILE A 1 284 ? 10.214  -1.597  -18.367 1.00 62.17  ? 284 ILE A CG2  1 
ATOM   3998  C CD1  . ILE A 1 284 ? 13.387  -2.423  -19.151 1.00 60.37  ? 284 ILE A CD1  1 
ATOM   3999  H H    . ILE A 1 284 ? 13.379  0.421   -17.138 1.00 73.05  ? 284 ILE A H    1 
ATOM   4000  H HA   . ILE A 1 284 ? 11.192  0.950   -18.515 1.00 70.68  ? 284 ILE A HA   1 
ATOM   4001  H HB   . ILE A 1 284 ? 11.978  -1.494  -17.321 1.00 67.55  ? 284 ILE A HB   1 
ATOM   4002  H HG12 . ILE A 1 284 ? 11.871  -1.401  -20.066 1.00 72.65  ? 284 ILE A HG12 1 
ATOM   4003  H HG13 . ILE A 1 284 ? 12.984  -0.442  -19.459 1.00 72.65  ? 284 ILE A HG13 1 
ATOM   4004  H HG21 . ILE A 1 284 ? 10.309  -2.538  -18.583 1.00 74.56  ? 284 ILE A HG21 1 
ATOM   4005  H HG22 . ILE A 1 284 ? 9.651   -1.492  -17.584 1.00 74.56  ? 284 ILE A HG22 1 
ATOM   4006  H HG23 . ILE A 1 284 ? 9.827   -1.123  -19.119 1.00 74.56  ? 284 ILE A HG23 1 
ATOM   4007  H HD11 . ILE A 1 284 ? 13.910  -2.517  -19.962 1.00 72.41  ? 284 ILE A HD11 1 
ATOM   4008  H HD12 . ILE A 1 284 ? 13.973  -2.266  -18.395 1.00 72.41  ? 284 ILE A HD12 1 
ATOM   4009  H HD13 . ILE A 1 284 ? 12.861  -3.224  -19.002 1.00 72.41  ? 284 ILE A HD13 1 
ATOM   4010  N N    . GLU A 1 285 ? 10.811  0.476   -15.362 1.00 54.14  ? 285 GLU A N    1 
ATOM   4011  C CA   . GLU A 1 285 ? 9.931   0.869   -14.257 1.00 56.34  ? 285 GLU A CA   1 
ATOM   4012  C C    . GLU A 1 285 ? 9.478   2.315   -14.419 1.00 46.44  ? 285 GLU A C    1 
ATOM   4013  O O    . GLU A 1 285 ? 8.280   2.607   -14.427 1.00 52.13  ? 285 GLU A O    1 
ATOM   4014  C CB   . GLU A 1 285 ? 10.640  0.687   -12.908 1.00 48.94  ? 285 GLU A CB   1 
ATOM   4015  H H    . GLU A 1 285 ? 11.544  0.095   -15.121 1.00 64.92  ? 285 GLU A H    1 
ATOM   4016  H HA   . GLU A 1 285 ? 9.143   0.304   -14.262 1.00 67.57  ? 285 GLU A HA   1 
ATOM   4017  N N    . GLN A 1 286 ? 10.431  3.232   -14.589 1.00 51.66  ? 286 GLN A N    1 
ATOM   4018  C CA   . GLN A 1 286 ? 10.094  4.647   -14.712 1.00 50.73  ? 286 GLN A CA   1 
ATOM   4019  C C    . GLN A 1 286 ? 9.158   4.891   -15.885 1.00 59.46  ? 286 GLN A C    1 
ATOM   4020  O O    . GLN A 1 286 ? 8.177   5.636   -15.772 1.00 53.40  ? 286 GLN A O    1 
ATOM   4021  C CB   . GLN A 1 286 ? 11.369  5.468   -14.883 1.00 59.16  ? 286 GLN A CB   1 
ATOM   4022  C CG   . GLN A 1 286 ? 11.257  6.924   -14.483 1.00 66.28  ? 286 GLN A CG   1 
ATOM   4023  C CD   . GLN A 1 286 ? 12.592  7.655   -14.569 1.00 89.01  ? 286 GLN A CD   1 
ATOM   4024  O OE1  . GLN A 1 286 ? 13.636  7.051   -14.847 1.00 89.21  ? 286 GLN A OE1  1 
ATOM   4025  N NE2  . GLN A 1 286 ? 12.566  8.962   -14.329 1.00 87.17  ? 286 GLN A NE2  1 
ATOM   4026  H H    . GLN A 1 286 ? 11.272  3.061   -14.636 1.00 61.95  ? 286 GLN A H    1 
ATOM   4027  H HA   . GLN A 1 286 ? 9.649   4.942   -13.902 1.00 60.83  ? 286 GLN A HA   1 
ATOM   4028  H HB2  . GLN A 1 286 ? 12.067  5.069   -14.340 1.00 70.96  ? 286 GLN A HB2  1 
ATOM   4029  H HB3  . GLN A 1 286 ? 11.630  5.441   -15.817 1.00 70.96  ? 286 GLN A HB3  1 
ATOM   4030  H HG2  . GLN A 1 286 ? 10.632  7.369   -15.077 1.00 79.50  ? 286 GLN A HG2  1 
ATOM   4031  H HG3  . GLN A 1 286 ? 10.943  6.978   -13.567 1.00 79.50  ? 286 GLN A HG3  1 
ATOM   4032  H HE21 . GLN A 1 286 ? 11.822  9.349   -14.138 1.00 104.56 ? 286 GLN A HE21 1 
ATOM   4033  H HE22 . GLN A 1 286 ? 13.293  9.421   -14.364 1.00 104.56 ? 286 GLN A HE22 1 
ATOM   4034  N N    . LEU A 1 287 ? 9.467   4.293   -17.039 1.00 60.04  ? 287 LEU A N    1 
ATOM   4035  C CA   . LEU A 1 287 ? 8.634   4.480   -18.214 1.00 55.44  ? 287 LEU A CA   1 
ATOM   4036  C C    . LEU A 1 287 ? 7.325   3.709   -18.106 1.00 56.43  ? 287 LEU A C    1 
ATOM   4037  O O    . LEU A 1 287 ? 6.343   4.083   -18.754 1.00 47.23  ? 287 LEU A O    1 
ATOM   4038  C CB   . LEU A 1 287 ? 9.411   4.066   -19.470 1.00 65.25  ? 287 LEU A CB   1 
ATOM   4039  C CG   . LEU A 1 287 ? 10.476  5.054   -19.980 1.00 55.25  ? 287 LEU A CG   1 
ATOM   4040  C CD1  . LEU A 1 287 ? 11.391  4.410   -21.018 1.00 53.80  ? 287 LEU A CD1  1 
ATOM   4041  C CD2  . LEU A 1 287 ? 9.837   6.306   -20.573 1.00 56.66  ? 287 LEU A CD2  1 
ATOM   4042  H H    . LEU A 1 287 ? 10.147  3.781   -17.161 1.00 72.00  ? 287 LEU A H    1 
ATOM   4043  H HA   . LEU A 1 287 ? 8.417   5.422   -18.296 1.00 66.48  ? 287 LEU A HA   1 
ATOM   4044  H HB2  . LEU A 1 287 ? 9.863   3.228   -19.285 1.00 78.25  ? 287 LEU A HB2  1 
ATOM   4045  H HB3  . LEU A 1 287 ? 8.775   3.935   -20.190 1.00 78.25  ? 287 LEU A HB3  1 
ATOM   4046  H HG   . LEU A 1 287 ? 11.028  5.330   -19.231 1.00 66.25  ? 287 LEU A HG   1 
ATOM   4047  H HD11 . LEU A 1 287 ? 12.045  5.064   -21.311 1.00 64.52  ? 287 LEU A HD11 1 
ATOM   4048  H HD12 . LEU A 1 287 ? 11.840  3.651   -20.615 1.00 64.52  ? 287 LEU A HD12 1 
ATOM   4049  H HD13 . LEU A 1 287 ? 10.855  4.117   -21.771 1.00 64.52  ? 287 LEU A HD13 1 
ATOM   4050  H HD21 . LEU A 1 287 ? 10.538  6.902   -20.881 1.00 67.95  ? 287 LEU A HD21 1 
ATOM   4051  H HD22 . LEU A 1 287 ? 9.270   6.049   -21.316 1.00 67.95  ? 287 LEU A HD22 1 
ATOM   4052  H HD23 . LEU A 1 287 ? 9.308   6.744   -19.888 1.00 67.95  ? 287 LEU A HD23 1 
ATOM   4053  N N    . GLU A 1 288 ? 7.280   2.645   -17.303 1.00 56.97  ? 288 GLU A N    1 
ATOM   4054  C CA   . GLU A 1 288 ? 6.004   1.996   -17.030 1.00 57.98  ? 288 GLU A CA   1 
ATOM   4055  C C    . GLU A 1 288 ? 5.096   2.927   -16.231 1.00 66.44  ? 288 GLU A C    1 
ATOM   4056  O O    . GLU A 1 288 ? 3.955   3.190   -16.631 1.00 62.46  ? 288 GLU A O    1 
ATOM   4057  C CB   . GLU A 1 288 ? 6.227   0.679   -16.286 1.00 60.98  ? 288 GLU A CB   1 
ATOM   4058  C CG   . GLU A 1 288 ? 6.723   -0.486  -17.159 1.00 58.93  ? 288 GLU A CG   1 
ATOM   4059  C CD   . GLU A 1 288 ? 6.888   -1.770  -16.371 1.00 53.06  ? 288 GLU A CD   1 
ATOM   4060  O OE1  . GLU A 1 288 ? 7.128   -1.699  -15.155 1.00 64.05  ? 288 GLU A OE1  1 
ATOM   4061  O OE2  . GLU A 1 288 ? 6.749   -2.864  -16.949 1.00 58.70  ? 288 GLU A OE2  1 
ATOM   4062  H H    . GLU A 1 288 ? 7.959   2.289   -16.913 1.00 68.32  ? 288 GLU A H    1 
ATOM   4063  H HA   . GLU A 1 288 ? 5.564   1.796   -17.871 1.00 69.53  ? 288 GLU A HA   1 
ATOM   4064  H HB2  . GLU A 1 288 ? 6.888   0.826   -15.591 1.00 73.14  ? 288 GLU A HB2  1 
ATOM   4065  H HB3  . GLU A 1 288 ? 5.388   0.407   -15.884 1.00 73.14  ? 288 GLU A HB3  1 
ATOM   4066  H HG2  . GLU A 1 288 ? 6.080   -0.647  -17.867 1.00 70.68  ? 288 GLU A HG2  1 
ATOM   4067  H HG3  . GLU A 1 288 ? 7.585   -0.253  -17.538 1.00 70.68  ? 288 GLU A HG3  1 
ATOM   4068  N N    . LYS A 1 289 ? 5.611   3.467   -15.119 1.00 69.75  ? 289 LYS A N    1 
ATOM   4069  C CA   . LYS A 1 289 ? 4.844   4.400   -14.292 1.00 69.87  ? 289 LYS A CA   1 
ATOM   4070  C C    . LYS A 1 289 ? 4.353   5.583   -15.114 1.00 58.51  ? 289 LYS A C    1 
ATOM   4071  O O    . LYS A 1 289 ? 3.143   5.791   -15.274 1.00 70.92  ? 289 LYS A O    1 
ATOM   4072  C CB   . LYS A 1 289 ? 5.699   4.878   -13.113 1.00 55.92  ? 289 LYS A CB   1 
ATOM   4073  H H    . LYS A 1 289 ? 6.403   3.308   -14.824 1.00 83.66  ? 289 LYS A H    1 
ATOM   4074  H HA   . LYS A 1 289 ? 4.069   3.941   -13.933 1.00 83.80  ? 289 LYS A HA   1 
ATOM   4075  N N    . GLU A 1 290 ? 5.279   6.371   -15.649 1.00 66.17  ? 290 GLU A N    1 
ATOM   4076  C CA   . GLU A 1 290 ? 4.906   7.508   -16.483 1.00 68.87  ? 290 GLU A CA   1 
ATOM   4077  C C    . GLU A 1 290 ? 3.871   7.095   -17.528 1.00 67.18  ? 290 GLU A C    1 
ATOM   4078  O O    . GLU A 1 290 ? 2.693   7.449   -17.405 1.00 66.12  ? 290 GLU A O    1 
ATOM   4079  C CB   . GLU A 1 290 ? 6.149   8.110   -17.137 1.00 60.71  ? 290 GLU A CB   1 
ATOM   4080  C CG   . GLU A 1 290 ? 7.205   8.562   -16.120 1.00 72.57  ? 290 GLU A CG   1 
ATOM   4081  C CD   . GLU A 1 290 ? 8.441   9.178   -16.765 1.00 82.94  ? 290 GLU A CD   1 
ATOM   4082  O OE1  . GLU A 1 290 ? 9.493   9.256   -16.083 1.00 74.98  ? 290 GLU A OE1  1 
ATOM   4083  O OE2  . GLU A 1 290 ? 8.359   9.590   -17.947 1.00 82.41  ? 290 GLU A OE2  1 
ATOM   4084  H H    . GLU A 1 290 ? 6.127   6.269   -15.546 1.00 79.36  ? 290 GLU A H    1 
ATOM   4085  H HA   . GLU A 1 290 ? 4.505   8.190   -15.922 1.00 82.60  ? 290 GLU A HA   1 
ATOM   4086  H HB2  . GLU A 1 290 ? 6.556   7.443   -17.713 1.00 72.81  ? 290 GLU A HB2  1 
ATOM   4087  H HB3  . GLU A 1 290 ? 5.887   8.883   -17.660 1.00 72.81  ? 290 GLU A HB3  1 
ATOM   4088  H HG2  . GLU A 1 290 ? 6.811   9.228   -15.534 1.00 87.04  ? 290 GLU A HG2  1 
ATOM   4089  H HG3  . GLU A 1 290 ? 7.491   7.794   -15.602 1.00 87.04  ? 290 GLU A HG3  1 
ATOM   4090  N N    . LEU A 1 291 ? 4.284   6.284   -18.508 1.00 62.79  ? 291 LEU A N    1 
ATOM   4091  C CA   . LEU A 1 291 ? 3.494   6.009   -19.708 1.00 65.48  ? 291 LEU A CA   1 
ATOM   4092  C C    . LEU A 1 291 ? 2.359   4.995   -19.544 1.00 64.03  ? 291 LEU A C    1 
ATOM   4093  O O    . LEU A 1 291 ? 1.611   4.795   -20.510 1.00 70.33  ? 291 LEU A O    1 
ATOM   4094  C CB   . LEU A 1 291 ? 4.401   5.483   -20.821 1.00 63.69  ? 291 LEU A CB   1 
ATOM   4095  C CG   . LEU A 1 291 ? 5.193   6.425   -21.709 1.00 57.67  ? 291 LEU A CG   1 
ATOM   4096  C CD1  . LEU A 1 291 ? 4.928   7.869   -21.375 1.00 66.55  ? 291 LEU A CD1  1 
ATOM   4097  C CD2  . LEU A 1 291 ? 6.668   6.081   -21.575 1.00 66.76  ? 291 LEU A CD2  1 
ATOM   4098  H H    . LEU A 1 291 ? 5.039   5.872   -18.497 1.00 75.31  ? 291 LEU A H    1 
ATOM   4099  H HA   . LEU A 1 291 ? 3.101   6.841   -20.016 1.00 78.53  ? 291 LEU A HA   1 
ATOM   4100  H HB2  . LEU A 1 291 ? 5.051   4.895   -20.406 1.00 76.38  ? 291 LEU A HB2  1 
ATOM   4101  H HB3  . LEU A 1 291 ? 3.846   4.955   -21.416 1.00 76.38  ? 291 LEU A HB3  1 
ATOM   4102  H HG   . LEU A 1 291 ? 4.935   6.279   -22.632 1.00 69.17  ? 291 LEU A HG   1 
ATOM   4103  H HD11 . LEU A 1 291 ? 5.454   8.431   -21.966 1.00 79.82  ? 291 LEU A HD11 1 
ATOM   4104  H HD12 . LEU A 1 291 ? 3.984   8.053   -21.498 1.00 79.82  ? 291 LEU A HD12 1 
ATOM   4105  H HD13 . LEU A 1 291 ? 5.181   8.031   -20.453 1.00 79.82  ? 291 LEU A HD13 1 
ATOM   4106  H HD21 . LEU A 1 291 ? 7.183   6.678   -22.139 1.00 80.07  ? 291 LEU A HD21 1 
ATOM   4107  H HD22 . LEU A 1 291 ? 6.934   6.188   -20.648 1.00 80.07  ? 291 LEU A HD22 1 
ATOM   4108  H HD23 . LEU A 1 291 ? 6.804   5.162   -21.854 1.00 80.07  ? 291 LEU A HD23 1 
ATOM   4109  N N    . LEU A 1 292 ? 2.205   4.328   -18.406 1.00 70.25  ? 292 LEU A N    1 
ATOM   4110  C CA   . LEU A 1 292 ? 1.236   3.221   -18.368 1.00 71.02  ? 292 LEU A CA   1 
ATOM   4111  C C    . LEU A 1 292 ? 0.642   2.920   -16.994 1.00 55.15  ? 292 LEU A C    1 
ATOM   4112  O O    . LEU A 1 292 ? 0.078   3.800   -16.348 1.00 73.12  ? 292 LEU A O    1 
ATOM   4113  C CB   . LEU A 1 292 ? 1.907   1.950   -18.921 1.00 59.43  ? 292 LEU A CB   1 
ATOM   4114  H H    . LEU A 1 292 ? 2.624   4.481   -17.670 1.00 84.26  ? 292 LEU A H    1 
ATOM   4115  H HA   . LEU A 1 292 ? 0.499   3.441   -18.959 1.00 85.18  ? 292 LEU A HA   1 
ATOM   4116  N N    . GLY A 1 294 ? 1.126   2.446   -13.632 1.00 84.59  ? 294 GLY A N    1 
ATOM   4117  C CA   . GLY A 1 294 ? 2.383   1.733   -13.631 1.00 68.54  ? 294 GLY A CA   1 
ATOM   4118  C C    . GLY A 1 294 ? 2.156   0.324   -14.100 1.00 75.79  ? 294 GLY A C    1 
ATOM   4119  O O    . GLY A 1 294 ? 2.669   -0.617  -13.516 1.00 64.34  ? 294 GLY A O    1 
ATOM   4120  H HA2  . GLY A 1 294 ? 3.013   2.169   -14.226 1.00 82.21  ? 294 GLY A HA2  1 
ATOM   4121  H HA3  . GLY A 1 294 ? 2.754   1.714   -12.735 1.00 82.21  ? 294 GLY A HA3  1 
ATOM   4122  N N    . GLN A 1 295 ? 1.374   0.188   -15.166 1.00 73.24  ? 295 GLN A N    1 
ATOM   4123  C CA   . GLN A 1 295 ? 1.043   -1.126  -15.704 1.00 71.14  ? 295 GLN A CA   1 
ATOM   4124  C C    . GLN A 1 295 ? 2.288   -1.802  -16.271 1.00 66.18  ? 295 GLN A C    1 
ATOM   4125  O O    . GLN A 1 295 ? 3.184   -1.146  -16.805 1.00 62.53  ? 295 GLN A O    1 
ATOM   4126  C CB   . GLN A 1 295 ? -0.044  -0.995  -16.761 1.00 61.75  ? 295 GLN A CB   1 
ATOM   4127  C CG   . GLN A 1 295 ? -1.428  -0.909  -16.159 1.00 72.76  ? 295 GLN A CG   1 
ATOM   4128  C CD   . GLN A 1 295 ? -2.112  -2.257  -16.072 1.00 87.60  ? 295 GLN A CD   1 
ATOM   4129  O OE1  . GLN A 1 295 ? -2.687  -2.733  -17.056 1.00 85.79  ? 295 GLN A OE1  1 
ATOM   4130  N NE2  . GLN A 1 295 ? -2.059  -2.881  -14.891 1.00 79.91  ? 295 GLN A NE2  1 
ATOM   4131  H H    . GLN A 1 295 ? 1.036   0.846   -15.604 1.00 87.85  ? 295 GLN A H    1 
ATOM   4132  H HA   . GLN A 1 295 ? 0.700   -1.683  -14.988 1.00 85.32  ? 295 GLN A HA   1 
ATOM   4133  H HB2  . GLN A 1 295 ? 0.111   -0.188  -17.277 1.00 74.06  ? 295 GLN A HB2  1 
ATOM   4134  H HB3  . GLN A 1 295 ? -0.016  -1.771  -17.342 1.00 74.06  ? 295 GLN A HB3  1 
ATOM   4135  H HG2  . GLN A 1 295 ? -1.360  -0.548  -15.261 1.00 87.27  ? 295 GLN A HG2  1 
ATOM   4136  H HG3  . GLN A 1 295 ? -1.976  -0.329  -16.709 1.00 87.27  ? 295 GLN A HG3  1 
ATOM   4137  H HE21 . GLN A 1 295 ? -1.648  -2.515  -14.229 1.00 95.84  ? 295 GLN A HE21 1 
ATOM   4138  H HE22 . GLN A 1 295 ? -2.433  -3.649  -14.793 1.00 95.84  ? 295 GLN A HE22 1 
ATOM   4139  N N    . LYS A 1 296 ? 2.361   -3.125  -16.111 1.00 71.73  ? 296 LYS A N    1 
ATOM   4140  C CA   . LYS A 1 296 ? 3.585   -3.870  -16.385 1.00 63.34  ? 296 LYS A CA   1 
ATOM   4141  C C    . LYS A 1 296 ? 3.641   -4.269  -17.857 1.00 61.45  ? 296 LYS A C    1 
ATOM   4142  O O    . LYS A 1 296 ? 2.703   -4.876  -18.381 1.00 66.12  ? 296 LYS A O    1 
ATOM   4143  C CB   . LYS A 1 296 ? 3.675   -5.108  -15.491 1.00 55.89  ? 296 LYS A CB   1 
ATOM   4144  H H    . LYS A 1 296 ? 1.707   -3.615  -15.843 1.00 86.03  ? 296 LYS A H    1 
ATOM   4145  H HA   . LYS A 1 296 ? 4.350   -3.304  -16.196 1.00 75.97  ? 296 LYS A HA   1 
ATOM   4146  N N    . LEU A 1 297 ? 4.734   -3.900  -18.523 1.00 62.91  ? 297 LEU A N    1 
ATOM   4147  C CA   . LEU A 1 297 ? 5.012   -4.390  -19.869 1.00 57.66  ? 297 LEU A CA   1 
ATOM   4148  C C    . LEU A 1 297 ? 5.075   -5.911  -19.879 1.00 42.63  ? 297 LEU A C    1 
ATOM   4149  O O    . LEU A 1 297 ? 5.679   -6.536  -19.005 1.00 53.53  ? 297 LEU A O    1 
ATOM   4150  C CB   . LEU A 1 297 ? 6.339   -3.822  -20.377 1.00 47.11  ? 297 LEU A CB   1 
ATOM   4151  C CG   . LEU A 1 297 ? 6.394   -2.624  -21.313 1.00 53.52  ? 297 LEU A CG   1 
ATOM   4152  C CD1  . LEU A 1 297 ? 7.794   -2.589  -22.016 1.00 44.74  ? 297 LEU A CD1  1 
ATOM   4153  C CD2  . LEU A 1 297 ? 5.283   -2.700  -22.344 1.00 56.72  ? 297 LEU A CD2  1 
ATOM   4154  H H    . LEU A 1 297 ? 5.332   -3.363  -18.215 1.00 75.45  ? 297 LEU A H    1 
ATOM   4155  H HA   . LEU A 1 297 ? 4.305   -4.107  -20.470 1.00 69.15  ? 297 LEU A HA   1 
ATOM   4156  H HB2  . LEU A 1 297 ? 6.860   -3.576  -19.596 1.00 56.49  ? 297 LEU A HB2  1 
ATOM   4157  H HB3  . LEU A 1 297 ? 6.799   -4.542  -20.836 1.00 56.49  ? 297 LEU A HB3  1 
ATOM   4158  H HG   . LEU A 1 297 ? 6.285   -1.807  -20.802 1.00 64.19  ? 297 LEU A HG   1 
ATOM   4159  H HD11 . LEU A 1 297 ? 7.828   -1.825  -22.613 1.00 53.65  ? 297 LEU A HD11 1 
ATOM   4160  H HD12 . LEU A 1 297 ? 8.484   -2.512  -21.339 1.00 53.65  ? 297 LEU A HD12 1 
ATOM   4161  H HD13 . LEU A 1 297 ? 7.914   -3.408  -22.520 1.00 53.65  ? 297 LEU A HD13 1 
ATOM   4162  H HD21 . LEU A 1 297 ? 5.340   -1.926  -22.927 1.00 68.02  ? 297 LEU A HD21 1 
ATOM   4163  H HD22 . LEU A 1 297 ? 5.388   -3.513  -22.862 1.00 68.02  ? 297 LEU A HD22 1 
ATOM   4164  H HD23 . LEU A 1 297 ? 4.427   -2.707  -21.886 1.00 68.02  ? 297 LEU A HD23 1 
ATOM   4165  N N    . GLN A 1 298 ? 4.472   -6.518  -20.892 1.00 58.47  ? 298 GLN A N    1 
ATOM   4166  C CA   . GLN A 1 298 ? 4.398   -7.980  -20.899 1.00 66.77  ? 298 GLN A CA   1 
ATOM   4167  C C    . GLN A 1 298 ? 5.687   -8.618  -21.436 1.00 48.91  ? 298 GLN A C    1 
ATOM   4168  O O    . GLN A 1 298 ? 6.160   -9.626  -20.889 1.00 37.84  ? 298 GLN A O    1 
ATOM   4169  C CB   . GLN A 1 298 ? 3.168   -8.425  -21.701 1.00 60.28  ? 298 GLN A CB   1 
ATOM   4170  C CG   . GLN A 1 298 ? 1.860   -7.975  -21.091 1.00 55.72  ? 298 GLN A CG   1 
ATOM   4171  C CD   . GLN A 1 298 ? 0.694   -8.808  -21.565 1.00 78.38  ? 298 GLN A CD   1 
ATOM   4172  O OE1  . GLN A 1 298 ? 0.762   -9.440  -22.626 1.00 71.91  ? 298 GLN A OE1  1 
ATOM   4173  N NE2  . GLN A 1 298 ? -0.383  -8.831  -20.775 1.00 84.85  ? 298 GLN A NE2  1 
ATOM   4174  H H    . GLN A 1 298 ? 4.109   -6.127  -21.566 1.00 70.12  ? 298 GLN A H    1 
ATOM   4175  H HA   . GLN A 1 298 ? 4.279   -8.287  -19.986 1.00 80.08  ? 298 GLN A HA   1 
ATOM   4176  H HB2  . GLN A 1 298 ? 3.224   -8.052  -22.595 1.00 72.29  ? 298 GLN A HB2  1 
ATOM   4177  H HB3  . GLN A 1 298 ? 3.157   -9.394  -21.747 1.00 72.29  ? 298 GLN A HB3  1 
ATOM   4178  H HG2  . GLN A 1 298 ? 1.915   -8.054  -20.126 1.00 66.83  ? 298 GLN A HG2  1 
ATOM   4179  H HG3  . GLN A 1 298 ? 1.694   -7.052  -21.341 1.00 66.83  ? 298 GLN A HG3  1 
ATOM   4180  H HE21 . GLN A 1 298 ? -0.389  -8.379  -20.044 1.00 101.78 ? 298 GLN A HE21 1 
ATOM   4181  H HE22 . GLN A 1 298 ? -1.072  -9.292  -21.001 1.00 101.78 ? 298 GLN A HE22 1 
ATOM   4182  N N    . GLY A 1 299 ? 6.282   -8.025  -22.476 1.00 31.87  ? 299 GLY A N    1 
ATOM   4183  C CA   . GLY A 1 299 ? 7.487   -8.555  -23.100 1.00 37.96  ? 299 GLY A CA   1 
ATOM   4184  C C    . GLY A 1 299 ? 8.614   -8.931  -22.138 1.00 36.56  ? 299 GLY A C    1 
ATOM   4185  O O    . GLY A 1 299 ? 9.134   -10.045 -22.166 1.00 29.50  ? 299 GLY A O    1 
ATOM   4186  H H    . GLY A 1 299 ? 5.996   -7.301  -22.842 1.00 38.21  ? 299 GLY A H    1 
ATOM   4187  H HA2  . GLY A 1 299 ? 7.253   -9.348  -23.608 1.00 45.50  ? 299 GLY A HA2  1 
ATOM   4188  H HA3  . GLY A 1 299 ? 7.833   -7.895  -23.721 1.00 45.50  ? 299 GLY A HA3  1 
ATOM   4189  N N    . PRO A 1 300 ? 9.048   -8.002  -21.295 1.00 32.68  ? 300 PRO A N    1 
ATOM   4190  C CA   . PRO A 1 300 ? 10.162  -8.329  -20.394 1.00 28.09  ? 300 PRO A CA   1 
ATOM   4191  C C    . PRO A 1 300 ? 9.914   -9.540  -19.504 1.00 36.38  ? 300 PRO A C    1 
ATOM   4192  O O    . PRO A 1 300 ? 10.802  -10.385 -19.384 1.00 29.22  ? 300 PRO A O    1 
ATOM   4193  C CB   . PRO A 1 300 ? 10.336  -7.033  -19.587 1.00 28.05  ? 300 PRO A CB   1 
ATOM   4194  C CG   . PRO A 1 300 ? 9.861   -5.973  -20.511 1.00 29.30  ? 300 PRO A CG   1 
ATOM   4195  C CD   . PRO A 1 300 ? 8.751   -6.568  -21.317 1.00 31.96  ? 300 PRO A CD   1 
ATOM   4196  H HA   . PRO A 1 300 ? 10.968  -8.484  -20.912 1.00 33.66  ? 300 PRO A HA   1 
ATOM   4197  H HB2  . PRO A 1 300 ? 9.789   -7.067  -18.786 1.00 33.62  ? 300 PRO A HB2  1 
ATOM   4198  H HB3  . PRO A 1 300 ? 11.271  -6.906  -19.364 1.00 33.62  ? 300 PRO A HB3  1 
ATOM   4199  H HG2  . PRO A 1 300 ? 9.537   -5.218  -19.995 1.00 35.12  ? 300 PRO A HG2  1 
ATOM   4200  H HG3  . PRO A 1 300 ? 10.590  -5.700  -21.090 1.00 35.12  ? 300 PRO A HG3  1 
ATOM   4201  H HD2  . PRO A 1 300 ? 7.895   -6.393  -20.894 1.00 38.31  ? 300 PRO A HD2  1 
ATOM   4202  H HD3  . PRO A 1 300 ? 8.775   -6.231  -22.226 1.00 38.31  ? 300 PRO A HD3  1 
ATOM   4203  N N    . GLU A 1 301 ? 8.734   -9.655  -18.877 1.00 30.91  ? 301 GLU A N    1 
ATOM   4204  C CA   . GLU A 1 301 ? 8.458   -10.781 -17.974 1.00 33.20  ? 301 GLU A CA   1 
ATOM   4205  C C    . GLU A 1 301 ? 8.445   -12.116 -18.714 1.00 36.39  ? 301 GLU A C    1 
ATOM   4206  O O    . GLU A 1 301 ? 9.017   -13.115 -18.254 1.00 36.26  ? 301 GLU A O    1 
ATOM   4207  C CB   . GLU A 1 301 ? 7.120   -10.565 -17.274 1.00 42.20  ? 301 GLU A CB   1 
ATOM   4208  C CG   . GLU A 1 301 ? 7.077   -9.297  -16.429 1.00 62.47  ? 301 GLU A CG   1 
ATOM   4209  C CD   . GLU A 1 301 ? 6.040   -9.370  -15.323 1.00 66.89  ? 301 GLU A CD   1 
ATOM   4210  O OE1  . GLU A 1 301 ? 4.828   -9.474  -15.645 1.00 48.48  ? 301 GLU A OE1  1 
ATOM   4211  O OE2  . GLU A 1 301 ? 6.460   -9.341  -14.136 1.00 57.81  ? 301 GLU A OE2  1 
ATOM   4212  H H    . GLU A 1 301 ? 8.082   -9.099  -18.956 1.00 37.05  ? 301 GLU A H    1 
ATOM   4213  H HA   . GLU A 1 301 ? 9.150   -10.820 -17.296 1.00 39.80  ? 301 GLU A HA   1 
ATOM   4214  H HB2  . GLU A 1 301 ? 6.422   -10.500 -17.944 1.00 50.60  ? 301 GLU A HB2  1 
ATOM   4215  H HB3  . GLU A 1 301 ? 6.946   -11.319 -16.689 1.00 50.60  ? 301 GLU A HB3  1 
ATOM   4216  H HG2  . GLU A 1 301 ? 7.945   -9.160  -16.018 1.00 74.93  ? 301 GLU A HG2  1 
ATOM   4217  H HG3  . GLU A 1 301 ? 6.856   -8.543  -16.999 1.00 74.93  ? 301 GLU A HG3  1 
ATOM   4218  N N    . THR A 1 302 ? 7.800   -12.163 -19.868 1.00 28.49  ? 302 THR A N    1 
ATOM   4219  C CA   . THR A 1 302 ? 7.876   -13.379 -20.668 1.00 28.70  ? 302 THR A CA   1 
ATOM   4220  C C    . THR A 1 302 ? 9.330   -13.768 -20.932 1.00 30.31  ? 302 THR A C    1 
ATOM   4221  O O    . THR A 1 302 ? 9.710   -14.933 -20.784 1.00 30.99  ? 302 THR A O    1 
ATOM   4222  C CB   . THR A 1 302 ? 7.117   -13.167 -21.961 1.00 25.14  ? 302 THR A CB   1 
ATOM   4223  O OG1  . THR A 1 302 ? 5.760   -12.828 -21.643 1.00 30.10  ? 302 THR A OG1  1 
ATOM   4224  C CG2  . THR A 1 302 ? 7.172   -14.431 -22.826 1.00 35.20  ? 302 THR A CG2  1 
ATOM   4225  H H    . THR A 1 302 ? 7.326   -11.529 -20.205 1.00 34.14  ? 302 THR A H    1 
ATOM   4226  H HA   . THR A 1 302 ? 7.452   -14.105 -20.184 1.00 34.39  ? 302 THR A HA   1 
ATOM   4227  H HB   . THR A 1 302 ? 7.523   -12.439 -22.457 1.00 30.12  ? 302 THR A HB   1 
ATOM   4228  H HG1  . THR A 1 302 ? 5.322   -12.706 -22.349 1.00 36.07  ? 302 THR A HG1  1 
ATOM   4229  H HG21 . THR A 1 302 ? 6.684   -14.289 -23.652 1.00 42.20  ? 302 THR A HG21 1 
ATOM   4230  H HG22 . THR A 1 302 ? 8.094   -14.648 -23.037 1.00 42.20  ? 302 THR A HG22 1 
ATOM   4231  H HG23 . THR A 1 302 ? 6.774   -15.176 -22.349 1.00 42.20  ? 302 THR A HG23 1 
ATOM   4232  N N    . ALA A 1 303 ? 10.161  -12.794 -21.278 1.00 25.56  ? 303 ALA A N    1 
ATOM   4233  C CA   . ALA A 1 303 ? 11.576  -13.071 -21.506 1.00 31.65  ? 303 ALA A CA   1 
ATOM   4234  C C    . ALA A 1 303 ? 12.215  -13.741 -20.291 1.00 30.51  ? 303 ALA A C    1 
ATOM   4235  O O    . ALA A 1 303 ? 12.963  -14.715 -20.425 1.00 27.81  ? 303 ALA A O    1 
ATOM   4236  C CB   . ALA A 1 303 ? 12.276  -11.765 -21.855 1.00 31.27  ? 303 ALA A CB   1 
ATOM   4237  H H    . ALA A 1 303 ? 9.935   -11.971 -21.386 1.00 30.63  ? 303 ALA A H    1 
ATOM   4238  H HA   . ALA A 1 303 ? 11.664  -13.672 -22.262 1.00 37.94  ? 303 ALA A HA   1 
ATOM   4239  H HB1  . ALA A 1 303 ? 13.217  -11.943 -22.008 1.00 37.49  ? 303 ALA A HB1  1 
ATOM   4240  H HB2  . ALA A 1 303 ? 11.874  -11.397 -22.658 1.00 37.49  ? 303 ALA A HB2  1 
ATOM   4241  H HB3  . ALA A 1 303 ? 12.172  -11.144 -21.118 1.00 37.49  ? 303 ALA A HB3  1 
ATOM   4242  N N    . ARG A 1 304 ? 11.921  -13.246 -19.095 1.00 37.57  ? 304 ARG A N    1 
ATOM   4243  C CA   . ARG A 1 304 ? 12.460  -13.866 -17.888 1.00 43.66  ? 304 ARG A CA   1 
ATOM   4244  C C    . ARG A 1 304 ? 11.950  -15.298 -17.723 1.00 37.08  ? 304 ARG A C    1 
ATOM   4245  O O    . ARG A 1 304 ? 12.720  -16.194 -17.365 1.00 33.03  ? 304 ARG A O    1 
ATOM   4246  C CB   . ARG A 1 304 ? 12.116  -13.019 -16.663 1.00 40.14  ? 304 ARG A CB   1 
ATOM   4247  C CG   . ARG A 1 304 ? 12.544  -13.675 -15.338 1.00 45.58  ? 304 ARG A CG   1 
ATOM   4248  C CD   . ARG A 1 304 ? 12.386  -12.744 -14.163 1.00 41.92  ? 304 ARG A CD   1 
ATOM   4249  N NE   . ARG A 1 304 ? 10.999  -12.337 -13.971 1.00 54.78  ? 304 ARG A NE   1 
ATOM   4250  C CZ   . ARG A 1 304 ? 10.603  -11.392 -13.124 1.00 54.00  ? 304 ARG A CZ   1 
ATOM   4251  N NH1  . ARG A 1 304 ? 11.487  -10.747 -12.367 1.00 58.96  ? 304 ARG A NH1  1 
ATOM   4252  N NH2  . ARG A 1 304 ? 9.317   -11.082 -13.046 1.00 53.45  ? 304 ARG A NH2  1 
ATOM   4253  H H    . ARG A 1 304 ? 11.419  -12.562 -18.955 1.00 45.04  ? 304 ARG A H    1 
ATOM   4254  H HA   . ARG A 1 304 ? 13.426  -13.903 -17.961 1.00 52.35  ? 304 ARG A HA   1 
ATOM   4255  H HB2  . ARG A 1 304 ? 12.570  -12.165 -16.733 1.00 48.13  ? 304 ARG A HB2  1 
ATOM   4256  H HB3  . ARG A 1 304 ? 11.156  -12.884 -16.633 1.00 48.13  ? 304 ARG A HB3  1 
ATOM   4257  H HG2  . ARG A 1 304 ? 11.994  -14.458 -15.178 1.00 54.65  ? 304 ARG A HG2  1 
ATOM   4258  H HG3  . ARG A 1 304 ? 13.478  -13.931 -15.396 1.00 54.65  ? 304 ARG A HG3  1 
ATOM   4259  H HD2  . ARG A 1 304 ? 12.682  -13.195 -13.357 1.00 50.26  ? 304 ARG A HD2  1 
ATOM   4260  H HD3  . ARG A 1 304 ? 12.917  -11.947 -14.315 1.00 50.26  ? 304 ARG A HD3  1 
ATOM   4261  H HE   . ARG A 1 304 ? 10.396  -12.735 -14.437 1.00 65.70  ? 304 ARG A HE   1 
ATOM   4262  H HH11 . ARG A 1 304 ? 12.323  -10.941 -12.422 1.00 70.71  ? 304 ARG A HH11 1 
ATOM   4263  H HH12 . ARG A 1 304 ? 11.223  -10.137 -11.821 1.00 70.71  ? 304 ARG A HH12 1 
ATOM   4264  H HH21 . ARG A 1 304 ? 8.744   -11.500 -13.533 1.00 64.10  ? 304 ARG A HH21 1 
ATOM   4265  H HH22 . ARG A 1 304 ? 9.054   -10.477 -12.495 1.00 64.10  ? 304 ARG A HH22 1 
ATOM   4266  N N    . GLU A 1 305 ? 10.669  -15.553 -18.031 1.00 37.34  ? 305 GLU A N    1 
ATOM   4267  C CA   . GLU A 1 305 ? 10.185  -16.930 -17.966 1.00 31.40  ? 305 GLU A CA   1 
ATOM   4268  C C    . GLU A 1 305 ? 10.894  -17.805 -18.985 1.00 40.15  ? 305 GLU A C    1 
ATOM   4269  O O    . GLU A 1 305 ? 11.215  -18.972 -18.704 1.00 32.02  ? 305 GLU A O    1 
ATOM   4270  C CB   . GLU A 1 305 ? 8.666   -17.000 -18.182 1.00 31.55  ? 305 GLU A CB   1 
ATOM   4271  C CG   . GLU A 1 305 ? 7.847   -16.505 -17.003 1.00 37.50  ? 305 GLU A CG   1 
ATOM   4272  C CD   . GLU A 1 305 ? 8.184   -17.256 -15.728 1.00 51.86  ? 305 GLU A CD   1 
ATOM   4273  O OE1  . GLU A 1 305 ? 8.298   -18.504 -15.778 1.00 48.35  ? 305 GLU A OE1  1 
ATOM   4274  O OE2  . GLU A 1 305 ? 8.377   -16.592 -14.689 1.00 60.75  ? 305 GLU A OE2  1 
ATOM   4275  H H    . GLU A 1 305 ? 10.085  -14.968 -18.270 1.00 44.77  ? 305 GLU A H    1 
ATOM   4276  H HA   . GLU A 1 305 ? 10.377  -17.287 -17.085 1.00 37.64  ? 305 GLU A HA   1 
ATOM   4277  H HB2  . GLU A 1 305 ? 8.436   -16.456 -18.951 1.00 37.81  ? 305 GLU A HB2  1 
ATOM   4278  H HB3  . GLU A 1 305 ? 8.418   -17.923 -18.348 1.00 37.81  ? 305 GLU A HB3  1 
ATOM   4279  H HG2  . GLU A 1 305 ? 8.033   -15.564 -16.858 1.00 44.95  ? 305 GLU A HG2  1 
ATOM   4280  H HG3  . GLU A 1 305 ? 6.905   -16.635 -17.191 1.00 44.95  ? 305 GLU A HG3  1 
ATOM   4281  N N    . LEU A 1 306 ? 11.109  -17.274 -20.193 1.00 32.07  ? 306 LEU A N    1 
ATOM   4282  C CA   . LEU A 1 306 ? 11.815  -18.032 -21.218 1.00 29.90  ? 306 LEU A CA   1 
ATOM   4283  C C    . LEU A 1 306 ? 13.201  -18.428 -20.741 1.00 27.01  ? 306 LEU A C    1 
ATOM   4284  O O    . LEU A 1 306 ? 13.707  -19.498 -21.095 1.00 29.11  ? 306 LEU A O    1 
ATOM   4285  C CB   . LEU A 1 306 ? 11.924  -17.208 -22.506 1.00 27.44  ? 306 LEU A CB   1 
ATOM   4286  C CG   . LEU A 1 306 ? 10.576  -16.928 -23.167 1.00 30.55  ? 306 LEU A CG   1 
ATOM   4287  C CD1  . LEU A 1 306 ? 10.746  -15.917 -24.268 1.00 26.57  ? 306 LEU A CD1  1 
ATOM   4288  C CD2  . LEU A 1 306 ? 10.019  -18.248 -23.724 1.00 33.64  ? 306 LEU A CD2  1 
ATOM   4289  H H    . LEU A 1 306 ? 10.858  -16.489 -20.438 1.00 38.45  ? 306 LEU A H    1 
ATOM   4290  H HA   . LEU A 1 306 ? 11.319  -18.842 -21.416 1.00 35.84  ? 306 LEU A HA   1 
ATOM   4291  H HB2  . LEU A 1 306 ? 12.336  -16.355 -22.298 1.00 32.88  ? 306 LEU A HB2  1 
ATOM   4292  H HB3  . LEU A 1 306 ? 12.472  -17.693 -23.143 1.00 32.88  ? 306 LEU A HB3  1 
ATOM   4293  H HG   . LEU A 1 306 ? 9.954   -16.576 -22.511 1.00 36.62  ? 306 LEU A HG   1 
ATOM   4294  H HD11 . LEU A 1 306 ? 9.883   -15.749 -24.678 1.00 31.84  ? 306 LEU A HD11 1 
ATOM   4295  H HD12 . LEU A 1 306 ? 11.099  -15.096 -23.891 1.00 31.84  ? 306 LEU A HD12 1 
ATOM   4296  H HD13 . LEU A 1 306 ? 11.363  -16.271 -24.928 1.00 31.84  ? 306 LEU A HD13 1 
ATOM   4297  H HD21 . LEU A 1 306 ? 9.162   -18.076 -24.145 1.00 40.33  ? 306 LEU A HD21 1 
ATOM   4298  H HD22 . LEU A 1 306 ? 10.643  -18.603 -24.375 1.00 40.33  ? 306 LEU A HD22 1 
ATOM   4299  H HD23 . LEU A 1 306 ? 9.909   -18.876 -22.993 1.00 40.33  ? 306 LEU A HD23 1 
ATOM   4300  N N    . TYR A 1 307 ? 13.859  -17.528 -20.016 1.00 34.76  ? 307 TYR A N    1 
ATOM   4301  C CA   . TYR A 1 307 ? 15.219  -17.780 -19.559 1.00 36.56  ? 307 TYR A CA   1 
ATOM   4302  C C    . TYR A 1 307 ? 15.257  -18.958 -18.588 1.00 33.87  ? 307 TYR A C    1 
ATOM   4303  O O    . TYR A 1 307 ? 16.157  -19.799 -18.661 1.00 31.89  ? 307 TYR A O    1 
ATOM   4304  C CB   . TYR A 1 307 ? 15.760  -16.505 -18.924 1.00 31.02  ? 307 TYR A CB   1 
ATOM   4305  C CG   . TYR A 1 307 ? 17.090  -16.638 -18.217 1.00 42.93  ? 307 TYR A CG   1 
ATOM   4306  C CD1  . TYR A 1 307 ? 18.232  -16.996 -18.914 1.00 40.37  ? 307 TYR A CD1  1 
ATOM   4307  C CD2  . TYR A 1 307 ? 17.208  -16.362 -16.853 1.00 42.31  ? 307 TYR A CD2  1 
ATOM   4308  C CE1  . TYR A 1 307 ? 19.473  -17.088 -18.269 1.00 47.37  ? 307 TYR A CE1  1 
ATOM   4309  C CE2  . TYR A 1 307 ? 18.440  -16.459 -16.204 1.00 53.88  ? 307 TYR A CE2  1 
ATOM   4310  C CZ   . TYR A 1 307 ? 19.569  -16.816 -16.928 1.00 40.20  ? 307 TYR A CZ   1 
ATOM   4311  O OH   . TYR A 1 307 ? 20.792  -16.907 -16.311 1.00 59.18  ? 307 TYR A OH   1 
ATOM   4312  H H    . TYR A 1 307 ? 13.540  -16.767 -19.776 1.00 41.67  ? 307 TYR A H    1 
ATOM   4313  H HA   . TYR A 1 307 ? 15.777  -17.999 -20.322 1.00 43.83  ? 307 TYR A HA   1 
ATOM   4314  H HB2  . TYR A 1 307 ? 15.867  -15.838 -19.620 1.00 37.18  ? 307 TYR A HB2  1 
ATOM   4315  H HB3  . TYR A 1 307 ? 15.115  -16.191 -18.271 1.00 37.18  ? 307 TYR A HB3  1 
ATOM   4316  H HD1  . TYR A 1 307 ? 18.176  -17.172 -19.825 1.00 48.40  ? 307 TYR A HD1  1 
ATOM   4317  H HD2  . TYR A 1 307 ? 16.454  -16.114 -16.369 1.00 50.73  ? 307 TYR A HD2  1 
ATOM   4318  H HE1  . TYR A 1 307 ? 20.231  -17.330 -18.751 1.00 56.80  ? 307 TYR A HE1  1 
ATOM   4319  H HE2  . TYR A 1 307 ? 18.506  -16.272 -15.296 1.00 64.61  ? 307 TYR A HE2  1 
ATOM   4320  H HH   . TYR A 1 307 ? 20.718  -16.718 -15.496 1.00 70.97  ? 307 TYR A HH   1 
ATOM   4321  N N    . SER A 1 308 ? 14.270  -19.048 -17.690 1.00 36.58  ? 308 SER A N    1 
ATOM   4322  C CA   . SER A 1 308 ? 14.201  -20.189 -16.778 1.00 31.31  ? 308 SER A CA   1 
ATOM   4323  C C    . SER A 1 308 ? 13.992  -21.485 -17.538 1.00 32.75  ? 308 SER A C    1 
ATOM   4324  O O    . SER A 1 308 ? 14.663  -22.493 -17.287 1.00 39.18  ? 308 SER A O    1 
ATOM   4325  C CB   . SER A 1 308 ? 13.082  -19.975 -15.769 1.00 41.49  ? 308 SER A CB   1 
ATOM   4326  O OG   . SER A 1 308 ? 13.545  -19.163 -14.708 1.00 52.43  ? 308 SER A OG   1 
ATOM   4327  H H    . SER A 1 308 ? 13.640  -18.471 -17.590 1.00 43.86  ? 308 SER A H    1 
ATOM   4328  H HA   . SER A 1 308 ? 15.038  -20.258 -16.291 1.00 37.53  ? 308 SER A HA   1 
ATOM   4329  H HB2  . SER A 1 308 ? 12.338  -19.534 -16.207 1.00 49.74  ? 308 SER A HB2  1 
ATOM   4330  H HB3  . SER A 1 308 ? 12.803  -20.834 -15.415 1.00 49.74  ? 308 SER A HB3  1 
ATOM   4331  H HG   . SER A 1 308 ? 12.930  -19.043 -14.149 1.00 62.88  ? 308 SER A HG   1 
ATOM   4332  N N    . ILE A 1 309 ? 13.042  -21.484 -18.465 1.00 32.79  ? 309 ILE A N    1 
ATOM   4333  C CA   . ILE A 1 309 ? 12.757  -22.683 -19.241 1.00 30.50  ? 309 ILE A CA   1 
ATOM   4334  C C    . ILE A 1 309 ? 13.985  -23.110 -20.011 1.00 35.42  ? 309 ILE A C    1 
ATOM   4335  O O    . ILE A 1 309 ? 14.331  -24.298 -20.060 1.00 32.43  ? 309 ILE A O    1 
ATOM   4336  C CB   . ILE A 1 309 ? 11.553  -22.439 -20.185 1.00 34.80  ? 309 ILE A CB   1 
ATOM   4337  C CG1  . ILE A 1 309 ? 10.282  -22.194 -19.371 1.00 38.17  ? 309 ILE A CG1  1 
ATOM   4338  C CG2  . ILE A 1 309 ? 11.327  -23.621 -21.108 1.00 32.21  ? 309 ILE A CG2  1 
ATOM   4339  C CD1  . ILE A 1 309 ? 9.205   -21.444 -20.139 1.00 47.82  ? 309 ILE A CD1  1 
ATOM   4340  H H    . ILE A 1 309 ? 12.551  -20.807 -18.663 1.00 39.30  ? 309 ILE A H    1 
ATOM   4341  H HA   . ILE A 1 309 ? 12.520  -23.402 -18.635 1.00 36.56  ? 309 ILE A HA   1 
ATOM   4342  H HB   . ILE A 1 309 ? 11.735  -21.653 -20.724 1.00 41.72  ? 309 ILE A HB   1 
ATOM   4343  H HG12 . ILE A 1 309 ? 9.914   -23.049 -19.100 1.00 45.76  ? 309 ILE A HG12 1 
ATOM   4344  H HG13 . ILE A 1 309 ? 10.509  -21.669 -18.587 1.00 45.76  ? 309 ILE A HG13 1 
ATOM   4345  H HG21 . ILE A 1 309 ? 10.569  -23.433 -21.682 1.00 38.61  ? 309 ILE A HG21 1 
ATOM   4346  H HG22 . ILE A 1 309 ? 12.123  -23.759 -21.645 1.00 38.61  ? 309 ILE A HG22 1 
ATOM   4347  H HG23 . ILE A 1 309 ? 11.149  -24.410 -20.572 1.00 38.61  ? 309 ILE A HG23 1 
ATOM   4348  H HD11 . ILE A 1 309 ? 8.433   -21.325 -19.564 1.00 57.35  ? 309 ILE A HD11 1 
ATOM   4349  H HD12 . ILE A 1 309 ? 9.553   -20.580 -20.409 1.00 57.35  ? 309 ILE A HD12 1 
ATOM   4350  H HD13 . ILE A 1 309 ? 8.958   -21.961 -20.922 1.00 57.35  ? 309 ILE A HD13 1 
ATOM   4351  N N    . LEU A 1 310 ? 14.641  -22.153 -20.666 1.00 40.41  ? 310 LEU A N    1 
ATOM   4352  C CA   . LEU A 1 310 ? 15.755  -22.514 -21.525 1.00 31.59  ? 310 LEU A CA   1 
ATOM   4353  C C    . LEU A 1 310 ? 16.941  -23.014 -20.706 1.00 34.01  ? 310 LEU A C    1 
ATOM   4354  O O    . LEU A 1 310 ? 17.708  -23.865 -21.173 1.00 36.67  ? 310 LEU A O    1 
ATOM   4355  C CB   . LEU A 1 310 ? 16.151  -21.320 -22.399 1.00 37.68  ? 310 LEU A CB   1 
ATOM   4356  C CG   . LEU A 1 310 ? 15.083  -20.869 -23.428 1.00 35.65  ? 310 LEU A CG   1 
ATOM   4357  C CD1  . LEU A 1 310 ? 15.416  -19.515 -24.042 1.00 34.58  ? 310 LEU A CD1  1 
ATOM   4358  C CD2  . LEU A 1 310 ? 14.892  -21.871 -24.534 1.00 32.11  ? 310 LEU A CD2  1 
ATOM   4359  H H    . LEU A 1 310 ? 14.464  -21.313 -20.630 1.00 48.45  ? 310 LEU A H    1 
ATOM   4360  H HA   . LEU A 1 310 ? 15.476  -23.233 -22.114 1.00 37.87  ? 310 LEU A HA   1 
ATOM   4361  H HB2  . LEU A 1 310 ? 16.337  -20.564 -21.821 1.00 45.17  ? 310 LEU A HB2  1 
ATOM   4362  H HB3  . LEU A 1 310 ? 16.952  -21.554 -22.894 1.00 45.17  ? 310 LEU A HB3  1 
ATOM   4363  H HG   . LEU A 1 310 ? 14.233  -20.778 -22.968 1.00 42.74  ? 310 LEU A HG   1 
ATOM   4364  H HD11 . LEU A 1 310 ? 14.721  -19.277 -24.676 1.00 41.46  ? 310 LEU A HD11 1 
ATOM   4365  H HD12 . LEU A 1 310 ? 15.461  -18.852 -23.336 1.00 41.46  ? 310 LEU A HD12 1 
ATOM   4366  H HD13 . LEU A 1 310 ? 16.271  -19.577 -24.495 1.00 41.46  ? 310 LEU A HD13 1 
ATOM   4367  H HD21 . LEU A 1 310 ? 14.216  -21.541 -25.146 1.00 38.48  ? 310 LEU A HD21 1 
ATOM   4368  H HD22 . LEU A 1 310 ? 15.734  -21.988 -25.002 1.00 38.48  ? 310 LEU A HD22 1 
ATOM   4369  H HD23 . LEU A 1 310 ? 14.606  -22.715 -24.149 1.00 38.48  ? 310 LEU A HD23 1 
ATOM   4370  N N    . GLN A 1 311 ? 17.115  -22.496 -19.497 1.00 28.62  ? 311 GLN A N    1 
ATOM   4371  C CA   . GLN A 1 311 ? 18.151  -23.031 -18.615 1.00 34.46  ? 311 GLN A CA   1 
ATOM   4372  C C    . GLN A 1 311 ? 17.901  -24.499 -18.328 1.00 33.48  ? 311 GLN A C    1 
ATOM   4373  O O    . GLN A 1 311 ? 18.811  -25.326 -18.421 1.00 37.58  ? 311 GLN A O    1 
ATOM   4374  C CB   . GLN A 1 311 ? 18.194  -22.264 -17.307 1.00 37.54  ? 311 GLN A CB   1 
ATOM   4375  C CG   . GLN A 1 311 ? 19.055  -21.048 -17.327 1.00 41.00  ? 311 GLN A CG   1 
ATOM   4376  C CD   . GLN A 1 311 ? 19.069  -20.321 -15.995 1.00 54.05  ? 311 GLN A CD   1 
ATOM   4377  O OE1  . GLN A 1 311 ? 19.818  -19.366 -15.825 1.00 64.01  ? 311 GLN A OE1  1 
ATOM   4378  N NE2  . GLN A 1 311 ? 18.252  -20.762 -15.044 1.00 47.76  ? 311 GLN A NE2  1 
ATOM   4379  H H    . GLN A 1 311 ? 16.657  -21.848 -19.166 1.00 34.30  ? 311 GLN A H    1 
ATOM   4380  H HA   . GLN A 1 311 ? 19.015  -22.947 -19.047 1.00 41.31  ? 311 GLN A HA   1 
ATOM   4381  H HB2  . GLN A 1 311 ? 17.293  -21.982 -17.083 1.00 45.01  ? 311 GLN A HB2  1 
ATOM   4382  H HB3  . GLN A 1 311 ? 18.533  -22.852 -16.614 1.00 45.01  ? 311 GLN A HB3  1 
ATOM   4383  H HG2  . GLN A 1 311 ? 19.966  -21.309 -17.537 1.00 49.16  ? 311 GLN A HG2  1 
ATOM   4384  H HG3  . GLN A 1 311 ? 18.721  -20.435 -18.001 1.00 49.16  ? 311 GLN A HG3  1 
ATOM   4385  H HE21 . GLN A 1 311 ? 18.235  -20.373 -14.277 1.00 57.27  ? 311 GLN A HE21 1 
ATOM   4386  H HE22 . GLN A 1 311 ? 17.739  -21.436 -15.195 1.00 57.27  ? 311 GLN A HE22 1 
ATOM   4387  N N    . HIS A 1 312 ? 16.656  -24.845 -17.999 1.00 32.01  ? 312 HIS A N    1 
ATOM   4388  C CA   . HIS A 1 312 ? 16.333  -26.222 -17.681 1.00 27.42  ? 312 HIS A CA   1 
ATOM   4389  C C    . HIS A 1 312 ? 16.623  -27.143 -18.832 1.00 33.48  ? 312 HIS A C    1 
ATOM   4390  O O    . HIS A 1 312 ? 16.871  -28.323 -18.600 1.00 42.14  ? 312 HIS A O    1 
ATOM   4391  C CB   . HIS A 1 312 ? 14.873  -26.323 -17.246 1.00 35.41  ? 312 HIS A CB   1 
ATOM   4392  C CG   . HIS A 1 312 ? 14.601  -25.679 -15.928 1.00 35.47  ? 312 HIS A CG   1 
ATOM   4393  N ND1  . HIS A 1 312 ? 13.346  -25.244 -15.552 1.00 49.32  ? 312 HIS A ND1  1 
ATOM   4394  C CD2  . HIS A 1 312 ? 15.416  -25.418 -14.880 1.00 47.68  ? 312 HIS A CD2  1 
ATOM   4395  C CE1  . HIS A 1 312 ? 13.407  -24.724 -14.340 1.00 50.79  ? 312 HIS A CE1  1 
ATOM   4396  N NE2  . HIS A 1 312 ? 14.647  -24.827 -13.902 1.00 39.71  ? 312 HIS A NE2  1 
ATOM   4397  H H    . HIS A 1 312 ? 15.990  -24.302 -17.956 1.00 38.36  ? 312 HIS A H    1 
ATOM   4398  H HA   . HIS A 1 312 ? 16.883  -26.504 -16.933 1.00 32.86  ? 312 HIS A HA   1 
ATOM   4399  H HB2  . HIS A 1 312 ? 14.317  -25.888 -17.910 1.00 42.45  ? 312 HIS A HB2  1 
ATOM   4400  H HB3  . HIS A 1 312 ? 14.631  -27.260 -17.175 1.00 42.45  ? 312 HIS A HB3  1 
ATOM   4401  H HD2  . HIS A 1 312 ? 16.326  -25.603 -14.829 1.00 57.18  ? 312 HIS A HD2  1 
ATOM   4402  H HE1  . HIS A 1 312 ? 12.692  -24.362 -13.867 1.00 60.91  ? 312 HIS A HE1  1 
ATOM   4403  H HE2  . HIS A 1 312 ? 14.932  -24.556 -13.137 1.00 47.61  ? 312 HIS A HE2  1 
ATOM   4404  N N    . LYS A 1 313 ? 16.657  -26.630 -20.058 1.00 38.43  ? 313 LYS A N    1 
ATOM   4405  C CA   . LYS A 1 313 ? 16.896  -27.451 -21.234 1.00 36.55  ? 313 LYS A CA   1 
ATOM   4406  C C    . LYS A 1 313 ? 18.289  -27.264 -21.807 1.00 40.44  ? 313 LYS A C    1 
ATOM   4407  O O    . LYS A 1 313 ? 18.633  -27.927 -22.798 1.00 40.50  ? 313 LYS A O    1 
ATOM   4408  C CB   . LYS A 1 313 ? 15.846  -27.150 -22.315 1.00 38.21  ? 313 LYS A CB   1 
ATOM   4409  C CG   . LYS A 1 313 ? 14.391  -27.434 -21.856 1.00 37.46  ? 313 LYS A CG   1 
ATOM   4410  C CD   . LYS A 1 313 ? 13.416  -27.446 -23.011 1.00 46.15  ? 313 LYS A CD   1 
ATOM   4411  C CE   . LYS A 1 313 ? 11.954  -27.644 -22.536 1.00 68.19  ? 313 LYS A CE   1 
ATOM   4412  N NZ   . LYS A 1 313 ? 11.330  -28.915 -23.038 1.00 74.36  ? 313 LYS A NZ   1 
ATOM   4413  H H    . LYS A 1 313 ? 16.542  -25.796 -20.235 1.00 46.07  ? 313 LYS A H    1 
ATOM   4414  H HA   . LYS A 1 313 ? 16.803  -28.384 -20.985 1.00 43.82  ? 313 LYS A HA   1 
ATOM   4415  H HB2  . LYS A 1 313 ? 15.905  -26.212 -22.557 1.00 45.81  ? 313 LYS A HB2  1 
ATOM   4416  H HB3  . LYS A 1 313 ? 16.028  -27.703 -23.091 1.00 45.81  ? 313 LYS A HB3  1 
ATOM   4417  H HG2  . LYS A 1 313 ? 14.358  -28.303 -21.425 1.00 44.91  ? 313 LYS A HG2  1 
ATOM   4418  H HG3  . LYS A 1 313 ? 14.113  -26.744 -21.234 1.00 44.91  ? 313 LYS A HG3  1 
ATOM   4419  H HD2  . LYS A 1 313 ? 13.469  -26.599 -23.480 1.00 55.34  ? 313 LYS A HD2  1 
ATOM   4420  H HD3  . LYS A 1 313 ? 13.641  -28.175 -23.610 1.00 55.34  ? 313 LYS A HD3  1 
ATOM   4421  H HE2  . LYS A 1 313 ? 11.939  -27.668 -21.567 1.00 81.79  ? 313 LYS A HE2  1 
ATOM   4422  H HE3  . LYS A 1 313 ? 11.417  -26.902 -22.856 1.00 81.79  ? 313 LYS A HE3  1 
ATOM   4423  H HZ1  . LYS A 1 313 ? 10.494  -28.982 -22.740 1.00 89.19  ? 313 LYS A HZ1  1 
ATOM   4424  H HZ2  . LYS A 1 313 ? 11.321  -28.917 -23.928 1.00 89.19  ? 313 LYS A HZ2  1 
ATOM   4425  H HZ3  . LYS A 1 313 ? 11.797  -29.616 -22.752 1.00 89.19  ? 313 LYS A HZ3  1 
ATOM   4426  N N    . GLY A 1 314 ? 19.085  -26.366 -21.229 1.00 35.61  ? 314 GLY A N    1 
ATOM   4427  C CA   . GLY A 1 314 ? 20.443  -26.159 -21.701 1.00 40.12  ? 314 GLY A CA   1 
ATOM   4428  C C    . GLY A 1 314 ? 20.521  -25.454 -23.032 1.00 35.49  ? 314 GLY A C    1 
ATOM   4429  O O    . GLY A 1 314 ? 21.471  -25.671 -23.793 1.00 31.22  ? 314 GLY A O    1 
ATOM   4430  H H    . GLY A 1 314 ? 18.861  -25.868 -20.565 1.00 42.69  ? 314 GLY A H    1 
ATOM   4431  H HA2  . GLY A 1 314 ? 20.930  -25.631 -21.049 1.00 48.10  ? 314 GLY A HA2  1 
ATOM   4432  H HA3  . GLY A 1 314 ? 20.885  -27.019 -21.787 1.00 48.10  ? 314 GLY A HA3  1 
ATOM   4433  N N    . LEU A 1 315 ? 19.556  -24.580 -23.316 1.00 41.35  ? 315 LEU A N    1 
ATOM   4434  C CA   . LEU A 1 315 ? 19.379  -24.011 -24.649 1.00 42.17  ? 315 LEU A CA   1 
ATOM   4435  C C    . LEU A 1 315 ? 19.463  -22.488 -24.642 1.00 33.59  ? 315 LEU A C    1 
ATOM   4436  O O    . LEU A 1 315 ? 19.087  -21.847 -25.632 1.00 40.24  ? 315 LEU A O    1 
ATOM   4437  C CB   . LEU A 1 315 ? 18.035  -24.481 -25.221 1.00 42.48  ? 315 LEU A CB   1 
ATOM   4438  C CG   . LEU A 1 315 ? 17.934  -25.964 -25.613 1.00 38.17  ? 315 LEU A CG   1 
ATOM   4439  C CD1  . LEU A 1 315 ? 16.567  -26.307 -26.150 1.00 41.93  ? 315 LEU A CD1  1 
ATOM   4440  C CD2  . LEU A 1 315 ? 18.999  -26.330 -26.651 1.00 38.08  ? 315 LEU A CD2  1 
ATOM   4441  H H    . LEU A 1 315 ? 18.982  -24.297 -22.743 1.00 49.58  ? 315 LEU A H    1 
ATOM   4442  H HA   . LEU A 1 315 ? 20.082  -24.345 -25.228 1.00 50.56  ? 315 LEU A HA   1 
ATOM   4443  H HB2  . LEU A 1 315 ? 17.348  -24.312 -24.558 1.00 50.94  ? 315 LEU A HB2  1 
ATOM   4444  H HB3  . LEU A 1 315 ? 17.846  -23.961 -26.018 1.00 50.94  ? 315 LEU A HB3  1 
ATOM   4445  H HG   . LEU A 1 315 ? 18.089  -26.507 -24.825 1.00 45.77  ? 315 LEU A HG   1 
ATOM   4446  H HD11 . LEU A 1 315 ? 16.548  -27.248 -26.384 1.00 50.27  ? 315 LEU A HD11 1 
ATOM   4447  H HD12 . LEU A 1 315 ? 15.905  -26.121 -25.467 1.00 50.27  ? 315 LEU A HD12 1 
ATOM   4448  H HD13 . LEU A 1 315 ? 16.393  -25.766 -26.936 1.00 50.27  ? 315 LEU A HD13 1 
ATOM   4449  H HD21 . LEU A 1 315 ? 18.909  -27.269 -26.877 1.00 45.65  ? 315 LEU A HD21 1 
ATOM   4450  H HD22 . LEU A 1 315 ? 18.868  -25.785 -27.442 1.00 45.65  ? 315 LEU A HD22 1 
ATOM   4451  H HD23 . LEU A 1 315 ? 19.877  -26.162 -26.274 1.00 45.65  ? 315 LEU A HD23 1 
ATOM   4452  N N    . VAL A 1 316 ? 19.914  -21.893 -23.542 1.00 33.39  ? 316 VAL A N    1 
ATOM   4453  C CA   . VAL A 1 316 ? 19.957  -20.444 -23.454 1.00 37.95  ? 316 VAL A CA   1 
ATOM   4454  C C    . VAL A 1 316 ? 20.722  -19.865 -24.640 1.00 38.54  ? 316 VAL A C    1 
ATOM   4455  O O    . VAL A 1 316 ? 20.380  -18.781 -25.121 1.00 34.09  ? 316 VAL A O    1 
ATOM   4456  C CB   . VAL A 1 316 ? 20.554  -20.013 -22.102 1.00 34.66  ? 316 VAL A CB   1 
ATOM   4457  C CG1  . VAL A 1 316 ? 20.884  -18.532 -22.075 1.00 40.62  ? 316 VAL A CG1  1 
ATOM   4458  C CG2  . VAL A 1 316 ? 19.575  -20.349 -20.928 1.00 34.71  ? 316 VAL A CG2  1 
ATOM   4459  H H    . VAL A 1 316 ? 20.198  -22.303 -22.841 1.00 40.03  ? 316 VAL A H    1 
ATOM   4460  H HA   . VAL A 1 316 ? 19.050  -20.104 -23.496 1.00 45.50  ? 316 VAL A HA   1 
ATOM   4461  H HB   . VAL A 1 316 ? 21.378  -20.503 -21.952 1.00 41.56  ? 316 VAL A HB   1 
ATOM   4462  H HG11 . VAL A 1 316 ? 21.256  -18.308 -21.207 1.00 48.71  ? 316 VAL A HG11 1 
ATOM   4463  H HG12 . VAL A 1 316 ? 21.530  -18.340 -22.772 1.00 48.71  ? 316 VAL A HG12 1 
ATOM   4464  H HG13 . VAL A 1 316 ? 20.071  -18.025 -22.228 1.00 48.71  ? 316 VAL A HG13 1 
ATOM   4465  H HG21 . VAL A 1 316 ? 19.976  -20.066 -20.091 1.00 41.61  ? 316 VAL A HG21 1 
ATOM   4466  H HG22 . VAL A 1 316 ? 18.739  -19.877 -21.070 1.00 41.61  ? 316 VAL A HG22 1 
ATOM   4467  H HG23 . VAL A 1 316 ? 19.417  -21.305 -20.913 1.00 41.61  ? 316 VAL A HG23 1 
ATOM   4468  N N    . ASP A 1 317 ? 21.726  -20.598 -25.159 1.00 31.71  ? 317 ASP A N    1 
ATOM   4469  C CA   . ASP A 1 317 ? 22.570  -20.129 -26.252 1.00 34.86  ? 317 ASP A CA   1 
ATOM   4470  C C    . ASP A 1 317 ? 21.860  -20.145 -27.590 1.00 35.09  ? 317 ASP A C    1 
ATOM   4471  O O    . ASP A 1 317 ? 22.354  -19.541 -28.550 1.00 35.45  ? 317 ASP A O    1 
ATOM   4472  C CB   . ASP A 1 317 ? 23.838  -20.996 -26.405 1.00 46.88  ? 317 ASP A CB   1 
ATOM   4473  C CG   . ASP A 1 317 ? 24.878  -20.731 -25.326 1.00 69.79  ? 317 ASP A CG   1 
ATOM   4474  O OD1  . ASP A 1 317 ? 24.822  -19.662 -24.680 1.00 63.36  ? 317 ASP A OD1  1 
ATOM   4475  O OD2  . ASP A 1 317 ? 25.762  -21.597 -25.131 1.00 92.36  ? 317 ASP A OD2  1 
ATOM   4476  H H    . ASP A 1 317 ? 21.933  -21.385 -24.881 1.00 38.01  ? 317 ASP A H    1 
ATOM   4477  H HA   . ASP A 1 317 ? 22.848  -19.217 -26.069 1.00 41.79  ? 317 ASP A HA   1 
ATOM   4478  H HB2  . ASP A 1 317 ? 23.588  -21.931 -26.354 1.00 56.22  ? 317 ASP A HB2  1 
ATOM   4479  H HB3  . ASP A 1 317 ? 24.246  -20.809 -27.265 1.00 56.22  ? 317 ASP A HB3  1 
ATOM   4480  N N    . LYS A 1 318 ? 20.749  -20.849 -27.691 1.00 39.35  ? 318 LYS A N    1 
ATOM   4481  C CA   . LYS A 1 318 ? 20.087  -21.023 -28.970 1.00 32.85  ? 318 LYS A CA   1 
ATOM   4482  C C    . LYS A 1 318 ? 19.053  -19.945 -29.248 1.00 31.12  ? 318 LYS A C    1 
ATOM   4483  O O    . LYS A 1 318 ? 18.477  -19.937 -30.334 1.00 31.55  ? 318 LYS A O    1 
ATOM   4484  C CB   . LYS A 1 318 ? 19.423  -22.406 -29.024 1.00 37.21  ? 318 LYS A CB   1 
ATOM   4485  C CG   . LYS A 1 318 ? 20.185  -23.419 -29.882 1.00 49.91  ? 318 LYS A CG   1 
ATOM   4486  C CD   . LYS A 1 318 ? 21.531  -23.654 -29.330 1.00 38.65  ? 318 LYS A CD   1 
ATOM   4487  C CE   . LYS A 1 318 ? 22.588  -23.883 -30.416 1.00 64.96  ? 318 LYS A CE   1 
ATOM   4488  N NZ   . LYS A 1 318 ? 23.966  -23.756 -29.835 1.00 58.35  ? 318 LYS A NZ   1 
ATOM   4489  H H    . LYS A 1 318 ? 20.355  -21.238 -27.033 1.00 47.18  ? 318 LYS A H    1 
ATOM   4490  H HA   . LYS A 1 318 ? 20.752  -20.984 -29.675 1.00 39.38  ? 318 LYS A HA   1 
ATOM   4491  H HB2  . LYS A 1 318 ? 19.367  -22.762 -28.123 1.00 44.61  ? 318 LYS A HB2  1 
ATOM   4492  H HB3  . LYS A 1 318 ? 18.533  -22.312 -29.397 1.00 44.61  ? 318 LYS A HB3  1 
ATOM   4493  H HG2  . LYS A 1 318 ? 19.705  -24.262 -29.889 1.00 59.85  ? 318 LYS A HG2  1 
ATOM   4494  H HG3  . LYS A 1 318 ? 20.279  -23.074 -30.783 1.00 59.85  ? 318 LYS A HG3  1 
ATOM   4495  H HD2  . LYS A 1 318 ? 21.799  -22.880 -28.810 1.00 46.34  ? 318 LYS A HD2  1 
ATOM   4496  H HD3  . LYS A 1 318 ? 21.508  -24.442 -28.764 1.00 46.34  ? 318 LYS A HD3  1 
ATOM   4497  H HE2  . LYS A 1 318 ? 22.489  -24.775 -30.782 1.00 77.91  ? 318 LYS A HE2  1 
ATOM   4498  H HE3  . LYS A 1 318 ? 22.486  -23.216 -31.114 1.00 77.91  ? 318 LYS A HE3  1 
ATOM   4499  H HZ1  . LYS A 1 318 ? 24.577  -23.889 -30.469 1.00 69.98  ? 318 LYS A HZ1  1 
ATOM   4500  H HZ2  . LYS A 1 318 ? 24.078  -22.942 -29.493 1.00 69.98  ? 318 LYS A HZ2  1 
ATOM   4501  H HZ3  . LYS A 1 318 ? 24.081  -24.359 -29.191 1.00 69.98  ? 318 LYS A HZ3  1 
ATOM   4502  N N    . PHE A 1 319 ? 18.793  -19.053 -28.293 1.00 27.16  ? 319 PHE A N    1 
ATOM   4503  C CA   . PHE A 1 319 ? 17.789  -18.009 -28.454 1.00 29.58  ? 319 PHE A CA   1 
ATOM   4504  C C    . PHE A 1 319 ? 18.414  -16.678 -28.073 1.00 25.33  ? 319 PHE A C    1 
ATOM   4505  O O    . PHE A 1 319 ? 18.063  -16.058 -27.072 1.00 23.94  ? 319 PHE A O    1 
ATOM   4506  C CB   . PHE A 1 319 ? 16.546  -18.336 -27.640 1.00 28.27  ? 319 PHE A CB   1 
ATOM   4507  C CG   . PHE A 1 319 ? 15.847  -19.559 -28.117 1.00 32.43  ? 319 PHE A CG   1 
ATOM   4508  C CD1  . PHE A 1 319 ? 16.233  -20.809 -27.664 1.00 29.61  ? 319 PHE A CD1  1 
ATOM   4509  C CD2  . PHE A 1 319 ? 14.815  -19.470 -29.048 1.00 30.05  ? 319 PHE A CD2  1 
ATOM   4510  C CE1  . PHE A 1 319 ? 15.598  -21.939 -28.113 1.00 33.34  ? 319 PHE A CE1  1 
ATOM   4511  C CE2  . PHE A 1 319 ? 14.175  -20.590 -29.485 1.00 27.67  ? 319 PHE A CE2  1 
ATOM   4512  C CZ   . PHE A 1 319 ? 14.567  -21.831 -29.027 1.00 28.17  ? 319 PHE A CZ   1 
ATOM   4513  H H    . PHE A 1 319 ? 19.193  -19.033 -27.532 1.00 32.55  ? 319 PHE A H    1 
ATOM   4514  H HA   . PHE A 1 319 ? 17.530  -17.961 -29.388 1.00 35.45  ? 319 PHE A HA   1 
ATOM   4515  H HB2  . PHE A 1 319 ? 16.804  -18.480 -26.716 1.00 33.88  ? 319 PHE A HB2  1 
ATOM   4516  H HB3  . PHE A 1 319 ? 15.925  -17.593 -27.699 1.00 33.88  ? 319 PHE A HB3  1 
ATOM   4517  H HD1  . PHE A 1 319 ? 16.927  -20.883 -27.048 1.00 35.49  ? 319 PHE A HD1  1 
ATOM   4518  H HD2  . PHE A 1 319 ? 14.546  -18.636 -29.359 1.00 36.02  ? 319 PHE A HD2  1 
ATOM   4519  H HE1  . PHE A 1 319 ? 15.858  -22.775 -27.800 1.00 39.97  ? 319 PHE A HE1  1 
ATOM   4520  H HE2  . PHE A 1 319 ? 13.485  -20.520 -30.104 1.00 33.16  ? 319 PHE A HE2  1 
ATOM   4521  H HZ   . PHE A 1 319 ? 14.133  -22.595 -29.330 1.00 33.76  ? 319 PHE A HZ   1 
ATOM   4522  N N    . PRO A 1 320 ? 19.369  -16.208 -28.873 1.00 27.13  ? 320 PRO A N    1 
ATOM   4523  C CA   . PRO A 1 320 ? 20.045  -14.959 -28.518 1.00 28.00  ? 320 PRO A CA   1 
ATOM   4524  C C    . PRO A 1 320 ? 19.135  -13.746 -28.552 1.00 27.15  ? 320 PRO A C    1 
ATOM   4525  O O    . PRO A 1 320 ? 19.315  -12.855 -27.714 1.00 29.72  ? 320 PRO A O    1 
ATOM   4526  C CB   . PRO A 1 320 ? 21.182  -14.863 -29.533 1.00 30.09  ? 320 PRO A CB   1 
ATOM   4527  C CG   . PRO A 1 320 ? 20.916  -15.841 -30.553 1.00 35.64  ? 320 PRO A CG   1 
ATOM   4528  C CD   . PRO A 1 320 ? 19.934  -16.848 -30.065 1.00 28.16  ? 320 PRO A CD   1 
ATOM   4529  H HA   . PRO A 1 320 ? 20.427  -15.036 -27.630 1.00 33.56  ? 320 PRO A HA   1 
ATOM   4530  H HB2  . PRO A 1 320 ? 21.197  -13.972 -29.916 1.00 36.07  ? 320 PRO A HB2  1 
ATOM   4531  H HB3  . PRO A 1 320 ? 22.024  -15.055 -29.092 1.00 36.07  ? 320 PRO A HB3  1 
ATOM   4532  H HG2  . PRO A 1 320 ? 20.559  -15.388 -31.332 1.00 42.73  ? 320 PRO A HG2  1 
ATOM   4533  H HG3  . PRO A 1 320 ? 21.748  -16.283 -30.784 1.00 42.73  ? 320 PRO A HG3  1 
ATOM   4534  H HD2  . PRO A 1 320 ? 19.243  -16.998 -30.730 1.00 33.75  ? 320 PRO A HD2  1 
ATOM   4535  H HD3  . PRO A 1 320 ? 20.385  -17.673 -29.826 1.00 33.75  ? 320 PRO A HD3  1 
ATOM   4536  N N    . LEU A 1 321 ? 18.136  -13.677 -29.442 1.00 26.76  ? 321 LEU A N    1 
ATOM   4537  C CA   . LEU A 1 321 ? 17.248  -12.515 -29.401 1.00 21.69  ? 321 LEU A CA   1 
ATOM   4538  C C    . LEU A 1 321 ? 16.467  -12.493 -28.096 1.00 24.31  ? 321 LEU A C    1 
ATOM   4539  O O    . LEU A 1 321 ? 16.534  -11.519 -27.343 1.00 24.11  ? 321 LEU A O    1 
ATOM   4540  C CB   . LEU A 1 321 ? 16.287  -12.494 -30.606 1.00 26.29  ? 321 LEU A CB   1 
ATOM   4541  C CG   . LEU A 1 321 ? 15.364  -11.264 -30.752 1.00 31.51  ? 321 LEU A CG   1 
ATOM   4542  C CD1  . LEU A 1 321 ? 15.845  -10.082 -30.014 1.00 37.59  ? 321 LEU A CD1  1 
ATOM   4543  C CD2  . LEU A 1 321 ? 15.265  -10.860 -32.223 1.00 35.24  ? 321 LEU A CD2  1 
ATOM   4544  H H    . LEU A 1 321 ? 17.959  -14.259 -30.049 1.00 32.06  ? 321 LEU A H    1 
ATOM   4545  H HA   . LEU A 1 321 ? 17.786  -11.709 -29.438 1.00 25.98  ? 321 LEU A HA   1 
ATOM   4546  H HB2  . LEU A 1 321 ? 16.818  -12.549 -31.415 1.00 31.51  ? 321 LEU A HB2  1 
ATOM   4547  H HB3  . LEU A 1 321 ? 15.714  -13.274 -30.547 1.00 31.51  ? 321 LEU A HB3  1 
ATOM   4548  H HG   . LEU A 1 321 ? 14.475  -11.485 -30.433 1.00 37.77  ? 321 LEU A HG   1 
ATOM   4549  H HD11 . LEU A 1 321 ? 15.222  -9.351  -30.149 1.00 45.06  ? 321 LEU A HD11 1 
ATOM   4550  H HD12 . LEU A 1 321 ? 15.900  -10.301 -29.071 1.00 45.06  ? 321 LEU A HD12 1 
ATOM   4551  H HD13 . LEU A 1 321 ? 16.721  -9.837  -30.349 1.00 45.06  ? 321 LEU A HD13 1 
ATOM   4552  H HD21 . LEU A 1 321 ? 14.683  -10.087 -32.299 1.00 42.24  ? 321 LEU A HD21 1 
ATOM   4553  H HD22 . LEU A 1 321 ? 16.151  -10.641 -32.550 1.00 42.24  ? 321 LEU A HD22 1 
ATOM   4554  H HD23 . LEU A 1 321 ? 14.899  -11.602 -32.730 1.00 42.24  ? 321 LEU A HD23 1 
ATOM   4555  N N    . PHE A 1 322 ? 15.696  -13.548 -27.830 1.00 20.25  ? 322 PHE A N    1 
ATOM   4556  C CA   . PHE A 1 322 ? 14.960  -13.643 -26.557 1.00 20.48  ? 322 PHE A CA   1 
ATOM   4557  C C    . PHE A 1 322 ? 15.844  -13.380 -25.345 1.00 25.84  ? 322 PHE A C    1 
ATOM   4558  O O    . PHE A 1 322 ? 15.413  -12.736 -24.385 1.00 25.41  ? 322 PHE A O    1 
ATOM   4559  C CB   . PHE A 1 322 ? 14.349  -15.027 -26.384 1.00 22.39  ? 322 PHE A CB   1 
ATOM   4560  C CG   . PHE A 1 322 ? 13.233  -15.359 -27.322 1.00 19.78  ? 322 PHE A CG   1 
ATOM   4561  C CD1  . PHE A 1 322 ? 12.608  -14.405 -28.090 1.00 29.11  ? 322 PHE A CD1  1 
ATOM   4562  C CD2  . PHE A 1 322 ? 12.795  -16.677 -27.402 1.00 26.04  ? 322 PHE A CD2  1 
ATOM   4563  C CE1  . PHE A 1 322 ? 11.561  -14.761 -28.933 1.00 25.85  ? 322 PHE A CE1  1 
ATOM   4564  C CE2  . PHE A 1 322 ? 11.749  -17.035 -28.222 1.00 24.18  ? 322 PHE A CE2  1 
ATOM   4565  C CZ   . PHE A 1 322 ? 11.135  -16.082 -28.988 1.00 24.03  ? 322 PHE A CZ   1 
ATOM   4566  H H    . PHE A 1 322 ? 15.580  -14.216 -28.359 1.00 24.26  ? 322 PHE A H    1 
ATOM   4567  H HA   . PHE A 1 322 ? 14.241  -12.991 -26.555 1.00 24.53  ? 322 PHE A HA   1 
ATOM   4568  H HB2  . PHE A 1 322 ? 15.046  -15.689 -26.516 1.00 26.82  ? 322 PHE A HB2  1 
ATOM   4569  H HB3  . PHE A 1 322 ? 14.001  -15.099 -25.482 1.00 26.82  ? 322 PHE A HB3  1 
ATOM   4570  H HD1  . PHE A 1 322 ? 12.888  -13.519 -28.047 1.00 34.89  ? 322 PHE A HD1  1 
ATOM   4571  H HD2  . PHE A 1 322 ? 13.204  -17.326 -26.876 1.00 31.20  ? 322 PHE A HD2  1 
ATOM   4572  H HE1  . PHE A 1 322 ? 11.141  -14.114 -29.452 1.00 30.98  ? 322 PHE A HE1  1 
ATOM   4573  H HE2  . PHE A 1 322 ? 11.471  -17.922 -28.267 1.00 28.98  ? 322 PHE A HE2  1 
ATOM   4574  H HZ   . PHE A 1 322 ? 10.438  -16.322 -29.555 1.00 28.79  ? 322 PHE A HZ   1 
ATOM   4575  N N    . MET A 1 323 ? 17.085  -13.877 -25.354 1.00 30.36  ? 323 MET A N    1 
ATOM   4576  C CA   . MET A 1 323 ? 17.919  -13.725 -24.161 1.00 28.19  ? 323 MET A CA   1 
ATOM   4577  C C    . MET A 1 323 ? 18.592  -12.371 -24.097 1.00 27.71  ? 323 MET A C    1 
ATOM   4578  O O    . MET A 1 323 ? 18.907  -11.894 -22.998 1.00 25.15  ? 323 MET A O    1 
ATOM   4579  C CB   . MET A 1 323 ? 18.964  -14.829 -24.105 1.00 32.44  ? 323 MET A CB   1 
ATOM   4580  C CG   . MET A 1 323 ? 18.345  -16.231 -23.880 1.00 37.76  ? 323 MET A CG   1 
ATOM   4581  S SD   . MET A 1 323 ? 17.398  -16.377 -22.323 1.00 32.90  ? 323 MET A SD   1 
ATOM   4582  C CE   . MET A 1 323 ? 15.696  -16.110 -22.889 1.00 35.50  ? 323 MET A CE   1 
ATOM   4583  H H    . MET A 1 323 ? 17.455  -14.291 -26.011 1.00 36.39  ? 323 MET A H    1 
ATOM   4584  H HA   . MET A 1 323 ? 17.353  -13.821 -23.379 1.00 33.78  ? 323 MET A HA   1 
ATOM   4585  H HB2  . MET A 1 323 ? 19.450  -14.847 -24.944 1.00 38.89  ? 323 MET A HB2  1 
ATOM   4586  H HB3  . MET A 1 323 ? 19.574  -14.650 -23.372 1.00 38.89  ? 323 MET A HB3  1 
ATOM   4587  H HG2  . MET A 1 323 ? 17.742  -16.427 -24.614 1.00 45.27  ? 323 MET A HG2  1 
ATOM   4588  H HG3  . MET A 1 323 ? 19.059  -16.888 -23.856 1.00 45.27  ? 323 MET A HG3  1 
ATOM   4589  H HE1  . MET A 1 323 ? 15.098  -16.167 -22.128 1.00 42.55  ? 323 MET A HE1  1 
ATOM   4590  H HE2  . MET A 1 323 ? 15.633  -15.231 -23.295 1.00 42.55  ? 323 MET A HE2  1 
ATOM   4591  H HE3  . MET A 1 323 ? 15.470  -16.792 -23.540 1.00 42.55  ? 323 MET A HE3  1 
ATOM   4592  N N    . ALA A 1 324 ? 18.775  -11.725 -25.246 1.00 28.77  ? 324 ALA A N    1 
ATOM   4593  C CA   . ALA A 1 324 ? 19.207  -10.331 -25.245 1.00 31.47  ? 324 ALA A CA   1 
ATOM   4594  C C    . ALA A 1 324 ? 18.147  -9.421  -24.617 1.00 29.06  ? 324 ALA A C    1 
ATOM   4595  O O    . ALA A 1 324 ? 18.452  -8.623  -23.732 1.00 31.26  ? 324 ALA A O    1 
ATOM   4596  C CB   . ALA A 1 324 ? 19.540  -9.901  -26.674 1.00 32.26  ? 324 ALA A CB   1 
ATOM   4597  H H    . ALA A 1 324 ? 18.659  -12.065 -26.027 1.00 34.49  ? 324 ALA A H    1 
ATOM   4598  H HA   . ALA A 1 324 ? 20.015  -10.253 -24.715 1.00 37.72  ? 324 ALA A HA   1 
ATOM   4599  H HB1  . ALA A 1 324 ? 19.825  -8.974  -26.666 1.00 38.67  ? 324 ALA A HB1  1 
ATOM   4600  H HB2  . ALA A 1 324 ? 20.252  -10.464 -27.015 1.00 38.67  ? 324 ALA A HB2  1 
ATOM   4601  H HB3  . ALA A 1 324 ? 18.747  -9.998  -27.225 1.00 38.67  ? 324 ALA A HB3  1 
ATOM   4602  N N    . VAL A 1 325 ? 16.884  -9.532  -25.050 1.00 21.73  ? 325 VAL A N    1 
ATOM   4603  C CA   . VAL A 1 325 ? 15.819  -8.795  -24.361 1.00 26.19  ? 325 VAL A CA   1 
ATOM   4604  C C    . VAL A 1 325 ? 15.911  -9.022  -22.856 1.00 26.12  ? 325 VAL A C    1 
ATOM   4605  O O    . VAL A 1 325 ? 15.876  -8.075  -22.064 1.00 30.92  ? 325 VAL A O    1 
ATOM   4606  C CB   . VAL A 1 325 ? 14.426  -9.197  -24.902 1.00 19.04  ? 325 VAL A CB   1 
ATOM   4607  C CG1  . VAL A 1 325 ? 13.336  -8.488  -24.107 1.00 22.80  ? 325 VAL A CG1  1 
ATOM   4608  C CG2  . VAL A 1 325 ? 14.315  -8.812  -26.358 1.00 25.39  ? 325 VAL A CG2  1 
ATOM   4609  H H    . VAL A 1 325 ? 16.626  -10.011 -25.716 1.00 26.03  ? 325 VAL A H    1 
ATOM   4610  H HA   . VAL A 1 325 ? 15.938  -7.846  -24.526 1.00 31.38  ? 325 VAL A HA   1 
ATOM   4611  H HB   . VAL A 1 325 ? 14.303  -10.156 -24.819 1.00 22.81  ? 325 VAL A HB   1 
ATOM   4612  H HG11 . VAL A 1 325 ? 12.470  -8.749  -24.457 1.00 27.32  ? 325 VAL A HG11 1 
ATOM   4613  H HG12 . VAL A 1 325 ? 13.408  -8.745  -23.174 1.00 27.32  ? 325 VAL A HG12 1 
ATOM   4614  H HG13 . VAL A 1 325 ? 13.454  -7.529  -24.197 1.00 27.32  ? 325 VAL A HG13 1 
ATOM   4615  H HG21 . VAL A 1 325 ? 13.439  -9.068  -26.687 1.00 30.42  ? 325 VAL A HG21 1 
ATOM   4616  H HG22 . VAL A 1 325 ? 14.432  -7.852  -26.441 1.00 30.42  ? 325 VAL A HG22 1 
ATOM   4617  H HG23 . VAL A 1 325 ? 15.005  -9.274  -26.860 1.00 30.42  ? 325 VAL A HG23 1 
ATOM   4618  N N    . TYR A 1 326 ? 16.031  -10.286 -22.442 1.00 25.41  ? 326 TYR A N    1 
ATOM   4619  C CA   . TYR A 1 326 ? 16.067  -10.595 -21.022 1.00 27.12  ? 326 TYR A CA   1 
ATOM   4620  C C    . TYR A 1 326 ? 17.271  -9.937  -20.344 1.00 31.64  ? 326 TYR A C    1 
ATOM   4621  O O    . TYR A 1 326 ? 17.131  -9.285  -19.312 1.00 29.37  ? 326 TYR A O    1 
ATOM   4622  C CB   . TYR A 1 326 ? 16.063  -12.110 -20.809 1.00 32.27  ? 326 TYR A CB   1 
ATOM   4623  C CG   . TYR A 1 326 ? 16.418  -12.467 -19.379 1.00 30.21  ? 326 TYR A CG   1 
ATOM   4624  C CD1  . TYR A 1 326 ? 15.531  -12.200 -18.339 1.00 35.26  ? 326 TYR A CD1  1 
ATOM   4625  C CD2  . TYR A 1 326 ? 17.671  -12.961 -19.061 1.00 40.86  ? 326 TYR A CD2  1 
ATOM   4626  C CE1  . TYR A 1 326 ? 15.870  -12.471 -17.027 1.00 44.68  ? 326 TYR A CE1  1 
ATOM   4627  C CE2  . TYR A 1 326 ? 18.029  -13.221 -17.750 1.00 39.59  ? 326 TYR A CE2  1 
ATOM   4628  C CZ   . TYR A 1 326 ? 17.126  -12.978 -16.743 1.00 39.12  ? 326 TYR A CZ   1 
ATOM   4629  O OH   . TYR A 1 326 ? 17.463  -13.224 -15.452 1.00 43.84  ? 326 TYR A OH   1 
ATOM   4630  H H    . TYR A 1 326 ? 16.092  -10.970 -22.960 1.00 30.45  ? 326 TYR A H    1 
ATOM   4631  H HA   . TYR A 1 326 ? 15.266  -10.238 -20.607 1.00 32.51  ? 326 TYR A HA   1 
ATOM   4632  H HB2  . TYR A 1 326 ? 15.178  -12.458 -20.999 1.00 38.68  ? 326 TYR A HB2  1 
ATOM   4633  H HB3  . TYR A 1 326 ? 16.718  -12.518 -21.397 1.00 38.68  ? 326 TYR A HB3  1 
ATOM   4634  H HD1  . TYR A 1 326 ? 14.690  -11.854 -18.532 1.00 42.27  ? 326 TYR A HD1  1 
ATOM   4635  H HD2  . TYR A 1 326 ? 18.285  -13.118 -19.741 1.00 48.99  ? 326 TYR A HD2  1 
ATOM   4636  H HE1  . TYR A 1 326 ? 15.266  -12.300 -16.341 1.00 53.57  ? 326 TYR A HE1  1 
ATOM   4637  H HE2  . TYR A 1 326 ? 18.869  -13.567 -17.553 1.00 47.46  ? 326 TYR A HE2  1 
ATOM   4638  H HH   . TYR A 1 326 ? 18.245  -13.528 -15.412 1.00 52.57  ? 326 TYR A HH   1 
ATOM   4639  N N    . LYS A 1 327 ? 18.460  -10.049 -20.933 1.00 33.84  ? 327 LYS A N    1 
ATOM   4640  C CA   . LYS A 1 327 ? 19.632  -9.541  -20.224 1.00 35.57  ? 327 LYS A CA   1 
ATOM   4641  C C    . LYS A 1 327 ? 19.675  -8.016  -20.185 1.00 38.02  ? 327 LYS A C    1 
ATOM   4642  O O    . LYS A 1 327 ? 20.186  -7.449  -19.211 1.00 30.56  ? 327 LYS A O    1 
ATOM   4643  C CB   . LYS A 1 327 ? 20.896  -10.120 -20.842 1.00 32.52  ? 327 LYS A CB   1 
ATOM   4644  C CG   . LYS A 1 327 ? 21.289  -11.444 -20.165 1.00 45.72  ? 327 LYS A CG   1 
ATOM   4645  C CD   . LYS A 1 327 ? 22.194  -12.356 -21.018 1.00 59.19  ? 327 LYS A CD   1 
ATOM   4646  C CE   . LYS A 1 327 ? 22.884  -13.453 -20.154 1.00 74.63  ? 327 LYS A CE   1 
ATOM   4647  N NZ   . LYS A 1 327 ? 22.045  -14.666 -19.844 1.00 59.58  ? 327 LYS A NZ   1 
ATOM   4648  H H    . LYS A 1 327 ? 18.612  -10.398 -21.704 1.00 40.57  ? 327 LYS A H    1 
ATOM   4649  H HA   . LYS A 1 327 ? 19.591  -9.851  -19.306 1.00 42.65  ? 327 LYS A HA   1 
ATOM   4650  H HB2  . LYS A 1 327 ? 20.743  -10.293 -21.784 1.00 38.99  ? 327 LYS A HB2  1 
ATOM   4651  H HB3  . LYS A 1 327 ? 21.626  -9.491  -20.729 1.00 38.99  ? 327 LYS A HB3  1 
ATOM   4652  H HG2  . LYS A 1 327 ? 21.764  -11.244 -19.343 1.00 54.82  ? 327 LYS A HG2  1 
ATOM   4653  H HG3  . LYS A 1 327 ? 20.480  -11.940 -19.961 1.00 54.82  ? 327 LYS A HG3  1 
ATOM   4654  H HD2  . LYS A 1 327 ? 21.657  -12.795 -21.695 1.00 70.99  ? 327 LYS A HD2  1 
ATOM   4655  H HD3  . LYS A 1 327 ? 22.886  -11.819 -21.435 1.00 70.99  ? 327 LYS A HD3  1 
ATOM   4656  H HE2  . LYS A 1 327 ? 23.674  -13.760 -20.625 1.00 89.51  ? 327 LYS A HE2  1 
ATOM   4657  H HE3  . LYS A 1 327 ? 23.145  -13.057 -19.308 1.00 89.51  ? 327 LYS A HE3  1 
ATOM   4658  H HZ1  . LYS A 1 327 ? 22.512  -15.240 -19.350 1.00 71.45  ? 327 LYS A HZ1  1 
ATOM   4659  H HZ2  . LYS A 1 327 ? 21.316  -14.424 -19.395 1.00 71.45  ? 327 LYS A HZ2  1 
ATOM   4660  H HZ3  . LYS A 1 327 ? 21.800  -15.067 -20.600 1.00 71.45  ? 327 LYS A HZ3  1 
ATOM   4661  N N    . VAL A 1 328 ? 19.138  -7.332  -21.206 1.00 28.82  ? 328 VAL A N    1 
ATOM   4662  C CA   . VAL A 1 328 ? 19.107  -5.869  -21.180 1.00 24.58  ? 328 VAL A CA   1 
ATOM   4663  C C    . VAL A 1 328 ? 18.084  -5.391  -20.159 1.00 36.25  ? 328 VAL A C    1 
ATOM   4664  O O    . VAL A 1 328 ? 18.275  -4.368  -19.490 1.00 38.92  ? 328 VAL A O    1 
ATOM   4665  C CB   . VAL A 1 328 ? 18.793  -5.303  -22.580 1.00 27.21  ? 328 VAL A CB   1 
ATOM   4666  C CG1  . VAL A 1 328 ? 18.554  -3.812  -22.529 1.00 33.68  ? 328 VAL A CG1  1 
ATOM   4667  C CG2  . VAL A 1 328 ? 19.876  -5.633  -23.567 1.00 30.04  ? 328 VAL A CG2  1 
ATOM   4668  H H    . VAL A 1 328 ? 18.793  -7.686  -21.910 1.00 34.55  ? 328 VAL A H    1 
ATOM   4669  H HA   . VAL A 1 328 ? 19.978  -5.538  -20.911 1.00 29.46  ? 328 VAL A HA   1 
ATOM   4670  H HB   . VAL A 1 328 ? 17.976  -5.716  -22.899 1.00 32.61  ? 328 VAL A HB   1 
ATOM   4671  H HG11 . VAL A 1 328 ? 18.361  -3.493  -23.424 1.00 40.38  ? 328 VAL A HG11 1 
ATOM   4672  H HG12 . VAL A 1 328 ? 17.802  -3.633  -21.943 1.00 40.38  ? 328 VAL A HG12 1 
ATOM   4673  H HG13 . VAL A 1 328 ? 19.351  -3.377  -22.187 1.00 40.38  ? 328 VAL A HG13 1 
ATOM   4674  H HG21 . VAL A 1 328 ? 19.640  -5.260  -24.431 1.00 36.00  ? 328 VAL A HG21 1 
ATOM   4675  H HG22 . VAL A 1 328 ? 20.712  -5.250  -23.258 1.00 36.00  ? 328 VAL A HG22 1 
ATOM   4676  H HG23 . VAL A 1 328 ? 19.959  -6.597  -23.634 1.00 36.00  ? 328 VAL A HG23 1 
ATOM   4677  N N    . CYS A 1 329 ? 16.977  -6.118  -20.034 1.00 30.50  ? 329 CYS A N    1 
ATOM   4678  C CA   . CYS A 1 329 ? 15.901  -5.717  -19.136 1.00 32.27  ? 329 CYS A CA   1 
ATOM   4679  C C    . CYS A 1 329 ? 16.188  -6.035  -17.666 1.00 38.58  ? 329 CYS A C    1 
ATOM   4680  O O    . CYS A 1 329 ? 15.767  -5.276  -16.786 1.00 30.03  ? 329 CYS A O    1 
ATOM   4681  C CB   . CYS A 1 329 ? 14.597  -6.410  -19.554 1.00 32.45  ? 329 CYS A CB   1 
ATOM   4682  S SG   . CYS A 1 329 ? 13.854  -5.773  -21.044 1.00 34.59  ? 329 CYS A SG   1 
ATOM   4683  H H    . CYS A 1 329 ? 16.825  -6.850  -20.461 1.00 36.56  ? 329 CYS A H    1 
ATOM   4684  H HA   . CYS A 1 329 ? 15.768  -4.760  -19.213 1.00 38.68  ? 329 CYS A HA   1 
ATOM   4685  H HB2  . CYS A 1 329 ? 14.780  -7.352  -19.698 1.00 38.90  ? 329 CYS A HB2  1 
ATOM   4686  H HB3  . CYS A 1 329 ? 13.950  -6.310  -18.838 1.00 38.90  ? 329 CYS A HB3  1 
ATOM   4687  H HG   . CYS A 1 329 ? 14.627  -5.903  -21.952 1.00 41.47  ? 329 CYS A HG   1 
ATOM   4688  N N    . TYR A 1 330 ? 16.890  -7.135  -17.378 1.00 38.30  ? 330 TYR A N    1 
ATOM   4689  C CA   . TYR A 1 330 ? 17.025  -7.634  -16.021 1.00 34.89  ? 330 TYR A CA   1 
ATOM   4690  C C    . TYR A 1 330 ? 18.461  -7.749  -15.524 1.00 35.68  ? 330 TYR A C    1 
ATOM   4691  O O    . TYR A 1 330 ? 18.678  -7.654  -14.325 1.00 44.08  ? 330 TYR A O    1 
ATOM   4692  C CB   . TYR A 1 330 ? 16.385  -9.013  -15.895 1.00 31.01  ? 330 TYR A CB   1 
ATOM   4693  C CG   . TYR A 1 330 ? 14.887  -8.985  -15.955 1.00 37.42  ? 330 TYR A CG   1 
ATOM   4694  C CD1  . TYR A 1 330 ? 14.126  -8.783  -14.810 1.00 36.83  ? 330 TYR A CD1  1 
ATOM   4695  C CD2  . TYR A 1 330 ? 14.231  -9.154  -17.154 1.00 35.65  ? 330 TYR A CD2  1 
ATOM   4696  C CE1  . TYR A 1 330 ? 12.747  -8.730  -14.862 1.00 30.49  ? 330 TYR A CE1  1 
ATOM   4697  C CE2  . TYR A 1 330 ? 12.861  -9.114  -17.220 1.00 36.37  ? 330 TYR A CE2  1 
ATOM   4698  C CZ   . TYR A 1 330 ? 12.118  -8.920  -16.070 1.00 32.56  ? 330 TYR A CZ   1 
ATOM   4699  O OH   . TYR A 1 330 ? 10.746  -8.873  -16.166 1.00 49.50  ? 330 TYR A OH   1 
ATOM   4700  H H    . TYR A 1 330 ? 17.301  -7.611  -17.965 1.00 45.92  ? 330 TYR A H    1 
ATOM   4701  H HA   . TYR A 1 330 ? 16.554  -7.034  -15.422 1.00 41.83  ? 330 TYR A HA   1 
ATOM   4702  H HB2  . TYR A 1 330 ? 16.701  -9.572  -16.622 1.00 37.17  ? 330 TYR A HB2  1 
ATOM   4703  H HB3  . TYR A 1 330 ? 16.641  -9.401  -15.044 1.00 37.17  ? 330 TYR A HB3  1 
ATOM   4704  H HD1  . TYR A 1 330 ? 14.556  -8.661  -13.994 1.00 44.15  ? 330 TYR A HD1  1 
ATOM   4705  H HD2  . TYR A 1 330 ? 14.723  -9.290  -17.931 1.00 42.74  ? 330 TYR A HD2  1 
ATOM   4706  H HE1  . TYR A 1 330 ? 12.250  -8.599  -14.087 1.00 36.55  ? 330 TYR A HE1  1 
ATOM   4707  H HE2  . TYR A 1 330 ? 12.432  -9.231  -18.036 1.00 43.61  ? 330 TYR A HE2  1 
ATOM   4708  H HH   . TYR A 1 330 ? 10.509  -9.006  -16.960 1.00 59.36  ? 330 TYR A HH   1 
ATOM   4709  N N    . GLU A 1 331 ? 19.435  -8.019  -16.389 1.00 38.07  ? 331 GLU A N    1 
ATOM   4710  C CA   . GLU A 1 331 ? 20.818  -8.175  -15.948 1.00 41.72  ? 331 GLU A CA   1 
ATOM   4711  C C    . GLU A 1 331 ? 21.695  -7.006  -16.358 1.00 37.69  ? 331 GLU A C    1 
ATOM   4712  O O    . GLU A 1 331 ? 22.912  -7.162  -16.441 1.00 38.49  ? 331 GLU A O    1 
ATOM   4713  C CB   . GLU A 1 331 ? 21.407  -9.490  -16.462 1.00 41.76  ? 331 GLU A CB   1 
ATOM   4714  C CG   . GLU A 1 331 ? 20.776  -10.697 -15.756 1.00 43.61  ? 331 GLU A CG   1 
ATOM   4715  C CD   . GLU A 1 331 ? 21.439  -12.015 -16.075 1.00 41.82  ? 331 GLU A CD   1 
ATOM   4716  O OE1  . GLU A 1 331 ? 22.427  -12.035 -16.845 1.00 59.17  ? 331 GLU A OE1  1 
ATOM   4717  O OE2  . GLU A 1 331 ? 20.959  -13.044 -15.546 1.00 54.07  ? 331 GLU A OE2  1 
ATOM   4718  H H    . GLU A 1 331 ? 19.321  -8.117  -17.236 1.00 45.64  ? 331 GLU A H    1 
ATOM   4719  H HA   . GLU A 1 331 ? 20.826  -8.215  -14.979 1.00 50.02  ? 331 GLU A HA   1 
ATOM   4720  H HB2  . GLU A 1 331 ? 21.233  -9.569  -17.413 1.00 50.07  ? 331 GLU A HB2  1 
ATOM   4721  H HB3  . GLU A 1 331 ? 22.361  -9.502  -16.292 1.00 50.07  ? 331 GLU A HB3  1 
ATOM   4722  H HG2  . GLU A 1 331 ? 20.834  -10.561 -14.797 1.00 52.29  ? 331 GLU A HG2  1 
ATOM   4723  H HG3  . GLU A 1 331 ? 19.845  -10.762 -16.021 1.00 52.29  ? 331 GLU A HG3  1 
ATOM   4724  N N    . GLY A 1 332 ? 21.095  -5.842  -16.612 1.00 38.51  ? 332 GLY A N    1 
ATOM   4725  C CA   . GLY A 1 332 ? 21.835  -4.627  -16.893 1.00 38.93  ? 332 GLY A CA   1 
ATOM   4726  C C    . GLY A 1 332 ? 22.762  -4.667  -18.096 1.00 37.13  ? 332 GLY A C    1 
ATOM   4727  O O    . GLY A 1 332 ? 23.680  -3.852  -18.184 1.00 42.65  ? 332 GLY A O    1 
ATOM   4728  H H    . GLY A 1 332 ? 20.242  -5.735  -16.626 1.00 46.17  ? 332 GLY A H    1 
ATOM   4729  H HA2  . GLY A 1 332 ? 21.202  -3.905  -17.034 1.00 46.68  ? 332 GLY A HA2  1 
ATOM   4730  H HA3  . GLY A 1 332 ? 22.371  -4.404  -16.116 1.00 46.68  ? 332 GLY A HA3  1 
ATOM   4731  N N    . GLN A 1 333 ? 22.543  -5.559  -19.035 1.00 38.26  ? 333 GLN A N    1 
ATOM   4732  C CA   . GLN A 1 333 ? 23.327  -5.525  -20.272 1.00 36.94  ? 333 GLN A CA   1 
ATOM   4733  C C    . GLN A 1 333 ? 23.024  -4.227  -21.029 1.00 34.70  ? 333 GLN A C    1 
ATOM   4734  O O    . GLN A 1 333 ? 21.857  -3.828  -21.124 1.00 33.04  ? 333 GLN A O    1 
ATOM   4735  C CB   . GLN A 1 333 ? 23.002  -6.756  -21.121 1.00 33.72  ? 333 GLN A CB   1 
ATOM   4736  C CG   . GLN A 1 333 ? 23.712  -6.894  -22.481 1.00 42.45  ? 333 GLN A CG   1 
ATOM   4737  C CD   . GLN A 1 333 ? 23.096  -8.037  -23.306 1.00 43.66  ? 333 GLN A CD   1 
ATOM   4738  O OE1  . GLN A 1 333 ? 23.243  -9.221  -22.974 1.00 48.29  ? 333 GLN A OE1  1 
ATOM   4739  N NE2  . GLN A 1 333 ? 22.362  -7.677  -24.353 1.00 43.34  ? 333 GLN A NE2  1 
ATOM   4740  H H    . GLN A 1 333 ? 21.958  -6.189  -18.994 1.00 45.87  ? 333 GLN A H    1 
ATOM   4741  H HA   . GLN A 1 333 ? 24.272  -5.541  -20.056 1.00 44.28  ? 333 GLN A HA   1 
ATOM   4742  H HB2  . GLN A 1 333 ? 23.227  -7.545  -20.603 1.00 40.43  ? 333 GLN A HB2  1 
ATOM   4743  H HB3  . GLN A 1 333 ? 22.048  -6.754  -21.298 1.00 40.43  ? 333 GLN A HB3  1 
ATOM   4744  H HG2  . GLN A 1 333 ? 23.614  -6.069  -22.981 1.00 50.89  ? 333 GLN A HG2  1 
ATOM   4745  H HG3  . GLN A 1 333 ? 24.650  -7.092  -22.336 1.00 50.89  ? 333 GLN A HG3  1 
ATOM   4746  H HE21 . GLN A 1 333 ? 22.273  -6.845  -24.550 1.00 51.97  ? 333 GLN A HE21 1 
ATOM   4747  H HE22 . GLN A 1 333 ? 21.992  -8.278  -24.845 1.00 51.97  ? 333 GLN A HE22 1 
ATOM   4748  N N    . PRO A 1 334 ? 24.031  -3.521  -21.539 1.00 36.97  ? 334 PRO A N    1 
ATOM   4749  C CA   . PRO A 1 334 ? 23.765  -2.229  -22.202 1.00 33.28  ? 334 PRO A CA   1 
ATOM   4750  C C    . PRO A 1 334 ? 22.968  -2.412  -23.489 1.00 37.11  ? 334 PRO A C    1 
ATOM   4751  O O    . PRO A 1 334 ? 23.312  -3.235  -24.339 1.00 34.65  ? 334 PRO A O    1 
ATOM   4752  C CB   . PRO A 1 334 ? 25.169  -1.673  -22.495 1.00 46.44  ? 334 PRO A CB   1 
ATOM   4753  C CG   . PRO A 1 334 ? 26.143  -2.626  -21.854 1.00 46.90  ? 334 PRO A CG   1 
ATOM   4754  C CD   . PRO A 1 334 ? 25.440  -3.931  -21.668 1.00 41.80  ? 334 PRO A CD   1 
ATOM   4755  H HA   . PRO A 1 334 ? 23.293  -1.628  -21.606 1.00 39.89  ? 334 PRO A HA   1 
ATOM   4756  H HB2  . PRO A 1 334 ? 25.309  -1.638  -23.454 1.00 55.69  ? 334 PRO A HB2  1 
ATOM   4757  H HB3  . PRO A 1 334 ? 25.254  -0.788  -22.107 1.00 55.69  ? 334 PRO A HB3  1 
ATOM   4758  H HG2  . PRO A 1 334 ? 26.910  -2.738  -22.437 1.00 56.23  ? 334 PRO A HG2  1 
ATOM   4759  H HG3  . PRO A 1 334 ? 26.422  -2.269  -20.997 1.00 56.23  ? 334 PRO A HG3  1 
ATOM   4760  H HD2  . PRO A 1 334 ? 25.560  -4.496  -22.446 1.00 50.12  ? 334 PRO A HD2  1 
ATOM   4761  H HD3  . PRO A 1 334 ? 25.743  -4.367  -20.856 1.00 50.12  ? 334 PRO A HD3  1 
ATOM   4762  N N    . VAL A 1 335 ? 21.917  -1.612  -23.644 1.00 36.28  ? 335 VAL A N    1 
ATOM   4763  C CA   . VAL A 1 335 ? 21.027  -1.781  -24.788 1.00 33.18  ? 335 VAL A CA   1 
ATOM   4764  C C    . VAL A 1 335 ? 21.743  -1.478  -26.102 1.00 38.97  ? 335 VAL A C    1 
ATOM   4765  O O    . VAL A 1 335 ? 21.298  -1.919  -27.172 1.00 40.43  ? 335 VAL A O    1 
ATOM   4766  C CB   . VAL A 1 335 ? 19.796  -0.887  -24.597 1.00 35.00  ? 335 VAL A CB   1 
ATOM   4767  C CG1  . VAL A 1 335 ? 20.203  0.555   -24.739 1.00 31.56  ? 335 VAL A CG1  1 
ATOM   4768  C CG2  . VAL A 1 335 ? 18.685  -1.235  -25.593 1.00 34.35  ? 335 VAL A CG2  1 
ATOM   4769  H H    . VAL A 1 335 ? 21.699  -0.974  -23.110 1.00 43.50  ? 335 VAL A H    1 
ATOM   4770  H HA   . VAL A 1 335 ? 20.725  -2.702  -24.819 1.00 39.77  ? 335 VAL A HA   1 
ATOM   4771  H HB   . VAL A 1 335 ? 19.448  -1.015  -23.700 1.00 41.96  ? 335 VAL A HB   1 
ATOM   4772  H HG11 . VAL A 1 335 ? 19.421  1.116   -24.617 1.00 37.83  ? 335 VAL A HG11 1 
ATOM   4773  H HG12 . VAL A 1 335 ? 20.868  0.763   -24.065 1.00 37.83  ? 335 VAL A HG12 1 
ATOM   4774  H HG13 . VAL A 1 335 ? 20.574  0.691   -25.625 1.00 37.83  ? 335 VAL A HG13 1 
ATOM   4775  H HG21 . VAL A 1 335 ? 17.928  -0.649  -25.438 1.00 41.18  ? 335 VAL A HG21 1 
ATOM   4776  H HG22 . VAL A 1 335 ? 19.020  -1.112  -26.495 1.00 41.18  ? 335 VAL A HG22 1 
ATOM   4777  H HG23 . VAL A 1 335 ? 18.421  -2.159  -25.461 1.00 41.18  ? 335 VAL A HG23 1 
ATOM   4778  N N    . GLY A 1 336 ? 22.832  -0.709  -26.055 1.00 32.15  ? 336 GLY A N    1 
ATOM   4779  C CA   . GLY A 1 336 ? 23.565  -0.373  -27.258 1.00 27.64  ? 336 GLY A CA   1 
ATOM   4780  C C    . GLY A 1 336 ? 24.297  -1.542  -27.891 1.00 33.61  ? 336 GLY A C    1 
ATOM   4781  O O    . GLY A 1 336 ? 24.702  -1.425  -29.053 1.00 44.26  ? 336 GLY A O    1 
ATOM   4782  H H    . GLY A 1 336 ? 23.162  -0.374  -25.335 1.00 38.54  ? 336 GLY A H    1 
ATOM   4783  H HA2  . GLY A 1 336 ? 22.947  -0.013  -27.914 1.00 33.13  ? 336 GLY A HA2  1 
ATOM   4784  H HA3  . GLY A 1 336 ? 24.217  0.314   -27.050 1.00 33.13  ? 336 GLY A HA3  1 
ATOM   4785  N N    . GLU A 1 337 ? 24.443  -2.662  -27.167 1.00 31.51  ? 337 GLU A N    1 
ATOM   4786  C CA   . GLU A 1 337 ? 25.116  -3.877  -27.625 1.00 39.42  ? 337 GLU A CA   1 
ATOM   4787  C C    . GLU A 1 337 ? 24.152  -4.990  -28.011 1.00 32.70  ? 337 GLU A C    1 
ATOM   4788  O O    . GLU A 1 337 ? 24.577  -6.104  -28.340 1.00 31.62  ? 337 GLU A O    1 
ATOM   4789  C CB   . GLU A 1 337 ? 26.051  -4.367  -26.533 1.00 47.34  ? 337 GLU A CB   1 
ATOM   4790  C CG   . GLU A 1 337 ? 27.380  -3.615  -26.557 1.00 65.87  ? 337 GLU A CG   1 
ATOM   4791  C CD   . GLU A 1 337 ? 28.083  -3.674  -25.245 1.00 69.73  ? 337 GLU A CD   1 
ATOM   4792  O OE1  . GLU A 1 337 ? 27.735  -4.584  -24.456 1.00 68.56  ? 337 GLU A OE1  1 
ATOM   4793  O OE2  . GLU A 1 337 ? 28.953  -2.801  -25.003 1.00 64.64  ? 337 GLU A OE2  1 
ATOM   4794  H H    . GLU A 1 337 ? 24.141  -2.738  -26.365 1.00 37.77  ? 337 GLU A H    1 
ATOM   4795  H HA   . GLU A 1 337 ? 25.652  -3.664  -28.405 1.00 47.27  ? 337 GLU A HA   1 
ATOM   4796  H HB2  . GLU A 1 337 ? 25.637  -4.224  -25.668 1.00 56.77  ? 337 GLU A HB2  1 
ATOM   4797  H HB3  . GLU A 1 337 ? 26.233  -5.310  -26.666 1.00 56.77  ? 337 GLU A HB3  1 
ATOM   4798  H HG2  . GLU A 1 337 ? 27.958  -4.012  -27.227 1.00 79.00  ? 337 GLU A HG2  1 
ATOM   4799  H HG3  . GLU A 1 337 ? 27.214  -2.683  -26.769 1.00 79.00  ? 337 GLU A HG3  1 
ATOM   4800  N N    . PHE A 1 338 ? 22.870  -4.708  -27.969 1.00 32.35  ? 338 PHE A N    1 
ATOM   4801  C CA   . PHE A 1 338 ? 21.848  -5.695  -28.293 1.00 35.29  ? 338 PHE A CA   1 
ATOM   4802  C C    . PHE A 1 338 ? 22.133  -6.388  -29.626 1.00 27.20  ? 338 PHE A C    1 
ATOM   4803  O O    . PHE A 1 338 ? 21.977  -7.600  -29.761 1.00 25.06  ? 338 PHE A O    1 
ATOM   4804  C CB   . PHE A 1 338 ? 20.505  -4.950  -28.295 1.00 39.69  ? 338 PHE A CB   1 
ATOM   4805  C CG   . PHE A 1 338 ? 19.400  -5.691  -28.920 1.00 30.76  ? 338 PHE A CG   1 
ATOM   4806  C CD1  . PHE A 1 338 ? 18.845  -6.766  -28.290 1.00 35.46  ? 338 PHE A CD1  1 
ATOM   4807  C CD2  . PHE A 1 338 ? 18.912  -5.289  -30.129 1.00 35.40  ? 338 PHE A CD2  1 
ATOM   4808  C CE1  . PHE A 1 338 ? 17.821  -7.446  -28.871 1.00 42.92  ? 338 PHE A CE1  1 
ATOM   4809  C CE2  . PHE A 1 338 ? 17.926  -5.946  -30.708 1.00 29.19  ? 338 PHE A CE2  1 
ATOM   4810  C CZ   . PHE A 1 338 ? 17.357  -7.030  -30.090 1.00 37.72  ? 338 PHE A CZ   1 
ATOM   4811  H H    . PHE A 1 338 ? 22.553  -3.938  -27.753 1.00 38.78  ? 338 PHE A H    1 
ATOM   4812  H HA   . PHE A 1 338 ? 21.822  -6.370  -27.597 1.00 42.30  ? 338 PHE A HA   1 
ATOM   4813  H HB2  . PHE A 1 338 ? 20.252  -4.763  -27.378 1.00 47.58  ? 338 PHE A HB2  1 
ATOM   4814  H HB3  . PHE A 1 338 ? 20.612  -4.117  -28.781 1.00 47.58  ? 338 PHE A HB3  1 
ATOM   4815  H HD1  . PHE A 1 338 ? 19.173  -7.039  -27.463 1.00 42.51  ? 338 PHE A HD1  1 
ATOM   4816  H HD2  . PHE A 1 338 ? 19.292  -4.557  -30.559 1.00 42.44  ? 338 PHE A HD2  1 
ATOM   4817  H HE1  . PHE A 1 338 ? 17.443  -8.183  -28.447 1.00 51.46  ? 338 PHE A HE1  1 
ATOM   4818  H HE2  . PHE A 1 338 ? 17.604  -5.664  -31.534 1.00 34.98  ? 338 PHE A HE2  1 
ATOM   4819  H HZ   . PHE A 1 338 ? 16.657  -7.484  -30.500 1.00 45.22  ? 338 PHE A HZ   1 
ATOM   4820  N N    . ILE A 1 339 ? 22.591  -5.630  -30.610 1.00 30.02  ? 339 ILE A N    1 
ATOM   4821  C CA   . ILE A 1 339 ? 22.803  -6.161  -31.939 1.00 28.03  ? 339 ILE A CA   1 
ATOM   4822  C C    . ILE A 1 339 ? 23.978  -7.142  -31.968 1.00 34.68  ? 339 ILE A C    1 
ATOM   4823  O O    . ILE A 1 339 ? 24.019  -8.052  -32.795 1.00 31.29  ? 339 ILE A O    1 
ATOM   4824  C CB   . ILE A 1 339 ? 22.997  -4.964  -32.896 1.00 29.21  ? 339 ILE A CB   1 
ATOM   4825  C CG1  . ILE A 1 339 ? 22.454  -5.301  -34.272 1.00 50.21  ? 339 ILE A CG1  1 
ATOM   4826  C CG2  . ILE A 1 339 ? 24.493  -4.595  -32.992 1.00 54.73  ? 339 ILE A CG2  1 
ATOM   4827  C CD1  . ILE A 1 339 ? 20.948  -5.368  -34.274 1.00 48.87  ? 339 ILE A CD1  1 
ATOM   4828  H H    . ILE A 1 339 ? 22.789  -4.797  -30.530 1.00 35.98  ? 339 ILE A H    1 
ATOM   4829  H HA   . ILE A 1 339 ? 22.007  -6.641  -32.217 1.00 33.59  ? 339 ILE A HA   1 
ATOM   4830  H HB   . ILE A 1 339 ? 22.509  -4.203  -32.545 1.00 35.01  ? 339 ILE A HB   1 
ATOM   4831  H HG12 . ILE A 1 339 ? 22.728  -4.614  -34.900 1.00 60.21  ? 339 ILE A HG12 1 
ATOM   4832  H HG13 . ILE A 1 339 ? 22.797  -6.165  -34.549 1.00 60.21  ? 339 ILE A HG13 1 
ATOM   4833  H HG21 . ILE A 1 339 ? 24.594  -3.843  -33.596 1.00 65.63  ? 339 ILE A HG21 1 
ATOM   4834  H HG22 . ILE A 1 339 ? 24.816  -4.357  -32.109 1.00 65.63  ? 339 ILE A HG22 1 
ATOM   4835  H HG23 . ILE A 1 339 ? 24.985  -5.360  -33.330 1.00 65.63  ? 339 ILE A HG23 1 
ATOM   4836  H HD11 . ILE A 1 339 ? 20.644  -5.585  -35.169 1.00 58.60  ? 339 ILE A HD11 1 
ATOM   4837  H HD12 . ILE A 1 339 ? 20.663  -6.055  -33.652 1.00 58.60  ? 339 ILE A HD12 1 
ATOM   4838  H HD13 . ILE A 1 339 ? 20.594  -4.507  -34.003 1.00 58.60  ? 339 ILE A HD13 1 
ATOM   4839  N N    . HIS A 1 340 ? 24.948  -6.984  -31.080 1.00 34.64  ? 340 HIS A N    1 
ATOM   4840  C CA   . HIS A 1 340 ? 26.091  -7.895  -31.089 1.00 40.78  ? 340 HIS A CA   1 
ATOM   4841  C C    . HIS A 1 340 ? 25.665  -9.334  -30.838 1.00 38.40  ? 340 HIS A C    1 
ATOM   4842  O O    . HIS A 1 340 ? 26.242  -10.263 -31.421 1.00 28.88  ? 340 HIS A O    1 
ATOM   4843  C CB   . HIS A 1 340 ? 27.134  -7.427  -30.071 1.00 32.00  ? 340 HIS A CB   1 
ATOM   4844  C CG   . HIS A 1 340 ? 27.807  -6.147  -30.462 1.00 35.61  ? 340 HIS A CG   1 
ATOM   4845  N ND1  . HIS A 1 340 ? 27.965  -5.094  -29.590 1.00 48.16  ? 340 HIS A ND1  1 
ATOM   4846  C CD2  . HIS A 1 340 ? 28.355  -5.746  -31.637 1.00 52.67  ? 340 HIS A CD2  1 
ATOM   4847  C CE1  . HIS A 1 340 ? 28.572  -4.096  -30.209 1.00 52.15  ? 340 HIS A CE1  1 
ATOM   4848  N NE2  . HIS A 1 340 ? 28.823  -4.466  -31.452 1.00 46.62  ? 340 HIS A NE2  1 
ATOM   4849  H H    . HIS A 1 340 ? 24.973  -6.375  -30.474 1.00 41.53  ? 340 HIS A H    1 
ATOM   4850  H HA   . HIS A 1 340 ? 26.504  -7.862  -31.966 1.00 48.89  ? 340 HIS A HA   1 
ATOM   4851  H HB2  . HIS A 1 340 ? 26.699  -7.286  -29.216 1.00 38.36  ? 340 HIS A HB2  1 
ATOM   4852  H HB3  . HIS A 1 340 ? 27.818  -8.109  -29.985 1.00 38.36  ? 340 HIS A HB3  1 
ATOM   4853  H HD2  . HIS A 1 340 ? 28.399  -6.241  -32.423 1.00 63.16  ? 340 HIS A HD2  1 
ATOM   4854  H HE1  . HIS A 1 340 ? 28.795  -3.277  -29.830 1.00 62.53  ? 340 HIS A HE1  1 
ATOM   4855  H HE2  . HIS A 1 340 ? 29.218  -3.986  -32.046 1.00 55.90  ? 340 HIS A HE2  1 
ATOM   4856  N N    . CYS A 1 341 ? 24.615  -9.529  -30.055 1.00 35.60  ? 341 CYS A N    1 
ATOM   4857  C CA   . CYS A 1 341 ? 24.077  -10.855 -29.685 1.00 29.36  ? 341 CYS A CA   1 
ATOM   4858  C C    . CYS A 1 341 ? 23.437  -11.537 -30.895 1.00 35.84  ? 341 CYS A C    1 
ATOM   4859  O O    . CYS A 1 341 ? 23.198  -12.701 -30.809 1.00 41.66  ? 341 CYS A O    1 
ATOM   4860  C CB   . CYS A 1 341 ? 23.067  -10.739 -28.552 1.00 40.88  ? 341 CYS A CB   1 
ATOM   4861  S SG   . CYS A 1 341 ? 23.576  -9.618  -27.224 1.00 48.92  ? 341 CYS A SG   1 
ATOM   4862  H H    . CYS A 1 341 ? 24.140  -8.847  -29.681 1.00 42.68  ? 341 CYS A H    1 
ATOM   4863  H HA   . CYS A 1 341 ? 24.828  -11.411 -29.374 1.00 35.19  ? 341 CYS A HA   1 
ATOM   4864  H HB2  . CYS A 1 341 ? 22.215  -10.421 -28.916 1.00 49.02  ? 341 CYS A HB2  1 
ATOM   4865  H HB3  . CYS A 1 341 ? 22.916  -11.626 -28.168 1.00 49.02  ? 341 CYS A HB3  1 
ATOM   4866  H HG   . CYS A 1 341 ? 22.650  -9.825  -26.485 1.00 58.66  ? 341 CYS A HG   1 
ATOM   4867  N N    . LEU A 1 342 ? 23.209  -10.840 -32.000 1.00 34.72  ? 342 LEU A N    1 
ATOM   4868  C CA   . LEU A 1 342 ? 22.595  -11.410 -33.197 1.00 19.07  ? 342 LEU A CA   1 
ATOM   4869  C C    . LEU A 1 342 ? 23.607  -11.670 -34.311 1.00 34.07  ? 342 LEU A C    1 
ATOM   4870  O O    . LEU A 1 342 ? 23.227  -12.085 -35.410 1.00 24.10  ? 342 LEU A O    1 
ATOM   4871  C CB   . LEU A 1 342 ? 21.514  -10.473 -33.718 1.00 26.40  ? 342 LEU A CB   1 
ATOM   4872  C CG   . LEU A 1 342 ? 20.468  -10.092 -32.671 1.00 30.94  ? 342 LEU A CG   1 
ATOM   4873  C CD1  . LEU A 1 342 ? 19.381  -9.248  -33.341 1.00 36.31  ? 342 LEU A CD1  1 
ATOM   4874  C CD2  . LEU A 1 342 ? 19.888  -11.339 -32.053 1.00 34.11  ? 342 LEU A CD2  1 
ATOM   4875  H H    . LEU A 1 342 ? 23.394  -10.003 -32.076 1.00 41.62  ? 342 LEU A H    1 
ATOM   4876  H HA   . LEU A 1 342 ? 22.176  -12.254 -32.967 1.00 22.85  ? 342 LEU A HA   1 
ATOM   4877  H HB2  . LEU A 1 342 ? 21.934  -9.656  -34.029 1.00 31.64  ? 342 LEU A HB2  1 
ATOM   4878  H HB3  . LEU A 1 342 ? 21.053  -10.907 -34.453 1.00 31.64  ? 342 LEU A HB3  1 
ATOM   4879  H HG   . LEU A 1 342 ? 20.884  -9.564  -31.972 1.00 37.08  ? 342 LEU A HG   1 
ATOM   4880  H HD11 . LEU A 1 342 ? 18.717  -9.005  -32.677 1.00 43.53  ? 342 LEU A HD11 1 
ATOM   4881  H HD12 . LEU A 1 342 ? 19.786  -8.448  -33.711 1.00 43.53  ? 342 LEU A HD12 1 
ATOM   4882  H HD13 . LEU A 1 342 ? 18.968  -9.768  -34.047 1.00 43.53  ? 342 LEU A HD13 1 
ATOM   4883  H HD21 . LEU A 1 342 ? 19.226  -11.085 -31.392 1.00 40.88  ? 342 LEU A HD21 1 
ATOM   4884  H HD22 . LEU A 1 342 ? 19.473  -11.872 -32.750 1.00 40.88  ? 342 LEU A HD22 1 
ATOM   4885  H HD23 . LEU A 1 342 ? 20.602  -11.843 -31.632 1.00 40.88  ? 342 LEU A HD23 1 
ATOM   4886  N N    . GLN A 1 343 ? 24.879  -11.451 -34.039 1.00 32.59  ? 343 GLN A N    1 
ATOM   4887  C CA   . GLN A 1 343 ? 25.912  -11.602 -35.029 1.00 25.41  ? 343 GLN A CA   1 
ATOM   4888  C C    . GLN A 1 343 ? 26.459  -13.021 -35.136 1.00 24.02  ? 343 GLN A C    1 
ATOM   4889  O O    . GLN A 1 343 ? 27.201  -13.316 -36.084 1.00 27.96  ? 343 GLN A O    1 
ATOM   4890  C CB   . GLN A 1 343 ? 27.042  -10.636 -34.729 1.00 33.55  ? 343 GLN A CB   1 
ATOM   4891  C CG   . GLN A 1 343 ? 26.650  -9.174  -34.902 1.00 33.08  ? 343 GLN A CG   1 
ATOM   4892  C CD   . GLN A 1 343 ? 27.845  -8.255  -34.629 1.00 32.67  ? 343 GLN A CD   1 
ATOM   4893  O OE1  . GLN A 1 343 ? 28.583  -8.429  -33.664 1.00 32.42  ? 343 GLN A OE1  1 
ATOM   4894  N NE2  . GLN A 1 343 ? 28.031  -7.299  -35.484 1.00 24.41  ? 343 GLN A NE2  1 
ATOM   4895  H H    . GLN A 1 343 ? 25.171  -11.207 -33.268 1.00 39.07  ? 343 GLN A H    1 
ATOM   4896  H HA   . GLN A 1 343 ? 25.545  -11.364 -35.895 1.00 30.46  ? 343 GLN A HA   1 
ATOM   4897  H HB2  . GLN A 1 343 ? 27.327  -10.762 -33.811 1.00 40.21  ? 343 GLN A HB2  1 
ATOM   4898  H HB3  . GLN A 1 343 ? 27.779  -10.820 -35.332 1.00 40.21  ? 343 GLN A HB3  1 
ATOM   4899  H HG2  . GLN A 1 343 ? 26.350  -9.025  -35.812 1.00 39.66  ? 343 GLN A HG2  1 
ATOM   4900  H HG3  . GLN A 1 343 ? 25.944  -8.953  -34.273 1.00 39.66  ? 343 GLN A HG3  1 
ATOM   4901  H HE21 . GLN A 1 343 ? 27.495  -7.208  -36.150 1.00 29.25  ? 343 GLN A HE21 1 
ATOM   4902  H HE22 . GLN A 1 343 ? 28.687  -6.753  -35.382 1.00 29.25  ? 343 GLN A HE22 1 
ATOM   4903  N N    A ASN A 1 344 ? 26.109  -13.907 -34.209 0.60 28.55  ? 344 ASN A N    1 
ATOM   4904  N N    B ASN A 1 344 ? 26.110  -13.927 -34.233 0.40 28.52  ? 344 ASN A N    1 
ATOM   4905  C CA   A ASN A 1 344 ? 26.414  -15.333 -34.327 0.60 30.61  ? 344 ASN A CA   1 
ATOM   4906  C CA   B ASN A 1 344 ? 26.421  -15.339 -34.438 0.40 30.57  ? 344 ASN A CA   1 
ATOM   4907  C C    A ASN A 1 344 ? 25.163  -16.163 -34.077 0.60 30.41  ? 344 ASN A C    1 
ATOM   4908  C C    B ASN A 1 344 ? 25.173  -16.146 -34.080 0.40 30.28  ? 344 ASN A C    1 
ATOM   4909  O O    A ASN A 1 344 ? 25.162  -17.116 -33.298 0.60 34.35  ? 344 ASN A O    1 
ATOM   4910  O O    B ASN A 1 344 ? 25.180  -17.030 -33.230 0.40 34.28  ? 344 ASN A O    1 
ATOM   4911  C CB   A ASN A 1 344 ? 27.524  -15.752 -33.365 0.60 26.58  ? 344 ASN A CB   1 
ATOM   4912  C CB   B ASN A 1 344 ? 27.668  -15.748 -33.651 0.40 27.00  ? 344 ASN A CB   1 
ATOM   4913  C CG   A ASN A 1 344 ? 28.012  -17.161 -33.633 0.60 25.70  ? 344 ASN A CG   1 
ATOM   4914  C CG   B ASN A 1 344 ? 28.914  -14.993 -34.111 0.40 29.28  ? 344 ASN A CG   1 
ATOM   4915  O OD1  A ASN A 1 344 ? 27.967  -17.638 -34.769 0.60 21.37  ? 344 ASN A OD1  1 
ATOM   4916  O OD1  B ASN A 1 344 ? 29.161  -13.882 -33.647 0.40 26.23  ? 344 ASN A OD1  1 
ATOM   4917  N ND2  A ASN A 1 344 ? 28.468  -17.839 -32.590 0.60 29.70  ? 344 ASN A ND2  1 
ATOM   4918  N ND2  B ASN A 1 344 ? 29.722  -15.607 -35.004 0.40 34.05  ? 344 ASN A ND2  1 
ATOM   4919  H H    A ASN A 1 344 ? 25.685  -13.704 -33.488 0.60 34.22  ? 344 ASN A H    1 
ATOM   4920  H H    B ASN A 1 344 ? 25.697  -13.756 -33.499 0.40 34.18  ? 344 ASN A H    1 
ATOM   4921  H HA   A ASN A 1 344 ? 26.717  -15.516 -35.230 0.60 36.69  ? 344 ASN A HA   1 
ATOM   4922  H HA   B ASN A 1 344 ? 26.606  -15.485 -35.379 0.40 36.64  ? 344 ASN A HA   1 
ATOM   4923  H HB2  A ASN A 1 344 ? 28.276  -15.148 -33.465 0.60 31.85  ? 344 ASN A HB2  1 
ATOM   4924  H HB2  B ASN A 1 344 ? 27.528  -15.554 -32.711 0.40 32.36  ? 344 ASN A HB2  1 
ATOM   4925  H HB3  A ASN A 1 344 ? 27.187  -15.718 -32.456 0.60 31.85  ? 344 ASN A HB3  1 
ATOM   4926  H HB3  B ASN A 1 344 ? 27.826  -16.696 -33.776 0.40 32.36  ? 344 ASN A HB3  1 
ATOM   4927  H HD21 A ASN A 1 344 ? 28.755  -18.643 -32.692 0.60 35.60  ? 344 ASN A HD21 1 
ATOM   4928  H HD21 B ASN A 1 344 ? 29.519  -16.388 -35.302 0.40 40.82  ? 344 ASN A HD21 1 
ATOM   4929  H HD22 A ASN A 1 344 ? 28.482  -17.472 -31.812 0.60 35.60  ? 344 ASN A HD22 1 
ATOM   4930  H HD22 B ASN A 1 344 ? 30.434  -15.212 -35.282 0.40 40.82  ? 344 ASN A HD22 1 
ATOM   4931  N N    . HIS A 1 345 ? 24.084  -15.816 -34.771 1.00 27.67  ? 345 HIS A N    1 
ATOM   4932  C CA   . HIS A 1 345 ? 22.798  -16.441 -34.535 1.00 22.85  ? 345 HIS A CA   1 
ATOM   4933  C C    . HIS A 1 345 ? 22.757  -17.887 -35.049 1.00 25.90  ? 345 HIS A C    1 
ATOM   4934  O O    . HIS A 1 345 ? 23.223  -18.180 -36.156 1.00 28.29  ? 345 HIS A O    1 
ATOM   4935  C CB   . HIS A 1 345 ? 21.698  -15.602 -35.225 1.00 27.20  ? 345 HIS A CB   1 
ATOM   4936  C CG   . HIS A 1 345 ? 20.322  -15.834 -34.662 1.00 27.54  ? 345 HIS A CG   1 
ATOM   4937  N ND1  . HIS A 1 345 ? 19.509  -16.867 -35.081 1.00 30.31  ? 345 HIS A ND1  1 
ATOM   4938  C CD2  . HIS A 1 345 ? 19.635  -15.181 -33.693 1.00 22.86  ? 345 HIS A CD2  1 
ATOM   4939  C CE1  . HIS A 1 345 ? 18.378  -16.846 -34.383 1.00 30.98  ? 345 HIS A CE1  1 
ATOM   4940  N NE2  . HIS A 1 345 ? 18.433  -15.838 -33.530 1.00 31.13  ? 345 HIS A NE2  1 
ATOM   4941  H H    . HIS A 1 345 ? 24.072  -15.218 -35.389 1.00 33.17  ? 345 HIS A H    1 
ATOM   4942  H HA   . HIS A 1 345 ? 22.619  -16.453 -33.582 1.00 27.38  ? 345 HIS A HA   1 
ATOM   4943  H HB2  . HIS A 1 345 ? 21.908  -14.661 -35.118 1.00 32.60  ? 345 HIS A HB2  1 
ATOM   4944  H HB3  . HIS A 1 345 ? 21.675  -15.829 -36.168 1.00 32.60  ? 345 HIS A HB3  1 
ATOM   4945  H HD2  . HIS A 1 345 ? 19.930  -14.443 -33.210 1.00 27.39  ? 345 HIS A HD2  1 
ATOM   4946  H HE1  . HIS A 1 345 ? 17.666  -17.435 -34.484 1.00 37.13  ? 345 HIS A HE1  1 
ATOM   4947  H HE2  . HIS A 1 345 ? 17.809  -15.611 -32.983 1.00 37.32  ? 345 HIS A HE2  1 
ATOM   4948  N N    . PRO A 1 346 ? 22.120  -18.794 -34.317 1.00 25.12  ? 346 PRO A N    1 
ATOM   4949  C CA   . PRO A 1 346 ? 21.890  -20.150 -34.844 1.00 23.72  ? 346 PRO A CA   1 
ATOM   4950  C C    . PRO A 1 346 ? 21.356  -20.194 -36.263 1.00 36.99  ? 346 PRO A C    1 
ATOM   4951  O O    . PRO A 1 346 ? 21.685  -21.141 -36.987 1.00 29.29  ? 346 PRO A O    1 
ATOM   4952  C CB   . PRO A 1 346 ? 20.863  -20.730 -33.870 1.00 36.81  ? 346 PRO A CB   1 
ATOM   4953  C CG   . PRO A 1 346 ? 21.076  -19.982 -32.595 1.00 36.52  ? 346 PRO A CG   1 
ATOM   4954  C CD   . PRO A 1 346 ? 21.513  -18.594 -32.987 1.00 33.24  ? 346 PRO A CD   1 
ATOM   4955  H HA   . PRO A 1 346 ? 22.706  -20.671 -34.794 1.00 28.43  ? 346 PRO A HA   1 
ATOM   4956  H HB2  . PRO A 1 346 ? 19.967  -20.581 -34.210 1.00 44.13  ? 346 PRO A HB2  1 
ATOM   4957  H HB3  . PRO A 1 346 ? 21.030  -21.678 -33.744 1.00 44.13  ? 346 PRO A HB3  1 
ATOM   4958  H HG2  . PRO A 1 346 ? 20.244  -19.948 -32.097 1.00 43.78  ? 346 PRO A HG2  1 
ATOM   4959  H HG3  . PRO A 1 346 ? 21.766  -20.421 -32.074 1.00 43.78  ? 346 PRO A HG3  1 
ATOM   4960  H HD2  . PRO A 1 346 ? 20.747  -18.003 -33.051 1.00 39.85  ? 346 PRO A HD2  1 
ATOM   4961  H HD3  . PRO A 1 346 ? 22.173  -18.257 -32.361 1.00 39.85  ? 346 PRO A HD3  1 
ATOM   4962  N N    . GLU A 1 347 ? 20.521  -19.228 -36.687 1.00 35.09  ? 347 GLU A N    1 
ATOM   4963  C CA   . GLU A 1 347 ? 20.005  -19.254 -38.057 1.00 29.48  ? 347 GLU A CA   1 
ATOM   4964  C C    . GLU A 1 347 ? 21.105  -19.179 -39.116 1.00 27.84  ? 347 GLU A C    1 
ATOM   4965  O O    . GLU A 1 347 ? 20.927  -19.709 -40.217 1.00 28.91  ? 347 GLU A O    1 
ATOM   4966  C CB   . GLU A 1 347 ? 19.008  -18.116 -38.297 1.00 35.36  ? 347 GLU A CB   1 
ATOM   4967  C CG   . GLU A 1 347 ? 17.645  -18.335 -37.624 1.00 36.71  ? 347 GLU A CG   1 
ATOM   4968  C CD   . GLU A 1 347 ? 16.938  -19.590 -38.090 1.00 40.06  ? 347 GLU A CD   1 
ATOM   4969  O OE1  . GLU A 1 347 ? 16.888  -19.808 -39.322 1.00 30.39  ? 347 GLU A OE1  1 
ATOM   4970  O OE2  . GLU A 1 347 ? 16.419  -20.339 -37.214 1.00 34.09  ? 347 GLU A OE2  1 
ATOM   4971  H H    . GLU A 1 347 ? 20.248  -18.566 -36.211 1.00 42.07  ? 347 GLU A H    1 
ATOM   4972  H HA   . GLU A 1 347 ? 19.530  -20.090 -38.190 1.00 35.33  ? 347 GLU A HA   1 
ATOM   4973  H HB2  . GLU A 1 347 ? 19.383  -17.293 -37.946 1.00 42.39  ? 347 GLU A HB2  1 
ATOM   4974  H HB3  . GLU A 1 347 ? 18.857  -18.028 -39.251 1.00 42.39  ? 347 GLU A HB3  1 
ATOM   4975  H HG2  . GLU A 1 347 ? 17.776  -18.406 -36.665 1.00 44.02  ? 347 GLU A HG2  1 
ATOM   4976  H HG3  . GLU A 1 347 ? 17.071  -17.579 -37.823 1.00 44.02  ? 347 GLU A HG3  1 
ATOM   4977  N N    . HIS A 1 348 ? 22.239  -18.552 -38.821 1.00 28.18  ? 348 HIS A N    1 
ATOM   4978  C CA   . HIS A 1 348 ? 23.287  -18.384 -39.826 1.00 25.16  ? 348 HIS A CA   1 
ATOM   4979  C C    . HIS A 1 348 ? 24.437  -19.344 -39.649 1.00 29.01  ? 348 HIS A C    1 
ATOM   4980  O O    . HIS A 1 348 ? 25.422  -19.281 -40.415 1.00 26.62  ? 348 HIS A O    1 
ATOM   4981  C CB   . HIS A 1 348 ? 23.786  -16.941 -39.812 1.00 28.96  ? 348 HIS A CB   1 
ATOM   4982  C CG   . HIS A 1 348 ? 22.675  -15.946 -39.885 1.00 28.63  ? 348 HIS A CG   1 
ATOM   4983  N ND1  . HIS A 1 348 ? 22.355  -15.097 -38.848 1.00 23.97  ? 348 HIS A ND1  1 
ATOM   4984  C CD2  . HIS A 1 348 ? 21.783  -15.698 -40.869 1.00 28.89  ? 348 HIS A CD2  1 
ATOM   4985  C CE1  . HIS A 1 348 ? 21.327  -14.347 -39.202 1.00 32.23  ? 348 HIS A CE1  1 
ATOM   4986  N NE2  . HIS A 1 348 ? 20.964  -14.687 -40.426 1.00 27.71  ? 348 HIS A NE2  1 
ATOM   4987  H H    . HIS A 1 348 ? 22.427  -18.216 -38.052 1.00 33.78  ? 348 HIS A H    1 
ATOM   4988  H HA   . HIS A 1 348 ? 22.902  -18.551 -40.701 1.00 30.15  ? 348 HIS A HA   1 
ATOM   4989  H HB2  . HIS A 1 348 ? 24.276  -16.784 -38.990 1.00 34.71  ? 348 HIS A HB2  1 
ATOM   4990  H HB3  . HIS A 1 348 ? 24.365  -16.800 -40.577 1.00 34.71  ? 348 HIS A HB3  1 
ATOM   4991  H HD2  . HIS A 1 348 ? 21.746  -16.115 -41.699 1.00 34.62  ? 348 HIS A HD2  1 
ATOM   4992  H HE1  . HIS A 1 348 ? 20.927  -13.691 -38.679 1.00 38.64  ? 348 HIS A HE1  1 
ATOM   4993  H HE2  . HIS A 1 348 ? 20.312  -14.341 -40.868 1.00 33.21  ? 348 HIS A HE2  1 
ATOM   4994  N N    . MET A 1 349 ? 24.301  -20.276 -38.718 1.00 27.00  ? 349 MET A N    1 
ATOM   4995  C CA   . MET A 1 349 ? 25.328  -21.272 -38.468 1.00 36.28  ? 349 MET A CA   1 
ATOM   4996  C C    . MET A 1 349 ? 25.271  -22.339 -39.541 1.00 44.30  ? 349 MET A C    1 
ATOM   4997  O O    . MET A 1 349 ? 24.193  -22.669 -40.088 1.00 45.85  ? 349 MET A O    1 
ATOM   4998  C CB   . MET A 1 349 ? 25.153  -21.889 -37.088 1.00 32.65  ? 349 MET A CB   1 
ATOM   4999  C CG   . MET A 1 349 ? 25.808  -21.070 -36.001 1.00 34.18  ? 349 MET A CG   1 
ATOM   5000  S SD   . MET A 1 349 ? 25.533  -21.829 -34.402 1.00 50.76  ? 349 MET A SD   1 
ATOM   5001  C CE   . MET A 1 349 ? 25.573  -20.405 -33.300 1.00 42.98  ? 349 MET A CE   1 
ATOM   5002  O OXT  . MET A 1 349 ? 26.341  -22.850 -39.878 1.00 56.27  ? 349 MET A OXT  1 
ATOM   5003  H H    . MET A 1 349 ? 23.611  -20.354 -38.210 1.00 32.36  ? 349 MET A H    1 
ATOM   5004  H HA   . MET A 1 349 ? 26.197  -20.843 -38.496 1.00 43.49  ? 349 MET A HA   1 
ATOM   5005  H HB2  . MET A 1 349 ? 24.206  -21.952 -36.887 1.00 39.14  ? 349 MET A HB2  1 
ATOM   5006  H HB3  . MET A 1 349 ? 25.554  -22.772 -37.082 1.00 39.14  ? 349 MET A HB3  1 
ATOM   5007  H HG2  . MET A 1 349 ? 26.764  -21.026 -36.160 1.00 40.97  ? 349 MET A HG2  1 
ATOM   5008  H HG3  . MET A 1 349 ? 25.424  -20.180 -35.989 1.00 40.97  ? 349 MET A HG3  1 
ATOM   5009  H HE1  . MET A 1 349 ? 25.431  -20.706 -32.390 1.00 51.53  ? 349 MET A HE1  1 
ATOM   5010  H HE2  . MET A 1 349 ? 26.438  -19.972 -33.375 1.00 51.53  ? 349 MET A HE2  1 
ATOM   5011  H HE3  . MET A 1 349 ? 24.870  -19.787 -33.558 1.00 51.53  ? 349 MET A HE3  1 
ATOM   5012  N N    . ALA B 1 2   ? 44.818  -24.788 -55.850 1.00 71.93  ? 2   ALA B N    1 
ATOM   5013  C CA   . ALA B 1 2   ? 43.606  -24.668 -56.649 1.00 64.97  ? 2   ALA B CA   1 
ATOM   5014  C C    . ALA B 1 2   ? 42.581  -23.817 -55.904 1.00 68.96  ? 2   ALA B C    1 
ATOM   5015  O O    . ALA B 1 2   ? 41.380  -24.113 -55.902 1.00 63.98  ? 2   ALA B O    1 
ATOM   5016  C CB   . ALA B 1 2   ? 43.039  -26.035 -56.966 1.00 68.36  ? 2   ALA B CB   1 
ATOM   5017  H HA   . ALA B 1 2   ? 43.817  -24.225 -57.486 1.00 77.93  ? 2   ALA B HA   1 
ATOM   5018  H HB1  . ALA B 1 2   ? 42.235  -25.927 -57.498 1.00 82.00  ? 2   ALA B HB1  1 
ATOM   5019  H HB2  . ALA B 1 2   ? 43.699  -26.542 -57.464 1.00 82.00  ? 2   ALA B HB2  1 
ATOM   5020  H HB3  . ALA B 1 2   ? 42.829  -26.489 -56.136 1.00 82.00  ? 2   ALA B HB3  1 
ATOM   5021  N N    . SER B 1 3   ? 43.083  -22.768 -55.254 1.00 58.93  ? 3   SER B N    1 
ATOM   5022  C CA   . SER B 1 3   ? 42.224  -21.769 -54.635 1.00 43.30  ? 3   SER B CA   1 
ATOM   5023  C C    . SER B 1 3   ? 41.372  -21.079 -55.696 1.00 44.82  ? 3   SER B C    1 
ATOM   5024  O O    . SER B 1 3   ? 41.832  -20.819 -56.810 1.00 40.67  ? 3   SER B O    1 
ATOM   5025  C CB   . SER B 1 3   ? 43.092  -20.762 -53.891 1.00 39.53  ? 3   SER B CB   1 
ATOM   5026  O OG   . SER B 1 3   ? 43.679  -19.863 -54.807 1.00 37.93  ? 3   SER B OG   1 
ATOM   5027  H H    . SER B 1 3   ? 43.923  -22.614 -55.159 1.00 70.68  ? 3   SER B H    1 
ATOM   5028  H HA   . SER B 1 3   ? 41.634  -22.199 -53.997 1.00 51.92  ? 3   SER B HA   1 
ATOM   5029  H HB2  . SER B 1 3   ? 42.541  -20.266 -53.267 1.00 47.39  ? 3   SER B HB2  1 
ATOM   5030  H HB3  . SER B 1 3   ? 43.793  -21.236 -53.416 1.00 47.39  ? 3   SER B HB3  1 
ATOM   5031  H HG   . SER B 1 3   ? 44.158  -19.307 -54.397 1.00 45.47  ? 3   SER B HG   1 
ATOM   5032  N N    . LYS B 1 4   ? 40.112  -20.791 -55.352 1.00 39.38  ? 4   LYS B N    1 
ATOM   5033  C CA   . LYS B 1 4   ? 39.136  -20.336 -56.342 1.00 34.14  ? 4   LYS B CA   1 
ATOM   5034  C C    . LYS B 1 4   ? 39.289  -18.854 -56.625 1.00 25.63  ? 4   LYS B C    1 
ATOM   5035  O O    . LYS B 1 4   ? 39.450  -18.040 -55.705 1.00 31.20  ? 4   LYS B O    1 
ATOM   5036  C CB   . LYS B 1 4   ? 37.712  -20.608 -55.860 1.00 28.07  ? 4   LYS B CB   1 
ATOM   5037  C CG   . LYS B 1 4   ? 37.481  -22.025 -55.387 1.00 41.02  ? 4   LYS B CG   1 
ATOM   5038  C CD   . LYS B 1 4   ? 37.780  -23.040 -56.478 1.00 57.01  ? 4   LYS B CD   1 
ATOM   5039  C CE   . LYS B 1 4   ? 37.380  -24.456 -56.068 1.00 52.83  ? 4   LYS B CE   1 
ATOM   5040  N NZ   . LYS B 1 4   ? 36.071  -24.860 -56.698 1.00 54.06  ? 4   LYS B NZ   1 
ATOM   5041  H H    . LYS B 1 4   ? 39.800  -20.852 -54.553 1.00 47.22  ? 4   LYS B H    1 
ATOM   5042  H HA   . LYS B 1 4   ? 39.273  -20.819 -57.172 1.00 40.93  ? 4   LYS B HA   1 
ATOM   5043  H HB2  . LYS B 1 4   ? 37.514  -20.013 -55.120 1.00 33.64  ? 4   LYS B HB2  1 
ATOM   5044  H HB3  . LYS B 1 4   ? 37.097  -20.436 -56.591 1.00 33.64  ? 4   LYS B HB3  1 
ATOM   5045  H HG2  . LYS B 1 4   ? 38.063  -22.209 -54.634 1.00 49.18  ? 4   LYS B HG2  1 
ATOM   5046  H HG3  . LYS B 1 4   ? 36.552  -22.126 -55.124 1.00 49.18  ? 4   LYS B HG3  1 
ATOM   5047  H HD2  . LYS B 1 4   ? 37.282  -22.805 -57.276 1.00 68.37  ? 4   LYS B HD2  1 
ATOM   5048  H HD3  . LYS B 1 4   ? 38.732  -23.037 -56.663 1.00 68.37  ? 4   LYS B HD3  1 
ATOM   5049  H HE2  . LYS B 1 4   ? 38.063  -25.079 -56.359 1.00 63.35  ? 4   LYS B HE2  1 
ATOM   5050  H HE3  . LYS B 1 4   ? 37.278  -24.494 -55.104 1.00 63.35  ? 4   LYS B HE3  1 
ATOM   5051  H HZ1  . LYS B 1 4   ? 35.855  -25.686 -56.448 1.00 64.83  ? 4   LYS B HZ1  1 
ATOM   5052  H HZ2  . LYS B 1 4   ? 35.426  -24.302 -56.443 1.00 64.83  ? 4   LYS B HZ2  1 
ATOM   5053  H HZ3  . LYS B 1 4   ? 36.140  -24.835 -57.585 1.00 64.83  ? 4   LYS B HZ3  1 
ATOM   5054  N N    . LYS B 1 5   ? 39.209  -18.496 -57.903 1.00 28.98  ? 5   LYS B N    1 
ATOM   5055  C CA   . LYS B 1 5   ? 39.328  -17.113 -58.327 1.00 26.92  ? 5   LYS B CA   1 
ATOM   5056  C C    . LYS B 1 5   ? 37.957  -16.483 -58.536 1.00 31.64  ? 5   LYS B C    1 
ATOM   5057  O O    . LYS B 1 5   ? 37.059  -17.097 -59.120 1.00 26.10  ? 5   LYS B O    1 
ATOM   5058  C CB   . LYS B 1 5   ? 40.134  -17.006 -59.626 1.00 33.52  ? 5   LYS B CB   1 
ATOM   5059  C CG   . LYS B 1 5   ? 41.598  -17.451 -59.502 1.00 43.03  ? 5   LYS B CG   1 
ATOM   5060  C CD   . LYS B 1 5   ? 42.334  -17.250 -60.853 1.00 47.89  ? 5   LYS B CD   1 
ATOM   5061  C CE   . LYS B 1 5   ? 43.803  -17.636 -60.774 1.00 58.70  ? 5   LYS B CE   1 
ATOM   5062  N NZ   . LYS B 1 5   ? 43.999  -19.111 -60.759 1.00 62.67  ? 5   LYS B NZ   1 
ATOM   5063  H H    . LYS B 1 5   ? 39.084  -19.048 -58.551 1.00 34.73  ? 5   LYS B H    1 
ATOM   5064  H HA   . LYS B 1 5   ? 39.792  -16.608 -57.640 1.00 32.26  ? 5   LYS B HA   1 
ATOM   5065  H HB2  . LYS B 1 5   ? 39.712  -17.562 -60.300 1.00 40.18  ? 5   LYS B HB2  1 
ATOM   5066  H HB3  . LYS B 1 5   ? 40.131  -16.081 -59.918 1.00 40.18  ? 5   LYS B HB3  1 
ATOM   5067  H HG2  . LYS B 1 5   ? 42.043  -16.918 -58.826 1.00 51.59  ? 5   LYS B HG2  1 
ATOM   5068  H HG3  . LYS B 1 5   ? 41.632  -18.392 -59.270 1.00 51.59  ? 5   LYS B HG3  1 
ATOM   5069  H HD2  . LYS B 1 5   ? 41.913  -17.803 -61.530 1.00 57.42  ? 5   LYS B HD2  1 
ATOM   5070  H HD3  . LYS B 1 5   ? 42.282  -16.315 -61.107 1.00 57.42  ? 5   LYS B HD3  1 
ATOM   5071  H HE2  . LYS B 1 5   ? 44.267  -17.278 -61.547 1.00 70.40  ? 5   LYS B HE2  1 
ATOM   5072  H HE3  . LYS B 1 5   ? 44.183  -17.273 -59.959 1.00 70.40  ? 5   LYS B HE3  1 
ATOM   5073  H HZ1  . LYS B 1 5   ? 44.867  -19.301 -60.712 1.00 75.16  ? 5   LYS B HZ1  1 
ATOM   5074  H HZ2  . LYS B 1 5   ? 43.587  -19.465 -60.054 1.00 75.16  ? 5   LYS B HZ2  1 
ATOM   5075  H HZ3  . LYS B 1 5   ? 43.664  -19.470 -61.501 1.00 75.16  ? 5   LYS B HZ3  1 
ATOM   5076  N N    . VAL B 1 6   ? 37.816  -15.235 -58.089 1.00 27.90  ? 6   VAL B N    1 
ATOM   5077  C CA   . VAL B 1 6   ? 36.539  -14.538 -58.090 1.00 29.51  ? 6   VAL B CA   1 
ATOM   5078  C C    . VAL B 1 6   ? 36.589  -13.384 -59.079 1.00 22.90  ? 6   VAL B C    1 
ATOM   5079  O O    . VAL B 1 6   ? 37.559  -12.623 -59.106 1.00 25.64  ? 6   VAL B O    1 
ATOM   5080  C CB   . VAL B 1 6   ? 36.217  -14.030 -56.668 1.00 35.17  ? 6   VAL B CB   1 
ATOM   5081  C CG1  . VAL B 1 6   ? 34.910  -13.254 -56.650 1.00 29.61  ? 6   VAL B CG1  1 
ATOM   5082  C CG2  . VAL B 1 6   ? 36.128  -15.179 -55.712 1.00 25.88  ? 6   VAL B CG2  1 
ATOM   5083  H H    . VAL B 1 6   ? 38.463  -14.764 -57.774 1.00 33.44  ? 6   VAL B H    1 
ATOM   5084  H HA   . VAL B 1 6   ? 35.837  -15.149 -58.365 1.00 35.37  ? 6   VAL B HA   1 
ATOM   5085  H HB   . VAL B 1 6   ? 36.927  -13.439 -56.370 1.00 42.17  ? 6   VAL B HB   1 
ATOM   5086  H HG11 . VAL B 1 6   ? 34.737  -12.948 -55.745 1.00 35.50  ? 6   VAL B HG11 1 
ATOM   5087  H HG12 . VAL B 1 6   ? 34.986  -12.493 -57.247 1.00 35.50  ? 6   VAL B HG12 1 
ATOM   5088  H HG13 . VAL B 1 6   ? 34.193  -13.836 -56.946 1.00 35.50  ? 6   VAL B HG13 1 
ATOM   5089  H HG21 . VAL B 1 6   ? 35.926  -14.837 -54.826 1.00 31.01  ? 6   VAL B HG21 1 
ATOM   5090  H HG22 . VAL B 1 6   ? 35.424  -15.778 -56.004 1.00 31.01  ? 6   VAL B HG22 1 
ATOM   5091  H HG23 . VAL B 1 6   ? 36.978  -15.646 -55.701 1.00 31.01  ? 6   VAL B HG23 1 
ATOM   5092  N N    . CYS B 1 7   ? 35.528  -13.209 -59.860 1.00 23.33  ? 7   CYS B N    1 
ATOM   5093  C CA   . CYS B 1 7   ? 35.363  -11.990 -60.643 1.00 26.82  ? 7   CYS B CA   1 
ATOM   5094  C C    . CYS B 1 7   ? 34.022  -11.352 -60.300 1.00 30.05  ? 7   CYS B C    1 
ATOM   5095  O O    . CYS B 1 7   ? 33.007  -12.054 -60.301 1.00 27.51  ? 7   CYS B O    1 
ATOM   5096  C CB   . CYS B 1 7   ? 35.422  -12.295 -62.125 1.00 28.65  ? 7   CYS B CB   1 
ATOM   5097  S SG   . CYS B 1 7   ? 34.939  -10.909 -63.087 1.00 32.47  ? 7   CYS B SG   1 
ATOM   5098  H H    . CYS B 1 7   ? 34.891  -13.780 -59.954 1.00 27.95  ? 7   CYS B H    1 
ATOM   5099  H HA   . CYS B 1 7   ? 36.070  -11.363 -60.426 1.00 32.14  ? 7   CYS B HA   1 
ATOM   5100  H HB2  . CYS B 1 7   ? 36.331  -12.532 -62.367 1.00 34.34  ? 7   CYS B HB2  1 
ATOM   5101  H HB3  . CYS B 1 7   ? 34.819  -13.029 -62.325 1.00 34.34  ? 7   CYS B HB3  1 
ATOM   5102  H HG   . CYS B 1 7   ? 35.002  -11.199 -64.250 1.00 38.92  ? 7   CYS B HG   1 
ATOM   5103  N N    . ILE B 1 8   ? 34.008  -10.035 -60.023 1.00 28.70  ? 8   ILE B N    1 
ATOM   5104  C CA   . ILE B 1 8   ? 32.775  -9.287  -59.744 1.00 26.60  ? 8   ILE B CA   1 
ATOM   5105  C C    . ILE B 1 8   ? 32.391  -8.582  -61.033 1.00 33.84  ? 8   ILE B C    1 
ATOM   5106  O O    . ILE B 1 8   ? 33.045  -7.617  -61.445 1.00 30.70  ? 8   ILE B O    1 
ATOM   5107  C CB   . ILE B 1 8   ? 32.930  -8.264  -58.599 1.00 31.31  ? 8   ILE B CB   1 
ATOM   5108  C CG1  . ILE B 1 8   ? 33.502  -8.901  -57.328 1.00 35.98  ? 8   ILE B CG1  1 
ATOM   5109  C CG2  . ILE B 1 8   ? 31.542  -7.662  -58.254 1.00 28.37  ? 8   ILE B CG2  1 
ATOM   5110  C CD1  . ILE B 1 8   ? 33.866  -7.907  -56.205 1.00 27.20  ? 8   ILE B CD1  1 
ATOM   5111  H H    . ILE B 1 8   ? 34.716  -9.548  -59.991 1.00 34.40  ? 8   ILE B H    1 
ATOM   5112  H HA   . ILE B 1 8   ? 32.067  -9.907  -59.509 1.00 31.88  ? 8   ILE B HA   1 
ATOM   5113  H HB   . ILE B 1 8   ? 33.520  -7.551  -58.890 1.00 37.53  ? 8   ILE B HB   1 
ATOM   5114  H HG12 . ILE B 1 8   ? 32.845  -9.518  -56.970 1.00 43.14  ? 8   ILE B HG12 1 
ATOM   5115  H HG13 . ILE B 1 8   ? 34.309  -9.385  -57.562 1.00 43.14  ? 8   ILE B HG13 1 
ATOM   5116  H HG21 . ILE B 1 8   ? 31.647  -7.021  -57.534 1.00 34.00  ? 8   ILE B HG21 1 
ATOM   5117  H HG22 . ILE B 1 8   ? 31.184  -7.222  -59.040 1.00 34.00  ? 8   ILE B HG22 1 
ATOM   5118  H HG23 . ILE B 1 8   ? 30.949  -8.378  -57.976 1.00 34.00  ? 8   ILE B HG23 1 
ATOM   5119  H HD11 . ILE B 1 8   ? 34.217  -8.401  -55.448 1.00 32.60  ? 8   ILE B HD11 1 
ATOM   5120  H HD12 . ILE B 1 8   ? 34.536  -7.288  -56.536 1.00 32.60  ? 8   ILE B HD12 1 
ATOM   5121  H HD13 . ILE B 1 8   ? 33.068  -7.422  -55.942 1.00 32.60  ? 8   ILE B HD13 1 
ATOM   5122  N N    . VAL B 1 9   ? 31.334  -9.063  -61.677 1.00 29.68  ? 9   VAL B N    1 
ATOM   5123  C CA   . VAL B 1 9   ? 30.889  -8.529  -62.960 1.00 28.42  ? 9   VAL B CA   1 
ATOM   5124  C C    . VAL B 1 9   ? 29.892  -7.425  -62.632 1.00 27.75  ? 9   VAL B C    1 
ATOM   5125  O O    . VAL B 1 9   ? 28.718  -7.693  -62.412 1.00 31.98  ? 9   VAL B O    1 
ATOM   5126  C CB   . VAL B 1 9   ? 30.251  -9.610  -63.841 1.00 25.13  ? 9   VAL B CB   1 
ATOM   5127  C CG1  . VAL B 1 9   ? 29.887  -9.015  -65.170 1.00 32.10  ? 9   VAL B CG1  1 
ATOM   5128  C CG2  . VAL B 1 9   ? 31.157  -10.844 -63.997 1.00 30.05  ? 9   VAL B CG2  1 
ATOM   5129  H H    . VAL B 1 9   ? 30.849  -9.711  -61.386 1.00 35.57  ? 9   VAL B H    1 
ATOM   5130  H HA   . VAL B 1 9   ? 31.641  -8.141  -63.435 1.00 34.06  ? 9   VAL B HA   1 
ATOM   5131  H HB   . VAL B 1 9   ? 29.429  -9.904  -63.419 1.00 30.11  ? 9   VAL B HB   1 
ATOM   5132  H HG11 . VAL B 1 9   ? 29.484  -9.703  -65.723 1.00 38.48  ? 9   VAL B HG11 1 
ATOM   5133  H HG12 . VAL B 1 9   ? 29.257  -8.291  -65.029 1.00 38.48  ? 9   VAL B HG12 1 
ATOM   5134  H HG13 . VAL B 1 9   ? 30.691  -8.677  -65.594 1.00 38.48  ? 9   VAL B HG13 1 
ATOM   5135  H HG21 . VAL B 1 9   ? 30.710  -11.495 -64.560 1.00 36.02  ? 9   VAL B HG21 1 
ATOM   5136  H HG22 . VAL B 1 9   ? 31.994  -10.571 -64.405 1.00 36.02  ? 9   VAL B HG22 1 
ATOM   5137  H HG23 . VAL B 1 9   ? 31.326  -11.224 -63.120 1.00 36.02  ? 9   VAL B HG23 1 
ATOM   5138  N N    . GLY B 1 10  ? 30.357  -6.182  -62.629 1.00 31.62  ? 10  GLY B N    1 
ATOM   5139  C CA   . GLY B 1 10  ? 29.553  -5.070  -62.163 1.00 34.49  ? 10  GLY B CA   1 
ATOM   5140  C C    . GLY B 1 10  ? 30.371  -4.241  -61.198 1.00 39.08  ? 10  GLY B C    1 
ATOM   5141  O O    . GLY B 1 10  ? 31.183  -4.782  -60.443 1.00 33.52  ? 10  GLY B O    1 
ATOM   5142  H H    . GLY B 1 10  ? 31.143  -5.957  -62.895 1.00 37.90  ? 10  GLY B H    1 
ATOM   5143  H HA2  . GLY B 1 10  ? 29.284  -4.515  -62.911 1.00 41.35  ? 10  GLY B HA2  1 
ATOM   5144  H HA3  . GLY B 1 10  ? 28.761  -5.398  -61.708 1.00 41.35  ? 10  GLY B HA3  1 
ATOM   5145  N N    . SER B 1 11  ? 30.207  -2.926  -61.226 1.00 29.94  ? 11  SER B N    1 
ATOM   5146  C CA   . SER B 1 11  ? 30.971  -2.097  -60.304 1.00 41.04  ? 11  SER B CA   1 
ATOM   5147  C C    . SER B 1 11  ? 30.188  -0.866  -59.904 1.00 32.36  ? 11  SER B C    1 
ATOM   5148  O O    . SER B 1 11  ? 30.768  0.211   -59.731 1.00 29.26  ? 11  SER B O    1 
ATOM   5149  C CB   . SER B 1 11  ? 32.296  -1.694  -60.936 1.00 37.47  ? 11  SER B CB   1 
ATOM   5150  O OG   . SER B 1 11  ? 32.074  -0.934  -62.111 1.00 34.91  ? 11  SER B OG   1 
ATOM   5151  H H    . SER B 1 11  ? 29.677  -2.498  -61.751 1.00 35.89  ? 11  SER B H    1 
ATOM   5152  H HA   . SER B 1 11  ? 31.162  -2.607  -59.501 1.00 49.21  ? 11  SER B HA   1 
ATOM   5153  H HB2  . SER B 1 11  ? 32.799  -1.159  -60.303 1.00 44.92  ? 11  SER B HB2  1 
ATOM   5154  H HB3  . SER B 1 11  ? 32.793  -2.495  -61.166 1.00 44.92  ? 11  SER B HB3  1 
ATOM   5155  H HG   . SER B 1 11  ? 32.809  -0.716  -62.455 1.00 41.85  ? 11  SER B HG   1 
ATOM   5156  N N    . GLY B 1 12  ? 28.868  -0.984  -59.832 1.00 28.86  ? 12  GLY B N    1 
ATOM   5157  C CA   . GLY B 1 12  ? 28.037  0.120   -59.400 1.00 31.69  ? 12  GLY B CA   1 
ATOM   5158  C C    . GLY B 1 12  ? 27.984  0.236   -57.890 1.00 31.26  ? 12  GLY B C    1 
ATOM   5159  O O    . GLY B 1 12  ? 28.948  -0.063  -57.173 1.00 32.55  ? 12  GLY B O    1 
ATOM   5160  H H    . GLY B 1 12  ? 28.431  -1.698  -60.028 1.00 34.59  ? 12  GLY B H    1 
ATOM   5161  H HA2  . GLY B 1 12  ? 28.387  0.950   -59.761 1.00 37.99  ? 12  GLY B HA2  1 
ATOM   5162  H HA3  . GLY B 1 12  ? 27.134  -0.005  -59.732 1.00 37.99  ? 12  GLY B HA3  1 
ATOM   5163  N N    . ASN B 1 13  ? 26.821  0.673   -57.404 1.00 34.71  ? 13  ASN B N    1 
ATOM   5164  C CA   . ASN B 1 13  ? 26.617  0.893   -55.974 1.00 29.73  ? 13  ASN B CA   1 
ATOM   5165  C C    . ASN B 1 13  ? 26.761  -0.409  -55.216 1.00 30.70  ? 13  ASN B C    1 
ATOM   5166  O O    . ASN B 1 13  ? 27.518  -0.509  -54.242 1.00 26.84  ? 13  ASN B O    1 
ATOM   5167  C CB   . ASN B 1 13  ? 25.223  1.504   -55.761 1.00 28.97  ? 13  ASN B CB   1 
ATOM   5168  C CG   . ASN B 1 13  ? 24.991  2.008   -54.353 1.00 38.17  ? 13  ASN B CG   1 
ATOM   5169  O OD1  . ASN B 1 13  ? 23.869  1.944   -53.848 1.00 33.33  ? 13  ASN B OD1  1 
ATOM   5170  N ND2  . ASN B 1 13  ? 26.019  2.549   -53.733 1.00 39.34  ? 13  ASN B ND2  1 
ATOM   5171  H H    . ASN B 1 13  ? 26.131  0.850   -57.886 1.00 41.61  ? 13  ASN B H    1 
ATOM   5172  H HA   . ASN B 1 13  ? 27.281  1.518   -55.644 1.00 35.63  ? 13  ASN B HA   1 
ATOM   5173  H HB2  . ASN B 1 13  ? 25.114  2.255   -56.367 1.00 34.72  ? 13  ASN B HB2  1 
ATOM   5174  H HB3  . ASN B 1 13  ? 24.552  0.829   -55.950 1.00 34.72  ? 13  ASN B HB3  1 
ATOM   5175  H HD21 . ASN B 1 13  ? 25.928  2.852   -52.933 1.00 47.16  ? 13  ASN B HD21 1 
ATOM   5176  H HD22 . ASN B 1 13  ? 26.785  2.584   -54.121 1.00 47.16  ? 13  ASN B HD22 1 
ATOM   5177  N N    . TRP B 1 14  ? 26.038  -1.423  -55.658 1.00 28.66  ? 14  TRP B N    1 
ATOM   5178  C CA   . TRP B 1 14  ? 26.013  -2.721  -55.005 1.00 27.48  ? 14  TRP B CA   1 
ATOM   5179  C C    . TRP B 1 14  ? 27.291  -3.496  -55.288 1.00 28.90  ? 14  TRP B C    1 
ATOM   5180  O O    . TRP B 1 14  ? 27.870  -4.108  -54.385 1.00 27.76  ? 14  TRP B O    1 
ATOM   5181  C CB   . TRP B 1 14  ? 24.766  -3.447  -55.505 1.00 33.08  ? 14  TRP B CB   1 
ATOM   5182  C CG   . TRP B 1 14  ? 24.232  -4.622  -54.790 1.00 33.46  ? 14  TRP B CG   1 
ATOM   5183  C CD1  . TRP B 1 14  ? 23.470  -5.590  -55.352 1.00 31.23  ? 14  TRP B CD1  1 
ATOM   5184  C CD2  . TRP B 1 14  ? 24.371  -4.978  -53.398 1.00 33.98  ? 14  TRP B CD2  1 
ATOM   5185  N NE1  . TRP B 1 14  ? 23.138  -6.546  -54.419 1.00 29.83  ? 14  TRP B NE1  1 
ATOM   5186  C CE2  . TRP B 1 14  ? 23.674  -6.193  -53.211 1.00 35.19  ? 14  TRP B CE2  1 
ATOM   5187  C CE3  . TRP B 1 14  ? 25.023  -4.400  -52.303 1.00 32.14  ? 14  TRP B CE3  1 
ATOM   5188  C CZ2  . TRP B 1 14  ? 23.584  -6.832  -51.970 1.00 38.37  ? 14  TRP B CZ2  1 
ATOM   5189  C CZ3  . TRP B 1 14  ? 24.948  -5.046  -51.062 1.00 44.66  ? 14  TRP B CZ3  1 
ATOM   5190  C CH2  . TRP B 1 14  ? 24.231  -6.247  -50.909 1.00 41.92  ? 14  TRP B CH2  1 
ATOM   5191  H H    . TRP B 1 14  ? 25.538  -1.383  -56.357 1.00 34.35  ? 14  TRP B H    1 
ATOM   5192  H HA   . TRP B 1 14  ? 25.934  -2.599  -54.046 1.00 32.93  ? 14  TRP B HA   1 
ATOM   5193  H HB2  . TRP B 1 14  ? 24.046  -2.797  -55.532 1.00 39.65  ? 14  TRP B HB2  1 
ATOM   5194  H HB3  . TRP B 1 14  ? 24.949  -3.741  -56.411 1.00 39.65  ? 14  TRP B HB3  1 
ATOM   5195  H HD1  . TRP B 1 14  ? 23.223  -5.616  -56.249 1.00 37.43  ? 14  TRP B HD1  1 
ATOM   5196  H HE1  . TRP B 1 14  ? 22.655  -7.243  -54.567 1.00 35.76  ? 14  TRP B HE1  1 
ATOM   5197  H HE3  . TRP B 1 14  ? 25.493  -3.603  -52.395 1.00 38.52  ? 14  TRP B HE3  1 
ATOM   5198  H HZ2  . TRP B 1 14  ? 23.121  -7.633  -51.872 1.00 46.00  ? 14  TRP B HZ2  1 
ATOM   5199  H HZ3  . TRP B 1 14  ? 25.372  -4.671  -50.325 1.00 53.54  ? 14  TRP B HZ3  1 
ATOM   5200  H HH2  . TRP B 1 14  ? 24.201  -6.656  -50.075 1.00 50.27  ? 14  TRP B HH2  1 
ATOM   5201  N N    . GLY B 1 15  ? 27.753  -3.466  -56.537 1.00 28.21  ? 15  GLY B N    1 
ATOM   5202  C CA   . GLY B 1 15  ? 28.997  -4.136  -56.869 1.00 24.22  ? 15  GLY B CA   1 
ATOM   5203  C C    . GLY B 1 15  ? 30.142  -3.650  -56.008 1.00 21.70  ? 15  GLY B C    1 
ATOM   5204  O O    . GLY B 1 15  ? 30.861  -4.443  -55.406 1.00 26.81  ? 15  GLY B O    1 
ATOM   5205  H H    . GLY B 1 15  ? 27.369  -3.070  -57.197 1.00 33.81  ? 15  GLY B H    1 
ATOM   5206  H HA2  . GLY B 1 15  ? 28.897  -5.092  -56.739 1.00 29.03  ? 15  GLY B HA2  1 
ATOM   5207  H HA3  . GLY B 1 15  ? 29.218  -3.971  -57.799 1.00 29.03  ? 15  GLY B HA3  1 
ATOM   5208  N N    . SER B 1 16  ? 30.287  -2.331  -55.901 1.00 24.37  ? 16  SER B N    1 
ATOM   5209  C CA   . SER B 1 16  ? 31.370  -1.761  -55.098 1.00 27.88  ? 16  SER B CA   1 
ATOM   5210  C C    . SER B 1 16  ? 31.229  -2.156  -53.633 1.00 30.30  ? 16  SER B C    1 
ATOM   5211  O O    . SER B 1 16  ? 32.203  -2.572  -52.996 1.00 27.84  ? 16  SER B O    1 
ATOM   5212  C CB   . SER B 1 16  ? 31.381  -0.240  -55.226 1.00 23.21  ? 16  SER B CB   1 
ATOM   5213  O OG   . SER B 1 16  ? 31.605  0.181   -56.550 1.00 28.27  ? 16  SER B OG   1 
ATOM   5214  H H    . SER B 1 16  ? 29.779  -1.749  -56.279 1.00 29.20  ? 16  SER B H    1 
ATOM   5215  H HA   . SER B 1 16  ? 32.219  -2.099  -55.422 1.00 33.42  ? 16  SER B HA   1 
ATOM   5216  H HB2  . SER B 1 16  ? 30.523  0.104   -54.931 1.00 27.80  ? 16  SER B HB2  1 
ATOM   5217  H HB3  . SER B 1 16  ? 32.086  0.115   -54.662 1.00 27.80  ? 16  SER B HB3  1 
ATOM   5218  H HG   . SER B 1 16  ? 31.000  -0.114  -57.052 1.00 33.88  ? 16  SER B HG   1 
ATOM   5219  N N    . ALA B 1 17  ? 30.017  -2.033  -53.071 1.00 26.07  ? 17  ALA B N    1 
ATOM   5220  C CA   . ALA B 1 17  ? 29.849  -2.446  -51.673 1.00 21.18  ? 17  ALA B CA   1 
ATOM   5221  C C    . ALA B 1 17  ? 30.133  -3.928  -51.506 1.00 32.54  ? 17  ALA B C    1 
ATOM   5222  O O    . ALA B 1 17  ? 30.760  -4.353  -50.528 1.00 26.64  ? 17  ALA B O    1 
ATOM   5223  C CB   . ALA B 1 17  ? 28.458  -2.124  -51.156 1.00 26.06  ? 17  ALA B CB   1 
ATOM   5224  H H    . ALA B 1 17  ? 29.310  -1.730  -53.456 1.00 31.24  ? 17  ALA B H    1 
ATOM   5225  H HA   . ALA B 1 17  ? 30.487  -1.961  -51.127 1.00 25.37  ? 17  ALA B HA   1 
ATOM   5226  H HB1  . ALA B 1 17  ? 28.390  -2.412  -50.232 1.00 31.23  ? 17  ALA B HB1  1 
ATOM   5227  H HB2  . ALA B 1 17  ? 28.313  -1.167  -51.215 1.00 31.23  ? 17  ALA B HB2  1 
ATOM   5228  H HB3  . ALA B 1 17  ? 27.803  -2.592  -51.698 1.00 31.23  ? 17  ALA B HB3  1 
ATOM   5229  N N    . ILE B 1 18  ? 29.676  -4.742  -52.446 1.00 28.38  ? 18  ILE B N    1 
ATOM   5230  C CA   . ILE B 1 18  ? 29.960  -6.167  -52.326 1.00 30.64  ? 18  ILE B CA   1 
ATOM   5231  C C    . ILE B 1 18  ? 31.459  -6.410  -52.427 1.00 23.24  ? 18  ILE B C    1 
ATOM   5232  O O    . ILE B 1 18  ? 31.990  -7.350  -51.808 1.00 22.93  ? 18  ILE B O    1 
ATOM   5233  C CB   . ILE B 1 18  ? 29.172  -6.940  -53.405 1.00 34.56  ? 18  ILE B CB   1 
ATOM   5234  C CG1  . ILE B 1 18  ? 27.739  -7.148  -52.918 1.00 33.02  ? 18  ILE B CG1  1 
ATOM   5235  C CG2  . ILE B 1 18  ? 29.840  -8.257  -53.755 1.00 38.97  ? 18  ILE B CG2  1 
ATOM   5236  C CD1  . ILE B 1 18  ? 27.629  -8.135  -51.749 1.00 43.48  ? 18  ILE B CD1  1 
ATOM   5237  H H    . ILE B 1 18  ? 29.219  -4.511  -53.136 1.00 34.02  ? 18  ILE B H    1 
ATOM   5238  H HA   . ILE B 1 18  ? 29.663  -6.478  -51.456 1.00 36.73  ? 18  ILE B HA   1 
ATOM   5239  H HB   . ILE B 1 18  ? 29.143  -6.395  -54.206 1.00 41.43  ? 18  ILE B HB   1 
ATOM   5240  H HG12 . ILE B 1 18  ? 27.381  -6.296  -52.623 1.00 39.58  ? 18  ILE B HG12 1 
ATOM   5241  H HG13 . ILE B 1 18  ? 27.206  -7.494  -53.651 1.00 39.58  ? 18  ILE B HG13 1 
ATOM   5242  H HG21 . ILE B 1 18  ? 29.313  -8.708  -54.433 1.00 46.72  ? 18  ILE B HG21 1 
ATOM   5243  H HG22 . ILE B 1 18  ? 30.732  -8.079  -54.092 1.00 46.72  ? 18  ILE B HG22 1 
ATOM   5244  H HG23 . ILE B 1 18  ? 29.892  -8.807  -52.957 1.00 46.72  ? 18  ILE B HG23 1 
ATOM   5245  H HD11 . ILE B 1 18  ? 26.697  -8.218  -51.493 1.00 52.13  ? 18  ILE B HD11 1 
ATOM   5246  H HD12 . ILE B 1 18  ? 27.973  -8.997  -52.031 1.00 52.13  ? 18  ILE B HD12 1 
ATOM   5247  H HD13 . ILE B 1 18  ? 28.148  -7.799  -51.002 1.00 52.13  ? 18  ILE B HD13 1 
ATOM   5248  N N    . ALA B 1 19  ? 32.154  -5.578  -53.208 1.00 20.74  ? 19  ALA B N    1 
ATOM   5249  C CA   . ALA B 1 19  ? 33.610  -5.703  -53.328 1.00 27.89  ? 19  ALA B CA   1 
ATOM   5250  C C    . ALA B 1 19  ? 34.303  -5.497  -51.989 1.00 27.76  ? 19  ALA B C    1 
ATOM   5251  O O    . ALA B 1 19  ? 35.325  -6.136  -51.720 1.00 30.35  ? 19  ALA B O    1 
ATOM   5252  C CB   . ALA B 1 19  ? 34.169  -4.703  -54.344 1.00 28.37  ? 19  ALA B CB   1 
ATOM   5253  H H    . ALA B 1 19  ? 31.812  -4.941  -53.672 1.00 24.85  ? 19  ALA B H    1 
ATOM   5254  H HA   . ALA B 1 19  ? 33.824  -6.596  -53.640 1.00 33.43  ? 19  ALA B HA   1 
ATOM   5255  H HB1  . ALA B 1 19  ? 35.131  -4.813  -54.398 1.00 34.00  ? 19  ALA B HB1  1 
ATOM   5256  H HB2  . ALA B 1 19  ? 33.767  -4.875  -55.210 1.00 34.00  ? 19  ALA B HB2  1 
ATOM   5257  H HB3  . ALA B 1 19  ? 33.954  -3.803  -54.052 1.00 34.00  ? 19  ALA B HB3  1 
ATOM   5258  N N    . LYS B 1 20  ? 33.774  -4.615  -51.128 1.00 26.88  ? 20  LYS B N    1 
ATOM   5259  C CA   . LYS B 1 20  ? 34.436  -4.425  -49.829 1.00 25.15  ? 20  LYS B CA   1 
ATOM   5260  C C    . LYS B 1 20  ? 34.485  -5.721  -49.057 1.00 25.84  ? 20  LYS B C    1 
ATOM   5261  O O    . LYS B 1 20  ? 35.500  -6.050  -48.439 1.00 30.12  ? 20  LYS B O    1 
ATOM   5262  C CB   . LYS B 1 20  ? 33.738  -3.372  -48.987 1.00 34.56  ? 20  LYS B CB   1 
ATOM   5263  C CG   . LYS B 1 20  ? 33.779  -2.017  -49.573 1.00 26.84  ? 20  LYS B CG   1 
ATOM   5264  C CD   . LYS B 1 20  ? 33.168  -1.018  -48.627 1.00 34.39  ? 20  LYS B CD   1 
ATOM   5265  C CE   . LYS B 1 20  ? 34.113  -0.710  -47.489 1.00 34.92  ? 20  LYS B CE   1 
ATOM   5266  N NZ   . LYS B 1 20  ? 33.414  0.183   -46.552 1.00 39.05  ? 20  LYS B NZ   1 
ATOM   5267  H H    . LYS B 1 20  ? 33.071  -4.139  -51.261 1.00 32.21  ? 20  LYS B H    1 
ATOM   5268  H HA   . LYS B 1 20  ? 35.348  -4.132  -49.980 1.00 30.13  ? 20  LYS B HA   1 
ATOM   5269  H HB2  . LYS B 1 20  ? 32.806  -3.622  -48.883 1.00 41.43  ? 20  LYS B HB2  1 
ATOM   5270  H HB3  . LYS B 1 20  ? 34.166  -3.333  -48.118 1.00 41.43  ? 20  LYS B HB3  1 
ATOM   5271  H HG2  . LYS B 1 20  ? 34.701  -1.762  -49.736 1.00 32.17  ? 20  LYS B HG2  1 
ATOM   5272  H HG3  . LYS B 1 20  ? 33.273  -2.006  -50.401 1.00 32.17  ? 20  LYS B HG3  1 
ATOM   5273  H HD2  . LYS B 1 20  ? 32.983  -0.194  -49.103 1.00 41.22  ? 20  LYS B HD2  1 
ATOM   5274  H HD3  . LYS B 1 20  ? 32.350  -1.385  -48.255 1.00 41.22  ? 20  LYS B HD3  1 
ATOM   5275  H HE2  . LYS B 1 20  ? 34.352  -1.528  -47.026 1.00 41.87  ? 20  LYS B HE2  1 
ATOM   5276  H HE3  . LYS B 1 20  ? 34.902  -0.258  -47.827 1.00 41.87  ? 20  LYS B HE3  1 
ATOM   5277  H HZ1  . LYS B 1 20  ? 33.948  0.384   -45.868 1.00 46.82  ? 20  LYS B HZ1  1 
ATOM   5278  H HZ2  . LYS B 1 20  ? 33.180  0.935   -46.967 1.00 46.82  ? 20  LYS B HZ2  1 
ATOM   5279  H HZ3  . LYS B 1 20  ? 32.682  -0.215  -46.241 1.00 46.82  ? 20  LYS B HZ3  1 
ATOM   5280  N N    . ILE B 1 21  ? 33.414  -6.500  -49.118 1.00 21.98  ? 21  ILE B N    1 
ATOM   5281  C CA   . ILE B 1 21  ? 33.369  -7.738  -48.357 1.00 25.25  ? 21  ILE B CA   1 
ATOM   5282  C C    . ILE B 1 21  ? 34.179  -8.806  -49.053 1.00 25.70  ? 21  ILE B C    1 
ATOM   5283  O O    . ILE B 1 21  ? 34.994  -9.506  -48.442 1.00 29.19  ? 21  ILE B O    1 
ATOM   5284  C CB   . ILE B 1 21  ? 31.920  -8.195  -48.189 1.00 22.45  ? 21  ILE B CB   1 
ATOM   5285  C CG1  . ILE B 1 21  ? 31.168  -7.177  -47.351 1.00 31.94  ? 21  ILE B CG1  1 
ATOM   5286  C CG2  . ILE B 1 21  ? 31.908  -9.592  -47.570 1.00 30.85  ? 21  ILE B CG2  1 
ATOM   5287  C CD1  . ILE B 1 21  ? 29.709  -7.503  -47.249 1.00 34.07  ? 21  ILE B CD1  1 
ATOM   5288  H H    . ILE B 1 21  ? 32.710  -6.338  -49.585 1.00 26.33  ? 21  ILE B H    1 
ATOM   5289  H HA   . ILE B 1 21  ? 33.749  -7.590  -47.477 1.00 30.25  ? 21  ILE B HA   1 
ATOM   5290  H HB   . ILE B 1 21  ? 31.505  -8.241  -49.065 1.00 26.90  ? 21  ILE B HB   1 
ATOM   5291  H HG12 . ILE B 1 21  ? 31.539  -7.167  -46.455 1.00 38.29  ? 21  ILE B HG12 1 
ATOM   5292  H HG13 . ILE B 1 21  ? 31.255  -6.302  -47.760 1.00 38.29  ? 21  ILE B HG13 1 
ATOM   5293  H HG21 . ILE B 1 21  ? 30.988  -9.881  -47.463 1.00 36.98  ? 21  ILE B HG21 1 
ATOM   5294  H HG22 . ILE B 1 21  ? 32.381  -10.201 -48.157 1.00 36.98  ? 21  ILE B HG22 1 
ATOM   5295  H HG23 . ILE B 1 21  ? 32.347  -9.557  -46.705 1.00 36.98  ? 21  ILE B HG23 1 
ATOM   5296  H HD11 . ILE B 1 21  ? 29.273  -6.827  -46.706 1.00 40.84  ? 21  ILE B HD11 1 
ATOM   5297  H HD12 . ILE B 1 21  ? 29.324  -7.511  -48.140 1.00 40.84  ? 21  ILE B HD12 1 
ATOM   5298  H HD13 . ILE B 1 21  ? 29.608  -8.375  -46.837 1.00 40.84  ? 21  ILE B HD13 1 
ATOM   5299  N N    . VAL B 1 22  ? 33.944  -8.945  -50.346 1.00 22.85  ? 22  VAL B N    1 
ATOM   5300  C CA   . VAL B 1 22  ? 34.509  -10.062 -51.088 1.00 25.43  ? 22  VAL B CA   1 
ATOM   5301  C C    . VAL B 1 22  ? 36.028  -9.974  -51.083 1.00 18.54  ? 22  VAL B C    1 
ATOM   5302  O O    . VAL B 1 22  ? 36.718  -10.971 -50.863 1.00 29.62  ? 22  VAL B O    1 
ATOM   5303  C CB   . VAL B 1 22  ? 33.946  -10.091 -52.517 1.00 25.22  ? 22  VAL B CB   1 
ATOM   5304  C CG1  . VAL B 1 22  ? 34.621  -11.183 -53.274 1.00 29.62  ? 22  VAL B CG1  1 
ATOM   5305  C CG2  . VAL B 1 22  ? 32.406  -10.377 -52.504 1.00 28.13  ? 22  VAL B CG2  1 
ATOM   5306  H H    . VAL B 1 22  ? 33.462  -8.411  -50.818 1.00 27.38  ? 22  VAL B H    1 
ATOM   5307  H HA   . VAL B 1 22  ? 34.256  -10.890 -50.651 1.00 30.48  ? 22  VAL B HA   1 
ATOM   5308  H HB   . VAL B 1 22  ? 34.111  -9.244  -52.962 1.00 30.22  ? 22  VAL B HB   1 
ATOM   5309  H HG11 . VAL B 1 22  ? 34.268  -11.205 -54.177 1.00 35.50  ? 22  VAL B HG11 1 
ATOM   5310  H HG12 . VAL B 1 22  ? 35.575  -11.010 -53.295 1.00 35.50  ? 22  VAL B HG12 1 
ATOM   5311  H HG13 . VAL B 1 22  ? 34.447  -12.028 -52.830 1.00 35.50  ? 22  VAL B HG13 1 
ATOM   5312  H HG21 . VAL B 1 22  ? 32.079  -10.390 -53.417 1.00 33.72  ? 22  VAL B HG21 1 
ATOM   5313  H HG22 . VAL B 1 22  ? 32.249  -11.238 -52.084 1.00 33.72  ? 22  VAL B HG22 1 
ATOM   5314  H HG23 . VAL B 1 22  ? 31.960  -9.678  -52.002 1.00 33.72  ? 22  VAL B HG23 1 
ATOM   5315  N N    . GLY B 1 23  ? 36.557  -8.778  -51.312 1.00 22.36  ? 23  GLY B N    1 
ATOM   5316  C CA   . GLY B 1 23  ? 37.996  -8.587  -51.250 1.00 25.56  ? 23  GLY B CA   1 
ATOM   5317  C C    . GLY B 1 23  ? 38.563  -9.024  -49.915 1.00 23.92  ? 23  GLY B C    1 
ATOM   5318  O O    . GLY B 1 23  ? 39.546  -9.766  -49.850 1.00 29.45  ? 23  GLY B O    1 
ATOM   5319  H H    . GLY B 1 23  ? 36.109  -8.070  -51.504 1.00 26.79  ? 23  GLY B H    1 
ATOM   5320  H HA2  . GLY B 1 23  ? 38.424  -9.103  -51.951 1.00 30.63  ? 23  GLY B HA2  1 
ATOM   5321  H HA3  . GLY B 1 23  ? 38.206  -7.649  -51.383 1.00 30.63  ? 23  GLY B HA3  1 
ATOM   5322  N N    . GLY B 1 24  ? 37.902  -8.628  -48.822 1.00 26.41  ? 24  GLY B N    1 
ATOM   5323  C CA   . GLY B 1 24  ? 38.423  -8.982  -47.522 1.00 17.41  ? 24  GLY B CA   1 
ATOM   5324  C C    . GLY B 1 24  ? 38.370  -10.473 -47.295 1.00 27.86  ? 24  GLY B C    1 
ATOM   5325  O O    . GLY B 1 24  ? 39.328  -11.080 -46.812 1.00 26.65  ? 24  GLY B O    1 
ATOM   5326  H H    . GLY B 1 24  ? 37.175  -8.168  -48.814 1.00 31.66  ? 24  GLY B H    1 
ATOM   5327  H HA2  . GLY B 1 24  ? 39.345  -8.689  -47.449 1.00 20.86  ? 24  GLY B HA2  1 
ATOM   5328  H HA3  . GLY B 1 24  ? 37.902  -8.544  -46.831 1.00 20.86  ? 24  GLY B HA3  1 
ATOM   5329  N N    . ASN B 1 25  ? 37.252  -11.098 -47.647 1.00 23.24  ? 25  ASN B N    1 
ATOM   5330  C CA   . ASN B 1 25  ? 37.160  -12.520 -47.378 1.00 21.60  ? 25  ASN B CA   1 
ATOM   5331  C C    . ASN B 1 25  ? 38.084  -13.317 -48.288 1.00 25.13  ? 25  ASN B C    1 
ATOM   5332  O O    . ASN B 1 25  ? 38.598  -14.368 -47.890 1.00 27.24  ? 25  ASN B O    1 
ATOM   5333  C CB   . ASN B 1 25  ? 35.702  -12.952 -47.507 1.00 26.31  ? 25  ASN B CB   1 
ATOM   5334  C CG   . ASN B 1 25  ? 34.867  -12.525 -46.279 1.00 26.16  ? 25  ASN B CG   1 
ATOM   5335  O OD1  . ASN B 1 25  ? 35.404  -12.412 -45.181 1.00 25.08  ? 25  ASN B OD1  1 
ATOM   5336  N ND2  . ASN B 1 25  ? 33.565  -12.301 -46.466 1.00 25.20  ? 25  ASN B ND2  1 
ATOM   5337  H H    . ASN B 1 25  ? 36.566  -10.740 -48.023 1.00 27.85  ? 25  ASN B H    1 
ATOM   5338  H HA   . ASN B 1 25  ? 37.437  -12.682 -46.462 1.00 25.88  ? 25  ASN B HA   1 
ATOM   5339  H HB2  . ASN B 1 25  ? 35.315  -12.539 -48.295 1.00 31.53  ? 25  ASN B HB2  1 
ATOM   5340  H HB3  . ASN B 1 25  ? 35.661  -13.918 -47.580 1.00 31.53  ? 25  ASN B HB3  1 
ATOM   5341  H HD21 . ASN B 1 25  ? 33.070  -12.062 -45.804 1.00 30.20  ? 25  ASN B HD21 1 
ATOM   5342  H HD22 . ASN B 1 25  ? 33.221  -12.391 -47.249 1.00 30.20  ? 25  ASN B HD22 1 
ATOM   5343  N N    . ALA B 1 26  ? 38.291  -12.838 -49.508 1.00 29.23  ? 26  ALA B N    1 
ATOM   5344  C CA   . ALA B 1 26  ? 39.113  -13.576 -50.461 1.00 37.32  ? 26  ALA B CA   1 
ATOM   5345  C C    . ALA B 1 26  ? 40.586  -13.517 -50.091 1.00 28.83  ? 26  ALA B C    1 
ATOM   5346  O O    . ALA B 1 26  ? 41.307  -14.473 -50.346 1.00 38.05  ? 26  ALA B O    1 
ATOM   5347  C CB   . ALA B 1 26  ? 38.918  -13.017 -51.860 1.00 23.59  ? 26  ALA B CB   1 
ATOM   5348  H H    . ALA B 1 26  ? 37.971  -12.098 -49.808 1.00 35.04  ? 26  ALA B H    1 
ATOM   5349  H HA   . ALA B 1 26  ? 38.838  -14.506 -50.465 1.00 44.74  ? 26  ALA B HA   1 
ATOM   5350  H HB1  . ALA B 1 26  ? 39.471  -13.518 -52.479 1.00 28.27  ? 26  ALA B HB1  1 
ATOM   5351  H HB2  . ALA B 1 26  ? 37.983  -13.103 -52.106 1.00 28.27  ? 26  ALA B HB2  1 
ATOM   5352  H HB3  . ALA B 1 26  ? 39.178  -12.083 -51.865 1.00 28.27  ? 26  ALA B HB3  1 
ATOM   5353  N N    . ALA B 1 27  ? 41.042  -12.396 -49.523 1.00 29.35  ? 27  ALA B N    1 
ATOM   5354  C CA   . ALA B 1 27  ? 42.381  -12.317 -48.916 1.00 26.44  ? 27  ALA B CA   1 
ATOM   5355  C C    . ALA B 1 27  ? 42.515  -13.249 -47.722 1.00 36.51  ? 27  ALA B C    1 
ATOM   5356  O O    . ALA B 1 27  ? 43.489  -14.010 -47.609 1.00 33.05  ? 27  ALA B O    1 
ATOM   5357  C CB   . ALA B 1 27  ? 42.655  -10.884 -48.491 1.00 34.64  ? 27  ALA B CB   1 
ATOM   5358  H H    . ALA B 1 27  ? 40.595  -11.663 -49.474 1.00 35.18  ? 27  ALA B H    1 
ATOM   5359  H HA   . ALA B 1 27  ? 43.046  -12.571 -49.575 1.00 31.68  ? 27  ALA B HA   1 
ATOM   5360  H HB1  . ALA B 1 27  ? 43.538  -10.836 -48.092 1.00 41.53  ? 27  ALA B HB1  1 
ATOM   5361  H HB2  . ALA B 1 27  ? 42.613  -10.310 -49.273 1.00 41.53  ? 27  ALA B HB2  1 
ATOM   5362  H HB3  . ALA B 1 27  ? 41.984  -10.613 -47.845 1.00 41.53  ? 27  ALA B HB3  1 
ATOM   5363  N N    . GLN B 1 28  ? 41.541  -13.220 -46.804 1.00 32.21  ? 28  GLN B N    1 
ATOM   5364  C CA   . GLN B 1 28  ? 41.796  -13.867 -45.524 1.00 25.06  ? 28  GLN B CA   1 
ATOM   5365  C C    . GLN B 1 28  ? 41.719  -15.378 -45.609 1.00 31.57  ? 28  GLN B C    1 
ATOM   5366  O O    . GLN B 1 28  ? 42.461  -16.066 -44.902 1.00 26.25  ? 28  GLN B O    1 
ATOM   5367  C CB   . GLN B 1 28  ? 40.810  -13.385 -44.454 1.00 38.06  ? 28  GLN B CB   1 
ATOM   5368  C CG   . GLN B 1 28  ? 41.160  -14.006 -43.109 1.00 36.51  ? 28  GLN B CG   1 
ATOM   5369  C CD   . GLN B 1 28  ? 40.238  -13.610 -41.999 1.00 43.91  ? 28  GLN B CD   1 
ATOM   5370  O OE1  . GLN B 1 28  ? 39.113  -13.168 -42.232 1.00 41.96  ? 28  GLN B OE1  1 
ATOM   5371  N NE2  . GLN B 1 28  ? 40.699  -13.806 -40.765 1.00 43.60  ? 28  GLN B NE2  1 
ATOM   5372  H H    . GLN B 1 28  ? 40.768  -12.853 -46.894 1.00 38.61  ? 28  GLN B H    1 
ATOM   5373  H HA   . GLN B 1 28  ? 42.690  -13.632 -45.229 1.00 30.03  ? 28  GLN B HA   1 
ATOM   5374  H HB2  . GLN B 1 28  ? 40.865  -12.420 -44.373 1.00 45.63  ? 28  GLN B HB2  1 
ATOM   5375  H HB3  . GLN B 1 28  ? 39.911  -13.656 -44.696 1.00 45.63  ? 28  GLN B HB3  1 
ATOM   5376  H HG2  . GLN B 1 28  ? 41.124  -14.972 -43.193 1.00 43.77  ? 28  GLN B HG2  1 
ATOM   5377  H HG3  . GLN B 1 28  ? 42.057  -13.731 -42.862 1.00 43.77  ? 28  GLN B HG3  1 
ATOM   5378  H HE21 . GLN B 1 28  ? 41.489  -14.124 -40.646 1.00 52.28  ? 28  GLN B HE21 1 
ATOM   5379  H HE22 . GLN B 1 28  ? 40.212  -13.600 -40.086 1.00 52.28  ? 28  GLN B HE22 1 
ATOM   5380  N N    . LEU B 1 29  ? 40.815  -15.918 -46.436 1.00 29.83  ? 29  LEU B N    1 
ATOM   5381  C CA   . LEU B 1 29  ? 40.518  -17.340 -46.416 1.00 27.88  ? 29  LEU B CA   1 
ATOM   5382  C C    . LEU B 1 29  ? 41.369  -18.034 -47.459 1.00 24.69  ? 29  LEU B C    1 
ATOM   5383  O O    . LEU B 1 29  ? 41.508  -17.557 -48.587 1.00 39.23  ? 29  LEU B O    1 
ATOM   5384  C CB   . LEU B 1 29  ? 39.030  -17.594 -46.674 1.00 32.92  ? 29  LEU B CB   1 
ATOM   5385  C CG   . LEU B 1 29  ? 38.051  -16.806 -45.755 1.00 28.26  ? 29  LEU B CG   1 
ATOM   5386  C CD1  . LEU B 1 29  ? 36.589  -16.923 -46.169 1.00 27.88  ? 29  LEU B CD1  1 
ATOM   5387  C CD2  . LEU B 1 29  ? 38.219  -17.265 -44.333 1.00 33.01  ? 29  LEU B CD2  1 
ATOM   5388  H H    . LEU B 1 29  ? 40.362  -15.474 -47.016 1.00 35.76  ? 29  LEU B H    1 
ATOM   5389  H HA   . LEU B 1 29  ? 40.744  -17.704 -45.546 1.00 33.41  ? 29  LEU B HA   1 
ATOM   5390  H HB2  . LEU B 1 29  ? 38.830  -17.348 -47.591 1.00 39.46  ? 29  LEU B HB2  1 
ATOM   5391  H HB3  . LEU B 1 29  ? 38.852  -18.539 -46.546 1.00 39.46  ? 29  LEU B HB3  1 
ATOM   5392  H HG   . LEU B 1 29  ? 38.288  -15.866 -45.788 1.00 33.86  ? 29  LEU B HG   1 
ATOM   5393  H HD11 . LEU B 1 29  ? 36.044  -16.409 -45.553 1.00 33.41  ? 29  LEU B HD11 1 
ATOM   5394  H HD12 . LEU B 1 29  ? 36.487  -16.577 -47.070 1.00 33.41  ? 29  LEU B HD12 1 
ATOM   5395  H HD13 . LEU B 1 29  ? 36.328  -17.857 -46.142 1.00 33.41  ? 29  LEU B HD13 1 
ATOM   5396  H HD21 . LEU B 1 29  ? 37.606  -16.770 -43.767 1.00 39.57  ? 29  LEU B HD21 1 
ATOM   5397  H HD22 . LEU B 1 29  ? 38.022  -18.214 -44.282 1.00 39.57  ? 29  LEU B HD22 1 
ATOM   5398  H HD23 . LEU B 1 29  ? 39.133  -17.101 -44.054 1.00 39.57  ? 29  LEU B HD23 1 
ATOM   5399  N N    . ALA B 1 30  ? 41.933  -19.174 -47.075 1.00 33.89  ? 30  ALA B N    1 
ATOM   5400  C CA   . ALA B 1 30  ? 42.889  -19.852 -47.941 1.00 44.40  ? 30  ALA B CA   1 
ATOM   5401  C C    . ALA B 1 30  ? 42.225  -20.514 -49.133 1.00 36.46  ? 30  ALA B C    1 
ATOM   5402  O O    . ALA B 1 30  ? 42.902  -20.767 -50.127 1.00 40.99  ? 30  ALA B O    1 
ATOM   5403  C CB   . ALA B 1 30  ? 43.672  -20.895 -47.152 1.00 46.71  ? 30  ALA B CB   1 
ATOM   5404  H H    . ALA B 1 30  ? 41.781  -19.572 -46.328 1.00 40.62  ? 30  ALA B H    1 
ATOM   5405  H HA   . ALA B 1 30  ? 43.522  -19.199 -48.279 1.00 53.24  ? 30  ALA B HA   1 
ATOM   5406  H HB1  . ALA B 1 30  ? 44.301  -21.333 -47.747 1.00 56.01  ? 30  ALA B HB1  1 
ATOM   5407  H HB2  . ALA B 1 30  ? 44.149  -20.454 -46.433 1.00 56.01  ? 30  ALA B HB2  1 
ATOM   5408  H HB3  . ALA B 1 30  ? 43.052  -21.546 -46.788 1.00 56.01  ? 30  ALA B HB3  1 
ATOM   5409  N N    . GLN B 1 31  ? 40.915  -20.782 -49.074 1.00 36.68  ? 31  GLN B N    1 
ATOM   5410  C CA   . GLN B 1 31  ? 40.260  -21.434 -50.196 1.00 26.07  ? 31  GLN B CA   1 
ATOM   5411  C C    . GLN B 1 31  ? 40.034  -20.491 -51.359 1.00 28.95  ? 31  GLN B C    1 
ATOM   5412  O O    . GLN B 1 31  ? 39.550  -20.935 -52.403 1.00 34.94  ? 31  GLN B O    1 
ATOM   5413  C CB   . GLN B 1 31  ? 38.919  -22.029 -49.792 1.00 38.71  ? 31  GLN B CB   1 
ATOM   5414  C CG   . GLN B 1 31  ? 38.006  -21.028 -49.130 1.00 30.22  ? 31  GLN B CG   1 
ATOM   5415  C CD   . GLN B 1 31  ? 38.090  -21.129 -47.610 1.00 38.01  ? 31  GLN B CD   1 
ATOM   5416  O OE1  . GLN B 1 31  ? 39.176  -21.325 -47.047 1.00 41.35  ? 31  GLN B OE1  1 
ATOM   5417  N NE2  . GLN B 1 31  ? 36.938  -21.048 -46.947 1.00 35.07  ? 31  GLN B NE2  1 
ATOM   5418  H H    . GLN B 1 31  ? 40.400  -20.598 -48.410 1.00 43.97  ? 31  GLN B H    1 
ATOM   5419  H HA   . GLN B 1 31  ? 40.824  -22.159 -50.508 1.00 31.24  ? 31  GLN B HA   1 
ATOM   5420  H HB2  . GLN B 1 31  ? 38.470  -22.363 -50.585 1.00 46.41  ? 31  GLN B HB2  1 
ATOM   5421  H HB3  . GLN B 1 31  ? 39.071  -22.754 -49.167 1.00 46.41  ? 31  GLN B HB3  1 
ATOM   5422  H HG2  . GLN B 1 31  ? 38.269  -20.132 -49.391 1.00 36.23  ? 31  GLN B HG2  1 
ATOM   5423  H HG3  . GLN B 1 31  ? 37.090  -21.202 -49.397 1.00 36.23  ? 31  GLN B HG3  1 
ATOM   5424  H HE21 . GLN B 1 31  ? 36.204  -20.920 -47.375 1.00 42.05  ? 31  GLN B HE21 1 
ATOM   5425  H HE22 . GLN B 1 31  ? 36.932  -21.103 -46.089 1.00 42.05  ? 31  GLN B HE22 1 
ATOM   5426  N N    . PHE B 1 32  ? 40.342  -19.211 -51.204 1.00 28.57  ? 32  PHE B N    1 
ATOM   5427  C CA   . PHE B 1 32  ? 40.101  -18.238 -52.266 1.00 33.45  ? 32  PHE B CA   1 
ATOM   5428  C C    . PHE B 1 32  ? 41.409  -17.597 -52.672 1.00 34.38  ? 32  PHE B C    1 
ATOM   5429  O O    . PHE B 1 32  ? 42.273  -17.348 -51.830 1.00 25.38  ? 32  PHE B O    1 
ATOM   5430  C CB   . PHE B 1 32  ? 39.134  -17.125 -51.844 1.00 30.52  ? 32  PHE B CB   1 
ATOM   5431  C CG   . PHE B 1 32  ? 37.743  -17.615 -51.531 1.00 33.85  ? 32  PHE B CG   1 
ATOM   5432  C CD1  . PHE B 1 32  ? 36.944  -18.149 -52.536 1.00 25.67  ? 32  PHE B CD1  1 
ATOM   5433  C CD2  . PHE B 1 32  ? 37.231  -17.508 -50.249 1.00 31.21  ? 32  PHE B CD2  1 
ATOM   5434  C CE1  . PHE B 1 32  ? 35.693  -18.590 -52.282 1.00 27.61  ? 32  PHE B CE1  1 
ATOM   5435  C CE2  . PHE B 1 32  ? 35.972  -17.944 -49.965 1.00 22.33  ? 32  PHE B CE2  1 
ATOM   5436  C CZ   . PHE B 1 32  ? 35.173  -18.496 -50.976 1.00 24.13  ? 32  PHE B CZ   1 
ATOM   5437  H H    . PHE B 1 32  ? 40.693  -18.877 -50.494 1.00 34.24  ? 32  PHE B H    1 
ATOM   5438  H HA   . PHE B 1 32  ? 39.728  -18.691 -53.039 1.00 40.10  ? 32  PHE B HA   1 
ATOM   5439  H HB2  . PHE B 1 32  ? 39.483  -16.693 -51.049 1.00 36.58  ? 32  PHE B HB2  1 
ATOM   5440  H HB3  . PHE B 1 32  ? 39.066  -16.480 -52.566 1.00 36.58  ? 32  PHE B HB3  1 
ATOM   5441  H HD1  . PHE B 1 32  ? 37.284  -18.218 -53.399 1.00 30.76  ? 32  PHE B HD1  1 
ATOM   5442  H HD2  . PHE B 1 32  ? 37.756  -17.148 -49.572 1.00 37.41  ? 32  PHE B HD2  1 
ATOM   5443  H HE1  . PHE B 1 32  ? 35.177  -18.951 -52.966 1.00 33.09  ? 32  PHE B HE1  1 
ATOM   5444  H HE2  . PHE B 1 32  ? 35.642  -17.874 -49.098 1.00 26.75  ? 32  PHE B HE2  1 
ATOM   5445  H HZ   . PHE B 1 32  ? 34.311  -18.792 -50.788 1.00 28.92  ? 32  PHE B HZ   1 
ATOM   5446  N N    . ASP B 1 33  ? 41.520  -17.311 -53.963 1.00 28.58  ? 33  ASP B N    1 
ATOM   5447  C CA   . ASP B 1 33  ? 42.679  -16.570 -54.491 1.00 33.13  ? 33  ASP B CA   1 
ATOM   5448  C C    . ASP B 1 33  ? 42.537  -15.115 -54.081 1.00 32.29  ? 33  ASP B C    1 
ATOM   5449  O O    . ASP B 1 33  ? 41.459  -14.539 -54.266 1.00 31.12  ? 33  ASP B O    1 
ATOM   5450  C CB   . ASP B 1 33  ? 42.707  -16.685 -56.003 1.00 27.02  ? 33  ASP B CB   1 
ATOM   5451  C CG   . ASP B 1 33  ? 43.979  -16.158 -56.637 1.00 37.16  ? 33  ASP B CG   1 
ATOM   5452  O OD1  . ASP B 1 33  ? 44.376  -14.995 -56.429 1.00 40.01  ? 33  ASP B OD1  1 
ATOM   5453  O OD2  . ASP B 1 33  ? 44.555  -16.923 -57.420 1.00 40.74  ? 33  ASP B OD2  1 
ATOM   5454  H H    . ASP B 1 33  ? 40.942  -17.531 -54.561 1.00 34.25  ? 33  ASP B H    1 
ATOM   5455  H HA   . ASP B 1 33  ? 43.503  -16.928 -54.126 1.00 39.72  ? 33  ASP B HA   1 
ATOM   5456  H HB2  . ASP B 1 33  ? 42.620  -17.619 -56.247 1.00 32.38  ? 33  ASP B HB2  1 
ATOM   5457  H HB3  . ASP B 1 33  ? 41.964  -16.180 -56.368 1.00 32.38  ? 33  ASP B HB3  1 
ATOM   5458  N N    . PRO B 1 34  ? 43.591  -14.472 -53.569 1.00 34.55  ? 34  PRO B N    1 
ATOM   5459  C CA   . PRO B 1 34  ? 43.440  -13.075 -53.129 1.00 25.29  ? 34  PRO B CA   1 
ATOM   5460  C C    . PRO B 1 34  ? 43.138  -12.113 -54.243 1.00 30.60  ? 34  PRO B C    1 
ATOM   5461  O O    . PRO B 1 34  ? 42.614  -11.016 -53.974 1.00 25.86  ? 34  PRO B O    1 
ATOM   5462  C CB   . PRO B 1 34  ? 44.797  -12.754 -52.491 1.00 34.00  ? 34  PRO B CB   1 
ATOM   5463  C CG   . PRO B 1 34  ? 45.765  -13.728 -53.144 1.00 34.18  ? 34  PRO B CG   1 
ATOM   5464  C CD   . PRO B 1 34  ? 44.948  -14.989 -53.294 1.00 37.11  ? 34  PRO B CD   1 
ATOM   5465  H HA   . PRO B 1 34  ? 42.747  -13.009 -52.454 1.00 30.30  ? 34  PRO B HA   1 
ATOM   5466  H HB2  . PRO B 1 34  ? 45.045  -11.837 -52.687 1.00 40.76  ? 34  PRO B HB2  1 
ATOM   5467  H HB3  . PRO B 1 34  ? 44.753  -12.903 -51.533 1.00 40.76  ? 34  PRO B HB3  1 
ATOM   5468  H HG2  . PRO B 1 34  ? 46.042  -13.388 -54.010 1.00 40.97  ? 34  PRO B HG2  1 
ATOM   5469  H HG3  . PRO B 1 34  ? 46.529  -13.875 -52.565 1.00 40.97  ? 34  PRO B HG3  1 
ATOM   5470  H HD2  . PRO B 1 34  ? 45.270  -15.515 -54.043 1.00 44.49  ? 34  PRO B HD2  1 
ATOM   5471  H HD3  . PRO B 1 34  ? 44.957  -15.500 -52.469 1.00 44.49  ? 34  PRO B HD3  1 
ATOM   5472  N N    . ARG B 1 35  ? 43.482  -12.446 -55.479 1.00 26.48  ? 35  ARG B N    1 
ATOM   5473  C CA   . ARG B 1 35  ? 43.294  -11.495 -56.572 1.00 20.88  ? 35  ARG B CA   1 
ATOM   5474  C C    . ARG B 1 35  ? 41.842  -11.573 -57.029 1.00 30.99  ? 35  ARG B C    1 
ATOM   5475  O O    . ARG B 1 35  ? 41.411  -12.598 -57.572 1.00 27.03  ? 35  ARG B O    1 
ATOM   5476  C CB   . ARG B 1 35  ? 44.237  -11.772 -57.726 1.00 33.85  ? 35  ARG B CB   1 
ATOM   5477  C CG   . ARG B 1 35  ? 44.083  -10.738 -58.838 1.00 37.42  ? 35  ARG B CG   1 
ATOM   5478  C CD   . ARG B 1 35  ? 45.310  -10.755 -59.754 1.00 51.14  ? 35  ARG B CD   1 
ATOM   5479  N NE   . ARG B 1 35  ? 45.220  -9.772  -60.837 1.00 41.89  ? 35  ARG B NE   1 
ATOM   5480  C CZ   . ARG B 1 35  ? 44.471  -9.929  -61.923 1.00 49.48  ? 35  ARG B CZ   1 
ATOM   5481  N NH1  . ARG B 1 35  ? 43.736  -11.038 -62.075 1.00 40.84  ? 35  ARG B NH1  1 
ATOM   5482  N NH2  . ARG B 1 35  ? 44.458  -8.974  -62.863 1.00 55.82  ? 35  ARG B NH2  1 
ATOM   5483  H H    . ARG B 1 35  ? 43.820  -13.202 -55.711 1.00 31.73  ? 35  ARG B H    1 
ATOM   5484  H HA   . ARG B 1 35  ? 43.464  -10.596 -56.248 1.00 25.01  ? 35  ARG B HA   1 
ATOM   5485  H HB2  . ARG B 1 35  ? 45.152  -11.739 -57.406 1.00 40.58  ? 35  ARG B HB2  1 
ATOM   5486  H HB3  . ARG B 1 35  ? 44.042  -12.647 -58.096 1.00 40.58  ? 35  ARG B HB3  1 
ATOM   5487  H HG2  . ARG B 1 35  ? 43.299  -10.948 -59.369 1.00 44.86  ? 35  ARG B HG2  1 
ATOM   5488  H HG3  . ARG B 1 35  ? 44.002  -9.853  -58.449 1.00 44.86  ? 35  ARG B HG3  1 
ATOM   5489  H HD2  . ARG B 1 35  ? 46.100  -10.553 -59.229 1.00 61.32  ? 35  ARG B HD2  1 
ATOM   5490  H HD3  . ARG B 1 35  ? 45.394  -11.635 -60.154 1.00 61.32  ? 35  ARG B HD3  1 
ATOM   5491  H HE   . ARG B 1 35  ? 45.730  -9.080  -60.795 1.00 50.22  ? 35  ARG B HE   1 
ATOM   5492  H HH11 . ARG B 1 35  ? 43.749  -11.648 -61.469 1.00 48.97  ? 35  ARG B HH11 1 
ATOM   5493  H HH12 . ARG B 1 35  ? 43.250  -11.140 -62.778 1.00 48.97  ? 35  ARG B HH12 1 
ATOM   5494  H HH21 . ARG B 1 35  ? 44.931  -8.264  -62.761 1.00 66.94  ? 35  ARG B HH21 1 
ATOM   5495  H HH22 . ARG B 1 35  ? 43.973  -9.070  -63.567 1.00 66.94  ? 35  ARG B HH22 1 
ATOM   5496  N N    . VAL B 1 36  ? 41.089  -10.508 -56.764 1.00 28.81  ? 36  VAL B N    1 
ATOM   5497  C CA   . VAL B 1 36  ? 39.671  -10.402 -57.120 1.00 32.99  ? 36  VAL B CA   1 
ATOM   5498  C C    . VAL B 1 36  ? 39.565  -9.374  -58.221 1.00 27.38  ? 36  VAL B C    1 
ATOM   5499  O O    . VAL B 1 36  ? 39.869  -8.195  -58.011 1.00 35.18  ? 36  VAL B O    1 
ATOM   5500  C CB   . VAL B 1 36  ? 38.790  -9.978  -55.930 1.00 26.35  ? 36  VAL B CB   1 
ATOM   5501  C CG1  . VAL B 1 36  ? 37.303  -9.769  -56.371 1.00 29.90  ? 36  VAL B CG1  1 
ATOM   5502  C CG2  . VAL B 1 36  ? 38.871  -11.014 -54.755 1.00 33.12  ? 36  VAL B CG2  1 
ATOM   5503  H H    . VAL B 1 36  ? 41.387  -9.808  -56.364 1.00 34.54  ? 36  VAL B H    1 
ATOM   5504  H HA   . VAL B 1 36  ? 39.353  -11.254 -57.456 1.00 39.55  ? 36  VAL B HA   1 
ATOM   5505  H HB   . VAL B 1 36  ? 39.116  -9.129  -55.593 1.00 31.58  ? 36  VAL B HB   1 
ATOM   5506  H HG11 . VAL B 1 36  ? 36.779  -9.503  -55.599 1.00 35.84  ? 36  VAL B HG11 1 
ATOM   5507  H HG12 . VAL B 1 36  ? 37.270  -9.075  -57.049 1.00 35.84  ? 36  VAL B HG12 1 
ATOM   5508  H HG13 . VAL B 1 36  ? 36.961  -10.601 -56.733 1.00 35.84  ? 36  VAL B HG13 1 
ATOM   5509  H HG21 . VAL B 1 36  ? 38.304  -10.712 -54.029 1.00 39.71  ? 36  VAL B HG21 1 
ATOM   5510  H HG22 . VAL B 1 36  ? 38.566  -11.878 -55.075 1.00 39.71  ? 36  VAL B HG22 1 
ATOM   5511  H HG23 . VAL B 1 36  ? 39.790  -11.078 -54.453 1.00 39.71  ? 36  VAL B HG23 1 
ATOM   5512  N N    . THR B 1 37  ? 39.107  -9.794  -59.379 1.00 32.38  ? 37  THR B N    1 
ATOM   5513  C CA   . THR B 1 37  ? 38.923  -8.852  -60.470 1.00 25.22  ? 37  THR B CA   1 
ATOM   5514  C C    . THR B 1 37  ? 37.522  -8.321  -60.370 1.00 23.10  ? 37  THR B C    1 
ATOM   5515  O O    . THR B 1 37  ? 36.629  -8.992  -59.856 1.00 27.99  ? 37  THR B O    1 
ATOM   5516  C CB   . THR B 1 37  ? 39.150  -9.502  -61.842 1.00 28.17  ? 37  THR B CB   1 
ATOM   5517  O OG1  . THR B 1 37  ? 38.256  -10.597 -62.012 1.00 31.70  ? 37  THR B OG1  1 
ATOM   5518  C CG2  . THR B 1 37  ? 40.536  -10.048 -61.950 1.00 34.17  ? 37  THR B CG2  1 
ATOM   5519  H H    . THR B 1 37  ? 38.897  -10.607 -59.564 1.00 38.81  ? 37  THR B H    1 
ATOM   5520  H HA   . THR B 1 37  ? 39.543  -8.113  -60.371 1.00 30.22  ? 37  THR B HA   1 
ATOM   5521  H HB   . THR B 1 37  ? 39.012  -8.849  -62.546 1.00 33.76  ? 37  THR B HB   1 
ATOM   5522  H HG1  . THR B 1 37  ? 38.379  -10.954 -62.763 1.00 38.00  ? 37  THR B HG1  1 
ATOM   5523  H HG21 . THR B 1 37  ? 40.664  -10.455 -62.821 1.00 40.96  ? 37  THR B HG21 1 
ATOM   5524  H HG22 . THR B 1 37  ? 41.183  -9.334  -61.837 1.00 40.96  ? 37  THR B HG22 1 
ATOM   5525  H HG23 . THR B 1 37  ? 40.682  -10.718 -61.264 1.00 40.96  ? 37  THR B HG23 1 
ATOM   5526  N N    . MET B 1 38  ? 37.340  -7.095  -60.817 1.00 26.41  ? 38  MET B N    1 
ATOM   5527  C CA   . MET B 1 38  ? 36.018  -6.492  -60.857 1.00 39.07  ? 38  MET B CA   1 
ATOM   5528  C C    . MET B 1 38  ? 35.878  -5.862  -62.229 1.00 26.97  ? 38  MET B C    1 
ATOM   5529  O O    . MET B 1 38  ? 36.598  -4.917  -62.550 1.00 31.73  ? 38  MET B O    1 
ATOM   5530  C CB   . MET B 1 38  ? 35.832  -5.455  -59.734 1.00 28.04  ? 38  MET B CB   1 
ATOM   5531  C CG   . MET B 1 38  ? 34.544  -4.636  -59.823 1.00 40.81  ? 38  MET B CG   1 
ATOM   5532  S SD   . MET B 1 38  ? 34.348  -3.702  -58.267 1.00 34.17  ? 38  MET B SD   1 
ATOM   5533  C CE   . MET B 1 38  ? 35.371  -2.249  -58.500 1.00 34.81  ? 38  MET B CE   1 
ATOM   5534  H H    . MET B 1 38  ? 37.969  -6.583  -61.105 1.00 31.65  ? 38  MET B H    1 
ATOM   5535  H HA   . MET B 1 38  ? 35.346  -7.183  -60.750 1.00 46.84  ? 38  MET B HA   1 
ATOM   5536  H HB2  . MET B 1 38  ? 35.826  -5.920  -58.883 1.00 33.61  ? 38  MET B HB2  1 
ATOM   5537  H HB3  . MET B 1 38  ? 36.577  -4.834  -59.760 1.00 33.61  ? 38  MET B HB3  1 
ATOM   5538  H HG2  . MET B 1 38  ? 34.603  -4.008  -60.560 1.00 48.92  ? 38  MET B HG2  1 
ATOM   5539  H HG3  . MET B 1 38  ? 33.783  -5.227  -59.932 1.00 48.92  ? 38  MET B HG3  1 
ATOM   5540  H HE1  . MET B 1 38  ? 35.318  -1.695  -57.705 1.00 41.72  ? 38  MET B HE1  1 
ATOM   5541  H HE2  . MET B 1 38  ? 36.288  -2.529  -58.648 1.00 41.72  ? 38  MET B HE2  1 
ATOM   5542  H HE3  . MET B 1 38  ? 35.047  -1.755  -59.269 1.00 41.72  ? 38  MET B HE3  1 
ATOM   5543  N N    . TRP B 1 39  ? 34.980  -6.392  -63.049 1.00 33.09  ? 39  TRP B N    1 
ATOM   5544  C CA   . TRP B 1 39  ? 34.735  -5.735  -64.320 1.00 25.59  ? 39  TRP B CA   1 
ATOM   5545  C C    . TRP B 1 39  ? 34.151  -4.362  -64.076 1.00 30.65  ? 39  TRP B C    1 
ATOM   5546  O O    . TRP B 1 39  ? 33.062  -4.233  -63.497 1.00 33.03  ? 39  TRP B O    1 
ATOM   5547  C CB   . TRP B 1 39  ? 33.775  -6.516  -65.203 1.00 37.51  ? 39  TRP B CB   1 
ATOM   5548  C CG   . TRP B 1 39  ? 33.459  -5.659  -66.424 1.00 30.21  ? 39  TRP B CG   1 
ATOM   5549  C CD1  . TRP B 1 39  ? 34.361  -5.196  -67.364 1.00 35.69  ? 39  TRP B CD1  1 
ATOM   5550  C CD2  . TRP B 1 39  ? 32.205  -5.114  -66.779 1.00 33.54  ? 39  TRP B CD2  1 
ATOM   5551  N NE1  . TRP B 1 39  ? 33.715  -4.413  -68.294 1.00 37.07  ? 39  TRP B NE1  1 
ATOM   5552  C CE2  . TRP B 1 39  ? 32.389  -4.366  -67.961 1.00 34.94  ? 39  TRP B CE2  1 
ATOM   5553  C CE3  . TRP B 1 39  ? 30.931  -5.206  -66.236 1.00 34.50  ? 39  TRP B CE3  1 
ATOM   5554  C CZ2  . TRP B 1 39  ? 31.369  -3.714  -68.577 1.00 32.95  ? 39  TRP B CZ2  1 
ATOM   5555  C CZ3  . TRP B 1 39  ? 29.911  -4.559  -66.871 1.00 36.25  ? 39  TRP B CZ3  1 
ATOM   5556  C CH2  . TRP B 1 39  ? 30.132  -3.829  -68.032 1.00 29.49  ? 39  TRP B CH2  1 
ATOM   5557  H H    . TRP B 1 39  ? 34.517  -7.101  -62.901 1.00 39.66  ? 39  TRP B H    1 
ATOM   5558  H HA   . TRP B 1 39  ? 35.573  -5.632  -64.796 1.00 30.66  ? 39  TRP B HA   1 
ATOM   5559  H HB2  . TRP B 1 39  ? 34.192  -7.341  -65.497 1.00 44.96  ? 39  TRP B HB2  1 
ATOM   5560  H HB3  . TRP B 1 39  ? 32.952  -6.695  -64.721 1.00 44.96  ? 39  TRP B HB3  1 
ATOM   5561  H HD1  . TRP B 1 39  ? 35.272  -5.384  -67.367 1.00 42.79  ? 39  TRP B HD1  1 
ATOM   5562  H HE1  . TRP B 1 39  ? 34.079  -4.036  -68.976 1.00 44.45  ? 39  TRP B HE1  1 
ATOM   5563  H HE3  . TRP B 1 39  ? 30.775  -5.702  -65.465 1.00 41.36  ? 39  TRP B HE3  1 
ATOM   5564  H HZ2  . TRP B 1 39  ? 31.509  -3.224  -69.355 1.00 39.49  ? 39  TRP B HZ2  1 
ATOM   5565  H HZ3  . TRP B 1 39  ? 29.051  -4.611  -66.522 1.00 43.46  ? 39  TRP B HZ3  1 
ATOM   5566  H HH2  . TRP B 1 39  ? 29.416  -3.394  -68.436 1.00 35.35  ? 39  TRP B HH2  1 
ATOM   5567  N N    . VAL B 1 40  ? 34.854  -3.344  -64.551 1.00 29.46  ? 40  VAL B N    1 
ATOM   5568  C CA   . VAL B 1 40  ? 34.432  -1.953  -64.459 1.00 30.90  ? 40  VAL B CA   1 
ATOM   5569  C C    . VAL B 1 40  ? 34.226  -1.407  -65.864 1.00 32.59  ? 40  VAL B C    1 
ATOM   5570  O O    . VAL B 1 40  ? 35.199  -1.105  -66.571 1.00 38.02  ? 40  VAL B O    1 
ATOM   5571  C CB   . VAL B 1 40  ? 35.466  -1.108  -63.713 1.00 37.43  ? 40  VAL B CB   1 
ATOM   5572  C CG1  . VAL B 1 40  ? 35.022  0.335   -63.650 1.00 33.94  ? 40  VAL B CG1  1 
ATOM   5573  C CG2  . VAL B 1 40  ? 35.752  -1.690  -62.324 1.00 31.29  ? 40  VAL B CG2  1 
ATOM   5574  H H    . VAL B 1 40  ? 35.611  -3.438  -64.948 1.00 35.30  ? 40  VAL B H    1 
ATOM   5575  H HA   . VAL B 1 40  ? 33.589  -1.901  -63.981 1.00 37.04  ? 40  VAL B HA   1 
ATOM   5576  H HB   . VAL B 1 40  ? 36.298  -1.133  -64.213 1.00 44.87  ? 40  VAL B HB   1 
ATOM   5577  H HG11 . VAL B 1 40  ? 35.692  0.851   -63.174 1.00 40.68  ? 40  VAL B HG11 1 
ATOM   5578  H HG12 . VAL B 1 40  ? 34.923  0.674   -64.554 1.00 40.68  ? 40  VAL B HG12 1 
ATOM   5579  H HG13 . VAL B 1 40  ? 34.173  0.384   -63.184 1.00 40.68  ? 40  VAL B HG13 1 
ATOM   5580  H HG21 . VAL B 1 40  ? 36.409  -1.134  -61.878 1.00 37.50  ? 40  VAL B HG21 1 
ATOM   5581  H HG22 . VAL B 1 40  ? 34.928  -1.703  -61.813 1.00 37.50  ? 40  VAL B HG22 1 
ATOM   5582  H HG23 . VAL B 1 40  ? 36.094  -2.592  -62.424 1.00 37.50  ? 40  VAL B HG23 1 
ATOM   5583  N N    . PHE B 1 41  ? 32.969  -1.263  -66.268 1.00 37.90  ? 41  PHE B N    1 
ATOM   5584  C CA   . PHE B 1 41  ? 32.634  -0.500  -67.463 1.00 39.04  ? 41  PHE B CA   1 
ATOM   5585  C C    . PHE B 1 41  ? 33.342  0.841   -67.415 1.00 41.79  ? 41  PHE B C    1 
ATOM   5586  O O    . PHE B 1 41  ? 33.117  1.639   -66.501 1.00 37.55  ? 41  PHE B O    1 
ATOM   5587  C CB   . PHE B 1 41  ? 31.111  -0.323  -67.512 1.00 49.00  ? 41  PHE B CB   1 
ATOM   5588  C CG   . PHE B 1 41  ? 30.600  0.426   -68.720 1.00 47.41  ? 41  PHE B CG   1 
ATOM   5589  C CD1  . PHE B 1 41  ? 30.283  -0.251  -69.899 1.00 55.73  ? 41  PHE B CD1  1 
ATOM   5590  C CD2  . PHE B 1 41  ? 30.407  1.791   -68.668 1.00 45.49  ? 41  PHE B CD2  1 
ATOM   5591  C CE1  . PHE B 1 41  ? 29.808  0.441   -71.015 1.00 51.28  ? 41  PHE B CE1  1 
ATOM   5592  C CE2  . PHE B 1 41  ? 29.944  2.482   -69.772 1.00 57.08  ? 41  PHE B CE2  1 
ATOM   5593  C CZ   . PHE B 1 41  ? 29.640  1.805   -70.946 1.00 56.74  ? 41  PHE B CZ   1 
ATOM   5594  H H    . PHE B 1 41  ? 32.288  -1.599  -65.864 1.00 45.44  ? 41  PHE B H    1 
ATOM   5595  H HA   . PHE B 1 41  ? 32.922  -0.981  -68.254 1.00 46.81  ? 41  PHE B HA   1 
ATOM   5596  H HB2  . PHE B 1 41  ? 30.697  -1.201  -67.515 1.00 58.76  ? 41  PHE B HB2  1 
ATOM   5597  H HB3  . PHE B 1 41  ? 30.830  0.166   -66.723 1.00 58.76  ? 41  PHE B HB3  1 
ATOM   5598  H HD1  . PHE B 1 41  ? 30.403  -1.172  -69.947 1.00 66.83  ? 41  PHE B HD1  1 
ATOM   5599  H HD2  . PHE B 1 41  ? 30.614  2.255   -67.889 1.00 54.54  ? 41  PHE B HD2  1 
ATOM   5600  H HE1  . PHE B 1 41  ? 29.607  -0.016  -71.800 1.00 61.50  ? 41  PHE B HE1  1 
ATOM   5601  H HE2  . PHE B 1 41  ? 29.825  3.403   -69.725 1.00 68.45  ? 41  PHE B HE2  1 
ATOM   5602  H HZ   . PHE B 1 41  ? 29.321  2.273   -71.684 1.00 68.04  ? 41  PHE B HZ   1 
ATOM   5603  N N    . GLU B 1 42  ? 34.226  1.081   -68.377 1.00 47.42  ? 42  GLU B N    1 
ATOM   5604  C CA   . GLU B 1 42  ? 35.117  2.236   -68.292 1.00 42.57  ? 42  GLU B CA   1 
ATOM   5605  C C    . GLU B 1 42  ? 34.354  3.542   -68.466 1.00 35.14  ? 42  GLU B C    1 
ATOM   5606  O O    . GLU B 1 42  ? 33.430  3.647   -69.280 1.00 39.95  ? 42  GLU B O    1 
ATOM   5607  C CB   . GLU B 1 42  ? 36.234  2.160   -69.349 1.00 49.37  ? 42  GLU B CB   1 
ATOM   5608  C CG   . GLU B 1 42  ? 37.401  3.125   -69.077 1.00 44.12  ? 42  GLU B CG   1 
ATOM   5609  C CD   . GLU B 1 42  ? 38.116  2.867   -67.748 1.00 49.52  ? 42  GLU B CD   1 
ATOM   5610  O OE1  . GLU B 1 42  ? 39.192  2.227   -67.756 1.00 45.75  ? 42  GLU B OE1  1 
ATOM   5611  O OE2  . GLU B 1 42  ? 37.611  3.317   -66.687 1.00 40.34  ? 42  GLU B OE2  1 
ATOM   5612  H H    . GLU B 1 42  ? 34.331  0.599   -69.081 1.00 56.87  ? 42  GLU B H    1 
ATOM   5613  H HA   . GLU B 1 42  ? 35.534  2.247   -67.416 1.00 51.05  ? 42  GLU B HA   1 
ATOM   5614  H HB2  . GLU B 1 42  ? 36.591  1.258   -69.364 1.00 59.20  ? 42  GLU B HB2  1 
ATOM   5615  H HB3  . GLU B 1 42  ? 35.861  2.382   -70.216 1.00 59.20  ? 42  GLU B HB3  1 
ATOM   5616  H HG2  . GLU B 1 42  ? 38.054  3.033   -69.788 1.00 52.91  ? 42  GLU B HG2  1 
ATOM   5617  H HG3  . GLU B 1 42  ? 37.058  4.032   -69.059 1.00 52.91  ? 42  GLU B HG3  1 
ATOM   5618  N N    . GLU B 1 43  ? 34.765  4.554   -67.700 1.00 35.93  ? 43  GLU B N    1 
ATOM   5619  C CA   . GLU B 1 43  ? 34.158  5.875   -67.767 1.00 42.61  ? 43  GLU B CA   1 
ATOM   5620  C C    . GLU B 1 43  ? 35.226  6.918   -67.471 1.00 43.35  ? 43  GLU B C    1 
ATOM   5621  O O    . GLU B 1 43  ? 36.163  6.680   -66.700 1.00 38.97  ? 43  GLU B O    1 
ATOM   5622  C CB   . GLU B 1 43  ? 32.990  6.061   -66.781 1.00 43.68  ? 43  GLU B CB   1 
ATOM   5623  C CG   . GLU B 1 43  ? 31.978  4.901   -66.658 1.00 42.80  ? 43  GLU B CG   1 
ATOM   5624  C CD   . GLU B 1 43  ? 30.806  5.249   -65.754 1.00 49.90  ? 43  GLU B CD   1 
ATOM   5625  O OE1  . GLU B 1 43  ? 30.480  6.448   -65.649 1.00 48.73  ? 43  GLU B OE1  1 
ATOM   5626  O OE2  . GLU B 1 43  ? 30.213  4.325   -65.151 1.00 42.44  ? 43  GLU B OE2  1 
ATOM   5627  H H    . GLU B 1 43  ? 35.404  4.496   -67.127 1.00 43.07  ? 43  GLU B H    1 
ATOM   5628  H HA   . GLU B 1 43  ? 33.824  6.027   -68.665 1.00 51.09  ? 43  GLU B HA   1 
ATOM   5629  H HB2  . GLU B 1 43  ? 33.362  6.209   -65.898 1.00 52.38  ? 43  GLU B HB2  1 
ATOM   5630  H HB3  . GLU B 1 43  ? 32.490  6.847   -67.052 1.00 52.38  ? 43  GLU B HB3  1 
ATOM   5631  H HG2  . GLU B 1 43  ? 31.627  4.691   -67.538 1.00 51.32  ? 43  GLU B HG2  1 
ATOM   5632  H HG3  . GLU B 1 43  ? 32.427  4.127   -66.285 1.00 51.32  ? 43  GLU B HG3  1 
ATOM   5633  N N    . ASP B 1 44  ? 35.049  8.087   -68.071 1.00 46.14  ? 44  ASP B N    1 
ATOM   5634  C CA   . ASP B 1 44  ? 35.958  9.209   -67.900 1.00 49.50  ? 44  ASP B CA   1 
ATOM   5635  C C    . ASP B 1 44  ? 35.462  10.047  -66.723 1.00 52.93  ? 44  ASP B C    1 
ATOM   5636  O O    . ASP B 1 44  ? 34.325  10.530  -66.738 1.00 48.42  ? 44  ASP B O    1 
ATOM   5637  C CB   . ASP B 1 44  ? 36.004  10.004  -69.208 1.00 56.46  ? 44  ASP B CB   1 
ATOM   5638  C CG   . ASP B 1 44  ? 37.015  11.123  -69.196 1.00 65.82  ? 44  ASP B CG   1 
ATOM   5639  O OD1  . ASP B 1 44  ? 36.968  11.952  -68.263 1.00 68.83  ? 44  ASP B OD1  1 
ATOM   5640  O OD2  . ASP B 1 44  ? 37.848  11.177  -70.137 1.00 69.54  ? 44  ASP B OD2  1 
ATOM   5641  H H    . ASP B 1 44  ? 34.390  8.258   -68.597 1.00 55.32  ? 44  ASP B H    1 
ATOM   5642  H HA   . ASP B 1 44  ? 36.849  8.883   -67.699 1.00 59.36  ? 44  ASP B HA   1 
ATOM   5643  H HB2  . ASP B 1 44  ? 36.236  9.402   -69.933 1.00 67.71  ? 44  ASP B HB2  1 
ATOM   5644  H HB3  . ASP B 1 44  ? 35.131  10.394  -69.370 1.00 67.71  ? 44  ASP B HB3  1 
ATOM   5645  N N    . ILE B 1 45  ? 36.282  10.175  -65.682 1.00 50.82  ? 45  ILE B N    1 
ATOM   5646  C CA   . ILE B 1 45  ? 35.954  11.017  -64.533 1.00 50.43  ? 45  ILE B CA   1 
ATOM   5647  C C    . ILE B 1 45  ? 37.022  12.095  -64.426 1.00 50.29  ? 45  ILE B C    1 
ATOM   5648  O O    . ILE B 1 45  ? 38.138  11.840  -63.957 1.00 46.40  ? 45  ILE B O    1 
ATOM   5649  C CB   . ILE B 1 45  ? 35.825  10.211  -63.237 1.00 57.03  ? 45  ILE B CB   1 
ATOM   5650  C CG1  . ILE B 1 45  ? 34.489  9.456   -63.246 1.00 54.03  ? 45  ILE B CG1  1 
ATOM   5651  C CG2  . ILE B 1 45  ? 35.854  11.135  -62.005 1.00 51.62  ? 45  ILE B CG2  1 
ATOM   5652  C CD1  . ILE B 1 45  ? 34.524  8.172   -62.530 1.00 57.21  ? 45  ILE B CD1  1 
ATOM   5653  H H    . ILE B 1 45  ? 37.043  9.780   -65.616 1.00 60.94  ? 45  ILE B H    1 
ATOM   5654  H HA   . ILE B 1 45  ? 35.104  11.454  -64.697 1.00 60.48  ? 45  ILE B HA   1 
ATOM   5655  H HB   . ILE B 1 45  ? 36.554  9.574   -63.180 1.00 68.39  ? 45  ILE B HB   1 
ATOM   5656  H HG12 . ILE B 1 45  ? 33.814  10.011  -62.825 1.00 64.80  ? 45  ILE B HG12 1 
ATOM   5657  H HG13 . ILE B 1 45  ? 34.239  9.276   -64.166 1.00 64.80  ? 45  ILE B HG13 1 
ATOM   5658  H HG21 . ILE B 1 45  ? 35.771  10.595  -61.204 1.00 61.90  ? 45  ILE B HG21 1 
ATOM   5659  H HG22 . ILE B 1 45  ? 36.696  11.618  -61.993 1.00 61.90  ? 45  ILE B HG22 1 
ATOM   5660  H HG23 . ILE B 1 45  ? 35.115  11.760  -62.062 1.00 61.90  ? 45  ILE B HG23 1 
ATOM   5661  H HD11 . ILE B 1 45  ? 33.648  7.759   -62.581 1.00 68.61  ? 45  ILE B HD11 1 
ATOM   5662  H HD12 . ILE B 1 45  ? 35.186  7.598   -62.946 1.00 68.61  ? 45  ILE B HD12 1 
ATOM   5663  H HD13 . ILE B 1 45  ? 34.761  8.334   -61.604 1.00 68.61  ? 45  ILE B HD13 1 
ATOM   5664  N N    . GLY B 1 46  ? 36.674  13.308  -64.841 1.00 55.36  ? 46  GLY B N    1 
ATOM   5665  C CA   . GLY B 1 46  ? 37.622  14.411  -64.841 1.00 59.49  ? 46  GLY B CA   1 
ATOM   5666  C C    . GLY B 1 46  ? 38.824  14.174  -65.728 1.00 62.90  ? 46  GLY B C    1 
ATOM   5667  O O    . GLY B 1 46  ? 39.959  14.441  -65.313 1.00 64.06  ? 46  GLY B O    1 
ATOM   5668  H H    . GLY B 1 46  ? 35.891  13.518  -65.128 1.00 66.39  ? 46  GLY B H    1 
ATOM   5669  H HA2  . GLY B 1 46  ? 37.175  15.216  -65.145 1.00 71.34  ? 46  GLY B HA2  1 
ATOM   5670  H HA3  . GLY B 1 46  ? 37.938  14.561  -63.936 1.00 71.34  ? 46  GLY B HA3  1 
ATOM   5671  N N    . GLY B 1 47  ? 38.605  13.663  -66.938 1.00 58.72  ? 47  GLY B N    1 
ATOM   5672  C CA   . GLY B 1 47  ? 39.724  13.327  -67.805 1.00 55.62  ? 47  GLY B CA   1 
ATOM   5673  C C    . GLY B 1 47  ? 40.620  12.242  -67.253 1.00 57.99  ? 47  GLY B C    1 
ATOM   5674  O O    . GLY B 1 47  ? 41.808  12.208  -67.581 1.00 46.31  ? 47  GLY B O    1 
ATOM   5675  H H    . GLY B 1 47  ? 37.829  13.503  -67.274 1.00 70.42  ? 47  GLY B H    1 
ATOM   5676  H HA2  . GLY B 1 47  ? 39.384  13.031  -68.664 1.00 66.71  ? 47  GLY B HA2  1 
ATOM   5677  H HA3  . GLY B 1 47  ? 40.263  14.121  -67.950 1.00 66.71  ? 47  GLY B HA3  1 
ATOM   5678  N N    . LYS B 1 48  ? 40.080  11.352  -66.412 1.00 63.53  ? 48  LYS B N    1 
ATOM   5679  C CA   . LYS B 1 48  ? 40.827  10.225  -65.864 1.00 57.91  ? 48  LYS B CA   1 
ATOM   5680  C C    . LYS B 1 48  ? 39.977  8.958   -65.960 1.00 54.56  ? 48  LYS B C    1 
ATOM   5681  O O    . LYS B 1 48  ? 38.742  9.010   -65.979 1.00 49.14  ? 48  LYS B O    1 
ATOM   5682  C CB   . LYS B 1 48  ? 41.257  10.492  -64.405 1.00 49.50  ? 48  LYS B CB   1 
ATOM   5683  H H    . LYS B 1 48  ? 39.264  11.384  -66.142 1.00 76.19  ? 48  LYS B H    1 
ATOM   5684  H HA   . LYS B 1 48  ? 41.628  10.089  -66.393 1.00 69.45  ? 48  LYS B HA   1 
ATOM   5685  N N    . LYS B 1 49  ? 40.655  7.817   -66.040 1.00 58.57  ? 49  LYS B N    1 
ATOM   5686  C CA   . LYS B 1 49  ? 39.983  6.540   -66.226 1.00 56.17  ? 49  LYS B CA   1 
ATOM   5687  C C    . LYS B 1 49  ? 39.523  5.966   -64.882 1.00 39.87  ? 49  LYS B C    1 
ATOM   5688  O O    . LYS B 1 49  ? 40.322  5.789   -63.951 1.00 35.20  ? 49  LYS B O    1 
ATOM   5689  C CB   . LYS B 1 49  ? 40.920  5.559   -66.940 1.00 52.68  ? 49  LYS B CB   1 
ATOM   5690  H H    . LYS B 1 49  ? 41.511  7.758   -65.990 1.00 70.25  ? 49  LYS B H    1 
ATOM   5691  H HA   . LYS B 1 49  ? 39.200  6.669   -66.783 1.00 67.36  ? 49  LYS B HA   1 
ATOM   5692  N N    . LEU B 1 50  ? 38.232  5.650   -64.794 1.00 44.40  ? 50  LEU B N    1 
ATOM   5693  C CA   . LEU B 1 50  ? 37.684  5.091   -63.560 1.00 39.54  ? 50  LEU B CA   1 
ATOM   5694  C C    . LEU B 1 50  ? 38.471  3.861   -63.092 1.00 37.23  ? 50  LEU B C    1 
ATOM   5695  O O    . LEU B 1 50  ? 38.798  3.739   -61.903 1.00 32.85  ? 50  LEU B O    1 
ATOM   5696  C CB   . LEU B 1 50  ? 36.203  4.763   -63.772 1.00 40.43  ? 50  LEU B CB   1 
ATOM   5697  C CG   . LEU B 1 50  ? 35.438  4.294   -62.521 1.00 46.94  ? 50  LEU B CG   1 
ATOM   5698  C CD1  . LEU B 1 50  ? 35.681  5.178   -61.259 1.00 36.04  ? 50  LEU B CD1  1 
ATOM   5699  C CD2  . LEU B 1 50  ? 33.978  4.244   -62.840 1.00 35.37  ? 50  LEU B CD2  1 
ATOM   5700  H H    . LEU B 1 50  ? 37.658  5.748   -65.427 1.00 53.24  ? 50  LEU B H    1 
ATOM   5701  H HA   . LEU B 1 50  ? 37.741  5.761   -62.861 1.00 47.41  ? 50  LEU B HA   1 
ATOM   5702  H HB2  . LEU B 1 50  ? 35.758  5.559   -64.103 1.00 48.47  ? 50  LEU B HB2  1 
ATOM   5703  H HB3  . LEU B 1 50  ? 36.137  4.058   -64.434 1.00 48.47  ? 50  LEU B HB3  1 
ATOM   5704  H HG   . LEU B 1 50  ? 35.722  3.392   -62.306 1.00 56.28  ? 50  LEU B HG   1 
ATOM   5705  H HD11 . LEU B 1 50  ? 36.627  5.166   -61.043 1.00 43.20  ? 50  LEU B HD11 1 
ATOM   5706  H HD12 . LEU B 1 50  ? 35.397  6.086   -61.450 1.00 43.20  ? 50  LEU B HD12 1 
ATOM   5707  H HD13 . LEU B 1 50  ? 35.167  4.819   -60.519 1.00 43.20  ? 50  LEU B HD13 1 
ATOM   5708  H HD21 . LEU B 1 50  ? 33.493  3.949   -62.053 1.00 42.40  ? 50  LEU B HD21 1 
ATOM   5709  H HD22 . LEU B 1 50  ? 33.681  5.131   -63.098 1.00 42.40  ? 50  LEU B HD22 1 
ATOM   5710  H HD23 . LEU B 1 50  ? 33.835  3.621   -63.569 1.00 42.40  ? 50  LEU B HD23 1 
ATOM   5711  N N    . THR B 1 51  ? 38.796  2.935   -64.015 1.00 30.52  ? 51  THR B N    1 
ATOM   5712  C CA   . THR B 1 51  ? 39.601  1.765   -63.653 1.00 28.58  ? 51  THR B CA   1 
ATOM   5713  C C    . THR B 1 51  ? 40.938  2.182   -63.072 1.00 37.62  ? 51  THR B C    1 
ATOM   5714  O O    . THR B 1 51  ? 41.473  1.515   -62.173 1.00 31.74  ? 51  THR B O    1 
ATOM   5715  C CB   . THR B 1 51  ? 39.875  0.887   -64.863 1.00 39.78  ? 51  THR B CB   1 
ATOM   5716  O OG1  . THR B 1 51  ? 40.508  1.693   -65.875 1.00 45.55  ? 51  THR B OG1  1 
ATOM   5717  C CG2  . THR B 1 51  ? 38.613  0.281   -65.389 1.00 39.77  ? 51  THR B CG2  1 
ATOM   5718  H H    . THR B 1 51  ? 38.564  2.966   -64.843 1.00 36.58  ? 51  THR B H    1 
ATOM   5719  H HA   . THR B 1 51  ? 39.127  1.238   -62.990 1.00 34.26  ? 51  THR B HA   1 
ATOM   5720  H HB   . THR B 1 51  ? 40.474  0.167   -64.608 1.00 47.70  ? 51  THR B HB   1 
ATOM   5721  H HG1  . THR B 1 51  ? 40.669  1.226   -66.555 1.00 54.62  ? 51  THR B HG1  1 
ATOM   5722  H HG21 . THR B 1 51  ? 38.808  -0.274  -66.160 1.00 47.68  ? 51  THR B HG21 1 
ATOM   5723  H HG22 . THR B 1 51  ? 38.197  -0.265  -64.704 1.00 47.68  ? 51  THR B HG22 1 
ATOM   5724  H HG23 . THR B 1 51  ? 37.995  0.981   -65.653 1.00 47.68  ? 51  THR B HG23 1 
ATOM   5725  N N    . GLU B 1 52  ? 41.509  3.259   -63.617 1.00 40.00  ? 52  GLU B N    1 
ATOM   5726  C CA   . GLU B 1 52  ? 42.769  3.799   -63.115 1.00 44.32  ? 52  GLU B CA   1 
ATOM   5727  C C    . GLU B 1 52  ? 42.597  4.378   -61.714 1.00 32.83  ? 52  GLU B C    1 
ATOM   5728  O O    . GLU B 1 52  ? 43.366  4.050   -60.801 1.00 34.51  ? 52  GLU B O    1 
ATOM   5729  C CB   . GLU B 1 52  ? 43.319  4.861   -64.086 1.00 47.07  ? 52  GLU B CB   1 
ATOM   5730  C CG   . GLU B 1 52  ? 44.375  4.320   -65.073 1.00 49.75  ? 52  GLU B CG   1 
ATOM   5731  C CD   . GLU B 1 52  ? 44.560  5.189   -66.334 1.00 60.51  ? 52  GLU B CD   1 
ATOM   5732  O OE1  . GLU B 1 52  ? 44.273  6.419   -66.323 1.00 54.32  ? 52  GLU B OE1  1 
ATOM   5733  O OE2  . GLU B 1 52  ? 44.978  4.614   -67.360 1.00 55.92  ? 52  GLU B OE2  1 
ATOM   5734  H H    . GLU B 1 52  ? 41.182  3.696   -64.282 1.00 47.96  ? 52  GLU B H    1 
ATOM   5735  H HA   . GLU B 1 52  ? 43.419  3.081   -63.062 1.00 53.14  ? 52  GLU B HA   1 
ATOM   5736  H HB2  . GLU B 1 52  ? 42.583  5.219   -64.606 1.00 56.45  ? 52  GLU B HB2  1 
ATOM   5737  H HB3  . GLU B 1 52  ? 43.732  5.571   -63.570 1.00 56.45  ? 52  GLU B HB3  1 
ATOM   5738  H HG2  . GLU B 1 52  ? 45.231  4.273   -64.619 1.00 59.66  ? 52  GLU B HG2  1 
ATOM   5739  H HG3  . GLU B 1 52  ? 44.107  3.434   -65.361 1.00 59.66  ? 52  GLU B HG3  1 
ATOM   5740  N N    . ILE B 1 53  ? 41.574  5.216   -61.514 1.00 40.56  ? 53  ILE B N    1 
ATOM   5741  C CA   . ILE B 1 53  ? 41.301  5.736   -60.173 1.00 36.22  ? 53  ILE B CA   1 
ATOM   5742  C C    . ILE B 1 53  ? 41.099  4.589   -59.188 1.00 38.29  ? 53  ILE B C    1 
ATOM   5743  O O    . ILE B 1 53  ? 41.653  4.594   -58.078 1.00 32.82  ? 53  ILE B O    1 
ATOM   5744  C CB   . ILE B 1 53  ? 40.100  6.690   -60.192 1.00 44.75  ? 53  ILE B CB   1 
ATOM   5745  C CG1  . ILE B 1 53  ? 40.469  7.972   -60.920 1.00 36.66  ? 53  ILE B CG1  1 
ATOM   5746  C CG2  . ILE B 1 53  ? 39.661  7.036   -58.767 1.00 43.89  ? 53  ILE B CG2  1 
ATOM   5747  C CD1  . ILE B 1 53  ? 39.279  8.805   -61.296 1.00 40.02  ? 53  ILE B CD1  1 
ATOM   5748  H H    . ILE B 1 53  ? 41.036  5.493   -62.125 1.00 48.63  ? 53  ILE B H    1 
ATOM   5749  H HA   . ILE B 1 53  ? 42.073  6.244   -59.876 1.00 43.42  ? 53  ILE B HA   1 
ATOM   5750  H HB   . ILE B 1 53  ? 39.363  6.263   -60.656 1.00 53.66  ? 53  ILE B HB   1 
ATOM   5751  H HG12 . ILE B 1 53  ? 41.038  8.507   -60.345 1.00 43.95  ? 53  ILE B HG12 1 
ATOM   5752  H HG13 . ILE B 1 53  ? 40.944  7.745   -61.735 1.00 43.95  ? 53  ILE B HG13 1 
ATOM   5753  H HG21 . ILE B 1 53  ? 38.902  7.639   -58.809 1.00 52.63  ? 53  ILE B HG21 1 
ATOM   5754  H HG22 . ILE B 1 53  ? 39.411  6.220   -58.307 1.00 52.63  ? 53  ILE B HG22 1 
ATOM   5755  H HG23 . ILE B 1 53  ? 40.399  7.464   -58.305 1.00 52.63  ? 53  ILE B HG23 1 
ATOM   5756  H HD11 . ILE B 1 53  ? 39.585  9.603   -61.755 1.00 47.99  ? 53  ILE B HD11 1 
ATOM   5757  H HD12 . ILE B 1 53  ? 38.704  8.287   -61.881 1.00 47.99  ? 53  ILE B HD12 1 
ATOM   5758  H HD13 . ILE B 1 53  ? 38.798  9.049   -60.490 1.00 47.99  ? 53  ILE B HD13 1 
ATOM   5759  N N    . ILE B 1 54  ? 40.315  3.583   -59.574 1.00 35.77  ? 54  ILE B N    1 
ATOM   5760  C CA   . ILE B 1 54  ? 40.104  2.461   -58.663 1.00 33.22  ? 54  ILE B CA   1 
ATOM   5761  C C    . ILE B 1 54  ? 41.417  1.749   -58.364 1.00 34.31  ? 54  ILE B C    1 
ATOM   5762  O O    . ILE B 1 54  ? 41.677  1.347   -57.220 1.00 32.93  ? 54  ILE B O    1 
ATOM   5763  C CB   . ILE B 1 54  ? 39.037  1.502   -59.221 1.00 29.55  ? 54  ILE B CB   1 
ATOM   5764  C CG1  . ILE B 1 54  ? 37.670  2.135   -59.089 1.00 29.51  ? 54  ILE B CG1  1 
ATOM   5765  C CG2  . ILE B 1 54  ? 38.998  0.238   -58.466 1.00 30.95  ? 54  ILE B CG2  1 
ATOM   5766  C CD1  . ILE B 1 54  ? 36.600  1.486   -59.935 1.00 33.97  ? 54  ILE B CD1  1 
ATOM   5767  H H    . ILE B 1 54  ? 39.908  3.526   -60.329 1.00 42.88  ? 54  ILE B H    1 
ATOM   5768  H HA   . ILE B 1 54  ? 39.767  2.809   -57.823 1.00 39.82  ? 54  ILE B HA   1 
ATOM   5769  H HB   . ILE B 1 54  ? 39.221  1.317   -60.155 1.00 35.41  ? 54  ILE B HB   1 
ATOM   5770  H HG12 . ILE B 1 54  ? 37.388  2.076   -58.162 1.00 35.37  ? 54  ILE B HG12 1 
ATOM   5771  H HG13 . ILE B 1 54  ? 37.731  3.066   -59.354 1.00 35.37  ? 54  ILE B HG13 1 
ATOM   5772  H HG21 . ILE B 1 54  ? 38.315  -0.336  -58.847 1.00 37.10  ? 54  ILE B HG21 1 
ATOM   5773  H HG22 . ILE B 1 54  ? 39.865  -0.193  -58.527 1.00 37.10  ? 54  ILE B HG22 1 
ATOM   5774  H HG23 . ILE B 1 54  ? 38.788  0.431   -57.538 1.00 37.10  ? 54  ILE B HG23 1 
ATOM   5775  H HD11 . ILE B 1 54  ? 35.761  1.950   -59.792 1.00 40.72  ? 54  ILE B HD11 1 
ATOM   5776  H HD12 . ILE B 1 54  ? 36.857  1.547   -60.869 1.00 40.72  ? 54  ILE B HD12 1 
ATOM   5777  H HD13 . ILE B 1 54  ? 36.514  0.556   -59.676 1.00 40.72  ? 54  ILE B HD13 1 
ATOM   5778  N N    . ASN B 1 55  ? 42.288  1.599   -59.363 1.00 38.00  ? 55  ASN B N    1 
ATOM   5779  C CA   . ASN B 1 55  ? 43.518  0.857   -59.095 1.00 39.44  ? 55  ASN B CA   1 
ATOM   5780  C C    . ASN B 1 55  ? 44.591  1.685   -58.394 1.00 36.32  ? 55  ASN B C    1 
ATOM   5781  O O    . ASN B 1 55  ? 45.529  1.098   -57.843 1.00 39.69  ? 55  ASN B O    1 
ATOM   5782  C CB   . ASN B 1 55  ? 44.056  0.260   -60.393 1.00 32.01  ? 55  ASN B CB   1 
ATOM   5783  C CG   . ASN B 1 55  ? 43.143  -0.847  -60.904 1.00 39.55  ? 55  ASN B CG   1 
ATOM   5784  O OD1  . ASN B 1 55  ? 42.438  -1.508  -60.107 1.00 35.83  ? 55  ASN B OD1  1 
ATOM   5785  N ND2  . ASN B 1 55  ? 43.121  -1.044  -62.211 1.00 40.05  ? 55  ASN B ND2  1 
ATOM   5786  H H    . ASN B 1 55  ? 42.199  1.900   -60.163 1.00 45.56  ? 55  ASN B H    1 
ATOM   5787  H HA   . ASN B 1 55  ? 43.300  0.116   -58.507 1.00 47.28  ? 55  ASN B HA   1 
ATOM   5788  H HB2  . ASN B 1 55  ? 44.105  0.953   -61.070 1.00 38.38  ? 55  ASN B HB2  1 
ATOM   5789  H HB3  . ASN B 1 55  ? 44.935  -0.118  -60.233 1.00 38.38  ? 55  ASN B HB3  1 
ATOM   5790  H HD21 . ASN B 1 55  ? 42.619  -1.657  -62.545 1.00 48.02  ? 55  ASN B HD21 1 
ATOM   5791  H HD22 . ASN B 1 55  ? 43.617  -0.566  -62.726 1.00 48.02  ? 55  ASN B HD22 1 
ATOM   5792  N N    . THR B 1 56  ? 44.462  3.011   -58.358 1.00 36.74  ? 56  THR B N    1 
ATOM   5793  C CA   . THR B 1 56  ? 45.426  3.845   -57.642 1.00 38.34  ? 56  THR B CA   1 
ATOM   5794  C C    . THR B 1 56  ? 44.929  4.333   -56.275 1.00 44.41  ? 56  THR B C    1 
ATOM   5795  O O    . THR B 1 56  ? 45.689  4.246   -55.306 1.00 36.70  ? 56  THR B O    1 
ATOM   5796  C CB   . THR B 1 56  ? 45.839  5.022   -58.528 1.00 42.15  ? 56  THR B CB   1 
ATOM   5797  O OG1  . THR B 1 56  ? 44.676  5.652   -59.072 1.00 53.87  ? 56  THR B OG1  1 
ATOM   5798  C CG2  . THR B 1 56  ? 46.702  4.534   -59.692 1.00 47.50  ? 56  THR B CG2  1 
ATOM   5799  H H    . THR B 1 56  ? 43.827  3.450   -58.738 1.00 44.04  ? 56  THR B H    1 
ATOM   5800  H HA   . THR B 1 56  ? 46.223  3.314   -57.482 1.00 45.97  ? 56  THR B HA   1 
ATOM   5801  H HB   . THR B 1 56  ? 46.348  5.663   -58.008 1.00 50.54  ? 56  THR B HB   1 
ATOM   5802  H HG1  . THR B 1 56  ? 44.240  5.101   -59.533 1.00 64.60  ? 56  THR B HG1  1 
ATOM   5803  H HG21 . THR B 1 56  ? 46.960  5.284   -60.251 1.00 56.96  ? 56  THR B HG21 1 
ATOM   5804  H HG22 . THR B 1 56  ? 47.502  4.103   -59.354 1.00 56.96  ? 56  THR B HG22 1 
ATOM   5805  H HG23 . THR B 1 56  ? 46.205  3.898   -60.230 1.00 56.96  ? 56  THR B HG23 1 
ATOM   5806  N N    . GLN B 1 57  ? 43.676  4.836   -56.166 1.00 42.25  ? 57  GLN B N    1 
ATOM   5807  C CA   . GLN B 1 57  ? 43.058  5.291   -54.903 1.00 37.83  ? 57  GLN B CA   1 
ATOM   5808  C C    . GLN B 1 57  ? 42.278  4.211   -54.136 1.00 46.92  ? 57  GLN B C    1 
ATOM   5809  O O    . GLN B 1 57  ? 41.949  4.407   -52.947 1.00 33.60  ? 57  GLN B O    1 
ATOM   5810  C CB   . GLN B 1 57  ? 42.040  6.399   -55.178 1.00 38.84  ? 57  GLN B CB   1 
ATOM   5811  C CG   . GLN B 1 57  ? 42.522  7.803   -55.248 1.00 46.35  ? 57  GLN B CG   1 
ATOM   5812  C CD   . GLN B 1 57  ? 41.359  8.777   -55.280 1.00 54.66  ? 57  GLN B CD   1 
ATOM   5813  O OE1  . GLN B 1 57  ? 40.538  8.820   -54.346 1.00 44.68  ? 57  GLN B OE1  1 
ATOM   5814  N NE2  . GLN B 1 57  ? 41.262  9.549   -56.358 1.00 55.02  ? 57  GLN B NE2  1 
ATOM   5815  H H    . GLN B 1 57  ? 43.149  4.923   -56.840 1.00 50.66  ? 57  GLN B H    1 
ATOM   5816  H HA   . GLN B 1 57  ? 43.746  5.645   -54.318 1.00 45.36  ? 57  GLN B HA   1 
ATOM   5817  H HB2  . GLN B 1 57  ? 41.614  6.206   -56.028 1.00 46.57  ? 57  GLN B HB2  1 
ATOM   5818  H HB3  . GLN B 1 57  ? 41.371  6.367   -54.476 1.00 46.57  ? 57  GLN B HB3  1 
ATOM   5819  H HG2  . GLN B 1 57  ? 43.062  7.998   -54.466 1.00 55.57  ? 57  GLN B HG2  1 
ATOM   5820  H HG3  . GLN B 1 57  ? 43.044  7.924   -56.057 1.00 55.57  ? 57  GLN B HG3  1 
ATOM   5821  H HE21 . GLN B 1 57  ? 41.848  9.488   -56.985 1.00 65.98  ? 57  GLN B HE21 1 
ATOM   5822  H HE22 . GLN B 1 57  ? 40.619  10.116  -56.424 1.00 65.98  ? 57  GLN B HE22 1 
ATOM   5823  N N    . HIS B 1 58  ? 41.888  3.133   -54.810 1.00 36.26  ? 58  HIS B N    1 
ATOM   5824  C CA   . HIS B 1 58  ? 41.096  2.054   -54.226 1.00 28.08  ? 58  HIS B CA   1 
ATOM   5825  C C    . HIS B 1 58  ? 39.759  2.580   -53.680 1.00 28.51  ? 58  HIS B C    1 
ATOM   5826  O O    . HIS B 1 58  ? 39.354  2.293   -52.565 1.00 26.99  ? 58  HIS B O    1 
ATOM   5827  C CB   . HIS B 1 58  ? 41.903  1.336   -53.153 1.00 31.83  ? 58  HIS B CB   1 
ATOM   5828  C CG   . HIS B 1 58  ? 43.191  0.751   -53.651 1.00 45.32  ? 58  HIS B CG   1 
ATOM   5829  N ND1  . HIS B 1 58  ? 43.246  -0.395  -54.416 1.00 36.74  ? 58  HIS B ND1  1 
ATOM   5830  C CD2  . HIS B 1 58  ? 44.478  1.137   -53.458 1.00 45.13  ? 58  HIS B CD2  1 
ATOM   5831  C CE1  . HIS B 1 58  ? 44.511  -0.686  -54.676 1.00 48.48  ? 58  HIS B CE1  1 
ATOM   5832  N NE2  . HIS B 1 58  ? 45.277  0.230   -54.108 1.00 38.97  ? 58  HIS B NE2  1 
ATOM   5833  H H    . HIS B 1 58  ? 42.079  3.000   -55.638 1.00 43.47  ? 58  HIS B H    1 
ATOM   5834  H HA   . HIS B 1 58  ? 40.894  1.408   -54.921 1.00 33.65  ? 58  HIS B HA   1 
ATOM   5835  H HB2  . HIS B 1 58  ? 42.117  1.967   -52.448 1.00 38.15  ? 58  HIS B HB2  1 
ATOM   5836  H HB3  . HIS B 1 58  ? 41.368  0.611   -52.793 1.00 38.15  ? 58  HIS B HB3  1 
ATOM   5837  H HD2  . HIS B 1 58  ? 44.765  1.878   -52.974 1.00 54.11  ? 58  HIS B HD2  1 
ATOM   5838  H HE1  . HIS B 1 58  ? 44.809  -1.406  -55.183 1.00 58.13  ? 58  HIS B HE1  1 
ATOM   5839  H HE2  . HIS B 1 58  ? 46.136  0.256   -54.145 1.00 46.72  ? 58  HIS B HE2  1 
ATOM   5840  N N    . GLU B 1 59  ? 39.088  3.365   -54.502 1.00 30.60  ? 59  GLU B N    1 
ATOM   5841  C CA   . GLU B 1 59  ? 37.853  4.055   -54.175 1.00 37.94  ? 59  GLU B CA   1 
ATOM   5842  C C    . GLU B 1 59  ? 37.092  4.175   -55.477 1.00 31.81  ? 59  GLU B C    1 
ATOM   5843  O O    . GLU B 1 59  ? 37.660  4.609   -56.478 1.00 32.46  ? 59  GLU B O    1 
ATOM   5844  C CB   . GLU B 1 59  ? 38.113  5.450   -53.600 1.00 35.86  ? 59  GLU B CB   1 
ATOM   5845  C CG   . GLU B 1 59  ? 36.843  6.296   -53.363 1.00 32.56  ? 59  GLU B CG   1 
ATOM   5846  C CD   . GLU B 1 59  ? 37.119  7.580   -52.544 1.00 40.59  ? 59  GLU B CD   1 
ATOM   5847  O OE1  . GLU B 1 59  ? 38.199  7.695   -51.907 1.00 46.54  ? 59  GLU B OE1  1 
ATOM   5848  O OE2  . GLU B 1 59  ? 36.249  8.471   -52.533 1.00 30.54  ? 59  GLU B OE2  1 
ATOM   5849  H H    . GLU B 1 59  ? 39.346  3.522   -55.307 1.00 36.68  ? 59  GLU B H    1 
ATOM   5850  H HA   . GLU B 1 59  ? 37.332  3.536   -53.542 1.00 45.49  ? 59  GLU B HA   1 
ATOM   5851  H HB2  . GLU B 1 59  ? 38.565  5.354   -52.747 1.00 42.99  ? 59  GLU B HB2  1 
ATOM   5852  H HB3  . GLU B 1 59  ? 38.680  5.938   -54.217 1.00 42.99  ? 59  GLU B HB3  1 
ATOM   5853  H HG2  . GLU B 1 59  ? 36.475  6.561   -54.221 1.00 39.03  ? 59  GLU B HG2  1 
ATOM   5854  H HG3  . GLU B 1 59  ? 36.195  5.763   -52.875 1.00 39.03  ? 59  GLU B HG3  1 
ATOM   5855  N N    . ASN B 1 60  ? 35.830  3.781   -55.478 1.00 28.41  ? 60  ASN B N    1 
ATOM   5856  C CA   . ASN B 1 60  ? 34.979  4.041   -56.639 1.00 25.34  ? 60  ASN B CA   1 
ATOM   5857  C C    . ASN B 1 60  ? 34.361  5.409   -56.388 1.00 33.47  ? 60  ASN B C    1 
ATOM   5858  O O    . ASN B 1 60  ? 33.288  5.553   -55.781 1.00 30.28  ? 60  ASN B O    1 
ATOM   5859  C CB   . ASN B 1 60  ? 33.963  2.929   -56.843 1.00 26.70  ? 60  ASN B CB   1 
ATOM   5860  C CG   . ASN B 1 60  ? 33.232  3.036   -58.153 1.00 25.25  ? 60  ASN B CG   1 
ATOM   5861  O OD1  . ASN B 1 60  ? 33.005  4.125   -58.651 1.00 31.39  ? 60  ASN B OD1  1 
ATOM   5862  N ND2  . ASN B 1 60  ? 32.881  1.889   -58.737 1.00 32.90  ? 60  ASN B ND2  1 
ATOM   5863  H H    . ASN B 1 60  ? 35.441  3.367   -54.832 1.00 34.05  ? 60  ASN B H    1 
ATOM   5864  H HA   . ASN B 1 60  ? 35.531  4.098   -57.434 1.00 30.37  ? 60  ASN B HA   1 
ATOM   5865  H HB2  . ASN B 1 60  ? 34.422  2.075   -56.825 1.00 32.00  ? 60  ASN B HB2  1 
ATOM   5866  H HB3  . ASN B 1 60  ? 33.306  2.967   -56.130 1.00 32.00  ? 60  ASN B HB3  1 
ATOM   5867  H HD21 . ASN B 1 60  ? 32.463  1.900   -59.489 1.00 39.43  ? 60  ASN B HD21 1 
ATOM   5868  H HD22 . ASN B 1 60  ? 33.063  1.140   -58.357 1.00 39.43  ? 60  ASN B HD22 1 
ATOM   5869  N N    . VAL B 1 61  ? 35.073  6.426   -56.869 1.00 36.75  ? 61  VAL B N    1 
ATOM   5870  C CA   . VAL B 1 61  ? 34.745  7.824   -56.628 1.00 26.50  ? 61  VAL B CA   1 
ATOM   5871  C C    . VAL B 1 61  ? 33.430  8.208   -57.227 1.00 30.07  ? 61  VAL B C    1 
ATOM   5872  O O    . VAL B 1 61  ? 32.887  9.261   -56.881 1.00 40.11  ? 61  VAL B O    1 
ATOM   5873  C CB   . VAL B 1 61  ? 35.854  8.737   -57.191 1.00 33.49  ? 61  VAL B CB   1 
ATOM   5874  C CG1  . VAL B 1 61  ? 37.204  8.411   -56.531 1.00 33.96  ? 61  VAL B CG1  1 
ATOM   5875  C CG2  . VAL B 1 61  ? 35.944  8.575   -58.716 1.00 37.73  ? 61  VAL B CG2  1 
ATOM   5876  H H    . VAL B 1 61  ? 35.776  6.324   -57.355 1.00 44.05  ? 61  VAL B H    1 
ATOM   5877  H HA   . VAL B 1 61  ? 34.691  7.973   -55.671 1.00 31.76  ? 61  VAL B HA   1 
ATOM   5878  H HB   . VAL B 1 61  ? 35.636  9.662   -56.996 1.00 40.15  ? 61  VAL B HB   1 
ATOM   5879  H HG11 . VAL B 1 61  ? 37.884  8.996   -56.900 1.00 40.71  ? 61  VAL B HG11 1 
ATOM   5880  H HG12 . VAL B 1 61  ? 37.129  8.552   -55.575 1.00 40.71  ? 61  VAL B HG12 1 
ATOM   5881  H HG13 . VAL B 1 61  ? 37.429  7.486   -56.714 1.00 40.71  ? 61  VAL B HG13 1 
ATOM   5882  H HG21 . VAL B 1 61  ? 36.644  9.155   -59.054 1.00 45.23  ? 61  VAL B HG21 1 
ATOM   5883  H HG22 . VAL B 1 61  ? 36.150  7.650   -58.923 1.00 45.23  ? 61  VAL B HG22 1 
ATOM   5884  H HG23 . VAL B 1 61  ? 35.092  8.821   -59.110 1.00 45.23  ? 61  VAL B HG23 1 
ATOM   5885  N N    . LYS B 1 62  ? 32.910  7.407   -58.155 1.00 35.69  ? 62  LYS B N    1 
ATOM   5886  C CA   . LYS B 1 62  ? 31.609  7.706   -58.741 1.00 37.84  ? 62  LYS B CA   1 
ATOM   5887  C C    . LYS B 1 62  ? 30.446  7.010   -58.027 1.00 26.25  ? 62  LYS B C    1 
ATOM   5888  O O    . LYS B 1 62  ? 29.464  7.663   -57.692 1.00 29.60  ? 62  LYS B O    1 
ATOM   5889  C CB   . LYS B 1 62  ? 31.574  7.319   -60.224 1.00 39.61  ? 62  LYS B CB   1 
ATOM   5890  C CG   . LYS B 1 62  ? 30.192  7.554   -60.844 1.00 38.82  ? 62  LYS B CG   1 
ATOM   5891  C CD   . LYS B 1 62  ? 30.232  7.702   -62.354 1.00 43.80  ? 62  LYS B CD   1 
ATOM   5892  C CE   . LYS B 1 62  ? 28.826  8.038   -62.890 1.00 50.21  ? 62  LYS B CE   1 
ATOM   5893  N NZ   . LYS B 1 62  ? 28.668  7.779   -64.345 1.00 56.90  ? 62  LYS B NZ   1 
ATOM   5894  H H    . LYS B 1 62  ? 33.285  6.694   -58.457 1.00 42.79  ? 62  LYS B H    1 
ATOM   5895  H HA   . LYS B 1 62  ? 31.457  8.662   -58.683 1.00 45.36  ? 62  LYS B HA   1 
ATOM   5896  H HB2  . LYS B 1 62  ? 32.219  7.857   -60.709 1.00 47.49  ? 62  LYS B HB2  1 
ATOM   5897  H HB3  . LYS B 1 62  ? 31.790  6.377   -60.313 1.00 47.49  ? 62  LYS B HB3  1 
ATOM   5898  H HG2  . LYS B 1 62  ? 29.620  6.799   -60.633 1.00 46.54  ? 62  LYS B HG2  1 
ATOM   5899  H HG3  . LYS B 1 62  ? 29.816  8.368   -60.474 1.00 46.54  ? 62  LYS B HG3  1 
ATOM   5900  H HD2  . LYS B 1 62  ? 30.834  8.424   -62.594 1.00 52.52  ? 62  LYS B HD2  1 
ATOM   5901  H HD3  . LYS B 1 62  ? 30.524  6.868   -62.755 1.00 52.52  ? 62  LYS B HD3  1 
ATOM   5902  H HE2  . LYS B 1 62  ? 28.174  7.495   -62.419 1.00 60.21  ? 62  LYS B HE2  1 
ATOM   5903  H HE3  . LYS B 1 62  ? 28.647  8.978   -62.733 1.00 60.21  ? 62  LYS B HE3  1 
ATOM   5904  H HZ1  . LYS B 1 62  ? 27.842  7.988   -64.603 1.00 68.24  ? 62  LYS B HZ1  1 
ATOM   5905  H HZ2  . LYS B 1 62  ? 29.248  8.272   -64.806 1.00 68.24  ? 62  LYS B HZ2  1 
ATOM   5906  H HZ3  . LYS B 1 62  ? 28.816  6.919   -64.519 1.00 68.24  ? 62  LYS B HZ3  1 
ATOM   5907  N N    . TYR B 1 63  ? 30.523  5.690   -57.814 1.00 31.53  ? 63  TYR B N    1 
ATOM   5908  C CA   . TYR B 1 63  ? 29.378  4.923   -57.334 1.00 34.88  ? 63  TYR B CA   1 
ATOM   5909  C C    . TYR B 1 63  ? 29.455  4.545   -55.863 1.00 29.98  ? 63  TYR B C    1 
ATOM   5910  O O    . TYR B 1 63  ? 28.469  4.029   -55.333 1.00 25.89  ? 63  TYR B O    1 
ATOM   5911  C CB   . TYR B 1 63  ? 29.216  3.623   -58.136 1.00 28.79  ? 63  TYR B CB   1 
ATOM   5912  C CG   . TYR B 1 63  ? 28.901  3.824   -59.615 1.00 30.10  ? 63  TYR B CG   1 
ATOM   5913  C CD1  . TYR B 1 63  ? 29.920  3.991   -60.534 1.00 36.63  ? 63  TYR B CD1  1 
ATOM   5914  C CD2  . TYR B 1 63  ? 27.591  3.847   -60.084 1.00 33.41  ? 63  TYR B CD2  1 
ATOM   5915  C CE1  . TYR B 1 63  ? 29.651  4.171   -61.885 1.00 44.70  ? 63  TYR B CE1  1 
ATOM   5916  C CE2  . TYR B 1 63  ? 27.312  4.024   -61.421 1.00 36.82  ? 63  TYR B CE2  1 
ATOM   5917  C CZ   . TYR B 1 63  ? 28.349  4.186   -62.328 1.00 42.20  ? 63  TYR B CZ   1 
ATOM   5918  O OH   . TYR B 1 63  ? 28.091  4.374   -63.677 1.00 41.17  ? 63  TYR B OH   1 
ATOM   5919  H H    . TYR B 1 63  ? 31.231  5.219   -57.942 1.00 37.80  ? 63  TYR B H    1 
ATOM   5920  H HA   . TYR B 1 63  ? 28.575  5.451   -57.461 1.00 41.81  ? 63  TYR B HA   1 
ATOM   5921  H HB2  . TYR B 1 63  ? 30.042  3.118   -58.077 1.00 34.51  ? 63  TYR B HB2  1 
ATOM   5922  H HB3  . TYR B 1 63  ? 28.490  3.108   -57.749 1.00 34.51  ? 63  TYR B HB3  1 
ATOM   5923  H HD1  . TYR B 1 63  ? 30.803  3.979   -60.244 1.00 43.91  ? 63  TYR B HD1  1 
ATOM   5924  H HD2  . TYR B 1 63  ? 26.890  3.735   -59.483 1.00 40.05  ? 63  TYR B HD2  1 
ATOM   5925  H HE1  . TYR B 1 63  ? 30.349  4.282   -62.488 1.00 53.60  ? 63  TYR B HE1  1 
ATOM   5926  H HE2  . TYR B 1 63  ? 26.429  4.036   -61.715 1.00 44.14  ? 63  TYR B HE2  1 
ATOM   5927  H HH   . TYR B 1 63  ? 28.813  4.464   -64.097 1.00 49.36  ? 63  TYR B HH   1 
ATOM   5928  N N    . LEU B 1 64  ? 30.609  4.714   -55.200 1.00 26.75  ? 64  LEU B N    1 
ATOM   5929  C CA   . LEU B 1 64  ? 30.664  4.451   -53.771 1.00 24.23  ? 64  LEU B CA   1 
ATOM   5930  C C    . LEU B 1 64  ? 31.730  5.358   -53.169 1.00 25.07  ? 64  LEU B C    1 
ATOM   5931  O O    . LEU B 1 64  ? 32.698  4.905   -52.538 1.00 28.01  ? 64  LEU B O    1 
ATOM   5932  C CB   . LEU B 1 64  ? 30.941  2.982   -53.473 1.00 26.24  ? 64  LEU B CB   1 
ATOM   5933  C CG   . LEU B 1 64  ? 30.642  2.584   -52.015 1.00 26.44  ? 64  LEU B CG   1 
ATOM   5934  C CD1  . LEU B 1 64  ? 29.097  2.446   -51.828 1.00 26.24  ? 64  LEU B CD1  1 
ATOM   5935  C CD2  . LEU B 1 64  ? 31.403  1.304   -51.627 1.00 25.86  ? 64  LEU B CD2  1 
ATOM   5936  H H    . LEU B 1 64  ? 31.351  4.974   -55.551 1.00 32.06  ? 64  LEU B H    1 
ATOM   5937  H HA   . LEU B 1 64  ? 29.811  4.683   -53.372 1.00 29.03  ? 64  LEU B HA   1 
ATOM   5938  H HB2  . LEU B 1 64  ? 30.386  2.435   -54.051 1.00 31.44  ? 64  LEU B HB2  1 
ATOM   5939  H HB3  . LEU B 1 64  ? 31.878  2.798   -53.646 1.00 31.44  ? 64  LEU B HB3  1 
ATOM   5940  H HG   . LEU B 1 64  ? 30.946  3.295   -51.430 1.00 31.69  ? 64  LEU B HG   1 
ATOM   5941  H HD11 . LEU B 1 64  ? 28.912  2.196   -50.910 1.00 31.44  ? 64  LEU B HD11 1 
ATOM   5942  H HD12 . LEU B 1 64  ? 28.679  3.298   -52.031 1.00 31.44  ? 64  LEU B HD12 1 
ATOM   5943  H HD13 . LEU B 1 64  ? 28.767  1.763   -52.432 1.00 31.44  ? 64  LEU B HD13 1 
ATOM   5944  H HD21 . LEU B 1 64  ? 31.194  1.080   -50.706 1.00 30.99  ? 64  LEU B HD21 1 
ATOM   5945  H HD22 . LEU B 1 64  ? 31.127  0.583   -52.214 1.00 30.99  ? 64  LEU B HD22 1 
ATOM   5946  H HD23 . LEU B 1 64  ? 32.355  1.462   -51.722 1.00 30.99  ? 64  LEU B HD23 1 
ATOM   5947  N N    . PRO B 1 65  ? 31.568  6.651   -53.324 1.00 23.75  ? 65  PRO B N    1 
ATOM   5948  C CA   . PRO B 1 65  ? 32.593  7.567   -52.832 1.00 32.92  ? 65  PRO B CA   1 
ATOM   5949  C C    . PRO B 1 65  ? 32.703  7.479   -51.327 1.00 33.12  ? 65  PRO B C    1 
ATOM   5950  O O    . PRO B 1 65  ? 31.764  7.087   -50.636 1.00 28.60  ? 65  PRO B O    1 
ATOM   5951  C CB   . PRO B 1 65  ? 32.092  8.930   -53.284 1.00 28.12  ? 65  PRO B CB   1 
ATOM   5952  C CG   . PRO B 1 65  ? 30.594  8.753   -53.288 1.00 31.93  ? 65  PRO B CG   1 
ATOM   5953  C CD   . PRO B 1 65  ? 30.366  7.348   -53.779 1.00 21.72  ? 65  PRO B CD   1 
ATOM   5954  H HA   . PRO B 1 65  ? 33.452  7.378   -53.240 1.00 39.46  ? 65  PRO B HA   1 
ATOM   5955  H HB2  . PRO B 1 65  ? 32.362  9.612   -52.649 1.00 33.70  ? 65  PRO B HB2  1 
ATOM   5956  H HB3  . PRO B 1 65  ? 32.423  9.128   -54.174 1.00 33.70  ? 65  PRO B HB3  1 
ATOM   5957  H HG2  . PRO B 1 65  ? 30.249  8.862   -52.387 1.00 38.27  ? 65  PRO B HG2  1 
ATOM   5958  H HG3  . PRO B 1 65  ? 30.190  9.397   -53.890 1.00 38.27  ? 65  PRO B HG3  1 
ATOM   5959  H HD2  . PRO B 1 65  ? 29.576  6.967   -53.366 1.00 26.02  ? 65  PRO B HD2  1 
ATOM   5960  H HD3  . PRO B 1 65  ? 30.309  7.331   -54.747 1.00 26.02  ? 65  PRO B HD3  1 
ATOM   5961  N N    . GLY B 1 66  ? 33.885  7.822   -50.822 1.00 32.57  ? 66  GLY B N    1 
ATOM   5962  C CA   . GLY B 1 66  ? 34.128  7.841   -49.398 1.00 28.96  ? 66  GLY B CA   1 
ATOM   5963  C C    . GLY B 1 66  ? 34.523  6.513   -48.817 1.00 27.99  ? 66  GLY B C    1 
ATOM   5964  O O    . GLY B 1 66  ? 34.909  6.457   -47.641 1.00 30.64  ? 66  GLY B O    1 
ATOM   5965  H H    . GLY B 1 66  ? 34.566  8.049   -51.296 1.00 39.04  ? 66  GLY B H    1 
ATOM   5966  H HA2  . GLY B 1 66  ? 34.837  8.475   -49.208 1.00 34.71  ? 66  GLY B HA2  1 
ATOM   5967  H HA3  . GLY B 1 66  ? 33.325  8.141   -48.944 1.00 34.71  ? 66  GLY B HA3  1 
ATOM   5968  N N    . HIS B 1 67  ? 34.424  5.439   -49.586 1.00 26.19  ? 67  HIS B N    1 
ATOM   5969  C CA   . HIS B 1 67  ? 34.742  4.102   -49.104 1.00 31.19  ? 67  HIS B CA   1 
ATOM   5970  C C    . HIS B 1 67  ? 35.967  3.557   -49.820 1.00 29.69  ? 67  HIS B C    1 
ATOM   5971  O O    . HIS B 1 67  ? 36.109  3.735   -51.027 1.00 27.92  ? 67  HIS B O    1 
ATOM   5972  C CB   . HIS B 1 67  ? 33.597  3.139   -49.331 1.00 30.63  ? 67  HIS B CB   1 
ATOM   5973  C CG   . HIS B 1 67  ? 32.384  3.456   -48.535 1.00 31.70  ? 67  HIS B CG   1 
ATOM   5974  N ND1  . HIS B 1 67  ? 32.053  2.778   -47.382 1.00 32.05  ? 67  HIS B ND1  1 
ATOM   5975  C CD2  . HIS B 1 67  ? 31.430  4.391   -48.717 1.00 28.40  ? 67  HIS B CD2  1 
ATOM   5976  C CE1  . HIS B 1 67  ? 30.926  3.274   -46.901 1.00 36.07  ? 67  HIS B CE1  1 
ATOM   5977  N NE2  . HIS B 1 67  ? 30.532  4.255   -47.692 1.00 26.04  ? 67  HIS B NE2  1 
ATOM   5978  H H    . HIS B 1 67  ? 34.169  5.459   -50.407 1.00 31.38  ? 67  HIS B H    1 
ATOM   5979  H HA   . HIS B 1 67  ? 34.931  4.136   -48.153 1.00 37.39  ? 67  HIS B HA   1 
ATOM   5980  H HB2  . HIS B 1 67  ? 33.351  3.162   -50.269 1.00 36.71  ? 67  HIS B HB2  1 
ATOM   5981  H HB3  . HIS B 1 67  ? 33.887  2.246   -49.088 1.00 36.71  ? 67  HIS B HB3  1 
ATOM   5982  H HD2  . HIS B 1 67  ? 31.384  5.004   -49.415 1.00 34.04  ? 67  HIS B HD2  1 
ATOM   5983  H HE1  . HIS B 1 67  ? 30.491  2.989   -46.129 1.00 43.24  ? 67  HIS B HE1  1 
ATOM   5984  H HE2  . HIS B 1 67  ? 29.827  4.735   -47.579 1.00 31.21  ? 67  HIS B HE2  1 
ATOM   5985  N N    . LYS B 1 68  ? 36.823  2.874   -49.063 1.00 32.68  ? 68  LYS B N    1 
ATOM   5986  C CA   . LYS B 1 68  ? 38.024  2.253   -49.596 1.00 31.85  ? 68  LYS B CA   1 
ATOM   5987  C C    . LYS B 1 68  ? 37.721  0.798   -49.895 1.00 27.69  ? 68  LYS B C    1 
ATOM   5988  O O    . LYS B 1 68  ? 37.161  0.090   -49.055 1.00 28.70  ? 68  LYS B O    1 
ATOM   5989  C CB   . LYS B 1 68  ? 39.185  2.350   -48.597 1.00 41.37  ? 68  LYS B CB   1 
ATOM   5990  C CG   . LYS B 1 68  ? 39.821  3.748   -48.473 1.00 42.03  ? 68  LYS B CG   1 
ATOM   5991  C CD   . LYS B 1 68  ? 40.281  4.280   -49.838 1.00 46.21  ? 68  LYS B CD   1 
ATOM   5992  C CE   . LYS B 1 68  ? 40.841  5.700   -49.777 1.00 47.78  ? 68  LYS B CE   1 
ATOM   5993  N NZ   . LYS B 1 68  ? 40.570  6.442   -51.071 1.00 44.10  ? 68  LYS B NZ   1 
ATOM   5994  H H    . LYS B 1 68  ? 36.724  2.756   -48.217 1.00 39.17  ? 68  LYS B H    1 
ATOM   5995  H HA   . LYS B 1 68  ? 38.284  2.694   -50.420 1.00 38.18  ? 68  LYS B HA   1 
ATOM   5996  H HB2  . LYS B 1 68  ? 38.858  2.098   -47.719 1.00 49.61  ? 68  LYS B HB2  1 
ATOM   5997  H HB3  . LYS B 1 68  ? 39.882  1.735   -48.873 1.00 49.61  ? 68  LYS B HB3  1 
ATOM   5998  H HG2  . LYS B 1 68  ? 39.167  4.366   -48.111 1.00 50.39  ? 68  LYS B HG2  1 
ATOM   5999  H HG3  . LYS B 1 68  ? 40.594  3.697   -47.890 1.00 50.39  ? 68  LYS B HG3  1 
ATOM   6000  H HD2  . LYS B 1 68  ? 40.978  3.700   -50.182 1.00 55.42  ? 68  LYS B HD2  1 
ATOM   6001  H HD3  . LYS B 1 68  ? 39.525  4.283   -50.445 1.00 55.42  ? 68  LYS B HD3  1 
ATOM   6002  H HE2  . LYS B 1 68  ? 40.415  6.184   -49.052 1.00 57.30  ? 68  LYS B HE2  1 
ATOM   6003  H HE3  . LYS B 1 68  ? 41.801  5.663   -49.641 1.00 57.30  ? 68  LYS B HE3  1 
ATOM   6004  H HZ1  . LYS B 1 68  ? 39.693  6.490   -51.216 1.00 52.87  ? 68  LYS B HZ1  1 
ATOM   6005  H HZ2  . LYS B 1 68  ? 40.900  7.267   -51.023 1.00 52.87  ? 68  LYS B HZ2  1 
ATOM   6006  H HZ3  . LYS B 1 68  ? 40.953  6.016   -51.752 1.00 52.87  ? 68  LYS B HZ3  1 
ATOM   6007  N N    . LEU B 1 69  ? 38.106  0.350   -51.089 1.00 30.69  ? 69  LEU B N    1 
ATOM   6008  C CA   . LEU B 1 69  ? 38.027  -1.067  -51.429 1.00 19.62  ? 69  LEU B CA   1 
ATOM   6009  C C    . LEU B 1 69  ? 39.320  -1.769  -51.068 1.00 26.70  ? 69  LEU B C    1 
ATOM   6010  O O    . LEU B 1 69  ? 40.388  -1.166  -51.152 1.00 39.47  ? 69  LEU B O    1 
ATOM   6011  C CB   . LEU B 1 69  ? 37.745  -1.235  -52.901 1.00 27.56  ? 69  LEU B CB   1 
ATOM   6012  C CG   . LEU B 1 69  ? 36.565  -0.367  -53.374 1.00 29.98  ? 69  LEU B CG   1 
ATOM   6013  C CD1  . LEU B 1 69  ? 36.398  -0.461  -54.904 1.00 39.51  ? 69  LEU B CD1  1 
ATOM   6014  C CD2  . LEU B 1 69  ? 35.278  -0.791  -52.675 1.00 31.53  ? 69  LEU B CD2  1 
ATOM   6015  H H    . LEU B 1 69  ? 38.416  0.847   -51.718 1.00 36.78  ? 69  LEU B H    1 
ATOM   6016  H HA   . LEU B 1 69  ? 37.304  -1.479  -50.929 1.00 23.50  ? 69  LEU B HA   1 
ATOM   6017  H HB2  . LEU B 1 69  ? 38.532  -0.977  -53.406 1.00 33.03  ? 69  LEU B HB2  1 
ATOM   6018  H HB3  . LEU B 1 69  ? 37.526  -2.164  -53.078 1.00 33.03  ? 69  LEU B HB3  1 
ATOM   6019  H HG   . LEU B 1 69  ? 36.741  0.560   -53.146 1.00 35.94  ? 69  LEU B HG   1 
ATOM   6020  H HD11 . LEU B 1 69  ? 35.649  0.095   -55.174 1.00 47.37  ? 69  LEU B HD11 1 
ATOM   6021  H HD12 . LEU B 1 69  ? 37.212  -0.150  -55.330 1.00 47.37  ? 69  LEU B HD12 1 
ATOM   6022  H HD13 . LEU B 1 69  ? 36.229  -1.385  -55.147 1.00 47.37  ? 69  LEU B HD13 1 
ATOM   6023  H HD21 . LEU B 1 69  ? 34.550  -0.231  -52.988 1.00 37.80  ? 69  LEU B HD21 1 
ATOM   6024  H HD22 . LEU B 1 69  ? 35.096  -1.720  -52.887 1.00 37.80  ? 69  LEU B HD22 1 
ATOM   6025  H HD23 . LEU B 1 69  ? 35.389  -0.685  -51.717 1.00 37.80  ? 69  LEU B HD23 1 
ATOM   6026  N N    . PRO B 1 70  ? 39.254  -3.016  -50.621 1.00 26.27  ? 70  PRO B N    1 
ATOM   6027  C CA   . PRO B 1 70  ? 40.470  -3.789  -50.401 1.00 23.83  ? 70  PRO B CA   1 
ATOM   6028  C C    . PRO B 1 70  ? 41.365  -3.730  -51.627 1.00 29.70  ? 70  PRO B C    1 
ATOM   6029  O O    . PRO B 1 70  ? 40.877  -3.759  -52.767 1.00 25.62  ? 70  PRO B O    1 
ATOM   6030  C CB   . PRO B 1 70  ? 39.950  -5.211  -50.143 1.00 27.57  ? 70  PRO B CB   1 
ATOM   6031  C CG   . PRO B 1 70  ? 38.502  -4.998  -49.674 1.00 26.06  ? 70  PRO B CG   1 
ATOM   6032  C CD   . PRO B 1 70  ? 38.031  -3.774  -50.334 1.00 30.12  ? 70  PRO B CD   1 
ATOM   6033  H HA   . PRO B 1 70  ? 40.951  -3.466  -49.622 1.00 28.55  ? 70  PRO B HA   1 
ATOM   6034  H HB2  . PRO B 1 70  ? 39.976  -5.726  -50.964 1.00 33.05  ? 70  PRO B HB2  1 
ATOM   6035  H HB3  . PRO B 1 70  ? 40.480  -5.635  -49.450 1.00 33.05  ? 70  PRO B HB3  1 
ATOM   6036  H HG2  . PRO B 1 70  ? 37.961  -5.758  -49.941 1.00 31.23  ? 70  PRO B HG2  1 
ATOM   6037  H HG3  . PRO B 1 70  ? 38.487  -4.892  -48.710 1.00 31.23  ? 70  PRO B HG3  1 
ATOM   6038  H HD2  . PRO B 1 70  ? 37.572  -3.994  -51.160 1.00 36.10  ? 70  PRO B HD2  1 
ATOM   6039  H HD3  . PRO B 1 70  ? 37.457  -3.270  -49.735 1.00 36.10  ? 70  PRO B HD3  1 
ATOM   6040  N N    . PRO B 1 71  ? 42.680  -3.571  -51.437 1.00 31.98  ? 71  PRO B N    1 
ATOM   6041  C CA   . PRO B 1 71  ? 43.542  -3.265  -52.573 1.00 30.93  ? 71  PRO B CA   1 
ATOM   6042  C C    . PRO B 1 71  ? 43.813  -4.461  -53.437 1.00 25.58  ? 71  PRO B C    1 
ATOM   6043  O O    . PRO B 1 71  ? 44.403  -4.304  -54.519 1.00 33.16  ? 71  PRO B O    1 
ATOM   6044  C CB   . PRO B 1 71  ? 44.832  -2.751  -51.907 1.00 32.68  ? 71  PRO B CB   1 
ATOM   6045  C CG   . PRO B 1 71  ? 44.882  -3.490  -50.622 1.00 34.45  ? 71  PRO B CG   1 
ATOM   6046  C CD   . PRO B 1 71  ? 43.428  -3.567  -50.169 1.00 30.93  ? 71  PRO B CD   1 
ATOM   6047  H HA   . PRO B 1 71  ? 43.154  -2.558  -53.112 1.00 37.07  ? 71  PRO B HA   1 
ATOM   6048  H HB2  . PRO B 1 71  ? 45.598  -2.966  -52.461 1.00 39.18  ? 71  PRO B HB2  1 
ATOM   6049  H HB3  . PRO B 1 71  ? 44.768  -1.795  -51.756 1.00 39.18  ? 71  PRO B HB3  1 
ATOM   6050  H HG2  . PRO B 1 71  ? 45.246  -4.377  -50.767 1.00 41.30  ? 71  PRO B HG2  1 
ATOM   6051  H HG3  . PRO B 1 71  ? 45.418  -2.997  -49.981 1.00 41.30  ? 71  PRO B HG3  1 
ATOM   6052  H HD2  . PRO B 1 71  ? 43.269  -4.389  -49.679 1.00 37.07  ? 71  PRO B HD2  1 
ATOM   6053  H HD3  . PRO B 1 71  ? 43.196  -2.787  -49.641 1.00 37.07  ? 71  PRO B HD3  1 
ATOM   6054  N N    . ASN B 1 72  ? 43.444  -5.645  -52.977 1.00 27.81  ? 72  ASN B N    1 
ATOM   6055  C CA   . ASN B 1 72  ? 43.534  -6.825  -53.811 1.00 22.25  ? 72  ASN B CA   1 
ATOM   6056  C C    . ASN B 1 72  ? 42.404  -6.916  -54.818 1.00 32.90  ? 72  ASN B C    1 
ATOM   6057  O O    . ASN B 1 72  ? 42.377  -7.880  -55.584 1.00 25.97  ? 72  ASN B O    1 
ATOM   6058  C CB   . ASN B 1 72  ? 43.545  -8.089  -52.957 1.00 25.34  ? 72  ASN B CB   1 
ATOM   6059  C CG   . ASN B 1 72  ? 42.426  -8.132  -51.976 1.00 27.46  ? 72  ASN B CG   1 
ATOM   6060  O OD1  . ASN B 1 72  ? 42.165  -7.150  -51.293 1.00 31.54  ? 72  ASN B OD1  1 
ATOM   6061  N ND2  . ASN B 1 72  ? 41.759  -9.274  -51.883 1.00 29.75  ? 72  ASN B ND2  1 
ATOM   6062  H H    . ASN B 1 72  ? 43.140  -5.791  -52.186 1.00 33.33  ? 72  ASN B H    1 
ATOM   6063  H HA   . ASN B 1 72  ? 44.368  -6.795  -54.305 1.00 26.65  ? 72  ASN B HA   1 
ATOM   6064  H HB2  . ASN B 1 72  ? 43.466  -8.862  -53.537 1.00 30.37  ? 72  ASN B HB2  1 
ATOM   6065  H HB3  . ASN B 1 72  ? 44.379  -8.128  -52.463 1.00 30.37  ? 72  ASN B HB3  1 
ATOM   6066  H HD21 . ASN B 1 72  ? 41.106  -9.346  -51.329 1.00 35.65  ? 72  ASN B HD21 1 
ATOM   6067  H HD22 . ASN B 1 72  ? 41.977  -9.941  -52.380 1.00 35.65  ? 72  ASN B HD22 1 
ATOM   6068  N N    . VAL B 1 73  ? 41.488  -5.946  -54.839 1.00 27.48  ? 73  VAL B N    1 
ATOM   6069  C CA   . VAL B 1 73  ? 40.416  -5.910  -55.820 1.00 28.79  ? 73  VAL B CA   1 
ATOM   6070  C C    . VAL B 1 73  ? 40.904  -5.067  -56.974 1.00 29.17  ? 73  VAL B C    1 
ATOM   6071  O O    . VAL B 1 73  ? 41.166  -3.873  -56.791 1.00 27.87  ? 73  VAL B O    1 
ATOM   6072  C CB   . VAL B 1 73  ? 39.122  -5.323  -55.237 1.00 31.05  ? 73  VAL B CB   1 
ATOM   6073  C CG1  . VAL B 1 73  ? 38.066  -5.128  -56.347 1.00 25.24  ? 73  VAL B CG1  1 
ATOM   6074  C CG2  . VAL B 1 73  ? 38.624  -6.194  -54.087 1.00 23.07  ? 73  VAL B CG2  1 
ATOM   6075  H H    . VAL B 1 73  ? 41.471  -5.289  -54.284 1.00 32.93  ? 73  VAL B H    1 
ATOM   6076  H HA   . VAL B 1 73  ? 40.235  -6.807  -56.142 1.00 34.51  ? 73  VAL B HA   1 
ATOM   6077  H HB   . VAL B 1 73  ? 39.321  -4.447  -54.871 1.00 37.22  ? 73  VAL B HB   1 
ATOM   6078  H HG11 . VAL B 1 73  ? 37.260  -4.758  -55.954 1.00 30.25  ? 73  VAL B HG11 1 
ATOM   6079  H HG12 . VAL B 1 73  ? 38.419  -4.520  -57.015 1.00 30.25  ? 73  VAL B HG12 1 
ATOM   6080  H HG13 . VAL B 1 73  ? 37.872  -5.988  -56.751 1.00 30.25  ? 73  VAL B HG13 1 
ATOM   6081  H HG21 . VAL B 1 73  ? 37.808  -5.810  -53.731 1.00 27.64  ? 73  VAL B HG21 1 
ATOM   6082  H HG22 . VAL B 1 73  ? 38.452  -7.088  -54.420 1.00 27.64  ? 73  VAL B HG22 1 
ATOM   6083  H HG23 . VAL B 1 73  ? 39.305  -6.223  -53.397 1.00 27.64  ? 73  VAL B HG23 1 
ATOM   6084  N N    . VAL B 1 74  ? 40.972  -5.682  -58.157 1.00 33.45  ? 74  VAL B N    1 
ATOM   6085  C CA   . VAL B 1 74  ? 41.561  -5.102  -59.365 1.00 32.70  ? 74  VAL B CA   1 
ATOM   6086  C C    . VAL B 1 74  ? 40.428  -4.755  -60.326 1.00 28.79  ? 74  VAL B C    1 
ATOM   6087  O O    . VAL B 1 74  ? 39.727  -5.652  -60.803 1.00 28.88  ? 74  VAL B O    1 
ATOM   6088  C CB   . VAL B 1 74  ? 42.540  -6.086  -60.048 1.00 24.71  ? 74  VAL B CB   1 
ATOM   6089  C CG1  . VAL B 1 74  ? 43.411  -5.370  -61.112 1.00 37.85  ? 74  VAL B CG1  1 
ATOM   6090  C CG2  . VAL B 1 74  ? 43.371  -6.841  -59.064 1.00 34.32  ? 74  VAL B CG2  1 
ATOM   6091  H H    . VAL B 1 74  ? 40.668  -6.476  -58.288 1.00 40.10  ? 74  VAL B H    1 
ATOM   6092  H HA   . VAL B 1 74  ? 42.040  -4.290  -59.139 1.00 39.19  ? 74  VAL B HA   1 
ATOM   6093  H HB   . VAL B 1 74  ? 42.009  -6.744  -60.523 1.00 29.61  ? 74  VAL B HB   1 
ATOM   6094  H HG11 . VAL B 1 74  ? 44.009  -6.017  -61.517 1.00 45.38  ? 74  VAL B HG11 1 
ATOM   6095  H HG12 . VAL B 1 74  ? 42.831  -4.987  -61.788 1.00 45.38  ? 74  VAL B HG12 1 
ATOM   6096  H HG13 . VAL B 1 74  ? 43.924  -4.669  -60.680 1.00 45.38  ? 74  VAL B HG13 1 
ATOM   6097  H HG21 . VAL B 1 74  ? 43.963  -7.440  -59.545 1.00 41.14  ? 74  VAL B HG21 1 
ATOM   6098  H HG22 . VAL B 1 74  ? 43.890  -6.211  -58.540 1.00 41.14  ? 74  VAL B HG22 1 
ATOM   6099  H HG23 . VAL B 1 74  ? 42.785  -7.351  -58.482 1.00 41.14  ? 74  VAL B HG23 1 
ATOM   6100  N N    . ALA B 1 75  ? 40.289  -3.470  -60.656 1.00 23.92  ? 75  ALA B N    1 
ATOM   6101  C CA   . ALA B 1 75  ? 39.434  -3.049  -61.751 1.00 32.10  ? 75  ALA B CA   1 
ATOM   6102  C C    . ALA B 1 75  ? 40.026  -3.465  -63.101 1.00 37.20  ? 75  ALA B C    1 
ATOM   6103  O O    . ALA B 1 75  ? 41.209  -3.235  -63.364 1.00 39.50  ? 75  ALA B O    1 
ATOM   6104  C CB   . ALA B 1 75  ? 39.255  -1.538  -61.721 1.00 30.46  ? 75  ALA B CB   1 
ATOM   6105  H H    . ALA B 1 75  ? 40.686  -2.821  -60.254 1.00 28.66  ? 75  ALA B H    1 
ATOM   6106  H HA   . ALA B 1 75  ? 38.562  -3.463  -61.658 1.00 38.48  ? 75  ALA B HA   1 
ATOM   6107  H HB1  . ALA B 1 75  ? 38.682  -1.274  -62.458 1.00 36.51  ? 75  ALA B HB1  1 
ATOM   6108  H HB2  . ALA B 1 75  ? 38.848  -1.286  -60.878 1.00 36.51  ? 75  ALA B HB2  1 
ATOM   6109  H HB3  . ALA B 1 75  ? 40.124  -1.116  -61.809 1.00 36.51  ? 75  ALA B HB3  1 
ATOM   6110  N N    . VAL B 1 76  ? 39.177  -4.050  -63.953 1.00 32.83  ? 76  VAL B N    1 
ATOM   6111  C CA   . VAL B 1 76  ? 39.539  -4.487  -65.296 1.00 37.30  ? 76  VAL B CA   1 
ATOM   6112  C C    . VAL B 1 76  ? 38.458  -3.982  -66.245 1.00 35.66  ? 76  VAL B C    1 
ATOM   6113  O O    . VAL B 1 76  ? 37.278  -4.302  -66.063 1.00 33.28  ? 76  VAL B O    1 
ATOM   6114  C CB   . VAL B 1 76  ? 39.657  -6.017  -65.406 1.00 39.06  ? 76  VAL B CB   1 
ATOM   6115  C CG1  . VAL B 1 76  ? 40.149  -6.412  -66.786 1.00 38.69  ? 76  VAL B CG1  1 
ATOM   6116  C CG2  . VAL B 1 76  ? 40.568  -6.556  -64.337 1.00 39.23  ? 76  VAL B CG2  1 
ATOM   6117  H H    . VAL B 1 76  ? 38.354  -4.209  -63.761 1.00 39.35  ? 76  VAL B H    1 
ATOM   6118  H HA   . VAL B 1 76  ? 40.387  -4.090  -65.551 1.00 44.71  ? 76  VAL B HA   1 
ATOM   6119  H HB   . VAL B 1 76  ? 38.779  -6.411  -65.277 1.00 46.83  ? 76  VAL B HB   1 
ATOM   6120  H HG11 . VAL B 1 76  ? 40.216  -7.379  -66.833 1.00 46.38  ? 76  VAL B HG11 1 
ATOM   6121  H HG12 . VAL B 1 76  ? 39.518  -6.092  -67.450 1.00 46.38  ? 76  VAL B HG12 1 
ATOM   6122  H HG13 . VAL B 1 76  ? 41.020  -6.013  -66.937 1.00 46.38  ? 76  VAL B HG13 1 
ATOM   6123  H HG21 . VAL B 1 76  ? 40.625  -7.520  -64.428 1.00 47.03  ? 76  VAL B HG21 1 
ATOM   6124  H HG22 . VAL B 1 76  ? 41.447  -6.160  -64.444 1.00 47.03  ? 76  VAL B HG22 1 
ATOM   6125  H HG23 . VAL B 1 76  ? 40.205  -6.326  -63.467 1.00 47.03  ? 76  VAL B HG23 1 
ATOM   6126  N N    . PRO B 1 77  ? 38.790  -3.190  -67.266 1.00 37.66  ? 77  PRO B N    1 
ATOM   6127  C CA   . PRO B 1 77  ? 37.728  -2.618  -68.110 1.00 38.24  ? 77  PRO B CA   1 
ATOM   6128  C C    . PRO B 1 77  ? 37.162  -3.560  -69.157 1.00 35.84  ? 77  PRO B C    1 
ATOM   6129  O O    . PRO B 1 77  ? 36.058  -3.294  -69.668 1.00 36.54  ? 77  PRO B O    1 
ATOM   6130  C CB   . PRO B 1 77  ? 38.410  -1.413  -68.772 1.00 41.71  ? 77  PRO B CB   1 
ATOM   6131  C CG   . PRO B 1 77  ? 39.852  -1.787  -68.803 1.00 34.79  ? 77  PRO B CG   1 
ATOM   6132  C CD   . PRO B 1 77  ? 40.102  -2.599  -67.548 1.00 33.84  ? 77  PRO B CD   1 
ATOM   6133  H HA   . PRO B 1 77  ? 37.002  -2.299  -67.552 1.00 45.85  ? 77  PRO B HA   1 
ATOM   6134  H HB2  . PRO B 1 77  ? 38.065  -1.290  -69.670 1.00 50.01  ? 77  PRO B HB2  1 
ATOM   6135  H HB3  . PRO B 1 77  ? 38.270  -0.618  -68.235 1.00 50.01  ? 77  PRO B HB3  1 
ATOM   6136  H HG2  . PRO B 1 77  ? 40.032  -2.319  -69.594 1.00 41.71  ? 77  PRO B HG2  1 
ATOM   6137  H HG3  . PRO B 1 77  ? 40.396  -0.983  -68.802 1.00 41.71  ? 77  PRO B HG3  1 
ATOM   6138  H HD2  . PRO B 1 77  ? 40.758  -3.293  -67.718 1.00 40.57  ? 77  PRO B HD2  1 
ATOM   6139  H HD3  . PRO B 1 77  ? 40.377  -2.020  -66.819 1.00 40.57  ? 77  PRO B HD3  1 
ATOM   6140  N N    . ASP B 1 78  ? 37.837  -4.652  -69.481 1.00 37.19  ? 78  ASP B N    1 
ATOM   6141  C CA   . ASP B 1 78  ? 37.326  -5.593  -70.472 1.00 43.38  ? 78  ASP B CA   1 
ATOM   6142  C C    . ASP B 1 78  ? 36.730  -6.778  -69.730 1.00 31.50  ? 78  ASP B C    1 
ATOM   6143  O O    . ASP B 1 78  ? 37.395  -7.410  -68.897 1.00 29.64  ? 78  ASP B O    1 
ATOM   6144  C CB   . ASP B 1 78  ? 38.412  -6.046  -71.465 1.00 44.38  ? 78  ASP B CB   1 
ATOM   6145  C CG   . ASP B 1 78  ? 37.830  -6.846  -72.627 1.00 44.08  ? 78  ASP B CG   1 
ATOM   6146  O OD1  . ASP B 1 78  ? 37.057  -6.273  -73.433 1.00 46.83  ? 78  ASP B OD1  1 
ATOM   6147  O OD2  . ASP B 1 78  ? 38.101  -8.057  -72.702 1.00 50.58  ? 78  ASP B OD2  1 
ATOM   6148  H H    . ASP B 1 78  ? 38.595  -4.874  -69.141 1.00 44.58  ? 78  ASP B H    1 
ATOM   6149  H HA   . ASP B 1 78  ? 36.617  -5.166  -70.977 1.00 52.02  ? 78  ASP B HA   1 
ATOM   6150  H HB2  . ASP B 1 78  ? 38.857  -5.265  -71.828 1.00 53.22  ? 78  ASP B HB2  1 
ATOM   6151  H HB3  . ASP B 1 78  ? 39.051  -6.609  -71.001 1.00 53.22  ? 78  ASP B HB3  1 
ATOM   6152  N N    . VAL B 1 79  ? 35.461  -7.056  -70.013 1.00 35.25  ? 79  VAL B N    1 
ATOM   6153  C CA   . VAL B 1 79  ? 34.735  -8.006  -69.193 1.00 30.97  ? 79  VAL B CA   1 
ATOM   6154  C C    . VAL B 1 79  ? 35.239  -9.415  -69.450 1.00 43.49  ? 79  VAL B C    1 
ATOM   6155  O O    . VAL B 1 79  ? 35.294  -10.249 -68.525 1.00 31.57  ? 79  VAL B O    1 
ATOM   6156  C CB   . VAL B 1 79  ? 33.220  -7.830  -69.439 1.00 34.21  ? 79  VAL B CB   1 
ATOM   6157  C CG1  . VAL B 1 79  ? 32.820  -8.325  -70.839 1.00 38.03  ? 79  VAL B CG1  1 
ATOM   6158  C CG2  . VAL B 1 79  ? 32.425  -8.513  -68.332 1.00 41.93  ? 79  VAL B CG2  1 
ATOM   6159  H H    . VAL B 1 79  ? 35.010  -6.714  -70.660 1.00 42.25  ? 79  VAL B H    1 
ATOM   6160  H HA   . VAL B 1 79  ? 34.904  -7.802  -68.260 1.00 37.12  ? 79  VAL B HA   1 
ATOM   6161  H HB   . VAL B 1 79  ? 33.014  -6.883  -69.398 1.00 41.01  ? 79  VAL B HB   1 
ATOM   6162  H HG11 . VAL B 1 79  ? 31.865  -8.199  -70.957 1.00 45.59  ? 79  VAL B HG11 1 
ATOM   6163  H HG12 . VAL B 1 79  ? 33.306  -7.813  -71.505 1.00 45.59  ? 79  VAL B HG12 1 
ATOM   6164  H HG13 . VAL B 1 79  ? 33.042  -9.266  -70.917 1.00 45.59  ? 79  VAL B HG13 1 
ATOM   6165  H HG21 . VAL B 1 79  ? 31.478  -8.392  -68.504 1.00 50.28  ? 79  VAL B HG21 1 
ATOM   6166  H HG22 . VAL B 1 79  ? 32.642  -9.458  -68.325 1.00 50.28  ? 79  VAL B HG22 1 
ATOM   6167  H HG23 . VAL B 1 79  ? 32.661  -8.112  -67.481 1.00 50.28  ? 79  VAL B HG23 1 
ATOM   6168  N N    . VAL B 1 80  ? 35.673  -9.691  -70.687 1.00 39.38  ? 80  VAL B N    1 
ATOM   6169  C CA   . VAL B 1 80  ? 36.266  -10.989 -70.984 1.00 31.78  ? 80  VAL B CA   1 
ATOM   6170  C C    . VAL B 1 80  ? 37.544  -11.186 -70.177 1.00 31.36  ? 80  VAL B C    1 
ATOM   6171  O O    . VAL B 1 80  ? 37.737  -12.230 -69.541 1.00 42.11  ? 80  VAL B O    1 
ATOM   6172  C CB   . VAL B 1 80  ? 36.532  -11.131 -72.495 1.00 46.76  ? 80  VAL B CB   1 
ATOM   6173  C CG1  . VAL B 1 80  ? 37.415  -12.335 -72.761 1.00 47.58  ? 80  VAL B CG1  1 
ATOM   6174  C CG2  . VAL B 1 80  ? 35.241  -11.281 -73.268 1.00 38.58  ? 80  VAL B CG2  1 
ATOM   6175  H H    . VAL B 1 80  ? 35.635  -9.152  -71.355 1.00 47.21  ? 80  VAL B H    1 
ATOM   6176  H HA   . VAL B 1 80  ? 35.641  -11.685 -70.725 1.00 38.10  ? 80  VAL B HA   1 
ATOM   6177  H HB   . VAL B 1 80  ? 36.991  -10.339 -72.817 1.00 56.07  ? 80  VAL B HB   1 
ATOM   6178  H HG11 . VAL B 1 80  ? 37.571  -12.407 -73.716 1.00 57.05  ? 80  VAL B HG11 1 
ATOM   6179  H HG12 . VAL B 1 80  ? 38.258  -12.217 -72.296 1.00 57.05  ? 80  VAL B HG12 1 
ATOM   6180  H HG13 . VAL B 1 80  ? 36.967  -13.132 -72.438 1.00 57.05  ? 80  VAL B HG13 1 
ATOM   6181  H HG21 . VAL B 1 80  ? 35.447  -11.367 -74.212 1.00 46.25  ? 80  VAL B HG21 1 
ATOM   6182  H HG22 . VAL B 1 80  ? 34.777  -12.073 -72.956 1.00 46.25  ? 80  VAL B HG22 1 
ATOM   6183  H HG23 . VAL B 1 80  ? 34.692  -10.495 -73.120 1.00 46.25  ? 80  VAL B HG23 1 
ATOM   6184  N N    . GLN B 1 81  ? 38.459  -10.210 -70.233 1.00 34.82  ? 81  GLN B N    1 
ATOM   6185  C CA   . GLN B 1 81  ? 39.695  -10.275 -69.441 1.00 36.16  ? 81  GLN B CA   1 
ATOM   6186  C C    . GLN B 1 81  ? 39.407  -10.419 -67.940 1.00 36.47  ? 81  GLN B C    1 
ATOM   6187  O O    . GLN B 1 81  ? 40.095  -11.169 -67.232 1.00 32.98  ? 81  GLN B O    1 
ATOM   6188  C CB   . GLN B 1 81  ? 40.544  -9.023  -69.668 1.00 43.73  ? 81  GLN B CB   1 
ATOM   6189  C CG   . GLN B 1 81  ? 41.020  -8.765  -71.099 1.00 65.59  ? 81  GLN B CG   1 
ATOM   6190  C CD   . GLN B 1 81  ? 42.105  -7.679  -71.172 1.00 64.33  ? 81  GLN B CD   1 
ATOM   6191  O OE1  . GLN B 1 81  ? 42.860  -7.463  -70.215 1.00 58.11  ? 81  GLN B OE1  1 
ATOM   6192  N NE2  . GLN B 1 81  ? 42.175  -6.989  -72.307 1.00 57.99  ? 81  GLN B NE2  1 
ATOM   6193  H H    . GLN B 1 81  ? 38.389  -9.505  -70.720 1.00 41.74  ? 81  GLN B H    1 
ATOM   6194  H HA   . GLN B 1 81  ? 40.212  -11.045 -69.723 1.00 43.35  ? 81  GLN B HA   1 
ATOM   6195  H HB2  . GLN B 1 81  ? 40.024  -8.251  -69.395 1.00 52.43  ? 81  GLN B HB2  1 
ATOM   6196  H HB3  . GLN B 1 81  ? 41.335  -9.089  -69.110 1.00 52.43  ? 81  GLN B HB3  1 
ATOM   6197  H HG2  . GLN B 1 81  ? 41.391  -9.585  -71.462 1.00 78.66  ? 81  GLN B HG2  1 
ATOM   6198  H HG3  . GLN B 1 81  ? 40.267  -8.475  -71.636 1.00 78.66  ? 81  GLN B HG3  1 
ATOM   6199  H HE21 . GLN B 1 81  ? 41.633  -7.165  -72.951 1.00 69.55  ? 81  GLN B HE21 1 
ATOM   6200  H HE22 . GLN B 1 81  ? 42.765  -6.370  -72.398 1.00 69.55  ? 81  GLN B HE22 1 
ATOM   6201  N N    . ALA B 1 82  ? 38.382  -9.718  -67.445 1.00 36.95  ? 82  ALA B N    1 
ATOM   6202  C CA   . ALA B 1 82  ? 38.031  -9.778  -66.023 1.00 43.75  ? 82  ALA B CA   1 
ATOM   6203  C C    . ALA B 1 82  ? 37.632  -11.186 -65.600 1.00 35.72  ? 82  ALA B C    1 
ATOM   6204  O O    . ALA B 1 82  ? 38.116  -11.697 -64.588 1.00 41.44  ? 82  ALA B O    1 
ATOM   6205  C CB   . ALA B 1 82  ? 36.906  -8.786  -65.732 1.00 33.55  ? 82  ALA B CB   1 
ATOM   6206  H H    . ALA B 1 82  ? 37.875  -9.202  -67.911 1.00 44.30  ? 82  ALA B H    1 
ATOM   6207  H HA   . ALA B 1 82  ? 38.803  -9.516  -65.498 1.00 52.45  ? 82  ALA B HA   1 
ATOM   6208  H HB1  . ALA B 1 82  ? 36.681  -8.833  -64.790 1.00 40.22  ? 82  ALA B HB1  1 
ATOM   6209  H HB2  . ALA B 1 82  ? 37.207  -7.892  -65.957 1.00 40.22  ? 82  ALA B HB2  1 
ATOM   6210  H HB3  . ALA B 1 82  ? 36.133  -9.021  -66.269 1.00 40.22  ? 82  ALA B HB3  1 
ATOM   6211  N N    . ALA B 1 83  ? 36.802  -11.856 -66.400 1.00 34.72  ? 83  ALA B N    1 
ATOM   6212  C CA   . ALA B 1 83  ? 36.165  -13.094 -65.986 1.00 34.15  ? 83  ALA B CA   1 
ATOM   6213  C C    . ALA B 1 83  ? 36.830  -14.370 -66.500 1.00 33.01  ? 83  ALA B C    1 
ATOM   6214  O O    . ALA B 1 83  ? 36.458  -15.474 -66.068 1.00 35.75  ? 83  ALA B O    1 
ATOM   6215  C CB   . ALA B 1 83  ? 34.702  -13.085 -66.453 1.00 40.63  ? 83  ALA B CB   1 
ATOM   6216  H H    . ALA B 1 83  ? 36.592  -11.606 -67.196 1.00 41.62  ? 83  ALA B H    1 
ATOM   6217  H HA   . ALA B 1 83  ? 36.165  -13.133 -65.017 1.00 40.93  ? 83  ALA B HA   1 
ATOM   6218  H HB1  . ALA B 1 83  ? 34.278  -13.912 -66.177 1.00 48.72  ? 83  ALA B HB1  1 
ATOM   6219  H HB2  . ALA B 1 83  ? 34.248  -12.328 -66.051 1.00 48.72  ? 83  ALA B HB2  1 
ATOM   6220  H HB3  . ALA B 1 83  ? 34.681  -13.009 -67.420 1.00 48.72  ? 83  ALA B HB3  1 
ATOM   6221  N N    . GLU B 1 84  ? 37.763  -14.287 -67.429 1.00 37.94  ? 84  GLU B N    1 
ATOM   6222  C CA   . GLU B 1 84  ? 38.076  -15.503 -68.184 1.00 42.33  ? 84  GLU B CA   1 
ATOM   6223  C C    . GLU B 1 84  ? 38.782  -16.553 -67.338 1.00 41.31  ? 84  GLU B C    1 
ATOM   6224  O O    . GLU B 1 84  ? 38.573  -17.744 -67.560 1.00 53.11  ? 84  GLU B O    1 
ATOM   6225  C CB   . GLU B 1 84  ? 38.902  -15.174 -69.403 1.00 46.60  ? 84  GLU B CB   1 
ATOM   6226  C CG   . GLU B 1 84  ? 40.275  -14.601 -69.135 1.00 45.04  ? 84  GLU B CG   1 
ATOM   6227  C CD   . GLU B 1 84  ? 40.870  -14.151 -70.441 1.00 56.38  ? 84  GLU B CD   1 
ATOM   6228  O OE1  . GLU B 1 84  ? 40.363  -14.657 -71.477 1.00 45.16  ? 84  GLU B OE1  1 
ATOM   6229  O OE2  . GLU B 1 84  ? 41.780  -13.289 -70.441 1.00 59.56  ? 84  GLU B OE2  1 
ATOM   6230  H H    . GLU B 1 84  ? 38.212  -13.585 -67.640 1.00 45.48  ? 84  GLU B H    1 
ATOM   6231  H HA   . GLU B 1 84  ? 37.243  -15.893 -68.494 1.00 50.76  ? 84  GLU B HA   1 
ATOM   6232  H HB2  . GLU B 1 84  ? 39.023  -15.986 -69.919 1.00 55.88  ? 84  GLU B HB2  1 
ATOM   6233  H HB3  . GLU B 1 84  ? 38.416  -14.523 -69.935 1.00 55.88  ? 84  GLU B HB3  1 
ATOM   6234  H HG2  . GLU B 1 84  ? 40.203  -13.836 -68.543 1.00 54.00  ? 84  GLU B HG2  1 
ATOM   6235  H HG3  . GLU B 1 84  ? 40.847  -15.283 -68.749 1.00 54.00  ? 84  GLU B HG3  1 
ATOM   6236  N N    . ASP B 1 85  ? 39.586  -16.159 -66.351 1.00 38.46  ? 85  ASP B N    1 
ATOM   6237  C CA   . ASP B 1 85  ? 40.197  -17.138 -65.456 1.00 29.74  ? 85  ASP B CA   1 
ATOM   6238  C C    . ASP B 1 85  ? 39.403  -17.340 -64.161 1.00 39.19  ? 85  ASP B C    1 
ATOM   6239  O O    . ASP B 1 85  ? 39.934  -17.920 -63.208 1.00 34.95  ? 85  ASP B O    1 
ATOM   6240  C CB   . ASP B 1 85  ? 41.641  -16.738 -65.155 1.00 39.09  ? 85  ASP B CB   1 
ATOM   6241  H H    . ASP B 1 85  ? 39.791  -15.342 -66.181 1.00 46.11  ? 85  ASP B H    1 
ATOM   6242  H HA   . ASP B 1 85  ? 40.224  -17.993 -65.913 1.00 35.65  ? 85  ASP B HA   1 
ATOM   6243  N N    . ALA B 1 86  ? 38.131  -16.943 -64.120 1.00 29.10  ? 86  ALA B N    1 
ATOM   6244  C CA   . ALA B 1 86  ? 37.406  -16.934 -62.846 1.00 36.14  ? 86  ALA B CA   1 
ATOM   6245  C C    . ALA B 1 86  ? 36.651  -18.231 -62.588 1.00 31.05  ? 86  ALA B C    1 
ATOM   6246  O O    . ALA B 1 86  ? 35.968  -18.757 -63.464 1.00 36.76  ? 86  ALA B O    1 
ATOM   6247  C CB   . ALA B 1 86  ? 36.412  -15.780 -62.802 1.00 39.64  ? 86  ALA B CB   1 
ATOM   6248  H H    . ALA B 1 86  ? 37.673  -16.679 -64.798 1.00 34.88  ? 86  ALA B H    1 
ATOM   6249  H HA   . ALA B 1 86  ? 38.041  -16.809 -62.124 1.00 43.32  ? 86  ALA B HA   1 
ATOM   6250  H HB1  . ALA B 1 86  ? 35.947  -15.797 -61.951 1.00 47.53  ? 86  ALA B HB1  1 
ATOM   6251  H HB2  . ALA B 1 86  ? 36.895  -14.944 -62.899 1.00 47.53  ? 86  ALA B HB2  1 
ATOM   6252  H HB3  . ALA B 1 86  ? 35.778  -15.882 -63.529 1.00 47.53  ? 86  ALA B HB3  1 
ATOM   6253  N N    . ASP B 1 87  ? 36.750  -18.727 -61.363 1.00 29.88  ? 87  ASP B N    1 
ATOM   6254  C CA   . ASP B 1 87  ? 35.910  -19.842 -60.937 1.00 25.09  ? 87  ASP B CA   1 
ATOM   6255  C C    . ASP B 1 87  ? 34.522  -19.401 -60.486 1.00 38.12  ? 87  ASP B C    1 
ATOM   6256  O O    . ASP B 1 87  ? 33.546  -20.159 -60.647 1.00 30.31  ? 87  ASP B O    1 
ATOM   6257  C CB   . ASP B 1 87  ? 36.602  -20.597 -59.805 1.00 36.79  ? 87  ASP B CB   1 
ATOM   6258  C CG   . ASP B 1 87  ? 38.036  -21.021 -60.187 1.00 45.71  ? 87  ASP B CG   1 
ATOM   6259  O OD1  . ASP B 1 87  ? 38.173  -21.921 -61.044 1.00 45.39  ? 87  ASP B OD1  1 
ATOM   6260  O OD2  . ASP B 1 87  ? 39.016  -20.428 -59.670 1.00 38.41  ? 87  ASP B OD2  1 
ATOM   6261  H H    . ASP B 1 87  ? 37.292  -18.440 -60.761 1.00 35.81  ? 87  ASP B H    1 
ATOM   6262  H HA   . ASP B 1 87  ? 35.800  -20.455 -61.682 1.00 30.07  ? 87  ASP B HA   1 
ATOM   6263  H HB2  . ASP B 1 87  ? 36.653  -20.024 -59.025 1.00 44.10  ? 87  ASP B HB2  1 
ATOM   6264  H HB3  . ASP B 1 87  ? 36.094  -21.398 -59.599 1.00 44.10  ? 87  ASP B HB3  1 
ATOM   6265  N N    . ILE B 1 88  ? 34.405  -18.209 -59.905 1.00 36.07  ? 88  ILE B N    1 
ATOM   6266  C CA   . ILE B 1 88  ? 33.134  -17.715 -59.350 1.00 35.65  ? 88  ILE B CA   1 
ATOM   6267  C C    . ILE B 1 88  ? 32.873  -16.353 -59.947 1.00 19.44  ? 88  ILE B C    1 
ATOM   6268  O O    . ILE B 1 88  ? 33.688  -15.440 -59.776 1.00 24.80  ? 88  ILE B O    1 
ATOM   6269  C CB   . ILE B 1 88  ? 33.151  -17.599 -57.811 1.00 30.98  ? 88  ILE B CB   1 
ATOM   6270  C CG1  . ILE B 1 88  ? 33.254  -18.966 -57.172 1.00 40.09  ? 88  ILE B CG1  1 
ATOM   6271  C CG2  . ILE B 1 88  ? 31.866  -16.933 -57.334 1.00 32.58  ? 88  ILE B CG2  1 
ATOM   6272  C CD1  . ILE B 1 88  ? 33.532  -18.927 -55.706 1.00 28.80  ? 88  ILE B CD1  1 
ATOM   6273  H H    . ILE B 1 88  ? 35.056  -17.655 -59.816 1.00 43.25  ? 88  ILE B H    1 
ATOM   6274  H HA   . ILE B 1 88  ? 32.412  -18.310 -59.608 1.00 42.74  ? 88  ILE B HA   1 
ATOM   6275  H HB   . ILE B 1 88  ? 33.911  -17.061 -57.540 1.00 37.13  ? 88  ILE B HB   1 
ATOM   6276  H HG12 . ILE B 1 88  ? 32.415  -19.436 -57.301 1.00 48.06  ? 88  ILE B HG12 1 
ATOM   6277  H HG13 . ILE B 1 88  ? 33.975  -19.457 -57.597 1.00 48.06  ? 88  ILE B HG13 1 
ATOM   6278  H HG21 . ILE B 1 88  ? 31.887  -16.865 -56.366 1.00 39.06  ? 88  ILE B HG21 1 
ATOM   6279  H HG22 . ILE B 1 88  ? 31.805  -16.048 -57.727 1.00 39.06  ? 88  ILE B HG22 1 
ATOM   6280  H HG23 . ILE B 1 88  ? 31.109  -17.472 -57.612 1.00 39.06  ? 88  ILE B HG23 1 
ATOM   6281  H HD11 . ILE B 1 88  ? 33.584  -19.835 -55.371 1.00 34.51  ? 88  ILE B HD11 1 
ATOM   6282  H HD12 . ILE B 1 88  ? 34.375  -18.470 -55.558 1.00 34.51  ? 88  ILE B HD12 1 
ATOM   6283  H HD13 . ILE B 1 88  ? 32.814  -18.449 -55.262 1.00 34.51  ? 88  ILE B HD13 1 
ATOM   6284  N N    . LEU B 1 89  ? 31.735  -16.194 -60.619 1.00 23.24  ? 89  LEU B N    1 
ATOM   6285  C CA   . LEU B 1 89  ? 31.336  -14.899 -61.143 1.00 21.16  ? 89  LEU B CA   1 
ATOM   6286  C C    . LEU B 1 89  ? 30.164  -14.355 -60.342 1.00 29.98  ? 89  LEU B C    1 
ATOM   6287  O O    . LEU B 1 89  ? 29.212  -15.092 -60.039 1.00 26.88  ? 89  LEU B O    1 
ATOM   6288  C CB   . LEU B 1 89  ? 30.928  -14.966 -62.612 1.00 28.81  ? 89  LEU B CB   1 
ATOM   6289  C CG   . LEU B 1 89  ? 32.059  -15.368 -63.576 1.00 37.40  ? 89  LEU B CG   1 
ATOM   6290  C CD1  . LEU B 1 89  ? 31.974  -16.857 -63.805 1.00 41.76  ? 89  LEU B CD1  1 
ATOM   6291  C CD2  . LEU B 1 89  ? 31.923  -14.615 -64.853 1.00 33.22  ? 89  LEU B CD2  1 
ATOM   6292  H H    . LEU B 1 89  ? 31.175  -16.827 -60.783 1.00 27.84  ? 89  LEU B H    1 
ATOM   6293  H HA   . LEU B 1 89  ? 32.076  -14.278 -61.061 1.00 25.35  ? 89  LEU B HA   1 
ATOM   6294  H HB2  . LEU B 1 89  ? 30.217  -15.619 -62.706 1.00 34.53  ? 89  LEU B HB2  1 
ATOM   6295  H HB3  . LEU B 1 89  ? 30.607  -14.093 -62.884 1.00 34.53  ? 89  LEU B HB3  1 
ATOM   6296  H HG   . LEU B 1 89  ? 32.920  -15.160 -63.180 1.00 44.84  ? 89  LEU B HG   1 
ATOM   6297  H HD11 . LEU B 1 89  ? 32.682  -17.124 -64.412 1.00 50.07  ? 89  LEU B HD11 1 
ATOM   6298  H HD12 . LEU B 1 89  ? 32.076  -17.313 -62.955 1.00 50.07  ? 89  LEU B HD12 1 
ATOM   6299  H HD13 . LEU B 1 89  ? 31.109  -17.067 -64.192 1.00 50.07  ? 89  LEU B HD13 1 
ATOM   6300  H HD21 . LEU B 1 89  ? 32.640  -14.876 -65.452 1.00 39.82  ? 89  LEU B HD21 1 
ATOM   6301  H HD22 . LEU B 1 89  ? 31.064  -14.825 -65.253 1.00 39.82  ? 89  LEU B HD22 1 
ATOM   6302  H HD23 . LEU B 1 89  ? 31.977  -13.664 -64.666 1.00 39.82  ? 89  LEU B HD23 1 
ATOM   6303  N N    . ILE B 1 90  ? 30.220  -13.057 -60.041 1.00 25.02  ? 90  ILE B N    1 
ATOM   6304  C CA   . ILE B 1 90  ? 29.204  -12.401 -59.222 1.00 26.63  ? 90  ILE B CA   1 
ATOM   6305  C C    . ILE B 1 90  ? 28.606  -11.338 -60.110 1.00 18.96  ? 90  ILE B C    1 
ATOM   6306  O O    . ILE B 1 90  ? 29.271  -10.355 -60.449 1.00 26.28  ? 90  ILE B O    1 
ATOM   6307  C CB   . ILE B 1 90  ? 29.770  -11.800 -57.928 1.00 29.46  ? 90  ILE B CB   1 
ATOM   6308  C CG1  . ILE B 1 90  ? 30.444  -12.889 -57.084 1.00 23.76  ? 90  ILE B CG1  1 
ATOM   6309  C CG2  . ILE B 1 90  ? 28.653  -11.053 -57.151 1.00 32.38  ? 90  ILE B CG2  1 
ATOM   6310  C CD1  . ILE B 1 90  ? 31.432  -12.364 -56.040 1.00 28.47  ? 90  ILE B CD1  1 
ATOM   6311  H H    . ILE B 1 90  ? 30.847  -12.529 -60.303 1.00 29.98  ? 90  ILE B H    1 
ATOM   6312  H HA   . ILE B 1 90  ? 28.510  -13.038 -58.990 1.00 31.92  ? 90  ILE B HA   1 
ATOM   6313  H HB   . ILE B 1 90  ? 30.448  -11.150 -58.172 1.00 35.31  ? 90  ILE B HB   1 
ATOM   6314  H HG12 . ILE B 1 90  ? 29.757  -13.387 -56.615 1.00 28.47  ? 90  ILE B HG12 1 
ATOM   6315  H HG13 . ILE B 1 90  ? 30.931  -13.483 -57.677 1.00 28.47  ? 90  ILE B HG13 1 
ATOM   6316  H HG21 . ILE B 1 90  ? 29.029  -10.681 -56.338 1.00 38.81  ? 90  ILE B HG21 1 
ATOM   6317  H HG22 . ILE B 1 90  ? 28.301  -10.342 -57.710 1.00 38.81  ? 90  ILE B HG22 1 
ATOM   6318  H HG23 . ILE B 1 90  ? 27.947  -11.682 -56.932 1.00 38.81  ? 90  ILE B HG23 1 
ATOM   6319  H HD11 . ILE B 1 90  ? 31.809  -13.116 -55.556 1.00 34.12  ? 90  ILE B HD11 1 
ATOM   6320  H HD12 . ILE B 1 90  ? 32.138  -11.874 -56.491 1.00 34.12  ? 90  ILE B HD12 1 
ATOM   6321  H HD13 . ILE B 1 90  ? 30.962  -11.778 -55.427 1.00 34.12  ? 90  ILE B HD13 1 
ATOM   6322  N N    . PHE B 1 91  ? 27.366  -11.560 -60.527 1.00 30.92  ? 91  PHE B N    1 
ATOM   6323  C CA   . PHE B 1 91  ? 26.690  -10.682 -61.473 1.00 27.46  ? 91  PHE B CA   1 
ATOM   6324  C C    . PHE B 1 91  ? 25.916  -9.631  -60.706 1.00 32.28  ? 91  PHE B C    1 
ATOM   6325  O O    . PHE B 1 91  ? 24.988  -9.959  -59.955 1.00 27.60  ? 91  PHE B O    1 
ATOM   6326  C CB   . PHE B 1 91  ? 25.751  -11.489 -62.372 1.00 25.35  ? 91  PHE B CB   1 
ATOM   6327  C CG   . PHE B 1 91  ? 26.475  -12.475 -63.225 1.00 23.92  ? 91  PHE B CG   1 
ATOM   6328  C CD1  . PHE B 1 91  ? 27.019  -12.077 -64.429 1.00 29.17  ? 91  PHE B CD1  1 
ATOM   6329  C CD2  . PHE B 1 91  ? 26.630  -13.785 -62.813 1.00 29.89  ? 91  PHE B CD2  1 
ATOM   6330  C CE1  . PHE B 1 91  ? 27.708  -12.980 -65.236 1.00 31.22  ? 91  PHE B CE1  1 
ATOM   6331  C CE2  . PHE B 1 91  ? 27.323  -14.706 -63.612 1.00 31.59  ? 91  PHE B CE2  1 
ATOM   6332  C CZ   . PHE B 1 91  ? 27.852  -14.297 -64.820 1.00 29.68  ? 91  PHE B CZ   1 
ATOM   6333  H H    . PHE B 1 91  ? 26.885  -12.225 -60.271 1.00 37.06  ? 91  PHE B H    1 
ATOM   6334  H HA   . PHE B 1 91  ? 27.347  -10.238 -62.032 1.00 32.91  ? 91  PHE B HA   1 
ATOM   6335  H HB2  . PHE B 1 91  ? 25.123  -11.977 -61.817 1.00 30.38  ? 91  PHE B HB2  1 
ATOM   6336  H HB3  . PHE B 1 91  ? 25.273  -10.880 -62.957 1.00 30.38  ? 91  PHE B HB3  1 
ATOM   6337  H HD1  . PHE B 1 91  ? 26.920  -11.196 -64.709 1.00 34.96  ? 91  PHE B HD1  1 
ATOM   6338  H HD2  . PHE B 1 91  ? 26.270  -14.059 -62.000 1.00 35.83  ? 91  PHE B HD2  1 
ATOM   6339  H HE1  . PHE B 1 91  ? 28.066  -12.704 -66.048 1.00 37.42  ? 91  PHE B HE1  1 
ATOM   6340  H HE2  . PHE B 1 91  ? 27.419  -15.588 -63.333 1.00 37.87  ? 91  PHE B HE2  1 
ATOM   6341  H HZ   . PHE B 1 91  ? 28.312  -14.904 -65.354 1.00 35.57  ? 91  PHE B HZ   1 
ATOM   6342  N N    . VAL B 1 92  ? 26.308  -8.400  -60.883 1.00 27.81  ? 92  VAL B N    1 
ATOM   6343  C CA   . VAL B 1 92  ? 25.721  -7.329  -60.161 1.00 32.29  ? 92  VAL B CA   1 
ATOM   6344  C C    . VAL B 1 92  ? 25.665  -6.063  -60.997 1.00 28.26  ? 92  VAL B C    1 
ATOM   6345  O O    . VAL B 1 92  ? 26.388  -5.146  -60.808 1.00 37.12  ? 92  VAL B O    1 
ATOM   6346  C CB   . VAL B 1 92  ? 26.521  -7.166  -58.845 1.00 32.49  ? 92  VAL B CB   1 
ATOM   6347  C CG1  . VAL B 1 92  ? 27.954  -6.790  -59.127 1.00 29.13  ? 92  VAL B CG1  1 
ATOM   6348  C CG2  . VAL B 1 92  ? 25.882  -6.217  -57.886 1.00 28.43  ? 92  VAL B CG2  1 
ATOM   6349  H H    . VAL B 1 92  ? 26.926  -8.159  -61.430 1.00 33.33  ? 92  VAL B H    1 
ATOM   6350  H HA   . VAL B 1 92  ? 24.802  -7.573  -59.925 1.00 38.70  ? 92  VAL B HA   1 
ATOM   6351  H HB   . VAL B 1 92  ? 26.543  -8.039  -58.401 1.00 38.95  ? 92  VAL B HB   1 
ATOM   6352  H HG11 . VAL B 1 92  ? 28.422  -6.699  -58.294 1.00 34.92  ? 92  VAL B HG11 1 
ATOM   6353  H HG12 . VAL B 1 92  ? 28.359  -7.481  -59.657 1.00 34.92  ? 92  VAL B HG12 1 
ATOM   6354  H HG13 . VAL B 1 92  ? 27.970  -5.958  -59.605 1.00 34.92  ? 92  VAL B HG13 1 
ATOM   6355  H HG21 . VAL B 1 92  ? 26.398  -6.197  -57.077 1.00 34.08  ? 92  VAL B HG21 1 
ATOM   6356  H HG22 . VAL B 1 92  ? 25.858  -5.343  -58.282 1.00 34.08  ? 92  VAL B HG22 1 
ATOM   6357  H HG23 . VAL B 1 92  ? 24.990  -6.517  -57.699 1.00 34.08  ? 92  VAL B HG23 1 
ATOM   6358  N N    . VAL B 1 93  ? 24.788  -6.061  -61.973 1.00 34.90  ? 93  VAL B N    1 
ATOM   6359  C CA   . VAL B 1 93  ? 24.592  -4.903  -62.840 1.00 35.57  ? 93  VAL B CA   1 
ATOM   6360  C C    . VAL B 1 93  ? 23.099  -4.661  -63.002 1.00 37.14  ? 93  VAL B C    1 
ATOM   6361  O O    . VAL B 1 93  ? 22.295  -5.605  -62.862 1.00 32.84  ? 93  VAL B O    1 
ATOM   6362  C CB   . VAL B 1 93  ? 25.249  -5.094  -64.210 1.00 33.85  ? 93  VAL B CB   1 
ATOM   6363  C CG1  . VAL B 1 93  ? 26.730  -5.353  -64.057 1.00 32.73  ? 93  VAL B CG1  1 
ATOM   6364  C CG2  . VAL B 1 93  ? 24.554  -6.204  -65.003 1.00 33.00  ? 93  VAL B CG2  1 
ATOM   6365  H H    . VAL B 1 93  ? 24.296  -6.735  -62.182 1.00 41.84  ? 93  VAL B H    1 
ATOM   6366  H HA   . VAL B 1 93  ? 24.984  -4.121  -62.422 1.00 42.64  ? 93  VAL B HA   1 
ATOM   6367  H HB   . VAL B 1 93  ? 25.149  -4.272  -64.715 1.00 40.58  ? 93  VAL B HB   1 
ATOM   6368  H HG11 . VAL B 1 93  ? 27.122  -5.470  -64.936 1.00 39.23  ? 93  VAL B HG11 1 
ATOM   6369  H HG12 . VAL B 1 93  ? 27.138  -4.595  -63.610 1.00 39.23  ? 93  VAL B HG12 1 
ATOM   6370  H HG13 . VAL B 1 93  ? 26.856  -6.156  -63.528 1.00 39.23  ? 93  VAL B HG13 1 
ATOM   6371  H HG21 . VAL B 1 93  ? 24.992  -6.299  -65.863 1.00 39.56  ? 93  VAL B HG21 1 
ATOM   6372  H HG22 . VAL B 1 93  ? 24.617  -7.034  -64.505 1.00 39.56  ? 93  VAL B HG22 1 
ATOM   6373  H HG23 . VAL B 1 93  ? 23.622  -5.964  -65.130 1.00 39.56  ? 93  VAL B HG23 1 
ATOM   6374  N N    . PRO B 1 94  ? 22.685  -3.433  -63.305 1.00 39.31  ? 94  PRO B N    1 
ATOM   6375  C CA   . PRO B 1 94  ? 21.270  -3.203  -63.604 1.00 38.52  ? 94  PRO B CA   1 
ATOM   6376  C C    . PRO B 1 94  ? 20.821  -4.146  -64.712 1.00 40.78  ? 94  PRO B C    1 
ATOM   6377  O O    . PRO B 1 94  ? 21.566  -4.436  -65.659 1.00 33.66  ? 94  PRO B O    1 
ATOM   6378  C CB   . PRO B 1 94  ? 21.224  -1.730  -64.042 1.00 38.09  ? 94  PRO B CB   1 
ATOM   6379  C CG   . PRO B 1 94  ? 22.471  -1.116  -63.488 1.00 37.21  ? 94  PRO B CG   1 
ATOM   6380  C CD   . PRO B 1 94  ? 23.499  -2.223  -63.544 1.00 40.96  ? 94  PRO B CD   1 
ATOM   6381  H HA   . PRO B 1 94  ? 20.722  -3.332  -62.814 1.00 46.19  ? 94  PRO B HA   1 
ATOM   6382  H HB2  . PRO B 1 94  ? 21.217  -1.677  -65.010 1.00 45.66  ? 94  PRO B HB2  1 
ATOM   6383  H HB3  . PRO B 1 94  ? 20.437  -1.304  -63.669 1.00 45.66  ? 94  PRO B HB3  1 
ATOM   6384  H HG2  . PRO B 1 94  ? 22.741  -0.366  -64.041 1.00 44.61  ? 94  PRO B HG2  1 
ATOM   6385  H HG3  . PRO B 1 94  ? 22.319  -0.832  -62.573 1.00 44.61  ? 94  PRO B HG3  1 
ATOM   6386  H HD2  . PRO B 1 94  ? 23.913  -2.259  -64.420 1.00 49.11  ? 94  PRO B HD2  1 
ATOM   6387  H HD3  . PRO B 1 94  ? 24.157  -2.112  -62.840 1.00 49.11  ? 94  PRO B HD3  1 
ATOM   6388  N N    . HIS B 1 95  ? 19.574  -4.588  -64.579 1.00 32.47  ? 95  HIS B N    1 
ATOM   6389  C CA   . HIS B 1 95  ? 18.980  -5.623  -65.411 1.00 45.80  ? 95  HIS B CA   1 
ATOM   6390  C C    . HIS B 1 95  ? 19.099  -5.315  -66.902 1.00 47.89  ? 95  HIS B C    1 
ATOM   6391  O O    . HIS B 1 95  ? 19.202  -6.236  -67.711 1.00 43.44  ? 95  HIS B O    1 
ATOM   6392  C CB   . HIS B 1 95  ? 17.520  -5.797  -64.949 1.00 34.81  ? 95  HIS B CB   1 
ATOM   6393  C CG   . HIS B 1 95  ? 16.539  -6.084  -66.034 1.00 70.46  ? 95  HIS B CG   1 
ATOM   6394  N ND1  . HIS B 1 95  ? 16.337  -7.351  -66.541 1.00 73.05  ? 95  HIS B ND1  1 
ATOM   6395  C CD2  . HIS B 1 95  ? 15.649  -5.277  -66.663 1.00 84.05  ? 95  HIS B CD2  1 
ATOM   6396  C CE1  . HIS B 1 95  ? 15.391  -7.305  -67.464 1.00 88.14  ? 95  HIS B CE1  1 
ATOM   6397  N NE2  . HIS B 1 95  ? 14.958  -6.058  -67.559 1.00 98.27  ? 95  HIS B NE2  1 
ATOM   6398  H H    . HIS B 1 95  ? 19.031  -4.286  -63.985 1.00 38.92  ? 95  HIS B H    1 
ATOM   6399  H HA   . HIS B 1 95  ? 19.443  -6.459  -65.246 1.00 54.92  ? 95  HIS B HA   1 
ATOM   6400  H HB2  . HIS B 1 95  ? 17.482  -6.534  -64.319 1.00 41.74  ? 95  HIS B HB2  1 
ATOM   6401  H HB3  . HIS B 1 95  ? 17.237  -4.980  -64.509 1.00 41.74  ? 95  HIS B HB3  1 
ATOM   6402  H HD2  . HIS B 1 95  ? 15.542  -4.363  -66.530 1.00 100.82 ? 95  HIS B HD2  1 
ATOM   6403  H HE1  . HIS B 1 95  ? 15.081  -8.027  -67.962 1.00 105.72 ? 95  HIS B HE1  1 
ATOM   6404  H HE2  . HIS B 1 95  ? 14.341  -5.782  -68.092 1.00 117.88 ? 95  HIS B HE2  1 
ATOM   6405  N N    . GLN B 1 96  ? 19.141  -4.070  -67.289 1.00 37.68  ? 96  GLN B N    1 
ATOM   6406  C CA   . GLN B 1 96  ? 19.142  -3.709  -68.677 1.00 45.09  ? 96  GLN B CA   1 
ATOM   6407  C C    . GLN B 1 96  ? 20.433  -3.954  -69.426 1.00 48.33  ? 96  GLN B C    1 
ATOM   6408  O O    . GLN B 1 96  ? 20.452  -3.919  -70.620 1.00 37.79  ? 96  GLN B O    1 
ATOM   6409  C CB   . GLN B 1 96  ? 18.721  -2.260  -68.836 1.00 38.26  ? 96  GLN B CB   1 
ATOM   6410  C CG   . GLN B 1 96  ? 19.691  -1.288  -68.248 1.00 49.85  ? 96  GLN B CG   1 
ATOM   6411  C CD   . GLN B 1 96  ? 19.154  -0.585  -67.028 1.00 57.98  ? 96  GLN B CD   1 
ATOM   6412  O OE1  . GLN B 1 96  ? 19.319  0.605   -66.873 1.00 62.18  ? 96  GLN B OE1  1 
ATOM   6413  N NE2  . GLN B 1 96  ? 18.495  -1.326  -66.163 1.00 53.26  ? 96  GLN B NE2  1 
ATOM   6414  H H    . GLN B 1 96  ? 19.215  -3.421  -66.751 1.00 45.18  ? 96  GLN B H    1 
ATOM   6415  H HA   . GLN B 1 96  ? 18.457  -4.250  -69.122 1.00 54.06  ? 96  GLN B HA   1 
ATOM   6416  H HB2  . GLN B 1 96  ? 18.637  -2.060  -69.782 1.00 45.86  ? 96  GLN B HB2  1 
ATOM   6417  H HB3  . GLN B 1 96  ? 17.867  -2.131  -68.395 1.00 45.86  ? 96  GLN B HB3  1 
ATOM   6418  H HG2  . GLN B 1 96  ? 20.496  -1.764  -67.988 1.00 59.78  ? 96  GLN B HG2  1 
ATOM   6419  H HG3  . GLN B 1 96  ? 19.905  -0.614  -68.912 1.00 59.78  ? 96  GLN B HG3  1 
ATOM   6420  H HE21 . GLN B 1 96  ? 18.291  -1.007  -65.391 1.00 63.87  ? 96  GLN B HE21 1 
ATOM   6421  H HE22 . GLN B 1 96  ? 18.267  -2.129  -66.370 1.00 63.87  ? 96  GLN B HE22 1 
ATOM   6422  N N    . PHE B 1 97  ? 21.500  -4.229  -68.709 1.00 50.31  ? 97  PHE B N    1 
ATOM   6423  C CA   . PHE B 1 97  ? 22.793  -4.456  -69.344 1.00 35.75  ? 97  PHE B CA   1 
ATOM   6424  C C    . PHE B 1 97  ? 23.229  -5.913  -69.337 1.00 36.31  ? 97  PHE B C    1 
ATOM   6425  O O    . PHE B 1 97  ? 24.241  -6.241  -69.962 1.00 42.24  ? 97  PHE B O    1 
ATOM   6426  C CB   . PHE B 1 97  ? 23.879  -3.625  -68.662 1.00 47.31  ? 97  PHE B CB   1 
ATOM   6427  C CG   . PHE B 1 97  ? 23.549  -2.176  -68.539 1.00 53.06  ? 97  PHE B CG   1 
ATOM   6428  C CD1  . PHE B 1 97  ? 23.595  -1.349  -69.643 1.00 54.39  ? 97  PHE B CD1  1 
ATOM   6429  C CD2  . PHE B 1 97  ? 23.218  -1.629  -67.308 1.00 51.93  ? 97  PHE B CD2  1 
ATOM   6430  C CE1  . PHE B 1 97  ? 23.298  -0.010  -69.531 1.00 51.60  ? 97  PHE B CE1  1 
ATOM   6431  C CE2  . PHE B 1 97  ? 22.923  -0.290  -67.192 1.00 56.88  ? 97  PHE B CE2  1 
ATOM   6432  C CZ   . PHE B 1 97  ? 22.969  0.522   -68.304 1.00 56.75  ? 97  PHE B CZ   1 
ATOM   6433  H H    . PHE B 1 97  ? 21.518  -4.281  -67.851 1.00 60.33  ? 97  PHE B H    1 
ATOM   6434  H HA   . PHE B 1 97  ? 22.740  -4.169  -70.269 1.00 42.86  ? 97  PHE B HA   1 
ATOM   6435  H HB2  . PHE B 1 97  ? 24.021  -3.972  -67.767 1.00 56.73  ? 97  PHE B HB2  1 
ATOM   6436  H HB3  . PHE B 1 97  ? 24.698  -3.700  -69.176 1.00 56.73  ? 97  PHE B HB3  1 
ATOM   6437  H HD1  . PHE B 1 97  ? 23.818  -1.702  -70.473 1.00 65.23  ? 97  PHE B HD1  1 
ATOM   6438  H HD2  . PHE B 1 97  ? 23.189  -2.174  -66.555 1.00 62.28  ? 97  PHE B HD2  1 
ATOM   6439  H HE1  . PHE B 1 97  ? 23.329  0.537   -70.282 1.00 61.88  ? 97  PHE B HE1  1 
ATOM   6440  H HE2  . PHE B 1 97  ? 22.699  0.067   -66.363 1.00 68.22  ? 97  PHE B HE2  1 
ATOM   6441  H HZ   . PHE B 1 97  ? 22.768  1.427   -68.228 1.00 68.05  ? 97  PHE B HZ   1 
ATOM   6442  N N    . ILE B 1 98  ? 22.508  -6.790  -68.642 1.00 37.89  ? 98  ILE B N    1 
ATOM   6443  C CA   . ILE B 1 98  ? 23.022  -8.131  -68.404 1.00 42.40  ? 98  ILE B CA   1 
ATOM   6444  C C    . ILE B 1 98  ? 23.068  -8.930  -69.705 1.00 48.66  ? 98  ILE B C    1 
ATOM   6445  O O    . ILE B 1 98  ? 23.975  -9.747  -69.918 1.00 41.37  ? 98  ILE B O    1 
ATOM   6446  C CB   . ILE B 1 98  ? 22.169  -8.834  -67.337 1.00 36.46  ? 98  ILE B CB   1 
ATOM   6447  C CG1  . ILE B 1 98  ? 22.748  -10.203 -66.972 1.00 47.40  ? 98  ILE B CG1  1 
ATOM   6448  C CG2  . ILE B 1 98  ? 20.778  -8.996  -67.841 1.00 32.53  ? 98  ILE B CG2  1 
ATOM   6449  C CD1  . ILE B 1 98  ? 24.141  -10.163 -66.375 1.00 37.39  ? 98  ILE B CD1  1 
ATOM   6450  H H    . ILE B 1 98  ? 21.732  -6.636  -68.303 1.00 45.42  ? 98  ILE B H    1 
ATOM   6451  H HA   . ILE B 1 98  ? 23.928  -8.064  -68.064 1.00 50.84  ? 98  ILE B HA   1 
ATOM   6452  H HB   . ILE B 1 98  ? 22.149  -8.281  -66.540 1.00 43.71  ? 98  ILE B HB   1 
ATOM   6453  H HG12 . ILE B 1 98  ? 22.163  -10.624 -66.322 1.00 56.83  ? 98  ILE B HG12 1 
ATOM   6454  H HG13 . ILE B 1 98  ? 22.788  -10.746 -67.774 1.00 56.83  ? 98  ILE B HG13 1 
ATOM   6455  H HG21 . ILE B 1 98  ? 20.246  -9.440  -67.162 1.00 39.00  ? 98  ILE B HG21 1 
ATOM   6456  H HG22 . ILE B 1 98  ? 20.407  -8.120  -68.031 1.00 39.00  ? 98  ILE B HG22 1 
ATOM   6457  H HG23 . ILE B 1 98  ? 20.796  -9.531  -68.650 1.00 39.00  ? 98  ILE B HG23 1 
ATOM   6458  H HD11 . ILE B 1 98  ? 24.425  -11.069 -66.176 1.00 44.82  ? 98  ILE B HD11 1 
ATOM   6459  H HD12 . ILE B 1 98  ? 24.747  -9.759  -67.016 1.00 44.82  ? 98  ILE B HD12 1 
ATOM   6460  H HD13 . ILE B 1 98  ? 24.121  -9.636  -65.561 1.00 44.82  ? 98  ILE B HD13 1 
ATOM   6461  N N    . GLY B 1 99  ? 22.082  -8.726  -70.573 1.00 46.32  ? 99  GLY B N    1 
ATOM   6462  C CA   . GLY B 1 99  ? 22.040  -9.335  -71.884 1.00 50.40  ? 99  GLY B CA   1 
ATOM   6463  C C    . GLY B 1 99  ? 23.297  -9.112  -72.697 1.00 40.23  ? 99  GLY B C    1 
ATOM   6464  O O    . GLY B 1 99  ? 23.932  -10.080 -73.113 1.00 44.78  ? 99  GLY B O    1 
ATOM   6465  H H    . GLY B 1 99  ? 21.405  -8.219  -70.413 1.00 55.54  ? 99  GLY B H    1 
ATOM   6466  H HA2  . GLY B 1 99  ? 21.908  -10.291 -71.787 1.00 60.44  ? 99  GLY B HA2  1 
ATOM   6467  H HA3  . GLY B 1 99  ? 21.290  -8.973  -72.380 1.00 60.44  ? 99  GLY B HA3  1 
ATOM   6468  N N    . LYS B 1 100 ? 23.665  -7.850  -72.934 1.00 42.68  ? 100 LYS B N    1 
ATOM   6469  C CA   . LYS B 1 100 ? 24.880  -7.561  -73.699 1.00 46.08  ? 100 LYS B CA   1 
ATOM   6470  C C    . LYS B 1 100 ? 26.113  -8.168  -73.026 1.00 53.44  ? 100 LYS B C    1 
ATOM   6471  O O    . LYS B 1 100 ? 26.979  -8.763  -73.692 1.00 38.54  ? 100 LYS B O    1 
ATOM   6472  C CB   . LYS B 1 100 ? 25.035  -6.045  -73.878 1.00 40.32  ? 100 LYS B CB   1 
ATOM   6473  H H    . LYS B 1 100 ? 23.236  -7.154  -72.668 1.00 51.18  ? 100 LYS B H    1 
ATOM   6474  H HA   . LYS B 1 100 ? 24.797  -7.958  -74.580 1.00 55.26  ? 100 LYS B HA   1 
ATOM   6475  N N    . ILE B 1 101 ? 26.209  -8.043  -71.700 1.00 48.52  ? 101 ILE B N    1 
ATOM   6476  C CA   . ILE B 1 101 ? 27.340  -8.636  -70.986 1.00 40.30  ? 101 ILE B CA   1 
ATOM   6477  C C    . ILE B 1 101 ? 27.405  -10.137 -71.251 1.00 47.12  ? 101 ILE B C    1 
ATOM   6478  O O    . ILE B 1 101 ? 28.476  -10.690 -71.546 1.00 39.19  ? 101 ILE B O    1 
ATOM   6479  C CB   . ILE B 1 101 ? 27.244  -8.332  -69.482 1.00 37.57  ? 101 ILE B CB   1 
ATOM   6480  C CG1  . ILE B 1 101 ? 27.495  -6.855  -69.242 1.00 42.15  ? 101 ILE B CG1  1 
ATOM   6481  C CG2  . ILE B 1 101 ? 28.197  -9.204  -68.674 1.00 41.53  ? 101 ILE B CG2  1 
ATOM   6482  C CD1  . ILE B 1 101 ? 26.777  -6.371  -67.971 1.00 45.27  ? 101 ILE B CD1  1 
ATOM   6483  H H    . ILE B 1 101 ? 25.644  -7.629  -71.200 1.00 58.19  ? 101 ILE B H    1 
ATOM   6484  H HA   . ILE B 1 101 ? 28.161  -8.240  -71.317 1.00 48.32  ? 101 ILE B HA   1 
ATOM   6485  H HB   . ILE B 1 101 ? 26.340  -8.532  -69.194 1.00 45.04  ? 101 ILE B HB   1 
ATOM   6486  H HG12 . ILE B 1 101 ? 28.447  -6.705  -69.131 1.00 50.54  ? 101 ILE B HG12 1 
ATOM   6487  H HG13 . ILE B 1 101 ? 27.158  -6.346  -69.995 1.00 50.54  ? 101 ILE B HG13 1 
ATOM   6488  H HG21 . ILE B 1 101 ? 28.107  -8.983  -67.734 1.00 49.79  ? 101 ILE B HG21 1 
ATOM   6489  H HG22 . ILE B 1 101 ? 27.970  -10.136 -68.818 1.00 49.79  ? 101 ILE B HG22 1 
ATOM   6490  H HG23 . ILE B 1 101 ? 29.106  -9.035  -68.968 1.00 49.79  ? 101 ILE B HG23 1 
ATOM   6491  H HD11 . ILE B 1 101 ? 26.958  -5.426  -67.847 1.00 54.28  ? 101 ILE B HD11 1 
ATOM   6492  H HD12 . ILE B 1 101 ? 25.824  -6.515  -68.073 1.00 54.28  ? 101 ILE B HD12 1 
ATOM   6493  H HD13 . ILE B 1 101 ? 27.109  -6.874  -67.210 1.00 54.28  ? 101 ILE B HD13 1 
ATOM   6494  N N    . CYS B 1 102 ? 26.268  -10.830 -71.126 1.00 34.00  ? 102 CYS B N    1 
ATOM   6495  C CA   . CYS B 1 102 ? 26.293  -12.261 -71.399 1.00 40.94  ? 102 CYS B CA   1 
ATOM   6496  C C    . CYS B 1 102 ? 26.668  -12.544 -72.861 1.00 47.43  ? 102 CYS B C    1 
ATOM   6497  O O    . CYS B 1 102 ? 27.365  -13.525 -73.146 1.00 43.49  ? 102 CYS B O    1 
ATOM   6498  C CB   . CYS B 1 102 ? 24.956  -12.886 -71.052 1.00 41.48  ? 102 CYS B CB   1 
ATOM   6499  S SG   . CYS B 1 102 ? 24.718  -12.993 -69.317 1.00 46.14  ? 102 CYS B SG   1 
ATOM   6500  H H    . CYS B 1 102 ? 25.504  -10.510 -70.895 1.00 40.76  ? 102 CYS B H    1 
ATOM   6501  H HA   . CYS B 1 102 ? 26.967  -12.673 -70.836 1.00 49.09  ? 102 CYS B HA   1 
ATOM   6502  H HB2  . CYS B 1 102 ? 24.244  -12.343 -71.423 1.00 49.73  ? 102 CYS B HB2  1 
ATOM   6503  H HB3  . CYS B 1 102 ? 24.919  -13.784 -71.419 1.00 49.73  ? 102 CYS B HB3  1 
ATOM   6504  H HG   . CYS B 1 102 ? 23.649  -13.493 -69.100 1.00 55.33  ? 102 CYS B HG   1 
ATOM   6505  N N    . ASP B 1 103 ? 26.274  -11.669 -73.787 1.00 38.21  ? 103 ASP B N    1 
ATOM   6506  C CA   . ASP B 1 103 ? 26.636  -11.880 -75.183 1.00 45.57  ? 103 ASP B CA   1 
ATOM   6507  C C    . ASP B 1 103 ? 28.125  -11.679 -75.433 1.00 41.04  ? 103 ASP B C    1 
ATOM   6508  O O    . ASP B 1 103 ? 28.644  -12.220 -76.413 1.00 49.72  ? 103 ASP B O    1 
ATOM   6509  C CB   . ASP B 1 103 ? 25.813  -10.959 -76.085 1.00 35.54  ? 103 ASP B CB   1 
ATOM   6510  C CG   . ASP B 1 103 ? 24.326  -11.361 -76.125 1.00 43.12  ? 103 ASP B CG   1 
ATOM   6511  O OD1  . ASP B 1 103 ? 24.023  -12.572 -76.100 1.00 49.46  ? 103 ASP B OD1  1 
ATOM   6512  O OD2  . ASP B 1 103 ? 23.453  -10.473 -76.173 1.00 54.65  ? 103 ASP B OD2  1 
ATOM   6513  H H    . ASP B 1 103 ? 25.807  -10.963 -73.636 1.00 45.81  ? 103 ASP B H    1 
ATOM   6514  H HA   . ASP B 1 103 ? 26.420  -12.795 -75.423 1.00 54.64  ? 103 ASP B HA   1 
ATOM   6515  H HB2  . ASP B 1 103 ? 25.871  -10.051 -75.749 1.00 42.60  ? 103 ASP B HB2  1 
ATOM   6516  H HB3  . ASP B 1 103 ? 26.162  -11.004 -76.989 1.00 42.60  ? 103 ASP B HB3  1 
ATOM   6517  N N    . GLN B 1 104 ? 28.834  -10.935 -74.574 1.00 47.65  ? 104 GLN B N    1 
ATOM   6518  C CA   . GLN B 1 104 ? 30.283  -10.817 -74.719 1.00 43.56  ? 104 GLN B CA   1 
ATOM   6519  C C    . GLN B 1 104 ? 31.032  -11.938 -74.009 1.00 43.09  ? 104 GLN B C    1 
ATOM   6520  O O    . GLN B 1 104 ? 32.162  -12.261 -74.396 1.00 40.75  ? 104 GLN B O    1 
ATOM   6521  C CB   . GLN B 1 104 ? 30.772  -9.456  -74.205 1.00 39.70  ? 104 GLN B CB   1 
ATOM   6522  C CG   . GLN B 1 104 ? 30.017  -8.230  -74.813 1.00 54.27  ? 104 GLN B CG   1 
ATOM   6523  C CD   . GLN B 1 104 ? 30.691  -6.864  -74.541 1.00 70.80  ? 104 GLN B CD   1 
ATOM   6524  O OE1  . GLN B 1 104 ? 31.198  -6.592  -73.441 1.00 55.79  ? 104 GLN B OE1  1 
ATOM   6525  N NE2  . GLN B 1 104 ? 30.690  -5.998  -75.557 1.00 71.07  ? 104 GLN B NE2  1 
ATOM   6526  H H    . GLN B 1 104 ? 28.503  -10.498 -73.911 1.00 57.13  ? 104 GLN B H    1 
ATOM   6527  H HA   . GLN B 1 104 ? 30.503  -10.870 -75.663 1.00 52.24  ? 104 GLN B HA   1 
ATOM   6528  H HB2  . GLN B 1 104 ? 30.655  -9.427  -73.243 1.00 47.60  ? 104 GLN B HB2  1 
ATOM   6529  H HB3  . GLN B 1 104 ? 31.713  -9.361  -74.423 1.00 47.60  ? 104 GLN B HB3  1 
ATOM   6530  H HG2  . GLN B 1 104 ? 29.963  -8.345  -75.775 1.00 65.08  ? 104 GLN B HG2  1 
ATOM   6531  H HG3  . GLN B 1 104 ? 29.124  -8.198  -74.437 1.00 65.08  ? 104 GLN B HG3  1 
ATOM   6532  H HE21 . GLN B 1 104 ? 30.330  -6.215  -76.307 1.00 85.25  ? 104 GLN B HE21 1 
ATOM   6533  H HE22 . GLN B 1 104 ? 31.050  -5.223  -75.462 1.00 85.25  ? 104 GLN B HE22 1 
ATOM   6534  N N    . LEU B 1 105 ? 30.436  -12.551 -72.991 1.00 43.03  ? 105 LEU B N    1 
ATOM   6535  C CA   . LEU B 1 105 ? 31.141  -13.571 -72.224 1.00 42.37  ? 105 LEU B CA   1 
ATOM   6536  C C    . LEU B 1 105 ? 30.932  -14.984 -72.761 1.00 34.45  ? 105 LEU B C    1 
ATOM   6537  O O    . LEU B 1 105 ? 31.724  -15.872 -72.436 1.00 35.19  ? 105 LEU B O    1 
ATOM   6538  C CB   . LEU B 1 105 ? 30.704  -13.536 -70.745 1.00 39.40  ? 105 LEU B CB   1 
ATOM   6539  C CG   . LEU B 1 105 ? 31.126  -12.365 -69.857 1.00 46.76  ? 105 LEU B CG   1 
ATOM   6540  C CD1  . LEU B 1 105 ? 30.506  -12.508 -68.444 1.00 35.33  ? 105 LEU B CD1  1 
ATOM   6541  C CD2  . LEU B 1 105 ? 32.625  -12.271 -69.750 1.00 36.67  ? 105 LEU B CD2  1 
ATOM   6542  H H    . LEU B 1 105 ? 29.633  -12.396 -72.726 1.00 51.59  ? 105 LEU B H    1 
ATOM   6543  H HA   . LEU B 1 105 ? 32.092  -13.381 -72.256 1.00 50.81  ? 105 LEU B HA   1 
ATOM   6544  H HB2  . LEU B 1 105 ? 29.735  -13.560 -70.727 1.00 47.24  ? 105 LEU B HB2  1 
ATOM   6545  H HB3  . LEU B 1 105 ? 31.044  -14.339 -70.322 1.00 47.24  ? 105 LEU B HB3  1 
ATOM   6546  H HG   . LEU B 1 105 ? 30.800  -11.538 -70.246 1.00 56.07  ? 105 LEU B HG   1 
ATOM   6547  H HD11 . LEU B 1 105 ? 30.787  -11.756 -67.899 1.00 42.36  ? 105 LEU B HD11 1 
ATOM   6548  H HD12 . LEU B 1 105 ? 29.539  -12.517 -68.523 1.00 42.36  ? 105 LEU B HD12 1 
ATOM   6549  H HD13 . LEU B 1 105 ? 30.814  -13.338 -68.047 1.00 42.36  ? 105 LEU B HD13 1 
ATOM   6550  H HD21 . LEU B 1 105 ? 32.855  -11.520 -69.181 1.00 43.96  ? 105 LEU B HD21 1 
ATOM   6551  H HD22 . LEU B 1 105 ? 32.966  -13.094 -69.366 1.00 43.96  ? 105 LEU B HD22 1 
ATOM   6552  H HD23 . LEU B 1 105 ? 32.996  -12.141 -70.637 1.00 43.96  ? 105 LEU B HD23 1 
ATOM   6553  N N    . LYS B 1 106 ? 29.906  -15.210 -73.573 1.00 36.55  ? 106 LYS B N    1 
ATOM   6554  C CA   . LYS B 1 106 ? 29.563  -16.560 -74.005 1.00 48.14  ? 106 LYS B CA   1 
ATOM   6555  C C    . LYS B 1 106 ? 30.759  -17.213 -74.703 1.00 45.28  ? 106 LYS B C    1 
ATOM   6556  O O    . LYS B 1 106 ? 31.421  -16.588 -75.531 1.00 46.24  ? 106 LYS B O    1 
ATOM   6557  C CB   . LYS B 1 106 ? 28.344  -16.506 -74.938 1.00 53.87  ? 106 LYS B CB   1 
ATOM   6558  C CG   . LYS B 1 106 ? 27.777  -17.851 -75.354 1.00 46.12  ? 106 LYS B CG   1 
ATOM   6559  C CD   . LYS B 1 106 ? 26.679  -17.675 -76.399 1.00 58.31  ? 106 LYS B CD   1 
ATOM   6560  C CE   . LYS B 1 106 ? 26.600  -18.887 -77.300 1.00 53.22  ? 106 LYS B CE   1 
ATOM   6561  N NZ   . LYS B 1 106 ? 26.550  -20.124 -76.483 1.00 60.45  ? 106 LYS B NZ   1 
ATOM   6562  H H    . LYS B 1 106 ? 29.391  -14.598 -73.889 1.00 43.82  ? 106 LYS B H    1 
ATOM   6563  H HA   . LYS B 1 106 ? 29.332  -17.097 -73.231 1.00 57.73  ? 106 LYS B HA   1 
ATOM   6564  H HB2  . LYS B 1 106 ? 27.636  -16.019 -74.489 1.00 64.60  ? 106 LYS B HB2  1 
ATOM   6565  H HB3  . LYS B 1 106 ? 28.598  -16.035 -75.747 1.00 64.60  ? 106 LYS B HB3  1 
ATOM   6566  H HG2  . LYS B 1 106 ? 28.483  -18.393 -75.740 1.00 55.31  ? 106 LYS B HG2  1 
ATOM   6567  H HG3  . LYS B 1 106 ? 27.395  -18.293 -74.580 1.00 55.31  ? 106 LYS B HG3  1 
ATOM   6568  H HD2  . LYS B 1 106 ? 25.824  -17.568 -75.953 1.00 69.93  ? 106 LYS B HD2  1 
ATOM   6569  H HD3  . LYS B 1 106 ? 26.875  -16.898 -76.946 1.00 69.93  ? 106 LYS B HD3  1 
ATOM   6570  H HE2  . LYS B 1 106 ? 25.795  -18.840 -77.839 1.00 63.82  ? 106 LYS B HE2  1 
ATOM   6571  H HE3  . LYS B 1 106 ? 27.387  -18.923 -77.866 1.00 63.82  ? 106 LYS B HE3  1 
ATOM   6572  H HZ1  . LYS B 1 106 ? 27.281  -20.185 -75.979 1.00 72.50  ? 106 LYS B HZ1  1 
ATOM   6573  H HZ2  . LYS B 1 106 ? 25.834  -20.110 -75.954 1.00 72.50  ? 106 LYS B HZ2  1 
ATOM   6574  H HZ3  . LYS B 1 106 ? 26.503  -20.837 -77.013 1.00 72.50  ? 106 LYS B HZ3  1 
ATOM   6575  N N    . GLY B 1 107 ? 31.055  -18.459 -74.323 1.00 48.08  ? 107 GLY B N    1 
ATOM   6576  C CA   . GLY B 1 107 ? 32.169  -19.210 -74.846 1.00 43.10  ? 107 GLY B CA   1 
ATOM   6577  C C    . GLY B 1 107 ? 33.516  -18.900 -74.233 1.00 55.25  ? 107 GLY B C    1 
ATOM   6578  O O    . GLY B 1 107 ? 34.504  -19.570 -74.583 1.00 47.97  ? 107 GLY B O    1 
ATOM   6579  H H    . GLY B 1 107 ? 30.599  -18.896 -73.740 1.00 57.65  ? 107 GLY B H    1 
ATOM   6580  H HA2  . GLY B 1 107 ? 31.996  -20.156 -74.717 1.00 51.68  ? 107 GLY B HA2  1 
ATOM   6581  H HA3  . GLY B 1 107 ? 32.234  -19.047 -75.800 1.00 51.68  ? 107 GLY B HA3  1 
ATOM   6582  N N    . HIS B 1 108 ? 33.595  -17.930 -73.318 1.00 49.51  ? 108 HIS B N    1 
ATOM   6583  C CA   . HIS B 1 108 ? 34.877  -17.419 -72.848 1.00 44.36  ? 108 HIS B CA   1 
ATOM   6584  C C    . HIS B 1 108 ? 35.150  -17.687 -71.379 1.00 42.80  ? 108 HIS B C    1 
ATOM   6585  O O    . HIS B 1 108 ? 36.075  -17.097 -70.828 1.00 47.81  ? 108 HIS B O    1 
ATOM   6586  C CB   . HIS B 1 108 ? 34.962  -15.920 -73.098 1.00 40.21  ? 108 HIS B CB   1 
ATOM   6587  C CG   . HIS B 1 108 ? 35.142  -15.559 -74.537 1.00 47.16  ? 108 HIS B CG   1 
ATOM   6588  N ND1  . HIS B 1 108 ? 34.215  -14.816 -75.237 1.00 51.29  ? 108 HIS B ND1  1 
ATOM   6589  C CD2  . HIS B 1 108 ? 36.146  -15.832 -75.406 1.00 46.15  ? 108 HIS B CD2  1 
ATOM   6590  C CE1  . HIS B 1 108 ? 34.641  -14.646 -76.476 1.00 50.81  ? 108 HIS B CE1  1 
ATOM   6591  N NE2  . HIS B 1 108 ? 35.811  -15.250 -76.602 1.00 52.47  ? 108 HIS B NE2  1 
ATOM   6592  H H    . HIS B 1 108 ? 32.914  -17.551 -72.954 1.00 59.37  ? 108 HIS B H    1 
ATOM   6593  H HA   . HIS B 1 108 ? 35.584  -17.843 -73.360 1.00 53.18  ? 108 HIS B HA   1 
ATOM   6594  H HB2  . HIS B 1 108 ? 34.142  -15.504 -72.788 1.00 48.21  ? 108 HIS B HB2  1 
ATOM   6595  H HB3  . HIS B 1 108 ? 35.718  -15.563 -72.606 1.00 48.21  ? 108 HIS B HB3  1 
ATOM   6596  H HD2  . HIS B 1 108 ? 36.919  -16.316 -75.224 1.00 55.33  ? 108 HIS B HD2  1 
ATOM   6597  H HE1  . HIS B 1 108 ? 34.194  -14.180 -77.146 1.00 60.93  ? 108 HIS B HE1  1 
ATOM   6598  H HE2  . HIS B 1 108 ? 36.283  -15.281 -77.321 1.00 62.92  ? 108 HIS B HE2  1 
ATOM   6599  N N    . LEU B 1 109 ? 34.387  -18.551 -70.728 1.00 40.59  ? 109 LEU B N    1 
ATOM   6600  C CA   . LEU B 1 109 ? 34.549  -18.745 -69.301 1.00 40.17  ? 109 LEU B CA   1 
ATOM   6601  C C    . LEU B 1 109 ? 35.244  -20.069 -69.043 1.00 41.79  ? 109 LEU B C    1 
ATOM   6602  O O    . LEU B 1 109 ? 35.213  -20.979 -69.870 1.00 39.73  ? 109 LEU B O    1 
ATOM   6603  C CB   . LEU B 1 109 ? 33.185  -18.706 -68.594 1.00 37.01  ? 109 LEU B CB   1 
ATOM   6604  C CG   . LEU B 1 109 ? 32.266  -17.507 -68.896 1.00 45.68  ? 109 LEU B CG   1 
ATOM   6605  C CD1  . LEU B 1 109 ? 30.970  -17.646 -68.114 1.00 47.27  ? 109 LEU B CD1  1 
ATOM   6606  C CD2  . LEU B 1 109 ? 32.916  -16.140 -68.601 1.00 42.15  ? 109 LEU B CD2  1 
ATOM   6607  H H    . LEU B 1 109 ? 33.772  -19.033 -71.087 1.00 48.67  ? 109 LEU B H    1 
ATOM   6608  H HA   . LEU B 1 109 ? 35.102  -18.034 -68.940 1.00 48.17  ? 109 LEU B HA   1 
ATOM   6609  H HB2  . LEU B 1 109 ? 32.697  -19.507 -68.839 1.00 44.37  ? 109 LEU B HB2  1 
ATOM   6610  H HB3  . LEU B 1 109 ? 33.343  -18.709 -67.637 1.00 44.37  ? 109 LEU B HB3  1 
ATOM   6611  H HG   . LEU B 1 109 ? 32.041  -17.524 -69.840 1.00 54.77  ? 109 LEU B HG   1 
ATOM   6612  H HD11 . LEU B 1 109 ? 30.399  -16.886 -68.312 1.00 56.68  ? 109 LEU B HD11 1 
ATOM   6613  H HD12 . LEU B 1 109 ? 30.529  -18.469 -68.378 1.00 56.68  ? 109 LEU B HD12 1 
ATOM   6614  H HD13 . LEU B 1 109 ? 31.174  -17.668 -67.166 1.00 56.68  ? 109 LEU B HD13 1 
ATOM   6615  H HD21 . LEU B 1 109 ? 32.283  -15.437 -68.814 1.00 50.54  ? 109 LEU B HD21 1 
ATOM   6616  H HD22 . LEU B 1 109 ? 33.152  -16.100 -67.661 1.00 50.54  ? 109 LEU B HD22 1 
ATOM   6617  H HD23 . LEU B 1 109 ? 33.713  -16.045 -69.147 1.00 50.54  ? 109 LEU B HD23 1 
ATOM   6618  N N    . LYS B 1 110 ? 35.918  -20.149 -67.907 1.00 44.55  ? 110 LYS B N    1 
ATOM   6619  C CA   . LYS B 1 110 ? 36.440  -21.426 -67.439 1.00 46.89  ? 110 LYS B CA   1 
ATOM   6620  C C    . LYS B 1 110 ? 35.355  -22.482 -67.549 1.00 46.54  ? 110 LYS B C    1 
ATOM   6621  O O    . LYS B 1 110 ? 34.175  -22.200 -67.336 1.00 48.02  ? 110 LYS B O    1 
ATOM   6622  C CB   . LYS B 1 110 ? 36.882  -21.340 -65.984 1.00 52.22  ? 110 LYS B CB   1 
ATOM   6623  C CG   . LYS B 1 110 ? 38.348  -21.096 -65.714 1.00 58.12  ? 110 LYS B CG   1 
ATOM   6624  C CD   . LYS B 1 110 ? 38.645  -21.480 -64.277 1.00 45.76  ? 110 LYS B CD   1 
ATOM   6625  C CE   . LYS B 1 110 ? 40.107  -21.720 -64.013 1.00 54.96  ? 110 LYS B CE   1 
ATOM   6626  N NZ   . LYS B 1 110 ? 40.256  -22.736 -62.936 1.00 54.03  ? 110 LYS B NZ   1 
ATOM   6627  H H    . LYS B 1 110 ? 36.088  -19.483 -67.389 1.00 53.42  ? 110 LYS B H    1 
ATOM   6628  H HA   . LYS B 1 110 ? 37.197  -21.694 -67.984 1.00 56.22  ? 110 LYS B HA   1 
ATOM   6629  H HB2  . LYS B 1 110 ? 36.391  -20.617 -65.564 1.00 62.63  ? 110 LYS B HB2  1 
ATOM   6630  H HB3  . LYS B 1 110 ? 36.649  -22.176 -65.550 1.00 62.63  ? 110 LYS B HB3  1 
ATOM   6631  H HG2  . LYS B 1 110 ? 38.888  -21.645 -66.303 1.00 69.70  ? 110 LYS B HG2  1 
ATOM   6632  H HG3  . LYS B 1 110 ? 38.553  -20.155 -65.835 1.00 69.70  ? 110 LYS B HG3  1 
ATOM   6633  H HD2  . LYS B 1 110 ? 38.351  -20.764 -63.692 1.00 54.87  ? 110 LYS B HD2  1 
ATOM   6634  H HD3  . LYS B 1 110 ? 38.166  -22.297 -64.065 1.00 54.87  ? 110 LYS B HD3  1 
ATOM   6635  H HE2  . LYS B 1 110 ? 40.534  -22.055 -64.817 1.00 65.91  ? 110 LYS B HE2  1 
ATOM   6636  H HE3  . LYS B 1 110 ? 40.526  -20.895 -63.721 1.00 65.91  ? 110 LYS B HE3  1 
ATOM   6637  H HZ1  . LYS B 1 110 ? 41.119  -22.883 -62.775 1.00 64.79  ? 110 LYS B HZ1  1 
ATOM   6638  H HZ2  . LYS B 1 110 ? 39.867  -22.447 -62.190 1.00 64.79  ? 110 LYS B HZ2  1 
ATOM   6639  H HZ3  . LYS B 1 110 ? 39.874  -23.500 -63.185 1.00 64.79  ? 110 LYS B HZ3  1 
ATOM   6640  N N    . ALA B 1 111 ? 35.765  -23.725 -67.835 1.00 46.16  ? 111 ALA B N    1 
ATOM   6641  C CA   . ALA B 1 111 ? 34.791  -24.790 -68.035 1.00 59.03  ? 111 ALA B CA   1 
ATOM   6642  C C    . ALA B 1 111 ? 34.010  -25.085 -66.763 1.00 56.72  ? 111 ALA B C    1 
ATOM   6643  O O    . ALA B 1 111 ? 32.861  -25.543 -66.840 1.00 55.82  ? 111 ALA B O    1 
ATOM   6644  C CB   . ALA B 1 111 ? 35.485  -26.063 -68.529 1.00 56.95  ? 111 ALA B CB   1 
ATOM   6645  H H    . ALA B 1 111 ? 36.586  -23.968 -67.917 1.00 55.34  ? 111 ALA B H    1 
ATOM   6646  H HA   . ALA B 1 111 ? 34.158  -24.512 -68.715 1.00 70.80  ? 111 ALA B HA   1 
ATOM   6647  H HB1  . ALA B 1 111 ? 34.819  -26.757 -68.655 1.00 68.30  ? 111 ALA B HB1  1 
ATOM   6648  H HB2  . ALA B 1 111 ? 35.929  -25.873 -69.371 1.00 68.30  ? 111 ALA B HB2  1 
ATOM   6649  H HB3  . ALA B 1 111 ? 36.136  -26.344 -67.867 1.00 68.30  ? 111 ALA B HB3  1 
ATOM   6650  N N    . ASN B 1 112 ? 34.597  -24.793 -65.607 1.00 47.69  ? 112 ASN B N    1 
ATOM   6651  C CA   . ASN B 1 112 ? 34.023  -25.123 -64.314 1.00 54.51  ? 112 ASN B CA   1 
ATOM   6652  C C    . ASN B 1 112 ? 33.404  -23.911 -63.616 1.00 47.76  ? 112 ASN B C    1 
ATOM   6653  O O    . ASN B 1 112 ? 33.152  -23.964 -62.407 1.00 44.74  ? 112 ASN B O    1 
ATOM   6654  C CB   . ASN B 1 112 ? 35.111  -25.718 -63.433 1.00 54.29  ? 112 ASN B CB   1 
ATOM   6655  C CG   . ASN B 1 112 ? 36.319  -24.781 -63.310 1.00 72.60  ? 112 ASN B CG   1 
ATOM   6656  O OD1  . ASN B 1 112 ? 36.313  -23.816 -62.527 1.00 53.85  ? 112 ASN B OD1  1 
ATOM   6657  N ND2  . ASN B 1 112 ? 37.350  -25.047 -64.112 1.00 86.71  ? 112 ASN B ND2  1 
ATOM   6658  H H    . ASN B 1 112 ? 35.355  -24.391 -65.548 1.00 57.18  ? 112 ASN B H    1 
ATOM   6659  H HA   . ASN B 1 112 ? 33.330  -25.791 -64.433 1.00 65.37  ? 112 ASN B HA   1 
ATOM   6660  H HB2  . ASN B 1 112 ? 34.754  -25.871 -62.544 1.00 65.11  ? 112 ASN B HB2  1 
ATOM   6661  H HB3  . ASN B 1 112 ? 35.414  -26.554 -63.821 1.00 65.11  ? 112 ASN B HB3  1 
ATOM   6662  H HD21 . ASN B 1 112 ? 38.053  -24.552 -64.087 1.00 104.01 ? 112 ASN B HD21 1 
ATOM   6663  H HD22 . ASN B 1 112 ? 37.317  -25.721 -64.646 1.00 104.01 ? 112 ASN B HD22 1 
ATOM   6664  N N    . ALA B 1 113 ? 33.186  -22.821 -64.337 1.00 40.98  ? 113 ALA B N    1 
ATOM   6665  C CA   . ALA B 1 113 ? 32.781  -21.572 -63.714 1.00 45.93  ? 113 ALA B CA   1 
ATOM   6666  C C    . ALA B 1 113 ? 31.350  -21.656 -63.177 1.00 43.25  ? 113 ALA B C    1 
ATOM   6667  O O    . ALA B 1 113 ? 30.479  -22.310 -63.768 1.00 28.97  ? 113 ALA B O    1 
ATOM   6668  C CB   . ALA B 1 113 ? 32.905  -20.433 -64.717 1.00 41.09  ? 113 ALA B CB   1 
ATOM   6669  H H    . ALA B 1 113 ? 33.267  -22.778 -65.193 1.00 49.13  ? 113 ALA B H    1 
ATOM   6670  H HA   . ALA B 1 113 ? 33.372  -21.383 -62.968 1.00 55.07  ? 113 ALA B HA   1 
ATOM   6671  H HB1  . ALA B 1 113 ? 32.632  -19.606 -64.290 1.00 49.26  ? 113 ALA B HB1  1 
ATOM   6672  H HB2  . ALA B 1 113 ? 33.828  -20.368 -65.008 1.00 49.26  ? 113 ALA B HB2  1 
ATOM   6673  H HB3  . ALA B 1 113 ? 32.331  -20.619 -65.477 1.00 49.26  ? 113 ALA B HB3  1 
ATOM   6674  N N    . THR B 1 114 ? 31.127  -21.000 -62.035 1.00 36.43  ? 114 THR B N    1 
ATOM   6675  C CA   . THR B 1 114 ? 29.832  -20.863 -61.372 1.00 29.12  ? 114 THR B CA   1 
ATOM   6676  C C    . THR B 1 114 ? 29.486  -19.394 -61.236 1.00 42.14  ? 114 THR B C    1 
ATOM   6677  O O    . THR B 1 114 ? 30.333  -18.515 -61.352 1.00 35.23  ? 114 THR B O    1 
ATOM   6678  C CB   . THR B 1 114 ? 29.825  -21.457 -59.966 1.00 34.32  ? 114 THR B CB   1 
ATOM   6679  O OG1  . THR B 1 114 ? 30.815  -20.778 -59.176 1.00 34.71  ? 114 THR B OG1  1 
ATOM   6680  C CG2  . THR B 1 114 ? 30.092  -22.915 -59.991 1.00 41.95  ? 114 THR B CG2  1 
ATOM   6681  H H    . THR B 1 114 ? 31.756  -20.603 -61.603 1.00 43.67  ? 114 THR B H    1 
ATOM   6682  H HA   . THR B 1 114 ? 29.145  -21.298 -61.899 1.00 34.90  ? 114 THR B HA   1 
ATOM   6683  H HB   . THR B 1 114 ? 28.951  -21.318 -59.567 1.00 41.14  ? 114 THR B HB   1 
ATOM   6684  H HG1  . THR B 1 114 ? 30.825  -21.092 -58.397 1.00 41.61  ? 114 THR B HG1  1 
ATOM   6685  H HG21 . THR B 1 114 ? 30.082  -23.270 -59.088 1.00 50.30  ? 114 THR B HG21 1 
ATOM   6686  H HG22 . THR B 1 114 ? 29.412  -23.368 -60.514 1.00 50.30  ? 114 THR B HG22 1 
ATOM   6687  H HG23 . THR B 1 114 ? 30.961  -23.086 -60.387 1.00 50.30  ? 114 THR B HG23 1 
ATOM   6688  N N    . GLY B 1 115 ? 28.228  -19.131 -60.937 1.00 33.33  ? 115 GLY B N    1 
ATOM   6689  C CA   . GLY B 1 115 ? 27.732  -17.778 -60.990 1.00 37.12  ? 115 GLY B CA   1 
ATOM   6690  C C    . GLY B 1 115 ? 26.757  -17.573 -59.860 1.00 28.49  ? 115 GLY B C    1 
ATOM   6691  O O    . GLY B 1 115 ? 26.088  -18.506 -59.413 1.00 26.51  ? 115 GLY B O    1 
ATOM   6692  H H    . GLY B 1 115 ? 27.644  -19.717 -60.702 1.00 39.95  ? 115 GLY B H    1 
ATOM   6693  H HA2  . GLY B 1 115 ? 28.465  -17.149 -60.898 1.00 44.51  ? 115 GLY B HA2  1 
ATOM   6694  H HA3  . GLY B 1 115 ? 27.280  -17.620 -61.834 1.00 44.51  ? 115 GLY B HA3  1 
ATOM   6695  N N    . ILE B 1 116 ? 26.700  -16.340 -59.385 1.00 28.91  ? 116 ILE B N    1 
ATOM   6696  C CA   . ILE B 1 116 ? 25.651  -15.939 -58.455 1.00 28.29  ? 116 ILE B CA   1 
ATOM   6697  C C    . ILE B 1 116 ? 25.145  -14.582 -58.907 1.00 25.50  ? 116 ILE B C    1 
ATOM   6698  O O    . ILE B 1 116 ? 25.931  -13.699 -59.269 1.00 29.40  ? 116 ILE B O    1 
ATOM   6699  C CB   . ILE B 1 116 ? 26.137  -15.932 -56.998 1.00 28.52  ? 116 ILE B CB   1 
ATOM   6700  C CG1  . ILE B 1 116 ? 24.978  -15.573 -56.077 1.00 24.00  ? 116 ILE B CG1  1 
ATOM   6701  C CG2  . ILE B 1 116 ? 27.347  -15.011 -56.820 1.00 28.04  ? 116 ILE B CG2  1 
ATOM   6702  C CD1  . ILE B 1 116 ? 25.356  -15.669 -54.615 1.00 26.01  ? 116 ILE B CD1  1 
ATOM   6703  H H    . ILE B 1 116 ? 27.255  -15.713 -59.584 1.00 34.65  ? 116 ILE B H    1 
ATOM   6704  H HA   . ILE B 1 116 ? 24.916  -16.569 -58.521 1.00 33.90  ? 116 ILE B HA   1 
ATOM   6705  H HB   . ILE B 1 116 ? 26.419  -16.834 -56.777 1.00 34.18  ? 116 ILE B HB   1 
ATOM   6706  H HG12 . ILE B 1 116 ? 24.699  -14.661 -56.257 1.00 28.75  ? 116 ILE B HG12 1 
ATOM   6707  H HG13 . ILE B 1 116 ? 24.242  -16.184 -56.239 1.00 28.75  ? 116 ILE B HG13 1 
ATOM   6708  H HG21 . ILE B 1 116 ? 27.625  -15.031 -55.891 1.00 33.60  ? 116 ILE B HG21 1 
ATOM   6709  H HG22 . ILE B 1 116 ? 28.068  -15.324 -57.389 1.00 33.60  ? 116 ILE B HG22 1 
ATOM   6710  H HG23 . ILE B 1 116 ? 27.095  -14.108 -57.071 1.00 33.60  ? 116 ILE B HG23 1 
ATOM   6711  H HD11 . ILE B 1 116 ? 24.587  -15.432 -54.074 1.00 31.17  ? 116 ILE B HD11 1 
ATOM   6712  H HD12 . ILE B 1 116 ? 25.631  -16.579 -54.420 1.00 31.17  ? 116 ILE B HD12 1 
ATOM   6713  H HD13 . ILE B 1 116 ? 26.088  -15.057 -54.438 1.00 31.17  ? 116 ILE B HD13 1 
ATOM   6714  N N    . SER B 1 117 ? 23.830  -14.461 -59.009 1.00 24.77  ? 117 SER B N    1 
ATOM   6715  C CA   . SER B 1 117 ? 23.201  -13.224 -59.423 1.00 27.33  ? 117 SER B CA   1 
ATOM   6716  C C    . SER B 1 117 ? 22.657  -12.460 -58.218 1.00 26.93  ? 117 SER B C    1 
ATOM   6717  O O    . SER B 1 117 ? 21.926  -13.016 -57.386 1.00 27.31  ? 117 SER B O    1 
ATOM   6718  C CB   . SER B 1 117 ? 22.059  -13.485 -60.387 1.00 25.53  ? 117 SER B CB   1 
ATOM   6719  O OG   . SER B 1 117 ? 21.525  -12.230 -60.838 1.00 31.78  ? 117 SER B OG   1 
ATOM   6720  H H    . SER B 1 117 ? 23.273  -15.094 -58.841 1.00 29.69  ? 117 SER B H    1 
ATOM   6721  H HA   . SER B 1 117 ? 23.855  -12.664 -59.869 1.00 32.75  ? 117 SER B HA   1 
ATOM   6722  H HB2  . SER B 1 117 ? 22.390  -13.985 -61.149 1.00 30.59  ? 117 SER B HB2  1 
ATOM   6723  H HB3  . SER B 1 117 ? 21.363  -13.985 -59.933 1.00 30.59  ? 117 SER B HB3  1 
ATOM   6724  H HG   . SER B 1 117 ? 20.891  -12.363 -61.373 1.00 38.09  ? 117 SER B HG   1 
ATOM   6725  N N    . LEU B 1 118 ? 22.991  -11.180 -58.184 1.00 25.28  ? 118 LEU B N    1 
ATOM   6726  C CA   . LEU B 1 118 ? 22.528  -10.215 -57.215 1.00 24.28  ? 118 LEU B CA   1 
ATOM   6727  C C    . LEU B 1 118 ? 21.541  -9.263  -57.854 1.00 31.72  ? 118 LEU B C    1 
ATOM   6728  O O    . LEU B 1 118 ? 21.064  -8.341  -57.183 1.00 26.20  ? 118 LEU B O    1 
ATOM   6729  C CB   . LEU B 1 118 ? 23.717  -9.407  -56.648 1.00 24.98  ? 118 LEU B CB   1 
ATOM   6730  C CG   . LEU B 1 118 ? 24.510  -10.072 -55.526 1.00 21.48  ? 118 LEU B CG   1 
ATOM   6731  C CD1  . LEU B 1 118 ? 25.120  -11.356 -55.980 1.00 24.22  ? 118 LEU B CD1  1 
ATOM   6732  C CD2  . LEU B 1 118 ? 25.575  -9.119  -55.027 1.00 35.36  ? 118 LEU B CD2  1 
ATOM   6733  H H    . LEU B 1 118 ? 23.526  -10.829 -58.759 1.00 30.29  ? 118 LEU B H    1 
ATOM   6734  H HA   . LEU B 1 118 ? 22.087  -10.674 -56.483 1.00 29.09  ? 118 LEU B HA   1 
ATOM   6735  H HB2  . LEU B 1 118 ? 24.337  -9.229  -57.373 1.00 29.93  ? 118 LEU B HB2  1 
ATOM   6736  H HB3  . LEU B 1 118 ? 23.377  -8.567  -56.303 1.00 29.93  ? 118 LEU B HB3  1 
ATOM   6737  H HG   . LEU B 1 118 ? 23.911  -10.267 -54.788 1.00 25.74  ? 118 LEU B HG   1 
ATOM   6738  H HD11 . LEU B 1 118 ? 25.614  -11.748 -55.243 1.00 29.02  ? 118 LEU B HD11 1 
ATOM   6739  H HD12 . LEU B 1 118 ? 24.414  -11.958 -56.263 1.00 29.02  ? 118 LEU B HD12 1 
ATOM   6740  H HD13 . LEU B 1 118 ? 25.718  -11.176 -56.722 1.00 29.02  ? 118 LEU B HD13 1 
ATOM   6741  H HD21 . LEU B 1 118 ? 26.074  -9.549  -54.314 1.00 42.39  ? 118 LEU B HD21 1 
ATOM   6742  H HD22 . LEU B 1 118 ? 26.170  -8.898  -55.761 1.00 42.39  ? 118 LEU B HD22 1 
ATOM   6743  H HD23 . LEU B 1 118 ? 25.148  -8.314  -54.693 1.00 42.39  ? 118 LEU B HD23 1 
ATOM   6744  N N    . ILE B 1 119 ? 21.229  -9.466  -59.133 1.00 22.49  ? 119 ILE B N    1 
ATOM   6745  C CA   . ILE B 1 119 ? 20.324  -8.599  -59.868 1.00 26.19  ? 119 ILE B CA   1 
ATOM   6746  C C    . ILE B 1 119 ? 18.903  -8.862  -59.382 1.00 34.43  ? 119 ILE B C    1 
ATOM   6747  O O    . ILE B 1 119 ? 18.397  -9.984  -59.486 1.00 36.31  ? 119 ILE B O    1 
ATOM   6748  C CB   . ILE B 1 119 ? 20.447  -8.853  -61.369 1.00 36.20  ? 119 ILE B CB   1 
ATOM   6749  C CG1  . ILE B 1 119 ? 21.889  -8.635  -61.815 1.00 34.55  ? 119 ILE B CG1  1 
ATOM   6750  C CG2  . ILE B 1 119 ? 19.469  -7.930  -62.127 1.00 41.57  ? 119 ILE B CG2  1 
ATOM   6751  C CD1  . ILE B 1 119 ? 22.176  -9.115  -63.222 1.00 36.01  ? 119 ILE B CD1  1 
ATOM   6752  H H    . ILE B 1 119 ? 21.540  -10.115 -59.604 1.00 26.94  ? 119 ILE B H    1 
ATOM   6753  H HA   . ILE B 1 119 ? 20.546  -7.672  -59.691 1.00 31.39  ? 119 ILE B HA   1 
ATOM   6754  H HB   . ILE B 1 119 ? 20.204  -9.775  -61.548 1.00 43.40  ? 119 ILE B HB   1 
ATOM   6755  H HG12 . ILE B 1 119 ? 22.087  -7.685  -61.781 1.00 41.41  ? 119 ILE B HG12 1 
ATOM   6756  H HG13 . ILE B 1 119 ? 22.479  -9.115  -61.213 1.00 41.41  ? 119 ILE B HG13 1 
ATOM   6757  H HG21 . ILE B 1 119 ? 19.553  -8.097  -63.079 1.00 49.84  ? 119 ILE B HG21 1 
ATOM   6758  H HG22 . ILE B 1 119 ? 18.564  -8.122  -61.835 1.00 49.84  ? 119 ILE B HG22 1 
ATOM   6759  H HG23 . ILE B 1 119 ? 19.692  -7.006  -61.932 1.00 49.84  ? 119 ILE B HG23 1 
ATOM   6760  H HD11 . ILE B 1 119 ? 23.107  -8.942  -63.431 1.00 43.17  ? 119 ILE B HD11 1 
ATOM   6761  H HD12 . ILE B 1 119 ? 21.996  -10.067 -63.273 1.00 43.17  ? 119 ILE B HD12 1 
ATOM   6762  H HD13 . ILE B 1 119 ? 21.603  -8.636  -63.841 1.00 43.17  ? 119 ILE B HD13 1 
ATOM   6763  N N    . LYS B 1 120 ? 18.255  -7.833  -58.849 1.00 37.53  ? 120 LYS B N    1 
ATOM   6764  C CA   . LYS B 1 120 ? 16.987  -8.035  -58.135 1.00 40.91  ? 120 LYS B CA   1 
ATOM   6765  C C    . LYS B 1 120 ? 15.798  -7.469  -58.905 1.00 42.16  ? 120 LYS B C    1 
ATOM   6766  O O    . LYS B 1 120 ? 15.820  -6.302  -59.282 1.00 48.52  ? 120 LYS B O    1 
ATOM   6767  C CB   . LYS B 1 120 ? 17.070  -7.401  -56.748 1.00 35.12  ? 120 LYS B CB   1 
ATOM   6768  C CG   . LYS B 1 120 ? 16.032  -7.922  -55.713 1.00 37.95  ? 120 LYS B CG   1 
ATOM   6769  C CD   . LYS B 1 120 ? 16.547  -7.824  -54.277 1.00 39.03  ? 120 LYS B CD   1 
ATOM   6770  C CE   . LYS B 1 120 ? 15.806  -6.824  -53.452 1.00 36.67  ? 120 LYS B CE   1 
ATOM   6771  N NZ   . LYS B 1 120 ? 16.277  -6.881  -51.996 1.00 31.43  ? 120 LYS B NZ   1 
ATOM   6772  H H    . LYS B 1 120 ? 18.519  -7.015  -58.884 1.00 45.00  ? 120 LYS B H    1 
ATOM   6773  H HA   . LYS B 1 120 ? 16.841  -8.987  -58.019 1.00 49.05  ? 120 LYS B HA   1 
ATOM   6774  H HB2  . LYS B 1 120 ? 17.953  -7.570  -56.385 1.00 42.10  ? 120 LYS B HB2  1 
ATOM   6775  H HB3  . LYS B 1 120 ? 16.935  -6.445  -56.839 1.00 42.10  ? 120 LYS B HB3  1 
ATOM   6776  H HG2  . LYS B 1 120 ? 15.223  -7.391  -55.780 1.00 45.49  ? 120 LYS B HG2  1 
ATOM   6777  H HG3  . LYS B 1 120 ? 15.837  -8.853  -55.900 1.00 45.49  ? 120 LYS B HG3  1 
ATOM   6778  H HD2  . LYS B 1 120 ? 16.453  -8.691  -53.851 1.00 46.79  ? 120 LYS B HD2  1 
ATOM   6779  H HD3  . LYS B 1 120 ? 17.481  -7.564  -54.295 1.00 46.79  ? 120 LYS B HD3  1 
ATOM   6780  H HE2  . LYS B 1 120 ? 15.975  -5.933  -53.795 1.00 43.96  ? 120 LYS B HE2  1 
ATOM   6781  H HE3  . LYS B 1 120 ? 14.857  -7.023  -53.477 1.00 43.96  ? 120 LYS B HE3  1 
ATOM   6782  H HZ1  . LYS B 1 120 ? 17.147  -6.701  -51.951 1.00 37.68  ? 120 LYS B HZ1  1 
ATOM   6783  H HZ2  . LYS B 1 120 ? 15.832  -6.283  -51.510 1.00 37.68  ? 120 LYS B HZ2  1 
ATOM   6784  H HZ3  . LYS B 1 120 ? 16.131  -7.692  -51.661 1.00 37.68  ? 120 LYS B HZ3  1 
ATOM   6785  N N    . GLY B 1 128 ? 9.572   -11.265 -69.694 1.00 53.65  ? 128 GLY B N    1 
ATOM   6786  C CA   . GLY B 1 128 ? 8.200   -11.669 -69.434 1.00 57.69  ? 128 GLY B CA   1 
ATOM   6787  C C    . GLY B 1 128 ? 8.040   -12.420 -68.133 1.00 66.07  ? 128 GLY B C    1 
ATOM   6788  O O    . GLY B 1 128 ? 7.190   -13.318 -67.995 1.00 54.69  ? 128 GLY B O    1 
ATOM   6789  H HA2  . GLY B 1 128 ? 7.634   -10.882 -69.404 1.00 69.19  ? 128 GLY B HA2  1 
ATOM   6790  H HA3  . GLY B 1 128 ? 7.891   -12.240 -70.156 1.00 69.19  ? 128 GLY B HA3  1 
ATOM   6791  N N    . LEU B 1 129 ? 8.852   -12.010 -67.182 1.00 68.45  ? 129 LEU B N    1 
ATOM   6792  C CA   . LEU B 1 129 ? 8.886   -12.569 -65.863 1.00 62.16  ? 129 LEU B CA   1 
ATOM   6793  C C    . LEU B 1 129 ? 9.866   -13.707 -65.727 1.00 57.06  ? 129 LEU B C    1 
ATOM   6794  O O    . LEU B 1 129 ? 9.918   -14.320 -64.702 1.00 64.95  ? 129 LEU B O    1 
ATOM   6795  C CB   . LEU B 1 129 ? 7.514   -12.953 -65.367 1.00 58.13  ? 129 LEU B CB   1 
ATOM   6796  C CG   . LEU B 1 129 ? 7.355   -12.378 -63.978 1.00 57.03  ? 129 LEU B CG   1 
ATOM   6797  C CD1  . LEU B 1 129 ? 5.951   -12.224 -63.477 1.00 56.12  ? 129 LEU B CD1  1 
ATOM   6798  C CD2  . LEU B 1 129 ? 8.151   -13.174 -63.007 1.00 55.43  ? 129 LEU B CD2  1 
ATOM   6799  H H    . LEU B 1 129 ? 9.421   -11.373 -67.291 1.00 82.10  ? 129 LEU B H    1 
ATOM   6800  H HA   . LEU B 1 129 ? 9.205   -11.865 -65.261 1.00 74.55  ? 129 LEU B HA   1 
ATOM   6801  H HB2  . LEU B 1 129 ? 6.833   -12.575 -65.946 1.00 69.71  ? 129 LEU B HB2  1 
ATOM   6802  H HB3  . LEU B 1 129 ? 7.435   -13.919 -65.320 1.00 69.71  ? 129 LEU B HB3  1 
ATOM   6803  H HG   . LEU B 1 129 ? 7.741   -11.488 -63.987 1.00 68.39  ? 129 LEU B HG   1 
ATOM   6804  H HD11 . LEU B 1 129 ? 5.791   -11.298 -63.279 1.00 67.30  ? 129 LEU B HD11 1 
ATOM   6805  H HD12 . LEU B 1 129 ? 5.343   -12.523 -64.157 1.00 67.30  ? 129 LEU B HD12 1 
ATOM   6806  H HD13 . LEU B 1 129 ? 5.843   -12.753 -62.684 1.00 67.30  ? 129 LEU B HD13 1 
ATOM   6807  H HD21 . LEU B 1 129 ? 7.651   -13.265 -62.193 1.00 66.48  ? 129 LEU B HD21 1 
ATOM   6808  H HD22 . LEU B 1 129 ? 8.326   -14.040 -63.383 1.00 66.48  ? 129 LEU B HD22 1 
ATOM   6809  H HD23 . LEU B 1 129 ? 8.978   -12.719 -62.835 1.00 66.48  ? 129 LEU B HD23 1 
ATOM   6810  N N    . LYS B 1 130 ? 10.678  -13.949 -66.726 1.00 44.75  ? 130 LYS B N    1 
ATOM   6811  C CA   . LYS B 1 130 ? 11.676  -14.998 -66.611 1.00 48.13  ? 130 LYS B CA   1 
ATOM   6812  C C    . LYS B 1 130 ? 12.735  -14.561 -65.618 1.00 38.50  ? 130 LYS B C    1 
ATOM   6813  O O    . LYS B 1 130 ? 13.084  -13.382 -65.538 1.00 36.85  ? 130 LYS B O    1 
ATOM   6814  C CB   . LYS B 1 130 ? 12.325  -15.298 -67.958 1.00 44.15  ? 130 LYS B CB   1 
ATOM   6815  C CG   . LYS B 1 130 ? 13.252  -16.507 -67.914 1.00 48.84  ? 130 LYS B CG   1 
ATOM   6816  C CD   . LYS B 1 130 ? 13.953  -16.707 -69.246 1.00 45.20  ? 130 LYS B CD   1 
ATOM   6817  C CE   . LYS B 1 130 ? 14.426  -18.137 -69.385 1.00 52.34  ? 130 LYS B CE   1 
ATOM   6818  N NZ   . LYS B 1 130 ? 14.958  -18.365 -70.777 1.00 73.53  ? 130 LYS B NZ   1 
ATOM   6819  H H    . LYS B 1 130 ? 10.691  -13.509 -67.465 1.00 53.66  ? 130 LYS B H    1 
ATOM   6820  H HA   . LYS B 1 130 ? 11.259  -15.809 -66.281 1.00 57.71  ? 130 LYS B HA   1 
ATOM   6821  H HB2  . LYS B 1 130 ? 11.630  -15.477 -68.610 1.00 52.94  ? 130 LYS B HB2  1 
ATOM   6822  H HB3  . LYS B 1 130 ? 12.849  -14.529 -68.234 1.00 52.94  ? 130 LYS B HB3  1 
ATOM   6823  H HG2  . LYS B 1 130 ? 13.927  -16.370 -67.231 1.00 58.56  ? 130 LYS B HG2  1 
ATOM   6824  H HG3  . LYS B 1 130 ? 12.732  -17.303 -67.720 1.00 58.56  ? 130 LYS B HG3  1 
ATOM   6825  H HD2  . LYS B 1 130 ? 13.334  -16.516 -69.968 1.00 54.20  ? 130 LYS B HD2  1 
ATOM   6826  H HD3  . LYS B 1 130 ? 14.724  -16.122 -69.296 1.00 54.20  ? 130 LYS B HD3  1 
ATOM   6827  H HE2  . LYS B 1 130 ? 15.139  -18.308 -68.750 1.00 62.77  ? 130 LYS B HE2  1 
ATOM   6828  H HE3  . LYS B 1 130 ? 13.683  -18.742 -69.235 1.00 62.77  ? 130 LYS B HE3  1 
ATOM   6829  H HZ1  . LYS B 1 130 ? 14.318  -18.210 -71.376 1.00 88.20  ? 130 LYS B HZ1  1 
ATOM   6830  H HZ2  . LYS B 1 130 ? 15.641  -17.816 -70.935 1.00 88.20  ? 130 LYS B HZ2  1 
ATOM   6831  H HZ3  . LYS B 1 130 ? 15.238  -19.205 -70.862 1.00 88.20  ? 130 LYS B HZ3  1 
ATOM   6832  N N    . LEU B 1 131 ? 13.252  -15.514 -64.861 1.00 47.89  ? 131 LEU B N    1 
ATOM   6833  C CA   . LEU B 1 131 ? 14.249  -15.177 -63.855 1.00 38.87  ? 131 LEU B CA   1 
ATOM   6834  C C    . LEU B 1 131 ? 15.544  -14.765 -64.518 1.00 39.76  ? 131 LEU B C    1 
ATOM   6835  O O    . LEU B 1 131 ? 16.081  -15.465 -65.392 1.00 39.47  ? 131 LEU B O    1 
ATOM   6836  C CB   . LEU B 1 131 ? 14.480  -16.342 -62.908 1.00 33.39  ? 131 LEU B CB   1 
ATOM   6837  C CG   . LEU B 1 131 ? 13.236  -16.790 -62.153 1.00 43.54  ? 131 LEU B CG   1 
ATOM   6838  C CD1  . LEU B 1 131 ? 13.615  -17.787 -61.088 1.00 42.56  ? 131 LEU B CD1  1 
ATOM   6839  C CD2  . LEU B 1 131 ? 12.509  -15.627 -61.543 1.00 44.90  ? 131 LEU B CD2  1 
ATOM   6840  H H    . LEU B 1 131 ? 13.050  -16.348 -64.905 1.00 57.43  ? 131 LEU B H    1 
ATOM   6841  H HA   . LEU B 1 131 ? 13.928  -14.425 -63.333 1.00 46.60  ? 131 LEU B HA   1 
ATOM   6842  H HB2  . LEU B 1 131 ? 14.803  -17.100 -63.420 1.00 40.02  ? 131 LEU B HB2  1 
ATOM   6843  H HB3  . LEU B 1 131 ? 15.146  -16.082 -62.252 1.00 40.02  ? 131 LEU B HB3  1 
ATOM   6844  H HG   . LEU B 1 131 ? 12.633  -17.228 -62.773 1.00 52.20  ? 131 LEU B HG   1 
ATOM   6845  H HD11 . LEU B 1 131 ? 12.815  -18.064 -60.616 1.00 51.03  ? 131 LEU B HD11 1 
ATOM   6846  H HD12 . LEU B 1 131 ? 14.033  -18.555 -61.510 1.00 51.03  ? 131 LEU B HD12 1 
ATOM   6847  H HD13 . LEU B 1 131 ? 14.236  -17.369 -60.471 1.00 51.03  ? 131 LEU B HD13 1 
ATOM   6848  H HD21 . LEU B 1 131 ? 11.726  -15.957 -61.074 1.00 53.83  ? 131 LEU B HD21 1 
ATOM   6849  H HD22 . LEU B 1 131 ? 13.102  -15.175 -60.922 1.00 53.83  ? 131 LEU B HD22 1 
ATOM   6850  H HD23 . LEU B 1 131 ? 12.240  -15.018 -62.248 1.00 53.83  ? 131 LEU B HD23 1 
ATOM   6851  N N    . ILE B 1 132 ? 16.031  -13.602 -64.114 1.00 37.66  ? 132 ILE B N    1 
ATOM   6852  C CA   . ILE B 1 132 ? 17.313  -13.131 -64.617 1.00 35.69  ? 132 ILE B CA   1 
ATOM   6853  C C    . ILE B 1 132 ? 18.407  -14.177 -64.418 1.00 30.97  ? 132 ILE B C    1 
ATOM   6854  O O    . ILE B 1 132 ? 19.290  -14.335 -65.268 1.00 36.38  ? 132 ILE B O    1 
ATOM   6855  C CB   . ILE B 1 132 ? 17.659  -11.787 -63.965 1.00 39.32  ? 132 ILE B CB   1 
ATOM   6856  C CG1  . ILE B 1 132 ? 16.714  -10.744 -64.549 1.00 32.51  ? 132 ILE B CG1  1 
ATOM   6857  C CG2  . ILE B 1 132 ? 19.124  -11.440 -64.202 1.00 34.21  ? 132 ILE B CG2  1 
ATOM   6858  C CD1  . ILE B 1 132 ? 16.586  -9.438  -63.767 1.00 49.01  ? 132 ILE B CD1  1 
ATOM   6859  H H    . ILE B 1 132 ? 15.647  -13.072 -63.556 1.00 45.15  ? 132 ILE B H    1 
ATOM   6860  H HA   . ILE B 1 132 ? 17.230  -12.978 -65.572 1.00 42.79  ? 132 ILE B HA   1 
ATOM   6861  H HB   . ILE B 1 132 ? 17.502  -11.852 -63.010 1.00 47.15  ? 132 ILE B HB   1 
ATOM   6862  H HG12 . ILE B 1 132 ? 17.024  -10.518 -65.440 1.00 38.97  ? 132 ILE B HG12 1 
ATOM   6863  H HG13 . ILE B 1 132 ? 15.828  -11.135 -64.606 1.00 38.97  ? 132 ILE B HG13 1 
ATOM   6864  H HG21 . ILE B 1 132 ? 19.318  -10.588 -63.781 1.00 41.01  ? 132 ILE B HG21 1 
ATOM   6865  H HG22 . ILE B 1 132 ? 19.679  -12.134 -63.814 1.00 41.01  ? 132 ILE B HG22 1 
ATOM   6866  H HG23 . ILE B 1 132 ? 19.284  -11.382 -65.156 1.00 41.01  ? 132 ILE B HG23 1 
ATOM   6867  H HD11 . ILE B 1 132 ? 15.963  -8.854  -64.228 1.00 58.77  ? 132 ILE B HD11 1 
ATOM   6868  H HD12 . ILE B 1 132 ? 16.257  -9.634  -62.876 1.00 58.77  ? 132 ILE B HD12 1 
ATOM   6869  H HD13 . ILE B 1 132 ? 17.457  -9.016  -63.713 1.00 58.77  ? 132 ILE B HD13 1 
ATOM   6870  N N    . SER B 1 133 ? 18.368  -14.933 -63.320 1.00 31.32  ? 133 SER B N    1 
ATOM   6871  C CA   . SER B 1 133 ? 19.415  -15.939 -63.157 1.00 35.41  ? 133 SER B CA   1 
ATOM   6872  C C    . SER B 1 133 ? 19.384  -16.958 -64.291 1.00 41.32  ? 133 SER B C    1 
ATOM   6873  O O    . SER B 1 133 ? 20.440  -17.467 -64.697 1.00 33.31  ? 133 SER B O    1 
ATOM   6874  C CB   . SER B 1 133 ? 19.283  -16.664 -61.836 1.00 28.44  ? 133 SER B CB   1 
ATOM   6875  O OG   . SER B 1 133 ? 18.041  -17.341 -61.761 1.00 40.40  ? 133 SER B OG   1 
ATOM   6876  H H    . SER B 1 133 ? 17.784  -14.890 -62.691 1.00 37.55  ? 133 SER B H    1 
ATOM   6877  H HA   . SER B 1 133 ? 20.280  -15.500 -63.173 1.00 42.45  ? 133 SER B HA   1 
ATOM   6878  H HB2  . SER B 1 133 ? 20.001  -17.311 -61.757 1.00 34.09  ? 133 SER B HB2  1 
ATOM   6879  H HB3  . SER B 1 133 ? 19.336  -16.019 -61.114 1.00 34.09  ? 133 SER B HB3  1 
ATOM   6880  H HG   . SER B 1 133 ? 17.410  -16.791 -61.830 1.00 48.44  ? 133 SER B HG   1 
ATOM   6881  N N    . GLU B 1 134 ? 18.177  -17.291 -64.778 1.00 39.78  ? 134 GLU B N    1 
ATOM   6882  C CA   . GLU B 1 134 ? 18.028  -18.219 -65.900 1.00 38.17  ? 134 GLU B CA   1 
ATOM   6883  C C    . GLU B 1 134 ? 18.544  -17.607 -67.189 1.00 37.06  ? 134 GLU B C    1 
ATOM   6884  O O    . GLU B 1 134 ? 19.188  -18.283 -67.988 1.00 47.89  ? 134 GLU B O    1 
ATOM   6885  C CB   . GLU B 1 134 ? 16.561  -18.624 -66.059 1.00 38.48  ? 134 GLU B CB   1 
ATOM   6886  C CG   . GLU B 1 134 ? 16.049  -19.464 -64.907 1.00 37.71  ? 134 GLU B CG   1 
ATOM   6887  C CD   . GLU B 1 134 ? 14.640  -20.002 -65.151 1.00 57.98  ? 134 GLU B CD   1 
ATOM   6888  O OE1  . GLU B 1 134 ? 13.975  -19.554 -66.122 1.00 57.53  ? 134 GLU B OE1  1 
ATOM   6889  O OE2  . GLU B 1 134 ? 14.212  -20.888 -64.379 1.00 48.89  ? 134 GLU B OE2  1 
ATOM   6890  H H    . GLU B 1 134 ? 17.431  -16.990 -64.472 1.00 47.69  ? 134 GLU B H    1 
ATOM   6891  H HA   . GLU B 1 134 ? 18.544  -19.020 -65.719 1.00 45.76  ? 134 GLU B HA   1 
ATOM   6892  H HB2  . GLU B 1 134 ? 16.017  -17.823 -66.111 1.00 46.13  ? 134 GLU B HB2  1 
ATOM   6893  H HB3  . GLU B 1 134 ? 16.465  -19.143 -66.873 1.00 46.13  ? 134 GLU B HB3  1 
ATOM   6894  H HG2  . GLU B 1 134 ? 16.641  -20.221 -64.779 1.00 45.21  ? 134 GLU B HG2  1 
ATOM   6895  H HG3  . GLU B 1 134 ? 16.027  -18.920 -64.104 1.00 45.21  ? 134 GLU B HG3  1 
ATOM   6896  N N    . VAL B 1 135 ? 18.283  -16.326 -67.408 1.00 31.55  ? 135 VAL B N    1 
ATOM   6897  C CA   . VAL B 1 135 ? 18.849  -15.688 -68.574 1.00 28.54  ? 135 VAL B CA   1 
ATOM   6898  C C    . VAL B 1 135 ? 20.346  -15.889 -68.594 1.00 41.74  ? 135 VAL B C    1 
ATOM   6899  O O    . VAL B 1 135 ? 20.923  -16.186 -69.646 1.00 31.48  ? 135 VAL B O    1 
ATOM   6900  C CB   . VAL B 1 135 ? 18.483  -14.195 -68.629 1.00 29.93  ? 135 VAL B CB   1 
ATOM   6901  C CG1  . VAL B 1 135 ? 19.230  -13.544 -69.796 1.00 39.97  ? 135 VAL B CG1  1 
ATOM   6902  C CG2  . VAL B 1 135 ? 16.975  -14.022 -68.821 1.00 39.76  ? 135 VAL B CG2  1 
ATOM   6903  H H    . VAL B 1 135 ? 17.796  -15.821 -66.911 1.00 37.81  ? 135 VAL B H    1 
ATOM   6904  H HA   . VAL B 1 135 ? 18.484  -16.110 -69.367 1.00 34.20  ? 135 VAL B HA   1 
ATOM   6905  H HB   . VAL B 1 135 ? 18.747  -13.759 -67.804 1.00 35.87  ? 135 VAL B HB   1 
ATOM   6906  H HG11 . VAL B 1 135 ? 18.999  -12.603 -69.832 1.00 47.92  ? 135 VAL B HG11 1 
ATOM   6907  H HG12 . VAL B 1 135 ? 20.184  -13.646 -69.656 1.00 47.92  ? 135 VAL B HG12 1 
ATOM   6908  H HG13 . VAL B 1 135 ? 18.968  -13.981 -70.622 1.00 47.92  ? 135 VAL B HG13 1 
ATOM   6909  H HG21 . VAL B 1 135 ? 16.769  -13.075 -68.853 1.00 47.67  ? 135 VAL B HG21 1 
ATOM   6910  H HG22 . VAL B 1 135 ? 16.712  -14.447 -69.652 1.00 47.67  ? 135 VAL B HG22 1 
ATOM   6911  H HG23 . VAL B 1 135 ? 16.513  -14.437 -68.076 1.00 47.67  ? 135 VAL B HG23 1 
ATOM   6912  N N    . ILE B 1 136 ? 20.999  -15.757 -67.432 1.00 34.10  ? 136 ILE B N    1 
ATOM   6913  C CA   . ILE B 1 136 ? 22.458  -15.834 -67.381 1.00 34.62  ? 136 ILE B CA   1 
ATOM   6914  C C    . ILE B 1 136 ? 22.917  -17.275 -67.518 1.00 36.23  ? 136 ILE B C    1 
ATOM   6915  O O    . ILE B 1 136 ? 23.810  -17.595 -68.319 1.00 31.52  ? 136 ILE B O    1 
ATOM   6916  C CB   . ILE B 1 136 ? 22.980  -15.221 -66.070 1.00 40.48  ? 136 ILE B CB   1 
ATOM   6917  C CG1  . ILE B 1 136 ? 22.594  -13.760 -65.989 1.00 29.25  ? 136 ILE B CG1  1 
ATOM   6918  C CG2  . ILE B 1 136 ? 24.518  -15.390 -65.933 1.00 34.35  ? 136 ILE B CG2  1 
ATOM   6919  C CD1  . ILE B 1 136 ? 22.561  -13.251 -64.564 1.00 37.69  ? 136 ILE B CD1  1 
ATOM   6920  H H    . ILE B 1 136 ? 20.622  -15.624 -66.670 1.00 40.88  ? 136 ILE B H    1 
ATOM   6921  H HA   . ILE B 1 136 ? 22.829  -15.328 -68.121 1.00 41.50  ? 136 ILE B HA   1 
ATOM   6922  H HB   . ILE B 1 136 ? 22.559  -15.686 -65.330 1.00 48.53  ? 136 ILE B HB   1 
ATOM   6923  H HG12 . ILE B 1 136 ? 23.242  -13.233 -66.483 1.00 35.06  ? 136 ILE B HG12 1 
ATOM   6924  H HG13 . ILE B 1 136 ? 21.710  -13.644 -66.371 1.00 35.06  ? 136 ILE B HG13 1 
ATOM   6925  H HG21 . ILE B 1 136 ? 24.805  -14.992 -65.096 1.00 41.17  ? 136 ILE B HG21 1 
ATOM   6926  H HG22 . ILE B 1 136 ? 24.733  -16.336 -65.940 1.00 41.17  ? 136 ILE B HG22 1 
ATOM   6927  H HG23 . ILE B 1 136 ? 24.952  -14.946 -66.678 1.00 41.17  ? 136 ILE B HG23 1 
ATOM   6928  H HD11 . ILE B 1 136 ? 22.309  -12.314 -64.570 1.00 45.18  ? 136 ILE B HD11 1 
ATOM   6929  H HD12 . ILE B 1 136 ? 21.911  -13.765 -64.060 1.00 45.18  ? 136 ILE B HD12 1 
ATOM   6930  H HD13 . ILE B 1 136 ? 23.442  -13.354 -64.171 1.00 45.18  ? 136 ILE B HD13 1 
ATOM   6931  N N    . GLY B 1 137 ? 22.352  -18.161 -66.693 1.00 29.08  ? 137 GLY B N    1 
ATOM   6932  C CA   . GLY B 1 137 ? 22.750  -19.555 -66.746 1.00 32.72  ? 137 GLY B CA   1 
ATOM   6933  C C    . GLY B 1 137 ? 22.601  -20.148 -68.138 1.00 47.65  ? 137 GLY B C    1 
ATOM   6934  O O    . GLY B 1 137 ? 23.445  -20.928 -68.579 1.00 37.19  ? 137 GLY B O    1 
ATOM   6935  H H    . GLY B 1 137 ? 21.748  -17.979 -66.108 1.00 34.86  ? 137 GLY B H    1 
ATOM   6936  H HA2  . GLY B 1 137 ? 23.678  -19.636 -66.475 1.00 39.23  ? 137 GLY B HA2  1 
ATOM   6937  H HA3  . GLY B 1 137 ? 22.205  -20.070 -66.132 1.00 39.23  ? 137 GLY B HA3  1 
ATOM   6938  N N    . GLU B 1 138 ? 21.530  -19.773 -68.855 1.00 44.93  ? 138 GLU B N    1 
ATOM   6939  C CA   . GLU B 1 138 ? 21.278  -20.321 -70.191 1.00 45.05  ? 138 GLU B CA   1 
ATOM   6940  C C    . GLU B 1 138 ? 22.246  -19.752 -71.215 1.00 43.04  ? 138 GLU B C    1 
ATOM   6941  O O    . GLU B 1 138 ? 22.793  -20.497 -72.035 1.00 53.25  ? 138 GLU B O    1 
ATOM   6942  C CB   . GLU B 1 138 ? 19.838  -20.037 -70.635 1.00 42.63  ? 138 GLU B CB   1 
ATOM   6943  C CG   . GLU B 1 138 ? 18.788  -20.908 -69.957 1.00 50.54  ? 138 GLU B CG   1 
ATOM   6944  C CD   . GLU B 1 138 ? 17.399  -20.336 -70.060 1.00 58.65  ? 138 GLU B CD   1 
ATOM   6945  O OE1  . GLU B 1 138 ? 17.227  -19.363 -70.831 1.00 61.63  ? 138 GLU B OE1  1 
ATOM   6946  O OE2  . GLU B 1 138 ? 16.491  -20.847 -69.352 1.00 58.53  ? 138 GLU B OE2  1 
ATOM   6947  H H    . GLU B 1 138 ? 20.940  -19.206 -68.590 1.00 53.88  ? 138 GLU B H    1 
ATOM   6948  H HA   . GLU B 1 138 ? 21.400  -21.283 -70.165 1.00 54.01  ? 138 GLU B HA   1 
ATOM   6949  H HB2  . GLU B 1 138 ? 19.628  -19.112 -70.434 1.00 51.11  ? 138 GLU B HB2  1 
ATOM   6950  H HB3  . GLU B 1 138 ? 19.773  -20.187 -71.591 1.00 51.11  ? 138 GLU B HB3  1 
ATOM   6951  H HG2  . GLU B 1 138 ? 18.784  -21.782 -70.377 1.00 60.61  ? 138 GLU B HG2  1 
ATOM   6952  H HG3  . GLU B 1 138 ? 19.008  -20.994 -69.016 1.00 60.61  ? 138 GLU B HG3  1 
ATOM   6953  N N    . ARG B 1 139 ? 22.455  -18.428 -71.209 1.00 44.07  ? 139 ARG B N    1 
ATOM   6954  C CA   . ARG B 1 139 ? 23.310  -17.833 -72.237 1.00 38.36  ? 139 ARG B CA   1 
ATOM   6955  C C    . ARG B 1 139 ? 24.766  -18.246 -72.054 1.00 48.04  ? 139 ARG B C    1 
ATOM   6956  O O    . ARG B 1 139 ? 25.480  -18.447 -73.052 1.00 39.44  ? 139 ARG B O    1 
ATOM   6957  C CB   . ARG B 1 139 ? 23.166  -16.307 -72.247 1.00 31.20  ? 139 ARG B CB   1 
ATOM   6958  H H    . ARG B 1 139 ? 22.126  -17.872 -70.641 1.00 52.84  ? 139 ARG B H    1 
ATOM   6959  H HA   . ARG B 1 139 ? 23.022  -18.159 -73.104 1.00 46.00  ? 139 ARG B HA   1 
ATOM   6960  N N    . LEU B 1 140 ? 25.208  -18.442 -70.802 1.00 30.74  ? 140 LEU B N    1 
ATOM   6961  C CA   . LEU B 1 140 ? 26.606  -18.733 -70.513 1.00 36.23  ? 140 LEU B CA   1 
ATOM   6962  C C    . LEU B 1 140 ? 26.883  -20.198 -70.205 1.00 40.17  ? 140 LEU B C    1 
ATOM   6963  O O    . LEU B 1 140 ? 28.051  -20.609 -70.234 1.00 38.15  ? 140 LEU B O    1 
ATOM   6964  C CB   . LEU B 1 140 ? 27.085  -17.893 -69.321 1.00 39.52  ? 140 LEU B CB   1 
ATOM   6965  C CG   . LEU B 1 140 ? 26.985  -16.398 -69.522 1.00 31.43  ? 140 LEU B CG   1 
ATOM   6966  C CD1  . LEU B 1 140 ? 27.395  -15.679 -68.212 1.00 42.05  ? 140 LEU B CD1  1 
ATOM   6967  C CD2  . LEU B 1 140 ? 27.855  -15.901 -70.702 1.00 46.46  ? 140 LEU B CD2  1 
ATOM   6968  H H    . LEU B 1 140 ? 24.708  -18.410 -70.103 1.00 36.85  ? 140 LEU B H    1 
ATOM   6969  H HA   . LEU B 1 140 ? 27.141  -18.486 -71.284 1.00 43.43  ? 140 LEU B HA   1 
ATOM   6970  H HB2  . LEU B 1 140 ? 26.549  -18.122 -68.546 1.00 47.38  ? 140 LEU B HB2  1 
ATOM   6971  H HB3  . LEU B 1 140 ? 28.016  -18.104 -69.148 1.00 47.38  ? 140 LEU B HB3  1 
ATOM   6972  H HG   . LEU B 1 140 ? 26.062  -16.167 -69.714 1.00 37.67  ? 140 LEU B HG   1 
ATOM   6973  H HD11 . LEU B 1 140 ? 27.329  -14.720 -68.345 1.00 50.42  ? 140 LEU B HD11 1 
ATOM   6974  H HD12 . LEU B 1 140 ? 26.798  -15.956 -67.500 1.00 50.42  ? 140 LEU B HD12 1 
ATOM   6975  H HD13 . LEU B 1 140 ? 28.308  -15.921 -67.992 1.00 50.42  ? 140 LEU B HD13 1 
ATOM   6976  H HD21 . LEU B 1 140 ? 27.754  -14.940 -70.786 1.00 55.71  ? 140 LEU B HD21 1 
ATOM   6977  H HD22 . LEU B 1 140 ? 28.783  -16.122 -70.524 1.00 55.71  ? 140 LEU B HD22 1 
ATOM   6978  H HD23 . LEU B 1 140 ? 27.561  -16.338 -71.517 1.00 55.71  ? 140 LEU B HD23 1 
ATOM   6979  N N    . GLY B 1 141 ? 25.857  -20.986 -69.899 1.00 32.50  ? 141 GLY B N    1 
ATOM   6980  C CA   . GLY B 1 141 ? 26.067  -22.351 -69.458 1.00 35.54  ? 141 GLY B CA   1 
ATOM   6981  C C    . GLY B 1 141 ? 26.806  -22.538 -68.144 1.00 41.97  ? 141 GLY B C    1 
ATOM   6982  O O    . GLY B 1 141 ? 27.727  -23.360 -68.077 1.00 43.07  ? 141 GLY B O    1 
ATOM   6983  H H    . GLY B 1 141 ? 25.031  -20.751 -69.940 1.00 38.96  ? 141 GLY B H    1 
ATOM   6984  H HA2  . GLY B 1 141 ? 25.203  -22.783 -69.371 1.00 42.60  ? 141 GLY B HA2  1 
ATOM   6985  H HA3  . GLY B 1 141 ? 26.566  -22.823 -70.143 1.00 42.60  ? 141 GLY B HA3  1 
ATOM   6986  N N    . ILE B 1 142 ? 26.387  -21.854 -67.079 1.00 39.51  ? 142 ILE B N    1 
ATOM   6987  C CA   . ILE B 1 142 ? 26.978  -22.068 -65.752 1.00 35.78  ? 142 ILE B CA   1 
ATOM   6988  C C    . ILE B 1 142 ? 25.869  -22.265 -64.726 1.00 34.74  ? 142 ILE B C    1 
ATOM   6989  O O    . ILE B 1 142 ? 24.808  -21.648 -64.840 1.00 40.44  ? 142 ILE B O    1 
ATOM   6990  C CB   . ILE B 1 142 ? 27.916  -20.913 -65.341 1.00 47.79  ? 142 ILE B CB   1 
ATOM   6991  C CG1  . ILE B 1 142 ? 27.164  -19.582 -65.189 1.00 37.87  ? 142 ILE B CG1  1 
ATOM   6992  C CG2  . ILE B 1 142 ? 29.067  -20.785 -66.354 1.00 47.48  ? 142 ILE B CG2  1 
ATOM   6993  C CD1  . ILE B 1 142 ? 28.096  -18.340 -65.164 1.00 35.92  ? 142 ILE B CD1  1 
ATOM   6994  H H    . ILE B 1 142 ? 25.763  -21.262 -67.095 1.00 47.37  ? 142 ILE B H    1 
ATOM   6995  H HA   . ILE B 1 142 ? 27.506  -22.882 -65.775 1.00 42.90  ? 142 ILE B HA   1 
ATOM   6996  H HB   . ILE B 1 142 ? 28.301  -21.136 -64.480 1.00 57.31  ? 142 ILE B HB   1 
ATOM   6997  H HG12 . ILE B 1 142 ? 26.553  -19.480 -65.936 1.00 45.40  ? 142 ILE B HG12 1 
ATOM   6998  H HG13 . ILE B 1 142 ? 26.666  -19.597 -64.357 1.00 45.40  ? 142 ILE B HG13 1 
ATOM   6999  H HG21 . ILE B 1 142 ? 29.646  -20.056 -66.083 1.00 56.94  ? 142 ILE B HG21 1 
ATOM   7000  H HG22 . ILE B 1 142 ? 29.566  -21.616 -66.371 1.00 56.94  ? 142 ILE B HG22 1 
ATOM   7001  H HG23 . ILE B 1 142 ? 28.696  -20.604 -67.232 1.00 56.94  ? 142 ILE B HG23 1 
ATOM   7002  H HD11 . ILE B 1 142 ? 27.555  -17.541 -65.066 1.00 43.06  ? 142 ILE B HD11 1 
ATOM   7003  H HD12 . ILE B 1 142 ? 28.707  -18.419 -64.415 1.00 43.06  ? 142 ILE B HD12 1 
ATOM   7004  H HD13 . ILE B 1 142 ? 28.595  -18.302 -65.995 1.00 43.06  ? 142 ILE B HD13 1 
ATOM   7005  N N    . PRO B 1 143 ? 26.054  -23.138 -63.742 1.00 25.27  ? 143 PRO B N    1 
ATOM   7006  C CA   . PRO B 1 143 ? 25.155  -23.143 -62.591 1.00 35.85  ? 143 PRO B CA   1 
ATOM   7007  C C    . PRO B 1 143 ? 25.077  -21.750 -61.973 1.00 39.87  ? 143 PRO B C    1 
ATOM   7008  O O    . PRO B 1 143 ? 26.082  -21.036 -61.854 1.00 33.88  ? 143 PRO B O    1 
ATOM   7009  C CB   . PRO B 1 143 ? 25.800  -24.152 -61.629 1.00 38.19  ? 143 PRO B CB   1 
ATOM   7010  C CG   . PRO B 1 143 ? 26.987  -24.725 -62.344 1.00 36.82  ? 143 PRO B CG   1 
ATOM   7011  C CD   . PRO B 1 143 ? 27.315  -23.850 -63.481 1.00 37.71  ? 143 PRO B CD   1 
ATOM   7012  H HA   . PRO B 1 143 ? 24.269  -23.446 -62.844 1.00 42.98  ? 143 PRO B HA   1 
ATOM   7013  H HB2  . PRO B 1 143 ? 26.079  -23.694 -60.821 1.00 45.78  ? 143 PRO B HB2  1 
ATOM   7014  H HB3  . PRO B 1 143 ? 25.161  -24.851 -61.419 1.00 45.78  ? 143 PRO B HB3  1 
ATOM   7015  H HG2  . PRO B 1 143 ? 27.737  -24.767 -61.730 1.00 44.14  ? 143 PRO B HG2  1 
ATOM   7016  H HG3  . PRO B 1 143 ? 26.767  -25.615 -62.662 1.00 44.14  ? 143 PRO B HG3  1 
ATOM   7017  H HD2  . PRO B 1 143 ? 28.013  -23.223 -63.235 1.00 45.21  ? 143 PRO B HD2  1 
ATOM   7018  H HD3  . PRO B 1 143 ? 27.569  -24.380 -64.253 1.00 45.21  ? 143 PRO B HD3  1 
ATOM   7019  N N    . MET B 1 144 ? 23.865  -21.358 -61.599 1.00 36.92  ? 144 MET B N    1 
ATOM   7020  C CA   . MET B 1 144 ? 23.601  -20.042 -61.050 1.00 38.76  ? 144 MET B CA   1 
ATOM   7021  C C    . MET B 1 144 ? 22.982  -20.146 -59.663 1.00 40.58  ? 144 MET B C    1 
ATOM   7022  O O    . MET B 1 144 ? 22.113  -20.987 -59.413 1.00 38.06  ? 144 MET B O    1 
ATOM   7023  C CB   . MET B 1 144 ? 22.690  -19.274 -61.965 1.00 32.56  ? 144 MET B CB   1 
ATOM   7024  C CG   . MET B 1 144 ? 23.374  -18.896 -63.249 1.00 37.39  ? 144 MET B CG   1 
ATOM   7025  S SD   . MET B 1 144 ? 24.664  -17.640 -62.996 1.00 38.95  ? 144 MET B SD   1 
ATOM   7026  C CE   . MET B 1 144 ? 23.711  -16.225 -62.433 1.00 34.01  ? 144 MET B CE   1 
ATOM   7027  H H    . MET B 1 144 ? 23.164  -21.852 -61.657 1.00 44.26  ? 144 MET B H    1 
ATOM   7028  H HA   . MET B 1 144 ? 24.438  -19.556 -60.985 1.00 46.47  ? 144 MET B HA   1 
ATOM   7029  H HB2  . MET B 1 144 ? 21.920  -19.823 -62.183 1.00 39.02  ? 144 MET B HB2  1 
ATOM   7030  H HB3  . MET B 1 144 ? 22.406  -18.459 -61.522 1.00 39.02  ? 144 MET B HB3  1 
ATOM   7031  H HG2  . MET B 1 144 ? 23.791  -19.684 -63.631 1.00 44.83  ? 144 MET B HG2  1 
ATOM   7032  H HG3  . MET B 1 144 ? 22.717  -18.535 -63.864 1.00 44.83  ? 144 MET B HG3  1 
ATOM   7033  H HE1  . MET B 1 144 ? 24.315  -15.484 -62.267 1.00 40.77  ? 144 MET B HE1  1 
ATOM   7034  H HE2  . MET B 1 144 ? 23.071  -15.982 -63.121 1.00 40.77  ? 144 MET B HE2  1 
ATOM   7035  H HE3  . MET B 1 144 ? 23.245  -16.463 -61.617 1.00 40.77  ? 144 MET B HE3  1 
ATOM   7036  N N    . SER B 1 145 ? 23.456  -19.286 -58.771 1.00 39.09  ? 145 SER B N    1 
ATOM   7037  C CA   . SER B 1 145 ? 22.897  -19.083 -57.449 1.00 29.47  ? 145 SER B CA   1 
ATOM   7038  C C    . SER B 1 145 ? 22.336  -17.668 -57.418 1.00 34.46  ? 145 SER B C    1 
ATOM   7039  O O    . SER B 1 145 ? 22.536  -16.889 -58.346 1.00 29.41  ? 145 SER B O    1 
ATOM   7040  C CB   . SER B 1 145 ? 23.972  -19.302 -56.379 1.00 35.05  ? 145 SER B CB   1 
ATOM   7041  O OG   . SER B 1 145 ? 24.528  -20.619 -56.435 1.00 34.72  ? 145 SER B OG   1 
ATOM   7042  H H    . SER B 1 145 ? 24.138  -18.785 -58.921 1.00 46.86  ? 145 SER B H    1 
ATOM   7043  H HA   . SER B 1 145 ? 22.173  -19.711 -57.298 1.00 35.32  ? 145 SER B HA   1 
ATOM   7044  H HB2  . SER B 1 145 ? 24.684  -18.657 -56.516 1.00 42.02  ? 145 SER B HB2  1 
ATOM   7045  H HB3  . SER B 1 145 ? 23.573  -19.170 -55.505 1.00 42.02  ? 145 SER B HB3  1 
ATOM   7046  H HG   . SER B 1 145 ? 25.113  -20.709 -55.839 1.00 41.63  ? 145 SER B HG   1 
ATOM   7047  N N    . VAL B 1 146 ? 21.611  -17.317 -56.361 1.00 27.19  ? 146 VAL B N    1 
ATOM   7048  C CA   . VAL B 1 146 ? 21.107  -15.960 -56.267 1.00 26.17  ? 146 VAL B CA   1 
ATOM   7049  C C    . VAL B 1 146 ? 21.382  -15.441 -54.859 1.00 25.62  ? 146 VAL B C    1 
ATOM   7050  O O    . VAL B 1 146 ? 21.560  -16.210 -53.916 1.00 28.35  ? 146 VAL B O    1 
ATOM   7051  C CB   . VAL B 1 146 ? 19.596  -15.873 -56.603 1.00 27.76  ? 146 VAL B CB   1 
ATOM   7052  C CG1  . VAL B 1 146 ? 19.312  -16.250 -58.094 1.00 26.67  ? 146 VAL B CG1  1 
ATOM   7053  C CG2  . VAL B 1 146 ? 18.814  -16.726 -55.612 1.00 29.16  ? 146 VAL B CG2  1 
ATOM   7054  H H    . VAL B 1 146 ? 21.404  -17.832 -55.704 1.00 32.58  ? 146 VAL B H    1 
ATOM   7055  H HA   . VAL B 1 146 ? 21.588  -15.399 -56.895 1.00 31.36  ? 146 VAL B HA   1 
ATOM   7056  H HB   . VAL B 1 146 ? 19.310  -14.954 -56.479 1.00 33.27  ? 146 VAL B HB   1 
ATOM   7057  H HG11 . VAL B 1 146 ? 18.359  -16.182 -58.260 1.00 31.97  ? 146 VAL B HG11 1 
ATOM   7058  H HG12 . VAL B 1 146 ? 19.794  -15.636 -58.671 1.00 31.97  ? 146 VAL B HG12 1 
ATOM   7059  H HG13 . VAL B 1 146 ? 19.613  -17.158 -58.252 1.00 31.97  ? 146 VAL B HG13 1 
ATOM   7060  H HG21 . VAL B 1 146 ? 17.869  -16.670 -55.824 1.00 34.95  ? 146 VAL B HG21 1 
ATOM   7061  H HG22 . VAL B 1 146 ? 19.115  -17.646 -55.683 1.00 34.95  ? 146 VAL B HG22 1 
ATOM   7062  H HG23 . VAL B 1 146 ? 18.973  -16.394 -54.715 1.00 34.95  ? 146 VAL B HG23 1 
ATOM   7063  N N    . LEU B 1 147 ? 21.399  -14.111 -54.728 1.00 26.31  ? 147 LEU B N    1 
ATOM   7064  C CA   . LEU B 1 147 ? 21.677  -13.462 -53.443 1.00 28.77  ? 147 LEU B CA   1 
ATOM   7065  C C    . LEU B 1 147 ? 20.671  -12.340 -53.298 1.00 29.15  ? 147 LEU B C    1 
ATOM   7066  O O    . LEU B 1 147 ? 20.729  -11.334 -54.028 1.00 20.17  ? 147 LEU B O    1 
ATOM   7067  C CB   . LEU B 1 147 ? 23.118  -12.931 -53.327 1.00 32.52  ? 147 LEU B CB   1 
ATOM   7068  C CG   . LEU B 1 147 ? 23.438  -12.285 -51.947 1.00 27.65  ? 147 LEU B CG   1 
ATOM   7069  C CD1  . LEU B 1 147 ? 24.882  -12.329 -51.640 1.00 28.39  ? 147 LEU B CD1  1 
ATOM   7070  C CD2  . LEU B 1 147 ? 22.995  -10.836 -51.827 1.00 27.18  ? 147 LEU B CD2  1 
ATOM   7071  H H    . LEU B 1 147 ? 21.252  -13.560 -55.372 1.00 31.53  ? 147 LEU B H    1 
ATOM   7072  H HA   . LEU B 1 147 ? 21.530  -14.097 -52.725 1.00 34.48  ? 147 LEU B HA   1 
ATOM   7073  H HB2  . LEU B 1 147 ? 23.735  -13.667 -53.461 1.00 38.99  ? 147 LEU B HB2  1 
ATOM   7074  H HB3  . LEU B 1 147 ? 23.259  -12.256 -54.010 1.00 38.99  ? 147 LEU B HB3  1 
ATOM   7075  H HG   . LEU B 1 147 ? 22.977  -12.789 -51.258 1.00 33.14  ? 147 LEU B HG   1 
ATOM   7076  H HD11 . LEU B 1 147 ? 25.033  -11.917 -50.774 1.00 34.03  ? 147 LEU B HD11 1 
ATOM   7077  H HD12 . LEU B 1 147 ? 25.173  -13.254 -51.622 1.00 34.03  ? 147 LEU B HD12 1 
ATOM   7078  H HD13 . LEU B 1 147 ? 25.366  -11.843 -52.326 1.00 34.03  ? 147 LEU B HD13 1 
ATOM   7079  H HD21 . LEU B 1 147 ? 23.228  -10.507 -50.945 1.00 32.57  ? 147 LEU B HD21 1 
ATOM   7080  H HD22 . LEU B 1 147 ? 23.447  -10.311 -52.506 1.00 32.57  ? 147 LEU B HD22 1 
ATOM   7081  H HD23 . LEU B 1 147 ? 22.035  -10.788 -51.956 1.00 32.57  ? 147 LEU B HD23 1 
ATOM   7082  N N    . MET B 1 148 ? 19.756  -12.530 -52.345 1.00 26.70  ? 148 MET B N    1 
ATOM   7083  C CA   . MET B 1 148 ? 18.596  -11.664 -52.188 1.00 28.06  ? 148 MET B CA   1 
ATOM   7084  C C    . MET B 1 148 ? 18.269  -11.527 -50.706 1.00 22.47  ? 148 MET B C    1 
ATOM   7085  O O    . MET B 1 148 ? 18.296  -12.517 -49.967 1.00 29.36  ? 148 MET B O    1 
ATOM   7086  C CB   . MET B 1 148 ? 17.358  -12.243 -52.920 1.00 28.30  ? 148 MET B CB   1 
ATOM   7087  C CG   . MET B 1 148 ? 17.639  -12.677 -54.386 1.00 40.47  ? 148 MET B CG   1 
ATOM   7088  S SD   . MET B 1 148 ? 17.602  -11.196 -55.331 1.00 42.51  ? 148 MET B SD   1 
ATOM   7089  C CE   . MET B 1 148 ? 18.494  -11.748 -56.796 1.00 36.70  ? 148 MET B CE   1 
ATOM   7090  H H    . MET B 1 148 ? 19.790  -13.167 -51.768 1.00 32.00  ? 148 MET B H    1 
ATOM   7091  H HA   . MET B 1 148 ? 18.793  -10.789 -52.559 1.00 33.63  ? 148 MET B HA   1 
ATOM   7092  H HB2  . MET B 1 148 ? 17.045  -13.022 -52.435 1.00 33.91  ? 148 MET B HB2  1 
ATOM   7093  H HB3  . MET B 1 148 ? 16.663  -11.567 -52.939 1.00 33.91  ? 148 MET B HB3  1 
ATOM   7094  H HG2  . MET B 1 148 ? 18.518  -13.082 -54.457 1.00 48.52  ? 148 MET B HG2  1 
ATOM   7095  H HG3  . MET B 1 148 ? 16.945  -13.277 -54.700 1.00 48.52  ? 148 MET B HG3  1 
ATOM   7096  H HE1  . MET B 1 148 ? 18.553  -11.012 -57.426 1.00 44.00  ? 148 MET B HE1  1 
ATOM   7097  H HE2  . MET B 1 148 ? 19.384  -12.032 -56.535 1.00 44.00  ? 148 MET B HE2  1 
ATOM   7098  H HE3  . MET B 1 148 ? 18.014  -12.490 -57.197 1.00 44.00  ? 148 MET B HE3  1 
ATOM   7099  N N    . GLY B 1 149 ? 17.916  -10.316 -50.291 1.00 23.31  ? 149 GLY B N    1 
ATOM   7100  C CA   . GLY B 1 149 ? 17.477  -10.115 -48.921 1.00 22.83  ? 149 GLY B CA   1 
ATOM   7101  C C    . GLY B 1 149 ? 17.143  -8.661  -48.657 1.00 23.93  ? 149 GLY B C    1 
ATOM   7102  O O    . GLY B 1 149 ? 17.228  -7.796  -49.539 1.00 21.59  ? 149 GLY B O    1 
ATOM   7103  H H    . GLY B 1 149 ? 17.922  -9.606  -50.776 1.00 27.93  ? 149 GLY B H    1 
ATOM   7104  H HA2  . GLY B 1 149 ? 16.688  -10.651 -48.748 1.00 27.36  ? 149 GLY B HA2  1 
ATOM   7105  H HA3  . GLY B 1 149 ? 18.179  -10.388 -48.310 1.00 27.36  ? 149 GLY B HA3  1 
ATOM   7106  N N    . ALA B 1 150 ? 16.763  -8.402  -47.403 1.00 25.82  ? 150 ALA B N    1 
ATOM   7107  C CA   . ALA B 1 150 ? 16.441  -7.035  -46.978 1.00 24.75  ? 150 ALA B CA   1 
ATOM   7108  C C    . ALA B 1 150 ? 17.754  -6.306  -46.744 1.00 21.69  ? 150 ALA B C    1 
ATOM   7109  O O    . ALA B 1 150 ? 18.284  -6.269  -45.629 1.00 19.48  ? 150 ALA B O    1 
ATOM   7110  C CB   . ALA B 1 150 ? 15.566  -7.026  -45.739 1.00 20.99  ? 150 ALA B CB   1 
ATOM   7111  H H    . ALA B 1 150 ? 16.685  -8.994  -46.784 1.00 30.95  ? 150 ALA B H    1 
ATOM   7112  H HA   . ALA B 1 150 ? 15.964  -6.582  -47.691 1.00 29.65  ? 150 ALA B HA   1 
ATOM   7113  H HB1  . ALA B 1 150 ? 15.377  -6.107  -45.493 1.00 25.15  ? 150 ALA B HB1  1 
ATOM   7114  H HB2  . ALA B 1 150 ? 14.739  -7.494  -45.934 1.00 25.15  ? 150 ALA B HB2  1 
ATOM   7115  H HB3  . ALA B 1 150 ? 16.036  -7.473  -45.018 1.00 25.15  ? 150 ALA B HB3  1 
ATOM   7116  N N    . ASN B 1 151 ? 18.289  -5.745  -47.804 1.00 26.81  ? 151 ASN B N    1 
ATOM   7117  C CA   . ASN B 1 151 ? 19.556  -5.072  -47.736 1.00 24.23  ? 151 ASN B CA   1 
ATOM   7118  C C    . ASN B 1 151 ? 19.782  -4.042  -48.808 1.00 22.11  ? 151 ASN B C    1 
ATOM   7119  O O    . ASN B 1 151 ? 19.161  -4.068  -49.816 1.00 22.68  ? 151 ASN B O    1 
ATOM   7120  C CB   . ASN B 1 151 ? 20.675  -6.091  -47.705 1.00 30.08  ? 151 ASN B CB   1 
ATOM   7121  C CG   . ASN B 1 151 ? 20.567  -7.109  -48.808 1.00 30.61  ? 151 ASN B CG   1 
ATOM   7122  O OD1  . ASN B 1 151 ? 20.403  -8.263  -48.591 1.00 40.35  ? 151 ASN B OD1  1 
ATOM   7123  N ND2  . ASN B 1 151 ? 20.707  -6.654  -49.985 1.00 25.53  ? 151 ASN B ND2  1 
ATOM   7124  H H    . ASN B 1 151 ? 17.930  -5.741  -48.585 1.00 32.13  ? 151 ASN B H    1 
ATOM   7125  H HA   . ASN B 1 151 ? 19.590  -4.594  -46.881 1.00 29.03  ? 151 ASN B HA   1 
ATOM   7126  H HB2  . ASN B 1 151 ? 21.523  -5.632  -47.803 1.00 36.05  ? 151 ASN B HB2  1 
ATOM   7127  H HB3  . ASN B 1 151 ? 20.649  -6.563  -46.858 1.00 36.05  ? 151 ASN B HB3  1 
ATOM   7128  H HD21 . ASN B 1 151 ? 19.973  -6.163  -50.411 1.00 30.60  ? 151 ASN B HD21 1 
ATOM   7129  H HD22 . ASN B 1 151 ? 21.548  -6.793  -50.468 1.00 30.60  ? 151 ASN B HD22 1 
ATOM   7130  N N    . ILE B 1 152 ? 20.646  -3.092  -48.525 1.00 27.47  ? 152 ILE B N    1 
ATOM   7131  C CA   . ILE B 1 152 ? 20.986  -2.059  -49.500 1.00 24.79  ? 152 ILE B CA   1 
ATOM   7132  C C    . ILE B 1 152 ? 22.471  -1.775  -49.403 1.00 31.88  ? 152 ILE B C    1 
ATOM   7133  O O    . ILE B 1 152 ? 23.087  -1.944  -48.353 1.00 27.23  ? 152 ILE B O    1 
ATOM   7134  C CB   . ILE B 1 152 ? 20.226  -0.729  -49.323 1.00 33.32  ? 152 ILE B CB   1 
ATOM   7135  C CG1  . ILE B 1 152 ? 20.512  -0.163  -47.944 1.00 30.30  ? 152 ILE B CG1  1 
ATOM   7136  C CG2  . ILE B 1 152 ? 18.711  -0.903  -49.575 1.00 33.77  ? 152 ILE B CG2  1 
ATOM   7137  C CD1  . ILE B 1 152 ? 19.880  1.229   -47.720 1.00 44.38  ? 152 ILE B CD1  1 
ATOM   7138  H H    . ILE B 1 152 ? 21.050  -3.004  -47.772 1.00 32.92  ? 152 ILE B H    1 
ATOM   7139  H HA   . ILE B 1 152 ? 20.802  -2.394  -50.392 1.00 29.71  ? 152 ILE B HA   1 
ATOM   7140  H HB   . ILE B 1 152 ? 20.566  -0.102  -49.980 1.00 39.95  ? 152 ILE B HB   1 
ATOM   7141  H HG12 . ILE B 1 152 ? 20.152  -0.765  -47.275 1.00 36.32  ? 152 ILE B HG12 1 
ATOM   7142  H HG13 . ILE B 1 152 ? 21.471  -0.077  -47.831 1.00 36.32  ? 152 ILE B HG13 1 
ATOM   7143  H HG21 . ILE B 1 152 ? 18.271  -0.047  -49.454 1.00 40.48  ? 152 ILE B HG21 1 
ATOM   7144  H HG22 . ILE B 1 152 ? 18.576  -1.219  -50.482 1.00 40.48  ? 152 ILE B HG22 1 
ATOM   7145  H HG23 . ILE B 1 152 ? 18.358  -1.549  -48.943 1.00 40.48  ? 152 ILE B HG23 1 
ATOM   7146  H HD11 . ILE B 1 152 ? 20.098  1.534   -46.826 1.00 53.21  ? 152 ILE B HD11 1 
ATOM   7147  H HD12 . ILE B 1 152 ? 20.237  1.847   -48.377 1.00 53.21  ? 152 ILE B HD12 1 
ATOM   7148  H HD13 . ILE B 1 152 ? 18.917  1.158   -47.821 1.00 53.21  ? 152 ILE B HD13 1 
ATOM   7149  N N    . ALA B 1 153 ? 23.005  -1.233  -50.495 1.00 30.06  ? 153 ALA B N    1 
ATOM   7150  C CA   . ALA B 1 153 ? 24.452  -1.146  -50.655 1.00 27.14  ? 153 ALA B CA   1 
ATOM   7151  C C    . ALA B 1 153 ? 25.071  -0.214  -49.625 1.00 29.74  ? 153 ALA B C    1 
ATOM   7152  O O    . ALA B 1 153 ? 26.047  -0.581  -48.959 1.00 29.11  ? 153 ALA B O    1 
ATOM   7153  C CB   . ALA B 1 153 ? 24.789  -0.689  -52.075 1.00 32.65  ? 153 ALA B CB   1 
ATOM   7154  H H    . ALA B 1 153 ? 22.555  -0.910  -51.152 1.00 36.02  ? 153 ALA B H    1 
ATOM   7155  H HA   . ALA B 1 153 ? 24.835  -2.027  -50.527 1.00 32.53  ? 153 ALA B HA   1 
ATOM   7156  H HB1  . ALA B 1 153 ? 25.753  -0.635  -52.169 1.00 39.14  ? 153 ALA B HB1  1 
ATOM   7157  H HB2  . ALA B 1 153 ? 24.430  -1.332  -52.707 1.00 39.14  ? 153 ALA B HB2  1 
ATOM   7158  H HB3  . ALA B 1 153 ? 24.392  0.183   -52.229 1.00 39.14  ? 153 ALA B HB3  1 
ATOM   7159  N N    . SER B 1 154 ? 24.508  0.998   -49.475 1.00 32.07  ? 154 SER B N    1 
ATOM   7160  C CA   . SER B 1 154 ? 25.055  1.975   -48.534 1.00 31.18  ? 154 SER B CA   1 
ATOM   7161  C C    . SER B 1 154 ? 25.218  1.369   -47.146 1.00 34.31  ? 154 SER B C    1 
ATOM   7162  O O    . SER B 1 154 ? 26.255  1.537   -46.490 1.00 28.80  ? 154 SER B O    1 
ATOM   7163  C CB   . SER B 1 154 ? 24.146  3.206   -48.475 1.00 41.33  ? 154 SER B CB   1 
ATOM   7164  O OG   . SER B 1 154 ? 22.795  2.850   -48.159 1.00 49.22  ? 154 SER B OG   1 
ATOM   7165  H H    . SER B 1 154 ? 23.816  1.271   -49.905 1.00 38.44  ? 154 SER B H    1 
ATOM   7166  H HA   . SER B 1 154 ? 25.929  2.259   -48.843 1.00 37.38  ? 154 SER B HA   1 
ATOM   7167  H HB2  . SER B 1 154 ? 24.479  3.809   -47.791 1.00 49.56  ? 154 SER B HB2  1 
ATOM   7168  H HB3  . SER B 1 154 ? 24.160  3.648   -49.338 1.00 49.56  ? 154 SER B HB3  1 
ATOM   7169  H HG   . SER B 1 154 ? 22.315  3.539   -48.132 1.00 59.02  ? 154 SER B HG   1 
ATOM   7170  N N    . GLU B 1 155 ? 24.224  0.614   -46.703 1.00 26.01  ? 155 GLU B N    1 
ATOM   7171  C CA   . GLU B 1 155 ? 24.277  0.074   -45.355 1.00 22.20  ? 155 GLU B CA   1 
ATOM   7172  C C    . GLU B 1 155 ? 25.305  -1.018  -45.281 1.00 32.27  ? 155 GLU B C    1 
ATOM   7173  O O    . GLU B 1 155 ? 26.038  -1.119  -44.288 1.00 30.95  ? 155 GLU B O    1 
ATOM   7174  C CB   . GLU B 1 155 ? 22.893  -0.449  -44.913 1.00 24.70  ? 155 GLU B CB   1 
ATOM   7175  C CG   . GLU B 1 155 ? 21.930  0.719   -44.563 1.00 32.26  ? 155 GLU B CG   1 
ATOM   7176  C CD   . GLU B 1 155 ? 20.476  0.303   -44.239 1.00 35.28  ? 155 GLU B CD   1 
ATOM   7177  O OE1  . GLU B 1 155 ? 20.162  -0.896  -44.249 1.00 29.35  ? 155 GLU B OE1  1 
ATOM   7178  O OE2  . GLU B 1 155 ? 19.636  1.197   -44.016 1.00 35.23  ? 155 GLU B OE2  1 
ATOM   7179  H H    . GLU B 1 155 ? 23.521  0.404   -47.153 1.00 31.16  ? 155 GLU B H    1 
ATOM   7180  H HA   . GLU B 1 155 ? 24.542  0.777   -44.742 1.00 26.59  ? 155 GLU B HA   1 
ATOM   7181  H HB2  . GLU B 1 155 ? 22.499  -0.962  -45.635 1.00 29.60  ? 155 GLU B HB2  1 
ATOM   7182  H HB3  . GLU B 1 155 ? 22.998  -1.003  -44.124 1.00 29.60  ? 155 GLU B HB3  1 
ATOM   7183  H HG2  . GLU B 1 155 ? 22.279  1.184   -43.787 1.00 38.67  ? 155 GLU B HG2  1 
ATOM   7184  H HG3  . GLU B 1 155 ? 21.897  1.328   -45.318 1.00 38.67  ? 155 GLU B HG3  1 
ATOM   7185  N N    . VAL B 1 156 ? 25.394  -1.840  -46.337 1.00 25.66  ? 156 VAL B N    1 
ATOM   7186  C CA   . VAL B 1 156 ? 26.384  -2.904  -46.303 1.00 25.14  ? 156 VAL B CA   1 
ATOM   7187  C C    . VAL B 1 156 ? 27.782  -2.315  -46.333 1.00 28.88  ? 156 VAL B C    1 
ATOM   7188  O O    . VAL B 1 156 ? 28.692  -2.830  -45.674 1.00 27.91  ? 156 VAL B O    1 
ATOM   7189  C CB   . VAL B 1 156 ? 26.160  -3.901  -47.441 1.00 35.18  ? 156 VAL B CB   1 
ATOM   7190  C CG1  . VAL B 1 156 ? 27.432  -4.766  -47.627 1.00 26.78  ? 156 VAL B CG1  1 
ATOM   7191  C CG2  . VAL B 1 156 ? 24.909  -4.773  -47.121 1.00 30.64  ? 156 VAL B CG2  1 
ATOM   7192  H H    . VAL B 1 156 ? 24.913  -1.802  -47.049 1.00 30.75  ? 156 VAL B H    1 
ATOM   7193  H HA   . VAL B 1 156 ? 26.288  -3.388  -45.468 1.00 30.13  ? 156 VAL B HA   1 
ATOM   7194  H HB   . VAL B 1 156 ? 25.994  -3.417  -48.266 1.00 42.18  ? 156 VAL B HB   1 
ATOM   7195  H HG11 . VAL B 1 156 ? 27.283  -5.395  -48.350 1.00 32.10  ? 156 VAL B HG11 1 
ATOM   7196  H HG12 . VAL B 1 156 ? 28.179  -4.186  -47.842 1.00 32.10  ? 156 VAL B HG12 1 
ATOM   7197  H HG13 . VAL B 1 156 ? 27.611  -5.245  -46.803 1.00 32.10  ? 156 VAL B HG13 1 
ATOM   7198  H HG21 . VAL B 1 156 ? 24.770  -5.404  -47.845 1.00 36.73  ? 156 VAL B HG21 1 
ATOM   7199  H HG22 . VAL B 1 156 ? 25.062  -5.251  -46.291 1.00 36.73  ? 156 VAL B HG22 1 
ATOM   7200  H HG23 . VAL B 1 156 ? 24.135  -4.195  -47.033 1.00 36.73  ? 156 VAL B HG23 1 
ATOM   7201  N N    . ALA B 1 157 ? 27.968  -1.231  -47.093 1.00 24.05  ? 157 ALA B N    1 
ATOM   7202  C CA   . ALA B 1 157 ? 29.239  -0.521  -47.090 1.00 30.05  ? 157 ALA B CA   1 
ATOM   7203  C C    . ALA B 1 157 ? 29.540  0.095   -45.732 1.00 33.42  ? 157 ALA B C    1 
ATOM   7204  O O    . ALA B 1 157 ? 30.710  0.156   -45.346 1.00 27.78  ? 157 ALA B O    1 
ATOM   7205  C CB   . ALA B 1 157 ? 29.245  0.551   -48.182 1.00 24.69  ? 157 ALA B CB   1 
ATOM   7206  H H    . ALA B 1 157 ? 27.375  -0.893  -47.616 1.00 28.82  ? 157 ALA B H    1 
ATOM   7207  H HA   . ALA B 1 157 ? 29.948  -1.152  -47.292 1.00 36.02  ? 157 ALA B HA   1 
ATOM   7208  H HB1  . ALA B 1 157 ? 30.098  1.013   -48.165 1.00 29.59  ? 157 ALA B HB1  1 
ATOM   7209  H HB2  . ALA B 1 157 ? 29.117  0.125   -49.044 1.00 29.59  ? 157 ALA B HB2  1 
ATOM   7210  H HB3  . ALA B 1 157 ? 28.525  1.178   -48.012 1.00 29.59  ? 157 ALA B HB3  1 
ATOM   7211  N N    . ASP B 1 158 ? 28.509  0.533   -44.984 1.00 26.48  ? 158 ASP B N    1 
ATOM   7212  C CA   . ASP B 1 158 ? 28.693  1.089   -43.643 1.00 22.86  ? 158 ASP B CA   1 
ATOM   7213  C C    . ASP B 1 158 ? 28.727  0.035   -42.563 1.00 26.67  ? 158 ASP B C    1 
ATOM   7214  O O    . ASP B 1 158 ? 28.823  0.393   -41.394 1.00 25.77  ? 158 ASP B O    1 
ATOM   7215  C CB   . ASP B 1 158 ? 27.609  2.122   -43.317 1.00 32.73  ? 158 ASP B CB   1 
ATOM   7216  C CG   . ASP B 1 158 ? 27.820  3.443   -44.052 1.00 37.97  ? 158 ASP B CG   1 
ATOM   7217  O OD1  . ASP B 1 158 ? 28.987  3.775   -44.412 1.00 40.96  ? 158 ASP B OD1  1 
ATOM   7218  O OD2  . ASP B 1 158 ? 26.820  4.144   -44.301 1.00 37.92  ? 158 ASP B OD2  1 
ATOM   7219  H H    . ASP B 1 158 ? 27.688  0.515   -45.241 1.00 31.73  ? 158 ASP B H    1 
ATOM   7220  H HA   . ASP B 1 158 ? 29.546  1.551   -43.621 1.00 27.39  ? 158 ASP B HA   1 
ATOM   7221  H HB2  . ASP B 1 158 ? 26.745  1.767   -43.577 1.00 39.23  ? 158 ASP B HB2  1 
ATOM   7222  H HB3  . ASP B 1 158 ? 27.621  2.303   -42.364 1.00 39.23  ? 158 ASP B HB3  1 
ATOM   7223  N N    . GLU B 1 159 ? 28.744  -1.248  -42.927 1.00 24.22  ? 159 GLU B N    1 
ATOM   7224  C CA   . GLU B 1 159 ? 28.747  -2.346  -41.948 1.00 21.61  ? 159 GLU B CA   1 
ATOM   7225  C C    . GLU B 1 159 ? 27.567  -2.238  -40.979 1.00 24.49  ? 159 GLU B C    1 
ATOM   7226  O O    . GLU B 1 159 ? 27.690  -2.573  -39.804 1.00 28.43  ? 159 GLU B O    1 
ATOM   7227  C CB   . GLU B 1 159 ? 30.071  -2.405  -41.179 1.00 25.26  ? 159 GLU B CB   1 
ATOM   7228  C CG   . GLU B 1 159 ? 31.300  -2.585  -42.158 1.00 32.56  ? 159 GLU B CG   1 
ATOM   7229  C CD   . GLU B 1 159 ? 32.656  -2.633  -41.472 1.00 33.43  ? 159 GLU B CD   1 
ATOM   7230  O OE1  . GLU B 1 159 ? 32.787  -2.193  -40.309 1.00 37.58  ? 159 GLU B OE1  1 
ATOM   7231  O OE2  . GLU B 1 159 ? 33.600  -3.113  -42.106 1.00 36.79  ? 159 GLU B OE2  1 
ATOM   7232  H H    . GLU B 1 159 ? 28.755  -1.515  -43.744 1.00 29.02  ? 159 GLU B H    1 
ATOM   7233  H HA   . GLU B 1 159 ? 28.653  -3.184  -42.428 1.00 25.88  ? 159 GLU B HA   1 
ATOM   7234  H HB2  . GLU B 1 159 ? 30.192  -1.578  -40.686 1.00 30.27  ? 159 GLU B HB2  1 
ATOM   7235  H HB3  . GLU B 1 159 ? 30.054  -3.160  -40.569 1.00 30.27  ? 159 GLU B HB3  1 
ATOM   7236  H HG2  . GLU B 1 159 ? 31.188  -3.416  -42.646 1.00 39.03  ? 159 GLU B HG2  1 
ATOM   7237  H HG3  . GLU B 1 159 ? 31.312  -1.841  -42.780 1.00 39.03  ? 159 GLU B HG3  1 
ATOM   7238  N N    . LYS B 1 160 ? 26.422  -1.756  -41.456 1.00 28.37  ? 160 LYS B N    1 
ATOM   7239  C CA   . LYS B 1 160 ? 25.203  -1.790  -40.639 1.00 25.32  ? 160 LYS B CA   1 
ATOM   7240  C C    . LYS B 1 160 ? 24.550  -3.162  -40.716 1.00 25.24  ? 160 LYS B C    1 
ATOM   7241  O O    . LYS B 1 160 ? 24.372  -3.715  -41.802 1.00 23.09  ? 160 LYS B O    1 
ATOM   7242  C CB   . LYS B 1 160 ? 24.253  -0.707  -41.096 1.00 26.56  ? 160 LYS B CB   1 
ATOM   7243  C CG   . LYS B 1 160 ? 24.850  0.681   -40.859 1.00 34.82  ? 160 LYS B CG   1 
ATOM   7244  C CD   . LYS B 1 160 ? 23.803  1.745   -40.991 1.00 41.41  ? 160 LYS B CD   1 
ATOM   7245  C CE   . LYS B 1 160 ? 24.372  3.114   -41.287 1.00 50.31  ? 160 LYS B CE   1 
ATOM   7246  N NZ   . LYS B 1 160 ? 23.263  4.095   -41.530 1.00 60.65  ? 160 LYS B NZ   1 
ATOM   7247  H H    . LYS B 1 160 ? 26.320  -1.409  -42.236 1.00 34.00  ? 160 LYS B H    1 
ATOM   7248  H HA   . LYS B 1 160 ? 25.435  -1.617  -39.713 1.00 30.34  ? 160 LYS B HA   1 
ATOM   7249  H HB2  . LYS B 1 160 ? 24.082  -0.809  -42.046 1.00 31.83  ? 160 LYS B HB2  1 
ATOM   7250  H HB3  . LYS B 1 160 ? 23.424  -0.773  -40.596 1.00 31.83  ? 160 LYS B HB3  1 
ATOM   7251  H HG2  . LYS B 1 160 ? 25.218  0.724   -39.962 1.00 41.74  ? 160 LYS B HG2  1 
ATOM   7252  H HG3  . LYS B 1 160 ? 25.542  0.850   -41.517 1.00 41.74  ? 160 LYS B HG3  1 
ATOM   7253  H HD2  . LYS B 1 160 ? 23.204  1.509   -41.716 1.00 49.65  ? 160 LYS B HD2  1 
ATOM   7254  H HD3  . LYS B 1 160 ? 23.307  1.803   -40.159 1.00 49.65  ? 160 LYS B HD3  1 
ATOM   7255  H HE2  . LYS B 1 160 ? 24.893  3.420   -40.528 1.00 60.33  ? 160 LYS B HE2  1 
ATOM   7256  H HE3  . LYS B 1 160 ? 24.925  3.070   -42.083 1.00 60.33  ? 160 LYS B HE3  1 
ATOM   7257  H HZ1  . LYS B 1 160 ? 23.601  4.900   -41.704 1.00 72.73  ? 160 LYS B HZ1  1 
ATOM   7258  H HZ2  . LYS B 1 160 ? 22.771  3.832   -42.223 1.00 72.73  ? 160 LYS B HZ2  1 
ATOM   7259  H HZ3  . LYS B 1 160 ? 22.742  4.150   -40.810 1.00 72.73  ? 160 LYS B HZ3  1 
ATOM   7260  N N    . PHE B 1 161 ? 24.225  -3.729  -39.554 1.00 19.72  ? 161 PHE B N    1 
ATOM   7261  C CA   . PHE B 1 161 ? 23.732  -5.101  -39.487 1.00 21.17  ? 161 PHE B CA   1 
ATOM   7262  C C    . PHE B 1 161 ? 22.513  -5.364  -40.384 1.00 26.77  ? 161 PHE B C    1 
ATOM   7263  O O    . PHE B 1 161 ? 21.465  -4.705  -40.280 1.00 22.87  ? 161 PHE B O    1 
ATOM   7264  C CB   . PHE B 1 161 ? 23.391  -5.453  -38.039 1.00 29.55  ? 161 PHE B CB   1 
ATOM   7265  C CG   . PHE B 1 161 ? 23.019  -6.888  -37.849 1.00 31.24  ? 161 PHE B CG   1 
ATOM   7266  C CD1  . PHE B 1 161 ? 21.688  -7.298  -37.931 1.00 29.55  ? 161 PHE B CD1  1 
ATOM   7267  C CD2  . PHE B 1 161 ? 23.988  -7.829  -37.550 1.00 18.33  ? 161 PHE B CD2  1 
ATOM   7268  C CE1  . PHE B 1 161 ? 21.352  -8.614  -37.753 1.00 25.44  ? 161 PHE B CE1  1 
ATOM   7269  C CE2  . PHE B 1 161 ? 23.663  -9.138  -37.395 1.00 23.87  ? 161 PHE B CE2  1 
ATOM   7270  C CZ   . PHE B 1 161 ? 22.331  -9.538  -37.488 1.00 27.51  ? 161 PHE B CZ   1 
ATOM   7271  H H    . PHE B 1 161 ? 24.281  -3.338  -38.790 1.00 23.63  ? 161 PHE B H    1 
ATOM   7272  H HA   . PHE B 1 161 ? 24.440  -5.697  -39.775 1.00 25.36  ? 161 PHE B HA   1 
ATOM   7273  H HB2  . PHE B 1 161 ? 24.164  -5.270  -37.482 1.00 35.42  ? 161 PHE B HB2  1 
ATOM   7274  H HB3  . PHE B 1 161 ? 22.641  -4.910  -37.752 1.00 35.42  ? 161 PHE B HB3  1 
ATOM   7275  H HD1  . PHE B 1 161 ? 21.025  -6.675  -38.122 1.00 35.42  ? 161 PHE B HD1  1 
ATOM   7276  H HD2  . PHE B 1 161 ? 24.879  -7.568  -37.499 1.00 21.95  ? 161 PHE B HD2  1 
ATOM   7277  H HE1  . PHE B 1 161 ? 20.464  -8.882  -37.821 1.00 30.48  ? 161 PHE B HE1  1 
ATOM   7278  H HE2  . PHE B 1 161 ? 24.324  -9.763  -37.200 1.00 28.60  ? 161 PHE B HE2  1 
ATOM   7279  H HZ   . PHE B 1 161 ? 22.105  -10.431 -37.362 1.00 32.97  ? 161 PHE B HZ   1 
ATOM   7280  N N    . CYS B 1 162 ? 22.630  -6.401  -41.206 1.00 22.04  ? 162 CYS B N    1 
ATOM   7281  C CA   . CYS B 1 162 ? 21.516  -6.920  -41.992 1.00 22.05  ? 162 CYS B CA   1 
ATOM   7282  C C    . CYS B 1 162 ? 21.848  -8.332  -42.474 1.00 25.18  ? 162 CYS B C    1 
ATOM   7283  O O    . CYS B 1 162 ? 22.969  -8.840  -42.311 1.00 24.76  ? 162 CYS B O    1 
ATOM   7284  C CB   . CYS B 1 162 ? 21.196  -6.006  -43.163 1.00 19.10  ? 162 CYS B CB   1 
ATOM   7285  S SG   . CYS B 1 162 ? 22.640  -5.812  -44.270 1.00 27.28  ? 162 CYS B SG   1 
ATOM   7286  H H    . CYS B 1 162 ? 23.364  -6.832  -41.329 1.00 26.41  ? 162 CYS B H    1 
ATOM   7287  H HA   . CYS B 1 162 ? 20.728  -6.973  -41.428 1.00 26.42  ? 162 CYS B HA   1 
ATOM   7288  H HB2  . CYS B 1 162 ? 20.467  -6.387  -43.677 1.00 22.88  ? 162 CYS B HB2  1 
ATOM   7289  H HB3  . CYS B 1 162 ? 20.950  -5.130  -42.828 1.00 22.88  ? 162 CYS B HB3  1 
ATOM   7290  H HG   . CYS B 1 162 ? 22.954  -6.890  -44.695 1.00 32.69  ? 162 CYS B HG   1 
ATOM   7291  N N    . GLU B 1 163 ? 20.856  -8.959  -43.076 1.00 23.88  ? 163 GLU B N    1 
ATOM   7292  C CA   . GLU B 1 163 ? 20.965  -10.340 -43.531 1.00 26.46  ? 163 GLU B CA   1 
ATOM   7293  C C    . GLU B 1 163 ? 20.727  -10.401 -45.026 1.00 27.01  ? 163 GLU B C    1 
ATOM   7294  O O    . GLU B 1 163 ? 20.196  -9.472  -45.637 1.00 24.54  ? 163 GLU B O    1 
ATOM   7295  C CB   . GLU B 1 163 ? 19.914  -11.285 -42.906 1.00 26.70  ? 163 GLU B CB   1 
ATOM   7296  C CG   . GLU B 1 163 ? 19.441  -10.990 -41.577 1.00 32.74  ? 163 GLU B CG   1 
ATOM   7297  C CD   . GLU B 1 163 ? 18.295  -11.929 -41.228 1.00 38.22  ? 163 GLU B CD   1 
ATOM   7298  O OE1  . GLU B 1 163 ? 18.616  -13.025 -40.737 1.00 29.20  ? 163 GLU B OE1  1 
ATOM   7299  O OE2  . GLU B 1 163 ? 17.105  -11.594 -41.499 1.00 22.02  ? 163 GLU B OE2  1 
ATOM   7300  H H    . GLU B 1 163 ? 20.091  -8.602  -43.238 1.00 28.61  ? 163 GLU B H    1 
ATOM   7301  H HA   . GLU B 1 163 ? 21.852  -10.683 -43.339 1.00 31.71  ? 163 GLU B HA   1 
ATOM   7302  H HB2  . GLU B 1 163 ? 19.136  -11.291 -43.487 1.00 32.00  ? 163 GLU B HB2  1 
ATOM   7303  H HB3  . GLU B 1 163 ? 20.294  -12.177 -42.879 1.00 32.00  ? 163 GLU B HB3  1 
ATOM   7304  H HG2  . GLU B 1 163 ? 20.158  -11.124 -40.938 1.00 39.25  ? 163 GLU B HG2  1 
ATOM   7305  H HG3  . GLU B 1 163 ? 19.116  -10.077 -41.541 1.00 39.25  ? 163 GLU B HG3  1 
ATOM   7306  N N    . THR B 1 164 ? 21.069  -11.556 -45.596 1.00 27.97  ? 164 THR B N    1 
ATOM   7307  C CA   . THR B 1 164 ? 20.627  -11.879 -46.937 1.00 23.93  ? 164 THR B CA   1 
ATOM   7308  C C    . THR B 1 164 ? 20.455  -13.389 -47.039 1.00 24.90  ? 164 THR B C    1 
ATOM   7309  O O    . THR B 1 164 ? 20.905  -14.164 -46.185 1.00 20.94  ? 164 THR B O    1 
ATOM   7310  C CB   . THR B 1 164 ? 21.597  -11.330 -48.018 1.00 27.10  ? 164 THR B CB   1 
ATOM   7311  O OG1  . THR B 1 164 ? 20.945  -11.383 -49.300 1.00 27.66  ? 164 THR B OG1  1 
ATOM   7312  C CG2  . THR B 1 164 ? 22.887  -12.122 -48.068 1.00 24.85  ? 164 THR B CG2  1 
ATOM   7313  H H    . THR B 1 164 ? 21.553  -12.161 -45.225 1.00 33.52  ? 164 THR B H    1 
ATOM   7314  H HA   . THR B 1 164 ? 19.759  -11.472 -47.086 1.00 28.68  ? 164 THR B HA   1 
ATOM   7315  H HB   . THR B 1 164 ? 21.816  -10.408 -47.810 1.00 32.48  ? 164 THR B HB   1 
ATOM   7316  H HG1  . THR B 1 164 ? 21.459  -11.088 -49.896 1.00 33.15  ? 164 THR B HG1  1 
ATOM   7317  H HG21 . THR B 1 164 ? 23.473  -11.758 -48.750 1.00 29.78  ? 164 THR B HG21 1 
ATOM   7318  H HG22 . THR B 1 164 ? 23.336  -12.077 -47.210 1.00 29.78  ? 164 THR B HG22 1 
ATOM   7319  H HG23 . THR B 1 164 ? 22.698  -13.050 -48.277 1.00 29.78  ? 164 THR B HG23 1 
ATOM   7320  N N    . THR B 1 165 ? 19.731  -13.796 -48.066 1.00 24.68  ? 165 THR B N    1 
ATOM   7321  C CA   . THR B 1 165 ? 19.567  -15.203 -48.363 1.00 27.37  ? 165 THR B CA   1 
ATOM   7322  C C    . THR B 1 165 ? 20.377  -15.518 -49.612 1.00 23.74  ? 165 THR B C    1 
ATOM   7323  O O    . THR B 1 165 ? 20.500  -14.701 -50.524 1.00 26.95  ? 165 THR B O    1 
ATOM   7324  C CB   . THR B 1 165 ? 18.092  -15.577 -48.583 1.00 31.53  ? 165 THR B CB   1 
ATOM   7325  O OG1  . THR B 1 165 ? 17.264  -14.977 -47.560 1.00 28.85  ? 165 THR B OG1  1 
ATOM   7326  C CG2  . THR B 1 165 ? 17.918  -17.094 -48.575 1.00 25.85  ? 165 THR B CG2  1 
ATOM   7327  H H    . THR B 1 165 ? 19.321  -13.271 -48.610 1.00 29.57  ? 165 THR B H    1 
ATOM   7328  H HA   . THR B 1 165 ? 19.913  -15.733 -47.628 1.00 32.80  ? 165 THR B HA   1 
ATOM   7329  H HB   . THR B 1 165 ? 17.809  -15.248 -49.450 1.00 37.79  ? 165 THR B HB   1 
ATOM   7330  H HG1  . THR B 1 165 ? 17.502  -15.249 -46.802 1.00 34.58  ? 165 THR B HG1  1 
ATOM   7331  H HG21 . THR B 1 165 ? 16.985  -17.321 -48.714 1.00 30.98  ? 165 THR B HG21 1 
ATOM   7332  H HG22 . THR B 1 165 ? 18.448  -17.492 -49.282 1.00 30.98  ? 165 THR B HG22 1 
ATOM   7333  H HG23 . THR B 1 165 ? 18.207  -17.456 -47.722 1.00 30.98  ? 165 THR B HG23 1 
ATOM   7334  N N    . ILE B 1 166 ? 20.908  -16.722 -49.657 1.00 33.10  ? 166 ILE B N    1 
ATOM   7335  C CA   . ILE B 1 166 ? 21.524  -17.230 -50.868 1.00 28.38  ? 166 ILE B CA   1 
ATOM   7336  C C    . ILE B 1 166 ? 20.752  -18.465 -51.274 1.00 23.57  ? 166 ILE B C    1 
ATOM   7337  O O    . ILE B 1 166 ? 20.525  -19.358 -50.451 1.00 29.50  ? 166 ILE B O    1 
ATOM   7338  C CB   . ILE B 1 166 ? 23.020  -17.564 -50.684 1.00 32.60  ? 166 ILE B CB   1 
ATOM   7339  C CG1  . ILE B 1 166 ? 23.851  -16.281 -50.570 1.00 33.95  ? 166 ILE B CG1  1 
ATOM   7340  C CG2  . ILE B 1 166 ? 23.514  -18.382 -51.908 1.00 36.77  ? 166 ILE B CG2  1 
ATOM   7341  C CD1  . ILE B 1 166 ? 25.357  -16.533 -50.262 1.00 26.24  ? 166 ILE B CD1  1 
ATOM   7342  H H    . ILE B 1 166 ? 20.926  -17.272 -48.996 1.00 39.68  ? 166 ILE B H    1 
ATOM   7343  H HA   . ILE B 1 166 ? 21.441  -16.570 -51.574 1.00 34.01  ? 166 ILE B HA   1 
ATOM   7344  H HB   . ILE B 1 166 ? 23.134  -18.093 -49.879 1.00 39.07  ? 166 ILE B HB   1 
ATOM   7345  H HG12 . ILE B 1 166 ? 23.797  -15.798 -51.410 1.00 40.70  ? 166 ILE B HG12 1 
ATOM   7346  H HG13 . ILE B 1 166 ? 23.489  -15.737 -49.854 1.00 40.70  ? 166 ILE B HG13 1 
ATOM   7347  H HG21 . ILE B 1 166 ? 24.454  -18.591 -51.789 1.00 44.09  ? 166 ILE B HG21 1 
ATOM   7348  H HG22 . ILE B 1 166 ? 22.998  -19.202 -51.968 1.00 44.09  ? 166 ILE B HG22 1 
ATOM   7349  H HG23 . ILE B 1 166 ? 23.390  -17.854 -52.711 1.00 44.09  ? 166 ILE B HG23 1 
ATOM   7350  H HD11 . ILE B 1 166 ? 25.814  -15.679 -50.205 1.00 31.45  ? 166 ILE B HD11 1 
ATOM   7351  H HD12 . ILE B 1 166 ? 25.431  -17.005 -49.418 1.00 31.45  ? 166 ILE B HD12 1 
ATOM   7352  H HD13 . ILE B 1 166 ? 25.740  -17.066 -50.975 1.00 31.45  ? 166 ILE B HD13 1 
ATOM   7353  N N    . GLY B 1 167 ? 20.303  -18.486 -52.526 1.00 29.83  ? 167 GLY B N    1 
ATOM   7354  C CA   . GLY B 1 167 ? 19.705  -19.667 -53.106 1.00 33.78  ? 167 GLY B CA   1 
ATOM   7355  C C    . GLY B 1 167 ? 20.748  -20.312 -54.000 1.00 26.49  ? 167 GLY B C    1 
ATOM   7356  O O    . GLY B 1 167 ? 21.306  -19.665 -54.888 1.00 29.72  ? 167 GLY B O    1 
ATOM   7357  H H    . GLY B 1 167 ? 20.336  -17.815 -53.062 1.00 35.75  ? 167 GLY B H    1 
ATOM   7358  H HA2  . GLY B 1 167 ? 19.444  -20.291 -52.411 1.00 40.49  ? 167 GLY B HA2  1 
ATOM   7359  H HA3  . GLY B 1 167 ? 18.928  -19.428 -53.636 1.00 40.49  ? 167 GLY B HA3  1 
ATOM   7360  N N    . CYS B 1 168 ? 21.016  -21.585 -53.734 1.00 31.48  ? 168 CYS B N    1 
ATOM   7361  C CA   . CYS B 1 168 ? 22.061  -22.331 -54.426 1.00 35.76  ? 168 CYS B CA   1 
ATOM   7362  C C    . CYS B 1 168 ? 21.745  -23.810 -54.289 1.00 34.07  ? 168 CYS B C    1 
ATOM   7363  O O    . CYS B 1 168 ? 21.600  -24.298 -53.166 1.00 34.06  ? 168 CYS B O    1 
ATOM   7364  C CB   . CYS B 1 168 ? 23.444  -22.033 -53.847 1.00 36.07  ? 168 CYS B CB   1 
ATOM   7365  S SG   . CYS B 1 168 ? 24.770  -22.981 -54.681 1.00 34.92  ? 168 CYS B SG   1 
ATOM   7366  H H    . CYS B 1 168 ? 20.597  -22.048 -53.143 1.00 37.73  ? 168 CYS B H    1 
ATOM   7367  H HA   . CYS B 1 168 ? 22.061  -22.098 -55.368 1.00 42.87  ? 168 CYS B HA   1 
ATOM   7368  H HB2  . CYS B 1 168 ? 23.636  -21.088 -53.955 1.00 43.24  ? 168 CYS B HB2  1 
ATOM   7369  H HB3  . CYS B 1 168 ? 23.451  -22.269 -52.906 1.00 43.24  ? 168 CYS B HB3  1 
ATOM   7370  H HG   . CYS B 1 168 ? 24.553  -24.154 -54.550 1.00 41.86  ? 168 CYS B HG   1 
ATOM   7371  N N    . LYS B 1 169 ? 21.652  -24.522 -55.425 1.00 42.11  ? 169 LYS B N    1 
ATOM   7372  C CA   . LYS B 1 169 ? 21.256  -25.934 -55.415 1.00 41.01  ? 169 LYS B CA   1 
ATOM   7373  C C    . LYS B 1 169 ? 22.364  -26.840 -54.858 1.00 46.14  ? 169 LYS B C    1 
ATOM   7374  O O    . LYS B 1 169 ? 22.097  -27.720 -54.030 1.00 52.73  ? 169 LYS B O    1 
ATOM   7375  C CB   . LYS B 1 169 ? 20.855  -26.356 -56.833 1.00 34.35  ? 169 LYS B CB   1 
ATOM   7376  H H    . LYS B 1 169 ? 21.812  -24.209 -56.210 1.00 50.49  ? 169 LYS B H    1 
ATOM   7377  H HA   . LYS B 1 169 ? 20.477  -26.035 -54.845 1.00 49.17  ? 169 LYS B HA   1 
ATOM   7378  N N    . ASP B 1 170 ? 23.610  -26.630 -55.266 1.00 44.09  ? 170 ASP B N    1 
ATOM   7379  C CA   . ASP B 1 170 ? 24.705  -27.504 -54.836 1.00 31.77  ? 170 ASP B CA   1 
ATOM   7380  C C    . ASP B 1 170 ? 25.194  -27.125 -53.433 1.00 40.25  ? 170 ASP B C    1 
ATOM   7381  O O    . ASP B 1 170 ? 25.590  -25.976 -53.209 1.00 41.98  ? 170 ASP B O    1 
ATOM   7382  C CB   . ASP B 1 170 ? 25.859  -27.404 -55.839 1.00 40.56  ? 170 ASP B CB   1 
ATOM   7383  C CG   . ASP B 1 170 ? 27.127  -28.039 -55.323 1.00 45.33  ? 170 ASP B CG   1 
ATOM   7384  O OD1  . ASP B 1 170 ? 27.010  -29.009 -54.545 1.00 53.85  ? 170 ASP B OD1  1 
ATOM   7385  O OD2  . ASP B 1 170 ? 28.233  -27.558 -55.673 1.00 49.02  ? 170 ASP B OD2  1 
ATOM   7386  H H    . ASP B 1 170 ? 23.851  -25.992 -55.790 1.00 52.87  ? 170 ASP B H    1 
ATOM   7387  H HA   . ASP B 1 170 ? 24.396  -28.423 -54.815 1.00 38.09  ? 170 ASP B HA   1 
ATOM   7388  H HB2  . ASP B 1 170 ? 25.607  -27.858 -56.659 1.00 48.63  ? 170 ASP B HB2  1 
ATOM   7389  H HB3  . ASP B 1 170 ? 26.042  -26.468 -56.019 1.00 48.63  ? 170 ASP B HB3  1 
ATOM   7390  N N    . PRO B 1 171 ? 25.229  -28.065 -52.483 1.00 41.41  ? 171 PRO B N    1 
ATOM   7391  C CA   . PRO B 1 171 ? 25.651  -27.704 -51.118 1.00 39.67  ? 171 PRO B CA   1 
ATOM   7392  C C    . PRO B 1 171 ? 27.052  -27.127 -51.024 1.00 42.32  ? 171 PRO B C    1 
ATOM   7393  O O    . PRO B 1 171 ? 27.263  -26.189 -50.261 1.00 36.45  ? 171 PRO B O    1 
ATOM   7394  C CB   . PRO B 1 171 ? 25.560  -29.039 -50.356 1.00 42.72  ? 171 PRO B CB   1 
ATOM   7395  C CG   . PRO B 1 171 ? 24.612  -29.855 -51.127 1.00 40.20  ? 171 PRO B CG   1 
ATOM   7396  C CD   . PRO B 1 171 ? 24.710  -29.444 -52.553 1.00 43.16  ? 171 PRO B CD   1 
ATOM   7397  H HA   . PRO B 1 171 ? 25.023  -27.075 -50.731 1.00 47.56  ? 171 PRO B HA   1 
ATOM   7398  H HB2  . PRO B 1 171 ? 26.433  -29.460 -50.330 1.00 51.22  ? 171 PRO B HB2  1 
ATOM   7399  H HB3  . PRO B 1 171 ? 25.227  -28.881 -49.459 1.00 51.22  ? 171 PRO B HB3  1 
ATOM   7400  H HG2  . PRO B 1 171 ? 24.847  -30.791 -51.031 1.00 48.20  ? 171 PRO B HG2  1 
ATOM   7401  H HG3  . PRO B 1 171 ? 23.714  -29.699 -50.794 1.00 48.20  ? 171 PRO B HG3  1 
ATOM   7402  H HD2  . PRO B 1 171 ? 25.334  -30.016 -53.027 1.00 51.75  ? 171 PRO B HD2  1 
ATOM   7403  H HD3  . PRO B 1 171 ? 23.833  -29.455 -52.968 1.00 51.75  ? 171 PRO B HD3  1 
ATOM   7404  N N    . ALA B 1 172 ? 28.025  -27.684 -51.740 1.00 38.84  ? 172 ALA B N    1 
ATOM   7405  C CA   . ALA B 1 172 ? 29.402  -27.229 -51.583 1.00 35.36  ? 172 ALA B CA   1 
ATOM   7406  C C    . ALA B 1 172 ? 29.599  -25.840 -52.174 1.00 38.81  ? 172 ALA B C    1 
ATOM   7407  O O    . ALA B 1 172 ? 30.314  -25.011 -51.602 1.00 40.57  ? 172 ALA B O    1 
ATOM   7408  C CB   . ALA B 1 172 ? 30.353  -28.232 -52.225 1.00 32.22  ? 172 ALA B CB   1 
ATOM   7409  H H    . ALA B 1 172 ? 27.917  -28.316 -52.313 1.00 46.56  ? 172 ALA B H    1 
ATOM   7410  H HA   . ALA B 1 172 ? 29.612  -27.183 -50.637 1.00 42.39  ? 172 ALA B HA   1 
ATOM   7411  H HB1  . ALA B 1 172 ? 31.264  -27.917 -52.114 1.00 38.62  ? 172 ALA B HB1  1 
ATOM   7412  H HB2  . ALA B 1 172 ? 30.244  -29.092 -51.791 1.00 38.62  ? 172 ALA B HB2  1 
ATOM   7413  H HB3  . ALA B 1 172 ? 30.141  -28.307 -53.169 1.00 38.62  ? 172 ALA B HB3  1 
ATOM   7414  N N    . GLN B 1 173 ? 28.923  -25.549 -53.267 1.00 32.97  ? 173 GLN B N    1 
ATOM   7415  C CA   . GLN B 1 173 ? 29.007  -24.238 -53.842 1.00 38.68  ? 173 GLN B CA   1 
ATOM   7416  C C    . GLN B 1 173 ? 28.291  -23.243 -52.937 1.00 44.12  ? 173 GLN B C    1 
ATOM   7417  O O    . GLN B 1 173 ? 28.691  -22.119 -52.864 1.00 38.27  ? 173 GLN B O    1 
ATOM   7418  C CB   . GLN B 1 173 ? 28.440  -24.172 -55.250 1.00 37.89  ? 173 GLN B CB   1 
ATOM   7419  C CG   . GLN B 1 173 ? 27.994  -22.805 -55.736 1.00 43.16  ? 173 GLN B CG   1 
ATOM   7420  C CD   . GLN B 1 173 ? 29.113  -21.938 -56.286 1.00 57.80  ? 173 GLN B CD   1 
ATOM   7421  O OE1  . GLN B 1 173 ? 28.881  -20.977 -57.006 1.00 60.99  ? 173 GLN B OE1  1 
ATOM   7422  N NE2  . GLN B 1 173 ? 30.321  -22.265 -55.938 1.00 41.81  ? 173 GLN B NE2  1 
ATOM   7423  H H    . GLN B 1 173 ? 28.410  -26.095 -53.690 1.00 39.52  ? 173 GLN B H    1 
ATOM   7424  H HA   . GLN B 1 173 ? 29.950  -23.975 -53.888 1.00 46.37  ? 173 GLN B HA   1 
ATOM   7425  H HB2  . GLN B 1 173 ? 29.119  -24.488 -55.866 1.00 45.42  ? 173 GLN B HB2  1 
ATOM   7426  H HB3  . GLN B 1 173 ? 27.669  -24.758 -55.295 1.00 45.42  ? 173 GLN B HB3  1 
ATOM   7427  H HG2  . GLN B 1 173 ? 27.374  -22.948 -56.468 1.00 51.75  ? 173 GLN B HG2  1 
ATOM   7428  H HG3  . GLN B 1 173 ? 27.539  -22.307 -55.044 1.00 51.75  ? 173 GLN B HG3  1 
ATOM   7429  H HE21 . GLN B 1 173 ? 30.675  -21.918 -55.236 1.00 50.12  ? 173 GLN B HE21 1 
ATOM   7430  H HE22 . GLN B 1 173 ? 30.767  -22.829 -56.410 1.00 50.12  ? 173 GLN B HE22 1 
ATOM   7431  N N    . GLY B 1 174 ? 27.243  -23.673 -52.258 1.00 36.78  ? 174 GLY B N    1 
ATOM   7432  C CA   . GLY B 1 174 ? 26.545  -22.772 -51.362 1.00 32.83  ? 174 GLY B CA   1 
ATOM   7433  C C    . GLY B 1 174 ? 27.424  -22.348 -50.202 1.00 37.76  ? 174 GLY B C    1 
ATOM   7434  O O    . GLY B 1 174 ? 27.529  -21.162 -49.883 1.00 31.89  ? 174 GLY B O    1 
ATOM   7435  H H    . GLY B 1 174 ? 26.918  -24.468 -52.303 1.00 44.10  ? 174 GLY B H    1 
ATOM   7436  H HA2  . GLY B 1 174 ? 26.268  -21.979 -51.847 1.00 39.35  ? 174 GLY B HA2  1 
ATOM   7437  H HA3  . GLY B 1 174 ? 25.755  -23.210 -51.008 1.00 39.35  ? 174 GLY B HA3  1 
ATOM   7438  N N    . GLN B 1 175 ? 28.060  -23.323 -49.581 1.00 35.99  ? 175 GLN B N    1 
ATOM   7439  C CA   . GLN B 1 175 ? 28.957  -23.131 -48.437 1.00 36.86  ? 175 GLN B CA   1 
ATOM   7440  C C    . GLN B 1 175 ? 30.087  -22.192 -48.833 1.00 37.07  ? 175 GLN B C    1 
ATOM   7441  O O    . GLN B 1 175 ? 30.495  -21.426 -48.005 1.00 28.11  ? 175 GLN B O    1 
ATOM   7442  C CB   . GLN B 1 175 ? 29.521  -24.465 -47.982 1.00 44.65  ? 175 GLN B CB   1 
ATOM   7443  C CG   . GLN B 1 175 ? 30.310  -24.364 -46.693 1.00 51.54  ? 175 GLN B CG   1 
ATOM   7444  C CD   . GLN B 1 175 ? 29.516  -23.721 -45.588 1.00 59.23  ? 175 GLN B CD   1 
ATOM   7445  O OE1  . GLN B 1 175 ? 28.306  -23.584 -45.655 1.00 43.49  ? 175 GLN B OE1  1 
ATOM   7446  N NE2  . GLN B 1 175 ? 30.217  -23.294 -44.563 1.00 63.95  ? 175 GLN B NE2  1 
ATOM   7447  H H    . GLN B 1 175 ? 27.977  -24.194 -49.834 1.00 43.15  ? 175 GLN B H    1 
ATOM   7448  H HA   . GLN B 1 175 ? 28.446  -22.726 -47.699 1.00 44.18  ? 175 GLN B HA   1 
ATOM   7449  H HB2  . GLN B 1 175 ? 28.780  -25.094 -47.857 1.00 53.54  ? 175 GLN B HB2  1 
ATOM   7450  H HB3  . GLN B 1 175 ? 30.101  -24.818 -48.688 1.00 53.54  ? 175 GLN B HB3  1 
ATOM   7451  H HG2  . GLN B 1 175 ? 30.583  -25.263 -46.410 1.00 61.81  ? 175 GLN B HG2  1 
ATOM   7452  H HG3  . GLN B 1 175 ? 31.123  -23.839 -46.852 1.00 61.81  ? 175 GLN B HG3  1 
ATOM   7453  H HE21 . GLN B 1 175 ? 31.100  -23.328 -44.587 1.00 76.70  ? 175 GLN B HE21 1 
ATOM   7454  H HE22 . GLN B 1 175 ? 29.806  -22.972 -43.850 1.00 76.70  ? 175 GLN B HE22 1 
ATOM   7455  N N    . LEU B 1 176 ? 30.495  -22.217 -50.097 1.00 36.96  ? 176 LEU B N    1 
ATOM   7456  C CA   . LEU B 1 176 ? 31.626  -21.431 -50.565 1.00 39.49  ? 176 LEU B CA   1 
ATOM   7457  C C    . LEU B 1 176 ? 31.226  -19.990 -50.775 1.00 30.18  ? 176 LEU B C    1 
ATOM   7458  O O    . LEU B 1 176 ? 31.996  -19.080 -50.446 1.00 32.49  ? 176 LEU B O    1 
ATOM   7459  C CB   . LEU B 1 176 ? 32.150  -22.027 -51.866 1.00 35.89  ? 176 LEU B CB   1 
ATOM   7460  C CG   . LEU B 1 176 ? 33.589  -21.823 -52.278 1.00 42.93  ? 176 LEU B CG   1 
ATOM   7461  C CD1  . LEU B 1 176 ? 34.561  -22.393 -51.257 1.00 38.45  ? 176 LEU B CD1  1 
ATOM   7462  C CD2  . LEU B 1 176 ? 33.760  -22.498 -53.624 1.00 39.12  ? 176 LEU B CD2  1 
ATOM   7463  H H    . LEU B 1 176 ? 30.131  -22.705 -50.705 1.00 44.31  ? 176 LEU B H    1 
ATOM   7464  H HA   . LEU B 1 176 ? 32.336  -21.461 -49.905 1.00 47.35  ? 176 LEU B HA   1 
ATOM   7465  H HB2  . LEU B 1 176 ? 32.012  -22.986 -51.821 1.00 43.02  ? 176 LEU B HB2  1 
ATOM   7466  H HB3  . LEU B 1 176 ? 31.606  -21.670 -52.586 1.00 43.02  ? 176 LEU B HB3  1 
ATOM   7467  H HG   . LEU B 1 176 ? 33.768  -20.876 -52.382 1.00 51.47  ? 176 LEU B HG   1 
ATOM   7468  H HD11 . LEU B 1 176 ? 35.468  -22.239 -51.564 1.00 46.10  ? 176 LEU B HD11 1 
ATOM   7469  H HD12 . LEU B 1 176 ? 34.420  -21.949 -50.406 1.00 46.10  ? 176 LEU B HD12 1 
ATOM   7470  H HD13 . LEU B 1 176 ? 34.400  -23.345 -51.165 1.00 46.10  ? 176 LEU B HD13 1 
ATOM   7471  H HD21 . LEU B 1 176 ? 34.677  -22.386 -53.920 1.00 46.90  ? 176 LEU B HD21 1 
ATOM   7472  H HD22 . LEU B 1 176 ? 33.554  -23.442 -53.532 1.00 46.90  ? 176 LEU B HD22 1 
ATOM   7473  H HD23 . LEU B 1 176 ? 33.154  -22.088 -54.262 1.00 46.90  ? 176 LEU B HD23 1 
ATOM   7474  N N    . LEU B 1 177 ? 30.025  -19.783 -51.338 1.00 27.18  ? 177 LEU B N    1 
ATOM   7475  C CA   . LEU B 1 177 ? 29.467  -18.439 -51.488 1.00 31.61  ? 177 LEU B CA   1 
ATOM   7476  C C    . LEU B 1 177 ? 29.200  -17.794 -50.126 1.00 22.86  ? 177 LEU B C    1 
ATOM   7477  O O    . LEU B 1 177 ? 29.425  -16.596 -49.948 1.00 30.45  ? 177 LEU B O    1 
ATOM   7478  C CB   . LEU B 1 177 ? 28.174  -18.501 -52.323 1.00 30.33  ? 177 LEU B CB   1 
ATOM   7479  C CG   . LEU B 1 177 ? 28.340  -18.918 -53.792 1.00 33.77  ? 177 LEU B CG   1 
ATOM   7480  C CD1  . LEU B 1 177 ? 27.017  -19.211 -54.454 1.00 34.74  ? 177 LEU B CD1  1 
ATOM   7481  C CD2  . LEU B 1 177 ? 29.048  -17.807 -54.534 1.00 29.74  ? 177 LEU B CD2  1 
ATOM   7482  H H    . LEU B 1 177 ? 29.517  -20.408 -51.639 1.00 32.58  ? 177 LEU B H    1 
ATOM   7483  H HA   . LEU B 1 177 ? 30.104  -17.884 -51.963 1.00 37.89  ? 177 LEU B HA   1 
ATOM   7484  H HB2  . LEU B 1 177 ? 27.573  -19.140 -51.908 1.00 36.36  ? 177 LEU B HB2  1 
ATOM   7485  H HB3  . LEU B 1 177 ? 27.764  -17.622 -52.316 1.00 36.36  ? 177 LEU B HB3  1 
ATOM   7486  H HG   . LEU B 1 177 ? 28.890  -19.716 -53.840 1.00 40.49  ? 177 LEU B HG   1 
ATOM   7487  H HD11 . LEU B 1 177 ? 27.175  -19.469 -55.375 1.00 41.65  ? 177 LEU B HD11 1 
ATOM   7488  H HD12 . LEU B 1 177 ? 26.580  -19.935 -53.978 1.00 41.65  ? 177 LEU B HD12 1 
ATOM   7489  H HD13 . LEU B 1 177 ? 26.465  -18.414 -54.422 1.00 41.65  ? 177 LEU B HD13 1 
ATOM   7490  H HD21 . LEU B 1 177 ? 29.155  -18.067 -55.463 1.00 35.65  ? 177 LEU B HD21 1 
ATOM   7491  H HD22 . LEU B 1 177 ? 28.515  -16.999 -54.475 1.00 35.65  ? 177 LEU B HD22 1 
ATOM   7492  H HD23 . LEU B 1 177 ? 29.917  -17.661 -54.129 1.00 35.65  ? 177 LEU B HD23 1 
ATOM   7493  N N    . LYS B 1 178 ? 28.725  -18.575 -49.156 1.00 26.62  ? 178 LYS B N    1 
ATOM   7494  C CA   . LYS B 1 178 ? 28.590  -18.063 -47.798 1.00 30.44  ? 178 LYS B CA   1 
ATOM   7495  C C    . LYS B 1 178 ? 29.940  -17.590 -47.265 1.00 31.90  ? 178 LYS B C    1 
ATOM   7496  O O    . LYS B 1 178 ? 30.082  -16.449 -46.811 1.00 29.22  ? 178 LYS B O    1 
ATOM   7497  C CB   . LYS B 1 178 ? 28.004  -19.140 -46.895 1.00 31.85  ? 178 LYS B CB   1 
ATOM   7498  C CG   . LYS B 1 178 ? 27.736  -18.701 -45.450 1.00 30.79  ? 178 LYS B CG   1 
ATOM   7499  C CD   . LYS B 1 178 ? 27.369  -19.907 -44.621 1.00 31.45  ? 178 LYS B CD   1 
ATOM   7500  C CE   . LYS B 1 178 ? 27.210  -19.568 -43.168 1.00 32.97  ? 178 LYS B CE   1 
ATOM   7501  N NZ   . LYS B 1 178 ? 25.845  -19.057 -42.924 1.00 32.51  ? 178 LYS B NZ   1 
ATOM   7502  H H    . LYS B 1 178 ? 28.478  -19.393 -49.257 1.00 31.91  ? 178 LYS B H    1 
ATOM   7503  H HA   . LYS B 1 178 ? 27.983  -17.306 -47.801 1.00 36.49  ? 178 LYS B HA   1 
ATOM   7504  H HB2  . LYS B 1 178 ? 27.160  -19.433 -47.272 1.00 38.18  ? 178 LYS B HB2  1 
ATOM   7505  H HB3  . LYS B 1 178 ? 28.622  -19.886 -46.863 1.00 38.18  ? 178 LYS B HB3  1 
ATOM   7506  H HG2  . LYS B 1 178 ? 28.536  -18.299 -45.077 1.00 36.90  ? 178 LYS B HG2  1 
ATOM   7507  H HG3  . LYS B 1 178 ? 26.997  -18.073 -45.430 1.00 36.90  ? 178 LYS B HG3  1 
ATOM   7508  H HD2  . LYS B 1 178 ? 26.527  -20.267 -44.941 1.00 37.69  ? 178 LYS B HD2  1 
ATOM   7509  H HD3  . LYS B 1 178 ? 28.069  -20.573 -44.702 1.00 37.69  ? 178 LYS B HD3  1 
ATOM   7510  H HE2  . LYS B 1 178 ? 27.344  -20.365 -42.631 1.00 39.52  ? 178 LYS B HE2  1 
ATOM   7511  H HE3  . LYS B 1 178 ? 27.848  -18.879 -42.922 1.00 39.52  ? 178 LYS B HE3  1 
ATOM   7512  H HZ1  . LYS B 1 178 ? 25.745  -18.855 -42.063 1.00 38.97  ? 178 LYS B HZ1  1 
ATOM   7513  H HZ2  . LYS B 1 178 ? 25.702  -18.326 -43.411 1.00 38.97  ? 178 LYS B HZ2  1 
ATOM   7514  H HZ3  . LYS B 1 178 ? 25.244  -19.676 -43.146 1.00 38.97  ? 178 LYS B HZ3  1 
ATOM   7515  N N    . GLU B 1 179 ? 30.952  -18.453 -47.332 1.00 33.75  ? 179 GLU B N    1 
ATOM   7516  C CA   . GLU B 1 179 ? 32.270  -18.067 -46.845 1.00 31.08  ? 179 GLU B CA   1 
ATOM   7517  C C    . GLU B 1 179 ? 32.713  -16.766 -47.486 1.00 25.66  ? 179 GLU B C    1 
ATOM   7518  O O    . GLU B 1 179 ? 33.273  -15.890 -46.822 1.00 29.35  ? 179 GLU B O    1 
ATOM   7519  C CB   . GLU B 1 179 ? 33.277  -19.189 -47.114 1.00 31.52  ? 179 GLU B CB   1 
ATOM   7520  C CG   . GLU B 1 179 ? 33.076  -20.365 -46.139 1.00 37.54  ? 179 GLU B CG   1 
ATOM   7521  C CD   . GLU B 1 179 ? 33.498  -21.735 -46.707 1.00 44.13  ? 179 GLU B CD   1 
ATOM   7522  O OE1  . GLU B 1 179 ? 34.033  -21.772 -47.832 1.00 40.82  ? 179 GLU B OE1  1 
ATOM   7523  O OE2  . GLU B 1 179 ? 33.279  -22.775 -46.034 1.00 45.25  ? 179 GLU B OE2  1 
ATOM   7524  H H    . GLU B 1 179 ? 30.902  -19.251 -47.649 1.00 40.46  ? 179 GLU B H    1 
ATOM   7525  H HA   . GLU B 1 179 ? 32.224  -17.929 -45.886 1.00 37.26  ? 179 GLU B HA   1 
ATOM   7526  H HB2  . GLU B 1 179 ? 33.157  -19.518 -48.018 1.00 37.78  ? 179 GLU B HB2  1 
ATOM   7527  H HB3  . GLU B 1 179 ? 34.177  -18.847 -46.997 1.00 37.78  ? 179 GLU B HB3  1 
ATOM   7528  H HG2  . GLU B 1 179 ? 33.603  -20.201 -45.341 1.00 45.01  ? 179 GLU B HG2  1 
ATOM   7529  H HG3  . GLU B 1 179 ? 32.136  -20.418 -45.906 1.00 45.01  ? 179 GLU B HG3  1 
ATOM   7530  N N    . LEU B 1 180 ? 32.426  -16.610 -48.776 1.00 27.69  ? 180 LEU B N    1 
ATOM   7531  C CA   . LEU B 1 180 ? 32.955  -15.480 -49.536 1.00 26.85  ? 180 LEU B CA   1 
ATOM   7532  C C    . LEU B 1 180 ? 32.295  -14.162 -49.169 1.00 31.43  ? 180 LEU B C    1 
ATOM   7533  O O    . LEU B 1 180 ? 32.913  -13.097 -49.326 1.00 23.10  ? 180 LEU B O    1 
ATOM   7534  C CB   . LEU B 1 180 ? 32.750  -15.730 -51.020 1.00 29.47  ? 180 LEU B CB   1 
ATOM   7535  C CG   . LEU B 1 180 ? 33.321  -14.711 -51.991 1.00 26.07  ? 180 LEU B CG   1 
ATOM   7536  C CD1  . LEU B 1 180 ? 34.854  -14.691 -51.858 1.00 26.03  ? 180 LEU B CD1  1 
ATOM   7537  C CD2  . LEU B 1 180 ? 32.904  -15.075 -53.433 1.00 34.17  ? 180 LEU B CD2  1 
ATOM   7538  H H    . LEU B 1 180 ? 31.929  -17.143 -49.233 1.00 33.19  ? 180 LEU B H    1 
ATOM   7539  H HA   . LEU B 1 180 ? 33.908  -15.400 -49.370 1.00 32.18  ? 180 LEU B HA   1 
ATOM   7540  H HB2  . LEU B 1 180 ? 33.152  -16.586 -51.238 1.00 35.32  ? 180 LEU B HB2  1 
ATOM   7541  H HB3  . LEU B 1 180 ? 31.796  -15.777 -51.186 1.00 35.32  ? 180 LEU B HB3  1 
ATOM   7542  H HG   . LEU B 1 180 ? 32.978  -13.828 -51.780 1.00 31.24  ? 180 LEU B HG   1 
ATOM   7543  H HD11 . LEU B 1 180 ? 35.216  -14.040 -52.479 1.00 31.19  ? 180 LEU B HD11 1 
ATOM   7544  H HD12 . LEU B 1 180 ? 35.089  -14.449 -50.949 1.00 31.19  ? 180 LEU B HD12 1 
ATOM   7545  H HD13 . LEU B 1 180 ? 35.200  -15.574 -52.065 1.00 31.19  ? 180 LEU B HD13 1 
ATOM   7546  H HD21 . LEU B 1 180 ? 33.274  -14.418 -54.043 1.00 40.96  ? 180 LEU B HD21 1 
ATOM   7547  H HD22 . LEU B 1 180 ? 33.247  -15.957 -53.647 1.00 40.96  ? 180 LEU B HD22 1 
ATOM   7548  H HD23 . LEU B 1 180 ? 31.936  -15.073 -53.491 1.00 40.96  ? 180 LEU B HD23 1 
ATOM   7549  N N    . MET B 1 181 ? 31.025  -14.206 -48.733 1.00 24.36  ? 181 MET B N    1 
ATOM   7550  C CA   . MET B 1 181 ? 30.243  -13.003 -48.526 1.00 30.90  ? 181 MET B CA   1 
ATOM   7551  C C    . MET B 1 181 ? 29.854  -12.752 -47.084 1.00 23.14  ? 181 MET B C    1 
ATOM   7552  O O    . MET B 1 181 ? 29.404  -11.651 -46.780 1.00 25.05  ? 181 MET B O    1 
ATOM   7553  C CB   . MET B 1 181 ? 28.982  -13.062 -49.383 1.00 34.74  ? 181 MET B CB   1 
ATOM   7554  C CG   . MET B 1 181 ? 29.402  -13.345 -50.756 1.00 42.10  ? 181 MET B CG   1 
ATOM   7555  S SD   . MET B 1 181 ? 28.737  -12.267 -51.955 1.00 51.38  ? 181 MET B SD   1 
ATOM   7556  C CE   . MET B 1 181 ? 28.176  -13.572 -52.985 1.00 34.41  ? 181 MET B CE   1 
ATOM   7557  H H    . MET B 1 181 ? 30.601  -14.933 -48.551 1.00 29.19  ? 181 MET B H    1 
ATOM   7558  H HA   . MET B 1 181 ? 30.765  -12.247 -48.834 1.00 37.04  ? 181 MET B HA   1 
ATOM   7559  H HB2  . MET B 1 181 ? 28.403  -13.777 -49.075 1.00 41.65  ? 181 MET B HB2  1 
ATOM   7560  H HB3  . MET B 1 181 ? 28.524  -12.208 -49.361 1.00 41.65  ? 181 MET B HB3  1 
ATOM   7561  H HG2  . MET B 1 181 ? 30.368  -13.278 -50.805 1.00 50.48  ? 181 MET B HG2  1 
ATOM   7562  H HG3  . MET B 1 181 ? 29.125  -14.246 -50.985 1.00 50.48  ? 181 MET B HG3  1 
ATOM   7563  H HE1  . MET B 1 181 ? 27.744  -13.193 -53.766 1.00 41.25  ? 181 MET B HE1  1 
ATOM   7564  H HE2  . MET B 1 181 ? 28.937  -14.110 -53.254 1.00 41.25  ? 181 MET B HE2  1 
ATOM   7565  H HE3  . MET B 1 181 ? 27.545  -14.116 -52.488 1.00 41.25  ? 181 MET B HE3  1 
ATOM   7566  N N    . GLN B 1 182 ? 30.022  -13.709 -46.190 1.00 24.71  ? 182 GLN B N    1 
ATOM   7567  C CA   . GLN B 1 182 ? 29.569  -13.502 -44.834 1.00 24.11  ? 182 GLN B CA   1 
ATOM   7568  C C    . GLN B 1 182 ? 30.599  -12.729 -43.998 1.00 27.97  ? 182 GLN B C    1 
ATOM   7569  O O    . GLN B 1 182 ? 31.814  -12.961 -44.087 1.00 25.57  ? 182 GLN B O    1 
ATOM   7570  C CB   . GLN B 1 182 ? 29.253  -14.828 -44.144 1.00 21.69  ? 182 GLN B CB   1 
ATOM   7571  C CG   . GLN B 1 182 ? 28.480  -14.613 -42.811 1.00 21.99  ? 182 GLN B CG   1 
ATOM   7572  C CD   . GLN B 1 182 ? 27.933  -15.894 -42.237 1.00 29.45  ? 182 GLN B CD   1 
ATOM   7573  O OE1  . GLN B 1 182 ? 26.781  -16.242 -42.482 1.00 33.26  ? 182 GLN B OE1  1 
ATOM   7574  N NE2  . GLN B 1 182 ? 28.753  -16.601 -41.456 1.00 30.52  ? 182 GLN B NE2  1 
ATOM   7575  H H    . GLN B 1 182 ? 30.388  -14.473 -46.340 1.00 29.61  ? 182 GLN B H    1 
ATOM   7576  H HA   . GLN B 1 182 ? 28.752  -12.979 -44.856 1.00 28.89  ? 182 GLN B HA   1 
ATOM   7577  H HB2  . GLN B 1 182 ? 28.702  -15.370 -44.730 1.00 25.99  ? 182 GLN B HB2  1 
ATOM   7578  H HB3  . GLN B 1 182 ? 30.082  -15.289 -43.943 1.00 25.99  ? 182 GLN B HB3  1 
ATOM   7579  H HG2  . GLN B 1 182 ? 29.082  -14.225 -42.157 1.00 26.35  ? 182 GLN B HG2  1 
ATOM   7580  H HG3  . GLN B 1 182 ? 27.735  -14.014 -42.972 1.00 26.35  ? 182 GLN B HG3  1 
ATOM   7581  H HE21 . GLN B 1 182 ? 29.553  -16.321 -41.308 1.00 36.58  ? 182 GLN B HE21 1 
ATOM   7582  H HE22 . GLN B 1 182 ? 28.484  -17.339 -41.105 1.00 36.58  ? 182 GLN B HE22 1 
ATOM   7583  N N    . THR B 1 183 ? 30.074  -11.775 -43.190 1.00 26.49  ? 183 THR B N    1 
ATOM   7584  C CA   . THR B 1 183 ? 30.784  -10.970 -42.193 1.00 29.26  ? 183 THR B CA   1 
ATOM   7585  C C    . THR B 1 183 ? 29.938  -10.870 -40.922 1.00 30.72  ? 183 THR B C    1 
ATOM   7586  O O    . THR B 1 183 ? 28.768  -11.308 -40.911 1.00 24.43  ? 183 THR B O    1 
ATOM   7587  C CB   . THR B 1 183 ? 31.069  -9.560  -42.708 1.00 29.78  ? 183 THR B CB   1 
ATOM   7588  O OG1  . THR B 1 183 ? 29.883  -8.756  -42.581 1.00 29.19  ? 183 THR B OG1  1 
ATOM   7589  C CG2  . THR B 1 183 ? 31.520  -9.572  -44.167 1.00 33.98  ? 183 THR B CG2  1 
ATOM   7590  H H    . THR B 1 183 ? 29.238  -11.573 -43.216 1.00 31.74  ? 183 THR B H    1 
ATOM   7591  H HA   . THR B 1 183 ? 31.628  -11.395 -41.971 1.00 35.07  ? 183 THR B HA   1 
ATOM   7592  H HB   . THR B 1 183 ? 31.778  -9.165  -42.177 1.00 35.69  ? 183 THR B HB   1 
ATOM   7593  H HG1  . THR B 1 183 ? 30.031  -7.978  -42.862 1.00 34.99  ? 183 THR B HG1  1 
ATOM   7594  H HG21 . THR B 1 183 ? 31.693  -8.666  -44.468 1.00 40.73  ? 183 THR B HG21 1 
ATOM   7595  H HG22 . THR B 1 183 ? 32.331  -10.096 -44.259 1.00 40.73  ? 183 THR B HG22 1 
ATOM   7596  H HG23 . THR B 1 183 ? 30.828  -9.962  -44.724 1.00 40.73  ? 183 THR B HG23 1 
ATOM   7597  N N    . PRO B 1 184 ? 30.475  -10.349 -39.815 1.00 31.02  ? 184 PRO B N    1 
ATOM   7598  C CA   . PRO B 1 184 ? 29.617  -10.209 -38.623 1.00 23.59  ? 184 PRO B CA   1 
ATOM   7599  C C    . PRO B 1 184 ? 28.400  -9.324  -38.863 1.00 23.85  ? 184 PRO B C    1 
ATOM   7600  O O    . PRO B 1 184 ? 27.391  -9.499  -38.163 1.00 21.51  ? 184 PRO B O    1 
ATOM   7601  C CB   . PRO B 1 184 ? 30.553  -9.616  -37.559 1.00 24.65  ? 184 PRO B CB   1 
ATOM   7602  C CG   . PRO B 1 184 ? 31.975  -10.121 -37.985 1.00 32.29  ? 184 PRO B CG   1 
ATOM   7603  C CD   . PRO B 1 184 ? 31.903  -10.090 -39.513 1.00 28.33  ? 184 PRO B CD   1 
ATOM   7604  H HA   . PRO B 1 184 ? 29.318  -11.082 -38.327 1.00 28.26  ? 184 PRO B HA   1 
ATOM   7605  H HB2  . PRO B 1 184 ? 30.508  -8.647  -37.582 1.00 29.54  ? 184 PRO B HB2  1 
ATOM   7606  H HB3  . PRO B 1 184 ? 30.314  -9.954  -36.682 1.00 29.54  ? 184 PRO B HB3  1 
ATOM   7607  H HG2  . PRO B 1 184 ? 32.657  -9.515  -37.655 1.00 38.71  ? 184 PRO B HG2  1 
ATOM   7608  H HG3  . PRO B 1 184 ? 32.119  -11.023 -37.660 1.00 38.71  ? 184 PRO B HG3  1 
ATOM   7609  H HD2  . PRO B 1 184 ? 32.164  -9.216  -39.844 1.00 33.95  ? 184 PRO B HD2  1 
ATOM   7610  H HD3  . PRO B 1 184 ? 32.459  -10.790 -39.890 1.00 33.95  ? 184 PRO B HD3  1 
ATOM   7611  N N    . ASN B 1 185 ? 28.440  -8.388  -39.820 1.00 18.95  ? 185 ASN B N    1 
ATOM   7612  C CA   . ASN B 1 185 ? 27.295  -7.513  -40.040 1.00 20.78  ? 185 ASN B CA   1 
ATOM   7613  C C    . ASN B 1 185 ? 26.500  -7.806  -41.305 1.00 24.32  ? 185 ASN B C    1 
ATOM   7614  O O    . ASN B 1 185 ? 25.521  -7.092  -41.581 1.00 22.45  ? 185 ASN B O    1 
ATOM   7615  C CB   . ASN B 1 185 ? 27.748  -6.064  -40.027 1.00 24.09  ? 185 ASN B CB   1 
ATOM   7616  C CG   . ASN B 1 185 ? 28.065  -5.613  -38.623 1.00 34.33  ? 185 ASN B CG   1 
ATOM   7617  O OD1  . ASN B 1 185 ? 27.148  -5.435  -37.815 1.00 23.12  ? 185 ASN B OD1  1 
ATOM   7618  N ND2  . ASN B 1 185 ? 29.359  -5.501  -38.294 1.00 24.54  ? 185 ASN B ND2  1 
ATOM   7619  H H    . ASN B 1 185 ? 29.107  -8.246  -40.344 1.00 22.70  ? 185 ASN B H    1 
ATOM   7620  H HA   . ASN B 1 185 ? 26.687  -7.626  -39.294 1.00 24.89  ? 185 ASN B HA   1 
ATOM   7621  H HB2  . ASN B 1 185 ? 28.549  -5.972  -40.566 1.00 28.87  ? 185 ASN B HB2  1 
ATOM   7622  H HB3  . ASN B 1 185 ? 27.039  -5.502  -40.377 1.00 28.87  ? 185 ASN B HB3  1 
ATOM   7623  H HD21 . ASN B 1 185 ? 29.580  -5.253  -37.501 1.00 29.40  ? 185 ASN B HD21 1 
ATOM   7624  H HD22 . ASN B 1 185 ? 29.967  -5.647  -38.885 1.00 29.40  ? 185 ASN B HD22 1 
ATOM   7625  N N    . PHE B 1 186 ? 26.866  -8.853  -42.052 1.00 17.64  ? 186 PHE B N    1 
ATOM   7626  C CA   . PHE B 1 186 ? 26.197  -9.237  -43.297 1.00 17.90  ? 186 PHE B CA   1 
ATOM   7627  C C    . PHE B 1 186 ? 26.023  -10.750 -43.177 1.00 22.84  ? 186 PHE B C    1 
ATOM   7628  O O    . PHE B 1 186 ? 26.934  -11.508 -43.556 1.00 23.42  ? 186 PHE B O    1 
ATOM   7629  C CB   . PHE B 1 186 ? 26.994  -8.840  -44.523 1.00 17.23  ? 186 PHE B CB   1 
ATOM   7630  C CG   . PHE B 1 186 ? 26.215  -8.985  -45.831 1.00 27.65  ? 186 PHE B CG   1 
ATOM   7631  C CD1  . PHE B 1 186 ? 24.996  -8.324  -46.007 1.00 31.28  ? 186 PHE B CD1  1 
ATOM   7632  C CD2  . PHE B 1 186 ? 26.689  -9.768  -46.868 1.00 24.27  ? 186 PHE B CD2  1 
ATOM   7633  C CE1  . PHE B 1 186 ? 24.267  -8.461  -47.213 1.00 30.00  ? 186 PHE B CE1  1 
ATOM   7634  C CE2  . PHE B 1 186 ? 25.980  -9.897  -48.059 1.00 25.39  ? 186 PHE B CE2  1 
ATOM   7635  C CZ   . PHE B 1 186 ? 24.790  -9.249  -48.242 1.00 25.38  ? 186 PHE B CZ   1 
ATOM   7636  H H    . PHE B 1 186 ? 27.520  -9.373  -41.848 1.00 21.13  ? 186 PHE B H    1 
ATOM   7637  H HA   . PHE B 1 186 ? 25.322  -8.822  -43.344 1.00 21.44  ? 186 PHE B HA   1 
ATOM   7638  H HB2  . PHE B 1 186 ? 27.261  -7.912  -44.437 1.00 20.64  ? 186 PHE B HB2  1 
ATOM   7639  H HB3  . PHE B 1 186 ? 27.781  -9.405  -44.582 1.00 20.64  ? 186 PHE B HB3  1 
ATOM   7640  H HD1  . PHE B 1 186 ? 24.657  -7.795  -45.321 1.00 37.49  ? 186 PHE B HD1  1 
ATOM   7641  H HD2  . PHE B 1 186 ? 27.500  -10.213 -46.769 1.00 29.09  ? 186 PHE B HD2  1 
ATOM   7642  H HE1  . PHE B 1 186 ? 23.459  -8.015  -47.327 1.00 35.95  ? 186 PHE B HE1  1 
ATOM   7643  H HE2  . PHE B 1 186 ? 26.323  -10.428 -48.742 1.00 30.43  ? 186 PHE B HE2  1 
ATOM   7644  H HZ   . PHE B 1 186 ? 24.321  -9.349  -49.039 1.00 30.41  ? 186 PHE B HZ   1 
ATOM   7645  N N    . ARG B 1 187 ? 24.895  -11.169 -42.579 1.00 21.33  ? 187 ARG B N    1 
ATOM   7646  C CA   . ARG B 1 187 ? 24.690  -12.557 -42.181 1.00 21.67  ? 187 ARG B CA   1 
ATOM   7647  C C    . ARG B 1 187 ? 23.937  -13.281 -43.283 1.00 26.52  ? 187 ARG B C    1 
ATOM   7648  O O    . ARG B 1 187 ? 22.977  -12.747 -43.841 1.00 28.25  ? 187 ARG B O    1 
ATOM   7649  C CB   . ARG B 1 187 ? 23.896  -12.704 -40.875 1.00 19.31  ? 187 ARG B CB   1 
ATOM   7650  C CG   . ARG B 1 187 ? 24.396  -11.918 -39.733 1.00 25.35  ? 187 ARG B CG   1 
ATOM   7651  C CD   . ARG B 1 187 ? 25.873  -12.222 -39.454 1.00 21.58  ? 187 ARG B CD   1 
ATOM   7652  N NE   . ARG B 1 187 ? 26.047  -13.588 -38.962 1.00 22.00  ? 187 ARG B NE   1 
ATOM   7653  C CZ   . ARG B 1 187 ? 27.195  -14.261 -39.034 1.00 32.25  ? 187 ARG B CZ   1 
ATOM   7654  N NH1  . ARG B 1 187 ? 28.255  -13.679 -39.586 1.00 23.56  ? 187 ARG B NH1  1 
ATOM   7655  N NH2  . ARG B 1 187 ? 27.294  -15.516 -38.557 1.00 28.79  ? 187 ARG B NH2  1 
ATOM   7656  H H    . ARG B 1 187 ? 24.231  -10.656 -42.395 1.00 25.55  ? 187 ARG B H    1 
ATOM   7657  H HA   . ARG B 1 187 ? 25.551  -12.988 -42.064 1.00 25.96  ? 187 ARG B HA   1 
ATOM   7658  H HB2  . ARG B 1 187 ? 22.981  -12.426 -41.041 1.00 23.13  ? 187 ARG B HB2  1 
ATOM   7659  H HB3  . ARG B 1 187 ? 23.908  -13.637 -40.613 1.00 23.13  ? 187 ARG B HB3  1 
ATOM   7660  H HG2  . ARG B 1 187 ? 24.311  -10.972 -39.933 1.00 30.38  ? 187 ARG B HG2  1 
ATOM   7661  H HG3  . ARG B 1 187 ? 23.883  -12.142 -38.940 1.00 30.38  ? 187 ARG B HG3  1 
ATOM   7662  H HD2  . ARG B 1 187 ? 26.382  -12.126 -40.274 1.00 25.86  ? 187 ARG B HD2  1 
ATOM   7663  H HD3  . ARG B 1 187 ? 26.205  -11.610 -38.778 1.00 25.86  ? 187 ARG B HD3  1 
ATOM   7664  H HE   . ARG B 1 187 ? 25.347  -14.012 -38.698 1.00 26.36  ? 187 ARG B HE   1 
ATOM   7665  H HH11 . ARG B 1 187 ? 28.195  -12.876 -39.890 1.00 28.24  ? 187 ARG B HH11 1 
ATOM   7666  H HH12 . ARG B 1 187 ? 29.000  -14.104 -39.639 1.00 28.24  ? 187 ARG B HH12 1 
ATOM   7667  H HH21 . ARG B 1 187 ? 26.610  -15.896 -38.201 1.00 34.51  ? 187 ARG B HH21 1 
ATOM   7668  H HH22 . ARG B 1 187 ? 28.041  -15.939 -38.613 1.00 34.51  ? 187 ARG B HH22 1 
ATOM   7669  N N    . ILE B 1 188 ? 24.338  -14.521 -43.545 1.00 25.67  ? 188 ILE B N    1 
ATOM   7670  C CA   . ILE B 1 188 ? 23.886  -15.267 -44.713 1.00 18.68  ? 188 ILE B CA   1 
ATOM   7671  C C    . ILE B 1 188 ? 23.204  -16.538 -44.246 1.00 28.88  ? 188 ILE B C    1 
ATOM   7672  O O    . ILE B 1 188 ? 23.715  -17.233 -43.365 1.00 22.90  ? 188 ILE B O    1 
ATOM   7673  C CB   . ILE B 1 188 ? 25.066  -15.568 -45.665 1.00 30.24  ? 188 ILE B CB   1 
ATOM   7674  C CG1  . ILE B 1 188 ? 25.648  -14.234 -46.128 1.00 24.48  ? 188 ILE B CG1  1 
ATOM   7675  C CG2  . ILE B 1 188 ? 24.625  -16.418 -46.807 1.00 35.35  ? 188 ILE B CG2  1 
ATOM   7676  C CD1  . ILE B 1 188 ? 26.419  -14.253 -47.377 1.00 39.97  ? 188 ILE B CD1  1 
ATOM   7677  H H    . ILE B 1 188 ? 24.885  -14.961 -43.049 1.00 30.76  ? 188 ILE B H    1 
ATOM   7678  H HA   . ILE B 1 188 ? 23.235  -14.735 -45.198 1.00 22.38  ? 188 ILE B HA   1 
ATOM   7679  H HB   . ILE B 1 188 ? 25.748  -16.047 -45.169 1.00 36.25  ? 188 ILE B HB   1 
ATOM   7680  H HG12 . ILE B 1 188 ? 24.916  -13.611 -46.252 1.00 29.34  ? 188 ILE B HG12 1 
ATOM   7681  H HG13 . ILE B 1 188 ? 26.237  -13.903 -45.432 1.00 29.34  ? 188 ILE B HG13 1 
ATOM   7682  H HG21 . ILE B 1 188 ? 25.385  -16.589 -47.384 1.00 42.37  ? 188 ILE B HG21 1 
ATOM   7683  H HG22 . ILE B 1 188 ? 24.276  -17.254 -46.461 1.00 42.37  ? 188 ILE B HG22 1 
ATOM   7684  H HG23 . ILE B 1 188 ? 23.933  -15.949 -47.300 1.00 42.37  ? 188 ILE B HG23 1 
ATOM   7685  H HD11 . ILE B 1 188 ? 26.735  -13.355 -47.566 1.00 47.92  ? 188 ILE B HD11 1 
ATOM   7686  H HD12 . ILE B 1 188 ? 27.173  -14.854 -47.273 1.00 47.92  ? 188 ILE B HD12 1 
ATOM   7687  H HD13 . ILE B 1 188 ? 25.847  -14.561 -48.096 1.00 47.92  ? 188 ILE B HD13 1 
ATOM   7688  N N    . THR B 1 189 ? 22.027  -16.820 -44.814 1.00 28.49  ? 189 THR B N    1 
ATOM   7689  C CA   . THR B 1 189 ? 21.416  -18.139 -44.763 1.00 25.22  ? 189 THR B CA   1 
ATOM   7690  C C    . THR B 1 189 ? 21.397  -18.712 -46.186 1.00 28.36  ? 189 THR B C    1 
ATOM   7691  O O    . THR B 1 189 ? 20.974  -18.034 -47.136 1.00 26.82  ? 189 THR B O    1 
ATOM   7692  C CB   . THR B 1 189 ? 20.006  -18.064 -44.188 1.00 30.97  ? 189 THR B CB   1 
ATOM   7693  O OG1  . THR B 1 189 ? 20.027  -17.393 -42.913 1.00 27.21  ? 189 THR B OG1  1 
ATOM   7694  C CG2  . THR B 1 189 ? 19.437  -19.485 -44.030 1.00 26.98  ? 189 THR B CG2  1 
ATOM   7695  H H    . THR B 1 189 ? 21.556  -16.243 -45.244 1.00 34.14  ? 189 THR B H    1 
ATOM   7696  H HA   . THR B 1 189 ? 21.949  -18.723 -44.201 1.00 30.22  ? 189 THR B HA   1 
ATOM   7697  H HB   . THR B 1 189 ? 19.435  -17.573 -44.800 1.00 37.12  ? 189 THR B HB   1 
ATOM   7698  H HG1  . THR B 1 189 ? 19.250  -17.352 -42.596 1.00 32.61  ? 189 THR B HG1  1 
ATOM   7699  H HG21 . THR B 1 189 ? 18.539  -19.444 -43.664 1.00 32.33  ? 189 THR B HG21 1 
ATOM   7700  H HG22 . THR B 1 189 ? 19.406  -19.927 -44.893 1.00 32.33  ? 189 THR B HG22 1 
ATOM   7701  H HG23 . THR B 1 189 ? 19.998  -20.002 -43.431 1.00 32.33  ? 189 THR B HG23 1 
ATOM   7702  N N    . VAL B 1 190 ? 21.905  -19.931 -46.344 1.00 31.79  ? 190 VAL B N    1 
ATOM   7703  C CA   . VAL B 1 190 ? 21.892  -20.619 -47.634 1.00 29.89  ? 190 VAL B CA   1 
ATOM   7704  C C    . VAL B 1 190 ? 20.691  -21.543 -47.658 1.00 28.71  ? 190 VAL B C    1 
ATOM   7705  O O    . VAL B 1 190 ? 20.484  -22.320 -46.718 1.00 31.11  ? 190 VAL B O    1 
ATOM   7706  C CB   . VAL B 1 190 ? 23.194  -21.410 -47.882 1.00 39.44  ? 190 VAL B CB   1 
ATOM   7707  C CG1  . VAL B 1 190 ? 23.064  -22.306 -49.128 1.00 33.42  ? 190 VAL B CG1  1 
ATOM   7708  C CG2  . VAL B 1 190 ? 24.382  -20.459 -48.069 1.00 34.14  ? 190 VAL B CG2  1 
ATOM   7709  H H    . VAL B 1 190 ? 22.269  -20.387 -45.711 1.00 38.11  ? 190 VAL B H    1 
ATOM   7710  H HA   . VAL B 1 190 ? 21.791  -19.968 -48.345 1.00 35.83  ? 190 VAL B HA   1 
ATOM   7711  H HB   . VAL B 1 190 ? 23.375  -21.978 -47.116 1.00 47.29  ? 190 VAL B HB   1 
ATOM   7712  H HG11 . VAL B 1 190 ? 23.895  -22.788 -49.257 1.00 40.06  ? 190 VAL B HG11 1 
ATOM   7713  H HG12 . VAL B 1 190 ? 22.335  -22.931 -48.992 1.00 40.06  ? 190 VAL B HG12 1 
ATOM   7714  H HG13 . VAL B 1 190 ? 22.882  -21.747 -49.900 1.00 40.06  ? 190 VAL B HG13 1 
ATOM   7715  H HG21 . VAL B 1 190 ? 25.184  -20.983 -48.222 1.00 40.93  ? 190 VAL B HG21 1 
ATOM   7716  H HG22 . VAL B 1 190 ? 24.210  -19.886 -48.831 1.00 40.93  ? 190 VAL B HG22 1 
ATOM   7717  H HG23 . VAL B 1 190 ? 24.485  -19.923 -47.267 1.00 40.93  ? 190 VAL B HG23 1 
ATOM   7718  N N    . VAL B 1 191 ? 19.885  -21.438 -48.722 1.00 25.09  ? 191 VAL B N    1 
ATOM   7719  C CA   . VAL B 1 191 ? 18.856  -22.420 -49.018 1.00 31.56  ? 191 VAL B CA   1 
ATOM   7720  C C    . VAL B 1 191 ? 18.994  -22.880 -50.470 1.00 38.88  ? 191 VAL B C    1 
ATOM   7721  O O    . VAL B 1 191 ? 19.671  -22.257 -51.294 1.00 31.77  ? 191 VAL B O    1 
ATOM   7722  C CB   . VAL B 1 191 ? 17.445  -21.871 -48.754 1.00 34.90  ? 191 VAL B CB   1 
ATOM   7723  C CG1  . VAL B 1 191 ? 17.350  -21.369 -47.337 1.00 29.75  ? 191 VAL B CG1  1 
ATOM   7724  C CG2  . VAL B 1 191 ? 17.136  -20.764 -49.721 1.00 28.06  ? 191 VAL B CG2  1 
ATOM   7725  H H    . VAL B 1 191 ? 19.922  -20.794 -49.291 1.00 30.06  ? 191 VAL B H    1 
ATOM   7726  H HA   . VAL B 1 191 ? 18.986  -23.193 -48.446 1.00 37.83  ? 191 VAL B HA   1 
ATOM   7727  H HB   . VAL B 1 191 ? 16.793  -22.578 -48.875 1.00 41.84  ? 191 VAL B HB   1 
ATOM   7728  H HG11 . VAL B 1 191 ? 16.456  -21.025 -47.183 1.00 35.65  ? 191 VAL B HG11 1 
ATOM   7729  H HG12 . VAL B 1 191 ? 17.531  -22.103 -46.730 1.00 35.65  ? 191 VAL B HG12 1 
ATOM   7730  H HG13 . VAL B 1 191 ? 18.003  -20.663 -47.208 1.00 35.65  ? 191 VAL B HG13 1 
ATOM   7731  H HG21 . VAL B 1 191 ? 16.244  -20.429 -49.542 1.00 33.64  ? 191 VAL B HG21 1 
ATOM   7732  H HG22 . VAL B 1 191 ? 17.787  -20.054 -49.606 1.00 33.64  ? 191 VAL B HG22 1 
ATOM   7733  H HG23 . VAL B 1 191 ? 17.184  -21.113 -50.625 1.00 33.64  ? 191 VAL B HG23 1 
ATOM   7734  N N    . GLN B 1 192 ? 18.333  -23.992 -50.774 1.00 33.46  ? 192 GLN B N    1 
ATOM   7735  C CA   . GLN B 1 192 ? 18.514  -24.680 -52.045 1.00 39.84  ? 192 GLN B CA   1 
ATOM   7736  C C    . GLN B 1 192 ? 17.518  -24.274 -53.117 1.00 45.81  ? 192 GLN B C    1 
ATOM   7737  O O    . GLN B 1 192 ? 17.630  -24.759 -54.245 1.00 50.94  ? 192 GLN B O    1 
ATOM   7738  C CB   . GLN B 1 192 ? 18.430  -26.182 -51.824 1.00 41.87  ? 192 GLN B CB   1 
ATOM   7739  C CG   . GLN B 1 192 ? 19.336  -26.669 -50.715 1.00 56.21  ? 192 GLN B CG   1 
ATOM   7740  C CD   . GLN B 1 192 ? 19.519  -28.184 -50.731 1.00 68.75  ? 192 GLN B CD   1 
ATOM   7741  O OE1  . GLN B 1 192 ? 18.552  -28.942 -50.707 1.00 66.62  ? 192 GLN B OE1  1 
ATOM   7742  N NE2  . GLN B 1 192 ? 20.766  -28.623 -50.792 1.00 68.92  ? 192 GLN B NE2  1 
ATOM   7743  H H    . GLN B 1 192 ? 17.766  -24.373 -50.251 1.00 40.11  ? 192 GLN B H    1 
ATOM   7744  H HA   . GLN B 1 192 ? 19.402  -24.481 -52.380 1.00 47.76  ? 192 GLN B HA   1 
ATOM   7745  H HB2  . GLN B 1 192 ? 17.518  -26.415 -51.588 1.00 50.21  ? 192 GLN B HB2  1 
ATOM   7746  H HB3  . GLN B 1 192 ? 18.687  -26.636 -52.641 1.00 50.21  ? 192 GLN B HB3  1 
ATOM   7747  H HG2  . GLN B 1 192 ? 20.210  -26.260 -50.818 1.00 67.41  ? 192 GLN B HG2  1 
ATOM   7748  H HG3  . GLN B 1 192 ? 18.952  -26.422 -49.860 1.00 67.41  ? 192 GLN B HG3  1 
ATOM   7749  H HE21 . GLN B 1 192 ? 21.419  -28.064 -50.811 1.00 82.66  ? 192 GLN B HE21 1 
ATOM   7750  H HE22 . GLN B 1 192 ? 20.924  -29.469 -50.806 1.00 82.66  ? 192 GLN B HE22 1 
ATOM   7751  N N    . GLU B 1 193 ? 16.584  -23.376 -52.817 1.00 40.57  ? 193 GLU B N    1 
ATOM   7752  C CA   . GLU B 1 193 ? 15.533  -22.965 -53.741 1.00 35.39  ? 193 GLU B CA   1 
ATOM   7753  C C    . GLU B 1 193 ? 15.910  -21.661 -54.440 1.00 39.30  ? 193 GLU B C    1 
ATOM   7754  O O    . GLU B 1 193 ? 15.531  -20.574 -54.009 1.00 47.81  ? 193 GLU B O    1 
ATOM   7755  C CB   . GLU B 1 193 ? 14.215  -22.817 -52.980 1.00 43.35  ? 193 GLU B CB   1 
ATOM   7756  C CG   . GLU B 1 193 ? 13.620  -24.182 -52.634 1.00 44.72  ? 193 GLU B CG   1 
ATOM   7757  C CD   . GLU B 1 193 ? 12.323  -24.162 -51.843 1.00 47.07  ? 193 GLU B CD   1 
ATOM   7758  O OE1  . GLU B 1 193 ? 11.579  -23.141 -51.846 1.00 49.22  ? 193 GLU B OE1  1 
ATOM   7759  O OE2  . GLU B 1 193 ? 12.057  -25.206 -51.196 1.00 51.75  ? 193 GLU B OE2  1 
ATOM   7760  H H    . GLU B 1 193 ? 16.538  -22.978 -52.056 1.00 48.64  ? 193 GLU B H    1 
ATOM   7761  H HA   . GLU B 1 193 ? 15.417  -23.650 -54.418 1.00 42.43  ? 193 GLU B HA   1 
ATOM   7762  H HB2  . GLU B 1 193 ? 14.374  -22.335 -52.153 1.00 51.98  ? 193 GLU B HB2  1 
ATOM   7763  H HB3  . GLU B 1 193 ? 13.578  -22.337 -53.532 1.00 51.98  ? 193 GLU B HB3  1 
ATOM   7764  H HG2  . GLU B 1 193 ? 13.447  -24.658 -53.461 1.00 53.62  ? 193 GLU B HG2  1 
ATOM   7765  H HG3  . GLU B 1 193 ? 14.271  -24.674 -52.109 1.00 53.62  ? 193 GLU B HG3  1 
ATOM   7766  N N    . VAL B 1 194 ? 16.589  -21.781 -55.578 1.00 38.95  ? 194 VAL B N    1 
ATOM   7767  C CA   . VAL B 1 194 ? 17.012  -20.608 -56.335 1.00 26.75  ? 194 VAL B CA   1 
ATOM   7768  C C    . VAL B 1 194 ? 15.811  -19.815 -56.838 1.00 34.84  ? 194 VAL B C    1 
ATOM   7769  O O    . VAL B 1 194 ? 15.743  -18.589 -56.687 1.00 35.36  ? 194 VAL B O    1 
ATOM   7770  C CB   . VAL B 1 194 ? 17.918  -21.036 -57.504 1.00 36.45  ? 194 VAL B CB   1 
ATOM   7771  C CG1  . VAL B 1 194 ? 18.124  -19.872 -58.446 1.00 32.36  ? 194 VAL B CG1  1 
ATOM   7772  C CG2  . VAL B 1 194 ? 19.235  -21.578 -56.994 1.00 36.30  ? 194 VAL B CG2  1 
ATOM   7773  H H    . VAL B 1 194 ? 16.816  -22.530 -55.933 1.00 46.70  ? 194 VAL B H    1 
ATOM   7774  H HA   . VAL B 1 194 ? 17.529  -20.028 -55.753 1.00 32.06  ? 194 VAL B HA   1 
ATOM   7775  H HB   . VAL B 1 194 ? 17.477  -21.744 -57.999 1.00 43.69  ? 194 VAL B HB   1 
ATOM   7776  H HG11 . VAL B 1 194 ? 18.696  -20.156 -59.177 1.00 38.79  ? 194 VAL B HG11 1 
ATOM   7777  H HG12 . VAL B 1 194 ? 17.263  -19.588 -58.790 1.00 38.79  ? 194 VAL B HG12 1 
ATOM   7778  H HG13 . VAL B 1 194 ? 18.544  -19.144 -57.961 1.00 38.79  ? 194 VAL B HG13 1 
ATOM   7779  H HG21 . VAL B 1 194 ? 19.783  -21.839 -57.751 1.00 43.52  ? 194 VAL B HG21 1 
ATOM   7780  H HG22 . VAL B 1 194 ? 19.684  -20.887 -56.482 1.00 43.52  ? 194 VAL B HG22 1 
ATOM   7781  H HG23 . VAL B 1 194 ? 19.061  -22.348 -56.430 1.00 43.52  ? 194 VAL B HG23 1 
ATOM   7782  N N    . ASP B 1 195 ? 14.882  -20.491 -57.516 1.00 34.89  ? 195 ASP B N    1 
ATOM   7783  C CA   . ASP B 1 195 ? 13.738  -19.805 -58.107 1.00 33.29  ? 195 ASP B CA   1 
ATOM   7784  C C    . ASP B 1 195 ? 12.939  -19.074 -57.029 1.00 34.21  ? 195 ASP B C    1 
ATOM   7785  O O    . ASP B 1 195 ? 12.525  -17.928 -57.216 1.00 31.14  ? 195 ASP B O    1 
ATOM   7786  C CB   . ASP B 1 195 ? 12.840  -20.822 -58.847 1.00 40.91  ? 195 ASP B CB   1 
ATOM   7787  C CG   . ASP B 1 195 ? 13.374  -21.221 -60.215 1.00 49.30  ? 195 ASP B CG   1 
ATOM   7788  O OD1  . ASP B 1 195 ? 14.605  -21.174 -60.427 1.00 63.68  ? 195 ASP B OD1  1 
ATOM   7789  O OD2  . ASP B 1 195 ? 12.554  -21.594 -61.098 1.00 57.41  ? 195 ASP B OD2  1 
ATOM   7790  H H    . ASP B 1 195 ? 14.893  -21.341 -57.646 1.00 41.83  ? 195 ASP B H    1 
ATOM   7791  H HA   . ASP B 1 195 ? 14.053  -19.151 -58.750 1.00 39.91  ? 195 ASP B HA   1 
ATOM   7792  H HB2  . ASP B 1 195 ? 12.767  -21.626 -58.310 1.00 49.05  ? 195 ASP B HB2  1 
ATOM   7793  H HB3  . ASP B 1 195 ? 11.961  -20.430 -58.974 1.00 49.05  ? 195 ASP B HB3  1 
ATOM   7794  N N    . THR B 1 196 ? 12.732  -19.718 -55.885 1.00 29.78  ? 196 THR B N    1 
ATOM   7795  C CA   . THR B 1 196 ? 11.911  -19.124 -54.830 1.00 36.02  ? 196 THR B CA   1 
ATOM   7796  C C    . THR B 1 196 ? 12.571  -17.883 -54.243 1.00 36.25  ? 196 THR B C    1 
ATOM   7797  O O    . THR B 1 196 ? 11.932  -16.840 -54.074 1.00 36.88  ? 196 THR B O    1 
ATOM   7798  C CB   . THR B 1 196 ? 11.662  -20.143 -53.730 1.00 38.66  ? 196 THR B CB   1 
ATOM   7799  O OG1  . THR B 1 196 ? 11.116  -21.350 -54.296 1.00 43.40  ? 196 THR B OG1  1 
ATOM   7800  C CG2  . THR B 1 196 ? 10.671  -19.582 -52.739 1.00 48.75  ? 196 THR B CG2  1 
ATOM   7801  H H    . THR B 1 196 ? 13.052  -20.493 -55.695 1.00 35.69  ? 196 THR B H    1 
ATOM   7802  H HA   . THR B 1 196 ? 11.054  -18.864 -55.201 1.00 43.19  ? 196 THR B HA   1 
ATOM   7803  H HB   . THR B 1 196 ? 12.491  -20.340 -53.268 1.00 46.35  ? 196 THR B HB   1 
ATOM   7804  H HG1  . THR B 1 196 ? 10.977  -21.915 -53.689 1.00 52.03  ? 196 THR B HG1  1 
ATOM   7805  H HG21 . THR B 1 196 ? 10.507  -20.227 -52.033 1.00 58.46  ? 196 THR B HG21 1 
ATOM   7806  H HG22 . THR B 1 196 ? 11.021  -18.767 -52.346 1.00 58.46  ? 196 THR B HG22 1 
ATOM   7807  H HG23 . THR B 1 196 ? 9.833   -19.382 -53.185 1.00 58.46  ? 196 THR B HG23 1 
ATOM   7808  N N    . VAL B 1 197 ? 13.847  -17.989 -53.901 1.00 36.31  ? 197 VAL B N    1 
ATOM   7809  C CA   . VAL B 1 197 ? 14.576  -16.836 -53.407 1.00 29.55  ? 197 VAL B CA   1 
ATOM   7810  C C    . VAL B 1 197 ? 14.417  -15.686 -54.380 1.00 35.57  ? 197 VAL B C    1 
ATOM   7811  O O    . VAL B 1 197 ? 14.201  -14.536 -53.979 1.00 39.01  ? 197 VAL B O    1 
ATOM   7812  C CB   . VAL B 1 197 ? 16.060  -17.214 -53.190 1.00 31.32  ? 197 VAL B CB   1 
ATOM   7813  C CG1  . VAL B 1 197 ? 16.959  -15.976 -52.945 1.00 30.76  ? 197 VAL B CG1  1 
ATOM   7814  C CG2  . VAL B 1 197 ? 16.165  -18.168 -52.017 1.00 28.85  ? 197 VAL B CG2  1 
ATOM   7815  H H    . VAL B 1 197 ? 14.309  -18.713 -53.945 1.00 43.53  ? 197 VAL B H    1 
ATOM   7816  H HA   . VAL B 1 197 ? 14.204  -16.564 -52.553 1.00 35.42  ? 197 VAL B HA   1 
ATOM   7817  H HB   . VAL B 1 197 ? 16.389  -17.672 -53.979 1.00 37.55  ? 197 VAL B HB   1 
ATOM   7818  H HG11 . VAL B 1 197 ? 17.874  -16.271 -52.816 1.00 36.87  ? 197 VAL B HG11 1 
ATOM   7819  H HG12 . VAL B 1 197 ? 16.905  -15.390 -53.716 1.00 36.87  ? 197 VAL B HG12 1 
ATOM   7820  H HG13 . VAL B 1 197 ? 16.646  -15.511 -52.153 1.00 36.87  ? 197 VAL B HG13 1 
ATOM   7821  H HG21 . VAL B 1 197 ? 17.097  -18.403 -51.884 1.00 34.58  ? 197 VAL B HG21 1 
ATOM   7822  H HG22 . VAL B 1 197 ? 15.817  -17.732 -51.224 1.00 34.58  ? 197 VAL B HG22 1 
ATOM   7823  H HG23 . VAL B 1 197 ? 15.647  -18.965 -52.211 1.00 34.58  ? 197 VAL B HG23 1 
ATOM   7824  N N    . GLU B 1 198 ? 14.488  -15.984 -55.677 1.00 31.91  ? 198 GLU B N    1 
ATOM   7825  C CA   . GLU B 1 198 ? 14.627  -14.939 -56.679 1.00 29.14  ? 198 GLU B CA   1 
ATOM   7826  C C    . GLU B 1 198 ? 13.306  -14.283 -57.013 1.00 25.89  ? 198 GLU B C    1 
ATOM   7827  O O    . GLU B 1 198 ? 13.263  -13.081 -57.296 1.00 30.28  ? 198 GLU B O    1 
ATOM   7828  C CB   . GLU B 1 198 ? 15.238  -15.506 -57.962 1.00 31.88  ? 198 GLU B CB   1 
ATOM   7829  C CG   . GLU B 1 198 ? 15.774  -14.415 -58.964 1.00 27.97  ? 198 GLU B CG   1 
ATOM   7830  C CD   . GLU B 1 198 ? 16.529  -15.036 -60.120 1.00 34.39  ? 198 GLU B CD   1 
ATOM   7831  O OE1  . GLU B 1 198 ? 16.596  -16.288 -60.150 1.00 33.51  ? 198 GLU B OE1  1 
ATOM   7832  O OE2  . GLU B 1 198 ? 17.039  -14.294 -60.979 1.00 29.17  ? 198 GLU B OE2  1 
ATOM   7833  H H    . GLU B 1 198 ? 14.459  -16.781 -55.998 1.00 38.25  ? 198 GLU B H    1 
ATOM   7834  H HA   . GLU B 1 198 ? 15.225  -14.254 -56.339 1.00 34.93  ? 198 GLU B HA   1 
ATOM   7835  H HB2  . GLU B 1 198 ? 15.984  -16.079 -57.724 1.00 38.22  ? 198 GLU B HB2  1 
ATOM   7836  H HB3  . GLU B 1 198 ? 14.562  -16.025 -58.425 1.00 38.22  ? 198 GLU B HB3  1 
ATOM   7837  H HG2  . GLU B 1 198 ? 15.024  -13.917 -59.325 1.00 33.53  ? 198 GLU B HG2  1 
ATOM   7838  H HG3  . GLU B 1 198 ? 16.377  -13.818 -58.494 1.00 33.53  ? 198 GLU B HG3  1 
ATOM   7839  N N    . ILE B 1 199 ? 12.222  -15.061 -57.035 1.00 28.72  ? 199 ILE B N    1 
ATOM   7840  C CA   . ILE B 1 199 ? 10.960  -14.499 -57.483 1.00 24.92  ? 199 ILE B CA   1 
ATOM   7841  C C    . ILE B 1 199 ? 10.439  -13.515 -56.448 1.00 24.66  ? 199 ILE B C    1 
ATOM   7842  O O    . ILE B 1 199 ? 9.772   -12.532 -56.802 1.00 28.58  ? 199 ILE B O    1 
ATOM   7843  C CB   . ILE B 1 199 ? 9.966   -15.634 -57.782 1.00 34.09  ? 199 ILE B CB   1 
ATOM   7844  C CG1  . ILE B 1 199 ? 8.779   -15.122 -58.571 1.00 30.76  ? 199 ILE B CG1  1 
ATOM   7845  C CG2  . ILE B 1 199 ? 9.478   -16.288 -56.506 1.00 29.12  ? 199 ILE B CG2  1 
ATOM   7846  C CD1  . ILE B 1 199 ? 9.000   -15.123 -59.977 1.00 41.47  ? 199 ILE B CD1  1 
ATOM   7847  H H    . ILE B 1 199 ? 12.195  -15.889 -56.803 1.00 34.42  ? 199 ILE B H    1 
ATOM   7848  H HA   . ILE B 1 199 ? 11.110  -14.011 -58.307 1.00 29.86  ? 199 ILE B HA   1 
ATOM   7849  H HB   . ILE B 1 199 ? 10.420  -16.305 -58.315 1.00 40.87  ? 199 ILE B HB   1 
ATOM   7850  H HG12 . ILE B 1 199 ? 8.012   -15.688 -58.389 1.00 36.87  ? 199 ILE B HG12 1 
ATOM   7851  H HG13 . ILE B 1 199 ? 8.589   -14.211 -58.299 1.00 36.87  ? 199 ILE B HG13 1 
ATOM   7852  H HG21 . ILE B 1 199 ? 8.856   -16.996 -56.733 1.00 34.90  ? 199 ILE B HG21 1 
ATOM   7853  H HG22 . ILE B 1 199 ? 10.239  -16.656 -56.030 1.00 34.90  ? 199 ILE B HG22 1 
ATOM   7854  H HG23 . ILE B 1 199 ? 9.036   -15.620 -55.959 1.00 34.90  ? 199 ILE B HG23 1 
ATOM   7855  H HD11 . ILE B 1 199 ? 8.206   -14.786 -60.421 1.00 49.72  ? 199 ILE B HD11 1 
ATOM   7856  H HD12 . ILE B 1 199 ? 9.758   -14.553 -60.178 1.00 49.72  ? 199 ILE B HD12 1 
ATOM   7857  H HD13 . ILE B 1 199 ? 9.181   -16.030 -60.268 1.00 49.72  ? 199 ILE B HD13 1 
ATOM   7858  N N    . CYS B 1 200 ? 10.760  -13.734 -55.162 1.00 19.53  ? 200 CYS B N    1 
ATOM   7859  C CA   . CYS B 1 200 ? 10.299  -12.819 -54.118 1.00 25.44  ? 200 CYS B CA   1 
ATOM   7860  C C    . CYS B 1 200 ? 10.563  -11.378 -54.485 1.00 28.36  ? 200 CYS B C    1 
ATOM   7861  O O    . CYS B 1 200 ? 9.734   -10.498 -54.228 1.00 28.13  ? 200 CYS B O    1 
ATOM   7862  C CB   . CYS B 1 200 ? 10.983  -13.134 -52.804 1.00 27.53  ? 200 CYS B CB   1 
ATOM   7863  S SG   . CYS B 1 200 ? 10.358  -14.624 -52.033 1.00 34.16  ? 200 CYS B SG   1 
ATOM   7864  H H    . CYS B 1 200 ? 11.234  -14.393 -54.878 1.00 23.40  ? 200 CYS B H    1 
ATOM   7865  H HA   . CYS B 1 200 ? 9.343   -12.930 -53.997 1.00 30.48  ? 200 CYS B HA   1 
ATOM   7866  H HB2  . CYS B 1 200 ? 11.932  -13.254 -52.963 1.00 33.00  ? 200 CYS B HB2  1 
ATOM   7867  H HB3  . CYS B 1 200 ? 10.841  -12.396 -52.190 1.00 33.00  ? 200 CYS B HB3  1 
ATOM   7868  H HG   . CYS B 1 200 ? 10.535  -15.551 -52.774 1.00 40.95  ? 200 CYS B HG   1 
ATOM   7869  N N    . GLY B 1 201 ? 11.721  -11.119 -55.095 1.00 27.81  ? 201 GLY B N    1 
ATOM   7870  C CA   . GLY B 1 201 ? 12.140  -9.748  -55.306 1.00 27.06  ? 201 GLY B CA   1 
ATOM   7871  C C    . GLY B 1 201 ? 11.195  -8.979  -56.185 1.00 32.41  ? 201 GLY B C    1 
ATOM   7872  O O    . GLY B 1 201 ? 11.004  -7.785  -55.987 1.00 48.68  ? 201 GLY B O    1 
ATOM   7873  H H    . GLY B 1 201 ? 12.269  -11.713 -55.389 1.00 33.33  ? 201 GLY B H    1 
ATOM   7874  H HA2  . GLY B 1 201 ? 12.200  -9.294  -54.451 1.00 32.43  ? 201 GLY B HA2  1 
ATOM   7875  H HA3  . GLY B 1 201 ? 13.018  -9.739  -55.720 1.00 32.43  ? 201 GLY B HA3  1 
ATOM   7876  N N    . ALA B 1 202 ? 10.577  -9.642  -57.164 1.00 33.96  ? 202 ALA B N    1 
ATOM   7877  C CA   . ALA B 1 202 ? 9.618   -8.927  -58.007 1.00 28.43  ? 202 ALA B CA   1 
ATOM   7878  C C    . ALA B 1 202 ? 8.234   -8.904  -57.382 1.00 34.20  ? 202 ALA B C    1 
ATOM   7879  O O    . ALA B 1 202 ? 7.529   -7.893  -57.468 1.00 33.62  ? 202 ALA B O    1 
ATOM   7880  C CB   . ALA B 1 202 ? 9.541   -9.551  -59.391 1.00 41.64  ? 202 ALA B CB   1 
ATOM   7881  H H    . ALA B 1 202 ? 10.689  -10.473 -57.356 1.00 40.72  ? 202 ALA B H    1 
ATOM   7882  H HA   . ALA B 1 202 ? 9.914   -8.009  -58.109 1.00 34.07  ? 202 ALA B HA   1 
ATOM   7883  H HB1  . ALA B 1 202 ? 8.899   -9.057  -59.925 1.00 49.93  ? 202 ALA B HB1  1 
ATOM   7884  H HB2  . ALA B 1 202 ? 10.418  -9.510  -59.805 1.00 49.93  ? 202 ALA B HB2  1 
ATOM   7885  H HB3  . ALA B 1 202 ? 9.259   -10.475 -59.305 1.00 49.93  ? 202 ALA B HB3  1 
ATOM   7886  N N    . LEU B 1 203 ? 7.839   -9.979  -56.715 1.00 27.59  ? 203 LEU B N    1 
ATOM   7887  C CA   . LEU B 1 203 ? 6.468   -10.020 -56.221 1.00 24.48  ? 203 LEU B CA   1 
ATOM   7888  C C    . LEU B 1 203 ? 6.276   -9.037  -55.087 1.00 29.52  ? 203 LEU B C    1 
ATOM   7889  O O    . LEU B 1 203 ? 5.250   -8.349  -55.025 1.00 31.02  ? 203 LEU B O    1 
ATOM   7890  C CB   . LEU B 1 203 ? 6.132   -11.447 -55.818 1.00 24.75  ? 203 LEU B CB   1 
ATOM   7891  C CG   . LEU B 1 203 ? 6.209   -12.384 -57.049 1.00 23.66  ? 203 LEU B CG   1 
ATOM   7892  C CD1  . LEU B 1 203 ? 5.978   -13.817 -56.734 1.00 25.99  ? 203 LEU B CD1  1 
ATOM   7893  C CD2  . LEU B 1 203 ? 5.194   -11.968 -58.135 1.00 30.43  ? 203 LEU B CD2  1 
ATOM   7894  H H    . LEU B 1 203 ? 8.320   -10.670 -56.541 1.00 33.06  ? 203 LEU B H    1 
ATOM   7895  H HA   . LEU B 1 203 ? 5.868   -9.765  -56.939 1.00 29.33  ? 203 LEU B HA   1 
ATOM   7896  H HB2  . LEU B 1 203 ? 6.770   -11.756 -55.155 1.00 29.66  ? 203 LEU B HB2  1 
ATOM   7897  H HB3  . LEU B 1 203 ? 5.230   -11.480 -55.462 1.00 29.66  ? 203 LEU B HB3  1 
ATOM   7898  H HG   . LEU B 1 203 ? 7.096   -12.310 -57.436 1.00 28.34  ? 203 LEU B HG   1 
ATOM   7899  H HD11 . LEU B 1 203 ? 6.043   -14.334 -57.552 1.00 31.15  ? 203 LEU B HD11 1 
ATOM   7900  H HD12 . LEU B 1 203 ? 6.651   -14.113 -56.101 1.00 31.15  ? 203 LEU B HD12 1 
ATOM   7901  H HD13 . LEU B 1 203 ? 5.094   -13.916 -56.348 1.00 31.15  ? 203 LEU B HD13 1 
ATOM   7902  H HD21 . LEU B 1 203 ? 5.271   -12.574 -58.888 1.00 36.47  ? 203 LEU B HD21 1 
ATOM   7903  H HD22 . LEU B 1 203 ? 4.299   -12.013 -57.763 1.00 36.47  ? 203 LEU B HD22 1 
ATOM   7904  H HD23 . LEU B 1 203 ? 5.389   -11.061 -58.418 1.00 36.47  ? 203 LEU B HD23 1 
ATOM   7905  N N    . LYS B 1 204 ? 7.286   -8.908  -54.224 1.00 26.36  ? 204 LYS B N    1 
ATOM   7906  C CA   . LYS B 1 204 ? 7.166   -8.065  -53.043 1.00 27.23  ? 204 LYS B CA   1 
ATOM   7907  C C    . LYS B 1 204 ? 6.751   -6.648  -53.414 1.00 29.43  ? 204 LYS B C    1 
ATOM   7908  O O    . LYS B 1 204 ? 6.019   -5.997  -52.659 1.00 24.90  ? 204 LYS B O    1 
ATOM   7909  C CB   . LYS B 1 204 ? 8.498   -8.051  -52.261 1.00 29.63  ? 204 LYS B CB   1 
ATOM   7910  C CG   . LYS B 1 204 ? 9.488   -7.038  -52.780 1.00 30.38  ? 204 LYS B CG   1 
ATOM   7911  C CD   . LYS B 1 204 ? 10.830  -7.097  -52.124 1.00 32.88  ? 204 LYS B CD   1 
ATOM   7912  C CE   . LYS B 1 204 ? 11.809  -6.236  -52.896 1.00 25.78  ? 204 LYS B CE   1 
ATOM   7913  N NZ   . LYS B 1 204 ? 11.619  -4.825  -52.664 1.00 26.98  ? 204 LYS B NZ   1 
ATOM   7914  H H    . LYS B 1 204 ? 8.048   -9.299  -54.302 1.00 31.59  ? 204 LYS B H    1 
ATOM   7915  H HA   . LYS B 1 204 ? 6.482   -8.433  -52.462 1.00 32.63  ? 204 LYS B HA   1 
ATOM   7916  H HB2  . LYS B 1 204 ? 8.315   -7.839  -51.332 1.00 35.51  ? 204 LYS B HB2  1 
ATOM   7917  H HB3  . LYS B 1 204 ? 8.908   -8.928  -52.324 1.00 35.51  ? 204 LYS B HB3  1 
ATOM   7918  H HG2  . LYS B 1 204 ? 9.617   -7.189  -53.730 1.00 36.42  ? 204 LYS B HG2  1 
ATOM   7919  H HG3  . LYS B 1 204 ? 9.128   -6.149  -52.636 1.00 36.42  ? 204 LYS B HG3  1 
ATOM   7920  H HD2  . LYS B 1 204 ? 10.765  -6.757  -51.218 1.00 39.41  ? 204 LYS B HD2  1 
ATOM   7921  H HD3  . LYS B 1 204 ? 11.154  -8.012  -52.124 1.00 39.41  ? 204 LYS B HD3  1 
ATOM   7922  H HE2  . LYS B 1 204 ? 12.712  -6.465  -52.626 1.00 30.89  ? 204 LYS B HE2  1 
ATOM   7923  H HE3  . LYS B 1 204 ? 11.694  -6.401  -53.845 1.00 30.89  ? 204 LYS B HE3  1 
ATOM   7924  H HZ1  . LYS B 1 204 ? 12.212  -4.356  -53.134 1.00 32.34  ? 204 LYS B HZ1  1 
ATOM   7925  H HZ2  . LYS B 1 204 ? 10.798  -4.584  -52.910 1.00 32.34  ? 204 LYS B HZ2  1 
ATOM   7926  H HZ3  . LYS B 1 204 ? 11.726  -4.642  -51.799 1.00 32.34  ? 204 LYS B HZ3  1 
ATOM   7927  N N    . ASN B 1 205 ? 7.171   -6.163  -54.584 1.00 22.65  ? 205 ASN B N    1 
ATOM   7928  C CA   . ASN B 1 205 ? 6.832   -4.787  -54.966 1.00 29.75  ? 205 ASN B CA   1 
ATOM   7929  C C    . ASN B 1 205 ? 5.362   -4.630  -55.356 1.00 29.67  ? 205 ASN B C    1 
ATOM   7930  O O    . ASN B 1 205 ? 4.810   -3.530  -55.243 1.00 31.41  ? 205 ASN B O    1 
ATOM   7931  C CB   . ASN B 1 205 ? 7.721   -4.319  -56.124 1.00 32.50  ? 205 ASN B CB   1 
ATOM   7932  C CG   . ASN B 1 205 ? 9.160   -4.216  -55.715 1.00 38.74  ? 205 ASN B CG   1 
ATOM   7933  O OD1  . ASN B 1 205 ? 9.446   -3.919  -54.567 1.00 31.11  ? 205 ASN B OD1  1 
ATOM   7934  N ND2  . ASN B 1 205 ? 10.067  -4.457  -56.641 1.00 38.76  ? 205 ASN B ND2  1 
ATOM   7935  H H    . ASN B 1 205 ? 7.641   -6.595  -55.161 1.00 27.14  ? 205 ASN B H    1 
ATOM   7936  H HA   . ASN B 1 205 ? 7.001   -4.204  -54.210 1.00 35.66  ? 205 ASN B HA   1 
ATOM   7937  H HB2  . ASN B 1 205 ? 7.658   -4.956  -56.853 1.00 38.96  ? 205 ASN B HB2  1 
ATOM   7938  H HB3  . ASN B 1 205 ? 7.427   -3.443  -56.418 1.00 38.96  ? 205 ASN B HB3  1 
ATOM   7939  H HD21 . ASN B 1 205 ? 10.903  -4.409  -56.447 1.00 46.47  ? 205 ASN B HD21 1 
ATOM   7940  H HD22 . ASN B 1 205 ? 9.822   -4.664  -57.440 1.00 46.47  ? 205 ASN B HD22 1 
ATOM   7941  N N    . VAL B 1 206 ? 4.711   -5.694  -55.815 1.00 27.05  ? 206 VAL B N    1 
ATOM   7942  C CA   . VAL B 1 206 ? 3.267   -5.604  -56.024 1.00 26.05  ? 206 VAL B CA   1 
ATOM   7943  C C    . VAL B 1 206 ? 2.556   -5.432  -54.681 1.00 27.78  ? 206 VAL B C    1 
ATOM   7944  O O    . VAL B 1 206 ? 1.690   -4.567  -54.517 1.00 24.40  ? 206 VAL B O    1 
ATOM   7945  C CB   . VAL B 1 206 ? 2.746   -6.834  -56.783 1.00 28.80  ? 206 VAL B CB   1 
ATOM   7946  C CG1  . VAL B 1 206 ? 1.293   -6.624  -57.119 1.00 24.47  ? 206 VAL B CG1  1 
ATOM   7947  C CG2  . VAL B 1 206 ? 3.554   -7.074  -58.060 1.00 26.02  ? 206 VAL B CG2  1 
ATOM   7948  H H    . VAL B 1 206 ? 5.065   -6.455  -56.006 1.00 32.42  ? 206 VAL B H    1 
ATOM   7949  H HA   . VAL B 1 206 ? 3.078   -4.820  -56.563 1.00 31.22  ? 206 VAL B HA   1 
ATOM   7950  H HB   . VAL B 1 206 ? 2.821   -7.619  -56.218 1.00 34.52  ? 206 VAL B HB   1 
ATOM   7951  H HG11 . VAL B 1 206 ? 0.964   -7.400  -57.598 1.00 29.32  ? 206 VAL B HG11 1 
ATOM   7952  H HG12 . VAL B 1 206 ? 0.793   -6.505  -56.297 1.00 29.32  ? 206 VAL B HG12 1 
ATOM   7953  H HG13 . VAL B 1 206 ? 1.209   -5.832  -57.674 1.00 29.32  ? 206 VAL B HG13 1 
ATOM   7954  H HG21 . VAL B 1 206 ? 3.201   -7.855  -58.515 1.00 31.19  ? 206 VAL B HG21 1 
ATOM   7955  H HG22 . VAL B 1 206 ? 3.477   -6.295  -58.633 1.00 31.19  ? 206 VAL B HG22 1 
ATOM   7956  H HG23 . VAL B 1 206 ? 4.483   -7.220  -57.823 1.00 31.19  ? 206 VAL B HG23 1 
ATOM   7957  N N    . VAL B 1 207 ? 2.935   -6.242  -53.695 1.00 26.65  ? 207 VAL B N    1 
ATOM   7958  C CA   . VAL B 1 207 ? 2.348   -6.123  -52.370 1.00 19.66  ? 207 VAL B CA   1 
ATOM   7959  C C    . VAL B 1 207 ? 2.578   -4.729  -51.815 1.00 24.85  ? 207 VAL B C    1 
ATOM   7960  O O    . VAL B 1 207 ? 1.673   -4.142  -51.212 1.00 25.15  ? 207 VAL B O    1 
ATOM   7961  C CB   . VAL B 1 207 ? 2.890   -7.225  -51.445 1.00 22.93  ? 207 VAL B CB   1 
ATOM   7962  C CG1  . VAL B 1 207 ? 2.237   -7.110  -50.052 1.00 27.00  ? 207 VAL B CG1  1 
ATOM   7963  C CG2  . VAL B 1 207 ? 2.609   -8.563  -52.037 1.00 24.09  ? 207 VAL B CG2  1 
ATOM   7964  H H    . VAL B 1 207 ? 3.525   -6.863  -53.770 1.00 31.93  ? 207 VAL B H    1 
ATOM   7965  H HA   . VAL B 1 207 ? 1.389   -6.251  -52.446 1.00 23.55  ? 207 VAL B HA   1 
ATOM   7966  H HB   . VAL B 1 207 ? 3.850   -7.125  -51.346 1.00 27.47  ? 207 VAL B HB   1 
ATOM   7967  H HG11 . VAL B 1 207 ? 2.588   -7.811  -49.480 1.00 32.36  ? 207 VAL B HG11 1 
ATOM   7968  H HG12 . VAL B 1 207 ? 2.446   -6.240  -49.676 1.00 32.36  ? 207 VAL B HG12 1 
ATOM   7969  H HG13 . VAL B 1 207 ? 1.277   -7.208  -50.144 1.00 32.36  ? 207 VAL B HG13 1 
ATOM   7970  H HG21 . VAL B 1 207 ? 2.955   -9.249  -51.444 1.00 28.87  ? 207 VAL B HG21 1 
ATOM   7971  H HG22 . VAL B 1 207 ? 1.650   -8.667  -52.140 1.00 28.87  ? 207 VAL B HG22 1 
ATOM   7972  H HG23 . VAL B 1 207 ? 3.043   -8.622  -52.902 1.00 28.87  ? 207 VAL B HG23 1 
ATOM   7973  N N    . ALA B 1 208 ? 3.774   -4.138  -52.042 1.00 27.87  ? 208 ALA B N    1 
ATOM   7974  C CA   . ALA B 1 208 ? 4.028   -2.846  -51.393 1.00 23.55  ? 208 ALA B CA   1 
ATOM   7975  C C    . ALA B 1 208 ? 3.165   -1.743  -51.989 1.00 22.22  ? 208 ALA B C    1 
ATOM   7976  O O    . ALA B 1 208 ? 2.850   -0.763  -51.306 1.00 23.98  ? 208 ALA B O    1 
ATOM   7977  C CB   . ALA B 1 208 ? 5.499   -2.450  -51.468 1.00 34.48  ? 208 ALA B CB   1 
ATOM   7978  H H    . ALA B 1 208 ? 4.409   -4.445  -52.535 1.00 33.40  ? 208 ALA B H    1 
ATOM   7979  H HA   . ALA B 1 208 ? 3.795   -2.923  -50.455 1.00 28.22  ? 208 ALA B HA   1 
ATOM   7980  H HB1  . ALA B 1 208 ? 5.617   -1.594  -51.028 1.00 41.34  ? 208 ALA B HB1  1 
ATOM   7981  H HB2  . ALA B 1 208 ? 6.031   -3.128  -51.023 1.00 41.34  ? 208 ALA B HB2  1 
ATOM   7982  H HB3  . ALA B 1 208 ? 5.760   -2.383  -52.400 1.00 41.34  ? 208 ALA B HB3  1 
ATOM   7983  N N    . VAL B 1 209 ? 2.771   -1.863  -53.253 1.00 27.43  ? 209 VAL B N    1 
ATOM   7984  C CA   . VAL B 1 209 ? 1.827   -0.895  -53.802 1.00 21.01  ? 209 VAL B CA   1 
ATOM   7985  C C    . VAL B 1 209 ? 0.490   -1.011  -53.068 1.00 25.97  ? 209 VAL B C    1 
ATOM   7986  O O    . VAL B 1 209 ? -0.079  -0.012  -52.614 1.00 32.01  ? 209 VAL B O    1 
ATOM   7987  C CB   . VAL B 1 209 ? 1.675   -1.072  -55.322 1.00 20.85  ? 209 VAL B CB   1 
ATOM   7988  C CG1  . VAL B 1 209 ? 0.556   -0.220  -55.816 1.00 24.22  ? 209 VAL B CG1  1 
ATOM   7989  C CG2  . VAL B 1 209 ? 2.987   -0.676  -56.060 1.00 28.17  ? 209 VAL B CG2  1 
ATOM   7990  H H    . VAL B 1 209 ? 3.026   -2.476  -53.800 1.00 32.88  ? 209 VAL B H    1 
ATOM   7991  H HA   . VAL B 1 209 ? 2.171   -0.003  -53.644 1.00 25.16  ? 209 VAL B HA   1 
ATOM   7992  H HB   . VAL B 1 209 ? 1.473   -1.999  -55.524 1.00 24.98  ? 209 VAL B HB   1 
ATOM   7993  H HG11 . VAL B 1 209 ? 0.469   -0.339  -56.775 1.00 29.03  ? 209 VAL B HG11 1 
ATOM   7994  H HG12 . VAL B 1 209 ? -0.264  -0.489  -55.373 1.00 29.03  ? 209 VAL B HG12 1 
ATOM   7995  H HG13 . VAL B 1 209 ? 0.753   0.708   -55.614 1.00 29.03  ? 209 VAL B HG13 1 
ATOM   7996  H HG21 . VAL B 1 209 ? 2.861   -0.797  -57.014 1.00 33.76  ? 209 VAL B HG21 1 
ATOM   7997  H HG22 . VAL B 1 209 ? 3.188   0.254   -55.869 1.00 33.76  ? 209 VAL B HG22 1 
ATOM   7998  H HG23 . VAL B 1 209 ? 3.709   -1.242  -55.747 1.00 33.76  ? 209 VAL B HG23 1 
ATOM   7999  N N    . GLY B 1 210 ? -0.003  -2.236  -52.890 1.00 25.95  ? 210 GLY B N    1 
ATOM   8000  C CA   . GLY B 1 210 ? -1.207  -2.411  -52.094 1.00 25.66  ? 210 GLY B CA   1 
ATOM   8001  C C    . GLY B 1 210 ? -1.046  -1.867  -50.687 1.00 23.33  ? 210 GLY B C    1 
ATOM   8002  O O    . GLY B 1 210 ? -1.954  -1.211  -50.152 1.00 29.42  ? 210 GLY B O    1 
ATOM   8003  H H    . GLY B 1 210 ? 0.332   -2.961  -53.211 1.00 31.10  ? 210 GLY B H    1 
ATOM   8004  H HA2  . GLY B 1 210 ? -1.947  -1.951  -52.520 1.00 30.75  ? 210 GLY B HA2  1 
ATOM   8005  H HA3  . GLY B 1 210 ? -1.423  -3.355  -52.036 1.00 30.75  ? 210 GLY B HA3  1 
ATOM   8006  N N    . ALA B 1 211 ? 0.107   -2.137  -50.064 1.00 20.07  ? 211 ALA B N    1 
ATOM   8007  C CA   . ALA B 1 211 ? 0.385   -1.597  -48.731 1.00 22.31  ? 211 ALA B CA   1 
ATOM   8008  C C    . ALA B 1 211 ? 0.290   -0.090  -48.740 1.00 28.00  ? 211 ALA B C    1 
ATOM   8009  O O    . ALA B 1 211 ? -0.292  0.514   -47.835 1.00 28.01  ? 211 ALA B O    1 
ATOM   8010  C CB   . ALA B 1 211 ? 1.766   -2.058  -48.255 1.00 29.58  ? 211 ALA B CB   1 
ATOM   8011  H H    . ALA B 1 211 ? 0.736   -2.625  -50.388 1.00 24.04  ? 211 ALA B H    1 
ATOM   8012  H HA   . ALA B 1 211 ? -0.276  -1.936  -48.108 1.00 26.73  ? 211 ALA B HA   1 
ATOM   8013  H HB1  . ALA B 1 211 ? 1.933   -1.692  -47.372 1.00 35.45  ? 211 ALA B HB1  1 
ATOM   8014  H HB2  . ALA B 1 211 ? 1.780   -3.027  -48.219 1.00 35.45  ? 211 ALA B HB2  1 
ATOM   8015  H HB3  . ALA B 1 211 ? 2.437   -1.740  -48.878 1.00 35.45  ? 211 ALA B HB3  1 
ATOM   8016  N N    . GLY B 1 212 ? 0.826   0.545   -49.773 1.00 27.96  ? 212 GLY B N    1 
ATOM   8017  C CA   . GLY B 1 212 ? 0.718   1.990   -49.843 1.00 28.90  ? 212 GLY B CA   1 
ATOM   8018  C C    . GLY B 1 212 ? -0.711  2.451   -50.069 1.00 27.96  ? 212 GLY B C    1 
ATOM   8019  O O    . GLY B 1 212 ? -1.126  3.492   -49.549 1.00 27.03  ? 212 GLY B O    1 
ATOM   8020  H H    . GLY B 1 212 ? 1.245   0.175   -50.427 1.00 33.51  ? 212 GLY B H    1 
ATOM   8021  H HA2  . GLY B 1 212 ? 1.040   2.379   -49.015 1.00 34.64  ? 212 GLY B HA2  1 
ATOM   8022  H HA3  . GLY B 1 212 ? 1.267   2.320   -50.572 1.00 34.64  ? 212 GLY B HA3  1 
ATOM   8023  N N    . PHE B 1 213 ? -1.465  1.715   -50.888 1.00 25.05  ? 213 PHE B N    1 
ATOM   8024  C CA   . PHE B 1 213 ? -2.883  2.043   -51.049 1.00 28.57  ? 213 PHE B CA   1 
ATOM   8025  C C    . PHE B 1 213 ? -3.582  2.047   -49.703 1.00 27.59  ? 213 PHE B C    1 
ATOM   8026  O O    . PHE B 1 213 ? -4.351  2.969   -49.388 1.00 25.63  ? 213 PHE B O    1 
ATOM   8027  C CB   . PHE B 1 213 ? -3.564  1.047   -51.983 1.00 28.48  ? 213 PHE B CB   1 
ATOM   8028  C CG   . PHE B 1 213 ? -3.170  1.166   -53.445 1.00 29.36  ? 213 PHE B CG   1 
ATOM   8029  C CD1  . PHE B 1 213 ? -2.458  2.251   -53.924 1.00 29.46  ? 213 PHE B CD1  1 
ATOM   8030  C CD2  . PHE B 1 213 ? -3.527  0.161   -54.339 1.00 30.67  ? 213 PHE B CD2  1 
ATOM   8031  C CE1  . PHE B 1 213 ? -2.131  2.330   -55.291 1.00 29.64  ? 213 PHE B CE1  1 
ATOM   8032  C CE2  . PHE B 1 213 ? -3.197  0.223   -55.684 1.00 36.48  ? 213 PHE B CE2  1 
ATOM   8033  C CZ   . PHE B 1 213 ? -2.500  1.308   -56.162 1.00 34.63  ? 213 PHE B CZ   1 
ATOM   8034  H H    . PHE B 1 213 ? -1.191  1.042   -51.348 1.00 30.02  ? 213 PHE B H    1 
ATOM   8035  H HA   . PHE B 1 213 ? -2.965  2.928   -51.437 1.00 34.24  ? 213 PHE B HA   1 
ATOM   8036  H HB2  . PHE B 1 213 ? -3.341  0.149   -51.692 1.00 34.14  ? 213 PHE B HB2  1 
ATOM   8037  H HB3  . PHE B 1 213 ? -4.523  1.177   -51.927 1.00 34.14  ? 213 PHE B HB3  1 
ATOM   8038  H HD1  . PHE B 1 213 ? -2.215  2.938   -53.347 1.00 35.32  ? 213 PHE B HD1  1 
ATOM   8039  H HD2  . PHE B 1 213 ? -4.003  -0.574  -54.025 1.00 36.76  ? 213 PHE B HD2  1 
ATOM   8040  H HE1  . PHE B 1 213 ? -1.652  3.060   -55.611 1.00 35.53  ? 213 PHE B HE1  1 
ATOM   8041  H HE2  . PHE B 1 213 ? -3.451  -0.461  -56.261 1.00 43.74  ? 213 PHE B HE2  1 
ATOM   8042  H HZ   . PHE B 1 213 ? -2.273  1.358   -57.063 1.00 41.51  ? 213 PHE B HZ   1 
ATOM   8043  N N    . CYS B 1 214 ? -3.283  1.040   -48.879 1.00 28.50  ? 214 CYS B N    1 
ATOM   8044  C CA   . CYS B 1 214 ? -3.823  0.965   -47.515 1.00 30.60  ? 214 CYS B CA   1 
ATOM   8045  C C    . CYS B 1 214 ? -3.508  2.229   -46.710 1.00 35.69  ? 214 CYS B C    1 
ATOM   8046  O O    . CYS B 1 214 ? -4.404  2.840   -46.112 1.00 31.04  ? 214 CYS B O    1 
ATOM   8047  C CB   . CYS B 1 214 ? -3.266  -0.301  -46.848 1.00 28.31  ? 214 CYS B CB   1 
ATOM   8048  S SG   . CYS B 1 214 ? -3.821  -0.668  -45.189 1.00 50.08  ? 214 CYS B SG   1 
ATOM   8049  H H    . CYS B 1 214 ? -2.767  0.384   -49.086 1.00 34.16  ? 214 CYS B H    1 
ATOM   8050  H HA   . CYS B 1 214 ? -4.788  0.876   -47.564 1.00 36.68  ? 214 CYS B HA   1 
ATOM   8051  H HB2  . CYS B 1 214 ? -3.502  -1.062  -47.401 1.00 33.93  ? 214 CYS B HB2  1 
ATOM   8052  H HB3  . CYS B 1 214 ? -2.300  -0.222  -46.813 1.00 33.93  ? 214 CYS B HB3  1 
ATOM   8053  H HG   . CYS B 1 214 ? -3.519  0.240   -44.466 1.00 60.06  ? 214 CYS B HG   1 
ATOM   8054  N N    . ASP B 1 215 ? -2.236  2.643   -46.697 1.00 31.37  ? 215 ASP B N    1 
ATOM   8055  C CA   . ASP B 1 215 ? -1.840  3.877   -46.009 1.00 30.81  ? 215 ASP B CA   1 
ATOM   8056  C C    . ASP B 1 215 ? -2.653  5.065   -46.525 1.00 31.64  ? 215 ASP B C    1 
ATOM   8057  O O    . ASP B 1 215 ? -3.233  5.836   -45.745 1.00 28.06  ? 215 ASP B O    1 
ATOM   8058  C CB   . ASP B 1 215 ? -0.327  4.150   -46.209 1.00 31.52  ? 215 ASP B CB   1 
ATOM   8059  C CG   . ASP B 1 215 ? 0.593   3.159   -45.466 1.00 35.62  ? 215 ASP B CG   1 
ATOM   8060  O OD1  . ASP B 1 215 ? 0.188   2.600   -44.440 1.00 31.59  ? 215 ASP B OD1  1 
ATOM   8061  O OD2  . ASP B 1 215 ? 1.763   2.960   -45.891 1.00 30.29  ? 215 ASP B OD2  1 
ATOM   8062  H H    . ASP B 1 215 ? -1.586  2.229   -47.077 1.00 37.60  ? 215 ASP B H    1 
ATOM   8063  H HA   . ASP B 1 215 ? -2.009  3.782   -45.059 1.00 36.93  ? 215 ASP B HA   1 
ATOM   8064  H HB2  . ASP B 1 215 ? -0.122  4.093   -47.155 1.00 37.78  ? 215 ASP B HB2  1 
ATOM   8065  H HB3  . ASP B 1 215 ? -0.126  5.042   -45.883 1.00 37.78  ? 215 ASP B HB3  1 
ATOM   8066  N N    . GLY B 1 216 ? -2.689  5.237   -47.846 1.00 28.66  ? 216 GLY B N    1 
ATOM   8067  C CA   . GLY B 1 216 ? -3.306  6.409   -48.424 1.00 35.56  ? 216 GLY B CA   1 
ATOM   8068  C C    . GLY B 1 216 ? -4.805  6.467   -48.220 1.00 33.41  ? 216 GLY B C    1 
ATOM   8069  O O    . GLY B 1 216 ? -5.387  7.556   -48.207 1.00 31.25  ? 216 GLY B O    1 
ATOM   8070  H H    . GLY B 1 216 ? -2.362  4.687   -48.421 1.00 34.36  ? 216 GLY B H    1 
ATOM   8071  H HA2  . GLY B 1 216 ? -2.915  7.203   -48.029 1.00 42.63  ? 216 GLY B HA2  1 
ATOM   8072  H HA3  . GLY B 1 216 ? -3.129  6.425   -49.378 1.00 42.63  ? 216 GLY B HA3  1 
ATOM   8073  N N    . LEU B 1 217 ? -5.451  5.313   -48.055 1.00 34.34  ? 217 LEU B N    1 
ATOM   8074  C CA   . LEU B 1 217 ? -6.879  5.280   -47.739 1.00 34.39  ? 217 LEU B CA   1 
ATOM   8075  C C    . LEU B 1 217 ? -7.155  5.564   -46.266 1.00 33.84  ? 217 LEU B C    1 
ATOM   8076  O O    . LEU B 1 217 ? -8.314  5.672   -45.877 1.00 31.14  ? 217 LEU B O    1 
ATOM   8077  C CB   . LEU B 1 217 ? -7.476  3.925   -48.130 1.00 34.65  ? 217 LEU B CB   1 
ATOM   8078  C CG   . LEU B 1 217 ? -7.450  3.623   -49.633 1.00 34.47  ? 217 LEU B CG   1 
ATOM   8079  C CD1  . LEU B 1 217 ? -7.962  2.236   -49.979 1.00 37.36  ? 217 LEU B CD1  1 
ATOM   8080  C CD2  . LEU B 1 217 ? -8.229  4.656   -50.445 1.00 40.32  ? 217 LEU B CD2  1 
ATOM   8081  H H    . LEU B 1 217 ? -5.085  4.537   -48.119 1.00 41.16  ? 217 LEU B H    1 
ATOM   8082  H HA   . LEU B 1 217 ? -7.329  5.963   -48.261 1.00 41.23  ? 217 LEU B HA   1 
ATOM   8083  H HB2  . LEU B 1 217 ? -6.976  3.226   -47.681 1.00 41.53  ? 217 LEU B HB2  1 
ATOM   8084  H HB3  . LEU B 1 217 ? -8.402  3.900   -47.842 1.00 41.53  ? 217 LEU B HB3  1 
ATOM   8085  H HG   . LEU B 1 217 ? -6.528  3.666   -49.929 1.00 41.32  ? 217 LEU B HG   1 
ATOM   8086  H HD11 . LEU B 1 217 ? -7.917  2.114   -50.941 1.00 44.79  ? 217 LEU B HD11 1 
ATOM   8087  H HD12 . LEU B 1 217 ? -7.407  1.575   -49.536 1.00 44.79  ? 217 LEU B HD12 1 
ATOM   8088  H HD13 . LEU B 1 217 ? -8.880  2.154   -49.678 1.00 44.79  ? 217 LEU B HD13 1 
ATOM   8089  H HD21 . LEU B 1 217 ? -8.181  4.420   -51.385 1.00 48.34  ? 217 LEU B HD21 1 
ATOM   8090  H HD22 . LEU B 1 217 ? -9.153  4.658   -50.151 1.00 48.34  ? 217 LEU B HD22 1 
ATOM   8091  H HD23 . LEU B 1 217 ? -7.834  5.531   -50.303 1.00 48.34  ? 217 LEU B HD23 1 
ATOM   8092  N N    . GLY B 1 218 ? -6.126  5.683   -45.434 1.00 31.24  ? 218 GLY B N    1 
ATOM   8093  C CA   . GLY B 1 218 ? -6.341  6.060   -44.056 1.00 32.33  ? 218 GLY B CA   1 
ATOM   8094  C C    . GLY B 1 218 ? -6.515  4.922   -43.084 1.00 30.92  ? 218 GLY B C    1 
ATOM   8095  O O    . GLY B 1 218 ? -6.850  5.176   -41.915 1.00 39.78  ? 218 GLY B O    1 
ATOM   8096  H H    . GLY B 1 218 ? -5.303  5.550   -45.646 1.00 37.45  ? 218 GLY B H    1 
ATOM   8097  H HA2  . GLY B 1 218 ? -5.587  6.591   -43.757 1.00 38.76  ? 218 GLY B HA2  1 
ATOM   8098  H HA3  . GLY B 1 218 ? -7.135  6.615   -44.005 1.00 38.76  ? 218 GLY B HA3  1 
ATOM   8099  N N    . PHE B 1 219 ? -6.256  3.684   -43.502 1.00 30.81  ? 219 PHE B N    1 
ATOM   8100  C CA   . PHE B 1 219 ? -6.381  2.544   -42.604 1.00 42.97  ? 219 PHE B CA   1 
ATOM   8101  C C    . PHE B 1 219 ? -5.171  2.419   -41.683 1.00 40.46  ? 219 PHE B C    1 
ATOM   8102  O O    . PHE B 1 219 ? -4.114  3.008   -41.906 1.00 27.92  ? 219 PHE B O    1 
ATOM   8103  C CB   . PHE B 1 219 ? -6.550  1.262   -43.396 1.00 41.62  ? 219 PHE B CB   1 
ATOM   8104  C CG   . PHE B 1 219 ? -7.884  1.139   -44.053 1.00 48.53  ? 219 PHE B CG   1 
ATOM   8105  C CD1  . PHE B 1 219 ? -8.961  0.567   -43.367 1.00 62.96  ? 219 PHE B CD1  1 
ATOM   8106  C CD2  . PHE B 1 219 ? -8.071  1.591   -45.355 1.00 38.67  ? 219 PHE B CD2  1 
ATOM   8107  C CE1  . PHE B 1 219 ? -10.210 0.450   -43.978 1.00 59.14  ? 219 PHE B CE1  1 
ATOM   8108  C CE2  . PHE B 1 219 ? -9.307  1.489   -45.976 1.00 49.86  ? 219 PHE B CE2  1 
ATOM   8109  C CZ   . PHE B 1 219 ? -10.384 0.915   -45.291 1.00 65.80  ? 219 PHE B CZ   1 
ATOM   8110  H H    . PHE B 1 219 ? -6.006  3.481   -44.299 1.00 36.92  ? 219 PHE B H    1 
ATOM   8111  H HA   . PHE B 1 219 ? -7.169  2.661   -42.051 1.00 51.52  ? 219 PHE B HA   1 
ATOM   8112  H HB2  . PHE B 1 219 ? -5.873  1.230   -44.090 1.00 49.90  ? 219 PHE B HB2  1 
ATOM   8113  H HB3  . PHE B 1 219 ? -6.443  0.507   -42.796 1.00 49.90  ? 219 PHE B HB3  1 
ATOM   8114  H HD1  . PHE B 1 219 ? -8.843  0.261   -42.497 1.00 75.51  ? 219 PHE B HD1  1 
ATOM   8115  H HD2  . PHE B 1 219 ? -7.359  1.974   -45.813 1.00 46.36  ? 219 PHE B HD2  1 
ATOM   8116  H HE1  . PHE B 1 219 ? -10.923 0.070   -43.517 1.00 70.92  ? 219 PHE B HE1  1 
ATOM   8117  H HE2  . PHE B 1 219 ? -9.418  1.794   -46.847 1.00 59.79  ? 219 PHE B HE2  1 
ATOM   8118  H HZ   . PHE B 1 219 ? -11.213 0.841   -45.705 1.00 78.92  ? 219 PHE B HZ   1 
ATOM   8119  N N    . GLY B 1 220 ? -5.339  1.618   -40.632 1.00 35.46  ? 220 GLY B N    1 
ATOM   8120  C CA   . GLY B 1 220 ? -4.330  1.462   -39.607 1.00 38.01  ? 220 GLY B CA   1 
ATOM   8121  C C    . GLY B 1 220 ? -3.445  0.246   -39.828 1.00 36.06  ? 220 GLY B C    1 
ATOM   8122  O O    . GLY B 1 220 ? -3.532  -0.463  -40.834 1.00 30.48  ? 220 GLY B O    1 
ATOM   8123  H H    . GLY B 1 220 ? -6.046  1.148   -40.494 1.00 42.51  ? 220 GLY B H    1 
ATOM   8124  H HA2  . GLY B 1 220 ? -3.766  2.251   -39.589 1.00 45.57  ? 220 GLY B HA2  1 
ATOM   8125  H HA3  . GLY B 1 220 ? -4.761  1.374   -38.742 1.00 45.57  ? 220 GLY B HA3  1 
ATOM   8126  N N    . ASP B 1 221 ? -2.603  -0.004  -38.826 1.00 30.86  ? 221 ASP B N    1 
ATOM   8127  C CA   . ASP B 1 221 ? -1.584  -1.046  -38.897 1.00 38.86  ? 221 ASP B CA   1 
ATOM   8128  C C    . ASP B 1 221 ? -2.188  -2.442  -38.946 1.00 29.93  ? 221 ASP B C    1 
ATOM   8129  O O    . ASP B 1 221 ? -1.596  -3.353  -39.532 1.00 27.53  ? 221 ASP B O    1 
ATOM   8130  C CB   . ASP B 1 221 ? -0.640  -0.930  -37.696 1.00 29.03  ? 221 ASP B CB   1 
ATOM   8131  C CG   . ASP B 1 221 ? 0.492   0.055   -37.931 1.00 57.12  ? 221 ASP B CG   1 
ATOM   8132  O OD1  . ASP B 1 221 ? 1.397   -0.247  -38.756 1.00 54.14  ? 221 ASP B OD1  1 
ATOM   8133  O OD2  . ASP B 1 221 ? 0.472   1.126   -37.279 1.00 52.80  ? 221 ASP B OD2  1 
ATOM   8134  H H    . ASP B 1 221 ? -2.603  0.427   -38.081 1.00 37.00  ? 221 ASP B H    1 
ATOM   8135  H HA   . ASP B 1 221 ? -1.060  -0.919  -39.703 1.00 46.59  ? 221 ASP B HA   1 
ATOM   8136  H HB2  . ASP B 1 221 ? -1.145  -0.627  -36.926 1.00 34.79  ? 221 ASP B HB2  1 
ATOM   8137  H HB3  . ASP B 1 221 ? -0.249  -1.799  -37.516 1.00 34.79  ? 221 ASP B HB3  1 
ATOM   8138  N N    . ASN B 1 222 ? -3.343  -2.659  -38.321 1.00 33.00  ? 222 ASN B N    1 
ATOM   8139  C CA   . ASN B 1 222 ? -3.878  -4.011  -38.353 1.00 28.73  ? 222 ASN B CA   1 
ATOM   8140  C C    . ASN B 1 222 ? -4.419  -4.324  -39.738 1.00 21.57  ? 222 ASN B C    1 
ATOM   8141  O O    . ASN B 1 222 ? -4.255  -5.444  -40.241 1.00 24.40  ? 222 ASN B O    1 
ATOM   8142  C CB   . ASN B 1 222 ? -4.935  -4.189  -37.262 1.00 30.21  ? 222 ASN B CB   1 
ATOM   8143  C CG   . ASN B 1 222 ? -4.327  -4.158  -35.865 1.00 28.84  ? 222 ASN B CG   1 
ATOM   8144  O OD1  . ASN B 1 222 ? -3.271  -4.743  -35.609 1.00 33.30  ? 222 ASN B OD1  1 
ATOM   8145  N ND2  . ASN B 1 222 ? -4.953  -3.425  -34.978 1.00 40.07  ? 222 ASN B ND2  1 
ATOM   8146  H H    . ASN B 1 222 ? -3.811  -2.076  -37.895 1.00 39.55  ? 222 ASN B H    1 
ATOM   8147  H HA   . ASN B 1 222 ? -3.159  -4.635  -38.170 1.00 34.44  ? 222 ASN B HA   1 
ATOM   8148  H HB2  . ASN B 1 222 ? -5.583  -3.470  -37.326 1.00 36.21  ? 222 ASN B HB2  1 
ATOM   8149  H HB3  . ASN B 1 222 ? -5.374  -5.046  -37.381 1.00 36.21  ? 222 ASN B HB3  1 
ATOM   8150  H HD21 . ASN B 1 222 ? -4.649  -3.368  -34.175 1.00 48.04  ? 222 ASN B HD21 1 
ATOM   8151  H HD22 . ASN B 1 222 ? -5.682  -3.021  -35.191 1.00 48.04  ? 222 ASN B HD22 1 
ATOM   8152  N N    . THR B 1 223 ? -5.012  -3.337  -40.395 1.00 24.41  ? 223 THR B N    1 
ATOM   8153  C CA   . THR B 1 223 ? -5.428  -3.538  -41.782 1.00 31.40  ? 223 THR B CA   1 
ATOM   8154  C C    . THR B 1 223 ? -4.210  -3.737  -42.678 1.00 26.94  ? 223 THR B C    1 
ATOM   8155  O O    . THR B 1 223 ? -4.183  -4.635  -43.529 1.00 29.52  ? 223 THR B O    1 
ATOM   8156  C CB   . THR B 1 223 ? -6.242  -2.345  -42.270 1.00 31.01  ? 223 THR B CB   1 
ATOM   8157  O OG1  . THR B 1 223 ? -7.326  -2.112  -41.382 1.00 33.75  ? 223 THR B OG1  1 
ATOM   8158  C CG2  . THR B 1 223 ? -6.776  -2.596  -43.659 1.00 35.40  ? 223 THR B CG2  1 
ATOM   8159  H H    . THR B 1 223 ? -5.184  -2.558  -40.073 1.00 29.25  ? 223 THR B H    1 
ATOM   8160  H HA   . THR B 1 223 ? -5.983  -4.331  -41.840 1.00 37.64  ? 223 THR B HA   1 
ATOM   8161  H HB   . THR B 1 223 ? -5.675  -1.558  -42.298 1.00 37.17  ? 223 THR B HB   1 
ATOM   8162  H HG1  . THR B 1 223 ? -7.822  -2.790  -41.350 1.00 40.45  ? 223 THR B HG1  1 
ATOM   8163  H HG21 . THR B 1 223 ? -7.292  -1.831  -43.959 1.00 42.43  ? 223 THR B HG21 1 
ATOM   8164  H HG22 . THR B 1 223 ? -6.041  -2.741  -44.275 1.00 42.43  ? 223 THR B HG22 1 
ATOM   8165  H HG23 . THR B 1 223 ? -7.346  -3.380  -43.658 1.00 42.43  ? 223 THR B HG23 1 
ATOM   8166  N N    . LYS B 1 224 ? -3.191  -2.896  -42.495 1.00 30.51  ? 224 LYS B N    1 
ATOM   8167  C CA   . LYS B 1 224 ? -1.996  -2.986  -43.320 1.00 33.14  ? 224 LYS B CA   1 
ATOM   8168  C C    . LYS B 1 224 ? -1.315  -4.328  -43.133 1.00 24.41  ? 224 LYS B C    1 
ATOM   8169  O O    . LYS B 1 224 ? -0.818  -4.912  -44.096 1.00 27.45  ? 224 LYS B O    1 
ATOM   8170  C CB   . LYS B 1 224 ? -1.042  -1.844  -42.967 1.00 34.60  ? 224 LYS B CB   1 
ATOM   8171  C CG   . LYS B 1 224 ? 0.251   -1.840  -43.788 1.00 35.08  ? 224 LYS B CG   1 
ATOM   8172  C CD   . LYS B 1 224 ? 1.000   -0.545  -43.611 1.00 32.40  ? 224 LYS B CD   1 
ATOM   8173  C CE   . LYS B 1 224 ? 2.246   -0.451  -44.472 1.00 33.46  ? 224 LYS B CE   1 
ATOM   8174  N NZ   . LYS B 1 224 ? 2.890   0.881   -44.227 1.00 35.22  ? 224 LYS B NZ   1 
ATOM   8175  H H    . LYS B 1 224 ? -3.171  -2.271  -41.904 1.00 36.57  ? 224 LYS B H    1 
ATOM   8176  H HA   . LYS B 1 224 ? -2.244  -2.898  -44.253 1.00 39.73  ? 224 LYS B HA   1 
ATOM   8177  H HB2  . LYS B 1 224 ? -1.494  -1.000  -43.122 1.00 41.48  ? 224 LYS B HB2  1 
ATOM   8178  H HB3  . LYS B 1 224 ? -0.798  -1.919  -42.031 1.00 41.48  ? 224 LYS B HB3  1 
ATOM   8179  H HG2  . LYS B 1 224 ? 0.822   -2.566  -43.492 1.00 42.05  ? 224 LYS B HG2  1 
ATOM   8180  H HG3  . LYS B 1 224 ? 0.035   -1.943  -44.728 1.00 42.05  ? 224 LYS B HG3  1 
ATOM   8181  H HD2  . LYS B 1 224 ? 0.416   0.191   -43.852 1.00 38.84  ? 224 LYS B HD2  1 
ATOM   8182  H HD3  . LYS B 1 224 ? 1.271   -0.462  -42.684 1.00 38.84  ? 224 LYS B HD3  1 
ATOM   8183  H HE2  . LYS B 1 224 ? 2.871   -1.151  -44.225 1.00 40.11  ? 224 LYS B HE2  1 
ATOM   8184  H HE3  . LYS B 1 224 ? 2.006   -0.515  -45.409 1.00 40.11  ? 224 LYS B HE3  1 
ATOM   8185  H HZ1  . LYS B 1 224 ? 3.110   0.958   -43.368 1.00 42.23  ? 224 LYS B HZ1  1 
ATOM   8186  H HZ2  . LYS B 1 224 ? 3.625   0.958   -44.722 1.00 42.23  ? 224 LYS B HZ2  1 
ATOM   8187  H HZ3  . LYS B 1 224 ? 2.326   1.535   -44.441 1.00 42.23  ? 224 LYS B HZ3  1 
ATOM   8188  N N    . ALA B 1 225 ? -1.294  -4.835  -41.888 1.00 28.71  ? 225 ALA B N    1 
ATOM   8189  C CA   . ALA B 1 225 ? -0.743  -6.162  -41.609 1.00 28.20  ? 225 ALA B CA   1 
ATOM   8190  C C    . ALA B 1 225 ? -1.493  -7.247  -42.365 1.00 24.71  ? 225 ALA B C    1 
ATOM   8191  O O    . ALA B 1 225 ? -0.885  -8.209  -42.861 1.00 21.10  ? 225 ALA B O    1 
ATOM   8192  C CB   . ALA B 1 225 ? -0.790  -6.443  -40.105 1.00 30.94  ? 225 ALA B CB   1 
ATOM   8193  H H    . ALA B 1 225 ? -1.594  -4.427  -41.193 1.00 34.41  ? 225 ALA B H    1 
ATOM   8194  H HA   . ALA B 1 225 ? 0.184   -6.185  -41.891 1.00 33.80  ? 225 ALA B HA   1 
ATOM   8195  H HB1  . ALA B 1 225 ? -0.422  -7.324  -39.938 1.00 37.09  ? 225 ALA B HB1  1 
ATOM   8196  H HB2  . ALA B 1 225 ? -0.265  -5.771  -39.643 1.00 37.09  ? 225 ALA B HB2  1 
ATOM   8197  H HB3  . ALA B 1 225 ? -1.712  -6.406  -39.806 1.00 37.09  ? 225 ALA B HB3  1 
ATOM   8198  N N    . ALA B 1 226 ? -2.817  -7.120  -42.447 1.00 23.78  ? 226 ALA B N    1 
ATOM   8199  C CA   . ALA B 1 226 ? -3.609  -8.074  -43.217 1.00 22.96  ? 226 ALA B CA   1 
ATOM   8200  C C    . ALA B 1 226 ? -3.260  -8.005  -44.701 1.00 24.32  ? 226 ALA B C    1 
ATOM   8201  O O    . ALA B 1 226 ? -3.063  -9.036  -45.355 1.00 25.65  ? 226 ALA B O    1 
ATOM   8202  C CB   . ALA B 1 226 ? -5.093  -7.795  -43.004 1.00 24.89  ? 226 ALA B CB   1 
ATOM   8203  H H    . ALA B 1 226 ? -3.276  -6.497  -42.071 1.00 28.50  ? 226 ALA B H    1 
ATOM   8204  H HA   . ALA B 1 226 ? -3.421  -8.972  -42.902 1.00 27.50  ? 226 ALA B HA   1 
ATOM   8205  H HB1  . ALA B 1 226 ? -5.611  -8.433  -43.519 1.00 29.83  ? 226 ALA B HB1  1 
ATOM   8206  H HB2  . ALA B 1 226 ? -5.299  -7.886  -42.060 1.00 29.83  ? 226 ALA B HB2  1 
ATOM   8207  H HB3  . ALA B 1 226 ? -5.290  -6.892  -43.300 1.00 29.83  ? 226 ALA B HB3  1 
ATOM   8208  N N    . VAL B 1 227 ? -3.149  -6.792  -45.247 1.00 26.21  ? 227 VAL B N    1 
ATOM   8209  C CA   . VAL B 1 227 ? -2.793  -6.630  -46.668 1.00 23.37  ? 227 VAL B CA   1 
ATOM   8210  C C    . VAL B 1 227 ? -1.449  -7.297  -46.968 1.00 22.63  ? 227 VAL B C    1 
ATOM   8211  O O    . VAL B 1 227 ? -1.299  -8.059  -47.930 1.00 26.96  ? 227 VAL B O    1 
ATOM   8212  C CB   . VAL B 1 227 ? -2.786  -5.133  -47.036 1.00 25.06  ? 227 VAL B CB   1 
ATOM   8213  C CG1  . VAL B 1 227 ? -2.257  -4.919  -48.447 1.00 33.34  ? 227 VAL B CG1  1 
ATOM   8214  C CG2  . VAL B 1 227 ? -4.200  -4.554  -46.920 1.00 32.14  ? 227 VAL B CG2  1 
ATOM   8215  H H    . VAL B 1 227 ? -3.273  -6.052  -44.825 1.00 31.41  ? 227 VAL B H    1 
ATOM   8216  H HA   . VAL B 1 227 ? -3.468  -7.065  -47.211 1.00 28.00  ? 227 VAL B HA   1 
ATOM   8217  H HB   . VAL B 1 227 ? -2.210  -4.654  -46.419 1.00 30.03  ? 227 VAL B HB   1 
ATOM   8218  H HG11 . VAL B 1 227 ? -2.266  -3.970  -48.647 1.00 39.97  ? 227 VAL B HG11 1 
ATOM   8219  H HG12 . VAL B 1 227 ? -1.350  -5.261  -48.499 1.00 39.97  ? 227 VAL B HG12 1 
ATOM   8220  H HG13 . VAL B 1 227 ? -2.826  -5.395  -49.072 1.00 39.97  ? 227 VAL B HG13 1 
ATOM   8221  H HG21 . VAL B 1 227 ? -4.176  -3.613  -47.155 1.00 38.53  ? 227 VAL B HG21 1 
ATOM   8222  H HG22 . VAL B 1 227 ? -4.787  -5.032  -47.527 1.00 38.53  ? 227 VAL B HG22 1 
ATOM   8223  H HG23 . VAL B 1 227 ? -4.510  -4.660  -46.007 1.00 38.53  ? 227 VAL B HG23 1 
ATOM   8224  N N    . ILE B 1 228 ? -0.463  -7.065  -46.112 1.00 25.48  ? 228 ILE B N    1 
ATOM   8225  C CA   . ILE B 1 228 ? 0.868   -7.638  -46.328 1.00 20.44  ? 228 ILE B CA   1 
ATOM   8226  C C    . ILE B 1 228 ? 0.829   -9.163  -46.250 1.00 22.86  ? 228 ILE B C    1 
ATOM   8227  O O    . ILE B 1 228 ? 1.412   -9.867  -47.087 1.00 22.61  ? 228 ILE B O    1 
ATOM   8228  C CB   . ILE B 1 228 ? 1.847   -7.042  -45.301 1.00 25.50  ? 228 ILE B CB   1 
ATOM   8229  C CG1  . ILE B 1 228 ? 1.973   -5.534  -45.586 1.00 31.94  ? 228 ILE B CG1  1 
ATOM   8230  C CG2  . ILE B 1 228 ? 3.182   -7.769  -45.295 1.00 25.08  ? 228 ILE B CG2  1 
ATOM   8231  C CD1  . ILE B 1 228 ? 2.651   -4.767  -44.474 1.00 34.50  ? 228 ILE B CD1  1 
ATOM   8232  H H    . ILE B 1 228 ? -0.533  -6.584  -45.403 1.00 30.53  ? 228 ILE B H    1 
ATOM   8233  H HA   . ILE B 1 228 ? 1.178   -7.392  -47.214 1.00 24.48  ? 228 ILE B HA   1 
ATOM   8234  H HB   . ILE B 1 228 ? 1.451   -7.145  -44.422 1.00 30.56  ? 228 ILE B HB   1 
ATOM   8235  H HG12 . ILE B 1 228 ? 2.494   -5.410  -46.395 1.00 38.29  ? 228 ILE B HG12 1 
ATOM   8236  H HG13 . ILE B 1 228 ? 1.085   -5.162  -45.705 1.00 38.29  ? 228 ILE B HG13 1 
ATOM   8237  H HG21 . ILE B 1 228 ? 3.761   -7.358  -44.635 1.00 30.05  ? 228 ILE B HG21 1 
ATOM   8238  H HG22 . ILE B 1 228 ? 3.032   -8.701  -45.071 1.00 30.05  ? 228 ILE B HG22 1 
ATOM   8239  H HG23 . ILE B 1 228 ? 3.582   -7.700  -46.176 1.00 30.05  ? 228 ILE B HG23 1 
ATOM   8240  H HD11 . ILE B 1 228 ? 2.696   -3.830  -44.720 1.00 41.36  ? 228 ILE B HD11 1 
ATOM   8241  H HD12 . ILE B 1 228 ? 2.137   -4.872  -43.659 1.00 41.36  ? 228 ILE B HD12 1 
ATOM   8242  H HD13 . ILE B 1 228 ? 3.546   -5.120  -44.349 1.00 41.36  ? 228 ILE B HD13 1 
ATOM   8243  N N    . ARG B 1 229 ? 0.171   -9.700  -45.221 1.00 20.84  ? 229 ARG B N    1 
ATOM   8244  C CA   . ARG B 1 229 ? 0.109   -11.149 -45.056 1.00 17.80  ? 229 ARG B CA   1 
ATOM   8245  C C    . ARG B 1 229 ? -0.580  -11.816 -46.243 1.00 24.02  ? 229 ARG B C    1 
ATOM   8246  O O    . ARG B 1 229 ? -0.104  -12.841 -46.762 1.00 23.31  ? 229 ARG B O    1 
ATOM   8247  C CB   . ARG B 1 229 ? -0.627  -11.506 -43.773 1.00 20.71  ? 229 ARG B CB   1 
ATOM   8248  C CG   . ARG B 1 229 ? -0.431  -12.957 -43.341 1.00 18.64  ? 229 ARG B CG   1 
ATOM   8249  C CD   . ARG B 1 229 ? -1.397  -13.364 -42.179 1.00 23.09  ? 229 ARG B CD   1 
ATOM   8250  N NE   . ARG B 1 229 ? -2.740  -13.629 -42.698 1.00 21.18  ? 229 ARG B NE   1 
ATOM   8251  C CZ   . ARG B 1 229 ? -3.084  -14.751 -43.337 1.00 24.60  ? 229 ARG B CZ   1 
ATOM   8252  N NH1  . ARG B 1 229 ? -4.303  -14.907 -43.821 1.00 30.80  ? 229 ARG B NH1  1 
ATOM   8253  N NH2  . ARG B 1 229 ? -2.213  -15.709 -43.533 1.00 23.20  ? 229 ARG B NH2  1 
ATOM   8254  H H    . ARG B 1 229 ? -0.242  -9.253  -44.614 1.00 24.96  ? 229 ARG B H    1 
ATOM   8255  H HA   . ARG B 1 229 ? 1.011   -11.500 -44.995 1.00 21.32  ? 229 ARG B HA   1 
ATOM   8256  H HB2  . ARG B 1 229 ? -0.303  -10.937 -43.057 1.00 24.81  ? 229 ARG B HB2  1 
ATOM   8257  H HB3  . ARG B 1 229 ? -1.577  -11.361 -43.905 1.00 24.81  ? 229 ARG B HB3  1 
ATOM   8258  H HG2  . ARG B 1 229 ? -0.605  -13.540 -44.096 1.00 22.33  ? 229 ARG B HG2  1 
ATOM   8259  H HG3  . ARG B 1 229 ? 0.481   -13.075 -43.031 1.00 22.33  ? 229 ARG B HG3  1 
ATOM   8260  H HD2  . ARG B 1 229 ? -1.068  -14.170 -41.752 1.00 27.66  ? 229 ARG B HD2  1 
ATOM   8261  H HD3  . ARG B 1 229 ? -1.454  -12.639 -41.537 1.00 27.66  ? 229 ARG B HD3  1 
ATOM   8262  H HE   . ARG B 1 229 ? -3.319  -12.995 -42.659 1.00 25.38  ? 229 ARG B HE   1 
ATOM   8263  H HH11 . ARG B 1 229 ? -4.895  -14.295 -43.701 1.00 36.91  ? 229 ARG B HH11 1 
ATOM   8264  H HH12 . ARG B 1 229 ? -4.517  -15.639 -44.221 1.00 36.91  ? 229 ARG B HH12 1 
ATOM   8265  H HH21 . ARG B 1 229 ? -1.409  -15.624 -43.241 1.00 27.80  ? 229 ARG B HH21 1 
ATOM   8266  H HH22 . ARG B 1 229 ? -2.448  -16.425 -43.946 1.00 27.80  ? 229 ARG B HH22 1 
ATOM   8267  N N    . LEU B 1 230 ? -1.750  -11.288 -46.646 1.00 25.44  ? 230 LEU B N    1 
ATOM   8268  C CA   . LEU B 1 230 ? -2.410  -11.822 -47.828 1.00 20.52  ? 230 LEU B CA   1 
ATOM   8269  C C    . LEU B 1 230 ? -1.518  -11.691 -49.052 1.00 26.02  ? 230 LEU B C    1 
ATOM   8270  O O    . LEU B 1 230 ? -1.463  -12.598 -49.891 1.00 25.75  ? 230 LEU B O    1 
ATOM   8271  C CB   . LEU B 1 230 ? -3.753  -11.112 -48.049 1.00 18.79  ? 230 LEU B CB   1 
ATOM   8272  C CG   . LEU B 1 230 ? -4.743  -11.391 -46.920 1.00 26.64  ? 230 LEU B CG   1 
ATOM   8273  C CD1  . LEU B 1 230 ? -6.046  -10.575 -47.038 1.00 25.27  ? 230 LEU B CD1  1 
ATOM   8274  C CD2  . LEU B 1 230 ? -5.070  -12.838 -46.924 1.00 28.12  ? 230 LEU B CD2  1 
ATOM   8275  H H    . LEU B 1 230 ? -2.163  -10.640 -46.259 1.00 30.49  ? 230 LEU B H    1 
ATOM   8276  H HA   . LEU B 1 230 ? -2.590  -12.765 -47.689 1.00 24.58  ? 230 LEU B HA   1 
ATOM   8277  H HB2  . LEU B 1 230 ? -3.603  -10.155 -48.091 1.00 22.50  ? 230 LEU B HB2  1 
ATOM   8278  H HB3  . LEU B 1 230 ? -4.145  -11.425 -48.879 1.00 22.50  ? 230 LEU B HB3  1 
ATOM   8279  H HG   . LEU B 1 230 ? -4.326  -11.177 -46.070 1.00 31.92  ? 230 LEU B HG   1 
ATOM   8280  H HD11 . LEU B 1 230 ? -6.626  -10.799 -46.294 1.00 30.28  ? 230 LEU B HD11 1 
ATOM   8281  H HD12 . LEU B 1 230 ? -5.829  -9.630  -47.016 1.00 30.28  ? 230 LEU B HD12 1 
ATOM   8282  H HD13 . LEU B 1 230 ? -6.481  -10.795 -47.876 1.00 30.28  ? 230 LEU B HD13 1 
ATOM   8283  H HD21 . LEU B 1 230 ? -5.699  -13.021 -46.208 1.00 33.71  ? 230 LEU B HD21 1 
ATOM   8284  H HD22 . LEU B 1 230 ? -5.465  -13.069 -47.779 1.00 33.71  ? 230 LEU B HD22 1 
ATOM   8285  H HD23 . LEU B 1 230 ? -4.256  -13.346 -46.787 1.00 33.71  ? 230 LEU B HD23 1 
ATOM   8286  N N    . GLY B 1 231 ? -0.830  -10.566 -49.178 1.00 27.14  ? 231 GLY B N    1 
ATOM   8287  C CA   . GLY B 1 231 ? 0.170   -10.449 -50.232 1.00 29.24  ? 231 GLY B CA   1 
ATOM   8288  C C    . GLY B 1 231 ? 1.174   -11.572 -50.173 1.00 23.36  ? 231 GLY B C    1 
ATOM   8289  O O    . GLY B 1 231 ? 1.481   -12.208 -51.188 1.00 26.98  ? 231 GLY B O    1 
ATOM   8290  H H    . GLY B 1 231 ? -0.918  -9.870  -48.680 1.00 32.53  ? 231 GLY B H    1 
ATOM   8291  H HA2  . GLY B 1 231 ? -0.266  -10.469 -51.098 1.00 35.05  ? 231 GLY B HA2  1 
ATOM   8292  H HA3  . GLY B 1 231 ? 0.642   -9.607  -50.142 1.00 35.05  ? 231 GLY B HA3  1 
ATOM   8293  N N    . LEU B 1 232 ? 1.641   -11.893 -48.971 1.00 20.54  ? 232 LEU B N    1 
ATOM   8294  C CA   . LEU B 1 232 ? 2.644   -12.947 -48.848 1.00 28.31  ? 232 LEU B CA   1 
ATOM   8295  C C    . LEU B 1 232 ? 2.090   -14.283 -49.315 1.00 29.40  ? 232 LEU B C    1 
ATOM   8296  O O    . LEU B 1 232 ? 2.770   -15.062 -50.006 1.00 24.74  ? 232 LEU B O    1 
ATOM   8297  C CB   . LEU B 1 232 ? 3.123   -13.050 -47.396 1.00 20.58  ? 232 LEU B CB   1 
ATOM   8298  C CG   . LEU B 1 232 ? 4.213   -14.108 -47.138 1.00 32.17  ? 232 LEU B CG   1 
ATOM   8299  C CD1  . LEU B 1 232 ? 5.475   -13.898 -47.975 1.00 25.51  ? 232 LEU B CD1  1 
ATOM   8300  C CD2  . LEU B 1 232 ? 4.575   -14.090 -45.620 1.00 30.88  ? 232 LEU B CD2  1 
ATOM   8301  H H    . LEU B 1 232 ? 1.401   -11.529 -48.230 1.00 24.61  ? 232 LEU B H    1 
ATOM   8302  H HA   . LEU B 1 232 ? 3.408   -12.725 -49.404 1.00 33.93  ? 232 LEU B HA   1 
ATOM   8303  H HB2  . LEU B 1 232 ? 3.482   -12.190 -47.128 1.00 24.66  ? 232 LEU B HB2  1 
ATOM   8304  H HB3  . LEU B 1 232 ? 2.362   -13.273 -46.837 1.00 24.66  ? 232 LEU B HB3  1 
ATOM   8305  H HG   . LEU B 1 232 ? 3.857   -14.985 -47.350 1.00 38.56  ? 232 LEU B HG   1 
ATOM   8306  H HD11 . LEU B 1 232 ? 6.114   -14.596 -47.762 1.00 30.56  ? 232 LEU B HD11 1 
ATOM   8307  H HD12 . LEU B 1 232 ? 5.241   -13.939 -48.915 1.00 30.56  ? 232 LEU B HD12 1 
ATOM   8308  H HD13 . LEU B 1 232 ? 5.851   -13.029 -47.765 1.00 30.56  ? 232 LEU B HD13 1 
ATOM   8309  H HD21 . LEU B 1 232 ? 5.261   -14.755 -45.452 1.00 37.02  ? 232 LEU B HD21 1 
ATOM   8310  H HD22 . LEU B 1 232 ? 4.903   -13.209 -45.384 1.00 37.02  ? 232 LEU B HD22 1 
ATOM   8311  H HD23 . LEU B 1 232 ? 3.780   -14.297 -45.104 1.00 37.02  ? 232 LEU B HD23 1 
ATOM   8312  N N    . MET B 1 233 ? 0.884   -14.601 -48.863 1.00 28.55  ? 233 MET B N    1 
ATOM   8313  C CA   . MET B 1 233 ? 0.234   -15.834 -49.279 1.00 28.60  ? 233 MET B CA   1 
ATOM   8314  C C    . MET B 1 233 ? 0.082   -15.862 -50.800 1.00 22.89  ? 233 MET B C    1 
ATOM   8315  O O    . MET B 1 233 ? 0.367   -16.879 -51.448 1.00 23.80  ? 233 MET B O    1 
ATOM   8316  C CB   . MET B 1 233 ? -1.125  -15.951 -48.574 1.00 25.68  ? 233 MET B CB   1 
ATOM   8317  C CG   . MET B 1 233 ? -1.089  -15.908 -47.027 1.00 27.81  ? 233 MET B CG   1 
ATOM   8318  S SD   . MET B 1 233 ? -0.235  -17.344 -46.341 1.00 39.03  ? 233 MET B SD   1 
ATOM   8319  C CE   . MET B 1 233 ? 1.416   -16.746 -46.225 1.00 40.32  ? 233 MET B CE   1 
ATOM   8320  H H    . MET B 1 233 ? 0.424   -14.123 -48.317 1.00 34.22  ? 233 MET B H    1 
ATOM   8321  H HA   . MET B 1 233 ? 0.780   -16.586 -49.003 1.00 34.27  ? 233 MET B HA   1 
ATOM   8322  H HB2  . MET B 1 233 ? -1.687  -15.219 -48.871 1.00 30.77  ? 233 MET B HB2  1 
ATOM   8323  H HB3  . MET B 1 233 ? -1.530  -16.795 -48.831 1.00 30.77  ? 233 MET B HB3  1 
ATOM   8324  H HG2  . MET B 1 233 ? -0.619  -15.109 -46.740 1.00 33.33  ? 233 MET B HG2  1 
ATOM   8325  H HG3  . MET B 1 233 ? -1.997  -15.903 -46.686 1.00 33.33  ? 233 MET B HG3  1 
ATOM   8326  H HE1  . MET B 1 233 ? 1.980   -17.446 -45.861 1.00 48.34  ? 233 MET B HE1  1 
ATOM   8327  H HE2  . MET B 1 233 ? 1.725   -16.499 -47.111 1.00 48.34  ? 233 MET B HE2  1 
ATOM   8328  H HE3  . MET B 1 233 ? 1.431   -15.972 -45.641 1.00 48.34  ? 233 MET B HE3  1 
ATOM   8329  N N    . GLU B 1 234 ? -0.312  -14.737 -51.390 1.00 24.06  ? 234 GLU B N    1 
ATOM   8330  C CA   . GLU B 1 234 ? -0.392  -14.697 -52.842 1.00 24.85  ? 234 GLU B CA   1 
ATOM   8331  C C    . GLU B 1 234 ? 0.991   -14.882 -53.473 1.00 28.90  ? 234 GLU B C    1 
ATOM   8332  O O    . GLU B 1 234 ? 1.122   -15.532 -54.533 1.00 29.44  ? 234 GLU B O    1 
ATOM   8333  C CB   . GLU B 1 234 ? -1.077  -13.401 -53.276 1.00 26.31  ? 234 GLU B CB   1 
ATOM   8334  C CG   . GLU B 1 234 ? -2.622  -13.451 -53.130 1.00 28.95  ? 234 GLU B CG   1 
ATOM   8335  C CD   . GLU B 1 234 ? -3.377  -12.289 -53.802 1.00 28.63  ? 234 GLU B CD   1 
ATOM   8336  O OE1  . GLU B 1 234 ? -2.885  -11.679 -54.787 1.00 29.51  ? 234 GLU B OE1  1 
ATOM   8337  O OE2  . GLU B 1 234 ? -4.503  -11.978 -53.349 1.00 36.23  ? 234 GLU B OE2  1 
ATOM   8338  H H    . GLU B 1 234 ? -0.530  -14.009 -50.988 1.00 28.83  ? 234 GLU B H    1 
ATOM   8339  H HA   . GLU B 1 234 ? -0.949  -15.434 -53.140 1.00 29.78  ? 234 GLU B HA   1 
ATOM   8340  H HB2  . GLU B 1 234 ? -0.748  -12.672 -52.728 1.00 31.53  ? 234 GLU B HB2  1 
ATOM   8341  H HB3  . GLU B 1 234 ? -0.870  -13.233 -54.209 1.00 31.53  ? 234 GLU B HB3  1 
ATOM   8342  H HG2  . GLU B 1 234 ? -2.943  -14.276 -53.526 1.00 34.69  ? 234 GLU B HG2  1 
ATOM   8343  H HG3  . GLU B 1 234 ? -2.843  -13.436 -52.186 1.00 34.69  ? 234 GLU B HG3  1 
ATOM   8344  N N    . MET B 1 235 ? 2.050   -14.388 -52.815 1.00 29.90  ? 235 MET B N    1 
ATOM   8345  C CA   . MET B 1 235 ? 3.398   -14.600 -53.349 1.00 22.33  ? 235 MET B CA   1 
ATOM   8346  C C    . MET B 1 235 ? 3.771   -16.072 -53.339 1.00 30.75  ? 235 MET B C    1 
ATOM   8347  O O    . MET B 1 235 ? 4.355   -16.594 -54.309 1.00 26.72  ? 235 MET B O    1 
ATOM   8348  C CB   . MET B 1 235 ? 4.420   -13.781 -52.549 1.00 30.25  ? 235 MET B CB   1 
ATOM   8349  C CG   . MET B 1 235 ? 4.331   -12.255 -52.747 1.00 31.22  ? 235 MET B CG   1 
ATOM   8350  S SD   . MET B 1 235 ? 5.425   -11.379 -51.576 1.00 29.10  ? 235 MET B SD   1 
ATOM   8351  C CE   . MET B 1 235 ? 6.901   -12.332 -51.691 1.00 29.86  ? 235 MET B CE   1 
ATOM   8352  H H    . MET B 1 235 ? 2.015   -13.940 -52.082 1.00 35.84  ? 235 MET B H    1 
ATOM   8353  H HA   . MET B 1 235 ? 3.421   -14.282 -54.265 1.00 26.75  ? 235 MET B HA   1 
ATOM   8354  H HB2  . MET B 1 235 ? 4.289   -13.962 -51.605 1.00 36.25  ? 235 MET B HB2  1 
ATOM   8355  H HB3  . MET B 1 235 ? 5.312   -14.059 -52.812 1.00 36.25  ? 235 MET B HB3  1 
ATOM   8356  H HG2  . MET B 1 235 ? 4.607   -12.031 -53.649 1.00 37.42  ? 235 MET B HG2  1 
ATOM   8357  H HG3  . MET B 1 235 ? 3.419   -11.963 -52.590 1.00 37.42  ? 235 MET B HG3  1 
ATOM   8358  H HE1  . MET B 1 235 ? 7.568   -11.951 -51.099 1.00 35.79  ? 235 MET B HE1  1 
ATOM   8359  H HE2  . MET B 1 235 ? 6.707   -13.245 -51.429 1.00 35.79  ? 235 MET B HE2  1 
ATOM   8360  H HE3  . MET B 1 235 ? 7.219   -12.310 -52.607 1.00 35.79  ? 235 MET B HE3  1 
ATOM   8361  N N    . ILE B 1 236 ? 3.476   -16.751 -52.224 1.00 26.07  ? 236 ILE B N    1 
ATOM   8362  C CA   . ILE B 1 236 ? 3.767   -18.177 -52.103 1.00 33.81  ? 236 ILE B CA   1 
ATOM   8363  C C    . ILE B 1 236 ? 2.977   -18.979 -53.143 1.00 35.87  ? 236 ILE B C    1 
ATOM   8364  O O    . ILE B 1 236 ? 3.529   -19.823 -53.864 1.00 28.41  ? 236 ILE B O    1 
ATOM   8365  C CB   . ILE B 1 236 ? 3.440   -18.659 -50.684 1.00 35.23  ? 236 ILE B CB   1 
ATOM   8366  C CG1  . ILE B 1 236 ? 4.328   -17.930 -49.661 1.00 43.07  ? 236 ILE B CG1  1 
ATOM   8367  C CG2  . ILE B 1 236 ? 3.629   -20.177 -50.623 1.00 36.13  ? 236 ILE B CG2  1 
ATOM   8368  C CD1  . ILE B 1 236 ? 4.052   -18.288 -48.223 1.00 30.02  ? 236 ILE B CD1  1 
ATOM   8369  H H    . ILE B 1 236 ? 3.108   -16.407 -51.527 1.00 31.24  ? 236 ILE B H    1 
ATOM   8370  H HA   . ILE B 1 236 ? 4.712   -18.324 -52.262 1.00 40.52  ? 236 ILE B HA   1 
ATOM   8371  H HB   . ILE B 1 236 ? 2.511   -18.454 -50.491 1.00 42.24  ? 236 ILE B HB   1 
ATOM   8372  H HG12 . ILE B 1 236 ? 5.256   -18.147 -49.845 1.00 51.64  ? 236 ILE B HG12 1 
ATOM   8373  H HG13 . ILE B 1 236 ? 4.192   -16.974 -49.757 1.00 51.64  ? 236 ILE B HG13 1 
ATOM   8374  H HG21 . ILE B 1 236 ? 3.423   -20.485 -49.727 1.00 43.32  ? 236 ILE B HG21 1 
ATOM   8375  H HG22 . ILE B 1 236 ? 3.031   -20.595 -51.263 1.00 43.32  ? 236 ILE B HG22 1 
ATOM   8376  H HG23 . ILE B 1 236 ? 4.550   -20.389 -50.843 1.00 43.32  ? 236 ILE B HG23 1 
ATOM   8377  H HD11 . ILE B 1 236 ? 4.654   -17.785 -47.652 1.00 35.98  ? 236 ILE B HD11 1 
ATOM   8378  H HD12 . ILE B 1 236 ? 3.132   -18.064 -48.013 1.00 35.98  ? 236 ILE B HD12 1 
ATOM   8379  H HD13 . ILE B 1 236 ? 4.198   -19.239 -48.101 1.00 35.98  ? 236 ILE B HD13 1 
ATOM   8380  N N    . ALA B 1 237 ? 1.660   -18.778 -53.178 1.00 27.81  ? 237 ALA B N    1 
ATOM   8381  C CA   . ALA B 1 237 ? 0.831   -19.524 -54.125 1.00 32.79  ? 237 ALA B CA   1 
ATOM   8382  C C    . ALA B 1 237 ? 1.256   -19.242 -55.556 1.00 31.71  ? 237 ALA B C    1 
ATOM   8383  O O    . ALA B 1 237 ? 1.308   -20.151 -56.380 1.00 42.60  ? 237 ALA B O    1 
ATOM   8384  C CB   . ALA B 1 237 ? -0.636  -19.158 -53.956 1.00 24.06  ? 237 ALA B CB   1 
ATOM   8385  H H    . ALA B 1 237 ? 1.229   -18.228 -52.676 1.00 33.33  ? 237 ALA B H    1 
ATOM   8386  H HA   . ALA B 1 237 ? 0.929   -20.474 -53.959 1.00 39.31  ? 237 ALA B HA   1 
ATOM   8387  H HB1  . ALA B 1 237 ? -1.164  -19.664 -54.593 1.00 28.83  ? 237 ALA B HB1  1 
ATOM   8388  H HB2  . ALA B 1 237 ? -0.913  -19.374 -53.051 1.00 28.83  ? 237 ALA B HB2  1 
ATOM   8389  H HB3  . ALA B 1 237 ? -0.745  -18.207 -54.116 1.00 28.83  ? 237 ALA B HB3  1 
ATOM   8390  N N    . PHE B 1 238 ? 1.543   -17.985 -55.881 1.00 34.06  ? 238 PHE B N    1 
ATOM   8391  C CA   . PHE B 1 238 ? 1.954   -17.710 -57.254 1.00 34.80  ? 238 PHE B CA   1 
ATOM   8392  C C    . PHE B 1 238 ? 3.280   -18.382 -57.585 1.00 38.56  ? 238 PHE B C    1 
ATOM   8393  O O    . PHE B 1 238 ? 3.441   -18.924 -58.682 1.00 36.13  ? 238 PHE B O    1 
ATOM   8394  C CB   . PHE B 1 238 ? 2.046   -16.218 -57.537 1.00 36.06  ? 238 PHE B CB   1 
ATOM   8395  C CG   . PHE B 1 238 ? 2.411   -15.940 -58.964 1.00 44.10  ? 238 PHE B CG   1 
ATOM   8396  C CD1  . PHE B 1 238 ? 1.429   -15.876 -59.928 1.00 31.09  ? 238 PHE B CD1  1 
ATOM   8397  C CD2  . PHE B 1 238 ? 3.743   -15.837 -59.353 1.00 27.41  ? 238 PHE B CD2  1 
ATOM   8398  C CE1  . PHE B 1 238 ? 1.746   -15.655 -61.258 1.00 34.08  ? 238 PHE B CE1  1 
ATOM   8399  C CE2  . PHE B 1 238 ? 4.071   -15.631 -60.691 1.00 39.49  ? 238 PHE B CE2  1 
ATOM   8400  C CZ   . PHE B 1 238 ? 3.069   -15.547 -61.640 1.00 33.15  ? 238 PHE B CZ   1 
ATOM   8401  H H    . PHE B 1 238 ? 1.510   -17.305 -55.356 1.00 40.83  ? 238 PHE B H    1 
ATOM   8402  H HA   . PHE B 1 238 ? 1.285   -18.078 -57.853 1.00 41.72  ? 238 PHE B HA   1 
ATOM   8403  H HB2  . PHE B 1 238 ? 1.186   -15.806 -57.359 1.00 43.23  ? 238 PHE B HB2  1 
ATOM   8404  H HB3  . PHE B 1 238 ? 2.728   -15.827 -56.969 1.00 43.23  ? 238 PHE B HB3  1 
ATOM   8405  H HD1  . PHE B 1 238 ? 0.536   -15.955 -59.678 1.00 37.27  ? 238 PHE B HD1  1 
ATOM   8406  H HD2  . PHE B 1 238 ? 4.417   -15.902 -58.716 1.00 32.85  ? 238 PHE B HD2  1 
ATOM   8407  H HE1  . PHE B 1 238 ? 1.071   -15.601 -61.895 1.00 40.85  ? 238 PHE B HE1  1 
ATOM   8408  H HE2  . PHE B 1 238 ? 4.962   -15.546 -60.945 1.00 47.35  ? 238 PHE B HE2  1 
ATOM   8409  H HZ   . PHE B 1 238 ? 3.284   -15.394 -62.531 1.00 39.74  ? 238 PHE B HZ   1 
ATOM   8410  N N    . ALA B 1 239 ? 4.225   -18.387 -56.645 1.00 37.47  ? 239 ALA B N    1 
ATOM   8411  C CA   . ALA B 1 239 ? 5.506   -19.030 -56.898 1.00 35.39  ? 239 ALA B CA   1 
ATOM   8412  C C    . ALA B 1 239 ? 5.364   -20.538 -57.042 1.00 39.44  ? 239 ALA B C    1 
ATOM   8413  O O    . ALA B 1 239 ? 6.168   -21.172 -57.741 1.00 34.17  ? 239 ALA B O    1 
ATOM   8414  C CB   . ALA B 1 239 ? 6.495   -18.731 -55.773 1.00 34.92  ? 239 ALA B CB   1 
ATOM   8415  H H    . ALA B 1 239 ? 4.148   -18.031 -55.866 1.00 44.92  ? 239 ALA B H    1 
ATOM   8416  H HA   . ALA B 1 239 ? 5.876   -18.683 -57.724 1.00 42.43  ? 239 ALA B HA   1 
ATOM   8417  H HB1  . ALA B 1 239 ? 7.337   -19.171 -55.969 1.00 41.86  ? 239 ALA B HB1  1 
ATOM   8418  H HB2  . ALA B 1 239 ? 6.628   -17.772 -55.717 1.00 41.86  ? 239 ALA B HB2  1 
ATOM   8419  H HB3  . ALA B 1 239 ? 6.133   -19.065 -54.938 1.00 41.86  ? 239 ALA B HB3  1 
ATOM   8420  N N    . LYS B 1 240 ? 4.397   -21.139 -56.353 1.00 36.84  ? 240 LYS B N    1 
ATOM   8421  C CA   . LYS B 1 240 ? 4.235   -22.580 -56.474 1.00 40.50  ? 240 LYS B CA   1 
ATOM   8422  C C    . LYS B 1 240 ? 3.637   -22.941 -57.828 1.00 40.84  ? 240 LYS B C    1 
ATOM   8423  O O    . LYS B 1 240 ? 3.888   -24.030 -58.354 1.00 49.79  ? 240 LYS B O    1 
ATOM   8424  C CB   . LYS B 1 240 ? 3.359   -23.113 -55.345 1.00 36.20  ? 240 LYS B CB   1 
ATOM   8425  C CG   . LYS B 1 240 ? 4.041   -23.233 -54.009 1.00 34.80  ? 240 LYS B CG   1 
ATOM   8426  C CD   . LYS B 1 240 ? 3.052   -23.647 -52.918 1.00 42.91  ? 240 LYS B CD   1 
ATOM   8427  C CE   . LYS B 1 240 ? 3.744   -24.103 -51.662 1.00 47.30  ? 240 LYS B CE   1 
ATOM   8428  N NZ   . LYS B 1 240 ? 2.980   -23.716 -50.446 1.00 52.25  ? 240 LYS B NZ   1 
ATOM   8429  H H    . LYS B 1 240 ? 3.840   -20.749 -55.826 1.00 44.16  ? 240 LYS B H    1 
ATOM   8430  H HA   . LYS B 1 240 ? 5.105   -23.004 -56.407 1.00 48.56  ? 240 LYS B HA   1 
ATOM   8431  H HB2  . LYS B 1 240 ? 2.602   -22.516 -55.234 1.00 43.40  ? 240 LYS B HB2  1 
ATOM   8432  H HB3  . LYS B 1 240 ? 3.042   -23.996 -55.591 1.00 43.40  ? 240 LYS B HB3  1 
ATOM   8433  H HG2  . LYS B 1 240 ? 4.736   -23.908 -54.063 1.00 41.72  ? 240 LYS B HG2  1 
ATOM   8434  H HG3  . LYS B 1 240 ? 4.423   -22.375 -53.766 1.00 41.72  ? 240 LYS B HG3  1 
ATOM   8435  H HD2  . LYS B 1 240 ? 2.490   -22.889 -52.694 1.00 51.45  ? 240 LYS B HD2  1 
ATOM   8436  H HD3  . LYS B 1 240 ? 2.507   -24.380 -53.245 1.00 51.45  ? 240 LYS B HD3  1 
ATOM   8437  H HE2  . LYS B 1 240 ? 3.825   -25.070 -51.674 1.00 56.71  ? 240 LYS B HE2  1 
ATOM   8438  H HE3  . LYS B 1 240 ? 4.621   -23.693 -51.613 1.00 56.71  ? 240 LYS B HE3  1 
ATOM   8439  H HZ1  . LYS B 1 240 ? 2.170   -24.084 -50.465 1.00 62.65  ? 240 LYS B HZ1  1 
ATOM   8440  H HZ2  . LYS B 1 240 ? 3.408   -23.995 -49.717 1.00 62.65  ? 240 LYS B HZ2  1 
ATOM   8441  H HZ3  . LYS B 1 240 ? 2.895   -22.831 -50.410 1.00 62.65  ? 240 LYS B HZ3  1 
ATOM   8442  N N    . LEU B 1 241 ? 2.883   -22.032 -58.405 1.00 43.87  ? 241 LEU B N    1 
ATOM   8443  C CA   . LEU B 1 241 ? 2.178   -22.252 -59.681 1.00 38.20  ? 241 LEU B CA   1 
ATOM   8444  C C    . LEU B 1 241 ? 3.061   -21.865 -60.871 1.00 48.77  ? 241 LEU B C    1 
ATOM   8445  O O    . LEU B 1 241 ? 2.850   -22.424 -61.926 1.00 65.09  ? 241 LEU B O    1 
ATOM   8446  C CB   . LEU B 1 241 ? 0.890   -21.432 -59.566 1.00 38.24  ? 241 LEU B CB   1 
ATOM   8447  C CG   . LEU B 1 241 ? 0.403   -20.638 -60.771 1.00 42.70  ? 241 LEU B CG   1 
ATOM   8448  C CD1  . LEU B 1 241 ? -0.910  -19.976 -60.435 1.00 49.87  ? 241 LEU B CD1  1 
ATOM   8449  C CD2  . LEU B 1 241 ? 1.391   -19.584 -61.206 1.00 48.17  ? 241 LEU B CD2  1 
ATOM   8450  H H    . LEU B 1 241 ? 2.750   -21.205 -58.047 1.00 52.61  ? 241 LEU B H    1 
ATOM   8451  H HA   . LEU B 1 241 ? 1.954   -23.208 -59.751 1.00 45.79  ? 241 LEU B HA   1 
ATOM   8452  H HB2  . LEU B 1 241 ? 0.174   -22.046 -59.308 1.00 45.84  ? 241 LEU B HB2  1 
ATOM   8453  H HB3  . LEU B 1 241 ? 1.006   -20.805 -58.825 1.00 45.84  ? 241 LEU B HB3  1 
ATOM   8454  H HG   . LEU B 1 241 ? 0.258   -21.263 -61.523 1.00 51.20  ? 241 LEU B HG   1 
ATOM   8455  H HD11 . LEU B 1 241 ? -1.217  -19.457 -61.199 1.00 59.80  ? 241 LEU B HD11 1 
ATOM   8456  H HD12 . LEU B 1 241 ? -1.571  -20.657 -60.219 1.00 59.80  ? 241 LEU B HD12 1 
ATOM   8457  H HD13 . LEU B 1 241 ? -0.790  -19.387 -59.670 1.00 59.80  ? 241 LEU B HD13 1 
ATOM   8458  H HD21 . LEU B 1 241 ? 0.910   -18.813 -61.553 1.00 57.76  ? 241 LEU B HD21 1 
ATOM   8459  H HD22 . LEU B 1 241 ? 1.932   -19.313 -60.444 1.00 57.76  ? 241 LEU B HD22 1 
ATOM   8460  H HD23 . LEU B 1 241 ? 1.967   -19.947 -61.901 1.00 57.76  ? 241 LEU B HD23 1 
ATOM   8461  N N    . PHE B 1 242 ? 4.082   -21.033 -60.699 1.00 42.97  ? 242 PHE B N    1 
ATOM   8462  C CA   . PHE B 1 242 ? 4.838   -20.480 -61.814 1.00 41.61  ? 242 PHE B CA   1 
ATOM   8463  C C    . PHE B 1 242 ? 6.257   -21.003 -61.912 1.00 45.58  ? 242 PHE B C    1 
ATOM   8464  O O    . PHE B 1 242 ? 6.764   -21.150 -63.023 1.00 54.93  ? 242 PHE B O    1 
ATOM   8465  C CB   . PHE B 1 242 ? 4.872   -18.952 -61.708 1.00 41.68  ? 242 PHE B CB   1 
ATOM   8466  C CG   . PHE B 1 242 ? 5.782   -18.286 -62.691 1.00 53.27  ? 242 PHE B CG   1 
ATOM   8467  C CD1  . PHE B 1 242 ? 5.347   -17.987 -63.974 1.00 59.00  ? 242 PHE B CD1  1 
ATOM   8468  C CD2  . PHE B 1 242 ? 7.064   -17.938 -62.328 1.00 42.77  ? 242 PHE B CD2  1 
ATOM   8469  C CE1  . PHE B 1 242 ? 6.183   -17.365 -64.879 1.00 50.17  ? 242 PHE B CE1  1 
ATOM   8470  C CE2  . PHE B 1 242 ? 7.909   -17.310 -63.231 1.00 57.90  ? 242 PHE B CE2  1 
ATOM   8471  C CZ   . PHE B 1 242 ? 7.463   -17.019 -64.505 1.00 59.77  ? 242 PHE B CZ   1 
ATOM   8472  H H    . PHE B 1 242 ? 4.351   -20.760 -59.929 1.00 51.52  ? 242 PHE B H    1 
ATOM   8473  H HA   . PHE B 1 242 ? 4.383   -20.708 -62.640 1.00 49.89  ? 242 PHE B HA   1 
ATOM   8474  H HB2  . PHE B 1 242 ? 3.977   -18.610 -61.857 1.00 49.98  ? 242 PHE B HB2  1 
ATOM   8475  H HB3  . PHE B 1 242 ? 5.172   -18.709 -60.818 1.00 49.98  ? 242 PHE B HB3  1 
ATOM   8476  H HD1  . PHE B 1 242 ? 4.483   -18.215 -64.230 1.00 70.76  ? 242 PHE B HD1  1 
ATOM   8477  H HD2  . PHE B 1 242 ? 7.367   -18.127 -61.470 1.00 51.28  ? 242 PHE B HD2  1 
ATOM   8478  H HE1  . PHE B 1 242 ? 5.880   -17.172 -65.737 1.00 60.16  ? 242 PHE B HE1  1 
ATOM   8479  H HE2  . PHE B 1 242 ? 8.774   -17.081 -62.977 1.00 69.43  ? 242 PHE B HE2  1 
ATOM   8480  H HZ   . PHE B 1 242 ? 8.030   -16.602 -65.113 1.00 71.68  ? 242 PHE B HZ   1 
ATOM   8481  N N    . CYS B 1 243 ? 6.906   -21.309 -60.794 1.00 42.43  ? 243 CYS B N    1 
ATOM   8482  C CA   . CYS B 1 243 ? 8.338   -21.596 -60.802 1.00 51.07  ? 243 CYS B CA   1 
ATOM   8483  C C    . CYS B 1 243 ? 8.598   -23.068 -61.109 1.00 59.63  ? 243 CYS B C    1 
ATOM   8484  O O    . CYS B 1 243 ? 7.887   -23.955 -60.625 1.00 53.92  ? 243 CYS B O    1 
ATOM   8485  C CB   . CYS B 1 243 ? 8.996   -21.213 -59.464 1.00 41.00  ? 243 CYS B CB   1 
ATOM   8486  S SG   . CYS B 1 243 ? 8.936   -19.418 -59.065 1.00 43.18  ? 243 CYS B SG   1 
ATOM   8487  H H    . CYS B 1 243 ? 6.541   -21.358 -60.016 1.00 50.88  ? 243 CYS B H    1 
ATOM   8488  H HA   . CYS B 1 243 ? 8.758   -21.069 -61.500 1.00 61.24  ? 243 CYS B HA   1 
ATOM   8489  H HB2  . CYS B 1 243 ? 8.543   -21.689 -58.750 1.00 49.16  ? 243 CYS B HB2  1 
ATOM   8490  H HB3  . CYS B 1 243 ? 9.929   -21.477 -59.491 1.00 49.16  ? 243 CYS B HB3  1 
ATOM   8491  H HG   . CYS B 1 243 ? 9.473   -19.234 -58.008 1.00 51.78  ? 243 CYS B HG   1 
ATOM   8492  N N    . SER B 1 244 ? 9.630   -23.310 -61.927 1.00 64.14  ? 244 SER B N    1 
ATOM   8493  C CA   . SER B 1 244 ? 10.060  -24.667 -62.249 1.00 55.62  ? 244 SER B CA   1 
ATOM   8494  C C    . SER B 1 244 ? 10.615  -25.359 -61.016 1.00 65.70  ? 244 SER B C    1 
ATOM   8495  O O    . SER B 1 244 ? 10.139  -26.432 -60.626 1.00 73.24  ? 244 SER B O    1 
ATOM   8496  C CB   . SER B 1 244 ? 11.115  -24.629 -63.362 1.00 53.14  ? 244 SER B CB   1 
ATOM   8497  O OG   . SER B 1 244 ? 10.932  -23.485 -64.179 1.00 56.12  ? 244 SER B OG   1 
ATOM   8498  H H    . SER B 1 244 ? 10.098  -22.698 -62.308 1.00 76.93  ? 244 SER B H    1 
ATOM   8499  H HA   . SER B 1 244 ? 9.299   -25.178 -62.567 1.00 66.70  ? 244 SER B HA   1 
ATOM   8500  H HB2  . SER B 1 244 ? 11.998  -24.594 -62.961 1.00 63.72  ? 244 SER B HB2  1 
ATOM   8501  H HB3  . SER B 1 244 ? 11.029  -25.426 -63.908 1.00 63.72  ? 244 SER B HB3  1 
ATOM   8502  H HG   . SER B 1 244 ? 11.512  -23.470 -64.786 1.00 67.30  ? 244 SER B HG   1 
ATOM   8503  N N    . GLY B 1 245 ? 11.626  -24.751 -60.383 1.00 64.36  ? 245 GLY B N    1 
ATOM   8504  C CA   . GLY B 1 245 ? 12.266  -25.319 -59.218 1.00 58.15  ? 245 GLY B CA   1 
ATOM   8505  C C    . GLY B 1 245 ? 11.248  -25.747 -58.184 1.00 48.61  ? 245 GLY B C    1 
ATOM   8506  O O    . GLY B 1 245 ? 10.053  -25.446 -58.306 1.00 55.36  ? 245 GLY B O    1 
ATOM   8507  H H    . GLY B 1 245 ? 11.956  -23.994 -60.623 1.00 77.19  ? 245 GLY B H    1 
ATOM   8508  H HA2  . GLY B 1 245 ? 12.790  -26.093 -59.478 1.00 69.74  ? 245 GLY B HA2  1 
ATOM   8509  H HA3  . GLY B 1 245 ? 12.859  -24.663 -58.819 1.00 69.74  ? 245 GLY B HA3  1 
ATOM   8510  N N    . PRO B 1 246 ? 11.697  -26.489 -57.165 1.00 43.65  ? 246 PRO B N    1 
ATOM   8511  C CA   . PRO B 1 246 ? 10.841  -26.781 -55.997 1.00 43.29  ? 246 PRO B CA   1 
ATOM   8512  C C    . PRO B 1 246 ? 10.591  -25.553 -55.122 1.00 51.61  ? 246 PRO B C    1 
ATOM   8513  O O    . PRO B 1 246 ? 11.455  -24.686 -54.978 1.00 46.21  ? 246 PRO B O    1 
ATOM   8514  C CB   . PRO B 1 246 ? 11.654  -27.824 -55.228 1.00 51.57  ? 246 PRO B CB   1 
ATOM   8515  C CG   . PRO B 1 246 ? 13.091  -27.564 -55.655 1.00 49.89  ? 246 PRO B CG   1 
ATOM   8516  C CD   . PRO B 1 246 ? 13.009  -27.151 -57.078 1.00 51.59  ? 246 PRO B CD   1 
ATOM   8517  H HA   . PRO B 1 246 ? 9.995   -27.164 -56.276 1.00 51.91  ? 246 PRO B HA   1 
ATOM   8518  H HB2  . PRO B 1 246 ? 11.546  -27.688 -54.273 1.00 61.85  ? 246 PRO B HB2  1 
ATOM   8519  H HB3  . PRO B 1 246 ? 11.372  -28.716 -55.485 1.00 61.85  ? 246 PRO B HB3  1 
ATOM   8520  H HG2  . PRO B 1 246 ? 13.468  -26.853 -55.113 1.00 59.83  ? 246 PRO B HG2  1 
ATOM   8521  H HG3  . PRO B 1 246 ? 13.611  -28.377 -55.563 1.00 59.83  ? 246 PRO B HG3  1 
ATOM   8522  H HD2  . PRO B 1 246 ? 13.719  -26.525 -57.290 1.00 61.87  ? 246 PRO B HD2  1 
ATOM   8523  H HD3  . PRO B 1 246 ? 13.035  -27.929 -57.658 1.00 61.87  ? 246 PRO B HD3  1 
ATOM   8524  N N    . VAL B 1 247 ? 9.408   -25.506 -54.493 1.00 51.63  ? 247 VAL B N    1 
ATOM   8525  C CA   . VAL B 1 247 ? 8.952   -24.300 -53.799 1.00 39.43  ? 247 VAL B CA   1 
ATOM   8526  C C    . VAL B 1 247 ? 8.242   -24.642 -52.492 1.00 47.91  ? 247 VAL B C    1 
ATOM   8527  O O    . VAL B 1 247 ? 7.152   -25.230 -52.508 1.00 45.98  ? 247 VAL B O    1 
ATOM   8528  C CB   . VAL B 1 247 ? 8.029   -23.466 -54.687 1.00 35.96  ? 247 VAL B CB   1 
ATOM   8529  C CG1  . VAL B 1 247 ? 7.658   -22.183 -54.003 1.00 40.10  ? 247 VAL B CG1  1 
ATOM   8530  C CG2  . VAL B 1 247 ? 8.706   -23.182 -55.983 1.00 41.58  ? 247 VAL B CG2  1 
ATOM   8531  H H    . VAL B 1 247 ? 8.853   -26.161 -54.455 1.00 61.92  ? 247 VAL B H    1 
ATOM   8532  H HA   . VAL B 1 247 ? 9.725   -23.755 -53.582 1.00 47.27  ? 247 VAL B HA   1 
ATOM   8533  H HB   . VAL B 1 247 ? 7.217   -23.964 -54.868 1.00 43.11  ? 247 VAL B HB   1 
ATOM   8534  H HG11 . VAL B 1 247 ? 7.073   -21.673 -54.585 1.00 48.07  ? 247 VAL B HG11 1 
ATOM   8535  H HG12 . VAL B 1 247 ? 7.201   -22.390 -53.173 1.00 48.07  ? 247 VAL B HG12 1 
ATOM   8536  H HG13 . VAL B 1 247 ? 8.466   -21.679 -53.819 1.00 48.07  ? 247 VAL B HG13 1 
ATOM   8537  H HG21 . VAL B 1 247 ? 8.113   -22.653 -56.539 1.00 49.86  ? 247 VAL B HG21 1 
ATOM   8538  H HG22 . VAL B 1 247 ? 9.524   -22.691 -55.810 1.00 49.86  ? 247 VAL B HG22 1 
ATOM   8539  H HG23 . VAL B 1 247 ? 8.910   -24.022 -56.423 1.00 49.86  ? 247 VAL B HG23 1 
ATOM   8540  N N    . SER B 1 248 ? 8.807   -24.171 -51.370 1.00 38.59  ? 248 SER B N    1 
ATOM   8541  C CA   . SER B 1 248 ? 8.327   -24.445 -50.024 1.00 40.77  ? 248 SER B CA   1 
ATOM   8542  C C    . SER B 1 248 ? 7.867   -23.164 -49.339 1.00 41.45  ? 248 SER B C    1 
ATOM   8543  O O    . SER B 1 248 ? 8.527   -22.124 -49.443 1.00 39.19  ? 248 SER B O    1 
ATOM   8544  C CB   . SER B 1 248 ? 9.444   -25.060 -49.188 1.00 44.89  ? 248 SER B CB   1 
ATOM   8545  O OG   . SER B 1 248 ? 9.905   -26.237 -49.783 1.00 44.52  ? 248 SER B OG   1 
ATOM   8546  H H    . SER B 1 248 ? 9.504   -23.667 -51.376 1.00 46.27  ? 248 SER B H    1 
ATOM   8547  H HA   . SER B 1 248 ? 7.583   -25.066 -50.060 1.00 48.88  ? 248 SER B HA   1 
ATOM   8548  H HB2  . SER B 1 248 ? 10.178  -24.429 -49.125 1.00 53.83  ? 248 SER B HB2  1 
ATOM   8549  H HB3  . SER B 1 248 ? 9.103   -25.265 -48.304 1.00 53.83  ? 248 SER B HB3  1 
ATOM   8550  H HG   . SER B 1 248 ? 10.202  -26.073 -50.551 1.00 53.38  ? 248 SER B HG   1 
ATOM   8551  N N    . SER B 1 249 ? 6.775   -23.254 -48.582 1.00 37.09  ? 249 SER B N    1 
ATOM   8552  C CA   . SER B 1 249 ? 6.305   -22.097 -47.827 1.00 42.65  ? 249 SER B CA   1 
ATOM   8553  C C    . SER B 1 249 ? 7.361   -21.595 -46.859 1.00 44.44  ? 249 SER B C    1 
ATOM   8554  O O    . SER B 1 249 ? 7.412   -20.401 -46.578 1.00 40.76  ? 249 SER B O    1 
ATOM   8555  C CB   . SER B 1 249 ? 5.033   -22.431 -47.040 1.00 39.82  ? 249 SER B CB   1 
ATOM   8556  O OG   . SER B 1 249 ? 3.919   -22.557 -47.914 1.00 41.04  ? 249 SER B OG   1 
ATOM   8557  H H    . SER B 1 249 ? 6.296   -23.963 -48.489 1.00 44.47  ? 249 SER B H    1 
ATOM   8558  H HA   . SER B 1 249 ? 6.097   -21.379 -48.445 1.00 51.14  ? 249 SER B HA   1 
ATOM   8559  H HB2  . SER B 1 249 ? 5.163   -23.270 -46.570 1.00 47.74  ? 249 SER B HB2  1 
ATOM   8560  H HB3  . SER B 1 249 ? 4.858   -21.718 -46.405 1.00 47.74  ? 249 SER B HB3  1 
ATOM   8561  H HG   . SER B 1 249 ? 3.228   -22.740 -47.474 1.00 49.21  ? 249 SER B HG   1 
ATOM   8562  N N    . ALA B 1 250 ? 8.200   -22.491 -46.337 1.00 35.86  ? 250 ALA B N    1 
ATOM   8563  C CA   . ALA B 1 250 ? 9.169   -22.131 -45.313 1.00 50.98  ? 250 ALA B CA   1 
ATOM   8564  C C    . ALA B 1 250 ? 10.299  -21.270 -45.863 1.00 44.96  ? 250 ALA B C    1 
ATOM   8565  O O    . ALA B 1 250 ? 10.983  -20.592 -45.090 1.00 44.33  ? 250 ALA B O    1 
ATOM   8566  C CB   . ALA B 1 250 ? 9.759   -23.396 -44.677 1.00 51.29  ? 250 ALA B CB   1 
ATOM   8567  H H    . ALA B 1 250 ? 8.225   -23.320 -46.564 1.00 42.99  ? 250 ALA B H    1 
ATOM   8568  H HA   . ALA B 1 250 ? 8.719   -21.626 -44.617 1.00 61.13  ? 250 ALA B HA   1 
ATOM   8569  H HB1  . ALA B 1 250 ? 10.402  -23.137 -43.998 1.00 61.51  ? 250 ALA B HB1  1 
ATOM   8570  H HB2  . ALA B 1 250 ? 9.042   -23.911 -44.275 1.00 61.51  ? 250 ALA B HB2  1 
ATOM   8571  H HB3  . ALA B 1 250 ? 10.198  -23.920 -45.366 1.00 61.51  ? 250 ALA B HB3  1 
ATOM   8572  N N    . THR B 1 251 ? 10.511  -21.286 -47.175 1.00 38.29  ? 251 THR B N    1 
ATOM   8573  C CA   . THR B 1 251 ? 11.525  -20.442 -47.768 1.00 34.65  ? 251 THR B CA   1 
ATOM   8574  C C    . THR B 1 251 ? 11.162  -18.977 -47.688 1.00 33.38  ? 251 THR B C    1 
ATOM   8575  O O    . THR B 1 251 ? 12.065  -18.128 -47.703 1.00 31.84  ? 251 THR B O    1 
ATOM   8576  C CB   . THR B 1 251 ? 11.734  -20.856 -49.208 1.00 38.95  ? 251 THR B CB   1 
ATOM   8577  O OG1  . THR B 1 251 ? 11.988  -22.264 -49.207 1.00 41.63  ? 251 THR B OG1  1 
ATOM   8578  C CG2  . THR B 1 251 ? 12.902  -20.072 -49.850 1.00 33.17  ? 251 THR B CG2  1 
ATOM   8579  H H    . THR B 1 251 ? 10.081  -21.776 -47.736 1.00 45.91  ? 251 THR B H    1 
ATOM   8580  H HA   . THR B 1 251 ? 12.361  -20.570 -47.294 1.00 41.54  ? 251 THR B HA   1 
ATOM   8581  H HB   . THR B 1 251 ? 10.928  -20.674 -49.716 1.00 46.69  ? 251 THR B HB   1 
ATOM   8582  H HG1  . THR B 1 251 ? 12.111  -22.534 -49.993 1.00 49.91  ? 251 THR B HG1  1 
ATOM   8583  H HG21 . THR B 1 251 ? 13.021  -20.351 -50.772 1.00 39.76  ? 251 THR B HG21 1 
ATOM   8584  H HG22 . THR B 1 251 ? 12.713  -19.121 -49.830 1.00 39.76  ? 251 THR B HG22 1 
ATOM   8585  H HG23 . THR B 1 251 ? 13.723  -20.241 -49.361 1.00 39.76  ? 251 THR B HG23 1 
ATOM   8586  N N    . PHE B 1 252 ? 9.870   -18.666 -47.607 1.00 28.30  ? 252 PHE B N    1 
ATOM   8587  C CA   . PHE B 1 252 ? 9.420   -17.285 -47.545 1.00 27.80  ? 252 PHE B CA   1 
ATOM   8588  C C    . PHE B 1 252 ? 9.622   -16.676 -46.167 1.00 25.18  ? 252 PHE B C    1 
ATOM   8589  O O    . PHE B 1 252 ? 9.432   -15.468 -46.020 1.00 25.40  ? 252 PHE B O    1 
ATOM   8590  C CB   . PHE B 1 252 ? 7.946   -17.183 -47.997 1.00 21.03  ? 252 PHE B CB   1 
ATOM   8591  C CG   . PHE B 1 252 ? 7.767   -17.502 -49.418 1.00 24.16  ? 252 PHE B CG   1 
ATOM   8592  C CD1  . PHE B 1 252 ? 7.868   -18.805 -49.853 1.00 27.84  ? 252 PHE B CD1  1 
ATOM   8593  C CD2  . PHE B 1 252 ? 7.637   -16.506 -50.336 1.00 30.47  ? 252 PHE B CD2  1 
ATOM   8594  C CE1  . PHE B 1 252 ? 7.765   -19.113 -51.180 1.00 31.93  ? 252 PHE B CE1  1 
ATOM   8595  C CE2  . PHE B 1 252 ? 7.523   -16.810 -51.678 1.00 39.09  ? 252 PHE B CE2  1 
ATOM   8596  C CZ   . PHE B 1 252 ? 7.586   -18.116 -52.091 1.00 31.76  ? 252 PHE B CZ   1 
ATOM   8597  H H    . PHE B 1 252 ? 9.232   -19.243 -47.586 1.00 33.92  ? 252 PHE B H    1 
ATOM   8598  H HA   . PHE B 1 252 ? 9.950   -16.765 -48.169 1.00 33.32  ? 252 PHE B HA   1 
ATOM   8599  H HB2  . PHE B 1 252 ? 7.413   -17.807 -47.480 1.00 25.20  ? 252 PHE B HB2  1 
ATOM   8600  H HB3  . PHE B 1 252 ? 7.633   -16.277 -47.851 1.00 25.20  ? 252 PHE B HB3  1 
ATOM   8601  H HD1  . PHE B 1 252 ? 7.983   -19.488 -49.232 1.00 33.37  ? 252 PHE B HD1  1 
ATOM   8602  H HD2  . PHE B 1 252 ? 7.587   -15.621 -50.056 1.00 36.52  ? 252 PHE B HD2  1 
ATOM   8603  H HE1  . PHE B 1 252 ? 7.804   -19.999 -51.458 1.00 38.28  ? 252 PHE B HE1  1 
ATOM   8604  H HE2  . PHE B 1 252 ? 7.406   -16.130 -52.302 1.00 46.87  ? 252 PHE B HE2  1 
ATOM   8605  H HZ   . PHE B 1 252 ? 7.511   -18.322 -52.995 1.00 38.07  ? 252 PHE B HZ   1 
ATOM   8606  N N    . LEU B 1 253 ? 10.019  -17.472 -45.178 1.00 26.39  ? 253 LEU B N    1 
ATOM   8607  C CA   . LEU B 1 253 ? 10.454  -16.950 -43.879 1.00 31.03  ? 253 LEU B CA   1 
ATOM   8608  C C    . LEU B 1 253 ? 11.894  -16.457 -43.907 1.00 29.70  ? 253 LEU B C    1 
ATOM   8609  O O    . LEU B 1 253 ? 12.354  -15.892 -42.912 1.00 21.77  ? 253 LEU B O    1 
ATOM   8610  C CB   . LEU B 1 253 ? 10.363  -18.018 -42.778 1.00 28.19  ? 253 LEU B CB   1 
ATOM   8611  C CG   . LEU B 1 253 ? 9.031   -18.766 -42.621 1.00 37.90  ? 253 LEU B CG   1 
ATOM   8612  C CD1  . LEU B 1 253 ? 9.290   -20.034 -41.802 1.00 41.35  ? 253 LEU B CD1  1 
ATOM   8613  C CD2  . LEU B 1 253 ? 7.950   -17.909 -41.977 1.00 31.09  ? 253 LEU B CD2  1 
ATOM   8614  H H    . LEU B 1 253 ? 10.046  -18.329 -45.233 1.00 31.63  ? 253 LEU B H    1 
ATOM   8615  H HA   . LEU B 1 253 ? 9.884   -16.206 -43.627 1.00 37.19  ? 253 LEU B HA   1 
ATOM   8616  H HB2  . LEU B 1 253 ? 11.044  -18.686 -42.951 1.00 33.78  ? 253 LEU B HB2  1 
ATOM   8617  H HB3  . LEU B 1 253 ? 10.548  -17.588 -41.928 1.00 33.78  ? 253 LEU B HB3  1 
ATOM   8618  H HG   . LEU B 1 253 ? 8.716   -19.036 -43.498 1.00 45.44  ? 253 LEU B HG   1 
ATOM   8619  H HD11 . LEU B 1 253 ? 8.456   -20.517 -41.696 1.00 49.58  ? 253 LEU B HD11 1 
ATOM   8620  H HD12 . LEU B 1 253 ? 9.935   -20.587 -42.272 1.00 49.58  ? 253 LEU B HD12 1 
ATOM   8621  H HD13 . LEU B 1 253 ? 9.640   -19.783 -40.933 1.00 49.58  ? 253 LEU B HD13 1 
ATOM   8622  H HD21 . LEU B 1 253 ? 7.135   -18.431 -41.904 1.00 37.27  ? 253 LEU B HD21 1 
ATOM   8623  H HD22 . LEU B 1 253 ? 8.248   -17.635 -41.096 1.00 37.27  ? 253 LEU B HD22 1 
ATOM   8624  H HD23 . LEU B 1 253 ? 7.794   -17.128 -42.531 1.00 37.27  ? 253 LEU B HD23 1 
ATOM   8625  N N    . GLU B 1 254 ? 12.608  -16.653 -45.012 1.00 28.73  ? 254 GLU B N    1 
ATOM   8626  C CA   . GLU B 1 254 ? 13.975  -16.167 -45.079 1.00 25.54  ? 254 GLU B CA   1 
ATOM   8627  C C    . GLU B 1 254 ? 13.954  -14.667 -45.353 1.00 34.29  ? 254 GLU B C    1 
ATOM   8628  O O    . GLU B 1 254 ? 12.900  -14.070 -45.623 1.00 25.77  ? 254 GLU B O    1 
ATOM   8629  C CB   . GLU B 1 254 ? 14.770  -16.920 -46.152 1.00 22.03  ? 254 GLU B CB   1 
ATOM   8630  C CG   . GLU B 1 254 ? 14.982  -18.417 -45.879 1.00 27.15  ? 254 GLU B CG   1 
ATOM   8631  C CD   . GLU B 1 254 ? 15.744  -18.721 -44.582 1.00 28.27  ? 254 GLU B CD   1 
ATOM   8632  O OE1  . GLU B 1 254 ? 16.497  -17.852 -44.083 1.00 31.65  ? 254 GLU B OE1  1 
ATOM   8633  O OE2  . GLU B 1 254 ? 15.587  -19.848 -44.053 1.00 41.22  ? 254 GLU B OE2  1 
ATOM   8634  H H    . GLU B 1 254 ? 12.330  -17.055 -45.720 1.00 34.43  ? 254 GLU B H    1 
ATOM   8635  H HA   . GLU B 1 254 ? 14.408  -16.313 -44.223 1.00 30.61  ? 254 GLU B HA   1 
ATOM   8636  H HB2  . GLU B 1 254 ? 14.298  -16.840 -46.996 1.00 26.39  ? 254 GLU B HB2  1 
ATOM   8637  H HB3  . GLU B 1 254 ? 15.646  -16.510 -46.230 1.00 26.39  ? 254 GLU B HB3  1 
ATOM   8638  H HG2  . GLU B 1 254 ? 14.115  -18.848 -45.820 1.00 32.54  ? 254 GLU B HG2  1 
ATOM   8639  H HG3  . GLU B 1 254 ? 15.487  -18.798 -46.615 1.00 32.54  ? 254 GLU B HG3  1 
ATOM   8640  N N    . SER B 1 255 ? 15.144  -14.060 -45.285 1.00 26.45  ? 255 SER B N    1 
ATOM   8641  C CA   . SER B 1 255 ? 15.252  -12.620 -45.478 1.00 20.21  ? 255 SER B CA   1 
ATOM   8642  C C    . SER B 1 255 ? 14.651  -12.213 -46.797 1.00 24.39  ? 255 SER B C    1 
ATOM   8643  O O    . SER B 1 255 ? 13.990  -11.166 -46.892 1.00 28.02  ? 255 SER B O    1 
ATOM   8644  C CB   . SER B 1 255 ? 16.720  -12.179 -45.394 1.00 27.89  ? 255 SER B CB   1 
ATOM   8645  O OG   . SER B 1 255 ? 16.818  -10.790 -45.650 1.00 22.33  ? 255 SER B OG   1 
ATOM   8646  H H    . SER B 1 255 ? 15.891  -14.457 -45.131 1.00 31.70  ? 255 SER B H    1 
ATOM   8647  H HA   . SER B 1 255 ? 14.762  -12.169 -44.773 1.00 24.21  ? 255 SER B HA   1 
ATOM   8648  H HB2  . SER B 1 255 ? 17.058  -12.365 -44.504 1.00 33.42  ? 255 SER B HB2  1 
ATOM   8649  H HB3  . SER B 1 255 ? 17.237  -12.664 -46.056 1.00 33.42  ? 255 SER B HB3  1 
ATOM   8650  H HG   . SER B 1 255 ? 16.370  -10.361 -45.084 1.00 26.76  ? 255 SER B HG   1 
ATOM   8651  N N    . CYS B 1 256 ? 14.821  -13.060 -47.816 1.00 23.50  ? 256 CYS B N    1 
ATOM   8652  C CA   . CYS B 1 256 ? 14.353  -12.753 -49.168 1.00 26.85  ? 256 CYS B CA   1 
ATOM   8653  C C    . CYS B 1 256 ? 12.839  -12.668 -49.243 1.00 21.44  ? 256 CYS B C    1 
ATOM   8654  O O    . CYS B 1 256 ? 12.313  -12.083 -50.181 1.00 26.50  ? 256 CYS B O    1 
ATOM   8655  C CB   . CYS B 1 256 ? 14.830  -13.825 -50.189 1.00 28.15  ? 256 CYS B CB   1 
ATOM   8656  S SG   . CYS B 1 256 ? 14.390  -15.554 -49.741 1.00 28.47  ? 256 CYS B SG   1 
ATOM   8657  H H    . CYS B 1 256 ? 15.207  -13.826 -47.747 1.00 28.16  ? 256 CYS B H    1 
ATOM   8658  H HA   . CYS B 1 256 ? 14.716  -11.896 -49.440 1.00 32.17  ? 256 CYS B HA   1 
ATOM   8659  H HB2  . CYS B 1 256 ? 14.428  -13.633 -51.050 1.00 33.74  ? 256 CYS B HB2  1 
ATOM   8660  H HB3  . CYS B 1 256 ? 15.796  -13.776 -50.261 1.00 33.74  ? 256 CYS B HB3  1 
ATOM   8661  H HG   . CYS B 1 256 ? 13.196  -15.645 -49.663 1.00 34.12  ? 256 CYS B HG   1 
ATOM   8662  N N    . GLY B 1 257 ? 12.130  -13.251 -48.284 1.00 29.61  ? 257 GLY B N    1 
ATOM   8663  C CA   . GLY B 1 257 ? 10.679  -13.256 -48.263 1.00 23.76  ? 257 GLY B CA   1 
ATOM   8664  C C    . GLY B 1 257 ? 10.159  -12.231 -47.287 1.00 22.44  ? 257 GLY B C    1 
ATOM   8665  O O    . GLY B 1 257 ? 9.974   -11.034 -47.599 1.00 25.51  ? 257 GLY B O    1 
ATOM   8666  H H    . GLY B 1 257 ? 12.481  -13.662 -47.615 1.00 35.49  ? 257 GLY B H    1 
ATOM   8667  H HA2  . GLY B 1 257 ? 10.336  -13.050 -49.147 1.00 28.47  ? 257 GLY B HA2  1 
ATOM   8668  H HA3  . GLY B 1 257 ? 10.356  -14.132 -47.999 1.00 28.47  ? 257 GLY B HA3  1 
ATOM   8669  N N    . VAL B 1 258 ? 9.939   -12.672 -46.062 1.00 22.81  ? 258 VAL B N    1 
ATOM   8670  C CA   . VAL B 1 258 ? 9.232   -11.843 -45.108 1.00 22.95  ? 258 VAL B CA   1 
ATOM   8671  C C    . VAL B 1 258 ? 10.002  -10.556 -44.803 1.00 22.10  ? 258 VAL B C    1 
ATOM   8672  O O    . VAL B 1 258 ? 9.395   -9.489  -44.614 1.00 26.08  ? 258 VAL B O    1 
ATOM   8673  C CB   . VAL B 1 258 ? 8.910   -12.637 -43.822 1.00 26.38  ? 258 VAL B CB   1 
ATOM   8674  C CG1  . VAL B 1 258 ? 10.140  -12.930 -43.029 1.00 29.33  ? 258 VAL B CG1  1 
ATOM   8675  C CG2  . VAL B 1 258 ? 7.871   -11.882 -42.977 1.00 31.57  ? 258 VAL B CG2  1 
ATOM   8676  H H    . VAL B 1 258 ? 10.186  -13.439 -45.761 1.00 27.33  ? 258 VAL B H    1 
ATOM   8677  H HA   . VAL B 1 258 ? 8.385   -11.582 -45.503 1.00 27.49  ? 258 VAL B HA   1 
ATOM   8678  H HB   . VAL B 1 258 ? 8.517   -13.487 -44.076 1.00 31.61  ? 258 VAL B HB   1 
ATOM   8679  H HG11 . VAL B 1 258 ? 10.052  -12.529 -42.150 1.00 35.15  ? 258 VAL B HG11 1 
ATOM   8680  H HG12 . VAL B 1 258 ? 10.908  -12.557 -43.489 1.00 35.15  ? 258 VAL B HG12 1 
ATOM   8681  H HG13 . VAL B 1 258 ? 10.240  -13.892 -42.945 1.00 35.15  ? 258 VAL B HG13 1 
ATOM   8682  H HG21 . VAL B 1 258 ? 7.085   -12.440 -42.870 1.00 37.84  ? 258 VAL B HG21 1 
ATOM   8683  H HG22 . VAL B 1 258 ? 7.633   -11.058 -43.431 1.00 37.84  ? 258 VAL B HG22 1 
ATOM   8684  H HG23 . VAL B 1 258 ? 8.256   -11.682 -42.109 1.00 37.84  ? 258 VAL B HG23 1 
ATOM   8685  N N    . ALA B 1 259 ? 11.325  -10.617 -44.685 1.00 27.86  ? 259 ALA B N    1 
ATOM   8686  C CA   . ALA B 1 259 ? 12.053  -9.414  -44.277 1.00 23.53  ? 259 ALA B CA   1 
ATOM   8687  C C    . ALA B 1 259 ? 12.030  -8.372  -45.378 1.00 17.61  ? 259 ALA B C    1 
ATOM   8688  O O    . ALA B 1 259 ? 11.737  -7.199  -45.127 1.00 22.56  ? 259 ALA B O    1 
ATOM   8689  C CB   . ALA B 1 259 ? 13.513  -9.724  -43.883 1.00 21.45  ? 259 ALA B CB   1 
ATOM   8690  H H    . ALA B 1 259 ? 11.811  -11.312 -44.828 1.00 33.39  ? 259 ALA B H    1 
ATOM   8691  H HA   . ALA B 1 259 ? 11.613  -9.033  -43.501 1.00 28.19  ? 259 ALA B HA   1 
ATOM   8692  H HB1  . ALA B 1 259 ? 13.951  -8.899  -43.622 1.00 25.70  ? 259 ALA B HB1  1 
ATOM   8693  H HB2  . ALA B 1 259 ? 13.514  -10.349 -43.141 1.00 25.70  ? 259 ALA B HB2  1 
ATOM   8694  H HB3  . ALA B 1 259 ? 13.969  -10.114 -44.645 1.00 25.70  ? 259 ALA B HB3  1 
ATOM   8695  N N    . ASP B 1 260 ? 12.357  -8.780  -46.608 1.00 23.84  ? 260 ASP B N    1 
ATOM   8696  C CA   . ASP B 1 260 ? 12.327  -7.839  -47.721 1.00 20.55  ? 260 ASP B CA   1 
ATOM   8697  C C    . ASP B 1 260 ? 10.911  -7.334  -47.958 1.00 29.10  ? 260 ASP B C    1 
ATOM   8698  O O    . ASP B 1 260 ? 10.703  -6.158  -48.287 1.00 24.85  ? 260 ASP B O    1 
ATOM   8699  C CB   . ASP B 1 260 ? 12.870  -8.493  -48.997 1.00 33.02  ? 260 ASP B CB   1 
ATOM   8700  C CG   . ASP B 1 260 ? 13.617  -7.497  -49.915 1.00 27.34  ? 260 ASP B CG   1 
ATOM   8701  O OD1  . ASP B 1 260 ? 13.668  -6.305  -49.556 1.00 27.26  ? 260 ASP B OD1  1 
ATOM   8702  O OD2  . ASP B 1 260 ? 14.129  -7.915  -50.996 1.00 27.08  ? 260 ASP B OD2  1 
ATOM   8703  H H    . ASP B 1 260 ? 12.594  -9.580  -46.817 1.00 28.57  ? 260 ASP B H    1 
ATOM   8704  H HA   . ASP B 1 260 ? 12.888  -7.076  -47.510 1.00 24.62  ? 260 ASP B HA   1 
ATOM   8705  H HB2  . ASP B 1 260 ? 13.491  -9.196  -48.751 1.00 39.58  ? 260 ASP B HB2  1 
ATOM   8706  H HB3  . ASP B 1 260 ? 12.130  -8.866  -49.500 1.00 39.58  ? 260 ASP B HB3  1 
ATOM   8707  N N    . LEU B 1 261 ? 9.914   -8.201  -47.765 1.00 27.15  ? 261 LEU B N    1 
ATOM   8708  C CA   . LEU B 1 261 ? 8.543   -7.733  -47.901 1.00 26.62  ? 261 LEU B CA   1 
ATOM   8709  C C    . LEU B 1 261 ? 8.254   -6.623  -46.898 1.00 25.04  ? 261 LEU B C    1 
ATOM   8710  O O    . LEU B 1 261 ? 7.751   -5.556  -47.268 1.00 28.16  ? 261 LEU B O    1 
ATOM   8711  C CB   . LEU B 1 261 ? 7.565   -8.897  -47.734 1.00 32.32  ? 261 LEU B CB   1 
ATOM   8712  C CG   . LEU B 1 261 ? 6.073   -8.538  -47.882 1.00 29.23  ? 261 LEU B CG   1 
ATOM   8713  C CD1  . LEU B 1 261 ? 5.774   -8.043  -49.280 1.00 25.08  ? 261 LEU B CD1  1 
ATOM   8714  C CD2  . LEU B 1 261 ? 5.154   -9.766  -47.527 1.00 30.12  ? 261 LEU B CD2  1 
ATOM   8715  H H    . LEU B 1 261 ? 10.003  -9.032  -47.562 1.00 32.54  ? 261 LEU B H    1 
ATOM   8716  H HA   . LEU B 1 261 ? 8.423   -7.368  -48.792 1.00 31.90  ? 261 LEU B HA   1 
ATOM   8717  H HB2  . LEU B 1 261 ? 7.770   -9.569  -48.403 1.00 38.74  ? 261 LEU B HB2  1 
ATOM   8718  H HB3  . LEU B 1 261 ? 7.686   -9.275  -46.849 1.00 38.74  ? 261 LEU B HB3  1 
ATOM   8719  H HG   . LEU B 1 261 ? 5.862   -7.821  -47.263 1.00 35.04  ? 261 LEU B HG   1 
ATOM   8720  H HD11 . LEU B 1 261 ? 4.831   -7.825  -49.342 1.00 30.05  ? 261 LEU B HD11 1 
ATOM   8721  H HD12 . LEU B 1 261 ? 6.309   -7.253  -49.456 1.00 30.05  ? 261 LEU B HD12 1 
ATOM   8722  H HD13 . LEU B 1 261 ? 5.996   -8.742  -49.915 1.00 30.05  ? 261 LEU B HD13 1 
ATOM   8723  H HD21 . LEU B 1 261 ? 4.226   -9.505  -47.630 1.00 36.10  ? 261 LEU B HD21 1 
ATOM   8724  H HD22 . LEU B 1 261 ? 5.361   -10.499 -48.128 1.00 36.10  ? 261 LEU B HD22 1 
ATOM   8725  H HD23 . LEU B 1 261 ? 5.323   -10.032 -46.610 1.00 36.10  ? 261 LEU B HD23 1 
ATOM   8726  N N    . ILE B 1 262 ? 8.601   -6.835  -45.620 1.00 19.37  ? 262 ILE B N    1 
ATOM   8727  C CA   . ILE B 1 262 ? 8.197   -5.864  -44.616 1.00 23.69  ? 262 ILE B CA   1 
ATOM   8728  C C    . ILE B 1 262 ? 9.039   -4.608  -44.731 1.00 23.78  ? 262 ILE B C    1 
ATOM   8729  O O    . ILE B 1 262 ? 8.529   -3.499  -44.587 1.00 28.32  ? 262 ILE B O    1 
ATOM   8730  C CB   . ILE B 1 262 ? 8.213   -6.435  -43.180 1.00 27.07  ? 262 ILE B CB   1 
ATOM   8731  C CG1  . ILE B 1 262 ? 9.570   -6.938  -42.730 1.00 34.66  ? 262 ILE B CG1  1 
ATOM   8732  C CG2  . ILE B 1 262 ? 7.219   -7.592  -43.075 1.00 36.00  ? 262 ILE B CG2  1 
ATOM   8733  C CD1  . ILE B 1 262 ? 9.588   -7.491  -41.265 1.00 38.07  ? 262 ILE B CD1  1 
ATOM   8734  H H    . ILE B 1 262 ? 9.050   -7.506  -45.325 1.00 23.21  ? 262 ILE B H    1 
ATOM   8735  H HA   . ILE B 1 262 ? 7.281   -5.606  -44.804 1.00 28.39  ? 262 ILE B HA   1 
ATOM   8736  H HB   . ILE B 1 262 ? 7.931   -5.734  -42.571 1.00 32.44  ? 262 ILE B HB   1 
ATOM   8737  H HG12 . ILE B 1 262 ? 9.848   -7.656  -43.321 1.00 41.55  ? 262 ILE B HG12 1 
ATOM   8738  H HG13 . ILE B 1 262 ? 10.206  -6.207  -42.779 1.00 41.55  ? 262 ILE B HG13 1 
ATOM   8739  H HG21 . ILE B 1 262 ? 7.237   -7.942  -42.170 1.00 43.16  ? 262 ILE B HG21 1 
ATOM   8740  H HG22 . ILE B 1 262 ? 6.331   -7.265  -43.286 1.00 43.16  ? 262 ILE B HG22 1 
ATOM   8741  H HG23 . ILE B 1 262 ? 7.475   -8.285  -43.703 1.00 43.16  ? 262 ILE B HG23 1 
ATOM   8742  H HD11 . ILE B 1 262 ? 10.485  -7.792  -41.052 1.00 45.64  ? 262 ILE B HD11 1 
ATOM   8743  H HD12 . ILE B 1 262 ? 9.323   -6.782  -40.657 1.00 45.64  ? 262 ILE B HD12 1 
ATOM   8744  H HD13 . ILE B 1 262 ? 8.965   -8.232  -41.200 1.00 45.64  ? 262 ILE B HD13 1 
ATOM   8745  N N    . THR B 1 263 ? 10.319  -4.735  -45.031 1.00 22.69  ? 263 THR B N    1 
ATOM   8746  C CA   . THR B 1 263 ? 11.055  -3.482  -45.148 1.00 24.32  ? 263 THR B CA   1 
ATOM   8747  C C    . THR B 1 263 ? 10.522  -2.675  -46.330 1.00 30.47  ? 263 THR B C    1 
ATOM   8748  O O    . THR B 1 263 ? 10.452  -1.448  -46.266 1.00 27.03  ? 263 THR B O    1 
ATOM   8749  C CB   . THR B 1 263 ? 12.560  -3.735  -45.260 1.00 25.62  ? 263 THR B CB   1 
ATOM   8750  O OG1  . THR B 1 263 ? 13.263  -2.504  -45.074 1.00 37.09  ? 263 THR B OG1  1 
ATOM   8751  C CG2  . THR B 1 263 ? 12.914  -4.259  -46.603 1.00 25.52  ? 263 THR B CG2  1 
ATOM   8752  H H    . THR B 1 263 ? 10.757  -5.463  -45.162 1.00 27.19  ? 263 THR B H    1 
ATOM   8753  H HA   . THR B 1 263 ? 10.906  -2.959  -44.345 1.00 29.15  ? 263 THR B HA   1 
ATOM   8754  H HB   . THR B 1 263 ? 12.837  -4.378  -44.590 1.00 30.71  ? 263 THR B HB   1 
ATOM   8755  H HG1  . THR B 1 263 ? 14.091  -2.634  -45.134 1.00 44.46  ? 263 THR B HG1  1 
ATOM   8756  H HG21 . THR B 1 263 ? 13.870  -4.413  -46.657 1.00 30.58  ? 263 THR B HG21 1 
ATOM   8757  H HG22 . THR B 1 263 ? 12.450  -5.095  -46.766 1.00 30.58  ? 263 THR B HG22 1 
ATOM   8758  H HG23 . THR B 1 263 ? 12.659  -3.618  -47.286 1.00 30.58  ? 263 THR B HG23 1 
ATOM   8759  N N    . THR B 1 264 ? 10.033  -3.348  -47.369 1.00 27.67  ? 264 THR B N    1 
ATOM   8760  C CA   . THR B 1 264 ? 9.542   -2.611  -48.517 1.00 26.22  ? 264 THR B CA   1 
ATOM   8761  C C    . THR B 1 264 ? 8.168   -2.018  -48.248 1.00 30.62  ? 264 THR B C    1 
ATOM   8762  O O    . THR B 1 264 ? 7.905   -0.882  -48.633 1.00 30.56  ? 264 THR B O    1 
ATOM   8763  C CB   . THR B 1 264 ? 9.470   -3.510  -49.760 1.00 27.04  ? 264 THR B CB   1 
ATOM   8764  O OG1  . THR B 1 264 ? 10.744  -4.089  -50.042 1.00 27.70  ? 264 THR B OG1  1 
ATOM   8765  C CG2  . THR B 1 264 ? 9.013   -2.666  -50.966 1.00 31.65  ? 264 THR B CG2  1 
ATOM   8766  H H    . THR B 1 264 ? 9.977   -4.204  -47.431 1.00 33.16  ? 264 THR B H    1 
ATOM   8767  H HA   . THR B 1 264 ? 10.151  -1.881  -48.709 1.00 31.42  ? 264 THR B HA   1 
ATOM   8768  H HB   . THR B 1 264 ? 8.819   -4.214  -49.613 1.00 32.40  ? 264 THR B HB   1 
ATOM   8769  H HG1  . THR B 1 264 ? 10.999  -4.554  -49.390 1.00 33.19  ? 264 THR B HG1  1 
ATOM   8770  H HG21 . THR B 1 264 ? 8.963   -3.221  -51.760 1.00 37.94  ? 264 THR B HG21 1 
ATOM   8771  H HG22 . THR B 1 264 ? 8.138   -2.286  -50.792 1.00 37.94  ? 264 THR B HG22 1 
ATOM   8772  H HG23 . THR B 1 264 ? 9.643   -1.946  -51.125 1.00 37.94  ? 264 THR B HG23 1 
ATOM   8773  N N    . CYS B 1 265 ? 7.274   -2.774  -47.615 1.00 25.78  ? 265 CYS B N    1 
ATOM   8774  C CA   . CYS B 1 265 ? 5.926   -2.279  -47.408 1.00 24.98  ? 265 CYS B CA   1 
ATOM   8775  C C    . CYS B 1 265 ? 5.871   -1.177  -46.377 1.00 31.68  ? 265 CYS B C    1 
ATOM   8776  O O    . CYS B 1 265 ? 4.871   -0.454  -46.330 1.00 33.14  ? 265 CYS B O    1 
ATOM   8777  C CB   . CYS B 1 265 ? 4.998   -3.420  -46.958 1.00 30.55  ? 265 CYS B CB   1 
ATOM   8778  S SG   . CYS B 1 265 ? 4.726   -4.636  -48.198 1.00 25.88  ? 265 CYS B SG   1 
ATOM   8779  H H    . CYS B 1 265 ? 7.423   -3.561  -47.302 1.00 30.89  ? 265 CYS B H    1 
ATOM   8780  H HA   . CYS B 1 265 ? 5.586   -1.925  -48.245 1.00 29.94  ? 265 CYS B HA   1 
ATOM   8781  H HB2  . CYS B 1 265 ? 5.394   -3.862  -46.191 1.00 36.61  ? 265 CYS B HB2  1 
ATOM   8782  H HB3  . CYS B 1 265 ? 4.137   -3.047  -46.714 1.00 36.61  ? 265 CYS B HB3  1 
ATOM   8783  H HG   . CYS B 1 265 ? 5.778   -5.124  -48.506 1.00 31.02  ? 265 CYS B HG   1 
ATOM   8784  N N    . TYR B 1 266 ? 6.900   -1.042  -45.541 1.00 29.28  ? 266 TYR B N    1 
ATOM   8785  C CA   . TYR B 1 266 ? 6.895   -0.001  -44.535 1.00 34.62  ? 266 TYR B CA   1 
ATOM   8786  C C    . TYR B 1 266 ? 7.776   1.187   -44.898 1.00 35.49  ? 266 TYR B C    1 
ATOM   8787  O O    . TYR B 1 266 ? 7.500   2.298   -44.432 1.00 41.14  ? 266 TYR B O    1 
ATOM   8788  C CB   . TYR B 1 266 ? 7.303   -0.576  -43.178 1.00 35.33  ? 266 TYR B CB   1 
ATOM   8789  C CG   . TYR B 1 266 ? 6.172   -1.341  -42.528 1.00 30.04  ? 266 TYR B CG   1 
ATOM   8790  C CD1  . TYR B 1 266 ? 5.254   -0.707  -41.705 1.00 37.24  ? 266 TYR B CD1  1 
ATOM   8791  C CD2  . TYR B 1 266 ? 6.022   -2.702  -42.752 1.00 43.60  ? 266 TYR B CD2  1 
ATOM   8792  C CE1  . TYR B 1 266 ? 4.215   -1.409  -41.122 1.00 36.79  ? 266 TYR B CE1  1 
ATOM   8793  C CE2  . TYR B 1 266 ? 4.991   -3.410  -42.176 1.00 38.35  ? 266 TYR B CE2  1 
ATOM   8794  C CZ   . TYR B 1 266 ? 4.099   -2.763  -41.363 1.00 32.58  ? 266 TYR B CZ   1 
ATOM   8795  O OH   . TYR B 1 266 ? 3.079   -3.492  -40.817 1.00 48.93  ? 266 TYR B OH   1 
ATOM   8796  H H    . TYR B 1 266 ? 7.603   -1.538  -45.540 1.00 35.09  ? 266 TYR B H    1 
ATOM   8797  H HA   . TYR B 1 266 ? 5.988   0.331   -44.446 1.00 41.50  ? 266 TYR B HA   1 
ATOM   8798  H HB2  . TYR B 1 266 ? 8.049   -1.184  -43.301 1.00 42.35  ? 266 TYR B HB2  1 
ATOM   8799  H HB3  . TYR B 1 266 ? 7.557   0.150   -42.587 1.00 42.35  ? 266 TYR B HB3  1 
ATOM   8800  H HD1  . TYR B 1 266 ? 5.336   0.205   -41.545 1.00 44.64  ? 266 TYR B HD1  1 
ATOM   8801  H HD2  . TYR B 1 266 ? 6.627   -3.144  -43.304 1.00 52.27  ? 266 TYR B HD2  1 
ATOM   8802  H HE1  . TYR B 1 266 ? 3.604   -0.975  -40.572 1.00 44.11  ? 266 TYR B HE1  1 
ATOM   8803  H HE2  . TYR B 1 266 ? 4.902   -4.321  -42.336 1.00 45.98  ? 266 TYR B HE2  1 
ATOM   8804  H HH   . TYR B 1 266 ? 2.596   -2.998  -40.339 1.00 58.68  ? 266 TYR B HH   1 
ATOM   8805  N N    . GLY B 1 267 ? 8.788   1.010   -45.742 1.00 40.47  ? 267 GLY B N    1 
ATOM   8806  C CA   . GLY B 1 267 ? 9.646   2.137   -46.066 1.00 41.70  ? 267 GLY B CA   1 
ATOM   8807  C C    . GLY B 1 267 ? 10.079  2.216   -47.504 1.00 43.02  ? 267 GLY B C    1 
ATOM   8808  O O    . GLY B 1 267 ? 11.060  2.882   -47.819 1.00 52.53  ? 267 GLY B O    1 
ATOM   8809  H H    . GLY B 1 267 ? 8.993   0.270   -46.129 1.00 48.53  ? 267 GLY B H    1 
ATOM   8810  H HA2  . GLY B 1 267 ? 9.179   2.959   -45.849 1.00 49.99  ? 267 GLY B HA2  1 
ATOM   8811  H HA3  . GLY B 1 267 ? 10.444  2.092   -45.516 1.00 49.99  ? 267 GLY B HA3  1 
ATOM   8812  N N    . GLY B 1 268 ? 9.333   1.608   -48.384 1.00 43.90  ? 268 GLY B N    1 
ATOM   8813  C CA   . GLY B 1 268 ? 9.712   1.574   -49.782 1.00 44.10  ? 268 GLY B CA   1 
ATOM   8814  C C    . GLY B 1 268 ? 9.203   2.760   -50.563 1.00 51.87  ? 268 GLY B C    1 
ATOM   8815  O O    . GLY B 1 268 ? 8.249   3.443   -50.178 1.00 48.65  ? 268 GLY B O    1 
ATOM   8816  H H    . GLY B 1 268 ? 8.596   1.202   -48.205 1.00 52.64  ? 268 GLY B H    1 
ATOM   8817  H HA2  . GLY B 1 268 ? 10.679  1.557   -49.851 1.00 52.87  ? 268 GLY B HA2  1 
ATOM   8818  H HA3  . GLY B 1 268 ? 9.362   0.767   -50.190 1.00 52.87  ? 268 GLY B HA3  1 
ATOM   8819  N N    . ARG B 1 269 ? 9.861   2.987   -51.699 1.00 39.26  ? 269 ARG B N    1 
ATOM   8820  C CA   . ARG B 1 269 ? 9.445   4.055   -52.598 1.00 36.35  ? 269 ARG B CA   1 
ATOM   8821  C C    . ARG B 1 269 ? 8.131   3.722   -53.298 1.00 39.46  ? 269 ARG B C    1 
ATOM   8822  O O    . ARG B 1 269 ? 7.287   4.604   -53.481 1.00 44.58  ? 269 ARG B O    1 
ATOM   8823  C CB   . ARG B 1 269 ? 10.537  4.321   -53.638 1.00 43.19  ? 269 ARG B CB   1 
ATOM   8824  H H    . ARG B 1 269 ? 10.545  2.540   -51.968 1.00 47.06  ? 269 ARG B H    1 
ATOM   8825  H HA   . ARG B 1 269 ? 9.315   4.867   -52.084 1.00 43.57  ? 269 ARG B HA   1 
ATOM   8826  N N    A ASN B 1 270 ? 7.962   2.469   -53.740 0.51 38.25  ? 270 ASN B N    1 
ATOM   8827  N N    B ASN B 1 270 ? 7.970   2.474   -53.738 0.49 38.25  ? 270 ASN B N    1 
ATOM   8828  C CA   A ASN B 1 270 ? 6.673   2.015   -54.265 0.51 40.14  ? 270 ASN B CA   1 
ATOM   8829  C CA   B ASN B 1 270 ? 6.684   2.009   -54.259 0.49 40.14  ? 270 ASN B CA   1 
ATOM   8830  C C    A ASN B 1 270 ? 5.536   2.356   -53.304 0.51 39.53  ? 270 ASN B C    1 
ATOM   8831  C C    B ASN B 1 270 ? 5.537   2.339   -53.305 0.49 39.53  ? 270 ASN B C    1 
ATOM   8832  O O    A ASN B 1 270 ? 4.454   2.780   -53.729 0.51 37.70  ? 270 ASN B O    1 
ATOM   8833  O O    B ASN B 1 270 ? 4.451   2.743   -53.737 0.49 37.67  ? 270 ASN B O    1 
ATOM   8834  C CB   A ASN B 1 270 ? 6.699   0.499   -54.516 0.51 34.40  ? 270 ASN B CB   1 
ATOM   8835  C CB   B ASN B 1 270 ? 6.746   0.499   -54.517 0.49 34.39  ? 270 ASN B CB   1 
ATOM   8836  C CG   A ASN B 1 270 ? 7.315   0.122   -55.848 0.51 44.10  ? 270 ASN B CG   1 
ATOM   8837  C CG   B ASN B 1 270 ? 7.574   -0.249  -53.468 0.49 38.10  ? 270 ASN B CG   1 
ATOM   8838  O OD1  A ASN B 1 270 ? 6.605   -0.263  -56.787 0.51 43.62  ? 270 ASN B OD1  1 
ATOM   8839  O OD1  B ASN B 1 270 ? 7.634   0.144   -52.283 0.49 30.30  ? 270 ASN B OD1  1 
ATOM   8840  N ND2  A ASN B 1 270 ? 8.644   0.192   -55.929 0.51 44.22  ? 270 ASN B ND2  1 
ATOM   8841  N ND2  B ASN B 1 270 ? 8.238   -1.322  -53.909 0.49 38.03  ? 270 ASN B ND2  1 
ATOM   8842  H H    A ASN B 1 270 ? 8.577   1.867   -53.746 0.51 45.86  ? 270 ASN B H    1 
ATOM   8843  H H    B ASN B 1 270 ? 8.589   1.877   -53.747 0.49 45.86  ? 270 ASN B H    1 
ATOM   8844  H HA   A ASN B 1 270 ? 6.499   2.459   -55.110 0.51 48.13  ? 270 ASN B HA   1 
ATOM   8845  H HA   B ASN B 1 270 ? 6.507   2.451   -55.104 0.49 48.13  ? 270 ASN B HA   1 
ATOM   8846  H HB2  A ASN B 1 270 ? 7.219   0.074   -53.816 0.51 41.24  ? 270 ASN B HB2  1 
ATOM   8847  H HB2  B ASN B 1 270 ? 5.846   0.138   -54.501 0.49 41.23  ? 270 ASN B HB2  1 
ATOM   8848  H HB3  A ASN B 1 270 ? 5.789   0.163   -54.503 0.51 41.24  ? 270 ASN B HB3  1 
ATOM   8849  H HB3  B ASN B 1 270 ? 7.151   0.343   -55.385 0.49 41.23  ? 270 ASN B HB3  1 
ATOM   8850  H HD21 A ASN B 1 270 ? 9.042   -0.015  -56.663 0.51 53.02  ? 270 ASN B HD21 1 
ATOM   8851  H HD21 B ASN B 1 270 ? 8.722   -1.781  -53.366 0.49 45.60  ? 270 ASN B HD21 1 
ATOM   8852  H HD22 A ASN B 1 270 ? 9.103   0.458   -55.252 0.51 53.02  ? 270 ASN B HD22 1 
ATOM   8853  H HD22 B ASN B 1 270 ? 8.175   -1.559  -54.733 0.49 45.60  ? 270 ASN B HD22 1 
ATOM   8854  N N    . ARG B 1 271 ? 5.760   2.158   -52.000 1.00 37.72  ? 271 ARG B N    1 
ATOM   8855  C CA   . ARG B 1 271 ? 4.728   2.456   -51.015 1.00 41.33  ? 271 ARG B CA   1 
ATOM   8856  C C    . ARG B 1 271 ? 4.435   3.958   -50.964 1.00 50.50  ? 271 ARG B C    1 
ATOM   8857  O O    . ARG B 1 271 ? 3.267   4.362   -50.887 1.00 39.03  ? 271 ARG B O    1 
ATOM   8858  C CB   . ARG B 1 271 ? 5.162   1.936   -49.640 1.00 43.13  ? 271 ARG B CB   1 
ATOM   8859  C CG   . ARG B 1 271 ? 4.113   2.086   -48.561 1.00 33.88  ? 271 ARG B CG   1 
ATOM   8860  C CD   . ARG B 1 271 ? 4.741   2.465   -47.219 1.00 35.30  ? 271 ARG B CD   1 
ATOM   8861  N NE   . ARG B 1 271 ? 5.285   3.814   -47.302 1.00 46.97  ? 271 ARG B NE   1 
ATOM   8862  C CZ   . ARG B 1 271 ? 4.558   4.921   -47.191 1.00 46.67  ? 271 ARG B CZ   1 
ATOM   8863  N NH1  . ARG B 1 271 ? 3.248   4.854   -46.984 1.00 42.08  ? 271 ARG B NH1  1 
ATOM   8864  N NH2  . ARG B 1 271 ? 5.136   6.100   -47.288 1.00 44.31  ? 271 ARG B NH2  1 
ATOM   8865  H H    A ARG B 1 271 ? 6.493   1.855   -51.668 0.51 45.22  ? 271 ARG B H    1 
ATOM   8866  H H    B ARG B 1 271 ? 6.496   1.865   -51.665 0.49 45.22  ? 271 ARG B H    1 
ATOM   8867  H HA   . ARG B 1 271 ? 3.910   1.998   -51.265 1.00 49.55  ? 271 ARG B HA   1 
ATOM   8868  H HB2  . ARG B 1 271 ? 5.373   0.992   -49.717 1.00 51.72  ? 271 ARG B HB2  1 
ATOM   8869  H HB3  . ARG B 1 271 ? 5.950   2.426   -49.357 1.00 51.72  ? 271 ARG B HB3  1 
ATOM   8870  H HG2  . ARG B 1 271 ? 3.491   2.786   -48.814 1.00 40.61  ? 271 ARG B HG2  1 
ATOM   8871  H HG3  . ARG B 1 271 ? 3.644   1.244   -48.450 1.00 40.61  ? 271 ARG B HG3  1 
ATOM   8872  H HD2  . ARG B 1 271 ? 4.065   2.445   -46.524 1.00 42.31  ? 271 ARG B HD2  1 
ATOM   8873  H HD3  . ARG B 1 271 ? 5.464   1.852   -47.013 1.00 42.31  ? 271 ARG B HD3  1 
ATOM   8874  H HE   . ARG B 1 271 ? 6.131   3.900   -47.431 1.00 56.32  ? 271 ARG B HE   1 
ATOM   8875  H HH11 . ARG B 1 271 ? 2.862   4.088   -46.922 1.00 50.45  ? 271 ARG B HH11 1 
ATOM   8876  H HH12 . ARG B 1 271 ? 2.786   5.575   -46.913 1.00 50.45  ? 271 ARG B HH12 1 
ATOM   8877  H HH21 . ARG B 1 271 ? 5.985   6.154   -47.420 1.00 53.12  ? 271 ARG B HH21 1 
ATOM   8878  H HH22 . ARG B 1 271 ? 4.667   6.817   -47.213 1.00 53.12  ? 271 ARG B HH22 1 
ATOM   8879  N N    . LYS B 1 272 ? 5.479   4.800   -50.987 1.00 41.33  ? 272 LYS B N    1 
ATOM   8880  C CA   . LYS B 1 272 ? 5.267   6.242   -50.854 1.00 36.80  ? 272 LYS B CA   1 
ATOM   8881  C C    . LYS B 1 272 ? 4.415   6.761   -51.992 1.00 38.92  ? 272 LYS B C    1 
ATOM   8882  O O    . LYS B 1 272 ? 3.504   7.577   -51.788 1.00 38.61  ? 272 LYS B O    1 
ATOM   8883  C CB   . LYS B 1 272 ? 6.600   7.001   -50.833 1.00 39.66  ? 272 LYS B CB   1 
ATOM   8884  H H    . LYS B 1 272 ? 6.301   4.565   -51.078 1.00 49.55  ? 272 LYS B H    1 
ATOM   8885  H HA   . LYS B 1 272 ? 4.803   6.421   -50.021 1.00 44.12  ? 272 LYS B HA   1 
ATOM   8886  N N    . VAL B 1 273 ? 4.730   6.318   -53.208 1.00 29.97  ? 273 VAL B N    1 
ATOM   8887  C CA   . VAL B 1 273 ? 4.013   6.773   -54.383 1.00 30.32  ? 273 VAL B CA   1 
ATOM   8888  C C    . VAL B 1 273 ? 2.578   6.280   -54.325 1.00 40.44  ? 273 VAL B C    1 
ATOM   8889  O O    . VAL B 1 273 ? 1.627   7.053   -54.487 1.00 37.86  ? 273 VAL B O    1 
ATOM   8890  C CB   . VAL B 1 273 ? 4.728   6.279   -55.651 1.00 32.57  ? 273 VAL B CB   1 
ATOM   8891  C CG1  . VAL B 1 273 ? 3.928   6.596   -56.884 1.00 32.58  ? 273 VAL B CG1  1 
ATOM   8892  C CG2  . VAL B 1 273 ? 6.143   6.902   -55.733 1.00 46.66  ? 273 VAL B CG2  1 
ATOM   8893  H H    . VAL B 1 273 ? 5.357   5.754   -53.373 1.00 35.92  ? 273 VAL B H    1 
ATOM   8894  H HA   . VAL B 1 273 ? 4.001   7.743   -54.397 1.00 36.34  ? 273 VAL B HA   1 
ATOM   8895  H HB   . VAL B 1 273 ? 4.829   5.316   -55.601 1.00 39.04  ? 273 VAL B HB   1 
ATOM   8896  H HG11 . VAL B 1 273 ? 4.407   6.272   -57.662 1.00 39.05  ? 273 VAL B HG11 1 
ATOM   8897  H HG12 . VAL B 1 273 ? 3.065   6.159   -56.820 1.00 39.05  ? 273 VAL B HG12 1 
ATOM   8898  H HG13 . VAL B 1 273 ? 3.810   7.557   -56.944 1.00 39.05  ? 273 VAL B HG13 1 
ATOM   8899  H HG21 . VAL B 1 273 ? 6.582   6.582   -56.537 1.00 55.94  ? 273 VAL B HG21 1 
ATOM   8900  H HG22 . VAL B 1 273 ? 6.061   7.868   -55.763 1.00 55.94  ? 273 VAL B HG22 1 
ATOM   8901  H HG23 . VAL B 1 273 ? 6.650   6.636   -54.950 1.00 55.94  ? 273 VAL B HG23 1 
ATOM   8902  N N    . ALA B 1 274 ? 2.412   4.978   -54.065 1.00 35.51  ? 274 ALA B N    1 
ATOM   8903  C CA   . ALA B 1 274 ? 1.091   4.396   -53.894 1.00 36.46  ? 274 ALA B CA   1 
ATOM   8904  C C    . ALA B 1 274 ? 0.261   5.204   -52.902 1.00 30.91  ? 274 ALA B C    1 
ATOM   8905  O O    . ALA B 1 274 ? -0.898  5.514   -53.183 1.00 30.91  ? 274 ALA B O    1 
ATOM   8906  C CB   . ALA B 1 274 ? 1.228   2.932   -53.451 1.00 41.03  ? 274 ALA B CB   1 
ATOM   8907  H H    . ALA B 1 274 ? 3.057   4.415   -53.983 1.00 42.57  ? 274 ALA B H    1 
ATOM   8908  H HA   . ALA B 1 274 ? 0.630   4.407   -54.747 1.00 43.71  ? 274 ALA B HA   1 
ATOM   8909  H HB1  . ALA B 1 274 ? 0.343   2.552   -53.340 1.00 49.20  ? 274 ALA B HB1  1 
ATOM   8910  H HB2  . ALA B 1 274 ? 1.716   2.441   -54.131 1.00 49.20  ? 274 ALA B HB2  1 
ATOM   8911  H HB3  . ALA B 1 274 ? 1.710   2.900   -52.610 1.00 49.20  ? 274 ALA B HB3  1 
ATOM   8912  N N    . GLU B 1 275 ? 0.847   5.577   -51.743 1.00 32.19  ? 275 GLU B N    1 
ATOM   8913  C CA   . GLU B 1 275 ? 0.092   6.324   -50.733 1.00 38.14  ? 275 GLU B CA   1 
ATOM   8914  C C    . GLU B 1 275 ? -0.358  7.656   -51.296 1.00 39.65  ? 275 GLU B C    1 
ATOM   8915  O O    . GLU B 1 275 ? -1.550  8.004   -51.261 1.00 36.07  ? 275 GLU B O    1 
ATOM   8916  C CB   . GLU B 1 275 ? 0.916   6.565   -49.450 1.00 32.94  ? 275 GLU B CB   1 
ATOM   8917  C CG   . GLU B 1 275 ? 0.218   7.595   -48.461 1.00 36.75  ? 275 GLU B CG   1 
ATOM   8918  C CD   . GLU B 1 275 ? 0.724   7.601   -46.993 1.00 45.09  ? 275 GLU B CD   1 
ATOM   8919  O OE1  . GLU B 1 275 ? 1.815   7.081   -46.719 1.00 42.64  ? 275 GLU B OE1  1 
ATOM   8920  O OE2  . GLU B 1 275 ? 0.011   8.147   -46.104 1.00 48.10  ? 275 GLU B OE2  1 
ATOM   8921  H H    . GLU B 1 275 ? 1.662   5.409   -51.528 1.00 38.59  ? 275 GLU B H    1 
ATOM   8922  H HA   . GLU B 1 275 ? -0.699  5.817   -50.491 1.00 45.73  ? 275 GLU B HA   1 
ATOM   8923  H HB2  . GLU B 1 275 ? 1.024   5.723   -48.980 1.00 39.49  ? 275 GLU B HB2  1 
ATOM   8924  H HB3  . GLU B 1 275 ? 1.784   6.923   -49.694 1.00 39.49  ? 275 GLU B HB3  1 
ATOM   8925  H HG2  . GLU B 1 275 ? 0.349   8.489   -48.813 1.00 44.06  ? 275 GLU B HG2  1 
ATOM   8926  H HG3  . GLU B 1 275 ? -0.731  7.396   -48.436 1.00 44.06  ? 275 GLU B HG3  1 
ATOM   8927  N N    . ALA B 1 276 ? 0.600   8.423   -51.800 1.00 33.69  ? 276 ALA B N    1 
ATOM   8928  C CA   . ALA B 1 276 ? 0.301   9.708   -52.404 1.00 40.27  ? 276 ALA B CA   1 
ATOM   8929  C C    . ALA B 1 276 ? -0.760  9.574   -53.488 1.00 28.54  ? 276 ALA B C    1 
ATOM   8930  O O    . ALA B 1 276 ? -1.651  10.419  -53.589 1.00 31.95  ? 276 ALA B O    1 
ATOM   8931  C CB   . ALA B 1 276 ? 1.579   10.315  -52.970 1.00 31.76  ? 276 ALA B CB   1 
ATOM   8932  H H    . ALA B 1 276 ? 1.436   8.218   -51.803 1.00 40.38  ? 276 ALA B H    1 
ATOM   8933  H HA   . ALA B 1 276 ? -0.041  10.307  -51.722 1.00 48.28  ? 276 ALA B HA   1 
ATOM   8934  H HB1  . ALA B 1 276 ? 1.370   11.173  -53.372 1.00 38.07  ? 276 ALA B HB1  1 
ATOM   8935  H HB2  . ALA B 1 276 ? 2.218   10.433  -52.250 1.00 38.07  ? 276 ALA B HB2  1 
ATOM   8936  H HB3  . ALA B 1 276 ? 1.943   9.715   -53.640 1.00 38.07  ? 276 ALA B HB3  1 
ATOM   8937  N N    . PHE B 1 277 ? -0.686  8.516   -54.300 1.00 30.72  ? 277 PHE B N    1 
ATOM   8938  C CA   . PHE B 1 277 ? -1.680  8.320   -55.354 1.00 35.30  ? 277 PHE B CA   1 
ATOM   8939  C C    . PHE B 1 277 ? -3.088  8.189   -54.783 1.00 46.67  ? 277 PHE B C    1 
ATOM   8940  O O    . PHE B 1 277 ? -4.057  8.679   -55.376 1.00 41.32  ? 277 PHE B O    1 
ATOM   8941  C CB   . PHE B 1 277 ? -1.343  7.082   -56.185 1.00 32.36  ? 277 PHE B CB   1 
ATOM   8942  C CG   . PHE B 1 277 ? -2.524  6.518   -56.960 1.00 46.14  ? 277 PHE B CG   1 
ATOM   8943  C CD1  . PHE B 1 277 ? -2.977  7.127   -58.120 1.00 53.75  ? 277 PHE B CD1  1 
ATOM   8944  C CD2  . PHE B 1 277 ? -3.182  5.376   -56.517 1.00 50.87  ? 277 PHE B CD2  1 
ATOM   8945  C CE1  . PHE B 1 277 ? -4.048  6.607   -58.819 1.00 57.47  ? 277 PHE B CE1  1 
ATOM   8946  C CE2  . PHE B 1 277 ? -4.260  4.860   -57.208 1.00 43.72  ? 277 PHE B CE2  1 
ATOM   8947  C CZ   . PHE B 1 277 ? -4.697  5.473   -58.355 1.00 54.00  ? 277 PHE B CZ   1 
ATOM   8948  H H    . PHE B 1 277 ? -0.080  7.907   -54.261 1.00 36.83  ? 277 PHE B H    1 
ATOM   8949  H HA   . PHE B 1 277 ? -1.668  9.090   -55.944 1.00 42.32  ? 277 PHE B HA   1 
ATOM   8950  H HB2  . PHE B 1 277 ? -0.652  7.315   -56.825 1.00 38.79  ? 277 PHE B HB2  1 
ATOM   8951  H HB3  . PHE B 1 277 ? -1.019  6.387   -55.591 1.00 38.79  ? 277 PHE B HB3  1 
ATOM   8952  H HD1  . PHE B 1 277 ? -2.549  7.890   -58.436 1.00 64.45  ? 277 PHE B HD1  1 
ATOM   8953  H HD2  . PHE B 1 277 ? -2.896  4.957   -55.738 1.00 61.01  ? 277 PHE B HD2  1 
ATOM   8954  H HE1  . PHE B 1 277 ? -4.343  7.026   -59.595 1.00 68.93  ? 277 PHE B HE1  1 
ATOM   8955  H HE2  . PHE B 1 277 ? -4.689  4.095   -56.897 1.00 52.42  ? 277 PHE B HE2  1 
ATOM   8956  H HZ   . PHE B 1 277 ? -5.418  5.123   -58.826 1.00 64.76  ? 277 PHE B HZ   1 
ATOM   8957  N N    . ALA B 1 278 ? -3.224  7.511   -53.642 1.00 40.02  ? 278 ALA B N    1 
ATOM   8958  C CA   . ALA B 1 278 ? -4.545  7.278   -53.083 1.00 29.73  ? 278 ALA B CA   1 
ATOM   8959  C C    . ALA B 1 278 ? -5.051  8.505   -52.357 1.00 40.60  ? 278 ALA B C    1 
ATOM   8960  O O    . ALA B 1 278 ? -6.257  8.755   -52.328 1.00 47.11  ? 278 ALA B O    1 
ATOM   8961  C CB   . ALA B 1 278 ? -4.494  6.079   -52.144 1.00 39.28  ? 278 ALA B CB   1 
ATOM   8962  H H    . ALA B 1 278 ? -2.576  7.182   -53.183 1.00 47.98  ? 278 ALA B H    1 
ATOM   8963  H HA   . ALA B 1 278 ? -5.164  7.075   -53.801 1.00 35.63  ? 278 ALA B HA   1 
ATOM   8964  H HB1  . ALA B 1 278 ? -5.379  5.930   -51.775 1.00 47.09  ? 278 ALA B HB1  1 
ATOM   8965  H HB2  . ALA B 1 278 ? -4.209  5.299   -52.644 1.00 47.09  ? 278 ALA B HB2  1 
ATOM   8966  H HB3  . ALA B 1 278 ? -3.864  6.264   -51.430 1.00 47.09  ? 278 ALA B HB3  1 
ATOM   8967  N N    . ARG B 1 279 ? -4.152  9.283   -51.769 1.00 42.71  ? 279 ARG B N    1 
ATOM   8968  C CA   . ARG B 1 279 ? -4.610  10.462  -51.062 1.00 36.41  ? 279 ARG B CA   1 
ATOM   8969  C C    . ARG B 1 279 ? -4.909  11.615  -52.007 1.00 44.81  ? 279 ARG B C    1 
ATOM   8970  O O    . ARG B 1 279 ? -5.748  12.450  -51.676 1.00 42.90  ? 279 ARG B O    1 
ATOM   8971  C CB   . ARG B 1 279 ? -3.589  10.892  -49.989 1.00 32.83  ? 279 ARG B CB   1 
ATOM   8972  C CG   . ARG B 1 279 ? -3.894  10.250  -48.631 1.00 44.01  ? 279 ARG B CG   1 
ATOM   8973  C CD   . ARG B 1 279 ? -2.867  10.519  -47.590 1.00 45.44  ? 279 ARG B CD   1 
ATOM   8974  N NE   . ARG B 1 279 ? -2.975  9.646   -46.412 1.00 42.39  ? 279 ARG B NE   1 
ATOM   8975  C CZ   . ARG B 1 279 ? -4.050  9.526   -45.622 1.00 49.84  ? 279 ARG B CZ   1 
ATOM   8976  N NH1  . ARG B 1 279 ? -5.186  10.186  -45.848 1.00 47.17  ? 279 ARG B NH1  1 
ATOM   8977  N NH2  . ARG B 1 279 ? -3.988  8.718   -44.573 1.00 50.92  ? 279 ARG B NH2  1 
ATOM   8978  H H    . ARG B 1 279 ? -3.302  9.155   -51.763 1.00 51.21  ? 279 ARG B H    1 
ATOM   8979  H HA   . ARG B 1 279 ? -5.436  10.242  -50.604 1.00 43.65  ? 279 ARG B HA   1 
ATOM   8980  H HB2  . ARG B 1 279 ? -2.701  10.614  -50.264 1.00 39.35  ? 279 ARG B HB2  1 
ATOM   8981  H HB3  . ARG B 1 279 ? -3.622  11.856  -49.884 1.00 39.35  ? 279 ARG B HB3  1 
ATOM   8982  H HG2  . ARG B 1 279 ? -4.741  10.595  -48.307 1.00 52.77  ? 279 ARG B HG2  1 
ATOM   8983  H HG3  . ARG B 1 279 ? -3.954  9.289   -48.747 1.00 52.77  ? 279 ARG B HG3  1 
ATOM   8984  H HD2  . ARG B 1 279 ? -1.987  10.387  -47.977 1.00 54.49  ? 279 ARG B HD2  1 
ATOM   8985  H HD3  . ARG B 1 279 ? -2.959  11.436  -47.289 1.00 54.49  ? 279 ARG B HD3  1 
ATOM   8986  H HE   . ARG B 1 279 ? -2.288  9.169   -46.213 1.00 50.82  ? 279 ARG B HE   1 
ATOM   8987  H HH11 . ARG B 1 279 ? -5.246  10.722  -46.518 1.00 56.56  ? 279 ARG B HH11 1 
ATOM   8988  H HH12 . ARG B 1 279 ? -5.857  10.080  -45.321 1.00 56.56  ? 279 ARG B HH12 1 
ATOM   8989  H HH21 . ARG B 1 279 ? -3.268  8.276   -44.412 1.00 61.07  ? 279 ARG B HH21 1 
ATOM   8990  H HH22 . ARG B 1 279 ? -4.675  8.620   -44.065 1.00 61.07  ? 279 ARG B HH22 1 
ATOM   8991  N N    . THR B 1 280 ? -4.267  11.681  -53.182 1.00 37.00  ? 280 THR B N    1 
ATOM   8992  C CA   . THR B 1 280 ? -4.298  12.910  -53.969 1.00 46.00  ? 280 THR B CA   1 
ATOM   8993  C C    . THR B 1 280 ? -5.086  12.811  -55.257 1.00 40.74  ? 280 THR B C    1 
ATOM   8994  O O    . THR B 1 280 ? -5.608  13.830  -55.708 1.00 49.62  ? 280 THR B O    1 
ATOM   8995  C CB   . THR B 1 280 ? -2.876  13.373  -54.334 1.00 43.53  ? 280 THR B CB   1 
ATOM   8996  O OG1  . THR B 1 280 ? -2.308  12.518  -55.355 1.00 38.63  ? 280 THR B OG1  1 
ATOM   8997  C CG2  . THR B 1 280 ? -1.997  13.416  -53.110 1.00 53.36  ? 280 THR B CG2  1 
ATOM   8998  H H    . THR B 1 280 ? -3.817  11.039  -53.536 1.00 44.35  ? 280 THR B H    1 
ATOM   8999  H HA   . THR B 1 280 ? -4.704  13.608  -53.431 1.00 55.15  ? 280 THR B HA   1 
ATOM   9000  H HB   . THR B 1 280 ? -2.929  14.276  -54.685 1.00 52.19  ? 280 THR B HB   1 
ATOM   9001  H HG1  . THR B 1 280 ? -2.269  11.726  -55.077 1.00 46.31  ? 280 THR B HG1  1 
ATOM   9002  H HG21 . THR B 1 280 ? -1.105  13.709  -53.353 1.00 63.99  ? 280 THR B HG21 1 
ATOM   9003  H HG22 . THR B 1 280 ? -2.365  14.034  -52.459 1.00 63.99  ? 280 THR B HG22 1 
ATOM   9004  H HG23 . THR B 1 280 ? -1.941  12.534  -52.711 1.00 63.99  ? 280 THR B HG23 1 
ATOM   9005  N N    . GLY B 1 281 ? -5.167  11.626  -55.867 1.00 42.80  ? 281 GLY B N    1 
ATOM   9006  C CA   . GLY B 1 281 ? -5.741  11.477  -57.184 1.00 40.51  ? 281 GLY B CA   1 
ATOM   9007  C C    . GLY B 1 281 ? -4.763  11.704  -58.325 1.00 45.58  ? 281 GLY B C    1 
ATOM   9008  O O    . GLY B 1 281 ? -5.127  11.501  -59.482 1.00 40.76  ? 281 GLY B O    1 
ATOM   9009  H H    . GLY B 1 281 ? -4.890  10.888  -55.524 1.00 51.32  ? 281 GLY B H    1 
ATOM   9010  H HA2  . GLY B 1 281 ? -6.103  10.581  -57.272 1.00 48.57  ? 281 GLY B HA2  1 
ATOM   9011  H HA3  . GLY B 1 281 ? -6.471  12.108  -57.285 1.00 48.57  ? 281 GLY B HA3  1 
ATOM   9012  N N    . LYS B 1 282 ? -3.538  12.124  -58.043 1.00 49.19  ? 282 LYS B N    1 
ATOM   9013  C CA   . LYS B 1 282 ? -2.557  12.271  -59.110 1.00 52.16  ? 282 LYS B CA   1 
ATOM   9014  C C    . LYS B 1 282 ? -2.075  10.910  -59.573 1.00 46.50  ? 282 LYS B C    1 
ATOM   9015  O O    . LYS B 1 282 ? -1.990  9.957   -58.793 1.00 47.67  ? 282 LYS B O    1 
ATOM   9016  C CB   . LYS B 1 282 ? -1.378  13.097  -58.641 1.00 42.52  ? 282 LYS B CB   1 
ATOM   9017  C CG   . LYS B 1 282 ? -1.772  14.462  -58.148 1.00 53.42  ? 282 LYS B CG   1 
ATOM   9018  C CD   . LYS B 1 282 ? -0.565  15.192  -57.565 1.00 63.08  ? 282 LYS B CD   1 
ATOM   9019  C CE   . LYS B 1 282 ? -0.565  16.667  -57.957 1.00 54.45  ? 282 LYS B CE   1 
ATOM   9020  N NZ   . LYS B 1 282 ? 0.639   17.336  -57.423 1.00 72.98  ? 282 LYS B NZ   1 
ATOM   9021  H H    . LYS B 1 282 ? -3.253  12.327  -57.258 1.00 58.99  ? 282 LYS B H    1 
ATOM   9022  H HA   . LYS B 1 282 ? -2.966  12.724  -59.864 1.00 62.55  ? 282 LYS B HA   1 
ATOM   9023  H HB2  . LYS B 1 282 ? -0.938  12.632  -57.913 1.00 50.98  ? 282 LYS B HB2  1 
ATOM   9024  H HB3  . LYS B 1 282 ? -0.762  13.213  -59.381 1.00 50.98  ? 282 LYS B HB3  1 
ATOM   9025  H HG2  . LYS B 1 282 ? -2.119  14.985  -58.888 1.00 64.06  ? 282 LYS B HG2  1 
ATOM   9026  H HG3  . LYS B 1 282 ? -2.442  14.374  -57.453 1.00 64.06  ? 282 LYS B HG3  1 
ATOM   9027  H HD2  . LYS B 1 282 ? -0.591  15.134  -56.597 1.00 75.66  ? 282 LYS B HD2  1 
ATOM   9028  H HD3  . LYS B 1 282 ? 0.249   14.787  -57.904 1.00 75.66  ? 282 LYS B HD3  1 
ATOM   9029  H HE2  . LYS B 1 282 ? -0.559  16.746  -58.924 1.00 65.30  ? 282 LYS B HE2  1 
ATOM   9030  H HE3  . LYS B 1 282 ? -1.349  17.101  -57.586 1.00 65.30  ? 282 LYS B HE3  1 
ATOM   9031  H HZ1  . LYS B 1 282 ? 0.636   18.195  -57.653 1.00 87.53  ? 282 LYS B HZ1  1 
ATOM   9032  H HZ2  . LYS B 1 282 ? 0.653   17.273  -56.535 1.00 87.53  ? 282 LYS B HZ2  1 
ATOM   9033  H HZ3  . LYS B 1 282 ? 1.371   16.951  -57.752 1.00 87.53  ? 282 LYS B HZ3  1 
ATOM   9034  N N    . SER B 1 283 ? -1.749  10.830  -60.858 1.00 48.81  ? 283 SER B N    1 
ATOM   9035  C CA   . SER B 1 283 ? -1.437  9.550   -61.473 1.00 46.58  ? 283 SER B CA   1 
ATOM   9036  C C    . SER B 1 283 ? -0.117  9.011   -60.945 1.00 39.61  ? 283 SER B C    1 
ATOM   9037  O O    . SER B 1 283 ? 0.689   9.718   -60.326 1.00 45.97  ? 283 SER B O    1 
ATOM   9038  C CB   . SER B 1 283 ? -1.357  9.672   -62.996 1.00 51.30  ? 283 SER B CB   1 
ATOM   9039  O OG   . SER B 1 283 ? -0.181  10.371  -63.376 1.00 53.49  ? 283 SER B OG   1 
ATOM   9040  H H    . SER B 1 283 ? -1.702  11.501  -61.393 1.00 58.53  ? 283 SER B H    1 
ATOM   9041  H HA   . SER B 1 283 ? -2.135  8.913   -61.256 1.00 55.86  ? 283 SER B HA   1 
ATOM   9042  H HB2  . SER B 1 283 ? -1.337  8.783   -63.384 1.00 61.51  ? 283 SER B HB2  1 
ATOM   9043  H HB3  . SER B 1 283 ? -2.132  10.158  -63.317 1.00 61.51  ? 283 SER B HB3  1 
ATOM   9044  H HG   . SER B 1 283 ? -0.143  10.434  -64.213 1.00 64.15  ? 283 SER B HG   1 
ATOM   9045  N N    . ILE B 1 284 ? 0.116   7.735   -61.232 1.00 51.03  ? 284 ILE B N    1 
ATOM   9046  C CA   . ILE B 1 284 ? 1.395   7.126   -60.880 1.00 62.15  ? 284 ILE B CA   1 
ATOM   9047  C C    . ILE B 1 284 ? 2.530   7.855   -61.593 1.00 48.17  ? 284 ILE B C    1 
ATOM   9048  O O    . ILE B 1 284 ? 3.574   8.144   -60.996 1.00 45.29  ? 284 ILE B O    1 
ATOM   9049  C CB   . ILE B 1 284 ? 1.389   5.619   -61.215 1.00 60.50  ? 284 ILE B CB   1 
ATOM   9050  C CG1  . ILE B 1 284 ? 0.116   4.941   -60.670 1.00 61.95  ? 284 ILE B CG1  1 
ATOM   9051  C CG2  . ILE B 1 284 ? 2.660   4.948   -60.685 1.00 49.15  ? 284 ILE B CG2  1 
ATOM   9052  C CD1  . ILE B 1 284 ? 0.344   4.023   -59.480 1.00 55.09  ? 284 ILE B CD1  1 
ATOM   9053  H H    . ILE B 1 284 ? -0.439  7.207   -61.624 1.00 61.20  ? 284 ILE B H    1 
ATOM   9054  H HA   . ILE B 1 284 ? 1.535   7.219   -59.924 1.00 74.53  ? 284 ILE B HA   1 
ATOM   9055  H HB   . ILE B 1 284 ? 1.384   5.528   -62.180 1.00 72.56  ? 284 ILE B HB   1 
ATOM   9056  H HG12 . ILE B 1 284 ? -0.508  5.630   -60.393 1.00 74.29  ? 284 ILE B HG12 1 
ATOM   9057  H HG13 . ILE B 1 284 ? -0.279  4.409   -61.378 1.00 74.29  ? 284 ILE B HG13 1 
ATOM   9058  H HG21 . ILE B 1 284 ? 2.635   4.004   -60.906 1.00 58.94  ? 284 ILE B HG21 1 
ATOM   9059  H HG22 . ILE B 1 284 ? 3.432   5.365   -61.099 1.00 58.94  ? 284 ILE B HG22 1 
ATOM   9060  H HG23 . ILE B 1 284 ? 2.699   5.062   -59.722 1.00 58.94  ? 284 ILE B HG23 1 
ATOM   9061  H HD11 . ILE B 1 284 ? -0.506  3.644   -59.207 1.00 66.06  ? 284 ILE B HD11 1 
ATOM   9062  H HD12 . ILE B 1 284 ? 0.954   3.316   -59.740 1.00 66.06  ? 284 ILE B HD12 1 
ATOM   9063  H HD13 . ILE B 1 284 ? 0.725   4.539   -58.752 1.00 66.06  ? 284 ILE B HD13 1 
ATOM   9064  N N    . GLU B 1 285 ? 2.339   8.163   -62.880 1.00 53.58  ? 285 GLU B N    1 
ATOM   9065  C CA   . GLU B 1 285 ? 3.366   8.847   -63.668 1.00 52.00  ? 285 GLU B CA   1 
ATOM   9066  C C    . GLU B 1 285 ? 3.813   10.147  -63.001 1.00 41.20  ? 285 GLU B C    1 
ATOM   9067  O O    . GLU B 1 285 ? 5.010   10.372  -62.770 1.00 51.84  ? 285 GLU B O    1 
ATOM   9068  C CB   . GLU B 1 285 ? 2.828   9.120   -65.073 1.00 51.32  ? 285 GLU B CB   1 
ATOM   9069  H H    . GLU B 1 285 ? 1.621   7.987   -63.319 1.00 64.26  ? 285 GLU B H    1 
ATOM   9070  H HA   . GLU B 1 285 ? 4.141   8.269   -63.750 1.00 62.36  ? 285 GLU B HA   1 
ATOM   9071  N N    . GLN B 1 286 ? 2.859   11.003  -62.655 1.00 34.96  ? 286 GLN B N    1 
ATOM   9072  C CA   . GLN B 1 286 ? 3.203   12.309  -62.112 1.00 38.72  ? 286 GLN B CA   1 
ATOM   9073  C C    . GLN B 1 286 ? 3.959   12.189  -60.806 1.00 52.38  ? 286 GLN B C    1 
ATOM   9074  O O    . GLN B 1 286 ? 4.853   12.999  -60.520 1.00 55.88  ? 286 GLN B O    1 
ATOM   9075  C CB   . GLN B 1 286 ? 1.948   13.141  -61.868 1.00 44.60  ? 286 GLN B CB   1 
ATOM   9076  C CG   . GLN B 1 286 ? 1.076   13.430  -63.058 1.00 47.71  ? 286 GLN B CG   1 
ATOM   9077  C CD   . GLN B 1 286 ? -0.181  14.133  -62.600 1.00 57.67  ? 286 GLN B CD   1 
ATOM   9078  O OE1  . GLN B 1 286 ? -1.149  13.486  -62.212 1.00 53.10  ? 286 GLN B OE1  1 
ATOM   9079  N NE2  . GLN B 1 286 ? -0.147  15.462  -62.573 1.00 50.01  ? 286 GLN B NE2  1 
ATOM   9080  H H    . GLN B 1 286 ? 2.015   10.854  -62.724 1.00 41.91  ? 286 GLN B H    1 
ATOM   9081  H HA   . GLN B 1 286 ? 3.763   12.782  -62.746 1.00 46.42  ? 286 GLN B HA   1 
ATOM   9082  H HB2  . GLN B 1 286 ? 1.399   12.674  -61.218 1.00 53.47  ? 286 GLN B HB2  1 
ATOM   9083  H HB3  . GLN B 1 286 ? 2.221   13.996  -61.499 1.00 53.47  ? 286 GLN B HB3  1 
ATOM   9084  H HG2  . GLN B 1 286 ? 1.548   14.008  -63.677 1.00 57.21  ? 286 GLN B HG2  1 
ATOM   9085  H HG3  . GLN B 1 286 ? 0.826   12.598  -63.490 1.00 57.21  ? 286 GLN B HG3  1 
ATOM   9086  H HE21 . GLN B 1 286 ? 0.555   15.879  -62.841 1.00 59.97  ? 286 GLN B HE21 1 
ATOM   9087  H HE22 . GLN B 1 286 ? -0.837  15.904  -62.313 1.00 59.97  ? 286 GLN B HE22 1 
ATOM   9088  N N    . LEU B 1 287 ? 3.573   11.223  -59.969 1.00 41.86  ? 287 LEU B N    1 
ATOM   9089  C CA   . LEU B 1 287 ? 4.193   11.112  -58.655 1.00 48.52  ? 287 LEU B CA   1 
ATOM   9090  C C    . LEU B 1 287 ? 5.624   10.570  -58.769 1.00 49.68  ? 287 LEU B C    1 
ATOM   9091  O O    . LEU B 1 287 ? 6.499   10.963  -57.988 1.00 52.20  ? 287 LEU B O    1 
ATOM   9092  C CB   . LEU B 1 287 ? 3.286   10.262  -57.739 1.00 42.69  ? 287 LEU B CB   1 
ATOM   9093  C CG   . LEU B 1 287 ? 1.932   10.898  -57.346 1.00 36.46  ? 287 LEU B CG   1 
ATOM   9094  C CD1  . LEU B 1 287 ? 0.928   9.922   -56.669 1.00 41.22  ? 287 LEU B CD1  1 
ATOM   9095  C CD2  . LEU B 1 287 ? 2.165   12.076  -56.433 1.00 43.36  ? 287 LEU B CD2  1 
ATOM   9096  H H    . LEU B 1 287 ? 2.968   10.634  -60.135 1.00 50.19  ? 287 LEU B H    1 
ATOM   9097  H HA   . LEU B 1 287 ? 4.249   11.998  -58.266 1.00 58.19  ? 287 LEU B HA   1 
ATOM   9098  H HB2  . LEU B 1 287 ? 3.092   9.426   -58.192 1.00 51.19  ? 287 LEU B HB2  1 
ATOM   9099  H HB3  . LEU B 1 287 ? 3.768   10.079  -56.917 1.00 51.19  ? 287 LEU B HB3  1 
ATOM   9100  H HG   . LEU B 1 287 ? 1.509   11.235  -58.151 1.00 43.71  ? 287 LEU B HG   1 
ATOM   9101  H HD11 . LEU B 1 287 ? 0.113   10.404  -56.459 1.00 49.42  ? 287 LEU B HD11 1 
ATOM   9102  H HD12 . LEU B 1 287 ? 0.734   9.194   -57.281 1.00 49.42  ? 287 LEU B HD12 1 
ATOM   9103  H HD13 . LEU B 1 287 ? 1.326   9.574   -55.856 1.00 49.42  ? 287 LEU B HD13 1 
ATOM   9104  H HD21 . LEU B 1 287 ? 1.309   12.464  -56.195 1.00 51.99  ? 287 LEU B HD21 1 
ATOM   9105  H HD22 . LEU B 1 287 ? 2.623   11.770  -55.635 1.00 51.99  ? 287 LEU B HD22 1 
ATOM   9106  H HD23 . LEU B 1 287 ? 2.709   12.731  -56.897 1.00 51.99  ? 287 LEU B HD23 1 
ATOM   9107  N N    . GLU B 1 288 ? 5.904   9.724   -59.769 1.00 49.34  ? 288 GLU B N    1 
ATOM   9108  C CA   . GLU B 1 288 ? 7.270   9.230   -59.958 1.00 46.02  ? 288 GLU B CA   1 
ATOM   9109  C C    . GLU B 1 288 ? 8.234   10.386  -60.210 1.00 59.14  ? 288 GLU B C    1 
ATOM   9110  O O    . GLU B 1 288 ? 9.329   10.439  -59.632 1.00 45.50  ? 288 GLU B O    1 
ATOM   9111  C CB   . GLU B 1 288 ? 7.308   8.247   -61.131 1.00 60.34  ? 288 GLU B CB   1 
ATOM   9112  C CG   . GLU B 1 288 ? 6.619   6.915   -60.877 1.00 56.50  ? 288 GLU B CG   1 
ATOM   9113  C CD   . GLU B 1 288 ? 6.331   6.146   -62.162 1.00 61.37  ? 288 GLU B CD   1 
ATOM   9114  O OE1  . GLU B 1 288 ? 6.199   6.784   -63.226 1.00 56.09  ? 288 GLU B OE1  1 
ATOM   9115  O OE2  . GLU B 1 288 ? 6.224   4.901   -62.103 1.00 61.53  ? 288 GLU B OE2  1 
ATOM   9116  H H    . GLU B 1 288 ? 5.332   9.428   -60.339 1.00 59.17  ? 288 GLU B H    1 
ATOM   9117  H HA   . GLU B 1 288 ? 7.556   8.763   -59.158 1.00 55.18  ? 288 GLU B HA   1 
ATOM   9118  H HB2  . GLU B 1 288 ? 6.874   8.660   -61.894 1.00 72.37  ? 288 GLU B HB2  1 
ATOM   9119  H HB3  . GLU B 1 288 ? 8.236   8.060   -61.347 1.00 72.37  ? 288 GLU B HB3  1 
ATOM   9120  H HG2  . GLU B 1 288 ? 7.191   6.364   -60.320 1.00 67.76  ? 288 GLU B HG2  1 
ATOM   9121  H HG3  . GLU B 1 288 ? 5.775   7.076   -60.429 1.00 67.76  ? 288 GLU B HG3  1 
ATOM   9122  N N    . LYS B 1 289 ? 7.821   11.325  -61.069 1.00 59.23  ? 289 LYS B N    1 
ATOM   9123  C CA   . LYS B 1 289 ? 8.620   12.502  -61.403 1.00 64.44  ? 289 LYS B CA   1 
ATOM   9124  C C    . LYS B 1 289 ? 8.781   13.425  -60.204 1.00 67.54  ? 289 LYS B C    1 
ATOM   9125  O O    . LYS B 1 289 ? 9.901   13.838  -59.874 1.00 57.59  ? 289 LYS B O    1 
ATOM   9126  C CB   . LYS B 1 289 ? 7.956   13.265  -62.553 1.00 46.18  ? 289 LYS B CB   1 
ATOM   9127  C CG   . LYS B 1 289 ? 7.801   12.470  -63.851 1.00 52.31  ? 289 LYS B CG   1 
ATOM   9128  C CD   . LYS B 1 289 ? 6.594   12.942  -64.651 1.00 45.56  ? 289 LYS B CD   1 
ATOM   9129  C CE   . LYS B 1 289 ? 6.516   12.277  -66.021 1.00 57.37  ? 289 LYS B CE   1 
ATOM   9130  N NZ   . LYS B 1 289 ? 5.090   12.010  -66.464 1.00 69.46  ? 289 LYS B NZ   1 
ATOM   9131  H H    . LYS B 1 289 ? 7.064   11.298  -61.478 1.00 71.04  ? 289 LYS B H    1 
ATOM   9132  H HA   . LYS B 1 289 ? 9.502   12.220  -61.692 1.00 77.29  ? 289 LYS B HA   1 
ATOM   9133  H HB2  . LYS B 1 289 ? 7.070   13.539  -62.271 1.00 55.37  ? 289 LYS B HB2  1 
ATOM   9134  H HB3  . LYS B 1 289 ? 8.491   14.049  -62.753 1.00 55.37  ? 289 LYS B HB3  1 
ATOM   9135  H HG2  . LYS B 1 289 ? 8.594   12.589  -64.397 1.00 62.73  ? 289 LYS B HG2  1 
ATOM   9136  H HG3  . LYS B 1 289 ? 7.677   11.531  -63.639 1.00 62.73  ? 289 LYS B HG3  1 
ATOM   9137  H HD2  . LYS B 1 289 ? 5.784   12.725  -64.163 1.00 54.63  ? 289 LYS B HD2  1 
ATOM   9138  H HD3  . LYS B 1 289 ? 6.657   13.901  -64.784 1.00 54.63  ? 289 LYS B HD3  1 
ATOM   9139  H HE2  . LYS B 1 289 ? 6.931   12.857  -66.678 1.00 68.81  ? 289 LYS B HE2  1 
ATOM   9140  H HE3  . LYS B 1 289 ? 6.983   11.427  -65.986 1.00 68.81  ? 289 LYS B HE3  1 
ATOM   9141  H HZ1  . LYS B 1 289 ? 5.088   11.623  -67.265 1.00 83.31  ? 289 LYS B HZ1  1 
ATOM   9142  H HZ2  . LYS B 1 289 ? 4.686   11.473  -65.881 1.00 83.31  ? 289 LYS B HZ2  1 
ATOM   9143  H HZ3  . LYS B 1 289 ? 4.639   12.776  -66.512 1.00 83.31  ? 289 LYS B HZ3  1 
ATOM   9144  N N    . GLU B 1 290 ? 7.658   13.789  -59.563 1.00 57.18  ? 290 GLU B N    1 
ATOM   9145  C CA   . GLU B 1 290 ? 7.703   14.717  -58.441 1.00 60.57  ? 290 GLU B CA   1 
ATOM   9146  C C    . GLU B 1 290 ? 8.485   14.126  -57.276 1.00 63.15  ? 290 GLU B C    1 
ATOM   9147  O O    . GLU B 1 290 ? 9.114   14.863  -56.508 1.00 66.41  ? 290 GLU B O    1 
ATOM   9148  C CB   . GLU B 1 290 ? 6.284   15.097  -57.995 1.00 60.57  ? 290 GLU B CB   1 
ATOM   9149  H H    . GLU B 1 290 ? 6.869   13.511  -59.763 1.00 68.57  ? 290 GLU B H    1 
ATOM   9150  H HA   . GLU B 1 290 ? 8.155   15.528  -58.722 1.00 72.64  ? 290 GLU B HA   1 
ATOM   9151  N N    . LEU B 1 291 ? 8.467   12.810  -57.132 1.00 57.78  ? 291 LEU B N    1 
ATOM   9152  C CA   . LEU B 1 291 ? 9.122   12.161  -56.009 1.00 64.29  ? 291 LEU B CA   1 
ATOM   9153  C C    . LEU B 1 291 ? 10.202  11.242  -56.591 1.00 68.77  ? 291 LEU B C    1 
ATOM   9154  O O    . LEU B 1 291 ? 10.906  10.547  -55.865 1.00 70.87  ? 291 LEU B O    1 
ATOM   9155  C CB   . LEU B 1 291 ? 8.111   11.382  -55.154 1.00 58.05  ? 291 LEU B CB   1 
ATOM   9156  C CG   . LEU B 1 291 ? 6.886   12.093  -54.549 1.00 60.96  ? 291 LEU B CG   1 
ATOM   9157  C CD1  . LEU B 1 291 ? 5.925   12.587  -55.611 1.00 61.79  ? 291 LEU B CD1  1 
ATOM   9158  C CD2  . LEU B 1 291 ? 6.116   11.186  -53.564 1.00 62.15  ? 291 LEU B CD2  1 
ATOM   9159  H H    . LEU B 1 291 ? 8.080   12.267  -57.675 1.00 69.29  ? 291 LEU B H    1 
ATOM   9160  H HA   . LEU B 1 291 ? 9.550   12.829  -55.451 1.00 77.11  ? 291 LEU B HA   1 
ATOM   9161  H HB2  . LEU B 1 291 ? 7.764   10.661  -55.702 1.00 69.62  ? 291 LEU B HB2  1 
ATOM   9162  H HB3  . LEU B 1 291 ? 8.599   10.998  -54.409 1.00 69.62  ? 291 LEU B HB3  1 
ATOM   9163  H HG   . LEU B 1 291 ? 7.195   12.867  -54.053 1.00 73.11  ? 291 LEU B HG   1 
ATOM   9164  H HD11 . LEU B 1 291 ? 5.175   13.025  -55.179 1.00 74.11  ? 291 LEU B HD11 1 
ATOM   9165  H HD12 . LEU B 1 291 ? 6.387   13.215  -56.188 1.00 74.11  ? 291 LEU B HD12 1 
ATOM   9166  H HD13 . LEU B 1 291 ? 5.611   11.829  -56.130 1.00 74.11  ? 291 LEU B HD13 1 
ATOM   9167  H HD21 . LEU B 1 291 ? 5.357   11.676  -53.211 1.00 74.54  ? 291 LEU B HD21 1 
ATOM   9168  H HD22 . LEU B 1 291 ? 5.809   10.396  -54.036 1.00 74.54  ? 291 LEU B HD22 1 
ATOM   9169  H HD23 . LEU B 1 291 ? 6.710   10.930  -52.841 1.00 74.54  ? 291 LEU B HD23 1 
ATOM   9170  N N    . ASN B 1 293 ? 13.045  10.407  -58.722 1.00 66.92  ? 293 ASN B N    1 
ATOM   9171  C CA   . ASN B 1 293 ? 13.454  11.449  -59.663 1.00 76.77  ? 293 ASN B CA   1 
ATOM   9172  C C    . ASN B 1 293 ? 12.619  11.384  -60.936 1.00 81.00  ? 293 ASN B C    1 
ATOM   9173  O O    . ASN B 1 293 ? 12.437  12.390  -61.629 1.00 84.58  ? 293 ASN B O    1 
ATOM   9174  C CB   . ASN B 1 293 ? 14.941  11.311  -60.011 1.00 55.02  ? 293 ASN B CB   1 
ATOM   9175  H H    . ASN B 1 293 ? 12.432  10.654  -58.171 1.00 80.26  ? 293 ASN B H    1 
ATOM   9176  H HA   . ASN B 1 293 ? 13.318  12.318  -59.255 1.00 92.08  ? 293 ASN B HA   1 
ATOM   9177  N N    . GLY B 1 294 ? 12.103  10.197  -61.226 1.00 73.00  ? 294 GLY B N    1 
ATOM   9178  C CA   . GLY B 1 294 ? 11.463  9.928   -62.501 1.00 64.42  ? 294 GLY B CA   1 
ATOM   9179  C C    . GLY B 1 294 ? 11.582  8.462   -62.849 1.00 66.29  ? 294 GLY B C    1 
ATOM   9180  O O    . GLY B 1 294 ? 10.953  7.984   -63.800 1.00 52.82  ? 294 GLY B O    1 
ATOM   9181  H H    . GLY B 1 294 ? 12.112  9.523   -60.692 1.00 87.56  ? 294 GLY B H    1 
ATOM   9182  H HA2  . GLY B 1 294 ? 10.524  10.165  -62.456 1.00 77.26  ? 294 GLY B HA2  1 
ATOM   9183  H HA3  . GLY B 1 294 ? 11.886  10.452  -63.200 1.00 77.26  ? 294 GLY B HA3  1 
ATOM   9184  N N    . GLN B 1 295 ? 12.406  7.749   -62.070 1.00 74.78  ? 295 GLN B N    1 
ATOM   9185  C CA   . GLN B 1 295 ? 12.532  6.303   -62.190 1.00 75.08  ? 295 GLN B CA   1 
ATOM   9186  C C    . GLN B 1 295 ? 11.182  5.647   -61.937 1.00 68.72  ? 295 GLN B C    1 
ATOM   9187  O O    . GLN B 1 295 ? 10.567  5.863   -60.886 1.00 64.35  ? 295 GLN B O    1 
ATOM   9188  C CB   . GLN B 1 295 ? 13.580  5.780   -61.200 1.00 61.58  ? 295 GLN B CB   1 
ATOM   9189  H H    . GLN B 1 295 ? 12.905  8.090   -61.458 1.00 89.69  ? 295 GLN B H    1 
ATOM   9190  H HA   . GLN B 1 295 ? 12.819  6.077   -63.089 1.00 90.05  ? 295 GLN B HA   1 
ATOM   9191  N N    . LYS B 1 296 ? 10.738  4.842   -62.906 1.00 77.15  ? 296 LYS B N    1 
ATOM   9192  C CA   . LYS B 1 296 ? 9.430   4.203   -62.900 1.00 64.60  ? 296 LYS B CA   1 
ATOM   9193  C C    . LYS B 1 296 ? 9.304   3.166   -61.771 1.00 71.02  ? 296 LYS B C    1 
ATOM   9194  O O    . LYS B 1 296 ? 10.290  2.646   -61.240 1.00 64.84  ? 296 LYS B O    1 
ATOM   9195  C CB   . LYS B 1 296 ? 9.173   3.541   -64.252 1.00 48.89  ? 296 LYS B CB   1 
ATOM   9196  H H    . LYS B 1 296 ? 11.201  4.648   -63.604 1.00 92.53  ? 296 LYS B H    1 
ATOM   9197  H HA   . LYS B 1 296 ? 8.749   4.879   -62.762 1.00 77.47  ? 296 LYS B HA   1 
ATOM   9198  N N    . LEU B 1 297 ? 8.054   2.871   -61.411 1.00 72.28  ? 297 LEU B N    1 
ATOM   9199  C CA   . LEU B 1 297 ? 7.738   1.934   -60.338 1.00 55.28  ? 297 LEU B CA   1 
ATOM   9200  C C    . LEU B 1 297 ? 7.740   0.487   -60.820 1.00 52.20  ? 297 LEU B C    1 
ATOM   9201  O O    . LEU B 1 297 ? 7.182   0.159   -61.875 1.00 54.49  ? 297 LEU B O    1 
ATOM   9202  C CB   . LEU B 1 297 ? 6.360   2.243   -59.764 1.00 45.16  ? 297 LEU B CB   1 
ATOM   9203  C CG   . LEU B 1 297 ? 6.175   3.295   -58.698 1.00 45.93  ? 297 LEU B CG   1 
ATOM   9204  C CD1  . LEU B 1 297 ? 5.072   2.749   -57.814 1.00 54.37  ? 297 LEU B CD1  1 
ATOM   9205  C CD2  . LEU B 1 297 ? 7.437   3.577   -57.891 1.00 49.21  ? 297 LEU B CD2  1 
ATOM   9206  H H    . LEU B 1 297 ? 7.357   3.210   -61.784 1.00 86.70  ? 297 LEU B H    1 
ATOM   9207  H HA   . LEU B 1 297 ? 8.393   2.023   -59.629 1.00 66.30  ? 297 LEU B HA   1 
ATOM   9208  H HB2  . LEU B 1 297 ? 5.794   2.506   -60.506 1.00 54.15  ? 297 LEU B HB2  1 
ATOM   9209  H HB3  . LEU B 1 297 ? 6.014   1.417   -59.391 1.00 54.15  ? 297 LEU B HB3  1 
ATOM   9210  H HG   . LEU B 1 297 ? 5.871   4.122   -59.103 1.00 55.07  ? 297 LEU B HG   1 
ATOM   9211  H HD11 . LEU B 1 297 ? 4.898   3.382   -57.099 1.00 65.20  ? 297 LEU B HD11 1 
ATOM   9212  H HD12 . LEU B 1 297 ? 4.271   2.626   -58.348 1.00 65.20  ? 297 LEU B HD12 1 
ATOM   9213  H HD13 . LEU B 1 297 ? 5.356   1.900   -57.442 1.00 65.20  ? 297 LEU B HD13 1 
ATOM   9214  H HD21 . LEU B 1 297 ? 7.243   4.259   -57.230 1.00 59.02  ? 297 LEU B HD21 1 
ATOM   9215  H HD22 . LEU B 1 297 ? 7.719   2.760   -57.451 1.00 59.02  ? 297 LEU B HD22 1 
ATOM   9216  H HD23 . LEU B 1 297 ? 8.133   3.887   -58.492 1.00 59.02  ? 297 LEU B HD23 1 
ATOM   9217  N N    A GLN B 1 298 ? 8.341   -0.380  -60.002 0.51 49.75  ? 298 GLN B N    1 
ATOM   9218  N N    B GLN B 1 298 ? 8.337   -0.401  -60.024 0.49 49.76  ? 298 GLN B N    1 
ATOM   9219  C CA   A GLN B 1 298 ? 8.485   -1.796  -60.333 0.51 51.04  ? 298 GLN B CA   1 
ATOM   9220  C CA   B GLN B 1 298 ? 8.425   -1.795  -60.457 0.49 50.94  ? 298 GLN B CA   1 
ATOM   9221  C C    A GLN B 1 298 ? 7.170   -2.549  -60.163 0.51 44.46  ? 298 GLN B C    1 
ATOM   9222  C C    B GLN B 1 298 ? 7.131   -2.558  -60.189 0.49 44.43  ? 298 GLN B C    1 
ATOM   9223  O O    A GLN B 1 298 ? 6.796   -3.365  -61.015 0.51 42.27  ? 298 GLN B O    1 
ATOM   9224  O O    B GLN B 1 298 ? 6.731   -3.399  -61.005 0.49 42.26  ? 298 GLN B O    1 
ATOM   9225  C CB   A GLN B 1 298 ? 9.558   -2.423  -59.437 0.51 50.85  ? 298 GLN B CB   1 
ATOM   9226  C CB   B GLN B 1 298 ? 9.590   -2.502  -59.766 0.49 50.21  ? 298 GLN B CB   1 
ATOM   9227  C CG   A GLN B 1 298 ? 10.962  -1.897  -59.681 0.51 48.50  ? 298 GLN B CG   1 
ATOM   9228  C CG   B GLN B 1 298 ? 10.934  -1.832  -59.969 0.49 48.39  ? 298 GLN B CG   1 
ATOM   9229  C CD   A GLN B 1 298 ? 11.872  -2.940  -60.281 0.51 42.09  ? 298 GLN B CD   1 
ATOM   9230  C CD   B GLN B 1 298 ? 11.361  -1.007  -58.765 0.49 44.80  ? 298 GLN B CD   1 
ATOM   9231  O OE1  A GLN B 1 298 ? 12.518  -2.701  -61.299 0.51 46.53  ? 298 GLN B OE1  1 
ATOM   9232  O OE1  B GLN B 1 298 ? 10.573  -0.250  -58.197 0.49 38.50  ? 298 GLN B OE1  1 
ATOM   9233  N NE2  A GLN B 1 298 ? 11.937  -4.104  -59.648 0.51 38.40  ? 298 GLN B NE2  1 
ATOM   9234  N NE2  B GLN B 1 298 ? 12.621  -1.151  -58.377 0.49 45.72  ? 298 GLN B NE2  1 
ATOM   9235  H H    A GLN B 1 298 ? 8.678   -0.168  -59.240 0.51 59.66  ? 298 GLN B H    1 
ATOM   9236  H H    B GLN B 1 298 ? 8.687   -0.231  -59.257 0.49 59.67  ? 298 GLN B H    1 
ATOM   9237  H HA   A GLN B 1 298 ? 8.769   -1.883  -61.256 0.51 61.21  ? 298 GLN B HA   1 
ATOM   9238  H HA   B GLN B 1 298 ? 8.589   -1.816  -61.413 0.49 61.09  ? 298 GLN B HA   1 
ATOM   9239  H HB2  A GLN B 1 298 ? 9.333   -2.244  -58.511 0.51 60.98  ? 298 GLN B HB2  1 
ATOM   9240  H HB2  B GLN B 1 298 ? 9.415   -2.530  -58.812 0.49 60.21  ? 298 GLN B HB2  1 
ATOM   9241  H HB3  A GLN B 1 298 ? 9.571   -3.381  -59.592 0.51 60.98  ? 298 GLN B HB3  1 
ATOM   9242  H HB3  B GLN B 1 298 ? 9.656   -3.406  -60.113 0.49 60.21  ? 298 GLN B HB3  1 
ATOM   9243  H HG2  A GLN B 1 298 ? 10.918  -1.147  -60.295 0.51 58.15  ? 298 GLN B HG2  1 
ATOM   9244  H HG2  B GLN B 1 298 ? 11.607  -2.513  -60.121 0.49 58.02  ? 298 GLN B HG2  1 
ATOM   9245  H HG3  A GLN B 1 298 ? 11.345  -1.614  -58.836 0.51 58.15  ? 298 GLN B HG3  1 
ATOM   9246  H HG3  B GLN B 1 298 ? 10.880  -1.240  -60.735 0.49 58.02  ? 298 GLN B HG3  1 
ATOM   9247  H HE21 A GLN B 1 298 ? 11.471  -4.233  -58.937 0.51 46.04  ? 298 GLN B HE21 1 
ATOM   9248  H HE21 B GLN B 1 298 ? 13.142  -1.689  -58.799 0.49 54.82  ? 298 GLN B HE21 1 
ATOM   9249  H HE22 A GLN B 1 298 ? 12.443  -4.730  -59.951 0.51 46.04  ? 298 GLN B HE22 1 
ATOM   9250  H HE22 B GLN B 1 298 ? 12.916  -0.708  -57.701 0.49 54.82  ? 298 GLN B HE22 1 
ATOM   9251  N N    . GLY B 1 299 ? 6.484   -2.299  -59.050 1.00 39.68  ? 299 GLY B N    1 
ATOM   9252  C CA   . GLY B 1 299 ? 5.265   -2.996  -58.681 1.00 34.57  ? 299 GLY B CA   1 
ATOM   9253  C C    . GLY B 1 299 ? 4.184   -3.028  -59.757 1.00 32.16  ? 299 GLY B C    1 
ATOM   9254  O O    . GLY B 1 299 ? 3.695   -4.096  -60.151 1.00 30.59  ? 299 GLY B O    1 
ATOM   9255  H H    A GLY B 1 299 ? 6.720   -1.705  -58.473 0.51 47.58  ? 299 GLY B H    1 
ATOM   9256  H H    B GLY B 1 299 ? 6.740   -1.716  -58.471 0.49 47.58  ? 299 GLY B H    1 
ATOM   9257  H HA2  . GLY B 1 299 ? 5.485   -3.912  -58.453 1.00 41.44  ? 299 GLY B HA2  1 
ATOM   9258  H HA3  . GLY B 1 299 ? 4.888   -2.573  -57.894 1.00 41.44  ? 299 GLY B HA3  1 
ATOM   9259  N N    . PRO B 1 300 ? 3.783   -1.856  -60.252 1.00 25.89  ? 300 PRO B N    1 
ATOM   9260  C CA   . PRO B 1 300 ? 2.676   -1.833  -61.217 1.00 32.07  ? 300 PRO B CA   1 
ATOM   9261  C C    . PRO B 1 300 ? 2.945   -2.647  -62.472 1.00 40.80  ? 300 PRO B C    1 
ATOM   9262  O O    . PRO B 1 300 ? 2.096   -3.448  -62.873 1.00 33.85  ? 300 PRO B O    1 
ATOM   9263  C CB   . PRO B 1 300 ? 2.516   -0.339  -61.509 1.00 26.81  ? 300 PRO B CB   1 
ATOM   9264  C CG   . PRO B 1 300 ? 3.092   0.359   -60.349 1.00 26.48  ? 300 PRO B CG   1 
ATOM   9265  C CD   . PRO B 1 300 ? 4.251   -0.501  -59.923 1.00 27.68  ? 300 PRO B CD   1 
ATOM   9266  H HA   . PRO B 1 300 ? 1.865   -2.160  -60.798 1.00 38.44  ? 300 PRO B HA   1 
ATOM   9267  H HB2  . PRO B 1 300 ? 3.000   -0.112  -62.318 1.00 32.13  ? 300 PRO B HB2  1 
ATOM   9268  H HB3  . PRO B 1 300 ? 1.574   -0.125  -61.603 1.00 32.13  ? 300 PRO B HB3  1 
ATOM   9269  H HG2  . PRO B 1 300 ? 3.396   1.241   -60.614 1.00 31.74  ? 300 PRO B HG2  1 
ATOM   9270  H HG3  . PRO B 1 300 ? 2.431   0.420   -59.642 1.00 31.74  ? 300 PRO B HG3  1 
ATOM   9271  H HD2  . PRO B 1 300 ? 5.044   -0.281  -60.436 1.00 33.17  ? 300 PRO B HD2  1 
ATOM   9272  H HD3  . PRO B 1 300 ? 4.406   -0.416  -58.969 1.00 33.17  ? 300 PRO B HD3  1 
ATOM   9273  N N    . GLU B 1 301 ? 4.128   -2.496  -63.089 1.00 43.01  ? 301 GLU B N    1 
ATOM   9274  C CA   . GLU B 1 301 ? 4.432   -3.251  -64.307 1.00 37.71  ? 301 GLU B CA   1 
ATOM   9275  C C    . GLU B 1 301 ? 4.479   -4.750  -64.042 1.00 33.04  ? 301 GLU B C    1 
ATOM   9276  O O    . GLU B 1 301 ? 4.042   -5.551  -64.878 1.00 36.34  ? 301 GLU B O    1 
ATOM   9277  C CB   . GLU B 1 301 ? 5.756   -2.765  -64.910 1.00 41.52  ? 301 GLU B CB   1 
ATOM   9278  C CG   . GLU B 1 301 ? 5.696   -1.359  -65.503 1.00 50.54  ? 301 GLU B CG   1 
ATOM   9279  C CD   . GLU B 1 301 ? 7.017   -0.968  -66.159 1.00 67.62  ? 301 GLU B CD   1 
ATOM   9280  O OE1  . GLU B 1 301 ? 7.796   -1.888  -66.498 1.00 74.02  ? 301 GLU B OE1  1 
ATOM   9281  O OE2  . GLU B 1 301 ? 7.281   0.245   -66.329 1.00 63.10  ? 301 GLU B OE2  1 
ATOM   9282  H H    . GLU B 1 301 ? 4.757   -1.973  -62.825 1.00 51.57  ? 301 GLU B H    1 
ATOM   9283  H HA   . GLU B 1 301 ? 3.732   -3.087  -64.958 1.00 45.21  ? 301 GLU B HA   1 
ATOM   9284  H HB2  . GLU B 1 301 ? 6.432   -2.763  -64.215 1.00 49.79  ? 301 GLU B HB2  1 
ATOM   9285  H HB3  . GLU B 1 301 ? 6.016   -3.373  -65.619 1.00 49.79  ? 301 GLU B HB3  1 
ATOM   9286  H HG2  . GLU B 1 301 ? 5.001   -1.326  -66.179 1.00 60.60  ? 301 GLU B HG2  1 
ATOM   9287  H HG3  . GLU B 1 301 ? 5.507   -0.722  -64.797 1.00 60.60  ? 301 GLU B HG3  1 
ATOM   9288  N N    . THR B 1 302 ? 5.025   -5.157  -62.889 1.00 33.51  ? 302 THR B N    1 
ATOM   9289  C CA   . THR B 1 302 ? 4.995   -6.568  -62.515 1.00 29.11  ? 302 THR B CA   1 
ATOM   9290  C C    . THR B 1 302 ? 3.552   -7.077  -62.386 1.00 30.43  ? 302 THR B C    1 
ATOM   9291  O O    . THR B 1 302 ? 3.245   -8.211  -62.770 1.00 33.69  ? 302 THR B O    1 
ATOM   9292  C CB   . THR B 1 302 ? 5.749   -6.760  -61.191 1.00 33.51  ? 302 THR B CB   1 
ATOM   9293  O OG1  . THR B 1 302 ? 7.107   -6.341  -61.352 1.00 37.09  ? 302 THR B OG1  1 
ATOM   9294  C CG2  . THR B 1 302 ? 5.718   -8.213  -60.720 1.00 30.43  ? 302 THR B CG2  1 
ATOM   9295  H H    . THR B 1 302 ? 5.411   -4.643  -62.317 1.00 40.17  ? 302 THR B H    1 
ATOM   9296  H HA   . THR B 1 302 ? 5.443   -7.090  -63.198 1.00 34.90  ? 302 THR B HA   1 
ATOM   9297  H HB   . THR B 1 302 ? 5.329   -6.214  -60.507 1.00 40.18  ? 302 THR B HB   1 
ATOM   9298  H HG1  . THR B 1 302 ? 7.134   -5.531  -61.570 1.00 44.47  ? 302 THR B HG1  1 
ATOM   9299  H HG21 . THR B 1 302 ? 6.201   -8.301  -59.884 1.00 36.48  ? 302 THR B HG21 1 
ATOM   9300  H HG22 . THR B 1 302 ? 4.800   -8.498  -60.586 1.00 36.48  ? 302 THR B HG22 1 
ATOM   9301  H HG23 . THR B 1 302 ? 6.132   -8.785  -61.385 1.00 36.48  ? 302 THR B HG23 1 
ATOM   9302  N N    . ALA B 1 303 ? 2.665   -6.266  -61.815 1.00 29.97  ? 303 ALA B N    1 
ATOM   9303  C CA   . ALA B 1 303 ? 1.270   -6.668  -61.676 1.00 26.82  ? 303 ALA B CA   1 
ATOM   9304  C C    . ALA B 1 303 ? 0.627   -6.885  -63.046 1.00 36.92  ? 303 ALA B C    1 
ATOM   9305  O O    . ALA B 1 303 ? -0.070  -7.881  -63.278 1.00 34.51  ? 303 ALA B O    1 
ATOM   9306  C CB   . ALA B 1 303 ? 0.512   -5.603  -60.890 1.00 28.32  ? 303 ALA B CB   1 
ATOM   9307  H H    . ALA B 1 303 ? 2.844   -5.485  -61.504 1.00 35.93  ? 303 ALA B H    1 
ATOM   9308  H HA   . ALA B 1 303 ? 1.224   -7.502  -61.182 1.00 32.14  ? 303 ALA B HA   1 
ATOM   9309  H HB1  . ALA B 1 303 ? -0.415  -5.877  -60.801 1.00 33.95  ? 303 ALA B HB1  1 
ATOM   9310  H HB2  . ALA B 1 303 ? 0.916   -5.511  -60.013 1.00 33.95  ? 303 ALA B HB2  1 
ATOM   9311  H HB3  . ALA B 1 303 ? 0.564   -4.761  -61.368 1.00 33.95  ? 303 ALA B HB3  1 
ATOM   9312  N N    . ARG B 1 304 ? 0.848   -5.949  -63.970 1.00 41.16  ? 304 ARG B N    1 
ATOM   9313  C CA   . ARG B 1 304 ? 0.392   -6.160  -65.343 1.00 50.95  ? 304 ARG B CA   1 
ATOM   9314  C C    . ARG B 1 304 ? 0.895   -7.502  -65.866 1.00 40.03  ? 304 ARG B C    1 
ATOM   9315  O O    . ARG B 1 304 ? 0.119   -8.326  -66.349 1.00 41.77  ? 304 ARG B O    1 
ATOM   9316  C CB   . ARG B 1 304 ? 0.857   -5.007  -66.249 1.00 46.72  ? 304 ARG B CB   1 
ATOM   9317  C CG   . ARG B 1 304 ? 0.065   -4.877  -67.562 1.00 52.37  ? 304 ARG B CG   1 
ATOM   9318  C CD   . ARG B 1 304 ? 0.954   -4.665  -68.776 1.00 59.40  ? 304 ARG B CD   1 
ATOM   9319  N NE   . ARG B 1 304 ? 1.930   -3.580  -68.625 1.00 68.56  ? 304 ARG B NE   1 
ATOM   9320  C CZ   . ARG B 1 304 ? 1.812   -2.362  -69.155 1.00 76.37  ? 304 ARG B CZ   1 
ATOM   9321  N NH1  . ARG B 1 304 ? 0.744   -2.036  -69.885 1.00 66.92  ? 304 ARG B NH1  1 
ATOM   9322  N NH2  . ARG B 1 304 ? 2.772   -1.456  -68.955 1.00 63.31  ? 304 ARG B NH2  1 
ATOM   9323  H H    . ARG B 1 304 ? 1.251   -5.202  -63.833 1.00 49.35  ? 304 ARG B H    1 
ATOM   9324  H HA   . ARG B 1 304 ? -0.578  -6.178  -65.354 1.00 61.10  ? 304 ARG B HA   1 
ATOM   9325  H HB2  . ARG B 1 304 ? 0.762   -4.172  -65.764 1.00 56.02  ? 304 ARG B HB2  1 
ATOM   9326  H HB3  . ARG B 1 304 ? 1.788   -5.148  -66.479 1.00 56.02  ? 304 ARG B HB3  1 
ATOM   9327  H HG2  . ARG B 1 304 ? -0.445  -5.690  -67.704 1.00 62.80  ? 304 ARG B HG2  1 
ATOM   9328  H HG3  . ARG B 1 304 ? -0.535  -4.118  -67.495 1.00 62.80  ? 304 ARG B HG3  1 
ATOM   9329  H HD2  . ARG B 1 304 ? 1.446   -5.483  -68.947 1.00 71.24  ? 304 ARG B HD2  1 
ATOM   9330  H HD3  . ARG B 1 304 ? 0.394   -4.454  -69.539 1.00 71.24  ? 304 ARG B HD3  1 
ATOM   9331  H HE   . ARG B 1 304 ? 2.634   -3.742  -68.158 1.00 82.23  ? 304 ARG B HE   1 
ATOM   9332  H HH11 . ARG B 1 304 ? 0.122   -2.615  -70.020 1.00 80.26  ? 304 ARG B HH11 1 
ATOM   9333  H HH12 . ARG B 1 304 ? 0.677   -1.247  -70.222 1.00 80.26  ? 304 ARG B HH12 1 
ATOM   9334  H HH21 . ARG B 1 304 ? 3.462   -1.659  -68.484 1.00 75.93  ? 304 ARG B HH21 1 
ATOM   9335  H HH22 . ARG B 1 304 ? 2.698   -0.669  -69.292 1.00 75.93  ? 304 ARG B HH22 1 
ATOM   9336  N N    . GLU B 1 305 ? 2.194   -7.757  -65.732 1.00 38.97  ? 305 GLU B N    1 
ATOM   9337  C CA   . GLU B 1 305 ? 2.734   -9.034  -66.183 1.00 33.90  ? 305 GLU B CA   1 
ATOM   9338  C C    . GLU B 1 305 ? 2.074   -10.204 -65.468 1.00 39.77  ? 305 GLU B C    1 
ATOM   9339  O O    . GLU B 1 305 ? 1.853   -11.264 -66.067 1.00 32.94  ? 305 GLU B O    1 
ATOM   9340  C CB   . GLU B 1 305 ? 4.256   -9.057  -65.973 1.00 35.39  ? 305 GLU B CB   1 
ATOM   9341  C CG   . GLU B 1 305 ? 4.951   -10.211 -66.650 1.00 48.98  ? 305 GLU B CG   1 
ATOM   9342  C CD   . GLU B 1 305 ? 4.599   -10.311 -68.120 1.00 59.52  ? 305 GLU B CD   1 
ATOM   9343  O OE1  . GLU B 1 305 ? 4.628   -9.249  -68.807 1.00 51.67  ? 305 GLU B OE1  1 
ATOM   9344  O OE2  . GLU B 1 305 ? 4.259   -11.441 -68.557 1.00 53.95  ? 305 GLU B OE2  1 
ATOM   9345  H H    . GLU B 1 305 ? 2.773   -7.219  -65.391 1.00 46.72  ? 305 GLU B H    1 
ATOM   9346  H HA   . GLU B 1 305 ? 2.562   -9.130  -67.133 1.00 40.64  ? 305 GLU B HA   1 
ATOM   9347  H HB2  . GLU B 1 305 ? 4.632   -8.236  -66.327 1.00 42.43  ? 305 GLU B HB2  1 
ATOM   9348  H HB3  . GLU B 1 305 ? 4.439   -9.119  -65.022 1.00 42.43  ? 305 GLU B HB3  1 
ATOM   9349  H HG2  . GLU B 1 305 ? 5.911   -10.090 -66.577 1.00 58.73  ? 305 GLU B HG2  1 
ATOM   9350  H HG3  . GLU B 1 305 ? 4.686   -11.039 -66.219 1.00 58.73  ? 305 GLU B HG3  1 
ATOM   9351  N N    . LEU B 1 306 ? 1.770   -10.047 -64.177 1.00 39.90  ? 306 LEU B N    1 
ATOM   9352  C CA   . LEU B 1 306 ? 1.076   -11.116 -63.466 1.00 37.37  ? 306 LEU B CA   1 
ATOM   9353  C C    . LEU B 1 306 ? -0.324  -11.323 -64.040 1.00 39.99  ? 306 LEU B C    1 
ATOM   9354  O O    . LEU B 1 306 ? -0.776  -12.460 -64.214 1.00 30.21  ? 306 LEU B O    1 
ATOM   9355  C CB   . LEU B 1 306 ? 1.010   -10.796 -61.970 1.00 31.98  ? 306 LEU B CB   1 
ATOM   9356  C CG   . LEU B 1 306 ? 2.307   -10.846 -61.164 1.00 31.41  ? 306 LEU B CG   1 
ATOM   9357  C CD1  . LEU B 1 306 ? 2.142   -10.187 -59.791 1.00 32.55  ? 306 LEU B CD1  1 
ATOM   9358  C CD2  . LEU B 1 306 ? 2.780   -12.299 -60.999 1.00 34.62  ? 306 LEU B CD2  1 
ATOM   9359  H H    . LEU B 1 306 ? 1.950   -9.351  -63.704 1.00 47.84  ? 306 LEU B H    1 
ATOM   9360  H HA   . LEU B 1 306 ? 1.572   -11.943 -63.575 1.00 44.81  ? 306 LEU B HA   1 
ATOM   9361  H HB2  . LEU B 1 306 ? 0.652   -9.899  -61.874 1.00 38.33  ? 306 LEU B HB2  1 
ATOM   9362  H HB3  . LEU B 1 306 ? 0.398   -11.426 -61.559 1.00 38.33  ? 306 LEU B HB3  1 
ATOM   9363  H HG   . LEU B 1 306 ? 2.995   -10.362 -61.647 1.00 37.65  ? 306 LEU B HG   1 
ATOM   9364  H HD11 . LEU B 1 306 ? 2.984   -10.240 -59.313 1.00 39.02  ? 306 LEU B HD11 1 
ATOM   9365  H HD12 . LEU B 1 306 ? 1.888   -9.259  -59.915 1.00 39.02  ? 306 LEU B HD12 1 
ATOM   9366  H HD13 . LEU B 1 306 ? 1.451   -10.656 -59.297 1.00 39.02  ? 306 LEU B HD13 1 
ATOM   9367  H HD21 . LEU B 1 306 ? 3.602   -12.307 -60.485 1.00 41.50  ? 306 LEU B HD21 1 
ATOM   9368  H HD22 . LEU B 1 306 ? 2.094   -12.803 -60.532 1.00 41.50  ? 306 LEU B HD22 1 
ATOM   9369  H HD23 . LEU B 1 306 ? 2.933   -12.683 -61.876 1.00 41.50  ? 306 LEU B HD23 1 
ATOM   9370  N N    . TYR B 1 307 ? -1.019  -10.234 -64.338 1.00 39.09  ? 307 TYR B N    1 
ATOM   9371  C CA   . TYR B 1 307 ? -2.350  -10.352 -64.920 1.00 42.87  ? 307 TYR B CA   1 
ATOM   9372  C C    . TYR B 1 307 ? -2.319  -11.132 -66.227 1.00 49.38  ? 307 TYR B C    1 
ATOM   9373  O O    . TYR B 1 307 ? -3.166  -12.000 -66.445 1.00 46.32  ? 307 TYR B O    1 
ATOM   9374  C CB   . TYR B 1 307 ? -2.949  -8.967  -65.155 1.00 52.18  ? 307 TYR B CB   1 
ATOM   9375  C CG   . TYR B 1 307 ? -4.197  -8.989  -66.010 1.00 60.90  ? 307 TYR B CG   1 
ATOM   9376  C CD1  . TYR B 1 307 ? -5.386  -9.511  -65.524 1.00 59.01  ? 307 TYR B CD1  1 
ATOM   9377  C CD2  . TYR B 1 307 ? -4.186  -8.478  -67.303 1.00 63.82  ? 307 TYR B CD2  1 
ATOM   9378  C CE1  . TYR B 1 307 ? -6.533  -9.527  -66.303 1.00 70.74  ? 307 TYR B CE1  1 
ATOM   9379  C CE2  . TYR B 1 307 ? -5.317  -8.488  -68.085 1.00 57.36  ? 307 TYR B CE2  1 
ATOM   9380  C CZ   . TYR B 1 307 ? -6.498  -9.015  -67.577 1.00 71.28  ? 307 TYR B CZ   1 
ATOM   9381  O OH   . TYR B 1 307 ? -7.653  -9.035  -68.330 1.00 76.43  ? 307 TYR B OH   1 
ATOM   9382  H H    . TYR B 1 307 ? -0.750  -9.427  -64.216 1.00 46.86  ? 307 TYR B H    1 
ATOM   9383  H HA   . TYR B 1 307 ? -2.925  -10.827 -64.300 1.00 51.40  ? 307 TYR B HA   1 
ATOM   9384  H HB2  . TYR B 1 307 ? -3.182  -8.576  -64.298 1.00 62.57  ? 307 TYR B HB2  1 
ATOM   9385  H HB3  . TYR B 1 307 ? -2.291  -8.412  -65.602 1.00 62.57  ? 307 TYR B HB3  1 
ATOM   9386  H HD1  . TYR B 1 307 ? -5.415  -9.855  -64.661 1.00 70.77  ? 307 TYR B HD1  1 
ATOM   9387  H HD2  . TYR B 1 307 ? -3.398  -8.122  -67.646 1.00 76.54  ? 307 TYR B HD2  1 
ATOM   9388  H HE1  . TYR B 1 307 ? -7.324  -9.878  -65.963 1.00 84.85  ? 307 TYR B HE1  1 
ATOM   9389  H HE2  . TYR B 1 307 ? -5.293  -8.141  -68.947 1.00 68.79  ? 307 TYR B HE2  1 
ATOM   9390  H HH   . TYR B 1 307 ? -7.509  -8.697  -69.086 1.00 91.67  ? 307 TYR B HH   1 
ATOM   9391  N N    . SER B 1 308 ? -1.351  -10.838 -67.113 1.00 54.85  ? 308 SER B N    1 
ATOM   9392  C CA   . SER B 1 308 ? -1.260  -11.577 -68.373 1.00 43.67  ? 308 SER B CA   1 
ATOM   9393  C C    . SER B 1 308 ? -1.076  -13.060 -68.111 1.00 42.45  ? 308 SER B C    1 
ATOM   9394  O O    . SER B 1 308 ? -1.785  -13.892 -68.683 1.00 46.39  ? 308 SER B O    1 
ATOM   9395  C CB   . SER B 1 308 ? -0.118  -11.046 -69.241 1.00 44.59  ? 308 SER B CB   1 
ATOM   9396  O OG   . SER B 1 308 ? -0.325  -9.674  -69.514 1.00 50.20  ? 308 SER B OG   1 
ATOM   9397  H H    . SER B 1 308 ? -0.752  -10.231 -67.007 1.00 65.78  ? 308 SER B H    1 
ATOM   9398  H HA   . SER B 1 308 ? -2.087  -11.461 -68.866 1.00 52.36  ? 308 SER B HA   1 
ATOM   9399  H HB2  . SER B 1 308 ? 0.721   -11.154 -68.766 1.00 53.47  ? 308 SER B HB2  1 
ATOM   9400  H HB3  . SER B 1 308 ? -0.096  -11.538 -70.077 1.00 53.47  ? 308 SER B HB3  1 
ATOM   9401  H HG   . SER B 1 308 ? 0.300   -9.378  -69.991 1.00 60.20  ? 308 SER B HG   1 
ATOM   9402  N N    . ILE B 1 309 ? -0.140  -13.417 -67.229 1.00 40.05  ? 309 ILE B N    1 
ATOM   9403  C CA   . ILE B 1 309 ? 0.074   -14.828 -66.924 1.00 35.92  ? 309 ILE B CA   1 
ATOM   9404  C C    . ILE B 1 309 ? -1.208  -15.446 -66.366 1.00 49.94  ? 309 ILE B C    1 
ATOM   9405  O O    . ILE B 1 309 ? -1.648  -16.508 -66.813 1.00 48.87  ? 309 ILE B O    1 
ATOM   9406  C CB   . ILE B 1 309 ? 1.256   -14.992 -65.955 1.00 44.47  ? 309 ILE B CB   1 
ATOM   9407  C CG1  . ILE B 1 309 ? 2.530   -14.454 -66.607 1.00 47.82  ? 309 ILE B CG1  1 
ATOM   9408  C CG2  . ILE B 1 309 ? 1.418   -16.456 -65.504 1.00 42.64  ? 309 ILE B CG2  1 
ATOM   9409  C CD1  . ILE B 1 309 ? 3.804   -14.712 -65.825 1.00 47.13  ? 309 ILE B CD1  1 
ATOM   9410  H H    . ILE B 1 309 ? 0.373   -12.873 -66.804 1.00 48.02  ? 309 ILE B H    1 
ATOM   9411  H HA   . ILE B 1 309 ? 0.296   -15.296 -67.745 1.00 43.06  ? 309 ILE B HA   1 
ATOM   9412  H HB   . ILE B 1 309 ? 1.074   -14.455 -65.167 1.00 53.32  ? 309 ILE B HB   1 
ATOM   9413  H HG12 . ILE B 1 309 ? 2.631   -14.871 -67.477 1.00 57.34  ? 309 ILE B HG12 1 
ATOM   9414  H HG13 . ILE B 1 309 ? 2.441   -13.494 -66.714 1.00 57.34  ? 309 ILE B HG13 1 
ATOM   9415  H HG21 . ILE B 1 309 ? 2.171   -16.517 -64.895 1.00 51.13  ? 309 ILE B HG21 1 
ATOM   9416  H HG22 . ILE B 1 309 ? 0.606   -16.739 -65.055 1.00 51.13  ? 309 ILE B HG22 1 
ATOM   9417  H HG23 . ILE B 1 309 ? 1.576   -17.011 -66.284 1.00 51.13  ? 309 ILE B HG23 1 
ATOM   9418  H HD11 . ILE B 1 309 ? 4.554   -14.338 -66.313 1.00 56.51  ? 309 ILE B HD11 1 
ATOM   9419  H HD12 . ILE B 1 309 ? 3.730   -14.289 -64.955 1.00 56.51  ? 309 ILE B HD12 1 
ATOM   9420  H HD13 . ILE B 1 309 ? 3.921   -15.669 -65.720 1.00 56.51  ? 309 ILE B HD13 1 
ATOM   9421  N N    . LEU B 1 310 ? -1.823  -14.790 -65.377 1.00 43.71  ? 310 LEU B N    1 
ATOM   9422  C CA   . LEU B 1 310 ? -2.999  -15.356 -64.724 1.00 50.34  ? 310 LEU B CA   1 
ATOM   9423  C C    . LEU B 1 310 ? -4.202  -15.342 -65.659 1.00 52.53  ? 310 LEU B C    1 
ATOM   9424  O O    . LEU B 1 310 ? -5.005  -16.281 -65.661 1.00 41.25  ? 310 LEU B O    1 
ATOM   9425  C CB   . LEU B 1 310 ? -3.317  -14.582 -63.438 1.00 44.57  ? 310 LEU B CB   1 
ATOM   9426  C CG   . LEU B 1 310 ? -2.314  -14.759 -62.268 1.00 43.22  ? 310 LEU B CG   1 
ATOM   9427  C CD1  . LEU B 1 310 ? -2.677  -13.915 -61.041 1.00 39.89  ? 310 LEU B CD1  1 
ATOM   9428  C CD2  . LEU B 1 310 ? -2.209  -16.218 -61.862 1.00 34.61  ? 310 LEU B CD2  1 
ATOM   9429  H H    . LEU B 1 310 ? -1.579  -14.025 -65.070 1.00 52.41  ? 310 LEU B H    1 
ATOM   9430  H HA   . LEU B 1 310 ? -2.816  -16.277 -64.484 1.00 60.36  ? 310 LEU B HA   1 
ATOM   9431  H HB2  . LEU B 1 310 ? -3.348  -13.637 -63.651 1.00 53.44  ? 310 LEU B HB2  1 
ATOM   9432  H HB3  . LEU B 1 310 ? -4.187  -14.869 -63.118 1.00 53.44  ? 310 LEU B HB3  1 
ATOM   9433  H HG   . LEU B 1 310 ? -1.436  -14.475 -62.568 1.00 51.83  ? 310 LEU B HG   1 
ATOM   9434  H HD11 . LEU B 1 310 ? -2.017  -14.067 -60.347 1.00 47.82  ? 310 LEU B HD11 1 
ATOM   9435  H HD12 . LEU B 1 310 ? -2.683  -12.979 -61.293 1.00 47.82  ? 310 LEU B HD12 1 
ATOM   9436  H HD13 . LEU B 1 310 ? -3.556  -14.179 -60.726 1.00 47.82  ? 310 LEU B HD13 1 
ATOM   9437  H HD21 . LEU B 1 310 ? -1.577  -16.297 -61.131 1.00 41.49  ? 310 LEU B HD21 1 
ATOM   9438  H HD22 . LEU B 1 310 ? -3.083  -16.530 -61.580 1.00 41.49  ? 310 LEU B HD22 1 
ATOM   9439  H HD23 . LEU B 1 310 ? -1.902  -16.735 -62.623 1.00 41.49  ? 310 LEU B HD23 1 
ATOM   9440  N N    . GLN B 1 311 ? -4.360  -14.278 -66.439 1.00 45.09  ? 311 GLN B N    1 
ATOM   9441  C CA   . GLN B 1 311 ? -5.521  -14.207 -67.312 1.00 57.00  ? 311 GLN B CA   1 
ATOM   9442  C C    . GLN B 1 311 ? -5.449  -15.284 -68.379 1.00 50.47  ? 311 GLN B C    1 
ATOM   9443  O O    . GLN B 1 311 ? -6.481  -15.823 -68.775 1.00 55.32  ? 311 GLN B O    1 
ATOM   9444  C CB   . GLN B 1 311 ? -5.648  -12.812 -67.932 1.00 69.19  ? 311 GLN B CB   1 
ATOM   9445  C CG   . GLN B 1 311 ? -5.043  -12.648 -69.340 1.00 77.29  ? 311 GLN B CG   1 
ATOM   9446  C CD   . GLN B 1 311 ? -6.073  -12.872 -70.428 1.00 62.27  ? 311 GLN B CD   1 
ATOM   9447  O OE1  . GLN B 1 311 ? -7.200  -12.410 -70.315 1.00 62.23  ? 311 GLN B OE1  1 
ATOM   9448  N NE2  . GLN B 1 311 ? -5.691  -13.583 -71.485 1.00 65.87  ? 311 GLN B NE2  1 
ATOM   9449  H H    . GLN B 1 311 ? -3.827  -13.604 -66.480 1.00 54.07  ? 311 GLN B H    1 
ATOM   9450  H HA   . GLN B 1 311 ? -6.318  -14.369 -66.784 1.00 68.36  ? 311 GLN B HA   1 
ATOM   9451  H HB2  . GLN B 1 311 ? -6.590  -12.589 -67.993 1.00 82.99  ? 311 GLN B HB2  1 
ATOM   9452  H HB3  . GLN B 1 311 ? -5.203  -12.177 -67.349 1.00 82.99  ? 311 GLN B HB3  1 
ATOM   9453  H HG2  . GLN B 1 311 ? -4.695  -11.747 -69.434 1.00 92.70  ? 311 GLN B HG2  1 
ATOM   9454  H HG3  . GLN B 1 311 ? -4.331  -13.296 -69.458 1.00 92.70  ? 311 GLN B HG3  1 
ATOM   9455  H HE21 . GLN B 1 311 ? -6.245  -13.733 -72.125 1.00 79.01  ? 311 GLN B HE21 1 
ATOM   9456  H HE22 . GLN B 1 311 ? -4.889  -13.892 -71.528 1.00 79.01  ? 311 GLN B HE22 1 
ATOM   9457  N N    . HIS B 1 312 ? -4.239  -15.641 -68.814 1.00 53.77  ? 312 HIS B N    1 
ATOM   9458  C CA   . HIS B 1 312 ? -4.069  -16.673 -69.828 1.00 54.86  ? 312 HIS B CA   1 
ATOM   9459  C C    . HIS B 1 312 ? -4.290  -18.072 -69.269 1.00 50.11  ? 312 HIS B C    1 
ATOM   9460  O O    . HIS B 1 312 ? -4.467  -19.015 -70.047 1.00 64.96  ? 312 HIS B O    1 
ATOM   9461  C CB   . HIS B 1 312 ? -2.679  -16.570 -70.470 1.00 62.27  ? 312 HIS B CB   1 
ATOM   9462  C CG   . HIS B 1 312 ? -2.411  -17.623 -71.500 1.00 67.14  ? 312 HIS B CG   1 
ATOM   9463  N ND1  . HIS B 1 312 ? -1.612  -18.721 -71.254 1.00 70.40  ? 312 HIS B ND1  1 
ATOM   9464  C CD2  . HIS B 1 312 ? -2.855  -17.757 -72.771 1.00 58.90  ? 312 HIS B CD2  1 
ATOM   9465  C CE1  . HIS B 1 312 ? -1.572  -19.484 -72.334 1.00 68.15  ? 312 HIS B CE1  1 
ATOM   9466  N NE2  . HIS B 1 312 ? -2.321  -18.924 -73.267 1.00 60.96  ? 312 HIS B NE2  1 
ATOM   9467  H H    . HIS B 1 312 ? -3.502  -15.298 -68.536 1.00 64.49  ? 312 HIS B H    1 
ATOM   9468  H HA   . HIS B 1 312 ? -4.726  -16.530 -70.527 1.00 65.79  ? 312 HIS B HA   1 
ATOM   9469  H HB2  . HIS B 1 312 ? -2.597  -15.705 -70.902 1.00 74.69  ? 312 HIS B HB2  1 
ATOM   9470  H HB3  . HIS B 1 312 ? -2.007  -16.656 -69.776 1.00 74.69  ? 312 HIS B HB3  1 
ATOM   9471  H HD2  . HIS B 1 312 ? -3.420  -17.173 -73.223 1.00 70.64  ? 312 HIS B HD2  1 
ATOM   9472  H HE1  . HIS B 1 312 ? -1.097  -20.279 -72.421 1.00 81.74  ? 312 HIS B HE1  1 
ATOM   9473  H HE2  . HIS B 1 312 ? -2.446  -19.233 -74.060 1.00 73.11  ? 312 HIS B HE2  1 
ATOM   9474  N N    . LYS B 1 313 ? -4.338  -18.234 -67.953 1.00 58.88  ? 313 LYS B N    1 
ATOM   9475  C CA   . LYS B 1 313 ? -4.714  -19.517 -67.359 1.00 63.78  ? 313 LYS B CA   1 
ATOM   9476  C C    . LYS B 1 313 ? -5.979  -19.406 -66.503 1.00 51.17  ? 313 LYS B C    1 
ATOM   9477  O O    . LYS B 1 313 ? -6.274  -20.302 -65.701 1.00 51.99  ? 313 LYS B O    1 
ATOM   9478  C CB   . LYS B 1 313 ? -3.547  -20.117 -66.564 1.00 67.96  ? 313 LYS B CB   1 
ATOM   9479  C CG   . LYS B 1 313 ? -2.601  -19.121 -65.911 1.00 62.23  ? 313 LYS B CG   1 
ATOM   9480  C CD   . LYS B 1 313 ? -1.156  -19.513 -66.107 1.00 65.04  ? 313 LYS B CD   1 
ATOM   9481  C CE   . LYS B 1 313 ? -0.811  -20.751 -65.292 1.00 58.49  ? 313 LYS B CE   1 
ATOM   9482  N NZ   . LYS B 1 313 ? 0.436   -21.380 -65.771 1.00 50.99  ? 313 LYS B NZ   1 
ATOM   9483  H H    . LYS B 1 313 ? -4.158  -17.619 -67.379 1.00 70.61  ? 313 LYS B H    1 
ATOM   9484  H HA   . LYS B 1 313 ? -4.913  -20.134 -68.080 1.00 76.49  ? 313 LYS B HA   1 
ATOM   9485  H HB2  . LYS B 1 313 ? -3.913  -20.672 -65.858 1.00 81.51  ? 313 LYS B HB2  1 
ATOM   9486  H HB3  . LYS B 1 313 ? -3.019  -20.665 -67.164 1.00 81.51  ? 313 LYS B HB3  1 
ATOM   9487  H HG2  . LYS B 1 313 ? -2.735  -18.246 -66.307 1.00 74.64  ? 313 LYS B HG2  1 
ATOM   9488  H HG3  . LYS B 1 313 ? -2.779  -19.088 -64.958 1.00 74.64  ? 313 LYS B HG3  1 
ATOM   9489  H HD2  . LYS B 1 313 ? -1.002  -19.712 -67.044 1.00 78.01  ? 313 LYS B HD2  1 
ATOM   9490  H HD3  . LYS B 1 313 ? -0.583  -18.786 -65.817 1.00 78.01  ? 313 LYS B HD3  1 
ATOM   9491  H HE2  . LYS B 1 313 ? -0.687  -20.498 -64.363 1.00 70.15  ? 313 LYS B HE2  1 
ATOM   9492  H HE3  . LYS B 1 313 ? -1.529  -21.398 -65.372 1.00 70.15  ? 313 LYS B HE3  1 
ATOM   9493  H HZ1  . LYS B 1 313 ? 0.620   -22.101 -65.282 1.00 61.15  ? 313 LYS B HZ1  1 
ATOM   9494  H HZ2  . LYS B 1 313 ? 0.346   -21.624 -66.622 1.00 61.15  ? 313 LYS B HZ2  1 
ATOM   9495  H HZ3  . LYS B 1 313 ? 1.112   -20.805 -65.705 1.00 61.15  ? 313 LYS B HZ3  1 
ATOM   9496  N N    . GLY B 1 314 ? -6.748  -18.329 -66.685 1.00 52.93  ? 314 GLY B N    1 
ATOM   9497  C CA   . GLY B 1 314 ? -8.059  -18.193 -66.068 1.00 46.14  ? 314 GLY B CA   1 
ATOM   9498  C C    . GLY B 1 314 ? -8.074  -18.075 -64.564 1.00 48.56  ? 314 GLY B C    1 
ATOM   9499  O O    . GLY B 1 314 ? -9.125  -18.304 -63.950 1.00 49.63  ? 314 GLY B O    1 
ATOM   9500  H H    . GLY B 1 314 ? -6.524  -17.655 -67.170 1.00 63.47  ? 314 GLY B H    1 
ATOM   9501  H HA2  . GLY B 1 314 ? -8.492  -17.404 -66.430 1.00 55.33  ? 314 GLY B HA2  1 
ATOM   9502  H HA3  . GLY B 1 314 ? -8.597  -18.963 -66.309 1.00 55.33  ? 314 GLY B HA3  1 
ATOM   9503  N N    . LEU B 1 315 ? -6.938  -17.730 -63.945 1.00 54.98  ? 315 LEU B N    1 
ATOM   9504  C CA   . LEU B 1 315 ? -6.792  -17.704 -62.494 1.00 43.42  ? 315 LEU B CA   1 
ATOM   9505  C C    . LEU B 1 315 ? -6.788  -16.299 -61.926 1.00 40.33  ? 315 LEU B C    1 
ATOM   9506  O O    . LEU B 1 315 ? -6.453  -16.115 -60.752 1.00 42.06  ? 315 LEU B O    1 
ATOM   9507  C CB   . LEU B 1 315 ? -5.509  -18.434 -62.098 1.00 41.99  ? 315 LEU B CB   1 
ATOM   9508  C CG   . LEU B 1 315 ? -5.599  -19.953 -62.248 1.00 49.99  ? 315 LEU B CG   1 
ATOM   9509  C CD1  . LEU B 1 315 ? -4.256  -20.627 -61.968 1.00 38.61  ? 315 LEU B CD1  1 
ATOM   9510  C CD2  . LEU B 1 315 ? -6.683  -20.515 -61.326 1.00 49.36  ? 315 LEU B CD2  1 
ATOM   9511  H H    . LEU B 1 315 ? -6.222  -17.500 -64.362 1.00 65.94  ? 315 LEU B H    1 
ATOM   9512  H HA   . LEU B 1 315 ? -7.538  -18.181 -62.098 1.00 52.06  ? 315 LEU B HA   1 
ATOM   9513  H HB2  . LEU B 1 315 ? -4.784  -18.123 -62.663 1.00 50.35  ? 315 LEU B HB2  1 
ATOM   9514  H HB3  . LEU B 1 315 ? -5.311  -18.238 -61.169 1.00 50.35  ? 315 LEU B HB3  1 
ATOM   9515  H HG   . LEU B 1 315 ? -5.850  -20.162 -63.161 1.00 59.94  ? 315 LEU B HG   1 
ATOM   9516  H HD11 . LEU B 1 315 ? -4.357  -21.586 -62.073 1.00 46.29  ? 315 LEU B HD11 1 
ATOM   9517  H HD12 . LEU B 1 315 ? -3.598  -20.292 -62.597 1.00 46.29  ? 315 LEU B HD12 1 
ATOM   9518  H HD13 . LEU B 1 315 ? -3.982  -20.420 -61.061 1.00 46.29  ? 315 LEU B HD13 1 
ATOM   9519  H HD21 . LEU B 1 315 ? -6.723  -21.478 -61.437 1.00 59.19  ? 315 LEU B HD21 1 
ATOM   9520  H HD22 . LEU B 1 315 ? -6.461  -20.296 -60.408 1.00 59.19  ? 315 LEU B HD22 1 
ATOM   9521  H HD23 . LEU B 1 315 ? -7.536  -20.118 -61.565 1.00 59.19  ? 315 LEU B HD23 1 
ATOM   9522  N N    . VAL B 1 316 ? -7.156  -15.299 -62.719 1.00 35.00  ? 316 VAL B N    1 
ATOM   9523  C CA   . VAL B 1 316 ? -7.264  -13.951 -62.167 1.00 53.29  ? 316 VAL B CA   1 
ATOM   9524  C C    . VAL B 1 316 ? -8.066  -13.964 -60.869 1.00 43.82  ? 316 VAL B C    1 
ATOM   9525  O O    . VAL B 1 316 ? -7.829  -13.143 -59.976 1.00 46.51  ? 316 VAL B O    1 
ATOM   9526  C CB   . VAL B 1 316 ? -7.877  -13.001 -63.214 1.00 39.55  ? 316 VAL B CB   1 
ATOM   9527  C CG1  . VAL B 1 316 ? -8.346  -11.637 -62.577 1.00 51.72  ? 316 VAL B CG1  1 
ATOM   9528  C CG2  . VAL B 1 316 ? -6.864  -12.784 -64.316 1.00 51.30  ? 316 VAL B CG2  1 
ATOM   9529  H H    . VAL B 1 316 ? -7.343  -15.368 -63.556 1.00 41.96  ? 316 VAL B H    1 
ATOM   9530  H HA   . VAL B 1 316 ? -6.374  -13.627 -61.960 1.00 63.91  ? 316 VAL B HA   1 
ATOM   9531  H HB   . VAL B 1 316 ? -8.654  -13.428 -63.606 1.00 47.42  ? 316 VAL B HB   1 
ATOM   9532  H HG11 . VAL B 1 316 ? -8.157  -11.652 -61.625 1.00 62.02  ? 316 VAL B HG11 1 
ATOM   9533  H HG12 . VAL B 1 316 ? -7.863  -10.909 -62.999 1.00 62.02  ? 316 VAL B HG12 1 
ATOM   9534  H HG13 . VAL B 1 316 ? -9.299  -11.532 -62.724 1.00 62.02  ? 316 VAL B HG13 1 
ATOM   9535  H HG21 . VAL B 1 316 ? -6.062  -13.290 -64.112 1.00 61.52  ? 316 VAL B HG21 1 
ATOM   9536  H HG22 . VAL B 1 316 ? -7.242  -13.086 -65.156 1.00 61.52  ? 316 VAL B HG22 1 
ATOM   9537  H HG23 . VAL B 1 316 ? -6.653  -11.838 -64.368 1.00 61.52  ? 316 VAL B HG23 1 
ATOM   9538  N N    . ASP B 1 317 ? -9.011  -14.888 -60.735 1.00 41.97  ? 317 ASP B N    1 
ATOM   9539  C CA   . ASP B 1 317 ? -9.867  -14.880 -59.557 1.00 42.61  ? 317 ASP B CA   1 
ATOM   9540  C C    . ASP B 1 317 ? -9.131  -15.347 -58.319 1.00 37.20  ? 317 ASP B C    1 
ATOM   9541  O O    . ASP B 1 317 ? -9.510  -14.968 -57.204 1.00 30.21  ? 317 ASP B O    1 
ATOM   9542  C CB   . ASP B 1 317 ? -11.093 -15.763 -59.790 1.00 45.01  ? 317 ASP B CB   1 
ATOM   9543  C CG   . ASP B 1 317 ? -12.203 -15.014 -60.492 1.00 57.34  ? 317 ASP B CG   1 
ATOM   9544  O OD1  . ASP B 1 317 ? -12.473 -13.863 -60.091 1.00 54.41  ? 317 ASP B OD1  1 
ATOM   9545  O OD2  . ASP B 1 317 ? -12.804 -15.562 -61.434 1.00 78.91  ? 317 ASP B OD2  1 
ATOM   9546  H H    . ASP B 1 317 ? -9.174  -15.517 -61.298 1.00 50.33  ? 317 ASP B H    1 
ATOM   9547  H HA   . ASP B 1 317 ? -10.176 -13.975 -59.398 1.00 51.09  ? 317 ASP B HA   1 
ATOM   9548  H HB2  . ASP B 1 317 ? -10.842 -16.519 -60.344 1.00 53.97  ? 317 ASP B HB2  1 
ATOM   9549  H HB3  . ASP B 1 317 ? -11.431 -16.072 -58.935 1.00 53.97  ? 317 ASP B HB3  1 
ATOM   9550  N N    . LYS B 1 318 ? -8.082  -16.146 -58.494 1.00 38.50  ? 318 LYS B N    1 
ATOM   9551  C CA   . LYS B 1 318 ? -7.386  -16.719 -57.360 1.00 41.91  ? 318 LYS B CA   1 
ATOM   9552  C C    . LYS B 1 318 ? -6.449  -15.728 -56.657 1.00 38.13  ? 318 LYS B C    1 
ATOM   9553  O O    . LYS B 1 318 ? -5.917  -16.076 -55.601 1.00 33.65  ? 318 LYS B O    1 
ATOM   9554  C CB   . LYS B 1 318 ? -6.610  -17.962 -57.814 1.00 38.12  ? 318 LYS B CB   1 
ATOM   9555  H H    . LYS B 1 318 ? -7.759  -16.369 -59.259 1.00 46.16  ? 318 LYS B H    1 
ATOM   9556  H HA   . LYS B 1 318 ? -8.045  -17.007 -56.709 1.00 50.25  ? 318 LYS B HA   1 
ATOM   9557  N N    . PHE B 1 319 ? -6.277  -14.501 -57.178 1.00 34.53  ? 319 PHE B N    1 
ATOM   9558  C CA   . PHE B 1 319 ? -5.215  -13.585 -56.736 1.00 34.05  ? 319 PHE B CA   1 
ATOM   9559  C C    . PHE B 1 319 ? -5.760  -12.174 -56.645 1.00 30.38  ? 319 PHE B C    1 
ATOM   9560  O O    . PHE B 1 319 ? -5.320  -11.274 -57.360 1.00 32.02  ? 319 PHE B O    1 
ATOM   9561  C CB   . PHE B 1 319 ? -4.009  -13.639 -57.682 1.00 24.88  ? 319 PHE B CB   1 
ATOM   9562  C CG   . PHE B 1 319 ? -3.263  -14.917 -57.619 1.00 31.80  ? 319 PHE B CG   1 
ATOM   9563  C CD1  . PHE B 1 319 ? -3.668  -15.990 -58.380 1.00 42.68  ? 319 PHE B CD1  1 
ATOM   9564  C CD2  . PHE B 1 319 ? -2.174  -15.070 -56.765 1.00 34.19  ? 319 PHE B CD2  1 
ATOM   9565  C CE1  . PHE B 1 319 ? -2.996  -17.211 -58.314 1.00 31.00  ? 319 PHE B CE1  1 
ATOM   9566  C CE2  . PHE B 1 319 ? -1.500  -16.272 -56.682 1.00 27.47  ? 319 PHE B CE2  1 
ATOM   9567  C CZ   . PHE B 1 319 ? -1.908  -17.354 -57.457 1.00 37.08  ? 319 PHE B CZ   1 
ATOM   9568  H H    . PHE B 1 319 ? -6.773  -14.173 -57.800 1.00 41.39  ? 319 PHE B H    1 
ATOM   9569  H HA   . PHE B 1 319 ? -4.916  -13.850 -55.852 1.00 40.82  ? 319 PHE B HA   1 
ATOM   9570  H HB2  . PHE B 1 319 ? -4.320  -13.521 -58.593 1.00 29.82  ? 319 PHE B HB2  1 
ATOM   9571  H HB3  . PHE B 1 319 ? -3.395  -12.925 -57.448 1.00 29.82  ? 319 PHE B HB3  1 
ATOM   9572  H HD1  . PHE B 1 319 ? -4.399  -15.900 -58.947 1.00 51.17  ? 319 PHE B HD1  1 
ATOM   9573  H HD2  . PHE B 1 319 ? -1.900  -14.354 -56.239 1.00 40.99  ? 319 PHE B HD2  1 
ATOM   9574  H HE1  . PHE B 1 319 ? -3.276  -17.927 -58.837 1.00 37.16  ? 319 PHE B HE1  1 
ATOM   9575  H HE2  . PHE B 1 319 ? -0.770  -16.357 -56.112 1.00 32.92  ? 319 PHE B HE2  1 
ATOM   9576  H HZ   . PHE B 1 319 ? -1.450  -18.162 -57.413 1.00 44.46  ? 319 PHE B HZ   1 
ATOM   9577  N N    . PRO B 1 320 ? -6.709  -11.934 -55.735 1.00 29.65  ? 320 PRO B N    1 
ATOM   9578  C CA   . PRO B 1 320 ? -7.386  -10.629 -55.725 1.00 26.67  ? 320 PRO B CA   1 
ATOM   9579  C C    . PRO B 1 320 ? -6.489  -9.473  -55.359 1.00 26.60  ? 320 PRO B C    1 
ATOM   9580  O O    . PRO B 1 320 ? -6.745  -8.336  -55.775 1.00 27.43  ? 320 PRO B O    1 
ATOM   9581  C CB   . PRO B 1 320 ? -8.495  -10.808 -54.674 1.00 30.84  ? 320 PRO B CB   1 
ATOM   9582  C CG   . PRO B 1 320 ? -8.495  -12.253 -54.315 1.00 29.47  ? 320 PRO B CG   1 
ATOM   9583  C CD   . PRO B 1 320 ? -7.207  -12.841 -54.683 1.00 30.04  ? 320 PRO B CD   1 
ATOM   9584  H HA   . PRO B 1 320 ? -7.791  -10.457 -56.589 1.00 31.96  ? 320 PRO B HA   1 
ATOM   9585  H HB2  . PRO B 1 320 ? -8.295  -10.264 -53.896 1.00 36.97  ? 320 PRO B HB2  1 
ATOM   9586  H HB3  . PRO B 1 320 ? -9.349  -10.553 -55.057 1.00 36.97  ? 320 PRO B HB3  1 
ATOM   9587  H HG2  . PRO B 1 320 ? -8.636  -12.340 -53.359 1.00 35.33  ? 320 PRO B HG2  1 
ATOM   9588  H HG3  . PRO B 1 320 ? -9.210  -12.697 -54.796 1.00 35.33  ? 320 PRO B HG3  1 
ATOM   9589  H HD2  . PRO B 1 320 ? -6.604  -12.840 -53.923 1.00 36.00  ? 320 PRO B HD2  1 
ATOM   9590  H HD3  . PRO B 1 320 ? -7.331  -13.735 -55.038 1.00 36.00  ? 320 PRO B HD3  1 
ATOM   9591  N N    . LEU B 1 321 ? -5.484  -9.697  -54.515 1.00 28.56  ? 321 LEU B N    1 
ATOM   9592  C CA   . LEU B 1 321 ? -4.591  -8.594  -54.169 1.00 30.10  ? 321 LEU B CA   1 
ATOM   9593  C C    . LEU B 1 321 ? -3.764  -8.178  -55.383 1.00 31.46  ? 321 LEU B C    1 
ATOM   9594  O O    . LEU B 1 321 ? -3.806  -7.019  -55.823 1.00 29.09  ? 321 LEU B O    1 
ATOM   9595  C CB   . LEU B 1 321 ? -3.667  -8.995  -53.012 1.00 28.81  ? 321 LEU B CB   1 
ATOM   9596  C CG   . LEU B 1 321 ? -2.994  -7.815  -52.326 1.00 37.76  ? 321 LEU B CG   1 
ATOM   9597  C CD1  . LEU B 1 321 ? -2.681  -8.215  -50.892 1.00 36.38  ? 321 LEU B CD1  1 
ATOM   9598  C CD2  . LEU B 1 321 ? -1.699  -7.453  -53.050 1.00 37.80  ? 321 LEU B CD2  1 
ATOM   9599  H H    . LEU B 1 321 ? -5.302  -10.449 -54.140 1.00 34.23  ? 321 LEU B H    1 
ATOM   9600  H HA   . LEU B 1 321 ? -5.120  -7.832  -53.886 1.00 36.08  ? 321 LEU B HA   1 
ATOM   9601  H HB2  . LEU B 1 321 ? -4.189  -9.468  -52.344 1.00 34.53  ? 321 LEU B HB2  1 
ATOM   9602  H HB3  . LEU B 1 321 ? -2.969  -9.575  -53.355 1.00 34.53  ? 321 LEU B HB3  1 
ATOM   9603  H HG   . LEU B 1 321 ? -3.586  -7.046  -52.322 1.00 45.27  ? 321 LEU B HG   1 
ATOM   9604  H HD11 . LEU B 1 321 ? -2.251  -7.470  -50.444 1.00 43.61  ? 321 LEU B HD11 1 
ATOM   9605  H HD12 . LEU B 1 321 ? -3.509  -8.441  -50.440 1.00 43.61  ? 321 LEU B HD12 1 
ATOM   9606  H HD13 . LEU B 1 321 ? -2.088  -8.982  -50.902 1.00 43.61  ? 321 LEU B HD13 1 
ATOM   9607  H HD21 . LEU B 1 321 ? -1.286  -6.700  -52.600 1.00 45.32  ? 321 LEU B HD21 1 
ATOM   9608  H HD22 . LEU B 1 321 ? -1.103  -8.218  -53.032 1.00 45.32  ? 321 LEU B HD22 1 
ATOM   9609  H HD23 . LEU B 1 321 ? -1.907  -7.217  -53.968 1.00 45.32  ? 321 LEU B HD23 1 
ATOM   9610  N N    . PHE B 1 322 ? -2.977  -9.111  -55.906 1.00 25.41  ? 322 PHE B N    1 
ATOM   9611  C CA   . PHE B 1 322 ? -2.200  -8.854  -57.117 1.00 30.49  ? 322 PHE B CA   1 
ATOM   9612  C C    . PHE B 1 322 ? -3.077  -8.240  -58.208 1.00 33.63  ? 322 PHE B C    1 
ATOM   9613  O O    . PHE B 1 322 ? -2.723  -7.223  -58.824 1.00 36.31  ? 322 PHE B O    1 
ATOM   9614  C CB   . PHE B 1 322 ? -1.603  -10.162 -57.621 1.00 23.34  ? 322 PHE B CB   1 
ATOM   9615  C CG   . PHE B 1 322 ? -0.440  -10.662 -56.846 1.00 20.83  ? 322 PHE B CG   1 
ATOM   9616  C CD1  . PHE B 1 322 ? 0.213   -9.884  -55.921 1.00 34.65  ? 322 PHE B CD1  1 
ATOM   9617  C CD2  . PHE B 1 322 ? -0.022  -11.951 -57.046 1.00 20.16  ? 322 PHE B CD2  1 
ATOM   9618  C CE1  . PHE B 1 322 ? 1.279   -10.386 -55.244 1.00 30.84  ? 322 PHE B CE1  1 
ATOM   9619  C CE2  . PHE B 1 322 ? 1.013   -12.457 -56.378 1.00 30.99  ? 322 PHE B CE2  1 
ATOM   9620  C CZ   . PHE B 1 322 ? 1.663   -11.684 -55.454 1.00 23.62  ? 322 PHE B CZ   1 
ATOM   9621  H H    . PHE B 1 322 ? -2.875  -9.901  -55.581 1.00 30.45  ? 322 PHE B H    1 
ATOM   9622  H HA   . PHE B 1 322 ? -1.478  -8.239  -56.917 1.00 36.54  ? 322 PHE B HA   1 
ATOM   9623  H HB2  . PHE B 1 322 ? -2.289  -10.847 -57.591 1.00 27.97  ? 322 PHE B HB2  1 
ATOM   9624  H HB3  . PHE B 1 322 ? -1.310  -10.035 -58.537 1.00 27.97  ? 322 PHE B HB3  1 
ATOM   9625  H HD1  . PHE B 1 322 ? -0.058  -9.006  -55.777 1.00 41.54  ? 322 PHE B HD1  1 
ATOM   9626  H HD2  . PHE B 1 322 ? -0.466  -12.483 -57.667 1.00 24.15  ? 322 PHE B HD2  1 
ATOM   9627  H HE1  . PHE B 1 322 ? 1.722   -9.863  -54.615 1.00 36.96  ? 322 PHE B HE1  1 
ATOM   9628  H HE2  . PHE B 1 322 ? 1.283   -13.334 -56.527 1.00 37.14  ? 322 PHE B HE2  1 
ATOM   9629  H HZ   . PHE B 1 322 ? 2.392   -12.031 -54.992 1.00 28.30  ? 322 PHE B HZ   1 
ATOM   9630  N N    . MET B 1 323 ? -4.235  -8.858  -58.462 1.00 30.61  ? 323 MET B N    1 
ATOM   9631  C CA   . MET B 1 323 ? -5.127  -8.347  -59.506 1.00 28.81  ? 323 MET B CA   1 
ATOM   9632  C C    . MET B 1 323 ? -5.753  -7.008  -59.148 1.00 32.54  ? 323 MET B C    1 
ATOM   9633  O O    . MET B 1 323 ? -5.936  -6.161  -60.037 1.00 30.41  ? 323 MET B O    1 
ATOM   9634  C CB   . MET B 1 323 ? -6.176  -9.392  -59.809 1.00 34.42  ? 323 MET B CB   1 
ATOM   9635  C CG   . MET B 1 323 ? -5.525  -10.635 -60.412 1.00 34.22  ? 323 MET B CG   1 
ATOM   9636  S SD   . MET B 1 323 ? -4.590  -10.310 -61.937 1.00 38.75  ? 323 MET B SD   1 
ATOM   9637  C CE   . MET B 1 323 ? -2.879  -10.118 -61.329 1.00 37.55  ? 323 MET B CE   1 
ATOM   9638  H H    . MET B 1 323 ? -4.521  -9.559  -58.054 1.00 36.69  ? 323 MET B H    1 
ATOM   9639  H HA   . MET B 1 323 ? -4.605  -8.226  -60.315 1.00 34.53  ? 323 MET B HA   1 
ATOM   9640  H HB2  . MET B 1 323 ? -6.626  -9.647  -58.988 1.00 41.26  ? 323 MET B HB2  1 
ATOM   9641  H HB3  . MET B 1 323 ? -6.813  -9.037  -60.448 1.00 41.26  ? 323 MET B HB3  1 
ATOM   9642  H HG2  . MET B 1 323 ? -4.911  -11.012 -59.763 1.00 41.02  ? 323 MET B HG2  1 
ATOM   9643  H HG3  . MET B 1 323 ? -6.219  -11.281 -60.621 1.00 41.02  ? 323 MET B HG3  1 
ATOM   9644  H HE1  . MET B 1 323 ? -2.295  -9.939  -62.082 1.00 45.01  ? 323 MET B HE1  1 
ATOM   9645  H HE2  . MET B 1 323 ? -2.848  -9.378  -60.702 1.00 45.01  ? 323 MET B HE2  1 
ATOM   9646  H HE3  . MET B 1 323 ? -2.608  -10.938 -60.887 1.00 45.01  ? 323 MET B HE3  1 
ATOM   9647  N N    . ALA B 1 324 ? -6.067  -6.763  -57.874 1.00 23.96  ? 324 ALA B N    1 
ATOM   9648  C CA   . ALA B 1 324 ? -6.575  -5.436  -57.548 1.00 26.30  ? 324 ALA B CA   1 
ATOM   9649  C C    . ALA B 1 324 ? -5.506  -4.368  -57.784 1.00 36.08  ? 324 ALA B C    1 
ATOM   9650  O O    . ALA B 1 324 ? -5.825  -3.216  -58.127 1.00 31.93  ? 324 ALA B O    1 
ATOM   9651  C CB   . ALA B 1 324 ? -7.069  -5.393  -56.103 1.00 34.58  ? 324 ALA B CB   1 
ATOM   9652  H H    . ALA B 1 324 ? -5.999  -7.314  -57.217 1.00 28.71  ? 324 ALA B H    1 
ATOM   9653  H HA   . ALA B 1 324 ? -7.327  -5.237  -58.126 1.00 31.52  ? 324 ALA B HA   1 
ATOM   9654  H HB1  . ALA B 1 324 ? -7.401  -4.503  -55.910 1.00 41.45  ? 324 ALA B HB1  1 
ATOM   9655  H HB2  . ALA B 1 324 ? -7.781  -6.043  -55.994 1.00 41.45  ? 324 ALA B HB2  1 
ATOM   9656  H HB3  . ALA B 1 324 ? -6.331  -5.607  -55.511 1.00 41.45  ? 324 ALA B HB3  1 
ATOM   9657  N N    . VAL B 1 325 ? -4.235  -4.713  -57.579 1.00 27.52  ? 325 VAL B N    1 
ATOM   9658  C CA   . VAL B 1 325 ? -3.177  -3.750  -57.848 1.00 32.58  ? 325 VAL B CA   1 
ATOM   9659  C C    . VAL B 1 325 ? -3.157  -3.423  -59.337 1.00 32.12  ? 325 VAL B C    1 
ATOM   9660  O O    . VAL B 1 325 ? -3.133  -2.258  -59.738 1.00 32.53  ? 325 VAL B O    1 
ATOM   9661  C CB   . VAL B 1 325 ? -1.816  -4.288  -57.349 1.00 23.78  ? 325 VAL B CB   1 
ATOM   9662  C CG1  . VAL B 1 325 ? -0.663  -3.474  -57.947 1.00 32.18  ? 325 VAL B CG1  1 
ATOM   9663  C CG2  . VAL B 1 325 ? -1.731  -4.224  -55.836 1.00 24.74  ? 325 VAL B CG2  1 
ATOM   9664  H H    . VAL B 1 325 ? -3.967  -5.478  -57.293 1.00 32.98  ? 325 VAL B H    1 
ATOM   9665  H HA   . VAL B 1 325 ? -3.368  -2.930  -57.365 1.00 39.05  ? 325 VAL B HA   1 
ATOM   9666  H HB   . VAL B 1 325 ? -1.714  -5.213  -57.623 1.00 28.50  ? 325 VAL B HB   1 
ATOM   9667  H HG11 . VAL B 1 325 ? 0.177   -3.830  -57.619 1.00 38.57  ? 325 VAL B HG11 1 
ATOM   9668  H HG12 . VAL B 1 325 ? -0.698  -3.541  -58.914 1.00 38.57  ? 325 VAL B HG12 1 
ATOM   9669  H HG13 . VAL B 1 325 ? -0.758  -2.547  -57.675 1.00 38.57  ? 325 VAL B HG13 1 
ATOM   9670  H HG21 . VAL B 1 325 ? -0.868  -4.567  -55.554 1.00 29.64  ? 325 VAL B HG21 1 
ATOM   9671  H HG22 . VAL B 1 325 ? -1.828  -3.301  -55.554 1.00 29.64  ? 325 VAL B HG22 1 
ATOM   9672  H HG23 . VAL B 1 325 ? -2.442  -4.763  -55.457 1.00 29.64  ? 325 VAL B HG23 1 
ATOM   9673  N N    . TYR B 1 326 ? -3.173  -4.453  -60.173 1.00 32.30  ? 326 TYR B N    1 
ATOM   9674  C CA   . TYR B 1 326 ? -3.235  -4.253  -61.617 1.00 43.02  ? 326 TYR B CA   1 
ATOM   9675  C C    . TYR B 1 326 ? -4.388  -3.331  -62.035 1.00 47.04  ? 326 TYR B C    1 
ATOM   9676  O O    . TYR B 1 326 ? -4.186  -2.353  -62.772 1.00 40.10  ? 326 TYR B O    1 
ATOM   9677  C CB   . TYR B 1 326 ? -3.368  -5.606  -62.321 1.00 44.40  ? 326 TYR B CB   1 
ATOM   9678  C CG   . TYR B 1 326 ? -3.775  -5.420  -63.766 1.00 57.25  ? 326 TYR B CG   1 
ATOM   9679  C CD1  . TYR B 1 326 ? -2.897  -4.851  -64.696 1.00 54.25  ? 326 TYR B CD1  1 
ATOM   9680  C CD2  . TYR B 1 326 ? -5.053  -5.774  -64.195 1.00 52.33  ? 326 TYR B CD2  1 
ATOM   9681  C CE1  . TYR B 1 326 ? -3.288  -4.660  -66.025 1.00 56.72  ? 326 TYR B CE1  1 
ATOM   9682  C CE2  . TYR B 1 326 ? -5.447  -5.597  -65.500 1.00 57.60  ? 326 TYR B CE2  1 
ATOM   9683  C CZ   . TYR B 1 326 ? -4.575  -5.039  -66.413 1.00 57.68  ? 326 TYR B CZ   1 
ATOM   9684  O OH   . TYR B 1 326 ? -5.028  -4.869  -67.698 1.00 59.91  ? 326 TYR B OH   1 
ATOM   9685  H H    . TYR B 1 326 ? -3.150  -5.278  -59.931 1.00 38.72  ? 326 TYR B H    1 
ATOM   9686  H HA   . TYR B 1 326 ? -2.406  -3.844  -61.912 1.00 51.59  ? 326 TYR B HA   1 
ATOM   9687  H HB2  . TYR B 1 326 ? -2.514  -6.066  -62.300 1.00 53.24  ? 326 TYR B HB2  1 
ATOM   9688  H HB3  . TYR B 1 326 ? -4.048  -6.136  -61.876 1.00 53.24  ? 326 TYR B HB3  1 
ATOM   9689  H HD1  . TYR B 1 326 ? -2.043  -4.599  -64.427 1.00 65.05  ? 326 TYR B HD1  1 
ATOM   9690  H HD2  . TYR B 1 326 ? -5.650  -6.149  -63.588 1.00 62.75  ? 326 TYR B HD2  1 
ATOM   9691  H HE1  . TYR B 1 326 ? -2.701  -4.284  -66.640 1.00 68.02  ? 326 TYR B HE1  1 
ATOM   9692  H HE2  . TYR B 1 326 ? -6.304  -5.842  -65.765 1.00 69.08  ? 326 TYR B HE2  1 
ATOM   9693  H HH   . TYR B 1 326 ? -5.817  -5.147  -67.764 1.00 71.85  ? 326 TYR B HH   1 
ATOM   9694  N N    . LYS B 1 327 ? -5.612  -3.629  -61.571 1.00 43.21  ? 327 LYS B N    1 
ATOM   9695  C CA   . LYS B 1 327 ? -6.792  -2.930  -62.073 1.00 30.26  ? 327 LYS B CA   1 
ATOM   9696  C C    . LYS B 1 327 ? -6.832  -1.478  -61.631 1.00 35.24  ? 327 LYS B C    1 
ATOM   9697  O O    . LYS B 1 327 ? -7.352  -0.624  -62.360 1.00 37.26  ? 327 LYS B O    1 
ATOM   9698  C CB   . LYS B 1 327 ? -8.061  -3.657  -61.619 1.00 36.53  ? 327 LYS B CB   1 
ATOM   9699  C CG   . LYS B 1 327 ? -8.341  -4.913  -62.409 1.00 42.41  ? 327 LYS B CG   1 
ATOM   9700  C CD   . LYS B 1 327 ? -9.630  -5.582  -61.923 1.00 46.91  ? 327 LYS B CD   1 
ATOM   9701  C CE   . LYS B 1 327 ? -10.296 -6.423  -63.020 1.00 61.71  ? 327 LYS B CE   1 
ATOM   9702  N NZ   . LYS B 1 327 ? -9.494  -7.613  -63.426 1.00 68.69  ? 327 LYS B NZ   1 
ATOM   9703  H H    . LYS B 1 327 ? -5.778  -4.225  -60.973 1.00 51.81  ? 327 LYS B H    1 
ATOM   9704  H HA   . LYS B 1 327 ? -6.774  -2.944  -63.043 1.00 36.28  ? 327 LYS B HA   1 
ATOM   9705  H HB2  . LYS B 1 327 ? -7.964  -3.907  -60.687 1.00 43.80  ? 327 LYS B HB2  1 
ATOM   9706  H HB3  . LYS B 1 327 ? -8.819  -3.062  -61.725 1.00 43.80  ? 327 LYS B HB3  1 
ATOM   9707  H HG2  . LYS B 1 327 ? -8.448  -4.687  -63.347 1.00 50.85  ? 327 LYS B HG2  1 
ATOM   9708  H HG3  . LYS B 1 327 ? -7.609  -5.538  -62.293 1.00 50.85  ? 327 LYS B HG3  1 
ATOM   9709  H HD2  . LYS B 1 327 ? -9.422  -6.167  -61.178 1.00 56.25  ? 327 LYS B HD2  1 
ATOM   9710  H HD3  . LYS B 1 327 ? -10.258 -4.897  -61.645 1.00 56.25  ? 327 LYS B HD3  1 
ATOM   9711  H HE2  . LYS B 1 327 ? -11.153 -6.740  -62.695 1.00 74.01  ? 327 LYS B HE2  1 
ATOM   9712  H HE3  . LYS B 1 327 ? -10.425 -5.869  -63.806 1.00 74.01  ? 327 LYS B HE3  1 
ATOM   9713  H HZ1  . LYS B 1 327 ? -9.922  -8.065  -64.062 1.00 82.38  ? 327 LYS B HZ1  1 
ATOM   9714  H HZ2  . LYS B 1 327 ? -8.702  -7.353  -63.739 1.00 82.38  ? 327 LYS B HZ2  1 
ATOM   9715  H HZ3  . LYS B 1 327 ? -9.367  -8.148  -62.726 1.00 82.38  ? 327 LYS B HZ3  1 
ATOM   9716  N N    . VAL B 1 328 ? -6.333  -1.172  -60.438 1.00 33.86  ? 328 VAL B N    1 
ATOM   9717  C CA   . VAL B 1 328 ? -6.260  0.221   -60.028 1.00 33.82  ? 328 VAL B CA   1 
ATOM   9718  C C    . VAL B 1 328 ? -5.196  0.957   -60.850 1.00 33.40  ? 328 VAL B C    1 
ATOM   9719  O O    . VAL B 1 328 ? -5.344  2.138   -61.174 1.00 38.33  ? 328 VAL B O    1 
ATOM   9720  C CB   . VAL B 1 328 ? -5.983  0.308   -58.516 1.00 37.73  ? 328 VAL B CB   1 
ATOM   9721  C CG1  . VAL B 1 328 ? -5.737  1.745   -58.078 1.00 32.71  ? 328 VAL B CG1  1 
ATOM   9722  C CG2  . VAL B 1 328 ? -7.157  -0.306  -57.700 1.00 29.67  ? 328 VAL B CG2  1 
ATOM   9723  H H    . VAL B 1 328 ? -6.038  -1.738  -59.862 1.00 40.59  ? 328 VAL B H    1 
ATOM   9724  H HA   . VAL B 1 328 ? -7.116  0.645   -60.199 1.00 40.54  ? 328 VAL B HA   1 
ATOM   9725  H HB   . VAL B 1 328 ? -5.183  -0.203  -58.315 1.00 45.24  ? 328 VAL B HB   1 
ATOM   9726  H HG11 . VAL B 1 328 ? -5.567  1.759   -57.124 1.00 39.21  ? 328 VAL B HG11 1 
ATOM   9727  H HG12 . VAL B 1 328 ? -4.968  2.093   -58.557 1.00 39.21  ? 328 VAL B HG12 1 
ATOM   9728  H HG13 . VAL B 1 328 ? -6.523  2.276   -58.283 1.00 39.21  ? 328 VAL B HG13 1 
ATOM   9729  H HG21 . VAL B 1 328 ? -6.954  -0.237  -56.754 1.00 35.56  ? 328 VAL B HG21 1 
ATOM   9730  H HG22 . VAL B 1 328 ? -7.970  0.182   -57.901 1.00 35.56  ? 328 VAL B HG22 1 
ATOM   9731  H HG23 . VAL B 1 328 ? -7.260  -1.238  -57.950 1.00 35.56  ? 328 VAL B HG23 1 
ATOM   9732  N N    . CYS B 1 329 ? -4.098  0.288   -61.168 1.00 31.04  ? 329 CYS B N    1 
ATOM   9733  C CA   . CYS B 1 329 ? -2.992  0.983   -61.835 1.00 37.36  ? 329 CYS B CA   1 
ATOM   9734  C C    . CYS B 1 329 ? -3.239  1.155   -63.335 1.00 44.73  ? 329 CYS B C    1 
ATOM   9735  O O    . CYS B 1 329 ? -2.765  2.134   -63.930 1.00 43.60  ? 329 CYS B O    1 
ATOM   9736  C CB   . CYS B 1 329 ? -1.693  0.214   -61.605 1.00 38.93  ? 329 CYS B CB   1 
ATOM   9737  S SG   . CYS B 1 329 ? -1.071  0.402   -59.919 1.00 36.11  ? 329 CYS B SG   1 
ATOM   9738  H H    . CYS B 1 329 ? -3.964  -0.548  -61.016 1.00 37.20  ? 329 CYS B H    1 
ATOM   9739  H HA   . CYS B 1 329 ? -2.892  1.865   -61.444 1.00 44.79  ? 329 CYS B HA   1 
ATOM   9740  H HB2  . CYS B 1 329 ? -1.851  -0.730  -61.764 1.00 46.67  ? 329 CYS B HB2  1 
ATOM   9741  H HB3  . CYS B 1 329 ? -1.016  0.546   -62.215 1.00 46.67  ? 329 CYS B HB3  1 
ATOM   9742  H HG   . CYS B 1 329 ? -0.053  -0.223  -59.806 1.00 43.30  ? 329 CYS B HG   1 
ATOM   9743  N N    . TYR B 1 330 ? -3.995  0.234   -63.945 1.00 39.77  ? 330 TYR B N    1 
ATOM   9744  C CA   . TYR B 1 330 ? -4.132  0.163   -65.388 1.00 39.39  ? 330 TYR B CA   1 
ATOM   9745  C C    . TYR B 1 330 ? -5.556  0.201   -65.932 1.00 47.75  ? 330 TYR B C    1 
ATOM   9746  O O    . TYR B 1 330 ? -5.713  0.519   -67.110 1.00 47.34  ? 330 TYR B O    1 
ATOM   9747  C CB   . TYR B 1 330 ? -3.461  -1.120  -65.897 1.00 42.24  ? 330 TYR B CB   1 
ATOM   9748  C CG   . TYR B 1 330 ? -1.960  -1.046  -65.746 1.00 56.07  ? 330 TYR B CG   1 
ATOM   9749  C CD1  . TYR B 1 330 ? -1.188  -0.280  -66.623 1.00 43.84  ? 330 TYR B CD1  1 
ATOM   9750  C CD2  . TYR B 1 330 ? -1.313  -1.705  -64.702 1.00 50.44  ? 330 TYR B CD2  1 
ATOM   9751  C CE1  . TYR B 1 330 ? 0.183   -0.197  -66.471 1.00 49.67  ? 330 TYR B CE1  1 
ATOM   9752  C CE2  . TYR B 1 330 ? 0.055   -1.626  -64.545 1.00 43.13  ? 330 TYR B CE2  1 
ATOM   9753  C CZ   . TYR B 1 330 ? 0.801   -0.866  -65.424 1.00 50.66  ? 330 TYR B CZ   1 
ATOM   9754  O OH   . TYR B 1 330 ? 2.169   -0.786  -65.241 1.00 52.73  ? 330 TYR B OH   1 
ATOM   9755  H H    . TYR B 1 330 ? -4.444  -0.369  -63.528 1.00 47.68  ? 330 TYR B H    1 
ATOM   9756  H HA   . TYR B 1 330 ? -3.655  0.913   -65.776 1.00 47.23  ? 330 TYR B HA   1 
ATOM   9757  H HB2  . TYR B 1 330 ? -3.782  -1.876  -65.383 1.00 50.64  ? 330 TYR B HB2  1 
ATOM   9758  H HB3  . TYR B 1 330 ? -3.667  -1.239  -66.838 1.00 50.64  ? 330 TYR B HB3  1 
ATOM   9759  H HD1  . TYR B 1 330 ? -1.602  0.173   -67.322 1.00 52.56  ? 330 TYR B HD1  1 
ATOM   9760  H HD2  . TYR B 1 330 ? -1.813  -2.213  -64.104 1.00 60.48  ? 330 TYR B HD2  1 
ATOM   9761  H HE1  . TYR B 1 330 ? 0.687   0.316   -67.061 1.00 59.56  ? 330 TYR B HE1  1 
ATOM   9762  H HE2  . TYR B 1 330 ? 0.471   -2.072  -63.843 1.00 51.71  ? 330 TYR B HE2  1 
ATOM   9763  H HH   . TYR B 1 330 ? 2.396   -1.239  -64.572 1.00 63.23  ? 330 TYR B HH   1 
ATOM   9764  N N    . GLU B 1 331 ? -6.588  -0.167  -65.165 1.00 44.18  ? 331 GLU B N    1 
ATOM   9765  C CA   . GLU B 1 331 ? -7.937  -0.295  -65.729 1.00 41.27  ? 331 GLU B CA   1 
ATOM   9766  C C    . GLU B 1 331 ? -8.917  0.649   -65.061 1.00 29.64  ? 331 GLU B C    1 
ATOM   9767  O O    . GLU B 1 331 ? -10.126 0.427   -65.124 1.00 45.23  ? 331 GLU B O    1 
ATOM   9768  C CB   . GLU B 1 331 ? -8.470  -1.727  -65.642 1.00 40.08  ? 331 GLU B CB   1 
ATOM   9769  C CG   . GLU B 1 331 ? -7.762  -2.717  -66.543 1.00 40.47  ? 331 GLU B CG   1 
ATOM   9770  C CD   . GLU B 1 331 ? -8.499  -4.052  -66.668 1.00 49.90  ? 331 GLU B CD   1 
ATOM   9771  O OE1  . GLU B 1 331 ? -9.518  -4.255  -65.973 1.00 56.08  ? 331 GLU B OE1  1 
ATOM   9772  O OE2  . GLU B 1 331 ? -8.067  -4.909  -67.469 1.00 63.13  ? 331 GLU B OE2  1 
ATOM   9773  H H    . GLU B 1 331 ? -6.535  -0.346  -64.326 1.00 52.97  ? 331 GLU B H    1 
ATOM   9774  H HA   . GLU B 1 331 ? -7.899  -0.056  -66.668 1.00 49.49  ? 331 GLU B HA   1 
ATOM   9775  H HB2  . GLU B 1 331 ? -8.372  -2.039  -64.728 1.00 48.05  ? 331 GLU B HB2  1 
ATOM   9776  H HB3  . GLU B 1 331 ? -9.408  -1.724  -65.888 1.00 48.05  ? 331 GLU B HB3  1 
ATOM   9777  H HG2  . GLU B 1 331 ? -7.684  -2.334  -67.431 1.00 48.52  ? 331 GLU B HG2  1 
ATOM   9778  H HG3  . GLU B 1 331 ? -6.879  -2.895  -66.182 1.00 48.52  ? 331 GLU B HG3  1 
ATOM   9779  N N    . GLY B 1 332 ? -8.418  1.685   -64.401 1.00 29.37  ? 332 GLY B N    1 
ATOM   9780  C CA   . GLY B 1 332 ? -9.279  2.686   -63.814 1.00 37.80  ? 332 GLY B CA   1 
ATOM   9781  C C    . GLY B 1 332 ? -10.108 2.261   -62.615 1.00 43.56  ? 332 GLY B C    1 
ATOM   9782  O O    . GLY B 1 332 ? -10.939 3.051   -62.167 1.00 42.18  ? 332 GLY B O    1 
ATOM   9783  H H    . GLY B 1 332 ? -7.578  1.827   -64.281 1.00 35.21  ? 332 GLY B H    1 
ATOM   9784  H HA2  . GLY B 1 332 ? -8.732  3.439   -63.539 1.00 45.31  ? 332 GLY B HA2  1 
ATOM   9785  H HA3  . GLY B 1 332 ? -9.893  3.002   -64.496 1.00 45.31  ? 332 GLY B HA3  1 
ATOM   9786  N N    . GLN B 1 333 ? -9.933  1.061   -62.071 1.00 39.62  ? 333 GLN B N    1 
ATOM   9787  C CA   . GLN B 1 333 ? -10.693 0.641   -60.872 1.00 32.24  ? 333 GLN B CA   1 
ATOM   9788  C C    . GLN B 1 333 ? -10.393 1.655   -59.769 1.00 46.48  ? 333 GLN B C    1 
ATOM   9789  O O    . GLN B 1 333 ? -9.218  1.912   -59.526 1.00 44.76  ? 333 GLN B O    1 
ATOM   9790  C CB   . GLN B 1 333 ? -10.350 -0.773  -60.423 1.00 38.34  ? 333 GLN B CB   1 
ATOM   9791  C CG   . GLN B 1 333 ? -10.936 -1.121  -59.066 1.00 38.88  ? 333 GLN B CG   1 
ATOM   9792  C CD   . GLN B 1 333 ? -10.937 -2.591  -58.740 1.00 40.71  ? 333 GLN B CD   1 
ATOM   9793  O OE1  . GLN B 1 333 ? -10.096 -3.358  -59.157 1.00 51.85  ? 333 GLN B OE1  1 
ATOM   9794  N NE2  . GLN B 1 333 ? -11.913 -3.002  -57.965 1.00 64.06  ? 333 GLN B NE2  1 
ATOM   9795  H H    . GLN B 1 333 ? -9.350  0.440   -62.395 1.00 47.51  ? 333 GLN B H    1 
ATOM   9796  H HA   . GLN B 1 333 ? -11.654 0.682   -61.084 1.00 38.64  ? 333 GLN B HA   1 
ATOM   9797  H HB2  . GLN B 1 333 ? -10.687 -1.405  -61.092 1.00 45.97  ? 333 GLN B HB2  1 
ATOM   9798  H HB3  . GLN B 1 333 ? -9.375  -0.862  -60.386 1.00 45.97  ? 333 GLN B HB3  1 
ATOM   9799  H HG2  . GLN B 1 333 ? -10.429 -0.647  -58.374 1.00 46.62  ? 333 GLN B HG2  1 
ATOM   9800  H HG3  . GLN B 1 333 ? -11.860 -0.792  -59.029 1.00 46.62  ? 333 GLN B HG3  1 
ATOM   9801  H HE21 . GLN B 1 333 ? -12.533 -2.433  -57.695 1.00 76.83  ? 333 GLN B HE21 1 
ATOM   9802  H HE22 . GLN B 1 333 ? -11.950 -3.848  -57.712 1.00 76.83  ? 333 GLN B HE22 1 
ATOM   9803  N N    . PRO B 1 334 ? -11.397 2.241   -59.094 1.00 32.20  ? 334 PRO B N    1 
ATOM   9804  C CA   . PRO B 1 334 ? -11.144 3.249   -58.055 1.00 31.48  ? 334 PRO B CA   1 
ATOM   9805  C C    . PRO B 1 334 ? -10.305 2.670   -56.929 1.00 40.75  ? 334 PRO B C    1 
ATOM   9806  O O    . PRO B 1 334 ? -10.570 1.576   -56.422 1.00 40.11  ? 334 PRO B O    1 
ATOM   9807  C CB   . PRO B 1 334 ? -12.546 3.630   -57.569 1.00 39.39  ? 334 PRO B CB   1 
ATOM   9808  C CG   . PRO B 1 334 ? -13.464 3.226   -58.659 1.00 42.00  ? 334 PRO B CG   1 
ATOM   9809  C CD   . PRO B 1 334 ? -12.837 2.000   -59.278 1.00 39.60  ? 334 PRO B CD   1 
ATOM   9810  H HA   . PRO B 1 334 ? -10.703 4.027   -58.429 1.00 37.73  ? 334 PRO B HA   1 
ATOM   9811  H HB2  . PRO B 1 334 ? -12.751 3.147   -56.753 1.00 47.22  ? 334 PRO B HB2  1 
ATOM   9812  H HB3  . PRO B 1 334 ? -12.591 4.588   -57.421 1.00 47.22  ? 334 PRO B HB3  1 
ATOM   9813  H HG2  . PRO B 1 334 ? -14.336 3.015   -58.290 1.00 50.36  ? 334 PRO B HG2  1 
ATOM   9814  H HG3  . PRO B 1 334 ? -13.532 3.942   -59.310 1.00 50.36  ? 334 PRO B HG3  1 
ATOM   9815  H HD2  . PRO B 1 334 ? -13.111 1.200   -58.802 1.00 47.48  ? 334 PRO B HD2  1 
ATOM   9816  H HD3  . PRO B 1 334 ? -13.055 1.946   -60.222 1.00 47.48  ? 334 PRO B HD3  1 
ATOM   9817  N N    . VAL B 1 335 ? -9.268  3.403   -56.537 1.00 45.14  ? 335 VAL B N    1 
ATOM   9818  C CA   . VAL B 1 335 ? -8.402  2.828   -55.527 1.00 33.68  ? 335 VAL B CA   1 
ATOM   9819  C C    . VAL B 1 335 ? -9.190  2.544   -54.247 1.00 40.41  ? 335 VAL B C    1 
ATOM   9820  O O    . VAL B 1 335 ? -8.800  1.666   -53.477 1.00 35.55  ? 335 VAL B O    1 
ATOM   9821  C CB   . VAL B 1 335 ? -7.186  3.728   -55.273 1.00 37.11  ? 335 VAL B CB   1 
ATOM   9822  C CG1  . VAL B 1 335 ? -7.598  5.034   -54.634 1.00 44.67  ? 335 VAL B CG1  1 
ATOM   9823  C CG2  . VAL B 1 335 ? -6.167  2.979   -54.418 1.00 38.29  ? 335 VAL B CG2  1 
ATOM   9824  H H    . VAL B 1 335 ? -9.056  4.187   -56.822 1.00 54.13  ? 335 VAL B H    1 
ATOM   9825  H HA   . VAL B 1 335 ? -8.069  1.978   -55.856 1.00 40.37  ? 335 VAL B HA   1 
ATOM   9826  H HB   . VAL B 1 335 ? -6.766  3.933   -56.123 1.00 44.49  ? 335 VAL B HB   1 
ATOM   9827  H HG11 . VAL B 1 335 ? -6.808  5.577   -54.488 1.00 53.57  ? 335 VAL B HG11 1 
ATOM   9828  H HG12 . VAL B 1 335 ? -8.212  5.495   -55.226 1.00 53.57  ? 335 VAL B HG12 1 
ATOM   9829  H HG13 . VAL B 1 335 ? -8.032  4.847   -53.787 1.00 53.57  ? 335 VAL B HG13 1 
ATOM   9830  H HG21 . VAL B 1 335 ? -5.402  3.554   -54.262 1.00 45.91  ? 335 VAL B HG21 1 
ATOM   9831  H HG22 . VAL B 1 335 ? -6.580  2.740   -53.573 1.00 45.91  ? 335 VAL B HG22 1 
ATOM   9832  H HG23 . VAL B 1 335 ? -5.889  2.178   -54.888 1.00 45.91  ? 335 VAL B HG23 1 
ATOM   9833  N N    . GLY B 1 336 ? -10.331 3.217   -54.032 1.00 33.00  ? 336 GLY B N    1 
ATOM   9834  C CA   . GLY B 1 336 ? -11.115 3.026   -52.812 1.00 40.78  ? 336 GLY B CA   1 
ATOM   9835  C C    . GLY B 1 336 ? -11.791 1.664   -52.692 1.00 31.66  ? 336 GLY B C    1 
ATOM   9836  O O    . GLY B 1 336 ? -12.313 1.344   -51.617 1.00 37.25  ? 336 GLY B O    1 
ATOM   9837  H H    . GLY B 1 336 ? -10.669 3.788   -54.579 1.00 39.56  ? 336 GLY B H    1 
ATOM   9838  H HA2  . GLY B 1 336 ? -10.534 3.140   -52.044 1.00 48.89  ? 336 GLY B HA2  1 
ATOM   9839  H HA3  . GLY B 1 336 ? -11.804 3.707   -52.771 1.00 48.89  ? 336 GLY B HA3  1 
ATOM   9840  N N    . GLU B 1 337 ? -11.783 0.869   -53.761 1.00 27.63  ? 337 GLU B N    1 
ATOM   9841  C CA   . GLU B 1 337 ? -12.300 -0.492  -53.787 1.00 34.84  ? 337 GLU B CA   1 
ATOM   9842  C C    . GLU B 1 337 ? -11.279 -1.538  -53.357 1.00 37.78  ? 337 GLU B C    1 
ATOM   9843  O O    . GLU B 1 337 ? -11.643 -2.705  -53.151 1.00 33.53  ? 337 GLU B O    1 
ATOM   9844  C CB   . GLU B 1 337 ? -12.771 -0.833  -55.211 1.00 40.26  ? 337 GLU B CB   1 
ATOM   9845  C CG   . GLU B 1 337 ? -13.928 0.027   -55.732 1.00 44.52  ? 337 GLU B CG   1 
ATOM   9846  C CD   . GLU B 1 337 ? -15.104 0.024   -54.786 1.00 46.46  ? 337 GLU B CD   1 
ATOM   9847  O OE1  . GLU B 1 337 ? -15.497 -1.073  -54.343 1.00 39.72  ? 337 GLU B OE1  1 
ATOM   9848  O OE2  . GLU B 1 337 ? -15.600 1.115   -54.450 1.00 51.65  ? 337 GLU B OE2  1 
ATOM   9849  H H    . GLU B 1 337 ? -11.464 1.115   -54.521 1.00 33.12  ? 337 GLU B H    1 
ATOM   9850  H HA   . GLU B 1 337 ? -13.064 -0.554  -53.193 1.00 41.76  ? 337 GLU B HA   1 
ATOM   9851  H HB2  . GLU B 1 337 ? -12.024 -0.719  -55.819 1.00 48.27  ? 337 GLU B HB2  1 
ATOM   9852  H HB3  . GLU B 1 337 ? -13.064 -1.758  -55.226 1.00 48.27  ? 337 GLU B HB3  1 
ATOM   9853  H HG2  . GLU B 1 337 ? -13.624 0.943   -55.833 1.00 53.38  ? 337 GLU B HG2  1 
ATOM   9854  H HG3  . GLU B 1 337 ? -14.226 -0.322  -56.587 1.00 53.38  ? 337 GLU B HG3  1 
ATOM   9855  N N    . PHE B 1 338 ? -10.012 -1.149  -53.224 1.00 33.22  ? 338 PHE B N    1 
ATOM   9856  C CA   . PHE B 1 338 ? -8.940  -2.108  -52.971 1.00 36.15  ? 338 PHE B CA   1 
ATOM   9857  C C    . PHE B 1 338 ? -9.256  -3.033  -51.783 1.00 30.99  ? 338 PHE B C    1 
ATOM   9858  O O    . PHE B 1 338 ? -9.105  -4.257  -51.869 1.00 30.58  ? 338 PHE B O    1 
ATOM   9859  C CB   . PHE B 1 338 ? -7.641  -1.328  -52.726 1.00 36.10  ? 338 PHE B CB   1 
ATOM   9860  C CG   . PHE B 1 338 ? -6.490  -2.202  -52.409 1.00 25.71  ? 338 PHE B CG   1 
ATOM   9861  C CD1  . PHE B 1 338 ? -5.948  -3.015  -53.374 1.00 32.99  ? 338 PHE B CD1  1 
ATOM   9862  C CD2  . PHE B 1 338 ? -5.957  -2.210  -51.132 1.00 29.65  ? 338 PHE B CD2  1 
ATOM   9863  C CE1  . PHE B 1 338 ? -4.886  -3.855  -53.072 1.00 42.94  ? 338 PHE B CE1  1 
ATOM   9864  C CE2  . PHE B 1 338 ? -4.913  -3.032  -50.816 1.00 39.15  ? 338 PHE B CE2  1 
ATOM   9865  C CZ   . PHE B 1 338 ? -4.367  -3.856  -51.785 1.00 37.97  ? 338 PHE B CZ   1 
ATOM   9866  H H    . PHE B 1 338 ? -9.747  -0.333  -53.276 1.00 39.82  ? 338 PHE B H    1 
ATOM   9867  H HA   . PHE B 1 338 ? -8.816  -2.661  -53.758 1.00 43.33  ? 338 PHE B HA   1 
ATOM   9868  H HB2  . PHE B 1 338 ? -7.422  -0.823  -53.525 1.00 43.28  ? 338 PHE B HB2  1 
ATOM   9869  H HB3  . PHE B 1 338 ? -7.773  -0.725  -51.978 1.00 43.28  ? 338 PHE B HB3  1 
ATOM   9870  H HD1  . PHE B 1 338 ? -6.307  -3.016  -54.232 1.00 39.55  ? 338 PHE B HD1  1 
ATOM   9871  H HD2  . PHE B 1 338 ? -6.328  -1.664  -50.476 1.00 35.53  ? 338 PHE B HD2  1 
ATOM   9872  H HE1  . PHE B 1 338 ? -4.519  -4.405  -53.727 1.00 51.48  ? 338 PHE B HE1  1 
ATOM   9873  H HE2  . PHE B 1 338 ? -4.561  -3.029  -49.955 1.00 46.93  ? 338 PHE B HE2  1 
ATOM   9874  H HZ   . PHE B 1 338 ? -3.647  -4.407  -51.575 1.00 45.52  ? 338 PHE B HZ   1 
ATOM   9875  N N    . ILE B 1 339 ? -9.689  -2.460  -50.665 1.00 29.60  ? 339 ILE B N    1 
ATOM   9876  C CA   . ILE B 1 339 ? -10.018 -3.277  -49.498 1.00 30.98  ? 339 ILE B CA   1 
ATOM   9877  C C    . ILE B 1 339 ? -11.192 -4.203  -49.797 1.00 37.40  ? 339 ILE B C    1 
ATOM   9878  O O    . ILE B 1 339 ? -11.149 -5.393  -49.466 1.00 32.57  ? 339 ILE B O    1 
ATOM   9879  C CB   . ILE B 1 339 ? -10.289 -2.359  -48.298 1.00 33.63  ? 339 ILE B CB   1 
ATOM   9880  C CG1  . ILE B 1 339 ? -9.021  -1.575  -47.956 1.00 41.00  ? 339 ILE B CG1  1 
ATOM   9881  C CG2  . ILE B 1 339 ? -10.814 -3.151  -47.117 1.00 41.97  ? 339 ILE B CG2  1 
ATOM   9882  C CD1  . ILE B 1 339 ? -7.827  -2.464  -47.573 1.00 46.06  ? 339 ILE B CD1  1 
ATOM   9883  H H    . ILE B 1 339 ? -9.800  -1.614  -50.555 1.00 35.48  ? 339 ILE B H    1 
ATOM   9884  H HA   . ILE B 1 339 ? -9.253  -3.832  -49.279 1.00 37.14  ? 339 ILE B HA   1 
ATOM   9885  H HB   . ILE B 1 339 ? -10.973 -1.722  -48.558 1.00 40.32  ? 339 ILE B HB   1 
ATOM   9886  H HG12 . ILE B 1 339 ? -8.762  -1.047  -48.727 1.00 49.16  ? 339 ILE B HG12 1 
ATOM   9887  H HG13 . ILE B 1 339 ? -9.208  -0.991  -47.205 1.00 49.16  ? 339 ILE B HG13 1 
ATOM   9888  H HG21 . ILE B 1 339 ? -10.975 -2.545  -46.377 1.00 50.32  ? 339 ILE B HG21 1 
ATOM   9889  H HG22 . ILE B 1 339 ? -11.641 -3.589  -47.373 1.00 50.32  ? 339 ILE B HG22 1 
ATOM   9890  H HG23 . ILE B 1 339 ? -10.153 -3.815  -46.864 1.00 50.32  ? 339 ILE B HG23 1 
ATOM   9891  H HD11 . ILE B 1 339 ? -7.065  -1.899  -47.370 1.00 55.23  ? 339 ILE B HD11 1 
ATOM   9892  H HD12 . ILE B 1 339 ? -8.064  -2.992  -46.794 1.00 55.23  ? 339 ILE B HD12 1 
ATOM   9893  H HD13 . ILE B 1 339 ? -7.617  -3.049  -48.318 1.00 55.23  ? 339 ILE B HD13 1 
ATOM   9894  N N    . HIS B 1 340 ? -12.250 -3.685  -50.439 1.00 31.18  ? 340 HIS B N    1 
ATOM   9895  C CA   . HIS B 1 340 ? -13.370 -4.552  -50.834 1.00 37.54  ? 340 HIS B CA   1 
ATOM   9896  C C    . HIS B 1 340 ? -12.881 -5.805  -51.546 1.00 36.46  ? 340 HIS B C    1 
ATOM   9897  O O    . HIS B 1 340 ? -13.407 -6.903  -51.328 1.00 36.11  ? 340 HIS B O    1 
ATOM   9898  C CB   . HIS B 1 340 ? -14.349 -3.793  -51.726 1.00 36.47  ? 340 HIS B CB   1 
ATOM   9899  C CG   . HIS B 1 340 ? -15.001 -2.641  -51.036 1.00 37.53  ? 340 HIS B CG   1 
ATOM   9900  N ND1  . HIS B 1 340 ? -15.426 -1.516  -51.705 1.00 30.43  ? 340 HIS B ND1  1 
ATOM   9901  C CD2  . HIS B 1 340 ? -15.280 -2.431  -49.724 1.00 40.57  ? 340 HIS B CD2  1 
ATOM   9902  C CE1  . HIS B 1 340 ? -15.939 -0.659  -50.833 1.00 41.85  ? 340 HIS B CE1  1 
ATOM   9903  N NE2  . HIS B 1 340 ? -15.861 -1.190  -49.625 1.00 28.51  ? 340 HIS B NE2  1 
ATOM   9904  H H    . HIS B 1 340 ? -12.343 -2.857  -50.653 1.00 37.38  ? 340 HIS B H    1 
ATOM   9905  H HA   . HIS B 1 340 ? -13.847 -4.830  -50.037 1.00 45.00  ? 340 HIS B HA   1 
ATOM   9906  H HB2  . HIS B 1 340 ? -13.871 -3.449  -52.496 1.00 43.72  ? 340 HIS B HB2  1 
ATOM   9907  H HB3  . HIS B 1 340 ? -15.047 -4.402  -52.015 1.00 43.72  ? 340 HIS B HB3  1 
ATOM   9908  H HD1  . HIS B 1 340 ? -15.361 -1.386  -52.553 1.00 36.47  ? 340 HIS B HD1  1 
ATOM   9909  H HD2  . HIS B 1 340 ? -15.104 -3.015  -49.022 1.00 48.65  ? 340 HIS B HD2  1 
ATOM   9910  H HE1  . HIS B 1 340 ? -16.300 0.173   -51.037 1.00 50.18  ? 340 HIS B HE1  1 
ATOM   9911  N N    . CYS B 1 341 ? -11.846 -5.664  -52.372 1.00 29.97  ? 341 CYS B N    1 
ATOM   9912  C CA   . CYS B 1 341 ? -11.314 -6.788  -53.134 1.00 32.39  ? 341 CYS B CA   1 
ATOM   9913  C C    . CYS B 1 341 ? -10.711 -7.878  -52.261 1.00 30.67  ? 341 CYS B C    1 
ATOM   9914  O O    . CYS B 1 341 ? -10.425 -8.963  -52.779 1.00 33.75  ? 341 CYS B O    1 
ATOM   9915  C CB   . CYS B 1 341 ? -10.243 -6.296  -54.132 1.00 43.71  ? 341 CYS B CB   1 
ATOM   9916  S SG   . CYS B 1 341 ? -10.882 -5.349  -55.557 1.00 44.36  ? 341 CYS B SG   1 
ATOM   9917  H H    . CYS B 1 341 ? -11.433 -4.923  -52.508 1.00 35.93  ? 341 CYS B H    1 
ATOM   9918  H HA   . CYS B 1 341 ? -12.035 -7.186  -53.646 1.00 38.83  ? 341 CYS B HA   1 
ATOM   9919  H HB2  . CYS B 1 341 ? -9.620  -5.723  -53.657 1.00 52.41  ? 341 CYS B HB2  1 
ATOM   9920  H HB3  . CYS B 1 341 ? -9.771  -7.067  -54.482 1.00 52.41  ? 341 CYS B HB3  1 
ATOM   9921  H HG   . CYS B 1 341 ? -11.454 -4.374  -55.154 1.00 53.19  ? 341 CYS B HG   1 
ATOM   9922  N N    . LEU B 1 342 ? -10.468 -7.605  -50.975 1.00 30.81  ? 342 LEU B N    1 
ATOM   9923  C CA   . LEU B 1 342 ? -9.910  -8.592  -50.047 1.00 38.48  ? 342 LEU B CA   1 
ATOM   9924  C C    . LEU B 1 342 ? -10.947 -9.197  -49.099 1.00 35.01  ? 342 LEU B C    1 
ATOM   9925  O O    . LEU B 1 342 ? -10.589 -10.035 -48.262 1.00 34.00  ? 342 LEU B O    1 
ATOM   9926  C CB   . LEU B 1 342 ? -8.797  -7.945  -49.211 1.00 31.09  ? 342 LEU B CB   1 
ATOM   9927  C CG   . LEU B 1 342 ? -7.725  -7.221  -50.030 1.00 38.32  ? 342 LEU B CG   1 
ATOM   9928  C CD1  . LEU B 1 342 ? -6.621  -6.704  -49.126 1.00 37.01  ? 342 LEU B CD1  1 
ATOM   9929  C CD2  . LEU B 1 342 ? -7.170  -8.176  -51.022 1.00 30.84  ? 342 LEU B CD2  1 
ATOM   9930  H H    . LEU B 1 342 ? -10.620 -6.840  -50.612 1.00 36.93  ? 342 LEU B H    1 
ATOM   9931  H HA   . LEU B 1 342 ? -9.517  -9.315  -50.559 1.00 46.14  ? 342 LEU B HA   1 
ATOM   9932  H HB2  . LEU B 1 342 ? -9.197  -7.296  -48.611 1.00 37.27  ? 342 LEU B HB2  1 
ATOM   9933  H HB3  . LEU B 1 342 ? -8.355  -8.637  -48.695 1.00 37.27  ? 342 LEU B HB3  1 
ATOM   9934  H HG   . LEU B 1 342 ? -8.121  -6.471  -50.502 1.00 45.94  ? 342 LEU B HG   1 
ATOM   9935  H HD11 . LEU B 1 342 ? -5.956  -6.250  -49.668 1.00 44.37  ? 342 LEU B HD11 1 
ATOM   9936  H HD12 . LEU B 1 342 ? -7.002  -6.085  -48.483 1.00 44.37  ? 342 LEU B HD12 1 
ATOM   9937  H HD13 . LEU B 1 342 ? -6.215  -7.454  -48.663 1.00 44.37  ? 342 LEU B HD13 1 
ATOM   9938  H HD21 . LEU B 1 342 ? -6.489  -7.726  -51.547 1.00 36.97  ? 342 LEU B HD21 1 
ATOM   9939  H HD22 . LEU B 1 342 ? -6.781  -8.929  -50.551 1.00 36.97  ? 342 LEU B HD22 1 
ATOM   9940  H HD23 . LEU B 1 342 ? -7.886  -8.481  -51.601 1.00 36.97  ? 342 LEU B HD23 1 
ATOM   9941  N N    . GLN B 1 343 ? -12.205 -8.778  -49.192 1.00 35.14  ? 343 GLN B N    1 
ATOM   9942  C CA   . GLN B 1 343 ? -13.261 -9.232  -48.293 1.00 31.68  ? 343 GLN B CA   1 
ATOM   9943  C C    . GLN B 1 343 ? -13.780 -10.628 -48.617 1.00 34.44  ? 343 GLN B C    1 
ATOM   9944  O O    . GLN B 1 343 ? -14.589 -11.151 -47.850 1.00 26.92  ? 343 GLN B O    1 
ATOM   9945  C CB   . GLN B 1 343 ? -14.414 -8.230  -48.314 1.00 34.92  ? 343 GLN B CB   1 
ATOM   9946  C CG   . GLN B 1 343 ? -14.066 -6.944  -47.593 1.00 37.85  ? 343 GLN B CG   1 
ATOM   9947  C CD   . GLN B 1 343 ? -15.171 -5.886  -47.598 1.00 31.62  ? 343 GLN B CD   1 
ATOM   9948  O OE1  . GLN B 1 343 ? -15.924 -5.744  -48.560 1.00 36.08  ? 343 GLN B OE1  1 
ATOM   9949  N NE2  . GLN B 1 343 ? -15.227 -5.104  -46.536 1.00 38.48  ? 343 GLN B NE2  1 
ATOM   9950  H H    . GLN B 1 343 ? -12.478 -8.216  -49.783 1.00 42.13  ? 343 GLN B H    1 
ATOM   9951  H HA   . GLN B 1 343 ? -12.909 -9.254  -47.389 1.00 37.98  ? 343 GLN B HA   1 
ATOM   9952  H HB2  . GLN B 1 343 ? -14.630 -8.012  -49.234 1.00 41.86  ? 343 GLN B HB2  1 
ATOM   9953  H HB3  . GLN B 1 343 ? -15.185 -8.623  -47.875 1.00 41.86  ? 343 GLN B HB3  1 
ATOM   9954  H HG2  . GLN B 1 343 ? -13.865 -7.153  -46.667 1.00 45.38  ? 343 GLN B HG2  1 
ATOM   9955  H HG3  . GLN B 1 343 ? -13.285 -6.554  -48.016 1.00 45.38  ? 343 GLN B HG3  1 
ATOM   9956  H HE21 . GLN B 1 343 ? -14.679 -5.225  -45.884 1.00 46.14  ? 343 GLN B HE21 1 
ATOM   9957  H HE22 . GLN B 1 343 ? -15.826 -4.489  -46.486 1.00 46.14  ? 343 GLN B HE22 1 
ATOM   9958  N N    . ASN B 1 344 ? -13.338 -11.249 -49.706 1.00 37.30  ? 344 ASN B N    1 
ATOM   9959  C CA   . ASN B 1 344 ? -13.753 -12.605 -50.035 1.00 30.70  ? 344 ASN B CA   1 
ATOM   9960  C C    . ASN B 1 344 ? -12.555 -13.368 -50.578 1.00 31.75  ? 344 ASN B C    1 
ATOM   9961  O O    . ASN B 1 344 ? -12.624 -14.053 -51.601 1.00 34.86  ? 344 ASN B O    1 
ATOM   9962  C CB   . ASN B 1 344 ? -14.948 -12.581 -51.007 1.00 35.62  ? 344 ASN B CB   1 
ATOM   9963  C CG   . ASN B 1 344 ? -16.233 -11.926 -50.369 1.00 37.34  ? 344 ASN B CG   1 
ATOM   9964  O OD1  . ASN B 1 344 ? -16.988 -12.562 -49.615 1.00 43.04  ? 344 ASN B OD1  1 
ATOM   9965  N ND2  . ASN B 1 344 ? -16.469 -10.657 -50.683 1.00 43.74  ? 344 ASN B ND2  1 
ATOM   9966  H H    . ASN B 1 344 ? -12.792 -10.902 -50.273 1.00 44.72  ? 344 ASN B H    1 
ATOM   9967  H HA   . ASN B 1 344 ? -14.043 -13.048 -49.223 1.00 36.80  ? 344 ASN B HA   1 
ATOM   9968  H HB2  . ASN B 1 344 ? -14.708 -12.066 -51.793 1.00 42.70  ? 344 ASN B HB2  1 
ATOM   9969  H HB3  . ASN B 1 344 ? -15.169 -13.491 -51.260 1.00 42.70  ? 344 ASN B HB3  1 
ATOM   9970  H HD21 . ASN B 1 344 ? -15.933 -10.236 -51.207 1.00 52.45  ? 344 ASN B HD21 1 
ATOM   9971  H HD22 . ASN B 1 344 ? -17.158 -10.255 -50.360 1.00 52.45  ? 344 ASN B HD22 1 
ATOM   9972  N N    . HIS B 1 345 ? -11.426 -13.266 -49.852 1.00 27.69  ? 345 HIS B N    1 
ATOM   9973  C CA   . HIS B 1 345 ? -10.157 -13.789 -50.324 1.00 24.27  ? 345 HIS B CA   1 
ATOM   9974  C C    . HIS B 1 345 ? -10.121 -15.310 -50.254 1.00 25.00  ? 345 HIS B C    1 
ATOM   9975  O O    . HIS B 1 345 ? -10.716 -15.916 -49.367 1.00 40.09  ? 345 HIS B O    1 
ATOM   9976  C CB   . HIS B 1 345 ? -9.001  -13.218 -49.481 1.00 30.51  ? 345 HIS B CB   1 
ATOM   9977  C CG   . HIS B 1 345 ? -7.656  -13.423 -50.102 1.00 27.40  ? 345 HIS B CG   1 
ATOM   9978  N ND1  . HIS B 1 345 ? -6.967  -14.609 -50.011 1.00 28.32  ? 345 HIS B ND1  1 
ATOM   9979  C CD2  . HIS B 1 345 ? -6.871  -12.590 -50.820 1.00 26.09  ? 345 HIS B CD2  1 
ATOM   9980  C CE1  . HIS B 1 345 ? -5.817  -14.508 -50.658 1.00 34.36  ? 345 HIS B CE1  1 
ATOM   9981  N NE2  . HIS B 1 345 ? -5.741  -13.295 -51.170 1.00 31.21  ? 345 HIS B NE2  1 
ATOM   9982  H H    . HIS B 1 345 ? -11.382 -12.893 -49.079 1.00 33.19  ? 345 HIS B H    1 
ATOM   9983  H HA   . HIS B 1 345 ? -10.023 -13.522 -51.247 1.00 29.09  ? 345 HIS B HA   1 
ATOM   9984  H HB2  . HIS B 1 345 ? -9.136  -12.264 -49.370 1.00 36.57  ? 345 HIS B HB2  1 
ATOM   9985  H HB3  . HIS B 1 345 ? -8.999  -13.654 -48.615 1.00 36.57  ? 345 HIS B HB3  1 
ATOM   9986  H HD2  . HIS B 1 345 ? -7.071  -11.713 -51.058 1.00 31.26  ? 345 HIS B HD2  1 
ATOM   9987  H HE1  . HIS B 1 345 ? -5.177  -15.177 -50.742 1.00 41.19  ? 345 HIS B HE1  1 
ATOM   9988  H HE2  . HIS B 1 345 ? -5.080  -12.985 -51.625 1.00 37.41  ? 345 HIS B HE2  1 
ATOM   9989  N N    . PRO B 1 346 ? -9.390  -15.954 -51.157 1.00 32.59  ? 346 PRO B N    1 
ATOM   9990  C CA   . PRO B 1 346 ? -9.259  -17.416 -51.074 1.00 31.97  ? 346 PRO B CA   1 
ATOM   9991  C C    . PRO B 1 346 ? -8.720  -17.940 -49.747 1.00 31.69  ? 346 PRO B C    1 
ATOM   9992  O O    . PRO B 1 346 ? -9.101  -19.042 -49.346 1.00 37.08  ? 346 PRO B O    1 
ATOM   9993  C CB   . PRO B 1 346 ? -8.295  -17.740 -52.221 1.00 28.19  ? 346 PRO B CB   1 
ATOM   9994  C CG   . PRO B 1 346 ? -8.536  -16.707 -53.229 1.00 28.52  ? 346 PRO B CG   1 
ATOM   9995  C CD   . PRO B 1 346 ? -8.939  -15.434 -52.453 1.00 30.25  ? 346 PRO B CD   1 
ATOM   9996  H HA   . PRO B 1 346 ? -10.115 -17.835 -51.254 1.00 38.32  ? 346 PRO B HA   1 
ATOM   9997  H HB2  . PRO B 1 346 ? -7.380  -17.700 -51.900 1.00 33.79  ? 346 PRO B HB2  1 
ATOM   9998  H HB3  . PRO B 1 346 ? -8.495  -18.620 -52.577 1.00 33.79  ? 346 PRO B HB3  1 
ATOM   9999  H HG2  . PRO B 1 346 ? -7.724  -16.553 -53.736 1.00 34.18  ? 346 PRO B HG2  1 
ATOM   10000 H HG3  . PRO B 1 346 ? -9.255  -16.989 -53.816 1.00 34.18  ? 346 PRO B HG3  1 
ATOM   10001 H HD2  . PRO B 1 346 ? -8.172  -14.852 -52.336 1.00 36.26  ? 346 PRO B HD2  1 
ATOM   10002 H HD3  . PRO B 1 346 ? -9.666  -14.978 -52.906 1.00 36.26  ? 346 PRO B HD3  1 
ATOM   10003 N N    . GLU B 1 347 ? -7.810  -17.232 -49.074 1.00 27.08  ? 347 GLU B N    1 
ATOM   10004 C CA   . GLU B 1 347 ? -7.276  -17.718 -47.790 1.00 25.24  ? 347 GLU B CA   1 
ATOM   10005 C C    . GLU B 1 347 ? -8.365  -17.964 -46.749 1.00 29.59  ? 347 GLU B C    1 
ATOM   10006 O O    . GLU B 1 347 ? -8.169  -18.761 -45.824 1.00 33.02  ? 347 GLU B O    1 
ATOM   10007 C CB   . GLU B 1 347 ? -6.271  -16.712 -47.215 1.00 35.91  ? 347 GLU B CB   1 
ATOM   10008 C CG   . GLU B 1 347 ? -4.967  -16.662 -47.928 1.00 37.84  ? 347 GLU B CG   1 
ATOM   10009 C CD   . GLU B 1 347 ? -4.236  -17.958 -47.810 1.00 40.34  ? 347 GLU B CD   1 
ATOM   10010 O OE1  . GLU B 1 347 ? -4.141  -18.464 -46.667 1.00 35.63  ? 347 GLU B OE1  1 
ATOM   10011 O OE2  . GLU B 1 347 ? -3.774  -18.468 -48.850 1.00 45.20  ? 347 GLU B OE2  1 
ATOM   10012 H H    . GLU B 1 347 ? -7.487  -16.477 -49.332 1.00 32.46  ? 347 GLU B H    1 
ATOM   10013 H HA   . GLU B 1 347 ? -6.810  -18.556 -47.939 1.00 30.25  ? 347 GLU B HA   1 
ATOM   10014 H HB2  . GLU B 1 347 ? -6.663  -15.825 -47.256 1.00 43.05  ? 347 GLU B HB2  1 
ATOM   10015 H HB3  . GLU B 1 347 ? -6.092  -16.946 -46.291 1.00 43.05  ? 347 GLU B HB3  1 
ATOM   10016 H HG2  . GLU B 1 347 ? -5.122  -16.485 -48.869 1.00 45.37  ? 347 GLU B HG2  1 
ATOM   10017 H HG3  . GLU B 1 347 ? -4.415  -15.965 -47.540 1.00 45.37  ? 347 GLU B HG3  1 
ATOM   10018 N N    . HIS B 1 348 ? -9.496  -17.277 -46.863 1.00 28.24  ? 348 HIS B N    1 
ATOM   10019 C CA   . HIS B 1 348 ? -10.548 -17.309 -45.862 1.00 29.72  ? 348 HIS B CA   1 
ATOM   10020 C C    . HIS B 1 348 ? -11.738 -18.161 -46.279 1.00 32.95  ? 348 HIS B C    1 
ATOM   10021 O O    . HIS B 1 348 ? -12.760 -18.151 -45.577 1.00 24.85  ? 348 HIS B O    1 
ATOM   10022 C CB   . HIS B 1 348 ? -11.005 -15.873 -45.569 1.00 29.16  ? 348 HIS B CB   1 
ATOM   10023 C CG   . HIS B 1 348 ? -9.892  -14.991 -45.111 1.00 32.98  ? 348 HIS B CG   1 
ATOM   10024 N ND1  . HIS B 1 348 ? -9.609  -13.781 -45.692 1.00 30.99  ? 348 HIS B ND1  1 
ATOM   10025 C CD2  . HIS B 1 348 ? -8.978  -15.160 -44.134 1.00 29.70  ? 348 HIS B CD2  1 
ATOM   10026 C CE1  . HIS B 1 348 ? -8.554  -13.247 -45.102 1.00 31.12  ? 348 HIS B CE1  1 
ATOM   10027 N NE2  . HIS B 1 348 ? -8.168  -14.054 -44.140 1.00 31.75  ? 348 HIS B NE2  1 
ATOM   10028 H H    . HIS B 1 348 ? -9.679  -16.771 -47.533 1.00 33.85  ? 348 HIS B H    1 
ATOM   10029 H HA   . HIS B 1 348 ? -10.189 -17.681 -45.041 1.00 35.62  ? 348 HIS B HA   1 
ATOM   10030 H HB2  . HIS B 1 348 ? -11.378 -15.490 -46.378 1.00 34.95  ? 348 HIS B HB2  1 
ATOM   10031 H HB3  . HIS B 1 348 ? -11.678 -15.893 -44.870 1.00 34.95  ? 348 HIS B HB3  1 
ATOM   10032 H HD2  . HIS B 1 348 ? -8.914  -15.888 -43.558 1.00 35.60  ? 348 HIS B HD2  1 
ATOM   10033 H HE1  . HIS B 1 348 ? -8.174  -12.424 -45.307 1.00 37.30  ? 348 HIS B HE1  1 
ATOM   10034 H HE2  . HIS B 1 348 ? -7.504  -13.918 -43.610 1.00 38.06  ? 348 HIS B HE2  1 
ATOM   10035 N N    . MET B 1 349 ? -11.642 -18.849 -47.424 1.00 28.95  ? 349 MET B N    1 
ATOM   10036 C CA   . MET B 1 349 ? -12.668 -19.771 -47.906 1.00 38.97  ? 349 MET B CA   1 
ATOM   10037 C C    . MET B 1 349 ? -12.573 -21.109 -47.218 1.00 40.40  ? 349 MET B C    1 
ATOM   10038 O O    . MET B 1 349 ? -11.508 -21.568 -46.802 1.00 47.17  ? 349 MET B O    1 
ATOM   10039 C CB   . MET B 1 349 ? -12.557 -20.012 -49.406 1.00 31.73  ? 349 MET B CB   1 
ATOM   10040 C CG   . MET B 1 349 ? -12.880 -18.840 -50.255 1.00 34.62  ? 349 MET B CG   1 
ATOM   10041 S SD   . MET B 1 349 ? -12.468 -19.107 -52.021 1.00 51.92  ? 349 MET B SD   1 
ATOM   10042 C CE   . MET B 1 349 ? -12.941 -17.508 -52.640 1.00 38.15  ? 349 MET B CE   1 
ATOM   10043 O OXT  . MET B 1 349 ? -13.609 -21.754 -47.125 1.00 62.54  ? 349 MET B OXT  1 
ATOM   10044 H H    . MET B 1 349 ? -10.966 -18.793 -47.953 1.00 34.70  ? 349 MET B H    1 
ATOM   10045 H HA   . MET B 1 349 ? -13.542 -19.388 -47.730 1.00 46.73  ? 349 MET B HA   1 
ATOM   10046 H HB2  . MET B 1 349 ? -11.646 -20.278 -49.608 1.00 38.03  ? 349 MET B HB2  1 
ATOM   10047 H HB3  . MET B 1 349 ? -13.166 -20.727 -49.649 1.00 38.03  ? 349 MET B HB3  1 
ATOM   10048 H HG2  . MET B 1 349 ? -13.831 -18.658 -50.193 1.00 41.50  ? 349 MET B HG2  1 
ATOM   10049 H HG3  . MET B 1 349 ? -12.374 -18.074 -49.942 1.00 41.50  ? 349 MET B HG3  1 
ATOM   10050 H HE1  . MET B 1 349 ? -12.781 -17.481 -53.596 1.00 45.74  ? 349 MET B HE1  1 
ATOM   10051 H HE2  . MET B 1 349 ? -13.883 -17.366 -52.457 1.00 45.74  ? 349 MET B HE2  1 
ATOM   10052 H HE3  . MET B 1 349 ? -12.410 -16.829 -52.195 1.00 45.74  ? 349 MET B HE3  1 
HETATM 10053 P PA   . NAD C 2 .   ? -10.734 -4.976  -20.256 1.00 43.91  ? 401 NAD A PA   1 
HETATM 10054 O O1A  . NAD C 2 .   ? -9.769  -4.456  -19.247 1.00 40.81  ? 401 NAD A O1A  1 
HETATM 10055 O O2A  . NAD C 2 .   ? -11.431 -3.921  -21.064 1.00 42.03  ? 401 NAD A O2A  1 
HETATM 10056 O O5B  . NAD C 2 .   ? -11.831 -6.005  -19.616 1.00 40.85  ? 401 NAD A O5B  1 
HETATM 10057 C C5B  . NAD C 2 .   ? -12.746 -5.506  -18.710 1.00 46.98  ? 401 NAD A C5B  1 
HETATM 10058 C C4B  . NAD C 2 .   ? -13.359 -6.788  -18.106 1.00 45.63  ? 401 NAD A C4B  1 
HETATM 10059 O O4B  . NAD C 2 .   ? -12.491 -7.264  -17.281 1.00 49.09  ? 401 NAD A O4B  1 
HETATM 10060 C C3B  . NAD C 2 .   ? -14.606 -6.480  -17.274 1.00 48.94  ? 401 NAD A C3B  1 
HETATM 10061 O O3B  . NAD C 2 .   ? -15.703 -6.340  -18.070 1.00 39.78  ? 401 NAD A O3B  1 
HETATM 10062 C C2B  . NAD C 2 .   ? -14.624 -7.763  -16.431 1.00 51.29  ? 401 NAD A C2B  1 
HETATM 10063 O O2B  . NAD C 2 .   ? -15.164 -8.891  -17.301 1.00 42.83  ? 401 NAD A O2B  1 
HETATM 10064 C C1B  . NAD C 2 .   ? -13.391 -8.015  -16.149 1.00 54.52  ? 401 NAD A C1B  1 
HETATM 10065 N N9A  . NAD C 2 .   ? -13.093 -7.505  -14.834 1.00 60.72  ? 401 NAD A N9A  1 
HETATM 10066 C C8A  . NAD C 2 .   ? -12.690 -6.258  -14.519 1.00 61.42  ? 401 NAD A C8A  1 
HETATM 10067 N N7A  . NAD C 2 .   ? -12.550 -6.200  -13.191 1.00 62.45  ? 401 NAD A N7A  1 
HETATM 10068 C C5A  . NAD C 2 .   ? -12.864 -7.406  -12.693 1.00 59.83  ? 401 NAD A C5A  1 
HETATM 10069 C C6A  . NAD C 2 .   ? -12.883 -7.881  -11.418 1.00 60.47  ? 401 NAD A C6A  1 
HETATM 10070 N N6A  . NAD C 2 .   ? -12.557 -7.184  -10.183 1.00 63.45  ? 401 NAD A N6A  1 
HETATM 10071 N N1A  . NAD C 2 .   ? -13.238 -9.151  -11.175 1.00 57.96  ? 401 NAD A N1A  1 
HETATM 10072 C C2A  . NAD C 2 .   ? -13.579 -9.983  -12.188 1.00 47.30  ? 401 NAD A C2A  1 
HETATM 10073 N N3A  . NAD C 2 .   ? -13.571 -9.510  -13.454 1.00 60.21  ? 401 NAD A N3A  1 
HETATM 10074 C C4A  . NAD C 2 .   ? -13.204 -8.216  -13.701 1.00 60.31  ? 401 NAD A C4A  1 
HETATM 10075 O O3   . NAD C 2 .   ? -9.791  -5.963  -21.130 1.00 41.06  ? 401 NAD A O3   1 
HETATM 10076 P PN   . NAD C 2 .   ? -9.951  -6.320  -22.724 1.00 39.56  ? 401 NAD A PN   1 
HETATM 10077 O O1N  . NAD C 2 .   ? -9.351  -5.183  -23.532 1.00 38.09  ? 401 NAD A O1N  1 
HETATM 10078 O O2N  . NAD C 2 .   ? -11.380 -6.593  -23.133 1.00 35.78  ? 401 NAD A O2N  1 
HETATM 10079 O O5D  . NAD C 2 .   ? -8.993  -7.605  -22.905 1.00 32.19  ? 401 NAD A O5D  1 
HETATM 10080 C C5D  . NAD C 2 .   ? -9.437  -8.892  -22.526 1.00 36.62  ? 401 NAD A C5D  1 
HETATM 10081 C C4D  . NAD C 2 .   ? -8.507  -9.922  -23.200 1.00 31.32  ? 401 NAD A C4D  1 
HETATM 10082 O O4D  . NAD C 2 .   ? -8.669  -9.819  -24.516 1.00 34.00  ? 401 NAD A O4D  1 
HETATM 10083 C C3D  . NAD C 2 .   ? -7.016  -9.604  -22.893 1.00 38.04  ? 401 NAD A C3D  1 
HETATM 10084 O O3D  . NAD C 2 .   ? -6.226  -10.694 -22.785 1.00 42.28  ? 401 NAD A O3D  1 
HETATM 10085 C C2D  . NAD C 2 .   ? -6.579  -8.822  -24.135 1.00 31.72  ? 401 NAD A C2D  1 
HETATM 10086 O O2D  . NAD C 2 .   ? -5.089  -8.981  -24.294 1.00 38.97  ? 401 NAD A O2D  1 
HETATM 10087 C C1D  . NAD C 2 .   ? -7.226  -9.420  -25.127 1.00 32.62  ? 401 NAD A C1D  1 
HETATM 10088 N N1N  . NAD C 2 .   ? -7.372  -8.642  -26.324 1.00 37.62  ? 401 NAD A N1N  1 
HETATM 10089 C C2N  . NAD C 2 .   ? -7.782  -7.306  -26.311 1.00 34.00  ? 401 NAD A C2N  1 
HETATM 10090 C C3N  . NAD C 2 .   ? -7.907  -6.589  -27.522 1.00 36.99  ? 401 NAD A C3N  1 
HETATM 10091 C C7N  . NAD C 2 .   ? -8.382  -5.136  -27.502 1.00 36.71  ? 401 NAD A C7N  1 
HETATM 10092 O O7N  . NAD C 2 .   ? -8.441  -4.488  -28.489 1.00 35.47  ? 401 NAD A O7N  1 
HETATM 10093 N N7N  . NAD C 2 .   ? -8.828  -4.500  -26.235 1.00 28.83  ? 401 NAD A N7N  1 
HETATM 10094 C C4N  . NAD C 2 .   ? -7.612  -7.203  -28.728 1.00 37.34  ? 401 NAD A C4N  1 
HETATM 10095 C C5N  . NAD C 2 .   ? -7.190  -8.521  -28.756 1.00 35.63  ? 401 NAD A C5N  1 
HETATM 10096 C C6N  . NAD C 2 .   ? -7.074  -9.239  -27.528 1.00 31.95  ? 401 NAD A C6N  1 
HETATM 10097 H H51A . NAD C 2 .   ? -13.424 -4.979  -19.160 1.00 56.33  ? 401 NAD A H51A 1 
HETATM 10098 H H52A . NAD C 2 .   ? -12.300 -4.983  -18.025 1.00 56.33  ? 401 NAD A H52A 1 
HETATM 10099 H H4B  . NAD C 2 .   ? -13.564 -7.437  -18.798 1.00 54.72  ? 401 NAD A H4B  1 
HETATM 10100 H H3B  . NAD C 2 .   ? -14.467 -5.699  -16.716 1.00 58.69  ? 401 NAD A H3B  1 
HETATM 10101 H HO3A . NAD C 2 .   ? -15.469 -6.033  -18.826 1.00 47.69  ? 401 NAD A HO3A 1 
HETATM 10102 H H2B  . NAD C 2 .   ? -15.152 -7.645  -15.626 1.00 61.51  ? 401 NAD A H2B  1 
HETATM 10103 H HO2A . NAD C 2 .   ? -15.223 -9.602  -16.839 1.00 51.36  ? 401 NAD A HO2A 1 
HETATM 10104 H H1B  . NAD C 2 .   ? -13.233 -8.971  -16.180 1.00 65.38  ? 401 NAD A H1B  1 
HETATM 10105 H H8A  . NAD C 2 .   ? -12.545 -5.560  -15.115 1.00 73.66  ? 401 NAD A H8A  1 
HETATM 10106 H H61A . NAD C 2 .   ? -12.329 -6.356  -10.203 1.00 76.09  ? 401 NAD A H61A 1 
HETATM 10107 H H62A . NAD C 2 .   ? -12.593 -7.602  -9.432  1.00 76.09  ? 401 NAD A H62A 1 
HETATM 10108 H H2A  . NAD C 2 .   ? -13.793 -10.799 -11.797 1.00 56.72  ? 401 NAD A H2A  1 
HETATM 10109 H H51N . NAD C 2 .   ? -9.389  -8.987  -21.562 1.00 43.91  ? 401 NAD A H51N 1 
HETATM 10110 H H52N . NAD C 2 .   ? -10.349 -9.028  -22.826 1.00 43.91  ? 401 NAD A H52N 1 
HETATM 10111 H H4D  . NAD C 2 .   ? -8.725  -10.820 -22.907 1.00 37.54  ? 401 NAD A H4D  1 
HETATM 10112 H H3D  . NAD C 2 .   ? -6.946  -9.047  -22.102 1.00 45.60  ? 401 NAD A H3D  1 
HETATM 10113 H HO3N . NAD C 2 .   ? -6.690  -11.357 -22.527 1.00 50.69  ? 401 NAD A HO3N 1 
HETATM 10114 H H2D  . NAD C 2 .   ? -6.832  -7.889  -24.066 1.00 38.02  ? 401 NAD A H2D  1 
HETATM 10115 H HO2N . NAD C 2 .   ? -4.873  -9.790  -24.148 1.00 46.73  ? 401 NAD A HO2N 1 
HETATM 10116 H H1D  . NAD C 2 .   ? -6.753  -10.237 -25.349 1.00 39.10  ? 401 NAD A H1D  1 
HETATM 10117 H H2N  . NAD C 2 .   ? -7.993  -6.894  -25.504 1.00 40.75  ? 401 NAD A H2N  1 
HETATM 10118 H H71N . NAD C 2 .   ? -9.098  -3.683  -26.235 1.00 34.56  ? 401 NAD A H71N 1 
HETATM 10119 H H72N . NAD C 2 .   ? -8.805  -4.944  -25.500 1.00 34.56  ? 401 NAD A H72N 1 
HETATM 10120 H H4N  . NAD C 2 .   ? -7.693  -6.726  -29.522 1.00 44.77  ? 401 NAD A H4N  1 
HETATM 10121 H H5N  . NAD C 2 .   ? -6.989  -8.934  -29.565 1.00 42.71  ? 401 NAD A H5N  1 
HETATM 10122 H H6N  . NAD C 2 .   ? -6.790  -10.125 -27.541 1.00 38.30  ? 401 NAD A H6N  1 
HETATM 10123 P P    . PO4 D 3 .   ? 2.025   -26.545 -23.091 1.00 87.65  ? 402 PO4 A P    1 
HETATM 10124 O O1   . PO4 D 3 .   ? 1.831   -26.107 -24.554 1.00 42.28  ? 402 PO4 A O1   1 
HETATM 10125 O O2   . PO4 D 3 .   ? 1.169   -27.781 -22.845 1.00 48.37  ? 402 PO4 A O2   1 
HETATM 10126 O O3   . PO4 D 3 .   ? 1.611   -25.468 -22.052 1.00 42.88  ? 402 PO4 A O3   1 
HETATM 10127 O O4   . PO4 D 3 .   ? 3.482   -26.997 -22.946 1.00 47.77  ? 402 PO4 A O4   1 
HETATM 10128 C C1   . EDO E 4 .   ? 16.522  -21.261 -32.907 1.00 31.08  ? 403 EDO A C1   1 
HETATM 10129 O O1   . EDO E 4 .   ? 17.774  -21.265 -32.325 1.00 28.80  ? 403 EDO A O1   1 
HETATM 10130 C C2   . EDO E 4 .   ? 16.433  -20.154 -33.949 1.00 35.57  ? 403 EDO A C2   1 
HETATM 10131 O O2   . EDO E 4 .   ? 17.194  -20.482 -35.082 1.00 40.87  ? 403 EDO A O2   1 
HETATM 10132 H H11  . EDO E 4 .   ? 16.364  -22.118 -33.334 1.00 37.25  ? 403 EDO A H11  1 
HETATM 10133 H H12  . EDO E 4 .   ? 15.851  -21.114 -32.223 1.00 37.25  ? 403 EDO A H12  1 
HETATM 10134 H HO1  . EDO E 4 .   ? 17.845  -21.937 -31.809 1.00 34.52  ? 403 EDO A HO1  1 
HETATM 10135 H H21  . EDO E 4 .   ? 15.506  -20.034 -34.209 1.00 42.64  ? 403 EDO A H21  1 
HETATM 10136 H H22  . EDO E 4 .   ? 16.767  -19.328 -33.567 1.00 42.64  ? 403 EDO A H22  1 
HETATM 10137 H HO2  . EDO E 4 .   ? 17.912  -20.027 -35.082 1.00 49.00  ? 403 EDO A HO2  1 
HETATM 10138 C C1   . EDO F 4 .   ? 6.350   -30.393 -33.785 1.00 61.51  ? 404 EDO A C1   1 
HETATM 10139 O O1   . EDO F 4 .   ? 5.241   -31.258 -33.824 1.00 52.46  ? 404 EDO A O1   1 
HETATM 10140 C C2   . EDO F 4 .   ? 7.261   -30.680 -32.582 1.00 58.66  ? 404 EDO A C2   1 
HETATM 10141 O O2   . EDO F 4 .   ? 6.487   -30.967 -31.441 1.00 58.80  ? 404 EDO A O2   1 
HETATM 10142 H H11  . EDO F 4 .   ? 6.863   -30.502 -34.601 1.00 73.77  ? 404 EDO A H11  1 
HETATM 10143 H H12  . EDO F 4 .   ? 6.035   -29.478 -33.731 1.00 73.77  ? 404 EDO A H12  1 
HETATM 10144 H HO1  . EDO F 4 .   ? 5.029   -31.411 -34.633 1.00 62.91  ? 404 EDO A HO1  1 
HETATM 10145 H H21  . EDO F 4 .   ? 7.829   -31.440 -32.783 1.00 70.35  ? 404 EDO A H21  1 
HETATM 10146 H H22  . EDO F 4 .   ? 7.815   -29.903 -32.406 1.00 70.35  ? 404 EDO A H22  1 
HETATM 10147 H HO2  . EDO F 4 .   ? 5.884   -30.375 -31.352 1.00 70.52  ? 404 EDO A HO2  1 
HETATM 10148 C C1   . EDO G 4 .   ? -1.919  -6.474  -31.639 1.00 44.09  ? 405 EDO A C1   1 
HETATM 10149 O O1   . EDO G 4 .   ? -1.302  -7.266  -30.663 1.00 48.35  ? 405 EDO A O1   1 
HETATM 10150 C C2   . EDO G 4 .   ? -3.277  -7.115  -31.866 1.00 52.24  ? 405 EDO A C2   1 
HETATM 10151 O O2   . EDO G 4 .   ? -3.925  -7.268  -30.625 1.00 42.99  ? 405 EDO A O2   1 
HETATM 10152 H H11  . EDO G 4 .   ? -1.400  -6.485  -32.459 1.00 52.87  ? 405 EDO A H11  1 
HETATM 10153 H H12  . EDO G 4 .   ? -2.025  -5.565  -31.318 1.00 52.87  ? 405 EDO A H12  1 
HETATM 10154 H HO1  . EDO G 4 .   ? -0.911  -7.922  -31.036 1.00 57.98  ? 405 EDO A HO1  1 
HETATM 10155 H H21  . EDO G 4 .   ? -3.160  -7.984  -32.281 1.00 62.65  ? 405 EDO A H21  1 
HETATM 10156 H H22  . EDO G 4 .   ? -3.811  -6.548  -32.444 1.00 62.65  ? 405 EDO A H22  1 
HETATM 10157 H HO2  . EDO G 4 .   ? -4.765  -7.306  -30.748 1.00 51.55  ? 405 EDO A HO2  1 
HETATM 10158 K K    . K   H 5 .   ? -30.623 -16.878 -35.109 1.00 44.02  ? 406 K   A K    1 
HETATM 10159 P PA   . NAD I 2 .   ? 24.267  1.046   -60.635 1.00 39.84  ? 401 NAD B PA   1 
HETATM 10160 O O1A  . NAD I 2 .   ? 23.573  2.092   -61.453 1.00 41.71  ? 401 NAD B O1A  1 
HETATM 10161 O O2A  . NAD I 2 .   ? 24.848  1.656   -59.384 1.00 40.99  ? 401 NAD B O2A  1 
HETATM 10162 O O5B  . NAD I 2 .   ? 25.415  0.309   -61.559 1.00 36.33  ? 401 NAD B O5B  1 
HETATM 10163 C C5B  . NAD I 2 .   ? 26.228  0.975   -62.489 1.00 41.03  ? 401 NAD B C5B  1 
HETATM 10164 C C4B  . NAD I 2 .   ? 26.912  -0.230  -63.249 1.00 44.73  ? 401 NAD B C4B  1 
HETATM 10165 O O4B  . NAD I 2 .   ? 26.102  -0.706  -64.135 1.00 46.80  ? 401 NAD B O4B  1 
HETATM 10166 C C3B  . NAD I 2 .   ? 28.187  0.150   -64.012 1.00 53.56  ? 401 NAD B C3B  1 
HETATM 10167 O O3B  . NAD I 2 .   ? 29.253  0.017   -63.177 1.00 54.40  ? 401 NAD B O3B  1 
HETATM 10168 C C2B  . NAD I 2 .   ? 28.207  -0.903  -65.143 1.00 49.57  ? 401 NAD B C2B  1 
HETATM 10169 O O2B  . NAD I 2 .   ? 28.782  -2.213  -64.596 1.00 42.88  ? 401 NAD B O2B  1 
HETATM 10170 C C1B  . NAD I 2 .   ? 26.968  -1.073  -65.465 1.00 50.72  ? 401 NAD B C1B  1 
HETATM 10171 N N9A  . NAD I 2 .   ? 26.656  -0.180  -66.552 1.00 56.74  ? 401 NAD B N9A  1 
HETATM 10172 C C8A  . NAD I 2 .   ? 26.282  1.113   -66.471 1.00 57.71  ? 401 NAD B C8A  1 
HETATM 10173 N N7A  . NAD I 2 .   ? 26.121  1.569   -67.723 1.00 56.24  ? 401 NAD B N7A  1 
HETATM 10174 C C5A  . NAD I 2 .   ? 26.391  0.563   -68.573 1.00 64.42  ? 401 NAD B C5A  1 
HETATM 10175 C C6A  . NAD I 2 .   ? 26.391  0.487   -69.950 1.00 65.09  ? 401 NAD B C6A  1 
HETATM 10176 N N6A  . NAD I 2 .   ? 26.077  1.490   -70.963 1.00 66.48  ? 401 NAD B N6A  1 
HETATM 10177 N N1A  . NAD I 2 .   ? 26.706  -0.663  -70.557 1.00 54.48  ? 401 NAD B N1A  1 
HETATM 10178 C C2A  . NAD I 2 .   ? 27.043  -1.748  -69.821 1.00 59.45  ? 401 NAD B C2A  1 
HETATM 10179 N N3A  . NAD I 2 .   ? 27.050  -1.687  -68.464 1.00 51.16  ? 401 NAD B N3A  1 
HETATM 10180 C C4A  . NAD I 2 .   ? 26.722  -0.521  -67.844 1.00 53.22  ? 401 NAD B C4A  1 
HETATM 10181 O O3   . NAD I 2 .   ? 23.303  -0.212  -60.218 1.00 34.97  ? 401 NAD B O3   1 
HETATM 10182 P PN   . NAD I 2 .   ? 23.256  -0.895  -58.713 1.00 37.34  ? 401 NAD B PN   1 
HETATM 10183 O O1N  . NAD I 2 .   ? 22.680  0.031   -57.651 1.00 33.57  ? 401 NAD B O1N  1 
HETATM 10184 O O2N  . NAD I 2 .   ? 24.585  -1.387  -58.279 1.00 34.11  ? 401 NAD B O2N  1 
HETATM 10185 O O5D  . NAD I 2 .   ? 22.268  -2.171  -58.852 1.00 36.59  ? 401 NAD B O5D  1 
HETATM 10186 C C5D  . NAD I 2 .   ? 22.672  -3.221  -59.694 1.00 32.56  ? 401 NAD B C5D  1 
HETATM 10187 C C4D  . NAD I 2 .   ? 21.836  -4.441  -59.272 1.00 30.11  ? 401 NAD B C4D  1 
HETATM 10188 O O4D  . NAD I 2 .   ? 21.966  -4.659  -57.963 1.00 34.49  ? 401 NAD B O4D  1 
HETATM 10189 C C3D  . NAD I 2 .   ? 20.328  -4.147  -59.517 1.00 42.63  ? 401 NAD B C3D  1 
HETATM 10190 O O3D  . NAD I 2 .   ? 19.738  -5.225  -60.049 1.00 42.39  ? 401 NAD B O3D  1 
HETATM 10191 C C2D  . NAD I 2 .   ? 19.753  -3.836  -58.089 1.00 44.23  ? 401 NAD B C2D  1 
HETATM 10192 O O2D  . NAD I 2 .   ? 18.255  -4.069  -57.959 1.00 46.21  ? 401 NAD B O2D  1 
HETATM 10193 C C1D  . NAD I 2 .   ? 20.470  -4.624  -57.274 1.00 41.61  ? 401 NAD B C1D  1 
HETATM 10194 N N1N  . NAD I 2 .   ? 20.500  -4.182  -55.898 1.00 34.06  ? 401 NAD B N1N  1 
HETATM 10195 C C2N  . NAD I 2 .   ? 20.965  -2.910  -55.512 1.00 29.68  ? 401 NAD B C2N  1 
HETATM 10196 C C3N  . NAD I 2 .   ? 20.975  -2.527  -54.142 1.00 35.47  ? 401 NAD B C3N  1 
HETATM 10197 C C7N  . NAD I 2 .   ? 21.504  -1.164  -53.717 1.00 34.75  ? 401 NAD B C7N  1 
HETATM 10198 O O7N  . NAD I 2 .   ? 21.499  -0.808  -52.577 1.00 34.52  ? 401 NAD B O7N  1 
HETATM 10199 N N7N  . NAD I 2 .   ? 22.050  -0.264  -54.772 1.00 30.93  ? 401 NAD B N7N  1 
HETATM 10200 C C4N  . NAD I 2 .   ? 20.510  -3.397  -53.195 1.00 28.66  ? 401 NAD B C4N  1 
HETATM 10201 C C5N  . NAD I 2 .   ? 20.056  -4.652  -53.554 1.00 34.02  ? 401 NAD B C5N  1 
HETATM 10202 C C6N  . NAD I 2 .   ? 20.044  -5.034  -54.927 1.00 33.38  ? 401 NAD B C6N  1 
HETATM 10203 H H51A . NAD I 2 .   ? 26.891  1.522   -62.040 1.00 49.20  ? 401 NAD B H51A 1 
HETATM 10204 H H52A . NAD I 2 .   ? 25.691  1.507   -63.097 1.00 49.20  ? 401 NAD B H52A 1 
HETATM 10205 H H4B  . NAD I 2 .   ? 27.127  -0.930  -62.613 1.00 53.63  ? 401 NAD B H4B  1 
HETATM 10206 H H3B  . NAD I 2 .   ? 28.124  1.048   -64.373 1.00 64.23  ? 401 NAD B H3B  1 
HETATM 10207 H HO3A . NAD I 2 .   ? 29.039  0.284   -62.398 1.00 65.24  ? 401 NAD B HO3A 1 
HETATM 10208 H H2B  . NAD I 2 .   ? 28.719  -0.583  -65.902 1.00 59.44  ? 401 NAD B H2B  1 
HETATM 10209 H HO2A . NAD I 2 .   ? 29.168  -2.066  -63.853 1.00 51.42  ? 401 NAD B HO2A 1 
HETATM 10210 H H1B  . NAD I 2 .   ? 26.811  -1.994  -65.726 1.00 60.83  ? 401 NAD B H1B  1 
HETATM 10211 H H8A  . NAD I 2 .   ? 26.162  1.604   -65.690 1.00 69.21  ? 401 NAD B H8A  1 
HETATM 10212 H H61A . NAD I 2 .   ? 26.039  1.267   -71.793 1.00 79.74  ? 401 NAD B H61A 1 
HETATM 10213 H H62A . NAD I 2 .   ? 25.930  2.305   -70.730 1.00 79.74  ? 401 NAD B H62A 1 
HETATM 10214 H H2A  . NAD I 2 .   ? 27.224  -2.423  -70.435 1.00 71.29  ? 401 NAD B H2A  1 
HETATM 10215 H H51N . NAD I 2 .   ? 22.491  -2.996  -60.620 1.00 39.03  ? 401 NAD B H51N 1 
HETATM 10216 H H52N . NAD I 2 .   ? 23.616  -3.405  -59.571 1.00 39.03  ? 401 NAD B H52N 1 
HETATM 10217 H H4D  . NAD I 2 .   ? 22.109  -5.228  -59.769 1.00 36.09  ? 401 NAD B H4D  1 
HETATM 10218 H H3D  . NAD I 2 .   ? 20.225  -3.375  -60.096 1.00 51.12  ? 401 NAD B H3D  1 
HETATM 10219 H HO3N . NAD I 2 .   ? 19.404  -5.022  -60.804 1.00 50.83  ? 401 NAD B HO3N 1 
HETATM 10220 H H2D  . NAD I 2 .   ? 19.945  -2.910  -57.872 1.00 53.03  ? 401 NAD B H2D  1 
HETATM 10221 H HO2N . NAD I 2 .   ? 18.058  -4.202  -57.143 1.00 55.41  ? 401 NAD B HO2N 1 
HETATM 10222 H H1D  . NAD I 2 .   ? 20.097  -5.519  -57.303 1.00 49.89  ? 401 NAD B H1D  1 
HETATM 10223 H H2N  . NAD I 2 .   ? 21.286  -2.322  -56.157 1.00 35.58  ? 401 NAD B H2N  1 
HETATM 10224 H H71N . NAD I 2 .   ? 22.357  0.511   -54.560 1.00 37.08  ? 401 NAD B H71N 1 
HETATM 10225 H H72N . NAD I 2 .   ? 22.056  -0.519  -55.593 1.00 37.08  ? 401 NAD B H72N 1 
HETATM 10226 H H4N  . NAD I 2 .   ? 20.523  -3.151  -52.298 1.00 34.35  ? 401 NAD B H4N  1 
HETATM 10227 H H5N  . NAD I 2 .   ? 19.738  -5.236  -52.904 1.00 40.79  ? 401 NAD B H5N  1 
HETATM 10228 H H6N  . NAD I 2 .   ? 19.725  -5.874  -55.166 1.00 40.01  ? 401 NAD B H6N  1 
HETATM 10229 P P    . PO4 J 3 .   ? 10.788  -20.097 -64.510 1.00 100.42 ? 402 PO4 B P    1 
HETATM 10230 O O1   . PO4 J 3 .   ? 11.662  -21.025 -65.337 1.00 61.11  ? 402 PO4 B O1   1 
HETATM 10231 O O2   . PO4 J 3 .   ? 11.139  -18.665 -64.906 1.00 61.61  ? 402 PO4 B O2   1 
HETATM 10232 O O3   . PO4 J 3 .   ? 11.067  -20.308 -63.020 1.00 52.04  ? 402 PO4 B O3   1 
HETATM 10233 O O4   . PO4 J 3 .   ? 9.319   -20.433 -64.783 1.00 58.42  ? 402 PO4 B O4   1 
HETATM 10234 C C1   . EDO K 4 .   ? -3.851  -17.165 -53.364 1.00 32.62  ? 403 EDO B C1   1 
HETATM 10235 O O1   . EDO K 4 .   ? -5.028  -17.818 -53.765 1.00 42.00  ? 403 EDO B O1   1 
HETATM 10236 C C2   . EDO K 4 .   ? -3.515  -17.667 -51.952 1.00 35.95  ? 403 EDO B C2   1 
HETATM 10237 O O2   . EDO K 4 .   ? -4.661  -17.557 -51.142 1.00 42.30  ? 403 EDO B O2   1 
HETATM 10238 H H11  . EDO K 4 .   ? -3.128  -17.382 -53.973 1.00 39.10  ? 403 EDO B H11  1 
HETATM 10239 H H12  . EDO K 4 .   ? -3.995  -16.206 -53.349 1.00 39.10  ? 403 EDO B H12  1 
HETATM 10240 H HO1  . EDO K 4 .   ? -4.832  -18.575 -54.098 1.00 50.36  ? 403 EDO B HO1  1 
HETATM 10241 H H21  . EDO K 4 .   ? -3.236  -18.595 -51.995 1.00 43.10  ? 403 EDO B H21  1 
HETATM 10242 H H22  . EDO K 4 .   ? -2.800  -17.130 -51.578 1.00 43.10  ? 403 EDO B H22  1 
HETATM 10243 H HO2  . EDO K 4 .   ? -4.750  -18.264 -50.679 1.00 50.72  ? 403 EDO B HO2  1 
HETATM 10244 K K    . K   L 5 .   ? 43.311  -16.203 -49.676 1.00 34.54  ? 404 K   B K    1 
HETATM 10245 O O    . HOH M 6 .   ? -4.781  -0.547  -36.866 1.00 33.09  ? 501 HOH A O    1 
HETATM 10246 O O    . HOH M 6 .   ? 24.130  -14.311 -31.832 1.00 41.14  ? 502 HOH A O    1 
HETATM 10247 O O    . HOH M 6 .   ? -17.630 -4.443  -15.740 1.00 44.78  ? 503 HOH A O    1 
HETATM 10248 O O    . HOH M 6 .   ? -13.845 -24.194 -41.021 1.00 43.60  ? 504 HOH A O    1 
HETATM 10249 O O    . HOH M 6 .   ? -17.361 -8.906  -17.502 1.00 42.98  ? 505 HOH A O    1 
HETATM 10250 O O    . HOH M 6 .   ? -15.354 -5.249  -37.343 1.00 29.61  ? 506 HOH A O    1 
HETATM 10251 O O    . HOH M 6 .   ? 11.424  -24.898 -16.682 1.00 43.83  ? 507 HOH A O    1 
HETATM 10252 O O    . HOH M 6 .   ? -31.497 -22.015 -28.456 1.00 37.21  ? 508 HOH A O    1 
HETATM 10253 O O    . HOH M 6 .   ? -0.997  -13.394 -32.004 1.00 27.56  ? 509 HOH A O    1 
HETATM 10254 O O    . HOH M 6 .   ? 9.629   5.625   -33.523 1.00 51.58  ? 510 HOH A O    1 
HETATM 10255 O O    . HOH M 6 .   ? 4.833   -31.308 -29.784 1.00 43.23  ? 511 HOH A O    1 
HETATM 10256 O O    . HOH M 6 .   ? -3.709  -10.403 -40.221 1.00 20.12  ? 512 HOH A O    1 
HETATM 10257 O O    . HOH M 6 .   ? -3.168  -27.121 -25.182 1.00 49.38  ? 513 HOH A O    1 
HETATM 10258 O O    . HOH M 6 .   ? -20.109 -15.294 -40.391 1.00 28.05  ? 514 HOH A O    1 
HETATM 10259 O O    . HOH M 6 .   ? -6.003  -17.696 -24.391 1.00 28.95  ? 515 HOH A O    1 
HETATM 10260 O O    . HOH M 6 .   ? 22.958  -11.563 -23.683 1.00 50.07  ? 516 HOH A O    1 
HETATM 10261 O O    . HOH M 6 .   ? -23.757 -28.201 -25.493 1.00 36.35  ? 517 HOH A O    1 
HETATM 10262 O O    . HOH M 6 .   ? -26.270 -19.831 -41.316 1.00 37.69  ? 518 HOH A O    1 
HETATM 10263 O O    . HOH M 6 .   ? -0.676  -21.187 -43.157 1.00 41.66  ? 519 HOH A O    1 
HETATM 10264 O O    . HOH M 6 .   ? -26.805 -17.391 -28.364 1.00 37.22  ? 520 HOH A O    1 
HETATM 10265 O O    . HOH M 6 .   ? -24.314 -3.111  -32.445 1.00 39.97  ? 521 HOH A O    1 
HETATM 10266 O O    . HOH M 6 .   ? 20.239  -2.575  -19.633 1.00 31.13  ? 522 HOH A O    1 
HETATM 10267 O O    . HOH M 6 .   ? -6.560  -1.008  -38.958 1.00 41.75  ? 523 HOH A O    1 
HETATM 10268 O O    . HOH M 6 .   ? 18.858  -4.594  -16.459 1.00 37.46  ? 524 HOH A O    1 
HETATM 10269 O O    . HOH M 6 .   ? -2.879  -29.447 -28.451 1.00 45.44  ? 525 HOH A O    1 
HETATM 10270 O O    . HOH M 6 .   ? -22.804 -24.307 -20.403 1.00 36.10  ? 526 HOH A O    1 
HETATM 10271 O O    . HOH M 6 .   ? -10.812 -1.410  -21.290 1.00 42.27  ? 527 HOH A O    1 
HETATM 10272 O O    . HOH M 6 .   ? -0.045  -27.247 -31.483 1.00 42.72  ? 528 HOH A O    1 
HETATM 10273 O O    . HOH M 6 .   ? -1.904  -15.740 -26.916 1.00 40.14  ? 529 HOH A O    1 
HETATM 10274 O O    . HOH M 6 .   ? -6.560  -11.248 -31.091 1.00 24.69  ? 530 HOH A O    1 
HETATM 10275 O O    . HOH M 6 .   ? -13.165 1.251   -12.591 1.00 53.28  ? 531 HOH A O    1 
HETATM 10276 O O    . HOH M 6 .   ? 1.064   -27.594 -17.963 1.00 38.72  ? 532 HOH A O    1 
HETATM 10277 O O    . HOH M 6 .   ? -17.797 -6.441  -38.931 1.00 34.58  ? 533 HOH A O    1 
HETATM 10278 O O    . HOH M 6 .   ? -20.192 -30.195 -28.064 1.00 50.18  ? 534 HOH A O    1 
HETATM 10279 O O    . HOH M 6 .   ? -8.059  -12.584 -29.040 1.00 23.62  ? 535 HOH A O    1 
HETATM 10280 O O    . HOH M 6 .   ? -6.529  -15.881 -13.375 1.00 41.86  ? 536 HOH A O    1 
HETATM 10281 O O    . HOH M 6 .   ? -26.085 -26.397 -16.982 1.00 45.34  ? 537 HOH A O    1 
HETATM 10282 O O    . HOH M 6 .   ? -4.931  -10.714 -20.473 1.00 42.18  ? 538 HOH A O    1 
HETATM 10283 O O    . HOH M 6 .   ? -5.855  -25.797 -24.891 1.00 36.29  ? 539 HOH A O    1 
HETATM 10284 O O    . HOH M 6 .   ? 21.941  -16.683 -25.692 1.00 36.03  ? 540 HOH A O    1 
HETATM 10285 O O    . HOH M 6 .   ? -2.110  -18.509 -23.296 1.00 31.02  ? 541 HOH A O    1 
HETATM 10286 O O    . HOH M 6 .   ? -9.355  -0.813  -28.465 1.00 45.08  ? 542 HOH A O    1 
HETATM 10287 O O    . HOH M 6 .   ? -11.119 -20.648 -42.382 1.00 32.14  ? 543 HOH A O    1 
HETATM 10288 O O    . HOH M 6 .   ? 21.248  -0.045  -21.544 1.00 49.93  ? 544 HOH A O    1 
HETATM 10289 O O    . HOH M 6 .   ? 22.578  -21.233 -41.724 1.00 27.19  ? 545 HOH A O    1 
HETATM 10290 O O    . HOH M 6 .   ? 24.166  -14.205 -36.945 1.00 17.85  ? 546 HOH A O    1 
HETATM 10291 O O    . HOH M 6 .   ? -13.627 -8.011  -22.381 1.00 29.42  ? 547 HOH A O    1 
HETATM 10292 O O    . HOH M 6 .   ? -4.875  -16.312 -40.038 1.00 28.79  ? 548 HOH A O    1 
HETATM 10293 O O    . HOH M 6 .   ? 9.431   -7.585  -14.170 1.00 46.34  ? 549 HOH A O    1 
HETATM 10294 O O    . HOH M 6 .   ? -11.192 2.154   -35.678 1.00 49.10  ? 550 HOH A O    1 
HETATM 10295 O O    . HOH M 6 .   ? -5.420  -8.110  -39.315 1.00 27.43  ? 551 HOH A O    1 
HETATM 10296 O O    . HOH M 6 .   ? -17.752 -30.815 -23.319 1.00 39.25  ? 552 HOH A O    1 
HETATM 10297 O O    . HOH M 6 .   ? -6.636  -4.953  -23.250 1.00 41.69  ? 553 HOH A O    1 
HETATM 10298 O O    . HOH M 6 .   ? -7.060  -4.798  -19.467 1.00 45.89  ? 554 HOH A O    1 
HETATM 10299 O O    . HOH M 6 .   ? -19.742 -29.628 -19.259 1.00 38.72  ? 555 HOH A O    1 
HETATM 10300 O O    . HOH M 6 .   ? -19.182 -27.332 -8.816  1.00 37.99  ? 556 HOH A O    1 
HETATM 10301 O O    . HOH M 6 .   ? 9.216   5.893   -27.851 1.00 41.09  ? 557 HOH A O    1 
HETATM 10302 O O    . HOH M 6 .   ? -9.901  -27.375 -30.159 1.00 32.38  ? 558 HOH A O    1 
HETATM 10303 O O    . HOH M 6 .   ? 4.602   -11.220 -23.694 1.00 30.95  ? 559 HOH A O    1 
HETATM 10304 O O    . HOH M 6 .   ? -14.001 -25.128 -28.868 1.00 29.68  ? 560 HOH A O    1 
HETATM 10305 O O    . HOH M 6 .   ? -7.047  -15.005 -41.294 1.00 24.87  ? 561 HOH A O    1 
HETATM 10306 O O    . HOH M 6 .   ? -1.571  -15.792 -29.888 1.00 30.23  ? 562 HOH A O    1 
HETATM 10307 O O    . HOH M 6 .   ? -28.035 -9.084  -37.084 1.00 33.72  ? 563 HOH A O    1 
HETATM 10308 O O    . HOH M 6 .   ? 2.923   2.430   -36.803 1.00 48.65  ? 564 HOH A O    1 
HETATM 10309 O O    . HOH M 6 .   ? -7.213  -27.177 -26.855 1.00 30.82  ? 565 HOH A O    1 
HETATM 10310 O O    . HOH M 6 .   ? 15.875  -21.670 -13.897 1.00 51.24  ? 566 HOH A O    1 
HETATM 10311 O O    . HOH M 6 .   ? -23.830 -19.713 -41.395 1.00 38.31  ? 567 HOH A O    1 
HETATM 10312 O O    . HOH M 6 .   ? -30.394 -27.424 -26.052 1.00 51.02  ? 568 HOH A O    1 
HETATM 10313 O O    . HOH M 6 .   ? -17.182 -27.691 -15.603 1.00 30.74  ? 569 HOH A O    1 
HETATM 10314 O O    . HOH M 6 .   ? -9.688  -31.686 -16.540 1.00 40.71  ? 570 HOH A O    1 
HETATM 10315 O O    . HOH M 6 .   ? -1.373  -29.645 -38.108 1.00 36.87  ? 571 HOH A O    1 
HETATM 10316 O O    . HOH M 6 .   ? 7.728   6.350   -30.571 1.00 50.51  ? 572 HOH A O    1 
HETATM 10317 O O    . HOH M 6 .   ? -16.139 -0.907  -43.135 1.00 43.80  ? 573 HOH A O    1 
HETATM 10318 O O    . HOH M 6 .   ? 30.006  -13.031 -36.392 1.00 28.80  ? 574 HOH A O    1 
HETATM 10319 O O    . HOH M 6 .   ? -31.864 -16.700 -40.795 1.00 38.17  ? 575 HOH A O    1 
HETATM 10320 O O    . HOH M 6 .   ? 20.068  4.081   -23.662 1.00 57.22  ? 576 HOH A O    1 
HETATM 10321 O O    . HOH M 6 .   ? -28.448 -9.065  -40.208 1.00 38.05  ? 577 HOH A O    1 
HETATM 10322 O O    . HOH M 6 .   ? 4.357   2.338   -30.748 1.00 38.26  ? 578 HOH A O    1 
HETATM 10323 O O    . HOH M 6 .   ? 13.117  -26.152 -32.226 1.00 37.06  ? 579 HOH A O    1 
HETATM 10324 O O    . HOH M 6 .   ? -8.008  -4.499  -35.753 1.00 21.26  ? 580 HOH A O    1 
HETATM 10325 O O    . HOH M 6 .   ? -13.256 -5.432  -37.964 1.00 29.22  ? 581 HOH A O    1 
HETATM 10326 O O    . HOH M 6 .   ? -6.103  -23.353 -42.809 1.00 41.87  ? 582 HOH A O    1 
HETATM 10327 O O    . HOH M 6 .   ? -14.335 2.374   -31.793 1.00 37.85  ? 583 HOH A O    1 
HETATM 10328 O O    . HOH M 6 .   ? 21.684  -24.784 -18.827 1.00 47.90  ? 584 HOH A O    1 
HETATM 10329 O O    . HOH M 6 .   ? 30.207  -5.284  -35.417 1.00 34.19  ? 585 HOH A O    1 
HETATM 10330 O O    . HOH M 6 .   ? 21.816  -12.922 -26.088 1.00 31.15  ? 586 HOH A O    1 
HETATM 10331 O O    . HOH M 6 .   ? 20.386  6.991   -36.613 1.00 47.13  ? 587 HOH A O    1 
HETATM 10332 O O    . HOH M 6 .   ? -25.545 -25.076 -13.535 1.00 38.75  ? 588 HOH A O    1 
HETATM 10333 O O    . HOH M 6 .   ? 23.883  1.340   -24.109 1.00 36.00  ? 589 HOH A O    1 
HETATM 10334 O O    . HOH M 6 .   ? -5.025  -27.020 -40.010 1.00 31.40  ? 590 HOH A O    1 
HETATM 10335 O O    . HOH M 6 .   ? -8.975  -28.857 -25.514 1.00 39.25  ? 591 HOH A O    1 
HETATM 10336 O O    . HOH M 6 .   ? 21.541  -22.971 -21.214 1.00 29.10  ? 592 HOH A O    1 
HETATM 10337 O O    . HOH M 6 .   ? -15.687 -32.714 -21.900 1.00 33.30  ? 593 HOH A O    1 
HETATM 10338 O O    . HOH M 6 .   ? -27.787 -22.304 -10.979 1.00 55.43  ? 594 HOH A O    1 
HETATM 10339 O O    . HOH M 6 .   ? -12.786 -1.429  -43.678 1.00 39.65  ? 595 HOH A O    1 
HETATM 10340 O O    . HOH M 6 .   ? -27.208 -7.407  -10.511 1.00 52.23  ? 596 HOH A O    1 
HETATM 10341 O O    . HOH M 6 .   ? 24.291  -25.746 -40.473 1.00 55.07  ? 597 HOH A O    1 
HETATM 10342 O O    . HOH M 6 .   ? -2.718  -28.300 -30.589 1.00 42.20  ? 598 HOH A O    1 
HETATM 10343 O O    . HOH M 6 .   ? 4.765   -26.272 -42.174 1.00 31.73  ? 599 HOH A O    1 
HETATM 10344 O O    . HOH M 6 .   ? -9.998  -30.115 -12.386 1.00 45.59  ? 600 HOH A O    1 
HETATM 10345 O O    . HOH M 6 .   ? -28.860 -18.277 -42.139 1.00 39.39  ? 601 HOH A O    1 
HETATM 10346 O O    . HOH M 6 .   ? 19.693  -23.446 -38.822 1.00 51.04  ? 602 HOH A O    1 
HETATM 10347 O O    . HOH M 6 .   ? -12.342 -22.724 -42.902 1.00 46.32  ? 603 HOH A O    1 
HETATM 10348 O O    . HOH M 6 .   ? 10.322  -22.965 -15.819 1.00 43.58  ? 604 HOH A O    1 
HETATM 10349 O O    . HOH M 6 .   ? -20.000 -4.304  -45.234 1.00 44.69  ? 605 HOH A O    1 
HETATM 10350 O O    . HOH M 6 .   ? -13.772 -27.884 -29.873 1.00 48.69  ? 606 HOH A O    1 
HETATM 10351 O O    . HOH M 6 .   ? 13.854  12.518  -22.767 1.00 39.81  ? 607 HOH A O    1 
HETATM 10352 O O    . HOH M 6 .   ? -26.921 -8.885  -8.428  1.00 46.16  ? 608 HOH A O    1 
HETATM 10353 O O    . HOH M 6 .   ? 19.159  -25.098 -41.230 1.00 54.17  ? 609 HOH A O    1 
HETATM 10354 O O    . HOH N 6 .   ? 26.549  -23.651 -46.912 1.00 40.20  ? 501 HOH B O    1 
HETATM 10355 O O    . HOH N 6 .   ? 31.974  1.292   -61.843 1.00 35.42  ? 502 HOH B O    1 
HETATM 10356 O O    . HOH N 6 .   ? 29.293  9.916   -64.701 1.00 50.30  ? 503 HOH B O    1 
HETATM 10357 O O    . HOH N 6 .   ? -10.047 -5.574  -58.727 1.00 43.16  ? 504 HOH B O    1 
HETATM 10358 O O    . HOH N 6 .   ? 31.054  -2.486  -64.228 1.00 31.43  ? 505 HOH B O    1 
HETATM 10359 O O    . HOH N 6 .   ? -17.102 -11.308 -47.641 1.00 35.09  ? 506 HOH B O    1 
HETATM 10360 O O    . HOH N 6 .   ? -17.774 -14.810 -49.625 1.00 32.10  ? 507 HOH B O    1 
HETATM 10361 O O    . HOH N 6 .   ? 28.773  -4.750  -44.227 1.00 27.11  ? 508 HOH B O    1 
HETATM 10362 O O    . HOH N 6 .   ? 26.674  -20.840 -57.979 1.00 28.75  ? 509 HOH B O    1 
HETATM 10363 O O    . HOH N 6 .   ? 16.481  -9.873  -43.126 1.00 18.90  ? 510 HOH B O    1 
HETATM 10364 O O    . HOH N 6 .   ? 22.136  2.417   -57.373 1.00 45.10  ? 511 HOH B O    1 
HETATM 10365 O O    . HOH N 6 .   ? -0.189  10.059  -65.839 1.00 39.01  ? 512 HOH B O    1 
HETATM 10366 O O    . HOH N 6 .   ? 10.117  8.506   -57.054 1.00 61.76  ? 513 HOH B O    1 
HETATM 10367 O O    . HOH N 6 .   ? 16.698  -17.419 -72.307 1.00 53.01  ? 514 HOH B O    1 
HETATM 10368 O O    . HOH N 6 .   ? 32.998  -15.314 -44.400 1.00 24.84  ? 515 HOH B O    1 
HETATM 10369 O O    . HOH N 6 .   ? 34.993  -7.604  -73.942 1.00 40.61  ? 516 HOH B O    1 
HETATM 10370 O O    . HOH N 6 .   ? 24.347  3.945   -58.489 1.00 39.98  ? 517 HOH B O    1 
HETATM 10371 O O    . HOH N 6 .   ? 44.622  0.252   -63.751 1.00 36.66  ? 518 HOH B O    1 
HETATM 10372 O O    . HOH N 6 .   ? 46.774  -14.360 -56.933 1.00 35.88  ? 519 HOH B O    1 
HETATM 10373 O O    . HOH N 6 .   ? 17.155  -4.556  -51.502 1.00 36.80  ? 520 HOH B O    1 
HETATM 10374 O O    . HOH N 6 .   ? 20.880  -8.809  -54.327 1.00 24.19  ? 521 HOH B O    1 
HETATM 10375 O O    . HOH N 6 .   ? 35.083  -1.045  -70.369 1.00 37.43  ? 522 HOH B O    1 
HETATM 10376 O O    . HOH N 6 .   ? 8.039   -5.563  -59.108 1.00 38.56  ? 523 HOH B O    1 
HETATM 10377 O O    . HOH N 6 .   ? 2.550   2.402   -42.196 1.00 48.20  ? 524 HOH B O    1 
HETATM 10378 O O    . HOH N 6 .   ? 15.962  -21.596 -62.643 1.00 43.02  ? 525 HOH B O    1 
HETATM 10379 O O    . HOH N 6 .   ? 22.701  -23.093 -58.026 1.00 43.03  ? 526 HOH B O    1 
HETATM 10380 O O    . HOH N 6 .   ? 17.237  0.256   -43.711 1.00 33.57  ? 527 HOH B O    1 
HETATM 10381 O O    . HOH N 6 .   ? -6.054  2.749   -64.167 1.00 44.45  ? 528 HOH B O    1 
HETATM 10382 O O    . HOH N 6 .   ? -15.339 -17.792 -45.741 1.00 38.36  ? 529 HOH B O    1 
HETATM 10383 O O    . HOH N 6 .   ? 20.931  -3.058  -45.492 1.00 28.62  ? 530 HOH B O    1 
HETATM 10384 O O    . HOH N 6 .   ? 39.615  -14.262 -56.463 1.00 29.15  ? 531 HOH B O    1 
HETATM 10385 O O    . HOH N 6 .   ? 17.527  -15.598 -45.028 1.00 25.05  ? 532 HOH B O    1 
HETATM 10386 O O    . HOH N 6 .   ? 31.224  1.987   -64.526 1.00 41.74  ? 533 HOH B O    1 
HETATM 10387 O O    . HOH N 6 .   ? 34.095  -25.270 -45.943 1.00 49.78  ? 534 HOH B O    1 
HETATM 10388 O O    . HOH N 6 .   ? 14.417  -11.939 -54.364 1.00 35.31  ? 535 HOH B O    1 
HETATM 10389 O O    . HOH N 6 .   ? 18.873  -12.544 -60.240 1.00 26.07  ? 536 HOH B O    1 
HETATM 10390 O O    . HOH N 6 .   ? 27.083  -3.704  -35.820 1.00 37.86  ? 537 HOH B O    1 
HETATM 10391 O O    . HOH N 6 .   ? -10.548 -16.520 -62.433 1.00 47.98  ? 538 HOH B O    1 
HETATM 10392 O O    . HOH N 6 .   ? 17.578  -18.007 -41.672 1.00 41.33  ? 539 HOH B O    1 
HETATM 10393 O O    . HOH N 6 .   ? 29.936  -19.675 -71.859 1.00 49.69  ? 540 HOH B O    1 
HETATM 10394 O O    . HOH N 6 .   ? 19.611  -14.833 -43.539 1.00 25.09  ? 541 HOH B O    1 
HETATM 10395 O O    . HOH N 6 .   ? 18.142  -7.343  -43.183 1.00 19.84  ? 542 HOH B O    1 
HETATM 10396 O O    . HOH N 6 .   ? 35.607  -18.010 -66.129 1.00 34.00  ? 543 HOH B O    1 
HETATM 10397 O O    . HOH N 6 .   ? 0.652   6.586   -64.238 1.00 49.59  ? 544 HOH B O    1 
HETATM 10398 O O    . HOH N 6 .   ? 26.718  -2.704  -59.238 1.00 34.57  ? 545 HOH B O    1 
HETATM 10399 O O    . HOH N 6 .   ? 13.568  -10.344 -51.991 1.00 28.52  ? 546 HOH B O    1 
HETATM 10400 O O    . HOH N 6 .   ? 39.602  9.992   -51.917 1.00 31.63  ? 547 HOH B O    1 
HETATM 10401 O O    . HOH N 6 .   ? 14.901  -10.948 -57.165 1.00 39.92  ? 548 HOH B O    1 
HETATM 10402 O O    . HOH N 6 .   ? 40.967  -1.762  -54.860 1.00 28.68  ? 549 HOH B O    1 
HETATM 10403 O O    . HOH N 6 .   ? 34.433  -24.334 -48.574 1.00 43.18  ? 550 HOH B O    1 
HETATM 10404 O O    . HOH N 6 .   ? 36.839  -14.168 -43.718 1.00 40.45  ? 551 HOH B O    1 
HETATM 10405 O O    . HOH N 6 .   ? 36.786  10.443  -50.763 1.00 31.50  ? 552 HOH B O    1 
HETATM 10406 O O    . HOH N 6 .   ? 18.063  -20.037 -61.972 1.00 36.63  ? 553 HOH B O    1 
HETATM 10407 O O    . HOH N 6 .   ? -4.934  -17.651 -44.204 1.00 34.13  ? 554 HOH B O    1 
HETATM 10408 O O    . HOH N 6 .   ? -9.900  -20.578 -44.778 1.00 40.52  ? 555 HOH B O    1 
HETATM 10409 O O    . HOH N 6 .   ? 24.187  3.478   -44.434 1.00 36.93  ? 556 HOH B O    1 
HETATM 10410 O O    . HOH N 6 .   ? -11.516 -12.380 -47.236 1.00 24.86  ? 557 HOH B O    1 
HETATM 10411 O O    . HOH N 6 .   ? 32.562  -25.468 -50.134 1.00 37.10  ? 558 HOH B O    1 
HETATM 10412 O O    . HOH N 6 .   ? 28.846  -1.831  -37.447 1.00 32.84  ? 559 HOH B O    1 
HETATM 10413 O O    . HOH N 6 .   ? 34.527  2.853   -53.268 1.00 28.12  ? 560 HOH B O    1 
HETATM 10414 O O    . HOH N 6 .   ? 7.956   4.964   -47.932 1.00 42.24  ? 561 HOH B O    1 
HETATM 10415 O O    . HOH N 6 .   ? 31.101  -6.176  -40.300 1.00 32.04  ? 562 HOH B O    1 
HETATM 10416 O O    . HOH N 6 .   ? 28.190  -18.844 -39.973 1.00 35.08  ? 563 HOH B O    1 
HETATM 10417 O O    . HOH N 6 .   ? -13.156 -15.500 -48.164 1.00 27.10  ? 564 HOH B O    1 
HETATM 10418 O O    . HOH N 6 .   ? 25.921  -5.133  -43.591 1.00 24.90  ? 565 HOH B O    1 
HETATM 10419 O O    . HOH N 6 .   ? -17.358 -3.429  -45.998 1.00 34.92  ? 566 HOH B O    1 
HETATM 10420 O O    . HOH N 6 .   ? 45.757  -14.190 -46.000 1.00 41.75  ? 567 HOH B O    1 
HETATM 10421 O O    . HOH N 6 .   ? -3.137  5.475   -42.978 1.00 34.85  ? 568 HOH B O    1 
HETATM 10422 O O    . HOH N 6 .   ? 3.139   -13.250 -70.372 1.00 45.47  ? 569 HOH B O    1 
HETATM 10423 O O    . HOH N 6 .   ? 43.396  -3.892  -64.983 1.00 34.87  ? 570 HOH B O    1 
HETATM 10424 O O    . HOH N 6 .   ? 44.496  -15.389 -43.076 1.00 35.55  ? 571 HOH B O    1 
HETATM 10425 O O    . HOH N 6 .   ? 42.424  0.182   -49.724 1.00 30.86  ? 572 HOH B O    1 
HETATM 10426 O O    . HOH N 6 .   ? 30.212  -24.603 -65.409 1.00 39.54  ? 573 HOH B O    1 
HETATM 10427 O O    . HOH N 6 .   ? 30.720  -6.101  -43.144 1.00 30.00  ? 574 HOH B O    1 
HETATM 10428 O O    . HOH N 6 .   ? -0.545  -22.266 -55.956 1.00 37.38  ? 575 HOH B O    1 
HETATM 10429 O O    . HOH N 6 .   ? 25.942  -17.462 -36.977 1.00 23.68  ? 576 HOH B O    1 
HETATM 10430 O O    . HOH N 6 .   ? 27.885  -31.002 -52.697 1.00 51.26  ? 577 HOH B O    1 
HETATM 10431 O O    . HOH N 6 .   ? 25.004  3.830   -51.390 1.00 34.52  ? 578 HOH B O    1 
HETATM 10432 O O    . HOH N 6 .   ? 31.843  -2.636  -37.633 1.00 40.65  ? 579 HOH B O    1 
HETATM 10433 O O    . HOH N 6 .   ? 19.258  -0.691  -41.530 1.00 29.98  ? 580 HOH B O    1 
HETATM 10434 O O    . HOH N 6 .   ? 19.299  -8.189  -51.971 1.00 26.83  ? 581 HOH B O    1 
HETATM 10435 O O    . HOH N 6 .   ? 4.830   3.110   -43.653 1.00 37.61  ? 582 HOH B O    1 
HETATM 10436 O O    . HOH N 6 .   ? 32.368  -20.434 -71.630 1.00 44.68  ? 583 HOH B O    1 
HETATM 10437 O O    . HOH N 6 .   ? 44.716  -18.436 -50.697 1.00 42.73  ? 584 HOH B O    1 
HETATM 10438 O O    . HOH N 6 .   ? 30.969  -14.100 -38.626 1.00 37.33  ? 585 HOH B O    1 
HETATM 10439 O O    . HOH N 6 .   ? 21.445  2.035   -51.952 1.00 37.57  ? 586 HOH B O    1 
HETATM 10440 O O    . HOH N 6 .   ? 23.736  -20.795 -44.216 1.00 37.74  ? 587 HOH B O    1 
HETATM 10441 O O    . HOH N 6 .   ? -16.457 -20.946 -47.332 1.00 48.47  ? 588 HOH B O    1 
HETATM 10442 O O    . HOH N 6 .   ? -16.973 -6.813  -51.123 1.00 38.43  ? 589 HOH B O    1 
HETATM 10443 O O    . HOH N 6 .   ? 3.624   9.448   -49.472 1.00 45.14  ? 590 HOH B O    1 
HETATM 10444 O O    . HOH N 6 .   ? 19.674  -21.543 -61.058 1.00 37.29  ? 591 HOH B O    1 
HETATM 10445 O O    . HOH N 6 .   ? 32.916  1.903   -71.673 1.00 46.90  ? 592 HOH B O    1 
HETATM 10446 O O    . HOH N 6 .   ? 32.026  -22.545 -69.412 1.00 48.45  ? 593 HOH B O    1 
HETATM 10447 O O    . HOH N 6 .   ? -8.034  5.678   -58.135 1.00 44.06  ? 594 HOH B O    1 
HETATM 10448 O O    . HOH N 6 .   ? 22.421  4.522   -45.635 1.00 41.72  ? 595 HOH B O    1 
HETATM 10449 O O    . HOH N 6 .   ? 0.591   -21.972 -51.221 1.00 38.61  ? 596 HOH B O    1 
HETATM 10450 O O    . HOH N 6 .   ? 45.335  -8.218  -56.406 1.00 42.53  ? 597 HOH B O    1 
HETATM 10451 O O    . HOH N 6 .   ? 44.752  -17.087 -46.715 1.00 48.57  ? 598 HOH B O    1 
HETATM 10452 O O    . HOH N 6 .   ? -2.780  1.798   -36.314 1.00 50.03  ? 599 HOH B O    1 
HETATM 10453 O O    . HOH N 6 .   ? -11.208 6.116   -54.712 1.00 41.77  ? 600 HOH B O    1 
HETATM 10454 O O    . HOH N 6 .   ? 36.240  2.386   -46.038 1.00 39.01  ? 601 HOH B O    1 
HETATM 10455 O O    . HOH N 6 .   ? -0.389  -19.589 -50.068 1.00 40.74  ? 602 HOH B O    1 
HETATM 10456 O O    . HOH N 6 .   ? 5.306   -26.041 -48.660 1.00 28.36  ? 603 HOH B O    1 
HETATM 10457 O O    . HOH N 6 .   ? 38.523  7.427   -48.768 1.00 54.35  ? 604 HOH B O    1 
HETATM 10458 O O    . HOH N 6 .   ? 30.168  -16.812 -38.135 1.00 44.86  ? 605 HOH B O    1 
HETATM 10459 O O    . HOH N 6 .   ? -18.104 -8.389  -49.166 1.00 31.20  ? 606 HOH B O    1 
HETATM 10460 O O    . HOH N 6 .   ? 41.003  -4.877  -69.795 1.00 40.71  ? 607 HOH B O    1 
HETATM 10461 O O    . HOH N 6 .   ? 33.065  -5.432  -44.231 1.00 35.75  ? 608 HOH B O    1 
HETATM 10462 O O    . HOH N 6 .   ? 26.711  6.528   -54.347 1.00 48.70  ? 609 HOH B O    1 
HETATM 10463 O O    . HOH N 6 .   ? 31.859  -3.516  -45.631 1.00 43.15  ? 610 HOH B O    1 
HETATM 10464 O O    . HOH N 6 .   ? 25.528  5.575   -52.539 1.00 49.91  ? 611 HOH B O    1 
HETATM 10465 O O    . HOH N 6 .   ? 25.343  -2.226  -36.791 1.00 33.06  ? 612 HOH B O    1 
HETATM 10466 O O    . HOH N 6 .   ? -16.086 -6.436  -53.491 1.00 48.21  ? 613 HOH B O    1 
HETATM 10467 O O    . HOH N 6 .   ? 24.696  -24.582 -58.039 1.00 42.92  ? 614 HOH B O    1 
HETATM 10468 O O    . HOH N 6 .   ? -9.728  7.024   -57.138 1.00 52.66  ? 615 HOH B O    1 
HETATM 10469 O O    . HOH N 6 .   ? 24.726  -23.378 -44.583 1.00 45.35  ? 616 HOH B O    1 
HETATM 10470 O O    . HOH N 6 .   ? 0.174   -24.586 -57.943 1.00 54.36  ? 617 HOH B O    1 
HETATM 10471 O O    . HOH N 6 .   ? 26.802  -23.847 -58.410 1.00 60.32  ? 618 HOH B O    1 
HETATM 10472 O O    . HOH N 6 .   ? 34.069  -21.081 -42.634 1.00 43.68  ? 619 HOH B O    1 
HETATM 10473 O O    . HOH N 6 .   ? 23.444  -1.031  -36.875 1.00 47.05  ? 620 HOH B O    1 
HETATM 10474 O O    . HOH N 6 .   ? 16.983  -23.859 -64.041 1.00 55.44  ? 621 HOH B O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   2   ALA ALA A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   LYS 5   5   5   LYS LYS A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   CYS 7   7   7   CYS CYS A . n 
A 1 8   ILE 8   8   8   ILE ILE A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  GLY 10  10  10  GLY GLY A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  ASN 13  13  13  ASN ASN A . n 
A 1 14  TRP 14  14  14  TRP TRP A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  ILE 18  18  18  ILE ILE A . n 
A 1 19  ALA 19  19  19  ALA ALA A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  ILE 21  21  21  ILE ILE A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  ASN 25  25  25  ASN ASN A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  GLN 28  28  28  GLN GLN A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  GLN 31  31  31  GLN GLN A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  ASP 33  33  33  ASP ASP A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  ARG 35  35  35  ARG ARG A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  MET 38  38  38  MET MET A . n 
A 1 39  TRP 39  39  39  TRP TRP A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  PHE 41  41  41  PHE PHE A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  ASP 44  44  44  ASP ASP A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  GLY 46  46  ?   ?   ?   A . n 
A 1 47  GLY 47  47  ?   ?   ?   A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  THR 51  51  51  THR THR A . n 
A 1 52  GLU 52  52  52  GLU GLU A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  ASN 55  55  55  ASN ASN A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  GLN 57  57  57  GLN GLN A . n 
A 1 58  HIS 58  58  58  HIS HIS A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  ASN 60  60  60  ASN ASN A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  LYS 62  62  62  LYS LYS A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  PRO 65  65  65  PRO PRO A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  HIS 67  67  67  HIS HIS A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  PRO 71  71  71  PRO PRO A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  VAL 76  76  76  VAL VAL A . n 
A 1 77  PRO 77  77  77  PRO PRO A . n 
A 1 78  ASP 78  78  78  ASP ASP A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  GLN 81  81  81  GLN GLN A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  ASP 87  87  87  ASP ASP A . n 
A 1 88  ILE 88  88  88  ILE ILE A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  PHE 91  91  91  PHE PHE A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  PRO 94  94  94  PRO PRO A . n 
A 1 95  HIS 95  95  95  HIS HIS A . n 
A 1 96  GLN 96  96  96  GLN GLN A . n 
A 1 97  PHE 97  97  97  PHE PHE A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 CYS 102 102 102 CYS CYS A . n 
A 1 103 ASP 103 103 103 ASP ASP A . n 
A 1 104 GLN 104 104 104 GLN GLN A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 HIS 108 108 108 HIS HIS A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 LYS 110 110 110 LYS LYS A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 ASN 112 112 112 ASN ASN A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 GLY 115 115 115 GLY GLY A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 ILE 119 119 119 ILE ILE A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 VAL 122 122 ?   ?   ?   A . n 
A 1 123 ASP 123 123 ?   ?   ?   A . n 
A 1 124 GLU 124 124 ?   ?   ?   A . n 
A 1 125 GLY 125 125 ?   ?   ?   A . n 
A 1 126 PRO 126 126 ?   ?   ?   A . n 
A 1 127 ASN 127 127 ?   ?   ?   A . n 
A 1 128 GLY 128 128 ?   ?   ?   A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 SER 133 133 133 SER SER A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 GLY 137 137 137 GLY GLY A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 ARG 139 139 139 ARG ARG A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 ILE 142 142 142 ILE ILE A . n 
A 1 143 PRO 143 143 143 PRO PRO A . n 
A 1 144 MET 144 144 144 MET MET A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 VAL 146 146 146 VAL VAL A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 MET 148 148 148 MET MET A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 ASN 151 151 151 ASN ASN A . n 
A 1 152 ILE 152 152 152 ILE ILE A . n 
A 1 153 ALA 153 153 153 ALA ALA A . n 
A 1 154 SER 154 154 154 SER SER A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 VAL 156 156 156 VAL VAL A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 GLU 159 159 159 GLU GLU A . n 
A 1 160 LYS 160 160 160 LYS LYS A . n 
A 1 161 PHE 161 161 161 PHE PHE A . n 
A 1 162 CYS 162 162 162 CYS CYS A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 THR 164 164 164 THR THR A . n 
A 1 165 THR 165 165 165 THR THR A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 GLY 167 167 167 GLY GLY A . n 
A 1 168 CYS 168 168 168 CYS CYS A . n 
A 1 169 LYS 169 169 169 LYS LYS A . n 
A 1 170 ASP 170 170 170 ASP ASP A . n 
A 1 171 PRO 171 171 171 PRO PRO A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 GLN 175 175 175 GLN GLN A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 LYS 178 178 178 LYS LYS A . n 
A 1 179 GLU 179 179 179 GLU GLU A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 MET 181 181 181 MET MET A . n 
A 1 182 GLN 182 182 182 GLN GLN A . n 
A 1 183 THR 183 183 183 THR THR A . n 
A 1 184 PRO 184 184 184 PRO PRO A . n 
A 1 185 ASN 185 185 185 ASN ASN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 ARG 187 187 187 ARG ARG A . n 
A 1 188 ILE 188 188 188 ILE ILE A . n 
A 1 189 THR 189 189 189 THR THR A . n 
A 1 190 VAL 190 190 190 VAL VAL A . n 
A 1 191 VAL 191 191 191 VAL VAL A . n 
A 1 192 GLN 192 192 192 GLN GLN A . n 
A 1 193 GLU 193 193 193 GLU GLU A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 ASP 195 195 195 ASP ASP A . n 
A 1 196 THR 196 196 196 THR THR A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 GLU 198 198 198 GLU GLU A . n 
A 1 199 ILE 199 199 199 ILE ILE A . n 
A 1 200 CYS 200 200 200 CYS CYS A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 LEU 203 203 203 LEU LEU A . n 
A 1 204 LYS 204 204 204 LYS LYS A . n 
A 1 205 ASN 205 205 205 ASN ASN A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 VAL 207 207 207 VAL VAL A . n 
A 1 208 ALA 208 208 208 ALA ALA A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 GLY 212 212 212 GLY GLY A . n 
A 1 213 PHE 213 213 213 PHE PHE A . n 
A 1 214 CYS 214 214 214 CYS CYS A . n 
A 1 215 ASP 215 215 215 ASP ASP A . n 
A 1 216 GLY 216 216 216 GLY GLY A . n 
A 1 217 LEU 217 217 217 LEU LEU A . n 
A 1 218 GLY 218 218 218 GLY GLY A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 GLY 220 220 220 GLY GLY A . n 
A 1 221 ASP 221 221 221 ASP ASP A . n 
A 1 222 ASN 222 222 222 ASN ASN A . n 
A 1 223 THR 223 223 223 THR THR A . n 
A 1 224 LYS 224 224 224 LYS LYS A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 ALA 226 226 226 ALA ALA A . n 
A 1 227 VAL 227 227 227 VAL VAL A . n 
A 1 228 ILE 228 228 228 ILE ILE A . n 
A 1 229 ARG 229 229 229 ARG ARG A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 GLY 231 231 231 GLY GLY A . n 
A 1 232 LEU 232 232 232 LEU LEU A . n 
A 1 233 MET 233 233 233 MET MET A . n 
A 1 234 GLU 234 234 234 GLU GLU A . n 
A 1 235 MET 235 235 235 MET MET A . n 
A 1 236 ILE 236 236 236 ILE ILE A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 PHE 238 238 238 PHE PHE A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 LYS 240 240 240 LYS LYS A . n 
A 1 241 LEU 241 241 241 LEU LEU A . n 
A 1 242 PHE 242 242 242 PHE PHE A . n 
A 1 243 CYS 243 243 243 CYS CYS A . n 
A 1 244 SER 244 244 244 SER SER A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 PRO 246 246 246 PRO PRO A . n 
A 1 247 VAL 247 247 247 VAL VAL A . n 
A 1 248 SER 248 248 248 SER SER A . n 
A 1 249 SER 249 249 249 SER SER A . n 
A 1 250 ALA 250 250 250 ALA ALA A . n 
A 1 251 THR 251 251 251 THR THR A . n 
A 1 252 PHE 252 252 252 PHE PHE A . n 
A 1 253 LEU 253 253 253 LEU LEU A . n 
A 1 254 GLU 254 254 254 GLU GLU A . n 
A 1 255 SER 255 255 255 SER SER A . n 
A 1 256 CYS 256 256 256 CYS CYS A . n 
A 1 257 GLY 257 257 257 GLY GLY A . n 
A 1 258 VAL 258 258 258 VAL VAL A . n 
A 1 259 ALA 259 259 259 ALA ALA A . n 
A 1 260 ASP 260 260 260 ASP ASP A . n 
A 1 261 LEU 261 261 261 LEU LEU A . n 
A 1 262 ILE 262 262 262 ILE ILE A . n 
A 1 263 THR 263 263 263 THR THR A . n 
A 1 264 THR 264 264 264 THR THR A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 TYR 266 266 266 TYR TYR A . n 
A 1 267 GLY 267 267 267 GLY GLY A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 ARG 269 269 269 ARG ARG A . n 
A 1 270 ASN 270 270 270 ASN ASN A . n 
A 1 271 ARG 271 271 271 ARG ARG A . n 
A 1 272 LYS 272 272 272 LYS LYS A . n 
A 1 273 VAL 273 273 273 VAL VAL A . n 
A 1 274 ALA 274 274 274 ALA ALA A . n 
A 1 275 GLU 275 275 275 GLU GLU A . n 
A 1 276 ALA 276 276 276 ALA ALA A . n 
A 1 277 PHE 277 277 277 PHE PHE A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 ARG 279 279 279 ARG ARG A . n 
A 1 280 THR 280 280 280 THR THR A . n 
A 1 281 GLY 281 281 281 GLY GLY A . n 
A 1 282 LYS 282 282 282 LYS LYS A . n 
A 1 283 SER 283 283 283 SER SER A . n 
A 1 284 ILE 284 284 284 ILE ILE A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 GLN 286 286 286 GLN GLN A . n 
A 1 287 LEU 287 287 287 LEU LEU A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 LYS 289 289 289 LYS LYS A . n 
A 1 290 GLU 290 290 290 GLU GLU A . n 
A 1 291 LEU 291 291 291 LEU LEU A . n 
A 1 292 LEU 292 292 292 LEU LEU A . n 
A 1 293 ASN 293 293 ?   ?   ?   A . n 
A 1 294 GLY 294 294 294 GLY GLY A . n 
A 1 295 GLN 295 295 295 GLN GLN A . n 
A 1 296 LYS 296 296 296 LYS LYS A . n 
A 1 297 LEU 297 297 297 LEU LEU A . n 
A 1 298 GLN 298 298 298 GLN GLN A . n 
A 1 299 GLY 299 299 299 GLY GLY A . n 
A 1 300 PRO 300 300 300 PRO PRO A . n 
A 1 301 GLU 301 301 301 GLU GLU A . n 
A 1 302 THR 302 302 302 THR THR A . n 
A 1 303 ALA 303 303 303 ALA ALA A . n 
A 1 304 ARG 304 304 304 ARG ARG A . n 
A 1 305 GLU 305 305 305 GLU GLU A . n 
A 1 306 LEU 306 306 306 LEU LEU A . n 
A 1 307 TYR 307 307 307 TYR TYR A . n 
A 1 308 SER 308 308 308 SER SER A . n 
A 1 309 ILE 309 309 309 ILE ILE A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 GLN 311 311 311 GLN GLN A . n 
A 1 312 HIS 312 312 312 HIS HIS A . n 
A 1 313 LYS 313 313 313 LYS LYS A . n 
A 1 314 GLY 314 314 314 GLY GLY A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 VAL 316 316 316 VAL VAL A . n 
A 1 317 ASP 317 317 317 ASP ASP A . n 
A 1 318 LYS 318 318 318 LYS LYS A . n 
A 1 319 PHE 319 319 319 PHE PHE A . n 
A 1 320 PRO 320 320 320 PRO PRO A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 PHE 322 322 322 PHE PHE A . n 
A 1 323 MET 323 323 323 MET MET A . n 
A 1 324 ALA 324 324 324 ALA ALA A . n 
A 1 325 VAL 325 325 325 VAL VAL A . n 
A 1 326 TYR 326 326 326 TYR TYR A . n 
A 1 327 LYS 327 327 327 LYS LYS A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 CYS 329 329 329 CYS CYS A . n 
A 1 330 TYR 330 330 330 TYR TYR A . n 
A 1 331 GLU 331 331 331 GLU GLU A . n 
A 1 332 GLY 332 332 332 GLY GLY A . n 
A 1 333 GLN 333 333 333 GLN GLN A . n 
A 1 334 PRO 334 334 334 PRO PRO A . n 
A 1 335 VAL 335 335 335 VAL VAL A . n 
A 1 336 GLY 336 336 336 GLY GLY A . n 
A 1 337 GLU 337 337 337 GLU GLU A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 ILE 339 339 339 ILE ILE A . n 
A 1 340 HIS 340 340 340 HIS HIS A . n 
A 1 341 CYS 341 341 341 CYS CYS A . n 
A 1 342 LEU 342 342 342 LEU LEU A . n 
A 1 343 GLN 343 343 343 GLN GLN A . n 
A 1 344 ASN 344 344 344 ASN ASN A . n 
A 1 345 HIS 345 345 345 HIS HIS A . n 
A 1 346 PRO 346 346 346 PRO PRO A . n 
A 1 347 GLU 347 347 347 GLU GLU A . n 
A 1 348 HIS 348 348 348 HIS HIS A . n 
A 1 349 MET 349 349 349 MET MET A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   ALA 2   2   2   ALA ALA B . n 
B 1 3   SER 3   3   3   SER SER B . n 
B 1 4   LYS 4   4   4   LYS LYS B . n 
B 1 5   LYS 5   5   5   LYS LYS B . n 
B 1 6   VAL 6   6   6   VAL VAL B . n 
B 1 7   CYS 7   7   7   CYS CYS B . n 
B 1 8   ILE 8   8   8   ILE ILE B . n 
B 1 9   VAL 9   9   9   VAL VAL B . n 
B 1 10  GLY 10  10  10  GLY GLY B . n 
B 1 11  SER 11  11  11  SER SER B . n 
B 1 12  GLY 12  12  12  GLY GLY B . n 
B 1 13  ASN 13  13  13  ASN ASN B . n 
B 1 14  TRP 14  14  14  TRP TRP B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  SER 16  16  16  SER SER B . n 
B 1 17  ALA 17  17  17  ALA ALA B . n 
B 1 18  ILE 18  18  18  ILE ILE B . n 
B 1 19  ALA 19  19  19  ALA ALA B . n 
B 1 20  LYS 20  20  20  LYS LYS B . n 
B 1 21  ILE 21  21  21  ILE ILE B . n 
B 1 22  VAL 22  22  22  VAL VAL B . n 
B 1 23  GLY 23  23  23  GLY GLY B . n 
B 1 24  GLY 24  24  24  GLY GLY B . n 
B 1 25  ASN 25  25  25  ASN ASN B . n 
B 1 26  ALA 26  26  26  ALA ALA B . n 
B 1 27  ALA 27  27  27  ALA ALA B . n 
B 1 28  GLN 28  28  28  GLN GLN B . n 
B 1 29  LEU 29  29  29  LEU LEU B . n 
B 1 30  ALA 30  30  30  ALA ALA B . n 
B 1 31  GLN 31  31  31  GLN GLN B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  ASP 33  33  33  ASP ASP B . n 
B 1 34  PRO 34  34  34  PRO PRO B . n 
B 1 35  ARG 35  35  35  ARG ARG B . n 
B 1 36  VAL 36  36  36  VAL VAL B . n 
B 1 37  THR 37  37  37  THR THR B . n 
B 1 38  MET 38  38  38  MET MET B . n 
B 1 39  TRP 39  39  39  TRP TRP B . n 
B 1 40  VAL 40  40  40  VAL VAL B . n 
B 1 41  PHE 41  41  41  PHE PHE B . n 
B 1 42  GLU 42  42  42  GLU GLU B . n 
B 1 43  GLU 43  43  43  GLU GLU B . n 
B 1 44  ASP 44  44  44  ASP ASP B . n 
B 1 45  ILE 45  45  45  ILE ILE B . n 
B 1 46  GLY 46  46  46  GLY GLY B . n 
B 1 47  GLY 47  47  47  GLY GLY B . n 
B 1 48  LYS 48  48  48  LYS LYS B . n 
B 1 49  LYS 49  49  49  LYS LYS B . n 
B 1 50  LEU 50  50  50  LEU LEU B . n 
B 1 51  THR 51  51  51  THR THR B . n 
B 1 52  GLU 52  52  52  GLU GLU B . n 
B 1 53  ILE 53  53  53  ILE ILE B . n 
B 1 54  ILE 54  54  54  ILE ILE B . n 
B 1 55  ASN 55  55  55  ASN ASN B . n 
B 1 56  THR 56  56  56  THR THR B . n 
B 1 57  GLN 57  57  57  GLN GLN B . n 
B 1 58  HIS 58  58  58  HIS HIS B . n 
B 1 59  GLU 59  59  59  GLU GLU B . n 
B 1 60  ASN 60  60  60  ASN ASN B . n 
B 1 61  VAL 61  61  61  VAL VAL B . n 
B 1 62  LYS 62  62  62  LYS LYS B . n 
B 1 63  TYR 63  63  63  TYR TYR B . n 
B 1 64  LEU 64  64  64  LEU LEU B . n 
B 1 65  PRO 65  65  65  PRO PRO B . n 
B 1 66  GLY 66  66  66  GLY GLY B . n 
B 1 67  HIS 67  67  67  HIS HIS B . n 
B 1 68  LYS 68  68  68  LYS LYS B . n 
B 1 69  LEU 69  69  69  LEU LEU B . n 
B 1 70  PRO 70  70  70  PRO PRO B . n 
B 1 71  PRO 71  71  71  PRO PRO B . n 
B 1 72  ASN 72  72  72  ASN ASN B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  VAL 74  74  74  VAL VAL B . n 
B 1 75  ALA 75  75  75  ALA ALA B . n 
B 1 76  VAL 76  76  76  VAL VAL B . n 
B 1 77  PRO 77  77  77  PRO PRO B . n 
B 1 78  ASP 78  78  78  ASP ASP B . n 
B 1 79  VAL 79  79  79  VAL VAL B . n 
B 1 80  VAL 80  80  80  VAL VAL B . n 
B 1 81  GLN 81  81  81  GLN GLN B . n 
B 1 82  ALA 82  82  82  ALA ALA B . n 
B 1 83  ALA 83  83  83  ALA ALA B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  ASP 85  85  85  ASP ASP B . n 
B 1 86  ALA 86  86  86  ALA ALA B . n 
B 1 87  ASP 87  87  87  ASP ASP B . n 
B 1 88  ILE 88  88  88  ILE ILE B . n 
B 1 89  LEU 89  89  89  LEU LEU B . n 
B 1 90  ILE 90  90  90  ILE ILE B . n 
B 1 91  PHE 91  91  91  PHE PHE B . n 
B 1 92  VAL 92  92  92  VAL VAL B . n 
B 1 93  VAL 93  93  93  VAL VAL B . n 
B 1 94  PRO 94  94  94  PRO PRO B . n 
B 1 95  HIS 95  95  95  HIS HIS B . n 
B 1 96  GLN 96  96  96  GLN GLN B . n 
B 1 97  PHE 97  97  97  PHE PHE B . n 
B 1 98  ILE 98  98  98  ILE ILE B . n 
B 1 99  GLY 99  99  99  GLY GLY B . n 
B 1 100 LYS 100 100 100 LYS LYS B . n 
B 1 101 ILE 101 101 101 ILE ILE B . n 
B 1 102 CYS 102 102 102 CYS CYS B . n 
B 1 103 ASP 103 103 103 ASP ASP B . n 
B 1 104 GLN 104 104 104 GLN GLN B . n 
B 1 105 LEU 105 105 105 LEU LEU B . n 
B 1 106 LYS 106 106 106 LYS LYS B . n 
B 1 107 GLY 107 107 107 GLY GLY B . n 
B 1 108 HIS 108 108 108 HIS HIS B . n 
B 1 109 LEU 109 109 109 LEU LEU B . n 
B 1 110 LYS 110 110 110 LYS LYS B . n 
B 1 111 ALA 111 111 111 ALA ALA B . n 
B 1 112 ASN 112 112 112 ASN ASN B . n 
B 1 113 ALA 113 113 113 ALA ALA B . n 
B 1 114 THR 114 114 114 THR THR B . n 
B 1 115 GLY 115 115 115 GLY GLY B . n 
B 1 116 ILE 116 116 116 ILE ILE B . n 
B 1 117 SER 117 117 117 SER SER B . n 
B 1 118 LEU 118 118 118 LEU LEU B . n 
B 1 119 ILE 119 119 119 ILE ILE B . n 
B 1 120 LYS 120 120 120 LYS LYS B . n 
B 1 121 GLY 121 121 ?   ?   ?   B . n 
B 1 122 VAL 122 122 ?   ?   ?   B . n 
B 1 123 ASP 123 123 ?   ?   ?   B . n 
B 1 124 GLU 124 124 ?   ?   ?   B . n 
B 1 125 GLY 125 125 ?   ?   ?   B . n 
B 1 126 PRO 126 126 ?   ?   ?   B . n 
B 1 127 ASN 127 127 ?   ?   ?   B . n 
B 1 128 GLY 128 128 128 GLY GLY B . n 
B 1 129 LEU 129 129 129 LEU LEU B . n 
B 1 130 LYS 130 130 130 LYS LYS B . n 
B 1 131 LEU 131 131 131 LEU LEU B . n 
B 1 132 ILE 132 132 132 ILE ILE B . n 
B 1 133 SER 133 133 133 SER SER B . n 
B 1 134 GLU 134 134 134 GLU GLU B . n 
B 1 135 VAL 135 135 135 VAL VAL B . n 
B 1 136 ILE 136 136 136 ILE ILE B . n 
B 1 137 GLY 137 137 137 GLY GLY B . n 
B 1 138 GLU 138 138 138 GLU GLU B . n 
B 1 139 ARG 139 139 139 ARG ARG B . n 
B 1 140 LEU 140 140 140 LEU LEU B . n 
B 1 141 GLY 141 141 141 GLY GLY B . n 
B 1 142 ILE 142 142 142 ILE ILE B . n 
B 1 143 PRO 143 143 143 PRO PRO B . n 
B 1 144 MET 144 144 144 MET MET B . n 
B 1 145 SER 145 145 145 SER SER B . n 
B 1 146 VAL 146 146 146 VAL VAL B . n 
B 1 147 LEU 147 147 147 LEU LEU B . n 
B 1 148 MET 148 148 148 MET MET B . n 
B 1 149 GLY 149 149 149 GLY GLY B . n 
B 1 150 ALA 150 150 150 ALA ALA B . n 
B 1 151 ASN 151 151 151 ASN ASN B . n 
B 1 152 ILE 152 152 152 ILE ILE B . n 
B 1 153 ALA 153 153 153 ALA ALA B . n 
B 1 154 SER 154 154 154 SER SER B . n 
B 1 155 GLU 155 155 155 GLU GLU B . n 
B 1 156 VAL 156 156 156 VAL VAL B . n 
B 1 157 ALA 157 157 157 ALA ALA B . n 
B 1 158 ASP 158 158 158 ASP ASP B . n 
B 1 159 GLU 159 159 159 GLU GLU B . n 
B 1 160 LYS 160 160 160 LYS LYS B . n 
B 1 161 PHE 161 161 161 PHE PHE B . n 
B 1 162 CYS 162 162 162 CYS CYS B . n 
B 1 163 GLU 163 163 163 GLU GLU B . n 
B 1 164 THR 164 164 164 THR THR B . n 
B 1 165 THR 165 165 165 THR THR B . n 
B 1 166 ILE 166 166 166 ILE ILE B . n 
B 1 167 GLY 167 167 167 GLY GLY B . n 
B 1 168 CYS 168 168 168 CYS CYS B . n 
B 1 169 LYS 169 169 169 LYS LYS B . n 
B 1 170 ASP 170 170 170 ASP ASP B . n 
B 1 171 PRO 171 171 171 PRO PRO B . n 
B 1 172 ALA 172 172 172 ALA ALA B . n 
B 1 173 GLN 173 173 173 GLN GLN B . n 
B 1 174 GLY 174 174 174 GLY GLY B . n 
B 1 175 GLN 175 175 175 GLN GLN B . n 
B 1 176 LEU 176 176 176 LEU LEU B . n 
B 1 177 LEU 177 177 177 LEU LEU B . n 
B 1 178 LYS 178 178 178 LYS LYS B . n 
B 1 179 GLU 179 179 179 GLU GLU B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 MET 181 181 181 MET MET B . n 
B 1 182 GLN 182 182 182 GLN GLN B . n 
B 1 183 THR 183 183 183 THR THR B . n 
B 1 184 PRO 184 184 184 PRO PRO B . n 
B 1 185 ASN 185 185 185 ASN ASN B . n 
B 1 186 PHE 186 186 186 PHE PHE B . n 
B 1 187 ARG 187 187 187 ARG ARG B . n 
B 1 188 ILE 188 188 188 ILE ILE B . n 
B 1 189 THR 189 189 189 THR THR B . n 
B 1 190 VAL 190 190 190 VAL VAL B . n 
B 1 191 VAL 191 191 191 VAL VAL B . n 
B 1 192 GLN 192 192 192 GLN GLN B . n 
B 1 193 GLU 193 193 193 GLU GLU B . n 
B 1 194 VAL 194 194 194 VAL VAL B . n 
B 1 195 ASP 195 195 195 ASP ASP B . n 
B 1 196 THR 196 196 196 THR THR B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 GLU 198 198 198 GLU GLU B . n 
B 1 199 ILE 199 199 199 ILE ILE B . n 
B 1 200 CYS 200 200 200 CYS CYS B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 ALA 202 202 202 ALA ALA B . n 
B 1 203 LEU 203 203 203 LEU LEU B . n 
B 1 204 LYS 204 204 204 LYS LYS B . n 
B 1 205 ASN 205 205 205 ASN ASN B . n 
B 1 206 VAL 206 206 206 VAL VAL B . n 
B 1 207 VAL 207 207 207 VAL VAL B . n 
B 1 208 ALA 208 208 208 ALA ALA B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 ALA 211 211 211 ALA ALA B . n 
B 1 212 GLY 212 212 212 GLY GLY B . n 
B 1 213 PHE 213 213 213 PHE PHE B . n 
B 1 214 CYS 214 214 214 CYS CYS B . n 
B 1 215 ASP 215 215 215 ASP ASP B . n 
B 1 216 GLY 216 216 216 GLY GLY B . n 
B 1 217 LEU 217 217 217 LEU LEU B . n 
B 1 218 GLY 218 218 218 GLY GLY B . n 
B 1 219 PHE 219 219 219 PHE PHE B . n 
B 1 220 GLY 220 220 220 GLY GLY B . n 
B 1 221 ASP 221 221 221 ASP ASP B . n 
B 1 222 ASN 222 222 222 ASN ASN B . n 
B 1 223 THR 223 223 223 THR THR B . n 
B 1 224 LYS 224 224 224 LYS LYS B . n 
B 1 225 ALA 225 225 225 ALA ALA B . n 
B 1 226 ALA 226 226 226 ALA ALA B . n 
B 1 227 VAL 227 227 227 VAL VAL B . n 
B 1 228 ILE 228 228 228 ILE ILE B . n 
B 1 229 ARG 229 229 229 ARG ARG B . n 
B 1 230 LEU 230 230 230 LEU LEU B . n 
B 1 231 GLY 231 231 231 GLY GLY B . n 
B 1 232 LEU 232 232 232 LEU LEU B . n 
B 1 233 MET 233 233 233 MET MET B . n 
B 1 234 GLU 234 234 234 GLU GLU B . n 
B 1 235 MET 235 235 235 MET MET B . n 
B 1 236 ILE 236 236 236 ILE ILE B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 PHE 238 238 238 PHE PHE B . n 
B 1 239 ALA 239 239 239 ALA ALA B . n 
B 1 240 LYS 240 240 240 LYS LYS B . n 
B 1 241 LEU 241 241 241 LEU LEU B . n 
B 1 242 PHE 242 242 242 PHE PHE B . n 
B 1 243 CYS 243 243 243 CYS CYS B . n 
B 1 244 SER 244 244 244 SER SER B . n 
B 1 245 GLY 245 245 245 GLY GLY B . n 
B 1 246 PRO 246 246 246 PRO PRO B . n 
B 1 247 VAL 247 247 247 VAL VAL B . n 
B 1 248 SER 248 248 248 SER SER B . n 
B 1 249 SER 249 249 249 SER SER B . n 
B 1 250 ALA 250 250 250 ALA ALA B . n 
B 1 251 THR 251 251 251 THR THR B . n 
B 1 252 PHE 252 252 252 PHE PHE B . n 
B 1 253 LEU 253 253 253 LEU LEU B . n 
B 1 254 GLU 254 254 254 GLU GLU B . n 
B 1 255 SER 255 255 255 SER SER B . n 
B 1 256 CYS 256 256 256 CYS CYS B . n 
B 1 257 GLY 257 257 257 GLY GLY B . n 
B 1 258 VAL 258 258 258 VAL VAL B . n 
B 1 259 ALA 259 259 259 ALA ALA B . n 
B 1 260 ASP 260 260 260 ASP ASP B . n 
B 1 261 LEU 261 261 261 LEU LEU B . n 
B 1 262 ILE 262 262 262 ILE ILE B . n 
B 1 263 THR 263 263 263 THR THR B . n 
B 1 264 THR 264 264 264 THR THR B . n 
B 1 265 CYS 265 265 265 CYS CYS B . n 
B 1 266 TYR 266 266 266 TYR TYR B . n 
B 1 267 GLY 267 267 267 GLY GLY B . n 
B 1 268 GLY 268 268 268 GLY GLY B . n 
B 1 269 ARG 269 269 269 ARG ARG B . n 
B 1 270 ASN 270 270 270 ASN ASN B . n 
B 1 271 ARG 271 271 271 ARG ARG B . n 
B 1 272 LYS 272 272 272 LYS LYS B . n 
B 1 273 VAL 273 273 273 VAL VAL B . n 
B 1 274 ALA 274 274 274 ALA ALA B . n 
B 1 275 GLU 275 275 275 GLU GLU B . n 
B 1 276 ALA 276 276 276 ALA ALA B . n 
B 1 277 PHE 277 277 277 PHE PHE B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 ARG 279 279 279 ARG ARG B . n 
B 1 280 THR 280 280 280 THR THR B . n 
B 1 281 GLY 281 281 281 GLY GLY B . n 
B 1 282 LYS 282 282 282 LYS LYS B . n 
B 1 283 SER 283 283 283 SER SER B . n 
B 1 284 ILE 284 284 284 ILE ILE B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 GLN 286 286 286 GLN GLN B . n 
B 1 287 LEU 287 287 287 LEU LEU B . n 
B 1 288 GLU 288 288 288 GLU GLU B . n 
B 1 289 LYS 289 289 289 LYS LYS B . n 
B 1 290 GLU 290 290 290 GLU GLU B . n 
B 1 291 LEU 291 291 291 LEU LEU B . n 
B 1 292 LEU 292 292 ?   ?   ?   B . n 
B 1 293 ASN 293 293 293 ASN ASN B . n 
B 1 294 GLY 294 294 294 GLY GLY B . n 
B 1 295 GLN 295 295 295 GLN GLN B . n 
B 1 296 LYS 296 296 296 LYS LYS B . n 
B 1 297 LEU 297 297 297 LEU LEU B . n 
B 1 298 GLN 298 298 298 GLN GLN B . n 
B 1 299 GLY 299 299 299 GLY GLY B . n 
B 1 300 PRO 300 300 300 PRO PRO B . n 
B 1 301 GLU 301 301 301 GLU GLU B . n 
B 1 302 THR 302 302 302 THR THR B . n 
B 1 303 ALA 303 303 303 ALA ALA B . n 
B 1 304 ARG 304 304 304 ARG ARG B . n 
B 1 305 GLU 305 305 305 GLU GLU B . n 
B 1 306 LEU 306 306 306 LEU LEU B . n 
B 1 307 TYR 307 307 307 TYR TYR B . n 
B 1 308 SER 308 308 308 SER SER B . n 
B 1 309 ILE 309 309 309 ILE ILE B . n 
B 1 310 LEU 310 310 310 LEU LEU B . n 
B 1 311 GLN 311 311 311 GLN GLN B . n 
B 1 312 HIS 312 312 312 HIS HIS B . n 
B 1 313 LYS 313 313 313 LYS LYS B . n 
B 1 314 GLY 314 314 314 GLY GLY B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 VAL 316 316 316 VAL VAL B . n 
B 1 317 ASP 317 317 317 ASP ASP B . n 
B 1 318 LYS 318 318 318 LYS LYS B . n 
B 1 319 PHE 319 319 319 PHE PHE B . n 
B 1 320 PRO 320 320 320 PRO PRO B . n 
B 1 321 LEU 321 321 321 LEU LEU B . n 
B 1 322 PHE 322 322 322 PHE PHE B . n 
B 1 323 MET 323 323 323 MET MET B . n 
B 1 324 ALA 324 324 324 ALA ALA B . n 
B 1 325 VAL 325 325 325 VAL VAL B . n 
B 1 326 TYR 326 326 326 TYR TYR B . n 
B 1 327 LYS 327 327 327 LYS LYS B . n 
B 1 328 VAL 328 328 328 VAL VAL B . n 
B 1 329 CYS 329 329 329 CYS CYS B . n 
B 1 330 TYR 330 330 330 TYR TYR B . n 
B 1 331 GLU 331 331 331 GLU GLU B . n 
B 1 332 GLY 332 332 332 GLY GLY B . n 
B 1 333 GLN 333 333 333 GLN GLN B . n 
B 1 334 PRO 334 334 334 PRO PRO B . n 
B 1 335 VAL 335 335 335 VAL VAL B . n 
B 1 336 GLY 336 336 336 GLY GLY B . n 
B 1 337 GLU 337 337 337 GLU GLU B . n 
B 1 338 PHE 338 338 338 PHE PHE B . n 
B 1 339 ILE 339 339 339 ILE ILE B . n 
B 1 340 HIS 340 340 340 HIS HIS B . n 
B 1 341 CYS 341 341 341 CYS CYS B . n 
B 1 342 LEU 342 342 342 LEU LEU B . n 
B 1 343 GLN 343 343 343 GLN GLN B . n 
B 1 344 ASN 344 344 344 ASN ASN B . n 
B 1 345 HIS 345 345 345 HIS HIS B . n 
B 1 346 PRO 346 346 346 PRO PRO B . n 
B 1 347 GLU 347 347 347 GLU GLU B . n 
B 1 348 HIS 348 348 348 HIS HIS B . n 
B 1 349 MET 349 349 349 MET MET B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NAD 1   401 1   NAD NAD A . 
D 3 PO4 1   402 1   PO4 PO4 A . 
E 4 EDO 1   403 1   EDO EDO A . 
F 4 EDO 1   404 4   EDO EDO A . 
G 4 EDO 1   405 5   EDO EDO A . 
H 5 K   1   406 1   K   K   A . 
I 2 NAD 1   401 2   NAD NAD B . 
J 3 PO4 1   402 2   PO4 PO4 B . 
K 4 EDO 1   403 2   EDO EDO B . 
L 5 K   1   404 2   K   K   B . 
M 6 HOH 1   501 161 HOH HOH A . 
M 6 HOH 2   502 154 HOH HOH A . 
M 6 HOH 3   503 216 HOH HOH A . 
M 6 HOH 4   504 233 HOH HOH A . 
M 6 HOH 5   505 220 HOH HOH A . 
M 6 HOH 6   506 140 HOH HOH A . 
M 6 HOH 7   507 157 HOH HOH A . 
M 6 HOH 8   508 40  HOH HOH A . 
M 6 HOH 9   509 18  HOH HOH A . 
M 6 HOH 10  510 70  HOH HOH A . 
M 6 HOH 11  511 89  HOH HOH A . 
M 6 HOH 12  512 3   HOH HOH A . 
M 6 HOH 13  513 123 HOH HOH A . 
M 6 HOH 14  514 32  HOH HOH A . 
M 6 HOH 15  515 10  HOH HOH A . 
M 6 HOH 16  516 114 HOH HOH A . 
M 6 HOH 17  517 71  HOH HOH A . 
M 6 HOH 18  518 63  HOH HOH A . 
M 6 HOH 19  519 221 HOH HOH A . 
M 6 HOH 20  520 236 HOH HOH A . 
M 6 HOH 21  521 79  HOH HOH A . 
M 6 HOH 22  522 27  HOH HOH A . 
M 6 HOH 23  523 181 HOH HOH A . 
M 6 HOH 24  524 68  HOH HOH A . 
M 6 HOH 25  525 96  HOH HOH A . 
M 6 HOH 26  526 57  HOH HOH A . 
M 6 HOH 27  527 120 HOH HOH A . 
M 6 HOH 28  528 169 HOH HOH A . 
M 6 HOH 29  529 150 HOH HOH A . 
M 6 HOH 30  530 212 HOH HOH A . 
M 6 HOH 31  531 228 HOH HOH A . 
M 6 HOH 32  532 127 HOH HOH A . 
M 6 HOH 33  533 102 HOH HOH A . 
M 6 HOH 34  534 205 HOH HOH A . 
M 6 HOH 35  535 5   HOH HOH A . 
M 6 HOH 36  536 173 HOH HOH A . 
M 6 HOH 37  537 56  HOH HOH A . 
M 6 HOH 38  538 72  HOH HOH A . 
M 6 HOH 39  539 119 HOH HOH A . 
M 6 HOH 40  540 175 HOH HOH A . 
M 6 HOH 41  541 47  HOH HOH A . 
M 6 HOH 42  542 73  HOH HOH A . 
M 6 HOH 43  543 62  HOH HOH A . 
M 6 HOH 44  544 217 HOH HOH A . 
M 6 HOH 45  545 21  HOH HOH A . 
M 6 HOH 46  546 1   HOH HOH A . 
M 6 HOH 47  547 34  HOH HOH A . 
M 6 HOH 48  548 20  HOH HOH A . 
M 6 HOH 49  549 218 HOH HOH A . 
M 6 HOH 50  550 186 HOH HOH A . 
M 6 HOH 51  551 26  HOH HOH A . 
M 6 HOH 52  552 166 HOH HOH A . 
M 6 HOH 53  553 49  HOH HOH A . 
M 6 HOH 54  554 126 HOH HOH A . 
M 6 HOH 55  555 97  HOH HOH A . 
M 6 HOH 56  556 206 HOH HOH A . 
M 6 HOH 57  557 100 HOH HOH A . 
M 6 HOH 58  558 112 HOH HOH