data_6EBT
# 
_entry.id   6EBT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.313 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6EBT         
WWPDB D_1000234001 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6EBT 
_pdbx_database_status.recvd_initial_deposition_date   2018-08-07 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Ajalla, M.A.A.' 1 ? 
'Nonato, M.C.'   2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Crystal structure of recombinant mutant N107T of human fumarase' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ajalla, M.A.A.' 1 ? 
primary 'Nonato, M.C.'   2 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6EBT 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     188.816 
_cell.length_a_esd                 ? 
_cell.length_b                     188.816 
_cell.length_b_esd                 ? 
_cell.length_c                     114.145 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        24 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6EBT 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Fumarate hydratase, mitochondrial' 50126.395 2   4.2.1.2 N107T ? ? 
2 non-polymer syn GLYCEROL                            92.094    5   ?       ?     ? ? 
3 water       nat water                               18.015    488 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Fumarase 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ASQNSFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVTQDYGLDPKIANAIMKAA
DEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVH
EVLLPGLQKLHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVGTGLN
TRIGFAEKVAAKVAALTGLPFVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPG
SSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVVGIQANTER
INKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ASQNSFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVTQDYGLDPKIANAIMKAA
DEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVH
EVLLPGLQKLHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVGTGLN
TRIGFAEKVAAKVAALTGLPFVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPG
SSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVVGIQANTER
INKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   SER n 
1 3   GLN n 
1 4   ASN n 
1 5   SER n 
1 6   PHE n 
1 7   ARG n 
1 8   ILE n 
1 9   GLU n 
1 10  TYR n 
1 11  ASP n 
1 12  THR n 
1 13  PHE n 
1 14  GLY n 
1 15  GLU n 
1 16  LEU n 
1 17  LYS n 
1 18  VAL n 
1 19  PRO n 
1 20  ASN n 
1 21  ASP n 
1 22  LYS n 
1 23  TYR n 
1 24  TYR n 
1 25  GLY n 
1 26  ALA n 
1 27  GLN n 
1 28  THR n 
1 29  VAL n 
1 30  ARG n 
1 31  SER n 
1 32  THR n 
1 33  MET n 
1 34  ASN n 
1 35  PHE n 
1 36  LYS n 
1 37  ILE n 
1 38  GLY n 
1 39  GLY n 
1 40  VAL n 
1 41  THR n 
1 42  GLU n 
1 43  ARG n 
1 44  MET n 
1 45  PRO n 
1 46  THR n 
1 47  PRO n 
1 48  VAL n 
1 49  ILE n 
1 50  LYS n 
1 51  ALA n 
1 52  PHE n 
1 53  GLY n 
1 54  ILE n 
1 55  LEU n 
1 56  LYS n 
1 57  ARG n 
1 58  ALA n 
1 59  ALA n 
1 60  ALA n 
1 61  GLU n 
1 62  VAL n 
1 63  THR n 
1 64  GLN n 
1 65  ASP n 
1 66  TYR n 
1 67  GLY n 
1 68  LEU n 
1 69  ASP n 
1 70  PRO n 
1 71  LYS n 
1 72  ILE n 
1 73  ALA n 
1 74  ASN n 
1 75  ALA n 
1 76  ILE n 
1 77  MET n 
1 78  LYS n 
1 79  ALA n 
1 80  ALA n 
1 81  ASP n 
1 82  GLU n 
1 83  VAL n 
1 84  ALA n 
1 85  GLU n 
1 86  GLY n 
1 87  LYS n 
1 88  LEU n 
1 89  ASN n 
1 90  ASP n 
1 91  HIS n 
1 92  PHE n 
1 93  PRO n 
1 94  LEU n 
1 95  VAL n 
1 96  VAL n 
1 97  TRP n 
1 98  GLN n 
1 99  THR n 
1 100 GLY n 
1 101 SER n 
1 102 GLY n 
1 103 THR n 
1 104 GLN n 
1 105 THR n 
1 106 ASN n 
1 107 MET n 
1 108 ASN n 
1 109 VAL n 
1 110 ASN n 
1 111 GLU n 
1 112 VAL n 
1 113 ILE n 
1 114 SER n 
1 115 ASN n 
1 116 ARG n 
1 117 ALA n 
1 118 ILE n 
1 119 GLU n 
1 120 MET n 
1 121 LEU n 
1 122 GLY n 
1 123 GLY n 
1 124 GLU n 
1 125 LEU n 
1 126 GLY n 
1 127 SER n 
1 128 LYS n 
1 129 ILE n 
1 130 PRO n 
1 131 VAL n 
1 132 HIS n 
1 133 PRO n 
1 134 ASN n 
1 135 ASP n 
1 136 HIS n 
1 137 VAL n 
1 138 ASN n 
1 139 LYS n 
1 140 SER n 
1 141 GLN n 
1 142 SER n 
1 143 SER n 
1 144 ASN n 
1 145 ASP n 
1 146 THR n 
1 147 PHE n 
1 148 PRO n 
1 149 THR n 
1 150 ALA n 
1 151 MET n 
1 152 HIS n 
1 153 ILE n 
1 154 ALA n 
1 155 ALA n 
1 156 ALA n 
1 157 ILE n 
1 158 GLU n 
1 159 VAL n 
1 160 HIS n 
1 161 GLU n 
1 162 VAL n 
1 163 LEU n 
1 164 LEU n 
1 165 PRO n 
1 166 GLY n 
1 167 LEU n 
1 168 GLN n 
1 169 LYS n 
1 170 LEU n 
1 171 HIS n 
1 172 ASP n 
1 173 ALA n 
1 174 LEU n 
1 175 ASP n 
1 176 ALA n 
1 177 LYS n 
1 178 SER n 
1 179 LYS n 
1 180 GLU n 
1 181 PHE n 
1 182 ALA n 
1 183 GLN n 
1 184 ILE n 
1 185 ILE n 
1 186 LYS n 
1 187 ILE n 
1 188 GLY n 
1 189 ARG n 
1 190 THR n 
1 191 HIS n 
1 192 THR n 
1 193 GLN n 
1 194 ASP n 
1 195 ALA n 
1 196 VAL n 
1 197 PRO n 
1 198 LEU n 
1 199 THR n 
1 200 LEU n 
1 201 GLY n 
1 202 GLN n 
1 203 GLU n 
1 204 PHE n 
1 205 SER n 
1 206 GLY n 
1 207 TYR n 
1 208 VAL n 
1 209 GLN n 
1 210 GLN n 
1 211 VAL n 
1 212 LYS n 
1 213 TYR n 
1 214 ALA n 
1 215 MET n 
1 216 THR n 
1 217 ARG n 
1 218 ILE n 
1 219 LYS n 
1 220 ALA n 
1 221 ALA n 
1 222 MET n 
1 223 PRO n 
1 224 ARG n 
1 225 ILE n 
1 226 TYR n 
1 227 GLU n 
1 228 LEU n 
1 229 ALA n 
1 230 ALA n 
1 231 GLY n 
1 232 GLY n 
1 233 THR n 
1 234 ALA n 
1 235 VAL n 
1 236 GLY n 
1 237 THR n 
1 238 GLY n 
1 239 LEU n 
1 240 ASN n 
1 241 THR n 
1 242 ARG n 
1 243 ILE n 
1 244 GLY n 
1 245 PHE n 
1 246 ALA n 
1 247 GLU n 
1 248 LYS n 
1 249 VAL n 
1 250 ALA n 
1 251 ALA n 
1 252 LYS n 
1 253 VAL n 
1 254 ALA n 
1 255 ALA n 
1 256 LEU n 
1 257 THR n 
1 258 GLY n 
1 259 LEU n 
1 260 PRO n 
1 261 PHE n 
1 262 VAL n 
1 263 THR n 
1 264 ALA n 
1 265 PRO n 
1 266 ASN n 
1 267 LYS n 
1 268 PHE n 
1 269 GLU n 
1 270 ALA n 
1 271 LEU n 
1 272 ALA n 
1 273 ALA n 
1 274 HIS n 
1 275 ASP n 
1 276 ALA n 
1 277 LEU n 
1 278 VAL n 
1 279 GLU n 
1 280 LEU n 
1 281 SER n 
1 282 GLY n 
1 283 ALA n 
1 284 MET n 
1 285 ASN n 
1 286 THR n 
1 287 THR n 
1 288 ALA n 
1 289 CYS n 
1 290 SER n 
1 291 LEU n 
1 292 MET n 
1 293 LYS n 
1 294 ILE n 
1 295 ALA n 
1 296 ASN n 
1 297 ASP n 
1 298 ILE n 
1 299 ARG n 
1 300 PHE n 
1 301 LEU n 
1 302 GLY n 
1 303 SER n 
1 304 GLY n 
1 305 PRO n 
1 306 ARG n 
1 307 SER n 
1 308 GLY n 
1 309 LEU n 
1 310 GLY n 
1 311 GLU n 
1 312 LEU n 
1 313 ILE n 
1 314 LEU n 
1 315 PRO n 
1 316 GLU n 
1 317 ASN n 
1 318 GLU n 
1 319 PRO n 
1 320 GLY n 
1 321 SER n 
1 322 SER n 
1 323 ILE n 
1 324 MET n 
1 325 PRO n 
1 326 GLY n 
1 327 LYS n 
1 328 VAL n 
1 329 ASN n 
1 330 PRO n 
1 331 THR n 
1 332 GLN n 
1 333 CYS n 
1 334 GLU n 
1 335 ALA n 
1 336 MET n 
1 337 THR n 
1 338 MET n 
1 339 VAL n 
1 340 ALA n 
1 341 ALA n 
1 342 GLN n 
1 343 VAL n 
1 344 MET n 
1 345 GLY n 
1 346 ASN n 
1 347 HIS n 
1 348 VAL n 
1 349 ALA n 
1 350 VAL n 
1 351 THR n 
1 352 VAL n 
1 353 GLY n 
1 354 GLY n 
1 355 SER n 
1 356 ASN n 
1 357 GLY n 
1 358 HIS n 
1 359 PHE n 
1 360 GLU n 
1 361 LEU n 
1 362 ASN n 
1 363 VAL n 
1 364 PHE n 
1 365 LYS n 
1 366 PRO n 
1 367 MET n 
1 368 MET n 
1 369 ILE n 
1 370 LYS n 
1 371 ASN n 
1 372 VAL n 
1 373 LEU n 
1 374 HIS n 
1 375 SER n 
1 376 ALA n 
1 377 ARG n 
1 378 LEU n 
1 379 LEU n 
1 380 GLY n 
1 381 ASP n 
1 382 ALA n 
1 383 SER n 
1 384 VAL n 
1 385 SER n 
1 386 PHE n 
1 387 THR n 
1 388 GLU n 
1 389 ASN n 
1 390 CYS n 
1 391 VAL n 
1 392 VAL n 
1 393 GLY n 
1 394 ILE n 
1 395 GLN n 
1 396 ALA n 
1 397 ASN n 
1 398 THR n 
1 399 GLU n 
1 400 ARG n 
1 401 ILE n 
1 402 ASN n 
1 403 LYS n 
1 404 LEU n 
1 405 MET n 
1 406 ASN n 
1 407 GLU n 
1 408 SER n 
1 409 LEU n 
1 410 MET n 
1 411 LEU n 
1 412 VAL n 
1 413 THR n 
1 414 ALA n 
1 415 LEU n 
1 416 ASN n 
1 417 PRO n 
1 418 HIS n 
1 419 ILE n 
1 420 GLY n 
1 421 TYR n 
1 422 ASP n 
1 423 LYS n 
1 424 ALA n 
1 425 ALA n 
1 426 LYS n 
1 427 ILE n 
1 428 ALA n 
1 429 LYS n 
1 430 THR n 
1 431 ALA n 
1 432 HIS n 
1 433 LYS n 
1 434 ASN n 
1 435 GLY n 
1 436 SER n 
1 437 THR n 
1 438 LEU n 
1 439 LYS n 
1 440 GLU n 
1 441 THR n 
1 442 ALA n 
1 443 ILE n 
1 444 GLU n 
1 445 LEU n 
1 446 GLY n 
1 447 TYR n 
1 448 LEU n 
1 449 THR n 
1 450 ALA n 
1 451 GLU n 
1 452 GLN n 
1 453 PHE n 
1 454 ASP n 
1 455 GLU n 
1 456 TRP n 
1 457 VAL n 
1 458 LYS n 
1 459 PRO n 
1 460 LYS n 
1 461 ASP n 
1 462 MET n 
1 463 LEU n 
1 464 GLY n 
1 465 PRO n 
1 466 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   466 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 FH 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   'pET28a modified vector' 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a-SUMO 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FUMH_HUMAN 
_struct_ref.pdbx_db_accession          P07954 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ASQNSFRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAA
DEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKIPVHPNDHVNKSQSSNDTFPTAMHIAAAIEVH
EVLLPGLQKLHDALDAKSKEFAQIIKIGRTHTQDAVPLTLGQEFSGYVQQVKYAMTRIKAAMPRIYELAAGGTAVGTGLN
TRIGFAEKVAAKVAALTGLPFVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEPG
SSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLLGDASVSFTENCVVGIQANTER
INKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK
;
_struct_ref.pdbx_align_begin           45 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6EBT A 1 ? 466 ? P07954 45 ? 510 ? 45 510 
2 1 6EBT B 1 ? 466 ? P07954 45 ? 510 ? 45 510 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6EBT THR A 63 ? UNP P07954 ASN 107 'engineered mutation' 107 1 
2 6EBT THR B 63 ? UNP P07954 ASN 107 'engineered mutation' 107 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6EBT 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.93 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         58.01 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;0.2 M HEPES
16% (m/v) PEG 10000
;
_exptl_crystal_grow.pdbx_pH_range   7.5 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'PSI PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-02-09 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'channel cut cryogenically cooled monochromator crystal' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9786 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SOLEIL BEAMLINE PROXIMA 1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9786 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   'PROXIMA 1' 
_diffrn_source.pdbx_synchrotron_site       SOLEIL 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6EBT 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.3 
_reflns.d_resolution_low                 94.1 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       53547 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  12.8 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.4 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.30 
_reflns_shell.d_res_low                   2.37 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6EBT 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.300 
_refine.ls_d_res_low                             93.597 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     53492 
_refine.ls_number_reflns_R_free                  2656 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.97 
_refine.ls_percent_reflns_R_free                 4.97 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1520 
_refine.ls_R_factor_R_free                       0.1854 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1502 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5UPP 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 15.38 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.21 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6883 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             488 
_refine_hist.number_atoms_total               7401 
_refine_hist.d_res_high                       2.300 
_refine_hist.d_res_low                        93.597 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.002 ? 7084 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.526 ? 9619 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 9.498 ? 4278 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.039 ? 1117 ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003 ? 1260 ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.3000 2.3418  . . 126 2625 100.00 . . . 0.2645 . 0.2034 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3418 2.3869  . . 141 2641 100.00 . . . 0.2106 . 0.1887 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3869 2.4356  . . 136 2624 100.00 . . . 0.2645 . 0.1814 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4356 2.4886  . . 147 2635 100.00 . . . 0.2518 . 0.1797 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4886 2.5465  . . 158 2619 100.00 . . . 0.2425 . 0.1714 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5465 2.6102  . . 152 2604 100.00 . . . 0.2116 . 0.1598 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6102 2.6807  . . 120 2669 100.00 . . . 0.1946 . 0.1484 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6807 2.7596  . . 159 2627 100.00 . . . 0.2019 . 0.1477 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7596 2.8487  . . 135 2655 100.00 . . . 0.1996 . 0.1466 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8487 2.9505  . . 127 2668 100.00 . . . 0.2062 . 0.1449 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9505 3.0687  . . 130 2670 100.00 . . . 0.1781 . 0.1489 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0687 3.2083  . . 123 2681 100.00 . . . 0.2038 . 0.1404 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2083 3.3775  . . 135 2664 100.00 . . . 0.1603 . 0.1419 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3775 3.5891  . . 145 2672 100.00 . . . 0.1840 . 0.1337 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5891 3.8662  . . 137 2696 100.00 . . . 0.1567 . 0.1314 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8662 4.2553  . . 136 2704 100.00 . . . 0.1432 . 0.1167 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2553 4.8710  . . 151 2711 100.00 . . . 0.1379 . 0.1154 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.8710 6.1368  . . 129 2778 100.00 . . . 0.1780 . 0.1680 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.1368 93.6744 . . 169 2893 100.00 . . . 0.1774 . 0.1862 . . . . . . . . . . 
# 
_struct.entry_id                     6EBT 
_struct.title                        'Crystal structure of recombinant mutant N107T of human fumarase' 
_struct.pdbx_descriptor              'Fumarate hydratase, mitochondrial (E.C.4.2.1.2)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6EBT 
_struct_keywords.text            'HsFH, fumarate hydratase, LYASE' 
_struct_keywords.pdbx_keywords   LYASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
I N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 25  ? PHE A 35  ? GLY A 69  PHE A 79  1 ? 11 
HELX_P HELX_P2  AA2 GLY A 39  ? ARG A 43  ? GLY A 83  ARG A 87  5 ? 5  
HELX_P HELX_P3  AA3 PRO A 45  ? GLN A 64  ? PRO A 89  GLN A 108 1 ? 20 
HELX_P HELX_P4  AA4 ASP A 65  ? GLY A 67  ? ASP A 109 GLY A 111 5 ? 3  
HELX_P HELX_P5  AA5 ASP A 69  ? GLU A 85  ? ASP A 113 GLU A 129 1 ? 17 
HELX_P HELX_P6  AA6 LEU A 88  ? PHE A 92  ? LEU A 132 PHE A 136 5 ? 5  
HELX_P HELX_P7  AA7 GLY A 102 ? LEU A 121 ? GLY A 146 LEU A 165 1 ? 20 
HELX_P HELX_P8  AA8 SER A 142 ? VAL A 162 ? SER A 186 VAL A 206 1 ? 21 
HELX_P HELX_P9  AA9 VAL A 162 ? PHE A 181 ? VAL A 206 PHE A 225 1 ? 20 
HELX_P HELX_P10 AB1 LEU A 200 ? ALA A 221 ? LEU A 244 ALA A 265 1 ? 22 
HELX_P HELX_P11 AB2 GLY A 244 ? GLY A 258 ? GLY A 288 GLY A 302 1 ? 15 
HELX_P HELX_P12 AB3 ASN A 266 ? ALA A 273 ? ASN A 310 ALA A 317 1 ? 8  
HELX_P HELX_P13 AB4 HIS A 274 ? GLY A 302 ? HIS A 318 GLY A 346 1 ? 29 
HELX_P HELX_P14 AB5 PRO A 330 ? ASN A 356 ? PRO A 374 ASN A 400 1 ? 27 
HELX_P HELX_P15 AB6 PHE A 364 ? ASN A 389 ? PHE A 408 ASN A 433 1 ? 26 
HELX_P HELX_P16 AB7 CYS A 390 ? ILE A 394 ? CYS A 434 ILE A 438 5 ? 5  
HELX_P HELX_P17 AB8 ASN A 397 ? SER A 408 ? ASN A 441 SER A 452 1 ? 12 
HELX_P HELX_P18 AB9 LEU A 409 ? ALA A 414 ? LEU A 453 ALA A 458 5 ? 6  
HELX_P HELX_P19 AC1 LEU A 415 ? GLY A 420 ? LEU A 459 GLY A 464 1 ? 6  
HELX_P HELX_P20 AC2 GLY A 420 ? GLY A 435 ? GLY A 464 GLY A 479 1 ? 16 
HELX_P HELX_P21 AC3 THR A 437 ? LEU A 445 ? THR A 481 LEU A 489 1 ? 9  
HELX_P HELX_P22 AC4 THR A 449 ? VAL A 457 ? THR A 493 VAL A 501 1 ? 9  
HELX_P HELX_P23 AC5 LYS A 458 ? MET A 462 ? LYS A 502 MET A 506 5 ? 5  
HELX_P HELX_P24 AC6 GLY B 25  ? PHE B 35  ? GLY B 69  PHE B 79  1 ? 11 
HELX_P HELX_P25 AC7 GLY B 39  ? ARG B 43  ? GLY B 83  ARG B 87  5 ? 5  
HELX_P HELX_P26 AC8 PRO B 45  ? GLN B 64  ? PRO B 89  GLN B 108 1 ? 20 
HELX_P HELX_P27 AC9 ASP B 65  ? GLY B 67  ? ASP B 109 GLY B 111 5 ? 3  
HELX_P HELX_P28 AD1 ASP B 69  ? GLU B 85  ? ASP B 113 GLU B 129 1 ? 17 
HELX_P HELX_P29 AD2 LEU B 88  ? PHE B 92  ? LEU B 132 PHE B 136 5 ? 5  
HELX_P HELX_P30 AD3 GLY B 102 ? LEU B 121 ? GLY B 146 LEU B 165 1 ? 20 
HELX_P HELX_P31 AD4 ASP B 145 ? VAL B 162 ? ASP B 189 VAL B 206 1 ? 18 
HELX_P HELX_P32 AD5 VAL B 162 ? PHE B 181 ? VAL B 206 PHE B 225 1 ? 20 
HELX_P HELX_P33 AD6 LEU B 200 ? ALA B 221 ? LEU B 244 ALA B 265 1 ? 22 
HELX_P HELX_P34 AD7 GLY B 244 ? GLY B 258 ? GLY B 288 GLY B 302 1 ? 15 
HELX_P HELX_P35 AD8 ASN B 266 ? ALA B 273 ? ASN B 310 ALA B 317 1 ? 8  
HELX_P HELX_P36 AD9 HIS B 274 ? GLY B 302 ? HIS B 318 GLY B 346 1 ? 29 
HELX_P HELX_P37 AE1 PRO B 330 ? ASN B 356 ? PRO B 374 ASN B 400 1 ? 27 
HELX_P HELX_P38 AE2 PHE B 364 ? CYS B 390 ? PHE B 408 CYS B 434 1 ? 27 
HELX_P HELX_P39 AE3 VAL B 391 ? ILE B 394 ? VAL B 435 ILE B 438 5 ? 4  
HELX_P HELX_P40 AE4 ASN B 397 ? SER B 408 ? ASN B 441 SER B 452 1 ? 12 
HELX_P HELX_P41 AE5 LEU B 409 ? ALA B 414 ? LEU B 453 ALA B 458 5 ? 6  
HELX_P HELX_P42 AE6 LEU B 415 ? GLY B 420 ? LEU B 459 GLY B 464 1 ? 6  
HELX_P HELX_P43 AE7 GLY B 420 ? GLY B 435 ? GLY B 464 GLY B 479 1 ? 16 
HELX_P HELX_P44 AE8 THR B 437 ? LEU B 445 ? THR B 481 LEU B 489 1 ? 9  
HELX_P HELX_P45 AE9 THR B 449 ? VAL B 457 ? THR B 493 VAL B 501 1 ? 9  
HELX_P HELX_P46 AF1 LYS B 458 ? MET B 462 ? LYS B 502 MET B 506 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ILE 129 A . ? ILE 173 A PRO 130 A ? PRO 174 A 1 -1.07 
2 GLY 304 A . ? GLY 348 A PRO 305 A ? PRO 349 A 1 5.00  
3 ILE 129 B . ? ILE 173 B PRO 130 B ? PRO 174 B 1 -4.09 
4 GLY 304 B . ? GLY 348 B PRO 305 B ? PRO 349 B 1 6.86  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? parallel      
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? parallel      
AA8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 6   ? ASP A 11  ? PHE A 50  ASP A 55  
AA1 2 GLY A 14  ? PRO A 19  ? GLY A 58  PRO A 63  
AA2 1 ILE A 185 ? THR A 190 ? ILE A 229 THR A 234 
AA2 2 GLN A 193 ? THR A 199 ? GLN A 237 THR A 243 
AA3 1 GLU A 227 ? LEU A 228 ? GLU A 271 LEU A 272 
AA3 2 VAL A 262 ? THR A 263 ? VAL A 306 THR A 307 
AA4 1 LEU A 312 ? ILE A 313 ? LEU A 356 ILE A 357 
AA4 2 GLN A 395 ? ALA A 396 ? GLN A 439 ALA A 440 
AA5 1 PHE B 6   ? ASP B 11  ? PHE B 50  ASP B 55  
AA5 2 GLY B 14  ? PRO B 19  ? GLY B 58  PRO B 63  
AA6 1 ILE B 185 ? THR B 190 ? ILE B 229 THR B 234 
AA6 2 GLN B 193 ? THR B 199 ? GLN B 237 THR B 243 
AA7 1 GLU B 227 ? LEU B 228 ? GLU B 271 LEU B 272 
AA7 2 VAL B 262 ? THR B 263 ? VAL B 306 THR B 307 
AA8 1 LEU B 312 ? ILE B 313 ? LEU B 356 ILE B 357 
AA8 2 GLN B 395 ? ALA B 396 ? GLN B 439 ALA B 440 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 9   ? N GLU A 53  O LEU A 16  ? O LEU A 60  
AA2 1 2 N GLY A 188 ? N GLY A 232 O ALA A 195 ? O ALA A 239 
AA3 1 2 N LEU A 228 ? N LEU A 272 O VAL A 262 ? O VAL A 306 
AA4 1 2 N ILE A 313 ? N ILE A 357 O GLN A 395 ? O GLN A 439 
AA5 1 2 N ARG B 7   ? N ARG B 51  O VAL B 18  ? O VAL B 62  
AA6 1 2 N LYS B 186 ? N LYS B 230 O LEU B 198 ? O LEU B 242 
AA7 1 2 N LEU B 228 ? N LEU B 272 O VAL B 262 ? O VAL B 306 
AA8 1 2 N ILE B 313 ? N ILE B 357 O GLN B 395 ? O GLN B 439 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A GOL 601 ? 4 'binding site for residue GOL A 601' 
AC2 Software A GOL 602 ? 3 'binding site for residue GOL A 602' 
AC3 Software B GOL 601 ? 2 'binding site for residue GOL B 601' 
AC4 Software B GOL 602 ? 5 'binding site for residue GOL B 602' 
AC5 Software B GOL 603 ? 3 'binding site for residue GOL B 603' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 GLY A 39  ? GLY A 83  . ? 1_555  ? 
2  AC1 4 VAL A 40  ? VAL A 84  . ? 1_555  ? 
3  AC1 4 ARG A 377 ? ARG A 421 . ? 12_544 ? 
4  AC1 4 HOH H .   ? HOH A 806 . ? 1_555  ? 
5  AC2 3 SER A 142 ? SER A 186 . ? 1_555  ? 
6  AC2 3 SER A 143 ? SER A 187 . ? 1_555  ? 
7  AC2 3 HOH H .   ? HOH A 859 . ? 1_555  ? 
8  AC3 2 GLU B 85  ? GLU B 129 . ? 1_555  ? 
9  AC3 2 HOH I .   ? HOH B 779 . ? 1_555  ? 
10 AC4 5 ALA B 251 ? ALA B 295 . ? 1_555  ? 
11 AC4 5 LYS B 252 ? LYS B 296 . ? 1_555  ? 
12 AC4 5 THR B 263 ? THR B 307 . ? 9_555  ? 
13 AC4 5 HOH I .   ? HOH B 704 . ? 1_555  ? 
14 AC4 5 HOH I .   ? HOH B 800 . ? 1_555  ? 
15 AC5 3 GLY B 39  ? GLY B 83  . ? 1_555  ? 
16 AC5 3 VAL B 40  ? VAL B 84  . ? 1_555  ? 
17 AC5 3 ARG B 377 ? ARG B 421 . ? 12_544 ? 
# 
_atom_sites.entry_id                    6EBT 
_atom_sites.fract_transf_matrix[1][1]   0.005296 
_atom_sites.fract_transf_matrix[1][2]   0.003058 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006115 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008761 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . SER A 1 5   ? 106.269 -63.584  -9.491  1.00 40.47  ? 49  SER A N    1 
ATOM   2     C CA   . SER A 1 5   ? 107.032 -64.594  -8.767  1.00 52.57  ? 49  SER A CA   1 
ATOM   3     C C    . SER A 1 5   ? 106.112 -65.658  -8.181  1.00 51.97  ? 49  SER A C    1 
ATOM   4     O O    . SER A 1 5   ? 104.961 -65.380  -7.845  1.00 49.24  ? 49  SER A O    1 
ATOM   5     C CB   . SER A 1 5   ? 107.858 -63.947  -7.656  1.00 55.17  ? 49  SER A CB   1 
ATOM   6     O OG   . SER A 1 5   ? 108.477 -64.932  -6.847  1.00 61.47  ? 49  SER A OG   1 
ATOM   7     H HA   . SER A 1 5   ? 107.643 -65.030  -9.382  1.00 63.08  ? 49  SER A HA   1 
ATOM   8     H HB2  . SER A 1 5   ? 108.544 -63.390  -8.056  1.00 66.21  ? 49  SER A HB2  1 
ATOM   9     H HB3  . SER A 1 5   ? 107.273 -63.406  -7.103  1.00 66.21  ? 49  SER A HB3  1 
ATOM   10    H HG   . SER A 1 5   ? 108.928 -64.564  -6.240  1.00 73.77  ? 49  SER A HG   1 
ATOM   11    N N    . PHE A 1 6   ? 106.632 -66.876  -8.055  1.00 55.91  ? 50  PHE A N    1 
ATOM   12    C CA   . PHE A 1 6   ? 105.844 -68.002  -7.579  1.00 51.41  ? 50  PHE A CA   1 
ATOM   13    C C    . PHE A 1 6   ? 106.734 -68.927  -6.763  1.00 41.32  ? 50  PHE A C    1 
ATOM   14    O O    . PHE A 1 6   ? 107.960 -68.916  -6.892  1.00 50.70  ? 50  PHE A O    1 
ATOM   15    C CB   . PHE A 1 6   ? 105.213 -68.774  -8.744  1.00 47.46  ? 50  PHE A CB   1 
ATOM   16    C CG   . PHE A 1 6   ? 106.211 -69.248  -9.764  1.00 58.56  ? 50  PHE A CG   1 
ATOM   17    C CD1  . PHE A 1 6   ? 106.977 -70.380  -9.533  1.00 58.02  ? 50  PHE A CD1  1 
ATOM   18    C CD2  . PHE A 1 6   ? 106.385 -68.560  -10.953 1.00 61.72  ? 50  PHE A CD2  1 
ATOM   19    C CE1  . PHE A 1 6   ? 107.898 -70.815  -10.467 1.00 54.69  ? 50  PHE A CE1  1 
ATOM   20    C CE2  . PHE A 1 6   ? 107.303 -68.992  -11.893 1.00 48.02  ? 50  PHE A CE2  1 
ATOM   21    C CZ   . PHE A 1 6   ? 108.061 -70.121  -11.649 1.00 52.54  ? 50  PHE A CZ   1 
ATOM   22    H H    . PHE A 1 6   ? 107.447 -67.076  -8.241  1.00 67.09  ? 50  PHE A H    1 
ATOM   23    H HA   . PHE A 1 6   ? 105.132 -67.678  -7.005  1.00 61.69  ? 50  PHE A HA   1 
ATOM   24    H HB2  . PHE A 1 6   ? 104.755 -69.553  -8.392  1.00 56.95  ? 50  PHE A HB2  1 
ATOM   25    H HB3  . PHE A 1 6   ? 104.579 -68.195  -9.196  1.00 56.95  ? 50  PHE A HB3  1 
ATOM   26    H HD1  . PHE A 1 6   ? 106.872 -70.851  -8.738  1.00 69.63  ? 50  PHE A HD1  1 
ATOM   27    H HD2  . PHE A 1 6   ? 105.878 -67.799  -11.122 1.00 74.07  ? 50  PHE A HD2  1 
ATOM   28    H HE1  . PHE A 1 6   ? 108.406 -71.576  -10.301 1.00 65.63  ? 50  PHE A HE1  1 
ATOM   29    H HE2  . PHE A 1 6   ? 107.412 -68.522  -12.688 1.00 57.63  ? 50  PHE A HE2  1 
ATOM   30    H HZ   . PHE A 1 6   ? 108.679 -70.413  -12.279 1.00 63.05  ? 50  PHE A HZ   1 
ATOM   31    N N    . ARG A 1 7   ? 106.097 -69.734  -5.921  1.00 35.06  ? 51  ARG A N    1 
ATOM   32    C CA   . ARG A 1 7   ? 106.760 -70.820  -5.220  1.00 26.12  ? 51  ARG A CA   1 
ATOM   33    C C    . ARG A 1 7   ? 106.232 -72.150  -5.743  1.00 29.87  ? 51  ARG A C    1 
ATOM   34    O O    . ARG A 1 7   ? 105.175 -72.219  -6.375  1.00 32.17  ? 51  ARG A O    1 
ATOM   35    C CB   . ARG A 1 7   ? 106.553 -70.719  -3.703  1.00 26.39  ? 51  ARG A CB   1 
ATOM   36    C CG   . ARG A 1 7   ? 105.107 -70.826  -3.242  1.00 34.64  ? 51  ARG A CG   1 
ATOM   37    C CD   . ARG A 1 7   ? 105.011 -70.745  -1.723  1.00 32.56  ? 51  ARG A CD   1 
ATOM   38    N NE   . ARG A 1 7   ? 103.644 -70.940  -1.244  1.00 36.58  ? 51  ARG A NE   1 
ATOM   39    C CZ   . ARG A 1 7   ? 102.757 -69.968  -1.052  1.00 35.58  ? 51  ARG A CZ   1 
ATOM   40    N NH1  . ARG A 1 7   ? 103.074 -68.702  -1.290  1.00 30.89  ? 51  ARG A NH1  1 
ATOM   41    N NH2  . ARG A 1 7   ? 101.540 -70.265  -0.616  1.00 40.31  ? 51  ARG A NH2  1 
ATOM   42    H H    . ARG A 1 7   ? 105.259 -69.668  -5.737  1.00 42.07  ? 51  ARG A H    1 
ATOM   43    H HA   . ARG A 1 7   ? 107.712 -70.781  -5.399  1.00 31.35  ? 51  ARG A HA   1 
ATOM   44    H HB2  . ARG A 1 7   ? 107.050 -71.435  -3.276  1.00 31.67  ? 51  ARG A HB2  1 
ATOM   45    H HB3  . ARG A 1 7   ? 106.893 -69.863  -3.402  1.00 31.67  ? 51  ARG A HB3  1 
ATOM   46    H HG2  . ARG A 1 7   ? 104.593 -70.096  -3.620  1.00 41.57  ? 51  ARG A HG2  1 
ATOM   47    H HG3  . ARG A 1 7   ? 104.741 -71.679  -3.526  1.00 41.57  ? 51  ARG A HG3  1 
ATOM   48    H HD2  . ARG A 1 7   ? 105.569 -71.435  -1.331  1.00 39.08  ? 51  ARG A HD2  1 
ATOM   49    H HD3  . ARG A 1 7   ? 105.310 -69.869  -1.432  1.00 39.08  ? 51  ARG A HD3  1 
ATOM   50    H HE   . ARG A 1 7   ? 103.395 -71.745  -1.074  1.00 43.90  ? 51  ARG A HE   1 
ATOM   51    H HH11 . ARG A 1 7   ? 103.861 -68.502  -1.574  1.00 37.07  ? 51  ARG A HH11 1 
ATOM   52    H HH12 . ARG A 1 7   ? 102.493 -68.081  -1.162  1.00 37.07  ? 51  ARG A HH12 1 
ATOM   53    H HH21 . ARG A 1 7   ? 101.327 -71.083  -0.458  1.00 48.37  ? 51  ARG A HH21 1 
ATOM   54    H HH22 . ARG A 1 7   ? 100.964 -69.639  -0.489  1.00 48.37  ? 51  ARG A HH22 1 
ATOM   55    N N    . ILE A 1 8   ? 106.988 -73.210  -5.479  1.00 35.66  ? 52  ILE A N    1 
ATOM   56    C CA   . ILE A 1 8   ? 106.676 -74.542  -5.981  1.00 29.08  ? 52  ILE A CA   1 
ATOM   57    C C    . ILE A 1 8   ? 106.101 -75.374  -4.845  1.00 37.53  ? 52  ILE A C    1 
ATOM   58    O O    . ILE A 1 8   ? 106.720 -75.503  -3.781  1.00 29.17  ? 52  ILE A O    1 
ATOM   59    C CB   . ILE A 1 8   ? 107.923 -75.217  -6.579  1.00 28.46  ? 52  ILE A CB   1 
ATOM   60    C CG1  . ILE A 1 8   ? 108.507 -74.363  -7.711  1.00 34.05  ? 52  ILE A CG1  1 
ATOM   61    C CG2  . ILE A 1 8   ? 107.592 -76.622  -7.076  1.00 26.57  ? 52  ILE A CG2  1 
ATOM   62    C CD1  . ILE A 1 8   ? 107.608 -74.218  -8.928  1.00 42.75  ? 52  ILE A CD1  1 
ATOM   63    H H    . ILE A 1 8   ? 107.703 -73.182  -5.001  1.00 42.79  ? 52  ILE A H    1 
ATOM   64    H HA   . ILE A 1 8   ? 106.005 -74.473  -6.678  1.00 34.90  ? 52  ILE A HA   1 
ATOM   65    H HB   . ILE A 1 8   ? 108.591 -75.292  -5.880  1.00 34.16  ? 52  ILE A HB   1 
ATOM   66    H HG12 . ILE A 1 8   ? 108.683 -73.473  -7.369  1.00 40.87  ? 52  ILE A HG12 1 
ATOM   67    H HG13 . ILE A 1 8   ? 109.337 -74.768  -8.007  1.00 40.87  ? 52  ILE A HG13 1 
ATOM   68    H HG21 . ILE A 1 8   ? 108.394 -77.022  -7.447  1.00 31.89  ? 52  ILE A HG21 1 
ATOM   69    H HG22 . ILE A 1 8   ? 107.271 -77.152  -6.330  1.00 31.89  ? 52  ILE A HG22 1 
ATOM   70    H HG23 . ILE A 1 8   ? 106.906 -76.561  -7.759  1.00 31.89  ? 52  ILE A HG23 1 
ATOM   71    H HD11 . ILE A 1 8   ? 108.057 -73.666  -9.587  1.00 51.30  ? 52  ILE A HD11 1 
ATOM   72    H HD12 . ILE A 1 8   ? 107.432 -75.098  -9.296  1.00 51.30  ? 52  ILE A HD12 1 
ATOM   73    H HD13 . ILE A 1 8   ? 106.776 -73.800  -8.657  1.00 51.30  ? 52  ILE A HD13 1 
ATOM   74    N N    . GLU A 1 9   ? 104.917 -75.936  -5.069  1.00 27.96  ? 53  GLU A N    1 
ATOM   75    C CA   . GLU A 1 9   ? 104.307 -76.892  -4.160  1.00 27.53  ? 53  GLU A CA   1 
ATOM   76    C C    . GLU A 1 9   ? 103.906 -78.122  -4.961  1.00 24.00  ? 53  GLU A C    1 
ATOM   77    O O    . GLU A 1 9   ? 103.858 -78.098  -6.194  1.00 23.31  ? 53  GLU A O    1 
ATOM   78    C CB   . GLU A 1 9   ? 103.091 -76.296  -3.434  1.00 35.20  ? 53  GLU A CB   1 
ATOM   79    C CG   . GLU A 1 9   ? 103.402 -75.069  -2.586  1.00 32.59  ? 53  GLU A CG   1 
ATOM   80    C CD   . GLU A 1 9   ? 102.259 -74.696  -1.656  1.00 40.45  ? 53  GLU A CD   1 
ATOM   81    O OE1  . GLU A 1 9   ? 101.534 -75.607  -1.203  1.00 37.80  ? 53  GLU A OE1  1 
ATOM   82    O OE2  . GLU A 1 9   ? 102.083 -73.490  -1.380  1.00 36.09  ? 53  GLU A OE2  1 
ATOM   83    H H    . GLU A 1 9   ? 104.436 -75.771  -5.762  1.00 33.56  ? 53  GLU A H    1 
ATOM   84    H HA   . GLU A 1 9   ? 104.958 -77.161  -3.493  1.00 33.04  ? 53  GLU A HA   1 
ATOM   85    H HB2  . GLU A 1 9   ? 102.431 -76.037  -4.095  1.00 42.25  ? 53  GLU A HB2  1 
ATOM   86    H HB3  . GLU A 1 9   ? 102.718 -76.972  -2.847  1.00 42.25  ? 53  GLU A HB3  1 
ATOM   87    H HG2  . GLU A 1 9   ? 104.185 -75.250  -2.043  1.00 39.11  ? 53  GLU A HG2  1 
ATOM   88    H HG3  . GLU A 1 9   ? 103.571 -74.314  -3.172  1.00 39.11  ? 53  GLU A HG3  1 
ATOM   89    N N    . TYR A 1 10  ? 103.620 -79.209  -4.250  1.00 23.46  ? 54  TYR A N    1 
ATOM   90    C CA   . TYR A 1 10  ? 103.330 -80.489  -4.878  1.00 27.39  ? 54  TYR A CA   1 
ATOM   91    C C    . TYR A 1 10  ? 102.071 -81.097  -4.282  1.00 28.89  ? 54  TYR A C    1 
ATOM   92    O O    . TYR A 1 10  ? 101.806 -80.954  -3.085  1.00 28.70  ? 54  TYR A O    1 
ATOM   93    C CB   . TYR A 1 10  ? 104.491 -81.478  -4.700  1.00 28.49  ? 54  TYR A CB   1 
ATOM   94    C CG   . TYR A 1 10  ? 105.834 -80.962  -5.157  1.00 32.56  ? 54  TYR A CG   1 
ATOM   95    C CD1  . TYR A 1 10  ? 106.253 -81.126  -6.469  1.00 33.22  ? 54  TYR A CD1  1 
ATOM   96    C CD2  . TYR A 1 10  ? 106.691 -80.321  -4.271  1.00 24.48  ? 54  TYR A CD2  1 
ATOM   97    C CE1  . TYR A 1 10  ? 107.484 -80.661  -6.890  1.00 33.93  ? 54  TYR A CE1  1 
ATOM   98    C CE2  . TYR A 1 10  ? 107.925 -79.852  -4.684  1.00 30.83  ? 54  TYR A CE2  1 
ATOM   99    C CZ   . TYR A 1 10  ? 108.315 -80.026  -5.994  1.00 31.15  ? 54  TYR A CZ   1 
ATOM   100   O OH   . TYR A 1 10  ? 109.540 -79.561  -6.414  1.00 32.57  ? 54  TYR A OH   1 
ATOM   101   H H    . TYR A 1 10  ? 103.589 -79.229  -3.390  1.00 28.15  ? 54  TYR A H    1 
ATOM   102   H HA   . TYR A 1 10  ? 103.184 -80.355  -5.827  1.00 32.87  ? 54  TYR A HA   1 
ATOM   103   H HB2  . TYR A 1 10  ? 104.566 -81.702  -3.759  1.00 34.19  ? 54  TYR A HB2  1 
ATOM   104   H HB3  . TYR A 1 10  ? 104.295 -82.280  -5.211  1.00 34.19  ? 54  TYR A HB3  1 
ATOM   105   H HD1  . TYR A 1 10  ? 105.694 -81.555  -7.076  1.00 39.87  ? 54  TYR A HD1  1 
ATOM   106   H HD2  . TYR A 1 10  ? 106.430 -80.203  -3.386  1.00 29.38  ? 54  TYR A HD2  1 
ATOM   107   H HE1  . TYR A 1 10  ? 107.749 -80.776  -7.774  1.00 40.71  ? 54  TYR A HE1  1 
ATOM   108   H HE2  . TYR A 1 10  ? 108.488 -79.423  -4.081  1.00 36.99  ? 54  TYR A HE2  1 
ATOM   109   H HH   . TYR A 1 10  ? 109.944 -79.197  -5.774  1.00 39.08  ? 54  TYR A HH   1 
ATOM   110   N N    . ASP A 1 11  ? 101.299 -81.774  -5.127  1.00 23.28  ? 55  ASP A N    1 
ATOM   111   C CA   . ASP A 1 11  ? 100.280 -82.712  -4.684  1.00 33.22  ? 55  ASP A CA   1 
ATOM   112   C C    . ASP A 1 11  ? 100.531 -84.040  -5.390  1.00 25.90  ? 55  ASP A C    1 
ATOM   113   O O    . ASP A 1 11  ? 101.484 -84.185  -6.161  1.00 30.02  ? 55  ASP A O    1 
ATOM   114   C CB   . ASP A 1 11  ? 98.862  -82.176  -4.942  1.00 31.35  ? 55  ASP A CB   1 
ATOM   115   C CG   . ASP A 1 11  ? 98.528  -82.047  -6.421  1.00 36.99  ? 55  ASP A CG   1 
ATOM   116   O OD1  . ASP A 1 11  ? 99.294  -82.546  -7.273  1.00 28.41  ? 55  ASP A OD1  1 
ATOM   117   O OD2  . ASP A 1 11  ? 97.481  -81.437  -6.729  1.00 28.55  ? 55  ASP A OD2  1 
ATOM   118   H H    . ASP A 1 11  ? 101.350 -81.703  -5.983  1.00 27.94  ? 55  ASP A H    1 
ATOM   119   H HA   . ASP A 1 11  ? 100.376 -82.856  -3.729  1.00 39.86  ? 55  ASP A HA   1 
ATOM   120   H HB2  . ASP A 1 11  ? 98.219  -82.783  -4.543  1.00 37.62  ? 55  ASP A HB2  1 
ATOM   121   H HB3  . ASP A 1 11  ? 98.780  -81.297  -4.540  1.00 37.62  ? 55  ASP A HB3  1 
ATOM   122   N N    . THR A 1 12  ? 99.666  -85.021  -5.130  1.00 31.42  ? 56  THR A N    1 
ATOM   123   C CA   . THR A 1 12  ? 99.887  -86.362  -5.658  1.00 30.26  ? 56  THR A CA   1 
ATOM   124   C C    . THR A 1 12  ? 99.799  -86.431  -7.179  1.00 24.96  ? 56  THR A C    1 
ATOM   125   O O    . THR A 1 12  ? 100.072 -87.496  -7.745  1.00 24.36  ? 56  THR A O    1 
ATOM   126   C CB   . THR A 1 12  ? 98.881  -87.338  -5.046  1.00 33.15  ? 56  THR A CB   1 
ATOM   127   O OG1  . THR A 1 12  ? 97.549  -86.852  -5.256  1.00 43.66  ? 56  THR A OG1  1 
ATOM   128   C CG2  . THR A 1 12  ? 99.142  -87.506  -3.552  1.00 27.97  ? 56  THR A CG2  1 
ATOM   129   H H    . THR A 1 12  ? 98.953  -84.935  -4.656  1.00 37.71  ? 56  THR A H    1 
ATOM   130   H HA   . THR A 1 12  ? 100.775 -86.654  -5.401  1.00 36.31  ? 56  THR A HA   1 
ATOM   131   H HB   . THR A 1 12  ? 98.977  -88.205  -5.470  1.00 39.78  ? 56  THR A HB   1 
ATOM   132   H HG1  . THR A 1 12  ? 96.992  -87.385  -4.921  1.00 52.39  ? 56  THR A HG1  1 
ATOM   133   H HG21 . THR A 1 12  ? 98.500  -88.126  -3.172  1.00 33.57  ? 56  THR A HG21 1 
ATOM   134   H HG22 . THR A 1 12  ? 100.037 -87.851  -3.409  1.00 33.57  ? 56  THR A HG22 1 
ATOM   135   H HG23 . THR A 1 12  ? 99.057  -86.650  -3.103  1.00 33.57  ? 56  THR A HG23 1 
ATOM   136   N N    . PHE A 1 13  ? 99.435  -85.337  -7.851  1.00 32.37  ? 57  PHE A N    1 
ATOM   137   C CA   . PHE A 1 13  ? 99.292  -85.333  -9.299  1.00 44.30  ? 57  PHE A CA   1 
ATOM   138   C C    . PHE A 1 13  ? 100.406 -84.589  -10.023 1.00 28.71  ? 57  PHE A C    1 
ATOM   139   O O    . PHE A 1 13  ? 100.513 -84.717  -11.247 1.00 30.51  ? 57  PHE A O    1 
ATOM   140   C CB   . PHE A 1 13  ? 97.938  -84.719  -9.690  1.00 33.89  ? 57  PHE A CB   1 
ATOM   141   C CG   . PHE A 1 13  ? 96.771  -85.297  -8.936  1.00 44.47  ? 57  PHE A CG   1 
ATOM   142   C CD1  . PHE A 1 13  ? 96.329  -86.584  -9.192  1.00 39.75  ? 57  PHE A CD1  1 
ATOM   143   C CD2  . PHE A 1 13  ? 96.114  -84.549  -7.972  1.00 30.11  ? 57  PHE A CD2  1 
ATOM   144   C CE1  . PHE A 1 13  ? 95.257  -87.117  -8.499  1.00 36.15  ? 57  PHE A CE1  1 
ATOM   145   C CE2  . PHE A 1 13  ? 95.042  -85.077  -7.276  1.00 36.74  ? 57  PHE A CE2  1 
ATOM   146   C CZ   . PHE A 1 13  ? 94.614  -86.362  -7.541  1.00 42.05  ? 57  PHE A CZ   1 
ATOM   147   H H    . PHE A 1 13  ? 99.265  -84.579  -7.482  1.00 38.84  ? 57  PHE A H    1 
ATOM   148   H HA   . PHE A 1 13  ? 99.300  -86.250  -9.613  1.00 53.16  ? 57  PHE A HA   1 
ATOM   149   H HB2  . PHE A 1 13  ? 97.963  -83.766  -9.513  1.00 40.67  ? 57  PHE A HB2  1 
ATOM   150   H HB3  . PHE A 1 13  ? 97.786  -84.874  -10.636 1.00 40.67  ? 57  PHE A HB3  1 
ATOM   151   H HD1  . PHE A 1 13  ? 96.760  -87.098  -9.837  1.00 47.70  ? 57  PHE A HD1  1 
ATOM   152   H HD2  . PHE A 1 13  ? 96.400  -83.683  -7.789  1.00 36.14  ? 57  PHE A HD2  1 
ATOM   153   H HE1  . PHE A 1 13  ? 94.970  -87.983  -8.679  1.00 43.39  ? 57  PHE A HE1  1 
ATOM   154   H HE2  . PHE A 1 13  ? 94.610  -84.566  -6.631  1.00 44.10  ? 57  PHE A HE2  1 
ATOM   155   H HZ   . PHE A 1 13  ? 93.892  -86.718  -7.074  1.00 50.46  ? 57  PHE A HZ   1 
ATOM   156   N N    . GLY A 1 14  ? 101.224 -83.825  -9.321  1.00 21.84  ? 58  GLY A N    1 
ATOM   157   C CA   . GLY A 1 14  ? 102.313 -83.105  -9.951  1.00 24.06  ? 58  GLY A CA   1 
ATOM   158   C C    . GLY A 1 14  ? 102.649 -81.853  -9.167  1.00 30.28  ? 58  GLY A C    1 
ATOM   159   O O    . GLY A 1 14  ? 102.063 -81.563  -8.127  1.00 32.13  ? 58  GLY A O    1 
ATOM   160   H H    . GLY A 1 14  ? 101.169 -83.707  -8.471  1.00 26.21  ? 58  GLY A H    1 
ATOM   161   H HA2  . GLY A 1 14  ? 103.101 -83.670  -9.992  0.52 28.88  ? 58  GLY A HA2  1 
ATOM   162   H HA3  . GLY A 1 14  ? 102.062 -82.851  -10.853 0.59 28.88  ? 58  GLY A HA3  1 
ATOM   163   N N    . GLU A 1 15  ? 103.619 -81.111  -9.693  1.00 25.87  ? 59  GLU A N    1 
ATOM   164   C CA   . GLU A 1 15  ? 104.038 -79.863  -9.075  1.00 33.74  ? 59  GLU A CA   1 
ATOM   165   C C    . GLU A 1 15  ? 103.174 -78.717  -9.581  1.00 32.60  ? 59  GLU A C    1 
ATOM   166   O O    . GLU A 1 15  ? 102.698 -78.729  -10.720 1.00 25.60  ? 59  GLU A O    1 
ATOM   167   C CB   . GLU A 1 15  ? 105.513 -79.566  -9.361  1.00 33.55  ? 59  GLU A CB   1 
ATOM   168   C CG   . GLU A 1 15  ? 105.808 -78.973  -10.740 1.00 42.44  ? 59  GLU A CG   1 
ATOM   169   C CD   . GLU A 1 15  ? 107.225 -78.447  -10.850 1.00 55.62  ? 59  GLU A CD   1 
ATOM   170   O OE1  . GLU A 1 15  ? 108.049 -78.771  -9.974  1.00 51.96  ? 59  GLU A OE1  1 
ATOM   171   O OE2  . GLU A 1 15  ? 107.509 -77.703  -11.811 1.00 63.97  ? 59  GLU A OE2  1 
ATOM   172   H H    . GLU A 1 15  ? 104.050 -81.310  -10.411 0.80 31.05  ? 59  GLU A H    1 
ATOM   173   H HA   . GLU A 1 15  ? 103.923 -79.928  -8.114  0.60 40.50  ? 59  GLU A HA   1 
ATOM   174   H HB2  . GLU A 1 15  ? 105.833 -78.935  -8.698  1.00 40.27  ? 59  GLU A HB2  1 
ATOM   175   H HB3  . GLU A 1 15  ? 106.012 -80.394  -9.287  1.00 40.27  ? 59  GLU A HB3  1 
ATOM   176   H HG2  . GLU A 1 15  ? 105.689 -79.661  -11.413 1.00 50.93  ? 59  GLU A HG2  1 
ATOM   177   H HG3  . GLU A 1 15  ? 105.200 -78.236  -10.906 1.00 50.93  ? 59  GLU A HG3  1 
ATOM   178   N N    . LEU A 1 16  ? 102.984 -77.717  -8.723  1.00 24.42  ? 60  LEU A N    1 
ATOM   179   C CA   . LEU A 1 16  ? 102.150 -76.570  -9.044  1.00 31.95  ? 60  LEU A CA   1 
ATOM   180   C C    . LEU A 1 16  ? 102.847 -75.286  -8.632  1.00 29.27  ? 60  LEU A C    1 
ATOM   181   O O    . LEU A 1 16  ? 103.436 -75.205  -7.551  1.00 31.86  ? 60  LEU A O    1 
ATOM   182   C CB   . LEU A 1 16  ? 100.787 -76.666  -8.349  1.00 27.95  ? 60  LEU A CB   1 
ATOM   183   C CG   . LEU A 1 16  ? 99.950  -77.883  -8.736  1.00 30.14  ? 60  LEU A CG   1 
ATOM   184   C CD1  . LEU A 1 16  ? 98.644  -77.899  -7.964  1.00 37.17  ? 60  LEU A CD1  1 
ATOM   185   C CD2  . LEU A 1 16  ? 99.686  -77.889  -10.232 1.00 32.07  ? 60  LEU A CD2  1 
ATOM   186   H H    . LEU A 1 16  ? 103.333 -77.683  -7.938  1.00 29.31  ? 60  LEU A H    1 
ATOM   187   H HA   . LEU A 1 16  ? 102.002 -76.541  -10.002 1.00 38.34  ? 60  LEU A HA   1 
ATOM   188   H HB2  . LEU A 1 16  ? 100.931 -76.702  -7.391  1.00 33.55  ? 60  LEU A HB2  1 
ATOM   189   H HB3  . LEU A 1 16  ? 100.271 -75.874  -8.571  1.00 33.55  ? 60  LEU A HB3  1 
ATOM   190   H HG   . LEU A 1 16  ? 100.441 -78.689  -8.514  1.00 36.17  ? 60  LEU A HG   1 
ATOM   191   H HD11 . LEU A 1 16  ? 98.132  -78.680  -8.227  1.00 44.61  ? 60  LEU A HD11 1 
ATOM   192   H HD12 . LEU A 1 16  ? 98.839  -77.935  -7.015  1.00 44.61  ? 60  LEU A HD12 1 
ATOM   193   H HD13 . LEU A 1 16  ? 98.146  -77.092  -8.170  1.00 44.61  ? 60  LEU A HD13 1 
ATOM   194   H HD21 . LEU A 1 16  ? 99.154  -78.669  -10.455 1.00 38.48  ? 60  LEU A HD21 1 
ATOM   195   H HD22 . LEU A 1 16  ? 99.205  -77.081  -10.471 1.00 38.48  ? 60  LEU A HD22 1 
ATOM   196   H HD23 . LEU A 1 16  ? 100.534 -77.921  -10.702 1.00 38.48  ? 60  LEU A HD23 1 
ATOM   197   N N    . LYS A 1 17  ? 102.770 -74.286  -9.501  1.00 28.05  ? 61  LYS A N    1 
ATOM   198   C CA   . LYS A 1 17  ? 103.259 -72.957  -9.172  1.00 36.84  ? 61  LYS A CA   1 
ATOM   199   C C    . LYS A 1 17  ? 102.203 -72.221  -8.358  1.00 30.66  ? 61  LYS A C    1 
ATOM   200   O O    . LYS A 1 17  ? 101.045 -72.120  -8.773  1.00 37.59  ? 61  LYS A O    1 
ATOM   201   C CB   . LYS A 1 17  ? 103.595 -72.177  -10.443 1.00 47.21  ? 61  LYS A CB   1 
ATOM   202   C CG   . LYS A 1 17  ? 104.664 -72.833  -11.304 1.00 52.17  ? 61  LYS A CG   1 
ATOM   203   C CD   . LYS A 1 17  ? 105.092 -71.930  -12.452 1.00 43.10  ? 61  LYS A CD   1 
ATOM   204   H H    . LYS A 1 17  ? 102.437 -74.353  -10.292 1.00 33.67  ? 61  LYS A H    1 
ATOM   205   H HA   . LYS A 1 17  ? 104.063 -73.032  -8.636  1.00 44.21  ? 61  LYS A HA   1 
ATOM   206   H HB2  . LYS A 1 17  ? 102.791 -72.095  -10.981 1.00 56.65  ? 61  LYS A HB2  1 
ATOM   207   H HB3  . LYS A 1 17  ? 103.914 -71.296  -10.194 1.00 56.65  ? 61  LYS A HB3  1 
ATOM   208   H HG2  . LYS A 1 17  ? 105.444 -73.020  -10.758 1.00 62.60  ? 61  LYS A HG2  1 
ATOM   209   H HG3  . LYS A 1 17  ? 104.313 -73.656  -11.680 1.00 62.60  ? 61  LYS A HG3  1 
ATOM   210   H HD2  . LYS A 1 17  ? 105.414 -72.480  -13.183 1.00 51.72  ? 61  LYS A HD2  1 
ATOM   211   H HD3  . LYS A 1 17  ? 104.328 -71.406  -12.742 1.00 51.72  ? 61  LYS A HD3  1 
ATOM   212   N N    . VAL A 1 18  ? 102.601 -71.726  -7.195  1.00 32.08  ? 62  VAL A N    1 
ATOM   213   C CA   . VAL A 1 18  ? 101.722 -70.981  -6.299  1.00 27.27  ? 62  VAL A CA   1 
ATOM   214   C C    . VAL A 1 18  ? 102.222 -69.540  -6.257  1.00 31.11  ? 62  VAL A C    1 
ATOM   215   O O    . VAL A 1 18  ? 103.399 -69.313  -5.947  1.00 27.32  ? 62  VAL A O    1 
ATOM   216   C CB   . VAL A 1 18  ? 101.695 -71.595  -4.890  1.00 35.53  ? 62  VAL A CB   1 
ATOM   217   C CG1  . VAL A 1 18  ? 100.686 -70.867  -4.010  1.00 25.53  ? 62  VAL A CG1  1 
ATOM   218   C CG2  . VAL A 1 18  ? 101.369 -73.078  -4.963  1.00 30.14  ? 62  VAL A CG2  1 
ATOM   219   H H    . VAL A 1 18  ? 103.401 -71.810  -6.891  1.00 38.49  ? 62  VAL A H    1 
ATOM   220   H HA   . VAL A 1 18  ? 100.820 -70.984  -6.654  1.00 32.73  ? 62  VAL A HA   1 
ATOM   221   H HB   . VAL A 1 18  ? 102.571 -71.499  -4.486  1.00 42.64  ? 62  VAL A HB   1 
ATOM   222   H HG11 . VAL A 1 18  ? 100.687 -71.272  -3.129  1.00 30.64  ? 62  VAL A HG11 1 
ATOM   223   H HG12 . VAL A 1 18  ? 100.940 -69.933  -3.946  1.00 30.64  ? 62  VAL A HG12 1 
ATOM   224   H HG13 . VAL A 1 18  ? 99.805  -70.945  -4.409  1.00 30.64  ? 62  VAL A HG13 1 
ATOM   225   H HG21 . VAL A 1 18  ? 101.357 -73.442  -4.064  1.00 36.17  ? 62  VAL A HG21 1 
ATOM   226   H HG22 . VAL A 1 18  ? 100.499 -73.190  -5.377  1.00 36.17  ? 62  VAL A HG22 1 
ATOM   227   H HG23 . VAL A 1 18  ? 102.048 -73.524  -5.492  1.00 36.17  ? 62  VAL A HG23 1 
ATOM   228   N N    . PRO A 1 19  ? 101.389 -68.545  -6.564  1.00 44.13  ? 63  PRO A N    1 
ATOM   229   C CA   . PRO A 1 19  ? 101.862 -67.158  -6.490  1.00 27.54  ? 63  PRO A CA   1 
ATOM   230   C C    . PRO A 1 19  ? 102.357 -66.826  -5.091  1.00 38.07  ? 63  PRO A C    1 
ATOM   231   O O    . PRO A 1 19  ? 101.730 -67.176  -4.090  1.00 37.52  ? 63  PRO A O    1 
ATOM   232   C CB   . PRO A 1 19  ? 100.624 -66.335  -6.864  1.00 38.62  ? 63  PRO A CB   1 
ATOM   233   C CG   . PRO A 1 19  ? 99.742  -67.280  -7.605  1.00 44.03  ? 63  PRO A CG   1 
ATOM   234   C CD   . PRO A 1 19  ? 99.985  -68.624  -7.003  1.00 32.44  ? 63  PRO A CD   1 
ATOM   235   H HA   . PRO A 1 19  ? 102.569 -67.000  -7.135  1.00 33.05  ? 63  PRO A HA   1 
ATOM   236   H HB2  . PRO A 1 19  ? 100.187 -66.017  -6.059  1.00 46.35  ? 63  PRO A HB2  1 
ATOM   237   H HB3  . PRO A 1 19  ? 100.884 -65.592  -7.431  1.00 46.35  ? 63  PRO A HB3  1 
ATOM   238   H HG2  . PRO A 1 19  ? 98.815  -67.018  -7.489  1.00 52.84  ? 63  PRO A HG2  1 
ATOM   239   H HG3  . PRO A 1 19  ? 99.982  -67.279  -8.545  1.00 52.84  ? 63  PRO A HG3  1 
ATOM   240   H HD2  . PRO A 1 19  ? 99.400  -68.766  -6.243  1.00 38.92  ? 63  PRO A HD2  1 
ATOM   241   H HD3  . PRO A 1 19  ? 99.877  -69.319  -7.671  1.00 38.92  ? 63  PRO A HD3  1 
ATOM   242   N N    . ASN A 1 20  ? 103.500 -66.140  -5.030  1.00 35.52  ? 64  ASN A N    1 
ATOM   243   C CA   . ASN A 1 20  ? 104.128 -65.878  -3.740  1.00 36.86  ? 64  ASN A CA   1 
ATOM   244   C C    . ASN A 1 20  ? 103.304 -64.921  -2.889  1.00 24.84  ? 64  ASN A C    1 
ATOM   245   O O    . ASN A 1 20  ? 103.403 -64.953  -1.658  1.00 35.20  ? 64  ASN A O    1 
ATOM   246   C CB   . ASN A 1 20  ? 105.542 -65.333  -3.949  1.00 45.11  ? 64  ASN A CB   1 
ATOM   247   C CG   . ASN A 1 20  ? 106.601 -66.415  -3.842  1.00 46.35  ? 64  ASN A CG   1 
ATOM   248   O OD1  . ASN A 1 20  ? 106.581 -67.228  -2.916  1.00 54.85  ? 64  ASN A OD1  1 
ATOM   249   N ND2  . ASN A 1 20  ? 107.526 -66.437  -4.794  1.00 52.32  ? 64  ASN A ND2  1 
ATOM   250   H H    . ASN A 1 20  ? 103.923 -65.823  -5.708  1.00 42.62  ? 64  ASN A H    1 
ATOM   251   H HA   . ASN A 1 20  ? 104.203 -66.714  -3.255  1.00 44.23  ? 64  ASN A HA   1 
ATOM   252   H HB2  . ASN A 1 20  ? 105.602 -64.939  -4.833  1.00 54.13  ? 64  ASN A HB2  1 
ATOM   253   H HB3  . ASN A 1 20  ? 105.726 -64.663  -3.272  1.00 54.13  ? 64  ASN A HB3  1 
ATOM   254   H HD21 . ASN A 1 20  ? 108.148 -67.031  -4.777  1.00 62.79  ? 64  ASN A HD21 1 
ATOM   255   H HD22 . ASN A 1 20  ? 107.504 -65.857  -5.429  1.00 62.79  ? 64  ASN A HD22 1 
ATOM   256   N N    . ASP A 1 21  ? 102.488 -64.075  -3.512  1.00 25.92  ? 65  ASP A N    1 
ATOM   257   C CA   . ASP A 1 21  ? 101.635 -63.149  -2.779  1.00 37.91  ? 65  ASP A CA   1 
ATOM   258   C C    . ASP A 1 21  ? 100.302 -63.770  -2.373  1.00 33.27  ? 65  ASP A C    1 
ATOM   259   O O    . ASP A 1 21  ? 99.398  -63.043  -1.948  1.00 31.08  ? 65  ASP A O    1 
ATOM   260   C CB   . ASP A 1 21  ? 101.390 -61.885  -3.612  1.00 28.75  ? 65  ASP A CB   1 
ATOM   261   C CG   . ASP A 1 21  ? 100.653 -62.167  -4.909  1.00 38.28  ? 65  ASP A CG   1 
ATOM   262   O OD1  . ASP A 1 21  ? 100.329 -63.344  -5.174  1.00 41.44  ? 65  ASP A OD1  1 
ATOM   263   O OD2  . ASP A 1 21  ? 100.399 -61.207  -5.665  1.00 53.16  ? 65  ASP A OD2  1 
ATOM   264   H H    . ASP A 1 21  ? 102.409 -64.019  -4.366  1.00 31.11  ? 65  ASP A H    1 
ATOM   265   H HA   . ASP A 1 21  ? 102.094 -62.882  -1.967  1.00 45.49  ? 65  ASP A HA   1 
ATOM   266   H HB2  . ASP A 1 21  ? 100.856 -61.264  -3.093  1.00 34.50  ? 65  ASP A HB2  1 
ATOM   267   H HB3  . ASP A 1 21  ? 102.244 -61.482  -3.834  1.00 34.50  ? 65  ASP A HB3  1 
ATOM   268   N N    . LYS A 1 22  ? 100.160 -65.090  -2.490  1.00 28.13  ? 66  LYS A N    1 
ATOM   269   C CA   . LYS A 1 22  ? 98.936  -65.792  -2.130  1.00 32.75  ? 66  LYS A CA   1 
ATOM   270   C C    . LYS A 1 22  ? 99.204  -66.737  -0.968  1.00 27.65  ? 66  LYS A C    1 
ATOM   271   O O    . LYS A 1 22  ? 100.256 -67.381  -0.909  1.00 24.33  ? 66  LYS A O    1 
ATOM   272   C CB   . LYS A 1 22  ? 98.377  -66.578  -3.321  1.00 29.19  ? 66  LYS A CB   1 
ATOM   273   C CG   . LYS A 1 22  ? 97.962  -65.710  -4.501  1.00 35.81  ? 66  LYS A CG   1 
ATOM   274   C CD   . LYS A 1 22  ? 96.761  -64.836  -4.171  1.00 37.63  ? 66  LYS A CD   1 
ATOM   275   C CE   . LYS A 1 22  ? 96.357  -63.984  -5.364  1.00 38.48  ? 66  LYS A CE   1 
ATOM   276   N NZ   . LYS A 1 22  ? 95.210  -63.091  -5.052  1.00 41.32  ? 66  LYS A NZ   1 
ATOM   277   H H    . LYS A 1 22  ? 100.778 -65.611  -2.784  1.00 33.75  ? 66  LYS A H    1 
ATOM   278   H HA   . LYS A 1 22  ? 98.268  -65.147  -1.850  1.00 39.31  ? 66  LYS A HA   1 
ATOM   279   H HB2  . LYS A 1 22  ? 99.056  -67.195  -3.633  1.00 35.04  ? 66  LYS A HB2  1 
ATOM   280   H HB3  . LYS A 1 22  ? 97.595  -67.072  -3.028  1.00 35.04  ? 66  LYS A HB3  1 
ATOM   281   H HG2  . LYS A 1 22  ? 98.700  -65.130  -4.745  1.00 42.97  ? 66  LYS A HG2  1 
ATOM   282   H HG3  . LYS A 1 22  ? 97.724  -66.282  -5.248  1.00 42.97  ? 66  LYS A HG3  1 
ATOM   283   H HD2  . LYS A 1 22  ? 96.009  -65.400  -3.931  1.00 45.16  ? 66  LYS A HD2  1 
ATOM   284   H HD3  . LYS A 1 22  ? 96.986  -64.245  -3.436  1.00 45.16  ? 66  LYS A HD3  1 
ATOM   285   H HE2  . LYS A 1 22  ? 97.108  -63.430  -5.628  1.00 46.18  ? 66  LYS A HE2  1 
ATOM   286   H HE3  . LYS A 1 22  ? 96.097  -64.565  -6.096  1.00 46.18  ? 66  LYS A HE3  1 
ATOM   287   H HZ1  . LYS A 1 22  ? 94.998  -62.607  -5.768  1.00 49.58  ? 66  LYS A HZ1  1 
ATOM   288   H HZ2  . LYS A 1 22  ? 94.503  -63.576  -4.812  1.00 49.58  ? 66  LYS A HZ2  1 
ATOM   289   H HZ3  . LYS A 1 22  ? 95.424  -62.542  -4.385  1.00 49.58  ? 66  LYS A HZ3  1 
ATOM   290   N N    . TYR A 1 23  ? 98.239  -66.823  -0.052  1.00 26.59  ? 67  TYR A N    1 
ATOM   291   C CA   . TYR A 1 23  ? 98.355  -67.668  1.130   1.00 24.27  ? 67  TYR A CA   1 
ATOM   292   C C    . TYR A 1 23  ? 97.785  -69.067  0.931   1.00 20.88  ? 67  TYR A C    1 
ATOM   293   O O    . TYR A 1 23  ? 97.981  -69.923  1.800   1.00 26.25  ? 67  TYR A O    1 
ATOM   294   C CB   . TYR A 1 23  ? 97.651  -67.015  2.325   1.00 26.48  ? 67  TYR A CB   1 
ATOM   295   C CG   . TYR A 1 23  ? 98.331  -65.771  2.852   1.00 31.46  ? 67  TYR A CG   1 
ATOM   296   C CD1  . TYR A 1 23  ? 99.587  -65.837  3.439   1.00 29.29  ? 67  TYR A CD1  1 
ATOM   297   C CD2  . TYR A 1 23  ? 97.705  -64.534  2.782   1.00 29.95  ? 67  TYR A CD2  1 
ATOM   298   C CE1  . TYR A 1 23  ? 100.207 -64.703  3.928   1.00 26.24  ? 67  TYR A CE1  1 
ATOM   299   C CE2  . TYR A 1 23  ? 98.316  -63.396  3.270   1.00 28.18  ? 67  TYR A CE2  1 
ATOM   300   C CZ   . TYR A 1 23  ? 99.567  -63.486  3.842   1.00 36.18  ? 67  TYR A CZ   1 
ATOM   301   O OH   . TYR A 1 23  ? 100.177 -62.354  4.329   1.00 32.13  ? 67  TYR A OH   1 
ATOM   302   H H    . TYR A 1 23  ? 97.496  -66.393  -0.097  1.00 31.91  ? 67  TYR A H    1 
ATOM   303   H HA   . TYR A 1 23  ? 99.294  -67.761  1.354   1.00 29.13  ? 67  TYR A HA   1 
ATOM   304   H HB2  . TYR A 1 23  ? 96.752  -66.769  2.058   1.00 31.78  ? 67  TYR A HB2  1 
ATOM   305   H HB3  . TYR A 1 23  ? 97.612  -67.658  3.050   1.00 31.78  ? 67  TYR A HB3  1 
ATOM   306   H HD1  . TYR A 1 23  ? 100.022 -66.657  3.498   1.00 35.15  ? 67  TYR A HD1  1 
ATOM   307   H HD2  . TYR A 1 23  ? 96.861  -64.470  2.396   1.00 35.94  ? 67  TYR A HD2  1 
ATOM   308   H HE1  . TYR A 1 23  ? 101.051 -64.761  4.316   1.00 31.49  ? 67  TYR A HE1  1 
ATOM   309   H HE2  . TYR A 1 23  ? 97.886  -62.573  3.212   1.00 33.81  ? 67  TYR A HE2  1 
ATOM   310   H HH   . TYR A 1 23  ? 100.929 -62.548  4.649   1.00 38.56  ? 67  TYR A HH   1 
ATOM   311   N N    . TYR A 1 24  ? 97.079  -69.323  -0.168  1.00 22.97  ? 68  TYR A N    1 
ATOM   312   C CA   . TYR A 1 24  ? 96.600  -70.672  -0.415  1.00 29.31  ? 68  TYR A CA   1 
ATOM   313   C C    . TYR A 1 24  ? 97.731  -71.534  -0.971  1.00 24.01  ? 68  TYR A C    1 
ATOM   314   O O    . TYR A 1 24  ? 98.803  -71.044  -1.337  1.00 28.74  ? 68  TYR A O    1 
ATOM   315   C CB   . TYR A 1 24  ? 95.395  -70.667  -1.359  1.00 21.70  ? 68  TYR A CB   1 
ATOM   316   C CG   . TYR A 1 24  ? 95.608  -70.006  -2.706  1.00 16.48  ? 68  TYR A CG   1 
ATOM   317   C CD1  . TYR A 1 24  ? 96.400  -70.600  -3.680  1.00 19.60  ? 68  TYR A CD1  1 
ATOM   318   C CD2  . TYR A 1 24  ? 94.980  -68.806  -3.017  1.00 25.83  ? 68  TYR A CD2  1 
ATOM   319   C CE1  . TYR A 1 24  ? 96.583  -70.003  -4.916  1.00 18.39  ? 68  TYR A CE1  1 
ATOM   320   C CE2  . TYR A 1 24  ? 95.154  -68.204  -4.249  1.00 16.71  ? 68  TYR A CE2  1 
ATOM   321   C CZ   . TYR A 1 24  ? 95.955  -68.807  -5.195  1.00 19.24  ? 68  TYR A CZ   1 
ATOM   322   O OH   . TYR A 1 24  ? 96.132  -68.209  -6.423  1.00 29.04  ? 68  TYR A OH   1 
ATOM   323   H H    . TYR A 1 24  ? 96.871  -68.747  -0.771  1.00 27.57  ? 68  TYR A H    1 
ATOM   324   H HA   . TYR A 1 24  ? 96.315  -71.062  0.426   1.00 35.17  ? 68  TYR A HA   1 
ATOM   325   H HB2  . TYR A 1 24  ? 95.135  -71.586  -1.526  1.00 26.04  ? 68  TYR A HB2  1 
ATOM   326   H HB3  . TYR A 1 24  ? 94.666  -70.200  -0.921  1.00 26.04  ? 68  TYR A HB3  1 
ATOM   327   H HD1  . TYR A 1 24  ? 96.825  -71.406  -3.494  1.00 23.52  ? 68  TYR A HD1  1 
ATOM   328   H HD2  . TYR A 1 24  ? 94.439  -68.396  -2.381  1.00 31.00  ? 68  TYR A HD2  1 
ATOM   329   H HE1  . TYR A 1 24  ? 97.122  -70.409  -5.556  1.00 22.07  ? 68  TYR A HE1  1 
ATOM   330   H HE2  . TYR A 1 24  ? 94.733  -67.397  -4.438  1.00 20.05  ? 68  TYR A HE2  1 
ATOM   331   H HH   . TYR A 1 24  ? 96.641  -68.678  -6.900  1.00 34.85  ? 68  TYR A HH   1 
ATOM   332   N N    . GLY A 1 25  ? 97.481  -72.842  -1.028  1.00 24.20  ? 69  GLY A N    1 
ATOM   333   C CA   . GLY A 1 25  ? 98.517  -73.798  -1.366  1.00 25.21  ? 69  GLY A CA   1 
ATOM   334   C C    . GLY A 1 25  ? 98.216  -74.665  -2.570  1.00 29.53  ? 69  GLY A C    1 
ATOM   335   O O    . GLY A 1 25  ? 97.389  -74.313  -3.416  1.00 25.93  ? 69  GLY A O    1 
ATOM   336   H H    . GLY A 1 25  ? 96.713  -73.196  -0.873  1.00 29.04  ? 69  GLY A H    1 
ATOM   337   H HA2  . GLY A 1 25  ? 99.342  -73.319  -1.542  1.00 30.25  ? 69  GLY A HA2  1 
ATOM   338   H HA3  . GLY A 1 25  ? 98.666  -74.383  -0.606  1.00 30.25  ? 69  GLY A HA3  1 
ATOM   339   N N    . ALA A 1 26  ? 98.887  -75.817  -2.646  1.00 27.34  ? 70  ALA A N    1 
ATOM   340   C CA   . ALA A 1 26  ? 98.774  -76.674  -3.821  1.00 27.74  ? 70  ALA A CA   1 
ATOM   341   C C    . ALA A 1 26  ? 97.357  -77.207  -3.990  1.00 28.20  ? 70  ALA A C    1 
ATOM   342   O O    . ALA A 1 26  ? 96.860  -77.320  -5.117  1.00 23.06  ? 70  ALA A O    1 
ATOM   343   C CB   . ALA A 1 26  ? 99.764  -77.834  -3.718  1.00 26.75  ? 70  ALA A CB   1 
ATOM   344   H H    . ALA A 1 26  ? 99.410  -76.120  -2.035  1.00 32.81  ? 70  ALA A H    1 
ATOM   345   H HA   . ALA A 1 26  ? 98.997  -76.158  -4.612  1.00 33.29  ? 70  ALA A HA   1 
ATOM   346   H HB1  . ALA A 1 26  ? 99.677  -78.394  -4.505  1.00 32.10  ? 70  ALA A HB1  1 
ATOM   347   H HB2  . ALA A 1 26  ? 100.664 -77.476  -3.664  1.00 32.10  ? 70  ALA A HB2  1 
ATOM   348   H HB3  . ALA A 1 26  ? 99.565  -78.349  -2.921  1.00 32.10  ? 70  ALA A HB3  1 
ATOM   349   N N    . GLN A 1 27  ? 96.693  -77.553  -2.886  1.00 25.02  ? 71  GLN A N    1 
ATOM   350   C CA   . GLN A 1 27  ? 95.354  -78.127  -2.988  1.00 32.58  ? 71  GLN A CA   1 
ATOM   351   C C    . GLN A 1 27  ? 94.373  -77.131  -3.599  1.00 31.87  ? 71  GLN A C    1 
ATOM   352   O O    . GLN A 1 27  ? 93.499  -77.512  -4.388  1.00 24.23  ? 71  GLN A O    1 
ATOM   353   C CB   . GLN A 1 27  ? 94.871  -78.587  -1.615  1.00 29.16  ? 71  GLN A CB   1 
ATOM   354   C CG   . GLN A 1 27  ? 95.840  -79.503  -0.883  1.00 46.41  ? 71  GLN A CG   1 
ATOM   355   C CD   . GLN A 1 27  ? 96.102  -80.789  -1.639  1.00 50.58  ? 71  GLN A CD   1 
ATOM   356   O OE1  . GLN A 1 27  ? 95.258  -81.253  -2.406  1.00 48.92  ? 71  GLN A OE1  1 
ATOM   357   N NE2  . GLN A 1 27  ? 97.278  -81.369  -1.432  1.00 55.17  ? 71  GLN A NE2  1 
ATOM   358   H H    . GLN A 1 27  ? 96.989  -77.469  -2.083  1.00 30.03  ? 71  GLN A H    1 
ATOM   359   H HA   . GLN A 1 27  ? 95.389  -78.904  -3.568  1.00 39.10  ? 71  GLN A HA   1 
ATOM   360   H HB2  . GLN A 1 27  ? 94.727  -77.805  -1.058  1.00 34.99  ? 71  GLN A HB2  1 
ATOM   361   H HB3  . GLN A 1 27  ? 94.036  -79.069  -1.725  1.00 34.99  ? 71  GLN A HB3  1 
ATOM   362   H HG2  . GLN A 1 27  ? 96.687  -79.043  -0.770  1.00 55.70  ? 71  GLN A HG2  1 
ATOM   363   H HG3  . GLN A 1 27  ? 95.468  -79.733  -0.018  1.00 55.70  ? 71  GLN A HG3  1 
ATOM   364   H HE21 . GLN A 1 27  ? 97.843  -81.013  -0.891  1.00 66.21  ? 71  GLN A HE21 1 
ATOM   365   H HE22 . GLN A 1 27  ? 97.473  -82.101  -1.838  1.00 66.21  ? 71  GLN A HE22 1 
ATOM   366   N N    . THR A 1 28  ? 94.505  -75.848  -3.249  1.00 23.96  ? 72  THR A N    1 
ATOM   367   C CA   . THR A 1 28  ? 93.656  -74.827  -3.852  1.00 23.60  ? 72  THR A CA   1 
ATOM   368   C C    . THR A 1 28  ? 93.969  -74.655  -5.333  1.00 25.33  ? 72  THR A C    1 
ATOM   369   O O    . THR A 1 28  ? 93.055  -74.565  -6.162  1.00 23.51  ? 72  THR A O    1 
ATOM   370   C CB   . THR A 1 28  ? 93.828  -73.498  -3.116  1.00 23.26  ? 72  THR A CB   1 
ATOM   371   O OG1  . THR A 1 28  ? 93.451  -73.659  -1.742  1.00 21.06  ? 72  THR A OG1  1 
ATOM   372   C CG2  . THR A 1 28  ? 92.968  -72.404  -3.751  1.00 21.16  ? 72  THR A CG2  1 
ATOM   373   H H    . THR A 1 28  ? 95.070  -75.551  -2.673  1.00 28.75  ? 72  THR A H    1 
ATOM   374   H HA   . THR A 1 28  ? 92.728  -75.098  -3.771  1.00 28.32  ? 72  THR A HA   1 
ATOM   375   H HB   . THR A 1 28  ? 94.757  -73.223  -3.164  1.00 27.91  ? 72  THR A HB   1 
ATOM   376   H HG1  . THR A 1 28  ? 93.934  -74.241  -1.378  1.00 25.27  ? 72  THR A HG1  1 
ATOM   377   H HG21 . THR A 1 28  ? 93.089  -71.569  -3.273  1.00 25.40  ? 72  THR A HG21 1 
ATOM   378   H HG22 . THR A 1 28  ? 93.225  -72.277  -4.678  1.00 25.40  ? 72  THR A HG22 1 
ATOM   379   H HG23 . THR A 1 28  ? 92.032  -72.656  -3.715  1.00 25.40  ? 72  THR A HG23 1 
ATOM   380   N N    . VAL A 1 29  ? 95.255  -74.607  -5.686  1.00 24.23  ? 73  VAL A N    1 
ATOM   381   C CA   . VAL A 1 29  ? 95.633  -74.445  -7.086  1.00 23.75  ? 73  VAL A CA   1 
ATOM   382   C C    . VAL A 1 29  ? 95.107  -75.612  -7.912  1.00 19.89  ? 73  VAL A C    1 
ATOM   383   O O    . VAL A 1 29  ? 94.615  -75.428  -9.032  1.00 24.39  ? 73  VAL A O    1 
ATOM   384   C CB   . VAL A 1 29  ? 97.160  -74.300  -7.215  1.00 23.66  ? 73  VAL A CB   1 
ATOM   385   C CG1  . VAL A 1 29  ? 97.571  -74.190  -8.676  1.00 17.88  ? 73  VAL A CG1  1 
ATOM   386   C CG2  . VAL A 1 29  ? 97.641  -73.084  -6.443  1.00 16.04  ? 73  VAL A CG2  1 
ATOM   387   H H    . VAL A 1 29  ? 95.918  -74.665  -5.140  1.00 29.08  ? 73  VAL A H    1 
ATOM   388   H HA   . VAL A 1 29  ? 95.228  -73.633  -7.428  1.00 28.50  ? 73  VAL A HA   1 
ATOM   389   H HB   . VAL A 1 29  ? 97.588  -75.086  -6.838  1.00 28.40  ? 73  VAL A HB   1 
ATOM   390   H HG11 . VAL A 1 29  ? 98.535  -74.100  -8.727  1.00 21.46  ? 73  VAL A HG11 1 
ATOM   391   H HG12 . VAL A 1 29  ? 97.288  -74.991  -9.144  1.00 21.46  ? 73  VAL A HG12 1 
ATOM   392   H HG13 . VAL A 1 29  ? 97.145  -73.411  -9.066  1.00 21.46  ? 73  VAL A HG13 1 
ATOM   393   H HG21 . VAL A 1 29  ? 98.604  -73.011  -6.537  1.00 19.25  ? 73  VAL A HG21 1 
ATOM   394   H HG22 . VAL A 1 29  ? 97.212  -72.292  -6.804  1.00 19.25  ? 73  VAL A HG22 1 
ATOM   395   H HG23 . VAL A 1 29  ? 97.406  -73.190  -5.508  1.00 19.25  ? 73  VAL A HG23 1 
ATOM   396   N N    . ARG A 1 30  ? 95.199  -76.830  -7.374  1.00 17.53  ? 74  ARG A N    1 
ATOM   397   C CA   . ARG A 1 30  ? 94.630  -77.984  -8.062  1.00 27.81  ? 74  ARG A CA   1 
ATOM   398   C C    . ARG A 1 30  ? 93.126  -77.839  -8.241  1.00 21.69  ? 74  ARG A C    1 
ATOM   399   O O    . ARG A 1 30  ? 92.578  -78.279  -9.258  1.00 24.20  ? 74  ARG A O    1 
ATOM   400   C CB   . ARG A 1 30  ? 94.956  -79.268  -7.298  1.00 24.38  ? 74  ARG A CB   1 
ATOM   401   C CG   . ARG A 1 30  ? 94.542  -80.551  -8.015  1.00 25.24  ? 74  ARG A CG   1 
ATOM   402   C CD   . ARG A 1 30  ? 95.300  -80.754  -9.326  1.00 24.03  ? 74  ARG A CD   1 
ATOM   403   N NE   . ARG A 1 30  ? 96.734  -80.936  -9.118  1.00 24.80  ? 74  ARG A NE   1 
ATOM   404   C CZ   . ARG A 1 30  ? 97.640  -80.959  -10.091 1.00 22.67  ? 74  ARG A CZ   1 
ATOM   405   N NH1  . ARG A 1 30  ? 97.271  -80.800  -11.355 1.00 23.96  ? 74  ARG A NH1  1 
ATOM   406   N NH2  . ARG A 1 30  ? 98.922  -81.135  -9.800  1.00 27.66  ? 74  ARG A NH2  1 
ATOM   407   H H    . ARG A 1 30  ? 95.580  -77.010  -6.624  1.00 21.04  ? 74  ARG A H    1 
ATOM   408   H HA   . ARG A 1 30  ? 95.030  -78.052  -8.943  1.00 33.38  ? 74  ARG A HA   1 
ATOM   409   H HB2  . ARG A 1 30  ? 95.914  -79.308  -7.152  1.00 29.26  ? 74  ARG A HB2  1 
ATOM   410   H HB3  . ARG A 1 30  ? 94.496  -79.247  -6.444  1.00 29.26  ? 74  ARG A HB3  1 
ATOM   411   H HG2  . ARG A 1 30  ? 94.727  -81.310  -7.440  1.00 30.29  ? 74  ARG A HG2  1 
ATOM   412   H HG3  . ARG A 1 30  ? 93.594  -80.510  -8.218  1.00 30.29  ? 74  ARG A HG3  1 
ATOM   413   H HD2  . ARG A 1 30  ? 94.958  -81.544  -9.772  1.00 28.84  ? 74  ARG A HD2  1 
ATOM   414   H HD3  . ARG A 1 30  ? 95.175  -79.973  -9.889  1.00 28.84  ? 74  ARG A HD3  1 
ATOM   415   H HE   . ARG A 1 30  ? 97.012  -81.036  -8.310  1.00 29.76  ? 74  ARG A HE   1 
ATOM   416   H HH11 . ARG A 1 30  ? 96.441  -80.686  -11.549 1.00 28.76  ? 74  ARG A HH11 1 
ATOM   417   H HH12 . ARG A 1 30  ? 97.861  -80.813  -11.980 1.00 28.76  ? 74  ARG A HH12 1 
ATOM   418   H HH21 . ARG A 1 30  ? 99.167  -81.237  -8.982  1.00 33.20  ? 74  ARG A HH21 1 
ATOM   419   H HH22 . ARG A 1 30  ? 99.508  -81.147  -10.429 1.00 33.20  ? 74  ARG A HH22 1 
ATOM   420   N N    . SER A 1 31  ? 92.443  -77.223  -7.274  1.00 22.54  ? 75  SER A N    1 
ATOM   421   C CA   . SER A 1 31  ? 90.995  -77.062  -7.370  1.00 20.74  ? 75  SER A CA   1 
ATOM   422   C C    . SER A 1 31  ? 90.615  -76.047  -8.443  1.00 25.11  ? 75  SER A C    1 
ATOM   423   O O    . SER A 1 31  ? 89.591  -76.208  -9.118  1.00 26.66  ? 75  SER A O    1 
ATOM   424   C CB   . SER A 1 31  ? 90.429  -76.647  -6.014  1.00 31.11  ? 75  SER A CB   1 
ATOM   425   O OG   . SER A 1 31  ? 90.663  -77.652  -5.043  1.00 27.25  ? 75  SER A OG   1 
ATOM   426   H H    . SER A 1 31  ? 92.792  -76.893  -6.561  1.00 27.05  ? 75  SER A H    1 
ATOM   427   H HA   . SER A 1 31  ? 90.600  -77.914  -7.611  1.00 24.89  ? 75  SER A HA   1 
ATOM   428   H HB2  . SER A 1 31  ? 90.859  -75.826  -5.729  1.00 37.33  ? 75  SER A HB2  1 
ATOM   429   H HB3  . SER A 1 31  ? 89.473  -76.508  -6.100  1.00 37.33  ? 75  SER A HB3  1 
ATOM   430   H HG   . SER A 1 31  ? 91.489  -77.783  -4.959  1.00 32.70  ? 75  SER A HG   1 
ATOM   431   N N    . THR A 1 32  ? 91.421  -74.994  -8.618  1.00 24.26  ? 76  THR A N    1 
ATOM   432   C CA   . THR A 1 32  ? 91.129  -74.019  -9.664  1.00 22.32  ? 76  THR A CA   1 
ATOM   433   C C    . THR A 1 32  ? 91.244  -74.637  -11.051 1.00 22.86  ? 76  THR A C    1 
ATOM   434   O O    . THR A 1 32  ? 90.595  -74.171  -11.994 1.00 36.80  ? 76  THR A O    1 
ATOM   435   C CB   . THR A 1 32  ? 92.067  -72.813  -9.562  1.00 22.16  ? 76  THR A CB   1 
ATOM   436   O OG1  . THR A 1 32  ? 93.420  -73.228  -9.788  1.00 21.70  ? 76  THR A OG1  1 
ATOM   437   C CG2  . THR A 1 32  ? 91.956  -72.147  -8.196  1.00 21.86  ? 76  THR A CG2  1 
ATOM   438   H H    . THR A 1 32  ? 92.126  -74.828  -8.154  1.00 29.12  ? 76  THR A H    1 
ATOM   439   H HA   . THR A 1 32  ? 90.220  -73.700  -9.553  1.00 26.79  ? 76  THR A HA   1 
ATOM   440   H HB   . THR A 1 32  ? 91.820  -72.161  -10.236 1.00 26.59  ? 76  THR A HB   1 
ATOM   441   H HG1  . THR A 1 32  ? 93.645  -73.800  -9.214  1.00 26.05  ? 76  THR A HG1  1 
ATOM   442   H HG21 . THR A 1 32  ? 92.556  -71.387  -8.148  1.00 26.23  ? 76  THR A HG21 1 
ATOM   443   H HG22 . THR A 1 32  ? 91.047  -71.842  -8.050  1.00 26.23  ? 76  THR A HG22 1 
ATOM   444   H HG23 . THR A 1 32  ? 92.192  -72.779  -7.499  1.00 26.23  ? 76  THR A HG23 1 
ATOM   445   N N    . MET A 1 33  ? 92.059  -75.680  -11.196 1.00 25.47  ? 77  MET A N    1 
ATOM   446   C CA   . MET A 1 33  ? 92.244  -76.326  -12.488 1.00 28.61  ? 77  MET A CA   1 
ATOM   447   C C    . MET A 1 33  ? 91.209  -77.414  -12.742 1.00 19.32  ? 77  MET A C    1 
ATOM   448   O O    . MET A 1 33  ? 90.773  -77.598  -13.883 1.00 39.65  ? 77  MET A O    1 
ATOM   449   C CB   . MET A 1 33  ? 93.650  -76.921  -12.577 1.00 22.17  ? 77  MET A CB   1 
ATOM   450   C CG   . MET A 1 33  ? 94.765  -75.887  -12.484 1.00 35.11  ? 77  MET A CG   1 
ATOM   451   S SD   . MET A 1 33  ? 96.412  -76.622  -12.559 1.00 35.03  ? 77  MET A SD   1 
ATOM   452   C CE   . MET A 1 33  ? 96.396  -77.588  -11.071 1.00 28.52  ? 77  MET A CE   1 
ATOM   453   H H    . MET A 1 33  ? 92.516  -76.032  -10.559 1.00 30.56  ? 77  MET A H    1 
ATOM   454   H HA   . MET A 1 33  ? 92.164  -75.655  -13.184 1.00 34.33  ? 77  MET A HA   1 
ATOM   455   H HB2  . MET A 1 33  ? 93.769  -77.550  -11.849 1.00 26.61  ? 77  MET A HB2  1 
ATOM   456   H HB3  . MET A 1 33  ? 93.742  -77.380  -13.426 1.00 26.61  ? 77  MET A HB3  1 
ATOM   457   H HG2  . MET A 1 33  ? 94.681  -75.265  -13.224 1.00 42.14  ? 77  MET A HG2  1 
ATOM   458   H HG3  . MET A 1 33  ? 94.687  -75.413  -11.642 1.00 42.14  ? 77  MET A HG3  1 
ATOM   459   H HE1  . MET A 1 33  ? 97.246  -78.049  -10.985 1.00 34.23  ? 77  MET A HE1  1 
ATOM   460   H HE2  . MET A 1 33  ? 96.261  -76.998  -10.313 1.00 34.23  ? 77  MET A HE2  1 
ATOM   461   H HE3  . MET A 1 33  ? 95.674  -78.233  -11.122 1.00 34.23  ? 77  MET A HE3  1 
ATOM   462   N N    . ASN A 1 34  ? 90.806  -78.140  -11.700 1.00 27.97  ? 78  ASN A N    1 
ATOM   463   C CA   . ASN A 1 34  ? 89.846  -79.225  -11.840 1.00 21.88  ? 78  ASN A CA   1 
ATOM   464   C C    . ASN A 1 34  ? 88.398  -78.763  -11.767 1.00 35.22  ? 78  ASN A C    1 
ATOM   465   O O    . ASN A 1 34  ? 87.496  -79.578  -11.991 1.00 26.71  ? 78  ASN A O    1 
ATOM   466   C CB   . ASN A 1 34  ? 90.080  -80.285  -10.759 1.00 25.31  ? 78  ASN A CB   1 
ATOM   467   C CG   . ASN A 1 34  ? 91.314  -81.124  -11.019 1.00 42.06  ? 78  ASN A CG   1 
ATOM   468   O OD1  . ASN A 1 34  ? 91.879  -81.103  -12.115 1.00 30.49  ? 78  ASN A OD1  1 
ATOM   469   N ND2  . ASN A 1 34  ? 91.731  -81.881  -10.013 1.00 35.52  ? 78  ASN A ND2  1 
ATOM   470   H H    . ASN A 1 34  ? 91.079  -78.020  -10.893 1.00 33.57  ? 78  ASN A H    1 
ATOM   471   H HA   . ASN A 1 34  ? 89.978  -79.648  -12.703 1.00 26.26  ? 78  ASN A HA   1 
ATOM   472   H HB2  . ASN A 1 34  ? 90.193  -79.843  -9.902  1.00 30.37  ? 78  ASN A HB2  1 
ATOM   473   H HB3  . ASN A 1 34  ? 89.314  -80.879  -10.727 1.00 30.37  ? 78  ASN A HB3  1 
ATOM   474   H HD21 . ASN A 1 34  ? 92.428  -82.377  -10.108 1.00 42.62  ? 78  ASN A HD21 1 
ATOM   475   H HD22 . ASN A 1 34  ? 91.306  -81.876  -9.266  1.00 42.62  ? 78  ASN A HD22 1 
ATOM   476   N N    . PHE A 1 35  ? 88.149  -77.491  -11.456 1.00 25.97  ? 79  PHE A N    1 
ATOM   477   C CA   . PHE A 1 35  ? 86.792  -76.976  -11.333 1.00 24.38  ? 79  PHE A CA   1 
ATOM   478   C C    . PHE A 1 35  ? 86.701  -75.611  -12.018 1.00 23.82  ? 79  PHE A C    1 
ATOM   479   O O    . PHE A 1 35  ? 86.379  -74.592  -11.414 1.00 24.72  ? 79  PHE A O    1 
ATOM   480   C CB   . PHE A 1 35  ? 86.374  -76.906  -9.866  1.00 23.63  ? 79  PHE A CB   1 
ATOM   481   C CG   . PHE A 1 35  ? 86.359  -78.243  -9.182  1.00 31.37  ? 79  PHE A CG   1 
ATOM   482   C CD1  . PHE A 1 35  ? 85.356  -79.160  -9.448  1.00 22.83  ? 79  PHE A CD1  1 
ATOM   483   C CD2  . PHE A 1 35  ? 87.349  -78.585  -8.277  1.00 34.80  ? 79  PHE A CD2  1 
ATOM   484   C CE1  . PHE A 1 35  ? 85.339  -80.395  -8.824  1.00 24.91  ? 79  PHE A CE1  1 
ATOM   485   C CE2  . PHE A 1 35  ? 87.338  -79.816  -7.649  1.00 34.94  ? 79  PHE A CE2  1 
ATOM   486   C CZ   . PHE A 1 35  ? 86.331  -80.723  -7.923  1.00 36.54  ? 79  PHE A CZ   1 
ATOM   487   H H    . PHE A 1 35  ? 88.758  -76.902  -11.310 1.00 31.16  ? 79  PHE A H    1 
ATOM   488   H HA   . PHE A 1 35  ? 86.184  -77.579  -11.788 1.00 29.26  ? 79  PHE A HA   1 
ATOM   489   H HB2  . PHE A 1 35  ? 86.997  -76.335  -9.390  1.00 28.36  ? 79  PHE A HB2  1 
ATOM   490   H HB3  . PHE A 1 35  ? 85.480  -76.534  -9.813  1.00 28.36  ? 79  PHE A HB3  1 
ATOM   491   H HD1  . PHE A 1 35  ? 84.685  -78.943  -10.055 1.00 27.40  ? 79  PHE A HD1  1 
ATOM   492   H HD2  . PHE A 1 35  ? 88.030  -77.979  -8.089  1.00 41.76  ? 79  PHE A HD2  1 
ATOM   493   H HE1  . PHE A 1 35  ? 84.660  -81.002  -9.010  1.00 29.90  ? 79  PHE A HE1  1 
ATOM   494   H HE2  . PHE A 1 35  ? 88.008  -80.035  -7.042  1.00 41.93  ? 79  PHE A HE2  1 
ATOM   495   H HZ   . PHE A 1 35  ? 86.322  -81.551  -7.501  1.00 43.85  ? 79  PHE A HZ   1 
ATOM   496   N N    . LYS A 1 36  ? 86.995  -75.593  -13.318 1.00 30.03  ? 80  LYS A N    1 
ATOM   497   C CA   . LYS A 1 36  ? 86.825  -74.394  -14.137 1.00 30.81  ? 80  LYS A CA   1 
ATOM   498   C C    . LYS A 1 36  ? 85.379  -74.371  -14.619 1.00 35.05  ? 80  LYS A C    1 
ATOM   499   O O    . LYS A 1 36  ? 85.051  -74.766  -15.740 1.00 26.57  ? 80  LYS A O    1 
ATOM   500   C CB   . LYS A 1 36  ? 87.809  -74.385  -15.301 1.00 25.03  ? 80  LYS A CB   1 
ATOM   501   C CG   . LYS A 1 36  ? 89.235  -74.729  -14.918 1.00 42.52  ? 80  LYS A CG   1 
ATOM   502   C CD   . LYS A 1 36  ? 90.197  -74.469  -16.067 1.00 39.69  ? 80  LYS A CD   1 
ATOM   503   H H    . LYS A 1 36  ? 87.297  -76.271  -13.754 1.00 36.04  ? 80  LYS A H    1 
ATOM   504   H HA   . LYS A 1 36  ? 86.982  -73.606  -13.594 1.00 36.98  ? 80  LYS A HA   1 
ATOM   505   H HB2  . LYS A 1 36  ? 87.516  -75.033  -15.960 1.00 30.03  ? 80  LYS A HB2  1 
ATOM   506   H HB3  . LYS A 1 36  ? 87.815  -73.498  -15.695 1.00 30.03  ? 80  LYS A HB3  1 
ATOM   507   H HG2  . LYS A 1 36  ? 89.505  -74.182  -14.164 1.00 51.02  ? 80  LYS A HG2  1 
ATOM   508   H HG3  . LYS A 1 36  ? 89.286  -75.670  -14.686 1.00 51.02  ? 80  LYS A HG3  1 
ATOM   509   H HD2  . LYS A 1 36  ? 89.764  -74.708  -16.901 1.00 47.63  ? 80  LYS A HD2  1 
ATOM   510   H HD3  . LYS A 1 36  ? 90.433  -73.528  -16.073 1.00 47.63  ? 80  LYS A HD3  1 
ATOM   511   N N    . ILE A 1 37  ? 84.496  -73.906  -13.739 1.00 19.45  ? 81  ILE A N    1 
ATOM   512   C CA   . ILE A 1 37  ? 83.058  -73.910  -13.989 1.00 19.76  ? 81  ILE A CA   1 
ATOM   513   C C    . ILE A 1 37  ? 82.510  -72.540  -13.610 1.00 12.88  ? 81  ILE A C    1 
ATOM   514   O O    . ILE A 1 37  ? 82.314  -72.248  -12.426 1.00 18.68  ? 81  ILE A O    1 
ATOM   515   C CB   . ILE A 1 37  ? 82.334  -75.024  -13.219 1.00 17.78  ? 81  ILE A CB   1 
ATOM   516   C CG1  . ILE A 1 37  ? 82.877  -76.393  -13.630 1.00 23.22  ? 81  ILE A CG1  1 
ATOM   517   C CG2  . ILE A 1 37  ? 80.832  -74.967  -13.480 1.00 15.83  ? 81  ILE A CG2  1 
ATOM   518   C CD1  . ILE A 1 37  ? 82.353  -77.544  -12.793 1.00 24.90  ? 81  ILE A CD1  1 
ATOM   519   H H    . ILE A 1 37  ? 84.710  -73.576  -12.974 1.00 23.34  ? 81  ILE A H    1 
ATOM   520   H HA   . ILE A 1 37  ? 82.900  -74.047  -14.936 1.00 23.71  ? 81  ILE A HA   1 
ATOM   521   H HB   . ILE A 1 37  ? 82.491  -74.899  -12.270 1.00 21.34  ? 81  ILE A HB   1 
ATOM   522   H HG12 . ILE A 1 37  ? 82.630  -76.562  -14.552 1.00 27.87  ? 81  ILE A HG12 1 
ATOM   523   H HG13 . ILE A 1 37  ? 83.843  -76.383  -13.546 1.00 27.87  ? 81  ILE A HG13 1 
ATOM   524   H HG21 . ILE A 1 37  ? 80.399  -75.679  -12.983 1.00 19.00  ? 81  ILE A HG21 1 
ATOM   525   H HG22 . ILE A 1 37  ? 80.494  -74.106  -13.187 1.00 19.00  ? 81  ILE A HG22 1 
ATOM   526   H HG23 . ILE A 1 37  ? 80.673  -75.080  -14.430 1.00 19.00  ? 81  ILE A HG23 1 
ATOM   527   H HD11 . ILE A 1 37  ? 82.742  -78.372  -13.116 1.00 29.88  ? 81  ILE A HD11 1 
ATOM   528   H HD12 . ILE A 1 37  ? 82.602  -77.400  -11.867 1.00 29.88  ? 81  ILE A HD12 1 
ATOM   529   H HD13 . ILE A 1 37  ? 81.387  -77.579  -12.875 1.00 29.88  ? 81  ILE A HD13 1 
ATOM   530   N N    . GLY A 1 38  ? 82.270  -71.690  -14.613 1.00 25.73  ? 82  GLY A N    1 
ATOM   531   C CA   . GLY A 1 38  ? 81.395  -70.542  -14.488 1.00 25.26  ? 82  GLY A CA   1 
ATOM   532   C C    . GLY A 1 38  ? 82.095  -69.196  -14.427 1.00 30.09  ? 82  GLY A C    1 
ATOM   533   O O    . GLY A 1 38  ? 81.505  -68.189  -14.841 1.00 33.97  ? 82  GLY A O    1 
ATOM   534   H H    . GLY A 1 38  ? 82.618  -71.768  -15.395 1.00 30.88  ? 82  GLY A H    1 
ATOM   535   H HA2  . GLY A 1 38  ? 80.787  -70.528  -15.244 1.00 30.31  ? 82  GLY A HA2  1 
ATOM   536   H HA3  . GLY A 1 38  ? 80.865  -70.638  -13.681 1.00 30.31  ? 82  GLY A HA3  1 
ATOM   537   N N    . GLY A 1 39  ? 83.317  -69.149  -13.911 1.00 26.16  ? 83  GLY A N    1 
ATOM   538   C CA   . GLY A 1 39  ? 84.050  -67.898  -13.810 1.00 31.56  ? 83  GLY A CA   1 
ATOM   539   C C    . GLY A 1 39  ? 84.001  -67.290  -12.421 1.00 26.30  ? 83  GLY A C    1 
ATOM   540   O O    . GLY A 1 39  ? 83.597  -67.916  -11.437 1.00 36.61  ? 83  GLY A O    1 
ATOM   541   H H    . GLY A 1 39  ? 83.745  -69.832  -13.612 1.00 31.39  ? 83  GLY A H    1 
ATOM   542   H HA2  . GLY A 1 39  ? 84.979  -68.051  -14.043 1.00 37.88  ? 83  GLY A HA2  1 
ATOM   543   H HA3  . GLY A 1 39  ? 83.679  -67.257  -14.436 1.00 37.88  ? 83  GLY A HA3  1 
ATOM   544   N N    . VAL A 1 40  ? 84.420  -66.022  -12.353 1.00 30.81  ? 84  VAL A N    1 
ATOM   545   C CA   . VAL A 1 40  ? 84.604  -65.369  -11.057 1.00 30.71  ? 84  VAL A CA   1 
ATOM   546   C C    . VAL A 1 40  ? 83.270  -65.079  -10.380 1.00 18.96  ? 84  VAL A C    1 
ATOM   547   O O    . VAL A 1 40  ? 83.197  -65.030  -9.146  1.00 27.76  ? 84  VAL A O    1 
ATOM   548   C CB   . VAL A 1 40  ? 85.438  -64.080  -11.203 1.00 35.84  ? 84  VAL A CB   1 
ATOM   549   C CG1  . VAL A 1 40  ? 86.854  -64.408  -11.651 1.00 37.46  ? 84  VAL A CG1  1 
ATOM   550   C CG2  . VAL A 1 40  ? 84.771  -63.095  -12.155 1.00 31.86  ? 84  VAL A CG2  1 
ATOM   551   H H    . VAL A 1 40  ? 84.601  -65.526  -13.032 1.00 36.98  ? 84  VAL A H    1 
ATOM   552   H HA   . VAL A 1 40  ? 85.099  -65.970  -10.479 1.00 36.86  ? 84  VAL A HA   1 
ATOM   553   H HB   . VAL A 1 40  ? 85.498  -63.652  -10.334 1.00 43.01  ? 84  VAL A HB   1 
ATOM   554   H HG11 . VAL A 1 40  ? 87.357  -63.583  -11.735 1.00 44.95  ? 84  VAL A HG11 1 
ATOM   555   H HG12 . VAL A 1 40  ? 87.269  -64.983  -10.989 1.00 44.95  ? 84  VAL A HG12 1 
ATOM   556   H HG13 . VAL A 1 40  ? 86.817  -64.862  -12.508 1.00 44.95  ? 84  VAL A HG13 1 
ATOM   557   H HG21 . VAL A 1 40  ? 85.321  -62.299  -12.222 1.00 38.23  ? 84  VAL A HG21 1 
ATOM   558   H HG22 . VAL A 1 40  ? 84.681  -63.510  -13.027 1.00 38.23  ? 84  VAL A HG22 1 
ATOM   559   H HG23 . VAL A 1 40  ? 83.895  -62.863  -11.807 1.00 38.23  ? 84  VAL A HG23 1 
ATOM   560   N N    . THR A 1 41  ? 82.199  -64.877  -11.149 1.00 17.16  ? 85  THR A N    1 
ATOM   561   C CA   . THR A 1 41  ? 80.894  -64.673  -10.529 1.00 29.97  ? 85  THR A CA   1 
ATOM   562   C C    . THR A 1 41  ? 80.432  -65.887  -9.734  1.00 17.68  ? 85  THR A C    1 
ATOM   563   O O    . THR A 1 41  ? 79.465  -65.775  -8.972  1.00 24.09  ? 85  THR A O    1 
ATOM   564   C CB   . THR A 1 41  ? 79.835  -64.331  -11.584 1.00 31.16  ? 85  THR A CB   1 
ATOM   565   O OG1  . THR A 1 41  ? 79.779  -65.367  -12.572 1.00 34.34  ? 85  THR A OG1  1 
ATOM   566   C CG2  . THR A 1 41  ? 80.150  -63.002  -12.258 1.00 31.10  ? 85  THR A CG2  1 
ATOM   567   H H    . THR A 1 41  ? 82.201  -64.855  -12.009 1.00 20.59  ? 85  THR A H    1 
ATOM   568   H HA   . THR A 1 41  ? 80.954  -63.923  -9.916  1.00 35.97  ? 85  THR A HA   1 
ATOM   569   H HB   . THR A 1 41  ? 78.969  -64.254  -11.154 1.00 37.40  ? 85  THR A HB   1 
ATOM   570   H HG1  . THR A 1 41  ? 79.578  -66.098  -12.211 1.00 41.21  ? 85  THR A HG1  1 
ATOM   571   H HG21 . THR A 1 41  ? 79.472  -62.798  -12.922 1.00 37.33  ? 85  THR A HG21 1 
ATOM   572   H HG22 . THR A 1 41  ? 80.167  -62.291  -11.598 1.00 37.33  ? 85  THR A HG22 1 
ATOM   573   H HG23 . THR A 1 41  ? 81.015  -63.048  -12.694 1.00 37.33  ? 85  THR A HG23 1 
ATOM   574   N N    . GLU A 1 42  ? 81.090  -67.035  -9.891  1.00 17.24  ? 86  GLU A N    1 
ATOM   575   C CA   . GLU A 1 42  ? 80.714  -68.259  -9.199  1.00 14.51  ? 86  GLU A CA   1 
ATOM   576   C C    . GLU A 1 42  ? 81.573  -68.533  -7.974  1.00 18.75  ? 86  GLU A C    1 
ATOM   577   O O    . GLU A 1 42  ? 81.453  -69.607  -7.375  1.00 20.33  ? 86  GLU A O    1 
ATOM   578   C CB   . GLU A 1 42  ? 80.796  -69.444  -10.158 1.00 13.61  ? 86  GLU A CB   1 
ATOM   579   C CG   . GLU A 1 42  ? 80.043  -69.235  -11.456 1.00 23.29  ? 86  GLU A CG   1 
ATOM   580   C CD   . GLU A 1 42  ? 78.605  -68.827  -11.238 1.00 22.34  ? 86  GLU A CD   1 
ATOM   581   O OE1  . GLU A 1 42  ? 77.877  -69.599  -10.580 1.00 16.10  ? 86  GLU A OE1  1 
ATOM   582   O OE2  . GLU A 1 42  ? 78.205  -67.742  -11.707 1.00 18.13  ? 86  GLU A OE2  1 
ATOM   583   H H    . GLU A 1 42  ? 81.773  -67.129  -10.405 1.00 20.69  ? 86  GLU A H    1 
ATOM   584   H HA   . GLU A 1 42  ? 79.794  -68.180  -8.903  1.00 17.41  ? 86  GLU A HA   1 
ATOM   585   H HB2  . GLU A 1 42  ? 81.727  -69.604  -10.379 1.00 16.34  ? 86  GLU A HB2  1 
ATOM   586   H HB3  . GLU A 1 42  ? 80.422  -70.226  -9.722  1.00 16.34  ? 86  GLU A HB3  1 
ATOM   587   H HG2  . GLU A 1 42  ? 80.479  -68.534  -11.965 1.00 27.95  ? 86  GLU A HG2  1 
ATOM   588   H HG3  . GLU A 1 42  ? 80.046  -70.063  -11.960 1.00 27.95  ? 86  GLU A HG3  1 
ATOM   589   N N    . ARG A 1 43  ? 82.429  -67.593  -7.586  1.00 22.63  ? 87  ARG A N    1 
ATOM   590   C CA   . ARG A 1 43  ? 83.279  -67.801  -6.423  1.00 20.85  ? 87  ARG A CA   1 
ATOM   591   C C    . ARG A 1 43  ? 82.434  -68.039  -5.179  1.00 24.95  ? 87  ARG A C    1 
ATOM   592   O O    . ARG A 1 43  ? 81.353  -67.465  -5.022  1.00 22.95  ? 87  ARG A O    1 
ATOM   593   C CB   . ARG A 1 43  ? 84.197  -66.598  -6.218  1.00 30.21  ? 87  ARG A CB   1 
ATOM   594   C CG   . ARG A 1 43  ? 85.400  -66.577  -7.148  1.00 40.68  ? 87  ARG A CG   1 
ATOM   595   C CD   . ARG A 1 43  ? 86.228  -65.328  -6.926  1.00 44.18  ? 87  ARG A CD   1 
ATOM   596   N NE   . ARG A 1 43  ? 86.665  -65.215  -5.537  1.00 51.67  ? 87  ARG A NE   1 
ATOM   597   C CZ   . ARG A 1 43  ? 87.004  -64.075  -4.942  1.00 47.01  ? 87  ARG A CZ   1 
ATOM   598   N NH1  . ARG A 1 43  ? 86.950  -62.928  -5.605  1.00 55.98  ? 87  ARG A NH1  1 
ATOM   599   N NH2  . ARG A 1 43  ? 87.390  -64.083  -3.675  1.00 55.64  ? 87  ARG A NH2  1 
ATOM   600   H H    . ARG A 1 43  ? 82.535  -66.834  -7.975  1.00 27.16  ? 87  ARG A H    1 
ATOM   601   H HA   . ARG A 1 43  ? 83.833  -68.584  -6.568  1.00 25.02  ? 87  ARG A HA   1 
ATOM   602   H HB2  . ARG A 1 43  ? 83.688  -65.787  -6.374  1.00 36.25  ? 87  ARG A HB2  1 
ATOM   603   H HB3  . ARG A 1 43  ? 84.527  -66.609  -5.306  1.00 36.25  ? 87  ARG A HB3  1 
ATOM   604   H HG2  . ARG A 1 43  ? 85.959  -67.350  -6.971  1.00 48.82  ? 87  ARG A HG2  1 
ATOM   605   H HG3  . ARG A 1 43  ? 85.096  -66.584  -8.070  1.00 48.82  ? 87  ARG A HG3  1 
ATOM   606   H HD2  . ARG A 1 43  ? 87.015  -65.361  -7.492  1.00 53.02  ? 87  ARG A HD2  1 
ATOM   607   H HD3  . ARG A 1 43  ? 85.693  -64.548  -7.141  1.00 53.02  ? 87  ARG A HD3  1 
ATOM   608   H HE   . ARG A 1 43  ? 86.707  -65.937  -5.072  1.00 62.00  ? 87  ARG A HE   1 
ATOM   609   H HH11 . ARG A 1 43  ? 86.700  -62.917  -6.428  1.00 67.17  ? 87  ARG A HH11 1 
ATOM   610   H HH12 . ARG A 1 43  ? 87.169  -62.194  -5.213  1.00 67.17  ? 87  ARG A HH12 1 
ATOM   611   H HH21 . ARG A 1 43  ? 87.425  -64.825  -3.240  1.00 66.77  ? 87  ARG A HH21 1 
ATOM   612   H HH22 . ARG A 1 43  ? 87.607  -63.347  -3.287  1.00 66.77  ? 87  ARG A HH22 1 
ATOM   613   N N    . MET A 1 44  ? 82.935  -68.901  -4.299  1.00 23.67  ? 88  MET A N    1 
ATOM   614   C CA   . MET A 1 44  ? 82.260  -69.175  -3.041  1.00 23.00  ? 88  MET A CA   1 
ATOM   615   C C    . MET A 1 44  ? 81.905  -67.857  -2.350  1.00 21.72  ? 88  MET A C    1 
ATOM   616   O O    . MET A 1 44  ? 82.764  -66.969  -2.244  1.00 23.59  ? 88  MET A O    1 
ATOM   617   C CB   . MET A 1 44  ? 83.162  -70.015  -2.136  1.00 18.72  ? 88  MET A CB   1 
ATOM   618   C CG   . MET A 1 44  ? 82.510  -70.484  -0.840  1.00 32.16  ? 88  MET A CG   1 
ATOM   619   S SD   . MET A 1 44  ? 81.197  -71.695  -1.082  1.00 22.11  ? 88  MET A SD   1 
ATOM   620   C CE   . MET A 1 44  ? 82.096  -73.048  -1.833  1.00 19.39  ? 88  MET A CE   1 
ATOM   621   H H    . MET A 1 44  ? 83.666  -69.340  -4.409  1.00 28.41  ? 88  MET A H    1 
ATOM   622   H HA   . MET A 1 44  ? 81.448  -69.677  -3.214  1.00 27.60  ? 88  MET A HA   1 
ATOM   623   H HB2  . MET A 1 44  ? 83.442  -70.805  -2.625  1.00 22.47  ? 88  MET A HB2  1 
ATOM   624   H HB3  . MET A 1 44  ? 83.940  -69.487  -1.898  1.00 22.47  ? 88  MET A HB3  1 
ATOM   625   H HG2  . MET A 1 44  ? 83.189  -70.892  -0.278  1.00 38.59  ? 88  MET A HG2  1 
ATOM   626   H HG3  . MET A 1 44  ? 82.127  -69.717  -0.387  1.00 38.59  ? 88  MET A HG3  1 
ATOM   627   H HE1  . MET A 1 44  ? 81.480  -73.775  -2.013  1.00 23.27  ? 88  MET A HE1  1 
ATOM   628   H HE2  . MET A 1 44  ? 82.497  -72.740  -2.661  1.00 23.27  ? 88  MET A HE2  1 
ATOM   629   H HE3  . MET A 1 44  ? 82.788  -73.345  -1.221  1.00 23.27  ? 88  MET A HE3  1 
ATOM   630   N N    . PRO A 1 45  ? 80.668  -67.684  -1.880  1.00 14.18  ? 89  PRO A N    1 
ATOM   631   C CA   . PRO A 1 45  ? 80.291  -66.403  -1.265  1.00 19.64  ? 89  PRO A CA   1 
ATOM   632   C C    . PRO A 1 45  ? 81.207  -66.034  -0.107  1.00 21.29  ? 89  PRO A C    1 
ATOM   633   O O    . PRO A 1 45  ? 81.493  -66.854  0.768   1.00 15.12  ? 89  PRO A O    1 
ATOM   634   C CB   . PRO A 1 45  ? 78.855  -66.648  -0.791  1.00 13.33  ? 89  PRO A CB   1 
ATOM   635   C CG   . PRO A 1 45  ? 78.347  -67.728  -1.671  1.00 22.09  ? 89  PRO A CG   1 
ATOM   636   C CD   . PRO A 1 45  ? 79.524  -68.610  -1.955  1.00 14.68  ? 89  PRO A CD   1 
ATOM   637   H HA   . PRO A 1 45  ? 80.299  -65.693  -1.926  1.00 23.57  ? 89  PRO A HA   1 
ATOM   638   H HB2  . PRO A 1 45  ? 78.860  -66.934  0.136   1.00 16.00  ? 89  PRO A HB2  1 
ATOM   639   H HB3  . PRO A 1 45  ? 78.331  -65.840  -0.900  1.00 16.00  ? 89  PRO A HB3  1 
ATOM   640   H HG2  . PRO A 1 45  ? 77.653  -68.224  -1.210  1.00 26.50  ? 89  PRO A HG2  1 
ATOM   641   H HG3  . PRO A 1 45  ? 78.004  -67.343  -2.493  1.00 26.50  ? 89  PRO A HG3  1 
ATOM   642   H HD2  . PRO A 1 45  ? 79.602  -69.299  -1.276  1.00 17.62  ? 89  PRO A HD2  1 
ATOM   643   H HD3  . PRO A 1 45  ? 79.455  -68.991  -2.844  1.00 17.62  ? 89  PRO A HD3  1 
ATOM   644   N N    . THR A 1 46  ? 81.656  -64.780  -0.107  1.00 23.86  ? 90  THR A N    1 
ATOM   645   C CA   . THR A 1 46  ? 82.494  -64.281  0.979   1.00 23.39  ? 90  THR A CA   1 
ATOM   646   C C    . THR A 1 46  ? 81.914  -64.564  2.359   1.00 24.62  ? 90  THR A C    1 
ATOM   647   O O    . THR A 1 46  ? 82.692  -64.915  3.263   1.00 17.07  ? 90  THR A O    1 
ATOM   648   C CB   . THR A 1 46  ? 82.730  -62.774  0.786   1.00 25.62  ? 90  THR A CB   1 
ATOM   649   O OG1  . THR A 1 46  ? 83.511  -62.561  -0.396  1.00 31.39  ? 90  THR A OG1  1 
ATOM   650   C CG2  . THR A 1 46  ? 83.464  -62.165  1.978   1.00 31.26  ? 90  THR A CG2  1 
ATOM   651   H H    . THR A 1 46  ? 81.491  -64.202  -0.722  1.00 28.63  ? 90  THR A H    1 
ATOM   652   H HA   . THR A 1 46  ? 83.357  -64.721  0.930   1.00 28.07  ? 90  THR A HA   1 
ATOM   653   H HB   . THR A 1 46  ? 81.875  -62.325  0.692   1.00 30.74  ? 90  THR A HB   1 
ATOM   654   H HG1  . THR A 1 46  ? 83.644  -61.739  -0.509  1.00 37.67  ? 90  THR A HG1  1 
ATOM   655   H HG21 . THR A 1 46  ? 83.600  -61.216  1.833   1.00 37.51  ? 90  THR A HG21 1 
ATOM   656   H HG22 . THR A 1 46  ? 82.942  -62.289  2.787   1.00 37.51  ? 90  THR A HG22 1 
ATOM   657   H HG23 . THR A 1 46  ? 84.326  -62.595  2.090   1.00 37.51  ? 90  THR A HG23 1 
ATOM   658   N N    . PRO A 1 47  ? 80.607  -64.431  2.599   1.00 22.70  ? 91  PRO A N    1 
ATOM   659   C CA   . PRO A 1 47  ? 80.071  -64.781  3.926   1.00 22.27  ? 91  PRO A CA   1 
ATOM   660   C C    . PRO A 1 47  ? 80.441  -66.182  4.393   1.00 24.04  ? 91  PRO A C    1 
ATOM   661   O O    . PRO A 1 47  ? 80.644  -66.385  5.597   1.00 20.08  ? 91  PRO A O    1 
ATOM   662   C CB   . PRO A 1 47  ? 78.558  -64.624  3.733   1.00 17.14  ? 91  PRO A CB   1 
ATOM   663   C CG   . PRO A 1 47  ? 78.430  -63.586  2.674   1.00 18.21  ? 91  PRO A CG   1 
ATOM   664   C CD   . PRO A 1 47  ? 79.582  -63.814  1.738   1.00 17.36  ? 91  PRO A CD   1 
ATOM   665   H HA   . PRO A 1 47  ? 80.374  -64.138  4.586   1.00 26.73  ? 91  PRO A HA   1 
ATOM   666   H HB2  . PRO A 1 47  ? 78.174  -65.465  3.441   1.00 20.57  ? 91  PRO A HB2  1 
ATOM   667   H HB3  . PRO A 1 47  ? 78.150  -64.325  4.561   1.00 20.57  ? 91  PRO A HB3  1 
ATOM   668   H HG2  . PRO A 1 47  ? 77.586  -63.698  2.210   1.00 21.85  ? 91  PRO A HG2  1 
ATOM   669   H HG3  . PRO A 1 47  ? 78.485  -62.704  3.075   1.00 21.85  ? 91  PRO A HG3  1 
ATOM   670   H HD2  . PRO A 1 47  ? 79.325  -64.423  1.029   1.00 20.84  ? 91  PRO A HD2  1 
ATOM   671   H HD3  . PRO A 1 47  ? 79.902  -62.969  1.384   1.00 20.84  ? 91  PRO A HD3  1 
ATOM   672   N N    . VAL A 1 48  ? 80.537  -67.157  3.485   1.00 19.33  ? 92  VAL A N    1 
ATOM   673   C CA   . VAL A 1 48  ? 80.973  -68.493  3.885   1.00 12.97  ? 92  VAL A CA   1 
ATOM   674   C C    . VAL A 1 48  ? 82.433  -68.464  4.322   1.00 19.11  ? 92  VAL A C    1 
ATOM   675   O O    . VAL A 1 48  ? 82.804  -69.065  5.337   1.00 17.48  ? 92  VAL A O    1 
ATOM   676   C CB   . VAL A 1 48  ? 80.745  -69.500  2.742   1.00 15.84  ? 92  VAL A CB   1 
ATOM   677   C CG1  . VAL A 1 48  ? 81.360  -70.859  3.080   1.00 16.44  ? 92  VAL A CG1  1 
ATOM   678   C CG2  . VAL A 1 48  ? 79.260  -69.661  2.460   1.00 21.23  ? 92  VAL A CG2  1 
ATOM   679   H H    . VAL A 1 48  ? 80.358  -67.072  2.648   1.00 23.20  ? 92  VAL A H    1 
ATOM   680   H HA   . VAL A 1 48  ? 80.442  -68.780  4.644   1.00 15.56  ? 92  VAL A HA   1 
ATOM   681   H HB   . VAL A 1 48  ? 81.170  -69.168  1.936   1.00 19.01  ? 92  VAL A HB   1 
ATOM   682   H HG11 . VAL A 1 48  ? 81.200  -71.470  2.343   1.00 19.73  ? 92  VAL A HG11 1 
ATOM   683   H HG12 . VAL A 1 48  ? 82.314  -70.748  3.216   1.00 19.73  ? 92  VAL A HG12 1 
ATOM   684   H HG13 . VAL A 1 48  ? 80.947  -71.201  3.888   1.00 19.73  ? 92  VAL A HG13 1 
ATOM   685   H HG21 . VAL A 1 48  ? 79.143  -70.299  1.738   1.00 25.48  ? 92  VAL A HG21 1 
ATOM   686   H HG22 . VAL A 1 48  ? 78.820  -69.984  3.262   1.00 25.48  ? 92  VAL A HG22 1 
ATOM   687   H HG23 . VAL A 1 48  ? 78.893  -68.801  2.204   1.00 25.48  ? 92  VAL A HG23 1 
ATOM   688   N N    . ILE A 1 49  ? 83.283  -67.767  3.566   1.00 16.63  ? 93  ILE A N    1 
ATOM   689   C CA   . ILE A 1 49  ? 84.698  -67.672  3.920   1.00 20.94  ? 93  ILE A CA   1 
ATOM   690   C C    . ILE A 1 49  ? 84.855  -67.051  5.303   1.00 19.81  ? 93  ILE A C    1 
ATOM   691   O O    . ILE A 1 49  ? 85.561  -67.583  6.168   1.00 21.27  ? 93  ILE A O    1 
ATOM   692   C CB   . ILE A 1 49  ? 85.464  -66.871  2.851   1.00 15.33  ? 93  ILE A CB   1 
ATOM   693   C CG1  . ILE A 1 49  ? 85.290  -67.508  1.467   1.00 12.76  ? 93  ILE A CG1  1 
ATOM   694   C CG2  . ILE A 1 49  ? 86.942  -66.763  3.204   1.00 19.72  ? 93  ILE A CG2  1 
ATOM   695   C CD1  . ILE A 1 49  ? 85.701  -68.971  1.384   1.00 14.31  ? 93  ILE A CD1  1 
ATOM   696   H H    . ILE A 1 49  ? 83.067  -67.343  2.849   1.00 19.95  ? 93  ILE A H    1 
ATOM   697   H HA   . ILE A 1 49  ? 85.075  -68.565  3.950   1.00 25.13  ? 93  ILE A HA   1 
ATOM   698   H HB   . ILE A 1 49  ? 85.093  -65.975  2.821   1.00 18.40  ? 93  ILE A HB   1 
ATOM   699   H HG12 . ILE A 1 49  ? 84.355  -67.451  1.215   1.00 15.32  ? 93  ILE A HG12 1 
ATOM   700   H HG13 . ILE A 1 49  ? 85.830  -67.015  0.829   1.00 15.32  ? 93  ILE A HG13 1 
ATOM   701   H HG21 . ILE A 1 49  ? 87.395  -66.254  2.514   1.00 23.67  ? 93  ILE A HG21 1 
ATOM   702   H HG22 . ILE A 1 49  ? 87.030  -66.313  4.059   1.00 23.67  ? 93  ILE A HG22 1 
ATOM   703   H HG23 . ILE A 1 49  ? 87.319  -67.655  3.260   1.00 23.67  ? 93  ILE A HG23 1 
ATOM   704   H HD11 . ILE A 1 49  ? 85.558  -69.287  0.478   1.00 17.18  ? 93  ILE A HD11 1 
ATOM   705   H HD12 . ILE A 1 49  ? 86.639  -69.048  1.618   1.00 17.18  ? 93  ILE A HD12 1 
ATOM   706   H HD13 . ILE A 1 49  ? 85.161  -69.485  2.004   1.00 17.18  ? 93  ILE A HD13 1 
ATOM   707   N N    . LYS A 1 50  ? 84.197  -65.913  5.531   1.00 22.78  ? 94  LYS A N    1 
ATOM   708   C CA   . LYS A 1 50  ? 84.267  -65.270  6.838   1.00 23.86  ? 94  LYS A CA   1 
ATOM   709   C C    . LYS A 1 50  ? 83.750  -66.192  7.934   1.00 24.18  ? 94  LYS A C    1 
ATOM   710   O O    . LYS A 1 50  ? 84.298  -66.220  9.043   1.00 16.99  ? 94  LYS A O    1 
ATOM   711   C CB   . LYS A 1 50  ? 83.470  -63.966  6.822   1.00 22.58  ? 94  LYS A CB   1 
ATOM   712   C CG   . LYS A 1 50  ? 84.068  -62.876  5.951   1.00 22.16  ? 94  LYS A CG   1 
ATOM   713   C CD   . LYS A 1 50  ? 83.213  -61.622  5.999   1.00 30.92  ? 94  LYS A CD   1 
ATOM   714   C CE   . LYS A 1 50  ? 83.845  -60.479  5.229   1.00 37.84  ? 94  LYS A CE   1 
ATOM   715   N NZ   . LYS A 1 50  ? 83.010  -59.248  5.283   1.00 50.55  ? 94  LYS A NZ   1 
ATOM   716   H H    . LYS A 1 50  ? 83.712  -65.501  4.953   1.00 27.34  ? 94  LYS A H    1 
ATOM   717   H HA   . LYS A 1 50  ? 85.192  -65.055  7.037   1.00 28.63  ? 94  LYS A HA   1 
ATOM   718   H HB2  . LYS A 1 50  ? 82.578  -64.152  6.492   1.00 27.10  ? 94  LYS A HB2  1 
ATOM   719   H HB3  . LYS A 1 50  ? 83.418  -63.624  7.728   1.00 27.10  ? 94  LYS A HB3  1 
ATOM   720   H HG2  . LYS A 1 50  ? 84.955  -62.655  6.273   1.00 26.60  ? 94  LYS A HG2  1 
ATOM   721   H HG3  . LYS A 1 50  ? 84.108  -63.184  5.032   1.00 26.60  ? 94  LYS A HG3  1 
ATOM   722   H HD2  . LYS A 1 50  ? 82.347  -61.810  5.606   1.00 37.11  ? 94  LYS A HD2  1 
ATOM   723   H HD3  . LYS A 1 50  ? 83.109  -61.343  6.923   1.00 37.11  ? 94  LYS A HD3  1 
ATOM   724   H HE2  . LYS A 1 50  ? 84.712  -60.275  5.614   1.00 45.41  ? 94  LYS A HE2  1 
ATOM   725   H HE3  . LYS A 1 50  ? 83.945  -60.737  4.299   1.00 45.41  ? 94  LYS A HE3  1 
ATOM   726   H HZ1  . LYS A 1 50  ? 83.402  -58.594  4.824   1.00 60.67  ? 94  LYS A HZ1  1 
ATOM   727   H HZ2  . LYS A 1 50  ? 82.209  -59.408  4.930   1.00 60.67  ? 94  LYS A HZ2  1 
ATOM   728   H HZ3  . LYS A 1 50  ? 82.907  -58.987  6.128   1.00 60.67  ? 94  LYS A HZ3  1 
ATOM   729   N N    . ALA A 1 51  ? 82.694  -66.955  7.644   1.00 19.03  ? 95  ALA A N    1 
ATOM   730   C CA   . ALA A 1 51  ? 82.154  -67.874  8.640   1.00 24.36  ? 95  ALA A CA   1 
ATOM   731   C C    . ALA A 1 51  ? 83.160  -68.966  8.972   1.00 20.10  ? 95  ALA A C    1 
ATOM   732   O O    . ALA A 1 51  ? 83.241  -69.417  10.122  1.00 21.32  ? 95  ALA A O    1 
ATOM   733   C CB   . ALA A 1 51  ? 80.841  -68.479  8.141   1.00 18.40  ? 95  ALA A CB   1 
ATOM   734   H H    . ALA A 1 51  ? 82.279  -66.957  6.890   1.00 22.84  ? 95  ALA A H    1 
ATOM   735   H HA   . ALA A 1 51  ? 81.967  -67.382  9.454   1.00 29.23  ? 95  ALA A HA   1 
ATOM   736   H HB1  . ALA A 1 51  ? 80.497  -69.087  8.814   1.00 22.08  ? 95  ALA A HB1  1 
ATOM   737   H HB2  . ALA A 1 51  ? 80.204  -67.765  7.984   1.00 22.08  ? 95  ALA A HB2  1 
ATOM   738   H HB3  . ALA A 1 51  ? 81.008  -68.961  7.315   1.00 22.08  ? 95  ALA A HB3  1 
ATOM   739   N N    . PHE A 1 52  ? 83.933  -69.408  7.977   1.00 20.09  ? 96  PHE A N    1 
ATOM   740   C CA   . PHE A 1 52  ? 85.018  -70.342  8.254   1.00 22.39  ? 96  PHE A CA   1 
ATOM   741   C C    . PHE A 1 52  ? 86.044  -69.718  9.191   1.00 16.92  ? 96  PHE A C    1 
ATOM   742   O O    . PHE A 1 52  ? 86.541  -70.382  10.108  1.00 21.68  ? 96  PHE A O    1 
ATOM   743   C CB   . PHE A 1 52  ? 85.682  -70.787  6.951   1.00 22.96  ? 96  PHE A CB   1 
ATOM   744   C CG   . PHE A 1 52  ? 85.127  -72.067  6.394   1.00 20.46  ? 96  PHE A CG   1 
ATOM   745   C CD1  . PHE A 1 52  ? 85.514  -73.289  6.916   1.00 19.50  ? 96  PHE A CD1  1 
ATOM   746   C CD2  . PHE A 1 52  ? 84.226  -72.050  5.342   1.00 20.27  ? 96  PHE A CD2  1 
ATOM   747   C CE1  . PHE A 1 52  ? 85.007  -74.471  6.405   1.00 23.20  ? 96  PHE A CE1  1 
ATOM   748   C CE2  . PHE A 1 52  ? 83.717  -73.229  4.827   1.00 21.38  ? 96  PHE A CE2  1 
ATOM   749   C CZ   . PHE A 1 52  ? 84.108  -74.439  5.361   1.00 19.12  ? 96  PHE A CZ   1 
ATOM   750   H H    . PHE A 1 52  ? 83.851  -69.186  7.150   1.00 24.12  ? 96  PHE A H    1 
ATOM   751   H HA   . PHE A 1 52  ? 84.654  -71.128  8.689   1.00 26.88  ? 96  PHE A HA   1 
ATOM   752   H HB2  . PHE A 1 52  ? 85.557  -70.094  6.284   1.00 27.55  ? 96  PHE A HB2  1 
ATOM   753   H HB3  . PHE A 1 52  ? 86.629  -70.921  7.113   1.00 27.55  ? 96  PHE A HB3  1 
ATOM   754   H HD1  . PHE A 1 52  ? 86.119  -73.316  7.622   1.00 23.41  ? 96  PHE A HD1  1 
ATOM   755   H HD2  . PHE A 1 52  ? 83.957  -71.236  4.979   1.00 24.32  ? 96  PHE A HD2  1 
ATOM   756   H HE1  . PHE A 1 52  ? 85.272  -75.286  6.766   1.00 27.85  ? 96  PHE A HE1  1 
ATOM   757   H HE2  . PHE A 1 52  ? 83.110  -73.206  4.123   1.00 25.66  ? 96  PHE A HE2  1 
ATOM   758   H HZ   . PHE A 1 52  ? 83.767  -75.232  5.015   1.00 22.95  ? 96  PHE A HZ   1 
ATOM   759   N N    . GLY A 1 53  ? 86.373  -68.443  8.977   1.00 24.63  ? 97  GLY A N    1 
ATOM   760   C CA   . GLY A 1 53  ? 87.269  -67.756  9.894   1.00 20.73  ? 97  GLY A CA   1 
ATOM   761   C C    . GLY A 1 53  ? 86.798  -67.847  11.331  1.00 19.86  ? 97  GLY A C    1 
ATOM   762   O O    . GLY A 1 53  ? 87.553  -68.241  12.224  1.00 24.96  ? 97  GLY A O    1 
ATOM   763   H H    . GLY A 1 53  ? 86.095  -67.964  8.318   1.00 29.56  ? 97  GLY A H    1 
ATOM   764   H HA2  . GLY A 1 53  ? 88.155  -68.147  9.835   1.00 24.88  ? 97  GLY A HA2  1 
ATOM   765   H HA3  . GLY A 1 53  ? 87.328  -66.820  9.649   1.00 24.88  ? 97  GLY A HA3  1 
ATOM   766   N N    . ILE A 1 54  ? 85.537  -67.483  11.575  1.00 19.15  ? 98  ILE A N    1 
ATOM   767   C CA   . ILE A 1 54  ? 84.958  -67.625  12.910  1.00 21.59  ? 98  ILE A CA   1 
ATOM   768   C C    . ILE A 1 54  ? 85.090  -69.065  13.384  1.00 27.32  ? 98  ILE A C    1 
ATOM   769   O O    . ILE A 1 54  ? 85.502  -69.337  14.517  1.00 21.49  ? 98  ILE A O    1 
ATOM   770   C CB   . ILE A 1 54  ? 83.487  -67.172  12.905  1.00 22.62  ? 98  ILE A CB   1 
ATOM   771   C CG1  . ILE A 1 54  ? 83.389  -65.679  12.582  1.00 21.13  ? 98  ILE A CG1  1 
ATOM   772   C CG2  . ILE A 1 54  ? 82.820  -67.472  14.247  1.00 20.67  ? 98  ILE A CG2  1 
ATOM   773   C CD1  . ILE A 1 54  ? 81.982  -65.217  12.249  1.00 19.56  ? 98  ILE A CD1  1 
ATOM   774   H H    . ILE A 1 54  ? 85.001  -67.153  10.989  1.00 22.98  ? 98  ILE A H    1 
ATOM   775   H HA   . ILE A 1 54  ? 85.445  -67.059  13.530  1.00 25.91  ? 98  ILE A HA   1 
ATOM   776   H HB   . ILE A 1 54  ? 83.018  -67.666  12.214  1.00 27.15  ? 98  ILE A HB   1 
ATOM   777   H HG12 . ILE A 1 54  ? 83.694  -65.172  13.350  1.00 25.36  ? 98  ILE A HG12 1 
ATOM   778   H HG13 . ILE A 1 54  ? 83.953  -65.488  11.816  1.00 25.36  ? 98  ILE A HG13 1 
ATOM   779   H HG21 . ILE A 1 54  ? 81.897  -67.177  14.213  1.00 24.80  ? 98  ILE A HG21 1 
ATOM   780   H HG22 . ILE A 1 54  ? 82.856  -68.428  14.410  1.00 24.80  ? 98  ILE A HG22 1 
ATOM   781   H HG23 . ILE A 1 54  ? 83.295  -66.998  14.948  1.00 24.80  ? 98  ILE A HG23 1 
ATOM   782   H HD11 . ILE A 1 54  ? 81.999  -64.266  12.056  1.00 23.47  ? 98  ILE A HD11 1 
ATOM   783   H HD12 . ILE A 1 54  ? 81.664  -65.706  11.474  1.00 23.47  ? 98  ILE A HD12 1 
ATOM   784   H HD13 . ILE A 1 54  ? 81.405  -65.390  13.009  1.00 23.47  ? 98  ILE A HD13 1 
ATOM   785   N N    . LEU A 1 55  ? 84.746  -70.010  12.509  1.00 27.13  ? 99  LEU A N    1 
ATOM   786   C CA   . LEU A 1 55  ? 84.729  -71.417  12.888  1.00 23.43  ? 99  LEU A CA   1 
ATOM   787   C C    . LEU A 1 55  ? 86.124  -71.911  13.252  1.00 19.96  ? 99  LEU A C    1 
ATOM   788   O O    . LEU A 1 55  ? 86.314  -72.563  14.285  1.00 19.21  ? 99  LEU A O    1 
ATOM   789   C CB   . LEU A 1 55  ? 84.141  -72.239  11.743  1.00 26.44  ? 99  LEU A CB   1 
ATOM   790   C CG   . LEU A 1 55  ? 84.234  -73.757  11.856  1.00 24.60  ? 99  LEU A CG   1 
ATOM   791   C CD1  . LEU A 1 55  ? 83.640  -74.238  13.171  1.00 35.61  ? 99  LEU A CD1  1 
ATOM   792   C CD2  . LEU A 1 55  ? 83.522  -74.385  10.673  1.00 39.51  ? 99  LEU A CD2  1 
ATOM   793   H H    . LEU A 1 55  ? 84.519  -69.860  11.693  1.00 32.56  ? 99  LEU A H    1 
ATOM   794   H HA   . LEU A 1 55  ? 84.157  -71.530  13.663  1.00 28.12  ? 99  LEU A HA   1 
ATOM   795   H HB2  . LEU A 1 55  ? 83.200  -72.017  11.665  1.00 31.74  ? 99  LEU A HB2  1 
ATOM   796   H HB3  . LEU A 1 55  ? 84.597  -71.986  10.925  1.00 31.74  ? 99  LEU A HB3  1 
ATOM   797   H HG   . LEU A 1 55  ? 85.166  -74.024  11.827  1.00 29.52  ? 99  LEU A HG   1 
ATOM   798   H HD11 . LEU A 1 55  ? 83.712  -75.204  13.216  1.00 42.73  ? 99  LEU A HD11 1 
ATOM   799   H HD12 . LEU A 1 55  ? 84.130  -73.835  13.905  1.00 42.73  ? 99  LEU A HD12 1 
ATOM   800   H HD13 . LEU A 1 55  ? 82.707  -73.974  13.211  1.00 42.73  ? 99  LEU A HD13 1 
ATOM   801   H HD21 . LEU A 1 55  ? 83.581  -75.351  10.745  1.00 47.42  ? 99  LEU A HD21 1 
ATOM   802   H HD22 . LEU A 1 55  ? 82.592  -74.109  10.682  1.00 47.42  ? 99  LEU A HD22 1 
ATOM   803   H HD23 . LEU A 1 55  ? 83.947  -74.087  9.854   1.00 47.42  ? 99  LEU A HD23 1 
ATOM   804   N N    . LYS A 1 56  ? 87.115  -71.618  12.408  1.00 18.21  ? 100 LYS A N    1 
ATOM   805   C CA   . LYS A 1 56  ? 88.477  -72.063  12.690  1.00 30.38  ? 100 LYS A CA   1 
ATOM   806   C C    . LYS A 1 56  ? 89.039  -71.387  13.932  1.00 26.38  ? 100 LYS A C    1 
ATOM   807   O O    . LYS A 1 56  ? 89.851  -71.984  14.650  1.00 22.21  ? 100 LYS A O    1 
ATOM   808   C CB   . LYS A 1 56  ? 89.377  -71.793  11.485  1.00 21.29  ? 100 LYS A CB   1 
ATOM   809   C CG   . LYS A 1 56  ? 88.939  -72.498  10.207  1.00 25.12  ? 100 LYS A CG   1 
ATOM   810   C CD   . LYS A 1 56  ? 89.010  -74.011  10.344  1.00 23.63  ? 100 LYS A CD   1 
ATOM   811   C CE   . LYS A 1 56  ? 88.622  -74.704  9.048   1.00 17.20  ? 100 LYS A CE   1 
ATOM   812   N NZ   . LYS A 1 56  ? 88.718  -76.188  9.147   1.00 25.38  ? 100 LYS A NZ   1 
ATOM   813   H H    . LYS A 1 56  ? 87.026  -71.171  11.679  1.00 21.86  ? 100 LYS A H    1 
ATOM   814   H HA   . LYS A 1 56  ? 88.469  -73.020  12.848  1.00 36.46  ? 100 LYS A HA   1 
ATOM   815   H HB2  . LYS A 1 56  ? 89.382  -70.839  11.308  1.00 25.55  ? 100 LYS A HB2  1 
ATOM   816   H HB3  . LYS A 1 56  ? 90.275  -72.092  11.694  1.00 25.55  ? 100 LYS A HB3  1 
ATOM   817   H HG2  . LYS A 1 56  ? 88.022  -72.255  10.005  1.00 30.15  ? 100 LYS A HG2  1 
ATOM   818   H HG3  . LYS A 1 56  ? 89.524  -72.232  9.479   1.00 30.15  ? 100 LYS A HG3  1 
ATOM   819   H HD2  . LYS A 1 56  ? 89.918  -74.271  10.568  1.00 28.36  ? 100 LYS A HD2  1 
ATOM   820   H HD3  . LYS A 1 56  ? 88.397  -74.299  11.038  1.00 28.36  ? 100 LYS A HD3  1 
ATOM   821   H HE2  . LYS A 1 56  ? 87.706  -74.475  8.828   1.00 20.64  ? 100 LYS A HE2  1 
ATOM   822   H HE3  . LYS A 1 56  ? 89.218  -74.410  8.341   1.00 20.64  ? 100 LYS A HE3  1 
ATOM   823   H HZ1  . LYS A 1 56  ? 88.485  -76.560  8.373   1.00 30.46  ? 100 LYS A HZ1  1 
ATOM   824   H HZ2  . LYS A 1 56  ? 89.553  -76.426  9.342   1.00 30.46  ? 100 LYS A HZ2  1 
ATOM   825   H HZ3  . LYS A 1 56  ? 88.175  -76.485  9.786   1.00 30.46  ? 100 LYS A HZ3  1 
ATOM   826   N N    . ARG A 1 57  ? 88.628  -70.145  14.194  1.00 21.05  ? 101 ARG A N    1 
ATOM   827   C CA   . ARG A 1 57  ? 88.976  -69.487  15.449  1.00 25.57  ? 101 ARG A CA   1 
ATOM   828   C C    . ARG A 1 57  ? 88.446  -70.280  16.639  1.00 22.61  ? 101 ARG A C    1 
ATOM   829   O O    . ARG A 1 57  ? 89.186  -70.577  17.585  1.00 30.47  ? 101 ARG A O    1 
ATOM   830   C CB   . ARG A 1 57  ? 88.419  -68.061  15.442  1.00 33.10  ? 101 ARG A CB   1 
ATOM   831   C CG   . ARG A 1 57  ? 88.379  -67.327  16.785  1.00 34.95  ? 101 ARG A CG   1 
ATOM   832   C CD   . ARG A 1 57  ? 89.705  -66.681  17.137  1.00 47.55  ? 101 ARG A CD   1 
ATOM   833   N NE   . ARG A 1 57  ? 89.525  -65.599  18.102  1.00 41.81  ? 101 ARG A NE   1 
ATOM   834   C CZ   . ARG A 1 57  ? 89.245  -65.783  19.388  1.00 44.35  ? 101 ARG A CZ   1 
ATOM   835   N NH1  . ARG A 1 57  ? 89.103  -67.008  19.876  1.00 52.61  ? 101 ARG A NH1  1 
ATOM   836   N NH2  . ARG A 1 57  ? 89.097  -64.739  20.192  1.00 58.89  ? 101 ARG A NH2  1 
ATOM   837   H H    . ARG A 1 57  ? 88.150  -69.666  13.664  1.00 25.26  ? 101 ARG A H    1 
ATOM   838   H HA   . ARG A 1 57  ? 89.942  -69.436  15.525  1.00 30.68  ? 101 ARG A HA   1 
ATOM   839   H HB2  . ARG A 1 57  ? 88.962  -67.528  14.841  1.00 39.73  ? 101 ARG A HB2  1 
ATOM   840   H HB3  . ARG A 1 57  ? 87.509  -68.094  15.107  1.00 39.73  ? 101 ARG A HB3  1 
ATOM   841   H HG2  . ARG A 1 57  ? 87.706  -66.630  16.745  1.00 41.94  ? 101 ARG A HG2  1 
ATOM   842   H HG3  . ARG A 1 57  ? 88.158  -67.961  17.486  1.00 41.94  ? 101 ARG A HG3  1 
ATOM   843   H HD2  . ARG A 1 57  ? 90.292  -67.345  17.530  1.00 57.07  ? 101 ARG A HD2  1 
ATOM   844   H HD3  . ARG A 1 57  ? 90.105  -66.310  16.335  1.00 57.07  ? 101 ARG A HD3  1 
ATOM   845   H HE   . ARG A 1 57  ? 89.606  -64.791  17.819  1.00 50.18  ? 101 ARG A HE   1 
ATOM   846   H HH11 . ARG A 1 57  ? 89.196  -67.690  19.361  1.00 63.13  ? 101 ARG A HH11 1 
ATOM   847   H HH12 . ARG A 1 57  ? 88.920  -67.120  20.709  1.00 63.13  ? 101 ARG A HH12 1 
ATOM   848   H HH21 . ARG A 1 57  ? 89.186  -63.942  19.882  1.00 70.67  ? 101 ARG A HH21 1 
ATOM   849   H HH22 . ARG A 1 57  ? 88.914  -64.859  21.024  1.00 70.67  ? 101 ARG A HH22 1 
ATOM   850   N N    . ALA A 1 58  ? 87.162  -70.640  16.603  1.00 25.42  ? 102 ALA A N    1 
ATOM   851   C CA   . ALA A 1 58  ? 86.557  -71.345  17.728  1.00 27.20  ? 102 ALA A CA   1 
ATOM   852   C C    . ALA A 1 58  ? 87.192  -72.714  17.930  1.00 29.16  ? 102 ALA A C    1 
ATOM   853   O O    . ALA A 1 58  ? 87.413  -73.142  19.068  1.00 30.84  ? 102 ALA A O    1 
ATOM   854   C CB   . ALA A 1 58  ? 85.051  -71.480  17.508  1.00 26.48  ? 102 ALA A CB   1 
ATOM   855   H H    . ALA A 1 58  ? 86.627  -70.489  15.947  1.00 30.50  ? 102 ALA A H    1 
ATOM   856   H HA   . ALA A 1 58  ? 86.697  -70.828  18.537  1.00 32.65  ? 102 ALA A HA   1 
ATOM   857   H HB1  . ALA A 1 58  ? 84.663  -71.950  18.263  1.00 31.78  ? 102 ALA A HB1  1 
ATOM   858   H HB2  . ALA A 1 58  ? 84.662  -70.594  17.434  1.00 31.78  ? 102 ALA A HB2  1 
ATOM   859   H HB3  . ALA A 1 58  ? 84.895  -71.979  16.691  1.00 31.78  ? 102 ALA A HB3  1 
ATOM   860   N N    . ALA A 1 59  ? 87.491  -73.420  16.838  1.00 30.45  ? 103 ALA A N    1 
ATOM   861   C CA   . ALA A 1 59  ? 88.072  -74.753  16.955  1.00 31.63  ? 103 ALA A CA   1 
ATOM   862   C C    . ALA A 1 59  ? 89.474  -74.690  17.549  1.00 27.27  ? 103 ALA A C    1 
ATOM   863   O O    . ALA A 1 59  ? 89.789  -75.414  18.500  1.00 25.37  ? 103 ALA A O    1 
ATOM   864   C CB   . ALA A 1 59  ? 88.097  -75.438  15.589  1.00 26.64  ? 103 ALA A CB   1 
ATOM   865   H H    . ALA A 1 59  ? 87.368  -73.152  16.030  1.00 36.55  ? 103 ALA A H    1 
ATOM   866   H HA   . ALA A 1 59  ? 87.520  -75.287  17.548  1.00 37.96  ? 103 ALA A HA   1 
ATOM   867   H HB1  . ALA A 1 59  ? 88.486  -76.322  15.686  1.00 31.98  ? 103 ALA A HB1  1 
ATOM   868   H HB2  . ALA A 1 59  ? 87.189  -75.511  15.256  1.00 31.98  ? 103 ALA A HB2  1 
ATOM   869   H HB3  . ALA A 1 59  ? 88.632  -74.906  14.979  1.00 31.98  ? 103 ALA A HB3  1 
ATOM   870   N N    . ALA A 1 60  ? 90.331  -73.827  16.998  1.00 22.11  ? 104 ALA A N    1 
ATOM   871   C CA   . ALA A 1 60  ? 91.688  -73.700  17.519  1.00 30.74  ? 104 ALA A CA   1 
ATOM   872   C C    . ALA A 1 60  ? 91.677  -73.387  19.009  1.00 32.70  ? 104 ALA A C    1 
ATOM   873   O O    . ALA A 1 60  ? 92.527  -73.877  19.762  1.00 40.68  ? 104 ALA A O    1 
ATOM   874   C CB   . ALA A 1 60  ? 92.446  -72.618  16.752  1.00 22.90  ? 104 ALA A CB   1 
ATOM   875   H H    . ALA A 1 60  ? 90.152  -73.312  16.333  1.00 26.54  ? 104 ALA A H    1 
ATOM   876   H HA   . ALA A 1 60  ? 92.154  -74.541  17.392  1.00 36.89  ? 104 ALA A HA   1 
ATOM   877   H HB1  . ALA A 1 60  ? 93.344  -72.548  17.111  1.00 27.48  ? 104 ALA A HB1  1 
ATOM   878   H HB2  . ALA A 1 60  ? 92.482  -72.863  15.814  1.00 27.48  ? 104 ALA A HB2  1 
ATOM   879   H HB3  . ALA A 1 60  ? 91.980  -71.774  16.856  1.00 27.48  ? 104 ALA A HB3  1 
ATOM   880   N N    . GLU A 1 61  ? 90.717  -72.576  19.455  1.00 27.81  ? 105 GLU A N    1 
ATOM   881   C CA   . GLU A 1 61  ? 90.651  -72.218  20.867  1.00 29.41  ? 105 GLU A CA   1 
ATOM   882   C C    . GLU A 1 61  ? 90.241  -73.408  21.725  1.00 34.55  ? 105 GLU A C    1 
ATOM   883   O O    . GLU A 1 61  ? 90.687  -73.527  22.872  1.00 40.04  ? 105 GLU A O    1 
ATOM   884   C CB   . GLU A 1 61  ? 89.679  -71.053  21.060  1.00 36.10  ? 105 GLU A CB   1 
ATOM   885   C CG   . GLU A 1 61  ? 89.799  -70.351  22.404  1.00 60.67  ? 105 GLU A CG   1 
ATOM   886   C CD   . GLU A 1 61  ? 89.019  -69.050  22.452  1.00 55.98  ? 105 GLU A CD   1 
ATOM   887   O OE1  . GLU A 1 61  ? 88.614  -68.558  21.378  1.00 50.21  ? 105 GLU A OE1  1 
ATOM   888   O OE2  . GLU A 1 61  ? 88.810  -68.518  23.563  1.00 56.33  ? 105 GLU A OE2  1 
ATOM   889   H H    . GLU A 1 61  ? 90.102  -72.225  18.967  1.00 33.37  ? 105 GLU A H    1 
ATOM   890   H HA   . GLU A 1 61  ? 91.529  -71.927  21.160  1.00 35.29  ? 105 GLU A HA   1 
ATOM   891   H HB2  . GLU A 1 61  ? 89.844  -70.394  20.368  1.00 43.32  ? 105 GLU A HB2  1 
ATOM   892   H HB3  . GLU A 1 61  ? 88.773  -71.389  20.983  1.00 43.32  ? 105 GLU A HB3  1 
ATOM   893   H HG2  . GLU A 1 61  ? 89.453  -70.934  23.098  1.00 72.81  ? 105 GLU A HG2  1 
ATOM   894   H HG3  . GLU A 1 61  ? 90.732  -70.148  22.573  1.00 72.81  ? 105 GLU A HG3  1 
ATOM   895   N N    . VAL A 1 62  ? 89.411  -74.303  21.187  1.00 36.68  ? 106 VAL A N    1 
ATOM   896   C CA   . VAL A 1 62  ? 88.950  -75.454  21.957  1.00 32.56  ? 106 VAL A CA   1 
ATOM   897   C C    . VAL A 1 62  ? 89.995  -76.563  21.955  1.00 35.29  ? 106 VAL A C    1 
ATOM   898   O O    . VAL A 1 62  ? 90.219  -77.219  22.977  1.00 40.81  ? 106 VAL A O    1 
ATOM   899   C CB   . VAL A 1 62  ? 87.599  -75.946  21.410  1.00 36.24  ? 106 VAL A CB   1 
ATOM   900   C CG1  . VAL A 1 62  ? 87.169  -77.236  22.100  1.00 36.33  ? 106 VAL A CG1  1 
ATOM   901   C CG2  . VAL A 1 62  ? 86.535  -74.873  21.592  1.00 30.73  ? 106 VAL A CG2  1 
ATOM   902   H H    . VAL A 1 62  ? 89.103  -74.266  20.385  1.00 44.02  ? 106 VAL A H    1 
ATOM   903   H HA   . VAL A 1 62  ? 88.814  -75.179  22.878  1.00 39.08  ? 106 VAL A HA   1 
ATOM   904   H HB   . VAL A 1 62  ? 87.686  -76.126  20.461  1.00 43.49  ? 106 VAL A HB   1 
ATOM   905   H HG11 . VAL A 1 62  ? 86.316  -77.520  21.735  1.00 43.60  ? 106 VAL A HG11 1 
ATOM   906   H HG12 . VAL A 1 62  ? 87.841  -77.917  21.943  1.00 43.60  ? 106 VAL A HG12 1 
ATOM   907   H HG13 . VAL A 1 62  ? 87.082  -77.070  23.052  1.00 43.60  ? 106 VAL A HG13 1 
ATOM   908   H HG21 . VAL A 1 62  ? 85.692  -75.201  21.242  1.00 36.88  ? 106 VAL A HG21 1 
ATOM   909   H HG22 . VAL A 1 62  ? 86.445  -74.675  22.537  1.00 36.88  ? 106 VAL A HG22 1 
ATOM   910   H HG23 . VAL A 1 62  ? 86.805  -74.075  21.111  1.00 36.88  ? 106 VAL A HG23 1 
ATOM   911   N N    . THR A 1 63  ? 90.646  -76.802  20.815  1.00 30.27  ? 107 THR A N    1 
ATOM   912   C CA   . THR A 1 63  ? 91.639  -77.867  20.744  1.00 48.92  ? 107 THR A CA   1 
ATOM   913   C C    . THR A 1 63  ? 92.900  -77.546  21.535  1.00 49.28  ? 107 THR A C    1 
ATOM   914   O O    . THR A 1 63  ? 93.701  -78.455  21.780  1.00 53.51  ? 107 THR A O    1 
ATOM   915   C CB   . THR A 1 63  ? 92.002  -78.165  19.287  1.00 38.02  ? 107 THR A CB   1 
ATOM   916   O OG1  . THR A 1 63  ? 92.571  -77.000  18.679  1.00 57.44  ? 107 THR A OG1  1 
ATOM   917   C CG2  . THR A 1 63  ? 90.765  -78.599  18.509  1.00 39.05  ? 107 THR A CG2  1 
ATOM   918   H H    . THR A 1 63  ? 90.533  -76.368  20.081  1.00 36.32  ? 107 THR A H    1 
ATOM   919   H HA   . THR A 1 63  ? 91.254  -78.674  21.122  1.00 58.70  ? 107 THR A HA   1 
ATOM   920   H HB   . THR A 1 63  ? 92.648  -78.888  19.260  1.00 45.63  ? 107 THR A HB   1 
ATOM   921   H HG1  . THR A 1 63  ? 92.019  -76.367  18.699  1.00 68.93  ? 107 THR A HG1  1 
ATOM   922   H HG21 . THR A 1 63  ? 91.003  -78.787  17.587  1.00 46.86  ? 107 THR A HG21 1 
ATOM   923   H HG22 . THR A 1 63  ? 90.388  -79.400  18.906  1.00 46.86  ? 107 THR A HG22 1 
ATOM   924   H HG23 . THR A 1 63  ? 90.099  -77.895  18.526  1.00 46.86  ? 107 THR A HG23 1 
ATOM   925   N N    . GLN A 1 64  ? 93.105  -76.284  21.926  1.00 39.95  ? 108 GLN A N    1 
ATOM   926   C CA   . GLN A 1 64  ? 94.134  -75.976  22.914  1.00 45.68  ? 108 GLN A CA   1 
ATOM   927   C C    . GLN A 1 64  ? 93.991  -76.871  24.136  1.00 64.45  ? 108 GLN A C    1 
ATOM   928   O O    . GLN A 1 64  ? 94.985  -77.375  24.672  1.00 54.06  ? 108 GLN A O    1 
ATOM   929   C CB   . GLN A 1 64  ? 94.046  -74.507  23.329  1.00 39.59  ? 108 GLN A CB   1 
ATOM   930   C CG   . GLN A 1 64  ? 94.954  -73.570  22.556  1.00 43.09  ? 108 GLN A CG   1 
ATOM   931   C CD   . GLN A 1 64  ? 94.952  -72.164  23.127  1.00 64.18  ? 108 GLN A CD   1 
ATOM   932   O OE1  . GLN A 1 64  ? 96.008  -71.569  23.351  1.00 46.09  ? 108 GLN A OE1  1 
ATOM   933   N NE2  . GLN A 1 64  ? 93.761  -71.624  23.366  1.00 61.01  ? 108 GLN A NE2  1 
ATOM   934   H H    . GLN A 1 64  ? 92.668  -75.602  21.638  1.00 47.94  ? 108 GLN A H    1 
ATOM   935   H HA   . GLN A 1 64  ? 95.009  -76.130  22.524  1.00 54.82  ? 108 GLN A HA   1 
ATOM   936   H HB2  . GLN A 1 64  ? 93.134  -74.204  23.200  1.00 47.51  ? 108 GLN A HB2  1 
ATOM   937   H HB3  . GLN A 1 64  ? 94.282  -74.436  24.267  1.00 47.51  ? 108 GLN A HB3  1 
ATOM   938   H HG2  . GLN A 1 64  ? 95.863  -73.908  22.591  1.00 51.71  ? 108 GLN A HG2  1 
ATOM   939   H HG3  . GLN A 1 64  ? 94.652  -73.522  21.636  1.00 51.71  ? 108 GLN A HG3  1 
ATOM   940   H HE21 . GLN A 1 64  ? 93.045  -72.069  23.198  1.00 73.21  ? 108 GLN A HE21 1 
ATOM   941   H HE22 . GLN A 1 64  ? 93.706  -70.829  23.690  1.00 73.21  ? 108 GLN A HE22 1 
ATOM   942   N N    . ASP A 1 65  ? 92.753  -77.081  24.589  1.00 67.16  ? 109 ASP A N    1 
ATOM   943   C CA   . ASP A 1 65  ? 92.510  -77.952  25.733  1.00 74.49  ? 109 ASP A CA   1 
ATOM   944   C C    . ASP A 1 65  ? 93.031  -79.361  25.490  1.00 67.30  ? 109 ASP A C    1 
ATOM   945   O O    . ASP A 1 65  ? 93.340  -80.082  26.446  1.00 69.52  ? 109 ASP A O    1 
ATOM   946   C CB   . ASP A 1 65  ? 91.014  -77.991  26.045  1.00 77.27  ? 109 ASP A CB   1 
ATOM   947   C CG   . ASP A 1 65  ? 90.479  -76.653  26.516  1.00 88.06  ? 109 ASP A CG   1 
ATOM   948   O OD1  . ASP A 1 65  ? 91.294  -75.736  26.757  1.00 80.83  ? 109 ASP A OD1  1 
ATOM   949   O OD2  . ASP A 1 65  ? 89.244  -76.517  26.641  1.00 84.46  ? 109 ASP A OD2  1 
ATOM   950   H H    . ASP A 1 65  ? 92.043  -76.733  24.251  1.00 80.60  ? 109 ASP A H    1 
ATOM   951   H HA   . ASP A 1 65  ? 92.970  -77.591  26.508  1.00 89.39  ? 109 ASP A HA   1 
ATOM   952   H HB2  . ASP A 1 65  ? 90.530  -78.242  25.242  1.00 92.72  ? 109 ASP A HB2  1 
ATOM   953   H HB3  . ASP A 1 65  ? 90.854  -78.642  26.746  1.00 92.72  ? 109 ASP A HB3  1 
ATOM   954   N N    . TYR A 1 66  ? 93.137  -79.773  24.225  0.98 65.71  ? 110 TYR A N    1 
ATOM   955   C CA   . TYR A 1 66  ? 93.529  -81.132  23.874  0.98 62.88  ? 110 TYR A CA   1 
ATOM   956   C C    . TYR A 1 66  ? 94.983  -81.218  23.419  0.98 73.14  ? 110 TYR A C    1 
ATOM   957   O O    . TYR A 1 66  ? 95.340  -82.120  22.654  0.98 66.18  ? 110 TYR A O    1 
ATOM   958   C CB   . TYR A 1 66  ? 92.601  -81.685  22.792  0.98 74.53  ? 110 TYR A CB   1 
ATOM   959   C CG   . TYR A 1 66  ? 91.130  -81.423  23.042  0.98 61.24  ? 110 TYR A CG   1 
ATOM   960   C CD1  . TYR A 1 66  ? 90.615  -81.379  24.333  0.98 67.40  ? 110 TYR A CD1  1 
ATOM   961   C CD2  . TYR A 1 66  ? 90.256  -81.218  21.983  0.98 54.59  ? 110 TYR A CD2  1 
ATOM   962   C CE1  . TYR A 1 66  ? 89.272  -81.139  24.560  0.98 67.14  ? 110 TYR A CE1  1 
ATOM   963   C CE2  . TYR A 1 66  ? 88.913  -80.977  22.200  0.98 54.08  ? 110 TYR A CE2  1 
ATOM   964   C CZ   . TYR A 1 66  ? 88.426  -80.938  23.490  0.98 63.61  ? 110 TYR A CZ   1 
ATOM   965   O OH   . TYR A 1 66  ? 87.089  -80.699  23.710  0.98 54.75  ? 110 TYR A OH   1 
ATOM   966   H H    . TYR A 1 66  ? 92.982  -79.272  23.544  0.98 78.86  ? 110 TYR A H    1 
ATOM   967   H HA   . TYR A 1 66  ? 93.434  -81.694  24.659  0.98 75.45  ? 110 TYR A HA   1 
ATOM   968   H HB2  . TYR A 1 66  ? 92.834  -81.276  21.944  0.98 89.44  ? 110 TYR A HB2  1 
ATOM   969   H HB3  . TYR A 1 66  ? 92.725  -82.646  22.738  0.98 89.44  ? 110 TYR A HB3  1 
ATOM   970   H HD1  . TYR A 1 66  ? 91.184  -81.514  25.056  0.98 80.88  ? 110 TYR A HD1  1 
ATOM   971   H HD2  . TYR A 1 66  ? 90.580  -81.243  21.112  0.98 65.50  ? 110 TYR A HD2  1 
ATOM   972   H HE1  . TYR A 1 66  ? 88.942  -81.113  25.429  0.98 80.58  ? 110 TYR A HE1  1 
ATOM   973   H HE2  . TYR A 1 66  ? 88.340  -80.842  21.480  0.98 64.89  ? 110 TYR A HE2  1 
ATOM   974   H HH   . TYR A 1 66  ? 86.691  -80.596  22.978  0.98 65.71  ? 110 TYR A HH   1 
ATOM   975   N N    . GLY A 1 67  ? 95.832  -80.287  23.866  1.00 69.86  ? 111 GLY A N    1 
ATOM   976   C CA   . GLY A 1 67  ? 97.266  -80.365  23.677  1.00 69.40  ? 111 GLY A CA   1 
ATOM   977   C C    . GLY A 1 67  ? 97.831  -79.348  22.703  1.00 72.88  ? 111 GLY A C    1 
ATOM   978   O O    . GLY A 1 67  ? 99.018  -79.011  22.799  1.00 83.48  ? 111 GLY A O    1 
ATOM   979   H H    . GLY A 1 67  ? 95.583  -79.583  24.293  1.00 83.84  ? 111 GLY A H    1 
ATOM   980   H HA2  . GLY A 1 67  ? 97.704  -80.237  24.533  1.00 83.28  ? 111 GLY A HA2  1 
ATOM   981   H HA3  . GLY A 1 67  ? 97.493  -81.251  23.352  1.00 83.28  ? 111 GLY A HA3  1 
ATOM   982   N N    . LEU A 1 68  ? 97.016  -78.860  21.768  1.00 69.23  ? 112 LEU A N    1 
ATOM   983   C CA   . LEU A 1 68  ? 97.512  -77.971  20.723  1.00 58.93  ? 112 LEU A CA   1 
ATOM   984   C C    . LEU A 1 68  ? 98.352  -76.848  21.320  1.00 51.14  ? 112 LEU A C    1 
ATOM   985   O O    . LEU A 1 68  ? 97.910  -76.134  22.223  1.00 57.36  ? 112 LEU A O    1 
ATOM   986   C CB   . LEU A 1 68  ? 96.338  -77.396  19.923  1.00 51.96  ? 112 LEU A CB   1 
ATOM   987   C CG   . LEU A 1 68  ? 96.679  -76.600  18.659  1.00 44.05  ? 112 LEU A CG   1 
ATOM   988   C CD1  . LEU A 1 68  ? 97.445  -77.452  17.654  1.00 52.85  ? 112 LEU A CD1  1 
ATOM   989   C CD2  . LEU A 1 68  ? 95.411  -76.052  18.024  1.00 44.12  ? 112 LEU A CD2  1 
ATOM   990   H H    . LEU A 1 68  ? 96.174  -79.030  21.718  1.00 83.08  ? 112 LEU A H    1 
ATOM   991   H HA   . LEU A 1 68  ? 98.073  -78.477  20.115  1.00 70.72  ? 112 LEU A HA   1 
ATOM   992   H HB2  . LEU A 1 68  ? 95.768  -78.132  19.652  1.00 62.36  ? 112 LEU A HB2  1 
ATOM   993   H HB3  . LEU A 1 68  ? 95.838  -76.804  20.507  1.00 62.36  ? 112 LEU A HB3  1 
ATOM   994   H HG   . LEU A 1 68  ? 97.240  -75.848  18.902  1.00 52.86  ? 112 LEU A HG   1 
ATOM   995   H HD11 . LEU A 1 68  ? 97.642  -76.915  16.871  1.00 63.42  ? 112 LEU A HD11 1 
ATOM   996   H HD12 . LEU A 1 68  ? 98.271  -77.755  18.063  1.00 63.42  ? 112 LEU A HD12 1 
ATOM   997   H HD13 . LEU A 1 68  ? 96.899  -78.214  17.405  1.00 63.42  ? 112 LEU A HD13 1 
ATOM   998   H HD21 . LEU A 1 68  ? 95.648  -75.553  17.227  1.00 52.95  ? 112 LEU A HD21 1 
ATOM   999   H HD22 . LEU A 1 68  ? 94.829  -76.792  17.791  1.00 52.95  ? 112 LEU A HD22 1 
ATOM   1000  H HD23 . LEU A 1 68  ? 94.967  -75.469  18.660  1.00 52.95  ? 112 LEU A HD23 1 
ATOM   1001  N N    . ASP A 1 69  ? 99.568  -76.700  20.804  1.00 51.79  ? 113 ASP A N    1 
ATOM   1002  C CA   . ASP A 1 69  ? 100.519 -75.749  21.367  1.00 46.84  ? 113 ASP A CA   1 
ATOM   1003  C C    . ASP A 1 69  ? 99.940  -74.335  21.332  1.00 48.54  ? 113 ASP A C    1 
ATOM   1004  O O    . ASP A 1 69  ? 99.456  -73.896  20.280  1.00 51.59  ? 113 ASP A O    1 
ATOM   1005  C CB   . ASP A 1 69  ? 101.835 -75.797  20.592  1.00 49.23  ? 113 ASP A CB   1 
ATOM   1006  C CG   . ASP A 1 69  ? 102.811 -74.723  21.032  1.00 59.16  ? 113 ASP A CG   1 
ATOM   1007  O OD1  . ASP A 1 69  ? 103.223 -74.740  22.210  1.00 58.46  ? 113 ASP A OD1  1 
ATOM   1008  O OD2  . ASP A 1 69  ? 103.166 -73.863  20.200  1.00 58.96  ? 113 ASP A OD2  1 
ATOM   1009  H H    . ASP A 1 69  ? 99.867  -77.138  20.127  1.00 62.15  ? 113 ASP A H    1 
ATOM   1010  H HA   . ASP A 1 69  ? 100.699 -75.984  22.291  1.00 56.21  ? 113 ASP A HA   1 
ATOM   1011  H HB2  . ASP A 1 69  ? 102.254 -76.661  20.734  1.00 59.08  ? 113 ASP A HB2  1 
ATOM   1012  H HB3  . ASP A 1 69  ? 101.652 -75.668  19.648  1.00 59.08  ? 113 ASP A HB3  1 
ATOM   1013  N N    . PRO A 1 70  ? 99.976  -73.590  22.446  1.00 48.24  ? 114 PRO A N    1 
ATOM   1014  C CA   . PRO A 1 70  ? 99.396  -72.234  22.424  1.00 42.51  ? 114 PRO A CA   1 
ATOM   1015  C C    . PRO A 1 70  ? 100.056 -71.297  21.428  1.00 40.84  ? 114 PRO A C    1 
ATOM   1016  O O    . PRO A 1 70  ? 99.369  -70.459  20.832  1.00 40.17  ? 114 PRO A O    1 
ATOM   1017  C CB   . PRO A 1 70  ? 99.591  -71.750  23.869  1.00 47.09  ? 114 PRO A CB   1 
ATOM   1018  C CG   . PRO A 1 70  ? 99.681  -72.991  24.675  1.00 47.62  ? 114 PRO A CG   1 
ATOM   1019  C CD   . PRO A 1 70  ? 100.382 -73.988  23.805  1.00 53.92  ? 114 PRO A CD   1 
ATOM   1020  H HA   . PRO A 1 70  ? 98.447  -72.281  22.232  1.00 51.01  ? 114 PRO A HA   1 
ATOM   1021  H HB2  . PRO A 1 70  ? 100.411 -71.237  23.935  1.00 56.52  ? 114 PRO A HB2  1 
ATOM   1022  H HB3  . PRO A 1 70  ? 98.828  -71.217  24.141  1.00 56.52  ? 114 PRO A HB3  1 
ATOM   1023  H HG2  . PRO A 1 70  ? 100.195 -72.820  25.480  1.00 57.15  ? 114 PRO A HG2  1 
ATOM   1024  H HG3  . PRO A 1 70  ? 98.789  -73.300  24.898  1.00 57.15  ? 114 PRO A HG3  1 
ATOM   1025  H HD2  . PRO A 1 70  ? 101.343 -73.911  23.908  1.00 64.71  ? 114 PRO A HD2  1 
ATOM   1026  H HD3  . PRO A 1 70  ? 100.073 -74.886  24.002  1.00 64.71  ? 114 PRO A HD3  1 
ATOM   1027  N N    . LYS A 1 71  ? 101.373 -71.397  21.238  1.00 44.75  ? 115 LYS A N    1 
ATOM   1028  C CA   . LYS A 1 71  ? 102.035 -70.537  20.262  1.00 44.89  ? 115 LYS A CA   1 
ATOM   1029  C C    . LYS A 1 71  ? 101.475 -70.769  18.865  1.00 45.27  ? 115 LYS A C    1 
ATOM   1030  O O    . LYS A 1 71  ? 101.296 -69.821  18.091  1.00 46.57  ? 115 LYS A O    1 
ATOM   1031  C CB   . LYS A 1 71  ? 103.543 -70.781  20.283  1.00 35.82  ? 115 LYS A CB   1 
ATOM   1032  H H    . LYS A 1 71  ? 101.893 -71.943  21.651  1.00 53.71  ? 115 LYS A H    1 
ATOM   1033  H HA   . LYS A 1 71  ? 101.878 -69.610  20.499  1.00 53.87  ? 115 LYS A HA   1 
ATOM   1034  N N    . ILE A 1 72  ? 101.188 -72.027  18.529  1.00 37.22  ? 116 ILE A N    1 
ATOM   1035  C CA   . ILE A 1 72  ? 100.579 -72.339  17.240  1.00 44.07  ? 116 ILE A CA   1 
ATOM   1036  C C    . ILE A 1 72  ? 99.106  -71.948  17.244  1.00 43.90  ? 116 ILE A C    1 
ATOM   1037  O O    . ILE A 1 72  ? 98.612  -71.312  16.305  1.00 36.21  ? 116 ILE A O    1 
ATOM   1038  C CB   . ILE A 1 72  ? 100.771 -73.832  16.915  1.00 42.11  ? 116 ILE A CB   1 
ATOM   1039  C CG1  . ILE A 1 72  ? 102.240 -74.107  16.584  1.00 37.15  ? 116 ILE A CG1  1 
ATOM   1040  C CG2  . ILE A 1 72  ? 99.872  -74.271  15.758  1.00 41.62  ? 116 ILE A CG2  1 
ATOM   1041  C CD1  . ILE A 1 72  ? 102.593 -75.576  16.527  1.00 36.90  ? 116 ILE A CD1  1 
ATOM   1042  H H    . ILE A 1 72  ? 101.335 -72.712  19.027  1.00 44.66  ? 116 ILE A H    1 
ATOM   1043  H HA   . ILE A 1 72  ? 101.023 -71.823  16.549  1.00 52.89  ? 116 ILE A HA   1 
ATOM   1044  H HB   . ILE A 1 72  ? 100.533 -74.349  17.701  1.00 50.54  ? 116 ILE A HB   1 
ATOM   1045  H HG12 . ILE A 1 72  ? 102.442 -73.721  15.717  1.00 44.59  ? 116 ILE A HG12 1 
ATOM   1046  H HG13 . ILE A 1 72  ? 102.795 -73.696  17.264  1.00 44.59  ? 116 ILE A HG13 1 
ATOM   1047  H HG21 . ILE A 1 72  ? 100.020 -75.213  15.583  1.00 49.95  ? 116 ILE A HG21 1 
ATOM   1048  H HG22 . ILE A 1 72  ? 98.946  -74.121  16.005  1.00 49.95  ? 116 ILE A HG22 1 
ATOM   1049  H HG23 . ILE A 1 72  ? 100.093 -73.749  14.971  1.00 49.95  ? 116 ILE A HG23 1 
ATOM   1050  H HD11 . ILE A 1 72  ? 103.535 -75.665  16.313  1.00 44.29  ? 116 ILE A HD11 1 
ATOM   1051  H HD12 . ILE A 1 72  ? 102.410 -75.978  17.391  1.00 44.29  ? 116 ILE A HD12 1 
ATOM   1052  H HD13 . ILE A 1 72  ? 102.056 -76.003  15.842  1.00 44.29  ? 116 ILE A HD13 1 
ATOM   1053  N N    . ALA A 1 73  ? 98.384  -72.319  18.304  1.00 34.46  ? 117 ALA A N    1 
ATOM   1054  C CA   . ALA A 1 73  ? 96.951  -72.051  18.358  1.00 40.76  ? 117 ALA A CA   1 
ATOM   1055  C C    . ALA A 1 73  ? 96.663  -70.556  18.292  1.00 36.09  ? 117 ALA A C    1 
ATOM   1056  O O    . ALA A 1 73  ? 95.701  -70.131  17.642  1.00 35.71  ? 117 ALA A O    1 
ATOM   1057  C CB   . ALA A 1 73  ? 96.356  -72.657  19.629  1.00 40.37  ? 117 ALA A CB   1 
ATOM   1058  H H    . ALA A 1 73  ? 98.699  -72.722  18.995  1.00 41.35  ? 117 ALA A H    1 
ATOM   1059  H HA   . ALA A 1 73  ? 96.523  -72.472  17.597  1.00 48.91  ? 117 ALA A HA   1 
ATOM   1060  H HB1  . ALA A 1 73  ? 95.404  -72.471  19.651  1.00 48.45  ? 117 ALA A HB1  1 
ATOM   1061  H HB2  . ALA A 1 73  ? 96.506  -73.615  19.621  1.00 48.45  ? 117 ALA A HB2  1 
ATOM   1062  H HB3  . ALA A 1 73  ? 96.789  -72.260  20.401  1.00 48.45  ? 117 ALA A HB3  1 
ATOM   1063  N N    . ASN A 1 74  ? 97.485  -69.741  18.956  1.00 37.61  ? 118 ASN A N    1 
ATOM   1064  C CA   . ASN A 1 74  ? 97.262  -68.299  18.935  1.00 40.97  ? 118 ASN A CA   1 
ATOM   1065  C C    . ASN A 1 74  ? 97.502  -67.725  17.545  1.00 30.88  ? 118 ASN A C    1 
ATOM   1066  O O    . ASN A 1 74  ? 96.792  -66.808  17.115  1.00 35.79  ? 118 ASN A O    1 
ATOM   1067  C CB   . ASN A 1 74  ? 98.161  -67.613  19.963  1.00 45.58  ? 118 ASN A CB   1 
ATOM   1068  C CG   . ASN A 1 74  ? 98.066  -66.102  19.899  1.00 57.40  ? 118 ASN A CG   1 
ATOM   1069  O OD1  . ASN A 1 74  ? 97.154  -65.501  20.468  1.00 63.22  ? 118 ASN A OD1  1 
ATOM   1070  N ND2  . ASN A 1 74  ? 99.012  -65.478  19.206  1.00 41.00  ? 118 ASN A ND2  1 
ATOM   1071  H H    . ASN A 1 74  ? 98.165  -69.994  19.418  1.00 45.13  ? 118 ASN A H    1 
ATOM   1072  H HA   . ASN A 1 74  ? 96.340  -68.119  19.178  1.00 49.17  ? 118 ASN A HA   1 
ATOM   1073  H HB2  . ASN A 1 74  ? 97.896  -67.893  20.853  1.00 54.70  ? 118 ASN A HB2  1 
ATOM   1074  H HB3  . ASN A 1 74  ? 99.083  -67.864  19.795  1.00 54.70  ? 118 ASN A HB3  1 
ATOM   1075  H HD21 . ASN A 1 74  ? 99.002  -64.620  19.140  1.00 49.20  ? 118 ASN A HD21 1 
ATOM   1076  H HD22 . ASN A 1 74  ? 99.634  -65.931  18.822  1.00 49.20  ? 118 ASN A HD22 1 
ATOM   1077  N N    . ALA A 1 75  ? 98.499  -68.246  16.828  1.00 31.50  ? 119 ALA A N    1 
ATOM   1078  C CA   . ALA A 1 75  ? 98.730  -67.800  15.458  1.00 35.41  ? 119 ALA A CA   1 
ATOM   1079  C C    . ALA A 1 75  ? 97.564  -68.185  14.554  1.00 25.70  ? 119 ALA A C    1 
ATOM   1080  O O    . ALA A 1 75  ? 97.160  -67.404  13.685  1.00 27.02  ? 119 ALA A O    1 
ATOM   1081  C CB   . ALA A 1 75  ? 100.037 -68.387  14.929  1.00 33.04  ? 119 ALA A CB   1 
ATOM   1082  H H    . ALA A 1 75  ? 99.046  -68.848  17.107  1.00 37.81  ? 119 ALA A H    1 
ATOM   1083  H HA   . ALA A 1 75  ? 98.809  -66.833  15.449  1.00 42.49  ? 119 ALA A HA   1 
ATOM   1084  H HB1  . ALA A 1 75  ? 100.175 -68.081  14.019  1.00 39.65  ? 119 ALA A HB1  1 
ATOM   1085  H HB2  . ALA A 1 75  ? 100.768 -68.088  15.493  1.00 39.65  ? 119 ALA A HB2  1 
ATOM   1086  H HB3  . ALA A 1 75  ? 99.979  -69.355  14.948  1.00 39.65  ? 119 ALA A HB3  1 
ATOM   1087  N N    . ILE A 1 76  ? 97.013  -69.385  14.746  1.00 24.93  ? 120 ILE A N    1 
ATOM   1088  C CA   . ILE A 1 76  ? 95.838  -69.800  13.985  1.00 29.48  ? 120 ILE A CA   1 
ATOM   1089  C C    . ILE A 1 76  ? 94.660  -68.886  14.294  1.00 27.84  ? 120 ILE A C    1 
ATOM   1090  O O    . ILE A 1 76  ? 93.916  -68.478  13.393  1.00 22.95  ? 120 ILE A O    1 
ATOM   1091  C CB   . ILE A 1 76  ? 95.507  -71.275  14.286  1.00 26.28  ? 120 ILE A CB   1 
ATOM   1092  C CG1  . ILE A 1 76  ? 96.595  -72.184  13.708  1.00 32.45  ? 120 ILE A CG1  1 
ATOM   1093  C CG2  . ILE A 1 76  ? 94.133  -71.651  13.729  1.00 27.71  ? 120 ILE A CG2  1 
ATOM   1094  C CD1  . ILE A 1 76  ? 96.457  -73.643  14.094  1.00 26.73  ? 120 ILE A CD1  1 
ATOM   1095  H H    . ILE A 1 76  ? 97.299  -69.972  15.306  1.00 29.92  ? 120 ILE A H    1 
ATOM   1096  H HA   . ILE A 1 76  ? 96.033  -69.726  13.038  1.00 35.38  ? 120 ILE A HA   1 
ATOM   1097  H HB   . ILE A 1 76  ? 95.489  -71.393  15.249  1.00 31.53  ? 120 ILE A HB   1 
ATOM   1098  H HG12 . ILE A 1 76  ? 96.563  -72.131  12.740  1.00 38.94  ? 120 ILE A HG12 1 
ATOM   1099  H HG13 . ILE A 1 76  ? 97.459  -71.876  14.024  1.00 38.94  ? 120 ILE A HG13 1 
ATOM   1100  H HG21 . ILE A 1 76  ? 93.954  -72.582  13.934  1.00 33.25  ? 120 ILE A HG21 1 
ATOM   1101  H HG22 . ILE A 1 76  ? 93.460  -71.086  14.140  1.00 33.25  ? 120 ILE A HG22 1 
ATOM   1102  H HG23 . ILE A 1 76  ? 94.135  -71.518  12.768  1.00 33.25  ? 120 ILE A HG23 1 
ATOM   1103  H HD11 . ILE A 1 76  ? 97.180  -74.146  13.689  1.00 32.08  ? 120 ILE A HD11 1 
ATOM   1104  H HD12 . ILE A 1 76  ? 96.500  -73.718  15.060  1.00 32.08  ? 120 ILE A HD12 1 
ATOM   1105  H HD13 . ILE A 1 76  ? 95.603  -73.974  13.773  1.00 32.08  ? 120 ILE A HD13 1 
ATOM   1106  N N    . MET A 1 77  ? 94.472  -68.550  15.571  1.00 27.97  ? 121 MET A N    1 
ATOM   1107  C CA   . MET A 1 77  ? 93.368  -67.677  15.953  1.00 31.72  ? 121 MET A CA   1 
ATOM   1108  C C    . MET A 1 77  ? 93.519  -66.292  15.333  1.00 23.88  ? 121 MET A C    1 
ATOM   1109  O O    . MET A 1 77  ? 92.538  -65.705  14.864  1.00 30.25  ? 121 MET A O    1 
ATOM   1110  C CB   . MET A 1 77  ? 93.286  -67.585  17.477  1.00 33.13  ? 121 MET A CB   1 
ATOM   1111  C CG   . MET A 1 77  ? 92.806  -68.872  18.138  1.00 30.07  ? 121 MET A CG   1 
ATOM   1112  S SD   . MET A 1 77  ? 93.172  -68.966  19.902  1.00 37.39  ? 121 MET A SD   1 
ATOM   1113  C CE   . MET A 1 77  ? 92.507  -67.408  20.480  1.00 50.89  ? 121 MET A CE   1 
ATOM   1114  H H    . MET A 1 77  ? 94.965  -68.811  16.226  1.00 33.57  ? 121 MET A H    1 
ATOM   1115  H HA   . MET A 1 77  ? 92.539  -68.069  15.637  1.00 38.07  ? 121 MET A HA   1 
ATOM   1116  H HB2  . MET A 1 77  ? 94.167  -67.382  17.826  1.00 39.76  ? 121 MET A HB2  1 
ATOM   1117  H HB3  . MET A 1 77  ? 92.666  -66.879  17.715  1.00 39.76  ? 121 MET A HB3  1 
ATOM   1118  H HG2  . MET A 1 77  ? 91.844  -68.938  18.031  1.00 36.09  ? 121 MET A HG2  1 
ATOM   1119  H HG3  . MET A 1 77  ? 93.237  -69.625  17.705  1.00 36.09  ? 121 MET A HG3  1 
ATOM   1120  H HE1  . MET A 1 77  ? 92.647  -67.342  21.438  1.00 61.07  ? 121 MET A HE1  1 
ATOM   1121  H HE2  . MET A 1 77  ? 92.964  -66.683  20.027  1.00 61.07  ? 121 MET A HE2  1 
ATOM   1122  H HE3  . MET A 1 77  ? 91.558  -67.378  20.282  1.00 61.07  ? 121 MET A HE3  1 
ATOM   1123  N N    . LYS A 1 78  ? 94.743  -65.757  15.315  1.00 32.56  ? 122 LYS A N    1 
ATOM   1124  C CA   . LYS A 1 78  ? 94.976  -64.456  14.694  1.00 40.58  ? 122 LYS A CA   1 
ATOM   1125  C C    . LYS A 1 78  ? 94.690  -64.505  13.197  1.00 37.09  ? 122 LYS A C    1 
ATOM   1126  O O    . LYS A 1 78  ? 93.984  -63.644  12.659  1.00 25.88  ? 122 LYS A O    1 
ATOM   1127  C CB   . LYS A 1 78  ? 96.413  -64.002  14.952  1.00 37.84  ? 122 LYS A CB   1 
ATOM   1128  C CG   . LYS A 1 78  ? 96.617  -63.296  16.284  1.00 53.12  ? 122 LYS A CG   1 
ATOM   1129  C CD   . LYS A 1 78  ? 98.096  -63.117  16.595  1.00 42.55  ? 122 LYS A CD   1 
ATOM   1130  H H    . LYS A 1 78  ? 95.444  -66.123  15.651  1.00 39.07  ? 122 LYS A H    1 
ATOM   1131  H HA   . LYS A 1 78  ? 94.378  -63.804  15.092  1.00 48.69  ? 122 LYS A HA   1 
ATOM   1132  H HB2  . LYS A 1 78  ? 96.992  -64.780  14.939  1.00 45.41  ? 122 LYS A HB2  1 
ATOM   1133  H HB3  . LYS A 1 78  ? 96.676  -63.387  14.249  1.00 45.41  ? 122 LYS A HB3  1 
ATOM   1134  H HG2  . LYS A 1 78  ? 96.205  -62.419  16.248  1.00 63.74  ? 122 LYS A HG2  1 
ATOM   1135  H HG3  . LYS A 1 78  ? 96.219  -63.826  16.992  1.00 63.74  ? 122 LYS A HG3  1 
ATOM   1136  H HD2  . LYS A 1 78  ? 98.561  -62.861  15.783  1.00 51.06  ? 122 LYS A HD2  1 
ATOM   1137  H HD3  . LYS A 1 78  ? 98.196  -62.425  17.267  1.00 51.06  ? 122 LYS A HD3  1 
ATOM   1138  N N    . ALA A 1 79  ? 95.240  -65.505  12.505  1.00 27.61  ? 123 ALA A N    1 
ATOM   1139  C CA   . ALA A 1 79  ? 94.984  -65.643  11.075  1.00 28.98  ? 123 ALA A CA   1 
ATOM   1140  C C    . ALA A 1 79  ? 93.503  -65.869  10.805  1.00 29.86  ? 123 ALA A C    1 
ATOM   1141  O O    . ALA A 1 79  ? 92.936  -65.283  9.875   1.00 19.54  ? 123 ALA A O    1 
ATOM   1142  C CB   . ALA A 1 79  ? 95.812  -66.792  10.502  1.00 24.48  ? 123 ALA A CB   1 
ATOM   1143  H H    . ALA A 1 79  ? 95.758  -66.107  12.836  1.00 33.14  ? 123 ALA A H    1 
ATOM   1144  H HA   . ALA A 1 79  ? 95.251  -64.826  10.625  1.00 34.77  ? 123 ALA A HA   1 
ATOM   1145  H HB1  . ALA A 1 79  ? 95.630  -66.869  9.552   1.00 29.38  ? 123 ALA A HB1  1 
ATOM   1146  H HB2  . ALA A 1 79  ? 96.753  -66.604  10.644  1.00 29.38  ? 123 ALA A HB2  1 
ATOM   1147  H HB3  . ALA A 1 79  ? 95.567  -67.614  10.954  1.00 29.38  ? 123 ALA A HB3  1 
ATOM   1148  N N    . ALA A 1 80  ? 92.862  -66.720  11.610  1.00 23.61  ? 124 ALA A N    1 
ATOM   1149  C CA   . ALA A 1 80  ? 91.429  -66.946  11.462  1.00 20.93  ? 124 ALA A CA   1 
ATOM   1150  C C    . ALA A 1 80  ? 90.652  -65.641  11.567  1.00 27.85  ? 124 ALA A C    1 
ATOM   1151  O O    . ALA A 1 80  ? 89.713  -65.406  10.796  1.00 25.12  ? 124 ALA A O    1 
ATOM   1152  C CB   . ALA A 1 80  ? 90.946  -67.942  12.515  1.00 21.40  ? 124 ALA A CB   1 
ATOM   1153  H H    . ALA A 1 80  ? 93.232  -67.172  12.241  1.00 28.34  ? 124 ALA A H    1 
ATOM   1154  H HA   . ALA A 1 80  ? 91.258  -67.328  10.586  1.00 25.12  ? 124 ALA A HA   1 
ATOM   1155  H HB1  . ALA A 1 80  ? 89.993  -68.082  12.403  1.00 25.69  ? 124 ALA A HB1  1 
ATOM   1156  H HB2  . ALA A 1 80  ? 91.420  -68.780  12.396  1.00 25.69  ? 124 ALA A HB2  1 
ATOM   1157  H HB3  . ALA A 1 80  ? 91.127  -67.581  13.396  1.00 25.69  ? 124 ALA A HB3  1 
ATOM   1158  N N    . ASP A 1 81  ? 91.028  -64.777  12.516  1.00 23.96  ? 125 ASP A N    1 
ATOM   1159  C CA   . ASP A 1 81  ? 90.342  -63.497  12.665  1.00 22.23  ? 125 ASP A CA   1 
ATOM   1160  C C    . ASP A 1 81  ? 90.450  -62.666  11.395  1.00 17.82  ? 125 ASP A C    1 
ATOM   1161  O O    . ASP A 1 81  ? 89.487  -62.000  10.997  1.00 30.52  ? 125 ASP A O    1 
ATOM   1162  C CB   . ASP A 1 81  ? 90.913  -62.724  13.854  1.00 30.31  ? 125 ASP A CB   1 
ATOM   1163  C CG   . ASP A 1 81  ? 90.579  -63.367  15.186  1.00 39.89  ? 125 ASP A CG   1 
ATOM   1164  O OD1  . ASP A 1 81  ? 89.568  -64.096  15.260  1.00 40.99  ? 125 ASP A OD1  1 
ATOM   1165  O OD2  . ASP A 1 81  ? 91.326  -63.139  16.161  1.00 45.94  ? 125 ASP A OD2  1 
ATOM   1166  H H    . ASP A 1 81  ? 91.667  -64.909  13.076  1.00 28.76  ? 125 ASP A H    1 
ATOM   1167  H HA   . ASP A 1 81  ? 89.402  -63.661  12.837  1.00 26.67  ? 125 ASP A HA   1 
ATOM   1168  H HB2  . ASP A 1 81  ? 91.879  -62.687  13.772  1.00 36.38  ? 125 ASP A HB2  1 
ATOM   1169  H HB3  . ASP A 1 81  ? 90.546  -61.826  13.853  1.00 36.38  ? 125 ASP A HB3  1 
ATOM   1170  N N    . GLU A 1 82  ? 91.614  -62.690  10.743  1.00 24.46  ? 126 GLU A N    1 
ATOM   1171  C CA   . GLU A 1 82  ? 91.783  -61.912  9.520   1.00 32.18  ? 126 GLU A CA   1 
ATOM   1172  C C    . GLU A 1 82  ? 90.843  -62.403  8.428   1.00 25.89  ? 126 GLU A C    1 
ATOM   1173  O O    . GLU A 1 82  ? 90.275  -61.598  7.679   1.00 27.48  ? 126 GLU A O    1 
ATOM   1174  C CB   . GLU A 1 82  ? 93.237  -61.975  9.055   1.00 32.20  ? 126 GLU A CB   1 
ATOM   1175  C CG   . GLU A 1 82  ? 94.217  -61.340  10.032  1.00 32.00  ? 126 GLU A CG   1 
ATOM   1176  C CD   . GLU A 1 82  ? 95.603  -61.170  9.444   1.00 39.13  ? 126 GLU A CD   1 
ATOM   1177  O OE1  . GLU A 1 82  ? 95.835  -61.643  8.311   1.00 31.90  ? 126 GLU A OE1  1 
ATOM   1178  O OE2  . GLU A 1 82  ? 96.461  -60.560  10.117  1.00 38.08  ? 126 GLU A OE2  1 
ATOM   1179  H H    . GLU A 1 82  ? 92.307  -63.139  10.984  1.00 29.36  ? 126 GLU A H    1 
ATOM   1180  H HA   . GLU A 1 82  ? 91.568  -60.985  9.705   1.00 38.62  ? 126 GLU A HA   1 
ATOM   1181  H HB2  . GLU A 1 82  ? 93.490  -62.904  8.942   1.00 38.64  ? 126 GLU A HB2  1 
ATOM   1182  H HB3  . GLU A 1 82  ? 93.315  -61.507  8.209   1.00 38.64  ? 126 GLU A HB3  1 
ATOM   1183  H HG2  . GLU A 1 82  ? 93.888  -60.463  10.283  1.00 38.40  ? 126 GLU A HG2  1 
ATOM   1184  H HG3  . GLU A 1 82  ? 94.291  -61.905  10.817  1.00 38.40  ? 126 GLU A HG3  1 
ATOM   1185  N N    . VAL A 1 83  ? 90.662  -63.720  8.321   1.00 25.04  ? 127 VAL A N    1 
ATOM   1186  C CA   . VAL A 1 83  ? 89.681  -64.259  7.383   1.00 32.34  ? 127 VAL A CA   1 
ATOM   1187  C C    . VAL A 1 83  ? 88.286  -63.776  7.756   1.00 23.15  ? 127 VAL A C    1 
ATOM   1188  O O    . VAL A 1 83  ? 87.548  -63.238  6.921   1.00 26.94  ? 127 VAL A O    1 
ATOM   1189  C CB   . VAL A 1 83  ? 89.755  -65.796  7.351   1.00 28.43  ? 127 VAL A CB   1 
ATOM   1190  C CG1  . VAL A 1 83  ? 88.693  -66.370  6.417   1.00 31.39  ? 127 VAL A CG1  1 
ATOM   1191  C CG2  . VAL A 1 83  ? 91.142  -66.256  6.920   1.00 18.54  ? 127 VAL A CG2  1 
ATOM   1192  H H    . VAL A 1 83  ? 91.088  -64.314  8.775   1.00 30.05  ? 127 VAL A H    1 
ATOM   1193  H HA   . VAL A 1 83  ? 89.883  -63.931  6.493   1.00 38.81  ? 127 VAL A HA   1 
ATOM   1194  H HB   . VAL A 1 83  ? 89.588  -66.140  8.242   1.00 34.12  ? 127 VAL A HB   1 
ATOM   1195  H HG11 . VAL A 1 83  ? 88.763  -67.337  6.416   1.00 37.67  ? 127 VAL A HG11 1 
ATOM   1196  H HG12 . VAL A 1 83  ? 87.816  -66.101  6.733   1.00 37.67  ? 127 VAL A HG12 1 
ATOM   1197  H HG13 . VAL A 1 83  ? 88.841  -66.027  5.522   1.00 37.67  ? 127 VAL A HG13 1 
ATOM   1198  H HG21 . VAL A 1 83  ? 91.163  -67.226  6.908   1.00 22.25  ? 127 VAL A HG21 1 
ATOM   1199  H HG22 . VAL A 1 83  ? 91.328  -65.910  6.034   1.00 22.25  ? 127 VAL A HG22 1 
ATOM   1200  H HG23 . VAL A 1 83  ? 91.796  -65.919  7.552   1.00 22.25  ? 127 VAL A HG23 1 
ATOM   1201  N N    . ALA A 1 84  ? 87.911  -63.948  9.026   1.00 25.15  ? 128 ALA A N    1 
ATOM   1202  C CA   . ALA A 1 84  ? 86.582  -63.551  9.478   1.00 21.98  ? 128 ALA A CA   1 
ATOM   1203  C C    . ALA A 1 84  ? 86.320  -62.072  9.224   1.00 25.51  ? 128 ALA A C    1 
ATOM   1204  O O    . ALA A 1 84  ? 85.190  -61.679  8.910   1.00 28.89  ? 128 ALA A O    1 
ATOM   1205  C CB   . ALA A 1 84  ? 86.424  -63.870  10.965  1.00 26.33  ? 128 ALA A CB   1 
ATOM   1206  H H    . ALA A 1 84  ? 88.407  -64.291  9.639   1.00 30.19  ? 128 ALA A H    1 
ATOM   1207  H HA   . ALA A 1 84  ? 85.917  -64.062  8.990   1.00 26.38  ? 128 ALA A HA   1 
ATOM   1208  H HB1  . ALA A 1 84  ? 85.538  -63.602  11.253  1.00 31.60  ? 128 ALA A HB1  1 
ATOM   1209  H HB2  . ALA A 1 84  ? 86.541  -64.824  11.097  1.00 31.60  ? 128 ALA A HB2  1 
ATOM   1210  H HB3  . ALA A 1 84  ? 87.097  -63.382  11.465  1.00 31.60  ? 128 ALA A HB3  1 
ATOM   1211  N N    . GLU A 1 85  ? 87.345  -61.234  9.361   1.00 26.52  ? 129 GLU A N    1 
ATOM   1212  C CA   . GLU A 1 85  ? 87.192  -59.791  9.227   1.00 36.04  ? 129 GLU A CA   1 
ATOM   1213  C C    . GLU A 1 85  ? 87.300  -59.316  7.783   1.00 32.75  ? 129 GLU A C    1 
ATOM   1214  O O    . GLU A 1 85  ? 87.299  -58.104  7.542   1.00 28.82  ? 129 GLU A O    1 
ATOM   1215  C CB   . GLU A 1 85  ? 88.232  -59.076  10.093  1.00 31.09  ? 129 GLU A CB   1 
ATOM   1216  C CG   . GLU A 1 85  ? 88.016  -59.265  11.588  1.00 41.54  ? 129 GLU A CG   1 
ATOM   1217  C CD   . GLU A 1 85  ? 89.230  -58.884  12.414  1.00 51.81  ? 129 GLU A CD   1 
ATOM   1218  O OE1  . GLU A 1 85  ? 90.245  -58.460  11.823  1.00 50.62  ? 129 GLU A OE1  1 
ATOM   1219  O OE2  . GLU A 1 85  ? 89.171  -59.012  13.656  1.00 58.65  ? 129 GLU A OE2  1 
ATOM   1220  H H    . GLU A 1 85  ? 88.150  -61.483  9.533   1.00 31.83  ? 129 GLU A H    1 
ATOM   1221  H HA   . GLU A 1 85  ? 86.314  -59.541  9.554   1.00 43.25  ? 129 GLU A HA   1 
ATOM   1222  H HB2  . GLU A 1 85  ? 89.112  -59.420  9.874   1.00 37.32  ? 129 GLU A HB2  1 
ATOM   1223  H HB3  . GLU A 1 85  ? 88.195  -58.125  9.905   1.00 37.32  ? 129 GLU A HB3  1 
ATOM   1224  H HG2  . GLU A 1 85  ? 87.274  -58.709  11.872  1.00 49.86  ? 129 GLU A HG2  1 
ATOM   1225  H HG3  . GLU A 1 85  ? 87.816  -60.198  11.762  1.00 49.86  ? 129 GLU A HG3  1 
ATOM   1226  N N    . GLY A 1 86  ? 87.390  -60.235  6.824   1.00 29.21  ? 130 GLY A N    1 
ATOM   1227  C CA   . GLY A 1 86  ? 87.434  -59.859  5.425   1.00 24.01  ? 130 GLY A CA   1 
ATOM   1228  C C    . GLY A 1 86  ? 88.752  -59.293  4.955   1.00 30.18  ? 130 GLY A C    1 
ATOM   1229  O O    . GLY A 1 86  ? 88.776  -58.556  3.965   1.00 33.99  ? 130 GLY A O    1 
ATOM   1230  H H    . GLY A 1 86  ? 87.428  -61.083  6.964   1.00 35.06  ? 130 GLY A H    1 
ATOM   1231  H HA2  . GLY A 1 86  ? 87.234  -60.640  4.885   1.00 28.81  ? 130 GLY A HA2  1 
ATOM   1232  H HA3  . GLY A 1 86  ? 86.747  -59.195  5.257   1.00 28.81  ? 130 GLY A HA3  1 
ATOM   1233  N N    . LYS A 1 87  ? 89.854  -59.616  5.629   1.00 25.44  ? 131 LYS A N    1 
ATOM   1234  C CA   . LYS A 1 87  ? 91.164  -59.100  5.252   1.00 30.17  ? 131 LYS A CA   1 
ATOM   1235  C C    . LYS A 1 87  ? 91.873  -59.954  4.208   1.00 25.96  ? 131 LYS A C    1 
ATOM   1236  O O    . LYS A 1 87  ? 92.898  -59.519  3.674   1.00 36.45  ? 131 LYS A O    1 
ATOM   1237  C CB   . LYS A 1 87  ? 92.063  -58.985  6.489   1.00 28.79  ? 131 LYS A CB   1 
ATOM   1238  C CG   . LYS A 1 87  ? 91.612  -57.944  7.499   1.00 32.86  ? 131 LYS A CG   1 
ATOM   1239  C CD   . LYS A 1 87  ? 92.590  -57.848  8.662   1.00 47.06  ? 131 LYS A CD   1 
ATOM   1240  C CE   . LYS A 1 87  ? 92.282  -56.660  9.559   1.00 54.73  ? 131 LYS A CE   1 
ATOM   1241  N NZ   . LYS A 1 87  ? 90.907  -56.725  10.124  1.00 64.32  ? 131 LYS A NZ   1 
ATOM   1242  H H    . LYS A 1 87  ? 89.868  -60.136  6.314   1.00 30.53  ? 131 LYS A H    1 
ATOM   1243  H HA   . LYS A 1 87  ? 91.053  -58.211  4.881   1.00 36.21  ? 131 LYS A HA   1 
ATOM   1244  H HB2  . LYS A 1 87  ? 92.081  -59.844  6.940   1.00 34.56  ? 131 LYS A HB2  1 
ATOM   1245  H HB3  . LYS A 1 87  ? 92.958  -58.748  6.201   1.00 34.56  ? 131 LYS A HB3  1 
ATOM   1246  H HG2  . LYS A 1 87  ? 91.566  -57.076  7.068   1.00 39.44  ? 131 LYS A HG2  1 
ATOM   1247  H HG3  . LYS A 1 87  ? 90.743  -58.192  7.852   1.00 39.44  ? 131 LYS A HG3  1 
ATOM   1248  H HD2  . LYS A 1 87  ? 92.531  -58.655  9.196   1.00 56.47  ? 131 LYS A HD2  1 
ATOM   1249  H HD3  . LYS A 1 87  ? 93.490  -57.741  8.315   1.00 56.47  ? 131 LYS A HD3  1 
ATOM   1250  H HE2  . LYS A 1 87  ? 92.911  -56.647  10.297  1.00 65.68  ? 131 LYS A HE2  1 
ATOM   1251  H HE3  . LYS A 1 87  ? 92.357  -55.843  9.041   1.00 65.68  ? 131 LYS A HE3  1 
ATOM   1252  H HZ1  . LYS A 1 87  ? 90.759  -56.017  10.643  1.00 77.18  ? 131 LYS A HZ1  1 
ATOM   1253  H HZ2  . LYS A 1 87  ? 90.308  -56.732  9.466   1.00 77.18  ? 131 LYS A HZ2  1 
ATOM   1254  H HZ3  . LYS A 1 87  ? 90.813  -57.465  10.610  1.00 77.18  ? 131 LYS A HZ3  1 
ATOM   1255  N N    . LEU A 1 88  ? 91.357  -61.148  3.899   1.00 26.43  ? 132 LEU A N    1 
ATOM   1256  C CA   . LEU A 1 88  ? 92.057  -62.096  3.038   1.00 23.13  ? 132 LEU A CA   1 
ATOM   1257  C C    . LEU A 1 88  ? 91.139  -62.666  1.962   1.00 23.34  ? 132 LEU A C    1 
ATOM   1258  O O    . LEU A 1 88  ? 91.321  -63.806  1.527   1.00 24.58  ? 132 LEU A O    1 
ATOM   1259  C CB   . LEU A 1 88  ? 92.664  -63.225  3.870   1.00 24.77  ? 132 LEU A CB   1 
ATOM   1260  C CG   . LEU A 1 88  ? 93.704  -62.800  4.912   1.00 24.79  ? 132 LEU A CG   1 
ATOM   1261  C CD1  . LEU A 1 88  ? 94.097  -63.976  5.796   1.00 24.21  ? 132 LEU A CD1  1 
ATOM   1262  C CD2  . LEU A 1 88  ? 94.935  -62.206  4.238   1.00 23.65  ? 132 LEU A CD2  1 
ATOM   1263  H H    . LEU A 1 88  ? 90.596  -61.431  4.180   1.00 31.72  ? 132 LEU A H    1 
ATOM   1264  H HA   . LEU A 1 88  ? 92.783  -61.633  2.591   1.00 27.76  ? 132 LEU A HA   1 
ATOM   1265  H HB2  . LEU A 1 88  ? 91.947  -63.676  4.343   1.00 29.73  ? 132 LEU A HB2  1 
ATOM   1266  H HB3  . LEU A 1 88  ? 93.096  -63.850  3.268   1.00 29.73  ? 132 LEU A HB3  1 
ATOM   1267  H HG   . LEU A 1 88  ? 93.317  -62.116  5.481   1.00 29.76  ? 132 LEU A HG   1 
ATOM   1268  H HD11 . LEU A 1 88  ? 94.754  -63.678  6.444   1.00 29.06  ? 132 LEU A HD11 1 
ATOM   1269  H HD12 . LEU A 1 88  ? 93.307  -64.305  6.253   1.00 29.06  ? 132 LEU A HD12 1 
ATOM   1270  H HD13 . LEU A 1 88  ? 94.473  -64.677  5.240   1.00 29.06  ? 132 LEU A HD13 1 
ATOM   1271  H HD21 . LEU A 1 88  ? 95.574  -61.947  4.920   1.00 28.38  ? 132 LEU A HD21 1 
ATOM   1272  H HD22 . LEU A 1 88  ? 95.327  -62.873  3.653   1.00 28.38  ? 132 LEU A HD22 1 
ATOM   1273  H HD23 . LEU A 1 88  ? 94.667  -61.429  3.722   1.00 28.38  ? 132 LEU A HD23 1 
ATOM   1274  N N    . ASN A 1 89  ? 90.159  -61.881  1.507   1.00 24.67  ? 133 ASN A N    1 
ATOM   1275  C CA   . ASN A 1 89  ? 89.209  -62.388  0.521   1.00 22.01  ? 133 ASN A CA   1 
ATOM   1276  C C    . ASN A 1 89  ? 89.886  -62.729  -0.800  1.00 20.96  ? 133 ASN A C    1 
ATOM   1277  O O    . ASN A 1 89  ? 89.397  -63.590  -1.540  1.00 21.49  ? 133 ASN A O    1 
ATOM   1278  C CB   . ASN A 1 89  ? 88.093  -61.369  0.290   1.00 22.91  ? 133 ASN A CB   1 
ATOM   1279  C CG   . ASN A 1 89  ? 87.268  -61.119  1.533   1.00 25.46  ? 133 ASN A CG   1 
ATOM   1280  O OD1  . ASN A 1 89  ? 87.306  -61.900  2.484   1.00 24.64  ? 133 ASN A OD1  1 
ATOM   1281  N ND2  . ASN A 1 89  ? 86.509  -60.029  1.532   1.00 24.91  ? 133 ASN A ND2  1 
ATOM   1282  H H    . ASN A 1 89  ? 90.026  -61.067  1.749   1.00 29.61  ? 133 ASN A H    1 
ATOM   1283  H HA   . ASN A 1 89  ? 88.804  -63.199  0.865   1.00 26.41  ? 133 ASN A HA   1 
ATOM   1284  H HB2  . ASN A 1 89  ? 88.486  -60.525  0.016   1.00 27.49  ? 133 ASN A HB2  1 
ATOM   1285  H HB3  . ASN A 1 89  ? 87.500  -61.700  -0.403  1.00 27.49  ? 133 ASN A HB3  1 
ATOM   1286  H HD21 . ASN A 1 89  ? 86.022  -59.843  2.215   1.00 29.90  ? 133 ASN A HD21 1 
ATOM   1287  H HD22 . ASN A 1 89  ? 86.506  -59.509  0.847   1.00 29.90  ? 133 ASN A HD22 1 
ATOM   1288  N N    . ASP A 1 90  ? 91.005  -62.074  -1.118  1.00 27.38  ? 134 ASP A N    1 
ATOM   1289  C CA   . ASP A 1 90  ? 91.682  -62.318  -2.388  1.00 27.23  ? 134 ASP A CA   1 
ATOM   1290  C C    . ASP A 1 90  ? 92.400  -63.661  -2.438  1.00 27.17  ? 134 ASP A C    1 
ATOM   1291  O O    . ASP A 1 90  ? 92.962  -63.996  -3.488  1.00 31.67  ? 134 ASP A O    1 
ATOM   1292  C CB   . ASP A 1 90  ? 92.685  -61.198  -2.676  1.00 37.93  ? 134 ASP A CB   1 
ATOM   1293  C CG   . ASP A 1 90  ? 92.011  -59.881  -3.005  1.00 49.76  ? 134 ASP A CG   1 
ATOM   1294  O OD1  . ASP A 1 90  ? 90.931  -59.906  -3.630  1.00 59.25  ? 134 ASP A OD1  1 
ATOM   1295  O OD2  . ASP A 1 90  ? 92.562  -58.823  -2.638  1.00 64.77  ? 134 ASP A OD2  1 
ATOM   1296  H H    . ASP A 1 90  ? 91.388  -61.488  -0.618  1.00 32.86  ? 134 ASP A H    1 
ATOM   1297  H HA   . ASP A 1 90  ? 91.021  -62.312  -3.098  1.00 32.68  ? 134 ASP A HA   1 
ATOM   1298  H HB2  . ASP A 1 90  ? 93.242  -61.064  -1.894  1.00 45.52  ? 134 ASP A HB2  1 
ATOM   1299  H HB3  . ASP A 1 90  ? 93.233  -61.452  -3.435  1.00 45.52  ? 134 ASP A HB3  1 
ATOM   1300  N N    . HIS A 1 91  ? 92.399  -64.435  -1.352  1.00 20.01  ? 135 HIS A N    1 
ATOM   1301  C CA   . HIS A 1 91  ? 93.089  -65.718  -1.307  1.00 26.36  ? 135 HIS A CA   1 
ATOM   1302  C C    . HIS A 1 91  ? 92.124  -66.898  -1.363  1.00 22.42  ? 135 HIS A C    1 
ATOM   1303  O O    . HIS A 1 91  ? 92.463  -67.996  -0.911  1.00 22.43  ? 135 HIS A O    1 
ATOM   1304  C CB   . HIS A 1 91  ? 93.955  -65.797  -0.051  1.00 25.88  ? 135 HIS A CB   1 
ATOM   1305  C CG   . HIS A 1 91  ? 94.900  -64.647  0.094   1.00 24.98  ? 135 HIS A CG   1 
ATOM   1306  N ND1  . HIS A 1 91  ? 96.137  -64.621  -0.512  1.00 26.29  ? 135 HIS A ND1  1 
ATOM   1307  C CD2  . HIS A 1 91  ? 94.784  -63.474  0.761   1.00 20.69  ? 135 HIS A CD2  1 
ATOM   1308  C CE1  . HIS A 1 91  ? 96.747  -63.487  -0.216  1.00 32.59  ? 135 HIS A CE1  1 
ATOM   1309  N NE2  . HIS A 1 91  ? 95.947  -62.773  0.555   1.00 28.29  ? 135 HIS A NE2  1 
ATOM   1310  H H    . HIS A 1 91  ? 91.998  -64.233  -0.618  1.00 24.01  ? 135 HIS A H    1 
ATOM   1311  H HA   . HIS A 1 91  ? 93.677  -65.782  -2.075  1.00 31.63  ? 135 HIS A HA   1 
ATOM   1312  H HB2  . HIS A 1 91  ? 93.377  -65.807  0.728   1.00 31.06  ? 135 HIS A HB2  1 
ATOM   1313  H HB3  . HIS A 1 91  ? 94.480  -66.612  -0.082  1.00 31.06  ? 135 HIS A HB3  1 
ATOM   1314  H HD2  . HIS A 1 91  ? 94.055  -63.198  1.269   1.00 24.83  ? 135 HIS A HD2  1 
ATOM   1315  H HE1  . HIS A 1 91  ? 97.594  -63.234  -0.503  1.00 39.12  ? 135 HIS A HE1  1 
ATOM   1316  H HE2  . HIS A 1 91  ? 96.125  -61.996  0.876   1.00 33.95  ? 135 HIS A HE2  1 
ATOM   1317  N N    . PHE A 1 92  ? 90.929  -66.692  -1.917  1.00 23.26  ? 136 PHE A N    1 
ATOM   1318  C CA   . PHE A 1 92  ? 89.916  -67.738  -2.038  1.00 17.62  ? 136 PHE A CA   1 
ATOM   1319  C C    . PHE A 1 92  ? 89.347  -67.674  -3.449  1.00 23.33  ? 136 PHE A C    1 
ATOM   1320  O O    . PHE A 1 92  ? 88.346  -66.988  -3.699  1.00 20.50  ? 136 PHE A O    1 
ATOM   1321  C CB   . PHE A 1 92  ? 88.832  -67.569  -0.977  1.00 16.18  ? 136 PHE A CB   1 
ATOM   1322  C CG   . PHE A 1 92  ? 89.352  -67.670  0.428   1.00 16.52  ? 136 PHE A CG   1 
ATOM   1323  C CD1  . PHE A 1 92  ? 89.836  -66.550  1.082   1.00 18.64  ? 136 PHE A CD1  1 
ATOM   1324  C CD2  . PHE A 1 92  ? 89.374  -68.886  1.087   1.00 20.15  ? 136 PHE A CD2  1 
ATOM   1325  C CE1  . PHE A 1 92  ? 90.323  -66.641  2.371   1.00 18.90  ? 136 PHE A CE1  1 
ATOM   1326  C CE2  . PHE A 1 92  ? 89.859  -68.984  2.377   1.00 24.52  ? 136 PHE A CE2  1 
ATOM   1327  C CZ   . PHE A 1 92  ? 90.334  -67.860  3.019   1.00 16.00  ? 136 PHE A CZ   1 
ATOM   1328  H H    . PHE A 1 92  ? 90.677  -65.935  -2.238  1.00 27.92  ? 136 PHE A H    1 
ATOM   1329  H HA   . PHE A 1 92  ? 90.332  -68.606  -1.915  1.00 21.15  ? 136 PHE A HA   1 
ATOM   1330  H HB2  . PHE A 1 92  ? 88.424  -66.696  -1.081  1.00 19.42  ? 136 PHE A HB2  1 
ATOM   1331  H HB3  . PHE A 1 92  ? 88.164  -68.262  -1.097  1.00 19.42  ? 136 PHE A HB3  1 
ATOM   1332  H HD1  . PHE A 1 92  ? 89.831  -65.727  0.650   1.00 22.37  ? 136 PHE A HD1  1 
ATOM   1333  H HD2  . PHE A 1 92  ? 89.054  -69.647  0.658   1.00 24.19  ? 136 PHE A HD2  1 
ATOM   1334  H HE1  . PHE A 1 92  ? 90.642  -65.881  2.802   1.00 22.68  ? 136 PHE A HE1  1 
ATOM   1335  H HE2  . PHE A 1 92  ? 89.865  -69.806  2.811   1.00 29.43  ? 136 PHE A HE2  1 
ATOM   1336  H HZ   . PHE A 1 92  ? 90.661  -67.923  3.888   1.00 19.20  ? 136 PHE A HZ   1 
ATOM   1337  N N    . PRO A 1 93  ? 89.967  -68.367  -4.405  1.00 18.78  ? 137 PRO A N    1 
ATOM   1338  C CA   . PRO A 1 93  ? 89.540  -68.278  -5.813  1.00 24.20  ? 137 PRO A CA   1 
ATOM   1339  C C    . PRO A 1 93  ? 88.594  -69.379  -6.279  1.00 12.35  ? 137 PRO A C    1 
ATOM   1340  O O    . PRO A 1 93  ? 88.336  -69.457  -7.485  1.00 24.56  ? 137 PRO A O    1 
ATOM   1341  C CB   . PRO A 1 93  ? 90.880  -68.394  -6.547  1.00 18.78  ? 137 PRO A CB   1 
ATOM   1342  C CG   . PRO A 1 93  ? 91.646  -69.363  -5.711  1.00 16.93  ? 137 PRO A CG   1 
ATOM   1343  C CD   . PRO A 1 93  ? 91.231  -69.113  -4.274  1.00 15.25  ? 137 PRO A CD   1 
ATOM   1344  H HA   . PRO A 1 93  ? 89.145  -67.411  -5.995  1.00 29.04  ? 137 PRO A HA   1 
ATOM   1345  H HB2  . PRO A 1 93  ? 90.739  -68.741  -7.442  1.00 22.54  ? 137 PRO A HB2  1 
ATOM   1346  H HB3  . PRO A 1 93  ? 91.321  -67.531  -6.572  1.00 22.54  ? 137 PRO A HB3  1 
ATOM   1347  H HG2  . PRO A 1 93  ? 91.419  -70.269  -5.976  1.00 20.32  ? 137 PRO A HG2  1 
ATOM   1348  H HG3  . PRO A 1 93  ? 92.596  -69.205  -5.822  1.00 20.32  ? 137 PRO A HG3  1 
ATOM   1349  H HD2  . PRO A 1 93  ? 91.081  -69.954  -3.814  1.00 18.30  ? 137 PRO A HD2  1 
ATOM   1350  H HD3  . PRO A 1 93  ? 91.897  -68.573  -3.820  1.00 18.30  ? 137 PRO A HD3  1 
ATOM   1351  N N    . LEU A 1 94  ? 88.084  -70.214  -5.382  1.00 18.12  ? 138 LEU A N    1 
ATOM   1352  C CA   . LEU A 1 94  ? 87.332  -71.395  -5.774  1.00 18.90  ? 138 LEU A CA   1 
ATOM   1353  C C    . LEU A 1 94  ? 85.853  -71.075  -5.945  1.00 25.08  ? 138 LEU A C    1 
ATOM   1354  O O    . LEU A 1 94  ? 85.296  -70.205  -5.269  1.00 19.03  ? 138 LEU A O    1 
ATOM   1355  C CB   . LEU A 1 94  ? 87.517  -72.501  -4.737  1.00 17.78  ? 138 LEU A CB   1 
ATOM   1356  C CG   . LEU A 1 94  ? 88.980  -72.816  -4.421  1.00 22.65  ? 138 LEU A CG   1 
ATOM   1357  C CD1  . LEU A 1 94  ? 89.067  -73.931  -3.406  1.00 23.77  ? 138 LEU A CD1  1 
ATOM   1358  C CD2  . LEU A 1 94  ? 89.753  -73.184  -5.684  1.00 25.74  ? 138 LEU A CD2  1 
ATOM   1359  H H    . LEU A 1 94  ? 88.162  -70.115  -4.531  1.00 21.74  ? 138 LEU A H    1 
ATOM   1360  H HA   . LEU A 1 94  ? 87.671  -71.719  -6.623  1.00 22.68  ? 138 LEU A HA   1 
ATOM   1361  H HB2  . LEU A 1 94  ? 87.087  -72.229  -3.911  1.00 21.34  ? 138 LEU A HB2  1 
ATOM   1362  H HB3  . LEU A 1 94  ? 87.104  -73.313  -5.070  1.00 21.34  ? 138 LEU A HB3  1 
ATOM   1363  H HG   . LEU A 1 94  ? 89.395  -72.028  -4.036  1.00 27.18  ? 138 LEU A HG   1 
ATOM   1364  H HD11 . LEU A 1 94  ? 90.001  -74.116  -3.219  1.00 28.52  ? 138 LEU A HD11 1 
ATOM   1365  H HD12 . LEU A 1 94  ? 88.615  -73.654  -2.594  1.00 28.52  ? 138 LEU A HD12 1 
ATOM   1366  H HD13 . LEU A 1 94  ? 88.639  -74.722  -3.770  1.00 28.52  ? 138 LEU A HD13 1 
ATOM   1367  H HD21 . LEU A 1 94  ? 90.674  -73.376  -5.445  1.00 30.89  ? 138 LEU A HD21 1 
ATOM   1368  H HD22 . LEU A 1 94  ? 89.345  -73.966  -6.087  1.00 30.89  ? 138 LEU A HD22 1 
ATOM   1369  H HD23 . LEU A 1 94  ? 89.721  -72.437  -6.303  1.00 30.89  ? 138 LEU A HD23 1 
ATOM   1370  N N    . VAL A 1 95  ? 85.216  -71.805  -6.860  1.00 20.19  ? 139 VAL A N    1 
ATOM   1371  C CA   . VAL A 1 95  ? 83.822  -71.563  -7.213  1.00 24.82  ? 139 VAL A CA   1 
ATOM   1372  C C    . VAL A 1 95  ? 82.897  -72.443  -6.382  1.00 17.74  ? 139 VAL A C    1 
ATOM   1373  O O    . VAL A 1 95  ? 83.337  -73.398  -5.731  1.00 13.30  ? 139 VAL A O    1 
ATOM   1374  C CB   . VAL A 1 95  ? 83.584  -71.795  -8.717  1.00 22.66  ? 139 VAL A CB   1 
ATOM   1375  C CG1  . VAL A 1 95  ? 84.418  -70.830  -9.543  1.00 24.67  ? 139 VAL A CG1  1 
ATOM   1376  C CG2  . VAL A 1 95  ? 83.888  -73.236  -9.098  1.00 15.41  ? 139 VAL A CG2  1 
ATOM   1377  H H    . VAL A 1 95  ? 85.577  -72.454  -7.294  1.00 24.23  ? 139 VAL A H    1 
ATOM   1378  H HA   . VAL A 1 95  ? 83.606  -70.638  -7.017  1.00 29.78  ? 139 VAL A HA   1 
ATOM   1379  H HB   . VAL A 1 95  ? 82.650  -71.626  -8.916  1.00 27.19  ? 139 VAL A HB   1 
ATOM   1380  H HG11 . VAL A 1 95  ? 84.252  -70.994  -10.484 1.00 29.61  ? 139 VAL A HG11 1 
ATOM   1381  H HG12 . VAL A 1 95  ? 84.166  -69.921  -9.316  1.00 29.61  ? 139 VAL A HG12 1 
ATOM   1382  H HG13 . VAL A 1 95  ? 85.357  -70.973  -9.342  1.00 29.61  ? 139 VAL A HG13 1 
ATOM   1383  H HG21 . VAL A 1 95  ? 83.730  -73.351  -10.048 1.00 18.49  ? 139 VAL A HG21 1 
ATOM   1384  H HG22 . VAL A 1 95  ? 84.817  -73.427  -8.892  1.00 18.49  ? 139 VAL A HG22 1 
ATOM   1385  H HG23 . VAL A 1 95  ? 83.308  -73.826  -8.592  1.00 18.49  ? 139 VAL A HG23 1 
ATOM   1386  N N    . VAL A 1 96  ? 81.603  -72.117  -6.405  1.00 17.92  ? 140 VAL A N    1 
ATOM   1387  C CA   . VAL A 1 96  ? 80.588  -72.946  -5.763  1.00 15.03  ? 140 VAL A CA   1 
ATOM   1388  C C    . VAL A 1 96  ? 80.622  -74.365  -6.309  1.00 14.95  ? 140 VAL A C    1 
ATOM   1389  O O    . VAL A 1 96  ? 80.365  -75.331  -5.579  1.00 17.53  ? 140 VAL A O    1 
ATOM   1390  C CB   . VAL A 1 96  ? 79.197  -72.309  -5.966  1.00 18.73  ? 140 VAL A CB   1 
ATOM   1391  C CG1  . VAL A 1 96  ? 78.089  -73.228  -5.463  1.00 19.50  ? 140 VAL A CG1  1 
ATOM   1392  C CG2  . VAL A 1 96  ? 79.127  -70.958  -5.274  1.00 23.78  ? 140 VAL A CG2  1 
ATOM   1393  H H    . VAL A 1 96  ? 81.288  -71.415  -6.790  1.00 21.51  ? 140 VAL A H    1 
ATOM   1394  H HA   . VAL A 1 96  ? 80.766  -72.985  -4.810  1.00 18.03  ? 140 VAL A HA   1 
ATOM   1395  H HB   . VAL A 1 96  ? 79.055  -72.164  -6.914  1.00 22.48  ? 140 VAL A HB   1 
ATOM   1396  H HG11 . VAL A 1 96  ? 77.233  -72.796  -5.606  1.00 23.41  ? 140 VAL A HG11 1 
ATOM   1397  H HG12 . VAL A 1 96  ? 78.125  -74.063  -5.954  1.00 23.41  ? 140 VAL A HG12 1 
ATOM   1398  H HG13 . VAL A 1 96  ? 78.223  -73.394  -4.516  1.00 23.41  ? 140 VAL A HG13 1 
ATOM   1399  H HG21 . VAL A 1 96  ? 78.247  -70.577  -5.414  1.00 28.54  ? 140 VAL A HG21 1 
ATOM   1400  H HG22 . VAL A 1 96  ? 79.288  -71.081  -4.325  1.00 28.54  ? 140 VAL A HG22 1 
ATOM   1401  H HG23 . VAL A 1 96  ? 79.805  -70.375  -5.651  1.00 28.54  ? 140 VAL A HG23 1 
ATOM   1402  N N    . TRP A 1 97  ? 80.946  -74.516  -7.591  1.00 22.88  ? 141 TRP A N    1 
ATOM   1403  C CA   . TRP A 1 97  ? 80.753  -75.775  -8.311  1.00 13.94  ? 141 TRP A CA   1 
ATOM   1404  C C    . TRP A 1 97  ? 81.979  -76.668  -8.119  1.00 16.88  ? 141 TRP A C    1 
ATOM   1405  O O    . TRP A 1 97  ? 82.734  -76.983  -9.041  1.00 14.99  ? 141 TRP A O    1 
ATOM   1406  C CB   . TRP A 1 97  ? 80.452  -75.481  -9.774  1.00 18.25  ? 141 TRP A CB   1 
ATOM   1407  C CG   . TRP A 1 97  ? 79.504  -74.330  -9.861  1.00 19.20  ? 141 TRP A CG   1 
ATOM   1408  C CD1  . TRP A 1 97  ? 79.781  -73.063  -10.286 1.00 14.18  ? 141 TRP A CD1  1 
ATOM   1409  C CD2  . TRP A 1 97  ? 78.133  -74.325  -9.450  1.00 13.05  ? 141 TRP A CD2  1 
ATOM   1410  N NE1  . TRP A 1 97  ? 78.661  -72.274  -10.182 1.00 20.65  ? 141 TRP A NE1  1 
ATOM   1411  C CE2  . TRP A 1 97  ? 77.635  -73.027  -9.673  1.00 23.89  ? 141 TRP A CE2  1 
ATOM   1412  C CE3  . TRP A 1 97  ? 77.275  -75.297  -8.926  1.00 13.71  ? 141 TRP A CE3  1 
ATOM   1413  C CZ2  . TRP A 1 97  ? 76.316  -72.676  -9.391  1.00 20.77  ? 141 TRP A CZ2  1 
ATOM   1414  C CZ3  . TRP A 1 97  ? 75.969  -74.948  -8.649  1.00 14.12  ? 141 TRP A CZ3  1 
ATOM   1415  C CH2  . TRP A 1 97  ? 75.501  -73.647  -8.881  1.00 13.60  ? 141 TRP A CH2  1 
ATOM   1416  H H    . TRP A 1 97  ? 81.287  -73.893  -8.076  1.00 27.46  ? 141 TRP A H    1 
ATOM   1417  H HA   . TRP A 1 97  ? 79.986  -76.237  -7.937  1.00 16.73  ? 141 TRP A HA   1 
ATOM   1418  H HB2  . TRP A 1 97  ? 81.272  -75.244  -10.235 1.00 21.90  ? 141 TRP A HB2  1 
ATOM   1419  H HB3  . TRP A 1 97  ? 80.039  -76.256  -10.185 1.00 21.90  ? 141 TRP A HB3  1 
ATOM   1420  H HD1  . TRP A 1 97  ? 80.608  -72.775  -10.600 1.00 17.01  ? 141 TRP A HD1  1 
ATOM   1421  H HE1  . TRP A 1 97  ? 78.611  -71.445  -10.404 1.00 24.78  ? 141 TRP A HE1  1 
ATOM   1422  H HE3  . TRP A 1 97  ? 77.579  -76.162  -8.768  1.00 16.46  ? 141 TRP A HE3  1 
ATOM   1423  H HZ2  . TRP A 1 97  ? 76.002  -71.815  -9.548  1.00 24.93  ? 141 TRP A HZ2  1 
ATOM   1424  H HZ3  . TRP A 1 97  ? 75.389  -75.586  -8.300  1.00 16.94  ? 141 TRP A HZ3  1 
ATOM   1425  H HH2  . TRP A 1 97  ? 74.615  -73.441  -8.686  1.00 16.32  ? 141 TRP A HH2  1 
ATOM   1426  N N    . GLN A 1 98  ? 82.155  -77.072  -6.863  1.00 21.55  ? 142 GLN A N    1 
ATOM   1427  C CA   . GLN A 1 98  ? 83.227  -77.966  -6.450  1.00 23.93  ? 142 GLN A CA   1 
ATOM   1428  C C    . GLN A 1 98  ? 82.611  -79.252  -5.915  1.00 20.28  ? 142 GLN A C    1 
ATOM   1429  O O    . GLN A 1 98  ? 81.509  -79.629  -6.325  1.00 27.88  ? 142 GLN A O    1 
ATOM   1430  C CB   . GLN A 1 98  ? 84.102  -77.284  -5.394  1.00 11.61  ? 142 GLN A CB   1 
ATOM   1431  C CG   . GLN A 1 98  ? 83.334  -76.847  -4.152  1.00 15.13  ? 142 GLN A CG   1 
ATOM   1432  C CD   . GLN A 1 98  ? 84.220  -76.200  -3.108  1.00 17.04  ? 142 GLN A CD   1 
ATOM   1433  O OE1  . GLN A 1 98  ? 84.559  -76.816  -2.098  1.00 26.26  ? 142 GLN A OE1  1 
ATOM   1434  N NE2  . GLN A 1 98  ? 84.598  -74.949  -3.344  1.00 20.88  ? 142 GLN A NE2  1 
ATOM   1435  H H    . GLN A 1 98  ? 81.647  -76.831  -6.213  1.00 25.86  ? 142 GLN A H    1 
ATOM   1436  H HA   . GLN A 1 98  ? 83.781  -78.184  -7.216  1.00 28.72  ? 142 GLN A HA   1 
ATOM   1437  H HB2  . GLN A 1 98  ? 84.793  -77.903  -5.113  1.00 13.93  ? 142 GLN A HB2  1 
ATOM   1438  H HB3  . GLN A 1 98  ? 84.507  -76.494  -5.786  1.00 13.93  ? 142 GLN A HB3  1 
ATOM   1439  H HG2  . GLN A 1 98  ? 82.656  -76.203  -4.410  1.00 18.15  ? 142 GLN A HG2  1 
ATOM   1440  H HG3  . GLN A 1 98  ? 82.916  -77.624  -3.750  1.00 18.15  ? 142 GLN A HG3  1 
ATOM   1441  H HE21 . GLN A 1 98  ? 84.339  -74.550  -4.060  1.00 25.05  ? 142 GLN A HE21 1 
ATOM   1442  H HE22 . GLN A 1 98  ? 85.102  -74.538  -2.781  1.00 25.05  ? 142 GLN A HE22 1 
ATOM   1443  N N    . THR A 1 99  ? 83.297  -79.933  -5.004  1.00 15.15  ? 143 THR A N    1 
ATOM   1444  C CA   . THR A 1 99  ? 82.699  -81.091  -4.359  1.00 20.12  ? 143 THR A CA   1 
ATOM   1445  C C    . THR A 1 99  ? 81.498  -80.661  -3.529  1.00 15.26  ? 143 THR A C    1 
ATOM   1446  O O    . THR A 1 99  ? 81.448  -79.553  -2.990  1.00 17.08  ? 143 THR A O    1 
ATOM   1447  C CB   . THR A 1 99  ? 83.719  -81.810  -3.474  1.00 25.01  ? 143 THR A CB   1 
ATOM   1448  O OG1  . THR A 1 99  ? 84.167  -80.929  -2.438  1.00 41.16  ? 143 THR A OG1  1 
ATOM   1449  C CG2  . THR A 1 99  ? 84.905  -82.269  -4.303  1.00 27.98  ? 143 THR A CG2  1 
ATOM   1450  H H    . THR A 1 99  ? 84.096  -79.748  -4.747  1.00 18.18  ? 143 THR A H    1 
ATOM   1451  H HA   . THR A 1 99  ? 82.393  -81.713  -5.037  1.00 24.15  ? 143 THR A HA   1 
ATOM   1452  H HB   . THR A 1 99  ? 83.304  -82.591  -3.075  1.00 30.02  ? 143 THR A HB   1 
ATOM   1453  H HG1  . THR A 1 99  ? 84.527  -80.249  -2.774  1.00 49.39  ? 143 THR A HG1  1 
ATOM   1454  H HG21 . THR A 1 99  ? 85.548  -82.724  -3.737  1.00 33.58  ? 143 THR A HG21 1 
ATOM   1455  H HG22 . THR A 1 99  ? 84.608  -82.880  -4.996  1.00 33.58  ? 143 THR A HG22 1 
ATOM   1456  H HG23 . THR A 1 99  ? 85.335  -81.506  -4.718  1.00 33.58  ? 143 THR A HG23 1 
ATOM   1457  N N    . GLY A 1 100 ? 80.521  -81.560  -3.429  1.00 16.87  ? 144 GLY A N    1 
ATOM   1458  C CA   . GLY A 1 100 ? 79.276  -81.253  -2.756  1.00 19.22  ? 144 GLY A CA   1 
ATOM   1459  C C    . GLY A 1 100 ? 79.391  -81.090  -1.258  1.00 20.11  ? 144 GLY A C    1 
ATOM   1460  O O    . GLY A 1 100 ? 78.444  -80.600  -0.633  1.00 19.03  ? 144 GLY A O    1 
ATOM   1461  H H    . GLY A 1 100 ? 80.561  -82.358  -3.747  1.00 20.25  ? 144 GLY A H    1 
ATOM   1462  H HA2  . GLY A 1 100 ? 78.915  -80.430  -3.121  1.00 23.07  ? 144 GLY A HA2  1 
ATOM   1463  H HA3  . GLY A 1 100 ? 78.639  -81.964  -2.932  1.00 23.07  ? 144 GLY A HA3  1 
ATOM   1464  N N    . SER A 1 101 ? 80.511  -81.499  -0.670  1.00 15.97  ? 145 SER A N    1 
ATOM   1465  C CA   . SER A 1 101 ? 80.753  -81.296  0.750   1.00 24.20  ? 145 SER A CA   1 
ATOM   1466  C C    . SER A 1 101 ? 81.455  -79.980  1.051   1.00 17.80  ? 145 SER A C    1 
ATOM   1467  O O    . SER A 1 101 ? 81.548  -79.599  2.222   1.00 26.25  ? 145 SER A O    1 
ATOM   1468  C CB   . SER A 1 101 ? 81.594  -82.448  1.306   1.00 24.36  ? 145 SER A CB   1 
ATOM   1469  O OG   . SER A 1 101 ? 82.826  -82.547  0.612   1.00 22.67  ? 145 SER A OG   1 
ATOM   1470  H H    . SER A 1 101 ? 81.153  -81.900  -1.078  1.00 19.17  ? 145 SER A H    1 
ATOM   1471  H HA   . SER A 1 101 ? 79.903  -81.295  1.217   1.00 29.05  ? 145 SER A HA   1 
ATOM   1472  H HB2  . SER A 1 101 ? 81.771  -82.286  2.245   1.00 29.23  ? 145 SER A HB2  1 
ATOM   1473  H HB3  . SER A 1 101 ? 81.103  -83.278  1.199   1.00 29.23  ? 145 SER A HB3  1 
ATOM   1474  H HG   . SER A 1 101 ? 83.281  -83.181  0.923   1.00 27.20  ? 145 SER A HG   1 
ATOM   1475  N N    . GLY A 1 102 ? 81.943  -79.279  0.030   1.00 13.89  ? 146 GLY A N    1 
ATOM   1476  C CA   . GLY A 1 102 ? 82.738  -78.091  0.248   1.00 17.56  ? 146 GLY A CA   1 
ATOM   1477  C C    . GLY A 1 102 ? 84.155  -78.363  0.694   1.00 19.50  ? 146 GLY A C    1 
ATOM   1478  O O    . GLY A 1 102 ? 84.786  -77.483  1.288   1.00 22.59  ? 146 GLY A O    1 
ATOM   1479  H H    . GLY A 1 102 ? 81.824  -79.477  -0.798  1.00 16.66  ? 146 GLY A H    1 
ATOM   1480  H HA2  . GLY A 1 102 ? 82.775  -77.579  -0.575  1.00 21.07  ? 146 GLY A HA2  1 
ATOM   1481  H HA3  . GLY A 1 102 ? 82.310  -77.543  0.925   1.00 21.07  ? 146 GLY A HA3  1 
ATOM   1482  N N    . THR A 1 103 ? 84.680  -79.559  0.419   1.00 18.87  ? 147 THR A N    1 
ATOM   1483  C CA   . THR A 1 103 ? 86.019  -79.917  0.877   1.00 24.01  ? 147 THR A CA   1 
ATOM   1484  C C    . THR A 1 103 ? 87.067  -78.932  0.372   1.00 14.90  ? 147 THR A C    1 
ATOM   1485  O O    . THR A 1 103 ? 87.968  -78.537  1.121   1.00 21.55  ? 147 THR A O    1 
ATOM   1486  C CB   . THR A 1 103 ? 86.361  -81.338  0.422   1.00 19.23  ? 147 THR A CB   1 
ATOM   1487  O OG1  . THR A 1 103 ? 85.373  -82.247  0.918   1.00 30.48  ? 147 THR A OG1  1 
ATOM   1488  C CG2  . THR A 1 103 ? 87.732  -81.763  0.931   1.00 22.92  ? 147 THR A CG2  1 
ATOM   1489  H H    . THR A 1 103 ? 84.283  -80.176  -0.030  1.00 22.64  ? 147 THR A H    1 
ATOM   1490  H HA   . THR A 1 103 ? 86.035  -79.901  1.847   1.00 28.81  ? 147 THR A HA   1 
ATOM   1491  H HB   . THR A 1 103 ? 86.371  -81.371  -0.548  1.00 23.08  ? 147 THR A HB   1 
ATOM   1492  H HG1  . THR A 1 103 ? 84.615  -82.037  0.623   1.00 36.58  ? 147 THR A HG1  1 
ATOM   1493  H HG21 . THR A 1 103 ? 87.931  -82.664  0.633   1.00 27.51  ? 147 THR A HG21 1 
ATOM   1494  H HG22 . THR A 1 103 ? 88.413  -81.161  0.592   1.00 27.51  ? 147 THR A HG22 1 
ATOM   1495  H HG23 . THR A 1 103 ? 87.747  -81.741  1.901   1.00 27.51  ? 147 THR A HG23 1 
ATOM   1496  N N    . GLN A 1 104 ? 86.972  -78.526  -0.895  1.00 16.70  ? 148 GLN A N    1 
ATOM   1497  C CA   . GLN A 1 104 ? 88.015  -77.684  -1.475  1.00 23.59  ? 148 GLN A CA   1 
ATOM   1498  C C    . GLN A 1 104 ? 88.107  -76.345  -0.755  1.00 22.44  ? 148 GLN A C    1 
ATOM   1499  O O    . GLN A 1 104 ? 89.207  -75.814  -0.555  1.00 17.61  ? 148 GLN A O    1 
ATOM   1500  C CB   . GLN A 1 104 ? 87.764  -77.471  -2.969  1.00 23.48  ? 148 GLN A CB   1 
ATOM   1501  C CG   . GLN A 1 104 ? 88.102  -78.669  -3.839  1.00 24.96  ? 148 GLN A CG   1 
ATOM   1502  C CD   . GLN A 1 104 ? 87.222  -79.866  -3.550  1.00 41.10  ? 148 GLN A CD   1 
ATOM   1503  O OE1  . GLN A 1 104 ? 86.031  -79.722  -3.267  1.00 39.02  ? 148 GLN A OE1  1 
ATOM   1504  N NE2  . GLN A 1 104 ? 87.806  -81.057  -3.608  1.00 32.74  ? 148 GLN A NE2  1 
ATOM   1505  H H    . GLN A 1 104 ? 86.327  -78.720  -1.430  1.00 20.05  ? 148 GLN A H    1 
ATOM   1506  H HA   . GLN A 1 104 ? 88.870  -78.133  -1.378  1.00 28.31  ? 148 GLN A HA   1 
ATOM   1507  H HB2  . GLN A 1 104 ? 86.824  -77.267  -3.099  1.00 28.18  ? 148 GLN A HB2  1 
ATOM   1508  H HB3  . GLN A 1 104 ? 88.305  -76.725  -3.271  1.00 28.18  ? 148 GLN A HB3  1 
ATOM   1509  H HG2  . GLN A 1 104 ? 87.984  -78.427  -4.770  1.00 29.95  ? 148 GLN A HG2  1 
ATOM   1510  H HG3  . GLN A 1 104 ? 89.023  -78.928  -3.677  1.00 29.95  ? 148 GLN A HG3  1 
ATOM   1511  H HE21 . GLN A 1 104 ? 88.642  -81.117  -3.801  1.00 39.29  ? 148 GLN A HE21 1 
ATOM   1512  H HE22 . GLN A 1 104 ? 87.349  -81.768  -3.451  1.00 39.29  ? 148 GLN A HE22 1 
ATOM   1513  N N    . THR A 1 105 ? 86.965  -75.783  -0.354  1.00 17.85  ? 149 THR A N    1 
ATOM   1514  C CA   . THR A 1 105 ? 86.987  -74.515  0.367   1.00 19.04  ? 149 THR A CA   1 
ATOM   1515  C C    . THR A 1 105 ? 87.504  -74.702  1.788   1.00 22.83  ? 149 THR A C    1 
ATOM   1516  O O    . THR A 1 105 ? 88.233  -73.847  2.305   1.00 12.86  ? 149 THR A O    1 
ATOM   1517  C CB   . THR A 1 105 ? 85.591  -73.890  0.369   1.00 17.63  ? 149 THR A CB   1 
ATOM   1518  O OG1  . THR A 1 105 ? 85.307  -73.360  -0.935  1.00 14.45  ? 149 THR A OG1  1 
ATOM   1519  C CG2  . THR A 1 105 ? 85.479  -72.761  1.401   1.00 18.75  ? 149 THR A CG2  1 
ATOM   1520  H H    . THR A 1 105 ? 86.181  -76.109  -0.486  1.00 21.42  ? 149 THR A H    1 
ATOM   1521  H HA   . THR A 1 105 ? 87.586  -73.904  -0.089  1.00 22.85  ? 149 THR A HA   1 
ATOM   1522  H HB   . THR A 1 105 ? 84.935  -74.570  0.589   1.00 21.16  ? 149 THR A HB   1 
ATOM   1523  H HG1  . THR A 1 105 ? 85.874  -72.774  -1.136  1.00 17.34  ? 149 THR A HG1  1 
ATOM   1524  H HG21 . THR A 1 105 ? 84.586  -72.382  1.382   1.00 22.51  ? 149 THR A HG21 1 
ATOM   1525  H HG22 . THR A 1 105 ? 85.656  -73.106  2.290   1.00 22.51  ? 149 THR A HG22 1 
ATOM   1526  H HG23 . THR A 1 105 ? 86.122  -72.063  1.200   1.00 22.51  ? 149 THR A HG23 1 
ATOM   1527  N N    . ASN A 1 106 ? 87.132  -75.805  2.440   1.00 14.65  ? 150 ASN A N    1 
ATOM   1528  C CA   . ASN A 1 106 ? 87.721  -76.119  3.736   1.00 25.25  ? 150 ASN A CA   1 
ATOM   1529  C C    . ASN A 1 106 ? 89.236  -76.220  3.626   1.00 23.23  ? 150 ASN A C    1 
ATOM   1530  O O    . ASN A 1 106 ? 89.966  -75.657  4.450   1.00 20.05  ? 150 ASN A O    1 
ATOM   1531  C CB   . ASN A 1 106 ? 87.136  -77.420  4.284   1.00 22.25  ? 150 ASN A CB   1 
ATOM   1532  C CG   . ASN A 1 106 ? 87.575  -77.703  5.707   1.00 21.43  ? 150 ASN A CG   1 
ATOM   1533  O OD1  . ASN A 1 106 ? 87.648  -76.798  6.538   1.00 14.11  ? 150 ASN A OD1  1 
ATOM   1534  N ND2  . ASN A 1 106 ? 87.878  -78.963  5.992   1.00 20.52  ? 150 ASN A ND2  1 
ATOM   1535  H H    . ASN A 1 106 ? 86.553  -76.375  2.158   1.00 17.58  ? 150 ASN A H    1 
ATOM   1536  H HA   . ASN A 1 106 ? 87.511  -75.407  4.361   1.00 30.31  ? 150 ASN A HA   1 
ATOM   1537  H HB2  . ASN A 1 106 ? 86.168  -77.361  4.274   1.00 26.70  ? 150 ASN A HB2  1 
ATOM   1538  H HB3  . ASN A 1 106 ? 87.429  -78.158  3.726   1.00 26.70  ? 150 ASN A HB3  1 
ATOM   1539  H HD21 . ASN A 1 106 ? 88.133  -79.174  6.786   1.00 24.62  ? 150 ASN A HD21 1 
ATOM   1540  H HD22 . ASN A 1 106 ? 87.820  -79.567  5.384   1.00 24.62  ? 150 ASN A HD22 1 
ATOM   1541  N N    . MET A 1 107 ? 89.727  -76.920  2.599   1.00 18.28  ? 151 MET A N    1 
ATOM   1542  C CA   . MET A 1 107 ? 91.164  -76.966  2.350   1.00 19.08  ? 151 MET A CA   1 
ATOM   1543  C C    . MET A 1 107 ? 91.705  -75.577  2.046   1.00 21.59  ? 151 MET A C    1 
ATOM   1544  O O    . MET A 1 107 ? 92.783  -75.202  2.523   1.00 25.74  ? 151 MET A O    1 
ATOM   1545  C CB   . MET A 1 107 ? 91.462  -77.914  1.190   1.00 18.68  ? 151 MET A CB   1 
ATOM   1546  C CG   . MET A 1 107 ? 91.151  -79.376  1.472   1.00 40.18  ? 151 MET A CG   1 
ATOM   1547  S SD   . MET A 1 107 ? 91.879  -80.490  0.247   1.00 55.36  ? 151 MET A SD   1 
ATOM   1548  C CE   . MET A 1 107 ? 91.516  -79.642  -1.293  1.00 47.80  ? 151 MET A CE   1 
ATOM   1549  H H    . MET A 1 107 ? 89.254  -77.371  2.041   1.00 21.94  ? 151 MET A H    1 
ATOM   1550  H HA   . MET A 1 107 ? 91.609  -77.311  3.140   1.00 22.90  ? 151 MET A HA   1 
ATOM   1551  H HB2  . MET A 1 107 ? 90.931  -77.643  0.425   1.00 22.42  ? 151 MET A HB2  1 
ATOM   1552  H HB3  . MET A 1 107 ? 92.405  -77.851  0.973   1.00 22.42  ? 151 MET A HB3  1 
ATOM   1553  H HG2  . MET A 1 107 ? 91.506  -79.613  2.343   1.00 48.22  ? 151 MET A HG2  1 
ATOM   1554  H HG3  . MET A 1 107 ? 90.189  -79.503  1.459   1.00 48.22  ? 151 MET A HG3  1 
ATOM   1555  H HE1  . MET A 1 107 ? 91.869  -80.163  -2.031  1.00 57.36  ? 151 MET A HE1  1 
ATOM   1556  H HE2  . MET A 1 107 ? 90.554  -79.550  -1.383  1.00 57.36  ? 151 MET A HE2  1 
ATOM   1557  H HE3  . MET A 1 107 ? 91.932  -78.766  -1.277  1.00 57.36  ? 151 MET A HE3  1 
ATOM   1558  N N    . ASN A 1 108 ? 90.968  -74.799  1.247   1.00 18.82  ? 152 ASN A N    1 
ATOM   1559  C CA   . ASN A 1 108 ? 91.367  -73.424  0.961   1.00 18.55  ? 152 ASN A CA   1 
ATOM   1560  C C    . ASN A 1 108 ? 91.548  -72.633  2.251   1.00 20.14  ? 152 ASN A C    1 
ATOM   1561  O O    . ASN A 1 108 ? 92.541  -71.913  2.417   1.00 13.18  ? 152 ASN A O    1 
ATOM   1562  C CB   . ASN A 1 108 ? 90.321  -72.764  0.062   1.00 21.52  ? 152 ASN A CB   1 
ATOM   1563  C CG   . ASN A 1 108 ? 90.825  -71.496  -0.628  1.00 16.99  ? 152 ASN A CG   1 
ATOM   1564  O OD1  . ASN A 1 108 ? 90.212  -71.047  -1.599  1.00 13.62  ? 152 ASN A OD1  1 
ATOM   1565  N ND2  . ASN A 1 108 ? 91.925  -70.920  -0.148  1.00 20.47  ? 152 ASN A ND2  1 
ATOM   1566  H H    . ASN A 1 108 ? 90.239  -75.045  0.862   1.00 22.59  ? 152 ASN A H    1 
ATOM   1567  H HA   . ASN A 1 108 ? 92.214  -73.430  0.488   1.00 22.26  ? 152 ASN A HA   1 
ATOM   1568  H HB2  . ASN A 1 108 ? 90.058  -73.394  -0.627  1.00 25.82  ? 152 ASN A HB2  1 
ATOM   1569  H HB3  . ASN A 1 108 ? 89.551  -72.524  0.601   1.00 25.82  ? 152 ASN A HB3  1 
ATOM   1570  H HD21 . ASN A 1 108 ? 92.232  -70.206  -0.516  1.00 24.56  ? 152 ASN A HD21 1 
ATOM   1571  H HD22 . ASN A 1 108 ? 92.329  -71.262  0.530   1.00 24.56  ? 152 ASN A HD22 1 
ATOM   1572  N N    . VAL A 1 109 ? 90.596  -72.755  3.176   1.00 13.91  ? 153 VAL A N    1 
ATOM   1573  C CA   . VAL A 1 109 ? 90.690  -72.047  4.448   1.00 16.84  ? 153 VAL A CA   1 
ATOM   1574  C C    . VAL A 1 109 ? 91.860  -72.575  5.273   1.00 29.79  ? 153 VAL A C    1 
ATOM   1575  O O    . VAL A 1 109 ? 92.605  -71.799  5.883   1.00 19.88  ? 153 VAL A O    1 
ATOM   1576  C CB   . VAL A 1 109 ? 89.357  -72.161  5.213   1.00 24.19  ? 153 VAL A CB   1 
ATOM   1577  C CG1  . VAL A 1 109 ? 89.501  -71.645  6.646   1.00 25.74  ? 153 VAL A CG1  1 
ATOM   1578  C CG2  . VAL A 1 109 ? 88.267  -71.394  4.478   1.00 21.84  ? 153 VAL A CG2  1 
ATOM   1579  H H    . VAL A 1 109 ? 89.890  -73.239  3.090   1.00 16.70  ? 153 VAL A H    1 
ATOM   1580  H HA   . VAL A 1 109 ? 90.851  -71.107  4.271   1.00 20.22  ? 153 VAL A HA   1 
ATOM   1581  H HB   . VAL A 1 109 ? 89.094  -73.093  5.254   1.00 29.04  ? 153 VAL A HB   1 
ATOM   1582  H HG11 . VAL A 1 109 ? 88.648  -71.730  7.099   1.00 30.89  ? 153 VAL A HG11 1 
ATOM   1583  H HG12 . VAL A 1 109 ? 90.174  -72.173  7.105   1.00 30.89  ? 153 VAL A HG12 1 
ATOM   1584  H HG13 . VAL A 1 109 ? 89.771  -70.714  6.621   1.00 30.89  ? 153 VAL A HG13 1 
ATOM   1585  H HG21 . VAL A 1 109 ? 87.436  -71.476  4.972   1.00 26.21  ? 153 VAL A HG21 1 
ATOM   1586  H HG22 . VAL A 1 109 ? 88.525  -70.461  4.415   1.00 26.21  ? 153 VAL A HG22 1 
ATOM   1587  H HG23 . VAL A 1 109 ? 88.162  -71.770  3.589   1.00 26.21  ? 153 VAL A HG23 1 
ATOM   1588  N N    . ASN A 1 110 ? 92.038  -73.898  5.313   1.00 16.58  ? 154 ASN A N    1 
ATOM   1589  C CA   . ASN A 1 110 ? 93.124  -74.473  6.100   1.00 20.81  ? 154 ASN A CA   1 
ATOM   1590  C C    . ASN A 1 110 ? 94.485  -74.050  5.558   1.00 21.25  ? 154 ASN A C    1 
ATOM   1591  O O    . ASN A 1 110 ? 95.402  -73.746  6.330   1.00 26.33  ? 154 ASN A O    1 
ATOM   1592  C CB   . ASN A 1 110 ? 93.008  -75.996  6.123   1.00 27.68  ? 154 ASN A CB   1 
ATOM   1593  C CG   . ASN A 1 110 ? 91.819  -76.481  6.930   1.00 22.48  ? 154 ASN A CG   1 
ATOM   1594  O OD1  . ASN A 1 110 ? 91.355  -75.802  7.845   1.00 18.91  ? 154 ASN A OD1  1 
ATOM   1595  N ND2  . ASN A 1 110 ? 91.323  -77.666  6.596   1.00 24.74  ? 154 ASN A ND2  1 
ATOM   1596  H H    . ASN A 1 110 ? 91.551  -74.474  4.900   1.00 19.90  ? 154 ASN A H    1 
ATOM   1597  H HA   . ASN A 1 110 ? 93.054  -74.154  7.014   1.00 24.98  ? 154 ASN A HA   1 
ATOM   1598  H HB2  . ASN A 1 110 ? 92.905  -76.319  5.214   1.00 33.22  ? 154 ASN A HB2  1 
ATOM   1599  H HB3  . ASN A 1 110 ? 93.811  -76.369  6.519   1.00 33.22  ? 154 ASN A HB3  1 
ATOM   1600  H HD21 . ASN A 1 110 ? 90.648  -77.986  7.023   1.00 29.69  ? 154 ASN A HD21 1 
ATOM   1601  H HD22 . ASN A 1 110 ? 91.676  -78.114  5.952   1.00 29.69  ? 154 ASN A HD22 1 
ATOM   1602  N N    . GLU A 1 111 ? 94.636  -74.023  4.234   1.00 20.80  ? 155 GLU A N    1 
ATOM   1603  C CA   . GLU A 1 111 ? 95.902  -73.597  3.645   1.00 31.06  ? 155 GLU A CA   1 
ATOM   1604  C C    . GLU A 1 111 ? 96.173  -72.124  3.920   1.00 29.21  ? 155 GLU A C    1 
ATOM   1605  O O    . GLU A 1 111 ? 97.295  -71.750  4.282   1.00 26.82  ? 155 GLU A O    1 
ATOM   1606  C CB   . GLU A 1 111 ? 95.897  -73.867  2.141   1.00 23.20  ? 155 GLU A CB   1 
ATOM   1607  C CG   . GLU A 1 111 ? 95.934  -75.342  1.779   1.00 18.66  ? 155 GLU A CG   1 
ATOM   1608  C CD   . GLU A 1 111 ? 96.024  -75.573  0.282   1.00 21.61  ? 155 GLU A CD   1 
ATOM   1609  O OE1  . GLU A 1 111 ? 95.540  -74.714  -0.485  1.00 27.23  ? 155 GLU A OE1  1 
ATOM   1610  O OE2  . GLU A 1 111 ? 96.589  -76.609  -0.126  1.00 25.18  ? 155 GLU A OE2  1 
ATOM   1611  H H    . GLU A 1 111 ? 94.031  -74.243  3.664   1.00 24.96  ? 155 GLU A H    1 
ATOM   1612  H HA   . GLU A 1 111 ? 96.622  -74.113  4.039   1.00 37.27  ? 155 GLU A HA   1 
ATOM   1613  H HB2  . GLU A 1 111 ? 95.090  -73.489  1.758   1.00 27.84  ? 155 GLU A HB2  1 
ATOM   1614  H HB3  . GLU A 1 111 ? 96.676  -73.446  1.745   1.00 27.84  ? 155 GLU A HB3  1 
ATOM   1615  H HG2  . GLU A 1 111 ? 96.710  -75.750  2.193   1.00 22.39  ? 155 GLU A HG2  1 
ATOM   1616  H HG3  . GLU A 1 111 ? 95.123  -75.767  2.100   1.00 22.39  ? 155 GLU A HG3  1 
ATOM   1617  N N    . VAL A 1 112 ? 95.158  -71.273  3.760   1.00 23.52  ? 156 VAL A N    1 
ATOM   1618  C CA   . VAL A 1 112 ? 95.352  -69.838  3.943   1.00 26.41  ? 156 VAL A CA   1 
ATOM   1619  C C    . VAL A 1 112 ? 95.671  -69.519  5.398   1.00 19.08  ? 156 VAL A C    1 
ATOM   1620  O O    . VAL A 1 112 ? 96.528  -68.676  5.690   1.00 22.64  ? 156 VAL A O    1 
ATOM   1621  C CB   . VAL A 1 112 ? 94.110  -69.075  3.445   1.00 21.93  ? 156 VAL A CB   1 
ATOM   1622  C CG1  . VAL A 1 112 ? 94.111  -67.629  3.930   1.00 20.53  ? 156 VAL A CG1  1 
ATOM   1623  C CG2  . VAL A 1 112 ? 94.051  -69.112  1.926   1.00 17.30  ? 156 VAL A CG2  1 
ATOM   1624  H H    . VAL A 1 112 ? 94.356  -71.500  3.547   1.00 28.23  ? 156 VAL A H    1 
ATOM   1625  H HA   . VAL A 1 112 ? 96.109  -69.554  3.405   1.00 31.70  ? 156 VAL A HA   1 
ATOM   1626  H HB   . VAL A 1 112 ? 93.313  -69.507  3.789   1.00 26.32  ? 156 VAL A HB   1 
ATOM   1627  H HG11 . VAL A 1 112 ? 93.316  -67.184  3.597   1.00 24.64  ? 156 VAL A HG11 1 
ATOM   1628  H HG12 . VAL A 1 112 ? 94.114  -67.622  4.900   1.00 24.64  ? 156 VAL A HG12 1 
ATOM   1629  H HG13 . VAL A 1 112 ? 94.905  -67.185  3.593   1.00 24.64  ? 156 VAL A HG13 1 
ATOM   1630  H HG21 . VAL A 1 112 ? 93.264  -68.628  1.629   1.00 20.76  ? 156 VAL A HG21 1 
ATOM   1631  H HG22 . VAL A 1 112 ? 94.851  -68.696  1.569   1.00 20.76  ? 156 VAL A HG22 1 
ATOM   1632  H HG23 . VAL A 1 112 ? 94.001  -70.036  1.635   1.00 20.76  ? 156 VAL A HG23 1 
ATOM   1633  N N    . ILE A 1 113 ? 94.992  -70.184  6.334   1.00 18.39  ? 157 ILE A N    1 
ATOM   1634  C CA   . ILE A 1 113 ? 95.197  -69.887  7.748   1.00 21.44  ? 157 ILE A CA   1 
ATOM   1635  C C    . ILE A 1 113 ? 96.572  -70.363  8.204   1.00 28.93  ? 157 ILE A C    1 
ATOM   1636  O O    . ILE A 1 113 ? 97.229  -69.707  9.021   1.00 24.56  ? 157 ILE A O    1 
ATOM   1637  C CB   . ILE A 1 113 ? 94.065  -70.505  8.591   1.00 23.02  ? 157 ILE A CB   1 
ATOM   1638  C CG1  . ILE A 1 113 ? 92.774  -69.704  8.391   1.00 25.05  ? 157 ILE A CG1  1 
ATOM   1639  C CG2  . ILE A 1 113 ? 94.440  -70.547  10.076  1.00 27.05  ? 157 ILE A CG2  1 
ATOM   1640  C CD1  . ILE A 1 113 ? 91.559  -70.280  9.095   1.00 24.75  ? 157 ILE A CD1  1 
ATOM   1641  H H    . ILE A 1 113 ? 94.415  -70.802  6.178   1.00 22.07  ? 157 ILE A H    1 
ATOM   1642  H HA   . ILE A 1 113 ? 95.164  -68.925  7.871   1.00 25.73  ? 157 ILE A HA   1 
ATOM   1643  H HB   . ILE A 1 113 ? 93.914  -71.413  8.285   1.00 27.63  ? 157 ILE A HB   1 
ATOM   1644  H HG12 . ILE A 1 113 ? 92.911  -68.806  8.730   1.00 30.07  ? 157 ILE A HG12 1 
ATOM   1645  H HG13 . ILE A 1 113 ? 92.575  -69.669  7.443   1.00 30.07  ? 157 ILE A HG13 1 
ATOM   1646  H HG21 . ILE A 1 113 ? 93.707  -70.940  10.575  1.00 32.46  ? 157 ILE A HG21 1 
ATOM   1647  H HG22 . ILE A 1 113 ? 95.241  -71.083  10.184  1.00 32.46  ? 157 ILE A HG22 1 
ATOM   1648  H HG23 . ILE A 1 113 ? 94.603  -69.642  10.385  1.00 32.46  ? 157 ILE A HG23 1 
ATOM   1649  H HD11 . ILE A 1 113 ? 90.793  -69.713  8.915   1.00 29.70  ? 157 ILE A HD11 1 
ATOM   1650  H HD12 . ILE A 1 113 ? 91.395  -71.175  8.759   1.00 29.70  ? 157 ILE A HD12 1 
ATOM   1651  H HD13 . ILE A 1 113 ? 91.732  -70.311  10.049  1.00 29.70  ? 157 ILE A HD13 1 
ATOM   1652  N N    . SER A 1 114 ? 97.032  -71.507  7.693   1.00 17.74  ? 158 SER A N    1 
ATOM   1653  C CA   . SER A 1 114 ? 98.339  -72.013  8.099   1.00 35.26  ? 158 SER A CA   1 
ATOM   1654  C C    . SER A 1 114 ? 99.458  -71.147  7.533   1.00 26.66  ? 158 SER A C    1 
ATOM   1655  O O    . SER A 1 114 ? 100.377 -70.754  8.259   1.00 30.25  ? 158 SER A O    1 
ATOM   1656  C CB   . SER A 1 114 ? 98.513  -73.467  7.657   1.00 24.96  ? 158 SER A CB   1 
ATOM   1657  O OG   . SER A 1 114 ? 98.625  -73.565  6.251   1.00 43.48  ? 158 SER A OG   1 
ATOM   1658  H H    . SER A 1 114 ? 96.616  -71.997  7.122   1.00 21.30  ? 158 SER A H    1 
ATOM   1659  H HA   . SER A 1 114 ? 98.401  -71.985  9.067   1.00 42.31  ? 158 SER A HA   1 
ATOM   1660  H HB2  . SER A 1 114 ? 99.318  -73.826  8.063   1.00 29.95  ? 158 SER A HB2  1 
ATOM   1661  H HB3  . SER A 1 114 ? 97.741  -73.978  7.947   1.00 29.95  ? 158 SER A HB3  1 
ATOM   1662  H HG   . SER A 1 114 ? 97.934  -73.258  5.886   1.00 52.17  ? 158 SER A HG   1 
ATOM   1663  N N    . ASN A 1 115 ? 99.393  -70.829  6.238   1.00 18.73  ? 159 ASN A N    1 
ATOM   1664  C CA   . ASN A 1 115 ? 100.446 -70.022  5.631   1.00 26.64  ? 159 ASN A CA   1 
ATOM   1665  C C    . ASN A 1 115 ? 100.504 -68.635  6.258   1.00 34.30  ? 159 ASN A C    1 
ATOM   1666  O O    . ASN A 1 115 ? 101.593 -68.092  6.478   1.00 25.69  ? 159 ASN A O    1 
ATOM   1667  C CB   . ASN A 1 115 ? 100.234 -69.925  4.120   1.00 21.73  ? 159 ASN A CB   1 
ATOM   1668  C CG   . ASN A 1 115 ? 100.791 -71.125  3.376   1.00 27.56  ? 159 ASN A CG   1 
ATOM   1669  O OD1  . ASN A 1 115 ? 101.771 -71.736  3.805   1.00 25.02  ? 159 ASN A OD1  1 
ATOM   1670  N ND2  . ASN A 1 115 ? 100.170 -71.467  2.254   1.00 23.76  ? 159 ASN A ND2  1 
ATOM   1671  H H    . ASN A 1 115 ? 98.763  -71.064  5.702   1.00 22.47  ? 159 ASN A H    1 
ATOM   1672  H HA   . ASN A 1 115 ? 101.300 -70.454  5.785   1.00 31.97  ? 159 ASN A HA   1 
ATOM   1673  H HB2  . ASN A 1 115 ? 99.284  -69.872  3.936   1.00 26.07  ? 159 ASN A HB2  1 
ATOM   1674  H HB3  . ASN A 1 115 ? 100.682 -69.132  3.788   1.00 26.07  ? 159 ASN A HB3  1 
ATOM   1675  H HD21 . ASN A 1 115 ? 100.448 -72.141  1.797   1.00 28.52  ? 159 ASN A HD21 1 
ATOM   1676  H HD22 . ASN A 1 115 ? 99.490  -71.016  1.984   1.00 28.52  ? 159 ASN A HD22 1 
ATOM   1677  N N    . ARG A 1 116 ? 99.345  -68.044  6.556   1.00 33.99  ? 160 ARG A N    1 
ATOM   1678  C CA   . ARG A 1 116 ? 99.337  -66.763  7.252   1.00 26.14  ? 160 ARG A CA   1 
ATOM   1679  C C    . ARG A 1 116 ? 99.899  -66.910  8.660   1.00 25.78  ? 160 ARG A C    1 
ATOM   1680  O O    . ARG A 1 116 ? 100.734 -66.108  9.093   1.00 26.41  ? 160 ARG A O    1 
ATOM   1681  C CB   . ARG A 1 116 ? 97.919  -66.191  7.297   1.00 27.10  ? 160 ARG A CB   1 
ATOM   1682  C CG   . ARG A 1 116 ? 97.809  -64.850  8.019   1.00 27.37  ? 160 ARG A CG   1 
ATOM   1683  C CD   . ARG A 1 116 ? 98.562  -63.744  7.290   1.00 35.47  ? 160 ARG A CD   1 
ATOM   1684  N NE   . ARG A 1 116 ? 98.508  -62.476  8.017   1.00 37.20  ? 160 ARG A NE   1 
ATOM   1685  C CZ   . ARG A 1 116 ? 99.556  -61.822  8.517   1.00 48.01  ? 160 ARG A CZ   1 
ATOM   1686  N NH1  . ARG A 1 116 ? 100.791 -62.284  8.372   1.00 37.26  ? 160 ARG A NH1  1 
ATOM   1687  N NH2  . ARG A 1 116 ? 99.365  -60.679  9.163   1.00 33.88  ? 160 ARG A NH2  1 
ATOM   1688  H H    . ARG A 1 116 ? 98.567  -68.360  6.370   1.00 40.79  ? 160 ARG A H    1 
ATOM   1689  H HA   . ARG A 1 116 ? 99.898  -66.136  6.768   1.00 31.37  ? 160 ARG A HA   1 
ATOM   1690  H HB2  . ARG A 1 116 ? 97.606  -66.064  6.388   1.00 32.52  ? 160 ARG A HB2  1 
ATOM   1691  H HB3  . ARG A 1 116 ? 97.344  -66.822  7.756   1.00 32.52  ? 160 ARG A HB3  1 
ATOM   1692  H HG2  . ARG A 1 116 ? 96.875  -64.594  8.074   1.00 32.85  ? 160 ARG A HG2  1 
ATOM   1693  H HG3  . ARG A 1 116 ? 98.184  -64.936  8.910   1.00 32.85  ? 160 ARG A HG3  1 
ATOM   1694  H HD2  . ARG A 1 116 ? 99.493  -64.001  7.198   1.00 42.57  ? 160 ARG A HD2  1 
ATOM   1695  H HD3  . ARG A 1 116 ? 98.164  -63.609  6.416   1.00 42.57  ? 160 ARG A HD3  1 
ATOM   1696  H HE   . ARG A 1 116 ? 97.733  -62.122  8.132   1.00 44.64  ? 160 ARG A HE   1 
ATOM   1697  H HH11 . ARG A 1 116 ? 100.928 -63.024  7.956   1.00 44.72  ? 160 ARG A HH11 1 
ATOM   1698  H HH12 . ARG A 1 116 ? 101.455 -61.846  8.699   1.00 44.72  ? 160 ARG A HH12 1 
ATOM   1699  H HH21 . ARG A 1 116 ? 98.569  -60.368  9.260   1.00 40.66  ? 160 ARG A HH21 1 
ATOM   1700  H HH22 . ARG A 1 116 ? 100.037 -60.249  9.483   1.00 40.66  ? 160 ARG A HH22 1 
ATOM   1701  N N    . ALA A 1 117 ? 99.448  -67.931  9.392   1.00 27.34  ? 161 ALA A N    1 
ATOM   1702  C CA   . ALA A 1 117 ? 99.983  -68.175  10.726  1.00 25.60  ? 161 ALA A CA   1 
ATOM   1703  C C    . ALA A 1 117 ? 101.479 -68.460  10.669  1.00 29.95  ? 161 ALA A C    1 
ATOM   1704  O O    . ALA A 1 117 ? 102.244 -67.981  11.514  1.00 25.23  ? 161 ALA A O    1 
ATOM   1705  C CB   . ALA A 1 117 ? 99.238  -69.335  11.384  1.00 26.49  ? 161 ALA A CB   1 
ATOM   1706  H H    . ALA A 1 117 ? 98.842  -68.487  9.141   1.00 32.81  ? 161 ALA A H    1 
ATOM   1707  H HA   . ALA A 1 117 ? 99.849  -67.384  11.271  1.00 30.72  ? 161 ALA A HA   1 
ATOM   1708  H HB1  . ALA A 1 117 ? 99.605  -69.485  12.269  1.00 31.79  ? 161 ALA A HB1  1 
ATOM   1709  H HB2  . ALA A 1 117 ? 98.297  -69.108  11.450  1.00 31.79  ? 161 ALA A HB2  1 
ATOM   1710  H HB3  . ALA A 1 117 ? 99.349  -70.131  10.841  1.00 31.79  ? 161 ALA A HB3  1 
ATOM   1711  N N    . ILE A 1 118 ? 101.912 -69.243  9.678   1.00 29.72  ? 162 ILE A N    1 
ATOM   1712  C CA   . ILE A 1 118 ? 103.339 -69.475  9.474   1.00 30.03  ? 162 ILE A CA   1 
ATOM   1713  C C    . ILE A 1 118 ? 104.069 -68.146  9.321   1.00 36.30  ? 162 ILE A C    1 
ATOM   1714  O O    . ILE A 1 118 ? 105.124 -67.920  9.926   1.00 27.05  ? 162 ILE A O    1 
ATOM   1715  C CB   . ILE A 1 118 ? 103.558 -70.388  8.253   1.00 31.19  ? 162 ILE A CB   1 
ATOM   1716  C CG1  . ILE A 1 118 ? 103.178 -71.830  8.603   1.00 23.14  ? 162 ILE A CG1  1 
ATOM   1717  C CG2  . ILE A 1 118 ? 105.008 -70.331  7.770   1.00 29.47  ? 162 ILE A CG2  1 
ATOM   1718  C CD1  . ILE A 1 118 ? 103.041 -72.744  7.401   1.00 27.44  ? 162 ILE A CD1  1 
ATOM   1719  H H    . ILE A 1 118 ? 101.402 -69.647  9.115   1.00 35.66  ? 162 ILE A H    1 
ATOM   1720  H HA   . ILE A 1 118 ? 103.700 -69.926  10.253  1.00 36.03  ? 162 ILE A HA   1 
ATOM   1721  H HB   . ILE A 1 118 ? 102.983 -70.084  7.534   1.00 37.43  ? 162 ILE A HB   1 
ATOM   1722  H HG12 . ILE A 1 118 ? 103.864 -72.201  9.180   1.00 27.77  ? 162 ILE A HG12 1 
ATOM   1723  H HG13 . ILE A 1 118 ? 102.327 -71.823  9.068   1.00 27.77  ? 162 ILE A HG13 1 
ATOM   1724  H HG21 . ILE A 1 118 ? 105.108 -70.916  7.003   1.00 35.36  ? 162 ILE A HG21 1 
ATOM   1725  H HG22 . ILE A 1 118 ? 105.222 -69.418  7.521   1.00 35.36  ? 162 ILE A HG22 1 
ATOM   1726  H HG23 . ILE A 1 118 ? 105.591 -70.623  8.489   1.00 35.36  ? 162 ILE A HG23 1 
ATOM   1727  H HD11 . ILE A 1 118 ? 102.800 -73.632  7.707   1.00 32.93  ? 162 ILE A HD11 1 
ATOM   1728  H HD12 . ILE A 1 118 ? 102.349 -72.395  6.818   1.00 32.93  ? 162 ILE A HD12 1 
ATOM   1729  H HD13 . ILE A 1 118 ? 103.888 -72.774  6.930   1.00 32.93  ? 162 ILE A HD13 1 
ATOM   1730  N N    . GLU A 1 119 ? 103.511 -67.245  8.511   1.00 35.84  ? 163 GLU A N    1 
ATOM   1731  C CA   . GLU A 1 119 ? 104.126 -65.936  8.319   1.00 27.87  ? 163 GLU A CA   1 
ATOM   1732  C C    . GLU A 1 119 ? 104.212 -65.173  9.635   1.00 39.43  ? 163 GLU A C    1 
ATOM   1733  O O    . GLU A 1 119 ? 105.243 -64.566  9.945   1.00 36.40  ? 163 GLU A O    1 
ATOM   1734  C CB   . GLU A 1 119 ? 103.333 -65.140  7.284   1.00 32.61  ? 163 GLU A CB   1 
ATOM   1735  C CG   . GLU A 1 119 ? 103.996 -63.851  6.844   1.00 32.04  ? 163 GLU A CG   1 
ATOM   1736  C CD   . GLU A 1 119 ? 103.204 -63.132  5.770   1.00 22.62  ? 163 GLU A CD   1 
ATOM   1737  O OE1  . GLU A 1 119 ? 101.995 -62.893  5.982   1.00 34.75  ? 163 GLU A OE1  1 
ATOM   1738  O OE2  . GLU A 1 119 ? 103.785 -62.814  4.712   1.00 39.09  ? 163 GLU A OE2  1 
ATOM   1739  H H    . GLU A 1 119 ? 102.785 -67.367  8.066   1.00 43.01  ? 163 GLU A H    1 
ATOM   1740  H HA   . GLU A 1 119 ? 105.028 -66.056  7.981   1.00 33.45  ? 163 GLU A HA   1 
ATOM   1741  H HB2  . GLU A 1 119 ? 103.209 -65.692  6.496   1.00 39.14  ? 163 GLU A HB2  1 
ATOM   1742  H HB3  . GLU A 1 119 ? 102.469 -64.913  7.663   1.00 39.14  ? 163 GLU A HB3  1 
ATOM   1743  H HG2  . GLU A 1 119 ? 104.076 -63.258  7.608   1.00 38.45  ? 163 GLU A HG2  1 
ATOM   1744  H HG3  . GLU A 1 119 ? 104.875 -64.052  6.486   1.00 38.45  ? 163 GLU A HG3  1 
ATOM   1745  N N    . MET A 1 120 ? 103.136 -65.195  10.426  1.00 33.62  ? 164 MET A N    1 
ATOM   1746  C CA   . MET A 1 120 ? 103.156 -64.529  11.723  1.00 37.28  ? 164 MET A CA   1 
ATOM   1747  C C    . MET A 1 120 ? 104.272 -65.062  12.609  1.00 34.48  ? 164 MET A C    1 
ATOM   1748  O O    . MET A 1 120 ? 104.815 -64.320  13.436  1.00 32.37  ? 164 MET A O    1 
ATOM   1749  C CB   . MET A 1 120 ? 101.806 -64.703  12.420  1.00 34.80  ? 164 MET A CB   1 
ATOM   1750  C CG   . MET A 1 120 ? 100.637 -64.063  11.692  1.00 33.35  ? 164 MET A CG   1 
ATOM   1751  S SD   . MET A 1 120 ? 99.059  -64.393  12.500  1.00 37.74  ? 164 MET A SD   1 
ATOM   1752  C CE   . MET A 1 120 ? 97.986  -63.271  11.607  1.00 42.25  ? 164 MET A CE   1 
ATOM   1753  H H    . MET A 1 120 ? 102.394 -65.585  10.235  1.00 40.35  ? 164 MET A H    1 
ATOM   1754  H HA   . MET A 1 120 ? 103.296 -63.579  11.583  1.00 44.74  ? 164 MET A HA   1 
ATOM   1755  H HB2  . MET A 1 120 ? 101.619 -65.652  12.502  1.00 41.77  ? 164 MET A HB2  1 
ATOM   1756  H HB3  . MET A 1 120 ? 101.858 -64.303  13.302  1.00 41.77  ? 164 MET A HB3  1 
ATOM   1757  H HG2  . MET A 1 120 ? 100.767 -63.102  11.666  1.00 40.03  ? 164 MET A HG2  1 
ATOM   1758  H HG3  . MET A 1 120 ? 100.593 -64.418  10.790  1.00 40.03  ? 164 MET A HG3  1 
ATOM   1759  H HE1  . MET A 1 120 ? 97.084  -63.353  11.955  1.00 50.70  ? 164 MET A HE1  1 
ATOM   1760  H HE2  . MET A 1 120 ? 98.307  -62.364  11.729  1.00 50.70  ? 164 MET A HE2  1 
ATOM   1761  H HE3  . MET A 1 120 ? 98.000  -63.503  10.666  1.00 50.70  ? 164 MET A HE3  1 
ATOM   1762  N N    . LEU A 1 121 ? 104.627 -66.337  12.457  1.00 38.33  ? 165 LEU A N    1 
ATOM   1763  C CA   . LEU A 1 121 ? 105.633 -66.979  13.291  1.00 34.07  ? 165 LEU A CA   1 
ATOM   1764  C C    . LEU A 1 121 ? 107.011 -67.001  12.640  1.00 31.80  ? 165 LEU A C    1 
ATOM   1765  O O    . LEU A 1 121 ? 107.921 -67.653  13.163  1.00 28.98  ? 165 LEU A O    1 
ATOM   1766  C CB   . LEU A 1 121 ? 105.192 -68.404  13.634  1.00 26.57  ? 165 LEU A CB   1 
ATOM   1767  C CG   . LEU A 1 121 ? 103.880 -68.533  14.412  1.00 33.75  ? 165 LEU A CG   1 
ATOM   1768  C CD1  . LEU A 1 121 ? 103.493 -69.992  14.575  1.00 27.11  ? 165 LEU A CD1  1 
ATOM   1769  C CD2  . LEU A 1 121 ? 103.984 -67.867  15.772  1.00 31.75  ? 165 LEU A CD2  1 
ATOM   1770  H H    . LEU A 1 121 ? 104.289 -66.860  11.863  1.00 46.00  ? 165 LEU A H    1 
ATOM   1771  H HA   . LEU A 1 121 ? 105.708 -66.485  14.122  1.00 40.89  ? 165 LEU A HA   1 
ATOM   1772  H HB2  . LEU A 1 121 ? 105.087 -68.898  12.806  1.00 31.89  ? 165 LEU A HB2  1 
ATOM   1773  H HB3  . LEU A 1 121 ? 105.888 -68.818  14.169  1.00 31.89  ? 165 LEU A HB3  1 
ATOM   1774  H HG   . LEU A 1 121 ? 103.174 -68.090  13.916  1.00 40.51  ? 165 LEU A HG   1 
ATOM   1775  H HD11 . LEU A 1 121 ? 102.661 -70.044  15.070  1.00 32.53  ? 165 LEU A HD11 1 
ATOM   1776  H HD12 . LEU A 1 121 ? 103.381 -70.388  13.697  1.00 32.53  ? 165 LEU A HD12 1 
ATOM   1777  H HD13 . LEU A 1 121 ? 104.196 -70.453  15.060  1.00 32.53  ? 165 LEU A HD13 1 
ATOM   1778  H HD21 . LEU A 1 121 ? 103.138 -67.966  16.238  1.00 38.10  ? 165 LEU A HD21 1 
ATOM   1779  H HD22 . LEU A 1 121 ? 104.693 -68.292  16.279  1.00 38.10  ? 165 LEU A HD22 1 
ATOM   1780  H HD23 . LEU A 1 121 ? 104.184 -66.926  15.648  1.00 38.10  ? 165 LEU A HD23 1 
ATOM   1781  N N    . GLY A 1 122 ? 107.186 -66.306  11.519  1.00 35.46  ? 166 GLY A N    1 
ATOM   1782  C CA   . GLY A 1 122 ? 108.487 -66.217  10.887  1.00 35.97  ? 166 GLY A CA   1 
ATOM   1783  C C    . GLY A 1 122 ? 108.900 -67.433  10.094  1.00 31.36  ? 166 GLY A C    1 
ATOM   1784  O O    . GLY A 1 122 ? 110.095 -67.618  9.847   1.00 36.82  ? 166 GLY A O    1 
ATOM   1785  H H    . GLY A 1 122 ? 106.564 -65.879  11.108  1.00 42.56  ? 166 GLY A H    1 
ATOM   1786  H HA2  . GLY A 1 122 ? 108.492 -65.454  10.288  1.00 43.16  ? 166 GLY A HA2  1 
ATOM   1787  H HA3  . GLY A 1 122 ? 109.158 -66.065  11.571  1.00 43.16  ? 166 GLY A HA3  1 
ATOM   1788  N N    . GLY A 1 123 ? 107.948 -68.270  9.680   1.00 37.21  ? 167 GLY A N    1 
ATOM   1789  C CA   . GLY A 1 123 ? 108.259 -69.452  8.909   1.00 25.82  ? 167 GLY A CA   1 
ATOM   1790  C C    . GLY A 1 123 ? 108.194 -69.202  7.413   1.00 22.08  ? 167 GLY A C    1 
ATOM   1791  O O    . GLY A 1 123 ? 107.946 -68.093  6.942   1.00 36.32  ? 167 GLY A O    1 
ATOM   1792  H H    . GLY A 1 123 ? 107.109 -68.167  9.840   1.00 44.65  ? 167 GLY A H    1 
ATOM   1793  H HA2  . GLY A 1 123 ? 109.153 -69.757  9.130   1.00 30.98  ? 167 GLY A HA2  1 
ATOM   1794  H HA3  . GLY A 1 123 ? 107.631 -70.157  9.130   1.00 30.98  ? 167 GLY A HA3  1 
ATOM   1795  N N    . GLU A 1 124 ? 108.423 -70.273  6.660   0.94 26.16  ? 168 GLU A N    1 
ATOM   1796  C CA   . GLU A 1 124 ? 108.439 -70.227  5.204   0.94 34.27  ? 168 GLU A CA   1 
ATOM   1797  C C    . GLU A 1 124 ? 107.076 -70.646  4.670   0.94 36.12  ? 168 GLU A C    1 
ATOM   1798  O O    . GLU A 1 124 ? 106.538 -71.682  5.075   0.94 32.83  ? 168 GLU A O    1 
ATOM   1799  C CB   . GLU A 1 124 ? 109.529 -71.143  4.644   0.94 35.35  ? 168 GLU A CB   1 
ATOM   1800  C CG   . GLU A 1 124 ? 109.906 -70.857  3.200   0.94 51.96  ? 168 GLU A CG   1 
ATOM   1801  C CD   . GLU A 1 124 ? 110.710 -69.579  3.048   0.94 75.66  ? 168 GLU A CD   1 
ATOM   1802  O OE1  . GLU A 1 124 ? 111.015 -68.938  4.077   0.94 64.97  ? 168 GLU A OE1  1 
ATOM   1803  O OE2  . GLU A 1 124 ? 111.039 -69.216  1.899   0.94 71.56  ? 168 GLU A OE2  1 
ATOM   1804  H H    . GLU A 1 124 ? 108.576 -71.057  6.978   0.94 31.39  ? 168 GLU A H    1 
ATOM   1805  H HA   . GLU A 1 124 ? 108.619 -69.320  4.911   0.94 41.12  ? 168 GLU A HA   1 
ATOM   1806  H HB2  . GLU A 1 124 ? 110.329 -71.041  5.184   0.94 42.42  ? 168 GLU A HB2  1 
ATOM   1807  H HB3  . GLU A 1 124 ? 109.218 -72.061  4.692   0.94 42.42  ? 168 GLU A HB3  1 
ATOM   1808  H HG2  . GLU A 1 124 ? 110.442 -71.591  2.861   0.94 62.35  ? 168 GLU A HG2  1 
ATOM   1809  H HG3  . GLU A 1 124 ? 109.096 -70.767  2.674   0.94 62.35  ? 168 GLU A HG3  1 
ATOM   1810  N N    . LEU A 1 125 ? 106.525 -69.843  3.765   1.00 30.81  ? 169 LEU A N    1 
ATOM   1811  C CA   . LEU A 1 125 ? 105.227 -70.153  3.183   1.00 30.19  ? 169 LEU A CA   1 
ATOM   1812  C C    . LEU A 1 125 ? 105.303 -71.423  2.345   1.00 28.36  ? 169 LEU A C    1 
ATOM   1813  O O    . LEU A 1 125 ? 106.287 -71.666  1.642   1.00 36.03  ? 169 LEU A O    1 
ATOM   1814  C CB   . LEU A 1 125 ? 104.737 -68.987  2.326   1.00 29.56  ? 169 LEU A CB   1 
ATOM   1815  C CG   . LEU A 1 125 ? 103.869 -67.959  3.056   1.00 39.93  ? 169 LEU A CG   1 
ATOM   1816  C CD1  . LEU A 1 125 ? 104.580 -67.417  4.286   1.00 48.89  ? 169 LEU A CD1  1 
ATOM   1817  C CD2  . LEU A 1 125 ? 103.486 -66.829  2.118   1.00 49.16  ? 169 LEU A CD2  1 
ATOM   1818  H H    . LEU A 1 125 ? 106.880 -69.116  3.474   1.00 36.98  ? 169 LEU A H    1 
ATOM   1819  H HA   . LEU A 1 125 ? 104.584 -70.298  3.895   1.00 36.23  ? 169 LEU A HA   1 
ATOM   1820  H HB2  . LEU A 1 125 ? 105.509 -68.519  1.973   1.00 35.48  ? 169 LEU A HB2  1 
ATOM   1821  H HB3  . LEU A 1 125 ? 104.211 -69.344  1.593   1.00 35.48  ? 169 LEU A HB3  1 
ATOM   1822  H HG   . LEU A 1 125 ? 103.052 -68.391  3.350   1.00 47.92  ? 169 LEU A HG   1 
ATOM   1823  H HD11 . LEU A 1 125 ? 104.004 -66.771  4.724   1.00 58.68  ? 169 LEU A HD11 1 
ATOM   1824  H HD12 . LEU A 1 125 ? 104.770 -68.152  4.890   1.00 58.68  ? 169 LEU A HD12 1 
ATOM   1825  H HD13 . LEU A 1 125 ? 105.407 -66.992  4.011   1.00 58.68  ? 169 LEU A HD13 1 
ATOM   1826  H HD21 . LEU A 1 125 ? 102.938 -66.191  2.600   1.00 58.99  ? 169 LEU A HD21 1 
ATOM   1827  H HD22 . LEU A 1 125 ? 104.293 -66.397  1.798   1.00 58.99  ? 169 LEU A HD22 1 
ATOM   1828  H HD23 . LEU A 1 125 ? 102.988 -67.195  1.370   1.00 58.99  ? 169 LEU A HD23 1 
ATOM   1829  N N    . GLY A 1 126 ? 104.250 -72.236  2.428   1.00 38.77  ? 170 GLY A N    1 
ATOM   1830  C CA   . GLY A 1 126 ? 104.170 -73.474  1.684   1.00 37.70  ? 170 GLY A CA   1 
ATOM   1831  C C    . GLY A 1 126 ? 104.807 -74.671  2.355   1.00 23.62  ? 170 GLY A C    1 
ATOM   1832  O O    . GLY A 1 126 ? 104.771 -75.770  1.786   1.00 32.44  ? 170 GLY A O    1 
ATOM   1833  H H    . GLY A 1 126 ? 103.561 -72.082  2.919   1.00 46.53  ? 170 GLY A H    1 
ATOM   1834  H HA2  . GLY A 1 126 ? 103.236 -73.684  1.525   1.00 45.24  ? 170 GLY A HA2  1 
ATOM   1835  H HA3  . GLY A 1 126 ? 104.599 -73.352  0.823   1.00 45.24  ? 170 GLY A HA3  1 
ATOM   1836  N N    . SER A 1 127 ? 105.375 -74.502  3.549   1.00 29.04  ? 171 SER A N    1 
ATOM   1837  C CA   . SER A 1 127 ? 106.144 -75.555  4.198   1.00 27.66  ? 171 SER A CA   1 
ATOM   1838  C C    . SER A 1 127 ? 105.342 -76.374  5.199   1.00 26.96  ? 171 SER A C    1 
ATOM   1839  O O    . SER A 1 127 ? 105.817 -77.434  5.620   1.00 31.26  ? 171 SER A O    1 
ATOM   1840  C CB   . SER A 1 127 ? 107.355 -74.948  4.917   1.00 25.57  ? 171 SER A CB   1 
ATOM   1841  O OG   . SER A 1 127 ? 106.940 -74.027  5.913   1.00 30.58  ? 171 SER A OG   1 
ATOM   1842  H H    . SER A 1 127 ? 105.328 -73.775  4.006   1.00 34.85  ? 171 SER A H    1 
ATOM   1843  H HA   . SER A 1 127 ? 106.477 -76.161  3.518   1.00 33.20  ? 171 SER A HA   1 
ATOM   1844  H HB2  . SER A 1 127 ? 107.862 -75.660  5.338   1.00 30.69  ? 171 SER A HB2  1 
ATOM   1845  H HB3  . SER A 1 127 ? 107.908 -74.485  4.269   1.00 30.69  ? 171 SER A HB3  1 
ATOM   1846  H HG   . SER A 1 127 ? 106.499 -73.404  5.562   1.00 36.70  ? 171 SER A HG   1 
ATOM   1847  N N    . LYS A 1 128 ? 104.156 -75.914  5.596   1.00 21.57  ? 172 LYS A N    1 
ATOM   1848  C CA   . LYS A 1 128 ? 103.377 -76.542  6.662   1.00 29.67  ? 172 LYS A CA   1 
ATOM   1849  C C    . LYS A 1 128 ? 104.105 -76.510  8.003   1.00 26.34  ? 172 LYS A C    1 
ATOM   1850  O O    . LYS A 1 128 ? 103.775 -77.281  8.909   1.00 20.33  ? 172 LYS A O    1 
ATOM   1851  C CB   . LYS A 1 128 ? 103.006 -77.988  6.308   1.00 32.87  ? 172 LYS A CB   1 
ATOM   1852  C CG   . LYS A 1 128 ? 102.135 -78.122  5.071   1.00 43.67  ? 172 LYS A CG   1 
ATOM   1853  C CD   . LYS A 1 128 ? 101.556 -79.526  4.952   1.00 56.99  ? 172 LYS A CD   1 
ATOM   1854  C CE   . LYS A 1 128 ? 102.596 -80.530  4.489   1.00 56.65  ? 172 LYS A CE   1 
ATOM   1855  N NZ   . LYS A 1 128 ? 103.035 -80.258  3.095   1.00 58.53  ? 172 LYS A NZ   1 
ATOM   1856  H H    . LYS A 1 128 ? 103.773 -75.223  5.255   1.00 25.89  ? 172 LYS A H    1 
ATOM   1857  H HA   . LYS A 1 128 ? 102.549 -76.047  6.769   1.00 35.60  ? 172 LYS A HA   1 
ATOM   1858  H HB2  . LYS A 1 128 ? 103.822 -78.488  6.151   1.00 39.45  ? 172 LYS A HB2  1 
ATOM   1859  H HB3  . LYS A 1 128 ? 102.522 -78.376  7.053   1.00 39.45  ? 172 LYS A HB3  1 
ATOM   1860  H HG2  . LYS A 1 128 ? 101.400 -77.493  5.126   1.00 52.41  ? 172 LYS A HG2  1 
ATOM   1861  H HG3  . LYS A 1 128 ? 102.671 -77.946  4.281   1.00 52.41  ? 172 LYS A HG3  1 
ATOM   1862  H HD2  . LYS A 1 128 ? 101.226 -79.810  5.819   1.00 68.39  ? 172 LYS A HD2  1 
ATOM   1863  H HD3  . LYS A 1 128 ? 100.833 -79.519  4.305   1.00 68.39  ? 172 LYS A HD3  1 
ATOM   1864  H HE2  . LYS A 1 128 ? 103.373 -80.477  5.068   1.00 67.98  ? 172 LYS A HE2  1 
ATOM   1865  H HE3  . LYS A 1 128 ? 102.216 -81.422  4.519   1.00 67.98  ? 172 LYS A HE3  1 
ATOM   1866  H HZ1  . LYS A 1 128 ? 103.644 -80.858  2.845   1.00 70.24  ? 172 LYS A HZ1  1 
ATOM   1867  H HZ2  . LYS A 1 128 ? 102.339 -80.305  2.542   1.00 70.24  ? 172 LYS A HZ2  1 
ATOM   1868  H HZ3  . LYS A 1 128 ? 103.392 -79.444  3.042   1.00 70.24  ? 172 LYS A HZ3  1 
ATOM   1869  N N    . ILE A 1 129 ? 105.089 -75.628  8.153   1.00 23.21  ? 173 ILE A N    1 
ATOM   1870  C CA   . ILE A 1 129 ? 105.892 -75.562  9.374   1.00 34.77  ? 173 ILE A CA   1 
ATOM   1871  C C    . ILE A 1 129 ? 105.860 -74.137  9.919   1.00 25.27  ? 173 ILE A C    1 
ATOM   1872  O O    . ILE A 1 129 ? 106.161 -73.191  9.176   1.00 26.62  ? 173 ILE A O    1 
ATOM   1873  C CB   . ILE A 1 129 ? 107.333 -76.021  9.106   1.00 28.67  ? 173 ILE A CB   1 
ATOM   1874  C CG1  . ILE A 1 129 ? 107.360 -77.532  8.865   1.00 31.43  ? 173 ILE A CG1  1 
ATOM   1875  C CG2  . ILE A 1 129 ? 108.255 -75.658  10.270  1.00 31.14  ? 173 ILE A CG2  1 
ATOM   1876  C CD1  . ILE A 1 129 ? 108.483 -77.980  7.964   1.00 32.72  ? 173 ILE A CD1  1 
ATOM   1877  H H    . ILE A 1 129 ? 105.314 -75.051  7.557   1.00 27.86  ? 173 ILE A H    1 
ATOM   1878  H HA   . ILE A 1 129 ? 105.506 -76.150  10.042  1.00 41.72  ? 173 ILE A HA   1 
ATOM   1879  H HB   . ILE A 1 129 ? 107.655 -75.576  8.307   1.00 34.41  ? 173 ILE A HB   1 
ATOM   1880  H HG12 . ILE A 1 129 ? 107.465 -77.984  9.717   1.00 37.71  ? 173 ILE A HG12 1 
ATOM   1881  H HG13 . ILE A 1 129 ? 106.524 -77.799  8.452   1.00 37.71  ? 173 ILE A HG13 1 
ATOM   1882  H HG21 . ILE A 1 129 ? 109.154 -75.963  10.067  1.00 37.36  ? 173 ILE A HG21 1 
ATOM   1883  H HG22 . ILE A 1 129 ? 108.250 -74.695  10.388  1.00 37.36  ? 173 ILE A HG22 1 
ATOM   1884  H HG23 . ILE A 1 129 ? 107.933 -76.092  11.076  1.00 37.36  ? 173 ILE A HG23 1 
ATOM   1885  H HD11 . ILE A 1 129 ? 108.437 -78.943  7.858   1.00 39.27  ? 173 ILE A HD11 1 
ATOM   1886  H HD12 . ILE A 1 129 ? 108.387 -77.547  7.102   1.00 39.27  ? 173 ILE A HD12 1 
ATOM   1887  H HD13 . ILE A 1 129 ? 109.329 -77.732  8.368   1.00 39.27  ? 173 ILE A HD13 1 
ATOM   1888  N N    . PRO A 1 130 ? 105.510 -73.921  11.200  1.00 26.51  ? 174 PRO A N    1 
ATOM   1889  C CA   . PRO A 1 130 ? 105.110 -74.909  12.210  1.00 39.38  ? 174 PRO A CA   1 
ATOM   1890  C C    . PRO A 1 130 ? 103.613 -75.233  12.205  1.00 26.99  ? 174 PRO A C    1 
ATOM   1891  O O    . PRO A 1 130 ? 103.186 -76.119  12.943  1.00 34.99  ? 174 PRO A O    1 
ATOM   1892  C CB   . PRO A 1 130 ? 105.503 -74.229  13.520  1.00 28.58  ? 174 PRO A CB   1 
ATOM   1893  C CG   . PRO A 1 130 ? 105.311 -72.781  13.247  1.00 27.17  ? 174 PRO A CG   1 
ATOM   1894  C CD   . PRO A 1 130 ? 105.643 -72.574  11.787  1.00 21.18  ? 174 PRO A CD   1 
ATOM   1895  H HA   . PRO A 1 130 ? 105.619 -75.727  12.105  1.00 47.26  ? 174 PRO A HA   1 
ATOM   1896  H HB2  . PRO A 1 130 ? 104.918 -74.527  14.235  1.00 34.30  ? 174 PRO A HB2  1 
ATOM   1897  H HB3  . PRO A 1 130 ? 106.430 -74.423  13.727  1.00 34.30  ? 174 PRO A HB3  1 
ATOM   1898  H HG2  . PRO A 1 130 ? 104.388 -72.538  13.422  1.00 32.61  ? 174 PRO A HG2  1 
ATOM   1899  H HG3  . PRO A 1 130 ? 105.910 -72.264  13.808  1.00 32.61  ? 174 PRO A HG3  1 
ATOM   1900  H HD2  . PRO A 1 130 ? 105.008 -71.964  11.380  1.00 25.42  ? 174 PRO A HD2  1 
ATOM   1901  H HD3  . PRO A 1 130 ? 106.554 -72.253  11.691  1.00 25.42  ? 174 PRO A HD3  1 
ATOM   1902  N N    . VAL A 1 131 ? 102.837 -74.526  11.390  1.00 29.58  ? 175 VAL A N    1 
ATOM   1903  C CA   . VAL A 1 131 ? 101.383 -74.657  11.374  1.00 36.02  ? 175 VAL A CA   1 
ATOM   1904  C C    . VAL A 1 131 ? 101.006 -75.553  10.202  1.00 25.74  ? 175 VAL A C    1 
ATOM   1905  O O    . VAL A 1 131 ? 101.192 -75.184  9.038   1.00 28.89  ? 175 VAL A O    1 
ATOM   1906  C CB   . VAL A 1 131 ? 100.696 -73.289  11.275  1.00 31.49  ? 175 VAL A CB   1 
ATOM   1907  C CG1  . VAL A 1 131 ? 99.186  -73.443  11.377  1.00 20.37  ? 175 VAL A CG1  1 
ATOM   1908  C CG2  . VAL A 1 131 ? 101.215 -72.356  12.361  1.00 30.70  ? 175 VAL A CG2  1 
ATOM   1909  H H    . VAL A 1 131 ? 103.135 -73.951  10.825  1.00 35.50  ? 175 VAL A H    1 
ATOM   1910  H HA   . VAL A 1 131 ? 101.091 -75.086  12.193  1.00 43.23  ? 175 VAL A HA   1 
ATOM   1911  H HB   . VAL A 1 131 ? 100.900 -72.893  10.414  1.00 37.79  ? 175 VAL A HB   1 
ATOM   1912  H HG11 . VAL A 1 131 ? 98.775  -72.567  11.312  1.00 24.45  ? 175 VAL A HG11 1 
ATOM   1913  H HG12 . VAL A 1 131 ? 98.877  -74.009  10.653  1.00 24.45  ? 175 VAL A HG12 1 
ATOM   1914  H HG13 . VAL A 1 131 ? 98.967  -73.849  12.231  1.00 24.45  ? 175 VAL A HG13 1 
ATOM   1915  H HG21 . VAL A 1 131 ? 100.768 -71.499  12.281  1.00 36.84  ? 175 VAL A HG21 1 
ATOM   1916  H HG22 . VAL A 1 131 ? 101.028 -72.747  13.229  1.00 36.84  ? 175 VAL A HG22 1 
ATOM   1917  H HG23 . VAL A 1 131 ? 102.172 -72.243  12.249  1.00 36.84  ? 175 VAL A HG23 1 
ATOM   1918  N N    . HIS A 1 132 ? 100.452 -76.728  10.507  1.00 23.36  ? 176 HIS A N    1 
ATOM   1919  C CA   . HIS A 1 132 ? 100.109 -77.723  9.497   1.00 29.55  ? 176 HIS A CA   1 
ATOM   1920  C C    . HIS A 1 132 ? 98.644  -77.586  9.113   1.00 26.35  ? 176 HIS A C    1 
ATOM   1921  O O    . HIS A 1 132 ? 97.783  -77.570  10.004  1.00 30.34  ? 176 HIS A O    1 
ATOM   1922  C CB   . HIS A 1 132 ? 100.376 -79.128  10.025  1.00 26.93  ? 176 HIS A CB   1 
ATOM   1923  C CG   . HIS A 1 132 ? 100.331 -80.188  8.969   1.00 34.71  ? 176 HIS A CG   1 
ATOM   1924  N ND1  . HIS A 1 132 ? 99.153  -80.632  8.408   1.00 35.66  ? 176 HIS A ND1  1 
ATOM   1925  C CD2  . HIS A 1 132 ? 101.321 -80.893  8.372   1.00 33.35  ? 176 HIS A CD2  1 
ATOM   1926  C CE1  . HIS A 1 132 ? 99.419  -81.563  7.510   1.00 37.14  ? 176 HIS A CE1  1 
ATOM   1927  N NE2  . HIS A 1 132 ? 100.727 -81.741  7.468   1.00 37.55  ? 176 HIS A NE2  1 
ATOM   1928  H H    . HIS A 1 132 ? 100.262 -76.974  11.309  1.00 28.04  ? 176 HIS A H    1 
ATOM   1929  H HA   . HIS A 1 132 ? 100.651 -77.582  8.705   1.00 35.46  ? 176 HIS A HA   1 
ATOM   1930  H HB2  . HIS A 1 132 ? 101.258 -79.149  10.428  1.00 32.32  ? 176 HIS A HB2  1 
ATOM   1931  H HB3  . HIS A 1 132 ? 99.705  -79.345  10.692  1.00 32.32  ? 176 HIS A HB3  1 
ATOM   1932  H HD2  . HIS A 1 132 ? 102.232 -80.818  8.541   1.00 40.02  ? 176 HIS A HD2  1 
ATOM   1933  H HE1  . HIS A 1 132 ? 98.791  -82.017  6.995   1.00 44.57  ? 176 HIS A HE1  1 
ATOM   1934  H HE2  . HIS A 1 132 ? 101.140 -82.297  6.959   1.00 45.06  ? 176 HIS A HE2  1 
ATOM   1935  N N    . PRO A 1 133 ? 98.308  -77.494  7.820   1.00 23.33  ? 177 PRO A N    1 
ATOM   1936  C CA   . PRO A 1 133 ? 96.904  -77.224  7.452   1.00 34.18  ? 177 PRO A CA   1 
ATOM   1937  C C    . PRO A 1 133 ? 95.907  -78.210  8.037   1.00 26.10  ? 177 PRO A C    1 
ATOM   1938  O O    . PRO A 1 133 ? 94.822  -77.801  8.469   1.00 29.46  ? 177 PRO A O    1 
ATOM   1939  C CB   . PRO A 1 133 ? 96.926  -77.294  5.918   1.00 25.48  ? 177 PRO A CB   1 
ATOM   1940  C CG   . PRO A 1 133 ? 98.338  -77.060  5.535   1.00 31.19  ? 177 PRO A CG   1 
ATOM   1941  C CD   . PRO A 1 133 ? 99.176  -77.617  6.639   1.00 25.51  ? 177 PRO A CD   1 
ATOM   1942  H HA   . PRO A 1 133 ? 96.656  -76.326  7.724   1.00 41.02  ? 177 PRO A HA   1 
ATOM   1943  H HB2  . PRO A 1 133 ? 96.633  -78.171  5.627   1.00 30.58  ? 177 PRO A HB2  1 
ATOM   1944  H HB3  . PRO A 1 133 ? 96.353  -76.602  5.552   1.00 30.58  ? 177 PRO A HB3  1 
ATOM   1945  H HG2  . PRO A 1 133 ? 98.526  -77.520  4.702   1.00 37.43  ? 177 PRO A HG2  1 
ATOM   1946  H HG3  . PRO A 1 133 ? 98.493  -76.108  5.439   1.00 37.43  ? 177 PRO A HG3  1 
ATOM   1947  H HD2  . PRO A 1 133 ? 99.384  -78.549  6.468   1.00 30.61  ? 177 PRO A HD2  1 
ATOM   1948  H HD3  . PRO A 1 133 ? 99.980  -77.087  6.753   1.00 30.61  ? 177 PRO A HD3  1 
ATOM   1949  N N    . ASN A 1 134 ? 96.236  -79.501  8.061   1.00 27.12  ? 178 ASN A N    1 
ATOM   1950  C CA   . ASN A 1 134 ? 95.309  -80.525  8.526   1.00 30.56  ? 178 ASN A CA   1 
ATOM   1951  C C    . ASN A 1 134 ? 95.513  -80.883  9.993   1.00 27.82  ? 178 ASN A C    1 
ATOM   1952  O O    . ASN A 1 134 ? 94.546  -80.924  10.759  1.00 31.93  ? 178 ASN A O    1 
ATOM   1953  C CB   . ASN A 1 134 ? 95.440  -81.784  7.658   1.00 27.38  ? 178 ASN A CB   1 
ATOM   1954  C CG   . ASN A 1 134 ? 94.386  -82.825  7.979   1.00 37.72  ? 178 ASN A CG   1 
ATOM   1955  O OD1  . ASN A 1 134 ? 93.192  -82.597  7.784   1.00 45.67  ? 178 ASN A OD1  1 
ATOM   1956  N ND2  . ASN A 1 134 ? 94.823  -83.983  8.463   1.00 55.70  ? 178 ASN A ND2  1 
ATOM   1957  H H    . ASN A 1 134 ? 96.999  -79.810  7.809   1.00 32.55  ? 178 ASN A H    1 
ATOM   1958  H HA   . ASN A 1 134 ? 94.403  -80.192  8.428   1.00 36.68  ? 178 ASN A HA   1 
ATOM   1959  H HB2  . ASN A 1 134 ? 95.345  -81.536  6.725   1.00 32.86  ? 178 ASN A HB2  1 
ATOM   1960  H HB3  . ASN A 1 134 ? 96.312  -82.182  7.809   1.00 32.86  ? 178 ASN A HB3  1 
ATOM   1961  H HD21 . ASN A 1 134 ? 94.263  -84.605  8.660   1.00 66.84  ? 178 ASN A HD21 1 
ATOM   1962  H HD22 . ASN A 1 134 ? 95.665  -84.110  8.579   1.00 66.84  ? 178 ASN A HD22 1 
ATOM   1963  N N    . ASP A 1 135 ? 96.758  -81.136  10.405  1.00 36.10  ? 179 ASP A N    1 
ATOM   1964  C CA   . ASP A 1 135 ? 97.012  -81.597  11.767  1.00 29.33  ? 179 ASP A CA   1 
ATOM   1965  C C    . ASP A 1 135 ? 96.714  -80.519  12.803  1.00 28.60  ? 179 ASP A C    1 
ATOM   1966  O O    . ASP A 1 135 ? 96.386  -80.843  13.950  1.00 27.39  ? 179 ASP A O    1 
ATOM   1967  C CB   . ASP A 1 135 ? 98.462  -82.062  11.900  1.00 37.41  ? 179 ASP A CB   1 
ATOM   1968  C CG   . ASP A 1 135 ? 98.831  -83.123  10.882  1.00 32.52  ? 179 ASP A CG   1 
ATOM   1969  O OD1  . ASP A 1 135 ? 97.915  -83.771  10.334  1.00 38.88  ? 179 ASP A OD1  1 
ATOM   1970  O OD2  . ASP A 1 135 ? 100.040 -83.311  10.631  1.00 45.62  ? 179 ASP A OD2  1 
ATOM   1971  H H    . ASP A 1 135 ? 97.463  -81.050  9.919   1.00 43.32  ? 179 ASP A H    1 
ATOM   1972  H HA   . ASP A 1 135 ? 96.438  -82.356  11.953  1.00 35.20  ? 179 ASP A HA   1 
ATOM   1973  H HB2  . ASP A 1 135 ? 99.051  -81.302  11.769  1.00 44.90  ? 179 ASP A HB2  1 
ATOM   1974  H HB3  . ASP A 1 135 ? 98.594  -82.436  12.785  1.00 44.90  ? 179 ASP A HB3  1 
ATOM   1975  N N    . HIS A 1 136 ? 96.822  -79.243  12.430  1.00 28.18  ? 180 HIS A N    1 
ATOM   1976  C CA   . HIS A 1 136 ? 96.621  -78.142  13.363  1.00 33.24  ? 180 HIS A CA   1 
ATOM   1977  C C    . HIS A 1 136 ? 95.368  -77.333  13.046  1.00 28.46  ? 180 HIS A C    1 
ATOM   1978  O O    . HIS A 1 136 ? 94.474  -77.223  13.890  1.00 25.95  ? 180 HIS A O    1 
ATOM   1979  C CB   . HIS A 1 136 ? 97.861  -77.237  13.366  1.00 30.47  ? 180 HIS A CB   1 
ATOM   1980  C CG   . HIS A 1 136 ? 99.096  -77.911  13.881  1.00 27.76  ? 180 HIS A CG   1 
ATOM   1981  N ND1  . HIS A 1 136 ? 100.360 -77.594  13.432  1.00 30.59  ? 180 HIS A ND1  1 
ATOM   1982  C CD2  . HIS A 1 136 ? 99.261  -78.883  14.809  1.00 29.94  ? 180 HIS A CD2  1 
ATOM   1983  C CE1  . HIS A 1 136 ? 101.249 -78.345  14.057  1.00 34.45  ? 180 HIS A CE1  1 
ATOM   1984  N NE2  . HIS A 1 136 ? 100.608 -79.135  14.899  1.00 30.77  ? 180 HIS A NE2  1 
ATOM   1985  H H    . HIS A 1 136 ? 97.013  -78.990  11.630  1.00 33.82  ? 180 HIS A H    1 
ATOM   1986  H HA   . HIS A 1 136 ? 96.518  -78.506  14.256  1.00 39.90  ? 180 HIS A HA   1 
ATOM   1987  H HB2  . HIS A 1 136 ? 98.038  -76.945  12.458  1.00 36.56  ? 180 HIS A HB2  1 
ATOM   1988  H HB3  . HIS A 1 136 ? 97.686  -76.467  13.931  1.00 36.56  ? 180 HIS A HB3  1 
ATOM   1989  H HD2  . HIS A 1 136 ? 98.587  -79.304  15.292  1.00 35.93  ? 180 HIS A HD2  1 
ATOM   1990  H HE1  . HIS A 1 136 ? 102.170 -78.319  13.929  1.00 41.35  ? 180 HIS A HE1  1 
ATOM   1991  H HE2  . HIS A 1 136 ? 100.975 -79.713  15.419  1.00 36.93  ? 180 HIS A HE2  1 
ATOM   1992  N N    . VAL A 1 137 ? 95.272  -76.763  11.843  1.00 23.86  ? 181 VAL A N    1 
ATOM   1993  C CA   . VAL A 1 137 ? 94.139  -75.897  11.532  1.00 25.46  ? 181 VAL A CA   1 
ATOM   1994  C C    . VAL A 1 137 ? 92.855  -76.707  11.390  1.00 28.27  ? 181 VAL A C    1 
ATOM   1995  O O    . VAL A 1 137 ? 91.770  -76.226  11.740  1.00 22.49  ? 181 VAL A O    1 
ATOM   1996  C CB   . VAL A 1 137 ? 94.426  -75.074  10.263  1.00 20.68  ? 181 VAL A CB   1 
ATOM   1997  C CG1  . VAL A 1 137 ? 93.293  -74.091  9.996   1.00 20.99  ? 181 VAL A CG1  1 
ATOM   1998  C CG2  . VAL A 1 137 ? 95.749  -74.332  10.396  1.00 20.77  ? 181 VAL A CG2  1 
ATOM   1999  H H    . VAL A 1 137 ? 95.838  -76.860  11.203  1.00 28.63  ? 181 VAL A H    1 
ATOM   2000  H HA   . VAL A 1 137 ? 94.014  -75.274  12.265  1.00 30.56  ? 181 VAL A HA   1 
ATOM   2001  H HB   . VAL A 1 137 ? 94.492  -75.673  9.503   1.00 24.82  ? 181 VAL A HB   1 
ATOM   2002  H HG11 . VAL A 1 137 ? 93.497  -73.585  9.194   1.00 25.19  ? 181 VAL A HG11 1 
ATOM   2003  H HG12 . VAL A 1 137 ? 92.468  -74.586  9.875   1.00 25.19  ? 181 VAL A HG12 1 
ATOM   2004  H HG13 . VAL A 1 137 ? 93.211  -73.491  10.754  1.00 25.19  ? 181 VAL A HG13 1 
ATOM   2005  H HG21 . VAL A 1 137 ? 95.907  -73.823  9.587   1.00 24.93  ? 181 VAL A HG21 1 
ATOM   2006  H HG22 . VAL A 1 137 ? 95.700  -73.736  11.160  1.00 24.93  ? 181 VAL A HG22 1 
ATOM   2007  H HG23 . VAL A 1 137 ? 96.461  -74.978  10.526  1.00 24.93  ? 181 VAL A HG23 1 
ATOM   2008  N N    . ASN A 1 138 ? 92.945  -77.937  10.883  1.00 28.00  ? 182 ASN A N    1 
ATOM   2009  C CA   . ASN A 1 138 ? 91.783  -78.795  10.697  1.00 19.88  ? 182 ASN A CA   1 
ATOM   2010  C C    . ASN A 1 138 ? 91.652  -79.839  11.801  1.00 21.49  ? 182 ASN A C    1 
ATOM   2011  O O    . ASN A 1 138 ? 90.977  -80.856  11.606  1.00 23.98  ? 182 ASN A O    1 
ATOM   2012  C CB   . ASN A 1 138 ? 91.851  -79.483  9.333   1.00 19.82  ? 182 ASN A CB   1 
ATOM   2013  C CG   . ASN A 1 138 ? 90.489  -79.935  8.836   1.00 19.16  ? 182 ASN A CG   1 
ATOM   2014  O OD1  . ASN A 1 138 ? 89.526  -79.170  8.838   1.00 21.94  ? 182 ASN A OD1  1 
ATOM   2015  N ND2  . ASN A 1 138 ? 90.403  -81.191  8.415   1.00 26.92  ? 182 ASN A ND2  1 
ATOM   2016  H H    . ASN A 1 138 ? 93.684  -78.300  10.636  1.00 33.61  ? 182 ASN A H    1 
ATOM   2017  H HA   . ASN A 1 138 ? 90.984  -78.245  10.713  1.00 23.86  ? 182 ASN A HA   1 
ATOM   2018  H HB2  . ASN A 1 138 ? 92.217  -78.862  8.684   1.00 23.78  ? 182 ASN A HB2  1 
ATOM   2019  H HB3  . ASN A 1 138 ? 92.421  -80.265  9.402   1.00 23.78  ? 182 ASN A HB3  1 
ATOM   2020  H HD21 . ASN A 1 138 ? 89.653  -81.497  8.124   1.00 32.31  ? 182 ASN A HD21 1 
ATOM   2021  H HD22 . ASN A 1 138 ? 91.096  -81.700  8.434   1.00 32.31  ? 182 ASN A HD22 1 
ATOM   2022  N N    . LYS A 1 139 ? 92.275  -79.606  12.954  1.00 34.04  ? 183 LYS A N    1 
ATOM   2023  C CA   . LYS A 1 139 ? 92.315  -80.613  14.006  1.00 26.67  ? 183 LYS A CA   1 
ATOM   2024  C C    . LYS A 1 139 ? 90.915  -80.913  14.527  1.00 21.43  ? 183 LYS A C    1 
ATOM   2025  O O    . LYS A 1 139 ? 90.134  -80.001  14.810  1.00 29.12  ? 183 LYS A O    1 
ATOM   2026  C CB   . LYS A 1 139 ? 93.212  -80.142  15.151  1.00 26.03  ? 183 LYS A CB   1 
ATOM   2027  C CG   . LYS A 1 139 ? 93.318  -81.144  16.284  1.00 39.56  ? 183 LYS A CG   1 
ATOM   2028  C CD   . LYS A 1 139 ? 94.618  -80.986  17.062  1.00 54.59  ? 183 LYS A CD   1 
ATOM   2029  C CE   . LYS A 1 139 ? 94.861  -82.171  17.987  1.00 48.49  ? 183 LYS A CE   1 
ATOM   2030  N NZ   . LYS A 1 139 ? 94.927  -83.465  17.247  1.00 49.50  ? 183 LYS A NZ   1 
ATOM   2031  H H    . LYS A 1 139 ? 92.682  -78.874  13.150  1.00 40.85  ? 183 LYS A H    1 
ATOM   2032  H HA   . LYS A 1 139 ? 92.687  -81.434  13.648  1.00 32.01  ? 183 LYS A HA   1 
ATOM   2033  H HB2  . LYS A 1 139 ? 94.105  -79.986  14.806  1.00 31.24  ? 183 LYS A HB2  1 
ATOM   2034  H HB3  . LYS A 1 139 ? 92.850  -79.318  15.514  1.00 31.24  ? 183 LYS A HB3  1 
ATOM   2035  H HG2  . LYS A 1 139 ? 92.579  -81.011  16.898  1.00 47.47  ? 183 LYS A HG2  1 
ATOM   2036  H HG3  . LYS A 1 139 ? 93.291  -82.042  15.919  1.00 47.47  ? 183 LYS A HG3  1 
ATOM   2037  H HD2  . LYS A 1 139 ? 95.359  -80.929  16.439  1.00 65.52  ? 183 LYS A HD2  1 
ATOM   2038  H HD3  . LYS A 1 139 ? 94.571  -80.182  17.603  1.00 65.52  ? 183 LYS A HD3  1 
ATOM   2039  H HE2  . LYS A 1 139 ? 95.704  -82.044  18.449  1.00 58.20  ? 183 LYS A HE2  1 
ATOM   2040  H HE3  . LYS A 1 139 ? 94.135  -82.227  18.628  1.00 58.20  ? 183 LYS A HE3  1 
ATOM   2041  H HZ1  . LYS A 1 139 ? 95.070  -84.134  17.816  1.00 59.41  ? 183 LYS A HZ1  1 
ATOM   2042  H HZ2  . LYS A 1 139 ? 94.161  -83.609  16.817  1.00 59.41  ? 183 LYS A HZ2  1 
ATOM   2043  H HZ3  . LYS A 1 139 ? 95.591  -83.443  16.654  1.00 59.41  ? 183 LYS A HZ3  1 
ATOM   2044  N N    . SER A 1 140 ? 90.609  -82.206  14.662  1.00 27.30  ? 184 SER A N    1 
ATOM   2045  C CA   . SER A 1 140 ? 89.322  -82.669  15.184  1.00 37.34  ? 184 SER A CA   1 
ATOM   2046  C C    . SER A 1 140 ? 88.160  -82.226  14.302  1.00 29.44  ? 184 SER A C    1 
ATOM   2047  O O    . SER A 1 140 ? 87.031  -82.078  14.774  1.00 24.07  ? 184 SER A O    1 
ATOM   2048  C CB   . SER A 1 140 ? 89.101  -82.190  16.622  1.00 36.86  ? 184 SER A CB   1 
ATOM   2049  O OG   . SER A 1 140 ? 90.066  -82.746  17.498  1.00 68.79  ? 184 SER A OG   1 
ATOM   2050  H H    . SER A 1 140 ? 91.143  -82.847  14.454  1.00 32.76  ? 184 SER A H    1 
ATOM   2051  H HA   . SER A 1 140 ? 89.327  -83.639  15.197  1.00 44.81  ? 184 SER A HA   1 
ATOM   2052  H HB2  . SER A 1 140 ? 89.173  -81.223  16.647  1.00 44.23  ? 184 SER A HB2  1 
ATOM   2053  H HB3  . SER A 1 140 ? 88.217  -82.464  16.913  1.00 44.23  ? 184 SER A HB3  1 
ATOM   2054  H HG   . SER A 1 140 ? 89.933  -82.476  18.282  1.00 82.55  ? 184 SER A HG   1 
ATOM   2055  N N    . GLN A 1 141 ? 88.420  -82.030  13.012  1.00 23.84  ? 185 GLN A N    1 
ATOM   2056  C CA   . GLN A 1 141 ? 87.429  -81.491  12.094  1.00 21.01  ? 185 GLN A CA   1 
ATOM   2057  C C    . GLN A 1 141 ? 87.325  -82.366  10.855  1.00 20.74  ? 185 GLN A C    1 
ATOM   2058  O O    . GLN A 1 141 ? 88.154  -83.244  10.601  1.00 23.80  ? 185 GLN A O    1 
ATOM   2059  C CB   . GLN A 1 141 ? 87.775  -80.057  11.680  1.00 18.48  ? 185 GLN A CB   1 
ATOM   2060  C CG   . GLN A 1 141 ? 87.743  -79.056  12.812  1.00 23.89  ? 185 GLN A CG   1 
ATOM   2061  C CD   . GLN A 1 141 ? 88.438  -77.761  12.450  1.00 29.79  ? 185 GLN A CD   1 
ATOM   2062  O OE1  . GLN A 1 141 ? 88.018  -77.055  11.532  1.00 24.18  ? 185 GLN A OE1  1 
ATOM   2063  N NE2  . GLN A 1 141 ? 89.518  -77.448  13.158  1.00 26.67  ? 185 GLN A NE2  1 
ATOM   2064  H H    . GLN A 1 141 ? 89.176  -82.204  12.641  1.00 28.61  ? 185 GLN A H    1 
ATOM   2065  H HA   . GLN A 1 141 ? 86.563  -81.480  12.531  1.00 25.22  ? 185 GLN A HA   1 
ATOM   2066  H HB2  . GLN A 1 141 ? 88.669  -80.049  11.304  1.00 22.18  ? 185 GLN A HB2  1 
ATOM   2067  H HB3  . GLN A 1 141 ? 87.137  -79.765  11.010  1.00 22.18  ? 185 GLN A HB3  1 
ATOM   2068  H HG2  . GLN A 1 141 ? 86.821  -78.852  13.031  1.00 28.67  ? 185 GLN A HG2  1 
ATOM   2069  H HG3  . GLN A 1 141 ? 88.194  -79.435  13.583  1.00 28.67  ? 185 GLN A HG3  1 
ATOM   2070  H HE21 . GLN A 1 141 ? 89.788  -77.972  13.785  1.00 32.01  ? 185 GLN A HE21 1 
ATOM   2071  H HE22 . GLN A 1 141 ? 89.947  -76.722  12.990  1.00 32.01  ? 185 GLN A HE22 1 
ATOM   2072  N N    . SER A 1 142 ? 86.279  -82.098  10.082  1.00 32.55  ? 186 SER A N    1 
ATOM   2073  C CA   . SER A 1 142 ? 86.069  -82.720  8.787   1.00 24.88  ? 186 SER A CA   1 
ATOM   2074  C C    . SER A 1 142 ? 85.339  -81.721  7.904   1.00 20.90  ? 186 SER A C    1 
ATOM   2075  O O    . SER A 1 142 ? 84.588  -80.877  8.397   1.00 23.58  ? 186 SER A O    1 
ATOM   2076  C CB   . SER A 1 142 ? 85.260  -84.018  8.909   1.00 29.01  ? 186 SER A CB   1 
ATOM   2077  O OG   . SER A 1 142 ? 84.843  -84.492  7.640   1.00 30.68  ? 186 SER A OG   1 
ATOM   2078  H H    . SER A 1 142 ? 85.660  -81.541  10.296  1.00 39.06  ? 186 SER A H    1 
ATOM   2079  H HA   . SER A 1 142 ? 86.926  -82.925  8.381   1.00 29.86  ? 186 SER A HA   1 
ATOM   2080  H HB2  . SER A 1 142 ? 85.813  -84.695  9.330   1.00 34.81  ? 186 SER A HB2  1 
ATOM   2081  H HB3  . SER A 1 142 ? 84.475  -83.849  9.454   1.00 34.81  ? 186 SER A HB3  1 
ATOM   2082  H HG   . SER A 1 142 ? 84.402  -85.202  7.728   1.00 36.82  ? 186 SER A HG   1 
ATOM   2083  N N    . SER A 1 143 ? 85.574  -81.807  6.594   1.00 26.04  ? 187 SER A N    1 
ATOM   2084  C CA   . SER A 1 143 ? 84.788  -80.999  5.669   1.00 27.01  ? 187 SER A CA   1 
ATOM   2085  C C    . SER A 1 143 ? 83.299  -81.255  5.847   1.00 31.53  ? 187 SER A C    1 
ATOM   2086  O O    . SER A 1 143 ? 82.483  -80.342  5.668   1.00 24.43  ? 187 SER A O    1 
ATOM   2087  C CB   . SER A 1 143 ? 85.202  -81.290  4.226   1.00 30.08  ? 187 SER A CB   1 
ATOM   2088  O OG   . SER A 1 143 ? 86.541  -80.895  3.984   1.00 44.30  ? 187 SER A OG   1 
ATOM   2089  H H    . SER A 1 143 ? 86.166  -82.311  6.226   1.00 31.25  ? 187 SER A H    1 
ATOM   2090  H HA   . SER A 1 143 ? 84.956  -80.060  5.846   1.00 32.42  ? 187 SER A HA   1 
ATOM   2091  H HB2  . SER A 1 143 ? 85.122  -82.243  4.062   1.00 36.09  ? 187 SER A HB2  1 
ATOM   2092  H HB3  . SER A 1 143 ? 84.617  -80.802  3.626   1.00 36.09  ? 187 SER A HB3  1 
ATOM   2093  H HG   . SER A 1 143 ? 87.060  -81.311  4.496   1.00 53.17  ? 187 SER A HG   1 
ATOM   2094  N N    . ASN A 1 144 ? 82.929  -82.483  6.218   1.00 19.32  ? 188 ASN A N    1 
ATOM   2095  C CA   . ASN A 1 144 ? 81.521  -82.857  6.264   1.00 15.99  ? 188 ASN A CA   1 
ATOM   2096  C C    . ASN A 1 144 ? 80.766  -82.125  7.364   1.00 21.21  ? 188 ASN A C    1 
ATOM   2097  O O    . ASN A 1 144 ? 79.570  -81.862  7.211   1.00 23.70  ? 188 ASN A O    1 
ATOM   2098  C CB   . ASN A 1 144 ? 81.392  -84.367  6.447   1.00 22.38  ? 188 ASN A CB   1 
ATOM   2099  C CG   . ASN A 1 144 ? 82.046  -85.143  5.325   1.00 18.58  ? 188 ASN A CG   1 
ATOM   2100  O OD1  . ASN A 1 144 ? 82.359  -84.587  4.272   1.00 21.82  ? 188 ASN A OD1  1 
ATOM   2101  N ND2  . ASN A 1 144 ? 82.251  -86.437  5.541   1.00 20.91  ? 188 ASN A ND2  1 
ATOM   2102  H H    . ASN A 1 144 ? 83.472  -83.110  6.445   1.00 23.19  ? 188 ASN A H    1 
ATOM   2103  H HA   . ASN A 1 144 ? 81.109  -82.625  5.417   1.00 19.20  ? 188 ASN A HA   1 
ATOM   2104  H HB2  . ASN A 1 144 ? 81.820  -84.623  7.279   1.00 26.86  ? 188 ASN A HB2  1 
ATOM   2105  H HB3  . ASN A 1 144 ? 80.452  -84.605  6.469   1.00 26.86  ? 188 ASN A HB3  1 
ATOM   2106  H HD21 . ASN A 1 144 ? 82.620  -86.921  4.933   1.00 25.10  ? 188 ASN A HD21 1 
ATOM   2107  H HD22 . ASN A 1 144 ? 82.015  -86.791  6.288   1.00 25.10  ? 188 ASN A HD22 1 
ATOM   2108  N N    . ASP A 1 145 ? 81.428  -81.792  8.475   1.00 16.72  ? 189 ASP A N    1 
ATOM   2109  C CA   . ASP A 1 145 ? 80.763  -81.087  9.562   1.00 16.11  ? 189 ASP A CA   1 
ATOM   2110  C C    . ASP A 1 145 ? 81.180  -79.630  9.696   1.00 20.56  ? 189 ASP A C    1 
ATOM   2111  O O    . ASP A 1 145 ? 80.475  -78.867  10.363  1.00 25.12  ? 189 ASP A O    1 
ATOM   2112  C CB   . ASP A 1 145 ? 81.007  -81.805  10.899  1.00 23.42  ? 189 ASP A CB   1 
ATOM   2113  C CG   . ASP A 1 145 ? 82.454  -81.749  11.343  1.00 25.70  ? 189 ASP A CG   1 
ATOM   2114  O OD1  . ASP A 1 145 ? 83.338  -81.571  10.482  1.00 26.87  ? 189 ASP A OD1  1 
ATOM   2115  O OD2  . ASP A 1 145 ? 82.705  -81.893  12.558  1.00 25.26  ? 189 ASP A OD2  1 
ATOM   2116  H H    . ASP A 1 145 ? 82.258  -81.964  8.620   1.00 20.07  ? 189 ASP A H    1 
ATOM   2117  H HA   . ASP A 1 145 ? 79.807  -81.100  9.395   1.00 19.33  ? 189 ASP A HA   1 
ATOM   2118  H HB2  . ASP A 1 145 ? 80.466  -81.384  11.586  1.00 28.11  ? 189 ASP A HB2  1 
ATOM   2119  H HB3  . ASP A 1 145 ? 80.758  -82.738  10.807  1.00 28.11  ? 189 ASP A HB3  1 
ATOM   2120  N N    . THR A 1 146 ? 82.288  -79.217  9.073   1.00 14.38  ? 190 THR A N    1 
ATOM   2121  C CA   . THR A 1 146 ? 82.695  -77.818  9.150   1.00 16.71  ? 190 THR A CA   1 
ATOM   2122  C C    . THR A 1 146 ? 81.984  -76.967  8.106   1.00 18.69  ? 190 THR A C    1 
ATOM   2123  O O    . THR A 1 146 ? 81.573  -75.841  8.403   1.00 17.97  ? 190 THR A O    1 
ATOM   2124  C CB   . THR A 1 146 ? 84.210  -77.686  8.985   1.00 22.91  ? 190 THR A CB   1 
ATOM   2125  O OG1  . THR A 1 146 ? 84.620  -78.273  7.743   1.00 26.63  ? 190 THR A OG1  1 
ATOM   2126  C CG2  . THR A 1 146 ? 84.933  -78.354  10.142  1.00 30.56  ? 190 THR A CG2  1 
ATOM   2127  H H    . THR A 1 146 ? 82.809  -79.719  8.609   1.00 17.26  ? 190 THR A H    1 
ATOM   2128  H HA   . THR A 1 146 ? 82.461  -77.472  10.025  1.00 20.05  ? 190 THR A HA   1 
ATOM   2129  H HB   . THR A 1 146 ? 84.448  -76.746  8.984   1.00 27.49  ? 190 THR A HB   1 
ATOM   2130  H HG1  . THR A 1 146 ? 84.414  -79.087  7.728   1.00 31.95  ? 190 THR A HG1  1 
ATOM   2131  H HG21 . THR A 1 146 ? 85.893  -78.266  10.028  1.00 36.68  ? 190 THR A HG21 1 
ATOM   2132  H HG22 . THR A 1 146 ? 84.675  -77.938  10.979  1.00 36.68  ? 190 THR A HG22 1 
ATOM   2133  H HG23 . THR A 1 146 ? 84.706  -79.297  10.175  1.00 36.68  ? 190 THR A HG23 1 
ATOM   2134  N N    . PHE A 1 147 ? 81.831  -77.472  6.882   1.00 17.97  ? 191 PHE A N    1 
ATOM   2135  C CA   . PHE A 1 147 ? 81.128  -76.684  5.872   1.00 15.12  ? 191 PHE A CA   1 
ATOM   2136  C C    . PHE A 1 147 ? 79.680  -76.440  6.266   1.00 14.29  ? 191 PHE A C    1 
ATOM   2137  O O    . PHE A 1 147 ? 79.234  -75.282  6.197   1.00 16.84  ? 191 PHE A O    1 
ATOM   2138  C CB   . PHE A 1 147 ? 81.235  -77.349  4.496   1.00 17.61  ? 191 PHE A CB   1 
ATOM   2139  C CG   . PHE A 1 147 ? 80.818  -76.451  3.368   1.00 17.72  ? 191 PHE A CG   1 
ATOM   2140  C CD1  . PHE A 1 147 ? 79.497  -76.398  2.955   1.00 24.53  ? 191 PHE A CD1  1 
ATOM   2141  C CD2  . PHE A 1 147 ? 81.743  -75.642  2.735   1.00 12.52  ? 191 PHE A CD2  1 
ATOM   2142  C CE1  . PHE A 1 147 ? 79.113  -75.564  1.922   1.00 15.91  ? 191 PHE A CE1  1 
ATOM   2143  C CE2  . PHE A 1 147 ? 81.365  -74.806  1.704   1.00 19.14  ? 191 PHE A CE2  1 
ATOM   2144  C CZ   . PHE A 1 147 ? 80.048  -74.767  1.297   1.00 17.23  ? 191 PHE A CZ   1 
ATOM   2145  H H    . PHE A 1 147 ? 82.114  -78.240  6.617   1.00 21.57  ? 191 PHE A H    1 
ATOM   2146  H HA   . PHE A 1 147 ? 81.559  -75.817  5.808   1.00 18.15  ? 191 PHE A HA   1 
ATOM   2147  H HB2  . PHE A 1 147 ? 82.157  -77.610  4.345   1.00 21.14  ? 191 PHE A HB2  1 
ATOM   2148  H HB3  . PHE A 1 147 ? 80.663  -78.132  4.481   1.00 21.14  ? 191 PHE A HB3  1 
ATOM   2149  H HD1  . PHE A 1 147 ? 78.862  -76.934  3.373   1.00 29.43  ? 191 PHE A HD1  1 
ATOM   2150  H HD2  . PHE A 1 147 ? 82.633  -75.664  3.005   1.00 15.02  ? 191 PHE A HD2  1 
ATOM   2151  H HE1  . PHE A 1 147 ? 78.224  -75.540  1.650   1.00 19.09  ? 191 PHE A HE1  1 
ATOM   2152  H HE2  . PHE A 1 147 ? 81.997  -74.270  1.283   1.00 22.97  ? 191 PHE A HE2  1 
ATOM   2153  H HZ   . PHE A 1 147 ? 79.791  -74.205  0.602   1.00 20.68  ? 191 PHE A HZ   1 
ATOM   2154  N N    . PRO A 1 148 ? 78.905  -77.442  6.698   1.00 17.72  ? 192 PRO A N    1 
ATOM   2155  C CA   . PRO A 1 148 ? 77.566  -77.131  7.228   1.00 19.84  ? 192 PRO A CA   1 
ATOM   2156  C C    . PRO A 1 148 ? 77.593  -76.100  8.338   1.00 20.26  ? 192 PRO A C    1 
ATOM   2157  O O    . PRO A 1 148 ? 76.730  -75.215  8.383   1.00 16.91  ? 192 PRO A O    1 
ATOM   2158  C CB   . PRO A 1 148 ? 77.058  -78.493  7.724   1.00 14.71  ? 192 PRO A CB   1 
ATOM   2159  C CG   . PRO A 1 148 ? 77.820  -79.491  6.953   1.00 15.32  ? 192 PRO A CG   1 
ATOM   2160  C CD   . PRO A 1 148 ? 79.176  -78.892  6.717   1.00 11.56  ? 192 PRO A CD   1 
ATOM   2161  H HA   . PRO A 1 148 ? 76.989  -76.817  6.515   1.00 23.81  ? 192 PRO A HA   1 
ATOM   2162  H HB2  . PRO A 1 148 ? 77.238  -78.583  8.673   1.00 17.66  ? 192 PRO A HB2  1 
ATOM   2163  H HB3  . PRO A 1 148 ? 76.108  -78.573  7.545   1.00 17.66  ? 192 PRO A HB3  1 
ATOM   2164  H HG2  . PRO A 1 148 ? 77.895  -80.309  7.468   1.00 18.38  ? 192 PRO A HG2  1 
ATOM   2165  H HG3  . PRO A 1 148 ? 77.372  -79.659  6.109   1.00 18.38  ? 192 PRO A HG3  1 
ATOM   2166  H HD2  . PRO A 1 148 ? 79.776  -79.115  7.446   1.00 13.87  ? 192 PRO A HD2  1 
ATOM   2167  H HD3  . PRO A 1 148 ? 79.531  -79.181  5.862   1.00 13.87  ? 192 PRO A HD3  1 
ATOM   2168  N N    . THR A 1 149 ? 78.571  -76.191  9.238   1.00 12.00  ? 193 THR A N    1 
ATOM   2169  C CA   . THR A 1 149 ? 78.699  -75.185  10.284  1.00 16.33  ? 193 THR A CA   1 
ATOM   2170  C C    . THR A 1 149 ? 78.906  -73.803  9.681   1.00 15.11  ? 193 THR A C    1 
ATOM   2171  O O    . THR A 1 149 ? 78.272  -72.830  10.105  1.00 9.68   ? 193 THR A O    1 
ATOM   2172  C CB   . THR A 1 149 ? 79.856  -75.543  11.218  1.00 21.39  ? 193 THR A CB   1 
ATOM   2173  O OG1  . THR A 1 149 ? 79.647  -76.855  11.759  1.00 23.47  ? 193 THR A OG1  1 
ATOM   2174  C CG2  . THR A 1 149 ? 79.955  -74.545  12.357  1.00 14.97  ? 193 THR A CG2  1 
ATOM   2175  H H    . THR A 1 149 ? 79.163  -76.815  9.264   1.00 14.40  ? 193 THR A H    1 
ATOM   2176  H HA   . THR A 1 149 ? 77.883  -75.166  10.808  1.00 19.59  ? 193 THR A HA   1 
ATOM   2177  H HB   . THR A 1 149 ? 80.689  -75.527  10.722  1.00 25.66  ? 193 THR A HB   1 
ATOM   2178  H HG1  . THR A 1 149 ? 79.609  -77.419  11.138  1.00 28.17  ? 193 THR A HG1  1 
ATOM   2179  H HG21 . THR A 1 149 ? 80.691  -74.782  12.942  1.00 17.97  ? 193 THR A HG21 1 
ATOM   2180  H HG22 . THR A 1 149 ? 80.106  -73.654  12.005  1.00 17.97  ? 193 THR A HG22 1 
ATOM   2181  H HG23 . THR A 1 149 ? 79.131  -74.545  12.870  1.00 17.97  ? 193 THR A HG23 1 
ATOM   2182  N N    . ALA A 1 150 ? 79.783  -73.700  8.680   1.00 17.73  ? 194 ALA A N    1 
ATOM   2183  C CA   . ALA A 1 150 ? 80.020  -72.412  8.039   1.00 21.97  ? 194 ALA A CA   1 
ATOM   2184  C C    . ALA A 1 150 ? 78.770  -71.916  7.323   1.00 20.82  ? 194 ALA A C    1 
ATOM   2185  O O    . ALA A 1 150 ? 78.490  -70.712  7.309   1.00 18.02  ? 194 ALA A O    1 
ATOM   2186  C CB   . ALA A 1 150 ? 81.193  -72.521  7.064   1.00 14.63  ? 194 ALA A CB   1 
ATOM   2187  H H    . ALA A 1 150 ? 80.245  -74.351  8.360   1.00 21.28  ? 194 ALA A H    1 
ATOM   2188  H HA   . ALA A 1 150 ? 80.255  -71.760  8.717   1.00 26.36  ? 194 ALA A HA   1 
ATOM   2189  H HB1  . ALA A 1 150 ? 81.337  -71.658  6.647   1.00 17.56  ? 194 ALA A HB1  1 
ATOM   2190  H HB2  . ALA A 1 150 ? 81.986  -72.789  7.554   1.00 17.56  ? 194 ALA A HB2  1 
ATOM   2191  H HB3  . ALA A 1 150 ? 80.980  -73.184  6.389   1.00 17.56  ? 194 ALA A HB3  1 
ATOM   2192  N N    . MET A 1 151 ? 78.005  -72.831  6.721   1.00 19.99  ? 195 MET A N    1 
ATOM   2193  C CA   . MET A 1 151 ? 76.769  -72.437  6.050   1.00 19.25  ? 195 MET A CA   1 
ATOM   2194  C C    . MET A 1 151 ? 75.820  -71.747  7.019   1.00 14.80  ? 195 MET A C    1 
ATOM   2195  O O    . MET A 1 151 ? 75.264  -70.685  6.716   1.00 14.42  ? 195 MET A O    1 
ATOM   2196  C CB   . MET A 1 151 ? 76.088  -73.657  5.428   1.00 21.99  ? 195 MET A CB   1 
ATOM   2197  C CG   . MET A 1 151 ? 76.872  -74.321  4.312   1.00 18.76  ? 195 MET A CG   1 
ATOM   2198  S SD   . MET A 1 151 ? 75.839  -75.375  3.273   1.00 23.23  ? 195 MET A SD   1 
ATOM   2199  C CE   . MET A 1 151 ? 75.421  -76.703  4.383   1.00 18.27  ? 195 MET A CE   1 
ATOM   2200  H H    . MET A 1 151 ? 78.177  -73.673  6.688   1.00 23.99  ? 195 MET A H    1 
ATOM   2201  H HA   . MET A 1 151 ? 76.986  -71.820  5.333   1.00 23.11  ? 195 MET A HA   1 
ATOM   2202  H HB2  . MET A 1 151 ? 75.947  -74.320  6.122   1.00 26.40  ? 195 MET A HB2  1 
ATOM   2203  H HB3  . MET A 1 151 ? 75.233  -73.381  5.062   1.00 26.40  ? 195 MET A HB3  1 
ATOM   2204  H HG2  . MET A 1 151 ? 77.264  -73.635  3.749   1.00 22.52  ? 195 MET A HG2  1 
ATOM   2205  H HG3  . MET A 1 151 ? 77.569  -74.872  4.700   1.00 22.52  ? 195 MET A HG3  1 
ATOM   2206  H HE1  . MET A 1 151 ? 74.856  -77.339  3.916   1.00 21.93  ? 195 MET A HE1  1 
ATOM   2207  H HE2  . MET A 1 151 ? 76.237  -77.138  4.676   1.00 21.93  ? 195 MET A HE2  1 
ATOM   2208  H HE3  . MET A 1 151 ? 74.947  -76.339  5.147   1.00 21.93  ? 195 MET A HE3  1 
ATOM   2209  N N    . HIS A 1 152 ? 75.619  -72.344  8.197   1.00 11.61  ? 196 HIS A N    1 
ATOM   2210  C CA   . HIS A 1 152 ? 74.636  -71.820  9.136   1.00 16.95  ? 196 HIS A CA   1 
ATOM   2211  C C    . HIS A 1 152 ? 75.126  -70.559  9.834   1.00 23.22  ? 196 HIS A C    1 
ATOM   2212  O O    . HIS A 1 152 ? 74.316  -69.679  10.150  1.00 15.13  ? 196 HIS A O    1 
ATOM   2213  C CB   . HIS A 1 152 ? 74.276  -72.893  10.161  1.00 12.75  ? 196 HIS A CB   1 
ATOM   2214  C CG   . HIS A 1 152 ? 73.306  -73.911  9.651   1.00 15.92  ? 196 HIS A CG   1 
ATOM   2215  N ND1  . HIS A 1 152 ? 72.710  -74.846  10.470  1.00 15.55  ? 196 HIS A ND1  1 
ATOM   2216  C CD2  . HIS A 1 152 ? 72.825  -74.140  8.406   1.00 19.59  ? 196 HIS A CD2  1 
ATOM   2217  C CE1  . HIS A 1 152 ? 71.904  -75.607  9.750   1.00 23.71  ? 196 HIS A CE1  1 
ATOM   2218  N NE2  . HIS A 1 152 ? 71.957  -75.200  8.495   1.00 18.08  ? 196 HIS A NE2  1 
ATOM   2219  H H    . HIS A 1 152 ? 76.036  -73.045  8.469   1.00 13.93  ? 196 HIS A H    1 
ATOM   2220  H HA   . HIS A 1 152 ? 73.829  -71.594  8.649   1.00 20.34  ? 196 HIS A HA   1 
ATOM   2221  H HB2  . HIS A 1 152 ? 75.086  -73.359  10.423  1.00 15.30  ? 196 HIS A HB2  1 
ATOM   2222  H HB3  . HIS A 1 152 ? 73.878  -72.465  10.935  1.00 15.30  ? 196 HIS A HB3  1 
ATOM   2223  H HD1  . HIS A 1 152 ? 72.841  -74.922  11.316  1.00 18.67  ? 196 HIS A HD1  1 
ATOM   2224  H HD2  . HIS A 1 152 ? 73.043  -73.668  7.635   1.00 23.52  ? 196 HIS A HD2  1 
ATOM   2225  H HE1  . HIS A 1 152 ? 71.389  -76.311  10.073  1.00 28.46  ? 196 HIS A HE1  1 
ATOM   2226  N N    . ILE A 1 153 ? 76.432  -70.447  10.090  1.00 17.38  ? 197 ILE A N    1 
ATOM   2227  C CA   . ILE A 1 153 ? 76.970  -69.194  10.614  1.00 12.25  ? 197 ILE A CA   1 
ATOM   2228  C C    . ILE A 1 153 ? 76.765  -68.077  9.600   1.00 15.11  ? 197 ILE A C    1 
ATOM   2229  O O    . ILE A 1 153 ? 76.321  -66.973  9.940   1.00 16.16  ? 197 ILE A O    1 
ATOM   2230  C CB   . ILE A 1 153 ? 78.456  -69.355  10.982  1.00 20.61  ? 197 ILE A CB   1 
ATOM   2231  C CG1  . ILE A 1 153 ? 78.616  -70.323  12.157  1.00 15.33  ? 197 ILE A CG1  1 
ATOM   2232  C CG2  . ILE A 1 153 ? 79.072  -68.003  11.340  1.00 22.13  ? 197 ILE A CG2  1 
ATOM   2233  C CD1  . ILE A 1 153 ? 80.042  -70.779  12.387  1.00 14.58  ? 197 ILE A CD1  1 
ATOM   2234  H H    . ILE A 1 153 ? 77.014  -71.068  9.970   1.00 20.86  ? 197 ILE A H    1 
ATOM   2235  H HA   . ILE A 1 153 ? 76.486  -68.957  11.421  1.00 14.70  ? 197 ILE A HA   1 
ATOM   2236  H HB   . ILE A 1 153 ? 78.927  -69.717  10.216  1.00 24.73  ? 197 ILE A HB   1 
ATOM   2237  H HG12 . ILE A 1 153 ? 78.311  -69.885  12.966  1.00 18.40  ? 197 ILE A HG12 1 
ATOM   2238  H HG13 . ILE A 1 153 ? 78.076  -71.111  11.987  1.00 18.40  ? 197 ILE A HG13 1 
ATOM   2239  H HG21 . ILE A 1 153 ? 80.006  -68.133  11.568  1.00 26.56  ? 197 ILE A HG21 1 
ATOM   2240  H HG22 . ILE A 1 153 ? 78.996  -67.410  10.577  1.00 26.56  ? 197 ILE A HG22 1 
ATOM   2241  H HG23 . ILE A 1 153 ? 78.595  -67.631  12.099  1.00 26.56  ? 197 ILE A HG23 1 
ATOM   2242  H HD11 . ILE A 1 153 ? 80.060  -71.387  13.143  1.00 17.50  ? 197 ILE A HD11 1 
ATOM   2243  H HD12 . ILE A 1 153 ? 80.361  -71.232  11.590  1.00 17.50  ? 197 ILE A HD12 1 
ATOM   2244  H HD13 . ILE A 1 153 ? 80.595  -70.004  12.571  1.00 17.50  ? 197 ILE A HD13 1 
ATOM   2245  N N    . ALA A 1 154 ? 77.079  -68.352  8.333   1.00 15.16  ? 198 ALA A N    1 
ATOM   2246  C CA   . ALA A 1 154 ? 76.942  -67.335  7.297   1.00 15.15  ? 198 ALA A CA   1 
ATOM   2247  C C    . ALA A 1 154 ? 75.485  -66.929  7.111   1.00 20.01  ? 198 ALA A C    1 
ATOM   2248  O O    . ALA A 1 154 ? 75.175  -65.738  7.000   1.00 16.77  ? 198 ALA A O    1 
ATOM   2249  C CB   . ALA A 1 154 ? 77.528  -67.848  5.982   1.00 20.89  ? 198 ALA A CB   1 
ATOM   2250  H H    . ALA A 1 154 ? 77.369  -69.112  8.052   1.00 18.20  ? 198 ALA A H    1 
ATOM   2251  H HA   . ALA A 1 154 ? 77.441  -66.547  7.561   1.00 18.18  ? 198 ALA A HA   1 
ATOM   2252  H HB1  . ALA A 1 154 ? 77.429  -67.161  5.304   1.00 25.07  ? 198 ALA A HB1  1 
ATOM   2253  H HB2  . ALA A 1 154 ? 78.467  -68.051  6.113   1.00 25.07  ? 198 ALA A HB2  1 
ATOM   2254  H HB3  . ALA A 1 154 ? 77.049  -68.648  5.714   1.00 25.07  ? 198 ALA A HB3  1 
ATOM   2255  N N    . ALA A 1 155 ? 74.575  -67.906  7.076   1.00 19.96  ? 199 ALA A N    1 
ATOM   2256  C CA   . ALA A 1 155 ? 73.165  -67.595  6.867   1.00 20.69  ? 199 ALA A CA   1 
ATOM   2257  C C    . ALA A 1 155 ? 72.600  -66.784  8.024   1.00 15.30  ? 199 ALA A C    1 
ATOM   2258  O O    . ALA A 1 155 ? 71.877  -65.803  7.810   1.00 14.32  ? 199 ALA A O    1 
ATOM   2259  C CB   . ALA A 1 155 ? 72.366  -68.883  6.680   1.00 19.08  ? 199 ALA A CB   1 
ATOM   2260  H H    . ALA A 1 155 ? 74.748  -68.743  7.170   1.00 23.95  ? 199 ALA A H    1 
ATOM   2261  H HA   . ALA A 1 155 ? 73.075  -67.067  6.058   1.00 24.83  ? 199 ALA A HA   1 
ATOM   2262  H HB1  . ALA A 1 155 ? 71.432  -68.658  6.543   1.00 22.90  ? 199 ALA A HB1  1 
ATOM   2263  H HB2  . ALA A 1 155 ? 72.709  -69.358  5.908   1.00 22.90  ? 199 ALA A HB2  1 
ATOM   2264  H HB3  . ALA A 1 155 ? 72.461  -69.431  7.475   1.00 22.90  ? 199 ALA A HB3  1 
ATOM   2265  N N    . ALA A 1 156 ? 72.915  -67.178  9.258   1.00 17.45  ? 200 ALA A N    1 
ATOM   2266  C CA   . ALA A 1 156 ? 72.419  -66.444  10.417  1.00 13.68  ? 200 ALA A CA   1 
ATOM   2267  C C    . ALA A 1 156 ? 72.914  -65.004  10.403  1.00 18.32  ? 200 ALA A C    1 
ATOM   2268  O O    . ALA A 1 156 ? 72.137  -64.065  10.618  1.00 17.30  ? 200 ALA A O    1 
ATOM   2269  C CB   . ALA A 1 156 ? 72.843  -67.150  11.705  1.00 19.29  ? 200 ALA A CB   1 
ATOM   2270  H H    . ALA A 1 156 ? 73.407  -67.857  9.448   1.00 20.94  ? 200 ALA A H    1 
ATOM   2271  H HA   . ALA A 1 156 ? 71.449  -66.427  10.389  1.00 16.42  ? 200 ALA A HA   1 
ATOM   2272  H HB1  . ALA A 1 156 ? 72.505  -66.649  12.465  1.00 23.15  ? 200 ALA A HB1  1 
ATOM   2273  H HB2  . ALA A 1 156 ? 72.474  -68.047  11.709  1.00 23.15  ? 200 ALA A HB2  1 
ATOM   2274  H HB3  . ALA A 1 156 ? 73.812  -67.189  11.739  1.00 23.15  ? 200 ALA A HB3  1 
ATOM   2275  N N    . ILE A 1 157 ? 74.209  -64.811  10.144  1.00 17.74  ? 201 ILE A N    1 
ATOM   2276  C CA   . ILE A 1 157 ? 74.773  -63.464  10.150  1.00 17.36  ? 201 ILE A CA   1 
ATOM   2277  C C    . ILE A 1 157 ? 74.163  -62.625  9.036   1.00 20.97  ? 201 ILE A C    1 
ATOM   2278  O O    . ILE A 1 157 ? 73.850  -61.443  9.227   1.00 22.89  ? 201 ILE A O    1 
ATOM   2279  C CB   . ILE A 1 157 ? 76.308  -63.533  10.042  1.00 20.69  ? 201 ILE A CB   1 
ATOM   2280  C CG1  . ILE A 1 157 ? 76.889  -64.066  11.355  1.00 20.71  ? 201 ILE A CG1  1 
ATOM   2281  C CG2  . ILE A 1 157 ? 76.893  -62.166  9.713   1.00 12.06  ? 201 ILE A CG2  1 
ATOM   2282  C CD1  . ILE A 1 157 ? 78.376  -64.340  11.321  1.00 14.50  ? 201 ILE A CD1  1 
ATOM   2283  H H    . ILE A 1 157 ? 74.773  -65.434  9.965   1.00 21.29  ? 201 ILE A H    1 
ATOM   2284  H HA   . ILE A 1 157 ? 74.555  -63.038  10.994  1.00 20.84  ? 201 ILE A HA   1 
ATOM   2285  H HB   . ILE A 1 157 ? 76.540  -64.149  9.329   1.00 24.83  ? 201 ILE A HB   1 
ATOM   2286  H HG12 . ILE A 1 157 ? 76.727  -63.412  12.053  1.00 24.85  ? 201 ILE A HG12 1 
ATOM   2287  H HG13 . ILE A 1 157 ? 76.441  -64.897  11.577  1.00 24.85  ? 201 ILE A HG13 1 
ATOM   2288  H HG21 . ILE A 1 157 ? 77.858  -62.243  9.652   1.00 14.48  ? 201 ILE A HG21 1 
ATOM   2289  H HG22 . ILE A 1 157 ? 76.531  -61.864  8.866   1.00 14.48  ? 201 ILE A HG22 1 
ATOM   2290  H HG23 . ILE A 1 157 ? 76.654  -61.543  10.417  1.00 14.48  ? 201 ILE A HG23 1 
ATOM   2291  H HD11 . ILE A 1 157 ? 78.655  -64.672  12.188  1.00 17.40  ? 201 ILE A HD11 1 
ATOM   2292  H HD12 . ILE A 1 157 ? 78.558  -65.005  10.637  1.00 17.40  ? 201 ILE A HD12 1 
ATOM   2293  H HD13 . ILE A 1 157 ? 78.844  -63.516  11.115  1.00 17.40  ? 201 ILE A HD13 1 
ATOM   2294  N N    . GLU A 1 158 ? 73.984  -63.217  7.854   1.00 19.02  ? 202 GLU A N    1 
ATOM   2295  C CA   . GLU A 1 158 ? 73.390  -62.478  6.745   1.00 18.39  ? 202 GLU A CA   1 
ATOM   2296  C C    . GLU A 1 158 ? 71.947  -62.099  7.053   1.00 19.93  ? 202 GLU A C    1 
ATOM   2297  O O    . GLU A 1 158 ? 71.519  -60.972  6.773   1.00 18.72  ? 202 GLU A O    1 
ATOM   2298  C CB   . GLU A 1 158 ? 73.468  -63.309  5.464   1.00 22.98  ? 202 GLU A CB   1 
ATOM   2299  C CG   . GLU A 1 158 ? 73.432  -62.488  4.180   1.00 44.02  ? 202 GLU A CG   1 
ATOM   2300  C CD   . GLU A 1 158 ? 74.747  -61.780  3.897   1.00 35.92  ? 202 GLU A CD   1 
ATOM   2301  O OE1  . GLU A 1 158 ? 75.696  -61.938  4.693   1.00 29.60  ? 202 GLU A OE1  1 
ATOM   2302  O OE2  . GLU A 1 158 ? 74.831  -61.069  2.874   1.00 35.64  ? 202 GLU A OE2  1 
ATOM   2303  H H    . GLU A 1 158 ? 74.195  -64.031  7.673   1.00 22.83  ? 202 GLU A H    1 
ATOM   2304  H HA   . GLU A 1 158 ? 73.892  -61.660  6.605   1.00 22.07  ? 202 GLU A HA   1 
ATOM   2305  H HB2  . GLU A 1 158 ? 74.298  -63.812  5.470   1.00 27.58  ? 202 GLU A HB2  1 
ATOM   2306  H HB3  . GLU A 1 158 ? 72.715  -63.921  5.444   1.00 27.58  ? 202 GLU A HB3  1 
ATOM   2307  H HG2  . GLU A 1 158 ? 73.242  -63.078  3.433   1.00 52.82  ? 202 GLU A HG2  1 
ATOM   2308  H HG3  . GLU A 1 158 ? 72.739  -61.814  4.255   1.00 52.82  ? 202 GLU A HG3  1 
ATOM   2309  N N    . VAL A 1 159 ? 71.183  -63.028  7.635   1.00 14.96  ? 203 VAL A N    1 
ATOM   2310  C CA   . VAL A 1 159 ? 69.796  -62.745  7.999   1.00 21.27  ? 203 VAL A CA   1 
ATOM   2311  C C    . VAL A 1 159 ? 69.726  -61.547  8.938   1.00 22.42  ? 203 VAL A C    1 
ATOM   2312  O O    . VAL A 1 159 ? 68.905  -60.639  8.760   1.00 15.11  ? 203 VAL A O    1 
ATOM   2313  C CB   . VAL A 1 159 ? 69.148  -63.992  8.632   1.00 23.62  ? 203 VAL A CB   1 
ATOM   2314  C CG1  . VAL A 1 159 ? 67.874  -63.634  9.399   1.00 18.31  ? 203 VAL A CG1  1 
ATOM   2315  C CG2  . VAL A 1 159 ? 68.834  -65.022  7.561   1.00 16.41  ? 203 VAL A CG2  1 
ATOM   2316  H H    . VAL A 1 159 ? 71.444  -63.824  7.827   1.00 17.96  ? 203 VAL A H    1 
ATOM   2317  H HA   . VAL A 1 159 ? 69.299  -62.524  7.196   1.00 25.52  ? 203 VAL A HA   1 
ATOM   2318  H HB   . VAL A 1 159 ? 69.774  -64.390  9.257   1.00 28.34  ? 203 VAL A HB   1 
ATOM   2319  H HG11 . VAL A 1 159 ? 67.499  -64.443  9.780   1.00 21.97  ? 203 VAL A HG11 1 
ATOM   2320  H HG12 . VAL A 1 159 ? 68.097  -63.007  10.105  1.00 21.97  ? 203 VAL A HG12 1 
ATOM   2321  H HG13 . VAL A 1 159 ? 67.240  -63.231  8.786   1.00 21.97  ? 203 VAL A HG13 1 
ATOM   2322  H HG21 . VAL A 1 159 ? 68.428  -65.797  7.979   1.00 19.69  ? 203 VAL A HG21 1 
ATOM   2323  H HG22 . VAL A 1 159 ? 68.221  -64.633  6.919   1.00 19.69  ? 203 VAL A HG22 1 
ATOM   2324  H HG23 . VAL A 1 159 ? 69.659  -65.279  7.119   1.00 19.69  ? 203 VAL A HG23 1 
ATOM   2325  N N    . HIS A 1 160 ? 70.583  -61.530  9.958   1.00 15.71  ? 204 HIS A N    1 
ATOM   2326  C CA   . HIS A 1 160 ? 70.477  -60.529  11.011  1.00 23.36  ? 204 HIS A CA   1 
ATOM   2327  C C    . HIS A 1 160 ? 71.104  -59.194  10.636  1.00 14.94  ? 204 HIS A C    1 
ATOM   2328  O O    . HIS A 1 160 ? 70.700  -58.163  11.186  1.00 18.95  ? 204 HIS A O    1 
ATOM   2329  C CB   . HIS A 1 160 ? 71.113  -61.060  12.297  1.00 21.19  ? 204 HIS A CB   1 
ATOM   2330  C CG   . HIS A 1 160 ? 70.182  -61.898  13.117  1.00 44.60  ? 204 HIS A CG   1 
ATOM   2331  N ND1  . HIS A 1 160 ? 69.314  -61.356  14.040  1.00 43.94  ? 204 HIS A ND1  1 
ATOM   2332  C CD2  . HIS A 1 160 ? 69.966  -63.234  13.137  1.00 33.31  ? 204 HIS A CD2  1 
ATOM   2333  C CE1  . HIS A 1 160 ? 68.611  -62.322  14.602  1.00 45.19  ? 204 HIS A CE1  1 
ATOM   2334  N NE2  . HIS A 1 160 ? 68.986  -63.471  14.071  1.00 58.04  ? 204 HIS A NE2  1 
ATOM   2335  H H    . HIS A 1 160 ? 71.232  -62.085  10.061  1.00 18.86  ? 204 HIS A H    1 
ATOM   2336  H HA   . HIS A 1 160 ? 69.537  -60.370  11.192  1.00 28.03  ? 204 HIS A HA   1 
ATOM   2337  H HB2  . HIS A 1 160 ? 71.880  -61.607  12.065  1.00 25.42  ? 204 HIS A HB2  1 
ATOM   2338  H HB3  . HIS A 1 160 ? 71.395  -60.309  12.841  1.00 25.42  ? 204 HIS A HB3  1 
ATOM   2339  H HD2  . HIS A 1 160 ? 70.401  -63.872  12.619  1.00 39.98  ? 204 HIS A HD2  1 
ATOM   2340  H HE1  . HIS A 1 160 ? 67.961  -62.211  15.259  1.00 54.23  ? 204 HIS A HE1  1 
ATOM   2341  H HE2  . HIS A 1 160 ? 68.670  -64.244  14.278  1.00 69.65  ? 204 HIS A HE2  1 
ATOM   2342  N N    . GLU A 1 161 ? 72.063  -59.179  9.711   1.00 17.41  ? 205 GLU A N    1 
ATOM   2343  C CA   . GLU A 1 161 ? 72.746  -57.944  9.351   1.00 18.91  ? 205 GLU A CA   1 
ATOM   2344  C C    . GLU A 1 161 ? 72.261  -57.338  8.043   1.00 15.22  ? 205 GLU A C    1 
ATOM   2345  O O    . GLU A 1 161 ? 72.389  -56.123  7.862   1.00 26.48  ? 205 GLU A O    1 
ATOM   2346  C CB   . GLU A 1 161 ? 74.258  -58.185  9.258   1.00 17.62  ? 205 GLU A CB   1 
ATOM   2347  C CG   . GLU A 1 161 ? 74.921  -58.460  10.601  1.00 22.84  ? 205 GLU A CG   1 
ATOM   2348  C CD   . GLU A 1 161 ? 76.419  -58.656  10.480  1.00 44.07  ? 205 GLU A CD   1 
ATOM   2349  O OE1  . GLU A 1 161 ? 76.946  -58.545  9.353   1.00 41.50  ? 205 GLU A OE1  1 
ATOM   2350  O OE2  . GLU A 1 161 ? 77.070  -58.918  11.514  1.00 51.31  ? 205 GLU A OE2  1 
ATOM   2351  H H    . GLU A 1 161 ? 72.334  -59.871  9.279   1.00 20.89  ? 205 GLU A H    1 
ATOM   2352  H HA   . GLU A 1 161 ? 72.594  -57.291  10.051  1.00 22.69  ? 205 GLU A HA   1 
ATOM   2353  H HB2  . GLU A 1 161 ? 74.418  -58.951  8.686   1.00 21.15  ? 205 GLU A HB2  1 
ATOM   2354  H HB3  . GLU A 1 161 ? 74.677  -57.397  8.877   1.00 21.15  ? 205 GLU A HB3  1 
ATOM   2355  H HG2  . GLU A 1 161 ? 74.762  -57.708  11.193  1.00 27.41  ? 205 GLU A HG2  1 
ATOM   2356  H HG3  . GLU A 1 161 ? 74.542  -59.269  10.981  1.00 27.41  ? 205 GLU A HG3  1 
ATOM   2357  N N    . VAL A 1 162 ? 71.701  -58.140  7.136   1.00 18.88  ? 206 VAL A N    1 
ATOM   2358  C CA   . VAL A 1 162 ? 71.311  -57.647  5.819   1.00 17.11  ? 206 VAL A CA   1 
ATOM   2359  C C    . VAL A 1 162 ? 69.813  -57.816  5.607   1.00 20.34  ? 206 VAL A C    1 
ATOM   2360  O O    . VAL A 1 162 ? 69.096  -56.837  5.373   1.00 19.84  ? 206 VAL A O    1 
ATOM   2361  C CB   . VAL A 1 162 ? 72.107  -58.361  4.711   1.00 19.12  ? 206 VAL A CB   1 
ATOM   2362  C CG1  . VAL A 1 162 ? 71.682  -57.864  3.333   1.00 20.96  ? 206 VAL A CG1  1 
ATOM   2363  C CG2  . VAL A 1 162 ? 73.600  -58.146  4.912   1.00 23.43  ? 206 VAL A CG2  1 
ATOM   2364  H H    . VAL A 1 162 ? 71.537  -58.974  7.262   1.00 22.65  ? 206 VAL A H    1 
ATOM   2365  H HA   . VAL A 1 162 ? 71.514  -56.699  5.766   1.00 20.53  ? 206 VAL A HA   1 
ATOM   2366  H HB   . VAL A 1 162 ? 71.930  -59.314  4.756   1.00 22.94  ? 206 VAL A HB   1 
ATOM   2367  H HG11 . VAL A 1 162 ? 72.198  -58.331  2.657   1.00 25.16  ? 206 VAL A HG11 1 
ATOM   2368  H HG12 . VAL A 1 162 ? 70.737  -58.044  3.211   1.00 25.16  ? 206 VAL A HG12 1 
ATOM   2369  H HG13 . VAL A 1 162 ? 71.848  -56.910  3.277   1.00 25.16  ? 206 VAL A HG13 1 
ATOM   2370  H HG21 . VAL A 1 162 ? 74.082  -58.603  4.206   1.00 28.12  ? 206 VAL A HG21 1 
ATOM   2371  H HG22 . VAL A 1 162 ? 73.789  -57.195  4.881   1.00 28.12  ? 206 VAL A HG22 1 
ATOM   2372  H HG23 . VAL A 1 162 ? 73.857  -58.507  5.775   1.00 28.12  ? 206 VAL A HG23 1 
ATOM   2373  N N    . LEU A 1 163 ? 69.324  -59.055  5.694   1.00 17.91  ? 207 LEU A N    1 
ATOM   2374  C CA   . LEU A 1 163 ? 67.943  -59.330  5.311   1.00 13.50  ? 207 LEU A CA   1 
ATOM   2375  C C    . LEU A 1 163 ? 66.959  -58.597  6.217   1.00 15.83  ? 207 LEU A C    1 
ATOM   2376  O O    . LEU A 1 163 ? 66.161  -57.773  5.753   1.00 16.32  ? 207 LEU A O    1 
ATOM   2377  C CB   . LEU A 1 163 ? 67.684  -60.837  5.334   1.00 11.33  ? 207 LEU A CB   1 
ATOM   2378  C CG   . LEU A 1 163 ? 66.278  -61.285  4.925   1.00 20.55  ? 207 LEU A CG   1 
ATOM   2379  C CD1  . LEU A 1 163 ? 65.898  -60.750  3.549   1.00 18.88  ? 207 LEU A CD1  1 
ATOM   2380  C CD2  . LEU A 1 163 ? 66.186  -62.800  4.949   1.00 15.91  ? 207 LEU A CD2  1 
ATOM   2381  H H    . LEU A 1 163 ? 69.765  -59.741  5.967   1.00 21.49  ? 207 LEU A H    1 
ATOM   2382  H HA   . LEU A 1 163 ? 67.801  -59.018  4.404   1.00 16.20  ? 207 LEU A HA   1 
ATOM   2383  H HB2  . LEU A 1 163 ? 68.310  -61.264  4.729   1.00 13.60  ? 207 LEU A HB2  1 
ATOM   2384  H HB3  . LEU A 1 163 ? 67.838  -61.159  6.236   1.00 13.60  ? 207 LEU A HB3  1 
ATOM   2385  H HG   . LEU A 1 163 ? 65.639  -60.937  5.567   1.00 24.66  ? 207 LEU A HG   1 
ATOM   2386  H HD11 . LEU A 1 163 ? 65.004  -61.055  3.328   1.00 22.65  ? 207 LEU A HD11 1 
ATOM   2387  H HD12 . LEU A 1 163 ? 65.921  -59.781  3.570   1.00 22.65  ? 207 LEU A HD12 1 
ATOM   2388  H HD13 . LEU A 1 163 ? 66.532  -61.083  2.895   1.00 22.65  ? 207 LEU A HD13 1 
ATOM   2389  H HD21 . LEU A 1 163 ? 65.290  -63.066  4.687   1.00 19.10  ? 207 LEU A HD21 1 
ATOM   2390  H HD22 . LEU A 1 163 ? 66.834  -63.165  4.327   1.00 19.10  ? 207 LEU A HD22 1 
ATOM   2391  H HD23 . LEU A 1 163 ? 66.375  -63.114  5.847   1.00 19.10  ? 207 LEU A HD23 1 
ATOM   2392  N N    . LEU A 1 164 ? 67.000  -58.881  7.516   1.00 14.34  ? 208 LEU A N    1 
ATOM   2393  C CA   . LEU A 1 164 ? 66.009  -58.334  8.436   1.00 19.22  ? 208 LEU A CA   1 
ATOM   2394  C C    . LEU A 1 164 ? 66.130  -56.818  8.566   1.00 15.50  ? 208 LEU A C    1 
ATOM   2395  O O    . LEU A 1 164 ? 65.107  -56.122  8.557   1.00 17.44  ? 208 LEU A O    1 
ATOM   2396  C CB   . LEU A 1 164 ? 66.124  -59.006  9.808   1.00 16.43  ? 208 LEU A CB   1 
ATOM   2397  C CG   . LEU A 1 164 ? 65.595  -60.440  9.884   1.00 17.64  ? 208 LEU A CG   1 
ATOM   2398  C CD1  . LEU A 1 164 ? 65.934  -61.067  11.225  1.00 16.02  ? 208 LEU A CD1  1 
ATOM   2399  C CD2  . LEU A 1 164 ? 64.093  -60.493  9.647   1.00 12.87  ? 208 LEU A CD2  1 
ATOM   2400  H H    . LEU A 1 164 ? 67.588  -59.386  7.888   1.00 17.21  ? 208 LEU A H    1 
ATOM   2401  H HA   . LEU A 1 164 ? 65.124  -58.528  8.088   1.00 23.06  ? 208 LEU A HA   1 
ATOM   2402  H HB2  . LEU A 1 164 ? 67.060  -59.028  10.061  1.00 19.71  ? 208 LEU A HB2  1 
ATOM   2403  H HB3  . LEU A 1 164 ? 65.627  -58.477  10.452  1.00 19.71  ? 208 LEU A HB3  1 
ATOM   2404  H HG   . LEU A 1 164 ? 66.023  -60.968  9.193   1.00 21.17  ? 208 LEU A HG   1 
ATOM   2405  H HD11 . LEU A 1 164 ? 65.587  -61.973  11.246  1.00 19.22  ? 208 LEU A HD11 1 
ATOM   2406  H HD12 . LEU A 1 164 ? 66.898  -61.079  11.333  1.00 19.22  ? 208 LEU A HD12 1 
ATOM   2407  H HD13 . LEU A 1 164 ? 65.528  -60.541  11.931  1.00 19.22  ? 208 LEU A HD13 1 
ATOM   2408  H HD21 . LEU A 1 164 ? 63.798  -61.415  9.703   1.00 15.45  ? 208 LEU A HD21 1 
ATOM   2409  H HD22 . LEU A 1 164 ? 63.648  -59.960  10.325  1.00 15.45  ? 208 LEU A HD22 1 
ATOM   2410  H HD23 . LEU A 1 164 ? 63.901  -60.136  8.766   1.00 15.45  ? 208 LEU A HD23 1 
ATOM   2411  N N    . PRO A 1 165 ? 67.336  -56.260  8.695   1.00 15.22  ? 209 PRO A N    1 
ATOM   2412  C CA   . PRO A 1 165 ? 67.435  -54.789  8.723   1.00 28.27  ? 209 PRO A CA   1 
ATOM   2413  C C    . PRO A 1 165 ? 66.875  -54.127  7.476   1.00 16.80  ? 209 PRO A C    1 
ATOM   2414  O O    . PRO A 1 165 ? 66.298  -53.036  7.563   1.00 17.40  ? 209 PRO A O    1 
ATOM   2415  C CB   . PRO A 1 165 ? 68.942  -54.543  8.875   1.00 14.80  ? 209 PRO A CB   1 
ATOM   2416  C CG   . PRO A 1 165 ? 69.461  -55.774  9.515   1.00 15.34  ? 209 PRO A CG   1 
ATOM   2417  C CD   . PRO A 1 165 ? 68.637  -56.897  8.960   1.00 18.35  ? 209 PRO A CD   1 
ATOM   2418  H HA   . PRO A 1 165 ? 66.975  -54.439  9.502   1.00 33.93  ? 209 PRO A HA   1 
ATOM   2419  H HB2  . PRO A 1 165 ? 69.343  -54.413  8.001   1.00 17.76  ? 209 PRO A HB2  1 
ATOM   2420  H HB3  . PRO A 1 165 ? 69.093  -53.770  9.442   1.00 17.76  ? 209 PRO A HB3  1 
ATOM   2421  H HG2  . PRO A 1 165 ? 70.396  -55.891  9.286   1.00 18.41  ? 209 PRO A HG2  1 
ATOM   2422  H HG3  . PRO A 1 165 ? 69.350  -55.713  10.477  1.00 18.41  ? 209 PRO A HG3  1 
ATOM   2423  H HD2  . PRO A 1 165 ? 69.027  -57.228  8.136   1.00 22.02  ? 209 PRO A HD2  1 
ATOM   2424  H HD3  . PRO A 1 165 ? 68.540  -57.604  9.617   1.00 22.02  ? 209 PRO A HD3  1 
ATOM   2425  N N    . GLY A 1 166 ? 67.036  -54.752  6.309   1.00 23.48  ? 210 GLY A N    1 
ATOM   2426  C CA   . GLY A 1 166 ? 66.465  -54.186  5.097   1.00 18.12  ? 210 GLY A CA   1 
ATOM   2427  C C    . GLY A 1 166 ? 64.948  -54.210  5.113   1.00 18.81  ? 210 GLY A C    1 
ATOM   2428  O O    . GLY A 1 166 ? 64.295  -53.218  4.778   1.00 18.27  ? 210 GLY A O    1 
ATOM   2429  H H    . GLY A 1 166 ? 67.463  -55.490  6.197   1.00 28.18  ? 210 GLY A H    1 
ATOM   2430  H HA2  . GLY A 1 166 ? 66.758  -53.267  5.001   1.00 21.74  ? 210 GLY A HA2  1 
ATOM   2431  H HA3  . GLY A 1 166 ? 66.773  -54.690  4.328   1.00 21.74  ? 210 GLY A HA3  1 
ATOM   2432  N N    . LEU A 1 167 ? 64.367  -55.346  5.505   1.00 15.93  ? 211 LEU A N    1 
ATOM   2433  C CA   . LEU A 1 167 ? 62.914  -55.441  5.590   1.00 17.94  ? 211 LEU A CA   1 
ATOM   2434  C C    . LEU A 1 167 ? 62.360  -54.481  6.636   1.00 18.46  ? 211 LEU A C    1 
ATOM   2435  O O    . LEU A 1 167 ? 61.290  -53.892  6.442   1.00 18.77  ? 211 LEU A O    1 
ATOM   2436  C CB   . LEU A 1 167 ? 62.500  -56.878  5.905   1.00 19.48  ? 211 LEU A CB   1 
ATOM   2437  C CG   . LEU A 1 167 ? 62.797  -57.903  4.809   1.00 21.08  ? 211 LEU A CG   1 
ATOM   2438  C CD1  . LEU A 1 167 ? 62.622  -59.321  5.331   1.00 20.04  ? 211 LEU A CD1  1 
ATOM   2439  C CD2  . LEU A 1 167 ? 61.904  -57.671  3.604   1.00 14.62  ? 211 LEU A CD2  1 
ATOM   2440  H H    . LEU A 1 167 ? 64.787  -56.064  5.724   1.00 19.11  ? 211 LEU A H    1 
ATOM   2441  H HA   . LEU A 1 167 ? 62.532  -55.201  4.732   1.00 21.53  ? 211 LEU A HA   1 
ATOM   2442  H HB2  . LEU A 1 167 ? 62.969  -57.164  6.705   1.00 23.38  ? 211 LEU A HB2  1 
ATOM   2443  H HB3  . LEU A 1 167 ? 61.544  -56.894  6.067   1.00 23.38  ? 211 LEU A HB3  1 
ATOM   2444  H HG   . LEU A 1 167 ? 63.718  -57.802  4.523   1.00 25.30  ? 211 LEU A HG   1 
ATOM   2445  H HD11 . LEU A 1 167 ? 62.816  -59.947  4.616   1.00 24.05  ? 211 LEU A HD11 1 
ATOM   2446  H HD12 . LEU A 1 167 ? 63.233  -59.462  6.071   1.00 24.05  ? 211 LEU A HD12 1 
ATOM   2447  H HD13 . LEU A 1 167 ? 61.706  -59.435  5.632   1.00 24.05  ? 211 LEU A HD13 1 
ATOM   2448  H HD21 . LEU A 1 167 ? 62.111  -58.332  2.925   1.00 17.55  ? 211 LEU A HD21 1 
ATOM   2449  H HD22 . LEU A 1 167 ? 60.977  -57.756  3.877   1.00 17.55  ? 211 LEU A HD22 1 
ATOM   2450  H HD23 . LEU A 1 167 ? 62.066  -56.779  3.258   1.00 17.55  ? 211 LEU A HD23 1 
ATOM   2451  N N    . GLN A 1 168 ? 63.076  -54.307  7.750   1.00 16.15  ? 212 GLN A N    1 
ATOM   2452  C CA   . GLN A 1 168 ? 62.624  -53.378  8.783   1.00 20.39  ? 212 GLN A CA   1 
ATOM   2453  C C    . GLN A 1 168 ? 62.527  -51.957  8.238   1.00 15.87  ? 212 GLN A C    1 
ATOM   2454  O O    . GLN A 1 168 ? 61.555  -51.244  8.512   1.00 16.21  ? 212 GLN A O    1 
ATOM   2455  C CB   . GLN A 1 168 ? 63.570  -53.429  9.982   1.00 21.40  ? 212 GLN A CB   1 
ATOM   2456  C CG   . GLN A 1 168 ? 63.097  -52.640  11.200  1.00 26.83  ? 212 GLN A CG   1 
ATOM   2457  C CD   . GLN A 1 168 ? 61.857  -53.234  11.847  1.00 34.19  ? 212 GLN A CD   1 
ATOM   2458  O OE1  . GLN A 1 168 ? 61.894  -54.335  12.397  1.00 16.19  ? 212 GLN A OE1  1 
ATOM   2459  N NE2  . GLN A 1 168 ? 60.751  -52.502  11.787  1.00 22.74  ? 212 GLN A NE2  1 
ATOM   2460  H H    . GLN A 1 168 ? 63.815  -54.709  7.928   1.00 19.39  ? 212 GLN A H    1 
ATOM   2461  H HA   . GLN A 1 168 ? 61.741  -53.645  9.084   1.00 24.47  ? 212 GLN A HA   1 
ATOM   2462  H HB2  . GLN A 1 168 ? 63.676  -54.354  10.254  1.00 25.68  ? 212 GLN A HB2  1 
ATOM   2463  H HB3  . GLN A 1 168 ? 64.430  -53.068  9.714   1.00 25.68  ? 212 GLN A HB3  1 
ATOM   2464  H HG2  . GLN A 1 168 ? 63.805  -52.630  11.863  1.00 32.20  ? 212 GLN A HG2  1 
ATOM   2465  H HG3  . GLN A 1 168 ? 62.887  -51.734  10.926  1.00 32.20  ? 212 GLN A HG3  1 
ATOM   2466  H HE21 . GLN A 1 168 ? 60.763  -51.736  11.396  1.00 27.29  ? 212 GLN A HE21 1 
ATOM   2467  H HE22 . GLN A 1 168 ? 60.022  -52.794  12.138  1.00 27.29  ? 212 GLN A HE22 1 
ATOM   2468  N N    . LYS A 1 169 ? 63.525  -51.531  7.459   1.00 19.05  ? 213 LYS A N    1 
ATOM   2469  C CA   . LYS A 1 169 ? 63.484  -50.204  6.852   1.00 13.10  ? 213 LYS A CA   1 
ATOM   2470  C C    . LYS A 1 169 ? 62.293  -50.067  5.912   1.00 16.50  ? 213 LYS A C    1 
ATOM   2471  O O    . LYS A 1 169 ? 61.579  -49.058  5.939   1.00 17.68  ? 213 LYS A O    1 
ATOM   2472  C CB   . LYS A 1 169 ? 64.791  -49.934  6.108   1.00 19.66  ? 213 LYS A CB   1 
ATOM   2473  C CG   . LYS A 1 169 ? 65.881  -49.321  6.977   1.00 36.27  ? 213 LYS A CG   1 
ATOM   2474  C CD   . LYS A 1 169 ? 67.275  -49.734  6.523   1.00 54.58  ? 213 LYS A CD   1 
ATOM   2475  C CE   . LYS A 1 169 ? 68.200  -48.534  6.394   1.00 50.75  ? 213 LYS A CE   1 
ATOM   2476  H H    . LYS A 1 169 ? 64.229  -51.987  7.271   1.00 22.86  ? 213 LYS A H    1 
ATOM   2477  H HA   . LYS A 1 169 ? 63.393  -49.539  7.552   1.00 15.72  ? 213 LYS A HA   1 
ATOM   2478  H HB2  . LYS A 1 169 ? 65.130  -50.772  5.757   1.00 23.59  ? 213 LYS A HB2  1 
ATOM   2479  H HB3  . LYS A 1 169 ? 64.614  -49.320  5.379   1.00 23.59  ? 213 LYS A HB3  1 
ATOM   2480  H HG2  . LYS A 1 169 ? 65.822  -48.355  6.928   1.00 43.52  ? 213 LYS A HG2  1 
ATOM   2481  H HG3  . LYS A 1 169 ? 65.762  -49.617  7.893   1.00 43.52  ? 213 LYS A HG3  1 
ATOM   2482  H HD2  . LYS A 1 169 ? 67.657  -50.343  7.175   1.00 65.50  ? 213 LYS A HD2  1 
ATOM   2483  H HD3  . LYS A 1 169 ? 67.215  -50.165  5.656   1.00 65.50  ? 213 LYS A HD3  1 
ATOM   2484  H HE2  . LYS A 1 169 ? 67.899  -47.980  5.657   1.00 60.90  ? 213 LYS A HE2  1 
ATOM   2485  H HE3  . LYS A 1 169 ? 68.176  -48.026  7.221   1.00 60.90  ? 213 LYS A HE3  1 
ATOM   2486  N N    . LEU A 1 170 ? 62.068  -51.072  5.062   1.00 16.59  ? 214 LEU A N    1 
ATOM   2487  C CA   . LEU A 1 170 ? 60.917  -51.034  4.167   1.00 10.53  ? 214 LEU A CA   1 
ATOM   2488  C C    . LEU A 1 170 ? 59.618  -51.001  4.957   1.00 14.01  ? 214 LEU A C    1 
ATOM   2489  O O    . LEU A 1 170 ? 58.688  -50.261  4.613   1.00 16.39  ? 214 LEU A O    1 
ATOM   2490  C CB   . LEU A 1 170 ? 60.943  -52.238  3.224   1.00 13.38  ? 214 LEU A CB   1 
ATOM   2491  C CG   . LEU A 1 170 ? 59.742  -52.405  2.285   1.00 16.01  ? 214 LEU A CG   1 
ATOM   2492  C CD1  . LEU A 1 170 ? 59.603  -51.207  1.362   1.00 12.58  ? 214 LEU A CD1  1 
ATOM   2493  C CD2  . LEU A 1 170 ? 59.867  -53.688  1.476   1.00 16.86  ? 214 LEU A CD2  1 
ATOM   2494  H H    . LEU A 1 170 ? 62.558  -51.775  4.988   1.00 19.91  ? 214 LEU A H    1 
ATOM   2495  H HA   . LEU A 1 170 ? 60.961  -50.229  3.627   1.00 12.64  ? 214 LEU A HA   1 
ATOM   2496  H HB2  . LEU A 1 170 ? 61.734  -52.170  2.668   1.00 16.05  ? 214 LEU A HB2  1 
ATOM   2497  H HB3  . LEU A 1 170 ? 60.999  -53.043  3.763   1.00 16.05  ? 214 LEU A HB3  1 
ATOM   2498  H HG   . LEU A 1 170 ? 58.934  -52.466  2.818   1.00 19.22  ? 214 LEU A HG   1 
ATOM   2499  H HD11 . LEU A 1 170 ? 58.837  -51.342  0.782   1.00 15.10  ? 214 LEU A HD11 1 
ATOM   2500  H HD12 . LEU A 1 170 ? 59.475  -50.409  1.898   1.00 15.10  ? 214 LEU A HD12 1 
ATOM   2501  H HD13 . LEU A 1 170 ? 60.410  -51.123  0.830   1.00 15.10  ? 214 LEU A HD13 1 
ATOM   2502  H HD21 . LEU A 1 170 ? 59.096  -53.768  0.892   1.00 20.23  ? 214 LEU A HD21 1 
ATOM   2503  H HD22 . LEU A 1 170 ? 60.680  -53.650  0.948   1.00 20.23  ? 214 LEU A HD22 1 
ATOM   2504  H HD23 . LEU A 1 170 ? 59.901  -54.443  2.084   1.00 20.23  ? 214 LEU A HD23 1 
ATOM   2505  N N    . HIS A 1 171 ? 59.539  -51.797  6.023   1.00 13.07  ? 215 HIS A N    1 
ATOM   2506  C CA   . HIS A 1 171 ? 58.362  -51.780  6.882   1.00 17.59  ? 215 HIS A CA   1 
ATOM   2507  C C    . HIS A 1 171 ? 58.114  -50.385  7.441   1.00 13.61  ? 215 HIS A C    1 
ATOM   2508  O O    . HIS A 1 171 ? 57.007  -49.847  7.333   1.00 13.65  ? 215 HIS A O    1 
ATOM   2509  C CB   . HIS A 1 171 ? 58.534  -52.788  8.018   1.00 16.30  ? 215 HIS A CB   1 
ATOM   2510  C CG   . HIS A 1 171 ? 57.479  -52.692  9.075   1.00 18.31  ? 215 HIS A CG   1 
ATOM   2511  N ND1  . HIS A 1 171 ? 57.553  -51.796  10.120  1.00 18.29  ? 215 HIS A ND1  1 
ATOM   2512  C CD2  . HIS A 1 171 ? 56.325  -53.379  9.248   1.00 13.98  ? 215 HIS A CD2  1 
ATOM   2513  C CE1  . HIS A 1 171 ? 56.489  -51.935  10.891  1.00 19.65  ? 215 HIS A CE1  1 
ATOM   2514  N NE2  . HIS A 1 171 ? 55.729  -52.889  10.384  1.00 19.98  ? 215 HIS A NE2  1 
ATOM   2515  H H    . HIS A 1 171 ? 60.149  -52.351  6.268   1.00 15.69  ? 215 HIS A H    1 
ATOM   2516  H HA   . HIS A 1 171 ? 57.585  -52.039  6.363   1.00 21.11  ? 215 HIS A HA   1 
ATOM   2517  H HB2  . HIS A 1 171 ? 58.503  -53.684  7.648   1.00 19.56  ? 215 HIS A HB2  1 
ATOM   2518  H HB3  . HIS A 1 171 ? 59.394  -52.637  8.442   1.00 19.56  ? 215 HIS A HB3  1 
ATOM   2519  H HD2  . HIS A 1 171 ? 55.998  -54.055  8.700   1.00 16.77  ? 215 HIS A HD2  1 
ATOM   2520  H HE1  . HIS A 1 171 ? 56.307  -51.446  11.660  1.00 23.59  ? 215 HIS A HE1  1 
ATOM   2521  H HE2  . HIS A 1 171 ? 54.982  -53.160  10.713  1.00 23.98  ? 215 HIS A HE2  1 
ATOM   2522  N N    . ASP A 1 172 ? 59.138  -49.783  8.048   1.00 17.87  ? 216 ASP A N    1 
ATOM   2523  C CA   . ASP A 1 172 ? 58.964  -48.474  8.667   1.00 17.23  ? 216 ASP A CA   1 
ATOM   2524  C C    . ASP A 1 172 ? 58.545  -47.429  7.641   1.00 16.70  ? 216 ASP A C    1 
ATOM   2525  O O    . ASP A 1 172 ? 57.687  -46.583  7.920   1.00 20.58  ? 216 ASP A O    1 
ATOM   2526  C CB   . ASP A 1 172 ? 60.255  -48.055  9.368   1.00 22.11  ? 216 ASP A CB   1 
ATOM   2527  C CG   . ASP A 1 172 ? 60.650  -49.010  10.480  1.00 22.79  ? 216 ASP A CG   1 
ATOM   2528  O OD1  . ASP A 1 172 ? 59.780  -49.777  10.946  1.00 17.47  ? 216 ASP A OD1  1 
ATOM   2529  O OD2  . ASP A 1 172 ? 61.830  -48.989  10.893  1.00 27.62  ? 216 ASP A OD2  1 
ATOM   2530  H H    . ASP A 1 172 ? 59.932  -50.108  8.113   1.00 21.45  ? 216 ASP A H    1 
ATOM   2531  H HA   . ASP A 1 172 ? 58.265  -48.533  9.337   1.00 20.68  ? 216 ASP A HA   1 
ATOM   2532  H HB2  . ASP A 1 172 ? 60.976  -48.035  8.719   1.00 26.54  ? 216 ASP A HB2  1 
ATOM   2533  H HB3  . ASP A 1 172 ? 60.133  -47.175  9.757   1.00 26.54  ? 216 ASP A HB3  1 
ATOM   2534  N N    . ALA A 1 173 ? 59.134  -47.474  6.444   1.00 19.12  ? 217 ALA A N    1 
ATOM   2535  C CA   . ALA A 1 173 ? 58.797  -46.489  5.422   1.00 22.17  ? 217 ALA A CA   1 
ATOM   2536  C C    . ALA A 1 173 ? 57.374  -46.683  4.917   1.00 11.90  ? 217 ALA A C    1 
ATOM   2537  O O    . ALA A 1 173 ? 56.656  -45.705  4.677   1.00 18.12  ? 217 ALA A O    1 
ATOM   2538  C CB   . ALA A 1 173 ? 59.791  -46.570  4.267   1.00 20.54  ? 217 ALA A CB   1 
ATOM   2539  H H    . ALA A 1 173 ? 59.721  -48.054  6.204   1.00 22.94  ? 217 ALA A H    1 
ATOM   2540  H HA   . ALA A 1 173 ? 58.858  -45.601  5.808   1.00 26.61  ? 217 ALA A HA   1 
ATOM   2541  H HB1  . ALA A 1 173 ? 59.551  -45.910  3.598   1.00 24.65  ? 217 ALA A HB1  1 
ATOM   2542  H HB2  . ALA A 1 173 ? 60.682  -46.392  4.604   1.00 24.65  ? 217 ALA A HB2  1 
ATOM   2543  H HB3  . ALA A 1 173 ? 59.754  -47.460  3.881   1.00 24.65  ? 217 ALA A HB3  1 
ATOM   2544  N N    . LEU A 1 174 ? 56.950  -47.935  4.737   1.00 16.04  ? 218 LEU A N    1 
ATOM   2545  C CA   . LEU A 1 174 ? 55.576  -48.194  4.322   1.00 24.79  ? 218 LEU A CA   1 
ATOM   2546  C C    . LEU A 1 174 ? 54.593  -47.779  5.406   1.00 13.33  ? 218 LEU A C    1 
ATOM   2547  O O    . LEU A 1 174 ? 53.505  -47.273  5.107   1.00 14.96  ? 218 LEU A O    1 
ATOM   2548  C CB   . LEU A 1 174 ? 55.401  -49.673  3.975   1.00 17.87  ? 218 LEU A CB   1 
ATOM   2549  C CG   . LEU A 1 174 ? 56.088  -50.127  2.687   1.00 13.60  ? 218 LEU A CG   1 
ATOM   2550  C CD1  . LEU A 1 174 ? 56.239  -51.636  2.667   1.00 19.45  ? 218 LEU A CD1  1 
ATOM   2551  C CD2  . LEU A 1 174 ? 55.305  -49.655  1.477   1.00 15.05  ? 218 LEU A CD2  1 
ATOM   2552  H H    . LEU A 1 174 ? 57.431  -48.640  4.848   1.00 19.25  ? 218 LEU A H    1 
ATOM   2553  H HA   . LEU A 1 174 ? 55.383  -47.674  3.526   1.00 29.75  ? 218 LEU A HA   1 
ATOM   2554  H HB2  . LEU A 1 174 ? 55.763  -50.204  4.702   1.00 21.44  ? 218 LEU A HB2  1 
ATOM   2555  H HB3  . LEU A 1 174 ? 54.453  -49.856  3.880   1.00 21.44  ? 218 LEU A HB3  1 
ATOM   2556  H HG   . LEU A 1 174 ? 56.974  -49.735  2.645   1.00 16.32  ? 218 LEU A HG   1 
ATOM   2557  H HD11 . LEU A 1 174 ? 56.676  -51.898  1.842   1.00 23.34  ? 218 LEU A HD11 1 
ATOM   2558  H HD12 . LEU A 1 174 ? 56.775  -51.909  3.428   1.00 23.34  ? 218 LEU A HD12 1 
ATOM   2559  H HD13 . LEU A 1 174 ? 55.359  -52.042  2.719   1.00 23.34  ? 218 LEU A HD13 1 
ATOM   2560  H HD21 . LEU A 1 174 ? 55.758  -49.953  0.672   1.00 18.06  ? 218 LEU A HD21 1 
ATOM   2561  H HD22 . LEU A 1 174 ? 54.412  -50.030  1.513   1.00 18.06  ? 218 LEU A HD22 1 
ATOM   2562  H HD23 . LEU A 1 174 ? 55.258  -48.686  1.490   1.00 18.06  ? 218 LEU A HD23 1 
ATOM   2563  N N    . ASP A 1 175 ? 54.960  -47.983  6.672   1.00 16.91  ? 219 ASP A N    1 
ATOM   2564  C CA   . ASP A 1 175 ? 54.097  -47.564  7.770   1.00 20.40  ? 219 ASP A CA   1 
ATOM   2565  C C    . ASP A 1 175 ? 53.952  -46.048  7.801   1.00 20.62  ? 219 ASP A C    1 
ATOM   2566  O O    . ASP A 1 175 ? 52.853  -45.525  8.028   1.00 19.61  ? 219 ASP A O    1 
ATOM   2567  C CB   . ASP A 1 175 ? 54.655  -48.087  9.093   1.00 26.56  ? 219 ASP A CB   1 
ATOM   2568  C CG   . ASP A 1 175 ? 53.658  -47.983  10.228  1.00 25.27  ? 219 ASP A CG   1 
ATOM   2569  O OD1  . ASP A 1 175 ? 52.526  -48.487  10.072  1.00 31.42  ? 219 ASP A OD1  1 
ATOM   2570  O OD2  . ASP A 1 175 ? 54.010  -47.408  11.279  1.00 42.09  ? 219 ASP A OD2  1 
ATOM   2571  H H    . ASP A 1 175 ? 55.695  -48.357  6.917   1.00 20.30  ? 219 ASP A H    1 
ATOM   2572  H HA   . ASP A 1 175 ? 53.215  -47.948  7.643   1.00 24.48  ? 219 ASP A HA   1 
ATOM   2573  H HB2  . ASP A 1 175 ? 54.894  -49.022  8.989   1.00 31.88  ? 219 ASP A HB2  1 
ATOM   2574  H HB3  . ASP A 1 175 ? 55.438  -47.569  9.334   1.00 31.88  ? 219 ASP A HB3  1 
ATOM   2575  N N    . ALA A 1 176 ? 55.048  -45.323  7.565   1.00 19.80  ? 220 ALA A N    1 
ATOM   2576  C CA   . ALA A 1 176 ? 54.978  -43.866  7.530   1.00 22.36  ? 220 ALA A CA   1 
ATOM   2577  C C    . ALA A 1 176 ? 54.029  -43.387  6.440   1.00 25.17  ? 220 ALA A C    1 
ATOM   2578  O O    . ALA A 1 176 ? 53.241  -42.458  6.655   1.00 27.08  ? 220 ALA A O    1 
ATOM   2579  C CB   . ALA A 1 176 ? 56.373  -43.277  7.318   1.00 16.53  ? 220 ALA A CB   1 
ATOM   2580  H H    . ALA A 1 176 ? 55.832  -45.647  7.425   1.00 23.76  ? 220 ALA A H    1 
ATOM   2581  H HA   . ALA A 1 176 ? 54.643  -43.545  8.382   1.00 26.84  ? 220 ALA A HA   1 
ATOM   2582  H HB1  . ALA A 1 176 ? 56.307  -42.310  7.297   1.00 19.84  ? 220 ALA A HB1  1 
ATOM   2583  H HB2  . ALA A 1 176 ? 56.947  -43.554  8.049   1.00 19.84  ? 220 ALA A HB2  1 
ATOM   2584  H HB3  . ALA A 1 176 ? 56.728  -43.603  6.476   1.00 19.84  ? 220 ALA A HB3  1 
ATOM   2585  N N    . LYS A 1 177 ? 54.090  -44.006  5.258   1.00 16.71  ? 221 LYS A N    1 
ATOM   2586  C CA   . LYS A 1 177 ? 53.204  -43.604  4.171   1.00 25.49  ? 221 LYS A CA   1 
ATOM   2587  C C    . LYS A 1 177 ? 51.759  -43.982  4.456   1.00 22.71  ? 221 LYS A C    1 
ATOM   2588  O O    . LYS A 1 177 ? 50.843  -43.246  4.070   1.00 21.55  ? 221 LYS A O    1 
ATOM   2589  C CB   . LYS A 1 177 ? 53.668  -44.231  2.856   1.00 22.03  ? 221 LYS A CB   1 
ATOM   2590  C CG   . LYS A 1 177 ? 54.983  -43.671  2.350   1.00 33.62  ? 221 LYS A CG   1 
ATOM   2591  C CD   . LYS A 1 177 ? 54.820  -42.252  1.821   1.00 18.30  ? 221 LYS A CD   1 
ATOM   2592  C CE   . LYS A 1 177 ? 56.131  -41.492  1.869   1.00 23.86  ? 221 LYS A CE   1 
ATOM   2593  N NZ   . LYS A 1 177 ? 56.015  -40.150  1.241   1.00 31.55  ? 221 LYS A NZ   1 
ATOM   2594  H H    . LYS A 1 177 ? 54.627  -44.649  5.066   1.00 20.05  ? 221 LYS A H    1 
ATOM   2595  H HA   . LYS A 1 177 ? 53.246  -42.640  4.073   1.00 30.59  ? 221 LYS A HA   1 
ATOM   2596  H HB2  . LYS A 1 177 ? 53.782  -45.185  2.987   1.00 26.44  ? 221 LYS A HB2  1 
ATOM   2597  H HB3  . LYS A 1 177 ? 52.995  -44.069  2.177   1.00 26.44  ? 221 LYS A HB3  1 
ATOM   2598  H HG2  . LYS A 1 177 ? 55.624  -43.652  3.077   1.00 40.35  ? 221 LYS A HG2  1 
ATOM   2599  H HG3  . LYS A 1 177 ? 55.311  -44.229  1.627   1.00 40.35  ? 221 LYS A HG3  1 
ATOM   2600  H HD2  . LYS A 1 177 ? 54.522  -42.286  0.898   1.00 21.96  ? 221 LYS A HD2  1 
ATOM   2601  H HD3  . LYS A 1 177 ? 54.173  -41.779  2.366   1.00 21.96  ? 221 LYS A HD3  1 
ATOM   2602  H HE2  . LYS A 1 177 ? 56.396  -41.371  2.795   1.00 28.63  ? 221 LYS A HE2  1 
ATOM   2603  H HE3  . LYS A 1 177 ? 56.809  -41.994  1.390   1.00 28.63  ? 221 LYS A HE3  1 
ATOM   2604  H HZ1  . LYS A 1 177 ? 56.797  -39.727  1.283   1.00 37.86  ? 221 LYS A HZ1  1 
ATOM   2605  H HZ2  . LYS A 1 177 ? 55.777  -40.234  0.387   1.00 37.86  ? 221 LYS A HZ2  1 
ATOM   2606  H HZ3  . LYS A 1 177 ? 55.401  -39.667  1.667   1.00 37.86  ? 221 LYS A HZ3  1 
ATOM   2607  N N    . SER A 1 178 ? 51.532  -45.113  5.124   1.00 19.39  ? 222 SER A N    1 
ATOM   2608  C CA   . SER A 1 178 ? 50.175  -45.483  5.506   1.00 18.81  ? 222 SER A CA   1 
ATOM   2609  C C    . SER A 1 178 ? 49.555  -44.407  6.389   1.00 19.16  ? 222 SER A C    1 
ATOM   2610  O O    . SER A 1 178 ? 48.408  -43.996  6.179   1.00 22.93  ? 222 SER A O    1 
ATOM   2611  C CB   . SER A 1 178 ? 50.183  -46.834  6.224   1.00 20.12  ? 222 SER A CB   1 
ATOM   2612  O OG   . SER A 1 178 ? 48.865  -47.306  6.439   1.00 29.55  ? 222 SER A OG   1 
ATOM   2613  H H    . SER A 1 178 ? 52.138  -45.674  5.363   1.00 23.28  ? 222 SER A H    1 
ATOM   2614  H HA   . SER A 1 178 ? 49.631  -45.568  4.708   1.00 22.58  ? 222 SER A HA   1 
ATOM   2615  H HB2  . SER A 1 178 ? 50.663  -47.476  5.679   1.00 24.15  ? 222 SER A HB2  1 
ATOM   2616  H HB3  . SER A 1 178 ? 50.625  -46.732  7.081   1.00 24.15  ? 222 SER A HB3  1 
ATOM   2617  H HG   . SER A 1 178 ? 48.470  -47.400  5.703   1.00 35.47  ? 222 SER A HG   1 
ATOM   2618  N N    . LYS A 1 179 ? 50.309  -43.932  7.382   1.00 22.92  ? 223 LYS A N    1 
ATOM   2619  C CA   . LYS A 1 179 ? 49.821  -42.861  8.244   1.00 32.76  ? 223 LYS A CA   1 
ATOM   2620  C C    . LYS A 1 179 ? 49.677  -41.557  7.471   1.00 28.13  ? 223 LYS A C    1 
ATOM   2621  O O    . LYS A 1 179 ? 48.697  -40.825  7.650   1.00 26.39  ? 223 LYS A O    1 
ATOM   2622  C CB   . LYS A 1 179 ? 50.768  -42.681  9.431   1.00 26.55  ? 223 LYS A CB   1 
ATOM   2623  C CG   . LYS A 1 179 ? 50.788  -43.862  10.389  1.00 34.10  ? 223 LYS A CG   1 
ATOM   2624  C CD   . LYS A 1 179 ? 52.085  -43.925  11.180  1.00 42.96  ? 223 LYS A CD   1 
ATOM   2625  C CE   . LYS A 1 179 ? 51.970  -44.865  12.373  1.00 41.93  ? 223 LYS A CE   1 
ATOM   2626  N NZ   . LYS A 1 179 ? 51.213  -46.111  12.057  1.00 55.88  ? 223 LYS A NZ   1 
ATOM   2627  H H    . LYS A 1 179 ? 51.100  -44.211  7.574   1.00 27.51  ? 223 LYS A H    1 
ATOM   2628  H HA   . LYS A 1 179 ? 48.948  -43.105  8.590   1.00 39.32  ? 223 LYS A HA   1 
ATOM   2629  H HB2  . LYS A 1 179 ? 51.670  -42.558  9.094   1.00 31.86  ? 223 LYS A HB2  1 
ATOM   2630  H HB3  . LYS A 1 179 ? 50.494  -41.897  9.932   1.00 31.86  ? 223 LYS A HB3  1 
ATOM   2631  H HG2  . LYS A 1 179 ? 50.054  -43.775  11.017  1.00 40.92  ? 223 LYS A HG2  1 
ATOM   2632  H HG3  . LYS A 1 179 ? 50.701  -44.685  9.883   1.00 40.92  ? 223 LYS A HG3  1 
ATOM   2633  H HD2  . LYS A 1 179 ? 52.795  -44.250  10.604  1.00 51.56  ? 223 LYS A HD2  1 
ATOM   2634  H HD3  . LYS A 1 179 ? 52.301  -43.039  11.511  1.00 51.56  ? 223 LYS A HD3  1 
ATOM   2635  H HE2  . LYS A 1 179 ? 52.861  -45.120  12.660  1.00 50.32  ? 223 LYS A HE2  1 
ATOM   2636  H HE3  . LYS A 1 179 ? 51.507  -44.407  13.092  1.00 50.32  ? 223 LYS A HE3  1 
ATOM   2637  H HZ1  . LYS A 1 179 ? 51.169  -46.631  12.778  1.00 67.06  ? 223 LYS A HZ1  1 
ATOM   2638  H HZ2  . LYS A 1 179 ? 50.387  -45.907  11.796  1.00 67.06  ? 223 LYS A HZ2  1 
ATOM   2639  H HZ3  . LYS A 1 179 ? 51.620  -46.557  11.403  1.00 67.06  ? 223 LYS A HZ3  1 
ATOM   2640  N N    . GLU A 1 180 ? 50.647  -41.254  6.606   1.00 27.88  ? 224 GLU A N    1 
ATOM   2641  C CA   . GLU A 1 180 ? 50.581  -40.040  5.801   1.00 18.32  ? 224 GLU A CA   1 
ATOM   2642  C C    . GLU A 1 180 ? 49.368  -40.041  4.878   1.00 33.40  ? 224 GLU A C    1 
ATOM   2643  O O    . GLU A 1 180 ? 48.825  -38.974  4.563   1.00 25.32  ? 224 GLU A O    1 
ATOM   2644  C CB   . GLU A 1 180 ? 51.873  -39.899  4.994   1.00 24.79  ? 224 GLU A CB   1 
ATOM   2645  C CG   . GLU A 1 180 ? 51.947  -38.680  4.090   1.00 28.34  ? 224 GLU A CG   1 
ATOM   2646  C CD   . GLU A 1 180 ? 53.269  -38.598  3.346   1.00 38.84  ? 224 GLU A CD   1 
ATOM   2647  O OE1  . GLU A 1 180 ? 54.229  -39.283  3.760   1.00 39.13  ? 224 GLU A OE1  1 
ATOM   2648  O OE2  . GLU A 1 180 ? 53.348  -37.855  2.345   1.00 38.91  ? 224 GLU A OE2  1 
ATOM   2649  H H    . GLU A 1 180 ? 51.348  -41.733  6.469   1.00 33.46  ? 224 GLU A H    1 
ATOM   2650  H HA   . GLU A 1 180 ? 50.510  -39.272  6.390   1.00 21.98  ? 224 GLU A HA   1 
ATOM   2651  H HB2  . GLU A 1 180 ? 52.618  -39.848  5.613   1.00 29.75  ? 224 GLU A HB2  1 
ATOM   2652  H HB3  . GLU A 1 180 ? 51.971  -40.684  4.432   1.00 29.75  ? 224 GLU A HB3  1 
ATOM   2653  H HG2  . GLU A 1 180 ? 51.233  -38.726  3.434   1.00 34.02  ? 224 GLU A HG2  1 
ATOM   2654  H HG3  . GLU A 1 180 ? 51.853  -37.879  4.629   1.00 34.02  ? 224 GLU A HG3  1 
ATOM   2655  N N    . PHE A 1 181 ? 48.923  -41.222  4.443   1.00 22.63  ? 225 PHE A N    1 
ATOM   2656  C CA   . PHE A 1 181 ? 47.826  -41.351  3.492   1.00 27.09  ? 225 PHE A CA   1 
ATOM   2657  C C    . PHE A 1 181 ? 46.529  -41.809  4.153   1.00 20.97  ? 225 PHE A C    1 
ATOM   2658  O O    . PHE A 1 181 ? 45.620  -42.283  3.463   1.00 19.44  ? 225 PHE A O    1 
ATOM   2659  C CB   . PHE A 1 181 ? 48.211  -42.327  2.379   1.00 24.14  ? 225 PHE A CB   1 
ATOM   2660  C CG   . PHE A 1 181 ? 49.392  -41.895  1.554   1.00 22.81  ? 225 PHE A CG   1 
ATOM   2661  C CD1  . PHE A 1 181 ? 49.726  -40.556  1.428   1.00 21.38  ? 225 PHE A CD1  1 
ATOM   2662  C CD2  . PHE A 1 181 ? 50.164  -42.838  0.892   1.00 21.75  ? 225 PHE A CD2  1 
ATOM   2663  C CE1  . PHE A 1 181 ? 50.810  -40.169  0.661   1.00 23.99  ? 225 PHE A CE1  1 
ATOM   2664  C CE2  . PHE A 1 181 ? 51.247  -42.455  0.126   1.00 28.65  ? 225 PHE A CE2  1 
ATOM   2665  C CZ   . PHE A 1 181 ? 51.571  -41.121  0.009   1.00 23.42  ? 225 PHE A CZ   1 
ATOM   2666  H H    . PHE A 1 181 ? 49.251  -41.977  4.692   1.00 27.16  ? 225 PHE A H    1 
ATOM   2667  H HA   . PHE A 1 181 ? 47.662  -40.486  3.085   1.00 32.51  ? 225 PHE A HA   1 
ATOM   2668  H HB2  . PHE A 1 181 ? 48.428  -43.184  2.778   1.00 28.97  ? 225 PHE A HB2  1 
ATOM   2669  H HB3  . PHE A 1 181 ? 47.455  -42.428  1.780   1.00 28.97  ? 225 PHE A HB3  1 
ATOM   2670  H HD1  . PHE A 1 181 ? 49.217  -39.912  1.863   1.00 25.66  ? 225 PHE A HD1  1 
ATOM   2671  H HD2  . PHE A 1 181 ? 49.950  -43.740  0.966   1.00 26.11  ? 225 PHE A HD2  1 
ATOM   2672  H HE1  . PHE A 1 181 ? 51.027  -39.268  0.585   1.00 28.79  ? 225 PHE A HE1  1 
ATOM   2673  H HE2  . PHE A 1 181 ? 51.758  -43.098  -0.311  1.00 34.38  ? 225 PHE A HE2  1 
ATOM   2674  H HZ   . PHE A 1 181 ? 52.301  -40.861  -0.505  1.00 28.10  ? 225 PHE A HZ   1 
ATOM   2675  N N    . ALA A 1 182 ? 46.418  -41.663  5.473   1.00 24.38  ? 226 ALA A N    1 
ATOM   2676  C CA   . ALA A 1 182 ? 45.272  -42.207  6.191   1.00 27.22  ? 226 ALA A CA   1 
ATOM   2677  C C    . ALA A 1 182 ? 43.956  -41.539  5.806   1.00 30.74  ? 226 ALA A C    1 
ATOM   2678  O O    . ALA A 1 182 ? 42.898  -42.159  5.957   1.00 23.37  ? 226 ALA A O    1 
ATOM   2679  C CB   . ALA A 1 182 ? 45.496  -42.072  7.698   1.00 24.59  ? 226 ALA A CB   1 
ATOM   2680  H H    . ALA A 1 182 ? 46.989  -41.255  5.971   1.00 29.26  ? 226 ALA A H    1 
ATOM   2681  H HA   . ALA A 1 182 ? 45.196  -43.152  5.986   1.00 32.66  ? 226 ALA A HA   1 
ATOM   2682  H HB1  . ALA A 1 182 ? 44.728  -42.436  8.165   1.00 29.52  ? 226 ALA A HB1  1 
ATOM   2683  H HB2  . ALA A 1 182 ? 46.296  -42.562  7.943   1.00 29.52  ? 226 ALA A HB2  1 
ATOM   2684  H HB3  . ALA A 1 182 ? 45.602  -41.133  7.918   1.00 29.52  ? 226 ALA A HB3  1 
ATOM   2685  N N    . GLN A 1 183 ? 43.989  -40.302  5.312   1.00 27.84  ? 227 GLN A N    1 
ATOM   2686  C CA   . GLN A 1 183 ? 42.772  -39.552  5.028   1.00 37.15  ? 227 GLN A CA   1 
ATOM   2687  C C    . GLN A 1 183 ? 42.423  -39.504  3.546   1.00 33.16  ? 227 GLN A C    1 
ATOM   2688  O O    . GLN A 1 183 ? 41.395  -38.920  3.190   1.00 29.37  ? 227 GLN A O    1 
ATOM   2689  C CB   . GLN A 1 183 ? 42.898  -38.119  5.561   1.00 45.88  ? 227 GLN A CB   1 
ATOM   2690  C CG   . GLN A 1 183 ? 43.433  -38.017  6.983   1.00 54.23  ? 227 GLN A CG   1 
ATOM   2691  C CD   . GLN A 1 183 ? 42.624  -38.826  7.976   1.00 59.74  ? 227 GLN A CD   1 
ATOM   2692  O OE1  . GLN A 1 183 ? 41.460  -39.148  7.734   1.00 79.58  ? 227 GLN A OE1  1 
ATOM   2693  N NE2  . GLN A 1 183 ? 43.241  -39.165  9.103   1.00 69.74  ? 227 GLN A NE2  1 
ATOM   2694  H H    . GLN A 1 183 ? 44.713  -39.872  5.133   1.00 33.41  ? 227 GLN A H    1 
ATOM   2695  H HA   . GLN A 1 183 ? 42.033  -39.975  5.491   1.00 44.58  ? 227 GLN A HA   1 
ATOM   2696  H HB2  . GLN A 1 183 ? 43.502  -37.626  4.984   1.00 55.06  ? 227 GLN A HB2  1 
ATOM   2697  H HB3  . GLN A 1 183 ? 42.021  -37.705  5.546   1.00 55.06  ? 227 GLN A HB3  1 
ATOM   2698  H HG2  . GLN A 1 183 ? 44.345  -38.345  7.002   1.00 65.08  ? 227 GLN A HG2  1 
ATOM   2699  H HG3  . GLN A 1 183 ? 43.409  -37.089  7.263   1.00 65.08  ? 227 GLN A HG3  1 
ATOM   2700  H HE21 . GLN A 1 183 ? 44.056  -38.925  9.236   1.00 83.70  ? 227 GLN A HE21 1 
ATOM   2701  H HE22 . GLN A 1 183 ? 42.825  -39.624  9.700   1.00 83.70  ? 227 GLN A HE22 1 
ATOM   2702  N N    . ILE A 1 184 ? 43.235  -40.097  2.677   1.00 27.50  ? 228 ILE A N    1 
ATOM   2703  C CA   . ILE A 1 184 ? 43.020  -40.017  1.236   1.00 24.23  ? 228 ILE A CA   1 
ATOM   2704  C C    . ILE A 1 184 ? 42.134  -41.186  0.818   1.00 23.30  ? 228 ILE A C    1 
ATOM   2705  O O    . ILE A 1 184 ? 42.589  -42.331  0.749   1.00 23.23  ? 228 ILE A O    1 
ATOM   2706  C CB   . ILE A 1 184 ? 44.347  -40.016  0.468   1.00 22.25  ? 228 ILE A CB   1 
ATOM   2707  C CG1  . ILE A 1 184 ? 45.191  -38.807  0.886   1.00 21.79  ? 228 ILE A CG1  1 
ATOM   2708  C CG2  . ILE A 1 184 ? 44.091  -39.994  -1.037  1.00 28.73  ? 228 ILE A CG2  1 
ATOM   2709  C CD1  . ILE A 1 184 ? 46.591  -38.790  0.306   1.00 27.55  ? 228 ILE A CD1  1 
ATOM   2710  H H    . ILE A 1 184 ? 43.926  -40.558  2.900   1.00 33.00  ? 228 ILE A H    1 
ATOM   2711  H HA   . ILE A 1 184 ? 42.551  -39.193  1.029   1.00 29.08  ? 228 ILE A HA   1 
ATOM   2712  H HB   . ILE A 1 184 ? 44.834  -40.826  0.688   1.00 26.71  ? 228 ILE A HB   1 
ATOM   2713  H HG12 . ILE A 1 184 ? 44.741  -37.999  0.595   1.00 26.15  ? 228 ILE A HG12 1 
ATOM   2714  H HG13 . ILE A 1 184 ? 45.273  -38.805  1.853   1.00 26.15  ? 228 ILE A HG13 1 
ATOM   2715  H HG21 . ILE A 1 184 ? 44.942  -39.994  -1.502  1.00 34.48  ? 228 ILE A HG21 1 
ATOM   2716  H HG22 . ILE A 1 184 ? 43.580  -40.781  -1.282  1.00 34.48  ? 228 ILE A HG22 1 
ATOM   2717  H HG23 . ILE A 1 184 ? 43.592  -39.192  -1.260  1.00 34.48  ? 228 ILE A HG23 1 
ATOM   2718  H HD11 . ILE A 1 184 ? 47.052  -37.996  0.619   1.00 33.06  ? 228 ILE A HD11 1 
ATOM   2719  H HD12 . ILE A 1 184 ? 47.063  -39.585  0.598   1.00 33.06  ? 228 ILE A HD12 1 
ATOM   2720  H HD13 . ILE A 1 184 ? 46.530  -38.777  -0.662  1.00 33.06  ? 228 ILE A HD13 1 
ATOM   2721  N N    . ILE A 1 185 ? 40.871  -40.893  0.528   1.00 20.32  ? 229 ILE A N    1 
ATOM   2722  C CA   . ILE A 1 185 ? 39.909  -41.904  0.106   1.00 19.83  ? 229 ILE A CA   1 
ATOM   2723  C C    . ILE A 1 185 ? 40.034  -42.097  -1.398  1.00 17.36  ? 229 ILE A C    1 
ATOM   2724  O O    . ILE A 1 185 ? 40.098  -41.123  -2.157  1.00 29.61  ? 229 ILE A O    1 
ATOM   2725  C CB   . ILE A 1 185 ? 38.476  -41.495  0.489   1.00 17.89  ? 229 ILE A CB   1 
ATOM   2726  C CG1  . ILE A 1 185 ? 38.389  -41.205  1.991   1.00 23.86  ? 229 ILE A CG1  1 
ATOM   2727  C CG2  . ILE A 1 185 ? 37.493  -42.592  0.094   1.00 27.41  ? 229 ILE A CG2  1 
ATOM   2728  C CD1  . ILE A 1 185 ? 37.038  -40.694  2.454   1.00 23.27  ? 229 ILE A CD1  1 
ATOM   2729  H H    . ILE A 1 185 ? 40.541  -40.100  0.568   1.00 24.39  ? 229 ILE A H    1 
ATOM   2730  H HA   . ILE A 1 185 ? 40.114  -42.746  0.541   1.00 23.80  ? 229 ILE A HA   1 
ATOM   2731  H HB   . ILE A 1 185 ? 38.246  -40.687  0.005   1.00 21.48  ? 229 ILE A HB   1 
ATOM   2732  H HG12 . ILE A 1 185 ? 38.577  -42.023  2.477   1.00 28.64  ? 229 ILE A HG12 1 
ATOM   2733  H HG13 . ILE A 1 185 ? 39.051  -40.532  2.215   1.00 28.64  ? 229 ILE A HG13 1 
ATOM   2734  H HG21 . ILE A 1 185 ? 36.597  -42.318  0.343   1.00 32.90  ? 229 ILE A HG21 1 
ATOM   2735  H HG22 . ILE A 1 185 ? 37.543  -42.730  -0.865  1.00 32.90  ? 229 ILE A HG22 1 
ATOM   2736  H HG23 . ILE A 1 185 ? 37.730  -43.410  0.559   1.00 32.90  ? 229 ILE A HG23 1 
ATOM   2737  H HD11 . ILE A 1 185 ? 37.072  -40.537  3.411   1.00 27.93  ? 229 ILE A HD11 1 
ATOM   2738  H HD12 . ILE A 1 185 ? 36.838  -39.866  1.989   1.00 27.93  ? 229 ILE A HD12 1 
ATOM   2739  H HD13 . ILE A 1 185 ? 36.363  -41.360  2.251   1.00 27.93  ? 229 ILE A HD13 1 
ATOM   2740  N N    . LYS A 1 186 ? 40.062  -43.354  -1.831  1.00 16.57  ? 230 LYS A N    1 
ATOM   2741  C CA   . LYS A 1 186 ? 40.154  -43.682  -3.244  1.00 24.92  ? 230 LYS A CA   1 
ATOM   2742  C C    . LYS A 1 186 ? 39.262  -44.879  -3.536  1.00 14.54  ? 230 LYS A C    1 
ATOM   2743  O O    . LYS A 1 186 ? 38.682  -45.487  -2.634  1.00 17.67  ? 230 LYS A O    1 
ATOM   2744  C CB   . LYS A 1 186 ? 41.597  -43.978  -3.661  1.00 23.28  ? 230 LYS A CB   1 
ATOM   2745  C CG   . LYS A 1 186 ? 42.203  -45.188  -2.972  1.00 33.85  ? 230 LYS A CG   1 
ATOM   2746  C CD   . LYS A 1 186 ? 43.479  -45.598  -3.662  1.00 57.20  ? 230 LYS A CD   1 
ATOM   2747  C CE   . LYS A 1 186 ? 44.124  -46.783  -2.984  1.00 36.02  ? 230 LYS A CE   1 
ATOM   2748  N NZ   . LYS A 1 186 ? 43.242  -47.978  -3.014  1.00 58.96  ? 230 LYS A NZ   1 
ATOM   2749  H H    . LYS A 1 186 ? 40.029  -44.042  -1.316  1.00 19.89  ? 230 LYS A H    1 
ATOM   2750  H HA   . LYS A 1 186 ? 39.835  -42.930  -3.768  1.00 29.90  ? 230 LYS A HA   1 
ATOM   2751  H HB2  . LYS A 1 186 ? 41.619  -44.140  -4.617  1.00 27.93  ? 230 LYS A HB2  1 
ATOM   2752  H HB3  . LYS A 1 186 ? 42.148  -43.209  -3.446  1.00 27.93  ? 230 LYS A HB3  1 
ATOM   2753  H HG2  . LYS A 1 186 ? 42.409  -44.966  -2.050  1.00 40.62  ? 230 LYS A HG2  1 
ATOM   2754  H HG3  . LYS A 1 186 ? 41.580  -45.929  -3.012  1.00 40.62  ? 230 LYS A HG3  1 
ATOM   2755  H HD2  . LYS A 1 186 ? 43.282  -45.843  -4.579  1.00 68.65  ? 230 LYS A HD2  1 
ATOM   2756  H HD3  . LYS A 1 186 ? 44.106  -44.858  -3.640  1.00 68.65  ? 230 LYS A HD3  1 
ATOM   2757  H HE2  . LYS A 1 186 ? 44.950  -47.003  -3.443  1.00 43.23  ? 230 LYS A HE2  1 
ATOM   2758  H HE3  . LYS A 1 186 ? 44.305  -46.562  -2.057  1.00 43.23  ? 230 LYS A HE3  1 
ATOM   2759  H HZ1  . LYS A 1 186 ? 43.643  -48.662  -2.609  1.00 70.76  ? 230 LYS A HZ1  1 
ATOM   2760  H HZ2  . LYS A 1 186 ? 42.477  -47.802  -2.594  1.00 70.76  ? 230 LYS A HZ2  1 
ATOM   2761  H HZ3  . LYS A 1 186 ? 43.065  -48.204  -3.856  1.00 70.76  ? 230 LYS A HZ3  1 
ATOM   2762  N N    . ILE A 1 187 ? 39.171  -45.219  -4.816  1.00 17.58  ? 231 ILE A N    1 
ATOM   2763  C CA   . ILE A 1 187 ? 38.340  -46.324  -5.275  1.00 26.16  ? 231 ILE A CA   1 
ATOM   2764  C C    . ILE A 1 187 ? 39.144  -47.615  -5.196  1.00 20.81  ? 231 ILE A C    1 
ATOM   2765  O O    . ILE A 1 187 ? 40.257  -47.702  -5.726  1.00 27.93  ? 231 ILE A O    1 
ATOM   2766  C CB   . ILE A 1 187 ? 37.837  -46.070  -6.706  1.00 19.00  ? 231 ILE A CB   1 
ATOM   2767  C CG1  . ILE A 1 187 ? 36.969  -44.807  -6.751  1.00 32.47  ? 231 ILE A CG1  1 
ATOM   2768  C CG2  . ILE A 1 187 ? 37.065  -47.271  -7.238  1.00 23.65  ? 231 ILE A CG2  1 
ATOM   2769  C CD1  . ILE A 1 187 ? 35.698  -44.879  -5.912  1.00 37.77  ? 231 ILE A CD1  1 
ATOM   2770  H H    . ILE A 1 187 ? 39.590  -44.817  -5.450  1.00 21.10  ? 231 ILE A H    1 
ATOM   2771  H HA   . ILE A 1 187 ? 37.569  -46.409  -4.692  1.00 31.39  ? 231 ILE A HA   1 
ATOM   2772  H HB   . ILE A 1 187 ? 38.608  -45.928  -7.277  1.00 22.81  ? 231 ILE A HB   1 
ATOM   2773  H HG12 . ILE A 1 187 ? 37.493  -44.059  -6.426  1.00 38.96  ? 231 ILE A HG12 1 
ATOM   2774  H HG13 . ILE A 1 187 ? 36.704  -44.646  -7.670  1.00 38.96  ? 231 ILE A HG13 1 
ATOM   2775  H HG21 . ILE A 1 187 ? 36.764  -47.077  -8.140  1.00 28.38  ? 231 ILE A HG21 1 
ATOM   2776  H HG22 . ILE A 1 187 ? 37.650  -48.045  -7.243  1.00 28.38  ? 231 ILE A HG22 1 
ATOM   2777  H HG23 . ILE A 1 187 ? 36.303  -47.436  -6.662  1.00 28.38  ? 231 ILE A HG23 1 
ATOM   2778  H HD11 . ILE A 1 187 ? 35.215  -44.043  -5.999  1.00 45.33  ? 231 ILE A HD11 1 
ATOM   2779  H HD12 . ILE A 1 187 ? 35.151  -45.613  -6.230  1.00 45.33  ? 231 ILE A HD12 1 
ATOM   2780  H HD13 . ILE A 1 187 ? 35.941  -45.025  -4.984  1.00 45.33  ? 231 ILE A HD13 1 
ATOM   2781  N N    . GLY A 1 188 ? 38.584  -48.615  -4.524  1.00 19.34  ? 232 GLY A N    1 
ATOM   2782  C CA   . GLY A 1 188 ? 39.214  -49.915  -4.484  1.00 22.05  ? 232 GLY A CA   1 
ATOM   2783  C C    . GLY A 1 188 ? 39.077  -50.649  -5.802  1.00 18.91  ? 232 GLY A C    1 
ATOM   2784  O O    . GLY A 1 188 ? 38.273  -50.299  -6.667  1.00 14.90  ? 232 GLY A O    1 
ATOM   2785  H H    . GLY A 1 188 ? 37.844  -48.562  -4.089  1.00 23.21  ? 232 GLY A H    1 
ATOM   2786  H HA2  . GLY A 1 188 ? 40.157  -49.813  -4.284  1.00 26.47  ? 232 GLY A HA2  1 
ATOM   2787  H HA3  . GLY A 1 188 ? 38.806  -50.452  -3.787  1.00 26.47  ? 232 GLY A HA3  1 
ATOM   2788  N N    . ARG A 1 189 ? 39.887  -51.693  -5.960  1.00 20.81  ? 233 ARG A N    1 
ATOM   2789  C CA   . ARG A 1 189 ? 39.887  -52.482  -7.186  1.00 20.24  ? 233 ARG A CA   1 
ATOM   2790  C C    . ARG A 1 189 ? 39.903  -53.958  -6.829  1.00 12.71  ? 233 ARG A C    1 
ATOM   2791  O O    . ARG A 1 189 ? 40.841  -54.435  -6.184  1.00 15.54  ? 233 ARG A O    1 
ATOM   2792  C CB   . ARG A 1 189 ? 41.081  -52.128  -8.076  1.00 19.21  ? 233 ARG A CB   1 
ATOM   2793  C CG   . ARG A 1 189 ? 41.055  -50.699  -8.583  1.00 16.42  ? 233 ARG A CG   1 
ATOM   2794  C CD   . ARG A 1 189 ? 42.164  -50.439  -9.582  1.00 20.40  ? 233 ARG A CD   1 
ATOM   2795  N NE   . ARG A 1 189 ? 42.203  -49.040  -9.995  1.00 15.44  ? 233 ARG A NE   1 
ATOM   2796  C CZ   . ARG A 1 189 ? 42.759  -48.062  -9.286  1.00 16.62  ? 233 ARG A CZ   1 
ATOM   2797  N NH1  . ARG A 1 189 ? 43.325  -48.320  -8.116  1.00 24.60  ? 233 ARG A NH1  1 
ATOM   2798  N NH2  . ARG A 1 189 ? 42.745  -46.821  -9.747  1.00 22.87  ? 233 ARG A NH2  1 
ATOM   2799  H H    . ARG A 1 189 ? 40.449  -51.965  -5.368  1.00 24.97  ? 233 ARG A H    1 
ATOM   2800  H HA   . ARG A 1 189 ? 39.074  -52.299  -7.683  1.00 24.29  ? 233 ARG A HA   1 
ATOM   2801  H HB2  . ARG A 1 189 ? 41.898  -52.248  -7.566  1.00 23.05  ? 233 ARG A HB2  1 
ATOM   2802  H HB3  . ARG A 1 189 ? 41.084  -52.718  -8.846  1.00 23.05  ? 233 ARG A HB3  1 
ATOM   2803  H HG2  . ARG A 1 189 ? 40.206  -50.532  -9.022  1.00 19.70  ? 233 ARG A HG2  1 
ATOM   2804  H HG3  . ARG A 1 189 ? 41.171  -50.093  -7.835  1.00 19.70  ? 233 ARG A HG3  1 
ATOM   2805  H HD2  . ARG A 1 189 ? 43.017  -50.659  -9.176  1.00 24.48  ? 233 ARG A HD2  1 
ATOM   2806  H HD3  . ARG A 1 189 ? 42.018  -50.985  -10.370 1.00 24.48  ? 233 ARG A HD3  1 
ATOM   2807  H HE   . ARG A 1 189 ? 41.842  -48.834  -10.748 1.00 18.53  ? 233 ARG A HE   1 
ATOM   2808  H HH11 . ARG A 1 189 ? 43.337  -49.124  -7.811  1.00 29.52  ? 233 ARG A HH11 1 
ATOM   2809  H HH12 . ARG A 1 189 ? 43.682  -47.683  -7.661  1.00 29.52  ? 233 ARG A HH12 1 
ATOM   2810  H HH21 . ARG A 1 189 ? 42.378  -46.647  -10.505 1.00 27.45  ? 233 ARG A HH21 1 
ATOM   2811  H HH22 . ARG A 1 189 ? 43.103  -46.188  -9.288  1.00 27.45  ? 233 ARG A HH22 1 
ATOM   2812  N N    . THR A 1 190 ? 38.863  -54.669  -7.249  1.00 19.75  ? 234 THR A N    1 
ATOM   2813  C CA   . THR A 1 190 ? 38.761  -56.111  -7.093  1.00 13.86  ? 234 THR A CA   1 
ATOM   2814  C C    . THR A 1 190 ? 38.541  -56.712  -8.471  1.00 22.46  ? 234 THR A C    1 
ATOM   2815  O O    . THR A 1 190 ? 37.664  -56.260  -9.215  1.00 15.50  ? 234 THR A O    1 
ATOM   2816  C CB   . THR A 1 190 ? 37.616  -56.485  -6.149  1.00 18.45  ? 234 THR A CB   1 
ATOM   2817  O OG1  . THR A 1 190 ? 36.385  -55.952  -6.653  1.00 20.53  ? 234 THR A OG1  1 
ATOM   2818  C CG2  . THR A 1 190 ? 37.874  -55.921  -4.756  1.00 22.50  ? 234 THR A CG2  1 
ATOM   2819  H H    . THR A 1 190 ? 38.180  -54.323  -7.642  1.00 23.71  ? 234 THR A H    1 
ATOM   2820  H HA   . THR A 1 190 ? 39.590  -56.460  -6.730  1.00 16.64  ? 234 THR A HA   1 
ATOM   2821  H HB   . THR A 1 190 ? 37.551  -57.450  -6.084  1.00 22.14  ? 234 THR A HB   1 
ATOM   2822  H HG1  . THR A 1 190 ? 36.227  -56.267  -7.415  1.00 24.64  ? 234 THR A HG1  1 
ATOM   2823  H HG21 . THR A 1 190 ? 37.146  -56.161  -4.162  1.00 27.01  ? 234 THR A HG21 1 
ATOM   2824  H HG22 . THR A 1 190 ? 38.702  -56.281  -4.402  1.00 27.01  ? 234 THR A HG22 1 
ATOM   2825  H HG23 . THR A 1 190 ? 37.942  -54.955  -4.797  1.00 27.01  ? 234 THR A HG23 1 
ATOM   2826  N N    . HIS A 1 191 ? 39.347  -57.713  -8.817  1.00 17.37  ? 235 HIS A N    1 
ATOM   2827  C CA   . HIS A 1 191 ? 39.402  -58.241  -10.176 1.00 15.60  ? 235 HIS A CA   1 
ATOM   2828  C C    . HIS A 1 191 ? 39.912  -57.193  -11.163 1.00 13.45  ? 235 HIS A C    1 
ATOM   2829  O O    . HIS A 1 191 ? 39.761  -57.355  -12.377 1.00 19.20  ? 235 HIS A O    1 
ATOM   2830  C CB   . HIS A 1 191 ? 38.031  -58.762  -10.631 1.00 16.45  ? 235 HIS A CB   1 
ATOM   2831  C CG   . HIS A 1 191 ? 37.380  -59.697  -9.658  1.00 20.64  ? 235 HIS A CG   1 
ATOM   2832  N ND1  . HIS A 1 191 ? 37.455  -61.067  -9.781  1.00 20.56  ? 235 HIS A ND1  1 
ATOM   2833  C CD2  . HIS A 1 191 ? 36.633  -59.461  -8.554  1.00 18.67  ? 235 HIS A CD2  1 
ATOM   2834  C CE1  . HIS A 1 191 ? 36.789  -61.636  -8.793  1.00 22.88  ? 235 HIS A CE1  1 
ATOM   2835  N NE2  . HIS A 1 191 ? 36.279  -60.683  -8.034  1.00 16.95  ? 235 HIS A NE2  1 
ATOM   2836  H H    . HIS A 1 191 ? 39.881  -58.109  -8.272  1.00 20.85  ? 235 HIS A H    1 
ATOM   2837  H HA   . HIS A 1 191 ? 40.021  -58.987  -10.194 1.00 18.72  ? 235 HIS A HA   1 
ATOM   2838  H HB2  . HIS A 1 191 ? 37.436  -58.007  -10.758 1.00 19.75  ? 235 HIS A HB2  1 
ATOM   2839  H HB3  . HIS A 1 191 ? 38.140  -59.238  -11.469 1.00 19.75  ? 235 HIS A HB3  1 
ATOM   2840  H HD1  . HIS A 1 191 ? 37.874  -61.487  -10.404 1.00 24.67  ? 235 HIS A HD1  1 
ATOM   2841  H HD2  . HIS A 1 191 ? 36.404  -58.628  -8.210  1.00 22.41  ? 235 HIS A HD2  1 
ATOM   2842  H HE1  . HIS A 1 191 ? 36.694  -62.551  -8.656  1.00 27.46  ? 235 HIS A HE1  1 
ATOM   2843  N N    . THR A 1 192 ? 40.526  -56.125  -10.649 1.00 13.94  ? 236 THR A N    1 
ATOM   2844  C CA   . THR A 1 192 ? 40.904  -54.908  -11.368 1.00 19.96  ? 236 THR A CA   1 
ATOM   2845  C C    . THR A 1 192 ? 39.701  -54.042  -11.724 1.00 19.69  ? 236 THR A C    1 
ATOM   2846  O O    . THR A 1 192 ? 39.875  -53.007  -12.379 1.00 19.29  ? 236 THR A O    1 
ATOM   2847  C CB   . THR A 1 192 ? 41.703  -55.181  -12.653 1.00 19.72  ? 236 THR A CB   1 
ATOM   2848  O OG1  . THR A 1 192 ? 40.852  -55.744  -13.661 1.00 24.31  ? 236 THR A OG1  1 
ATOM   2849  C CG2  . THR A 1 192 ? 42.879  -56.112  -12.377 1.00 23.88  ? 236 THR A CG2  1 
ATOM   2850  H H    . THR A 1 192 ? 40.749  -56.085  -9.820  1.00 16.73  ? 236 THR A H    1 
ATOM   2851  H HA   . THR A 1 192 ? 41.473  -54.380  -10.785 1.00 23.95  ? 236 THR A HA   1 
ATOM   2852  H HB   . THR A 1 192 ? 42.062  -54.342  -12.982 1.00 23.67  ? 236 THR A HB   1 
ATOM   2853  H HG1  . THR A 1 192 ? 40.524  -56.467  -13.389 1.00 29.17  ? 236 THR A HG1  1 
ATOM   2854  H HG21 . THR A 1 192 ? 43.372  -56.275  -13.196 1.00 28.66  ? 236 THR A HG21 1 
ATOM   2855  H HG22 . THR A 1 192 ? 43.474  -55.710  -11.725 1.00 28.66  ? 236 THR A HG22 1 
ATOM   2856  H HG23 . THR A 1 192 ? 42.557  -56.959  -12.030 1.00 28.66  ? 236 THR A HG23 1 
ATOM   2857  N N    . GLN A 1 193 ? 38.494  -54.415  -11.304 1.00 17.64  ? 237 GLN A N    1 
ATOM   2858  C CA   . GLN A 1 193 ? 37.302  -53.618  -11.548 1.00 13.08  ? 237 GLN A CA   1 
ATOM   2859  C C    . GLN A 1 193 ? 37.072  -52.638  -10.402 1.00 21.57  ? 237 GLN A C    1 
ATOM   2860  O O    . GLN A 1 193 ? 37.411  -52.913  -9.249  1.00 16.67  ? 237 GLN A O    1 
ATOM   2861  C CB   . GLN A 1 193 ? 36.078  -54.523  -11.710 1.00 12.99  ? 237 GLN A CB   1 
ATOM   2862  C CG   . GLN A 1 193 ? 36.122  -55.413  -12.944 1.00 20.15  ? 237 GLN A CG   1 
ATOM   2863  C CD   . GLN A 1 193 ? 35.986  -54.628  -14.235 1.00 24.16  ? 237 GLN A CD   1 
ATOM   2864  O OE1  . GLN A 1 193 ? 36.880  -54.636  -15.079 1.00 29.52  ? 237 GLN A OE1  1 
ATOM   2865  N NE2  . GLN A 1 193 ? 34.859  -53.947  -14.394 1.00 30.04  ? 237 GLN A NE2  1 
ATOM   2866  H H    . GLN A 1 193 ? 38.341  -55.140  -10.867 1.00 21.17  ? 237 GLN A H    1 
ATOM   2867  H HA   . GLN A 1 193 ? 37.417  -53.110  -12.366 1.00 15.69  ? 237 GLN A HA   1 
ATOM   2868  H HB2  . GLN A 1 193 ? 36.011  -55.099  -10.932 1.00 15.59  ? 237 GLN A HB2  1 
ATOM   2869  H HB3  . GLN A 1 193 ? 35.286  -53.967  -11.776 1.00 15.59  ? 237 GLN A HB3  1 
ATOM   2870  H HG2  . GLN A 1 193 ? 36.972  -55.882  -12.966 1.00 24.18  ? 237 GLN A HG2  1 
ATOM   2871  H HG3  . GLN A 1 193 ? 35.392  -56.050  -12.901 1.00 24.18  ? 237 GLN A HG3  1 
ATOM   2872  H HE21 . GLN A 1 193 ? 34.254  -53.967  -13.782 1.00 36.05  ? 237 GLN A HE21 1 
ATOM   2873  H HE22 . GLN A 1 193 ? 34.732  -53.486  -15.108 1.00 36.05  ? 237 GLN A HE22 1 
ATOM   2874  N N    . ASP A 1 194 ? 36.490  -51.486  -10.734 1.00 23.31  ? 238 ASP A N    1 
ATOM   2875  C CA   . ASP A 1 194 ? 36.137  -50.501  -9.718  1.00 21.01  ? 238 ASP A CA   1 
ATOM   2876  C C    . ASP A 1 194 ? 35.340  -51.158  -8.599  1.00 22.02  ? 238 ASP A C    1 
ATOM   2877  O O    . ASP A 1 194 ? 34.458  -51.983  -8.845  1.00 16.48  ? 238 ASP A O    1 
ATOM   2878  C CB   . ASP A 1 194 ? 35.319  -49.363  -10.335 1.00 19.65  ? 238 ASP A CB   1 
ATOM   2879  C CG   . ASP A 1 194 ? 36.026  -48.691  -11.497 1.00 30.34  ? 238 ASP A CG   1 
ATOM   2880  O OD1  . ASP A 1 194 ? 37.222  -48.977  -11.724 1.00 27.42  ? 238 ASP A OD1  1 
ATOM   2881  O OD2  . ASP A 1 194 ? 35.378  -47.878  -12.186 1.00 29.84  ? 238 ASP A OD2  1 
ATOM   2882  H H    . ASP A 1 194 ? 36.290  -51.253  -11.537 1.00 27.97  ? 238 ASP A H    1 
ATOM   2883  H HA   . ASP A 1 194 ? 36.947  -50.126  -9.338  1.00 25.22  ? 238 ASP A HA   1 
ATOM   2884  H HB2  . ASP A 1 194 ? 34.478  -49.720  -10.662 1.00 23.58  ? 238 ASP A HB2  1 
ATOM   2885  H HB3  . ASP A 1 194 ? 35.152  -48.691  -9.656  1.00 23.58  ? 238 ASP A HB3  1 
ATOM   2886  N N    . ALA A 1 195 ? 35.653  -50.781  -7.362  1.00 21.36  ? 239 ALA A N    1 
ATOM   2887  C CA   . ALA A 1 195 ? 34.993  -51.340  -6.193  1.00 21.26  ? 239 ALA A CA   1 
ATOM   2888  C C    . ALA A 1 195 ? 34.776  -50.230  -5.172  1.00 24.44  ? 239 ALA A C    1 
ATOM   2889  O O    . ALA A 1 195 ? 35.124  -49.067  -5.401  1.00 25.56  ? 239 ALA A O    1 
ATOM   2890  C CB   . ALA A 1 195 ? 35.811  -52.495  -5.603  1.00 25.64  ? 239 ALA A CB   1 
ATOM   2891  H H    . ALA A 1 195 ? 36.254  -50.195  -7.174  1.00 25.63  ? 239 ALA A H    1 
ATOM   2892  H HA   . ALA A 1 195 ? 34.125  -51.686  -6.452  1.00 25.51  ? 239 ALA A HA   1 
ATOM   2893  H HB1  . ALA A 1 195 ? 35.346  -52.846  -4.827  1.00 30.77  ? 239 ALA A HB1  1 
ATOM   2894  H HB2  . ALA A 1 195 ? 35.905  -53.189  -6.274  1.00 30.77  ? 239 ALA A HB2  1 
ATOM   2895  H HB3  . ALA A 1 195 ? 36.685  -52.163  -5.344  1.00 30.77  ? 239 ALA A HB3  1 
ATOM   2896  N N    . VAL A 1 196 ? 34.195  -50.595  -4.034  1.00 24.58  ? 240 VAL A N    1 
ATOM   2897  C CA   . VAL A 1 196 ? 33.872  -49.627  -2.988  1.00 21.84  ? 240 VAL A CA   1 
ATOM   2898  C C    . VAL A 1 196 ? 35.162  -48.994  -2.479  1.00 26.58  ? 240 VAL A C    1 
ATOM   2899  O O    . VAL A 1 196 ? 36.251  -49.547  -2.696  1.00 21.74  ? 240 VAL A O    1 
ATOM   2900  C CB   . VAL A 1 196 ? 33.081  -50.281  -1.844  1.00 26.17  ? 240 VAL A CB   1 
ATOM   2901  C CG1  . VAL A 1 196 ? 31.742  -50.791  -2.357  1.00 24.77  ? 240 VAL A CG1  1 
ATOM   2902  C CG2  . VAL A 1 196 ? 33.882  -51.409  -1.202  1.00 22.90  ? 240 VAL A CG2  1 
ATOM   2903  H H    . VAL A 1 196 ? 33.974  -51.403  -3.841  1.00 29.50  ? 240 VAL A H    1 
ATOM   2904  H HA   . VAL A 1 196 ? 33.322  -48.923  -3.368  1.00 26.21  ? 240 VAL A HA   1 
ATOM   2905  H HB   . VAL A 1 196 ? 32.905  -49.614  -1.162  1.00 31.41  ? 240 VAL A HB   1 
ATOM   2906  H HG11 . VAL A 1 196 ? 31.258  -51.200  -1.622  1.00 29.72  ? 240 VAL A HG11 1 
ATOM   2907  H HG12 . VAL A 1 196 ? 31.236  -50.045  -2.713  1.00 29.72  ? 240 VAL A HG12 1 
ATOM   2908  H HG13 . VAL A 1 196 ? 31.901  -51.446  -3.054  1.00 29.72  ? 240 VAL A HG13 1 
ATOM   2909  H HG21 . VAL A 1 196 ? 33.357  -51.800  -0.486  1.00 27.48  ? 240 VAL A HG21 1 
ATOM   2910  H HG22 . VAL A 1 196 ? 34.077  -52.080  -1.875  1.00 27.48  ? 240 VAL A HG22 1 
ATOM   2911  H HG23 . VAL A 1 196 ? 34.708  -51.046  -0.847  1.00 27.48  ? 240 VAL A HG23 1 
ATOM   2912  N N    . PRO A 1 197 ? 35.096  -47.855  -1.796  1.00 15.83  ? 241 PRO A N    1 
ATOM   2913  C CA   . PRO A 1 197 ? 36.319  -47.121  -1.466  1.00 18.15  ? 241 PRO A CA   1 
ATOM   2914  C C    . PRO A 1 197 ? 37.085  -47.725  -0.300  1.00 22.29  ? 241 PRO A C    1 
ATOM   2915  O O    . PRO A 1 197 ? 36.587  -48.556  0.462   1.00 21.97  ? 241 PRO A O    1 
ATOM   2916  C CB   . PRO A 1 197 ? 35.811  -45.719  -1.097  1.00 19.78  ? 241 PRO A CB   1 
ATOM   2917  C CG   . PRO A 1 197 ? 34.341  -45.710  -1.400  1.00 22.34  ? 241 PRO A CG   1 
ATOM   2918  C CD   . PRO A 1 197 ? 33.896  -47.126  -1.360  1.00 17.06  ? 241 PRO A CD   1 
ATOM   2919  H HA   . PRO A 1 197 ? 36.900  -47.061  -2.241  1.00 21.79  ? 241 PRO A HA   1 
ATOM   2920  H HB2  . PRO A 1 197 ? 35.964  -45.558  -0.153  1.00 23.74  ? 241 PRO A HB2  1 
ATOM   2921  H HB3  . PRO A 1 197 ? 36.272  -45.056  -1.634  1.00 23.74  ? 241 PRO A HB3  1 
ATOM   2922  H HG2  . PRO A 1 197 ? 33.876  -45.189  -0.727  1.00 26.82  ? 241 PRO A HG2  1 
ATOM   2923  H HG3  . PRO A 1 197 ? 34.196  -45.334  -2.282  1.00 26.82  ? 241 PRO A HG3  1 
ATOM   2924  H HD2  . PRO A 1 197 ? 33.653  -47.380  -0.456  1.00 20.48  ? 241 PRO A HD2  1 
ATOM   2925  H HD3  . PRO A 1 197 ? 33.165  -47.270  -1.981  1.00 20.48  ? 241 PRO A HD3  1 
ATOM   2926  N N    . LEU A 1 198 ? 38.335  -47.285  -0.193  1.00 19.45  ? 242 LEU A N    1 
ATOM   2927  C CA   . LEU A 1 198 ? 39.148  -47.447  1.003   1.00 14.96  ? 242 LEU A CA   1 
ATOM   2928  C C    . LEU A 1 198 ? 40.234  -46.388  0.939   1.00 21.86  ? 242 LEU A C    1 
ATOM   2929  O O    . LEU A 1 198 ? 40.516  -45.833  -0.126  1.00 22.23  ? 242 LEU A O    1 
ATOM   2930  C CB   . LEU A 1 198 ? 39.747  -48.854  1.115   1.00 25.73  ? 242 LEU A CB   1 
ATOM   2931  C CG   . LEU A 1 198 ? 40.627  -49.358  -0.032  1.00 20.95  ? 242 LEU A CG   1 
ATOM   2932  C CD1  . LEU A 1 198 ? 42.063  -48.880  0.085   1.00 47.58  ? 242 LEU A CD1  1 
ATOM   2933  C CD2  . LEU A 1 198 ? 40.607  -50.862  -0.057  1.00 57.26  ? 242 LEU A CD2  1 
ATOM   2934  H H    . LEU A 1 198 ? 38.747  -46.874  -0.826  1.00 23.35  ? 242 LEU A H    1 
ATOM   2935  H HA   . LEU A 1 198 ? 38.603  -47.282  1.789   1.00 17.96  ? 242 LEU A HA   1 
ATOM   2936  H HB2  . LEU A 1 198 ? 40.288  -48.884  1.919   1.00 30.88  ? 242 LEU A HB2  1 
ATOM   2937  H HB3  . LEU A 1 198 ? 39.014  -49.483  1.204   1.00 30.88  ? 242 LEU A HB3  1 
ATOM   2938  H HG   . LEU A 1 198 ? 40.268  -49.037  -0.874  1.00 25.14  ? 242 LEU A HG   1 
ATOM   2939  H HD11 . LEU A 1 198 ? 42.572  -49.228  -0.663  1.00 57.10  ? 242 LEU A HD11 1 
ATOM   2940  H HD12 . LEU A 1 198 ? 42.074  -47.910  0.072   1.00 57.10  ? 242 LEU A HD12 1 
ATOM   2941  H HD13 . LEU A 1 198 ? 42.436  -49.205  0.919   1.00 57.10  ? 242 LEU A HD13 1 
ATOM   2942  H HD21 . LEU A 1 198 ? 41.166  -51.172  -0.785  1.00 68.72  ? 242 LEU A HD21 1 
ATOM   2943  H HD22 . LEU A 1 198 ? 40.947  -51.196  0.788   1.00 68.72  ? 242 LEU A HD22 1 
ATOM   2944  H HD23 . LEU A 1 198 ? 39.694  -51.163  -0.188  1.00 68.72  ? 242 LEU A HD23 1 
ATOM   2945  N N    . THR A 1 199 ? 40.840  -46.108  2.086   1.00 26.52  ? 243 THR A N    1 
ATOM   2946  C CA   . THR A 1 199 ? 41.883  -45.098  2.117   1.00 16.90  ? 243 THR A CA   1 
ATOM   2947  C C    . THR A 1 199 ? 43.181  -45.651  1.549   1.00 23.79  ? 243 THR A C    1 
ATOM   2948  O O    . THR A 1 199 ? 43.493  -46.839  1.680   1.00 22.83  ? 243 THR A O    1 
ATOM   2949  C CB   . THR A 1 199 ? 42.126  -44.593  3.538   1.00 19.62  ? 243 THR A CB   1 
ATOM   2950  O OG1  . THR A 1 199 ? 42.568  -45.672  4.367   1.00 22.61  ? 243 THR A OG1  1 
ATOM   2951  C CG2  . THR A 1 199 ? 40.861  -43.984  4.114   1.00 23.95  ? 243 THR A CG2  1 
ATOM   2952  H H    . THR A 1 199 ? 40.670  -46.479  2.842   1.00 31.82  ? 243 THR A H    1 
ATOM   2953  H HA   . THR A 1 199 ? 41.611  -44.344  1.571   1.00 20.29  ? 243 THR A HA   1 
ATOM   2954  H HB   . THR A 1 199 ? 42.811  -43.906  3.519   1.00 23.55  ? 243 THR A HB   1 
ATOM   2955  H HG1  . THR A 1 199 ? 42.703  -45.398  5.149   1.00 27.13  ? 243 THR A HG1  1 
ATOM   2956  H HG21 . THR A 1 199 ? 41.026  -43.667  5.016   1.00 28.74  ? 243 THR A HG21 1 
ATOM   2957  H HG22 . THR A 1 199 ? 40.573  -43.238  3.565   1.00 28.74  ? 243 THR A HG22 1 
ATOM   2958  H HG23 . THR A 1 199 ? 40.155  -44.649  4.138   1.00 28.74  ? 243 THR A HG23 1 
ATOM   2959  N N    . LEU A 1 200 ? 43.937  -44.767  0.902   1.00 19.44  ? 244 LEU A N    1 
ATOM   2960  C CA   . LEU A 1 200 ? 45.275  -45.126  0.461   1.00 17.50  ? 244 LEU A CA   1 
ATOM   2961  C C    . LEU A 1 200 ? 46.122  -45.613  1.628   1.00 18.09  ? 244 LEU A C    1 
ATOM   2962  O O    . LEU A 1 200 ? 47.014  -46.449  1.443   1.00 22.57  ? 244 LEU A O    1 
ATOM   2963  C CB   . LEU A 1 200 ? 45.907  -43.918  -0.230  1.00 20.17  ? 244 LEU A CB   1 
ATOM   2964  C CG   . LEU A 1 200 ? 47.141  -44.071  -1.113  1.00 25.99  ? 244 LEU A CG   1 
ATOM   2965  C CD1  . LEU A 1 200 ? 47.000  -45.232  -2.075  1.00 19.24  ? 244 LEU A CD1  1 
ATOM   2966  C CD2  . LEU A 1 200 ? 47.339  -42.771  -1.878  1.00 20.81  ? 244 LEU A CD2  1 
ATOM   2967  H H    . LEU A 1 200 ? 43.700  -43.963  0.710   1.00 23.33  ? 244 LEU A H    1 
ATOM   2968  H HA   . LEU A 1 200 ? 45.213  -45.845  -0.187  1.00 21.00  ? 244 LEU A HA   1 
ATOM   2969  H HB2  . LEU A 1 200 ? 45.223  -43.517  -0.788  1.00 24.21  ? 244 LEU A HB2  1 
ATOM   2970  H HB3  . LEU A 1 200 ? 46.148  -43.285  0.464   1.00 24.21  ? 244 LEU A HB3  1 
ATOM   2971  H HG   . LEU A 1 200 ? 47.921  -44.224  -0.557  1.00 31.19  ? 244 LEU A HG   1 
ATOM   2972  H HD11 . LEU A 1 200 ? 47.803  -45.294  -2.615  1.00 23.09  ? 244 LEU A HD11 1 
ATOM   2973  H HD12 . LEU A 1 200 ? 46.879  -46.050  -1.567  1.00 23.09  ? 244 LEU A HD12 1 
ATOM   2974  H HD13 . LEU A 1 200 ? 46.229  -45.079  -2.644  1.00 23.09  ? 244 LEU A HD13 1 
ATOM   2975  H HD21 . LEU A 1 200 ? 48.122  -42.855  -2.445  1.00 24.98  ? 244 LEU A HD21 1 
ATOM   2976  H HD22 . LEU A 1 200 ? 46.554  -42.602  -2.422  1.00 24.98  ? 244 LEU A HD22 1 
ATOM   2977  H HD23 . LEU A 1 200 ? 47.465  -42.048  -1.244  1.00 24.98  ? 244 LEU A HD23 1 
ATOM   2978  N N    . GLY A 1 201 ? 45.841  -45.122  2.836   1.00 16.35  ? 245 GLY A N    1 
ATOM   2979  C CA   . GLY A 1 201 ? 46.555  -45.603  4.007   1.00 21.36  ? 245 GLY A CA   1 
ATOM   2980  C C    . GLY A 1 201 ? 46.155  -47.014  4.391   1.00 18.59  ? 245 GLY A C    1 
ATOM   2981  O O    . GLY A 1 201 ? 47.002  -47.825  4.776   1.00 22.27  ? 245 GLY A O    1 
ATOM   2982  H H    . GLY A 1 201 ? 45.250  -44.519  2.998   1.00 19.62  ? 245 GLY A H    1 
ATOM   2983  H HA2  . GLY A 1 201 ? 47.509  -45.591  3.831   1.00 25.63  ? 245 GLY A HA2  1 
ATOM   2984  H HA3  . GLY A 1 201 ? 46.374  -45.017  4.758   1.00 25.63  ? 245 GLY A HA3  1 
ATOM   2985  N N    . GLN A 1 202 ? 44.861  -47.328  4.295   1.00 17.63  ? 246 GLN A N    1 
ATOM   2986  C CA   . GLN A 1 202 ? 44.412  -48.696  4.524   1.00 20.22  ? 246 GLN A CA   1 
ATOM   2987  C C    . GLN A 1 202 ? 45.095  -49.659  3.562   1.00 17.61  ? 246 GLN A C    1 
ATOM   2988  O O    . GLN A 1 202 ? 45.570  -50.727  3.964   1.00 19.04  ? 246 GLN A O    1 
ATOM   2989  C CB   . GLN A 1 202 ? 42.893  -48.778  4.376   1.00 16.17  ? 246 GLN A CB   1 
ATOM   2990  C CG   . GLN A 1 202 ? 42.121  -48.372  5.622   1.00 21.22  ? 246 GLN A CG   1 
ATOM   2991  C CD   . GLN A 1 202 ? 40.628  -48.242  5.368   1.00 20.37  ? 246 GLN A CD   1 
ATOM   2992  O OE1  . GLN A 1 202 ? 40.203  -47.791  4.305   1.00 21.33  ? 246 GLN A OE1  1 
ATOM   2993  N NE2  . GLN A 1 202 ? 39.826  -48.642  6.347   1.00 20.00  ? 246 GLN A NE2  1 
ATOM   2994  H H    . GLN A 1 202 ? 44.234  -46.772  4.102   1.00 21.16  ? 246 GLN A H    1 
ATOM   2995  H HA   . GLN A 1 202 ? 44.642  -48.959  5.429   1.00 24.27  ? 246 GLN A HA   1 
ATOM   2996  H HB2  . GLN A 1 202 ? 42.619  -48.190  3.655   1.00 19.41  ? 246 GLN A HB2  1 
ATOM   2997  H HB3  . GLN A 1 202 ? 42.650  -49.693  4.164   1.00 19.41  ? 246 GLN A HB3  1 
ATOM   2998  H HG2  . GLN A 1 202 ? 42.251  -49.045  6.308   1.00 25.46  ? 246 GLN A HG2  1 
ATOM   2999  H HG3  . GLN A 1 202 ? 42.449  -47.513  5.932   1.00 25.46  ? 246 GLN A HG3  1 
ATOM   3000  H HE21 . GLN A 1 202 ? 40.159  -48.955  7.076   1.00 24.00  ? 246 GLN A HE21 1 
ATOM   3001  H HE22 . GLN A 1 202 ? 38.973  -48.589  6.253   1.00 24.00  ? 246 GLN A HE22 1 
ATOM   3002  N N    . GLU A 1 203 ? 45.146  -49.295  2.278   1.00 17.96  ? 247 GLU A N    1 
ATOM   3003  C CA   . GLU A 1 203 ? 45.807  -50.143  1.293   1.00 15.00  ? 247 GLU A CA   1 
ATOM   3004  C C    . GLU A 1 203 ? 47.278  -50.335  1.640   1.00 20.72  ? 247 GLU A C    1 
ATOM   3005  O O    . GLU A 1 203 ? 47.814  -51.442  1.519   1.00 16.01  ? 247 GLU A O    1 
ATOM   3006  C CB   . GLU A 1 203 ? 45.657  -49.530  -0.098  1.00 22.64  ? 247 GLU A CB   1 
ATOM   3007  C CG   . GLU A 1 203 ? 46.037  -50.460  -1.232  1.00 16.53  ? 247 GLU A CG   1 
ATOM   3008  C CD   . GLU A 1 203 ? 45.852  -49.821  -2.595  1.00 19.48  ? 247 GLU A CD   1 
ATOM   3009  O OE1  . GLU A 1 203 ? 46.439  -48.746  -2.834  1.00 20.28  ? 247 GLU A OE1  1 
ATOM   3010  O OE2  . GLU A 1 203 ? 45.109  -50.382  -3.426  1.00 18.03  ? 247 GLU A OE2  1 
ATOM   3011  H H    . GLU A 1 203 ? 44.810  -48.571  1.959   1.00 21.56  ? 247 GLU A H    1 
ATOM   3012  H HA   . GLU A 1 203 ? 45.382  -51.014  1.287   1.00 18.00  ? 247 GLU A HA   1 
ATOM   3013  H HB2  . GLU A 1 203 ? 44.731  -49.273  -0.226  1.00 27.17  ? 247 GLU A HB2  1 
ATOM   3014  H HB3  . GLU A 1 203 ? 46.226  -48.747  -0.156  1.00 27.17  ? 247 GLU A HB3  1 
ATOM   3015  H HG2  . GLU A 1 203 ? 46.971  -50.706  -1.140  1.00 19.84  ? 247 GLU A HG2  1 
ATOM   3016  H HG3  . GLU A 1 203 ? 45.479  -51.252  -1.193  1.00 19.84  ? 247 GLU A HG3  1 
ATOM   3017  N N    . PHE A 1 204 ? 47.944  -49.268  2.085   1.00 18.68  ? 248 PHE A N    1 
ATOM   3018  C CA   . PHE A 1 204 ? 49.350  -49.377  2.456   1.00 16.67  ? 248 PHE A CA   1 
ATOM   3019  C C    . PHE A 1 204 ? 49.532  -50.150  3.754   1.00 19.76  ? 248 PHE A C    1 
ATOM   3020  O O    . PHE A 1 204 ? 50.560  -50.812  3.935   1.00 14.89  ? 248 PHE A O    1 
ATOM   3021  C CB   . PHE A 1 204 ? 49.971  -47.987  2.574   1.00 18.58  ? 248 PHE A CB   1 
ATOM   3022  C CG   . PHE A 1 204 ? 50.613  -47.508  1.308   1.00 19.69  ? 248 PHE A CG   1 
ATOM   3023  C CD1  . PHE A 1 204 ? 49.842  -47.137  0.221   1.00 16.91  ? 248 PHE A CD1  1 
ATOM   3024  C CD2  . PHE A 1 204 ? 51.991  -47.434  1.204   1.00 20.23  ? 248 PHE A CD2  1 
ATOM   3025  C CE1  . PHE A 1 204 ? 50.434  -46.698  -0.946  1.00 22.16  ? 248 PHE A CE1  1 
ATOM   3026  C CE2  . PHE A 1 204 ? 52.588  -46.996  0.041   1.00 21.69  ? 248 PHE A CE2  1 
ATOM   3027  C CZ   . PHE A 1 204 ? 51.809  -46.629  -1.036  1.00 19.68  ? 248 PHE A CZ   1 
ATOM   3028  H H    . PHE A 1 204 ? 47.609  -48.482  2.179   1.00 22.42  ? 248 PHE A H    1 
ATOM   3029  H HA   . PHE A 1 204 ? 49.822  -49.855  1.756   1.00 20.01  ? 248 PHE A HA   1 
ATOM   3030  H HB2  . PHE A 1 204 ? 49.277  -47.353  2.814   1.00 22.30  ? 248 PHE A HB2  1 
ATOM   3031  H HB3  . PHE A 1 204 ? 50.652  -48.007  3.264   1.00 22.30  ? 248 PHE A HB3  1 
ATOM   3032  H HD1  . PHE A 1 204 ? 48.915  -47.183  0.278   1.00 20.30  ? 248 PHE A HD1  1 
ATOM   3033  H HD2  . PHE A 1 204 ? 52.520  -47.682  1.927   1.00 24.28  ? 248 PHE A HD2  1 
ATOM   3034  H HE1  . PHE A 1 204 ? 49.907  -46.450  -1.670  1.00 26.60  ? 248 PHE A HE1  1 
ATOM   3035  H HE2  . PHE A 1 204 ? 53.515  -46.950  -0.018  1.00 26.04  ? 248 PHE A HE2  1 
ATOM   3036  H HZ   . PHE A 1 204 ? 52.210  -46.332  -1.821  1.00 23.61  ? 248 PHE A HZ   1 
ATOM   3037  N N    . SER A 1 205 ? 48.557  -50.081  4.665   1.00 17.63  ? 249 SER A N    1 
ATOM   3038  C CA   . SER A 1 205 ? 48.644  -50.870  5.889   1.00 18.54  ? 249 SER A CA   1 
ATOM   3039  C C    . SER A 1 205 ? 48.701  -52.359  5.578   1.00 17.05  ? 249 SER A C    1 
ATOM   3040  O O    . SER A 1 205 ? 49.284  -53.133  6.347   1.00 16.80  ? 249 SER A O    1 
ATOM   3041  C CB   . SER A 1 205 ? 47.457  -50.567  6.803   1.00 18.01  ? 249 SER A CB   1 
ATOM   3042  O OG   . SER A 1 205 ? 46.285  -51.224  6.351   1.00 18.47  ? 249 SER A OG   1 
ATOM   3043  H H    . SER A 1 205 ? 47.851  -49.595  4.599   1.00 21.15  ? 249 SER A H    1 
ATOM   3044  H HA   . SER A 1 205 ? 49.456  -50.631  6.363   1.00 22.25  ? 249 SER A HA   1 
ATOM   3045  H HB2  . SER A 1 205 ? 47.663  -50.873  7.700   1.00 21.61  ? 249 SER A HB2  1 
ATOM   3046  H HB3  . SER A 1 205 ? 47.299  -49.610  6.807   1.00 21.61  ? 249 SER A HB3  1 
ATOM   3047  H HG   . SER A 1 205 ? 46.094  -50.968  5.574   1.00 22.17  ? 249 SER A HG   1 
ATOM   3048  N N    . GLY A 1 206 ? 48.101  -52.778  4.462   1.00 15.33  ? 250 GLY A N    1 
ATOM   3049  C CA   . GLY A 1 206 ? 48.228  -54.162  4.041   1.00 13.57  ? 250 GLY A CA   1 
ATOM   3050  C C    . GLY A 1 206 ? 49.651  -54.519  3.659   1.00 18.43  ? 250 GLY A C    1 
ATOM   3051  O O    . GLY A 1 206 ? 50.148  -55.592  4.013   1.00 14.47  ? 250 GLY A O    1 
ATOM   3052  H H    . GLY A 1 206 ? 47.625  -52.285  3.943   1.00 18.39  ? 250 GLY A H    1 
ATOM   3053  H HA2  . GLY A 1 206 ? 47.947  -54.747  4.762   1.00 16.28  ? 250 GLY A HA2  1 
ATOM   3054  H HA3  . GLY A 1 206 ? 47.655  -54.321  3.274   1.00 16.28  ? 250 GLY A HA3  1 
ATOM   3055  N N    . TYR A 1 207 ? 50.328  -53.627  2.930   1.00 13.80  ? 251 TYR A N    1 
ATOM   3056  C CA   . TYR A 1 207 ? 51.736  -53.848  2.620   1.00 14.97  ? 251 TYR A CA   1 
ATOM   3057  C C    . TYR A 1 207 ? 52.564  -53.914  3.895   1.00 16.01  ? 251 TYR A C    1 
ATOM   3058  O O    . TYR A 1 207 ? 53.461  -54.757  4.022   1.00 13.41  ? 251 TYR A O    1 
ATOM   3059  C CB   . TYR A 1 207 ? 52.266  -52.739  1.711   1.00 14.23  ? 251 TYR A CB   1 
ATOM   3060  C CG   . TYR A 1 207 ? 51.421  -52.445  0.491   1.00 8.47   ? 251 TYR A CG   1 
ATOM   3061  C CD1  . TYR A 1 207 ? 50.652  -53.431  -0.110  1.00 16.58  ? 251 TYR A CD1  1 
ATOM   3062  C CD2  . TYR A 1 207 ? 51.400  -51.172  -0.062  1.00 19.49  ? 251 TYR A CD2  1 
ATOM   3063  C CE1  . TYR A 1 207 ? 49.883  -53.153  -1.228  1.00 18.40  ? 251 TYR A CE1  1 
ATOM   3064  C CE2  . TYR A 1 207 ? 50.638  -50.886  -1.175  1.00 18.84  ? 251 TYR A CE2  1 
ATOM   3065  C CZ   . TYR A 1 207 ? 49.881  -51.878  -1.755  1.00 14.04  ? 251 TYR A CZ   1 
ATOM   3066  O OH   . TYR A 1 207 ? 49.121  -51.589  -2.866  1.00 17.35  ? 251 TYR A OH   1 
ATOM   3067  H H    . TYR A 1 207 ? 49.999  -52.900  2.610   1.00 16.56  ? 251 TYR A H    1 
ATOM   3068  H HA   . TYR A 1 207 ? 51.831  -54.694  2.154   1.00 17.97  ? 251 TYR A HA   1 
ATOM   3069  H HB2  . TYR A 1 207 ? 52.328  -51.921  2.227   1.00 17.07  ? 251 TYR A HB2  1 
ATOM   3070  H HB3  . TYR A 1 207 ? 53.149  -52.993  1.399   1.00 17.07  ? 251 TYR A HB3  1 
ATOM   3071  H HD1  . TYR A 1 207 ? 50.652  -54.291  0.244   1.00 19.89  ? 251 TYR A HD1  1 
ATOM   3072  H HD2  . TYR A 1 207 ? 51.910  -50.498  0.326   1.00 23.39  ? 251 TYR A HD2  1 
ATOM   3073  H HE1  . TYR A 1 207 ? 49.371  -53.822  -1.621  1.00 22.09  ? 251 TYR A HE1  1 
ATOM   3074  H HE2  . TYR A 1 207 ? 50.635  -50.027  -1.531  1.00 22.61  ? 251 TYR A HE2  1 
ATOM   3075  H HH   . TYR A 1 207 ? 48.710  -52.277  -3.120  1.00 20.82  ? 251 TYR A HH   1 
ATOM   3076  N N    . VAL A 1 208 ? 52.278  -53.026  4.851   1.00 18.80  ? 252 VAL A N    1 
ATOM   3077  C CA   . VAL A 1 208 ? 52.988  -53.039  6.127   1.00 15.95  ? 252 VAL A CA   1 
ATOM   3078  C C    . VAL A 1 208 ? 52.855  -54.403  6.790   1.00 16.83  ? 252 VAL A C    1 
ATOM   3079  O O    . VAL A 1 208 ? 53.841  -54.991  7.251   1.00 18.01  ? 252 VAL A O    1 
ATOM   3080  C CB   . VAL A 1 208 ? 52.464  -51.917  7.042   1.00 20.05  ? 252 VAL A CB   1 
ATOM   3081  C CG1  . VAL A 1 208 ? 53.112  -51.989  8.420   1.00 20.27  ? 252 VAL A CG1  1 
ATOM   3082  C CG2  . VAL A 1 208 ? 52.719  -50.555  6.413   1.00 17.23  ? 252 VAL A CG2  1 
ATOM   3083  H H    . VAL A 1 208 ? 51.680  -52.411  4.784   1.00 22.57  ? 252 VAL A H    1 
ATOM   3084  H HA   . VAL A 1 208 ? 53.931  -52.877  5.965   1.00 19.15  ? 252 VAL A HA   1 
ATOM   3085  H HB   . VAL A 1 208 ? 51.506  -52.021  7.154   1.00 24.06  ? 252 VAL A HB   1 
ATOM   3086  H HG11 . VAL A 1 208 ? 52.762  -51.271  8.971   1.00 24.33  ? 252 VAL A HG11 1 
ATOM   3087  H HG12 . VAL A 1 208 ? 52.903  -52.847  8.822   1.00 24.33  ? 252 VAL A HG12 1 
ATOM   3088  H HG13 . VAL A 1 208 ? 54.072  -51.894  8.322   1.00 24.33  ? 252 VAL A HG13 1 
ATOM   3089  H HG21 . VAL A 1 208 ? 52.381  -49.866  7.006   1.00 20.67  ? 252 VAL A HG21 1 
ATOM   3090  H HG22 . VAL A 1 208 ? 53.673  -50.441  6.284   1.00 20.67  ? 252 VAL A HG22 1 
ATOM   3091  H HG23 . VAL A 1 208 ? 52.261  -50.511  5.559   1.00 20.67  ? 252 VAL A HG23 1 
ATOM   3092  N N    . GLN A 1 209 ? 51.627  -54.927  6.847   1.00 14.65  ? 253 GLN A N    1 
ATOM   3093  C CA   . GLN A 1 209 ? 51.397  -56.225  7.471   1.00 12.32  ? 253 GLN A CA   1 
ATOM   3094  C C    . GLN A 1 209 ? 52.197  -57.319  6.775   1.00 14.90  ? 253 GLN A C    1 
ATOM   3095  O O    . GLN A 1 209 ? 52.791  -58.179  7.434   1.00 18.83  ? 253 GLN A O    1 
ATOM   3096  C CB   . GLN A 1 209 ? 49.904  -56.555  7.447   1.00 15.80  ? 253 GLN A CB   1 
ATOM   3097  C CG   . GLN A 1 209 ? 49.489  -57.698  8.367   1.00 20.41  ? 253 GLN A CG   1 
ATOM   3098  C CD   . GLN A 1 209 ? 49.371  -57.270  9.821   1.00 16.58  ? 253 GLN A CD   1 
ATOM   3099  O OE1  . GLN A 1 209 ? 49.997  -56.305  10.248  1.00 19.72  ? 253 GLN A OE1  1 
ATOM   3100  N NE2  . GLN A 1 209 ? 48.555  -57.986  10.583  1.00 21.92  ? 253 GLN A NE2  1 
ATOM   3101  H H    . GLN A 1 209 ? 50.919  -54.551  6.534   1.00 17.58  ? 253 GLN A H    1 
ATOM   3102  H HA   . GLN A 1 209 ? 51.683  -56.187  8.397   1.00 14.79  ? 253 GLN A HA   1 
ATOM   3103  H HB2  . GLN A 1 209 ? 49.408  -55.767  7.716   1.00 18.96  ? 253 GLN A HB2  1 
ATOM   3104  H HB3  . GLN A 1 209 ? 49.656  -56.803  6.542   1.00 18.96  ? 253 GLN A HB3  1 
ATOM   3105  H HG2  . GLN A 1 209 ? 48.625  -58.035  8.083   1.00 24.50  ? 253 GLN A HG2  1 
ATOM   3106  H HG3  . GLN A 1 209 ? 50.153  -58.403  8.315   1.00 24.50  ? 253 GLN A HG3  1 
ATOM   3107  H HE21 . GLN A 1 209 ? 48.127  -58.652  10.248  1.00 26.30  ? 253 GLN A HE21 1 
ATOM   3108  H HE22 . GLN A 1 209 ? 48.454  -57.784  11.413  1.00 26.30  ? 253 GLN A HE22 1 
ATOM   3109  N N    . GLN A 1 210 ? 52.230  -57.299  5.440   1.00 15.86  ? 254 GLN A N    1 
ATOM   3110  C CA   . GLN A 1 210 ? 52.958  -58.329  4.705   1.00 17.53  ? 254 GLN A CA   1 
ATOM   3111  C C    . GLN A 1 210 ? 54.440  -58.304  5.049   1.00 13.53  ? 254 GLN A C    1 
ATOM   3112  O O    . GLN A 1 210 ? 55.062  -59.358  5.226   1.00 16.07  ? 254 GLN A O    1 
ATOM   3113  C CB   . GLN A 1 210 ? 52.757  -58.144  3.201   1.00 17.71  ? 254 GLN A CB   1 
ATOM   3114  C CG   . GLN A 1 210 ? 51.343  -58.418  2.718   1.00 18.79  ? 254 GLN A CG   1 
ATOM   3115  C CD   . GLN A 1 210 ? 51.203  -58.255  1.217   1.00 17.73  ? 254 GLN A CD   1 
ATOM   3116  O OE1  . GLN A 1 210 ? 50.841  -57.185  0.728   1.00 16.77  ? 254 GLN A OE1  1 
ATOM   3117  N NE2  . GLN A 1 210 ? 51.493  -59.320  0.476   1.00 18.07  ? 254 GLN A NE2  1 
ATOM   3118  H H    . GLN A 1 210 ? 51.844  -56.710  4.946   1.00 19.04  ? 254 GLN A H    1 
ATOM   3119  H HA   . GLN A 1 210 ? 52.607  -59.199  4.950   1.00 21.04  ? 254 GLN A HA   1 
ATOM   3120  H HB2  . GLN A 1 210 ? 52.975  -57.227  2.969   1.00 21.26  ? 254 GLN A HB2  1 
ATOM   3121  H HB3  . GLN A 1 210 ? 53.351  -58.750  2.732   1.00 21.26  ? 254 GLN A HB3  1 
ATOM   3122  H HG2  . GLN A 1 210 ? 51.101  -59.329  2.946   1.00 22.55  ? 254 GLN A HG2  1 
ATOM   3123  H HG3  . GLN A 1 210 ? 50.735  -57.795  3.147   1.00 22.55  ? 254 GLN A HG3  1 
ATOM   3124  H HE21 . GLN A 1 210 ? 51.744  -60.051  0.854   1.00 21.69  ? 254 GLN A HE21 1 
ATOM   3125  H HE22 . GLN A 1 210 ? 51.429  -59.278  -0.380  1.00 21.69  ? 254 GLN A HE22 1 
ATOM   3126  N N    . VAL A 1 211 ? 55.024  -57.109  5.143   1.00 14.93  ? 255 VAL A N    1 
ATOM   3127  C CA   . VAL A 1 211 ? 56.437  -57.005  5.487   1.00 10.89  ? 255 VAL A CA   1 
ATOM   3128  C C    . VAL A 1 211 ? 56.653  -57.379  6.947   1.00 14.01  ? 255 VAL A C    1 
ATOM   3129  O O    . VAL A 1 211 ? 57.646  -58.030  7.294   1.00 18.29  ? 255 VAL A O    1 
ATOM   3130  C CB   . VAL A 1 211 ? 56.961  -55.592  5.171   1.00 9.14   ? 255 VAL A CB   1 
ATOM   3131  C CG1  . VAL A 1 211 ? 58.443  -55.478  5.497   1.00 16.41  ? 255 VAL A CG1  1 
ATOM   3132  C CG2  . VAL A 1 211 ? 56.717  -55.253  3.706   1.00 15.81  ? 255 VAL A CG2  1 
ATOM   3133  H H    . VAL A 1 211 ? 54.630  -56.356  5.015   1.00 17.92  ? 255 VAL A H    1 
ATOM   3134  H HA   . VAL A 1 211 ? 56.938  -57.634  4.943   1.00 13.07  ? 255 VAL A HA   1 
ATOM   3135  H HB   . VAL A 1 211 ? 56.482  -54.946  5.714   1.00 10.97  ? 255 VAL A HB   1 
ATOM   3136  H HG11 . VAL A 1 211 ? 58.744  -54.580  5.289   1.00 19.70  ? 255 VAL A HG11 1 
ATOM   3137  H HG12 . VAL A 1 211 ? 58.573  -55.661  6.441   1.00 19.70  ? 255 VAL A HG12 1 
ATOM   3138  H HG13 . VAL A 1 211 ? 58.933  -56.124  4.964   1.00 19.70  ? 255 VAL A HG13 1 
ATOM   3139  H HG21 . VAL A 1 211 ? 57.054  -54.361  3.529   1.00 18.97  ? 255 VAL A HG21 1 
ATOM   3140  H HG22 . VAL A 1 211 ? 57.183  -55.899  3.152   1.00 18.97  ? 255 VAL A HG22 1 
ATOM   3141  H HG23 . VAL A 1 211 ? 55.765  -55.290  3.528   1.00 18.97  ? 255 VAL A HG23 1 
ATOM   3142  N N    . LYS A 1 212 ? 55.730  -56.983  7.827   1.00 17.34  ? 256 LYS A N    1 
ATOM   3143  C CA   . LYS A 1 212 ? 55.817  -57.404  9.223   1.00 16.32  ? 256 LYS A CA   1 
ATOM   3144  C C    . LYS A 1 212 ? 55.788  -58.922  9.330   1.00 14.53  ? 256 LYS A C    1 
ATOM   3145  O O    . LYS A 1 212 ? 56.602  -59.525  10.040  1.00 20.14  ? 256 LYS A O    1 
ATOM   3146  C CB   . LYS A 1 212 ? 54.676  -56.794  10.038  1.00 14.03  ? 256 LYS A CB   1 
ATOM   3147  C CG   . LYS A 1 212 ? 54.714  -57.197  11.509  1.00 20.92  ? 256 LYS A CG   1 
ATOM   3148  C CD   . LYS A 1 212 ? 53.702  -56.439  12.350  1.00 31.35  ? 256 LYS A CD   1 
ATOM   3149  C CE   . LYS A 1 212 ? 52.325  -57.073  12.271  1.00 41.15  ? 256 LYS A CE   1 
ATOM   3150  N NZ   . LYS A 1 212 ? 51.339  -56.378  13.144  1.00 54.25  ? 256 LYS A NZ   1 
ATOM   3151  H H    . LYS A 1 212 ? 55.057  -56.481  7.644   1.00 20.81  ? 256 LYS A H    1 
ATOM   3152  H HA   . LYS A 1 212 ? 56.656  -57.091  9.596   1.00 19.59  ? 256 LYS A HA   1 
ATOM   3153  H HB2  . LYS A 1 212 ? 54.737  -55.827  9.991   1.00 16.84  ? 256 LYS A HB2  1 
ATOM   3154  H HB3  . LYS A 1 212 ? 53.830  -57.091  9.668   1.00 16.84  ? 256 LYS A HB3  1 
ATOM   3155  H HG2  . LYS A 1 212 ? 54.516  -58.143  11.582  1.00 25.10  ? 256 LYS A HG2  1 
ATOM   3156  H HG3  . LYS A 1 212 ? 55.597  -57.013  11.864  1.00 25.10  ? 256 LYS A HG3  1 
ATOM   3157  H HD2  . LYS A 1 212 ? 53.987  -56.446  13.277  1.00 37.63  ? 256 LYS A HD2  1 
ATOM   3158  H HD3  . LYS A 1 212 ? 53.635  -55.527  12.026  1.00 37.63  ? 256 LYS A HD3  1 
ATOM   3159  H HE2  . LYS A 1 212 ? 52.005  -57.026  11.357  1.00 49.38  ? 256 LYS A HE2  1 
ATOM   3160  H HE3  . LYS A 1 212 ? 52.384  -57.997  12.558  1.00 49.38  ? 256 LYS A HE3  1 
ATOM   3161  H HZ1  . LYS A 1 212 ? 50.544  -56.772  13.077  1.00 65.11  ? 256 LYS A HZ1  1 
ATOM   3162  H HZ2  . LYS A 1 212 ? 51.607  -56.412  13.992  1.00 65.11  ? 256 LYS A HZ2  1 
ATOM   3163  H HZ3  . LYS A 1 212 ? 51.262  -55.527  12.898  1.00 65.11  ? 256 LYS A HZ3  1 
ATOM   3164  N N    . TYR A 1 213 ? 54.849  -59.558  8.629   1.00 15.08  ? 257 TYR A N    1 
ATOM   3165  C CA   . TYR A 1 213 ? 54.775  -61.013  8.644   1.00 18.47  ? 257 TYR A CA   1 
ATOM   3166  C C    . TYR A 1 213 ? 55.982  -61.646  7.964   1.00 13.69  ? 257 TYR A C    1 
ATOM   3167  O O    . TYR A 1 213 ? 56.432  -62.719  8.381   1.00 14.08  ? 257 TYR A O    1 
ATOM   3168  C CB   . TYR A 1 213 ? 53.475  -61.474  7.980   1.00 13.96  ? 257 TYR A CB   1 
ATOM   3169  C CG   . TYR A 1 213 ? 52.236  -61.318  8.842   1.00 14.84  ? 257 TYR A CG   1 
ATOM   3170  C CD1  . TYR A 1 213 ? 52.313  -60.804  10.133  1.00 15.70  ? 257 TYR A CD1  1 
ATOM   3171  C CD2  . TYR A 1 213 ? 50.985  -61.702  8.368   1.00 20.90  ? 257 TYR A CD2  1 
ATOM   3172  C CE1  . TYR A 1 213 ? 51.186  -60.669  10.919  1.00 20.18  ? 257 TYR A CE1  1 
ATOM   3173  C CE2  . TYR A 1 213 ? 49.849  -61.570  9.152   1.00 16.05  ? 257 TYR A CE2  1 
ATOM   3174  C CZ   . TYR A 1 213 ? 49.958  -61.054  10.428  1.00 26.27  ? 257 TYR A CZ   1 
ATOM   3175  O OH   . TYR A 1 213 ? 48.839  -60.919  11.220  1.00 23.68  ? 257 TYR A OH   1 
ATOM   3176  H H    . TYR A 1 213 ? 54.252  -59.174  8.144   1.00 18.10  ? 257 TYR A H    1 
ATOM   3177  H HA   . TYR A 1 213 ? 54.762  -61.316  9.565   1.00 22.16  ? 257 TYR A HA   1 
ATOM   3178  H HB2  . TYR A 1 213 ? 53.338  -60.955  7.173   1.00 16.76  ? 257 TYR A HB2  1 
ATOM   3179  H HB3  . TYR A 1 213 ? 53.559  -62.414  7.754   1.00 16.76  ? 257 TYR A HB3  1 
ATOM   3180  H HD1  . TYR A 1 213 ? 53.140  -60.544  10.472  1.00 18.84  ? 257 TYR A HD1  1 
ATOM   3181  H HD2  . TYR A 1 213 ? 50.909  -62.051  7.510   1.00 25.09  ? 257 TYR A HD2  1 
ATOM   3182  H HE1  . TYR A 1 213 ? 51.256  -60.323  11.780  1.00 24.22  ? 257 TYR A HE1  1 
ATOM   3183  H HE2  . TYR A 1 213 ? 49.020  -61.830  8.821   1.00 19.26  ? 257 TYR A HE2  1 
ATOM   3184  H HH   . TYR A 1 213 ? 48.160  -61.188  10.805  1.00 28.42  ? 257 TYR A HH   1 
ATOM   3185  N N    . ALA A 1 214 ? 56.531  -60.999  6.935   1.00 16.00  ? 258 ALA A N    1 
ATOM   3186  C CA   . ALA A 1 214 ? 57.741  -61.523  6.312   1.00 16.82  ? 258 ALA A CA   1 
ATOM   3187  C C    . ALA A 1 214 ? 58.864  -61.656  7.333   1.00 11.50  ? 258 ALA A C    1 
ATOM   3188  O O    . ALA A 1 214 ? 59.565  -62.675  7.371   1.00 18.63  ? 258 ALA A O    1 
ATOM   3189  C CB   . ALA A 1 214 ? 58.171  -60.623  5.154   1.00 17.18  ? 258 ALA A CB   1 
ATOM   3190  H H    . ALA A 1 214 ? 56.229  -60.273  6.587   1.00 19.21  ? 258 ALA A H    1 
ATOM   3191  H HA   . ALA A 1 214 ? 57.555  -62.405  5.954   1.00 20.19  ? 258 ALA A HA   1 
ATOM   3192  H HB1  . ALA A 1 214 ? 58.976  -60.988  4.754   1.00 20.62  ? 258 ALA A HB1  1 
ATOM   3193  H HB2  . ALA A 1 214 ? 57.458  -60.593  4.497   1.00 20.62  ? 258 ALA A HB2  1 
ATOM   3194  H HB3  . ALA A 1 214 ? 58.345  -59.732  5.495   1.00 20.62  ? 258 ALA A HB3  1 
ATOM   3195  N N    . MET A 1 215 ? 59.040  -60.643  8.183   1.00 15.57  ? 259 MET A N    1 
ATOM   3196  C CA   . MET A 1 215 ? 60.088  -60.700  9.196   1.00 21.91  ? 259 MET A CA   1 
ATOM   3197  C C    . MET A 1 215 ? 59.793  -61.775  10.232  1.00 18.66  ? 259 MET A C    1 
ATOM   3198  O O    . MET A 1 215 ? 60.706  -62.471  10.692  1.00 19.18  ? 259 MET A O    1 
ATOM   3199  C CB   . MET A 1 215 ? 60.236  -59.337  9.866   1.00 15.40  ? 259 MET A CB   1 
ATOM   3200  C CG   . MET A 1 215 ? 60.544  -58.213  8.893   1.00 26.80  ? 259 MET A CG   1 
ATOM   3201  S SD   . MET A 1 215 ? 60.789  -56.636  9.717   1.00 23.16  ? 259 MET A SD   1 
ATOM   3202  C CE   . MET A 1 215 ? 62.344  -56.943  10.547  1.00 36.03  ? 259 MET A CE   1 
ATOM   3203  H H    . MET A 1 215 ? 58.571  -59.922  8.193   1.00 18.69  ? 259 MET A H    1 
ATOM   3204  H HA   . MET A 1 215 ? 60.930  -60.909  8.761   1.00 26.29  ? 259 MET A HA   1 
ATOM   3205  H HB2  . MET A 1 215 ? 59.406  -59.119  10.319  1.00 18.48  ? 259 MET A HB2  1 
ATOM   3206  H HB3  . MET A 1 215 ? 60.961  -59.381  10.509  1.00 18.48  ? 259 MET A HB3  1 
ATOM   3207  H HG2  . MET A 1 215 ? 61.356  -58.428  8.408   1.00 32.17  ? 259 MET A HG2  1 
ATOM   3208  H HG3  . MET A 1 215 ? 59.803  -58.118  8.274   1.00 32.17  ? 259 MET A HG3  1 
ATOM   3209  H HE1  . MET A 1 215 ? 62.599  -56.150  11.043  1.00 43.24  ? 259 MET A HE1  1 
ATOM   3210  H HE2  . MET A 1 215 ? 62.235  -57.692  11.154  1.00 43.24  ? 259 MET A HE2  1 
ATOM   3211  H HE3  . MET A 1 215 ? 63.021  -57.151  9.884   1.00 43.24  ? 259 MET A HE3  1 
ATOM   3212  N N    . THR A 1 216 ? 58.524  -61.918  10.619  1.00 20.65  ? 260 THR A N    1 
ATOM   3213  C CA   . THR A 1 216 ? 58.149  -62.982  11.543  1.00 18.29  ? 260 THR A CA   1 
ATOM   3214  C C    . THR A 1 216 ? 58.430  -64.350  10.939  1.00 12.26  ? 260 THR A C    1 
ATOM   3215  O O    . THR A 1 216 ? 58.885  -65.265  11.636  1.00 16.26  ? 260 THR A O    1 
ATOM   3216  C CB   . THR A 1 216 ? 56.670  -62.856  11.913  1.00 16.51  ? 260 THR A CB   1 
ATOM   3217  O OG1  . THR A 1 216 ? 56.433  -61.576  12.512  1.00 18.97  ? 260 THR A OG1  1 
ATOM   3218  C CG2  . THR A 1 216 ? 56.259  -63.947  12.890  1.00 18.45  ? 260 THR A CG2  1 
ATOM   3219  H H    . THR A 1 216 ? 57.872  -61.419  10.363  1.00 24.78  ? 260 THR A H    1 
ATOM   3220  H HA   . THR A 1 216 ? 58.672  -62.897  12.356  1.00 21.95  ? 260 THR A HA   1 
ATOM   3221  H HB   . THR A 1 216 ? 56.129  -62.942  11.112  1.00 19.81  ? 260 THR A HB   1 
ATOM   3222  H HG1  . THR A 1 216 ? 56.636  -60.964  11.974  1.00 22.76  ? 260 THR A HG1  1 
ATOM   3223  H HG21 . THR A 1 216 ? 55.320  -63.854  13.115  1.00 22.14  ? 260 THR A HG21 1 
ATOM   3224  H HG22 . THR A 1 216 ? 56.403  -64.820  12.492  1.00 22.14  ? 260 THR A HG22 1 
ATOM   3225  H HG23 . THR A 1 216 ? 56.786  -63.880  13.702  1.00 22.14  ? 260 THR A HG23 1 
ATOM   3226  N N    . ARG A 1 217 ? 58.170  -64.505  9.639   1.00 15.53  ? 261 ARG A N    1 
ATOM   3227  C CA   . ARG A 1 217 ? 58.374  -65.793  8.985   1.00 17.11  ? 261 ARG A CA   1 
ATOM   3228  C C    . ARG A 1 217 ? 59.854  -66.139  8.897   1.00 19.43  ? 261 ARG A C    1 
ATOM   3229  O O    . ARG A 1 217 ? 60.239  -67.299  9.094   1.00 15.27  ? 261 ARG A O    1 
ATOM   3230  C CB   . ARG A 1 217 ? 57.738  -65.772  7.595   1.00 14.16  ? 261 ARG A CB   1 
ATOM   3231  C CG   . ARG A 1 217 ? 56.223  -65.753  7.626   1.00 11.62  ? 261 ARG A CG   1 
ATOM   3232  C CD   . ARG A 1 217 ? 55.621  -65.637  6.240   1.00 9.95   ? 261 ARG A CD   1 
ATOM   3233  N NE   . ARG A 1 217 ? 54.170  -65.811  6.280   1.00 18.75  ? 261 ARG A NE   1 
ATOM   3234  C CZ   . ARG A 1 217 ? 53.266  -64.884  5.975   1.00 21.39  ? 261 ARG A CZ   1 
ATOM   3235  N NH1  . ARG A 1 217 ? 53.628  -63.676  5.567   1.00 21.77  ? 261 ARG A NH1  1 
ATOM   3236  N NH2  . ARG A 1 217 ? 51.977  -65.180  6.065   1.00 23.43  ? 261 ARG A NH2  1 
ATOM   3237  H H    . ARG A 1 217 ? 57.878  -63.884  9.120   1.00 18.64  ? 261 ARG A H    1 
ATOM   3238  H HA   . ARG A 1 217 ? 57.935  -66.484  9.505   1.00 20.54  ? 261 ARG A HA   1 
ATOM   3239  H HB2  . ARG A 1 217 ? 58.036  -64.977  7.125   1.00 17.00  ? 261 ARG A HB2  1 
ATOM   3240  H HB3  . ARG A 1 217 ? 58.016  -66.565  7.110   1.00 17.00  ? 261 ARG A HB3  1 
ATOM   3241  H HG2  . ARG A 1 217 ? 55.903  -66.577  8.026   1.00 13.95  ? 261 ARG A HG2  1 
ATOM   3242  H HG3  . ARG A 1 217 ? 55.925  -64.992  8.149   1.00 13.95  ? 261 ARG A HG3  1 
ATOM   3243  H HD2  . ARG A 1 217 ? 55.813  -64.757  5.879   1.00 11.94  ? 261 ARG A HD2  1 
ATOM   3244  H HD3  . ARG A 1 217 ? 55.996  -66.325  5.668   1.00 11.94  ? 261 ARG A HD3  1 
ATOM   3245  H HE   . ARG A 1 217 ? 53.875  -66.582  6.521   1.00 22.50  ? 261 ARG A HE   1 
ATOM   3246  H HH11 . ARG A 1 217 ? 54.462  -63.475  5.507   1.00 26.13  ? 261 ARG A HH11 1 
ATOM   3247  H HH12 . ARG A 1 217 ? 53.029  -63.091  5.371   1.00 26.13  ? 261 ARG A HH12 1 
ATOM   3248  H HH21 . ARG A 1 217 ? 51.733  -65.964  6.324   1.00 28.12  ? 261 ARG A HH21 1 
ATOM   3249  H HH22 . ARG A 1 217 ? 51.385  -64.590  5.863   1.00 28.12  ? 261 ARG A HH22 1 
ATOM   3250  N N    . ILE A 1 218 ? 60.699  -65.149  8.600   1.00 12.17  ? 262 ILE A N    1 
ATOM   3251  C CA   . ILE A 1 218 ? 62.140  -65.384  8.546   1.00 15.60  ? 262 ILE A CA   1 
ATOM   3252  C C    . ILE A 1 218 ? 62.661  -65.766  9.926   1.00 19.29  ? 262 ILE A C    1 
ATOM   3253  O O    . ILE A 1 218 ? 63.444  -66.711  10.076  1.00 15.59  ? 262 ILE A O    1 
ATOM   3254  C CB   . ILE A 1 218 ? 62.858  -64.141  7.987   1.00 15.51  ? 262 ILE A CB   1 
ATOM   3255  C CG1  . ILE A 1 218 ? 62.546  -63.986  6.499   1.00 14.76  ? 262 ILE A CG1  1 
ATOM   3256  C CG2  . ILE A 1 218 ? 64.369  -64.233  8.185   1.00 14.50  ? 262 ILE A CG2  1 
ATOM   3257  C CD1  . ILE A 1 218 ? 62.805  -62.606  5.962   1.00 19.77  ? 262 ILE A CD1  1 
ATOM   3258  H H    . ILE A 1 218 ? 60.464  -64.340  8.427   1.00 14.61  ? 262 ILE A H    1 
ATOM   3259  H HA   . ILE A 1 218 ? 62.315  -66.125  7.945   1.00 18.72  ? 262 ILE A HA   1 
ATOM   3260  H HB   . ILE A 1 218 ? 62.531  -63.357  8.456   1.00 18.62  ? 262 ILE A HB   1 
ATOM   3261  H HG12 . ILE A 1 218 ? 63.098  -64.607  5.998   1.00 17.71  ? 262 ILE A HG12 1 
ATOM   3262  H HG13 . ILE A 1 218 ? 61.609  -64.189  6.353   1.00 17.71  ? 262 ILE A HG13 1 
ATOM   3263  H HG21 . ILE A 1 218 ? 64.784  -63.435  7.821   1.00 17.40  ? 262 ILE A HG21 1 
ATOM   3264  H HG22 . ILE A 1 218 ? 64.559  -64.302  9.133   1.00 17.40  ? 262 ILE A HG22 1 
ATOM   3265  H HG23 . ILE A 1 218 ? 64.700  -65.018  7.722   1.00 17.40  ? 262 ILE A HG23 1 
ATOM   3266  H HD11 . ILE A 1 218 ? 62.584  -62.588  5.018   1.00 23.72  ? 262 ILE A HD11 1 
ATOM   3267  H HD12 . ILE A 1 218 ? 62.251  -61.972  6.444   1.00 23.72  ? 262 ILE A HD12 1 
ATOM   3268  H HD13 . ILE A 1 218 ? 63.742  -62.389  6.088   1.00 23.72  ? 262 ILE A HD13 1 
ATOM   3269  N N    . LYS A 1 219 ? 62.231  -65.034  10.954  1.00 15.59  ? 263 LYS A N    1 
ATOM   3270  C CA   . LYS A 1 219 ? 62.651  -65.352  12.315  1.00 16.89  ? 263 LYS A CA   1 
ATOM   3271  C C    . LYS A 1 219 ? 62.193  -66.747  12.723  1.00 15.77  ? 263 LYS A C    1 
ATOM   3272  O O    . LYS A 1 219 ? 62.952  -67.503  13.341  1.00 15.55  ? 263 LYS A O    1 
ATOM   3273  C CB   . LYS A 1 219 ? 62.110  -64.298  13.280  1.00 19.90  ? 263 LYS A CB   1 
ATOM   3274  C CG   . LYS A 1 219 ? 62.929  -63.017  13.308  1.00 27.01  ? 263 LYS A CG   1 
ATOM   3275  C CD   . LYS A 1 219 ? 62.100  -61.823  13.739  1.00 24.25  ? 263 LYS A CD   1 
ATOM   3276  C CE   . LYS A 1 219 ? 62.923  -60.849  14.566  1.00 49.77  ? 263 LYS A CE   1 
ATOM   3277  N NZ   . LYS A 1 219 ? 62.264  -59.519  14.690  1.00 65.17  ? 263 LYS A NZ   1 
ATOM   3278  H H    . LYS A 1 219 ? 61.702  -64.359  10.891  1.00 18.71  ? 263 LYS A H    1 
ATOM   3279  H HA   . LYS A 1 219 ? 63.620  -65.329  12.360  1.00 20.27  ? 263 LYS A HA   1 
ATOM   3280  H HB2  . LYS A 1 219 ? 61.205  -64.066  13.016  1.00 23.88  ? 263 LYS A HB2  1 
ATOM   3281  H HB3  . LYS A 1 219 ? 62.106  -64.668  14.177  1.00 23.88  ? 263 LYS A HB3  1 
ATOM   3282  H HG2  . LYS A 1 219 ? 63.661  -63.120  13.937  1.00 32.42  ? 263 LYS A HG2  1 
ATOM   3283  H HG3  . LYS A 1 219 ? 63.275  -62.840  12.419  1.00 32.42  ? 263 LYS A HG3  1 
ATOM   3284  H HD2  . LYS A 1 219 ? 61.776  -61.356  12.953  1.00 29.10  ? 263 LYS A HD2  1 
ATOM   3285  H HD3  . LYS A 1 219 ? 61.355  -62.128  14.280  1.00 29.10  ? 263 LYS A HD3  1 
ATOM   3286  H HE2  . LYS A 1 219 ? 63.041  -61.211  15.459  1.00 59.73  ? 263 LYS A HE2  1 
ATOM   3287  H HE3  . LYS A 1 219 ? 63.785  -60.721  14.141  1.00 59.73  ? 263 LYS A HE3  1 
ATOM   3288  H HZ1  . LYS A 1 219 ? 62.769  -58.973  15.178  1.00 78.21  ? 263 LYS A HZ1  1 
ATOM   3289  H HZ2  . LYS A 1 219 ? 62.148  -59.161  13.883  1.00 78.21  ? 263 LYS A HZ2  1 
ATOM   3290  H HZ3  . LYS A 1 219 ? 61.470  -59.607  15.083  1.00 78.21  ? 263 LYS A HZ3  1 
ATOM   3291  N N    . ALA A 1 220 ? 60.956  -67.112  12.382  1.00 20.49  ? 264 ALA A N    1 
ATOM   3292  C CA   . ALA A 1 220 ? 60.457  -68.439  12.718  1.00 14.52  ? 264 ALA A CA   1 
ATOM   3293  C C    . ALA A 1 220 ? 61.219  -69.549  12.007  1.00 16.59  ? 264 ALA A C    1 
ATOM   3294  O O    . ALA A 1 220 ? 61.086  -70.713  12.398  1.00 17.63  ? 264 ALA A O    1 
ATOM   3295  C CB   . ALA A 1 220 ? 58.969  -68.540  12.380  1.00 20.25  ? 264 ALA A CB   1 
ATOM   3296  H H    . ALA A 1 220 ? 60.395  -66.615  11.961  1.00 24.59  ? 264 ALA A H    1 
ATOM   3297  H HA   . ALA A 1 220 ? 60.555  -68.577  13.673  1.00 17.43  ? 264 ALA A HA   1 
ATOM   3298  H HB1  . ALA A 1 220 ? 58.654  -69.429  12.610  1.00 24.30  ? 264 ALA A HB1  1 
ATOM   3299  H HB2  . ALA A 1 220 ? 58.484  -67.874  12.891  1.00 24.30  ? 264 ALA A HB2  1 
ATOM   3300  H HB3  . ALA A 1 220 ? 58.850  -68.382  11.431  1.00 24.30  ? 264 ALA A HB3  1 
ATOM   3301  N N    . ALA A 1 221 ? 62.006  -69.224  10.983  1.00 19.09  ? 265 ALA A N    1 
ATOM   3302  C CA   . ALA A 1 221 ? 62.784  -70.206  10.242  1.00 23.66  ? 265 ALA A CA   1 
ATOM   3303  C C    . ALA A 1 221 ? 64.250  -70.233  10.659  1.00 17.59  ? 265 ALA A C    1 
ATOM   3304  O O    . ALA A 1 221 ? 65.064  -70.864  9.978   1.00 25.23  ? 265 ALA A O    1 
ATOM   3305  C CB   . ALA A 1 221 ? 62.679  -69.929  8.742   1.00 18.49  ? 265 ALA A CB   1 
ATOM   3306  H H    . ALA A 1 221 ? 62.106  -68.420  10.694  1.00 22.91  ? 265 ALA A H    1 
ATOM   3307  H HA   . ALA A 1 221 ? 62.413  -71.087  10.408  1.00 28.40  ? 265 ALA A HA   1 
ATOM   3308  H HB1  . ALA A 1 221 ? 63.202  -70.590  8.262   1.00 22.19  ? 265 ALA A HB1  1 
ATOM   3309  H HB2  . ALA A 1 221 ? 61.748  -69.985  8.476   1.00 22.19  ? 265 ALA A HB2  1 
ATOM   3310  H HB3  . ALA A 1 221 ? 63.022  -69.040  8.561   1.00 22.19  ? 265 ALA A HB3  1 
ATOM   3311  N N    . MET A 1 222 ? 64.603  -69.555  11.749  1.00 22.19  ? 266 MET A N    1 
ATOM   3312  C CA   . MET A 1 222 ? 65.985  -69.453  12.203  1.00 21.05  ? 266 MET A CA   1 
ATOM   3313  C C    . MET A 1 222 ? 66.361  -70.427  13.320  1.00 19.62  ? 266 MET A C    1 
ATOM   3314  O O    . MET A 1 222 ? 67.542  -70.781  13.427  1.00 18.74  ? 266 MET A O    1 
ATOM   3315  C CB   . MET A 1 222 ? 66.262  -68.022  12.671  1.00 20.27  ? 266 MET A CB   1 
ATOM   3316  C CG   . MET A 1 222 ? 66.391  -67.003  11.539  1.00 20.06  ? 266 MET A CG   1 
ATOM   3317  S SD   . MET A 1 222 ? 67.671  -67.412  10.334  1.00 22.14  ? 266 MET A SD   1 
ATOM   3318  C CE   . MET A 1 222 ? 69.106  -67.525  11.399  1.00 22.24  ? 266 MET A CE   1 
ATOM   3319  H H    . MET A 1 222 ? 64.046  -69.136  12.252  1.00 26.63  ? 266 MET A H    1 
ATOM   3320  H HA   . MET A 1 222 ? 66.565  -69.626  11.445  1.00 25.27  ? 266 MET A HA   1 
ATOM   3321  H HB2  . MET A 1 222 ? 65.534  -67.736  13.244  1.00 24.33  ? 266 MET A HB2  1 
ATOM   3322  H HB3  . MET A 1 222 ? 67.094  -68.015  13.170  1.00 24.33  ? 266 MET A HB3  1 
ATOM   3323  H HG2  . MET A 1 222 ? 65.545  -66.951  11.067  1.00 24.07  ? 266 MET A HG2  1 
ATOM   3324  H HG3  . MET A 1 222 ? 66.608  -66.138  11.920  1.00 24.07  ? 266 MET A HG3  1 
ATOM   3325  H HE1  . MET A 1 222 ? 69.882  -67.746  10.861  1.00 26.70  ? 266 MET A HE1  1 
ATOM   3326  H HE2  . MET A 1 222 ? 69.240  -66.671  11.839  1.00 26.70  ? 266 MET A HE2  1 
ATOM   3327  H HE3  . MET A 1 222 ? 68.953  -68.218  12.061  1.00 26.70  ? 266 MET A HE3  1 
ATOM   3328  N N    . PRO A 1 223 ? 65.429  -70.878  14.175  1.00 18.78  ? 267 PRO A N    1 
ATOM   3329  C CA   . PRO A 1 223 ? 65.853  -71.719  15.312  1.00 25.72  ? 267 PRO A CA   1 
ATOM   3330  C C    . PRO A 1 223 ? 66.759  -72.876  14.927  1.00 13.97  ? 267 PRO A C    1 
ATOM   3331  O O    . PRO A 1 223 ? 67.717  -73.174  15.650  1.00 23.60  ? 267 PRO A O    1 
ATOM   3332  C CB   . PRO A 1 223 ? 64.523  -72.220  15.887  1.00 16.51  ? 267 PRO A CB   1 
ATOM   3333  C CG   . PRO A 1 223 ? 63.554  -71.172  15.543  1.00 22.06  ? 267 PRO A CG   1 
ATOM   3334  C CD   . PRO A 1 223 ? 63.975  -70.630  14.211  1.00 25.37  ? 267 PRO A CD   1 
ATOM   3335  H HA   . PRO A 1 223 ? 66.301  -71.175  15.978  1.00 30.86  ? 267 PRO A HA   1 
ATOM   3336  H HB2  . PRO A 1 223 ? 64.282  -73.062  15.471  1.00 19.82  ? 267 PRO A HB2  1 
ATOM   3337  H HB3  . PRO A 1 223 ? 64.597  -72.319  16.849  1.00 19.82  ? 267 PRO A HB3  1 
ATOM   3338  H HG2  . PRO A 1 223 ? 62.666  -71.558  15.487  1.00 26.47  ? 267 PRO A HG2  1 
ATOM   3339  H HG3  . PRO A 1 223 ? 63.580  -70.475  16.216  1.00 26.47  ? 267 PRO A HG3  1 
ATOM   3340  H HD2  . PRO A 1 223 ? 63.533  -71.112  13.495  1.00 30.45  ? 267 PRO A HD2  1 
ATOM   3341  H HD3  . PRO A 1 223 ? 63.794  -69.678  14.162  1.00 30.45  ? 267 PRO A HD3  1 
ATOM   3342  N N    . ARG A 1 224 ? 66.485  -73.539  13.810  1.00 14.07  ? 268 ARG A N    1 
ATOM   3343  C CA   . ARG A 1 224 ? 67.289  -74.674  13.387  1.00 13.07  ? 268 ARG A CA   1 
ATOM   3344  C C    . ARG A 1 224 ? 68.496  -74.264  12.553  1.00 16.24  ? 268 ARG A C    1 
ATOM   3345  O O    . ARG A 1 224 ? 69.408  -75.079  12.370  1.00 12.63  ? 268 ARG A O    1 
ATOM   3346  C CB   . ARG A 1 224 ? 66.413  -75.666  12.616  1.00 14.64  ? 268 ARG A CB   1 
ATOM   3347  C CG   . ARG A 1 224 ? 65.438  -76.412  13.522  1.00 17.64  ? 268 ARG A CG   1 
ATOM   3348  C CD   . ARG A 1 224 ? 64.182  -76.844  12.790  1.00 24.92  ? 268 ARG A CD   1 
ATOM   3349  N NE   . ARG A 1 224 ? 63.347  -75.702  12.424  1.00 28.49  ? 268 ARG A NE   1 
ATOM   3350  C CZ   . ARG A 1 224 ? 62.503  -75.090  13.250  1.00 21.54  ? 268 ARG A CZ   1 
ATOM   3351  N NH1  . ARG A 1 224 ? 62.372  -75.500  14.505  1.00 30.44  ? 268 ARG A NH1  1 
ATOM   3352  N NH2  . ARG A 1 224 ? 61.789  -74.060  12.821  1.00 33.25  ? 268 ARG A NH2  1 
ATOM   3353  H H    . ARG A 1 224 ? 65.836  -73.350  13.278  1.00 16.88  ? 268 ARG A H    1 
ATOM   3354  H HA   . ARG A 1 224 ? 67.620  -75.129  14.177  1.00 15.68  ? 268 ARG A HA   1 
ATOM   3355  H HB2  . ARG A 1 224 ? 65.896  -75.183  11.952  1.00 17.57  ? 268 ARG A HB2  1 
ATOM   3356  H HB3  . ARG A 1 224 ? 66.982  -76.321  12.183  1.00 17.57  ? 268 ARG A HB3  1 
ATOM   3357  H HG2  . ARG A 1 224 ? 65.872  -77.208  13.869  1.00 21.17  ? 268 ARG A HG2  1 
ATOM   3358  H HG3  . ARG A 1 224 ? 65.175  -75.831  14.253  1.00 21.17  ? 268 ARG A HG3  1 
ATOM   3359  H HD2  . ARG A 1 224 ? 64.431  -77.309  11.976  1.00 29.91  ? 268 ARG A HD2  1 
ATOM   3360  H HD3  . ARG A 1 224 ? 63.662  -77.428  13.364  1.00 29.91  ? 268 ARG A HD3  1 
ATOM   3361  H HE   . ARG A 1 224 ? 63.405  -75.405  11.619  1.00 34.19  ? 268 ARG A HE   1 
ATOM   3362  H HH11 . ARG A 1 224 ? 62.833  -76.167  14.790  1.00 36.53  ? 268 ARG A HH11 1 
ATOM   3363  H HH12 . ARG A 1 224 ? 61.825  -75.098  15.034  1.00 36.53  ? 268 ARG A HH12 1 
ATOM   3364  H HH21 . ARG A 1 224 ? 61.870  -73.789  12.008  1.00 39.90  ? 268 ARG A HH21 1 
ATOM   3365  H HH22 . ARG A 1 224 ? 61.243  -73.662  13.354  1.00 39.90  ? 268 ARG A HH22 1 
ATOM   3366  N N    . ILE A 1 225 ? 68.531  -73.025  12.055  1.00 13.57  ? 269 ILE A N    1 
ATOM   3367  C CA   . ILE A 1 225 ? 69.766  -72.492  11.489  1.00 12.31  ? 269 ILE A CA   1 
ATOM   3368  C C    . ILE A 1 225 ? 70.825  -72.346  12.576  1.00 14.23  ? 269 ILE A C    1 
ATOM   3369  O O    . ILE A 1 225 ? 72.026  -72.451  12.302  1.00 18.54  ? 269 ILE A O    1 
ATOM   3370  C CB   . ILE A 1 225 ? 69.499  -71.146  10.785  1.00 17.47  ? 269 ILE A CB   1 
ATOM   3371  C CG1  . ILE A 1 225 ? 68.566  -71.332  9.582   1.00 20.74  ? 269 ILE A CG1  1 
ATOM   3372  C CG2  . ILE A 1 225 ? 70.805  -70.483  10.350  1.00 16.81  ? 269 ILE A CG2  1 
ATOM   3373  C CD1  . ILE A 1 225 ? 69.143  -72.168  8.452   1.00 16.54  ? 269 ILE A CD1  1 
ATOM   3374  H H    . ILE A 1 225 ? 67.863  -72.484  12.035  1.00 16.29  ? 269 ILE A H    1 
ATOM   3375  H HA   . ILE A 1 225 ? 70.102  -73.114  10.826  1.00 14.77  ? 269 ILE A HA   1 
ATOM   3376  H HB   . ILE A 1 225 ? 69.059  -70.557  11.418  1.00 20.97  ? 269 ILE A HB   1 
ATOM   3377  H HG12 . ILE A 1 225 ? 67.754  -71.767  9.884   1.00 24.88  ? 269 ILE A HG12 1 
ATOM   3378  H HG13 . ILE A 1 225 ? 68.351  -70.458  9.220   1.00 24.88  ? 269 ILE A HG13 1 
ATOM   3379  H HG21 . ILE A 1 225 ? 70.602  -69.642  9.912   1.00 20.17  ? 269 ILE A HG21 1 
ATOM   3380  H HG22 . ILE A 1 225 ? 71.354  -70.324  11.134  1.00 20.17  ? 269 ILE A HG22 1 
ATOM   3381  H HG23 . ILE A 1 225 ? 71.269  -71.073  9.735   1.00 20.17  ? 269 ILE A HG23 1 
ATOM   3382  H HD11 . ILE A 1 225 ? 68.487  -72.230  7.740   1.00 19.85  ? 269 ILE A HD11 1 
ATOM   3383  H HD12 . ILE A 1 225 ? 69.949  -71.741  8.123   1.00 19.85  ? 269 ILE A HD12 1 
ATOM   3384  H HD13 . ILE A 1 225 ? 69.351  -73.053  8.789   1.00 19.85  ? 269 ILE A HD13 1 
ATOM   3385  N N    . TYR A 1 226 ? 70.408  -72.105  13.821  1.00 18.23  ? 270 TYR A N    1 
ATOM   3386  C CA   . TYR A 1 226 ? 71.354  -71.941  14.918  1.00 22.30  ? 270 TYR A CA   1 
ATOM   3387  C C    . TYR A 1 226 ? 72.021  -73.245  15.328  1.00 23.17  ? 270 TYR A C    1 
ATOM   3388  O O    . TYR A 1 226 ? 73.021  -73.205  16.053  1.00 19.24  ? 270 TYR A O    1 
ATOM   3389  C CB   . TYR A 1 226 ? 70.646  -71.324  16.123  1.00 19.61  ? 270 TYR A CB   1 
ATOM   3390  C CG   . TYR A 1 226 ? 70.188  -69.905  15.889  1.00 15.31  ? 270 TYR A CG   1 
ATOM   3391  C CD1  . TYR A 1 226 ? 71.064  -68.949  15.397  1.00 19.72  ? 270 TYR A CD1  1 
ATOM   3392  C CD2  . TYR A 1 226 ? 68.878  -69.522  16.150  1.00 23.98  ? 270 TYR A CD2  1 
ATOM   3393  C CE1  . TYR A 1 226 ? 70.653  -67.655  15.178  1.00 27.84  ? 270 TYR A CE1  1 
ATOM   3394  C CE2  . TYR A 1 226 ? 68.460  -68.225  15.933  1.00 28.22  ? 270 TYR A CE2  1 
ATOM   3395  C CZ   . TYR A 1 226 ? 69.354  -67.298  15.446  1.00 30.80  ? 270 TYR A CZ   1 
ATOM   3396  O OH   . TYR A 1 226 ? 68.964  -66.005  15.219  1.00 38.57  ? 270 TYR A OH   1 
ATOM   3397  H H    . TYR A 1 226 ? 69.583  -72.031  14.052  1.00 21.88  ? 270 TYR A H    1 
ATOM   3398  H HA   . TYR A 1 226 ? 72.052  -71.327  14.639  1.00 26.77  ? 270 TYR A HA   1 
ATOM   3399  H HB2  . TYR A 1 226 ? 69.864  -71.858  16.335  1.00 23.54  ? 270 TYR A HB2  1 
ATOM   3400  H HB3  . TYR A 1 226 ? 71.256  -71.320  16.878  1.00 23.54  ? 270 TYR A HB3  1 
ATOM   3401  H HD1  . TYR A 1 226 ? 71.945  -69.185  15.214  1.00 23.66  ? 270 TYR A HD1  1 
ATOM   3402  H HD2  . TYR A 1 226 ? 68.275  -70.149  16.480  1.00 28.78  ? 270 TYR A HD2  1 
ATOM   3403  H HE1  . TYR A 1 226 ? 71.252  -67.024  14.849  1.00 33.41  ? 270 TYR A HE1  1 
ATOM   3404  H HE2  . TYR A 1 226 ? 67.581  -67.979  16.112  1.00 33.87  ? 270 TYR A HE2  1 
ATOM   3405  H HH   . TYR A 1 226 ? 69.611  -65.558  14.923  1.00 46.28  ? 270 TYR A HH   1 
ATOM   3406  N N    . GLU A 1 227 ? 71.507  -74.388  14.884  1.00 15.87  ? 271 GLU A N    1 
ATOM   3407  C CA   . GLU A 1 227 ? 72.128  -75.668  15.191  1.00 14.80  ? 271 GLU A CA   1 
ATOM   3408  C C    . GLU A 1 227 ? 73.352  -75.868  14.308  1.00 15.29  ? 271 GLU A C    1 
ATOM   3409  O O    . GLU A 1 227 ? 73.277  -75.716  13.084  1.00 16.58  ? 271 GLU A O    1 
ATOM   3410  C CB   . GLU A 1 227 ? 71.128  -76.804  14.989  1.00 10.32  ? 271 GLU A CB   1 
ATOM   3411  C CG   . GLU A 1 227 ? 69.887  -76.683  15.860  1.00 15.16  ? 271 GLU A CG   1 
ATOM   3412  C CD   . GLU A 1 227 ? 68.948  -77.861  15.712  1.00 18.94  ? 271 GLU A CD   1 
ATOM   3413  O OE1  . GLU A 1 227 ? 69.273  -78.792  14.945  1.00 23.83  ? 271 GLU A OE1  1 
ATOM   3414  O OE2  . GLU A 1 227 ? 67.885  -77.854  16.366  1.00 29.05  ? 271 GLU A OE2  1 
ATOM   3415  H H    . GLU A 1 227 ? 70.797  -74.448  14.402  1.00 19.04  ? 271 GLU A H    1 
ATOM   3416  H HA   . GLU A 1 227 ? 72.414  -75.673  16.118  1.00 17.77  ? 271 GLU A HA   1 
ATOM   3417  H HB2  . GLU A 1 227 ? 70.842  -76.808  14.062  1.00 12.38  ? 271 GLU A HB2  1 
ATOM   3418  H HB3  . GLU A 1 227 ? 71.561  -77.645  15.204  1.00 12.38  ? 271 GLU A HB3  1 
ATOM   3419  H HG2  . GLU A 1 227 ? 70.159  -76.630  16.790  1.00 18.20  ? 271 GLU A HG2  1 
ATOM   3420  H HG3  . GLU A 1 227 ? 69.403  -75.880  15.610  1.00 18.20  ? 271 GLU A HG3  1 
ATOM   3421  N N    . LEU A 1 228 ? 74.480  -76.206  14.928  1.00 14.96  ? 272 LEU A N    1 
ATOM   3422  C CA   . LEU A 1 228 ? 75.749  -76.356  14.229  1.00 17.17  ? 272 LEU A CA   1 
ATOM   3423  C C    . LEU A 1 228 ? 76.165  -77.819  14.200  1.00 15.09  ? 272 LEU A C    1 
ATOM   3424  O O    . LEU A 1 228 ? 76.047  -78.531  15.202  1.00 23.18  ? 272 LEU A O    1 
ATOM   3425  C CB   . LEU A 1 228 ? 76.844  -75.515  14.892  1.00 18.97  ? 272 LEU A CB   1 
ATOM   3426  C CG   . LEU A 1 228 ? 76.584  -74.007  14.946  1.00 17.00  ? 272 LEU A CG   1 
ATOM   3427  C CD1  . LEU A 1 228 ? 77.753  -73.287  15.603  1.00 18.08  ? 272 LEU A CD1  1 
ATOM   3428  C CD2  . LEU A 1 228 ? 76.319  -73.439  13.554  1.00 17.78  ? 272 LEU A CD2  1 
ATOM   3429  H H    . LEU A 1 228 ? 74.535  -76.356  15.773  1.00 17.95  ? 272 LEU A H    1 
ATOM   3430  H HA   . LEU A 1 228 ? 75.646  -76.052  13.314  1.00 20.61  ? 272 LEU A HA   1 
ATOM   3431  H HB2  . LEU A 1 228 ? 76.956  -75.822  15.805  1.00 22.77  ? 272 LEU A HB2  1 
ATOM   3432  H HB3  . LEU A 1 228 ? 77.671  -75.649  14.403  1.00 22.77  ? 272 LEU A HB3  1 
ATOM   3433  H HG   . LEU A 1 228 ? 75.795  -73.846  15.486  1.00 20.40  ? 272 LEU A HG   1 
ATOM   3434  H HD11 . LEU A 1 228 ? 77.565  -72.335  15.625  1.00 21.70  ? 272 LEU A HD11 1 
ATOM   3435  H HD12 . LEU A 1 228 ? 77.864  -73.624  16.506  1.00 21.70  ? 272 LEU A HD12 1 
ATOM   3436  H HD13 . LEU A 1 228 ? 78.557  -73.453  15.087  1.00 21.70  ? 272 LEU A HD13 1 
ATOM   3437  H HD21 . LEU A 1 228 ? 76.160  -72.485  13.629  1.00 21.34  ? 272 LEU A HD21 1 
ATOM   3438  H HD22 . LEU A 1 228 ? 77.094  -73.602  12.994  1.00 21.34  ? 272 LEU A HD22 1 
ATOM   3439  H HD23 . LEU A 1 228 ? 75.540  -73.877  13.178  1.00 21.34  ? 272 LEU A HD23 1 
ATOM   3440  N N    . ALA A 1 229 ? 76.657  -78.258  13.042  1.00 18.99  ? 273 ALA A N    1 
ATOM   3441  C CA   . ALA A 1 229 ? 77.064  -79.643  12.853  1.00 18.14  ? 273 ALA A CA   1 
ATOM   3442  C C    . ALA A 1 229 ? 78.443  -79.941  13.423  1.00 23.32  ? 273 ALA A C    1 
ATOM   3443  O O    . ALA A 1 229 ? 78.790  -81.117  13.578  1.00 22.73  ? 273 ALA A O    1 
ATOM   3444  C CB   . ALA A 1 229 ? 77.055  -79.991  11.365  1.00 17.65  ? 273 ALA A CB   1 
ATOM   3445  H H    . ALA A 1 229 ? 76.766  -77.765  12.345  1.00 22.79  ? 273 ALA A H    1 
ATOM   3446  H HA   . ALA A 1 229 ? 76.425  -80.221  13.299  1.00 21.77  ? 273 ALA A HA   1 
ATOM   3447  H HB1  . ALA A 1 229 ? 77.327  -80.916  11.256  1.00 21.18  ? 273 ALA A HB1  1 
ATOM   3448  H HB2  . ALA A 1 229 ? 76.157  -79.867  11.017  1.00 21.18  ? 273 ALA A HB2  1 
ATOM   3449  H HB3  . ALA A 1 229 ? 77.674  -79.407  10.900  1.00 21.18  ? 273 ALA A HB3  1 
ATOM   3450  N N    . ALA A 1 230 ? 79.233  -78.913  13.726  1.00 24.41  ? 274 ALA A N    1 
ATOM   3451  C CA   . ALA A 1 230 ? 80.588  -79.108  14.229  1.00 20.95  ? 274 ALA A CA   1 
ATOM   3452  C C    . ALA A 1 230 ? 80.600  -80.112  15.370  1.00 21.48  ? 274 ALA A C    1 
ATOM   3453  O O    . ALA A 1 230 ? 79.932  -79.919  16.390  1.00 21.19  ? 274 ALA A O    1 
ATOM   3454  C CB   . ALA A 1 230 ? 81.167  -77.770  14.692  1.00 20.76  ? 274 ALA A CB   1 
ATOM   3455  H H    . ALA A 1 230 ? 79.005  -78.087  13.648  1.00 29.30  ? 274 ALA A H    1 
ATOM   3456  H HA   . ALA A 1 230 ? 81.148  -79.452  13.516  1.00 25.14  ? 274 ALA A HA   1 
ATOM   3457  H HB1  . ALA A 1 230 ? 82.067  -77.914  15.024  1.00 24.92  ? 274 ALA A HB1  1 
ATOM   3458  H HB2  . ALA A 1 230 ? 81.185  -77.157  13.940  1.00 24.92  ? 274 ALA A HB2  1 
ATOM   3459  H HB3  . ALA A 1 230 ? 80.607  -77.411  15.398  1.00 24.92  ? 274 ALA A HB3  1 
ATOM   3460  N N    . GLY A 1 231 ? 81.363  -81.187  15.191  1.00 22.54  ? 275 GLY A N    1 
ATOM   3461  C CA   . GLY A 1 231 ? 81.438  -82.275  16.148  1.00 19.25  ? 275 GLY A CA   1 
ATOM   3462  C C    . GLY A 1 231 ? 80.990  -83.615  15.603  1.00 23.72  ? 275 GLY A C    1 
ATOM   3463  O O    . GLY A 1 231 ? 81.309  -84.653  16.201  1.00 33.13  ? 275 GLY A O    1 
ATOM   3464  H H    . GLY A 1 231 ? 81.859  -81.307  14.499  1.00 27.06  ? 275 GLY A H    1 
ATOM   3465  H HA2  . GLY A 1 231 ? 82.354  -82.366  16.453  1.00 23.10  ? 275 GLY A HA2  1 
ATOM   3466  H HA3  . GLY A 1 231 ? 80.884  -82.062  16.915  1.00 23.10  ? 275 GLY A HA3  1 
ATOM   3467  N N    . GLY A 1 232 ? 80.252  -83.635  14.489  1.00 26.92  ? 276 GLY A N    1 
ATOM   3468  C CA   . GLY A 1 232 ? 79.856  -84.893  13.881  1.00 20.46  ? 276 GLY A CA   1 
ATOM   3469  C C    . GLY A 1 232 ? 80.952  -85.571  13.092  1.00 19.41  ? 276 GLY A C    1 
ATOM   3470  O O    . GLY A 1 232 ? 80.843  -86.768  12.804  1.00 23.67  ? 276 GLY A O    1 
ATOM   3471  H H    . GLY A 1 232 ? 79.974  -82.936  14.073  1.00 32.31  ? 276 GLY A H    1 
ATOM   3472  H HA2  . GLY A 1 232 ? 79.563  -85.503  14.577  1.00 24.56  ? 276 GLY A HA2  1 
ATOM   3473  H HA3  . GLY A 1 232 ? 79.108  -84.735  13.284  1.00 24.56  ? 276 GLY A HA3  1 
ATOM   3474  N N    . THR A 1 233 ? 82.002  -84.833  12.744  1.00 16.65  ? 277 THR A N    1 
ATOM   3475  C CA   . THR A 1 233 ? 83.150  -85.338  11.978  1.00 28.37  ? 277 THR A CA   1 
ATOM   3476  C C    . THR A 1 233 ? 82.625  -85.935  10.673  1.00 21.42  ? 277 THR A C    1 
ATOM   3477  O O    . THR A 1 233 ? 81.844  -85.267  9.976   1.00 21.40  ? 277 THR A O    1 
ATOM   3478  C CB   . THR A 1 233 ? 83.974  -86.278  12.853  1.00 22.98  ? 277 THR A CB   1 
ATOM   3479  O OG1  . THR A 1 233 ? 83.160  -87.361  13.320  1.00 37.31  ? 277 THR A OG1  1 
ATOM   3480  C CG2  . THR A 1 233 ? 84.550  -85.521  14.041  1.00 25.28  ? 277 THR A CG2  1 
ATOM   3481  H H    . THR A 1 233 ? 82.078  -84.001  12.948  1.00 19.99  ? 277 THR A H    1 
ATOM   3482  H HA   . THR A 1 233 ? 83.719  -84.588  11.745  1.00 34.04  ? 277 THR A HA   1 
ATOM   3483  H HB   . THR A 1 233 ? 84.712  -86.634  12.333  1.00 27.58  ? 277 THR A HB   1 
ATOM   3484  H HG1  . THR A 1 233 ? 82.856  -87.795  12.667  1.00 44.78  ? 277 THR A HG1  1 
ATOM   3485  H HG21 . THR A 1 233 ? 85.073  -86.122  14.595  1.00 30.34  ? 277 THR A HG21 1 
ATOM   3486  H HG22 . THR A 1 233 ? 85.121  -84.801  13.730  1.00 30.34  ? 277 THR A HG22 1 
ATOM   3487  H HG23 . THR A 1 233 ? 83.832  -85.146  14.574  1.00 30.34  ? 277 THR A HG23 1 
ATOM   3488  N N    . ALA A 1 234 ? 83.006  -87.162  10.306  1.00 19.69  ? 278 ALA A N    1 
ATOM   3489  C CA   . ALA A 1 234 ? 82.841  -87.620  8.929   1.00 22.69  ? 278 ALA A CA   1 
ATOM   3490  C C    . ALA A 1 234 ? 81.429  -88.122  8.640   1.00 16.53  ? 278 ALA A C    1 
ATOM   3491  O O    . ALA A 1 234 ? 80.901  -87.879  7.550   1.00 20.85  ? 278 ALA A O    1 
ATOM   3492  C CB   . ALA A 1 234 ? 83.863  -88.714  8.620   1.00 23.27  ? 278 ALA A CB   1 
ATOM   3493  H H    . ALA A 1 234 ? 83.360  -87.743  10.833  1.00 23.63  ? 278 ALA A H    1 
ATOM   3494  H HA   . ALA A 1 234 ? 83.017  -86.876  8.332   1.00 27.23  ? 278 ALA A HA   1 
ATOM   3495  H HB1  . ALA A 1 234 ? 83.743  -89.009  7.704   1.00 27.92  ? 278 ALA A HB1  1 
ATOM   3496  H HB2  . ALA A 1 234 ? 84.756  -88.354  8.738   1.00 27.92  ? 278 ALA A HB2  1 
ATOM   3497  H HB3  . ALA A 1 234 ? 83.722  -89.457  9.228   1.00 27.92  ? 278 ALA A HB3  1 
ATOM   3498  N N    . VAL A 1 235 ? 80.804  -88.829  9.584   1.00 13.64  ? 279 VAL A N    1 
ATOM   3499  C CA   . VAL A 1 235 ? 79.493  -89.426  9.358   1.00 22.68  ? 279 VAL A CA   1 
ATOM   3500  C C    . VAL A 1 235 ? 78.477  -89.057  10.427  1.00 19.06  ? 279 VAL A C    1 
ATOM   3501  O O    . VAL A 1 235 ? 77.342  -89.532  10.371  1.00 18.16  ? 279 VAL A O    1 
ATOM   3502  C CB   . VAL A 1 235 ? 79.591  -90.961  9.232   1.00 19.39  ? 279 VAL A CB   1 
ATOM   3503  C CG1  . VAL A 1 235 ? 80.508  -91.340  8.081   1.00 12.84  ? 279 VAL A CG1  1 
ATOM   3504  C CG2  . VAL A 1 235 ? 80.072  -91.589  10.532  1.00 22.47  ? 279 VAL A CG2  1 
ATOM   3505  H H    . VAL A 1 235 ? 81.123  -88.976  10.369  1.00 16.37  ? 279 VAL A H    1 
ATOM   3506  H HA   . VAL A 1 235 ? 79.152  -89.091  8.513   1.00 27.22  ? 279 VAL A HA   1 
ATOM   3507  H HB   . VAL A 1 235 ? 78.709  -91.317  9.038   1.00 23.27  ? 279 VAL A HB   1 
ATOM   3508  H HG11 . VAL A 1 235 ? 80.555  -92.307  8.020   1.00 15.40  ? 279 VAL A HG11 1 
ATOM   3509  H HG12 . VAL A 1 235 ? 80.149  -90.973  7.258   1.00 15.40  ? 279 VAL A HG12 1 
ATOM   3510  H HG13 . VAL A 1 235 ? 81.391  -90.975  8.249   1.00 15.40  ? 279 VAL A HG13 1 
ATOM   3511  H HG21 . VAL A 1 235 ? 80.123  -92.551  10.418  1.00 26.97  ? 279 VAL A HG21 1 
ATOM   3512  H HG22 . VAL A 1 235 ? 80.949  -91.235  10.747  1.00 26.97  ? 279 VAL A HG22 1 
ATOM   3513  H HG23 . VAL A 1 235 ? 79.445  -91.371  11.239  1.00 26.97  ? 279 VAL A HG23 1 
ATOM   3514  N N    . GLY A 1 236 ? 78.840  -88.224  11.401  1.00 20.03  ? 280 GLY A N    1 
ATOM   3515  C CA   . GLY A 1 236 ? 77.925  -87.805  12.441  1.00 22.46  ? 280 GLY A CA   1 
ATOM   3516  C C    . GLY A 1 236 ? 78.151  -88.459  13.788  1.00 17.77  ? 280 GLY A C    1 
ATOM   3517  O O    . GLY A 1 236 ? 77.552  -88.019  14.777  1.00 20.24  ? 280 GLY A O    1 
ATOM   3518  H H    . GLY A 1 236 ? 79.627  -87.886  11.476  1.00 24.04  ? 280 GLY A H    1 
ATOM   3519  H HA2  . GLY A 1 236 ? 78.001  -86.845  12.559  1.00 26.96  ? 280 GLY A HA2  1 
ATOM   3520  H HA3  . GLY A 1 236 ? 77.018  -88.002  12.161  1.00 26.96  ? 280 GLY A HA3  1 
ATOM   3521  N N    . THR A 1 237 ? 78.995  -89.491  13.857  1.00 17.56  ? 281 THR A N    1 
ATOM   3522  C CA   . THR A 1 237 ? 79.241  -90.165  15.127  1.00 19.48  ? 281 THR A CA   1 
ATOM   3523  C C    . THR A 1 237 ? 80.094  -89.319  16.062  1.00 31.25  ? 281 THR A C    1 
ATOM   3524  O O    . THR A 1 237 ? 79.992  -89.458  17.286  1.00 26.31  ? 281 THR A O    1 
ATOM   3525  C CB   . THR A 1 237 ? 79.928  -91.509  14.889  1.00 20.21  ? 281 THR A CB   1 
ATOM   3526  O OG1  . THR A 1 237 ? 81.119  -91.308  14.116  1.00 20.50  ? 281 THR A OG1  1 
ATOM   3527  C CG2  . THR A 1 237 ? 79.003  -92.471  14.158  1.00 24.82  ? 281 THR A CG2  1 
ATOM   3528  H H    . THR A 1 237 ? 79.432  -89.815  13.190  1.00 21.08  ? 281 THR A H    1 
ATOM   3529  H HA   . THR A 1 237 ? 78.392  -90.334  15.565  1.00 23.38  ? 281 THR A HA   1 
ATOM   3530  H HB   . THR A 1 237 ? 80.164  -91.904  15.743  1.00 24.26  ? 281 THR A HB   1 
ATOM   3531  H HG1  . THR A 1 237 ? 81.502  -92.044  13.981  1.00 24.60  ? 281 THR A HG1  1 
ATOM   3532  H HG21 . THR A 1 237 ? 79.453  -93.319  14.015  1.00 29.79  ? 281 THR A HG21 1 
ATOM   3533  H HG22 . THR A 1 237 ? 78.203  -92.625  14.684  1.00 29.79  ? 281 THR A HG22 1 
ATOM   3534  H HG23 . THR A 1 237 ? 78.750  -92.099  13.299  1.00 29.79  ? 281 THR A HG23 1 
ATOM   3535  N N    . GLY A 1 238 ? 80.926  -88.440  15.516  1.00 31.42  ? 282 GLY A N    1 
ATOM   3536  C CA   . GLY A 1 238 ? 81.926  -87.777  16.324  1.00 29.55  ? 282 GLY A CA   1 
ATOM   3537  C C    . GLY A 1 238 ? 83.161  -88.610  16.553  1.00 29.93  ? 282 GLY A C    1 
ATOM   3538  O O    . GLY A 1 238 ? 83.875  -88.388  17.533  1.00 37.62  ? 282 GLY A O    1 
ATOM   3539  H H    . GLY A 1 238 ? 80.930  -88.214  14.686  1.00 37.71  ? 282 GLY A H    1 
ATOM   3540  H HA2  . GLY A 1 238 ? 82.192  -86.952  15.890  1.00 35.46  ? 282 GLY A HA2  1 
ATOM   3541  H HA3  . GLY A 1 238 ? 81.543  -87.557  17.188  1.00 35.46  ? 282 GLY A HA3  1 
ATOM   3542  N N    . LEU A 1 239 ? 83.424  -89.585  15.687  1.00 31.43  ? 283 LEU A N    1 
ATOM   3543  C CA   . LEU A 1 239 ? 84.648  -90.365  15.788  1.00 33.85  ? 283 LEU A CA   1 
ATOM   3544  C C    . LEU A 1 239 ? 85.859  -89.453  15.637  1.00 31.12  ? 283 LEU A C    1 
ATOM   3545  O O    . LEU A 1 239 ? 85.848  -88.503  14.850  1.00 29.86  ? 283 LEU A O    1 
ATOM   3546  C CB   . LEU A 1 239 ? 84.667  -91.452  14.713  1.00 30.89  ? 283 LEU A CB   1 
ATOM   3547  C CG   . LEU A 1 239 ? 85.830  -92.443  14.741  1.00 24.20  ? 283 LEU A CG   1 
ATOM   3548  C CD1  . LEU A 1 239 ? 85.765  -93.318  15.980  1.00 35.42  ? 283 LEU A CD1  1 
ATOM   3549  C CD2  . LEU A 1 239 ? 85.818  -93.293  13.484  1.00 35.96  ? 283 LEU A CD2  1 
ATOM   3550  H H    . LEU A 1 239 ? 82.911  -89.813  15.036  1.00 37.72  ? 283 LEU A H    1 
ATOM   3551  H HA   . LEU A 1 239 ? 84.690  -90.791  16.658  1.00 40.62  ? 283 LEU A HA   1 
ATOM   3552  H HB2  . LEU A 1 239 ? 83.850  -91.969  14.795  1.00 37.07  ? 283 LEU A HB2  1 
ATOM   3553  H HB3  . LEU A 1 239 ? 84.684  -91.018  13.846  1.00 37.07  ? 283 LEU A HB3  1 
ATOM   3554  H HG   . LEU A 1 239 ? 86.665  -91.951  14.764  1.00 29.04  ? 283 LEU A HG   1 
ATOM   3555  H HD11 . LEU A 1 239 ? 86.513  -93.935  15.970  1.00 42.51  ? 283 LEU A HD11 1 
ATOM   3556  H HD12 . LEU A 1 239 ? 85.811  -92.754  16.767  1.00 42.51  ? 283 LEU A HD12 1 
ATOM   3557  H HD13 . LEU A 1 239 ? 84.929  -93.811  15.974  1.00 42.51  ? 283 LEU A HD13 1 
ATOM   3558  H HD21 . LEU A 1 239 ? 86.561  -93.916  13.517  1.00 43.15  ? 283 LEU A HD21 1 
ATOM   3559  H HD22 . LEU A 1 239 ? 84.980  -93.780  13.440  1.00 43.15  ? 283 LEU A HD22 1 
ATOM   3560  H HD23 . LEU A 1 239 ? 85.906  -92.714  12.711  1.00 43.15  ? 283 LEU A HD23 1 
ATOM   3561  N N    . ASN A 1 240 ? 86.903  -89.740  16.416  1.00 32.36  ? 284 ASN A N    1 
ATOM   3562  C CA   . ASN A 1 240 ? 88.168  -89.007  16.358  1.00 35.27  ? 284 ASN A CA   1 
ATOM   3563  C C    . ASN A 1 240 ? 88.046  -87.588  16.910  1.00 34.91  ? 284 ASN A C    1 
ATOM   3564  O O    . ASN A 1 240 ? 88.700  -86.669  16.416  1.00 44.32  ? 284 ASN A O    1 
ATOM   3565  C CB   . ASN A 1 240 ? 88.724  -88.963  14.930  1.00 40.59  ? 284 ASN A CB   1 
ATOM   3566  C CG   . ASN A 1 240 ? 88.929  -90.343  14.343  1.00 58.62  ? 284 ASN A CG   1 
ATOM   3567  O OD1  . ASN A 1 240 ? 89.386  -91.259  15.029  1.00 63.72  ? 284 ASN A OD1  1 
ATOM   3568  N ND2  . ASN A 1 240 ? 88.587  -90.504  13.069  1.00 50.88  ? 284 ASN A ND2  1 
ATOM   3569  H H    . ASN A 1 240 ? 86.902  -90.371  17.000  1.00 38.84  ? 284 ASN A H    1 
ATOM   3570  H HA   . ASN A 1 240 ? 88.816  -89.476  16.906  1.00 42.32  ? 284 ASN A HA   1 
ATOM   3571  H HB2  . ASN A 1 240 ? 88.100  -88.485  14.362  1.00 48.72  ? 284 ASN A HB2  1 
ATOM   3572  H HB3  . ASN A 1 240 ? 89.581  -88.510  14.938  1.00 48.72  ? 284 ASN A HB3  1 
ATOM   3573  H HD21 . ASN A 1 240 ? 88.685  -91.270  12.691  1.00 61.05  ? 284 ASN A HD21 1 
ATOM   3574  H HD22 . ASN A 1 240 ? 88.268  -89.841  12.623  1.00 61.05  ? 284 ASN A HD22 1 
ATOM   3575  N N    . THR A 1 241 ? 87.215  -87.391  17.929  1.00 28.99  ? 285 THR A N    1 
ATOM   3576  C CA   . THR A 1 241 ? 87.172  -86.120  18.639  1.00 36.70  ? 285 THR A CA   1 
ATOM   3577  C C    . THR A 1 241 ? 86.742  -86.386  20.076  1.00 37.22  ? 285 THR A C    1 
ATOM   3578  O O    . THR A 1 241 ? 86.332  -87.494  20.431  1.00 37.31  ? 285 THR A O    1 
ATOM   3579  C CB   . THR A 1 241 ? 86.247  -85.108  17.949  1.00 37.34  ? 285 THR A CB   1 
ATOM   3580  O OG1  . THR A 1 241 ? 86.393  -83.825  18.567  1.00 73.08  ? 285 THR A OG1  1 
ATOM   3581  C CG2  . THR A 1 241 ? 84.790  -85.540  18.020  1.00 36.08  ? 285 THR A CG2  1 
ATOM   3582  H H    . THR A 1 241 ? 86.664  -87.980  18.229  1.00 34.79  ? 285 THR A H    1 
ATOM   3583  H HA   . THR A 1 241 ? 88.065  -85.742  18.659  1.00 44.05  ? 285 THR A HA   1 
ATOM   3584  H HB   . THR A 1 241 ? 86.494  -85.039  17.014  1.00 44.81  ? 285 THR A HB   1 
ATOM   3585  H HG1  . THR A 1 241 ? 85.888  -83.267  18.193  1.00 87.70  ? 285 THR A HG1  1 
ATOM   3586  H HG21 . THR A 1 241 ? 84.228  -84.884  17.578  1.00 43.30  ? 285 THR A HG21 1 
ATOM   3587  H HG22 . THR A 1 241 ? 84.677  -86.398  17.581  1.00 43.30  ? 285 THR A HG22 1 
ATOM   3588  H HG23 . THR A 1 241 ? 84.512  -85.620  18.946  1.00 43.30  ? 285 THR A HG23 1 
ATOM   3589  N N    . ARG A 1 242 ? 86.839  -85.351  20.902  0.93 29.18  ? 286 ARG A N    1 
ATOM   3590  C CA   . ARG A 1 242 ? 86.685  -85.486  22.342  0.93 35.62  ? 286 ARG A CA   1 
ATOM   3591  C C    . ARG A 1 242 ? 85.268  -85.141  22.785  0.93 28.03  ? 286 ARG A C    1 
ATOM   3592  O O    . ARG A 1 242 ? 84.609  -84.268  22.212  0.93 32.84  ? 286 ARG A O    1 
ATOM   3593  C CB   . ARG A 1 242 ? 87.685  -84.584  23.069  0.93 49.21  ? 286 ARG A CB   1 
ATOM   3594  C CG   . ARG A 1 242 ? 89.135  -84.788  22.644  0.93 49.18  ? 286 ARG A CG   1 
ATOM   3595  C CD   . ARG A 1 242 ? 89.579  -86.231  22.816  0.93 56.09  ? 286 ARG A CD   1 
ATOM   3596  N NE   . ARG A 1 242 ? 89.095  -86.800  24.069  0.93 68.46  ? 286 ARG A NE   1 
ATOM   3597  C CZ   . ARG A 1 242 ? 89.580  -86.498  25.270  0.93 72.83  ? 286 ARG A CZ   1 
ATOM   3598  N NH1  . ARG A 1 242 ? 90.569  -85.622  25.391  0.93 64.15  ? 286 ARG A NH1  1 
ATOM   3599  N NH2  . ARG A 1 242 ? 89.070  -87.068  26.352  0.93 51.23  ? 286 ARG A NH2  1 
ATOM   3600  H H    . ARG A 1 242 ? 86.996  -84.545  20.646  0.93 35.02  ? 286 ARG A H    1 
ATOM   3601  H HA   . ARG A 1 242 ? 86.866  -86.404  22.596  0.93 42.75  ? 286 ARG A HA   1 
ATOM   3602  H HB2  . ARG A 1 242 ? 87.454  -83.658  22.893  0.93 59.05  ? 286 ARG A HB2  1 
ATOM   3603  H HB3  . ARG A 1 242 ? 87.629  -84.760  24.021  0.93 59.05  ? 286 ARG A HB3  1 
ATOM   3604  H HG2  . ARG A 1 242 ? 89.229  -84.552  21.708  0.93 59.02  ? 286 ARG A HG2  1 
ATOM   3605  H HG3  . ARG A 1 242 ? 89.709  -84.228  23.190  0.93 59.02  ? 286 ARG A HG3  1 
ATOM   3606  H HD2  . ARG A 1 242 ? 89.227  -86.763  22.085  0.93 67.31  ? 286 ARG A HD2  1 
ATOM   3607  H HD3  . ARG A 1 242 ? 90.549  -86.268  22.821  0.93 67.31  ? 286 ARG A HD3  1 
ATOM   3608  H HE   . ARG A 1 242 ? 88.452  -87.370  24.029  0.93 82.16  ? 286 ARG A HE   1 
ATOM   3609  H HH11 . ARG A 1 242 ? 90.902  -85.249  24.691  0.93 76.98  ? 286 ARG A HH11 1 
ATOM   3610  H HH12 . ARG A 1 242 ? 90.880  -85.428  26.169  0.93 76.98  ? 286 ARG A HH12 1 
ATOM   3611  H HH21 . ARG A 1 242 ? 88.429  -87.635  26.278  0.93 61.48  ? 286 ARG A HH21 1 
ATOM   3612  H HH22 . ARG A 1 242 ? 89.384  -86.872  27.129  0.93 61.48  ? 286 ARG A HH22 1 
ATOM   3613  N N    . ILE A 1 243 ? 84.807  -85.842  23.824  1.00 31.19  ? 287 ILE A N    1 
ATOM   3614  C CA   . ILE A 1 243 ? 83.515  -85.532  24.423  1.00 38.13  ? 287 ILE A CA   1 
ATOM   3615  C C    . ILE A 1 243 ? 83.501  -84.074  24.855  1.00 35.03  ? 287 ILE A C    1 
ATOM   3616  O O    . ILE A 1 243 ? 84.455  -83.578  25.469  1.00 35.64  ? 287 ILE A O    1 
ATOM   3617  C CB   . ILE A 1 243 ? 83.236  -86.472  25.605  1.00 45.90  ? 287 ILE A CB   1 
ATOM   3618  C CG1  . ILE A 1 243 ? 83.131  -87.922  25.121  1.00 53.54  ? 287 ILE A CG1  1 
ATOM   3619  C CG2  . ILE A 1 243 ? 81.951  -86.071  26.326  1.00 35.60  ? 287 ILE A CG2  1 
ATOM   3620  C CD1  . ILE A 1 243 ? 83.192  -88.948  26.232  1.00 46.11  ? 287 ILE A CD1  1 
ATOM   3621  H H    . ILE A 1 243 ? 85.223  -86.496  24.196  1.00 37.43  ? 287 ILE A H    1 
ATOM   3622  H HA   . ILE A 1 243 ? 82.817  -85.660  23.762  1.00 45.76  ? 287 ILE A HA   1 
ATOM   3623  H HB   . ILE A 1 243 ? 83.974  -86.409  26.232  1.00 55.08  ? 287 ILE A HB   1 
ATOM   3624  H HG12 . ILE A 1 243 ? 82.285  -88.035  24.659  1.00 64.25  ? 287 ILE A HG12 1 
ATOM   3625  H HG13 . ILE A 1 243 ? 83.864  -88.101  24.512  1.00 64.25  ? 287 ILE A HG13 1 
ATOM   3626  H HG21 . ILE A 1 243 ? 81.801  -86.680  27.066  1.00 42.72  ? 287 ILE A HG21 1 
ATOM   3627  H HG22 . ILE A 1 243 ? 82.045  -85.164  26.657  1.00 42.72  ? 287 ILE A HG22 1 
ATOM   3628  H HG23 . ILE A 1 243 ? 81.211  -86.120  25.701  1.00 42.72  ? 287 ILE A HG23 1 
ATOM   3629  H HD11 . ILE A 1 243 ? 83.119  -89.835  25.846  1.00 55.34  ? 287 ILE A HD11 1 
ATOM   3630  H HD12 . ILE A 1 243 ? 84.038  -88.858  26.698  1.00 55.34  ? 287 ILE A HD12 1 
ATOM   3631  H HD13 . ILE A 1 243 ? 82.457  -88.793  26.846  1.00 55.34  ? 287 ILE A HD13 1 
ATOM   3632  N N    . GLY A 1 244 ? 82.410  -83.378  24.537  1.00 37.84  ? 288 GLY A N    1 
ATOM   3633  C CA   . GLY A 1 244 ? 82.280  -81.970  24.838  1.00 21.41  ? 288 GLY A CA   1 
ATOM   3634  C C    . GLY A 1 244 ? 82.806  -81.039  23.767  1.00 27.28  ? 288 GLY A C    1 
ATOM   3635  O O    . GLY A 1 244 ? 82.534  -79.833  23.831  1.00 30.03  ? 288 GLY A O    1 
ATOM   3636  H H    . GLY A 1 244 ? 81.724  -83.712  24.140  1.00 45.41  ? 288 GLY A H    1 
ATOM   3637  H HA2  . GLY A 1 244 ? 81.342  -81.763  24.979  1.00 25.70  ? 288 GLY A HA2  1 
ATOM   3638  H HA3  . GLY A 1 244 ? 82.756  -81.778  25.661  1.00 25.70  ? 288 GLY A HA3  1 
ATOM   3639  N N    . PHE A 1 245 ? 83.549  -81.556  22.787  1.00 20.67  ? 289 PHE A N    1 
ATOM   3640  C CA   . PHE A 1 245 ? 84.067  -80.704  21.721  1.00 29.01  ? 289 PHE A CA   1 
ATOM   3641  C C    . PHE A 1 245 ? 82.934  -80.007  20.977  1.00 22.19  ? 289 PHE A C    1 
ATOM   3642  O O    . PHE A 1 245 ? 82.994  -78.799  20.720  1.00 21.94  ? 289 PHE A O    1 
ATOM   3643  C CB   . PHE A 1 245 ? 84.915  -81.536  20.758  1.00 26.97  ? 289 PHE A CB   1 
ATOM   3644  C CG   . PHE A 1 245 ? 85.390  -80.774  19.553  1.00 24.56  ? 289 PHE A CG   1 
ATOM   3645  C CD1  . PHE A 1 245 ? 86.363  -79.796  19.673  1.00 30.13  ? 289 PHE A CD1  1 
ATOM   3646  C CD2  . PHE A 1 245 ? 84.868  -81.042  18.299  1.00 22.52  ? 289 PHE A CD2  1 
ATOM   3647  C CE1  . PHE A 1 245 ? 86.803  -79.096  18.565  1.00 33.16  ? 289 PHE A CE1  1 
ATOM   3648  C CE2  . PHE A 1 245 ? 85.305  -80.347  17.187  1.00 30.76  ? 289 PHE A CE2  1 
ATOM   3649  C CZ   . PHE A 1 245 ? 86.275  -79.373  17.320  1.00 30.64  ? 289 PHE A CZ   1 
ATOM   3650  H H    . PHE A 1 245 ? 83.765  -82.386  22.718  1.00 24.81  ? 289 PHE A H    1 
ATOM   3651  H HA   . PHE A 1 245 ? 84.636  -80.021  22.109  1.00 34.81  ? 289 PHE A HA   1 
ATOM   3652  H HB2  . PHE A 1 245 ? 85.697  -81.861  21.231  1.00 32.37  ? 289 PHE A HB2  1 
ATOM   3653  H HB3  . PHE A 1 245 ? 84.386  -82.286  20.444  1.00 32.37  ? 289 PHE A HB3  1 
ATOM   3654  H HD1  . PHE A 1 245 ? 86.723  -79.607  20.510  1.00 36.16  ? 289 PHE A HD1  1 
ATOM   3655  H HD2  . PHE A 1 245 ? 84.216  -81.697  18.203  1.00 27.03  ? 289 PHE A HD2  1 
ATOM   3656  H HE1  . PHE A 1 245 ? 87.457  -78.440  18.657  1.00 39.79  ? 289 PHE A HE1  1 
ATOM   3657  H HE2  . PHE A 1 245 ? 84.946  -80.535  16.350  1.00 36.92  ? 289 PHE A HE2  1 
ATOM   3658  H HZ   . PHE A 1 245 ? 86.569  -78.903  16.574  1.00 36.77  ? 289 PHE A HZ   1 
ATOM   3659  N N    . ALA A 1 246 ? 81.884  -80.756  20.628  1.00 25.11  ? 290 ALA A N    1 
ATOM   3660  C CA   . ALA A 1 246 ? 80.779  -80.181  19.866  1.00 28.32  ? 290 ALA A CA   1 
ATOM   3661  C C    . ALA A 1 246 ? 80.132  -79.027  20.620  1.00 24.16  ? 290 ALA A C    1 
ATOM   3662  O O    . ALA A 1 246 ? 79.870  -77.963  20.048  1.00 19.14  ? 290 ALA A O    1 
ATOM   3663  C CB   . ALA A 1 246 ? 79.746  -81.262  19.549  1.00 24.65  ? 290 ALA A CB   1 
ATOM   3664  H H    . ALA A 1 246 ? 81.791  -81.589  20.818  1.00 30.14  ? 290 ALA A H    1 
ATOM   3665  H HA   . ALA A 1 246 ? 81.120  -79.836  19.025  1.00 33.98  ? 290 ALA A HA   1 
ATOM   3666  H HB1  . ALA A 1 246 ? 79.020  -80.866  19.043  1.00 29.59  ? 290 ALA A HB1  1 
ATOM   3667  H HB2  . ALA A 1 246 ? 80.171  -81.961  19.027  1.00 29.59  ? 290 ALA A HB2  1 
ATOM   3668  H HB3  . ALA A 1 246 ? 79.409  -81.629  20.381  1.00 29.59  ? 290 ALA A HB3  1 
ATOM   3669  N N    . GLU A 1 247 ? 79.865  -79.220  21.914  1.00 26.71  ? 291 GLU A N    1 
ATOM   3670  C CA   . GLU A 1 247 ? 79.211  -78.175  22.696  1.00 25.53  ? 291 GLU A CA   1 
ATOM   3671  C C    . GLU A 1 247 ? 80.125  -76.972  22.892  1.00 22.75  ? 291 GLU A C    1 
ATOM   3672  O O    . GLU A 1 247 ? 79.666  -75.824  22.853  1.00 22.11  ? 291 GLU A O    1 
ATOM   3673  C CB   . GLU A 1 247 ? 78.765  -78.728  24.050  1.00 18.53  ? 291 GLU A CB   1 
ATOM   3674  C CG   . GLU A 1 247 ? 77.618  -79.729  23.976  1.00 24.86  ? 291 GLU A CG   1 
ATOM   3675  C CD   . GLU A 1 247 ? 78.069  -81.119  23.566  1.00 43.21  ? 291 GLU A CD   1 
ATOM   3676  O OE1  . GLU A 1 247 ? 79.292  -81.335  23.408  1.00 22.68  ? 291 GLU A OE1  1 
ATOM   3677  O OE2  . GLU A 1 247 ? 77.197  -81.998  23.405  1.00 32.77  ? 291 GLU A OE2  1 
ATOM   3678  H H    . GLU A 1 247 ? 80.049  -79.935  22.354  1.00 32.05  ? 291 GLU A H    1 
ATOM   3679  H HA   . GLU A 1 247 ? 78.420  -77.875  22.221  1.00 30.63  ? 291 GLU A HA   1 
ATOM   3680  H HB2  . GLU A 1 247 ? 79.518  -79.174  24.467  1.00 22.24  ? 291 GLU A HB2  1 
ATOM   3681  H HB3  . GLU A 1 247 ? 78.474  -77.989  24.607  1.00 22.24  ? 291 GLU A HB3  1 
ATOM   3682  H HG2  . GLU A 1 247 ? 77.200  -79.795  24.849  1.00 29.83  ? 291 GLU A HG2  1 
ATOM   3683  H HG3  . GLU A 1 247 ? 76.972  -79.420  23.322  1.00 29.83  ? 291 GLU A HG3  1 
ATOM   3684  N N    . LYS A 1 248 ? 81.421  -77.210  23.101  1.00 19.94  ? 292 LYS A N    1 
ATOM   3685  C CA   . LYS A 1 248 ? 82.342  -76.106  23.358  1.00 29.18  ? 292 LYS A CA   1 
ATOM   3686  C C    . LYS A 1 248 ? 82.559  -75.259  22.110  1.00 20.55  ? 292 LYS A C    1 
ATOM   3687  O O    . LYS A 1 248 ? 82.641  -74.027  22.196  1.00 28.06  ? 292 LYS A O    1 
ATOM   3688  C CB   . LYS A 1 248 ? 83.671  -76.649  23.884  1.00 27.34  ? 292 LYS A CB   1 
ATOM   3689  C CG   . LYS A 1 248 ? 83.569  -77.249  25.278  1.00 32.99  ? 292 LYS A CG   1 
ATOM   3690  C CD   . LYS A 1 248 ? 84.882  -77.867  25.731  1.00 49.52  ? 292 LYS A CD   1 
ATOM   3691  C CE   . LYS A 1 248 ? 84.756  -78.461  27.126  1.00 43.38  ? 292 LYS A CE   1 
ATOM   3692  N NZ   . LYS A 1 248 ? 86.025  -79.087  27.588  1.00 83.74  ? 292 LYS A NZ   1 
ATOM   3693  H H    . LYS A 1 248 ? 81.786  -77.989  23.099  1.00 23.93  ? 292 LYS A H    1 
ATOM   3694  H HA   . LYS A 1 248 ? 81.962  -75.534  24.043  1.00 35.01  ? 292 LYS A HA   1 
ATOM   3695  H HB2  . LYS A 1 248 ? 83.985  -77.343  23.283  1.00 32.81  ? 292 LYS A HB2  1 
ATOM   3696  H HB3  . LYS A 1 248 ? 84.315  -75.925  23.917  1.00 32.81  ? 292 LYS A HB3  1 
ATOM   3697  H HG2  . LYS A 1 248 ? 83.331  -76.551  25.908  1.00 39.59  ? 292 LYS A HG2  1 
ATOM   3698  H HG3  . LYS A 1 248 ? 82.892  -77.943  25.277  1.00 39.59  ? 292 LYS A HG3  1 
ATOM   3699  H HD2  . LYS A 1 248 ? 85.130  -78.577  25.118  1.00 59.43  ? 292 LYS A HD2  1 
ATOM   3700  H HD3  . LYS A 1 248 ? 85.569  -77.183  25.751  1.00 59.43  ? 292 LYS A HD3  1 
ATOM   3701  H HE2  . LYS A 1 248 ? 84.522  -77.757  27.751  1.00 52.06  ? 292 LYS A HE2  1 
ATOM   3702  H HE3  . LYS A 1 248 ? 84.068  -79.144  27.120  1.00 52.06  ? 292 LYS A HE3  1 
ATOM   3703  H HZ1  . LYS A 1 248 ? 85.918  -79.423  28.405  1.00 100.49 ? 292 LYS A HZ1  1 
ATOM   3704  H HZ2  . LYS A 1 248 ? 86.260  -79.742  27.033  1.00 100.49 ? 292 LYS A HZ2  1 
ATOM   3705  H HZ3  . LYS A 1 248 ? 86.674  -78.478  27.608  1.00 100.49 ? 292 LYS A HZ3  1 
ATOM   3706  N N    . VAL A 1 249 ? 82.655  -75.896  20.940  1.00 23.83  ? 293 VAL A N    1 
ATOM   3707  C CA   . VAL A 1 249 ? 82.803  -75.145  19.696  1.00 27.14  ? 293 VAL A CA   1 
ATOM   3708  C C    . VAL A 1 249 ? 81.576  -74.275  19.452  1.00 21.73  ? 293 VAL A C    1 
ATOM   3709  O O    . VAL A 1 249 ? 81.692  -73.109  19.052  1.00 18.50  ? 293 VAL A O    1 
ATOM   3710  C CB   . VAL A 1 249 ? 83.057  -76.107  18.521  1.00 23.55  ? 293 VAL A CB   1 
ATOM   3711  C CG1  . VAL A 1 249 ? 82.933  -75.385  17.182  1.00 23.26  ? 293 VAL A CG1  1 
ATOM   3712  C CG2  . VAL A 1 249 ? 84.431  -76.732  18.648  1.00 33.16  ? 293 VAL A CG2  1 
ATOM   3713  H H    . VAL A 1 249 ? 82.638  -76.750  20.843  1.00 28.59  ? 293 VAL A H    1 
ATOM   3714  H HA   . VAL A 1 249 ? 83.572  -74.559  19.773  1.00 32.57  ? 293 VAL A HA   1 
ATOM   3715  H HB   . VAL A 1 249 ? 82.398  -76.818  18.543  1.00 28.27  ? 293 VAL A HB   1 
ATOM   3716  H HG11 . VAL A 1 249 ? 83.099  -76.017  16.466  1.00 27.92  ? 293 VAL A HG11 1 
ATOM   3717  H HG12 . VAL A 1 249 ? 82.038  -75.021  17.102  1.00 27.92  ? 293 VAL A HG12 1 
ATOM   3718  H HG13 . VAL A 1 249 ? 83.586  -74.668  17.149  1.00 27.92  ? 293 VAL A HG13 1 
ATOM   3719  H HG21 . VAL A 1 249 ? 84.574  -77.334  17.901  1.00 39.79  ? 293 VAL A HG21 1 
ATOM   3720  H HG22 . VAL A 1 249 ? 85.100  -76.029  18.640  1.00 39.79  ? 293 VAL A HG22 1 
ATOM   3721  H HG23 . VAL A 1 249 ? 84.478  -77.224  19.483  1.00 39.79  ? 293 VAL A HG23 1 
ATOM   3722  N N    . ALA A 1 250 ? 80.383  -74.825  19.683  1.00 18.39  ? 294 ALA A N    1 
ATOM   3723  C CA   . ALA A 1 250 ? 79.158  -74.065  19.458  1.00 22.82  ? 294 ALA A CA   1 
ATOM   3724  C C    . ALA A 1 250 ? 79.066  -72.885  20.416  1.00 24.28  ? 294 ALA A C    1 
ATOM   3725  O O    . ALA A 1 250 ? 78.720  -71.768  20.012  1.00 22.57  ? 294 ALA A O    1 
ATOM   3726  C CB   . ALA A 1 250 ? 77.940  -74.978  19.606  1.00 18.31  ? 294 ALA A CB   1 
ATOM   3727  H H    . ALA A 1 250 ? 80.259  -75.628  19.967  1.00 22.07  ? 294 ALA A H    1 
ATOM   3728  H HA   . ALA A 1 250 ? 79.164  -73.716  18.553  1.00 27.39  ? 294 ALA A HA   1 
ATOM   3729  H HB1  . ALA A 1 250 ? 77.136  -74.457  19.453  1.00 21.98  ? 294 ALA A HB1  1 
ATOM   3730  H HB2  . ALA A 1 250 ? 78.001  -75.693  18.953  1.00 21.98  ? 294 ALA A HB2  1 
ATOM   3731  H HB3  . ALA A 1 250 ? 77.930  -75.348  20.502  1.00 21.98  ? 294 ALA A HB3  1 
ATOM   3732  N N    . ALA A 1 251 ? 79.368  -73.117  21.697  1.00 25.46  ? 295 ALA A N    1 
ATOM   3733  C CA   . ALA A 1 251 ? 79.357  -72.028  22.668  1.00 22.44  ? 295 ALA A CA   1 
ATOM   3734  C C    . ALA A 1 251 ? 80.393  -70.969  22.325  1.00 13.70  ? 295 ALA A C    1 
ATOM   3735  O O    . ALA A 1 251 ? 80.162  -69.777  22.557  1.00 24.77  ? 295 ALA A O    1 
ATOM   3736  C CB   . ALA A 1 251 ? 79.606  -72.571  24.074  1.00 25.13  ? 295 ALA A CB   1 
ATOM   3737  H H    . ALA A 1 251 ? 79.578  -73.885  22.022  1.00 30.56  ? 295 ALA A H    1 
ATOM   3738  H HA   . ALA A 1 251 ? 78.484  -71.607  22.660  1.00 26.94  ? 295 ALA A HA   1 
ATOM   3739  H HB1  . ALA A 1 251 ? 79.596  -71.833  24.704  1.00 30.16  ? 295 ALA A HB1  1 
ATOM   3740  H HB2  . ALA A 1 251 ? 78.907  -73.206  24.295  1.00 30.16  ? 295 ALA A HB2  1 
ATOM   3741  H HB3  . ALA A 1 251 ? 80.471  -73.011  24.094  1.00 30.16  ? 295 ALA A HB3  1 
ATOM   3742  N N    . LYS A 1 252 ? 81.536  -71.381  21.773  1.00 17.85  ? 296 LYS A N    1 
ATOM   3743  C CA   . LYS A 1 252 ? 82.554  -70.416  21.370  1.00 16.89  ? 296 LYS A CA   1 
ATOM   3744  C C    . LYS A 1 252 ? 82.088  -69.595  20.173  1.00 21.57  ? 296 LYS A C    1 
ATOM   3745  O O    . LYS A 1 252 ? 82.254  -68.370  20.152  1.00 22.66  ? 296 LYS A O    1 
ATOM   3746  C CB   . LYS A 1 252 ? 83.861  -71.142  21.054  1.00 19.11  ? 296 LYS A CB   1 
ATOM   3747  C CG   . LYS A 1 252 ? 85.044  -70.216  20.822  1.00 31.83  ? 296 LYS A CG   1 
ATOM   3748  H H    . LYS A 1 252 ? 81.743  -72.202  21.624  1.00 21.42  ? 296 LYS A H    1 
ATOM   3749  H HA   . LYS A 1 252 ? 82.720  -69.806  22.105  1.00 20.27  ? 296 LYS A HA   1 
ATOM   3750  H HB2  . LYS A 1 252 ? 84.083  -71.723  21.799  1.00 22.94  ? 296 LYS A HB2  1 
ATOM   3751  H HB3  . LYS A 1 252 ? 83.738  -71.672  20.251  1.00 22.94  ? 296 LYS A HB3  1 
ATOM   3752  N N    . VAL A 1 253 ? 81.495  -70.249  19.170  1.00 23.61  ? 297 VAL A N    1 
ATOM   3753  C CA   . VAL A 1 253 ? 80.946  -69.518  18.030  1.00 20.05  ? 297 VAL A CA   1 
ATOM   3754  C C    . VAL A 1 253 ? 79.851  -68.563  18.490  1.00 16.32  ? 297 VAL A C    1 
ATOM   3755  O O    . VAL A 1 253 ? 79.759  -67.424  18.016  1.00 18.10  ? 297 VAL A O    1 
ATOM   3756  C CB   . VAL A 1 253 ? 80.431  -70.503  16.963  1.00 29.00  ? 297 VAL A CB   1 
ATOM   3757  C CG1  . VAL A 1 253 ? 79.665  -69.769  15.865  1.00 18.67  ? 297 VAL A CG1  1 
ATOM   3758  C CG2  . VAL A 1 253 ? 81.592  -71.280  16.360  1.00 22.77  ? 297 VAL A CG2  1 
ATOM   3759  H H    . VAL A 1 253 ? 81.401  -71.103  19.127  1.00 28.33  ? 297 VAL A H    1 
ATOM   3760  H HA   . VAL A 1 253 ? 81.653  -68.989  17.629  1.00 24.06  ? 297 VAL A HA   1 
ATOM   3761  H HB   . VAL A 1 253 ? 79.828  -71.137  17.380  1.00 34.80  ? 297 VAL A HB   1 
ATOM   3762  H HG11 . VAL A 1 253 ? 79.355  -70.415  15.211  1.00 22.40  ? 297 VAL A HG11 1 
ATOM   3763  H HG12 . VAL A 1 253 ? 78.908  -69.310  16.262  1.00 22.40  ? 297 VAL A HG12 1 
ATOM   3764  H HG13 . VAL A 1 253 ? 80.257  -69.127  15.442  1.00 22.40  ? 297 VAL A HG13 1 
ATOM   3765  H HG21 . VAL A 1 253 ? 81.248  -71.893  15.692  1.00 27.33  ? 297 VAL A HG21 1 
ATOM   3766  H HG22 . VAL A 1 253 ? 82.211  -70.656  15.949  1.00 27.33  ? 297 VAL A HG22 1 
ATOM   3767  H HG23 . VAL A 1 253 ? 82.040  -71.775  17.064  1.00 27.33  ? 297 VAL A HG23 1 
ATOM   3768  N N    . ALA A 1 254 ? 78.999  -69.009  19.415  1.00 13.72  ? 298 ALA A N    1 
ATOM   3769  C CA   . ALA A 1 254 ? 77.949  -68.135  19.928  1.00 22.69  ? 298 ALA A CA   1 
ATOM   3770  C C    . ALA A 1 254 ? 78.541  -66.906  20.607  1.00 27.47  ? 298 ALA A C    1 
ATOM   3771  O O    . ALA A 1 254 ? 78.038  -65.789  20.439  1.00 22.59  ? 298 ALA A O    1 
ATOM   3772  C CB   . ALA A 1 254 ? 77.054  -68.905  20.897  1.00 22.00  ? 298 ALA A CB   1 
ATOM   3773  H H    . ALA A 1 254 ? 79.009  -69.799  19.755  1.00 16.47  ? 298 ALA A H    1 
ATOM   3774  H HA   . ALA A 1 254 ? 77.400  -67.833  19.187  1.00 27.23  ? 298 ALA A HA   1 
ATOM   3775  H HB1  . ALA A 1 254 ? 76.362  -68.311  21.227  1.00 26.41  ? 298 ALA A HB1  1 
ATOM   3776  H HB2  . ALA A 1 254 ? 76.651  -69.653  20.427  1.00 26.41  ? 298 ALA A HB2  1 
ATOM   3777  H HB3  . ALA A 1 254 ? 77.593  -69.229  21.635  1.00 26.41  ? 298 ALA A HB3  1 
ATOM   3778  N N    . ALA A 1 255 ? 79.619  -67.092  21.373  1.00 21.17  ? 299 ALA A N    1 
ATOM   3779  C CA   . ALA A 1 255 ? 80.244  -65.965  22.056  1.00 25.04  ? 299 ALA A CA   1 
ATOM   3780  C C    . ALA A 1 255 ? 80.911  -65.020  21.065  1.00 24.78  ? 299 ALA A C    1 
ATOM   3781  O O    . ALA A 1 255 ? 80.867  -63.796  21.238  1.00 29.80  ? 299 ALA A O    1 
ATOM   3782  C CB   . ALA A 1 255 ? 81.260  -66.475  23.076  1.00 24.56  ? 299 ALA A CB   1 
ATOM   3783  H H    . ALA A 1 255 ? 80.000  -67.850  21.511  1.00 25.41  ? 299 ALA A H    1 
ATOM   3784  H HA   . ALA A 1 255 ? 79.563  -65.467  22.534  1.00 30.05  ? 299 ALA A HA   1 
ATOM   3785  H HB1  . ALA A 1 255 ? 81.668  -65.716  23.522  1.00 29.47  ? 299 ALA A HB1  1 
ATOM   3786  H HB2  . ALA A 1 255 ? 80.804  -67.034  23.724  1.00 29.47  ? 299 ALA A HB2  1 
ATOM   3787  H HB3  . ALA A 1 255 ? 81.939  -66.991  22.613  1.00 29.47  ? 299 ALA A HB3  1 
ATOM   3788  N N    . LEU A 1 256 ? 81.534  -65.569  20.020  1.00 17.39  ? 300 LEU A N    1 
ATOM   3789  C CA   . LEU A 1 256 ? 82.239  -64.738  19.051  1.00 19.43  ? 300 LEU A CA   1 
ATOM   3790  C C    . LEU A 1 256 ? 81.270  -63.919  18.208  1.00 24.43  ? 300 LEU A C    1 
ATOM   3791  O O    . LEU A 1 256 ? 81.566  -62.773  17.852  1.00 30.56  ? 300 LEU A O    1 
ATOM   3792  C CB   . LEU A 1 256 ? 83.114  -65.615  18.155  1.00 27.37  ? 300 LEU A CB   1 
ATOM   3793  C CG   . LEU A 1 256 ? 84.348  -66.227  18.819  1.00 26.90  ? 300 LEU A CG   1 
ATOM   3794  C CD1  . LEU A 1 256 ? 84.898  -67.367  17.981  1.00 31.74  ? 300 LEU A CD1  1 
ATOM   3795  C CD2  . LEU A 1 256 ? 85.412  -65.168  19.037  1.00 26.70  ? 300 LEU A CD2  1 
ATOM   3796  H H    . LEU A 1 256 ? 81.561  -66.412  19.853  1.00 20.87  ? 300 LEU A H    1 
ATOM   3797  H HA   . LEU A 1 256 ? 82.818  -64.121  19.526  1.00 23.32  ? 300 LEU A HA   1 
ATOM   3798  H HB2  . LEU A 1 256 ? 82.571  -66.346  17.821  1.00 32.84  ? 300 LEU A HB2  1 
ATOM   3799  H HB3  . LEU A 1 256 ? 83.423  -65.077  17.410  1.00 32.84  ? 300 LEU A HB3  1 
ATOM   3800  H HG   . LEU A 1 256 ? 84.097  -66.584  19.686  1.00 32.28  ? 300 LEU A HG   1 
ATOM   3801  H HD11 . LEU A 1 256 ? 85.678  -67.737  18.424  1.00 38.09  ? 300 LEU A HD11 1 
ATOM   3802  H HD12 . LEU A 1 256 ? 84.214  -68.050  17.890  1.00 38.09  ? 300 LEU A HD12 1 
ATOM   3803  H HD13 . LEU A 1 256 ? 85.144  -67.026  17.107  1.00 38.09  ? 300 LEU A HD13 1 
ATOM   3804  H HD21 . LEU A 1 256 ? 86.184  -65.578  19.458  1.00 32.05  ? 300 LEU A HD21 1 
ATOM   3805  H HD22 . LEU A 1 256 ? 85.664  -64.793  18.178  1.00 32.05  ? 300 LEU A HD22 1 
ATOM   3806  H HD23 . LEU A 1 256 ? 85.053  -64.472  19.609  1.00 32.05  ? 300 LEU A HD23 1 
ATOM   3807  N N    . THR A 1 257 ? 80.111  -64.487  17.878  1.00 20.27  ? 301 THR A N    1 
ATOM   3808  C CA   . THR A 1 257 ? 79.164  -63.825  16.992  1.00 23.68  ? 301 THR A CA   1 
ATOM   3809  C C    . THR A 1 257 ? 78.096  -63.037  17.735  1.00 25.98  ? 301 THR A C    1 
ATOM   3810  O O    . THR A 1 257 ? 77.534  -62.095  17.164  1.00 30.29  ? 301 THR A O    1 
ATOM   3811  C CB   . THR A 1 257 ? 78.476  -64.853  16.088  1.00 13.99  ? 301 THR A CB   1 
ATOM   3812  O OG1  . THR A 1 257 ? 77.652  -65.718  16.878  1.00 17.52  ? 301 THR A OG1  1 
ATOM   3813  C CG2  . THR A 1 257 ? 79.507  -65.683  15.333  1.00 22.80  ? 301 THR A CG2  1 
ATOM   3814  H H    . THR A 1 257 ? 79.851  -65.258  18.157  1.00 24.32  ? 301 THR A H    1 
ATOM   3815  H HA   . THR A 1 257 ? 79.649  -63.206  16.423  1.00 28.42  ? 301 THR A HA   1 
ATOM   3816  H HB   . THR A 1 257 ? 77.924  -64.390  15.438  1.00 16.79  ? 301 THR A HB   1 
ATOM   3817  H HG1  . THR A 1 257 ? 78.121  -66.123  17.446  1.00 21.03  ? 301 THR A HG1  1 
ATOM   3818  H HG21 . THR A 1 257 ? 79.060  -66.330  14.765  1.00 27.36  ? 301 THR A HG21 1 
ATOM   3819  H HG22 . THR A 1 257 ? 80.057  -65.105  14.781  1.00 27.36  ? 301 THR A HG22 1 
ATOM   3820  H HG23 . THR A 1 257 ? 80.076  -66.155  15.961  1.00 27.36  ? 301 THR A HG23 1 
ATOM   3821  N N    . GLY A 1 258 ? 77.809  -63.386  18.985  1.00 21.61  ? 302 GLY A N    1 
ATOM   3822  C CA   . GLY A 1 258 ? 76.696  -62.790  19.689  1.00 22.01  ? 302 GLY A CA   1 
ATOM   3823  C C    . GLY A 1 258 ? 75.350  -63.377  19.338  1.00 21.25  ? 302 GLY A C    1 
ATOM   3824  O O    . GLY A 1 258 ? 74.324  -62.804  19.717  1.00 23.26  ? 302 GLY A O    1 
ATOM   3825  H H    . GLY A 1 258 ? 78.247  -63.968  19.443  1.00 25.94  ? 302 GLY A H    1 
ATOM   3826  H HA2  . GLY A 1 258 ? 76.832  -62.897  20.644  1.00 26.42  ? 302 GLY A HA2  1 
ATOM   3827  H HA3  . GLY A 1 258 ? 76.670  -61.840  19.493  1.00 26.42  ? 302 GLY A HA3  1 
ATOM   3828  N N    . LEU A 1 259 ? 75.320  -64.499  18.625  1.00 26.77  ? 303 LEU A N    1 
ATOM   3829  C CA   . LEU A 1 259 ? 74.079  -65.139  18.231  1.00 17.32  ? 303 LEU A CA   1 
ATOM   3830  C C    . LEU A 1 259 ? 73.903  -66.460  18.974  1.00 17.63  ? 303 LEU A C    1 
ATOM   3831  O O    . LEU A 1 259 ? 74.887  -67.090  19.373  1.00 20.85  ? 303 LEU A O    1 
ATOM   3832  C CB   . LEU A 1 259 ? 74.051  -65.392  16.719  1.00 21.78  ? 303 LEU A CB   1 
ATOM   3833  C CG   . LEU A 1 259 ? 74.053  -64.140  15.838  1.00 29.82  ? 303 LEU A CG   1 
ATOM   3834  C CD1  . LEU A 1 259 ? 74.219  -64.511  14.372  1.00 21.63  ? 303 LEU A CD1  1 
ATOM   3835  C CD2  . LEU A 1 259 ? 72.779  -63.328  16.039  1.00 23.98  ? 303 LEU A CD2  1 
ATOM   3836  H H    . LEU A 1 259 ? 76.022  -64.915  18.353  1.00 32.12  ? 303 LEU A H    1 
ATOM   3837  H HA   . LEU A 1 259 ? 73.334  -64.560  18.457  1.00 20.79  ? 303 LEU A HA   1 
ATOM   3838  H HB2  . LEU A 1 259 ? 74.832  -65.916  16.481  1.00 26.13  ? 303 LEU A HB2  1 
ATOM   3839  H HB3  . LEU A 1 259 ? 73.248  -65.894  16.507  1.00 26.13  ? 303 LEU A HB3  1 
ATOM   3840  H HG   . LEU A 1 259 ? 74.804  -63.580  16.090  1.00 35.78  ? 303 LEU A HG   1 
ATOM   3841  H HD11 . LEU A 1 259 ? 74.217  -63.700  13.840  1.00 25.96  ? 303 LEU A HD11 1 
ATOM   3842  H HD12 . LEU A 1 259 ? 75.061  -64.979  14.259  1.00 25.96  ? 303 LEU A HD12 1 
ATOM   3843  H HD13 . LEU A 1 259 ? 73.483  -65.083  14.107  1.00 25.96  ? 303 LEU A HD13 1 
ATOM   3844  H HD21 . LEU A 1 259 ? 72.811  -62.544  15.469  1.00 28.78  ? 303 LEU A HD21 1 
ATOM   3845  H HD22 . LEU A 1 259 ? 72.015  -63.877  15.803  1.00 28.78  ? 303 LEU A HD22 1 
ATOM   3846  H HD23 . LEU A 1 259 ? 72.719  -63.059  16.969  1.00 28.78  ? 303 LEU A HD23 1 
ATOM   3847  N N    . PRO A 1 260 ? 72.663  -66.908  19.174  1.00 16.91  ? 304 PRO A N    1 
ATOM   3848  C CA   . PRO A 1 260 ? 72.409  -68.102  19.999  1.00 23.06  ? 304 PRO A CA   1 
ATOM   3849  C C    . PRO A 1 260 ? 72.676  -69.407  19.255  1.00 22.14  ? 304 PRO A C    1 
ATOM   3850  O O    . PRO A 1 260 ? 71.796  -70.254  19.086  1.00 18.98  ? 304 PRO A O    1 
ATOM   3851  C CB   . PRO A 1 260 ? 70.931  -67.927  20.370  1.00 19.75  ? 304 PRO A CB   1 
ATOM   3852  C CG   . PRO A 1 260 ? 70.345  -67.250  19.180  1.00 17.09  ? 304 PRO A CG   1 
ATOM   3853  C CD   . PRO A 1 260 ? 71.411  -66.312  18.674  1.00 25.89  ? 304 PRO A CD   1 
ATOM   3854  H HA   . PRO A 1 260 ? 72.947  -68.075  20.806  1.00 27.67  ? 304 PRO A HA   1 
ATOM   3855  H HB2  . PRO A 1 260 ? 70.521  -68.794  20.512  1.00 23.71  ? 304 PRO A HB2  1 
ATOM   3856  H HB3  . PRO A 1 260 ? 70.851  -67.370  21.160  1.00 23.71  ? 304 PRO A HB3  1 
ATOM   3857  H HG2  . PRO A 1 260 ? 70.125  -67.911  18.506  1.00 20.51  ? 304 PRO A HG2  1 
ATOM   3858  H HG3  . PRO A 1 260 ? 69.554  -66.755  19.445  1.00 20.51  ? 304 PRO A HG3  1 
ATOM   3859  H HD2  . PRO A 1 260 ? 71.410  -66.292  17.704  1.00 31.07  ? 304 PRO A HD2  1 
ATOM   3860  H HD3  . PRO A 1 260 ? 71.286  -65.425  19.048  1.00 31.07  ? 304 PRO A HD3  1 
ATOM   3861  N N    . PHE A 1 261 ? 73.914  -69.582  18.805  1.00 18.94  ? 305 PHE A N    1 
ATOM   3862  C CA   . PHE A 1 261 ? 74.292  -70.832  18.165  1.00 18.18  ? 305 PHE A CA   1 
ATOM   3863  C C    . PHE A 1 261 ? 74.345  -71.957  19.190  1.00 26.10  ? 305 PHE A C    1 
ATOM   3864  O O    . PHE A 1 261 ? 74.747  -71.755  20.339  1.00 25.66  ? 305 PHE A O    1 
ATOM   3865  C CB   . PHE A 1 261 ? 75.644  -70.691  17.468  1.00 20.73  ? 305 PHE A CB   1 
ATOM   3866  C CG   . PHE A 1 261 ? 75.599  -69.846  16.229  1.00 21.13  ? 305 PHE A CG   1 
ATOM   3867  C CD1  . PHE A 1 261 ? 75.015  -70.326  15.071  1.00 18.64  ? 305 PHE A CD1  1 
ATOM   3868  C CD2  . PHE A 1 261 ? 76.144  -68.574  16.220  1.00 23.77  ? 305 PHE A CD2  1 
ATOM   3869  C CE1  . PHE A 1 261 ? 74.971  -69.553  13.928  1.00 17.77  ? 305 PHE A CE1  1 
ATOM   3870  C CE2  . PHE A 1 261 ? 76.105  -67.798  15.079  1.00 25.12  ? 305 PHE A CE2  1 
ATOM   3871  C CZ   . PHE A 1 261 ? 75.516  -68.288  13.932  1.00 17.78  ? 305 PHE A CZ   1 
ATOM   3872  H H    . PHE A 1 261 ? 74.545  -69.001  18.859  1.00 22.73  ? 305 PHE A H    1 
ATOM   3873  H HA   . PHE A 1 261 ? 73.628  -71.062  17.496  1.00 21.82  ? 305 PHE A HA   1 
ATOM   3874  H HB2  . PHE A 1 261 ? 76.272  -70.282  18.084  1.00 24.88  ? 305 PHE A HB2  1 
ATOM   3875  H HB3  . PHE A 1 261 ? 75.959  -71.573  17.215  1.00 24.88  ? 305 PHE A HB3  1 
ATOM   3876  H HD1  . PHE A 1 261 ? 74.644  -71.179  15.063  1.00 22.37  ? 305 PHE A HD1  1 
ATOM   3877  H HD2  . PHE A 1 261 ? 76.541  -68.239  16.991  1.00 28.53  ? 305 PHE A HD2  1 
ATOM   3878  H HE1  . PHE A 1 261 ? 74.575  -69.887  13.156  1.00 21.33  ? 305 PHE A HE1  1 
ATOM   3879  H HE2  . PHE A 1 261 ? 76.473  -66.944  15.084  1.00 30.15  ? 305 PHE A HE2  1 
ATOM   3880  H HZ   . PHE A 1 261 ? 75.489  -67.766  13.162  1.00 21.34  ? 305 PHE A HZ   1 
ATOM   3881  N N    . VAL A 1 262 ? 73.916  -73.149  18.769  1.00 20.35  ? 306 VAL A N    1 
ATOM   3882  C CA   . VAL A 1 262 ? 73.964  -74.343  19.601  1.00 15.99  ? 306 VAL A CA   1 
ATOM   3883  C C    . VAL A 1 262 ? 74.395  -75.513  18.728  1.00 23.06  ? 306 VAL A C    1 
ATOM   3884  O O    . VAL A 1 262 ? 74.346  -75.452  17.498  1.00 21.59  ? 306 VAL A O    1 
ATOM   3885  C CB   . VAL A 1 262 ? 72.609  -74.651  20.278  1.00 18.70  ? 306 VAL A CB   1 
ATOM   3886  C CG1  . VAL A 1 262 ? 72.134  -73.451  21.085  1.00 20.48  ? 306 VAL A CG1  1 
ATOM   3887  C CG2  . VAL A 1 262 ? 71.557  -75.056  19.246  1.00 20.75  ? 306 VAL A CG2  1 
ATOM   3888  H H    . VAL A 1 262 ? 73.587  -73.289  17.987  1.00 24.42  ? 306 VAL A H    1 
ATOM   3889  H HA   . VAL A 1 262 ? 74.629  -74.222  20.296  1.00 19.20  ? 306 VAL A HA   1 
ATOM   3890  H HB   . VAL A 1 262 ? 72.726  -75.394  20.891  1.00 22.45  ? 306 VAL A HB   1 
ATOM   3891  H HG11 . VAL A 1 262 ? 71.285  -73.667  21.500  1.00 24.58  ? 306 VAL A HG11 1 
ATOM   3892  H HG12 . VAL A 1 262 ? 72.794  -73.248  21.766  1.00 24.58  ? 306 VAL A HG12 1 
ATOM   3893  H HG13 . VAL A 1 262 ? 72.029  -72.693  20.489  1.00 24.58  ? 306 VAL A HG13 1 
ATOM   3894  H HG21 . VAL A 1 262 ? 70.722  -75.242  19.703  1.00 24.90  ? 306 VAL A HG21 1 
ATOM   3895  H HG22 . VAL A 1 262 ? 71.436  -74.328  18.617  1.00 24.90  ? 306 VAL A HG22 1 
ATOM   3896  H HG23 . VAL A 1 262 ? 71.863  -75.850  18.779  1.00 24.90  ? 306 VAL A HG23 1 
ATOM   3897  N N    . THR A 1 263 ? 74.824  -76.587  19.381  1.00 21.66  ? 307 THR A N    1 
ATOM   3898  C CA   . THR A 1 263 ? 75.191  -77.798  18.663  1.00 19.10  ? 307 THR A CA   1 
ATOM   3899  C C    . THR A 1 263 ? 73.933  -78.554  18.255  1.00 22.48  ? 307 THR A C    1 
ATOM   3900  O O    . THR A 1 263 ? 72.947  -78.597  18.997  1.00 18.50  ? 307 THR A O    1 
ATOM   3901  C CB   . THR A 1 263 ? 76.094  -78.685  19.524  1.00 17.49  ? 307 THR A CB   1 
ATOM   3902  O OG1  . THR A 1 263 ? 76.715  -79.685  18.706  1.00 28.59  ? 307 THR A OG1  1 
ATOM   3903  C CG2  . THR A 1 263 ? 75.303  -79.361  20.645  1.00 25.84  ? 307 THR A CG2  1 
ATOM   3904  H H    . THR A 1 263 ? 74.910  -76.640  20.235  1.00 26.00  ? 307 THR A H    1 
ATOM   3905  H HA   . THR A 1 263 ? 75.678  -77.558  17.859  1.00 22.92  ? 307 THR A HA   1 
ATOM   3906  H HB   . THR A 1 263 ? 76.782  -78.136  19.931  1.00 20.99  ? 307 THR A HB   1 
ATOM   3907  H HG1  . THR A 1 263 ? 77.179  -79.319  18.109  1.00 34.31  ? 307 THR A HG1  1 
ATOM   3908  H HG21 . THR A 1 263 ? 75.892  -79.918  21.177  1.00 31.02  ? 307 THR A HG21 1 
ATOM   3909  H HG22 . THR A 1 263 ? 74.900  -78.690  21.217  1.00 31.02  ? 307 THR A HG22 1 
ATOM   3910  H HG23 . THR A 1 263 ? 74.602  -79.915  20.267  1.00 31.02  ? 307 THR A HG23 1 
ATOM   3911  N N    . ALA A 1 264 ? 73.969  -79.146  17.068  1.00 22.75  ? 308 ALA A N    1 
ATOM   3912  C CA   . ALA A 1 264 ? 72.812  -79.877  16.571  1.00 17.61  ? 308 ALA A CA   1 
ATOM   3913  C C    . ALA A 1 264 ? 72.535  -81.082  17.467  1.00 21.65  ? 308 ALA A C    1 
ATOM   3914  O O    . ALA A 1 264 ? 73.442  -81.894  17.700  1.00 16.96  ? 308 ALA A O    1 
ATOM   3915  C CB   . ALA A 1 264 ? 73.042  -80.337  15.134  1.00 22.24  ? 308 ALA A CB   1 
ATOM   3916  H H    . ALA A 1 264 ? 74.644  -79.140  16.535  1.00 27.31  ? 308 ALA A H    1 
ATOM   3917  H HA   . ALA A 1 264 ? 72.034  -79.298  16.587  1.00 21.13  ? 308 ALA A HA   1 
ATOM   3918  H HB1  . ALA A 1 264 ? 72.258  -80.820  14.828  1.00 26.69  ? 308 ALA A HB1  1 
ATOM   3919  H HB2  . ALA A 1 264 ? 73.191  -79.560  14.574  1.00 26.69  ? 308 ALA A HB2  1 
ATOM   3920  H HB3  . ALA A 1 264 ? 73.819  -80.918  15.109  1.00 26.69  ? 308 ALA A HB3  1 
ATOM   3921  N N    . PRO A 1 265 ? 71.314  -81.234  17.993  1.00 18.64  ? 309 PRO A N    1 
ATOM   3922  C CA   . PRO A 1 265 ? 71.019  -82.419  18.819  1.00 16.55  ? 309 PRO A CA   1 
ATOM   3923  C C    . PRO A 1 265 ? 71.263  -83.741  18.112  1.00 19.27  ? 309 PRO A C    1 
ATOM   3924  O O    . PRO A 1 265 ? 71.599  -84.731  18.774  1.00 21.13  ? 309 PRO A O    1 
ATOM   3925  C CB   . PRO A 1 265 ? 69.537  -82.237  19.172  1.00 16.41  ? 309 PRO A CB   1 
ATOM   3926  C CG   . PRO A 1 265 ? 69.312  -80.770  19.108  1.00 27.90  ? 309 PRO A CG   1 
ATOM   3927  C CD   . PRO A 1 265 ? 70.209  -80.258  18.017  1.00 22.64  ? 309 PRO A CD   1 
ATOM   3928  H HA   . PRO A 1 265 ? 71.544  -82.395  19.635  1.00 19.86  ? 309 PRO A HA   1 
ATOM   3929  H HB2  . PRO A 1 265 ? 68.986  -82.698  18.521  1.00 19.69  ? 309 PRO A HB2  1 
ATOM   3930  H HB3  . PRO A 1 265 ? 69.369  -82.572  20.067  1.00 19.69  ? 309 PRO A HB3  1 
ATOM   3931  H HG2  . PRO A 1 265 ? 68.383  -80.593  18.894  1.00 33.49  ? 309 PRO A HG2  1 
ATOM   3932  H HG3  . PRO A 1 265 ? 69.548  -80.368  19.958  1.00 33.49  ? 309 PRO A HG3  1 
ATOM   3933  H HD2  . PRO A 1 265 ? 69.741  -80.256  17.168  1.00 27.17  ? 309 PRO A HD2  1 
ATOM   3934  H HD3  . PRO A 1 265 ? 70.544  -79.375  18.241  1.00 27.17  ? 309 PRO A HD3  1 
ATOM   3935  N N    . ASN A 1 266 ? 71.098  -83.796  16.791  1.00 21.69  ? 310 ASN A N    1 
ATOM   3936  C CA   . ASN A 1 266 ? 71.340  -85.010  16.016  1.00 17.03  ? 310 ASN A CA   1 
ATOM   3937  C C    . ASN A 1 266 ? 72.261  -84.656  14.858  1.00 15.68  ? 310 ASN A C    1 
ATOM   3938  O O    . ASN A 1 266 ? 71.841  -83.987  13.908  1.00 17.60  ? 310 ASN A O    1 
ATOM   3939  C CB   . ASN A 1 266 ? 70.030  -85.616  15.508  1.00 19.34  ? 310 ASN A CB   1 
ATOM   3940  C CG   . ASN A 1 266 ? 70.233  -86.963  14.839  1.00 15.63  ? 310 ASN A CG   1 
ATOM   3941  O OD1  . ASN A 1 266 ? 70.798  -87.048  13.748  1.00 21.85  ? 310 ASN A OD1  1 
ATOM   3942  N ND2  . ASN A 1 266 ? 69.765  -88.024  15.487  1.00 26.23  ? 310 ASN A ND2  1 
ATOM   3943  H H    . ASN A 1 266 ? 70.842  -83.129  16.313  1.00 26.03  ? 310 ASN A H    1 
ATOM   3944  H HA   . ASN A 1 266 ? 71.785  -85.667  16.574  1.00 20.44  ? 310 ASN A HA   1 
ATOM   3945  H HB2  . ASN A 1 266 ? 69.427  -85.740  16.257  1.00 23.21  ? 310 ASN A HB2  1 
ATOM   3946  H HB3  . ASN A 1 266 ? 69.634  -85.014  14.859  1.00 23.21  ? 310 ASN A HB3  1 
ATOM   3947  H HD21 . ASN A 1 266 ? 69.856  -88.809  15.148  1.00 31.47  ? 310 ASN A HD21 1 
ATOM   3948  H HD22 . ASN A 1 266 ? 69.372  -87.925  16.245  1.00 31.47  ? 310 ASN A HD22 1 
ATOM   3949  N N    . LYS A 1 267 ? 73.516  -85.105  14.937  1.00 21.06  ? 311 LYS A N    1 
ATOM   3950  C CA   . LYS A 1 267 ? 74.504  -84.761  13.921  1.00 25.34  ? 311 LYS A CA   1 
ATOM   3951  C C    . LYS A 1 267 ? 74.278  -85.502  12.612  1.00 21.26  ? 311 LYS A C    1 
ATOM   3952  O O    . LYS A 1 267 ? 74.796  -85.072  11.577  1.00 14.83  ? 311 LYS A O    1 
ATOM   3953  C CB   . LYS A 1 267 ? 75.915  -85.055  14.436  1.00 17.59  ? 311 LYS A CB   1 
ATOM   3954  C CG   . LYS A 1 267 ? 76.350  -84.181  15.596  1.00 18.89  ? 311 LYS A CG   1 
ATOM   3955  C CD   . LYS A 1 267 ? 76.407  -82.715  15.201  1.00 28.39  ? 311 LYS A CD   1 
ATOM   3956  C CE   . LYS A 1 267 ? 77.035  -81.871  16.294  1.00 25.81  ? 311 LYS A CE   1 
ATOM   3957  N NZ   . LYS A 1 267 ? 76.324  -82.025  17.592  1.00 24.79  ? 311 LYS A NZ   1 
ATOM   3958  H H    . LYS A 1 267 ? 73.816  -85.607  15.568  1.00 25.28  ? 311 LYS A H    1 
ATOM   3959  H HA   . LYS A 1 267 ? 74.446  -83.811  13.738  1.00 30.41  ? 311 LYS A HA   1 
ATOM   3960  H HB2  . LYS A 1 267 ? 75.952  -85.978  14.732  1.00 21.11  ? 311 LYS A HB2  1 
ATOM   3961  H HB3  . LYS A 1 267 ? 76.545  -84.918  13.711  1.00 21.11  ? 311 LYS A HB3  1 
ATOM   3962  H HG2  . LYS A 1 267 ? 75.715  -84.276  16.323  1.00 22.67  ? 311 LYS A HG2  1 
ATOM   3963  H HG3  . LYS A 1 267 ? 77.235  -84.452  15.885  1.00 22.67  ? 311 LYS A HG3  1 
ATOM   3964  H HD2  . LYS A 1 267 ? 76.942  -82.620  14.397  1.00 34.08  ? 311 LYS A HD2  1 
ATOM   3965  H HD3  . LYS A 1 267 ? 75.506  -82.390  15.045  1.00 34.08  ? 311 LYS A HD3  1 
ATOM   3966  H HE2  . LYS A 1 267 ? 77.957  -82.146  16.419  1.00 30.97  ? 311 LYS A HE2  1 
ATOM   3967  H HE3  . LYS A 1 267 ? 76.997  -80.937  16.037  1.00 30.97  ? 311 LYS A HE3  1 
ATOM   3968  H HZ1  . LYS A 1 267 ? 76.713  -81.521  18.213  1.00 29.75  ? 311 LYS A HZ1  1 
ATOM   3969  H HZ2  . LYS A 1 267 ? 75.475  -81.774  17.505  1.00 29.75  ? 311 LYS A HZ2  1 
ATOM   3970  H HZ3  . LYS A 1 267 ? 76.350  -82.876  17.853  1.00 29.75  ? 311 LYS A HZ3  1 
ATOM   3971  N N    . PHE A 1 268 ? 73.527  -86.602  12.628  1.00 17.88  ? 312 PHE A N    1 
ATOM   3972  C CA   . PHE A 1 268 ? 73.249  -87.313  11.385  1.00 16.18  ? 312 PHE A CA   1 
ATOM   3973  C C    . PHE A 1 268 ? 72.240  -86.549  10.540  1.00 20.49  ? 312 PHE A C    1 
ATOM   3974  O O    . PHE A 1 268 ? 72.372  -86.482  9.312   1.00 15.56  ? 312 PHE A O    1 
ATOM   3975  C CB   . PHE A 1 268 ? 72.754  -88.724  11.696  1.00 17.89  ? 312 PHE A CB   1 
ATOM   3976  C CG   . PHE A 1 268 ? 73.627  -89.457  12.670  1.00 25.70  ? 312 PHE A CG   1 
ATOM   3977  C CD1  . PHE A 1 268 ? 74.827  -90.013  12.260  1.00 22.79  ? 312 PHE A CD1  1 
ATOM   3978  C CD2  . PHE A 1 268 ? 73.259  -89.573  14.000  1.00 15.20  ? 312 PHE A CD2  1 
ATOM   3979  C CE1  . PHE A 1 268 ? 75.640  -90.680  13.155  1.00 17.68  ? 312 PHE A CE1  1 
ATOM   3980  C CE2  . PHE A 1 268 ? 74.066  -90.238  14.901  1.00 20.36  ? 312 PHE A CE2  1 
ATOM   3981  C CZ   . PHE A 1 268 ? 75.261  -90.790  14.478  1.00 14.21  ? 312 PHE A CZ   1 
ATOM   3982  H H    . PHE A 1 268 ? 73.173  -86.950  13.330  1.00 21.45  ? 312 PHE A H    1 
ATOM   3983  H HA   . PHE A 1 268 ? 74.071  -87.389  10.875  1.00 19.42  ? 312 PHE A HA   1 
ATOM   3984  H HB2  . PHE A 1 268 ? 71.864  -88.668  12.076  1.00 21.47  ? 312 PHE A HB2  1 
ATOM   3985  H HB3  . PHE A 1 268 ? 72.730  -89.237  10.873  1.00 21.47  ? 312 PHE A HB3  1 
ATOM   3986  H HD1  . PHE A 1 268 ? 75.087  -89.939  11.370  1.00 27.36  ? 312 PHE A HD1  1 
ATOM   3987  H HD2  . PHE A 1 268 ? 72.457  -89.200  14.289  1.00 18.24  ? 312 PHE A HD2  1 
ATOM   3988  H HE1  . PHE A 1 268 ? 76.442  -91.052  12.868  1.00 21.21  ? 312 PHE A HE1  1 
ATOM   3989  H HE2  . PHE A 1 268 ? 73.808  -90.312  15.791  1.00 24.43  ? 312 PHE A HE2  1 
ATOM   3990  H HZ   . PHE A 1 268 ? 75.805  -91.242  15.083  1.00 17.05  ? 312 PHE A HZ   1 
ATOM   3991  N N    . GLU A 1 269 ? 71.229  -85.960  11.181  1.00 14.46  ? 313 GLU A N    1 
ATOM   3992  C CA   . GLU A 1 269 ? 70.321  -85.066  10.473  1.00 18.66  ? 313 GLU A CA   1 
ATOM   3993  C C    . GLU A 1 269 ? 71.047  -83.823  9.981   1.00 24.25  ? 313 GLU A C    1 
ATOM   3994  O O    . GLU A 1 269 ? 70.676  -83.255  8.947   1.00 16.79  ? 313 GLU A O    1 
ATOM   3995  C CB   . GLU A 1 269 ? 69.154  -84.687  11.387  1.00 17.50  ? 313 GLU A CB   1 
ATOM   3996  C CG   . GLU A 1 269 ? 68.154  -83.706  10.781  1.00 16.78  ? 313 GLU A CG   1 
ATOM   3997  C CD   . GLU A 1 269 ? 68.480  -82.251  11.078  1.00 26.57  ? 313 GLU A CD   1 
ATOM   3998  O OE1  . GLU A 1 269 ? 69.360  -81.989  11.926  1.00 23.48  ? 313 GLU A OE1  1 
ATOM   3999  O OE2  . GLU A 1 269 ? 67.849  -81.367  10.462  1.00 19.31  ? 313 GLU A OE2  1 
ATOM   4000  H H    . GLU A 1 269 ? 71.052  -86.061  12.017  1.00 17.35  ? 313 GLU A H    1 
ATOM   4001  H HA   . GLU A 1 269 ? 69.960  -85.529  9.701   1.00 22.39  ? 313 GLU A HA   1 
ATOM   4002  H HB2  . GLU A 1 269 ? 68.668  -85.494  11.619  1.00 21.00  ? 313 GLU A HB2  1 
ATOM   4003  H HB3  . GLU A 1 269 ? 69.512  -84.280  12.192  1.00 21.00  ? 313 GLU A HB3  1 
ATOM   4004  H HG2  . GLU A 1 269 ? 68.148  -83.819  9.818   1.00 20.14  ? 313 GLU A HG2  1 
ATOM   4005  H HG3  . GLU A 1 269 ? 67.273  -83.893  11.141  1.00 20.14  ? 313 GLU A HG3  1 
ATOM   4006  N N    . ALA A 1 270 ? 72.092  -83.400  10.692  1.00 14.20  ? 314 ALA A N    1 
ATOM   4007  C CA   . ALA A 1 270 ? 72.816  -82.190  10.327  1.00 10.53  ? 314 ALA A CA   1 
ATOM   4008  C C    . ALA A 1 270 ? 73.758  -82.409  9.151   1.00 11.80  ? 314 ALA A C    1 
ATOM   4009  O O    . ALA A 1 270 ? 74.025  -81.465  8.399   1.00 8.91   ? 314 ALA A O    1 
ATOM   4010  C CB   . ALA A 1 270 ? 73.604  -81.671  11.531  1.00 18.35  ? 314 ALA A CB   1 
ATOM   4011  H H    . ALA A 1 270 ? 72.399  -83.798  11.390  1.00 17.05  ? 314 ALA A H    1 
ATOM   4012  H HA   . ALA A 1 270 ? 72.176  -81.507  10.073  1.00 12.63  ? 314 ALA A HA   1 
ATOM   4013  H HB1  . ALA A 1 270 ? 74.080  -80.866  11.273  1.00 22.02  ? 314 ALA A HB1  1 
ATOM   4014  H HB2  . ALA A 1 270 ? 72.985  -81.473  12.251  1.00 22.02  ? 314 ALA A HB2  1 
ATOM   4015  H HB3  . ALA A 1 270 ? 74.234  -82.352  11.813  1.00 22.02  ? 314 ALA A HB3  1 
ATOM   4016  N N    . LEU A 1 271 ? 74.273  -83.625  8.975   1.00 15.68  ? 315 LEU A N    1 
ATOM   4017  C CA   . LEU A 1 271 ? 75.171  -83.912  7.862   1.00 18.80  ? 315 LEU A CA   1 
ATOM   4018  C C    . LEU A 1 271 ? 74.426  -84.426  6.639   1.00 15.47  ? 315 LEU A C    1 
ATOM   4019  O O    . LEU A 1 271 ? 74.745  -84.035  5.510   1.00 21.61  ? 315 LEU A O    1 
ATOM   4020  C CB   . LEU A 1 271 ? 76.225  -84.945  8.270   1.00 17.60  ? 315 LEU A CB   1 
ATOM   4021  C CG   . LEU A 1 271 ? 77.180  -84.645  9.429   1.00 25.53  ? 315 LEU A CG   1 
ATOM   4022  C CD1  . LEU A 1 271 ? 78.383  -85.575  9.343   1.00 20.78  ? 315 LEU A CD1  1 
ATOM   4023  C CD2  . LEU A 1 271 ? 77.624  -83.200  9.445   1.00 23.84  ? 315 LEU A CD2  1 
ATOM   4024  H H    . LEU A 1 271 ? 74.117  -84.300  9.486   1.00 18.82  ? 315 LEU A H    1 
ATOM   4025  H HA   . LEU A 1 271 ? 75.632  -83.096  7.611   1.00 22.56  ? 315 LEU A HA   1 
ATOM   4026  H HB2  . LEU A 1 271 ? 75.757  -85.762  8.504   1.00 21.12  ? 315 LEU A HB2  1 
ATOM   4027  H HB3  . LEU A 1 271 ? 76.780  -85.117  7.494   1.00 21.12  ? 315 LEU A HB3  1 
ATOM   4028  H HG   . LEU A 1 271 ? 76.724  -84.825  10.266  1.00 30.64  ? 315 LEU A HG   1 
ATOM   4029  H HD11 . LEU A 1 271 ? 78.985  -85.381  10.079  1.00 24.94  ? 315 LEU A HD11 1 
ATOM   4030  H HD12 . LEU A 1 271 ? 78.077  -86.494  9.399   1.00 24.94  ? 315 LEU A HD12 1 
ATOM   4031  H HD13 . LEU A 1 271 ? 78.836  -85.428  8.498   1.00 24.94  ? 315 LEU A HD13 1 
ATOM   4032  H HD21 . LEU A 1 271 ? 78.225  -83.063  10.194  1.00 28.61  ? 315 LEU A HD21 1 
ATOM   4033  H HD22 . LEU A 1 271 ? 78.082  -83.002  8.613   1.00 28.61  ? 315 LEU A HD22 1 
ATOM   4034  H HD23 . LEU A 1 271 ? 76.844  -82.631  9.537   1.00 28.61  ? 315 LEU A HD23 1 
ATOM   4035  N N    . ALA A 1 272 ? 73.439  -85.299  6.846   1.00 15.25  ? 316 ALA A N    1 
ATOM   4036  C CA   . ALA A 1 272 ? 72.751  -85.971  5.752   1.00 9.83   ? 316 ALA A CA   1 
ATOM   4037  C C    . ALA A 1 272 ? 71.739  -85.083  5.041   1.00 21.43  ? 316 ALA A C    1 
ATOM   4038  O O    . ALA A 1 272 ? 71.252  -85.462  3.970   1.00 13.20  ? 316 ALA A O    1 
ATOM   4039  C CB   . ALA A 1 272 ? 72.045  -87.222  6.277   1.00 17.31  ? 316 ALA A CB   1 
ATOM   4040  H H    . ALA A 1 272 ? 73.147  -85.519  7.624   1.00 18.31  ? 316 ALA A H    1 
ATOM   4041  H HA   . ALA A 1 272 ? 73.408  -86.254  5.097   1.00 11.79  ? 316 ALA A HA   1 
ATOM   4042  H HB1  . ALA A 1 272 ? 71.591  -87.661  5.541   1.00 20.78  ? 316 ALA A HB1  1 
ATOM   4043  H HB2  . ALA A 1 272 ? 72.706  -87.819  6.662   1.00 20.78  ? 316 ALA A HB2  1 
ATOM   4044  H HB3  . ALA A 1 272 ? 71.402  -86.961  6.955   1.00 20.78  ? 316 ALA A HB3  1 
ATOM   4045  N N    . ALA A 1 273 ? 71.414  -83.921  5.599   1.00 12.02  ? 317 ALA A N    1 
ATOM   4046  C CA   . ALA A 1 273 ? 70.408  -83.054  5.011   1.00 13.12  ? 317 ALA A CA   1 
ATOM   4047  C C    . ALA A 1 273 ? 70.675  -81.620  5.438   1.00 17.86  ? 317 ALA A C    1 
ATOM   4048  O O    . ALA A 1 273 ? 71.439  -81.355  6.369   1.00 14.77  ? 317 ALA A O    1 
ATOM   4049  C CB   . ALA A 1 273 ? 68.991  -83.472  5.424   1.00 13.40  ? 317 ALA A CB   1 
ATOM   4050  H H    . ALA A 1 273 ? 71.765  -83.614  6.321   1.00 14.43  ? 317 ALA A H    1 
ATOM   4051  H HA   . ALA A 1 273 ? 70.469  -83.100  4.044   1.00 15.74  ? 317 ALA A HA   1 
ATOM   4052  H HB1  . ALA A 1 273 ? 68.352  -82.871  5.012   1.00 16.08  ? 317 ALA A HB1  1 
ATOM   4053  H HB2  . ALA A 1 273 ? 68.831  -84.381  5.124   1.00 16.08  ? 317 ALA A HB2  1 
ATOM   4054  H HB3  . ALA A 1 273 ? 68.917  -83.424  6.390   1.00 16.08  ? 317 ALA A HB3  1 
ATOM   4055  N N    . HIS A 1 274 ? 70.027  -80.693  4.742   1.00 18.33  ? 318 HIS A N    1 
ATOM   4056  C CA   . HIS A 1 274 ? 70.061  -79.282  5.100   1.00 16.50  ? 318 HIS A CA   1 
ATOM   4057  C C    . HIS A 1 274 ? 68.657  -78.706  4.987   1.00 17.08  ? 318 HIS A C    1 
ATOM   4058  O O    . HIS A 1 274 ? 68.411  -77.707  4.309   1.00 17.07  ? 318 HIS A O    1 
ATOM   4059  C CB   . HIS A 1 274 ? 71.077  -78.549  4.232   1.00 16.51  ? 318 HIS A CB   1 
ATOM   4060  C CG   . HIS A 1 274 ? 72.463  -79.084  4.387   1.00 21.14  ? 318 HIS A CG   1 
ATOM   4061  N ND1  . HIS A 1 274 ? 73.155  -79.010  5.576   1.00 20.20  ? 318 HIS A ND1  1 
ATOM   4062  C CD2  . HIS A 1 274 ? 73.267  -79.745  3.522   1.00 18.89  ? 318 HIS A CD2  1 
ATOM   4063  C CE1  . HIS A 1 274 ? 74.336  -79.584  5.431   1.00 21.27  ? 318 HIS A CE1  1 
ATOM   4064  N NE2  . HIS A 1 274 ? 74.428  -80.037  4.194   1.00 17.73  ? 318 HIS A NE2  1 
ATOM   4065  H H    . HIS A 1 274 ? 69.551  -80.861  4.046   1.00 22.00  ? 318 HIS A H    1 
ATOM   4066  H HA   . HIS A 1 274 ? 70.344  -79.198  6.024   1.00 19.81  ? 318 HIS A HA   1 
ATOM   4067  H HB2  . HIS A 1 274 ? 70.823  -78.641  3.301   1.00 19.81  ? 318 HIS A HB2  1 
ATOM   4068  H HB3  . HIS A 1 274 ? 71.088  -77.611  4.482   1.00 19.81  ? 318 HIS A HB3  1 
ATOM   4069  H HD1  . HIS A 1 274 ? 72.867  -78.642  6.298   1.00 24.24  ? 318 HIS A HD1  1 
ATOM   4070  H HD2  . HIS A 1 274 ? 73.073  -79.953  2.636   1.00 22.67  ? 318 HIS A HD2  1 
ATOM   4071  H HE1  . HIS A 1 274 ? 74.991  -79.654  6.086   1.00 25.53  ? 318 HIS A HE1  1 
ATOM   4072  N N    . ASP A 1 275 ? 67.715  -79.363  5.670   1.00 17.06  ? 319 ASP A N    1 
ATOM   4073  C CA   . ASP A 1 275 ? 66.320  -78.946  5.650   1.00 15.13  ? 319 ASP A CA   1 
ATOM   4074  C C    . ASP A 1 275 ? 66.118  -77.576  6.278   1.00 11.37  ? 319 ASP A C    1 
ATOM   4075  O O    . ASP A 1 275 ? 65.116  -76.915  5.984   1.00 18.55  ? 319 ASP A O    1 
ATOM   4076  C CB   . ASP A 1 275 ? 65.464  -79.986  6.375   1.00 15.65  ? 319 ASP A CB   1 
ATOM   4077  C CG   . ASP A 1 275 ? 65.650  -81.382  5.813   1.00 19.31  ? 319 ASP A CG   1 
ATOM   4078  O OD1  . ASP A 1 275 ? 66.041  -81.501  4.631   1.00 16.18  ? 319 ASP A OD1  1 
ATOM   4079  O OD2  . ASP A 1 275 ? 65.405  -82.359  6.550   1.00 15.76  ? 319 ASP A OD2  1 
ATOM   4080  H H    . ASP A 1 275 ? 67.865  -80.057  6.155   1.00 20.48  ? 319 ASP A H    1 
ATOM   4081  H HA   . ASP A 1 275 ? 66.018  -78.900  4.729   1.00 18.16  ? 319 ASP A HA   1 
ATOM   4082  H HB2  . ASP A 1 275 ? 65.713  -80.003  7.313   1.00 18.79  ? 319 ASP A HB2  1 
ATOM   4083  H HB3  . ASP A 1 275 ? 64.529  -79.747  6.284   1.00 18.79  ? 319 ASP A HB3  1 
ATOM   4084  N N    . ALA A 1 276 ? 67.039  -77.136  7.138   1.00 12.05  ? 320 ALA A N    1 
ATOM   4085  C CA   . ALA A 1 276 ? 66.931  -75.796  7.702   1.00 21.68  ? 320 ALA A CA   1 
ATOM   4086  C C    . ALA A 1 276 ? 67.149  -74.733  6.632   1.00 13.85  ? 320 ALA A C    1 
ATOM   4087  O O    . ALA A 1 276 ? 66.484  -73.691  6.638   1.00 16.34  ? 320 ALA A O    1 
ATOM   4088  C CB   . ALA A 1 276 ? 67.931  -75.624  8.843   1.00 15.01  ? 320 ALA A CB   1 
ATOM   4089  H H    . ALA A 1 276 ? 67.721  -77.586  7.405   1.00 14.47  ? 320 ALA A H    1 
ATOM   4090  H HA   . ALA A 1 276 ? 66.039  -75.677  8.064   1.00 26.02  ? 320 ALA A HA   1 
ATOM   4091  H HB1  . ALA A 1 276 ? 67.845  -74.728  9.205   1.00 18.01  ? 320 ALA A HB1  1 
ATOM   4092  H HB2  . ALA A 1 276 ? 67.738  -76.279  9.532   1.00 18.01  ? 320 ALA A HB2  1 
ATOM   4093  H HB3  . ALA A 1 276 ? 68.828  -75.757  8.500   1.00 18.01  ? 320 ALA A HB3  1 
ATOM   4094  N N    . LEU A 1 277 ? 68.076  -74.977  5.704   1.00 12.62  ? 321 LEU A N    1 
ATOM   4095  C CA   . LEU A 1 277 ? 68.263  -74.051  4.593   1.00 20.12  ? 321 LEU A CA   1 
ATOM   4096  C C    . LEU A 1 277 ? 67.054  -74.058  3.665   1.00 19.02  ? 321 LEU A C    1 
ATOM   4097  O O    . LEU A 1 277 ? 66.646  -73.003  3.163   1.00 17.77  ? 321 LEU A O    1 
ATOM   4098  C CB   . LEU A 1 277 ? 69.537  -74.399  3.823   1.00 14.31  ? 321 LEU A CB   1 
ATOM   4099  C CG   . LEU A 1 277 ? 70.857  -74.187  4.564   1.00 21.91  ? 321 LEU A CG   1 
ATOM   4100  C CD1  . LEU A 1 277 ? 72.015  -74.599  3.677   1.00 22.09  ? 321 LEU A CD1  1 
ATOM   4101  C CD2  . LEU A 1 277 ? 71.021  -72.739  5.008   1.00 21.67  ? 321 LEU A CD2  1 
ATOM   4102  H H    . LEU A 1 277 ? 68.599  -75.660  5.696   1.00 15.14  ? 321 LEU A H    1 
ATOM   4103  H HA   . LEU A 1 277 ? 68.363  -73.153  4.946   1.00 24.14  ? 321 LEU A HA   1 
ATOM   4104  H HB2  . LEU A 1 277 ? 69.494  -75.335  3.573   1.00 17.18  ? 321 LEU A HB2  1 
ATOM   4105  H HB3  . LEU A 1 277 ? 69.566  -73.854  3.022   1.00 17.18  ? 321 LEU A HB3  1 
ATOM   4106  H HG   . LEU A 1 277 ? 70.870  -74.748  5.356   1.00 26.29  ? 321 LEU A HG   1 
ATOM   4107  H HD11 . LEU A 1 277 ? 72.846  -74.460  4.158   1.00 26.51  ? 321 LEU A HD11 1 
ATOM   4108  H HD12 . LEU A 1 277 ? 71.918  -75.537  3.448   1.00 26.51  ? 321 LEU A HD12 1 
ATOM   4109  H HD13 . LEU A 1 277 ? 72.004  -74.058  2.872   1.00 26.51  ? 321 LEU A HD13 1 
ATOM   4110  H HD21 . LEU A 1 277 ? 71.868  -72.646  5.473   1.00 26.01  ? 321 LEU A HD21 1 
ATOM   4111  H HD22 . LEU A 1 277 ? 71.008  -72.166  4.226   1.00 26.01  ? 321 LEU A HD22 1 
ATOM   4112  H HD23 . LEU A 1 277 ? 70.290  -72.507  5.602   1.00 26.01  ? 321 LEU A HD23 1 
ATOM   4113  N N    . VAL A 1 278 ? 66.467  -75.232  3.426   1.00 17.69  ? 322 VAL A N    1 
ATOM   4114  C CA   . VAL A 1 278 ? 65.214  -75.286  2.677   1.00 12.96  ? 322 VAL A CA   1 
ATOM   4115  C C    . VAL A 1 278 ? 64.140  -74.487  3.404   1.00 18.85  ? 322 VAL A C    1 
ATOM   4116  O O    . VAL A 1 278 ? 63.381  -73.728  2.788   1.00 12.99  ? 322 VAL A O    1 
ATOM   4117  C CB   . VAL A 1 278 ? 64.780  -76.749  2.459   1.00 14.23  ? 322 VAL A CB   1 
ATOM   4118  C CG1  . VAL A 1 278 ? 63.474  -76.814  1.676   1.00 16.61  ? 322 VAL A CG1  1 
ATOM   4119  C CG2  . VAL A 1 278 ? 65.861  -77.532  1.728   1.00 12.43  ? 322 VAL A CG2  1 
ATOM   4120  H H    . VAL A 1 278 ? 66.767  -75.996  3.681   1.00 21.23  ? 322 VAL A H    1 
ATOM   4121  H HA   . VAL A 1 278 ? 65.350  -74.881  1.806   1.00 15.56  ? 322 VAL A HA   1 
ATOM   4122  H HB   . VAL A 1 278 ? 64.635  -77.169  3.321   1.00 17.08  ? 322 VAL A HB   1 
ATOM   4123  H HG11 . VAL A 1 278 ? 63.226  -77.744  1.554   1.00 19.93  ? 322 VAL A HG11 1 
ATOM   4124  H HG12 . VAL A 1 278 ? 62.784  -76.350  2.176   1.00 19.93  ? 322 VAL A HG12 1 
ATOM   4125  H HG13 . VAL A 1 278 ? 63.601  -76.389  0.814   1.00 19.93  ? 322 VAL A HG13 1 
ATOM   4126  H HG21 . VAL A 1 278 ? 65.559  -78.446  1.605   1.00 14.91  ? 322 VAL A HG21 1 
ATOM   4127  H HG22 . VAL A 1 278 ? 66.022  -77.118  0.866   1.00 14.91  ? 322 VAL A HG22 1 
ATOM   4128  H HG23 . VAL A 1 278 ? 66.673  -77.520  2.258   1.00 14.91  ? 322 VAL A HG23 1 
ATOM   4129  N N    . GLU A 1 279 ? 64.067  -74.639  4.729   1.00 12.17  ? 323 GLU A N    1 
ATOM   4130  C CA   . GLU A 1 279 ? 63.100  -73.885  5.521   1.00 14.62  ? 323 GLU A CA   1 
ATOM   4131  C C    . GLU A 1 279 ? 63.331  -72.385  5.386   1.00 12.35  ? 323 GLU A C    1 
ATOM   4132  O O    . GLU A 1 279 ? 62.397  -71.623  5.112   1.00 15.64  ? 323 GLU A O    1 
ATOM   4133  C CB   . GLU A 1 279 ? 63.188  -74.313  6.987   1.00 18.57  ? 323 GLU A CB   1 
ATOM   4134  C CG   . GLU A 1 279 ? 62.264  -73.556  7.930   1.00 24.15  ? 323 GLU A CG   1 
ATOM   4135  C CD   . GLU A 1 279 ? 62.458  -73.961  9.380   1.00 33.97  ? 323 GLU A CD   1 
ATOM   4136  O OE1  . GLU A 1 279 ? 63.331  -74.814  9.650   1.00 17.36  ? 323 GLU A OE1  1 
ATOM   4137  O OE2  . GLU A 1 279 ? 61.737  -73.428  10.248  1.00 30.75  ? 323 GLU A OE2  1 
ATOM   4138  H H    . GLU A 1 279 ? 64.563  -75.170  5.188   1.00 14.60  ? 323 GLU A H    1 
ATOM   4139  H HA   . GLU A 1 279 ? 62.205  -74.082  5.202   1.00 17.55  ? 323 GLU A HA   1 
ATOM   4140  H HB2  . GLU A 1 279 ? 62.962  -75.255  7.048   1.00 22.29  ? 323 GLU A HB2  1 
ATOM   4141  H HB3  . GLU A 1 279 ? 64.098  -74.176  7.295   1.00 22.29  ? 323 GLU A HB3  1 
ATOM   4142  H HG2  . GLU A 1 279 ? 62.446  -72.606  7.856   1.00 28.99  ? 323 GLU A HG2  1 
ATOM   4143  H HG3  . GLU A 1 279 ? 61.343  -73.739  7.687   1.00 28.99  ? 323 GLU A HG3  1 
ATOM   4144  N N    . LEU A 1 280 ? 64.574  -71.940  5.585   1.00 14.36  ? 324 LEU A N    1 
ATOM   4145  C CA   . LEU A 1 280 ? 64.866  -70.515  5.485   1.00 15.63  ? 324 LEU A CA   1 
ATOM   4146  C C    . LEU A 1 280 ? 64.595  -70.001  4.079   1.00 17.68  ? 324 LEU A C    1 
ATOM   4147  O O    . LEU A 1 280 ? 64.016  -68.922  3.903   1.00 11.73  ? 324 LEU A O    1 
ATOM   4148  C CB   . LEU A 1 280 ? 66.317  -70.246  5.887   1.00 15.14  ? 324 LEU A CB   1 
ATOM   4149  C CG   . LEU A 1 280 ? 66.801  -68.798  5.785   1.00 17.73  ? 324 LEU A CG   1 
ATOM   4150  C CD1  . LEU A 1 280 ? 65.937  -67.866  6.624   1.00 16.46  ? 324 LEU A CD1  1 
ATOM   4151  C CD2  . LEU A 1 280 ? 68.257  -68.708  6.210   1.00 15.78  ? 324 LEU A CD2  1 
ATOM   4152  H H    . LEU A 1 280 ? 65.251  -72.435  5.776   1.00 17.23  ? 324 LEU A H    1 
ATOM   4153  H HA   . LEU A 1 280 ? 64.291  -70.030  6.098   1.00 18.76  ? 324 LEU A HA   1 
ATOM   4154  H HB2  . LEU A 1 280 ? 66.432  -70.523  6.809   1.00 18.17  ? 324 LEU A HB2  1 
ATOM   4155  H HB3  . LEU A 1 280 ? 66.892  -70.781  5.318   1.00 18.17  ? 324 LEU A HB3  1 
ATOM   4156  H HG   . LEU A 1 280 ? 66.742  -68.510  4.861   1.00 21.28  ? 324 LEU A HG   1 
ATOM   4157  H HD11 . LEU A 1 280 ? 66.272  -66.960  6.535   1.00 19.76  ? 324 LEU A HD11 1 
ATOM   4158  H HD12 . LEU A 1 280 ? 65.022  -67.913  6.305   1.00 19.76  ? 324 LEU A HD12 1 
ATOM   4159  H HD13 . LEU A 1 280 ? 65.979  -68.146  7.551   1.00 19.76  ? 324 LEU A HD13 1 
ATOM   4160  H HD21 . LEU A 1 280 ? 68.550  -67.786  6.141   1.00 18.94  ? 324 LEU A HD21 1 
ATOM   4161  H HD22 . LEU A 1 280 ? 68.337  -69.013  7.128   1.00 18.94  ? 324 LEU A HD22 1 
ATOM   4162  H HD23 . LEU A 1 280 ? 68.791  -69.270  5.627   1.00 18.94  ? 324 LEU A HD23 1 
ATOM   4163  N N    . SER A 1 281 ? 65.003  -70.763  3.062   1.00 11.90  ? 325 SER A N    1 
ATOM   4164  C CA   . SER A 1 281 ? 64.715  -70.371  1.687   1.00 11.79  ? 325 SER A CA   1 
ATOM   4165  C C    . SER A 1 281 ? 63.213  -70.242  1.459   1.00 14.40  ? 325 SER A C    1 
ATOM   4166  O O    . SER A 1 281 ? 62.762  -69.344  0.739   1.00 14.31  ? 325 SER A O    1 
ATOM   4167  C CB   . SER A 1 281 ? 65.324  -71.382  0.718   1.00 10.23  ? 325 SER A CB   1 
ATOM   4168  O OG   . SER A 1 281 ? 65.174  -70.960  -0.627  1.00 16.31  ? 325 SER A OG   1 
ATOM   4169  H H    . SER A 1 281 ? 65.440  -71.499  3.142   1.00 14.28  ? 325 SER A H    1 
ATOM   4170  H HA   . SER A 1 281 ? 65.120  -69.507  1.514   1.00 14.15  ? 325 SER A HA   1 
ATOM   4171  H HB2  . SER A 1 281 ? 66.270  -71.476  0.915   1.00 12.28  ? 325 SER A HB2  1 
ATOM   4172  H HB3  . SER A 1 281 ? 64.877  -72.235  0.832   1.00 12.28  ? 325 SER A HB3  1 
ATOM   4173  H HG   . SER A 1 281 ? 64.359  -70.876  -0.813  1.00 19.57  ? 325 SER A HG   1 
ATOM   4174  N N    . GLY A 1 282 ? 62.422  -71.126  2.071   1.00 15.82  ? 326 GLY A N    1 
ATOM   4175  C CA   . GLY A 1 282 ? 60.979  -71.047  1.913   1.00 15.47  ? 326 GLY A CA   1 
ATOM   4176  C C    . GLY A 1 282 ? 60.396  -69.786  2.522   1.00 10.45  ? 326 GLY A C    1 
ATOM   4177  O O    . GLY A 1 282 ? 59.436  -69.218  1.995   1.00 15.05  ? 326 GLY A O    1 
ATOM   4178  H H    . GLY A 1 282 ? 62.695  -71.769  2.573   1.00 18.98  ? 326 GLY A H    1 
ATOM   4179  H HA2  . GLY A 1 282 ? 60.756  -71.064  0.969   1.00 18.56  ? 326 GLY A HA2  1 
ATOM   4180  H HA3  . GLY A 1 282 ? 60.565  -71.813  2.340   1.00 18.56  ? 326 GLY A HA3  1 
ATOM   4181  N N    . ALA A 1 283 ? 60.961  -69.334  3.643   1.00 16.30  ? 327 ALA A N    1 
ATOM   4182  C CA   . ALA A 1 283 ? 60.515  -68.077  4.235   1.00 16.66  ? 327 ALA A CA   1 
ATOM   4183  C C    . ALA A 1 283 ? 60.857  -66.899  3.333   1.00 13.58  ? 327 ALA A C    1 
ATOM   4184  O O    . ALA A 1 283 ? 60.057  -65.967  3.186   1.00 12.35  ? 327 ALA A O    1 
ATOM   4185  C CB   . ALA A 1 283 ? 61.137  -67.897  5.619   1.00 18.61  ? 327 ALA A CB   1 
ATOM   4186  H H    . ALA A 1 283 ? 61.592  -69.729  4.071   1.00 19.57  ? 327 ALA A H    1 
ATOM   4187  H HA   . ALA A 1 283 ? 59.551  -68.103  4.341   1.00 19.99  ? 327 ALA A HA   1 
ATOM   4188  H HB1  . ALA A 1 283 ? 60.830  -67.058  5.996   1.00 22.33  ? 327 ALA A HB1  1 
ATOM   4189  H HB2  . ALA A 1 283 ? 60.864  -68.635  6.186   1.00 22.33  ? 327 ALA A HB2  1 
ATOM   4190  H HB3  . ALA A 1 283 ? 62.103  -67.887  5.531   1.00 22.33  ? 327 ALA A HB3  1 
ATOM   4191  N N    . MET A 1 284 ? 62.041  -66.922  2.717   1.00 11.90  ? 328 MET A N    1 
ATOM   4192  C CA   . MET A 1 284 ? 62.385  -65.889  1.748   1.00 16.16  ? 328 MET A CA   1 
ATOM   4193  C C    . MET A 1 284 ? 61.533  -66.008  0.492   1.00 15.05  ? 328 MET A C    1 
ATOM   4194  O O    . MET A 1 284 ? 61.241  -64.997  -0.157  1.00 16.17  ? 328 MET A O    1 
ATOM   4195  C CB   . MET A 1 284 ? 63.872  -65.971  1.401   1.00 12.23  ? 328 MET A CB   1 
ATOM   4196  C CG   . MET A 1 284 ? 64.782  -65.639  2.574   1.00 14.58  ? 328 MET A CG   1 
ATOM   4197  S SD   . MET A 1 284 ? 66.525  -65.537  2.137   1.00 13.59  ? 328 MET A SD   1 
ATOM   4198  C CE   . MET A 1 284 ? 66.878  -67.240  1.719   1.00 16.00  ? 328 MET A CE   1 
ATOM   4199  H H    . MET A 1 284 ? 62.651  -67.516  2.842   1.00 14.28  ? 328 MET A H    1 
ATOM   4200  H HA   . MET A 1 284 ? 62.224  -65.021  2.150   1.00 19.40  ? 328 MET A HA   1 
ATOM   4201  H HB2  . MET A 1 284 ? 64.077  -66.874  1.110   1.00 14.68  ? 328 MET A HB2  1 
ATOM   4202  H HB3  . MET A 1 284 ? 64.063  -65.343  0.687   1.00 14.68  ? 328 MET A HB3  1 
ATOM   4203  H HG2  . MET A 1 284 ? 64.518  -64.780  2.941   1.00 17.50  ? 328 MET A HG2  1 
ATOM   4204  H HG3  . MET A 1 284 ? 64.686  -66.328  3.250   1.00 17.50  ? 328 MET A HG3  1 
ATOM   4205  H HE1  . MET A 1 284 ? 67.810  -67.315  1.460   1.00 19.20  ? 328 MET A HE1  1 
ATOM   4206  H HE2  . MET A 1 284 ? 66.704  -67.798  2.493   1.00 19.20  ? 328 MET A HE2  1 
ATOM   4207  H HE3  . MET A 1 284 ? 66.308  -67.509  0.982   1.00 19.20  ? 328 MET A HE3  1 
ATOM   4208  N N    . ASN A 1 285 ? 61.117  -67.227  0.141   1.00 10.81  ? 329 ASN A N    1 
ATOM   4209  C CA   . ASN A 1 285 ? 60.215  -67.402  -0.990  1.00 8.79   ? 329 ASN A CA   1 
ATOM   4210  C C    . ASN A 1 285 ? 58.868  -66.741  -0.718  1.00 17.58  ? 329 ASN A C    1 
ATOM   4211  O O    . ASN A 1 285 ? 58.292  -66.095  -1.603  1.00 13.82  ? 329 ASN A O    1 
ATOM   4212  C CB   . ASN A 1 285 ? 60.046  -68.891  -1.289  1.00 13.36  ? 329 ASN A CB   1 
ATOM   4213  C CG   . ASN A 1 285 ? 59.182  -69.149  -2.505  1.00 15.37  ? 329 ASN A CG   1 
ATOM   4214  O OD1  . ASN A 1 285 ? 59.625  -68.989  -3.641  1.00 13.64  ? 329 ASN A OD1  1 
ATOM   4215  N ND2  . ASN A 1 285 ? 57.946  -69.568  -2.271  1.00 17.92  ? 329 ASN A ND2  1 
ATOM   4216  H H    . ASN A 1 285 ? 61.341  -67.956  0.538   1.00 12.98  ? 329 ASN A H    1 
ATOM   4217  H HA   . ASN A 1 285 ? 60.603  -66.981  -1.773  1.00 10.56  ? 329 ASN A HA   1 
ATOM   4218  H HB2  . ASN A 1 285 ? 60.919  -69.281  -1.452  1.00 16.04  ? 329 ASN A HB2  1 
ATOM   4219  H HB3  . ASN A 1 285 ? 59.627  -69.320  -0.527  1.00 16.04  ? 329 ASN A HB3  1 
ATOM   4220  H HD21 . ASN A 1 285 ? 57.416  -69.730  -2.928  1.00 21.51  ? 329 ASN A HD21 1 
ATOM   4221  H HD22 . ASN A 1 285 ? 57.675  -69.679  -1.462  1.00 21.51  ? 329 ASN A HD22 1 
ATOM   4222  N N    . THR A 1 286 ? 58.355  -66.881  0.507   1.00 15.96  ? 330 THR A N    1 
ATOM   4223  C CA   . THR A 1 286 ? 57.142  -66.164  0.890   1.00 14.87  ? 330 THR A CA   1 
ATOM   4224  C C    . THR A 1 286 ? 57.367  -64.658  0.838   1.00 14.35  ? 330 THR A C    1 
ATOM   4225  O O    . THR A 1 286 ? 56.552  -63.914  0.278   1.00 15.03  ? 330 THR A O    1 
ATOM   4226  C CB   . THR A 1 286 ? 56.699  -66.594  2.292   1.00 17.37  ? 330 THR A CB   1 
ATOM   4227  O OG1  . THR A 1 286 ? 56.490  -68.012  2.319   1.00 18.07  ? 330 THR A OG1  1 
ATOM   4228  C CG2  . THR A 1 286 ? 55.405  -65.896  2.691   1.00 14.88  ? 330 THR A CG2  1 
ATOM   4229  H H    . THR A 1 286 ? 58.686  -67.380  1.124   1.00 19.16  ? 330 THR A H    1 
ATOM   4230  H HA   . THR A 1 286 ? 56.432  -66.385  0.268   1.00 17.85  ? 330 THR A HA   1 
ATOM   4231  H HB   . THR A 1 286 ? 57.386  -66.357  2.934   1.00 20.85  ? 330 THR A HB   1 
ATOM   4232  H HG1  . THR A 1 286 ? 57.202  -68.411  2.121   1.00 21.69  ? 330 THR A HG1  1 
ATOM   4233  H HG21 . THR A 1 286 ? 55.138  -66.178  3.580   1.00 17.86  ? 330 THR A HG21 1 
ATOM   4234  H HG22 . THR A 1 286 ? 55.534  -64.934  2.691   1.00 17.86  ? 330 THR A HG22 1 
ATOM   4235  H HG23 . THR A 1 286 ? 54.700  -66.120  2.064   1.00 17.86  ? 330 THR A HG23 1 
ATOM   4236  N N    . THR A 1 287 ? 58.473  -64.190  1.425   1.00 16.94  ? 331 THR A N    1 
ATOM   4237  C CA   . THR A 1 287 ? 58.808  -62.770  1.373   1.00 20.78  ? 331 THR A CA   1 
ATOM   4238  C C    . THR A 1 287 ? 58.786  -62.252  -0.061  1.00 14.69  ? 331 THR A C    1 
ATOM   4239  O O    . THR A 1 287 ? 58.284  -61.153  -0.329  1.00 9.34   ? 331 THR A O    1 
ATOM   4240  C CB   . THR A 1 287 ? 60.185  -62.539  2.006   1.00 9.13   ? 331 THR A CB   1 
ATOM   4241  O OG1  . THR A 1 287 ? 60.173  -62.995  3.365   1.00 14.58  ? 331 THR A OG1  1 
ATOM   4242  C CG2  . THR A 1 287 ? 60.567  -61.064  1.981   1.00 15.49  ? 331 THR A CG2  1 
ATOM   4243  H H    . THR A 1 287 ? 59.039  -64.673  1.855   1.00 20.33  ? 331 THR A H    1 
ATOM   4244  H HA   . THR A 1 287 ? 58.153  -62.269  1.884   1.00 24.94  ? 331 THR A HA   1 
ATOM   4245  H HB   . THR A 1 287 ? 60.854  -63.035  1.508   1.00 10.96  ? 331 THR A HB   1 
ATOM   4246  H HG1  . THR A 1 287 ? 59.991  -63.815  3.392   1.00 17.50  ? 331 THR A HG1  1 
ATOM   4247  H HG21 . THR A 1 287 ? 61.440  -60.940  2.385   1.00 18.59  ? 331 THR A HG21 1 
ATOM   4248  H HG22 . THR A 1 287 ? 60.596  -60.745  1.065   1.00 18.59  ? 331 THR A HG22 1 
ATOM   4249  H HG23 . THR A 1 287 ? 59.914  -60.544  2.475   1.00 18.59  ? 331 THR A HG23 1 
ATOM   4250  N N    . ALA A 1 288 ? 59.327  -63.033  -0.998  1.00 12.24  ? 332 ALA A N    1 
ATOM   4251  C CA   . ALA A 1 288 ? 59.355  -62.610  -2.393  1.00 12.61  ? 332 ALA A CA   1 
ATOM   4252  C C    . ALA A 1 288 ? 57.947  -62.465  -2.958  1.00 14.35  ? 332 ALA A C    1 
ATOM   4253  O O    . ALA A 1 288 ? 57.676  -61.539  -3.732  1.00 15.75  ? 332 ALA A O    1 
ATOM   4254  C CB   . ALA A 1 288 ? 60.168  -63.604  -3.221  1.00 12.13  ? 332 ALA A CB   1 
ATOM   4255  H H    . ALA A 1 288 ? 59.679  -63.804  -0.851  1.00 14.69  ? 332 ALA A H    1 
ATOM   4256  H HA   . ALA A 1 288 ? 59.791  -61.745  -2.451  1.00 15.14  ? 332 ALA A HA   1 
ATOM   4257  H HB1  . ALA A 1 288 ? 60.178  -63.310  -4.145  1.00 14.56  ? 332 ALA A HB1  1 
ATOM   4258  H HB2  . ALA A 1 288 ? 61.073  -63.637  -2.874  1.00 14.56  ? 332 ALA A HB2  1 
ATOM   4259  H HB3  . ALA A 1 288 ? 59.756  -64.480  -3.156  1.00 14.56  ? 332 ALA A HB3  1 
ATOM   4260  N N    . CYS A 1 289 ? 57.040  -63.375  -2.595  1.00 11.67  ? 333 CYS A N    1 
ATOM   4261  C CA   . CYS A 1 289 ? 55.648  -63.233  -3.014  1.00 13.10  ? 333 CYS A CA   1 
ATOM   4262  C C    . CYS A 1 289 ? 55.043  -61.947  -2.464  1.00 18.71  ? 333 CYS A C    1 
ATOM   4263  O O    . CYS A 1 289 ? 54.322  -61.236  -3.174  1.00 13.12  ? 333 CYS A O    1 
ATOM   4264  C CB   . CYS A 1 289 ? 54.830  -64.442  -2.560  1.00 10.11  ? 333 CYS A CB   1 
ATOM   4265  S SG   . CYS A 1 289 ? 55.285  -65.997  -3.344  1.00 17.54  ? 333 CYS A SG   1 
ATOM   4266  H H    . CYS A 1 289 ? 57.202  -64.071  -2.115  1.00 14.00  ? 333 CYS A H    1 
ATOM   4267  H HA   . CYS A 1 289 ? 55.612  -63.191  -3.983  1.00 15.72  ? 333 CYS A HA   1 
ATOM   4268  H HB2  . CYS A 1 289 ? 54.945  -64.551  -1.603  1.00 12.14  ? 333 CYS A HB2  1 
ATOM   4269  H HB3  . CYS A 1 289 ? 53.896  -64.275  -2.759  1.00 12.14  ? 333 CYS A HB3  1 
ATOM   4270  H HG   . CYS A 1 289 ? 55.133  -65.896  -4.530  1.00 21.05  ? 333 CYS A HG   1 
ATOM   4271  N N    . SER A 1 290 ? 55.326  -61.633  -1.199  1.00 9.79   ? 334 SER A N    1 
ATOM   4272  C CA   . SER A 1 290 ? 54.818  -60.401  -0.605  1.00 11.71  ? 334 SER A CA   1 
ATOM   4273  C C    . SER A 1 290 ? 55.370  -59.178  -1.327  1.00 17.58  ? 334 SER A C    1 
ATOM   4274  O O    . SER A 1 290 ? 54.620  -58.266  -1.695  1.00 11.12  ? 334 SER A O    1 
ATOM   4275  C CB   . SER A 1 290 ? 55.180  -60.352  0.879   1.00 19.55  ? 334 SER A CB   1 
ATOM   4276  O OG   . SER A 1 290 ? 54.595  -61.430  1.586   1.00 14.93  ? 334 SER A OG   1 
ATOM   4277  H H    . SER A 1 290 ? 55.806  -62.112  -0.670  1.00 11.75  ? 334 SER A H    1 
ATOM   4278  H HA   . SER A 1 290 ? 53.851  -60.386  -0.682  1.00 14.05  ? 334 SER A HA   1 
ATOM   4279  H HB2  . SER A 1 290 ? 56.144  -60.403  0.970   1.00 23.47  ? 334 SER A HB2  1 
ATOM   4280  H HB3  . SER A 1 290 ? 54.856  -59.518  1.254   1.00 23.47  ? 334 SER A HB3  1 
ATOM   4281  H HG   . SER A 1 290 ? 53.758  -61.398  1.517   1.00 17.92  ? 334 SER A HG   1 
ATOM   4282  N N    . LEU A 1 291 ? 56.689  -59.144  -1.541  1.00 16.45  ? 335 LEU A N    1 
ATOM   4283  C CA   . LEU A 1 291 ? 57.309  -57.978  -2.164  1.00 15.84  ? 335 LEU A CA   1 
ATOM   4284  C C    . LEU A 1 291 ? 56.947  -57.863  -3.639  1.00 14.23  ? 335 LEU A C    1 
ATOM   4285  O O    . LEU A 1 291 ? 56.921  -56.752  -4.181  1.00 16.34  ? 335 LEU A O    1 
ATOM   4286  C CB   . LEU A 1 291 ? 58.827  -58.036  -1.990  1.00 13.27  ? 335 LEU A CB   1 
ATOM   4287  C CG   . LEU A 1 291 ? 59.323  -57.996  -0.541  1.00 14.05  ? 335 LEU A CG   1 
ATOM   4288  C CD1  . LEU A 1 291 ? 60.825  -58.199  -0.489  1.00 18.42  ? 335 LEU A CD1  1 
ATOM   4289  C CD2  . LEU A 1 291 ? 58.945  -56.691  0.139   1.00 16.58  ? 335 LEU A CD2  1 
ATOM   4290  H H    . LEU A 1 291 ? 57.237  -59.774  -1.336  1.00 19.75  ? 335 LEU A H    1 
ATOM   4291  H HA   . LEU A 1 291 ? 56.989  -57.178  -1.717  1.00 19.01  ? 335 LEU A HA   1 
ATOM   4292  H HB2  . LEU A 1 291 ? 59.151  -58.860  -2.386  1.00 15.93  ? 335 LEU A HB2  1 
ATOM   4293  H HB3  . LEU A 1 291 ? 59.219  -57.278  -2.452  1.00 15.93  ? 335 LEU A HB3  1 
ATOM   4294  H HG   . LEU A 1 291 ? 58.908  -58.721  -0.047  1.00 16.86  ? 335 LEU A HG   1 
ATOM   4295  H HD11 . LEU A 1 291 ? 61.115  -58.170  0.436   1.00 22.11  ? 335 LEU A HD11 1 
ATOM   4296  H HD12 . LEU A 1 291 ? 61.040  -59.061  -0.877  1.00 22.11  ? 335 LEU A HD12 1 
ATOM   4297  H HD13 . LEU A 1 291 ? 61.256  -57.492  -0.994  1.00 22.11  ? 335 LEU A HD13 1 
ATOM   4298  H HD21 . LEU A 1 291 ? 59.275  -56.703  1.051   1.00 19.89  ? 335 LEU A HD21 1 
ATOM   4299  H HD22 . LEU A 1 291 ? 59.345  -55.954  -0.348  1.00 19.89  ? 335 LEU A HD22 1 
ATOM   4300  H HD23 . LEU A 1 291 ? 57.979  -56.603  0.137   1.00 19.89  ? 335 LEU A HD23 1 
ATOM   4301  N N    . MET A 1 292 ? 56.674  -58.986  -4.307  1.00 15.70  ? 336 MET A N    1 
ATOM   4302  C CA   . MET A 1 292 ? 56.176  -58.913  -5.677  1.00 13.22  ? 336 MET A CA   1 
ATOM   4303  C C    . MET A 1 292 ? 54.835  -58.192  -5.724  1.00 14.72  ? 336 MET A C    1 
ATOM   4304  O O    . MET A 1 292 ? 54.608  -57.339  -6.590  1.00 17.38  ? 336 MET A O    1 
ATOM   4305  C CB   . MET A 1 292 ? 56.049  -60.317  -6.269  1.00 13.86  ? 336 MET A CB   1 
ATOM   4306  C CG   . MET A 1 292 ? 55.644  -60.344  -7.742  1.00 15.01  ? 336 MET A CG   1 
ATOM   4307  S SD   . MET A 1 292 ? 56.995  -59.909  -8.853  1.00 19.26  ? 336 MET A SD   1 
ATOM   4308  C CE   . MET A 1 292 ? 57.683  -61.528  -9.198  1.00 16.55  ? 336 MET A CE   1 
ATOM   4309  H H    . MET A 1 292 ? 56.767  -59.782  -3.997  1.00 18.84  ? 336 MET A H    1 
ATOM   4310  H HA   . MET A 1 292 ? 56.815  -58.421  -6.216  1.00 15.86  ? 336 MET A HA   1 
ATOM   4311  H HB2  . MET A 1 292 ? 56.905  -60.766  -6.191  1.00 16.64  ? 336 MET A HB2  1 
ATOM   4312  H HB3  . MET A 1 292 ? 55.376  -60.805  -5.770  1.00 16.64  ? 336 MET A HB3  1 
ATOM   4313  H HG2  . MET A 1 292 ? 55.346  -61.238  -7.970  1.00 18.01  ? 336 MET A HG2  1 
ATOM   4314  H HG3  . MET A 1 292 ? 54.925  -59.709  -7.883  1.00 18.01  ? 336 MET A HG3  1 
ATOM   4315  H HE1  . MET A 1 292 ? 58.437  -61.429  -9.801  1.00 19.86  ? 336 MET A HE1  1 
ATOM   4316  H HE2  . MET A 1 292 ? 57.976  -61.930  -8.365  1.00 19.86  ? 336 MET A HE2  1 
ATOM   4317  H HE3  . MET A 1 292 ? 57.000  -62.080  -9.610  1.00 19.86  ? 336 MET A HE3  1 
ATOM   4318  N N    . LYS A 1 293 ? 53.936  -58.516  -4.793  1.00 16.84  ? 337 LYS A N    1 
ATOM   4319  C CA   . LYS A 1 293 ? 52.638  -57.852  -4.739  1.00 19.53  ? 337 LYS A CA   1 
ATOM   4320  C C    . LYS A 1 293 ? 52.797  -56.366  -4.438  1.00 19.14  ? 337 LYS A C    1 
ATOM   4321  O O    . LYS A 1 293 ? 52.229  -55.512  -5.131  1.00 11.41  ? 337 LYS A O    1 
ATOM   4322  C CB   . LYS A 1 293 ? 51.759  -58.531  -3.685  1.00 16.13  ? 337 LYS A CB   1 
ATOM   4323  C CG   . LYS A 1 293 ? 50.468  -57.797  -3.331  1.00 13.02  ? 337 LYS A CG   1 
ATOM   4324  C CD   . LYS A 1 293 ? 49.556  -57.654  -4.530  1.00 26.00  ? 337 LYS A CD   1 
ATOM   4325  C CE   . LYS A 1 293 ? 48.128  -57.347  -4.098  1.00 19.36  ? 337 LYS A CE   1 
ATOM   4326  N NZ   . LYS A 1 293 ? 48.028  -56.111  -3.273  1.00 19.24  ? 337 LYS A NZ   1 
ATOM   4327  H H    . LYS A 1 293 ? 54.055  -59.114  -4.185  1.00 20.21  ? 337 LYS A H    1 
ATOM   4328  H HA   . LYS A 1 293 ? 52.200  -57.940  -5.600  1.00 23.43  ? 337 LYS A HA   1 
ATOM   4329  H HB2  . LYS A 1 293 ? 51.513  -59.410  -4.012  1.00 19.36  ? 337 LYS A HB2  1 
ATOM   4330  H HB3  . LYS A 1 293 ? 52.275  -58.622  -2.869  1.00 19.36  ? 337 LYS A HB3  1 
ATOM   4331  H HG2  . LYS A 1 293 ? 49.995  -58.297  -2.648  1.00 15.63  ? 337 LYS A HG2  1 
ATOM   4332  H HG3  . LYS A 1 293 ? 50.685  -56.909  -3.008  1.00 15.63  ? 337 LYS A HG3  1 
ATOM   4333  H HD2  . LYS A 1 293 ? 49.870  -56.925  -5.087  1.00 31.20  ? 337 LYS A HD2  1 
ATOM   4334  H HD3  . LYS A 1 293 ? 49.551  -58.484  -5.032  1.00 31.20  ? 337 LYS A HD3  1 
ATOM   4335  H HE2  . LYS A 1 293 ? 47.579  -57.225  -4.889  1.00 23.24  ? 337 LYS A HE2  1 
ATOM   4336  H HE3  . LYS A 1 293 ? 47.791  -58.088  -3.571  1.00 23.24  ? 337 LYS A HE3  1 
ATOM   4337  H HZ1  . LYS A 1 293 ? 47.181  -55.967  -3.043  1.00 23.09  ? 337 LYS A HZ1  1 
ATOM   4338  H HZ2  . LYS A 1 293 ? 48.518  -56.197  -2.536  1.00 23.09  ? 337 LYS A HZ2  1 
ATOM   4339  H HZ3  . LYS A 1 293 ? 48.324  -55.411  -3.737  1.00 23.09  ? 337 LYS A HZ3  1 
ATOM   4340  N N    . ILE A 1 294 ? 53.569  -56.040  -3.401  1.00 18.27  ? 338 ILE A N    1 
ATOM   4341  C CA   . ILE A 1 294 ? 53.737  -54.646  -2.996  1.00 19.24  ? 338 ILE A CA   1 
ATOM   4342  C C    . ILE A 1 294 ? 54.326  -53.830  -4.138  1.00 19.51  ? 338 ILE A C    1 
ATOM   4343  O O    . ILE A 1 294 ? 53.837  -52.742  -4.467  1.00 17.26  ? 338 ILE A O    1 
ATOM   4344  C CB   . ILE A 1 294 ? 54.613  -54.561  -1.734  1.00 13.13  ? 338 ILE A CB   1 
ATOM   4345  C CG1  . ILE A 1 294 ? 53.923  -55.276  -0.565  1.00 19.54  ? 338 ILE A CG1  1 
ATOM   4346  C CG2  . ILE A 1 294 ? 54.904  -53.103  -1.377  1.00 15.54  ? 338 ILE A CG2  1 
ATOM   4347  C CD1  . ILE A 1 294 ? 54.806  -55.473  0.645   1.00 19.33  ? 338 ILE A CD1  1 
ATOM   4348  H H    . ILE A 1 294 ? 54.004  -56.604  -2.919  1.00 21.93  ? 338 ILE A H    1 
ATOM   4349  H HA   . ILE A 1 294 ? 52.867  -54.274  -2.781  1.00 23.09  ? 338 ILE A HA   1 
ATOM   4350  H HB   . ILE A 1 294 ? 55.455  -55.007  -1.913  1.00 15.75  ? 338 ILE A HB   1 
ATOM   4351  H HG12 . ILE A 1 294 ? 53.156  -54.751  -0.289  1.00 23.45  ? 338 ILE A HG12 1 
ATOM   4352  H HG13 . ILE A 1 294 ? 53.632  -56.151  -0.864  1.00 23.45  ? 338 ILE A HG13 1 
ATOM   4353  H HG21 . ILE A 1 294 ? 55.456  -53.077  -0.580  1.00 18.65  ? 338 ILE A HG21 1 
ATOM   4354  H HG22 . ILE A 1 294 ? 55.371  -52.684  -2.117  1.00 18.65  ? 338 ILE A HG22 1 
ATOM   4355  H HG23 . ILE A 1 294 ? 54.065  -52.644  -1.213  1.00 18.65  ? 338 ILE A HG23 1 
ATOM   4356  H HD11 . ILE A 1 294 ? 54.299  -55.929  1.334   1.00 23.19  ? 338 ILE A HD11 1 
ATOM   4357  H HD12 . ILE A 1 294 ? 55.575  -56.008  0.390   1.00 23.19  ? 338 ILE A HD12 1 
ATOM   4358  H HD13 . ILE A 1 294 ? 55.098  -54.606  0.967   1.00 23.19  ? 338 ILE A HD13 1 
ATOM   4359  N N    . ALA A 1 295 ? 55.394  -54.339  -4.755  1.00 16.43  ? 339 ALA A N    1 
ATOM   4360  C CA   . ALA A 1 295 ? 56.085  -53.575  -5.787  1.00 16.38  ? 339 ALA A CA   1 
ATOM   4361  C C    . ALA A 1 295 ? 55.229  -53.432  -7.038  1.00 14.13  ? 339 ALA A C    1 
ATOM   4362  O O    . ALA A 1 295 ? 55.165  -52.349  -7.631  1.00 17.42  ? 339 ALA A O    1 
ATOM   4363  C CB   . ALA A 1 295 ? 57.421  -54.238  -6.119  1.00 18.31  ? 339 ALA A CB   1 
ATOM   4364  H H    . ALA A 1 295 ? 55.732  -55.113  -4.595  1.00 19.71  ? 339 ALA A H    1 
ATOM   4365  H HA   . ALA A 1 295 ? 56.270  -52.685  -5.448  1.00 19.66  ? 339 ALA A HA   1 
ATOM   4366  H HB1  . ALA A 1 295 ? 57.868  -53.719  -6.806  1.00 21.98  ? 339 ALA A HB1  1 
ATOM   4367  H HB2  . ALA A 1 295 ? 57.967  -54.267  -5.318  1.00 21.98  ? 339 ALA A HB2  1 
ATOM   4368  H HB3  . ALA A 1 295 ? 57.255  -55.138  -6.440  1.00 21.98  ? 339 ALA A HB3  1 
ATOM   4369  N N    . ASN A 1 296 ? 54.561  -54.508  -7.456  1.00 12.82  ? 340 ASN A N    1 
ATOM   4370  C CA   . ASN A 1 296 ? 53.738  -54.432  -8.657  1.00 18.22  ? 340 ASN A CA   1 
ATOM   4371  C C    . ASN A 1 296 ? 52.549  -53.501  -8.449  1.00 19.64  ? 340 ASN A C    1 
ATOM   4372  O O    . ASN A 1 296 ? 52.204  -52.721  -9.343  1.00 16.40  ? 340 ASN A O    1 
ATOM   4373  C CB   . ASN A 1 296 ? 53.273  -55.829  -9.067  1.00 11.82  ? 340 ASN A CB   1 
ATOM   4374  C CG   . ASN A 1 296 ? 52.674  -55.857  -10.459 1.00 23.63  ? 340 ASN A CG   1 
ATOM   4375  O OD1  . ASN A 1 296 ? 53.368  -55.624  -11.448 1.00 21.39  ? 340 ASN A OD1  1 
ATOM   4376  N ND2  . ASN A 1 296 ? 51.382  -56.149  -10.544 1.00 18.20  ? 340 ASN A ND2  1 
ATOM   4377  H H    . ASN A 1 296 ? 54.569  -55.277  -7.071  1.00 15.38  ? 340 ASN A H    1 
ATOM   4378  H HA   . ASN A 1 296 ? 54.273  -54.072  -9.382  1.00 21.87  ? 340 ASN A HA   1 
ATOM   4379  H HB2  . ASN A 1 296 ? 54.033  -56.432  -9.055  1.00 14.18  ? 340 ASN A HB2  1 
ATOM   4380  H HB3  . ASN A 1 296 ? 52.596  -56.133  -8.443  1.00 14.18  ? 340 ASN A HB3  1 
ATOM   4381  H HD21 . ASN A 1 296 ? 50.997  -56.177  -11.313 1.00 21.85  ? 340 ASN A HD21 1 
ATOM   4382  H HD22 . ASN A 1 296 ? 50.929  -56.311  -9.831  1.00 21.85  ? 340 ASN A HD22 1 
ATOM   4383  N N    . ASP A 1 297 ? 51.912  -53.564  -7.277  1.00 17.85  ? 341 ASP A N    1 
ATOM   4384  C CA   . ASP A 1 297 ? 50.850  -52.617  -6.953  1.00 15.86  ? 341 ASP A CA   1 
ATOM   4385  C C    . ASP A 1 297 ? 51.330  -51.182  -7.117  1.00 16.83  ? 341 ASP A C    1 
ATOM   4386  O O    . ASP A 1 297 ? 50.722  -50.384  -7.838  1.00 19.85  ? 341 ASP A O    1 
ATOM   4387  C CB   . ASP A 1 297 ? 50.354  -52.842  -5.522  1.00 14.91  ? 341 ASP A CB   1 
ATOM   4388  C CG   . ASP A 1 297 ? 49.141  -53.745  -5.455  1.00 19.96  ? 341 ASP A CG   1 
ATOM   4389  O OD1  . ASP A 1 297 ? 48.847  -54.433  -6.454  1.00 16.39  ? 341 ASP A OD1  1 
ATOM   4390  O OD2  . ASP A 1 297 ? 48.475  -53.759  -4.398  1.00 13.59  ? 341 ASP A OD2  1 
ATOM   4391  H H    . ASP A 1 297 ? 52.076  -54.140  -6.660  1.00 21.42  ? 341 ASP A H    1 
ATOM   4392  H HA   . ASP A 1 297 ? 50.103  -52.757  -7.557  1.00 19.04  ? 341 ASP A HA   1 
ATOM   4393  H HB2  . ASP A 1 297 ? 51.063  -53.253  -5.003  1.00 17.90  ? 341 ASP A HB2  1 
ATOM   4394  H HB3  . ASP A 1 297 ? 50.113  -51.986  -5.133  1.00 17.90  ? 341 ASP A HB3  1 
ATOM   4395  N N    . ILE A 1 298 ? 52.423  -50.834  -6.434  1.00 14.05  ? 342 ILE A N    1 
ATOM   4396  C CA   . ILE A 1 298 ? 52.952  -49.475  -6.509  1.00 23.51  ? 342 ILE A CA   1 
ATOM   4397  C C    . ILE A 1 298 ? 53.317  -49.129  -7.945  1.00 20.70  ? 342 ILE A C    1 
ATOM   4398  O O    . ILE A 1 298 ? 53.139  -47.988  -8.389  1.00 15.40  ? 342 ILE A O    1 
ATOM   4399  C CB   . ILE A 1 298 ? 54.153  -49.323  -5.556  1.00 13.90  ? 342 ILE A CB   1 
ATOM   4400  C CG1  . ILE A 1 298 ? 53.671  -49.379  -4.102  1.00 18.48  ? 342 ILE A CG1  1 
ATOM   4401  C CG2  . ILE A 1 298 ? 54.907  -48.021  -5.823  1.00 24.27  ? 342 ILE A CG2  1 
ATOM   4402  C CD1  . ILE A 1 298 ? 54.782  -49.401  -3.069  1.00 18.90  ? 342 ILE A CD1  1 
ATOM   4403  H H    . ILE A 1 298 ? 52.872  -51.363  -5.925  1.00 16.86  ? 342 ILE A H    1 
ATOM   4404  H HA   . ILE A 1 298 ? 52.264  -48.855  -6.219  1.00 28.21  ? 342 ILE A HA   1 
ATOM   4405  H HB   . ILE A 1 298 ? 54.760  -50.065  -5.706  1.00 16.68  ? 342 ILE A HB   1 
ATOM   4406  H HG12 . ILE A 1 298 ? 53.123  -48.597  -3.928  1.00 22.18  ? 342 ILE A HG12 1 
ATOM   4407  H HG13 . ILE A 1 298 ? 53.142  -50.182  -3.982  1.00 22.18  ? 342 ILE A HG13 1 
ATOM   4408  H HG21 . ILE A 1 298 ? 55.655  -47.957  -5.209  1.00 29.12  ? 342 ILE A HG21 1 
ATOM   4409  H HG22 . ILE A 1 298 ? 55.230  -48.025  -6.738  1.00 29.12  ? 342 ILE A HG22 1 
ATOM   4410  H HG23 . ILE A 1 298 ? 54.303  -47.274  -5.689  1.00 29.12  ? 342 ILE A HG23 1 
ATOM   4411  H HD11 . ILE A 1 298 ? 54.388  -49.436  -2.184  1.00 22.68  ? 342 ILE A HD11 1 
ATOM   4412  H HD12 . ILE A 1 298 ? 55.334  -50.185  -3.217  1.00 22.68  ? 342 ILE A HD12 1 
ATOM   4413  H HD13 . ILE A 1 298 ? 55.316  -48.597  -3.163  1.00 22.68  ? 342 ILE A HD13 1 
ATOM   4414  N N    . ARG A 1 299 ? 53.829  -50.107  -8.695  1.00 17.37  ? 343 ARG A N    1 
ATOM   4415  C CA   . ARG A 1 299 ? 54.107  -49.897  -10.112 1.00 16.72  ? 343 ARG A CA   1 
ATOM   4416  C C    . ARG A 1 299 ? 52.854  -49.438  -10.850 1.00 13.63  ? 343 ARG A C    1 
ATOM   4417  O O    . ARG A 1 299 ? 52.858  -48.404  -11.528 1.00 17.98  ? 343 ARG A O    1 
ATOM   4418  C CB   . ARG A 1 299 ? 54.651  -51.187  -10.726 1.00 20.43  ? 343 ARG A CB   1 
ATOM   4419  C CG   . ARG A 1 299 ? 55.189  -51.044  -12.137 1.00 21.44  ? 343 ARG A CG   1 
ATOM   4420  C CD   . ARG A 1 299 ? 54.798  -52.239  -12.997 1.00 27.04  ? 343 ARG A CD   1 
ATOM   4421  N NE   . ARG A 1 299 ? 55.120  -53.519  -12.368 1.00 24.10  ? 343 ARG A NE   1 
ATOM   4422  C CZ   . ARG A 1 299 ? 56.292  -54.139  -12.463 1.00 19.03  ? 343 ARG A CZ   1 
ATOM   4423  N NH1  . ARG A 1 299 ? 57.285  -53.605  -13.160 1.00 24.88  ? 343 ARG A NH1  1 
ATOM   4424  N NH2  . ARG A 1 299 ? 56.474  -55.304  -11.855 1.00 22.08  ? 343 ARG A NH2  1 
ATOM   4425  H H    . ARG A 1 299 ? 54.022  -50.894  -8.408  1.00 20.84  ? 343 ARG A H    1 
ATOM   4426  H HA   . ARG A 1 299 ? 54.783  -49.207  -10.206 1.00 20.06  ? 343 ARG A HA   1 
ATOM   4427  H HB2  . ARG A 1 299 ? 55.375  -51.514  -10.168 1.00 24.52  ? 343 ARG A HB2  1 
ATOM   4428  H HB3  . ARG A 1 299 ? 53.937  -51.844  -10.750 1.00 24.52  ? 343 ARG A HB3  1 
ATOM   4429  H HG2  . ARG A 1 299 ? 54.820  -50.243  -12.541 1.00 25.73  ? 343 ARG A HG2  1 
ATOM   4430  H HG3  . ARG A 1 299 ? 56.157  -50.991  -12.108 1.00 25.73  ? 343 ARG A HG3  1 
ATOM   4431  H HD2  . ARG A 1 299 ? 53.841  -52.215  -13.156 1.00 32.45  ? 343 ARG A HD2  1 
ATOM   4432  H HD3  . ARG A 1 299 ? 55.275  -52.191  -13.840 1.00 32.45  ? 343 ARG A HD3  1 
ATOM   4433  H HE   . ARG A 1 299 ? 54.505  -53.899  -11.902 1.00 28.92  ? 343 ARG A HE   1 
ATOM   4434  H HH11 . ARG A 1 299 ? 57.174  -52.851  -13.558 1.00 29.86  ? 343 ARG A HH11 1 
ATOM   4435  H HH12 . ARG A 1 299 ? 58.040  -54.013  -13.215 1.00 29.86  ? 343 ARG A HH12 1 
ATOM   4436  H HH21 . ARG A 1 299 ? 55.835  -55.656  -11.400 1.00 26.50  ? 343 ARG A HH21 1 
ATOM   4437  H HH22 . ARG A 1 299 ? 57.232  -55.705  -11.912 1.00 26.50  ? 343 ARG A HH22 1 
ATOM   4438  N N    . PHE A 1 300 ? 51.762  -50.196  -10.720 1.00 21.50  ? 344 PHE A N    1 
ATOM   4439  C CA   . PHE A 1 300 ? 50.539  -49.873  -11.448 1.00 19.27  ? 344 PHE A CA   1 
ATOM   4440  C C    . PHE A 1 300 ? 49.832  -48.653  -10.869 1.00 14.50  ? 344 PHE A C    1 
ATOM   4441  O O    . PHE A 1 300 ? 49.203  -47.894  -11.616 1.00 16.30  ? 344 PHE A O    1 
ATOM   4442  C CB   . PHE A 1 300 ? 49.603  -51.081  -11.452 1.00 13.96  ? 344 PHE A CB   1 
ATOM   4443  C CG   . PHE A 1 300 ? 49.871  -52.050  -12.569 1.00 19.83  ? 344 PHE A CG   1 
ATOM   4444  C CD1  . PHE A 1 300 ? 50.837  -53.034  -12.438 1.00 24.93  ? 344 PHE A CD1  1 
ATOM   4445  C CD2  . PHE A 1 300 ? 49.153  -51.977  -13.752 1.00 25.57  ? 344 PHE A CD2  1 
ATOM   4446  C CE1  . PHE A 1 300 ? 51.083  -53.927  -13.470 1.00 20.44  ? 344 PHE A CE1  1 
ATOM   4447  C CE2  . PHE A 1 300 ? 49.393  -52.865  -14.784 1.00 22.97  ? 344 PHE A CE2  1 
ATOM   4448  C CZ   . PHE A 1 300 ? 50.360  -53.841  -14.643 1.00 25.47  ? 344 PHE A CZ   1 
ATOM   4449  H H    . PHE A 1 300 ? 51.706  -50.894  -10.221 1.00 25.80  ? 344 PHE A H    1 
ATOM   4450  H HA   . PHE A 1 300 ? 50.768  -49.673  -12.369 1.00 23.12  ? 344 PHE A HA   1 
ATOM   4451  H HB2  . PHE A 1 300 ? 49.705  -51.559  -10.614 1.00 16.75  ? 344 PHE A HB2  1 
ATOM   4452  H HB3  . PHE A 1 300 ? 48.689  -50.769  -11.543 1.00 16.75  ? 344 PHE A HB3  1 
ATOM   4453  H HD1  . PHE A 1 300 ? 51.327  -53.095  -11.650 1.00 29.91  ? 344 PHE A HD1  1 
ATOM   4454  H HD2  . PHE A 1 300 ? 48.501  -51.322  -13.853 1.00 30.69  ? 344 PHE A HD2  1 
ATOM   4455  H HE1  . PHE A 1 300 ? 51.734  -54.583  -13.372 1.00 24.53  ? 344 PHE A HE1  1 
ATOM   4456  H HE2  . PHE A 1 300 ? 48.905  -52.805  -15.573 1.00 27.57  ? 344 PHE A HE2  1 
ATOM   4457  H HZ   . PHE A 1 300 ? 50.523  -54.439  -15.337 1.00 30.57  ? 344 PHE A HZ   1 
ATOM   4458  N N    . LEU A 1 301 ? 49.910  -48.446  -9.554  1.00 16.17  ? 345 LEU A N    1 
ATOM   4459  C CA   . LEU A 1 301 ? 49.284  -47.266  -8.967  1.00 17.21  ? 345 LEU A CA   1 
ATOM   4460  C C    . LEU A 1 301 ? 49.968  -45.988  -9.428  1.00 20.70  ? 345 LEU A C    1 
ATOM   4461  O O    . LEU A 1 301 ? 49.332  -44.929  -9.481  1.00 20.09  ? 345 LEU A O    1 
ATOM   4462  C CB   . LEU A 1 301 ? 49.303  -47.356  -7.440  1.00 19.04  ? 345 LEU A CB   1 
ATOM   4463  C CG   . LEU A 1 301 ? 48.392  -48.407  -6.800  1.00 21.22  ? 345 LEU A CG   1 
ATOM   4464  C CD1  . LEU A 1 301 ? 48.568  -48.404  -5.290  1.00 22.99  ? 345 LEU A CD1  1 
ATOM   4465  C CD2  . LEU A 1 301 ? 46.929  -48.180  -7.161  1.00 22.36  ? 345 LEU A CD2  1 
ATOM   4466  H H    . LEU A 1 301 ? 50.311  -48.960  -8.993  1.00 19.41  ? 345 LEU A H    1 
ATOM   4467  H HA   . LEU A 1 301 ? 48.358  -47.227  -9.252  1.00 20.65  ? 345 LEU A HA   1 
ATOM   4468  H HB2  . LEU A 1 301 ? 50.210  -47.555  -7.160  1.00 22.86  ? 345 LEU A HB2  1 
ATOM   4469  H HB3  . LEU A 1 301 ? 49.039  -46.494  -7.083  1.00 22.86  ? 345 LEU A HB3  1 
ATOM   4470  H HG   . LEU A 1 301 ? 48.647  -49.284  -7.127  1.00 25.46  ? 345 LEU A HG   1 
ATOM   4471  H HD11 . LEU A 1 301 ? 47.985  -49.075  -4.903  1.00 27.59  ? 345 LEU A HD11 1 
ATOM   4472  H HD12 . LEU A 1 301 ? 49.493  -48.608  -5.080  1.00 27.59  ? 345 LEU A HD12 1 
ATOM   4473  H HD13 . LEU A 1 301 ? 48.337  -47.526  -4.948  1.00 27.59  ? 345 LEU A HD13 1 
ATOM   4474  H HD21 . LEU A 1 301 ? 46.390  -48.865  -6.736  1.00 26.84  ? 345 LEU A HD21 1 
ATOM   4475  H HD22 . LEU A 1 301 ? 46.660  -47.303  -6.845  1.00 26.84  ? 345 LEU A HD22 1 
ATOM   4476  H HD23 . LEU A 1 301 ? 46.831  -48.231  -8.124  1.00 26.84  ? 345 LEU A HD23 1 
ATOM   4477  N N    . GLY A 1 302 ? 51.252  -46.063  -9.760  1.00 24.62  ? 346 GLY A N    1 
ATOM   4478  C CA   . GLY A 1 302 ? 51.971  -44.939  -10.312 1.00 20.47  ? 346 GLY A CA   1 
ATOM   4479  C C    . GLY A 1 302 ? 51.924  -44.839  -11.817 1.00 19.60  ? 346 GLY A C    1 
ATOM   4480  O O    . GLY A 1 302 ? 52.558  -43.946  -12.387 1.00 22.58  ? 346 GLY A O    1 
ATOM   4481  H H    . GLY A 1 302 ? 51.732  -46.771  -9.670  1.00 29.54  ? 346 GLY A H    1 
ATOM   4482  H HA2  . GLY A 1 302 ? 51.605  -44.120  -9.946  1.00 24.57  ? 346 GLY A HA2  1 
ATOM   4483  H HA3  . GLY A 1 302 ? 52.902  -44.999  -10.046 1.00 24.57  ? 346 GLY A HA3  1 
ATOM   4484  N N    . SER A 1 303 ? 51.192  -45.728  -12.484 1.00 17.46  ? 347 SER A N    1 
ATOM   4485  C CA   . SER A 1 303 ? 51.120  -45.699  -13.936 1.00 22.09  ? 347 SER A CA   1 
ATOM   4486  C C    . SER A 1 303 ? 50.425  -44.430  -14.412 1.00 19.79  ? 347 SER A C    1 
ATOM   4487  O O    . SER A 1 303 ? 49.527  -43.898  -13.755 1.00 21.84  ? 347 SER A O    1 
ATOM   4488  C CB   . SER A 1 303 ? 50.376  -46.926  -14.464 1.00 17.21  ? 347 SER A CB   1 
ATOM   4489  O OG   . SER A 1 303 ? 49.021  -46.924  -14.050 1.00 19.57  ? 347 SER A OG   1 
ATOM   4490  H H    . SER A 1 303 ? 50.730  -46.355  -12.118 1.00 20.95  ? 347 SER A H    1 
ATOM   4491  H HA   . SER A 1 303 ? 52.019  -45.708  -14.301 1.00 26.51  ? 347 SER A HA   1 
ATOM   4492  H HB2  . SER A 1 303 ? 50.409  -46.921  -15.434 1.00 20.65  ? 347 SER A HB2  1 
ATOM   4493  H HB3  . SER A 1 303 ? 50.807  -47.726  -14.124 1.00 20.65  ? 347 SER A HB3  1 
ATOM   4494  H HG   . SER A 1 303 ? 48.978  -46.929  -13.211 1.00 23.48  ? 347 SER A HG   1 
ATOM   4495  N N    . GLY A 1 304 ? 50.848  -43.950  -15.577 1.00 27.24  ? 348 GLY A N    1 
ATOM   4496  C CA   . GLY A 1 304 ? 50.322  -42.725  -16.124 1.00 33.94  ? 348 GLY A CA   1 
ATOM   4497  C C    . GLY A 1 304 ? 51.316  -42.059  -17.053 1.00 29.44  ? 348 GLY A C    1 
ATOM   4498  O O    . GLY A 1 304 ? 52.120  -42.729  -17.710 1.00 23.98  ? 348 GLY A O    1 
ATOM   4499  H H    . GLY A 1 304 ? 51.446  -44.326  -16.068 1.00 32.68  ? 348 GLY A H    1 
ATOM   4500  H HA2  . GLY A 1 304 ? 49.510  -42.912  -16.621 1.00 40.73  ? 348 GLY A HA2  1 
ATOM   4501  H HA3  . GLY A 1 304 ? 50.110  -42.111  -15.404 1.00 40.73  ? 348 GLY A HA3  1 
ATOM   4502  N N    . PRO A 1 305 ? 51.311  -40.716  -17.107 1.00 22.26  ? 349 PRO A N    1 
ATOM   4503  C CA   . PRO A 1 305 ? 50.511  -39.798  -16.285 1.00 29.91  ? 349 PRO A CA   1 
ATOM   4504  C C    . PRO A 1 305 ? 49.008  -39.754  -16.588 1.00 17.39  ? 349 PRO A C    1 
ATOM   4505  O O    . PRO A 1 305 ? 48.261  -39.296  -15.723 1.00 27.97  ? 349 PRO A O    1 
ATOM   4506  C CB   . PRO A 1 305 ? 51.144  -38.431  -16.579 1.00 29.81  ? 349 PRO A CB   1 
ATOM   4507  C CG   . PRO A 1 305 ? 51.791  -38.579  -17.902 1.00 31.17  ? 349 PRO A CG   1 
ATOM   4508  C CD   . PRO A 1 305 ? 52.264  -39.992  -17.966 1.00 35.01  ? 349 PRO A CD   1 
ATOM   4509  H HA   . PRO A 1 305 ? 50.635  -40.005  -15.345 1.00 35.89  ? 349 PRO A HA   1 
ATOM   4510  H HB2  . PRO A 1 305 ? 50.452  -37.751  -16.609 1.00 35.78  ? 349 PRO A HB2  1 
ATOM   4511  H HB3  . PRO A 1 305 ? 51.801  -38.222  -15.898 1.00 35.78  ? 349 PRO A HB3  1 
ATOM   4512  H HG2  . PRO A 1 305 ? 51.142  -38.404  -18.602 1.00 37.41  ? 349 PRO A HG2  1 
ATOM   4513  H HG3  . PRO A 1 305 ? 52.538  -37.965  -17.969 1.00 37.41  ? 349 PRO A HG3  1 
ATOM   4514  H HD2  . PRO A 1 305 ? 52.217  -40.323  -18.877 1.00 42.02  ? 349 PRO A HD2  1 
ATOM   4515  H HD3  . PRO A 1 305 ? 53.163  -40.063  -17.608 1.00 42.02  ? 349 PRO A HD3  1 
ATOM   4516  N N    . ARG A 1 306 ? 48.563  -40.213  -17.761 1.00 23.04  ? 350 ARG A N    1 
ATOM   4517  C CA   . ARG A 1 306 ? 47.171  -39.989  -18.144 1.00 25.02  ? 350 ARG A CA   1 
ATOM   4518  C C    . ARG A 1 306 ? 46.445  -41.238  -18.634 1.00 20.30  ? 350 ARG A C    1 
ATOM   4519  O O    . ARG A 1 306 ? 45.220  -41.324  -18.507 1.00 27.08  ? 350 ARG A O    1 
ATOM   4520  C CB   . ARG A 1 306 ? 47.108  -38.897  -19.212 1.00 25.04  ? 350 ARG A CB   1 
ATOM   4521  C CG   . ARG A 1 306 ? 47.692  -37.578  -18.734 1.00 37.35  ? 350 ARG A CG   1 
ATOM   4522  C CD   . ARG A 1 306 ? 46.902  -36.386  -19.228 1.00 39.69  ? 350 ARG A CD   1 
ATOM   4523  N NE   . ARG A 1 306 ? 47.270  -35.164  -18.521 1.00 50.75  ? 350 ARG A NE   1 
ATOM   4524  C CZ   . ARG A 1 306 ? 46.939  -33.940  -18.917 1.00 52.60  ? 350 ARG A CZ   1 
ATOM   4525  N NH1  . ARG A 1 306 ? 46.233  -33.761  -20.026 1.00 38.37  ? 350 ARG A NH1  1 
ATOM   4526  N NH2  . ARG A 1 306 ? 47.322  -32.889  -18.205 1.00 40.26  ? 350 ARG A NH2  1 
ATOM   4527  H H    . ARG A 1 306 ? 49.033  -40.645  -18.336 1.00 27.65  ? 350 ARG A H    1 
ATOM   4528  H HA   . ARG A 1 306 ? 46.691  -39.662  -17.368 1.00 30.02  ? 350 ARG A HA   1 
ATOM   4529  H HB2  . ARG A 1 306 ? 47.613  -39.185  -19.989 1.00 30.05  ? 350 ARG A HB2  1 
ATOM   4530  H HB3  . ARG A 1 306 ? 46.182  -38.745  -19.456 1.00 30.05  ? 350 ARG A HB3  1 
ATOM   4531  H HG2  . ARG A 1 306 ? 47.686  -37.562  -17.764 1.00 44.82  ? 350 ARG A HG2  1 
ATOM   4532  H HG3  . ARG A 1 306 ? 48.600  -37.495  -19.063 1.00 44.82  ? 350 ARG A HG3  1 
ATOM   4533  H HD2  . ARG A 1 306 ? 47.079  -36.254  -20.173 1.00 47.63  ? 350 ARG A HD2  1 
ATOM   4534  H HD3  . ARG A 1 306 ? 45.956  -36.547  -19.083 1.00 47.63  ? 350 ARG A HD3  1 
ATOM   4535  H HE   . ARG A 1 306 ? 47.732  -35.242  -17.800 1.00 60.90  ? 350 ARG A HE   1 
ATOM   4536  H HH11 . ARG A 1 306 ? 45.984  -34.440  -20.491 1.00 46.05  ? 350 ARG A HH11 1 
ATOM   4537  H HH12 . ARG A 1 306 ? 46.023  -32.966  -20.279 1.00 46.05  ? 350 ARG A HH12 1 
ATOM   4538  H HH21 . ARG A 1 306 ? 47.781  -33.001  -17.486 1.00 48.32  ? 350 ARG A HH21 1 
ATOM   4539  H HH22 . ARG A 1 306 ? 47.110  -32.096  -18.461 1.00 48.32  ? 350 ARG A HH22 1 
ATOM   4540  N N    . SER A 1 307 ? 47.166  -42.207  -19.198 1.00 24.81  ? 351 SER A N    1 
ATOM   4541  C CA   . SER A 1 307 ? 46.544  -43.430  -19.692 1.00 28.02  ? 351 SER A CA   1 
ATOM   4542  C C    . SER A 1 307 ? 46.674  -44.589  -18.710 1.00 26.27  ? 351 SER A C    1 
ATOM   4543  O O    . SER A 1 307 ? 46.486  -45.747  -19.099 1.00 20.58  ? 351 SER A O    1 
ATOM   4544  C CB   . SER A 1 307 ? 47.136  -43.817  -21.048 1.00 24.24  ? 351 SER A CB   1 
ATOM   4545  O OG   . SER A 1 307 ? 46.691  -42.933  -22.062 1.00 31.38  ? 351 SER A OG   1 
ATOM   4546  H H    . SER A 1 307 ? 48.019  -42.178  -19.305 1.00 29.77  ? 351 SER A H    1 
ATOM   4547  H HA   . SER A 1 307 ? 45.598  -43.263  -19.823 1.00 33.63  ? 351 SER A HA   1 
ATOM   4548  H HB2  . SER A 1 307 ? 48.103  -43.775  -20.995 1.00 29.09  ? 351 SER A HB2  1 
ATOM   4549  H HB3  . SER A 1 307 ? 46.855  -44.719  -21.270 1.00 29.09  ? 351 SER A HB3  1 
ATOM   4550  H HG   . SER A 1 307 ? 45.853  -42.959  -22.118 1.00 37.66  ? 351 SER A HG   1 
ATOM   4551  N N    . GLY A 1 308 ? 46.983  -44.302  -17.448 1.00 19.88  ? 352 GLY A N    1 
ATOM   4552  C CA   . GLY A 1 308 ? 47.085  -45.331  -16.434 1.00 26.96  ? 352 GLY A CA   1 
ATOM   4553  C C    . GLY A 1 308 ? 46.158  -45.072  -15.265 1.00 22.22  ? 352 GLY A C    1 
ATOM   4554  O O    . GLY A 1 308 ? 45.059  -44.537  -15.439 1.00 28.06  ? 352 GLY A O    1 
ATOM   4555  H H    . GLY A 1 308 ? 47.140  -43.508  -17.157 1.00 23.85  ? 352 GLY A H    1 
ATOM   4556  H HA2  . GLY A 1 308 ? 46.859  -46.191  -16.821 1.00 32.36  ? 352 GLY A HA2  1 
ATOM   4557  H HA3  . GLY A 1 308 ? 47.995  -45.371  -16.103 1.00 32.36  ? 352 GLY A HA3  1 
ATOM   4558  N N    . LEU A 1 309 ? 46.591  -45.450  -14.064 1.00 16.18  ? 353 LEU A N    1 
ATOM   4559  C CA   . LEU A 1 309 ? 45.800  -45.215  -12.864 1.00 23.41  ? 353 LEU A CA   1 
ATOM   4560  C C    . LEU A 1 309 ? 46.141  -43.879  -12.218 1.00 20.38  ? 353 LEU A C    1 
ATOM   4561  O O    . LEU A 1 309 ? 45.240  -43.147  -11.796 1.00 24.47  ? 353 LEU A O    1 
ATOM   4562  C CB   . LEU A 1 309 ? 46.008  -46.360  -11.868 1.00 22.50  ? 353 LEU A CB   1 
ATOM   4563  C CG   . LEU A 1 309 ? 45.776  -47.773  -12.416 1.00 17.28  ? 353 LEU A CG   1 
ATOM   4564  C CD1  . LEU A 1 309 ? 45.843  -48.798  -11.297 1.00 22.66  ? 353 LEU A CD1  1 
ATOM   4565  C CD2  . LEU A 1 309 ? 44.448  -47.879  -13.150 1.00 20.25  ? 353 LEU A CD2  1 
ATOM   4566  H H    . LEU A 1 309 ? 47.342  -45.844  -13.920 1.00 19.42  ? 353 LEU A H    1 
ATOM   4567  H HA   . LEU A 1 309 ? 44.860  -45.198  -13.106 1.00 28.10  ? 353 LEU A HA   1 
ATOM   4568  H HB2  . LEU A 1 309 ? 46.921  -46.321  -11.544 1.00 27.00  ? 353 LEU A HB2  1 
ATOM   4569  H HB3  . LEU A 1 309 ? 45.397  -46.234  -11.125 1.00 27.00  ? 353 LEU A HB3  1 
ATOM   4570  H HG   . LEU A 1 309 ? 46.481  -47.980  -13.049 1.00 20.74  ? 353 LEU A HG   1 
ATOM   4571  H HD11 . LEU A 1 309 ? 45.694  -49.681  -11.669 1.00 27.20  ? 353 LEU A HD11 1 
ATOM   4572  H HD12 . LEU A 1 309 ? 46.720  -48.757  -10.883 1.00 27.20  ? 353 LEU A HD12 1 
ATOM   4573  H HD13 . LEU A 1 309 ? 45.158  -48.595  -10.642 1.00 27.20  ? 353 LEU A HD13 1 
ATOM   4574  H HD21 . LEU A 1 309 ? 44.342  -48.785  -13.480 1.00 24.30  ? 353 LEU A HD21 1 
ATOM   4575  H HD22 . LEU A 1 309 ? 43.730  -47.664  -12.535 1.00 24.30  ? 353 LEU A HD22 1 
ATOM   4576  H HD23 . LEU A 1 309 ? 44.447  -47.255  -13.893 1.00 24.30  ? 353 LEU A HD23 1 
ATOM   4577  N N    . GLY A 1 310 ? 47.426  -43.548  -12.132 1.00 21.74  ? 354 GLY A N    1 
ATOM   4578  C CA   . GLY A 1 310 ? 47.838  -42.216  -11.734 1.00 25.26  ? 354 GLY A CA   1 
ATOM   4579  C C    . GLY A 1 310 ? 47.487  -41.824  -10.317 1.00 21.65  ? 354 GLY A C    1 
ATOM   4580  O O    . GLY A 1 310 ? 47.269  -40.638  -10.050 1.00 27.93  ? 354 GLY A O    1 
ATOM   4581  H H    . GLY A 1 310 ? 48.078  -44.083  -12.301 1.00 26.09  ? 354 GLY A H    1 
ATOM   4582  H HA2  . GLY A 1 310 ? 48.801  -42.144  -11.832 1.00 30.32  ? 354 GLY A HA2  1 
ATOM   4583  H HA3  . GLY A 1 310 ? 47.429  -41.570  -12.331 1.00 30.32  ? 354 GLY A HA3  1 
ATOM   4584  N N    . GLU A 1 311 ? 47.433  -42.782  -9.394  1.00 20.26  ? 355 GLU A N    1 
ATOM   4585  C CA   . GLU A 1 311 ? 47.161  -42.439  -8.003  1.00 17.85  ? 355 GLU A CA   1 
ATOM   4586  C C    . GLU A 1 311 ? 48.418  -41.991  -7.270  1.00 18.69  ? 355 GLU A C    1 
ATOM   4587  O O    . GLU A 1 311 ? 48.333  -41.164  -6.355  1.00 18.45  ? 355 GLU A O    1 
ATOM   4588  C CB   . GLU A 1 311 ? 46.538  -43.629  -7.274  1.00 16.53  ? 355 GLU A CB   1 
ATOM   4589  C CG   . GLU A 1 311 ? 45.188  -44.061  -7.820  1.00 25.79  ? 355 GLU A CG   1 
ATOM   4590  C CD   . GLU A 1 311 ? 44.592  -45.201  -7.020  1.00 30.88  ? 355 GLU A CD   1 
ATOM   4591  O OE1  . GLU A 1 311 ? 45.133  -45.501  -5.936  1.00 27.75  ? 355 GLU A OE1  1 
ATOM   4592  O OE2  . GLU A 1 311 ? 43.594  -45.799  -7.473  1.00 33.42  ? 355 GLU A OE2  1 
ATOM   4593  H H    . GLU A 1 311 ? 47.547  -43.621  -9.544  1.00 24.31  ? 355 GLU A H    1 
ATOM   4594  H HA   . GLU A 1 311 ? 46.525  -41.707  -7.979  1.00 21.42  ? 355 GLU A HA   1 
ATOM   4595  H HB2  . GLU A 1 311 ? 47.140  -44.386  -7.344  1.00 19.84  ? 355 GLU A HB2  1 
ATOM   4596  H HB3  . GLU A 1 311 ? 46.417  -43.392  -6.341  1.00 19.84  ? 355 GLU A HB3  1 
ATOM   4597  H HG2  . GLU A 1 311 ? 44.573  -43.311  -7.782  1.00 30.95  ? 355 GLU A HG2  1 
ATOM   4598  H HG3  . GLU A 1 311 ? 45.295  -44.358  -8.737  1.00 30.95  ? 355 GLU A HG3  1 
ATOM   4599  N N    . LEU A 1 312 ? 49.579  -42.513  -7.654  1.00 23.70  ? 356 LEU A N    1 
ATOM   4600  C CA   . LEU A 1 312 ? 50.829  -42.226  -6.971  1.00 18.12  ? 356 LEU A CA   1 
ATOM   4601  C C    . LEU A 1 312 ? 51.784  -41.501  -7.904  1.00 18.57  ? 356 LEU A C    1 
ATOM   4602  O O    . LEU A 1 312 ? 51.777  -41.709  -9.120  1.00 22.21  ? 356 LEU A O    1 
ATOM   4603  C CB   . LEU A 1 312 ? 51.499  -43.510  -6.457  1.00 21.03  ? 356 LEU A CB   1 
ATOM   4604  C CG   . LEU A 1 312 ? 50.737  -44.319  -5.407  1.00 25.65  ? 356 LEU A CG   1 
ATOM   4605  C CD1  . LEU A 1 312 ? 51.539  -45.550  -5.013  1.00 23.61  ? 356 LEU A CD1  1 
ATOM   4606  C CD2  . LEU A 1 312 ? 50.417  -43.471  -4.185  1.00 20.07  ? 356 LEU A CD2  1 
ATOM   4607  H H    . LEU A 1 312 ? 49.667  -43.048  -8.321  1.00 28.44  ? 356 LEU A H    1 
ATOM   4608  H HA   . LEU A 1 312 ? 50.652  -41.651  -6.210  1.00 21.75  ? 356 LEU A HA   1 
ATOM   4609  H HB2  . LEU A 1 312 ? 51.649  -44.096  -7.216  1.00 25.24  ? 356 LEU A HB2  1 
ATOM   4610  H HB3  . LEU A 1 312 ? 52.353  -43.268  -6.067  1.00 25.24  ? 356 LEU A HB3  1 
ATOM   4611  H HG   . LEU A 1 312 ? 49.898  -44.620  -5.790  1.00 30.78  ? 356 LEU A HG   1 
ATOM   4612  H HD11 . LEU A 1 312 ? 51.042  -46.051  -4.347  1.00 28.33  ? 356 LEU A HD11 1 
ATOM   4613  H HD12 . LEU A 1 312 ? 51.684  -46.098  -5.800  1.00 28.33  ? 356 LEU A HD12 1 
ATOM   4614  H HD13 . LEU A 1 312 ? 52.391  -45.267  -4.646  1.00 28.33  ? 356 LEU A HD13 1 
ATOM   4615  H HD21 . LEU A 1 312 ? 49.936  -44.014  -3.541  1.00 24.09  ? 356 LEU A HD21 1 
ATOM   4616  H HD22 . LEU A 1 312 ? 51.247  -43.154  -3.795  1.00 24.09  ? 356 LEU A HD22 1 
ATOM   4617  H HD23 . LEU A 1 312 ? 49.871  -42.717  -4.458  1.00 24.09  ? 356 LEU A HD23 1 
ATOM   4618  N N    . ILE A 1 313 ? 52.610  -40.649  -7.310  1.00 20.00  ? 357 ILE A N    1 
ATOM   4619  C CA   . ILE A 1 313 ? 53.675  -39.943  -8.007  1.00 21.06  ? 357 ILE A CA   1 
ATOM   4620  C C    . ILE A 1 313 ? 54.986  -40.468  -7.438  1.00 18.98  ? 357 ILE A C    1 
ATOM   4621  O O    . ILE A 1 313 ? 55.363  -40.125  -6.311  1.00 27.50  ? 357 ILE A O    1 
ATOM   4622  C CB   . ILE A 1 313 ? 53.559  -38.422  -7.835  1.00 23.63  ? 357 ILE A CB   1 
ATOM   4623  C CG1  . ILE A 1 313 ? 52.196  -37.929  -8.329  1.00 31.98  ? 357 ILE A CG1  1 
ATOM   4624  C CG2  . ILE A 1 313 ? 54.673  -37.712  -8.588  1.00 32.00  ? 357 ILE A CG2  1 
ATOM   4625  C CD1  . ILE A 1 313 ? 51.840  -36.540  -7.845  1.00 35.44  ? 357 ILE A CD1  1 
ATOM   4626  H H    . ILE A 1 313 ? 52.570  -40.457  -6.473  1.00 24.00  ? 357 ILE A H    1 
ATOM   4627  H HA   . ILE A 1 313 ? 53.641  -40.152  -8.954  1.00 25.28  ? 357 ILE A HA   1 
ATOM   4628  H HB   . ILE A 1 313 ? 53.641  -38.211  -6.892  1.00 28.35  ? 357 ILE A HB   1 
ATOM   4629  H HG12 . ILE A 1 313 ? 52.202  -37.913  -9.299  1.00 38.37  ? 357 ILE A HG12 1 
ATOM   4630  H HG13 . ILE A 1 313 ? 51.510  -38.538  -8.014  1.00 38.37  ? 357 ILE A HG13 1 
ATOM   4631  H HG21 . ILE A 1 313 ? 54.578  -36.755  -8.464  1.00 38.40  ? 357 ILE A HG21 1 
ATOM   4632  H HG22 . ILE A 1 313 ? 55.528  -38.008  -8.239  1.00 38.40  ? 357 ILE A HG22 1 
ATOM   4633  H HG23 . ILE A 1 313 ? 54.607  -37.932  -9.530  1.00 38.40  ? 357 ILE A HG23 1 
ATOM   4634  H HD11 . ILE A 1 313 ? 50.969  -36.297  -8.196  1.00 42.54  ? 357 ILE A HD11 1 
ATOM   4635  H HD12 . ILE A 1 313 ? 51.818  -36.540  -6.875  1.00 42.54  ? 357 ILE A HD12 1 
ATOM   4636  H HD13 . ILE A 1 313 ? 52.511  -35.914  -8.161  1.00 42.54  ? 357 ILE A HD13 1 
ATOM   4637  N N    . LEU A 1 314 ? 55.680  -41.303  -8.209  1.00 24.63  ? 358 LEU A N    1 
ATOM   4638  C CA   . LEU A 1 314 ? 56.902  -41.913  -7.711  1.00 24.00  ? 358 LEU A CA   1 
ATOM   4639  C C    . LEU A 1 314 ? 58.097  -40.983  -7.920  1.00 26.15  ? 358 LEU A C    1 
ATOM   4640  O O    . LEU A 1 314 ? 58.106  -40.172  -8.850  1.00 25.05  ? 358 LEU A O    1 
ATOM   4641  C CB   . LEU A 1 314 ? 57.163  -43.239  -8.415  1.00 22.25  ? 358 LEU A CB   1 
ATOM   4642  C CG   . LEU A 1 314 ? 56.001  -44.235  -8.492  1.00 29.11  ? 358 LEU A CG   1 
ATOM   4643  C CD1  . LEU A 1 314 ? 56.529  -45.603  -8.883  1.00 28.86  ? 358 LEU A CD1  1 
ATOM   4644  C CD2  . LEU A 1 314 ? 55.223  -44.318  -7.188  1.00 29.20  ? 358 LEU A CD2  1 
ATOM   4645  H H    . LEU A 1 314 ? 55.467  -41.527  -9.012  1.00 29.56  ? 358 LEU A H    1 
ATOM   4646  H HA   . LEU A 1 314 ? 56.811  -42.085  -6.760  1.00 28.80  ? 358 LEU A HA   1 
ATOM   4647  H HB2  . LEU A 1 314 ? 57.434  -43.047  -9.326  1.00 26.70  ? 358 LEU A HB2  1 
ATOM   4648  H HB3  . LEU A 1 314 ? 57.890  -43.686  -7.954  1.00 26.70  ? 358 LEU A HB3  1 
ATOM   4649  H HG   . LEU A 1 314 ? 55.387  -43.945  -9.186  1.00 34.94  ? 358 LEU A HG   1 
ATOM   4650  H HD11 . LEU A 1 314 ? 55.787  -46.226  -8.929  1.00 34.63  ? 358 LEU A HD11 1 
ATOM   4651  H HD12 . LEU A 1 314 ? 56.962  -45.538  -9.749  1.00 34.63  ? 358 LEU A HD12 1 
ATOM   4652  H HD13 . LEU A 1 314 ? 57.168  -45.897  -8.215  1.00 34.63  ? 358 LEU A HD13 1 
ATOM   4653  H HD21 . LEU A 1 314 ? 54.502  -44.959  -7.291  1.00 35.04  ? 358 LEU A HD21 1 
ATOM   4654  H HD22 . LEU A 1 314 ? 55.822  -44.603  -6.481  1.00 35.04  ? 358 LEU A HD22 1 
ATOM   4655  H HD23 . LEU A 1 314 ? 54.860  -43.442  -6.981  1.00 35.04  ? 358 LEU A HD23 1 
ATOM   4656  N N    . PRO A 1 315 ? 59.121  -41.080  -7.072  1.00 27.49  ? 359 PRO A N    1 
ATOM   4657  C CA   . PRO A 1 315 ? 60.316  -40.254  -7.274  1.00 22.73  ? 359 PRO A CA   1 
ATOM   4658  C C    . PRO A 1 315 ? 61.057  -40.642  -8.541  1.00 25.55  ? 359 PRO A C    1 
ATOM   4659  O O    . PRO A 1 315 ? 61.074  -41.805  -8.949  1.00 33.99  ? 359 PRO A O    1 
ATOM   4660  C CB   . PRO A 1 315 ? 61.168  -40.543  -6.032  1.00 20.96  ? 359 PRO A CB   1 
ATOM   4661  C CG   . PRO A 1 315 ? 60.238  -41.153  -5.054  1.00 32.32  ? 359 PRO A CG   1 
ATOM   4662  C CD   . PRO A 1 315 ? 59.226  -41.894  -5.851  1.00 22.59  ? 359 PRO A CD   1 
ATOM   4663  H HA   . PRO A 1 315 ? 60.084  -39.313  -7.302  1.00 27.28  ? 359 PRO A HA   1 
ATOM   4664  H HB2  . PRO A 1 315 ? 61.879  -41.162  -6.261  1.00 25.15  ? 359 PRO A HB2  1 
ATOM   4665  H HB3  . PRO A 1 315 ? 61.533  -39.713  -5.686  1.00 25.15  ? 359 PRO A HB3  1 
ATOM   4666  H HG2  . PRO A 1 315 ? 60.728  -41.760  -4.477  1.00 38.79  ? 359 PRO A HG2  1 
ATOM   4667  H HG3  . PRO A 1 315 ? 59.814  -40.455  -4.531  1.00 38.79  ? 359 PRO A HG3  1 
ATOM   4668  H HD2  . PRO A 1 315 ? 59.546  -42.785  -6.062  1.00 27.11  ? 359 PRO A HD2  1 
ATOM   4669  H HD3  . PRO A 1 315 ? 58.377  -41.919  -5.383  1.00 27.11  ? 359 PRO A HD3  1 
ATOM   4670  N N    . GLU A 1 316 ? 61.685  -39.646  -9.159  1.00 35.86  ? 360 GLU A N    1 
ATOM   4671  C CA   . GLU A 1 316 ? 62.491  -39.880  -10.348 1.00 30.34  ? 360 GLU A CA   1 
ATOM   4672  C C    . GLU A 1 316 ? 63.842  -40.469  -9.961  1.00 32.63  ? 360 GLU A C    1 
ATOM   4673  O O    . GLU A 1 316 ? 64.516  -39.962  -9.059  1.00 36.08  ? 360 GLU A O    1 
ATOM   4674  C CB   . GLU A 1 316 ? 62.689  -38.579  -11.126 1.00 35.85  ? 360 GLU A CB   1 
ATOM   4675  C CG   . GLU A 1 316 ? 61.447  -38.089  -11.847 1.00 39.05  ? 360 GLU A CG   1 
ATOM   4676  C CD   . GLU A 1 316 ? 61.725  -36.896  -12.742 1.00 46.00  ? 360 GLU A CD   1 
ATOM   4677  O OE1  . GLU A 1 316 ? 62.701  -36.166  -12.473 1.00 40.68  ? 360 GLU A OE1  1 
ATOM   4678  O OE2  . GLU A 1 316 ? 60.973  -36.694  -13.719 1.00 62.09  ? 360 GLU A OE2  1 
ATOM   4679  H H    . GLU A 1 316 ? 61.659  -38.824  -8.907  1.00 43.04  ? 360 GLU A H    1 
ATOM   4680  H HA   . GLU A 1 316 ? 62.036  -40.514  -10.924 1.00 36.41  ? 360 GLU A HA   1 
ATOM   4681  H HB2  . GLU A 1 316 ? 62.964  -37.885  -10.506 1.00 43.02  ? 360 GLU A HB2  1 
ATOM   4682  H HB3  . GLU A 1 316 ? 63.382  -38.717  -11.791 1.00 43.02  ? 360 GLU A HB3  1 
ATOM   4683  H HG2  . GLU A 1 316 ? 61.099  -38.805  -12.401 1.00 46.86  ? 360 GLU A HG2  1 
ATOM   4684  H HG3  . GLU A 1 316 ? 60.784  -37.824  -11.191 1.00 46.86  ? 360 GLU A HG3  1 
ATOM   4685  N N    . ASN A 1 317 ? 64.227  -41.554  -10.638 1.00 31.57  ? 361 ASN A N    1 
ATOM   4686  C CA   . ASN A 1 317 ? 65.578  -42.089  -10.555 1.00 33.43  ? 361 ASN A CA   1 
ATOM   4687  C C    . ASN A 1 317 ? 66.294  -42.105  -11.896 1.00 36.07  ? 361 ASN A C    1 
ATOM   4688  O O    . ASN A 1 317 ? 67.503  -42.364  -11.926 1.00 51.38  ? 361 ASN A O    1 
ATOM   4689  C CB   . ASN A 1 317 ? 65.566  -43.514  -9.979  1.00 47.27  ? 361 ASN A CB   1 
ATOM   4690  C CG   . ASN A 1 317 ? 65.257  -43.541  -8.496  1.00 41.35  ? 361 ASN A CG   1 
ATOM   4691  O OD1  . ASN A 1 317 ? 66.123  -43.262  -7.666  1.00 73.15  ? 361 ASN A OD1  1 
ATOM   4692  N ND2  . ASN A 1 317 ? 64.025  -43.886  -8.154  1.00 40.45  ? 361 ASN A ND2  1 
ATOM   4693  H H    . ASN A 1 317 ? 63.711  -42.002  -11.160 1.00 37.89  ? 361 ASN A H    1 
ATOM   4694  H HA   . ASN A 1 317 ? 66.095  -41.532  -9.952  1.00 40.11  ? 361 ASN A HA   1 
ATOM   4695  H HB2  . ASN A 1 317 ? 64.887  -44.034  -10.436 1.00 56.73  ? 361 ASN A HB2  1 
ATOM   4696  H HB3  . ASN A 1 317 ? 66.438  -43.916  -10.111 1.00 56.73  ? 361 ASN A HB3  1 
ATOM   4697  H HD21 . ASN A 1 317 ? 63.801  -43.916  -7.324  1.00 48.54  ? 361 ASN A HD21 1 
ATOM   4698  H HD22 . ASN A 1 317 ? 63.448  -44.079  -8.762  1.00 48.54  ? 361 ASN A HD22 1 
ATOM   4699  N N    . GLU A 1 318 ? 65.593  -41.853  -12.995 1.00 38.13  ? 362 GLU A N    1 
ATOM   4700  C CA   . GLU A 1 318 ? 66.192  -41.648  -14.302 1.00 45.78  ? 362 GLU A CA   1 
ATOM   4701  C C    . GLU A 1 318 ? 65.989  -40.206  -14.745 1.00 49.67  ? 362 GLU A C    1 
ATOM   4702  O O    . GLU A 1 318 ? 65.064  -39.529  -14.284 1.00 45.96  ? 362 GLU A O    1 
ATOM   4703  C CB   . GLU A 1 318 ? 65.574  -42.583  -15.350 1.00 49.81  ? 362 GLU A CB   1 
ATOM   4704  C CG   . GLU A 1 318 ? 65.512  -44.031  -14.937 1.00 39.02  ? 362 GLU A CG   1 
ATOM   4705  C CD   . GLU A 1 318 ? 65.018  -44.928  -16.055 1.00 50.25  ? 362 GLU A CD   1 
ATOM   4706  O OE1  . GLU A 1 318 ? 65.813  -45.752  -16.558 1.00 40.35  ? 362 GLU A OE1  1 
ATOM   4707  O OE2  . GLU A 1 318 ? 63.838  -44.794  -16.448 1.00 44.67  ? 362 GLU A OE2  1 
ATOM   4708  H H    . GLU A 1 318 ? 64.735  -41.795  -13.005 1.00 45.75  ? 362 GLU A H    1 
ATOM   4709  H HA   . GLU A 1 318 ? 67.145  -41.825  -14.254 1.00 54.94  ? 362 GLU A HA   1 
ATOM   4710  H HB2  . GLU A 1 318 ? 64.668  -42.290  -15.531 1.00 59.77  ? 362 GLU A HB2  1 
ATOM   4711  H HB3  . GLU A 1 318 ? 66.103  -42.531  -16.161 1.00 59.77  ? 362 GLU A HB3  1 
ATOM   4712  H HG2  . GLU A 1 318 ? 66.400  -44.327  -14.683 1.00 46.83  ? 362 GLU A HG2  1 
ATOM   4713  H HG3  . GLU A 1 318 ? 64.904  -44.121  -14.187 1.00 46.83  ? 362 GLU A HG3  1 
ATOM   4714  N N    . PRO A 1 319 ? 66.832  -39.699  -15.644 1.00 48.70  ? 363 PRO A N    1 
ATOM   4715  C CA   . PRO A 1 319 ? 66.629  -38.334  -16.151 1.00 69.22  ? 363 PRO A CA   1 
ATOM   4716  C C    . PRO A 1 319 ? 65.278  -38.199  -16.847 1.00 61.95  ? 363 PRO A C    1 
ATOM   4717  O O    . PRO A 1 319 ? 64.982  -38.932  -17.799 1.00 51.19  ? 363 PRO A O    1 
ATOM   4718  C CB   . PRO A 1 319 ? 67.799  -38.133  -17.121 1.00 69.58  ? 363 PRO A CB   1 
ATOM   4719  C CG   . PRO A 1 319 ? 68.278  -39.510  -17.451 1.00 60.22  ? 363 PRO A CG   1 
ATOM   4720  C CD   . PRO A 1 319 ? 68.021  -40.335  -16.234 1.00 52.44  ? 363 PRO A CD   1 
ATOM   4721  H HA   . PRO A 1 319 ? 66.690  -37.689  -15.429 1.00 83.06  ? 363 PRO A HA   1 
ATOM   4722  H HB2  . PRO A 1 319 ? 67.488  -37.679  -17.919 1.00 83.50  ? 363 PRO A HB2  1 
ATOM   4723  H HB3  . PRO A 1 319 ? 68.500  -37.622  -16.686 1.00 83.50  ? 363 PRO A HB3  1 
ATOM   4724  H HG2  . PRO A 1 319 ? 67.779  -39.855  -18.207 1.00 72.26  ? 363 PRO A HG2  1 
ATOM   4725  H HG3  . PRO A 1 319 ? 69.227  -39.485  -17.651 1.00 72.26  ? 363 PRO A HG3  1 
ATOM   4726  H HD2  . PRO A 1 319 ? 67.828  -41.252  -16.481 1.00 62.93  ? 363 PRO A HD2  1 
ATOM   4727  H HD3  . PRO A 1 319 ? 68.773  -40.280  -15.623 1.00 62.93  ? 363 PRO A HD3  1 
ATOM   4728  N N    . GLY A 1 320 ? 64.470  -37.275  -16.365 1.00 70.01  ? 364 GLY A N    1 
ATOM   4729  C CA   . GLY A 1 320 ? 63.162  -37.021  -16.948 1.00 77.14  ? 364 GLY A CA   1 
ATOM   4730  C C    . GLY A 1 320 ? 63.244  -35.962  -18.029 1.00 78.67  ? 364 GLY A C    1 
ATOM   4731  O O    . GLY A 1 320 ? 63.758  -34.863  -17.798 1.00 74.32  ? 364 GLY A O    1 
ATOM   4732  H H    . GLY A 1 320 ? 64.655  -36.774  -15.692 1.00 84.01  ? 364 GLY A H    1 
ATOM   4733  H HA2  . GLY A 1 320 ? 62.812  -37.837  -17.338 1.00 92.57  ? 364 GLY A HA2  1 
ATOM   4734  H HA3  . GLY A 1 320 ? 62.549  -36.717  -16.260 1.00 92.57  ? 364 GLY A HA3  1 
ATOM   4735  N N    . SER A 1 321 ? 62.734  -36.297  -19.210 1.00 73.11  ? 365 SER A N    1 
ATOM   4736  C CA   . SER A 1 321 ? 62.769  -35.374  -20.333 1.00 55.49  ? 365 SER A CA   1 
ATOM   4737  C C    . SER A 1 321 ? 61.885  -34.161  -20.062 1.00 61.74  ? 365 SER A C    1 
ATOM   4738  O O    . SER A 1 321 ? 60.855  -34.250  -19.388 1.00 57.89  ? 365 SER A O    1 
ATOM   4739  C CB   . SER A 1 321 ? 62.314  -36.075  -21.613 1.00 54.81  ? 365 SER A CB   1 
ATOM   4740  O OG   . SER A 1 321 ? 62.381  -35.200  -22.725 1.00 73.35  ? 365 SER A OG   1 
ATOM   4741  H H    . SER A 1 321 ? 62.363  -37.053  -19.385 1.00 87.74  ? 365 SER A H    1 
ATOM   4742  H HA   . SER A 1 321 ? 63.679  -35.063  -20.464 1.00 66.60  ? 365 SER A HA   1 
ATOM   4743  H HB2  . SER A 1 321 ? 62.891  -36.837  -21.776 1.00 65.78  ? 365 SER A HB2  1 
ATOM   4744  H HB3  . SER A 1 321 ? 61.398  -36.371  -21.500 1.00 65.78  ? 365 SER A HB3  1 
ATOM   4745  H HG   . SER A 1 321 ? 62.129  -35.598  -23.419 1.00 88.02  ? 365 SER A HG   1 
ATOM   4746  N N    . SER A 1 322 ? 62.303  -33.013  -20.600 1.00 50.68  ? 366 SER A N    1 
ATOM   4747  C CA   . SER A 1 322 ? 61.537  -31.786  -20.412 1.00 62.90  ? 366 SER A CA   1 
ATOM   4748  C C    . SER A 1 322 ? 60.215  -31.829  -21.166 1.00 63.57  ? 366 SER A C    1 
ATOM   4749  O O    . SER A 1 322 ? 59.225  -31.245  -20.712 1.00 54.06  ? 366 SER A O    1 
ATOM   4750  C CB   . SER A 1 322 ? 62.362  -30.580  -20.861 1.00 53.58  ? 366 SER A CB   1 
ATOM   4751  H H    . SER A 1 322 ? 63.018  -32.921  -21.070 1.00 60.82  ? 366 SER A H    1 
ATOM   4752  H HA   . SER A 1 322 ? 61.340  -31.679  -19.469 1.00 75.48  ? 366 SER A HA   1 
ATOM   4753  N N    . ILE A 1 323 ? 60.176  -32.518  -22.312 1.00 58.32  ? 367 ILE A N    1 
ATOM   4754  C CA   . ILE A 1 323 ? 58.956  -32.609  -23.107 1.00 62.19  ? 367 ILE A CA   1 
ATOM   4755  C C    . ILE A 1 323 ? 58.052  -33.753  -22.658 1.00 61.23  ? 367 ILE A C    1 
ATOM   4756  O O    . ILE A 1 323 ? 56.959  -33.924  -23.215 1.00 57.28  ? 367 ILE A O    1 
ATOM   4757  C CB   . ILE A 1 323 ? 59.310  -32.752  -24.605 1.00 61.56  ? 367 ILE A CB   1 
ATOM   4758  C CG1  . ILE A 1 323 ? 58.080  -32.492  -25.482 1.00 73.83  ? 367 ILE A CG1  1 
ATOM   4759  C CG2  . ILE A 1 323 ? 59.922  -34.124  -24.891 1.00 54.18  ? 367 ILE A CG2  1 
ATOM   4760  C CD1  . ILE A 1 323 ? 58.374  -32.434  -26.968 1.00 63.64  ? 367 ILE A CD1  1 
ATOM   4761  H H    . ILE A 1 323 ? 60.846  -32.941  -22.648 1.00 69.99  ? 367 ILE A H    1 
ATOM   4762  H HA   . ILE A 1 323 ? 58.457  -31.784  -23.002 1.00 74.64  ? 367 ILE A HA   1 
ATOM   4763  H HB   . ILE A 1 323 ? 59.975  -32.079  -24.819 1.00 73.88  ? 367 ILE A HB   1 
ATOM   4764  H HG12 . ILE A 1 323 ? 57.438  -33.204  -25.337 1.00 88.60  ? 367 ILE A HG12 1 
ATOM   4765  H HG13 . ILE A 1 323 ? 57.689  -31.642  -25.226 1.00 88.60  ? 367 ILE A HG13 1 
ATOM   4766  H HG21 . ILE A 1 323 ? 60.133  -34.185  -25.836 1.00 65.02  ? 367 ILE A HG21 1 
ATOM   4767  H HG22 . ILE A 1 323 ? 60.730  -34.225  -24.364 1.00 65.02  ? 367 ILE A HG22 1 
ATOM   4768  H HG23 . ILE A 1 323 ? 59.281  -34.812  -24.651 1.00 65.02  ? 367 ILE A HG23 1 
ATOM   4769  H HD11 . ILE A 1 323 ? 57.547  -32.267  -27.447 1.00 76.38  ? 367 ILE A HD11 1 
ATOM   4770  H HD12 . ILE A 1 323 ? 59.005  -31.717  -27.136 1.00 76.38  ? 367 ILE A HD12 1 
ATOM   4771  H HD13 . ILE A 1 323 ? 58.753  -33.282  -27.247 1.00 76.38  ? 367 ILE A HD13 1 
ATOM   4772  N N    . MET A 1 324 ? 58.464  -34.532  -21.659 1.00 60.57  ? 368 MET A N    1 
ATOM   4773  C CA   . MET A 1 324 ? 57.665  -35.633  -21.124 1.00 53.33  ? 368 MET A CA   1 
ATOM   4774  C C    . MET A 1 324 ? 57.405  -35.413  -19.637 1.00 45.89  ? 368 MET A C    1 
ATOM   4775  O O    . MET A 1 324 ? 57.804  -36.227  -18.796 1.00 44.51  ? 368 MET A O    1 
ATOM   4776  C CB   . MET A 1 324 ? 58.360  -36.971  -21.362 1.00 47.43  ? 368 MET A CB   1 
ATOM   4777  C CG   . MET A 1 324 ? 58.397  -37.383  -22.822 1.00 43.35  ? 368 MET A CG   1 
ATOM   4778  S SD   . MET A 1 324 ? 56.753  -37.733  -23.474 1.00 52.06  ? 368 MET A SD   1 
ATOM   4779  C CE   . MET A 1 324 ? 56.904  -37.082  -25.134 1.00 50.20  ? 368 MET A CE   1 
ATOM   4780  H H    . MET A 1 324 ? 59.224  -34.441  -21.266 1.00 72.69  ? 368 MET A H    1 
ATOM   4781  H HA   . MET A 1 324 ? 56.814  -35.655  -21.589 1.00 63.99  ? 368 MET A HA   1 
ATOM   4782  H HB2  . MET A 1 324 ? 59.275  -36.908  -21.046 1.00 56.92  ? 368 MET A HB2  1 
ATOM   4783  H HB3  . MET A 1 324 ? 57.888  -37.661  -20.870 1.00 56.92  ? 368 MET A HB3  1 
ATOM   4784  H HG2  . MET A 1 324 ? 58.783  -36.663  -23.346 1.00 52.02  ? 368 MET A HG2  1 
ATOM   4785  H HG3  . MET A 1 324 ? 58.935  -38.186  -22.912 1.00 52.02  ? 368 MET A HG3  1 
ATOM   4786  H HE1  . MET A 1 324 ? 56.065  -37.212  -25.602 1.00 60.24  ? 368 MET A HE1  1 
ATOM   4787  H HE2  . MET A 1 324 ? 57.113  -36.136  -25.084 1.00 60.24  ? 368 MET A HE2  1 
ATOM   4788  H HE3  . MET A 1 324 ? 57.616  -37.554  -25.594 1.00 60.24  ? 368 MET A HE3  1 
ATOM   4789  N N    . PRO A 1 325 ? 56.731  -34.323  -19.279 1.00 46.82  ? 369 PRO A N    1 
ATOM   4790  C CA   . PRO A 1 325 ? 56.424  -34.083  -17.867 1.00 47.02  ? 369 PRO A CA   1 
ATOM   4791  C C    . PRO A 1 325 ? 55.480  -35.138  -17.315 1.00 47.07  ? 369 PRO A C    1 
ATOM   4792  O O    . PRO A 1 325 ? 54.600  -35.647  -18.013 1.00 33.69  ? 369 PRO A O    1 
ATOM   4793  C CB   . PRO A 1 325 ? 55.770  -32.696  -17.876 1.00 43.74  ? 369 PRO A CB   1 
ATOM   4794  C CG   . PRO A 1 325 ? 55.221  -32.548  -19.255 1.00 40.46  ? 369 PRO A CG   1 
ATOM   4795  C CD   . PRO A 1 325 ? 56.177  -33.272  -20.152 1.00 42.50  ? 369 PRO A CD   1 
ATOM   4796  H HA   . PRO A 1 325 ? 57.237  -34.059  -17.338 1.00 56.43  ? 369 PRO A HA   1 
ATOM   4797  H HB2  . PRO A 1 325 ? 55.059  -32.664  -17.217 1.00 52.49  ? 369 PRO A HB2  1 
ATOM   4798  H HB3  . PRO A 1 325 ? 56.438  -32.016  -17.696 1.00 52.49  ? 369 PRO A HB3  1 
ATOM   4799  H HG2  . PRO A 1 325 ? 54.340  -32.951  -19.300 1.00 48.56  ? 369 PRO A HG2  1 
ATOM   4800  H HG3  . PRO A 1 325 ? 55.179  -31.607  -19.489 1.00 48.56  ? 369 PRO A HG3  1 
ATOM   4801  H HD2  . PRO A 1 325 ? 55.705  -33.667  -20.901 1.00 51.01  ? 369 PRO A HD2  1 
ATOM   4802  H HD3  . PRO A 1 325 ? 56.881  -32.674  -20.449 1.00 51.01  ? 369 PRO A HD3  1 
ATOM   4803  N N    . GLY A 1 326 ? 55.678  -35.466  -16.038 1.00 45.67  ? 370 GLY A N    1 
ATOM   4804  C CA   . GLY A 1 326 ? 54.850  -36.434  -15.352 1.00 35.44  ? 370 GLY A CA   1 
ATOM   4805  C C    . GLY A 1 326 ? 55.205  -37.883  -15.600 1.00 37.27  ? 370 GLY A C    1 
ATOM   4806  O O    . GLY A 1 326 ? 54.749  -38.754  -14.848 1.00 30.31  ? 370 GLY A O    1 
ATOM   4807  H H    . GLY A 1 326 ? 56.299  -35.132  -15.546 1.00 54.80  ? 370 GLY A H    1 
ATOM   4808  H HA2  . GLY A 1 326 ? 54.907  -36.273  -14.397 1.00 42.53  ? 370 GLY A HA2  1 
ATOM   4809  H HA3  . GLY A 1 326 ? 53.927  -36.303  -15.622 1.00 42.53  ? 370 GLY A HA3  1 
ATOM   4810  N N    . LYS A 1 327 ? 56.000  -38.178  -16.625 1.00 35.14  ? 371 LYS A N    1 
ATOM   4811  C CA   . LYS A 1 327 ? 56.390  -39.551  -16.917 1.00 35.38  ? 371 LYS A CA   1 
ATOM   4812  C C    . LYS A 1 327 ? 57.556  -39.952  -16.022 1.00 25.98  ? 371 LYS A C    1 
ATOM   4813  O O    . LYS A 1 327 ? 58.644  -39.374  -16.111 1.00 35.16  ? 371 LYS A O    1 
ATOM   4814  C CB   . LYS A 1 327 ? 56.763  -39.698  -18.390 1.00 33.67  ? 371 LYS A CB   1 
ATOM   4815  C CG   . LYS A 1 327 ? 57.129  -41.116  -18.793 1.00 40.37  ? 371 LYS A CG   1 
ATOM   4816  C CD   . LYS A 1 327 ? 57.085  -41.301  -20.305 1.00 42.99  ? 371 LYS A CD   1 
ATOM   4817  C CE   . LYS A 1 327 ? 57.498  -42.713  -20.703 1.00 49.17  ? 371 LYS A CE   1 
ATOM   4818  N NZ   . LYS A 1 327 ? 57.206  -43.010  -22.133 1.00 44.25  ? 371 LYS A NZ   1 
ATOM   4819  H H    . LYS A 1 327 ? 56.328  -37.597  -17.168 1.00 42.17  ? 371 LYS A H    1 
ATOM   4820  H HA   . LYS A 1 327 ? 55.644  -40.143  -16.731 1.00 42.46  ? 371 LYS A HA   1 
ATOM   4821  H HB2  . LYS A 1 327 ? 56.007  -39.422  -18.933 1.00 40.40  ? 371 LYS A HB2  1 
ATOM   4822  H HB3  . LYS A 1 327 ? 57.526  -39.130  -18.577 1.00 40.40  ? 371 LYS A HB3  1 
ATOM   4823  H HG2  . LYS A 1 327 ? 58.029  -41.312  -18.490 1.00 48.45  ? 371 LYS A HG2  1 
ATOM   4824  H HG3  . LYS A 1 327 ? 56.498  -41.735  -18.393 1.00 48.45  ? 371 LYS A HG3  1 
ATOM   4825  H HD2  . LYS A 1 327 ? 56.181  -41.148  -20.621 1.00 51.59  ? 371 LYS A HD2  1 
ATOM   4826  H HD3  . LYS A 1 327 ? 57.697  -40.676  -20.723 1.00 51.59  ? 371 LYS A HD3  1 
ATOM   4827  H HE2  . LYS A 1 327 ? 58.452  -42.815  -20.563 1.00 59.00  ? 371 LYS A HE2  1 
ATOM   4828  H HE3  . LYS A 1 327 ? 57.011  -43.351  -20.158 1.00 59.00  ? 371 LYS A HE3  1 
ATOM   4829  H HZ1  . LYS A 1 327 ? 57.460  -43.841  -22.328 1.00 53.10  ? 371 LYS A HZ1  1 
ATOM   4830  H HZ2  . LYS A 1 327 ? 56.334  -42.930  -22.288 1.00 53.10  ? 371 LYS A HZ2  1 
ATOM   4831  H HZ3  . LYS A 1 327 ? 57.647  -42.442  -22.657 1.00 53.10  ? 371 LYS A HZ3  1 
ATOM   4832  N N    . VAL A 1 328 ? 57.325  -40.937  -15.157 1.00 28.47  ? 372 VAL A N    1 
ATOM   4833  C CA   . VAL A 1 328 ? 58.348  -41.477  -14.268 1.00 29.18  ? 372 VAL A CA   1 
ATOM   4834  C C    . VAL A 1 328 ? 58.277  -42.995  -14.346 1.00 25.65  ? 372 VAL A C    1 
ATOM   4835  O O    . VAL A 1 328 ? 57.250  -43.590  -13.997 1.00 27.35  ? 372 VAL A O    1 
ATOM   4836  C CB   . VAL A 1 328 ? 58.164  -41.002  -12.816 1.00 26.98  ? 372 VAL A CB   1 
ATOM   4837  C CG1  . VAL A 1 328 ? 59.259  -41.572  -11.920 1.00 26.30  ? 372 VAL A CG1  1 
ATOM   4838  C CG2  . VAL A 1 328 ? 58.155  -39.480  -12.747 1.00 28.14  ? 372 VAL A CG2  1 
ATOM   4839  H H    . VAL A 1 328 ? 56.560  -41.318  -15.065 1.00 34.16  ? 372 VAL A H    1 
ATOM   4840  H HA   . VAL A 1 328 ? 59.224  -41.194  -14.574 1.00 35.02  ? 372 VAL A HA   1 
ATOM   4841  H HB   . VAL A 1 328 ? 57.310  -41.322  -12.485 1.00 32.38  ? 372 VAL A HB   1 
ATOM   4842  H HG11 . VAL A 1 328 ? 59.120  -41.258  -11.013 1.00 31.56  ? 372 VAL A HG11 1 
ATOM   4843  H HG12 . VAL A 1 328 ? 59.215  -42.541  -11.946 1.00 31.56  ? 372 VAL A HG12 1 
ATOM   4844  H HG13 . VAL A 1 328 ? 60.122  -41.271  -12.247 1.00 31.56  ? 372 VAL A HG13 1 
ATOM   4845  H HG21 . VAL A 1 328 ? 58.038  -39.207  -11.824 1.00 33.77  ? 372 VAL A HG21 1 
ATOM   4846  H HG22 . VAL A 1 328 ? 58.999  -39.145  -13.087 1.00 33.77  ? 372 VAL A HG22 1 
ATOM   4847  H HG23 . VAL A 1 328 ? 57.423  -39.144  -13.287 1.00 33.77  ? 372 VAL A HG23 1 
ATOM   4848  N N    . ASN A 1 329 ? 59.355  -43.616  -14.799 1.00 28.49  ? 373 ASN A N    1 
ATOM   4849  C CA   . ASN A 1 329 ? 59.408  -45.071  -14.828 1.00 27.16  ? 373 ASN A CA   1 
ATOM   4850  C C    . ASN A 1 329 ? 59.597  -45.603  -13.409 1.00 26.55  ? 373 ASN A C    1 
ATOM   4851  O O    . ASN A 1 329 ? 60.442  -45.087  -12.668 1.00 24.61  ? 373 ASN A O    1 
ATOM   4852  C CB   . ASN A 1 329 ? 60.546  -45.553  -15.724 1.00 23.73  ? 373 ASN A CB   1 
ATOM   4853  C CG   . ASN A 1 329 ? 60.230  -45.408  -17.200 1.00 25.59  ? 373 ASN A CG   1 
ATOM   4854  O OD1  . ASN A 1 329 ? 59.067  -45.325  -17.591 1.00 24.60  ? 373 ASN A OD1  1 
ATOM   4855  N ND2  . ASN A 1 329 ? 61.266  -45.391  -18.028 1.00 28.42  ? 373 ASN A ND2  1 
ATOM   4856  H H    . ASN A 1 329 ? 60.062  -43.225  -15.093 1.00 34.19  ? 373 ASN A H    1 
ATOM   4857  H HA   . ASN A 1 329 ? 58.573  -45.419  -15.178 1.00 32.60  ? 373 ASN A HA   1 
ATOM   4858  H HB2  . ASN A 1 329 ? 61.341  -45.030  -15.535 1.00 28.48  ? 373 ASN A HB2  1 
ATOM   4859  H HB3  . ASN A 1 329 ? 60.715  -46.491  -15.544 1.00 28.48  ? 373 ASN A HB3  1 
ATOM   4860  H HD21 . ASN A 1 329 ? 61.139  -45.311  -18.875 1.00 34.10  ? 373 ASN A HD21 1 
ATOM   4861  H HD22 . ASN A 1 329 ? 62.066  -45.460  -17.718 1.00 34.10  ? 373 ASN A HD22 1 
ATOM   4862  N N    . PRO A 1 330 ? 58.837  -46.625  -12.989 1.00 20.98  ? 374 PRO A N    1 
ATOM   4863  C CA   . PRO A 1 330 ? 59.007  -47.188  -11.632 1.00 21.83  ? 374 PRO A CA   1 
ATOM   4864  C C    . PRO A 1 330 ? 60.211  -48.119  -11.553 1.00 21.30  ? 374 PRO A C    1 
ATOM   4865  O O    . PRO A 1 330 ? 60.102  -49.341  -11.420 1.00 22.04  ? 374 PRO A O    1 
ATOM   4866  C CB   . PRO A 1 330 ? 57.676  -47.913  -11.415 1.00 16.38  ? 374 PRO A CB   1 
ATOM   4867  C CG   . PRO A 1 330 ? 57.297  -48.380  -12.777 1.00 20.62  ? 374 PRO A CG   1 
ATOM   4868  C CD   . PRO A 1 330 ? 57.775  -47.318  -13.737 1.00 21.87  ? 374 PRO A CD   1 
ATOM   4869  H HA   . PRO A 1 330 ? 59.101  -46.478  -10.978 1.00 26.19  ? 374 PRO A HA   1 
ATOM   4870  H HB2  . PRO A 1 330 ? 57.803  -48.663  -10.814 1.00 19.65  ? 374 PRO A HB2  1 
ATOM   4871  H HB3  . PRO A 1 330 ? 57.016  -47.294  -11.064 1.00 19.65  ? 374 PRO A HB3  1 
ATOM   4872  H HG2  . PRO A 1 330 ? 57.734  -49.226  -12.962 1.00 24.75  ? 374 PRO A HG2  1 
ATOM   4873  H HG3  . PRO A 1 330 ? 56.333  -48.476  -12.829 1.00 24.75  ? 374 PRO A HG3  1 
ATOM   4874  H HD2  . PRO A 1 330 ? 58.138  -47.727  -14.538 1.00 26.25  ? 374 PRO A HD2  1 
ATOM   4875  H HD3  . PRO A 1 330 ? 57.054  -46.704  -13.947 1.00 26.25  ? 374 PRO A HD3  1 
ATOM   4876  N N    . THR A 1 331 ? 61.403  -47.522  -11.623 1.00 22.93  ? 375 THR A N    1 
ATOM   4877  C CA   . THR A 1 331 ? 62.624  -48.303  -11.800 1.00 25.11  ? 375 THR A CA   1 
ATOM   4878  C C    . THR A 1 331 ? 62.867  -49.246  -10.629 1.00 16.46  ? 375 THR A C    1 
ATOM   4879  O O    . THR A 1 331 ? 63.224  -50.413  -10.827 1.00 20.37  ? 375 THR A O    1 
ATOM   4880  C CB   . THR A 1 331 ? 63.816  -47.367  -11.978 1.00 27.78  ? 375 THR A CB   1 
ATOM   4881  O OG1  . THR A 1 331 ? 63.920  -46.498  -10.845 1.00 46.52  ? 375 THR A OG1  1 
ATOM   4882  C CG2  . THR A 1 331 ? 63.651  -46.534  -13.234 1.00 41.79  ? 375 THR A CG2  1 
ATOM   4883  H H    . THR A 1 331 ? 61.529  -46.673  -11.571 1.00 27.52  ? 375 THR A H    1 
ATOM   4884  H HA   . THR A 1 331 ? 62.541  -48.840  -12.603 1.00 30.14  ? 375 THR A HA   1 
ATOM   4885  H HB   . THR A 1 331 ? 64.628  -47.891  -12.061 1.00 33.34  ? 375 THR A HB   1 
ATOM   4886  H HG1  . THR A 1 331 ? 64.575  -45.981  -10.940 1.00 55.83  ? 375 THR A HG1  1 
ATOM   4887  H HG21 . THR A 1 331 ? 64.412  -45.942  -13.341 1.00 50.15  ? 375 THR A HG21 1 
ATOM   4888  H HG22 . THR A 1 331 ? 63.590  -47.112  -14.010 1.00 50.15  ? 375 THR A HG22 1 
ATOM   4889  H HG23 . THR A 1 331 ? 62.843  -46.000  -13.174 1.00 50.15  ? 375 THR A HG23 1 
ATOM   4890  N N    . GLN A 1 332 ? 62.690  -48.760  -9.400  1.00 15.80  ? 376 GLN A N    1 
ATOM   4891  C CA   . GLN A 1 332 ? 62.952  -49.600  -8.237  1.00 16.50  ? 376 GLN A CA   1 
ATOM   4892  C C    . GLN A 1 332 ? 61.946  -50.740  -8.140  1.00 24.38  ? 376 GLN A C    1 
ATOM   4893  O O    . GLN A 1 332 ? 62.300  -51.852  -7.733  1.00 21.82  ? 376 GLN A O    1 
ATOM   4894  C CB   . GLN A 1 332 ? 62.938  -48.752  -6.966  1.00 17.99  ? 376 GLN A CB   1 
ATOM   4895  C CG   . GLN A 1 332 ? 64.048  -47.716  -6.912  1.00 23.99  ? 376 GLN A CG   1 
ATOM   4896  C CD   . GLN A 1 332 ? 65.429  -48.341  -6.846  1.00 23.31  ? 376 GLN A CD   1 
ATOM   4897  O OE1  . GLN A 1 332 ? 65.607  -49.423  -6.287  1.00 25.96  ? 376 GLN A OE1  1 
ATOM   4898  N NE2  . GLN A 1 332 ? 66.415  -47.661  -7.419  1.00 37.62  ? 376 GLN A NE2  1 
ATOM   4899  H H    . GLN A 1 332 ? 62.424  -47.963  -9.217  1.00 18.97  ? 376 GLN A H    1 
ATOM   4900  H HA   . GLN A 1 332 ? 63.836  -49.990  -8.325  1.00 19.80  ? 376 GLN A HA   1 
ATOM   4901  H HB2  . GLN A 1 332 ? 62.091  -48.282  -6.913  1.00 21.60  ? 376 GLN A HB2  1 
ATOM   4902  H HB3  . GLN A 1 332 ? 63.039  -49.336  -6.199  1.00 21.60  ? 376 GLN A HB3  1 
ATOM   4903  H HG2  . GLN A 1 332 ? 64.006  -47.165  -7.709  1.00 28.79  ? 376 GLN A HG2  1 
ATOM   4904  H HG3  . GLN A 1 332 ? 63.930  -47.166  -6.121  1.00 28.79  ? 376 GLN A HG3  1 
ATOM   4905  H HE21 . GLN A 1 332 ? 66.253  -46.907  -7.800  1.00 45.14  ? 376 GLN A HE21 1 
ATOM   4906  H HE22 . GLN A 1 332 ? 67.216  -47.973  -7.408  1.00 45.14  ? 376 GLN A HE22 1 
ATOM   4907  N N    . CYS A 1 333 ? 60.687  -50.485  -8.508  1.00 17.56  ? 377 CYS A N    1 
ATOM   4908  C CA   . CYS A 1 333 ? 59.707  -51.564  -8.574  1.00 17.84  ? 377 CYS A CA   1 
ATOM   4909  C C    . CYS A 1 333 ? 60.185  -52.679  -9.494  1.00 18.88  ? 377 CYS A C    1 
ATOM   4910  O O    . CYS A 1 333 ? 59.928  -53.861  -9.237  1.00 18.73  ? 377 CYS A O    1 
ATOM   4911  C CB   . CYS A 1 333 ? 58.357  -51.029  -9.058  1.00 23.27  ? 377 CYS A CB   1 
ATOM   4912  S SG   . CYS A 1 333 ? 57.572  -49.831  -7.958  1.00 24.25  ? 377 CYS A SG   1 
ATOM   4913  H H    . CYS A 1 333 ? 60.382  -49.709  -8.719  1.00 21.07  ? 377 CYS A H    1 
ATOM   4914  H HA   . CYS A 1 333 ? 59.583  -51.937  -7.687  1.00 21.41  ? 377 CYS A HA   1 
ATOM   4915  H HB2  . CYS A 1 333 ? 58.486  -50.597  -9.916  1.00 27.92  ? 377 CYS A HB2  1 
ATOM   4916  H HB3  . CYS A 1 333 ? 57.747  -51.777  -9.159  1.00 27.92  ? 377 CYS A HB3  1 
ATOM   4917  H HG   . CYS A 1 333 ? 57.380  -50.347  -6.891  1.00 29.10  ? 377 CYS A HG   1 
ATOM   4918  N N    . GLU A 1 334 ? 60.882  -52.322  -10.574 1.00 18.49  ? 378 GLU A N    1 
ATOM   4919  C CA   . GLU A 1 334 ? 61.340  -53.327  -11.526 1.00 22.85  ? 378 GLU A CA   1 
ATOM   4920  C C    . GLU A 1 334 ? 62.516  -54.116  -10.968 1.00 16.51  ? 378 GLU A C    1 
ATOM   4921  O O    . GLU A 1 334 ? 62.591  -55.338  -11.143 1.00 17.92  ? 378 GLU A O    1 
ATOM   4922  C CB   . GLU A 1 334 ? 61.708  -52.657  -12.848 1.00 16.42  ? 378 GLU A CB   1 
ATOM   4923  C CG   . GLU A 1 334 ? 60.503  -52.053  -13.547 1.00 23.76  ? 378 GLU A CG   1 
ATOM   4924  C CD   . GLU A 1 334 ? 60.864  -51.274  -14.794 1.00 17.63  ? 378 GLU A CD   1 
ATOM   4925  O OE1  . GLU A 1 334 ? 62.053  -51.260  -15.177 1.00 19.00  ? 378 GLU A OE1  1 
ATOM   4926  O OE2  . GLU A 1 334 ? 59.948  -50.675  -15.394 1.00 15.22  ? 378 GLU A OE2  1 
ATOM   4927  H H    . GLU A 1 334 ? 61.098  -51.514  -10.775 1.00 22.19  ? 378 GLU A H    1 
ATOM   4928  H HA   . GLU A 1 334 ? 60.617  -53.951  -11.697 1.00 27.42  ? 378 GLU A HA   1 
ATOM   4929  H HB2  . GLU A 1 334 ? 62.344  -51.946  -12.676 1.00 19.71  ? 378 GLU A HB2  1 
ATOM   4930  H HB3  . GLU A 1 334 ? 62.099  -53.318  -13.440 1.00 19.71  ? 378 GLU A HB3  1 
ATOM   4931  H HG2  . GLU A 1 334 ? 59.899  -52.766  -13.806 1.00 28.52  ? 378 GLU A HG2  1 
ATOM   4932  H HG3  . GLU A 1 334 ? 60.056  -51.446  -12.936 1.00 28.52  ? 378 GLU A HG3  1 
ATOM   4933  N N    . ALA A 1 335 ? 63.441  -53.440  -10.287 1.00 16.62  ? 379 ALA A N    1 
ATOM   4934  C CA   . ALA A 1 335 ? 64.523  -54.154  -9.623  1.00 14.69  ? 379 ALA A CA   1 
ATOM   4935  C C    . ALA A 1 335 ? 63.978  -55.097  -8.558  1.00 19.77  ? 379 ALA A C    1 
ATOM   4936  O O    . ALA A 1 335 ? 64.421  -56.247  -8.450  1.00 14.05  ? 379 ALA A O    1 
ATOM   4937  C CB   . ALA A 1 335 ? 65.509  -53.158  -9.011  1.00 15.83  ? 379 ALA A CB   1 
ATOM   4938  H H    . ALA A 1 335 ? 63.464  -52.585  -10.198 1.00 19.95  ? 379 ALA A H    1 
ATOM   4939  H HA   . ALA A 1 335 ? 65.001  -54.685  -10.278 1.00 17.63  ? 379 ALA A HA   1 
ATOM   4940  H HB1  . ALA A 1 335 ? 66.222  -53.649  -8.573  1.00 18.99  ? 379 ALA A HB1  1 
ATOM   4941  H HB2  . ALA A 1 335 ? 65.874  -52.602  -9.717  1.00 18.99  ? 379 ALA A HB2  1 
ATOM   4942  H HB3  . ALA A 1 335 ? 65.040  -52.608  -8.364  1.00 18.99  ? 379 ALA A HB3  1 
ATOM   4943  N N    . MET A 1 336 ? 63.001  -54.635  -7.773  1.00 15.39  ? 380 MET A N    1 
ATOM   4944  C CA   . MET A 1 336 ? 62.466  -55.456  -6.691  1.00 22.20  ? 380 MET A CA   1 
ATOM   4945  C C    . MET A 1 336 ? 61.718  -56.670  -7.229  1.00 14.16  ? 380 MET A C    1 
ATOM   4946  O O    . MET A 1 336 ? 61.868  -57.779  -6.704  1.00 15.62  ? 380 MET A O    1 
ATOM   4947  C CB   . MET A 1 336 ? 61.550  -54.614  -5.798  1.00 16.06  ? 380 MET A CB   1 
ATOM   4948  C CG   . MET A 1 336 ? 60.811  -55.404  -4.722  1.00 16.36  ? 380 MET A CG   1 
ATOM   4949  S SD   . MET A 1 336 ? 61.904  -56.302  -3.605  1.00 21.96  ? 380 MET A SD   1 
ATOM   4950  C CE   . MET A 1 336 ? 62.476  -54.967  -2.558  1.00 16.54  ? 380 MET A CE   1 
ATOM   4951  H H    . MET A 1 336 ? 62.637  -53.859  -7.847  1.00 18.47  ? 380 MET A H    1 
ATOM   4952  H HA   . MET A 1 336 ? 63.204  -55.766  -6.144  1.00 26.65  ? 380 MET A HA   1 
ATOM   4953  H HB2  . MET A 1 336 ? 62.087  -53.940  -5.352  1.00 19.28  ? 380 MET A HB2  1 
ATOM   4954  H HB3  . MET A 1 336 ? 60.884  -54.183  -6.357  1.00 19.28  ? 380 MET A HB3  1 
ATOM   4955  H HG2  . MET A 1 336 ? 60.282  -54.789  -4.190  1.00 19.63  ? 380 MET A HG2  1 
ATOM   4956  H HG3  . MET A 1 336 ? 60.230  -56.051  -5.152  1.00 19.63  ? 380 MET A HG3  1 
ATOM   4957  H HE1  . MET A 1 336 ? 63.088  -55.325  -1.896  1.00 19.85  ? 380 MET A HE1  1 
ATOM   4958  H HE2  . MET A 1 336 ? 62.930  -54.309  -3.107  1.00 19.85  ? 380 MET A HE2  1 
ATOM   4959  H HE3  . MET A 1 336 ? 61.712  -54.561  -2.119  1.00 19.85  ? 380 MET A HE3  1 
ATOM   4960  N N    . THR A 1 337 ? 60.902  -56.488  -8.271  1.00 11.71  ? 381 THR A N    1 
ATOM   4961  C CA   . THR A 1 337 ? 60.135  -57.616  -8.790  1.00 17.11  ? 381 THR A CA   1 
ATOM   4962  C C    . THR A 1 337 ? 61.028  -58.615  -9.515  1.00 17.41  ? 381 THR A C    1 
ATOM   4963  O O    . THR A 1 337 ? 60.731  -59.815  -9.520  1.00 15.59  ? 381 THR A O    1 
ATOM   4964  C CB   . THR A 1 337 ? 59.017  -57.132  -9.717  1.00 12.32  ? 381 THR A CB   1 
ATOM   4965  O OG1  . THR A 1 337 ? 59.558  -56.312  -10.759 1.00 17.06  ? 381 THR A OG1  1 
ATOM   4966  C CG2  . THR A 1 337 ? 57.975  -56.349  -8.929  1.00 14.00  ? 381 THR A CG2  1 
ATOM   4967  H H    . THR A 1 337 ? 60.778  -55.743  -8.682  1.00 14.06  ? 381 THR A H    1 
ATOM   4968  H HA   . THR A 1 337 ? 59.720  -58.079  -8.045  1.00 20.53  ? 381 THR A HA   1 
ATOM   4969  H HB   . THR A 1 337 ? 58.579  -57.901  -10.114 1.00 14.78  ? 381 THR A HB   1 
ATOM   4970  H HG1  . THR A 1 337 ? 59.944  -55.643  -10.427 1.00 20.47  ? 381 THR A HG1  1 
ATOM   4971  H HG21 . THR A 1 337 ? 57.270  -56.046  -9.522  1.00 16.81  ? 381 THR A HG21 1 
ATOM   4972  H HG22 . THR A 1 337 ? 57.587  -56.913  -8.241  1.00 16.81  ? 381 THR A HG22 1 
ATOM   4973  H HG23 . THR A 1 337 ? 58.388  -55.578  -8.509  1.00 16.81  ? 381 THR A HG23 1 
ATOM   4974  N N    . MET A 1 338 ? 62.118  -58.150  -10.129 1.00 14.39  ? 382 MET A N    1 
ATOM   4975  C CA   . MET A 1 338 ? 63.089  -59.086  -10.689 1.00 14.04  ? 382 MET A CA   1 
ATOM   4976  C C    . MET A 1 338 ? 63.777  -59.879  -9.585  1.00 11.90  ? 382 MET A C    1 
ATOM   4977  O O    . MET A 1 338 ? 63.989  -61.090  -9.722  1.00 16.53  ? 382 MET A O    1 
ATOM   4978  C CB   . MET A 1 338 ? 64.119  -58.341  -11.540 1.00 8.71   ? 382 MET A CB   1 
ATOM   4979  C CG   . MET A 1 338 ? 63.605  -57.938  -12.916 1.00 13.15  ? 382 MET A CG   1 
ATOM   4980  S SD   . MET A 1 338 ? 64.911  -57.414  -14.050 1.00 16.83  ? 382 MET A SD   1 
ATOM   4981  C CE   . MET A 1 338 ? 65.531  -55.964  -13.204 1.00 18.28  ? 382 MET A CE   1 
ATOM   4982  H H    . MET A 1 338 ? 62.313  -57.319  -10.233 1.00 17.28  ? 382 MET A H    1 
ATOM   4983  H HA   . MET A 1 338 ? 62.621  -59.706  -11.270 1.00 16.85  ? 382 MET A HA   1 
ATOM   4984  H HB2  . MET A 1 338 ? 64.383  -57.532  -11.074 1.00 10.46  ? 382 MET A HB2  1 
ATOM   4985  H HB3  . MET A 1 338 ? 64.891  -58.914  -11.669 1.00 10.46  ? 382 MET A HB3  1 
ATOM   4986  H HG2  . MET A 1 338 ? 63.151  -58.697  -13.315 1.00 15.78  ? 382 MET A HG2  1 
ATOM   4987  H HG3  . MET A 1 338 ? 62.984  -57.199  -12.815 1.00 15.78  ? 382 MET A HG3  1 
ATOM   4988  H HE1  . MET A 1 338 ? 66.254  -55.580  -13.725 1.00 21.94  ? 382 MET A HE1  1 
ATOM   4989  H HE2  . MET A 1 338 ? 64.812  -55.320  -13.113 1.00 21.94  ? 382 MET A HE2  1 
ATOM   4990  H HE3  . MET A 1 338 ? 65.856  -56.225  -12.328 1.00 21.94  ? 382 MET A HE3  1 
ATOM   4991  N N    . VAL A 1 339 ? 64.125  -59.217  -8.479  1.00 13.32  ? 383 VAL A N    1 
ATOM   4992  C CA   . VAL A 1 339 ? 64.712  -59.921  -7.342  1.00 15.86  ? 383 VAL A CA   1 
ATOM   4993  C C    . VAL A 1 339 ? 63.742  -60.968  -6.810  1.00 11.24  ? 383 VAL A C    1 
ATOM   4994  O O    . VAL A 1 339 ? 64.133  -62.102  -6.507  1.00 11.12  ? 383 VAL A O    1 
ATOM   4995  C CB   . VAL A 1 339 ? 65.120  -58.917  -6.248  1.00 22.57  ? 383 VAL A CB   1 
ATOM   4996  C CG1  . VAL A 1 339 ? 65.383  -59.624  -4.919  1.00 17.93  ? 383 VAL A CG1  1 
ATOM   4997  C CG2  . VAL A 1 339 ? 66.355  -58.143  -6.681  1.00 16.58  ? 383 VAL A CG2  1 
ATOM   4998  H H    . VAL A 1 339 ? 64.032  -58.370  -8.364  1.00 15.99  ? 383 VAL A H    1 
ATOM   4999  H HA   . VAL A 1 339 ? 65.513  -60.381  -7.638  1.00 19.04  ? 383 VAL A HA   1 
ATOM   5000  H HB   . VAL A 1 339 ? 64.399  -58.282  -6.114  1.00 27.09  ? 383 VAL A HB   1 
ATOM   5001  H HG11 . VAL A 1 339 ? 65.637  -58.963  -4.255  1.00 21.52  ? 383 VAL A HG11 1 
ATOM   5002  H HG12 . VAL A 1 339 ? 64.574  -60.080  -4.639  1.00 21.52  ? 383 VAL A HG12 1 
ATOM   5003  H HG13 . VAL A 1 339 ? 66.101  -60.265  -5.039  1.00 21.52  ? 383 VAL A HG13 1 
ATOM   5004  H HG21 . VAL A 1 339 ? 66.596  -57.517  -5.980  1.00 19.90  ? 383 VAL A HG21 1 
ATOM   5005  H HG22 . VAL A 1 339 ? 67.082  -58.767  -6.832  1.00 19.90  ? 383 VAL A HG22 1 
ATOM   5006  H HG23 . VAL A 1 339 ? 66.155  -57.663  -7.500  1.00 19.90  ? 383 VAL A HG23 1 
ATOM   5007  N N    . ALA A 1 340 ? 62.463  -60.606  -6.685  1.00 11.40  ? 384 ALA A N    1 
ATOM   5008  C CA   . ALA A 1 340 ? 61.466  -61.554  -6.196  1.00 13.18  ? 384 ALA A CA   1 
ATOM   5009  C C    . ALA A 1 340 ? 61.428  -62.805  -7.065  1.00 15.07  ? 384 ALA A C    1 
ATOM   5010  O O    . ALA A 1 340 ? 61.447  -63.931  -6.555  1.00 17.05  ? 384 ALA A O    1 
ATOM   5011  C CB   . ALA A 1 340 ? 60.091  -60.887  -6.151  1.00 12.22  ? 384 ALA A CB   1 
ATOM   5012  H H    . ALA A 1 340 ? 62.153  -59.827  -6.874  1.00 13.68  ? 384 ALA A H    1 
ATOM   5013  H HA   . ALA A 1 340 ? 61.699  -61.822  -5.294  1.00 15.81  ? 384 ALA A HA   1 
ATOM   5014  H HB1  . ALA A 1 340 ? 59.441  -61.528  -5.825  1.00 14.67  ? 384 ALA A HB1  1 
ATOM   5015  H HB2  . ALA A 1 340 ? 60.131  -60.123  -5.555  1.00 14.67  ? 384 ALA A HB2  1 
ATOM   5016  H HB3  . ALA A 1 340 ? 59.852  -60.598  -7.046  1.00 14.67  ? 384 ALA A HB3  1 
ATOM   5017  N N    . ALA A 1 341 ? 61.376  -62.626  -8.388  1.00 17.59  ? 385 ALA A N    1 
ATOM   5018  C CA   . ALA A 1 341 ? 61.383  -63.773  -9.290  1.00 14.42  ? 385 ALA A CA   1 
ATOM   5019  C C    . ALA A 1 341 ? 62.643  -64.608  -9.106  1.00 14.50  ? 385 ALA A C    1 
ATOM   5020  O O    . ALA A 1 341 ? 62.584  -65.844  -9.101  1.00 11.22  ? 385 ALA A O    1 
ATOM   5021  C CB   . ALA A 1 341 ? 61.260  -63.300  -10.738 1.00 9.83   ? 385 ALA A CB   1 
ATOM   5022  H H    . ALA A 1 341 ? 61.337  -61.862  -8.780  1.00 21.11  ? 385 ALA A H    1 
ATOM   5023  H HA   . ALA A 1 341 ? 60.618  -64.335  -9.092  1.00 17.31  ? 385 ALA A HA   1 
ATOM   5024  H HB1  . ALA A 1 341 ? 61.266  -64.073  -11.324 1.00 11.80  ? 385 ALA A HB1  1 
ATOM   5025  H HB2  . ALA A 1 341 ? 60.428  -62.812  -10.842 1.00 11.80  ? 385 ALA A HB2  1 
ATOM   5026  H HB3  . ALA A 1 341 ? 62.011  -62.722  -10.946 1.00 11.80  ? 385 ALA A HB3  1 
ATOM   5027  N N    . GLN A 1 342 ? 63.794  -63.951  -8.947  1.00 11.24  ? 386 GLN A N    1 
ATOM   5028  C CA   . GLN A 1 342 ? 65.041  -64.684  -8.758  1.00 11.34  ? 386 GLN A CA   1 
ATOM   5029  C C    . GLN A 1 342 ? 64.991  -65.535  -7.495  1.00 12.14  ? 386 GLN A C    1 
ATOM   5030  O O    . GLN A 1 342 ? 65.419  -66.695  -7.502  1.00 10.22  ? 386 GLN A O    1 
ATOM   5031  C CB   . GLN A 1 342 ? 66.217  -63.708  -8.705  1.00 14.55  ? 386 GLN A CB   1 
ATOM   5032  C CG   . GLN A 1 342 ? 67.579  -64.377  -8.641  1.00 12.00  ? 386 GLN A CG   1 
ATOM   5033  C CD   . GLN A 1 342 ? 67.929  -65.120  -9.915  1.00 14.24  ? 386 GLN A CD   1 
ATOM   5034  O OE1  . GLN A 1 342 ? 68.088  -64.515  -10.975 1.00 20.50  ? 386 GLN A OE1  1 
ATOM   5035  N NE2  . GLN A 1 342 ? 68.047  -66.439  -9.819  1.00 16.56  ? 386 GLN A NE2  1 
ATOM   5036  H H    . GLN A 1 342 ? 63.877  -63.095  -8.946  1.00 13.49  ? 386 GLN A H    1 
ATOM   5037  H HA   . GLN A 1 342 ? 65.177  -65.277  -9.514  1.00 13.61  ? 386 GLN A HA   1 
ATOM   5038  H HB2  . GLN A 1 342 ? 66.197  -63.153  -9.500  1.00 17.46  ? 386 GLN A HB2  1 
ATOM   5039  H HB3  . GLN A 1 342 ? 66.124  -63.152  -7.915  1.00 17.46  ? 386 GLN A HB3  1 
ATOM   5040  H HG2  . GLN A 1 342 ? 68.257  -63.699  -8.494  1.00 14.40  ? 386 GLN A HG2  1 
ATOM   5041  H HG3  . GLN A 1 342 ? 67.584  -65.015  -7.911  1.00 14.40  ? 386 GLN A HG3  1 
ATOM   5042  H HE21 . GLN A 1 342 ? 67.927  -66.827  -9.061  1.00 19.88  ? 386 GLN A HE21 1 
ATOM   5043  H HE22 . GLN A 1 342 ? 68.244  -66.905  -10.514 1.00 19.88  ? 386 GLN A HE22 1 
ATOM   5044  N N    . VAL A 1 343 ? 64.470  -64.976  -6.400  1.00 17.20  ? 387 VAL A N    1 
ATOM   5045  C CA   . VAL A 1 343 ? 64.366  -65.728  -5.152  1.00 10.37  ? 387 VAL A CA   1 
ATOM   5046  C C    . VAL A 1 343 ? 63.533  -66.987  -5.355  1.00 8.26   ? 387 VAL A C    1 
ATOM   5047  O O    . VAL A 1 343 ? 63.844  -68.051  -4.809  1.00 11.49  ? 387 VAL A O    1 
ATOM   5048  C CB   . VAL A 1 343 ? 63.782  -64.833  -4.043  1.00 12.97  ? 387 VAL A CB   1 
ATOM   5049  C CG1  . VAL A 1 343 ? 63.474  -65.643  -2.788  1.00 10.25  ? 387 VAL A CG1  1 
ATOM   5050  C CG2  . VAL A 1 343 ? 64.747  -63.702  -3.719  1.00 16.39  ? 387 VAL A CG2  1 
ATOM   5051  H H    . VAL A 1 343 ? 64.173  -64.170  -6.356  1.00 20.64  ? 387 VAL A H    1 
ATOM   5052  H HA   . VAL A 1 343 ? 65.255  -66.001  -4.876  1.00 12.45  ? 387 VAL A HA   1 
ATOM   5053  H HB   . VAL A 1 343 ? 62.953  -64.440  -4.357  1.00 15.57  ? 387 VAL A HB   1 
ATOM   5054  H HG11 . VAL A 1 343 ? 63.109  -65.051  -2.112  1.00 12.30  ? 387 VAL A HG11 1 
ATOM   5055  H HG12 . VAL A 1 343 ? 62.828  -66.332  -3.008  1.00 12.30  ? 387 VAL A HG12 1 
ATOM   5056  H HG13 . VAL A 1 343 ? 64.294  -66.049  -2.465  1.00 12.30  ? 387 VAL A HG13 1 
ATOM   5057  H HG21 . VAL A 1 343 ? 64.363  -63.150  -3.020  1.00 19.67  ? 387 VAL A HG21 1 
ATOM   5058  H HG22 . VAL A 1 343 ? 65.588  -64.081  -3.418  1.00 19.67  ? 387 VAL A HG22 1 
ATOM   5059  H HG23 . VAL A 1 343 ? 64.891  -63.172  -4.518  1.00 19.67  ? 387 VAL A HG23 1 
ATOM   5060  N N    . MET A 1 344 ? 62.463  -66.888  -6.146  1.00 15.60  ? 388 MET A N    1 
ATOM   5061  C CA   . MET A 1 344 ? 61.607  -68.047  -6.377  1.00 14.03  ? 388 MET A CA   1 
ATOM   5062  C C    . MET A 1 344 ? 62.361  -69.152  -7.104  1.00 14.16  ? 388 MET A C    1 
ATOM   5063  O O    . MET A 1 344 ? 62.215  -70.335  -6.774  1.00 14.90  ? 388 MET A O    1 
ATOM   5064  C CB   . MET A 1 344 ? 60.372  -67.626  -7.168  1.00 16.29  ? 388 MET A CB   1 
ATOM   5065  C CG   . MET A 1 344 ? 59.511  -66.622  -6.432  1.00 14.86  ? 388 MET A CG   1 
ATOM   5066  S SD   . MET A 1 344 ? 58.279  -65.835  -7.476  1.00 17.15  ? 388 MET A SD   1 
ATOM   5067  C CE   . MET A 1 344 ? 57.610  -64.641  -6.320  1.00 14.52  ? 388 MET A CE   1 
ATOM   5068  H H    . MET A 1 344 ? 62.215  -66.172  -6.553  1.00 18.73  ? 388 MET A H    1 
ATOM   5069  H HA   . MET A 1 344 ? 61.306  -68.388  -5.520  1.00 16.84  ? 388 MET A HA   1 
ATOM   5070  H HB2  . MET A 1 344 ? 60.655  -67.222  -8.003  1.00 19.55  ? 388 MET A HB2  1 
ATOM   5071  H HB3  . MET A 1 344 ? 59.830  -68.410  -7.347  1.00 19.55  ? 388 MET A HB3  1 
ATOM   5072  H HG2  . MET A 1 344 ? 59.046  -67.076  -5.712  1.00 17.83  ? 388 MET A HG2  1 
ATOM   5073  H HG3  . MET A 1 344 ? 60.082  -65.926  -6.069  1.00 17.83  ? 388 MET A HG3  1 
ATOM   5074  H HE1  . MET A 1 344 ? 56.914  -64.130  -6.761  1.00 17.43  ? 388 MET A HE1  1 
ATOM   5075  H HE2  . MET A 1 344 ? 57.242  -65.112  -5.556  1.00 17.43  ? 388 MET A HE2  1 
ATOM   5076  H HE3  . MET A 1 344 ? 58.322  -64.049  -6.031  1.00 17.43  ? 388 MET A HE3  1 
ATOM   5077  N N    . GLY A 1 345 ? 63.175  -68.788  -8.094  1.00 14.03  ? 389 GLY A N    1 
ATOM   5078  C CA   . GLY A 1 345 ? 63.986  -69.786  -8.769  1.00 11.72  ? 389 GLY A CA   1 
ATOM   5079  C C    . GLY A 1 345 ? 65.070  -70.349  -7.871  1.00 13.22  ? 389 GLY A C    1 
ATOM   5080  O O    . GLY A 1 345 ? 65.309  -71.560  -7.856  1.00 14.13  ? 389 GLY A O    1 
ATOM   5081  H H    . GLY A 1 345 ? 63.272  -67.985  -8.387  1.00 16.84  ? 389 GLY A H    1 
ATOM   5082  H HA2  . GLY A 1 345 ? 63.421  -70.517  -9.064  1.00 14.07  ? 389 GLY A HA2  1 
ATOM   5083  H HA3  . GLY A 1 345 ? 64.407  -69.389  -9.547  1.00 14.07  ? 389 GLY A HA3  1 
ATOM   5084  N N    . ASN A 1 346 ? 65.740  -69.481  -7.108  1.00 16.18  ? 390 ASN A N    1 
ATOM   5085  C CA   . ASN A 1 346 ? 66.748  -69.953  -6.164  1.00 19.21  ? 390 ASN A CA   1 
ATOM   5086  C C    . ASN A 1 346 ? 66.152  -70.954  -5.182  1.00 11.84  ? 390 ASN A C    1 
ATOM   5087  O O    . ASN A 1 346 ? 66.796  -71.948  -4.829  1.00 12.91  ? 390 ASN A O    1 
ATOM   5088  C CB   . ASN A 1 346 ? 67.362  -68.773  -5.408  1.00 13.59  ? 390 ASN A CB   1 
ATOM   5089  C CG   . ASN A 1 346 ? 68.178  -67.856  -6.305  1.00 10.32  ? 390 ASN A CG   1 
ATOM   5090  O OD1  . ASN A 1 346 ? 68.446  -68.170  -7.466  1.00 13.30  ? 390 ASN A OD1  1 
ATOM   5091  N ND2  . ASN A 1 346 ? 68.587  -66.716  -5.760  1.00 15.25  ? 390 ASN A ND2  1 
ATOM   5092  H H    . ASN A 1 346 ? 65.630  -68.628  -7.118  1.00 19.41  ? 390 ASN A H    1 
ATOM   5093  H HA   . ASN A 1 346 ? 67.457  -70.398  -6.654  1.00 23.06  ? 390 ASN A HA   1 
ATOM   5094  H HB2  . ASN A 1 346 ? 66.649  -68.247  -5.011  1.00 16.31  ? 390 ASN A HB2  1 
ATOM   5095  H HB3  . ASN A 1 346 ? 67.948  -69.113  -4.714  1.00 16.31  ? 390 ASN A HB3  1 
ATOM   5096  H HD21 . ASN A 1 346 ? 69.052  -66.161  -6.224  1.00 18.30  ? 390 ASN A HD21 1 
ATOM   5097  H HD22 . ASN A 1 346 ? 68.387  -66.533  -4.944  1.00 18.30  ? 390 ASN A HD22 1 
ATOM   5098  N N    . HIS A 1 347 ? 64.920  -70.711  -4.730  1.00 12.60  ? 391 HIS A N    1 
ATOM   5099  C CA   . HIS A 1 347 ? 64.305  -71.618  -3.767  1.00 12.45  ? 391 HIS A CA   1 
ATOM   5100  C C    . HIS A 1 347 ? 64.142  -73.013  -4.355  1.00 8.73   ? 391 HIS A C    1 
ATOM   5101  O O    . HIS A 1 347 ? 64.388  -74.014  -3.672  1.00 12.30  ? 391 HIS A O    1 
ATOM   5102  C CB   . HIS A 1 347 ? 62.954  -71.072  -3.309  1.00 11.51  ? 391 HIS A CB   1 
ATOM   5103  C CG   . HIS A 1 347 ? 62.214  -72.002  -2.400  1.00 22.62  ? 391 HIS A CG   1 
ATOM   5104  N ND1  . HIS A 1 347 ? 62.704  -72.381  -1.168  1.00 7.79   ? 391 HIS A ND1  1 
ATOM   5105  C CD2  . HIS A 1 347 ? 61.031  -72.644  -2.548  1.00 15.48  ? 391 HIS A CD2  1 
ATOM   5106  C CE1  . HIS A 1 347 ? 61.850  -73.210  -0.595  1.00 18.32  ? 391 HIS A CE1  1 
ATOM   5107  N NE2  . HIS A 1 347 ? 60.827  -73.387  -1.411  1.00 20.32  ? 391 HIS A NE2  1 
ATOM   5108  H H    . HIS A 1 347 ? 64.431  -70.042  -4.960  1.00 15.12  ? 391 HIS A H    1 
ATOM   5109  H HA   . HIS A 1 347 ? 64.879  -71.687  -2.989  1.00 14.95  ? 391 HIS A HA   1 
ATOM   5110  H HB2  . HIS A 1 347 ? 63.098  -70.240  -2.831  1.00 13.81  ? 391 HIS A HB2  1 
ATOM   5111  H HB3  . HIS A 1 347 ? 62.399  -70.913  -4.088  1.00 13.81  ? 391 HIS A HB3  1 
ATOM   5112  H HD2  . HIS A 1 347 ? 60.462  -72.590  -3.282  1.00 18.58  ? 391 HIS A HD2  1 
ATOM   5113  H HE1  . HIS A 1 347 ? 61.952  -73.603  0.242   1.00 21.99  ? 391 HIS A HE1  1 
ATOM   5114  H HE2  . HIS A 1 347 ? 60.143  -73.884  -1.255  1.00 24.38  ? 391 HIS A HE2  1 
ATOM   5115  N N    . VAL A 1 348 ? 63.729  -73.099  -5.621  1.00 14.44  ? 392 VAL A N    1 
ATOM   5116  C CA   . VAL A 1 348 ? 63.614  -74.399  -6.275  1.00 10.78  ? 392 VAL A CA   1 
ATOM   5117  C C    . VAL A 1 348 ? 64.980  -75.068  -6.357  1.00 14.58  ? 392 VAL A C    1 
ATOM   5118  O O    . VAL A 1 348 ? 65.109  -76.281  -6.154  1.00 14.78  ? 392 VAL A O    1 
ATOM   5119  C CB   . VAL A 1 348 ? 62.969  -74.238  -7.663  1.00 15.49  ? 392 VAL A CB   1 
ATOM   5120  C CG1  . VAL A 1 348 ? 63.152  -75.496  -8.509  1.00 12.57  ? 392 VAL A CG1  1 
ATOM   5121  C CG2  . VAL A 1 348 ? 61.487  -73.917  -7.515  1.00 15.78  ? 392 VAL A CG2  1 
ATOM   5122  H H    . VAL A 1 348 ? 63.513  -72.430  -6.116  1.00 17.33  ? 392 VAL A H    1 
ATOM   5123  H HA   . VAL A 1 348 ? 63.036  -74.968  -5.742  1.00 12.94  ? 392 VAL A HA   1 
ATOM   5124  H HB   . VAL A 1 348 ? 63.392  -73.499  -8.127  1.00 18.59  ? 392 VAL A HB   1 
ATOM   5125  H HG11 . VAL A 1 348 ? 62.735  -75.359  -9.374  1.00 15.09  ? 392 VAL A HG11 1 
ATOM   5126  H HG12 . VAL A 1 348 ? 64.101  -75.664  -8.622  1.00 15.09  ? 392 VAL A HG12 1 
ATOM   5127  H HG13 . VAL A 1 348 ? 62.735  -76.245  -8.055  1.00 15.09  ? 392 VAL A HG13 1 
ATOM   5128  H HG21 . VAL A 1 348 ? 61.095  -73.818  -8.397  1.00 18.93  ? 392 VAL A HG21 1 
ATOM   5129  H HG22 . VAL A 1 348 ? 61.053  -74.642  -7.039  1.00 18.93  ? 392 VAL A HG22 1 
ATOM   5130  H HG23 . VAL A 1 348 ? 61.392  -73.090  -7.016  1.00 18.93  ? 392 VAL A HG23 1 
ATOM   5131  N N    . ALA A 1 349 ? 66.020  -74.288  -6.656  1.00 13.35  ? 393 ALA A N    1 
ATOM   5132  C CA   . ALA A 1 349 ? 67.373  -74.835  -6.678  1.00 12.07  ? 393 ALA A CA   1 
ATOM   5133  C C    . ALA A 1 349 ? 67.771  -75.368  -5.308  1.00 13.55  ? 393 ALA A C    1 
ATOM   5134  O O    . ALA A 1 349 ? 68.355  -76.454  -5.201  1.00 9.84   ? 393 ALA A O    1 
ATOM   5135  C CB   . ALA A 1 349 ? 68.354  -73.762  -7.150  1.00 13.43  ? 393 ALA A CB   1 
ATOM   5136  H H    . ALA A 1 349 ? 65.969  -73.451  -6.847  1.00 16.02  ? 393 ALA A H    1 
ATOM   5137  H HA   . ALA A 1 349 ? 67.407  -75.571  -7.308  1.00 14.49  ? 393 ALA A HA   1 
ATOM   5138  H HB1  . ALA A 1 349 ? 69.249  -74.137  -7.161  1.00 16.11  ? 393 ALA A HB1  1 
ATOM   5139  H HB2  . ALA A 1 349 ? 68.104  -73.477  -8.043  1.00 16.11  ? 393 ALA A HB2  1 
ATOM   5140  H HB3  . ALA A 1 349 ? 68.317  -73.010  -6.539  1.00 16.11  ? 393 ALA A HB3  1 
ATOM   5141  N N    . VAL A 1 350 ? 67.455  -74.621  -4.246  1.00 10.59  ? 394 VAL A N    1 
ATOM   5142  C CA   . VAL A 1 350 ? 67.700  -75.103  -2.890  1.00 16.51  ? 394 VAL A CA   1 
ATOM   5143  C C    . VAL A 1 350 ? 66.902  -76.375  -2.630  1.00 15.08  ? 394 VAL A C    1 
ATOM   5144  O O    . VAL A 1 350 ? 67.398  -77.322  -2.005  1.00 10.01  ? 394 VAL A O    1 
ATOM   5145  C CB   . VAL A 1 350 ? 67.359  -74.002  -1.867  1.00 9.90   ? 394 VAL A CB   1 
ATOM   5146  C CG1  . VAL A 1 350 ? 67.401  -74.541  -0.440  1.00 15.82  ? 394 VAL A CG1  1 
ATOM   5147  C CG2  . VAL A 1 350 ? 68.312  -72.825  -2.009  1.00 14.57  ? 394 VAL A CG2  1 
ATOM   5148  H H    . VAL A 1 350 ? 67.102  -73.838  -4.286  1.00 12.71  ? 394 VAL A H    1 
ATOM   5149  H HA   . VAL A 1 350 ? 68.641  -75.317  -2.796  1.00 19.82  ? 394 VAL A HA   1 
ATOM   5150  H HB   . VAL A 1 350 ? 66.459  -73.680  -2.038  1.00 11.89  ? 394 VAL A HB   1 
ATOM   5151  H HG11 . VAL A 1 350 ? 67.182  -73.824  0.175   1.00 18.99  ? 394 VAL A HG11 1 
ATOM   5152  H HG12 . VAL A 1 350 ? 66.755  -75.260  -0.355  1.00 18.99  ? 394 VAL A HG12 1 
ATOM   5153  H HG13 . VAL A 1 350 ? 68.293  -74.875  -0.255  1.00 18.99  ? 394 VAL A HG13 1 
ATOM   5154  H HG21 . VAL A 1 350 ? 68.076  -72.148  -1.355  1.00 17.49  ? 394 VAL A HG21 1 
ATOM   5155  H HG22 . VAL A 1 350 ? 69.219  -73.133  -1.854  1.00 17.49  ? 394 VAL A HG22 1 
ATOM   5156  H HG23 . VAL A 1 350 ? 68.234  -72.462  -2.905  1.00 17.49  ? 394 VAL A HG23 1 
ATOM   5157  N N    . THR A 1 351 ? 65.656  -76.417  -3.107  1.00 14.23  ? 395 THR A N    1 
ATOM   5158  C CA   . THR A 1 351 ? 64.788  -77.563  -2.853  1.00 10.51  ? 395 THR A CA   1 
ATOM   5159  C C    . THR A 1 351 ? 65.326  -78.828  -3.514  1.00 16.07  ? 395 THR A C    1 
ATOM   5160  O O    . THR A 1 351 ? 65.308  -79.907  -2.909  1.00 9.72   ? 395 THR A O    1 
ATOM   5161  C CB   . THR A 1 351 ? 63.372  -77.253  -3.344  1.00 11.85  ? 395 THR A CB   1 
ATOM   5162  O OG1  . THR A 1 351 ? 62.833  -76.160  -2.588  1.00 14.76  ? 395 THR A OG1  1 
ATOM   5163  C CG2  . THR A 1 351 ? 62.447  -78.462  -3.200  1.00 15.19  ? 395 THR A CG2  1 
ATOM   5164  H H    . THR A 1 351 ? 65.293  -75.796  -3.579  1.00 17.07  ? 395 THR A H    1 
ATOM   5165  H HA   . THR A 1 351 ? 64.746  -77.720  -1.896  1.00 12.62  ? 395 THR A HA   1 
ATOM   5166  H HB   . THR A 1 351 ? 63.406  -77.007  -4.282  1.00 14.23  ? 395 THR A HB   1 
ATOM   5167  H HG1  . THR A 1 351 ? 63.314  -75.478  -2.685  1.00 17.71  ? 395 THR A HG1  1 
ATOM   5168  H HG21 . THR A 1 351 ? 61.558  -78.238  -3.518  1.00 18.23  ? 395 THR A HG21 1 
ATOM   5169  H HG22 . THR A 1 351 ? 62.790  -79.205  -3.720  1.00 18.23  ? 395 THR A HG22 1 
ATOM   5170  H HG23 . THR A 1 351 ? 62.391  -78.727  -2.269  1.00 18.23  ? 395 THR A HG23 1 
ATOM   5171  N N    . VAL A 1 352 ? 65.804  -78.722  -4.755  1.00 12.71  ? 396 VAL A N    1 
ATOM   5172  C CA   . VAL A 1 352 ? 66.329  -79.899  -5.444  1.00 12.02  ? 396 VAL A CA   1 
ATOM   5173  C C    . VAL A 1 352 ? 67.551  -80.438  -4.712  1.00 14.59  ? 396 VAL A C    1 
ATOM   5174  O O    . VAL A 1 352 ? 67.685  -81.650  -4.506  1.00 18.12  ? 396 VAL A O    1 
ATOM   5175  C CB   . VAL A 1 352 ? 66.649  -79.563  -6.913  1.00 11.87  ? 396 VAL A CB   1 
ATOM   5176  C CG1  . VAL A 1 352 ? 67.317  -80.747  -7.609  1.00 11.28  ? 396 VAL A CG1  1 
ATOM   5177  C CG2  . VAL A 1 352 ? 65.381  -79.173  -7.654  1.00 13.78  ? 396 VAL A CG2  1 
ATOM   5178  H H    . VAL A 1 352 ? 65.835  -77.994  -5.212  1.00 15.26  ? 396 VAL A H    1 
ATOM   5179  H HA   . VAL A 1 352 ? 65.651  -80.592  -5.439  1.00 14.43  ? 396 VAL A HA   1 
ATOM   5180  H HB   . VAL A 1 352 ? 67.261  -78.810  -6.942  1.00 14.24  ? 396 VAL A HB   1 
ATOM   5181  H HG11 . VAL A 1 352 ? 67.506  -80.506  -8.530  1.00 13.54  ? 396 VAL A HG11 1 
ATOM   5182  H HG12 . VAL A 1 352 ? 68.143  -80.960  -7.147  1.00 13.54  ? 396 VAL A HG12 1 
ATOM   5183  H HG13 . VAL A 1 352 ? 66.716  -81.508  -7.583  1.00 13.54  ? 396 VAL A HG13 1 
ATOM   5184  H HG21 . VAL A 1 352 ? 65.605  -78.966  -8.575  1.00 16.53  ? 396 VAL A HG21 1 
ATOM   5185  H HG22 . VAL A 1 352 ? 64.757  -79.915  -7.623  1.00 16.53  ? 396 VAL A HG22 1 
ATOM   5186  H HG23 . VAL A 1 352 ? 64.992  -78.395  -7.225  1.00 16.53  ? 396 VAL A HG23 1 
ATOM   5187  N N    . GLY A 1 353 ? 68.459  -79.550  -4.305  1.00 14.22  ? 397 GLY A N    1 
ATOM   5188  C CA   . GLY A 1 353 ? 69.642  -79.995  -3.588  1.00 16.19  ? 397 GLY A CA   1 
ATOM   5189  C C    . GLY A 1 353 ? 69.318  -80.586  -2.229  1.00 14.75  ? 397 GLY A C    1 
ATOM   5190  O O    . GLY A 1 353 ? 69.865  -81.624  -1.847  1.00 13.67  ? 397 GLY A O    1 
ATOM   5191  H H    . GLY A 1 353 ? 68.411  -78.701  -4.431  1.00 17.07  ? 397 GLY A H    1 
ATOM   5192  H HA2  . GLY A 1 353 ? 70.103  -80.668  -4.113  1.00 19.43  ? 397 GLY A HA2  1 
ATOM   5193  H HA3  . GLY A 1 353 ? 70.242  -79.243  -3.459  1.00 19.43  ? 397 GLY A HA3  1 
ATOM   5194  N N    . GLY A 1 354 ? 68.422  -79.939  -1.482  1.00 11.30  ? 398 GLY A N    1 
ATOM   5195  C CA   . GLY A 1 354 ? 68.053  -80.437  -0.168  1.00 14.45  ? 398 GLY A CA   1 
ATOM   5196  C C    . GLY A 1 354 ? 67.375  -81.791  -0.193  1.00 14.14  ? 398 GLY A C    1 
ATOM   5197  O O    . GLY A 1 354 ? 67.407  -82.509  0.812   1.00 13.68  ? 398 GLY A O    1 
ATOM   5198  H H    . GLY A 1 354 ? 68.020  -79.216  -1.715  1.00 13.56  ? 398 GLY A H    1 
ATOM   5199  H HA2  . GLY A 1 354 ? 68.849  -80.507  0.381   1.00 17.35  ? 398 GLY A HA2  1 
ATOM   5200  H HA3  . GLY A 1 354 ? 67.450  -79.804  0.253   1.00 17.35  ? 398 GLY A HA3  1 
ATOM   5201  N N    . SER A 1 355 ? 66.765  -82.160  -1.317  1.00 18.36  ? 399 SER A N    1 
ATOM   5202  C CA   . SER A 1 355 ? 66.050  -83.423  -1.428  1.00 15.81  ? 399 SER A CA   1 
ATOM   5203  C C    . SER A 1 355 ? 66.943  -84.583  -1.849  1.00 13.68  ? 399 SER A C    1 
ATOM   5204  O O    . SER A 1 355 ? 66.506  -85.736  -1.767  1.00 12.63  ? 399 SER A O    1 
ATOM   5205  C CB   . SER A 1 355 ? 64.906  -83.293  -2.438  1.00 18.76  ? 399 SER A CB   1 
ATOM   5206  O OG   . SER A 1 355 ? 65.406  -83.251  -3.765  1.00 18.10  ? 399 SER A OG   1 
ATOM   5207  H H    . SER A 1 355 ? 66.751  -81.688  -2.035  1.00 22.04  ? 399 SER A H    1 
ATOM   5208  H HA   . SER A 1 355 ? 65.664  -83.642  -0.566  1.00 18.98  ? 399 SER A HA   1 
ATOM   5209  H HB2  . SER A 1 355 ? 64.316  -84.058  -2.347  1.00 22.51  ? 399 SER A HB2  1 
ATOM   5210  H HB3  . SER A 1 355 ? 64.418  -82.474  -2.258  1.00 22.51  ? 399 SER A HB3  1 
ATOM   5211  H HG   . SER A 1 355 ? 65.919  -82.593  -3.858  1.00 21.73  ? 399 SER A HG   1 
ATOM   5212  N N    . ASN A 1 356 ? 68.175  -84.313  -2.284  1.00 13.48  ? 400 ASN A N    1 
ATOM   5213  C CA   . ASN A 1 356 ? 69.027  -85.318  -2.909  1.00 21.14  ? 400 ASN A CA   1 
ATOM   5214  C C    . ASN A 1 356 ? 70.192  -85.742  -2.016  1.00 17.61  ? 400 ASN A C    1 
ATOM   5215  O O    . ASN A 1 356 ? 71.273  -86.067  -2.511  1.00 13.75  ? 400 ASN A O    1 
ATOM   5216  C CB   . ASN A 1 356 ? 69.540  -84.797  -4.252  1.00 17.48  ? 400 ASN A CB   1 
ATOM   5217  C CG   . ASN A 1 356 ? 68.547  -85.014  -5.376  1.00 17.06  ? 400 ASN A CG   1 
ATOM   5218  O OD1  . ASN A 1 356 ? 67.946  -86.083  -5.488  1.00 18.49  ? 400 ASN A OD1  1 
ATOM   5219  N ND2  . ASN A 1 356 ? 68.367  -84.000  -6.215  1.00 23.77  ? 400 ASN A ND2  1 
ATOM   5220  H H    . ASN A 1 356 ? 68.544  -83.538  -2.227  1.00 16.18  ? 400 ASN A H    1 
ATOM   5221  H HA   . ASN A 1 356 ? 68.493  -86.108  -3.086  1.00 25.38  ? 400 ASN A HA   1 
ATOM   5222  H HB2  . ASN A 1 356 ? 69.709  -83.845  -4.179  1.00 20.98  ? 400 ASN A HB2  1 
ATOM   5223  H HB3  . ASN A 1 356 ? 70.360  -85.264  -4.480  1.00 20.98  ? 400 ASN A HB3  1 
ATOM   5224  H HD21 . ASN A 1 356 ? 67.814  -84.075  -6.869  1.00 28.52  ? 400 ASN A HD21 1 
ATOM   5225  H HD22 . ASN A 1 356 ? 68.805  -83.268  -6.105  1.00 28.52  ? 400 ASN A HD22 1 
ATOM   5226  N N    . GLY A 1 357 ? 69.987  -85.758  -0.702  1.00 13.82  ? 401 GLY A N    1 
ATOM   5227  C CA   . GLY A 1 357 ? 70.989  -86.315  0.183   1.00 13.86  ? 401 GLY A CA   1 
ATOM   5228  C C    . GLY A 1 357 ? 71.120  -87.816  -0.000  1.00 17.84  ? 401 GLY A C    1 
ATOM   5229  O O    . GLY A 1 357 ? 70.176  -88.506  -0.385  1.00 16.93  ? 401 GLY A O    1 
ATOM   5230  H H    . GLY A 1 357 ? 69.285  -85.456  -0.307  1.00 16.59  ? 401 GLY A H    1 
ATOM   5231  H HA2  . GLY A 1 357 ? 71.849  -85.904  0.002   1.00 16.64  ? 401 GLY A HA2  1 
ATOM   5232  H HA3  . GLY A 1 357 ? 70.747  -86.135  1.104   1.00 16.64  ? 401 GLY A HA3  1 
ATOM   5233  N N    . HIS A 1 358 ? 72.317  -88.328  0.276   1.00 18.02  ? 402 HIS A N    1 
ATOM   5234  C CA   . HIS A 1 358 ? 72.602  -89.756  0.161   1.00 13.51  ? 402 HIS A CA   1 
ATOM   5235  C C    . HIS A 1 358 ? 73.193  -90.241  1.477   1.00 19.72  ? 402 HIS A C    1 
ATOM   5236  O O    . HIS A 1 358 ? 74.307  -89.853  1.843   1.00 14.77  ? 402 HIS A O    1 
ATOM   5237  C CB   . HIS A 1 358 ? 73.555  -90.043  -1.000  1.00 15.42  ? 402 HIS A CB   1 
ATOM   5238  C CG   . HIS A 1 358 ? 73.085  -89.502  -2.312  1.00 15.33  ? 402 HIS A CG   1 
ATOM   5239  N ND1  . HIS A 1 358 ? 73.832  -88.622  -3.063  1.00 13.60  ? 402 HIS A ND1  1 
ATOM   5240  C CD2  . HIS A 1 358 ? 71.944  -89.718  -3.008  1.00 15.16  ? 402 HIS A CD2  1 
ATOM   5241  C CE1  . HIS A 1 358 ? 73.171  -88.315  -4.164  1.00 26.21  ? 402 HIS A CE1  1 
ATOM   5242  N NE2  . HIS A 1 358 ? 72.022  -88.967  -4.156  1.00 13.11  ? 402 HIS A NE2  1 
ATOM   5243  H H    . HIS A 1 358 ? 72.991  -87.862  0.536   1.00 21.63  ? 402 HIS A H    1 
ATOM   5244  H HA   . HIS A 1 358 ? 71.775  -90.237  0.002   1.00 16.21  ? 402 HIS A HA   1 
ATOM   5245  H HB2  . HIS A 1 358 ? 74.416  -89.641  -0.804  1.00 18.50  ? 402 HIS A HB2  1 
ATOM   5246  H HB3  . HIS A 1 358 ? 73.654  -91.003  -1.093  1.00 18.50  ? 402 HIS A HB3  1 
ATOM   5247  H HD2  . HIS A 1 358 ? 71.238  -90.269  -2.756  1.00 18.20  ? 402 HIS A HD2  1 
ATOM   5248  H HE1  . HIS A 1 358 ? 73.465  -87.739  -4.833  1.00 31.45  ? 402 HIS A HE1  1 
ATOM   5249  H HE2  . HIS A 1 358 ? 71.421  -88.929  -4.770  1.00 15.74  ? 402 HIS A HE2  1 
ATOM   5250  N N    . PHE A 1 359 ? 72.442  -91.084  2.183   1.00 20.81  ? 403 PHE A N    1 
ATOM   5251  C CA   . PHE A 1 359 ? 72.925  -91.738  3.391   1.00 20.94  ? 403 PHE A CA   1 
ATOM   5252  C C    . PHE A 1 359 ? 73.453  -90.714  4.393   1.00 14.05  ? 403 PHE A C    1 
ATOM   5253  O O    . PHE A 1 359 ? 72.687  -89.878  4.880   1.00 24.67  ? 403 PHE A O    1 
ATOM   5254  C CB   . PHE A 1 359 ? 73.981  -92.783  3.014   1.00 21.05  ? 403 PHE A CB   1 
ATOM   5255  C CG   . PHE A 1 359 ? 73.599  -93.613  1.824   1.00 14.34  ? 403 PHE A CG   1 
ATOM   5256  C CD1  . PHE A 1 359 ? 72.556  -94.520  1.897   1.00 19.37  ? 403 PHE A CD1  1 
ATOM   5257  C CD2  . PHE A 1 359 ? 74.273  -93.473  0.626   1.00 16.95  ? 403 PHE A CD2  1 
ATOM   5258  C CE1  . PHE A 1 359 ? 72.198  -95.277  0.796   1.00 14.96  ? 403 PHE A CE1  1 
ATOM   5259  C CE2  . PHE A 1 359 ? 73.922  -94.227  -0.478  1.00 16.34  ? 403 PHE A CE2  1 
ATOM   5260  C CZ   . PHE A 1 359 ? 72.884  -95.129  -0.393  1.00 20.34  ? 403 PHE A CZ   1 
ATOM   5261  H H    . PHE A 1 359 ? 71.634  -91.295  1.976   1.00 24.98  ? 403 PHE A H    1 
ATOM   5262  H HA   . PHE A 1 359 ? 72.185  -92.204  3.809   1.00 25.14  ? 403 PHE A HA   1 
ATOM   5263  H HB2  . PHE A 1 359 ? 74.812  -92.329  2.805   1.00 25.27  ? 403 PHE A HB2  1 
ATOM   5264  H HB3  . PHE A 1 359 ? 74.113  -93.382  3.765   1.00 25.27  ? 403 PHE A HB3  1 
ATOM   5265  H HD1  . PHE A 1 359 ? 72.091  -94.622  2.696   1.00 23.25  ? 403 PHE A HD1  1 
ATOM   5266  H HD2  . PHE A 1 359 ? 74.974  -92.865  0.563   1.00 20.34  ? 403 PHE A HD2  1 
ATOM   5267  H HE1  . PHE A 1 359 ? 71.498  -95.886  0.857   1.00 17.96  ? 403 PHE A HE1  1 
ATOM   5268  H HE2  . PHE A 1 359 ? 74.386  -94.125  -1.278  1.00 19.62  ? 403 PHE A HE2  1 
ATOM   5269  H HZ   . PHE A 1 359 ? 72.647  -95.638  -1.135  1.00 24.41  ? 403 PHE A HZ   1 
ATOM   5270  N N    . GLU A 1 360 ? 74.749  -90.751  4.704   1.00 16.49  ? 404 GLU A N    1 
ATOM   5271  C CA   . GLU A 1 360 ? 75.279  -89.950  5.800   1.00 16.03  ? 404 GLU A CA   1 
ATOM   5272  C C    . GLU A 1 360 ? 75.603  -88.514  5.413   1.00 15.18  ? 404 GLU A C    1 
ATOM   5273  O O    . GLU A 1 360 ? 75.852  -87.700  6.308   1.00 14.81  ? 404 GLU A O    1 
ATOM   5274  C CB   . GLU A 1 360 ? 76.539  -90.607  6.369   1.00 14.68  ? 404 GLU A CB   1 
ATOM   5275  C CG   . GLU A 1 360 ? 76.261  -91.753  7.329   1.00 19.99  ? 404 GLU A CG   1 
ATOM   5276  C CD   . GLU A 1 360 ? 75.374  -92.820  6.723   1.00 23.72  ? 404 GLU A CD   1 
ATOM   5277  O OE1  . GLU A 1 360 ? 75.848  -93.554  5.831   1.00 18.73  ? 404 GLU A OE1  1 
ATOM   5278  O OE2  . GLU A 1 360 ? 74.197  -92.913  7.127   1.00 16.73  ? 404 GLU A OE2  1 
ATOM   5279  H H    . GLU A 1 360 ? 75.337  -91.229  4.297   1.00 19.79  ? 404 GLU A H    1 
ATOM   5280  H HA   . GLU A 1 360 ? 74.617  -89.920  6.509   1.00 19.24  ? 404 GLU A HA   1 
ATOM   5281  H HB2  . GLU A 1 360 ? 77.067  -90.958  5.634   1.00 17.62  ? 404 GLU A HB2  1 
ATOM   5282  H HB3  . GLU A 1 360 ? 77.051  -89.937  6.849   1.00 17.62  ? 404 GLU A HB3  1 
ATOM   5283  H HG2  . GLU A 1 360 ? 77.101  -92.167  7.579   1.00 23.99  ? 404 GLU A HG2  1 
ATOM   5284  H HG3  . GLU A 1 360 ? 75.815  -91.404  8.117   1.00 23.99  ? 404 GLU A HG3  1 
ATOM   5285  N N    . LEU A 1 361 ? 75.611  -88.171  4.127   1.00 10.19  ? 405 LEU A N    1 
ATOM   5286  C CA   . LEU A 1 361 ? 76.093  -86.854  3.721   1.00 13.70  ? 405 LEU A CA   1 
ATOM   5287  C C    . LEU A 1 361 ? 75.311  -86.342  2.523   1.00 19.27  ? 405 LEU A C    1 
ATOM   5288  O O    . LEU A 1 361 ? 75.265  -86.999  1.479   1.00 18.18  ? 405 LEU A O    1 
ATOM   5289  C CB   . LEU A 1 361 ? 77.585  -86.915  3.396   1.00 17.99  ? 405 LEU A CB   1 
ATOM   5290  C CG   . LEU A 1 361 ? 78.287  -85.571  3.218   1.00 10.91  ? 405 LEU A CG   1 
ATOM   5291  C CD1  . LEU A 1 361 ? 78.268  -84.776  4.514   1.00 17.77  ? 405 LEU A CD1  1 
ATOM   5292  C CD2  . LEU A 1 361 ? 79.712  -85.796  2.744   1.00 16.56  ? 405 LEU A CD2  1 
ATOM   5293  H H    . LEU A 1 361 ? 75.347  -88.672  3.481   1.00 12.23  ? 405 LEU A H    1 
ATOM   5294  H HA   . LEU A 1 361 ? 75.968  -86.230  4.453   1.00 16.45  ? 405 LEU A HA   1 
ATOM   5295  H HB2  . LEU A 1 361 ? 78.035  -87.384  4.116   1.00 21.59  ? 405 LEU A HB2  1 
ATOM   5296  H HB3  . LEU A 1 361 ? 77.697  -87.412  2.570   1.00 21.59  ? 405 LEU A HB3  1 
ATOM   5297  H HG   . LEU A 1 361 ? 77.822  -85.056  2.541   1.00 13.10  ? 405 LEU A HG   1 
ATOM   5298  H HD11 . LEU A 1 361 ? 78.720  -83.930  4.371   1.00 21.33  ? 405 LEU A HD11 1 
ATOM   5299  H HD12 . LEU A 1 361 ? 77.347  -84.620  4.775   1.00 21.33  ? 405 LEU A HD12 1 
ATOM   5300  H HD13 . LEU A 1 361 ? 78.726  -85.284  5.202   1.00 21.33  ? 405 LEU A HD13 1 
ATOM   5301  H HD21 . LEU A 1 361 ? 80.147  -84.936  2.635   1.00 19.87  ? 405 LEU A HD21 1 
ATOM   5302  H HD22 . LEU A 1 361 ? 80.185  -86.324  3.405   1.00 19.87  ? 405 LEU A HD22 1 
ATOM   5303  H HD23 . LEU A 1 361 ? 79.692  -86.267  1.896   1.00 19.87  ? 405 LEU A HD23 1 
ATOM   5304  N N    . ASN A 1 362 ? 74.706  -85.167  2.681   1.00 18.16  ? 406 ASN A N    1 
ATOM   5305  C CA   . ASN A 1 362 ? 74.163  -84.417  1.556   1.00 16.75  ? 406 ASN A CA   1 
ATOM   5306  C C    . ASN A 1 362 ? 75.309  -83.692  0.863   1.00 9.92   ? 406 ASN A C    1 
ATOM   5307  O O    . ASN A 1 362 ? 75.991  -82.871  1.484   1.00 12.22  ? 406 ASN A O    1 
ATOM   5308  C CB   . ASN A 1 362 ? 73.108  -83.420  2.036   1.00 12.77  ? 406 ASN A CB   1 
ATOM   5309  C CG   . ASN A 1 362 ? 72.522  -82.593  0.906   1.00 20.06  ? 406 ASN A CG   1 
ATOM   5310  O OD1  . ASN A 1 362 ? 73.228  -81.832  0.247   1.00 15.81  ? 406 ASN A OD1  1 
ATOM   5311  N ND2  . ASN A 1 362 ? 71.217  -82.721  0.693   1.00 17.80  ? 406 ASN A ND2  1 
ATOM   5312  H H    . ASN A 1 362 ? 74.597  -84.779  3.440   1.00 21.79  ? 406 ASN A H    1 
ATOM   5313  H HA   . ASN A 1 362 ? 73.751  -85.026  0.923   1.00 20.11  ? 406 ASN A HA   1 
ATOM   5314  H HB2  . ASN A 1 362 ? 72.383  -83.907  2.459   1.00 15.33  ? 406 ASN A HB2  1 
ATOM   5315  H HB3  . ASN A 1 362 ? 73.515  -82.812  2.673   1.00 15.33  ? 406 ASN A HB3  1 
ATOM   5316  H HD21 . ASN A 1 362 ? 70.837  -82.274  0.064   1.00 21.36  ? 406 ASN A HD21 1 
ATOM   5317  H HD22 . ASN A 1 362 ? 70.751  -83.252  1.184   1.00 21.36  ? 406 ASN A HD22 1 
ATOM   5318  N N    . VAL A 1 363 ? 75.523  -83.990  -0.417  1.00 10.69  ? 407 VAL A N    1 
ATOM   5319  C CA   . VAL A 1 363 ? 76.650  -83.421  -1.148  1.00 12.46  ? 407 VAL A CA   1 
ATOM   5320  C C    . VAL A 1 363 ? 76.135  -82.430  -2.185  1.00 20.65  ? 407 VAL A C    1 
ATOM   5321  O O    . VAL A 1 363 ? 76.516  -82.478  -3.360  1.00 11.60  ? 407 VAL A O    1 
ATOM   5322  C CB   . VAL A 1 363 ? 77.510  -84.525  -1.792  1.00 21.58  ? 407 VAL A CB   1 
ATOM   5323  C CG1  . VAL A 1 363 ? 78.231  -85.317  -0.714  1.00 17.27  ? 407 VAL A CG1  1 
ATOM   5324  C CG2  . VAL A 1 363 ? 76.663  -85.456  -2.647  1.00 16.37  ? 407 VAL A CG2  1 
ATOM   5325  H H    . VAL A 1 363 ? 75.030  -84.518  -0.883  1.00 12.83  ? 407 VAL A H    1 
ATOM   5326  H HA   . VAL A 1 363 ? 77.212  -82.933  -0.526  1.00 14.96  ? 407 VAL A HA   1 
ATOM   5327  H HB   . VAL A 1 363 ? 78.179  -84.115  -2.363  1.00 25.90  ? 407 VAL A HB   1 
ATOM   5328  H HG11 . VAL A 1 363 ? 78.767  -86.007  -1.135  1.00 20.72  ? 407 VAL A HG11 1 
ATOM   5329  H HG12 . VAL A 1 363 ? 78.800  -84.716  -0.209  1.00 20.72  ? 407 VAL A HG12 1 
ATOM   5330  H HG13 . VAL A 1 363 ? 77.573  -85.721  -0.127  1.00 20.72  ? 407 VAL A HG13 1 
ATOM   5331  H HG21 . VAL A 1 363 ? 77.236  -86.136  -3.035  1.00 19.65  ? 407 VAL A HG21 1 
ATOM   5332  H HG22 . VAL A 1 363 ? 75.988  -85.871  -2.088  1.00 19.65  ? 407 VAL A HG22 1 
ATOM   5333  H HG23 . VAL A 1 363 ? 76.239  -84.939  -3.350  1.00 19.65  ? 407 VAL A HG23 1 
ATOM   5334  N N    . PHE A 1 364 ? 75.257  -81.525  -1.745  1.00 13.40  ? 408 PHE A N    1 
ATOM   5335  C CA   . PHE A 1 364 ? 74.847  -80.359  -2.520  1.00 16.12  ? 408 PHE A CA   1 
ATOM   5336  C C    . PHE A 1 364 ? 75.081  -79.067  -1.743  1.00 17.05  ? 408 PHE A C    1 
ATOM   5337  O O    . PHE A 1 364 ? 74.452  -78.048  -2.039  1.00 13.56  ? 408 PHE A O    1 
ATOM   5338  C CB   . PHE A 1 364 ? 73.371  -80.470  -2.916  1.00 14.74  ? 408 PHE A CB   1 
ATOM   5339  C CG   . PHE A 1 364 ? 73.097  -81.500  -3.971  1.00 13.76  ? 408 PHE A CG   1 
ATOM   5340  C CD1  . PHE A 1 364 ? 73.103  -82.847  -3.663  1.00 11.97  ? 408 PHE A CD1  1 
ATOM   5341  C CD2  . PHE A 1 364 ? 72.816  -81.117  -5.271  1.00 16.61  ? 408 PHE A CD2  1 
ATOM   5342  C CE1  . PHE A 1 364 ? 72.848  -83.797  -4.636  1.00 18.49  ? 408 PHE A CE1  1 
ATOM   5343  C CE2  . PHE A 1 364 ? 72.559  -82.062  -6.247  1.00 14.14  ? 408 PHE A CE2  1 
ATOM   5344  C CZ   . PHE A 1 364 ? 72.575  -83.403  -5.928  1.00 15.07  ? 408 PHE A CZ   1 
ATOM   5345  H H    . PHE A 1 364 ? 74.876  -81.570  -0.976  1.00 16.08  ? 408 PHE A H    1 
ATOM   5346  H HA   . PHE A 1 364 ? 75.373  -80.319  -3.334  1.00 19.35  ? 408 PHE A HA   1 
ATOM   5347  H HB2  . PHE A 1 364 ? 72.854  -80.707  -2.130  1.00 17.69  ? 408 PHE A HB2  1 
ATOM   5348  H HB3  . PHE A 1 364 ? 73.074  -79.611  -3.257  1.00 17.69  ? 408 PHE A HB3  1 
ATOM   5349  H HD1  . PHE A 1 364 ? 73.289  -83.118  -2.793  1.00 14.37  ? 408 PHE A HD1  1 
ATOM   5350  H HD2  . PHE A 1 364 ? 72.806  -80.213  -5.492  1.00 19.93  ? 408 PHE A HD2  1 
ATOM   5351  H HE1  . PHE A 1 364 ? 72.858  -84.700  -4.417  1.00 22.19  ? 408 PHE A HE1  1 
ATOM   5352  H HE2  . PHE A 1 364 ? 72.375  -81.793  -7.118  1.00 16.97  ? 408 PHE A HE2  1 
ATOM   5353  H HZ   . PHE A 1 364 ? 72.402  -84.040  -6.582  1.00 18.09  ? 408 PHE A HZ   1 
ATOM   5354  N N    . LYS A 1 365 ? 75.980  -79.088  -0.758  1.00 10.98  ? 409 LYS A N    1 
ATOM   5355  C CA   . LYS A 1 365 ? 76.047  -77.993  0.209   1.00 11.37  ? 409 LYS A CA   1 
ATOM   5356  C C    . LYS A 1 365 ? 76.413  -76.660  -0.425  1.00 14.13  ? 409 LYS A C    1 
ATOM   5357  O O    . LYS A 1 365 ? 75.717  -75.665  -0.158  1.00 17.88  ? 409 LYS A O    1 
ATOM   5358  C CB   . LYS A 1 365 ? 77.030  -78.348  1.329   1.00 16.49  ? 409 LYS A CB   1 
ATOM   5359  C CG   . LYS A 1 365 ? 76.828  -79.717  1.949   1.00 13.55  ? 409 LYS A CG   1 
ATOM   5360  C CD   . LYS A 1 365 ? 77.725  -79.886  3.165   1.00 16.08  ? 409 LYS A CD   1 
ATOM   5361  C CE   . LYS A 1 365 ? 77.828  -81.338  3.604   1.00 18.34  ? 409 LYS A CE   1 
ATOM   5362  N NZ   . LYS A 1 365 ? 76.517  -81.888  4.031   1.00 17.41  ? 409 LYS A NZ   1 
ATOM   5363  H H    . LYS A 1 365 ? 76.555  -79.715  -0.630  1.00 13.18  ? 409 LYS A H    1 
ATOM   5364  H HA   . LYS A 1 365 ? 75.172  -77.890  0.613   1.00 13.65  ? 409 LYS A HA   1 
ATOM   5365  H HB2  . LYS A 1 365 ? 77.931  -78.319  0.971   1.00 19.79  ? 409 LYS A HB2  1 
ATOM   5366  H HB3  . LYS A 1 365 ? 76.941  -77.690  2.037   1.00 19.79  ? 409 LYS A HB3  1 
ATOM   5367  H HG2  . LYS A 1 365 ? 75.905  -79.812  2.232   1.00 16.26  ? 409 LYS A HG2  1 
ATOM   5368  H HG3  . LYS A 1 365 ? 77.056  -80.402  1.302   1.00 16.26  ? 409 LYS A HG3  1 
ATOM   5369  H HD2  . LYS A 1 365 ? 78.616  -79.572  2.949   1.00 19.30  ? 409 LYS A HD2  1 
ATOM   5370  H HD3  . LYS A 1 365 ? 77.360  -79.373  3.903   1.00 19.30  ? 409 LYS A HD3  1 
ATOM   5371  H HE2  . LYS A 1 365 ? 78.153  -81.872  2.863   1.00 22.01  ? 409 LYS A HE2  1 
ATOM   5372  H HE3  . LYS A 1 365 ? 78.440  -81.401  4.354   1.00 22.01  ? 409 LYS A HE3  1 
ATOM   5373  H HZ1  . LYS A 1 365 ? 76.611  -82.737  4.281   1.00 20.89  ? 409 LYS A HZ1  1 
ATOM   5374  H HZ2  . LYS A 1 365 ? 76.199  -81.418  4.716   1.00 20.89  ? 409 LYS A HZ2  1 
ATOM   5375  H HZ3  . LYS A 1 365 ? 75.937  -81.847  3.357   1.00 20.89  ? 409 LYS A HZ3  1 
ATOM   5376  N N    . PRO A 1 366 ? 77.467  -76.551  -1.241  1.00 14.99  ? 410 PRO A N    1 
ATOM   5377  C CA   . PRO A 1 366 ? 77.839  -75.222  -1.749  1.00 13.27  ? 410 PRO A CA   1 
ATOM   5378  C C    . PRO A 1 366 ? 76.729  -74.533  -2.521  1.00 14.20  ? 410 PRO A C    1 
ATOM   5379  O O    . PRO A 1 366 ? 76.520  -73.326  -2.347  1.00 12.12  ? 410 PRO A O    1 
ATOM   5380  C CB   . PRO A 1 366 ? 79.048  -75.521  -2.643  1.00 16.61  ? 410 PRO A CB   1 
ATOM   5381  C CG   . PRO A 1 366 ? 79.608  -76.786  -2.102  1.00 13.95  ? 410 PRO A CG   1 
ATOM   5382  C CD   . PRO A 1 366 ? 78.416  -77.585  -1.688  1.00 15.97  ? 410 PRO A CD   1 
ATOM   5383  H HA   . PRO A 1 366 ? 78.119  -74.651  -1.017  1.00 15.92  ? 410 PRO A HA   1 
ATOM   5384  H HB2  . PRO A 1 366 ? 78.758  -75.637  -3.561  1.00 19.93  ? 410 PRO A HB2  1 
ATOM   5385  H HB3  . PRO A 1 366 ? 79.695  -74.801  -2.574  1.00 19.93  ? 410 PRO A HB3  1 
ATOM   5386  H HG2  . PRO A 1 366 ? 80.106  -77.247  -2.795  1.00 16.75  ? 410 PRO A HG2  1 
ATOM   5387  H HG3  . PRO A 1 366 ? 80.175  -76.594  -1.339  1.00 16.75  ? 410 PRO A HG3  1 
ATOM   5388  H HD2  . PRO A 1 366 ? 78.055  -78.073  -2.444  1.00 19.16  ? 410 PRO A HD2  1 
ATOM   5389  H HD3  . PRO A 1 366 ? 78.643  -78.178  -0.955  1.00 19.16  ? 410 PRO A HD3  1 
ATOM   5390  N N    . MET A 1 367 ? 76.004  -75.264  -3.370  1.00 18.31  ? 411 MET A N    1 
ATOM   5391  C CA   . MET A 1 367 ? 74.964  -74.636  -4.179  1.00 11.57  ? 411 MET A CA   1 
ATOM   5392  C C    . MET A 1 367 ? 73.761  -74.227  -3.336  1.00 17.81  ? 411 MET A C    1 
ATOM   5393  O O    . MET A 1 367 ? 73.118  -73.212  -3.628  1.00 18.47  ? 411 MET A O    1 
ATOM   5394  C CB   . MET A 1 367 ? 74.548  -75.584  -5.303  1.00 14.06  ? 411 MET A CB   1 
ATOM   5395  C CG   . MET A 1 367 ? 73.571  -76.692  -4.907  1.00 33.82  ? 411 MET A CG   1 
ATOM   5396  S SD   . MET A 1 367 ? 71.829  -76.215  -4.924  1.00 26.41  ? 411 MET A SD   1 
ATOM   5397  C CE   . MET A 1 367 ? 71.638  -75.614  -6.586  1.00 20.89  ? 411 MET A CE   1 
ATOM   5398  H H    . MET A 1 367 ? 76.093  -76.110  -3.494  1.00 21.97  ? 411 MET A H    1 
ATOM   5399  H HA   . MET A 1 367 ? 75.334  -73.840  -4.592  1.00 13.89  ? 411 MET A HA   1 
ATOM   5400  H HB2  . MET A 1 367 ? 74.126  -75.062  -6.004  1.00 16.87  ? 411 MET A HB2  1 
ATOM   5401  H HB3  . MET A 1 367 ? 75.345  -76.011  -5.654  1.00 16.87  ? 411 MET A HB3  1 
ATOM   5402  H HG2  . MET A 1 367 ? 73.678  -77.432  -5.525  1.00 40.58  ? 411 MET A HG2  1 
ATOM   5403  H HG3  . MET A 1 367 ? 73.786  -76.985  -4.008  1.00 40.58  ? 411 MET A HG3  1 
ATOM   5404  H HE1  . MET A 1 367 ? 70.721  -75.324  -6.713  1.00 25.07  ? 411 MET A HE1  1 
ATOM   5405  H HE2  . MET A 1 367 ? 72.243  -74.868  -6.723  1.00 25.07  ? 411 MET A HE2  1 
ATOM   5406  H HE3  . MET A 1 367 ? 71.848  -76.330  -7.206  1.00 25.07  ? 411 MET A HE3  1 
ATOM   5407  N N    . MET A 1 368 ? 73.448  -74.986  -2.284  1.00 14.65  ? 412 MET A N    1 
ATOM   5408  C CA   . MET A 1 368 ? 72.326  -74.624  -1.423  1.00 18.44  ? 412 MET A CA   1 
ATOM   5409  C C    . MET A 1 368 ? 72.608  -73.332  -0.669  1.00 16.22  ? 412 MET A C    1 
ATOM   5410  O O    . MET A 1 368 ? 71.764  -72.429  -0.631  1.00 13.48  ? 412 MET A O    1 
ATOM   5411  C CB   . MET A 1 368 ? 72.026  -75.758  -0.443  1.00 16.30  ? 412 MET A CB   1 
ATOM   5412  C CG   . MET A 1 368 ? 71.555  -77.044  -1.102  1.00 12.75  ? 412 MET A CG   1 
ATOM   5413  S SD   . MET A 1 368 ? 71.131  -78.315  0.104   1.00 14.93  ? 412 MET A SD   1 
ATOM   5414  C CE   . MET A 1 368 ? 69.657  -77.611  0.838   1.00 12.99  ? 412 MET A CE   1 
ATOM   5415  H H    . MET A 1 368 ? 73.862  -75.703  -2.052  1.00 17.58  ? 412 MET A H    1 
ATOM   5416  H HA   . MET A 1 368 ? 71.539  -74.496  -1.976  1.00 22.13  ? 412 MET A HA   1 
ATOM   5417  H HB2  . MET A 1 368 ? 72.833  -75.960  0.056   1.00 19.56  ? 412 MET A HB2  1 
ATOM   5418  H HB3  . MET A 1 368 ? 71.330  -75.466  0.166   1.00 19.56  ? 412 MET A HB3  1 
ATOM   5419  H HG2  . MET A 1 368 ? 70.766  -76.858  -1.634  1.00 15.30  ? 412 MET A HG2  1 
ATOM   5420  H HG3  . MET A 1 368 ? 72.264  -77.389  -1.667  1.00 15.30  ? 412 MET A HG3  1 
ATOM   5421  H HE1  . MET A 1 368 ? 69.324  -78.216  1.519   1.00 15.59  ? 412 MET A HE1  1 
ATOM   5422  H HE2  . MET A 1 368 ? 69.881  -76.755  1.236   1.00 15.59  ? 412 MET A HE2  1 
ATOM   5423  H HE3  . MET A 1 368 ? 68.987  -77.490  0.147   1.00 15.59  ? 412 MET A HE3  1 
ATOM   5424  N N    . ILE A 1 369 ? 73.794  -73.220  -0.064  1.00 11.92  ? 413 ILE A N    1 
ATOM   5425  C CA   . ILE A 1 369 ? 74.105  -72.018  0.702   1.00 16.01  ? 413 ILE A CA   1 
ATOM   5426  C C    . ILE A 1 369 ? 74.315  -70.826  -0.222  1.00 11.09  ? 413 ILE A C    1 
ATOM   5427  O O    . ILE A 1 369 ? 74.005  -69.685  0.146   1.00 14.35  ? 413 ILE A O    1 
ATOM   5428  C CB   . ILE A 1 369 ? 75.330  -72.250  1.605   1.00 15.83  ? 413 ILE A CB   1 
ATOM   5429  C CG1  . ILE A 1 369 ? 75.577  -71.034  2.501   1.00 14.39  ? 413 ILE A CG1  1 
ATOM   5430  C CG2  . ILE A 1 369 ? 76.577  -72.556  0.777   1.00 15.82  ? 413 ILE A CG2  1 
ATOM   5431  C CD1  . ILE A 1 369 ? 74.433  -70.714  3.443   1.00 15.09  ? 413 ILE A CD1  1 
ATOM   5432  H H    . ILE A 1 369 ? 74.418  -73.812  -0.081  1.00 14.30  ? 413 ILE A H    1 
ATOM   5433  H HA   . ILE A 1 369 ? 73.351  -71.814  1.277   1.00 19.22  ? 413 ILE A HA   1 
ATOM   5434  H HB   . ILE A 1 369 ? 75.148  -73.015  2.174   1.00 19.00  ? 413 ILE A HB   1 
ATOM   5435  H HG12 . ILE A 1 369 ? 76.366  -71.199  3.041   1.00 17.27  ? 413 ILE A HG12 1 
ATOM   5436  H HG13 . ILE A 1 369 ? 75.721  -70.257  1.939   1.00 17.27  ? 413 ILE A HG13 1 
ATOM   5437  H HG21 . ILE A 1 369 ? 77.327  -72.697  1.376   1.00 18.99  ? 413 ILE A HG21 1 
ATOM   5438  H HG22 . ILE A 1 369 ? 76.417  -73.357  0.252   1.00 18.99  ? 413 ILE A HG22 1 
ATOM   5439  H HG23 . ILE A 1 369 ? 76.757  -71.806  0.190   1.00 18.99  ? 413 ILE A HG23 1 
ATOM   5440  H HD11 . ILE A 1 369 ? 74.668  -69.936  3.971   1.00 18.12  ? 413 ILE A HD11 1 
ATOM   5441  H HD12 . ILE A 1 369 ? 73.636  -70.532  2.921   1.00 18.12  ? 413 ILE A HD12 1 
ATOM   5442  H HD13 . ILE A 1 369 ? 74.282  -71.476  4.024   1.00 18.12  ? 413 ILE A HD13 1 
ATOM   5443  N N    . LYS A 1 370 ? 74.844  -71.055  -1.425  1.00 12.06  ? 414 LYS A N    1 
ATOM   5444  C CA   . LYS A 1 370 ? 74.964  -69.970  -2.394  1.00 14.47  ? 414 LYS A CA   1 
ATOM   5445  C C    . LYS A 1 370 ? 73.600  -69.358  -2.689  1.00 17.88  ? 414 LYS A C    1 
ATOM   5446  O O    . LYS A 1 370 ? 73.424  -68.136  -2.621  1.00 13.76  ? 414 LYS A O    1 
ATOM   5447  C CB   . LYS A 1 370 ? 75.616  -70.481  -3.678  1.00 13.11  ? 414 LYS A CB   1 
ATOM   5448  C CG   . LYS A 1 370 ? 75.476  -69.548  -4.886  1.00 17.65  ? 414 LYS A CG   1 
ATOM   5449  C CD   . LYS A 1 370 ? 76.093  -68.177  -4.638  1.00 15.92  ? 414 LYS A CD   1 
ATOM   5450  C CE   . LYS A 1 370 ? 75.666  -67.180  -5.701  1.00 20.70  ? 414 LYS A CE   1 
ATOM   5451  N NZ   . LYS A 1 370 ? 76.341  -65.861  -5.548  1.00 30.01  ? 414 LYS A NZ   1 
ATOM   5452  H H    . LYS A 1 370 ? 75.136  -71.816  -1.699  1.00 14.47  ? 414 LYS A H    1 
ATOM   5453  H HA   . LYS A 1 370 ? 75.531  -69.276  -2.023  1.00 17.37  ? 414 LYS A HA   1 
ATOM   5454  H HB2  . LYS A 1 370 ? 76.564  -70.608  -3.514  1.00 15.74  ? 414 LYS A HB2  1 
ATOM   5455  H HB3  . LYS A 1 370 ? 75.211  -71.330  -3.914  1.00 15.74  ? 414 LYS A HB3  1 
ATOM   5456  H HG2  . LYS A 1 370 ? 75.924  -69.947  -5.648  1.00 21.18  ? 414 LYS A HG2  1 
ATOM   5457  H HG3  . LYS A 1 370 ? 74.534  -69.423  -5.082  1.00 21.18  ? 414 LYS A HG3  1 
ATOM   5458  H HD2  . LYS A 1 370 ? 75.801  -67.845  -3.774  1.00 19.11  ? 414 LYS A HD2  1 
ATOM   5459  H HD3  . LYS A 1 370 ? 77.060  -68.251  -4.661  1.00 19.11  ? 414 LYS A HD3  1 
ATOM   5460  H HE2  . LYS A 1 370 ? 75.891  -67.534  -6.576  1.00 24.84  ? 414 LYS A HE2  1 
ATOM   5461  H HE3  . LYS A 1 370 ? 74.708  -67.038  -5.636  1.00 24.84  ? 414 LYS A HE3  1 
ATOM   5462  H HZ1  . LYS A 1 370 ? 76.068  -65.304  -6.186  1.00 36.01  ? 414 LYS A HZ1  1 
ATOM   5463  H HZ2  . LYS A 1 370 ? 76.146  -65.510  -4.754  1.00 36.01  ? 414 LYS A HZ2  1 
ATOM   5464  H HZ3  . LYS A 1 370 ? 77.223  -65.963  -5.610  1.00 36.01  ? 414 LYS A HZ3  1 
ATOM   5465  N N    . ASN A 1 371 ? 72.617  -70.200  -3.008  1.00 11.49  ? 415 ASN A N    1 
ATOM   5466  C CA   . ASN A 1 371 ? 71.289  -69.696  -3.336  1.00 16.44  ? 415 ASN A CA   1 
ATOM   5467  C C    . ASN A 1 371 ? 70.630  -69.035  -2.132  1.00 16.38  ? 415 ASN A C    1 
ATOM   5468  O O    . ASN A 1 371 ? 69.925  -68.029  -2.282  1.00 17.59  ? 415 ASN A O    1 
ATOM   5469  C CB   . ASN A 1 371 ? 70.421  -70.831  -3.875  1.00 12.81  ? 415 ASN A CB   1 
ATOM   5470  C CG   . ASN A 1 371 ? 70.731  -71.163  -5.322  1.00 10.17  ? 415 ASN A CG   1 
ATOM   5471  O OD1  . ASN A 1 371 ? 70.202  -70.533  -6.237  1.00 13.33  ? 415 ASN A OD1  1 
ATOM   5472  N ND2  . ASN A 1 371 ? 71.596  -72.151  -5.536  1.00 9.99   ? 415 ASN A ND2  1 
ATOM   5473  H H    . ASN A 1 371 ? 72.693  -71.056  -3.041  1.00 13.79  ? 415 ASN A H    1 
ATOM   5474  H HA   . ASN A 1 371 ? 71.371  -69.027  -4.034  1.00 19.73  ? 415 ASN A HA   1 
ATOM   5475  H HB2  . ASN A 1 371 ? 70.576  -71.627  -3.343  1.00 15.38  ? 415 ASN A HB2  1 
ATOM   5476  H HB3  . ASN A 1 371 ? 69.488  -70.570  -3.819  1.00 15.38  ? 415 ASN A HB3  1 
ATOM   5477  H HD21 . ASN A 1 371 ? 71.803  -72.375  -6.341  1.00 11.98  ? 415 ASN A HD21 1 
ATOM   5478  H HD22 . ASN A 1 371 ? 71.949  -72.566  -4.870  1.00 11.98  ? 415 ASN A HD22 1 
ATOM   5479  N N    . VAL A 1 372 ? 70.848  -69.578  -0.931  1.00 12.07  ? 416 VAL A N    1 
ATOM   5480  C CA   . VAL A 1 372 ? 70.284  -68.968  0.272   1.00 10.27  ? 416 VAL A CA   1 
ATOM   5481  C C    . VAL A 1 372 ? 70.881  -67.582  0.493   1.00 15.10  ? 416 VAL A C    1 
ATOM   5482  O O    . VAL A 1 372 ? 70.160  -66.602  0.711   1.00 13.46  ? 416 VAL A O    1 
ATOM   5483  C CB   . VAL A 1 372 ? 70.501  -69.883  1.491   1.00 19.04  ? 416 VAL A CB   1 
ATOM   5484  C CG1  . VAL A 1 372 ? 70.282  -69.124  2.799   1.00 14.94  ? 416 VAL A CG1  1 
ATOM   5485  C CG2  . VAL A 1 372 ? 69.558  -71.078  1.424   1.00 13.61  ? 416 VAL A CG2  1 
ATOM   5486  H H    . VAL A 1 372 ? 71.311  -70.288  -0.789  1.00 14.49  ? 416 VAL A H    1 
ATOM   5487  H HA   . VAL A 1 372 ? 69.328  -68.861  0.149   1.00 12.33  ? 416 VAL A HA   1 
ATOM   5488  H HB   . VAL A 1 372 ? 71.413  -70.215  1.483   1.00 22.85  ? 416 VAL A HB   1 
ATOM   5489  H HG11 . VAL A 1 372 ? 70.426  -69.729  3.543   1.00 17.94  ? 416 VAL A HG11 1 
ATOM   5490  H HG12 . VAL A 1 372 ? 70.910  -68.386  2.845   1.00 17.94  ? 416 VAL A HG12 1 
ATOM   5491  H HG13 . VAL A 1 372 ? 69.373  -68.786  2.819   1.00 17.94  ? 416 VAL A HG13 1 
ATOM   5492  H HG21 . VAL A 1 372 ? 69.709  -71.643  2.198   1.00 16.34  ? 416 VAL A HG21 1 
ATOM   5493  H HG22 . VAL A 1 372 ? 68.643  -70.758  1.421   1.00 16.34  ? 416 VAL A HG22 1 
ATOM   5494  H HG23 . VAL A 1 372 ? 69.737  -71.576  0.611   1.00 16.34  ? 416 VAL A HG23 1 
ATOM   5495  N N    . LEU A 1 373 ? 72.211  -67.480  0.441   1.00 12.37  ? 417 LEU A N    1 
ATOM   5496  C CA   . LEU A 1 373 ? 72.860  -66.191  0.659   1.00 10.82  ? 417 LEU A CA   1 
ATOM   5497  C C    . LEU A 1 373 ? 72.537  -65.216  -0.465  1.00 17.19  ? 417 LEU A C    1 
ATOM   5498  O O    . LEU A 1 373 ? 72.371  -64.014  -0.226  1.00 15.87  ? 417 LEU A O    1 
ATOM   5499  C CB   . LEU A 1 373 ? 74.372  -66.382  0.788   1.00 17.25  ? 417 LEU A CB   1 
ATOM   5500  C CG   . LEU A 1 373 ? 74.840  -67.191  1.999   1.00 16.93  ? 417 LEU A CG   1 
ATOM   5501  C CD1  . LEU A 1 373 ? 76.343  -67.417  1.933   1.00 23.55  ? 417 LEU A CD1  1 
ATOM   5502  C CD2  . LEU A 1 373 ? 74.463  -66.499  3.299   1.00 18.13  ? 417 LEU A CD2  1 
ATOM   5503  H H    . LEU A 1 373 ? 72.751  -68.131  0.284   1.00 14.85  ? 417 LEU A H    1 
ATOM   5504  H HA   . LEU A 1 373 ? 72.535  -65.809  1.489   1.00 12.99  ? 417 LEU A HA   1 
ATOM   5505  H HB2  . LEU A 1 373 ? 74.691  -66.838  -0.006  1.00 20.71  ? 417 LEU A HB2  1 
ATOM   5506  H HB3  . LEU A 1 373 ? 74.787  -65.507  0.846   1.00 20.71  ? 417 LEU A HB3  1 
ATOM   5507  H HG   . LEU A 1 373 ? 74.406  -68.059  1.985   1.00 20.32  ? 417 LEU A HG   1 
ATOM   5508  H HD11 . LEU A 1 373 ? 76.619  -67.931  2.708   1.00 28.27  ? 417 LEU A HD11 1 
ATOM   5509  H HD12 . LEU A 1 373 ? 76.553  -67.904  1.121   1.00 28.27  ? 417 LEU A HD12 1 
ATOM   5510  H HD13 . LEU A 1 373 ? 76.791  -66.557  1.929   1.00 28.27  ? 417 LEU A HD13 1 
ATOM   5511  H HD21 . LEU A 1 373 ? 74.774  -67.036  4.044   1.00 21.75  ? 417 LEU A HD21 1 
ATOM   5512  H HD22 . LEU A 1 373 ? 74.883  -65.624  3.324   1.00 21.75  ? 417 LEU A HD22 1 
ATOM   5513  H HD23 . LEU A 1 373 ? 73.499  -66.404  3.338   1.00 21.75  ? 417 LEU A HD23 1 
ATOM   5514  N N    . HIS A 1 374 ? 72.449  -65.718  -1.697  1.00 12.89  ? 418 HIS A N    1 
ATOM   5515  C CA   . HIS A 1 374 ? 72.053  -64.880  -2.822  1.00 7.83   ? 418 HIS A CA   1 
ATOM   5516  C C    . HIS A 1 374 ? 70.696  -64.235  -2.563  1.00 18.45  ? 418 HIS A C    1 
ATOM   5517  O O    . HIS A 1 374 ? 70.546  -63.011  -2.661  1.00 14.95  ? 418 HIS A O    1 
ATOM   5518  C CB   . HIS A 1 374 ? 72.025  -65.729  -4.095  1.00 16.80  ? 418 HIS A CB   1 
ATOM   5519  C CG   . HIS A 1 374 ? 71.986  -64.936  -5.363  1.00 18.19  ? 418 HIS A CG   1 
ATOM   5520  N ND1  . HIS A 1 374 ? 71.351  -65.391  -6.499  1.00 20.55  ? 418 HIS A ND1  1 
ATOM   5521  C CD2  . HIS A 1 374 ? 72.519  -63.735  -5.685  1.00 19.76  ? 418 HIS A CD2  1 
ATOM   5522  C CE1  . HIS A 1 374 ? 71.485  -64.499  -7.463  1.00 18.33  ? 418 HIS A CE1  1 
ATOM   5523  N NE2  . HIS A 1 374 ? 72.191  -63.485  -6.996  1.00 19.05  ? 418 HIS A NE2  1 
ATOM   5524  H H    . HIS A 1 374 ? 72.614  -66.536  -1.904  1.00 15.47  ? 418 HIS A H    1 
ATOM   5525  H HA   . HIS A 1 374 ? 72.707  -64.174  -2.941  1.00 9.40   ? 418 HIS A HA   1 
ATOM   5526  H HB2  . HIS A 1 374 ? 72.822  -66.281  -4.118  1.00 20.17  ? 418 HIS A HB2  1 
ATOM   5527  H HB3  . HIS A 1 374 ? 71.237  -66.293  -4.076  1.00 20.17  ? 418 HIS A HB3  1 
ATOM   5528  H HD2  . HIS A 1 374 ? 73.011  -63.181  -5.123  1.00 23.72  ? 418 HIS A HD2  1 
ATOM   5529  H HE1  . HIS A 1 374 ? 71.142  -64.572  -8.325  1.00 22.00  ? 418 HIS A HE1  1 
ATOM   5530  H HE2  . HIS A 1 374 ? 72.407  -62.781  -7.439  1.00 22.86  ? 418 HIS A HE2  1 
ATOM   5531  N N    . SER A 1 375 ? 69.697  -65.047  -2.209  1.00 18.36  ? 419 SER A N    1 
ATOM   5532  C CA   . SER A 1 375 ? 68.359  -64.519  -1.962  1.00 18.24  ? 419 SER A CA   1 
ATOM   5533  C C    . SER A 1 375 ? 68.355  -63.527  -0.806  1.00 13.67  ? 419 SER A C    1 
ATOM   5534  O O    . SER A 1 375 ? 67.733  -62.462  -0.895  1.00 14.95  ? 419 SER A O    1 
ATOM   5535  C CB   . SER A 1 375 ? 67.391  -65.668  -1.682  1.00 14.72  ? 419 SER A CB   1 
ATOM   5536  O OG   . SER A 1 375 ? 67.252  -66.505  -2.817  1.00 14.74  ? 419 SER A OG   1 
ATOM   5537  H H    . SER A 1 375 ? 69.770  -65.898  -2.106  1.00 22.04  ? 419 SER A H    1 
ATOM   5538  H HA   . SER A 1 375 ? 68.052  -64.055  -2.757  1.00 21.90  ? 419 SER A HA   1 
ATOM   5539  H HB2  . SER A 1 375 ? 67.732  -66.195  -0.943  1.00 17.67  ? 419 SER A HB2  1 
ATOM   5540  H HB3  . SER A 1 375 ? 66.523  -65.301  -1.454  1.00 17.67  ? 419 SER A HB3  1 
ATOM   5541  H HG   . SER A 1 375 ? 67.997  -66.831  -3.026  1.00 17.69  ? 419 SER A HG   1 
ATOM   5542  N N    . ALA A 1 376 ? 69.038  -63.859  0.293   1.00 13.89  ? 420 ALA A N    1 
ATOM   5543  C CA   . ALA A 1 376 ? 69.034  -62.982  1.459   1.00 17.30  ? 420 ALA A CA   1 
ATOM   5544  C C    . ALA A 1 376 ? 69.667  -61.635  1.139   1.00 18.64  ? 420 ALA A C    1 
ATOM   5545  O O    . ALA A 1 376 ? 69.141  -60.583  1.523   1.00 16.70  ? 420 ALA A O    1 
ATOM   5546  C CB   . ALA A 1 376 ? 69.768  -63.652  2.620   1.00 17.70  ? 420 ALA A CB   1 
ATOM   5547  H H    . ALA A 1 376 ? 69.504  -64.576  0.384   1.00 16.67  ? 420 ALA A H    1 
ATOM   5548  H HA   . ALA A 1 376 ? 68.117  -62.825  1.734   1.00 20.77  ? 420 ALA A HA   1 
ATOM   5549  H HB1  . ALA A 1 376 ? 69.756  -63.056  3.386   1.00 21.24  ? 420 ALA A HB1  1 
ATOM   5550  H HB2  . ALA A 1 376 ? 69.319  -64.483  2.840   1.00 21.24  ? 420 ALA A HB2  1 
ATOM   5551  H HB3  . ALA A 1 376 ? 70.683  -63.830  2.354   1.00 21.24  ? 420 ALA A HB3  1 
ATOM   5552  N N    . ARG A 1 377 ? 70.801  -61.650  0.437   1.00 13.07  ? 421 ARG A N    1 
ATOM   5553  C CA   . ARG A 1 377 ? 71.465  -60.406  0.057   1.00 11.78  ? 421 ARG A CA   1 
ATOM   5554  C C    . ARG A 1 377 ? 70.581  -59.573  -0.864  1.00 20.62  ? 421 ARG A C    1 
ATOM   5555  O O    . ARG A 1 377 ? 70.439  -58.358  -0.679  1.00 13.31  ? 421 ARG A O    1 
ATOM   5556  C CB   . ARG A 1 377 ? 72.802  -60.725  -0.615  1.00 19.27  ? 421 ARG A CB   1 
ATOM   5557  C CG   . ARG A 1 377 ? 73.562  -59.524  -1.174  1.00 24.78  ? 421 ARG A CG   1 
ATOM   5558  C CD   . ARG A 1 377 ? 74.387  -58.831  -0.112  1.00 26.87  ? 421 ARG A CD   1 
ATOM   5559  N NE   . ARG A 1 377 ? 74.980  -57.598  -0.627  1.00 46.30  ? 421 ARG A NE   1 
ATOM   5560  C CZ   . ARG A 1 377 ? 76.163  -57.515  -1.229  1.00 28.49  ? 421 ARG A CZ   1 
ATOM   5561  N NH1  . ARG A 1 377 ? 76.914  -58.594  -1.402  1.00 37.46  ? 421 ARG A NH1  1 
ATOM   5562  N NH2  . ARG A 1 377 ? 76.597  -56.338  -1.660  1.00 27.29  ? 421 ARG A NH2  1 
ATOM   5563  H H    . ARG A 1 377 ? 71.203  -62.362  0.170   1.00 15.69  ? 421 ARG A H    1 
ATOM   5564  H HA   . ARG A 1 377 ? 71.645  -59.885  0.856   1.00 14.13  ? 421 ARG A HA   1 
ATOM   5565  H HB2  . ARG A 1 377 ? 73.378  -61.156  0.036   1.00 23.12  ? 421 ARG A HB2  1 
ATOM   5566  H HB3  . ARG A 1 377 ? 72.637  -61.332  -1.353  1.00 23.12  ? 421 ARG A HB3  1 
ATOM   5567  H HG2  . ARG A 1 377 ? 74.163  -59.825  -1.874  1.00 29.74  ? 421 ARG A HG2  1 
ATOM   5568  H HG3  . ARG A 1 377 ? 72.928  -58.883  -1.530  1.00 29.74  ? 421 ARG A HG3  1 
ATOM   5569  H HD2  . ARG A 1 377 ? 73.818  -58.605  0.640   1.00 32.24  ? 421 ARG A HD2  1 
ATOM   5570  H HD3  . ARG A 1 377 ? 75.104  -59.419  0.173   1.00 32.24  ? 421 ARG A HD3  1 
ATOM   5571  H HE   . ARG A 1 377 ? 74.530  -56.871  -0.533  1.00 55.57  ? 421 ARG A HE   1 
ATOM   5572  H HH11 . ARG A 1 377 ? 76.636  -59.359  -1.125  1.00 44.96  ? 421 ARG A HH11 1 
ATOM   5573  H HH12 . ARG A 1 377 ? 77.678  -58.528  -1.791  1.00 44.96  ? 421 ARG A HH12 1 
ATOM   5574  H HH21 . ARG A 1 377 ? 76.114  -55.635  -1.550  1.00 32.75  ? 421 ARG A HH21 1 
ATOM   5575  H HH22 . ARG A 1 377 ? 77.362  -56.278  -2.048  1.00 32.75  ? 421 ARG A HH22 1 
ATOM   5576  N N    . LEU A 1 378 ? 69.983  -60.211  -1.872  1.00 9.78   ? 422 LEU A N    1 
ATOM   5577  C CA   . LEU A 1 378 ? 69.171  -59.476  -2.836  1.00 13.21  ? 422 LEU A CA   1 
ATOM   5578  C C    . LEU A 1 378 ? 67.934  -58.878  -2.173  1.00 14.12  ? 422 LEU A C    1 
ATOM   5579  O O    . LEU A 1 378 ? 67.599  -57.710  -2.402  1.00 15.05  ? 422 LEU A O    1 
ATOM   5580  C CB   . LEU A 1 378 ? 68.771  -60.389  -3.996  1.00 12.35  ? 422 LEU A CB   1 
ATOM   5581  C CG   . LEU A 1 378 ? 69.883  -60.910  -4.908  1.00 14.62  ? 422 LEU A CG   1 
ATOM   5582  C CD1  . LEU A 1 378 ? 69.287  -61.834  -5.956  1.00 14.30  ? 422 LEU A CD1  1 
ATOM   5583  C CD2  . LEU A 1 378 ? 70.644  -59.770  -5.572  1.00 20.65  ? 422 LEU A CD2  1 
ATOM   5584  H H    . LEU A 1 378 ? 70.033  -61.057  -2.018  1.00 11.74  ? 422 LEU A H    1 
ATOM   5585  H HA   . LEU A 1 378 ? 69.697  -58.746  -3.198  1.00 15.85  ? 422 LEU A HA   1 
ATOM   5586  H HB2  . LEU A 1 378 ? 68.322  -61.164  -3.625  1.00 14.82  ? 422 LEU A HB2  1 
ATOM   5587  H HB3  . LEU A 1 378 ? 68.149  -59.902  -4.559  1.00 14.82  ? 422 LEU A HB3  1 
ATOM   5588  H HG   . LEU A 1 378 ? 70.513  -61.424  -4.378  1.00 17.55  ? 422 LEU A HG   1 
ATOM   5589  H HD11 . LEU A 1 378 ? 69.997  -62.161  -6.530  1.00 17.16  ? 422 LEU A HD11 1 
ATOM   5590  H HD12 . LEU A 1 378 ? 68.852  -62.578  -5.511  1.00 17.16  ? 422 LEU A HD12 1 
ATOM   5591  H HD13 . LEU A 1 378 ? 68.638  -61.338  -6.481  1.00 17.16  ? 422 LEU A HD13 1 
ATOM   5592  H HD21 . LEU A 1 378 ? 71.338  -60.142  -6.139  1.00 24.79  ? 422 LEU A HD21 1 
ATOM   5593  H HD22 . LEU A 1 378 ? 70.025  -59.246  -6.105  1.00 24.79  ? 422 LEU A HD22 1 
ATOM   5594  H HD23 . LEU A 1 378 ? 71.042  -59.213  -4.884  1.00 24.79  ? 422 LEU A HD23 1 
ATOM   5595  N N    . LEU A 1 379 ? 67.239  -59.665  -1.348  1.00 15.44  ? 423 LEU A N    1 
ATOM   5596  C CA   . LEU A 1 379 ? 66.050  -59.151  -0.674  1.00 16.26  ? 423 LEU A CA   1 
ATOM   5597  C C    . LEU A 1 379 ? 66.403  -58.015  0.277   1.00 12.87  ? 423 LEU A C    1 
ATOM   5598  O O    . LEU A 1 379 ? 65.707  -56.994  0.321   1.00 17.60  ? 423 LEU A O    1 
ATOM   5599  C CB   . LEU A 1 379 ? 65.340  -60.279  0.077   1.00 13.37  ? 423 LEU A CB   1 
ATOM   5600  C CG   . LEU A 1 379 ? 64.644  -61.336  -0.784  1.00 15.97  ? 423 LEU A CG   1 
ATOM   5601  C CD1  . LEU A 1 379 ? 64.124  -62.472  0.084   1.00 12.53  ? 423 LEU A CD1  1 
ATOM   5602  C CD2  . LEU A 1 379 ? 63.508  -60.720  -1.581  1.00 16.52  ? 423 LEU A CD2  1 
ATOM   5603  H H    . LEU A 1 379 ? 67.431  -60.483  -1.167  1.00 18.53  ? 423 LEU A H    1 
ATOM   5604  H HA   . LEU A 1 379 ? 65.436  -58.803  -1.340  1.00 19.51  ? 423 LEU A HA   1 
ATOM   5605  H HB2  . LEU A 1 379 ? 65.996  -60.739  0.624   1.00 16.04  ? 423 LEU A HB2  1 
ATOM   5606  H HB3  . LEU A 1 379 ? 64.664  -59.884  0.650   1.00 16.04  ? 423 LEU A HB3  1 
ATOM   5607  H HG   . LEU A 1 379 ? 65.285  -61.706  -1.411  1.00 19.17  ? 423 LEU A HG   1 
ATOM   5608  H HD11 . LEU A 1 379 ? 63.689  -63.127  -0.483  1.00 15.04  ? 423 LEU A HD11 1 
ATOM   5609  H HD12 . LEU A 1 379 ? 64.871  -62.880  0.549   1.00 15.04  ? 423 LEU A HD12 1 
ATOM   5610  H HD13 . LEU A 1 379 ? 63.490  -62.114  0.725   1.00 15.04  ? 423 LEU A HD13 1 
ATOM   5611  H HD21 . LEU A 1 379 ? 63.087  -61.411  -2.115  1.00 19.83  ? 423 LEU A HD21 1 
ATOM   5612  H HD22 . LEU A 1 379 ? 62.862  -60.338  -0.965  1.00 19.83  ? 423 LEU A HD22 1 
ATOM   5613  H HD23 . LEU A 1 379 ? 63.866  -60.027  -2.157  1.00 19.83  ? 423 LEU A HD23 1 
ATOM   5614  N N    . GLY A 1 380 ? 67.482  -58.171  1.044   1.00 14.80  ? 424 GLY A N    1 
ATOM   5615  C CA   . GLY A 1 380 ? 67.897  -57.103  1.939   1.00 18.55  ? 424 GLY A CA   1 
ATOM   5616  C C    . GLY A 1 380 ? 68.313  -55.852  1.191   1.00 20.23  ? 424 GLY A C    1 
ATOM   5617  O O    . GLY A 1 380 ? 67.811  -54.757  1.457   1.00 16.08  ? 424 GLY A O    1 
ATOM   5618  H H    . GLY A 1 380 ? 67.979  -58.873  1.063   1.00 17.77  ? 424 GLY A H    1 
ATOM   5619  H HA2  . GLY A 1 380 ? 67.164  -56.877  2.533   1.00 22.27  ? 424 GLY A HA2  1 
ATOM   5620  H HA3  . GLY A 1 380 ? 68.646  -57.404  2.476   1.00 22.27  ? 424 GLY A HA3  1 
ATOM   5621  N N    . ASP A 1 381 ? 69.235  -55.999  0.237   1.00 17.93  ? 425 ASP A N    1 
ATOM   5622  C CA   . ASP A 1 381 ? 69.695  -54.851  -0.536  1.00 16.17  ? 425 ASP A CA   1 
ATOM   5623  C C    . ASP A 1 381 ? 68.546  -54.203  -1.299  1.00 22.80  ? 425 ASP A C    1 
ATOM   5624  O O    . ASP A 1 381 ? 68.414  -52.974  -1.322  1.00 15.58  ? 425 ASP A O    1 
ATOM   5625  C CB   . ASP A 1 381 ? 70.798  -55.275  -1.504  1.00 14.11  ? 425 ASP A CB   1 
ATOM   5626  C CG   . ASP A 1 381 ? 72.118  -55.544  -0.810  1.00 19.91  ? 425 ASP A CG   1 
ATOM   5627  O OD1  . ASP A 1 381 ? 72.169  -55.482  0.435   1.00 13.62  ? 425 ASP A OD1  1 
ATOM   5628  O OD2  . ASP A 1 381 ? 73.111  -55.814  -1.515  1.00 28.27  ? 425 ASP A OD2  1 
ATOM   5629  H H    . ASP A 1 381 ? 69.605  -56.746  0.022   1.00 21.52  ? 425 ASP A H    1 
ATOM   5630  H HA   . ASP A 1 381 ? 70.065  -54.189  0.069   1.00 19.41  ? 425 ASP A HA   1 
ATOM   5631  H HB2  . ASP A 1 381 ? 70.525  -56.090  -1.955  1.00 16.93  ? 425 ASP A HB2  1 
ATOM   5632  H HB3  . ASP A 1 381 ? 70.938  -54.568  -2.153  1.00 16.93  ? 425 ASP A HB3  1 
ATOM   5633  N N    . ALA A 1 382 ? 67.707  -55.017  -1.944  1.00 16.39  ? 426 ALA A N    1 
ATOM   5634  C CA   . ALA A 1 382 ? 66.596  -54.468  -2.714  1.00 12.86  ? 426 ALA A CA   1 
ATOM   5635  C C    . ALA A 1 382 ? 65.604  -53.746  -1.813  1.00 19.11  ? 426 ALA A C    1 
ATOM   5636  O O    . ALA A 1 382 ? 65.021  -52.729  -2.208  1.00 20.09  ? 426 ALA A O    1 
ATOM   5637  C CB   . ALA A 1 382 ? 65.897  -55.579  -3.495  1.00 19.41  ? 426 ALA A CB   1 
ATOM   5638  H H    . ALA A 1 382 ? 67.759  -55.876  -1.951  1.00 19.67  ? 426 ALA A H    1 
ATOM   5639  H HA   . ALA A 1 382 ? 66.943  -53.826  -3.353  1.00 15.44  ? 426 ALA A HA   1 
ATOM   5640  H HB1  . ALA A 1 382 ? 65.163  -55.195  -4.000  1.00 23.30  ? 426 ALA A HB1  1 
ATOM   5641  H HB2  . ALA A 1 382 ? 66.535  -55.990  -4.099  1.00 23.30  ? 426 ALA A HB2  1 
ATOM   5642  H HB3  . ALA A 1 382 ? 65.560  -56.239  -2.870  1.00 23.30  ? 426 ALA A HB3  1 
ATOM   5643  N N    . SER A 1 383 ? 65.394  -54.257  -0.598  1.00 15.14  ? 427 SER A N    1 
ATOM   5644  C CA   . SER A 1 383 ? 64.501  -53.587  0.342   1.00 27.11  ? 427 SER A CA   1 
ATOM   5645  C C    . SER A 1 383 ? 65.007  -52.188  0.668   1.00 20.92  ? 427 SER A C    1 
ATOM   5646  O O    . SER A 1 383 ? 64.241  -51.217  0.645   1.00 18.79  ? 427 SER A O    1 
ATOM   5647  C CB   . SER A 1 383 ? 64.360  -54.423  1.614   1.00 22.07  ? 427 SER A CB   1 
ATOM   5648  O OG   . SER A 1 383 ? 63.630  -55.611  1.361   1.00 22.61  ? 427 SER A OG   1 
ATOM   5649  H H    . SER A 1 383 ? 65.751  -54.980  -0.300  1.00 18.17  ? 427 SER A H    1 
ATOM   5650  H HA   . SER A 1 383 ? 63.623  -53.503  -0.061  1.00 32.53  ? 427 SER A HA   1 
ATOM   5651  H HB2  . SER A 1 383 ? 65.244  -54.660  1.936   1.00 26.49  ? 427 SER A HB2  1 
ATOM   5652  H HB3  . SER A 1 383 ? 63.892  -53.902  2.284   1.00 26.49  ? 427 SER A HB3  1 
ATOM   5653  H HG   . SER A 1 383 ? 64.024  -56.073  0.782   1.00 27.14  ? 427 SER A HG   1 
ATOM   5654  N N    . VAL A 1 384 ? 66.301  -52.065  0.972   1.00 19.37  ? 428 VAL A N    1 
ATOM   5655  C CA   . VAL A 1 384 ? 66.884  -50.752  1.242   1.00 16.19  ? 428 VAL A CA   1 
ATOM   5656  C C    . VAL A 1 384 ? 66.722  -49.844  0.029   1.00 18.18  ? 428 VAL A C    1 
ATOM   5657  O O    . VAL A 1 384 ? 66.249  -48.706  0.139   1.00 18.15  ? 428 VAL A O    1 
ATOM   5658  C CB   . VAL A 1 384 ? 68.364  -50.895  1.642   1.00 15.94  ? 428 VAL A CB   1 
ATOM   5659  C CG1  . VAL A 1 384 ? 69.004  -49.525  1.856   1.00 17.81  ? 428 VAL A CG1  1 
ATOM   5660  C CG2  . VAL A 1 384 ? 68.497  -51.744  2.899   1.00 19.54  ? 428 VAL A CG2  1 
ATOM   5661  H H    . VAL A 1 384 ? 66.856  -52.719  1.027   1.00 23.25  ? 428 VAL A H    1 
ATOM   5662  H HA   . VAL A 1 384 ? 66.412  -50.345  1.985   1.00 19.43  ? 428 VAL A HA   1 
ATOM   5663  H HB   . VAL A 1 384 ? 68.843  -51.341  0.926   1.00 19.13  ? 428 VAL A HB   1 
ATOM   5664  H HG11 . VAL A 1 384 ? 69.933  -49.646  2.106   1.00 21.38  ? 428 VAL A HG11 1 
ATOM   5665  H HG12 . VAL A 1 384 ? 68.946  -49.018  1.031   1.00 21.38  ? 428 VAL A HG12 1 
ATOM   5666  H HG13 . VAL A 1 384 ? 68.528  -49.062  2.563   1.00 21.38  ? 428 VAL A HG13 1 
ATOM   5667  H HG21 . VAL A 1 384 ? 69.436  -51.820  3.130   1.00 23.45  ? 428 VAL A HG21 1 
ATOM   5668  H HG22 . VAL A 1 384 ? 68.012  -51.317  3.621   1.00 23.45  ? 428 VAL A HG22 1 
ATOM   5669  H HG23 . VAL A 1 384 ? 68.127  -52.624  2.725   1.00 23.45  ? 428 VAL A HG23 1 
ATOM   5670  N N    . SER A 1 385 ? 67.118  -50.333  -1.148  1.00 17.65  ? 429 SER A N    1 
ATOM   5671  C CA   . SER A 1 385 ? 67.033  -49.522  -2.358  1.00 12.60  ? 429 SER A CA   1 
ATOM   5672  C C    . SER A 1 385 ? 65.592  -49.115  -2.643  1.00 15.05  ? 429 SER A C    1 
ATOM   5673  O O    . SER A 1 385 ? 65.310  -47.949  -2.943  1.00 24.05  ? 429 SER A O    1 
ATOM   5674  C CB   . SER A 1 385 ? 67.620  -50.290  -3.541  1.00 17.25  ? 429 SER A CB   1 
ATOM   5675  O OG   . SER A 1 385 ? 67.709  -49.466  -4.689  1.00 23.51  ? 429 SER A OG   1 
ATOM   5676  H H    . SER A 1 385 ? 67.436  -51.123  -1.269  1.00 21.18  ? 429 SER A H    1 
ATOM   5677  H HA   . SER A 1 385 ? 67.555  -48.714  -2.235  1.00 15.13  ? 429 SER A HA   1 
ATOM   5678  H HB2  . SER A 1 385 ? 68.508  -50.601  -3.306  1.00 20.70  ? 429 SER A HB2  1 
ATOM   5679  H HB3  . SER A 1 385 ? 67.047  -51.047  -3.741  1.00 20.70  ? 429 SER A HB3  1 
ATOM   5680  H HG   . SER A 1 385 ? 66.946  -49.190  -4.904  1.00 28.21  ? 429 SER A HG   1 
ATOM   5681  N N    . PHE A 1 386 ? 64.665  -50.070  -2.559  1.00 13.23  ? 430 PHE A N    1 
ATOM   5682  C CA   . PHE A 1 386 ? 63.260  -49.768  -2.808  1.00 14.52  ? 430 PHE A CA   1 
ATOM   5683  C C    . PHE A 1 386 ? 62.736  -48.736  -1.819  1.00 21.71  ? 430 PHE A C    1 
ATOM   5684  O O    . PHE A 1 386 ? 61.893  -47.903  -2.176  1.00 18.59  ? 430 PHE A O    1 
ATOM   5685  C CB   . PHE A 1 386 ? 62.442  -51.059  -2.737  1.00 16.33  ? 430 PHE A CB   1 
ATOM   5686  C CG   . PHE A 1 386 ? 61.005  -50.899  -3.139  1.00 13.23  ? 430 PHE A CG   1 
ATOM   5687  C CD1  . PHE A 1 386 ? 60.668  -50.441  -4.401  1.00 25.91  ? 430 PHE A CD1  1 
ATOM   5688  C CD2  . PHE A 1 386 ? 59.987  -51.235  -2.260  1.00 24.84  ? 430 PHE A CD2  1 
ATOM   5689  C CE1  . PHE A 1 386 ? 59.341  -50.303  -4.774  1.00 30.75  ? 430 PHE A CE1  1 
ATOM   5690  C CE2  . PHE A 1 386 ? 58.660  -51.101  -2.627  1.00 19.52  ? 430 PHE A CE2  1 
ATOM   5691  C CZ   . PHE A 1 386 ? 58.337  -50.635  -3.885  1.00 21.27  ? 430 PHE A CZ   1 
ATOM   5692  H H    . PHE A 1 386 ? 64.823  -50.892  -2.361  1.00 15.88  ? 430 PHE A H    1 
ATOM   5693  H HA   . PHE A 1 386 ? 63.169  -49.402  -3.701  1.00 17.43  ? 430 PHE A HA   1 
ATOM   5694  H HB2  . PHE A 1 386 ? 62.842  -51.714  -3.329  1.00 19.60  ? 430 PHE A HB2  1 
ATOM   5695  H HB3  . PHE A 1 386 ? 62.458  -51.388  -1.825  1.00 19.60  ? 430 PHE A HB3  1 
ATOM   5696  H HD1  . PHE A 1 386 ? 61.341  -50.216  -5.003  1.00 31.09  ? 430 PHE A HD1  1 
ATOM   5697  H HD2  . PHE A 1 386 ? 60.199  -51.548  -1.410  1.00 29.82  ? 430 PHE A HD2  1 
ATOM   5698  H HE1  . PHE A 1 386 ? 59.126  -49.990  -5.623  1.00 36.90  ? 430 PHE A HE1  1 
ATOM   5699  H HE2  . PHE A 1 386 ? 57.986  -51.324  -2.026  1.00 23.43  ? 430 PHE A HE2  1 
ATOM   5700  H HZ   . PHE A 1 386 ? 57.445  -50.544  -4.133  1.00 25.53  ? 430 PHE A HZ   1 
ATOM   5701  N N    . THR A 1 387 ? 63.233  -48.763  -0.583  1.00 18.48  ? 431 THR A N    1 
ATOM   5702  C CA   . THR A 1 387 ? 62.796  -47.804  0.426   1.00 18.09  ? 431 THR A CA   1 
ATOM   5703  C C    . THR A 1 387 ? 63.334  -46.407  0.132   1.00 16.50  ? 431 THR A C    1 
ATOM   5704  O O    . THR A 1 387 ? 62.571  -45.439  0.031   1.00 24.62  ? 431 THR A O    1 
ATOM   5705  C CB   . THR A 1 387 ? 63.251  -48.271  1.810   1.00 18.72  ? 431 THR A CB   1 
ATOM   5706  O OG1  . THR A 1 387 ? 62.641  -49.532  2.116   1.00 20.89  ? 431 THR A OG1  1 
ATOM   5707  C CG2  . THR A 1 387 ? 62.868  -47.257  2.876   1.00 19.29  ? 431 THR A CG2  1 
ATOM   5708  H H    . THR A 1 387 ? 63.823  -49.324  -0.306  1.00 22.17  ? 431 THR A H    1 
ATOM   5709  H HA   . THR A 1 387 ? 61.827  -47.761  0.425   1.00 21.71  ? 431 THR A HA   1 
ATOM   5710  H HB   . THR A 1 387 ? 64.216  -48.370  1.816   1.00 22.47  ? 431 THR A HB   1 
ATOM   5711  H HG1  . THR A 1 387 ? 62.864  -50.105  1.545   1.00 25.06  ? 431 THR A HG1  1 
ATOM   5712  H HG21 . THR A 1 387 ? 63.162  -47.565  3.747   1.00 23.16  ? 431 THR A HG21 1 
ATOM   5713  H HG22 . THR A 1 387 ? 63.285  -46.403  2.686   1.00 23.16  ? 431 THR A HG22 1 
ATOM   5714  H HG23 . THR A 1 387 ? 61.905  -47.141  2.891   1.00 23.16  ? 431 THR A HG23 1 
ATOM   5715  N N    . GLU A 1 388 ? 64.655  -46.286  -0.005  1.00 21.93  ? 432 GLU A N    1 
ATOM   5716  C CA   . GLU A 1 388 ? 65.277  -44.969  -0.075  1.00 26.04  ? 432 GLU A CA   1 
ATOM   5717  C C    . GLU A 1 388 ? 65.017  -44.278  -1.406  1.00 24.56  ? 432 GLU A C    1 
ATOM   5718  O O    . GLU A 1 388 ? 64.943  -43.046  -1.455  1.00 28.05  ? 432 GLU A O    1 
ATOM   5719  C CB   . GLU A 1 388 ? 66.780  -45.092  0.161   1.00 21.84  ? 432 GLU A CB   1 
ATOM   5720  C CG   . GLU A 1 388 ? 67.145  -45.592  1.548   1.00 28.54  ? 432 GLU A CG   1 
ATOM   5721  C CD   . GLU A 1 388 ? 68.626  -45.878  1.697   1.00 49.07  ? 432 GLU A CD   1 
ATOM   5722  O OE1  . GLU A 1 388 ? 69.358  -45.785  0.689   1.00 41.23  ? 432 GLU A OE1  1 
ATOM   5723  O OE2  . GLU A 1 388 ? 69.057  -46.197  2.826   1.00 46.40  ? 432 GLU A OE2  1 
ATOM   5724  H H    . GLU A 1 388 ? 65.206  -46.944  -0.060  1.00 26.31  ? 432 GLU A H    1 
ATOM   5725  H HA   . GLU A 1 388 ? 64.909  -44.410  0.627   1.00 31.25  ? 432 GLU A HA   1 
ATOM   5726  H HB2  . GLU A 1 388 ? 67.148  -45.715  -0.485  1.00 26.21  ? 432 GLU A HB2  1 
ATOM   5727  H HB3  . GLU A 1 388 ? 67.187  -44.219  0.045   1.00 26.21  ? 432 GLU A HB3  1 
ATOM   5728  H HG2  . GLU A 1 388 ? 66.902  -44.917  2.201   1.00 34.25  ? 432 GLU A HG2  1 
ATOM   5729  H HG3  . GLU A 1 388 ? 66.661  -46.414  1.725   1.00 34.25  ? 432 GLU A HG3  1 
ATOM   5730  N N    . ASN A 1 389 ? 64.878  -45.040  -2.489  1.00 23.98  ? 433 ASN A N    1 
ATOM   5731  C CA   . ASN A 1 389 ? 64.782  -44.471  -3.826  1.00 16.97  ? 433 ASN A CA   1 
ATOM   5732  C C    . ASN A 1 389 ? 63.376  -44.549  -4.405  1.00 19.03  ? 433 ASN A C    1 
ATOM   5733  O O    . ASN A 1 389 ? 63.186  -44.230  -5.582  1.00 20.05  ? 433 ASN A O    1 
ATOM   5734  C CB   . ASN A 1 389 ? 65.777  -45.166  -4.757  1.00 28.46  ? 433 ASN A CB   1 
ATOM   5735  C CG   . ASN A 1 389 ? 67.218  -44.925  -4.348  1.00 22.91  ? 433 ASN A CG   1 
ATOM   5736  O OD1  . ASN A 1 389 ? 67.602  -43.802  -4.025  1.00 28.94  ? 433 ASN A OD1  1 
ATOM   5737  N ND2  . ASN A 1 389 ? 68.020  -45.984  -4.345  1.00 24.81  ? 433 ASN A ND2  1 
ATOM   5738  H H    . ASN A 1 389 ? 64.836  -45.899  -2.473  1.00 28.78  ? 433 ASN A H    1 
ATOM   5739  H HA   . ASN A 1 389 ? 65.028  -43.534  -3.780  1.00 20.36  ? 433 ASN A HA   1 
ATOM   5740  H HB2  . ASN A 1 389 ? 65.614  -46.122  -4.739  1.00 34.16  ? 433 ASN A HB2  1 
ATOM   5741  H HB3  . ASN A 1 389 ? 65.659  -44.825  -5.658  1.00 34.16  ? 433 ASN A HB3  1 
ATOM   5742  H HD21 . ASN A 1 389 ? 68.846  -45.898  -4.121  1.00 29.78  ? 433 ASN A HD21 1 
ATOM   5743  H HD22 . ASN A 1 389 ? 67.713  -46.756  -4.569  1.00 29.78  ? 433 ASN A HD22 1 
ATOM   5744  N N    . CYS A 1 390 ? 62.385  -44.952  -3.612  1.00 21.73  ? 434 CYS A N    1 
ATOM   5745  C CA   . CYS A 1 390 ? 61.008  -44.961  -4.091  1.00 21.77  ? 434 CYS A CA   1 
ATOM   5746  C C    . CYS A 1 390 ? 60.020  -44.661  -2.970  1.00 18.87  ? 434 CYS A C    1 
ATOM   5747  O O    . CYS A 1 390 ? 59.351  -43.624  -2.993  1.00 22.68  ? 434 CYS A O    1 
ATOM   5748  C CB   . CYS A 1 390 ? 60.676  -46.307  -4.737  1.00 21.10  ? 434 CYS A CB   1 
ATOM   5749  S SG   . CYS A 1 390 ? 59.006  -46.394  -5.435  1.00 26.97  ? 434 CYS A SG   1 
ATOM   5750  H H    . CYS A 1 390 ? 62.483  -45.222  -2.801  1.00 26.08  ? 434 CYS A H    1 
ATOM   5751  H HA   . CYS A 1 390 ? 60.908  -44.273  -4.767  1.00 26.13  ? 434 CYS A HA   1 
ATOM   5752  H HB2  . CYS A 1 390 ? 61.306  -46.472  -5.456  1.00 25.33  ? 434 CYS A HB2  1 
ATOM   5753  H HB3  . CYS A 1 390 ? 60.753  -47.003  -4.066  1.00 25.33  ? 434 CYS A HB3  1 
ATOM   5754  H HG   . CYS A 1 390 ? 58.206  -46.208  -4.560  1.00 32.37  ? 434 CYS A HG   1 
ATOM   5755  N N    . VAL A 1 391 ? 59.934  -45.550  -1.978  1.00 17.43  ? 435 VAL A N    1 
ATOM   5756  C CA   . VAL A 1 391 ? 58.838  -45.487  -1.011  1.00 19.31  ? 435 VAL A CA   1 
ATOM   5757  C C    . VAL A 1 391 ? 58.834  -44.148  -0.279  1.00 20.91  ? 435 VAL A C    1 
ATOM   5758  O O    . VAL A 1 391 ? 57.812  -43.453  -0.235  1.00 19.51  ? 435 VAL A O    1 
ATOM   5759  C CB   . VAL A 1 391 ? 58.918  -46.670  -0.030  1.00 22.99  ? 435 VAL A CB   1 
ATOM   5760  C CG1  . VAL A 1 391 ? 57.830  -46.565  1.035   1.00 24.56  ? 435 VAL A CG1  1 
ATOM   5761  C CG2  . VAL A 1 391 ? 58.786  -47.988  -0.783  1.00 21.69  ? 435 VAL A CG2  1 
ATOM   5762  H H    . VAL A 1 391 ? 60.490  -46.192  -1.845  1.00 20.92  ? 435 VAL A H    1 
ATOM   5763  H HA   . VAL A 1 391 ? 57.998  -45.561  -1.491  1.00 23.17  ? 435 VAL A HA   1 
ATOM   5764  H HB   . VAL A 1 391 ? 59.780  -46.659  0.415   1.00 27.59  ? 435 VAL A HB   1 
ATOM   5765  H HG11 . VAL A 1 391 ? 57.905  -47.321  1.638   1.00 29.47  ? 435 VAL A HG11 1 
ATOM   5766  H HG12 . VAL A 1 391 ? 57.949  -45.737  1.527   1.00 29.47  ? 435 VAL A HG12 1 
ATOM   5767  H HG13 . VAL A 1 391 ? 56.963  -46.571  0.602   1.00 29.47  ? 435 VAL A HG13 1 
ATOM   5768  H HG21 . VAL A 1 391 ? 58.839  -48.721  -0.149  1.00 26.03  ? 435 VAL A HG21 1 
ATOM   5769  H HG22 . VAL A 1 391 ? 57.931  -48.006  -1.240  1.00 26.03  ? 435 VAL A HG22 1 
ATOM   5770  H HG23 . VAL A 1 391 ? 59.508  -48.056  -1.429  1.00 26.03  ? 435 VAL A HG23 1 
ATOM   5771  N N    . VAL A 1 392 ? 59.969  -43.766  0.313   1.00 16.48  ? 436 VAL A N    1 
ATOM   5772  C CA   . VAL A 1 392 ? 59.995  -42.561  1.139   1.00 21.38  ? 436 VAL A CA   1 
ATOM   5773  C C    . VAL A 1 392 ? 59.586  -41.327  0.348   1.00 21.48  ? 436 VAL A C    1 
ATOM   5774  O O    . VAL A 1 392 ? 59.113  -40.347  0.934   1.00 30.28  ? 436 VAL A O    1 
ATOM   5775  C CB   . VAL A 1 392 ? 61.386  -42.355  1.777   1.00 23.07  ? 436 VAL A CB   1 
ATOM   5776  C CG1  . VAL A 1 392 ? 61.732  -43.524  2.684   1.00 27.27  ? 436 VAL A CG1  1 
ATOM   5777  C CG2  . VAL A 1 392 ? 62.455  -42.156  0.710   1.00 27.85  ? 436 VAL A CG2  1 
ATOM   5778  H H    . VAL A 1 392 ? 60.722  -44.178  0.253   1.00 19.78  ? 436 VAL A H    1 
ATOM   5779  H HA   . VAL A 1 392 ? 59.355  -42.670  1.860   1.00 25.66  ? 436 VAL A HA   1 
ATOM   5780  H HB   . VAL A 1 392 ? 61.362  -41.554  2.324   1.00 27.69  ? 436 VAL A HB   1 
ATOM   5781  H HG11 . VAL A 1 392 ? 62.608  -43.373  3.073   1.00 32.73  ? 436 VAL A HG11 1 
ATOM   5782  H HG12 . VAL A 1 392 ? 61.065  -43.587  3.386   1.00 32.73  ? 436 VAL A HG12 1 
ATOM   5783  H HG13 . VAL A 1 392 ? 61.739  -44.339  2.159   1.00 32.73  ? 436 VAL A HG13 1 
ATOM   5784  H HG21 . VAL A 1 392 ? 63.314  -42.030  1.143   1.00 33.42  ? 436 VAL A HG21 1 
ATOM   5785  H HG22 . VAL A 1 392 ? 62.483  -42.942  0.141   1.00 33.42  ? 436 VAL A HG22 1 
ATOM   5786  H HG23 . VAL A 1 392 ? 62.232  -41.373  0.182   1.00 33.42  ? 436 VAL A HG23 1 
ATOM   5787  N N    . GLY A 1 393 ? 59.749  -41.348  -0.971  1.00 15.42  ? 437 GLY A N    1 
ATOM   5788  C CA   . GLY A 1 393 ? 59.409  -40.223  -1.814  1.00 20.56  ? 437 GLY A CA   1 
ATOM   5789  C C    . GLY A 1 393 ? 58.084  -40.325  -2.539  1.00 24.82  ? 437 GLY A C    1 
ATOM   5790  O O    . GLY A 1 393 ? 57.795  -39.470  -3.384  1.00 24.11  ? 437 GLY A O    1 
ATOM   5791  H H    . GLY A 1 393 ? 60.061  -42.021  -1.405  1.00 18.51  ? 437 GLY A H    1 
ATOM   5792  H HA2  . GLY A 1 393 ? 59.388  -39.420  -1.269  1.00 24.67  ? 437 GLY A HA2  1 
ATOM   5793  H HA3  . GLY A 1 393 ? 60.105  -40.112  -2.481  1.00 24.67  ? 437 GLY A HA3  1 
ATOM   5794  N N    . ILE A 1 394 ? 57.267  -41.336  -2.243  1.00 19.35  ? 438 ILE A N    1 
ATOM   5795  C CA   . ILE A 1 394 ? 55.971  -41.465  -2.898  1.00 18.50  ? 438 ILE A CA   1 
ATOM   5796  C C    . ILE A 1 394 ? 55.059  -40.336  -2.442  1.00 22.81  ? 438 ILE A C    1 
ATOM   5797  O O    . ILE A 1 394 ? 54.954  -40.042  -1.244  1.00 15.95  ? 438 ILE A O    1 
ATOM   5798  C CB   . ILE A 1 394 ? 55.342  -42.834  -2.597  1.00 22.49  ? 438 ILE A CB   1 
ATOM   5799  C CG1  . ILE A 1 394 ? 56.140  -43.949  -3.273  1.00 19.50  ? 438 ILE A CG1  1 
ATOM   5800  C CG2  . ILE A 1 394 ? 53.887  -42.872  -3.065  1.00 17.06  ? 438 ILE A CG2  1 
ATOM   5801  C CD1  . ILE A 1 394 ? 55.693  -45.347  -2.900  1.00 28.25  ? 438 ILE A CD1  1 
ATOM   5802  H H    . ILE A 1 394 ? 57.440  -41.955  -1.671  1.00 23.23  ? 438 ILE A H    1 
ATOM   5803  H HA   . ILE A 1 394 ? 56.090  -41.390  -3.858  1.00 22.21  ? 438 ILE A HA   1 
ATOM   5804  H HB   . ILE A 1 394 ? 55.361  -42.978  -1.638  1.00 26.99  ? 438 ILE A HB   1 
ATOM   5805  H HG12 . ILE A 1 394 ? 56.049  -43.857  -4.235  1.00 23.40  ? 438 ILE A HG12 1 
ATOM   5806  H HG13 . ILE A 1 394 ? 57.073  -43.860  -3.022  1.00 23.40  ? 438 ILE A HG13 1 
ATOM   5807  H HG21 . ILE A 1 394 ? 53.514  -43.745  -2.864  1.00 20.47  ? 438 ILE A HG21 1 
ATOM   5808  H HG22 . ILE A 1 394 ? 53.387  -42.183  -2.600  1.00 20.47  ? 438 ILE A HG22 1 
ATOM   5809  H HG23 . ILE A 1 394 ? 53.860  -42.713  -4.022  1.00 20.47  ? 438 ILE A HG23 1 
ATOM   5810  H HD11 . ILE A 1 394 ? 56.247  -45.990  -3.369  1.00 33.90  ? 438 ILE A HD11 1 
ATOM   5811  H HD12 . ILE A 1 394 ? 55.790  -45.463  -1.942  1.00 33.90  ? 438 ILE A HD12 1 
ATOM   5812  H HD13 . ILE A 1 394 ? 54.765  -45.460  -3.156  1.00 33.90  ? 438 ILE A HD13 1 
ATOM   5813  N N    . GLN A 1 395 ? 54.384  -39.707  -3.398  1.00 18.70  ? 439 GLN A N    1 
ATOM   5814  C CA   . GLN A 1 395 ? 53.350  -38.724  -3.121  1.00 26.10  ? 439 GLN A CA   1 
ATOM   5815  C C    . GLN A 1 395 ? 52.034  -39.208  -3.710  1.00 22.74  ? 439 GLN A C    1 
ATOM   5816  O O    . GLN A 1 395 ? 52.012  -39.947  -4.698  1.00 26.50  ? 439 GLN A O    1 
ATOM   5817  C CB   . GLN A 1 395 ? 53.696  -37.352  -3.709  1.00 23.64  ? 439 GLN A CB   1 
ATOM   5818  C CG   . GLN A 1 395 ? 55.019  -36.783  -3.235  1.00 25.56  ? 439 GLN A CG   1 
ATOM   5819  C CD   . GLN A 1 395 ? 55.341  -35.451  -3.885  1.00 52.93  ? 439 GLN A CD   1 
ATOM   5820  O OE1  . GLN A 1 395 ? 56.430  -35.260  -4.427  1.00 57.06  ? 439 GLN A OE1  1 
ATOM   5821  N NE2  . GLN A 1 395 ? 54.394  -34.520  -3.831  1.00 58.04  ? 439 GLN A NE2  1 
ATOM   5822  H H    . GLN A 1 395 ? 54.513  -39.838  -4.238  1.00 22.45  ? 439 GLN A H    1 
ATOM   5823  H HA   . GLN A 1 395 ? 53.242  -38.630  -2.162  1.00 31.32  ? 439 GLN A HA   1 
ATOM   5824  H HB2  . GLN A 1 395 ? 53.738  -37.430  -4.675  1.00 28.37  ? 439 GLN A HB2  1 
ATOM   5825  H HB3  . GLN A 1 395 ? 53.000  -36.724  -3.461  1.00 28.37  ? 439 GLN A HB3  1 
ATOM   5826  H HG2  . GLN A 1 395 ? 54.980  -36.648  -2.275  1.00 30.68  ? 439 GLN A HG2  1 
ATOM   5827  H HG3  . GLN A 1 395 ? 55.729  -37.405  -3.456  1.00 30.68  ? 439 GLN A HG3  1 
ATOM   5828  H HE21 . GLN A 1 395 ? 53.646  -34.689  -3.442  1.00 69.65  ? 439 GLN A HE21 1 
ATOM   5829  H HE22 . GLN A 1 395 ? 54.530  -33.748  -4.186  1.00 69.65  ? 439 GLN A HE22 1 
ATOM   5830  N N    . ALA A 1 396 ? 50.935  -38.786  -3.094  1.00 27.26  ? 440 ALA A N    1 
ATOM   5831  C CA   . ALA A 1 396 ? 49.609  -39.099  -3.599  1.00 19.58  ? 440 ALA A CA   1 
ATOM   5832  C C    . ALA A 1 396 ? 49.159  -38.020  -4.573  1.00 21.83  ? 440 ALA A C    1 
ATOM   5833  O O    . ALA A 1 396 ? 49.331  -36.825  -4.319  1.00 21.74  ? 440 ALA A O    1 
ATOM   5834  C CB   . ALA A 1 396 ? 48.605  -39.217  -2.451  1.00 21.56  ? 440 ALA A CB   1 
ATOM   5835  H H    . ALA A 1 396 ? 50.934  -38.312  -2.376  1.00 32.72  ? 440 ALA A H    1 
ATOM   5836  H HA   . ALA A 1 396 ? 49.635  -39.946  -4.071  1.00 23.49  ? 440 ALA A HA   1 
ATOM   5837  H HB1  . ALA A 1 396 ? 47.731  -39.426  -2.817  1.00 25.87  ? 440 ALA A HB1  1 
ATOM   5838  H HB2  . ALA A 1 396 ? 48.892  -39.926  -1.853  1.00 25.87  ? 440 ALA A HB2  1 
ATOM   5839  H HB3  . ALA A 1 396 ? 48.571  -38.374  -1.973  1.00 25.87  ? 440 ALA A HB3  1 
ATOM   5840  N N    . ASN A 1 397 ? 48.594  -38.450  -5.700  1.00 20.69  ? 441 ASN A N    1 
ATOM   5841  C CA   . ASN A 1 397 ? 47.991  -37.520  -6.654  1.00 27.03  ? 441 ASN A CA   1 
ATOM   5842  C C    . ASN A 1 397 ? 46.549  -37.251  -6.221  1.00 17.33  ? 441 ASN A C    1 
ATOM   5843  O O    . ASN A 1 397 ? 45.577  -37.723  -6.814  1.00 22.33  ? 441 ASN A O    1 
ATOM   5844  C CB   . ASN A 1 397 ? 48.068  -38.076  -8.069  1.00 26.88  ? 441 ASN A CB   1 
ATOM   5845  C CG   . ASN A 1 397 ? 47.748  -37.032  -9.123  1.00 32.28  ? 441 ASN A CG   1 
ATOM   5846  O OD1  . ASN A 1 397 ? 47.055  -36.051  -8.852  1.00 29.67  ? 441 ASN A OD1  1 
ATOM   5847  N ND2  . ASN A 1 397 ? 48.250  -37.241  -10.333 1.00 31.77  ? 441 ASN A ND2  1 
ATOM   5848  H H    . ASN A 1 397 ? 48.545  -39.275  -5.935  1.00 24.84  ? 441 ASN A H    1 
ATOM   5849  H HA   . ASN A 1 397 ? 48.476  -36.680  -6.631  1.00 32.44  ? 441 ASN A HA   1 
ATOM   5850  H HB2  . ASN A 1 397 ? 48.966  -38.402  -8.233  1.00 32.26  ? 441 ASN A HB2  1 
ATOM   5851  H HB3  . ASN A 1 397 ? 47.429  -38.800  -8.160  1.00 32.26  ? 441 ASN A HB3  1 
ATOM   5852  H HD21 . ASN A 1 397 ? 48.097  -36.678  -10.965 1.00 38.13  ? 441 ASN A HD21 1 
ATOM   5853  H HD22 . ASN A 1 397 ? 48.728  -37.939  -10.486 1.00 38.13  ? 441 ASN A HD22 1 
ATOM   5854  N N    . THR A 1 398 ? 46.433  -36.473  -5.142  1.00 25.60  ? 442 THR A N    1 
ATOM   5855  C CA   . THR A 1 398 ? 45.131  -36.234  -4.527  1.00 27.75  ? 442 THR A CA   1 
ATOM   5856  C C    . THR A 1 398 ? 44.153  -35.615  -5.516  1.00 24.26  ? 442 THR A C    1 
ATOM   5857  O O    . THR A 1 398 ? 42.961  -35.946  -5.509  1.00 27.13  ? 442 THR A O    1 
ATOM   5858  C CB   . THR A 1 398 ? 45.289  -35.336  -3.300  1.00 23.17  ? 442 THR A CB   1 
ATOM   5859  O OG1  . THR A 1 398 ? 46.087  -34.195  -3.639  1.00 34.18  ? 442 THR A OG1  1 
ATOM   5860  C CG2  . THR A 1 398 ? 45.950  -36.100  -2.163  1.00 27.37  ? 442 THR A CG2  1 
ATOM   5861  H H    . THR A 1 398 ? 47.089  -36.076  -4.752  1.00 30.72  ? 442 THR A H    1 
ATOM   5862  H HA   . THR A 1 398 ? 44.762  -37.081  -4.232  1.00 33.30  ? 442 THR A HA   1 
ATOM   5863  H HB   . THR A 1 398 ? 44.414  -35.041  -3.003  1.00 27.80  ? 442 THR A HB   1 
ATOM   5864  H HG1  . THR A 1 398 ? 46.177  -33.698  -2.968  1.00 41.02  ? 442 THR A HG1  1 
ATOM   5865  H HG21 . THR A 1 398 ? 46.047  -35.524  -1.389  1.00 32.85  ? 442 THR A HG21 1 
ATOM   5866  H HG22 . THR A 1 398 ? 45.408  -36.867  -1.920  1.00 32.85  ? 442 THR A HG22 1 
ATOM   5867  H HG23 . THR A 1 398 ? 46.828  -36.409  -2.438  1.00 32.85  ? 442 THR A HG23 1 
ATOM   5868  N N    . GLU A 1 399 ? 44.634  -34.717  -6.376  1.00 35.41  ? 443 GLU A N    1 
ATOM   5869  C CA   . GLU A 1 399 ? 43.750  -34.095  -7.355  1.00 37.07  ? 443 GLU A CA   1 
ATOM   5870  C C    . GLU A 1 399 ? 43.121  -35.144  -8.265  1.00 35.95  ? 443 GLU A C    1 
ATOM   5871  O O    . GLU A 1 399 ? 41.905  -35.139  -8.490  1.00 40.95  ? 443 GLU A O    1 
ATOM   5872  C CB   . GLU A 1 399 ? 44.520  -33.056  -8.172  1.00 37.66  ? 443 GLU A CB   1 
ATOM   5873  C CG   . GLU A 1 399 ? 44.988  -31.860  -7.355  1.00 44.95  ? 443 GLU A CG   1 
ATOM   5874  C CD   . GLU A 1 399 ? 45.477  -30.713  -8.219  1.00 70.94  ? 443 GLU A CD   1 
ATOM   5875  O OE1  . GLU A 1 399 ? 46.380  -30.936  -9.053  1.00 67.25  ? 443 GLU A OE1  1 
ATOM   5876  O OE2  . GLU A 1 399 ? 44.950  -29.591  -8.070  1.00 72.21  ? 443 GLU A OE2  1 
ATOM   5877  H H    . GLU A 1 399 ? 45.452  -34.456  -6.411  0.97 42.50  ? 443 GLU A H    1 
ATOM   5878  H HA   . GLU A 1 399 ? 43.034  -33.637  -6.888  0.60 44.48  ? 443 GLU A HA   1 
ATOM   5879  H HB2  . GLU A 1 399 ? 45.305  -33.479  -8.555  1.00 45.19  ? 443 GLU A HB2  1 
ATOM   5880  H HB3  . GLU A 1 399 ? 43.945  -32.726  -8.880  1.00 45.19  ? 443 GLU A HB3  1 
ATOM   5881  H HG2  . GLU A 1 399 ? 44.248  -31.537  -6.817  1.00 53.94  ? 443 GLU A HG2  1 
ATOM   5882  H HG3  . GLU A 1 399 ? 45.719  -32.136  -6.781  1.00 53.94  ? 443 GLU A HG3  1 
ATOM   5883  N N    . ARG A 1 400 ? 43.934  -36.062  -8.790  1.00 30.40  ? 444 ARG A N    1 
ATOM   5884  C CA   . ARG A 1 400 ? 43.403  -37.092  -9.677  1.00 29.23  ? 444 ARG A CA   1 
ATOM   5885  C C    . ARG A 1 400 ? 42.579  -38.116  -8.906  1.00 30.59  ? 444 ARG A C    1 
ATOM   5886  O O    . ARG A 1 400 ? 41.581  -38.632  -9.421  1.00 36.05  ? 444 ARG A O    1 
ATOM   5887  C CB   . ARG A 1 400 ? 44.543  -37.779  -10.429 1.00 28.83  ? 444 ARG A CB   1 
ATOM   5888  C CG   . ARG A 1 400 ? 44.086  -38.938  -11.301 1.00 23.89  ? 444 ARG A CG   1 
ATOM   5889  C CD   . ARG A 1 400 ? 45.183  -39.401  -12.234 1.00 24.54  ? 444 ARG A CD   1 
ATOM   5890  N NE   . ARG A 1 400 ? 44.798  -40.602  -12.970 1.00 23.49  ? 444 ARG A NE   1 
ATOM   5891  C CZ   . ARG A 1 400 ? 44.309  -40.619  -14.208 1.00 37.87  ? 444 ARG A CZ   1 
ATOM   5892  N NH1  . ARG A 1 400 ? 44.138  -39.493  -14.886 1.00 34.72  ? 444 ARG A NH1  1 
ATOM   5893  N NH2  . ARG A 1 400 ? 43.993  -41.776  -14.774 1.00 36.26  ? 444 ARG A NH2  1 
ATOM   5894  H H    . ARG A 1 400 ? 44.782  -36.110  -8.651  1.00 36.48  ? 444 ARG A H    1 
ATOM   5895  H HA   . ARG A 1 400 ? 42.822  -36.674  -10.332 1.00 35.08  ? 444 ARG A HA   1 
ATOM   5896  H HB2  . ARG A 1 400 ? 44.976  -37.128  -11.003 1.00 34.60  ? 444 ARG A HB2  1 
ATOM   5897  H HB3  . ARG A 1 400 ? 45.179  -38.125  -9.784  1.00 34.60  ? 444 ARG A HB3  1 
ATOM   5898  H HG2  . ARG A 1 400 ? 43.834  -39.684  -10.734 1.00 28.67  ? 444 ARG A HG2  1 
ATOM   5899  H HG3  . ARG A 1 400 ? 43.330  -38.655  -11.839 1.00 28.67  ? 444 ARG A HG3  1 
ATOM   5900  H HD2  . ARG A 1 400 ? 45.373  -38.700  -12.876 1.00 29.45  ? 444 ARG A HD2  1 
ATOM   5901  H HD3  . ARG A 1 400 ? 45.977  -39.605  -11.716 1.00 29.45  ? 444 ARG A HD3  1 
ATOM   5902  H HE   . ARG A 1 400 ? 44.894  -41.359  -12.572 1.00 28.19  ? 444 ARG A HE   1 
ATOM   5903  H HH11 . ARG A 1 400 ? 44.341  -38.739  -14.526 1.00 41.67  ? 444 ARG A HH11 1 
ATOM   5904  H HH12 . ARG A 1 400 ? 43.822  -39.516  -15.686 1.00 41.67  ? 444 ARG A HH12 1 
ATOM   5905  H HH21 . ARG A 1 400 ? 44.102  -42.511  -14.341 1.00 43.52  ? 444 ARG A HH21 1 
ATOM   5906  H HH22 . ARG A 1 400 ? 43.678  -41.791  -15.575 1.00 43.52  ? 444 ARG A HH22 1 
ATOM   5907  N N    . ILE A 1 401 ? 42.985  -38.428  -7.674  1.00 25.42  ? 445 ILE A N    1 
ATOM   5908  C CA   . ILE A 1 401 ? 42.222  -39.366  -6.854  1.00 27.20  ? 445 ILE A CA   1 
ATOM   5909  C C    . ILE A 1 401 ? 40.832  -38.808  -6.569  1.00 28.06  ? 445 ILE A C    1 
ATOM   5910  O O    . ILE A 1 401 ? 39.818  -39.492  -6.748  1.00 31.12  ? 445 ILE A O    1 
ATOM   5911  C CB   . ILE A 1 401 ? 42.988  -39.683  -5.556  1.00 26.39  ? 445 ILE A CB   1 
ATOM   5912  C CG1  . ILE A 1 401 ? 44.139  -40.647  -5.855  1.00 23.66  ? 445 ILE A CG1  1 
ATOM   5913  C CG2  . ILE A 1 401 ? 42.061  -40.280  -4.492  1.00 28.58  ? 445 ILE A CG2  1 
ATOM   5914  C CD1  . ILE A 1 401 ? 45.149  -40.767  -4.738  1.00 25.25  ? 445 ILE A CD1  1 
ATOM   5915  H H    . ILE A 1 401 ? 43.690  -38.114  -7.295  1.00 30.50  ? 445 ILE A H    1 
ATOM   5916  H HA   . ILE A 1 401 ? 42.113  -40.195  -7.345  1.00 32.64  ? 445 ILE A HA   1 
ATOM   5917  H HB   . ILE A 1 401 ? 43.360  -38.857  -5.210  1.00 31.67  ? 445 ILE A HB   1 
ATOM   5918  H HG12 . ILE A 1 401 ? 43.772  -41.529  -6.018  1.00 28.39  ? 445 ILE A HG12 1 
ATOM   5919  H HG13 . ILE A 1 401 ? 44.608  -40.335  -6.645  1.00 28.39  ? 445 ILE A HG13 1 
ATOM   5920  H HG21 . ILE A 1 401 ? 42.578  -40.466  -3.692  1.00 34.30  ? 445 ILE A HG21 1 
ATOM   5921  H HG22 . ILE A 1 401 ? 41.359  -39.642  -4.292  1.00 34.30  ? 445 ILE A HG22 1 
ATOM   5922  H HG23 . ILE A 1 401 ? 41.675  -41.101  -4.835  1.00 34.30  ? 445 ILE A HG23 1 
ATOM   5923  H HD11 . ILE A 1 401 ? 45.841  -41.392  -5.005  1.00 30.30  ? 445 ILE A HD11 1 
ATOM   5924  H HD12 . ILE A 1 401 ? 45.538  -39.895  -4.568  1.00 30.30  ? 445 ILE A HD12 1 
ATOM   5925  H HD13 . ILE A 1 401 ? 44.701  -41.091  -3.941  1.00 30.30  ? 445 ILE A HD13 1 
ATOM   5926  N N    . ASN A 1 402 ? 40.764  -37.551  -6.124  1.00 31.36  ? 446 ASN A N    1 
ATOM   5927  C CA   . ASN A 1 402 ? 39.471  -36.946  -5.827  1.00 40.96  ? 446 ASN A CA   1 
ATOM   5928  C C    . ASN A 1 402 ? 38.628  -36.771  -7.084  1.00 50.86  ? 446 ASN A C    1 
ATOM   5929  O O    . ASN A 1 402 ? 37.398  -36.875  -7.021  1.00 39.13  ? 446 ASN A O    1 
ATOM   5930  C CB   . ASN A 1 402 ? 39.666  -35.599  -5.132  1.00 49.34  ? 446 ASN A CB   1 
ATOM   5931  C CG   . ASN A 1 402 ? 38.366  -34.835  -4.971  1.00 75.03  ? 446 ASN A CG   1 
ATOM   5932  O OD1  . ASN A 1 402 ? 37.537  -35.168  -4.123  1.00 67.44  ? 446 ASN A OD1  1 
ATOM   5933  N ND2  . ASN A 1 402 ? 38.182  -33.801  -5.786  1.00 69.60  ? 446 ASN A ND2  1 
ATOM   5934  H H    . ASN A 1 402 ? 41.441  -37.038  -5.989  1.00 37.63  ? 446 ASN A H    1 
ATOM   5935  H HA   . ASN A 1 402 ? 38.984  -37.526  -5.221  1.00 49.16  ? 446 ASN A HA   1 
ATOM   5936  H HB2  . ASN A 1 402 ? 40.038  -35.749  -4.249  1.00 59.21  ? 446 ASN A HB2  1 
ATOM   5937  H HB3  . ASN A 1 402 ? 40.271  -35.055  -5.660  1.00 59.21  ? 446 ASN A HB3  1 
ATOM   5938  H HD21 . ASN A 1 402 ? 37.461  -33.335  -5.734  1.00 83.52  ? 446 ASN A HD21 1 
ATOM   5939  H HD22 . ASN A 1 402 ? 38.784  -33.597  -6.365  1.00 83.52  ? 446 ASN A HD22 1 
ATOM   5940  N N    . LYS A 1 403 ? 39.264  -36.505  -8.228  1.00 37.11  ? 447 LYS A N    1 
ATOM   5941  C CA   . LYS A 1 403 ? 38.517  -36.369  -9.474  1.00 43.99  ? 447 LYS A CA   1 
ATOM   5942  C C    . LYS A 1 403 ? 37.839  -37.680  -9.850  1.00 47.58  ? 447 LYS A C    1 
ATOM   5943  O O    . LYS A 1 403 ? 36.663  -37.699  -10.229 1.00 41.87  ? 447 LYS A O    1 
ATOM   5944  C CB   . LYS A 1 403 ? 39.448  -35.900  -10.594 1.00 45.72  ? 447 LYS A CB   1 
ATOM   5945  C CG   . LYS A 1 403 ? 38.865  -36.054  -11.993 1.00 48.95  ? 447 LYS A CG   1 
ATOM   5946  C CD   . LYS A 1 403 ? 39.696  -35.312  -13.028 1.00 42.42  ? 447 LYS A CD   1 
ATOM   5947  H H    . LYS A 1 403 ? 40.114  -36.401  -8.306  1.00 44.53  ? 447 LYS A H    1 
ATOM   5948  H HA   . LYS A 1 403 ? 37.827  -35.698  -9.357  1.00 52.79  ? 447 LYS A HA   1 
ATOM   5949  H HB2  . LYS A 1 403 ? 39.648  -34.961  -10.460 1.00 54.87  ? 447 LYS A HB2  1 
ATOM   5950  H HB3  . LYS A 1 403 ? 40.266  -36.419  -10.557 1.00 54.87  ? 447 LYS A HB3  1 
ATOM   5951  H HG2  . LYS A 1 403 ? 38.850  -36.994  -12.231 1.00 58.74  ? 447 LYS A HG2  1 
ATOM   5952  H HG3  . LYS A 1 403 ? 37.966  -35.689  -12.007 1.00 58.74  ? 447 LYS A HG3  1 
ATOM   5953  N N    . LEU A 1 404 ? 38.570  -38.793  -9.752  1.00 39.57  ? 448 LEU A N    1 
ATOM   5954  C CA   . LEU A 1 404 ? 37.992  -40.089  -10.081 1.00 39.42  ? 448 LEU A CA   1 
ATOM   5955  C C    . LEU A 1 404 ? 37.003  -40.562  -9.025  1.00 40.74  ? 448 LEU A C    1 
ATOM   5956  O O    . LEU A 1 404 ? 36.185  -41.443  -9.310  1.00 51.70  ? 448 LEU A O    1 
ATOM   5957  C CB   . LEU A 1 404 ? 39.103  -41.125  -10.270 1.00 36.91  ? 448 LEU A CB   1 
ATOM   5958  C CG   . LEU A 1 404 ? 40.091  -40.827  -11.403 1.00 53.40  ? 448 LEU A CG   1 
ATOM   5959  C CD1  . LEU A 1 404 ? 41.148  -41.913  -11.487 1.00 42.98  ? 448 LEU A CD1  1 
ATOM   5960  C CD2  . LEU A 1 404 ? 39.381  -40.668  -12.747 1.00 44.96  ? 448 LEU A CD2  1 
ATOM   5961  H H    . LEU A 1 404 ? 39.392  -38.821  -9.500  1.00 47.49  ? 448 LEU A H    1 
ATOM   5962  H HA   . LEU A 1 404 ? 37.513  -40.013  -10.921 1.00 47.30  ? 448 LEU A HA   1 
ATOM   5963  H HB2  . LEU A 1 404 ? 39.613  -41.182  -9.446  1.00 44.30  ? 448 LEU A HB2  1 
ATOM   5964  H HB3  . LEU A 1 404 ? 38.694  -41.984  -10.458 1.00 44.30  ? 448 LEU A HB3  1 
ATOM   5965  H HG   . LEU A 1 404 ? 40.543  -39.991  -11.208 1.00 64.08  ? 448 LEU A HG   1 
ATOM   5966  H HD11 . LEU A 1 404 ? 41.760  -41.702  -12.210 1.00 51.57  ? 448 LEU A HD11 1 
ATOM   5967  H HD12 . LEU A 1 404 ? 41.630  -41.951  -10.646 1.00 51.57  ? 448 LEU A HD12 1 
ATOM   5968  H HD13 . LEU A 1 404 ? 40.714  -42.763  -11.659 1.00 51.57  ? 448 LEU A HD13 1 
ATOM   5969  H HD21 . LEU A 1 404 ? 40.041  -40.481  -13.432 1.00 53.95  ? 448 LEU A HD21 1 
ATOM   5970  H HD22 . LEU A 1 404 ? 38.912  -41.491  -12.955 1.00 53.95  ? 448 LEU A HD22 1 
ATOM   5971  H HD23 . LEU A 1 404 ? 38.750  -39.934  -12.686 1.00 53.95  ? 448 LEU A HD23 1 
ATOM   5972  N N    . MET A 1 405 ? 37.056  -39.998  -7.817  1.00 44.13  ? 449 MET A N    1 
ATOM   5973  C CA   . MET A 1 405 ? 36.025  -40.281  -6.826  1.00 42.47  ? 449 MET A CA   1 
ATOM   5974  C C    . MET A 1 405 ? 34.698  -39.649  -7.226  1.00 43.60  ? 449 MET A C    1 
ATOM   5975  O O    . MET A 1 405 ? 33.643  -40.284  -7.122  1.00 34.50  ? 449 MET A O    1 
ATOM   5976  C CB   . MET A 1 405 ? 36.469  -39.775  -5.454  1.00 51.02  ? 449 MET A CB   1 
ATOM   5977  C CG   . MET A 1 405 ? 37.397  -40.725  -4.706  1.00 54.38  ? 449 MET A CG   1 
ATOM   5978  S SD   . MET A 1 405 ? 36.555  -42.183  -4.057  1.00 42.80  ? 449 MET A SD   1 
ATOM   5979  C CE   . MET A 1 405 ? 35.460  -41.440  -2.856  1.00 25.74  ? 449 MET A CE   1 
ATOM   5980  H H    . MET A 1 405 ? 37.670  -39.457  -7.552  1.00 52.96  ? 449 MET A H    1 
ATOM   5981  H HA   . MET A 1 405 ? 35.907  -41.242  -6.763  1.00 50.96  ? 449 MET A HA   1 
ATOM   5982  H HB2  . MET A 1 405 ? 36.940  -38.934  -5.570  1.00 61.23  ? 449 MET A HB2  1 
ATOM   5983  H HB3  . MET A 1 405 ? 35.683  -39.636  -4.904  1.00 61.23  ? 449 MET A HB3  1 
ATOM   5984  H HG2  . MET A 1 405 ? 38.092  -41.027  -5.311  1.00 65.26  ? 449 MET A HG2  1 
ATOM   5985  H HG3  . MET A 1 405 ? 37.793  -40.252  -3.957  1.00 65.26  ? 449 MET A HG3  1 
ATOM   5986  H HE1  . MET A 1 405 ? 34.941  -42.139  -2.429  1.00 30.90  ? 449 MET A HE1  1 
ATOM   5987  H HE2  . MET A 1 405 ? 35.991  -40.970  -2.194  1.00 30.90  ? 449 MET A HE2  1 
ATOM   5988  H HE3  . MET A 1 405 ? 34.870  -40.819  -3.310  1.00 30.90  ? 449 MET A HE3  1 
ATOM   5989  N N    . ASN A 1 406 ? 34.735  -38.399  -7.696  1.00 45.24  ? 450 ASN A N    1 
ATOM   5990  C CA   . ASN A 1 406 ? 33.519  -37.738  -8.158  1.00 58.35  ? 450 ASN A CA   1 
ATOM   5991  C C    . ASN A 1 406 ? 32.999  -38.357  -9.449  1.00 49.47  ? 450 ASN A C    1 
ATOM   5992  O O    . ASN A 1 406 ? 31.790  -38.319  -9.709  1.00 46.92  ? 450 ASN A O    1 
ATOM   5993  C CB   . ASN A 1 406 ? 33.778  -36.245  -8.361  1.00 49.86  ? 450 ASN A CB   1 
ATOM   5994  C CG   . ASN A 1 406 ? 34.264  -35.560  -7.100  1.00 68.50  ? 450 ASN A CG   1 
ATOM   5995  O OD1  . ASN A 1 406 ? 33.868  -35.920  -5.991  1.00 76.44  ? 450 ASN A OD1  1 
ATOM   5996  N ND2  . ASN A 1 406 ? 35.131  -34.567  -7.263  1.00 66.57  ? 450 ASN A ND2  1 
ATOM   5997  H H    . ASN A 1 406 ? 35.445  -37.918  -7.755  1.00 54.29  ? 450 ASN A H    1 
ATOM   5998  H HA   . ASN A 1 406 ? 32.830  -37.834  -7.481  1.00 70.02  ? 450 ASN A HA   1 
ATOM   5999  H HB2  . ASN A 1 406 ? 34.456  -36.132  -9.045  1.00 59.84  ? 450 ASN A HB2  1 
ATOM   6000  H HB3  . ASN A 1 406 ? 32.953  -35.816  -8.637  1.00 59.84  ? 450 ASN A HB3  1 
ATOM   6001  H HD21 . ASN A 1 406 ? 35.437  -34.146  -6.578  1.00 79.89  ? 450 ASN A HD21 1 
ATOM   6002  H HD22 . ASN A 1 406 ? 35.386  -34.344  -8.054  1.00 79.89  ? 450 ASN A HD22 1 
ATOM   6003  N N    . GLU A 1 407 ? 33.887  -38.923  -10.266 1.00 37.44  ? 451 GLU A N    1 
ATOM   6004  C CA   . GLU A 1 407 ? 33.502  -39.513  -11.541 1.00 42.36  ? 451 GLU A CA   1 
ATOM   6005  C C    . GLU A 1 407 ? 33.168  -40.996  -11.443 1.00 43.74  ? 451 GLU A C    1 
ATOM   6006  O O    . GLU A 1 407 ? 32.722  -41.578  -12.437 1.00 46.77  ? 451 GLU A O    1 
ATOM   6007  C CB   . GLU A 1 407 ? 34.622  -39.316  -12.569 1.00 39.93  ? 451 GLU A CB   1 
ATOM   6008  C CG   . GLU A 1 407 ? 34.861  -37.863  -12.960 1.00 50.10  ? 451 GLU A CG   1 
ATOM   6009  C CD   . GLU A 1 407 ? 36.004  -37.699  -13.947 1.00 57.25  ? 451 GLU A CD   1 
ATOM   6010  O OE1  . GLU A 1 407 ? 36.537  -38.724  -14.423 1.00 43.20  ? 451 GLU A OE1  1 
ATOM   6011  O OE2  . GLU A 1 407 ? 36.371  -36.543  -14.246 1.00 46.55  ? 451 GLU A OE2  1 
ATOM   6012  H H    . GLU A 1 407 ? 34.728  -38.978  -10.099 1.00 44.93  ? 451 GLU A H    1 
ATOM   6013  H HA   . GLU A 1 407 ? 32.713  -39.054  -11.870 1.00 50.83  ? 451 GLU A HA   1 
ATOM   6014  H HB2  . GLU A 1 407 ? 35.449  -39.661  -12.198 1.00 47.92  ? 451 GLU A HB2  1 
ATOM   6015  H HB3  . GLU A 1 407 ? 34.395  -39.805  -13.375 1.00 47.92  ? 451 GLU A HB3  1 
ATOM   6016  H HG2  . GLU A 1 407 ? 34.056  -37.511  -13.372 1.00 60.12  ? 451 GLU A HG2  1 
ATOM   6017  H HG3  . GLU A 1 407 ? 35.077  -37.353  -12.164 1.00 60.12  ? 451 GLU A HG3  1 
ATOM   6018  N N    . SER A 1 408 ? 33.357  -41.617  -10.282 1.00 36.29  ? 452 SER A N    1 
ATOM   6019  C CA   . SER A 1 408 ? 33.144  -43.050  -10.149 1.00 37.89  ? 452 SER A CA   1 
ATOM   6020  C C    . SER A 1 408 ? 31.658  -43.381  -10.061 1.00 44.50  ? 452 SER A C    1 
ATOM   6021  O O    . SER A 1 408 ? 30.851  -42.600  -9.549  1.00 39.86  ? 452 SER A O    1 
ATOM   6022  C CB   . SER A 1 408 ? 33.859  -43.586  -8.908  1.00 34.66  ? 452 SER A CB   1 
ATOM   6023  O OG   . SER A 1 408 ? 33.550  -44.954  -8.696  1.00 32.46  ? 452 SER A OG   1 
ATOM   6024  H H    . SER A 1 408 ? 33.610  -41.228  -9.557  1.00 43.55  ? 452 SER A H    1 
ATOM   6025  H HA   . SER A 1 408 ? 33.509  -43.500  -10.927 1.00 45.47  ? 452 SER A HA   1 
ATOM   6026  H HB2  . SER A 1 408 ? 34.817  -43.495  -9.032  1.00 41.59  ? 452 SER A HB2  1 
ATOM   6027  H HB3  . SER A 1 408 ? 33.575  -43.075  -8.134  1.00 41.59  ? 452 SER A HB3  1 
ATOM   6028  H HG   . SER A 1 408 ? 33.949  -45.236  -8.013  1.00 38.96  ? 452 SER A HG   1 
ATOM   6029  N N    . LEU A 1 409 ? 31.306  -44.561  -10.569 1.00 40.48  ? 453 LEU A N    1 
ATOM   6030  C CA   . LEU A 1 409 ? 29.955  -45.094  -10.455 1.00 48.93  ? 453 LEU A CA   1 
ATOM   6031  C C    . LEU A 1 409 ? 29.744  -45.903  -9.182  1.00 52.99  ? 453 LEU A C    1 
ATOM   6032  O O    . LEU A 1 409 ? 28.618  -46.344  -8.927  1.00 57.96  ? 453 LEU A O    1 
ATOM   6033  C CB   . LEU A 1 409 ? 29.631  -45.983  -11.662 1.00 40.39  ? 453 LEU A CB   1 
ATOM   6034  C CG   . LEU A 1 409 ? 29.734  -45.379  -13.063 1.00 47.46  ? 453 LEU A CG   1 
ATOM   6035  C CD1  . LEU A 1 409 ? 29.363  -46.426  -14.104 1.00 43.32  ? 453 LEU A CD1  1 
ATOM   6036  C CD2  . LEU A 1 409 ? 28.847  -44.157  -13.196 1.00 48.43  ? 453 LEU A CD2  1 
ATOM   6037  H H    . LEU A 1 409 ? 31.845  -45.081  -10.992 1.00 48.57  ? 453 LEU A H    1 
ATOM   6038  H HA   . LEU A 1 409 ? 29.325  -44.356  -10.449 1.00 58.72  ? 453 LEU A HA   1 
ATOM   6039  H HB2  . LEU A 1 409 ? 30.233  -46.744  -11.640 1.00 48.47  ? 453 LEU A HB2  1 
ATOM   6040  H HB3  . LEU A 1 409 ? 28.720  -46.301  -11.561 1.00 48.47  ? 453 LEU A HB3  1 
ATOM   6041  H HG   . LEU A 1 409 ? 30.651  -45.105  -13.224 1.00 56.95  ? 453 LEU A HG   1 
ATOM   6042  H HD11 . LEU A 1 409 ? 29.433  -46.031  -14.988 1.00 51.99  ? 453 LEU A HD11 1 
ATOM   6043  H HD12 . LEU A 1 409 ? 29.974  -47.177  -14.028 1.00 51.99  ? 453 LEU A HD12 1 
ATOM   6044  H HD13 . LEU A 1 409 ? 28.453  -46.722  -13.944 1.00 51.99  ? 453 LEU A HD13 1 
ATOM   6045  H HD21 . LEU A 1 409 ? 28.936  -43.799  -14.093 1.00 58.12  ? 453 LEU A HD21 1 
ATOM   6046  H HD22 . LEU A 1 409 ? 27.927  -44.416  -13.032 1.00 58.12  ? 453 LEU A HD22 1 
ATOM   6047  H HD23 . LEU A 1 409 ? 29.125  -43.493  -12.546 1.00 58.12  ? 453 LEU A HD23 1 
ATOM   6048  N N    . MET A 1 410 ? 30.790  -46.105  -8.377  1.00 41.94  ? 454 MET A N    1 
ATOM   6049  C CA   . MET A 1 410 ? 30.710  -47.046  -7.265  1.00 47.51  ? 454 MET A CA   1 
ATOM   6050  C C    . MET A 1 410 ? 29.942  -46.496  -6.070  1.00 46.85  ? 454 MET A C    1 
ATOM   6051  O O    . MET A 1 410 ? 29.401  -47.277  -5.279  1.00 51.07  ? 454 MET A O    1 
ATOM   6052  C CB   . MET A 1 410 ? 32.119  -47.449  -6.823  1.00 49.42  ? 454 MET A CB   1 
ATOM   6053  C CG   . MET A 1 410 ? 32.780  -48.505  -7.697  1.00 33.04  ? 454 MET A CG   1 
ATOM   6054  S SD   . MET A 1 410 ? 31.788  -49.997  -7.901  1.00 44.90  ? 454 MET A SD   1 
ATOM   6055  C CE   . MET A 1 410 ? 31.342  -50.371  -6.206  1.00 47.84  ? 454 MET A CE   1 
ATOM   6056  H H    . MET A 1 410 ? 31.550  -45.711  -8.455  1.00 50.33  ? 454 MET A H    1 
ATOM   6057  H HA   . MET A 1 410 ? 30.261  -47.849  -7.574  1.00 57.01  ? 454 MET A HA   1 
ATOM   6058  H HB2  . MET A 1 410 ? 32.684  -46.661  -6.835  1.00 59.31  ? 454 MET A HB2  1 
ATOM   6059  H HB3  . MET A 1 410 ? 32.071  -47.802  -5.920  1.00 59.31  ? 454 MET A HB3  1 
ATOM   6060  H HG2  . MET A 1 410 ? 32.937  -48.129  -8.577  1.00 39.65  ? 454 MET A HG2  1 
ATOM   6061  H HG3  . MET A 1 410 ? 33.624  -48.762  -7.293  1.00 39.65  ? 454 MET A HG3  1 
ATOM   6062  H HE1  . MET A 1 410 ? 30.795  -51.172  -6.193  1.00 57.41  ? 454 MET A HE1  1 
ATOM   6063  H HE2  . MET A 1 410 ? 32.151  -50.514  -5.691  1.00 57.41  ? 454 MET A HE2  1 
ATOM   6064  H HE3  . MET A 1 410 ? 30.844  -49.624  -5.839  1.00 57.41  ? 454 MET A HE3  1 
ATOM   6065  N N    . LEU A 1 411 ? 29.881  -45.178  -5.914  1.00 40.46  ? 455 LEU A N    1 
ATOM   6066  C CA   . LEU A 1 411 ? 29.265  -44.579  -4.737  1.00 53.61  ? 455 LEU A CA   1 
ATOM   6067  C C    . LEU A 1 411 ? 27.748  -44.461  -4.844  1.00 70.81  ? 455 LEU A C    1 
ATOM   6068  O O    . LEU A 1 411 ? 27.125  -43.884  -3.945  1.00 60.46  ? 455 LEU A O    1 
ATOM   6069  C CB   . LEU A 1 411 ? 29.868  -43.195  -4.484  1.00 51.54  ? 455 LEU A CB   1 
ATOM   6070  C CG   . LEU A 1 411 ? 31.394  -43.103  -4.542  1.00 55.05  ? 455 LEU A CG   1 
ATOM   6071  C CD1  . LEU A 1 411 ? 31.843  -41.684  -4.228  1.00 40.17  ? 455 LEU A CD1  1 
ATOM   6072  C CD2  . LEU A 1 411 ? 32.046  -44.098  -3.591  1.00 52.27  ? 455 LEU A CD2  1 
ATOM   6073  H H    . LEU A 1 411 ? 30.189  -44.607  -6.479  1.00 48.55  ? 455 LEU A H    1 
ATOM   6074  H HA   . LEU A 1 411 ? 29.465  -45.133  -3.966  1.00 64.33  ? 455 LEU A HA   1 
ATOM   6075  H HB2  . LEU A 1 411 ? 29.517  -42.584  -5.151  1.00 61.85  ? 455 LEU A HB2  1 
ATOM   6076  H HB3  . LEU A 1 411 ? 29.594  -42.900  -3.602  1.00 61.85  ? 455 LEU A HB3  1 
ATOM   6077  H HG   . LEU A 1 411 ? 31.687  -43.315  -5.442  1.00 66.06  ? 455 LEU A HG   1 
ATOM   6078  H HD11 . LEU A 1 411 ? 32.811  -41.643  -4.269  1.00 48.21  ? 455 LEU A HD11 1 
ATOM   6079  H HD12 . LEU A 1 411 ? 31.458  -41.080  -4.882  1.00 48.21  ? 455 LEU A HD12 1 
ATOM   6080  H HD13 . LEU A 1 411 ? 31.538  -41.446  -3.339  1.00 48.21  ? 455 LEU A HD13 1 
ATOM   6081  H HD21 . LEU A 1 411 ? 33.010  -44.010  -3.655  1.00 62.72  ? 455 LEU A HD21 1 
ATOM   6082  H HD22 . LEU A 1 411 ? 31.756  -43.906  -2.685  1.00 62.72  ? 455 LEU A HD22 1 
ATOM   6083  H HD23 . LEU A 1 411 ? 31.778  -44.996  -3.841  1.00 62.72  ? 455 LEU A HD23 1 
ATOM   6084  N N    . VAL A 1 412 ? 27.138  -44.995  -5.905  1.00 69.45  ? 456 VAL A N    1 
ATOM   6085  C CA   . VAL A 1 412 ? 25.706  -44.803  -6.111  1.00 61.31  ? 456 VAL A CA   1 
ATOM   6086  C C    . VAL A 1 412 ? 24.893  -45.489  -5.021  1.00 75.48  ? 456 VAL A C    1 
ATOM   6087  O O    . VAL A 1 412 ? 23.774  -45.062  -4.711  1.00 76.71  ? 456 VAL A O    1 
ATOM   6088  C CB   . VAL A 1 412 ? 25.299  -45.303  -7.510  1.00 62.05  ? 456 VAL A CB   1 
ATOM   6089  C CG1  . VAL A 1 412 ? 25.521  -46.808  -7.635  1.00 66.09  ? 456 VAL A CG1  1 
ATOM   6090  C CG2  . VAL A 1 412 ? 23.852  -44.940  -7.808  1.00 66.44  ? 456 VAL A CG2  1 
ATOM   6091  H H    . VAL A 1 412 ? 27.527  -45.466  -6.510  1.00 83.35  ? 456 VAL A H    1 
ATOM   6092  H HA   . VAL A 1 412 ? 25.511  -43.853  -6.070  1.00 73.57  ? 456 VAL A HA   1 
ATOM   6093  H HB   . VAL A 1 412 ? 25.857  -44.865  -8.173  1.00 74.46  ? 456 VAL A HB   1 
ATOM   6094  H HG11 . VAL A 1 412 ? 25.257  -47.093  -8.524  1.00 79.31  ? 456 VAL A HG11 1 
ATOM   6095  H HG12 . VAL A 1 412 ? 26.460  -47.002  -7.491  1.00 79.31  ? 456 VAL A HG12 1 
ATOM   6096  H HG13 . VAL A 1 412 ? 24.983  -47.263  -6.968  1.00 79.31  ? 456 VAL A HG13 1 
ATOM   6097  H HG21 . VAL A 1 412 ? 23.621  -45.265  -8.692  1.00 79.74  ? 456 VAL A HG21 1 
ATOM   6098  H HG22 . VAL A 1 412 ? 23.280  -45.354  -7.142  1.00 79.74  ? 456 VAL A HG22 1 
ATOM   6099  H HG23 . VAL A 1 412 ? 23.756  -43.975  -7.774  1.00 79.74  ? 456 VAL A HG23 1 
ATOM   6100  N N    . THR A 1 413 ? 25.425  -46.556  -4.421  1.00 78.88  ? 457 THR A N    1 
ATOM   6101  C CA   . THR A 1 413 ? 24.674  -47.299  -3.416  1.00 68.56  ? 457 THR A CA   1 
ATOM   6102  C C    . THR A 1 413 ? 24.426  -46.494  -2.147  1.00 71.98  ? 457 THR A C    1 
ATOM   6103  O O    . THR A 1 413 ? 23.610  -46.914  -1.321  1.00 59.22  ? 457 THR A O    1 
ATOM   6104  C CB   . THR A 1 413 ? 25.403  -48.598  -3.064  1.00 50.13  ? 457 THR A CB   1 
ATOM   6105  O OG1  . THR A 1 413 ? 26.688  -48.296  -2.506  1.00 64.74  ? 457 THR A OG1  1 
ATOM   6106  C CG2  . THR A 1 413 ? 25.578  -49.463  -4.305  1.00 43.37  ? 457 THR A CG2  1 
ATOM   6107  H H    . THR A 1 413 ? 26.212  -46.866  -4.579  1.00 94.66  ? 457 THR A H    1 
ATOM   6108  H HA   . THR A 1 413 ? 23.810  -47.537  -3.787  1.00 82.27  ? 457 THR A HA   1 
ATOM   6109  H HB   . THR A 1 413 ? 24.880  -49.095  -2.416  1.00 60.16  ? 457 THR A HB   1 
ATOM   6110  H HG1  . THR A 1 413 ? 27.091  -49.007  -2.312  1.00 77.69  ? 457 THR A HG1  1 
ATOM   6111  H HG21 . THR A 1 413 ? 26.041  -50.284  -4.074  1.00 52.05  ? 457 THR A HG21 1 
ATOM   6112  H HG22 . THR A 1 413 ? 24.711  -49.685  -4.679  1.00 52.05  ? 457 THR A HG22 1 
ATOM   6113  H HG23 . THR A 1 413 ? 26.097  -48.986  -4.971  1.00 52.05  ? 457 THR A HG23 1 
ATOM   6114  N N    . ALA A 1 414 ? 25.105  -45.358  -1.970  1.00 75.71  ? 458 ALA A N    1 
ATOM   6115  C CA   . ALA A 1 414 ? 24.835  -44.497  -0.825  1.00 67.43  ? 458 ALA A CA   1 
ATOM   6116  C C    . ALA A 1 414 ? 23.471  -43.825  -0.920  1.00 75.93  ? 458 ALA A C    1 
ATOM   6117  O O    . ALA A 1 414 ? 22.951  -43.360  0.100   1.00 77.38  ? 458 ALA A O    1 
ATOM   6118  C CB   . ALA A 1 414 ? 25.927  -43.434  -0.696  1.00 67.54  ? 458 ALA A CB   1 
ATOM   6119  H H    . ALA A 1 414 ? 25.722  -45.068  -2.495  1.00 90.86  ? 458 ALA A H    1 
ATOM   6120  H HA   . ALA A 1 414 ? 24.846  -45.035  -0.018  1.00 80.92  ? 458 ALA A HA   1 
ATOM   6121  H HB1  . ALA A 1 414 ? 25.731  -42.871  0.069   1.00 81.05  ? 458 ALA A HB1  1 
ATOM   6122  H HB2  . ALA A 1 414 ? 26.782  -43.874  -0.573  1.00 81.05  ? 458 ALA A HB2  1 
ATOM   6123  H HB3  . ALA A 1 414 ? 25.943  -42.899  -1.505  1.00 81.05  ? 458 ALA A HB3  1 
ATOM   6124  N N    . LEU A 1 415 ? 22.885  -43.761  -2.117  1.00 85.01  ? 459 LEU A N    1 
ATOM   6125  C CA   . LEU A 1 415 ? 21.567  -43.169  -2.304  1.00 78.18  ? 459 LEU A CA   1 
ATOM   6126  C C    . LEU A 1 415 ? 20.431  -44.142  -2.016  1.00 77.75  ? 459 LEU A C    1 
ATOM   6127  O O    . LEU A 1 415 ? 19.271  -43.717  -1.981  1.00 79.56  ? 459 LEU A O    1 
ATOM   6128  C CB   . LEU A 1 415 ? 21.424  -42.648  -3.738  1.00 67.56  ? 459 LEU A CB   1 
ATOM   6129  C CG   . LEU A 1 415 ? 22.414  -41.580  -4.209  1.00 68.98  ? 459 LEU A CG   1 
ATOM   6130  C CD1  . LEU A 1 415 ? 22.251  -41.337  -5.704  1.00 48.89  ? 459 LEU A CD1  1 
ATOM   6131  C CD2  . LEU A 1 415 ? 22.233  -40.282  -3.435  1.00 61.61  ? 459 LEU A CD2  1 
ATOM   6132  H H    . LEU A 1 415 ? 23.238  -44.058  -2.843  1.00 102.01 ? 459 LEU A H    1 
ATOM   6133  H HA   . LEU A 1 415 ? 21.473  -42.414  -1.702  1.00 93.82  ? 459 LEU A HA   1 
ATOM   6134  H HB2  . LEU A 1 415 ? 21.515  -43.403  -4.340  1.00 81.07  ? 459 LEU A HB2  1 
ATOM   6135  H HB3  . LEU A 1 415 ? 20.535  -42.272  -3.832  1.00 81.07  ? 459 LEU A HB3  1 
ATOM   6136  H HG   . LEU A 1 415 ? 23.317  -41.897  -4.054  1.00 82.78  ? 459 LEU A HG   1 
ATOM   6137  H HD11 . LEU A 1 415 ? 22.885  -40.658  -5.984  1.00 58.68  ? 459 LEU A HD11 1 
ATOM   6138  H HD12 . LEU A 1 415 ? 22.422  -42.166  -6.179  1.00 58.68  ? 459 LEU A HD12 1 
ATOM   6139  H HD13 . LEU A 1 415 ? 21.346  -41.036  -5.878  1.00 58.68  ? 459 LEU A HD13 1 
ATOM   6140  H HD21 . LEU A 1 415 ? 22.874  -39.630  -3.758  1.00 73.94  ? 459 LEU A HD21 1 
ATOM   6141  H HD22 . LEU A 1 415 ? 21.330  -39.956  -3.573  1.00 73.94  ? 459 LEU A HD22 1 
ATOM   6142  H HD23 . LEU A 1 415 ? 22.383  -40.454  -2.492  1.00 73.94  ? 459 LEU A HD23 1 
ATOM   6143  N N    . ASN A 1 416 ? 20.731  -45.424  -1.809  1.00 80.04  ? 460 ASN A N    1 
ATOM   6144  C CA   . ASN A 1 416 ? 19.688  -46.436  -1.643  1.00 78.62  ? 460 ASN A CA   1 
ATOM   6145  C C    . ASN A 1 416 ? 18.654  -46.077  -0.585  1.00 70.11  ? 460 ASN A C    1 
ATOM   6146  O O    . ASN A 1 416 ? 17.452  -46.105  -0.897  1.00 79.14  ? 460 ASN A O    1 
ATOM   6147  C CB   . ASN A 1 416 ? 20.346  -47.785  -1.321  1.00 79.17  ? 460 ASN A CB   1 
ATOM   6148  C CG   . ASN A 1 416 ? 21.010  -48.415  -2.530  1.00 73.37  ? 460 ASN A CG   1 
ATOM   6149  O OD1  . ASN A 1 416 ? 21.247  -47.751  -3.539  1.00 69.42  ? 460 ASN A OD1  1 
ATOM   6150  N ND2  . ASN A 1 416 ? 21.315  -49.704  -2.433  1.00 59.79  ? 460 ASN A ND2  1 
ATOM   6151  H H    . ASN A 1 416 ? 21.532  -45.734  -1.761  1.00 96.06  ? 460 ASN A H    1 
ATOM   6152  H HA   . ASN A 1 416 ? 19.219  -46.535  -2.487  1.00 94.34  ? 460 ASN A HA   1 
ATOM   6153  H HB2  . ASN A 1 416 ? 21.025  -47.651  -0.641  1.00 95.00  ? 460 ASN A HB2  1 
ATOM   6154  H HB3  . ASN A 1 416 ? 19.668  -48.398  -0.997  1.00 95.00  ? 460 ASN A HB3  1 
ATOM   6155  H HD21 . ASN A 1 416 ? 21.693  -50.107  -3.091  1.00 71.75  ? 460 ASN A HD21 1 
ATOM   6156  H HD22 . ASN A 1 416 ? 21.135  -50.135  -1.711  1.00 71.75  ? 460 ASN A HD22 1 
ATOM   6157  N N    . PRO A 1 417 ? 19.024  -45.743  0.656   1.00 63.92  ? 461 PRO A N    1 
ATOM   6158  C CA   . PRO A 1 417 ? 17.999  -45.490  1.681   1.00 73.89  ? 461 PRO A CA   1 
ATOM   6159  C C    . PRO A 1 417 ? 17.236  -44.186  1.498   1.00 77.42  ? 461 PRO A C    1 
ATOM   6160  O O    . PRO A 1 417 ? 16.289  -43.942  2.256   1.00 82.37  ? 461 PRO A O    1 
ATOM   6161  C CB   . PRO A 1 417 ? 18.806  -45.476  2.985   1.00 62.32  ? 461 PRO A CB   1 
ATOM   6162  C CG   . PRO A 1 417 ? 20.175  -45.068  2.573   1.00 64.59  ? 461 PRO A CG   1 
ATOM   6163  C CD   . PRO A 1 417 ? 20.388  -45.652  1.207   1.00 75.38  ? 461 PRO A CD   1 
ATOM   6164  H HA   . PRO A 1 417 ? 17.367  -46.225  1.708   1.00 88.67  ? 461 PRO A HA   1 
ATOM   6165  H HB2  . PRO A 1 417 ? 18.425  -44.831  3.601   1.00 74.79  ? 461 PRO A HB2  1 
ATOM   6166  H HB3  . PRO A 1 417 ? 18.815  -46.364  3.376   1.00 74.79  ? 461 PRO A HB3  1 
ATOM   6167  H HG2  . PRO A 1 417 ? 20.229  -44.100  2.542   1.00 77.51  ? 461 PRO A HG2  1 
ATOM   6168  H HG3  . PRO A 1 417 ? 20.823  -45.425  3.200   1.00 77.51  ? 461 PRO A HG3  1 
ATOM   6169  H HD2  . PRO A 1 417 ? 20.932  -45.057  0.667   1.00 90.45  ? 461 PRO A HD2  1 
ATOM   6170  H HD3  . PRO A 1 417 ? 20.785  -46.534  1.275   1.00 90.45  ? 461 PRO A HD3  1 
ATOM   6171  N N    . HIS A 1 418 ? 17.603  -43.350  0.529   1.00 67.38  ? 462 HIS A N    1 
ATOM   6172  C CA   . HIS A 1 418 ? 16.984  -42.040  0.356   1.00 68.78  ? 462 HIS A CA   1 
ATOM   6173  C C    . HIS A 1 418 ? 16.050  -41.954  -0.840  1.00 74.23  ? 462 HIS A C    1 
ATOM   6174  O O    . HIS A 1 418 ? 14.965  -41.378  -0.722  1.00 73.97  ? 462 HIS A O    1 
ATOM   6175  C CB   . HIS A 1 418 ? 18.068  -40.964  0.226   1.00 76.12  ? 462 HIS A CB   1 
ATOM   6176  C CG   . HIS A 1 418 ? 18.948  -40.851  1.431   1.00 67.62  ? 462 HIS A CG   1 
ATOM   6177  N ND1  . HIS A 1 418 ? 20.321  -40.952  1.364   1.00 73.27  ? 462 HIS A ND1  1 
ATOM   6178  C CD2  . HIS A 1 418 ? 18.649  -40.647  2.736   1.00 71.45  ? 462 HIS A CD2  1 
ATOM   6179  C CE1  . HIS A 1 418 ? 20.830  -40.816  2.575   1.00 81.98  ? 462 HIS A CE1  1 
ATOM   6180  N NE2  . HIS A 1 418 ? 19.837  -40.629  3.426   1.00 83.05  ? 462 HIS A NE2  1 
ATOM   6181  H H    . HIS A 1 418 ? 18.216  -43.522  -0.049  1.00 80.85  ? 462 HIS A H    1 
ATOM   6182  H HA   . HIS A 1 418 ? 16.464  -41.837  1.149   1.00 82.54  ? 462 HIS A HA   1 
ATOM   6183  H HB2  . HIS A 1 418 ? 18.631  -41.177  -0.534  1.00 91.34  ? 462 HIS A HB2  1 
ATOM   6184  H HB3  . HIS A 1 418 ? 17.641  -40.104  0.088   1.00 91.34  ? 462 HIS A HB3  1 
ATOM   6185  H HD2  . HIS A 1 418 ? 17.799  -40.540  3.098   1.00 85.75  ? 462 HIS A HD2  1 
ATOM   6186  H HE1  . HIS A 1 418 ? 21.734  -40.844  2.792   1.00 98.38  ? 462 HIS A HE1  1 
ATOM   6187  H HE2  . HIS A 1 418 ? 19.921  -40.514  4.274   1.00 99.66  ? 462 HIS A HE2  1 
ATOM   6188  N N    . ILE A 1 419 ? 16.432  -42.507  -1.992  1.00 74.19  ? 463 ILE A N    1 
ATOM   6189  C CA   . ILE A 1 419 ? 15.604  -42.461  -3.190  1.00 72.18  ? 463 ILE A CA   1 
ATOM   6190  C C    . ILE A 1 419 ? 15.295  -43.843  -3.744  1.00 71.84  ? 463 ILE A C    1 
ATOM   6191  O O    . ILE A 1 419 ? 14.668  -43.945  -4.804  1.00 58.00  ? 463 ILE A O    1 
ATOM   6192  C CB   . ILE A 1 419 ? 16.241  -41.575  -4.284  1.00 68.49  ? 463 ILE A CB   1 
ATOM   6193  C CG1  . ILE A 1 419 ? 17.457  -42.260  -4.920  1.00 68.61  ? 463 ILE A CG1  1 
ATOM   6194  C CG2  . ILE A 1 419 ? 16.642  -40.224  -3.695  1.00 64.64  ? 463 ILE A CG2  1 
ATOM   6195  C CD1  . ILE A 1 419 ? 17.987  -41.546  -6.145  1.00 62.69  ? 463 ILE A CD1  1 
ATOM   6196  H H    . ILE A 1 419 ? 17.178  -42.920  -2.103  1.00 89.04  ? 463 ILE A H    1 
ATOM   6197  H HA   . ILE A 1 419 ? 14.756  -42.054  -2.953  1.00 86.61  ? 463 ILE A HA   1 
ATOM   6198  H HB   . ILE A 1 419 ? 15.579  -41.422  -4.977  1.00 82.19  ? 463 ILE A HB   1 
ATOM   6199  H HG12 . ILE A 1 419 ? 18.173  -42.298  -4.266  1.00 82.33  ? 463 ILE A HG12 1 
ATOM   6200  H HG13 . ILE A 1 419 ? 17.207  -43.159  -5.186  1.00 82.33  ? 463 ILE A HG13 1 
ATOM   6201  H HG21 . ILE A 1 419 ? 17.039  -39.681  -4.394  1.00 77.57  ? 463 ILE A HG21 1 
ATOM   6202  H HG22 . ILE A 1 419 ? 15.851  -39.786  -3.345  1.00 77.57  ? 463 ILE A HG22 1 
ATOM   6203  H HG23 . ILE A 1 419 ? 17.283  -40.369  -2.982  1.00 77.57  ? 463 ILE A HG23 1 
ATOM   6204  H HD11 . ILE A 1 419 ? 18.751  -42.036  -6.489  1.00 75.23  ? 463 ILE A HD11 1 
ATOM   6205  H HD12 . ILE A 1 419 ? 17.288  -41.510  -6.816  1.00 75.23  ? 463 ILE A HD12 1 
ATOM   6206  H HD13 . ILE A 1 419 ? 18.255  -40.648  -5.895  1.00 75.23  ? 463 ILE A HD13 1 
ATOM   6207  N N    . GLY A 1 420 ? 15.712  -44.904  -3.069  1.00 72.64  ? 464 GLY A N    1 
ATOM   6208  C CA   . GLY A 1 420 ? 15.362  -46.254  -3.486  1.00 76.45  ? 464 GLY A CA   1 
ATOM   6209  C C    . GLY A 1 420 ? 16.393  -46.867  -4.412  1.00 74.41  ? 464 GLY A C    1 
ATOM   6210  O O    . GLY A 1 420 ? 17.091  -46.185  -5.162  1.00 64.53  ? 464 GLY A O    1 
ATOM   6211  H H    . GLY A 1 420 ? 16.200  -44.869  -2.362  1.00 87.17  ? 464 GLY A H    1 
ATOM   6212  H HA2  . GLY A 1 420 ? 15.278  -46.821  -2.704  1.00 91.74  ? 464 GLY A HA2  1 
ATOM   6213  H HA3  . GLY A 1 420 ? 14.509  -46.238  -3.946  1.00 91.74  ? 464 GLY A HA3  1 
ATOM   6214  N N    . TYR A 1 421 ? 16.485  -48.197  -4.352  1.00 74.82  ? 465 TYR A N    1 
ATOM   6215  C CA   . TYR A 1 421 ? 17.412  -48.927  -5.212  1.00 78.64  ? 465 TYR A CA   1 
ATOM   6216  C C    . TYR A 1 421 ? 17.139  -48.639  -6.684  1.00 73.82  ? 465 TYR A C    1 
ATOM   6217  O O    . TYR A 1 421 ? 18.052  -48.286  -7.439  1.00 75.39  ? 465 TYR A O    1 
ATOM   6218  C CB   . TYR A 1 421 ? 17.306  -50.429  -4.927  1.00 80.91  ? 465 TYR A CB   1 
ATOM   6219  C CG   . TYR A 1 421 ? 18.134  -51.309  -5.844  1.00 89.58  ? 465 TYR A CG   1 
ATOM   6220  C CD1  . TYR A 1 421 ? 17.711  -51.597  -7.138  1.00 84.27  ? 465 TYR A CD1  1 
ATOM   6221  C CD2  . TYR A 1 421 ? 19.329  -51.869  -5.409  1.00 93.00  ? 465 TYR A CD2  1 
ATOM   6222  C CE1  . TYR A 1 421 ? 18.460  -52.400  -7.975  1.00 86.21  ? 465 TYR A CE1  1 
ATOM   6223  C CE2  . TYR A 1 421 ? 20.085  -52.677  -6.241  1.00 92.84  ? 465 TYR A CE2  1 
ATOM   6224  C CZ   . TYR A 1 421 ? 19.645  -52.939  -7.522  1.00 92.49  ? 465 TYR A CZ   1 
ATOM   6225  O OH   . TYR A 1 421 ? 20.391  -53.742  -8.354  1.00 84.12  ? 465 TYR A OH   1 
ATOM   6226  H H    . TYR A 1 421 ? 16.023  -48.696  -3.825  1.00 89.78  ? 465 TYR A H    1 
ATOM   6227  H HA   . TYR A 1 421 ? 18.318  -48.645  -5.012  1.00 94.37  ? 465 TYR A HA   1 
ATOM   6228  H HB2  . TYR A 1 421 ? 17.601  -50.593  -4.018  1.00 97.09  ? 465 TYR A HB2  1 
ATOM   6229  H HB3  . TYR A 1 421 ? 16.379  -50.697  -5.022  1.00 97.09  ? 465 TYR A HB3  1 
ATOM   6230  H HD1  . TYR A 1 421 ? 16.913  -51.234  -7.448  1.00 101.12 ? 465 TYR A HD1  1 
ATOM   6231  H HD2  . TYR A 1 421 ? 19.629  -51.692  -4.547  1.00 111.60 ? 465 TYR A HD2  1 
ATOM   6232  H HE1  . TYR A 1 421 ? 18.164  -52.580  -8.838  1.00 103.46 ? 465 TYR A HE1  1 
ATOM   6233  H HE2  . TYR A 1 421 ? 20.885  -53.041  -5.938  1.00 111.42 ? 465 TYR A HE2  1 
ATOM   6234  H HH   . TYR A 1 421 ? 21.084  -54.003  -7.957  1.00 100.94 ? 465 TYR A HH   1 
ATOM   6235  N N    . ASP A 1 422 ? 15.884  -48.794  -7.111  0.89 74.83  ? 466 ASP A N    1 
ATOM   6236  C CA   . ASP A 1 422 ? 15.561  -48.673  -8.529  0.89 75.67  ? 466 ASP A CA   1 
ATOM   6237  C C    . ASP A 1 422 ? 15.909  -47.289  -9.062  0.89 69.67  ? 466 ASP A C    1 
ATOM   6238  O O    . ASP A 1 422 ? 16.430  -47.158  -10.176 0.89 67.43  ? 466 ASP A O    1 
ATOM   6239  C CB   . ASP A 1 422 ? 14.080  -48.979  -8.755  0.89 87.59  ? 466 ASP A CB   1 
ATOM   6240  C CG   . ASP A 1 422 ? 13.692  -50.364  -8.274  0.89 79.20  ? 466 ASP A CG   1 
ATOM   6241  O OD1  . ASP A 1 422 ? 14.544  -51.275  -8.331  0.89 74.26  ? 466 ASP A OD1  1 
ATOM   6242  O OD2  . ASP A 1 422 ? 12.535  -50.540  -7.837  0.89 82.04  ? 466 ASP A OD2  1 
ATOM   6243  H H    . ASP A 1 422 ? 15.210  -48.967  -6.605  0.89 89.80  ? 466 ASP A H    1 
ATOM   6244  H HA   . ASP A 1 422 ? 16.080  -49.324  -9.027  0.89 90.81  ? 466 ASP A HA   1 
ATOM   6245  H HB2  . ASP A 1 422 ? 13.545  -48.331  -8.271  0.89 105.11 ? 466 ASP A HB2  1 
ATOM   6246  H HB3  . ASP A 1 422 ? 13.887  -48.926  -9.705  0.89 105.11 ? 466 ASP A HB3  1 
ATOM   6247  N N    . LYS A 1 423 ? 15.626  -46.241  -8.285  1.00 67.29  ? 467 LYS A N    1 
ATOM   6248  C CA   . LYS A 1 423 ? 15.986  -44.893  -8.711  1.00 71.58  ? 467 LYS A CA   1 
ATOM   6249  C C    . LYS A 1 423 ? 17.498  -44.703  -8.735  1.00 80.46  ? 467 LYS A C    1 
ATOM   6250  O O    . LYS A 1 423 ? 18.006  -43.874  -9.499  1.00 68.93  ? 467 LYS A O    1 
ATOM   6251  C CB   . LYS A 1 423 ? 15.333  -43.859  -7.792  1.00 60.85  ? 467 LYS A CB   1 
ATOM   6252  H H    . LYS A 1 423 ? 15.234  -46.285  -7.521  1.00 80.75  ? 467 LYS A H    1 
ATOM   6253  H HA   . LYS A 1 423 ? 15.652  -44.747  -9.610  1.00 85.90  ? 467 LYS A HA   1 
ATOM   6254  N N    . ALA A 1 424 ? 18.229  -45.458  -7.913  1.00 92.68  ? 468 ALA A N    1 
ATOM   6255  C CA   . ALA A 1 424 ? 19.686  -45.370  -7.918  1.00 76.95  ? 468 ALA A CA   1 
ATOM   6256  C C    . ALA A 1 424 ? 20.269  -46.020  -9.168  1.00 74.97  ? 468 ALA A C    1 
ATOM   6257  O O    . ALA A 1 424 ? 21.166  -45.462  -9.811  1.00 59.74  ? 468 ALA A O    1 
ATOM   6258  C CB   . ALA A 1 424 ? 20.251  -46.020  -6.655  1.00 78.70  ? 468 ALA A CB   1 
ATOM   6259  H H    . ALA A 1 424 ? 17.909  -46.023  -7.349  1.00 111.22 ? 468 ALA A H    1 
ATOM   6260  H HA   . ALA A 1 424 ? 19.946  -44.436  -7.917  1.00 92.35  ? 468 ALA A HA   1 
ATOM   6261  H HB1  . ALA A 1 424 ? 21.219  -45.955  -6.672  1.00 94.45  ? 468 ALA A HB1  1 
ATOM   6262  H HB2  . ALA A 1 424 ? 19.901  -45.557  -5.878  1.00 94.45  ? 468 ALA A HB2  1 
ATOM   6263  H HB3  . ALA A 1 424 ? 19.983  -46.952  -6.633  1.00 94.45  ? 468 ALA A HB3  1 
ATOM   6264  N N    . ALA A 1 425 ? 19.767  -47.204  -9.529  1.00 67.84  ? 469 ALA A N    1 
ATOM   6265  C CA   . ALA A 1 425 ? 20.224  -47.864  -10.747 1.00 63.01  ? 469 ALA A CA   1 
ATOM   6266  C C    . ALA A 1 425 ? 19.960  -47.011  -11.978 1.00 71.49  ? 469 ALA A C    1 
ATOM   6267  O O    . ALA A 1 425 ? 20.732  -47.061  -12.943 1.00 65.63  ? 469 ALA A O    1 
ATOM   6268  C CB   . ALA A 1 425 ? 19.549  -49.230  -10.886 1.00 64.23  ? 469 ALA A CB   1 
ATOM   6269  H H    . ALA A 1 425 ? 19.169  -47.639  -9.090  1.00 81.41  ? 469 ALA A H    1 
ATOM   6270  H HA   . ALA A 1 425 ? 21.181  -48.010  -10.685 1.00 75.61  ? 469 ALA A HA   1 
ATOM   6271  H HB1  . ALA A 1 425 ? 19.862  -49.656  -11.699 1.00 77.08  ? 469 ALA A HB1  1 
ATOM   6272  H HB2  . ALA A 1 425 ? 19.779  -49.775  -10.117 1.00 77.08  ? 469 ALA A HB2  1 
ATOM   6273  H HB3  . ALA A 1 425 ? 18.588  -49.104  -10.927 1.00 77.08  ? 469 ALA A HB3  1 
ATOM   6274  N N    . LYS A 1 426 ? 18.883  -46.224  -11.968 1.00 74.77  ? 470 LYS A N    1 
ATOM   6275  C CA   . LYS A 1 426 ? 18.605  -45.338  -13.093 1.00 70.25  ? 470 LYS A CA   1 
ATOM   6276  C C    . LYS A 1 426 ? 19.682  -44.268  -13.219 1.00 65.67  ? 470 LYS A C    1 
ATOM   6277  O O    . LYS A 1 426 ? 20.170  -43.990  -14.321 1.00 64.21  ? 470 LYS A O    1 
ATOM   6278  C CB   . LYS A 1 426 ? 17.225  -44.698  -12.929 1.00 72.51  ? 470 LYS A CB   1 
ATOM   6279  H H    . LYS A 1 426 ? 18.308  -46.186  -11.330 1.00 89.72  ? 470 LYS A H    1 
ATOM   6280  H HA   . LYS A 1 426 ? 18.600  -45.858  -13.911 1.00 84.30  ? 470 LYS A HA   1 
ATOM   6281  N N    . ILE A 1 427 ? 20.066  -43.654  -12.097 1.00 64.95  ? 471 ILE A N    1 
ATOM   6282  C CA   . ILE A 1 427 ? 21.162  -42.688  -12.114 1.00 70.30  ? 471 ILE A CA   1 
ATOM   6283  C C    . ILE A 1 427 ? 22.438  -43.352  -12.612 1.00 66.12  ? 471 ILE A C    1 
ATOM   6284  O O    . ILE A 1 427 ? 23.173  -42.786  -13.432 1.00 53.58  ? 471 ILE A O    1 
ATOM   6285  C CB   . ILE A 1 427 ? 21.355  -42.075  -10.713 1.00 75.04  ? 471 ILE A CB   1 
ATOM   6286  C CG1  . ILE A 1 427 ? 20.080  -41.360  -10.255 1.00 75.31  ? 471 ILE A CG1  1 
ATOM   6287  C CG2  . ILE A 1 427 ? 22.532  -41.099  -10.709 1.00 60.39  ? 471 ILE A CG2  1 
ATOM   6288  C CD1  . ILE A 1 427 ? 20.062  -41.032  -8.775  1.00 65.28  ? 471 ILE A CD1  1 
ATOM   6289  H H    . ILE A 1 427 ? 19.713  -43.779  -11.323 1.00 77.95  ? 471 ILE A H    1 
ATOM   6290  H HA   . ILE A 1 427 ? 20.939  -41.970  -12.726 1.00 84.37  ? 471 ILE A HA   1 
ATOM   6291  H HB   . ILE A 1 427 ? 21.548  -42.791  -10.088 1.00 90.05  ? 471 ILE A HB   1 
ATOM   6292  H HG12 . ILE A 1 427 ? 19.995  -40.526  -10.745 1.00 90.37  ? 471 ILE A HG12 1 
ATOM   6293  H HG13 . ILE A 1 427 ? 19.317  -41.930  -10.442 1.00 90.37  ? 471 ILE A HG13 1 
ATOM   6294  H HG21 . ILE A 1 427 ? 22.631  -40.729  -9.818  1.00 72.47  ? 471 ILE A HG21 1 
ATOM   6295  H HG22 . ILE A 1 427 ? 23.338  -41.575  -10.961 1.00 72.47  ? 471 ILE A HG22 1 
ATOM   6296  H HG23 . ILE A 1 427 ? 22.354  -40.388  -11.345 1.00 72.47  ? 471 ILE A HG23 1 
ATOM   6297  H HD11 . ILE A 1 427 ? 19.229  -40.583  -8.562  1.00 78.34  ? 471 ILE A HD11 1 
ATOM   6298  H HD12 . ILE A 1 427 ? 20.134  -41.856  -8.269  1.00 78.34  ? 471 ILE A HD12 1 
ATOM   6299  H HD13 . ILE A 1 427 ? 20.812  -40.452  -8.572  1.00 78.34  ? 471 ILE A HD13 1 
ATOM   6300  N N    . ALA A 1 428 ? 22.720  -44.563  -12.128 1.00 65.64  ? 472 ALA A N    1 
ATOM   6301  C CA   . ALA A 1 428 ? 23.930  -45.271  -12.531 1.00 64.21  ? 472 ALA A CA   1 
ATOM   6302  C C    . ALA A 1 428 ? 23.912  -45.580  -14.023 1.00 68.70  ? 472 ALA A C    1 
ATOM   6303  O O    . ALA A 1 428 ? 24.808  -45.170  -14.770 1.00 58.39  ? 472 ALA A O    1 
ATOM   6304  C CB   . ALA A 1 428 ? 24.075  -46.556  -11.714 1.00 60.13  ? 472 ALA A CB   1 
ATOM   6305  H H    . ALA A 1 428 ? 22.228  -44.992  -11.569 1.00 78.77  ? 472 ALA A H    1 
ATOM   6306  H HA   . ALA A 1 428 ? 24.701  -44.710  -12.349 1.00 77.06  ? 472 ALA A HA   1 
ATOM   6307  H HB1  . ALA A 1 428 ? 24.883  -47.017  -11.992 1.00 72.16  ? 472 ALA A HB1  1 
ATOM   6308  H HB2  . ALA A 1 428 ? 24.131  -46.328  -10.773 1.00 72.16  ? 472 ALA A HB2  1 
ATOM   6309  H HB3  . ALA A 1 428 ? 23.302  -47.120  -11.874 1.00 72.16  ? 472 ALA A HB3  1 
ATOM   6310  N N    . LYS A 1 429 ? 22.890  -46.311  -14.476 1.00 54.75  ? 473 LYS A N    1 
ATOM   6311  C CA   . LYS A 1 429 ? 22.818  -46.696  -15.881 1.00 54.73  ? 473 LYS A CA   1 
ATOM   6312  C C    . LYS A 1 429 ? 22.793  -45.480  -16.798 1.00 54.62  ? 473 LYS A C    1 
ATOM   6313  O O    . LYS A 1 429 ? 23.299  -45.544  -17.925 1.00 61.66  ? 473 LYS A O    1 
ATOM   6314  C CB   . LYS A 1 429 ? 21.585  -47.568  -16.118 1.00 55.34  ? 473 LYS A CB   1 
ATOM   6315  C CG   . LYS A 1 429 ? 21.605  -48.885  -15.355 1.00 58.49  ? 473 LYS A CG   1 
ATOM   6316  C CD   . LYS A 1 429 ? 20.277  -49.618  -15.468 1.00 56.70  ? 473 LYS A CD   1 
ATOM   6317  H H    . LYS A 1 429 ? 22.235  -46.592  -13.994 1.00 65.71  ? 473 LYS A H    1 
ATOM   6318  H HA   . LYS A 1 429 ? 23.603  -47.222  -16.104 1.00 65.68  ? 473 LYS A HA   1 
ATOM   6319  H HB2  . LYS A 1 429 ? 20.796  -47.077  -15.839 1.00 66.41  ? 473 LYS A HB2  1 
ATOM   6320  H HB3  . LYS A 1 429 ? 21.526  -47.775  -17.064 1.00 66.41  ? 473 LYS A HB3  1 
ATOM   6321  H HG2  . LYS A 1 429 ? 22.299  -49.456  -15.721 1.00 70.19  ? 473 LYS A HG2  1 
ATOM   6322  H HG3  . LYS A 1 429 ? 21.775  -48.709  -14.417 1.00 70.19  ? 473 LYS A HG3  1 
ATOM   6323  H HD2  . LYS A 1 429 ? 19.820  -49.320  -16.270 1.00 68.04  ? 473 LYS A HD2  1 
ATOM   6324  H HD3  . LYS A 1 429 ? 20.446  -50.572  -15.517 1.00 68.04  ? 473 LYS A HD3  1 
ATOM   6325  N N    . THR A 1 430 ? 22.218  -44.368  -16.338 1.00 60.04  ? 474 THR A N    1 
ATOM   6326  C CA   . THR A 1 430 ? 22.136  -43.170  -17.168 1.00 59.43  ? 474 THR A CA   1 
ATOM   6327  C C    . THR A 1 430 ? 23.488  -42.473  -17.267 1.00 64.16  ? 474 THR A C    1 
ATOM   6328  O O    . THR A 1 430 ? 23.922  -42.094  -18.361 1.00 43.86  ? 474 THR A O    1 
ATOM   6329  C CB   . THR A 1 430 ? 21.083  -42.213  -16.608 1.00 67.58  ? 474 THR A CB   1 
ATOM   6330  O OG1  . THR A 1 430 ? 19.829  -42.897  -16.483 1.00 71.52  ? 474 THR A OG1  1 
ATOM   6331  C CG2  . THR A 1 430 ? 20.908  -41.007  -17.524 1.00 40.56  ? 474 THR A CG2  1 
ATOM   6332  H H    . THR A 1 430 ? 21.870  -44.283  -15.556 1.00 72.05  ? 474 THR A H    1 
ATOM   6333  H HA   . THR A 1 430 ? 21.864  -43.424  -18.064 1.00 71.31  ? 474 THR A HA   1 
ATOM   6334  H HB   . THR A 1 430 ? 21.365  -41.896  -15.735 1.00 81.10  ? 474 THR A HB   1 
ATOM   6335  H HG1  . THR A 1 430 ? 19.910  -43.552  -15.964 1.00 85.83  ? 474 THR A HG1  1 
ATOM   6336  H HG21 . THR A 1 430 ? 20.238  -40.408  -17.158 1.00 48.67  ? 474 THR A HG21 1 
ATOM   6337  H HG22 . THR A 1 430 ? 21.747  -40.529  -17.606 1.00 48.67  ? 474 THR A HG22 1 
ATOM   6338  H HG23 . THR A 1 430 ? 20.623  -41.298  -18.404 1.00 48.67  ? 474 THR A HG23 1 
ATOM   6339  N N    . ALA A 1 431 ? 24.163  -42.284  -16.130 1.00 69.05  ? 475 ALA A N    1 
ATOM   6340  C CA   . ALA A 1 431 ? 25.490  -41.677  -16.153 1.00 63.92  ? 475 ALA A CA   1 
ATOM   6341  C C    . ALA A 1 431 ? 26.468  -42.540  -16.939 1.00 64.41  ? 475 ALA A C    1 
ATOM   6342  O O    . ALA A 1 431 ? 27.306  -42.019  -17.686 1.00 42.58  ? 475 ALA A O    1 
ATOM   6343  C CB   . ALA A 1 431 ? 25.993  -41.456  -14.727 1.00 48.11  ? 475 ALA A CB   1 
ATOM   6344  H H    . ALA A 1 431 ? 23.878  -42.496  -15.346 1.00 82.87  ? 475 ALA A H    1 
ATOM   6345  H HA   . ALA A 1 431 ? 25.434  -40.813  -16.590 1.00 76.70  ? 475 ALA A HA   1 
ATOM   6346  H HB1  . ALA A 1 431 ? 26.874  -41.052  -14.763 1.00 57.74  ? 475 ALA A HB1  1 
ATOM   6347  H HB2  . ALA A 1 431 ? 25.377  -40.866  -14.264 1.00 57.74  ? 475 ALA A HB2  1 
ATOM   6348  H HB3  . ALA A 1 431 ? 26.038  -42.311  -14.272 1.00 57.74  ? 475 ALA A HB3  1 
ATOM   6349  N N    . HIS A 1 432 ? 26.375  -43.863  -16.786 1.00 52.69  ? 476 HIS A N    1 
ATOM   6350  C CA   . HIS A 1 432 ? 27.213  -44.764  -17.571 1.00 48.06  ? 476 HIS A CA   1 
ATOM   6351  C C    . HIS A 1 432 ? 26.941  -44.593  -19.060 1.00 59.20  ? 476 HIS A C    1 
ATOM   6352  O O    . HIS A 1 432 ? 27.873  -44.488  -19.866 1.00 55.75  ? 476 HIS A O    1 
ATOM   6353  C CB   . HIS A 1 432 ? 26.967  -46.211  -17.141 1.00 55.78  ? 476 HIS A CB   1 
ATOM   6354  C CG   . HIS A 1 432 ? 27.838  -47.206  -17.844 1.00 59.17  ? 476 HIS A CG   1 
ATOM   6355  N ND1  . HIS A 1 432 ? 29.194  -47.021  -18.012 1.00 61.30  ? 476 HIS A ND1  1 
ATOM   6356  C CD2  . HIS A 1 432 ? 27.547  -48.397  -18.418 1.00 56.53  ? 476 HIS A CD2  1 
ATOM   6357  C CE1  . HIS A 1 432 ? 29.699  -48.054  -18.661 1.00 49.25  ? 476 HIS A CE1  1 
ATOM   6358  N NE2  . HIS A 1 432 ? 28.722  -48.904  -18.919 1.00 39.22  ? 476 HIS A NE2  1 
ATOM   6359  H H    . HIS A 1 432 ? 25.841  -44.258  -16.239 1.00 63.23  ? 476 HIS A H    1 
ATOM   6360  H HA   . HIS A 1 432 ? 28.145  -44.554  -17.408 1.00 57.67  ? 476 HIS A HA   1 
ATOM   6361  H HB2  . HIS A 1 432 ? 27.138  -46.287  -16.189 1.00 66.94  ? 476 HIS A HB2  1 
ATOM   6362  H HB3  . HIS A 1 432 ? 26.044  -46.440  -17.329 1.00 66.94  ? 476 HIS A HB3  1 
ATOM   6363  H HD2  . HIS A 1 432 ? 26.709  -48.797  -18.465 1.00 67.83  ? 476 HIS A HD2  1 
ATOM   6364  H HE1  . HIS A 1 432 ? 30.592  -48.165  -18.897 1.00 59.10  ? 476 HIS A HE1  1 
ATOM   6365  H HE2  . HIS A 1 432 ? 28.806  -49.652  -19.334 1.00 47.06  ? 476 HIS A HE2  1 
ATOM   6366  N N    . LYS A 1 433 ? 25.663  -44.559  -19.441 1.00 65.07  ? 477 LYS A N    1 
ATOM   6367  C CA   . LYS A 1 433 ? 25.309  -44.360  -20.842 1.00 57.57  ? 477 LYS A CA   1 
ATOM   6368  C C    . LYS A 1 433 ? 25.785  -43.003  -21.348 1.00 61.54  ? 477 LYS A C    1 
ATOM   6369  O O    . LYS A 1 433 ? 26.286  -42.893  -22.473 1.00 59.81  ? 477 LYS A O    1 
ATOM   6370  C CB   . LYS A 1 433 ? 23.796  -44.495  -21.019 1.00 57.89  ? 477 LYS A CB   1 
ATOM   6371  C CG   . LYS A 1 433 ? 23.275  -43.989  -22.355 1.00 61.83  ? 477 LYS A CG   1 
ATOM   6372  H H    . LYS A 1 433 ? 24.990  -44.647  -18.912 1.00 78.09  ? 477 LYS A H    1 
ATOM   6373  H HA   . LYS A 1 433 ? 25.736  -45.047  -21.377 1.00 69.09  ? 477 LYS A HA   1 
ATOM   6374  H HB2  . LYS A 1 433 ? 23.557  -45.432  -20.945 1.00 69.47  ? 477 LYS A HB2  1 
ATOM   6375  H HB3  . LYS A 1 433 ? 23.355  -43.989  -20.319 1.00 69.47  ? 477 LYS A HB3  1 
ATOM   6376  H HG2  . LYS A 1 433 ? 23.138  -43.031  -22.298 1.00 74.20  ? 477 LYS A HG2  1 
ATOM   6377  H HG3  . LYS A 1 433 ? 23.927  -44.190  -23.045 1.00 74.20  ? 477 LYS A HG3  1 
ATOM   6378  N N    . ASN A 1 434 ? 25.645  -41.960  -20.529 1.00 60.05  ? 478 ASN A N    1 
ATOM   6379  C CA   . ASN A 1 434 ? 25.954  -40.604  -20.961 1.00 57.22  ? 478 ASN A CA   1 
ATOM   6380  C C    . ASN A 1 434 ? 27.401  -40.203  -20.712 1.00 69.97  ? 478 ASN A C    1 
ATOM   6381  O O    . ASN A 1 434 ? 27.871  -39.232  -21.317 1.00 64.22  ? 478 ASN A O    1 
ATOM   6382  C CB   . ASN A 1 434 ? 25.029  -39.606  -20.255 1.00 68.37  ? 478 ASN A CB   1 
ATOM   6383  C CG   . ASN A 1 434 ? 23.609  -39.649  -20.790 1.00 79.37  ? 478 ASN A CG   1 
ATOM   6384  O OD1  . ASN A 1 434 ? 23.387  -39.926  -21.969 1.00 84.73  ? 478 ASN A OD1  1 
ATOM   6385  N ND2  . ASN A 1 434 ? 22.641  -39.374  -19.923 1.00 62.07  ? 478 ASN A ND2  1 
ATOM   6386  H H    . ASN A 1 434 ? 25.371  -42.015  -19.716 1.00 72.07  ? 478 ASN A H    1 
ATOM   6387  H HA   . ASN A 1 434 ? 25.789  -40.536  -21.915 1.00 68.66  ? 478 ASN A HA   1 
ATOM   6388  H HB2  . ASN A 1 434 ? 25.000  -39.816  -19.309 1.00 82.05  ? 478 ASN A HB2  1 
ATOM   6389  H HB3  . ASN A 1 434 ? 25.372  -38.709  -20.386 1.00 82.05  ? 478 ASN A HB3  1 
ATOM   6390  H HD21 . ASN A 1 434 ? 21.819  -39.386  -20.178 1.00 74.48  ? 478 ASN A HD21 1 
ATOM   6391  H HD22 . ASN A 1 434 ? 22.835  -39.185  -19.107 1.00 74.48  ? 478 ASN A HD22 1 
ATOM   6392  N N    . GLY A 1 435 ? 28.116  -40.916  -19.845 1.00 62.94  ? 479 GLY A N    1 
ATOM   6393  C CA   . GLY A 1 435 ? 29.499  -40.589  -19.567 1.00 56.69  ? 479 GLY A CA   1 
ATOM   6394  C C    . GLY A 1 435 ? 29.706  -39.431  -18.617 1.00 56.90  ? 479 GLY A C    1 
ATOM   6395  O O    . GLY A 1 435 ? 30.835  -38.938  -18.506 1.00 60.27  ? 479 GLY A O    1 
ATOM   6396  H H    . GLY A 1 435 ? 27.818  -41.593  -19.407 1.00 75.53  ? 479 GLY A H    1 
ATOM   6397  H HA2  . GLY A 1 435 ? 29.935  -41.367  -19.187 1.00 68.04  ? 479 GLY A HA2  1 
ATOM   6398  H HA3  . GLY A 1 435 ? 29.944  -40.373  -20.401 1.00 68.04  ? 479 GLY A HA3  1 
ATOM   6399  N N    . SER A 1 436 ? 28.660  -38.977  -17.935 1.00 61.16  ? 480 SER A N    1 
ATOM   6400  C CA   . SER A 1 436 ? 28.767  -37.911  -16.955 1.00 75.88  ? 480 SER A CA   1 
ATOM   6401  C C    . SER A 1 436 ? 28.889  -38.521  -15.559 1.00 64.22  ? 480 SER A C    1 
ATOM   6402  O O    . SER A 1 436 ? 29.046  -39.735  -15.397 1.00 54.37  ? 480 SER A O    1 
ATOM   6403  C CB   . SER A 1 436 ? 27.565  -36.970  -17.076 1.00 69.64  ? 480 SER A CB   1 
ATOM   6404  O OG   . SER A 1 436 ? 26.344  -37.680  -16.962 1.00 70.01  ? 480 SER A OG   1 
ATOM   6405  H H    . SER A 1 436 ? 27.861  -39.280  -18.027 1.00 73.40  ? 480 SER A H    1 
ATOM   6406  H HA   . SER A 1 436 ? 29.571  -37.398  -17.131 1.00 91.05  ? 480 SER A HA   1 
ATOM   6407  H HB2  . SER A 1 436 ? 27.611  -36.309  -16.369 1.00 83.57  ? 480 SER A HB2  1 
ATOM   6408  H HB3  . SER A 1 436 ? 27.594  -36.532  -17.941 1.00 83.57  ? 480 SER A HB3  1 
ATOM   6409  H HG   . SER A 1 436 ? 25.696  -37.151  -17.031 1.00 84.01  ? 480 SER A HG   1 
ATOM   6410  N N    . THR A 1 437 ? 28.816  -37.676  -14.535 1.00 66.79  ? 481 THR A N    1 
ATOM   6411  C CA   . THR A 1 437 ? 28.971  -38.121  -13.160 1.00 58.83  ? 481 THR A CA   1 
ATOM   6412  C C    . THR A 1 437 ? 27.620  -38.510  -12.563 1.00 57.36  ? 481 THR A C    1 
ATOM   6413  O O    . THR A 1 437 ? 26.564  -38.338  -13.174 1.00 56.31  ? 481 THR A O    1 
ATOM   6414  C CB   . THR A 1 437 ? 29.625  -37.027  -12.314 1.00 56.72  ? 481 THR A CB   1 
ATOM   6415  O OG1  . THR A 1 437 ? 28.712  -35.935  -12.150 1.00 53.16  ? 481 THR A OG1  1 
ATOM   6416  C CG2  . THR A 1 437 ? 30.902  -36.522  -12.977 1.00 55.55  ? 481 THR A CG2  1 
ATOM   6417  H H    . THR A 1 437 ? 28.676  -36.831  -14.615 1.00 80.15  ? 481 THR A H    1 
ATOM   6418  H HA   . THR A 1 437 ? 29.547  -38.901  -13.141 1.00 70.60  ? 481 THR A HA   1 
ATOM   6419  H HB   . THR A 1 437 ? 29.855  -37.387  -11.444 1.00 68.06  ? 481 THR A HB   1 
ATOM   6420  H HG1  . THR A 1 437 ? 29.067  -35.331  -11.686 1.00 63.79  ? 481 THR A HG1  1 
ATOM   6421  H HG21 . THR A 1 437 ? 31.307  -35.829  -12.432 1.00 66.67  ? 481 THR A HG21 1 
ATOM   6422  H HG22 . THR A 1 437 ? 31.533  -37.251  -13.080 1.00 66.67  ? 481 THR A HG22 1 
ATOM   6423  H HG23 . THR A 1 437 ? 30.698  -36.156  -13.852 1.00 66.67  ? 481 THR A HG23 1 
ATOM   6424  N N    . LEU A 1 438 ? 27.668  -39.045  -11.340 1.00 64.38  ? 482 LEU A N    1 
ATOM   6425  C CA   . LEU A 1 438 ? 26.441  -39.420  -10.645 1.00 58.97  ? 482 LEU A CA   1 
ATOM   6426  C C    . LEU A 1 438 ? 25.655  -38.190  -10.208 1.00 66.95  ? 482 LEU A C    1 
ATOM   6427  O O    . LEU A 1 438 ? 24.420  -38.181  -10.272 1.00 52.56  ? 482 LEU A O    1 
ATOM   6428  C CB   . LEU A 1 438 ? 26.771  -40.296  -9.435  1.00 62.23  ? 482 LEU A CB   1 
ATOM   6429  C CG   . LEU A 1 438 ? 27.309  -41.699  -9.718  1.00 58.60  ? 482 LEU A CG   1 
ATOM   6430  C CD1  . LEU A 1 438 ? 27.827  -42.337  -8.436  1.00 46.41  ? 482 LEU A CD1  1 
ATOM   6431  C CD2  . LEU A 1 438 ? 26.237  -42.574  -10.352 1.00 43.92  ? 482 LEU A CD2  1 
ATOM   6432  H H    . LEU A 1 438 ? 28.390  -39.199  -10.899 1.00 77.25  ? 482 LEU A H    1 
ATOM   6433  H HA   . LEU A 1 438 ? 25.882  -39.936  -11.246 1.00 70.77  ? 482 LEU A HA   1 
ATOM   6434  H HB2  . LEU A 1 438 ? 27.438  -39.836  -8.903  1.00 74.68  ? 482 LEU A HB2  1 
ATOM   6435  H HB3  . LEU A 1 438 ? 25.962  -40.401  -8.910  1.00 74.68  ? 482 LEU A HB3  1 
ATOM   6436  H HG   . LEU A 1 438 ? 28.050  -41.634  -10.341 1.00 70.33  ? 482 LEU A HG   1 
ATOM   6437  H HD11 . LEU A 1 438 ? 28.163  -43.224  -8.638  1.00 55.69  ? 482 LEU A HD11 1 
ATOM   6438  H HD12 . LEU A 1 438 ? 28.540  -41.787  -8.076  1.00 55.69  ? 482 LEU A HD12 1 
ATOM   6439  H HD13 . LEU A 1 438 ? 27.099  -42.396  -7.798  1.00 55.69  ? 482 LEU A HD13 1 
ATOM   6440  H HD21 . LEU A 1 438 ? 26.607  -43.455  -10.519 1.00 52.71  ? 482 LEU A HD21 1 
ATOM   6441  H HD22 . LEU A 1 438 ? 25.485  -42.641  -9.743  1.00 52.71  ? 482 LEU A HD22 1 
ATOM   6442  H HD23 . LEU A 1 438 ? 25.954  -42.170  -11.186 1.00 52.71  ? 482 LEU A HD23 1 
ATOM   6443  N N    . LYS A 1 439 ? 26.351  -37.144  -9.758  1.00 74.77  ? 483 LYS A N    1 
ATOM   6444  C CA   . LYS A 1 439 ? 25.668  -35.946  -9.278  1.00 61.85  ? 483 LYS A CA   1 
ATOM   6445  C C    . LYS A 1 439 ? 25.007  -35.195  -10.427 1.00 75.96  ? 483 LYS A C    1 
ATOM   6446  O O    . LYS A 1 439 ? 23.848  -34.777  -10.324 1.00 83.55  ? 483 LYS A O    1 
ATOM   6447  C CB   . LYS A 1 439 ? 26.656  -35.042  -8.540  1.00 49.63  ? 483 LYS A CB   1 
ATOM   6448  H H    . LYS A 1 439 ? 27.210  -37.104  -9.720  1.00 89.73  ? 483 LYS A H    1 
ATOM   6449  H HA   . LYS A 1 439 ? 24.975  -36.207  -8.652  1.00 74.22  ? 483 LYS A HA   1 
ATOM   6450  N N    . GLU A 1 440 ? 25.732  -35.011  -11.534 1.00 67.75  ? 484 GLU A N    1 
ATOM   6451  C CA   . GLU A 1 440 ? 25.161  -34.320  -12.685 1.00 56.85  ? 484 GLU A CA   1 
ATOM   6452  C C    . GLU A 1 440 ? 23.954  -35.072  -13.232 1.00 64.52  ? 484 GLU A C    1 
ATOM   6453  O O    . GLU A 1 440 ? 22.979  -34.457  -13.680 1.00 76.54  ? 484 GLU A O    1 
ATOM   6454  C CB   . GLU A 1 440 ? 26.224  -34.150  -13.770 1.00 62.07  ? 484 GLU A CB   1 
ATOM   6455  C CG   . GLU A 1 440 ? 27.423  -33.318  -13.336 1.00 73.92  ? 484 GLU A CG   1 
ATOM   6456  C CD   . GLU A 1 440 ? 28.572  -33.387  -14.324 1.00 77.83  ? 484 GLU A CD   1 
ATOM   6457  O OE1  . GLU A 1 440 ? 28.525  -34.240  -15.235 1.00 62.13  ? 484 GLU A OE1  1 
ATOM   6458  O OE2  . GLU A 1 440 ? 29.524  -32.589  -14.188 1.00 82.57  ? 484 GLU A OE2  1 
ATOM   6459  H H    . GLU A 1 440 ? 26.544  -35.273  -11.640 1.00 81.30  ? 484 GLU A H    1 
ATOM   6460  H HA   . GLU A 1 440 ? 24.866  -33.438  -12.412 1.00 68.22  ? 484 GLU A HA   1 
ATOM   6461  H HB2  . GLU A 1 440 ? 26.550  -35.026  -14.028 1.00 74.49  ? 484 GLU A HB2  1 
ATOM   6462  H HB3  . GLU A 1 440 ? 25.821  -33.711  -14.536 1.00 74.49  ? 484 GLU A HB3  1 
ATOM   6463  H HG2  . GLU A 1 440 ? 27.151  -32.390  -13.257 1.00 88.70  ? 484 GLU A HG2  1 
ATOM   6464  H HG3  . GLU A 1 440 ? 27.742  -33.645  -12.481 1.00 88.70  ? 484 GLU A HG3  1 
ATOM   6465  N N    . THR A 1 441 ? 24.000  -36.406  -13.203 1.00 65.04  ? 485 THR A N    1 
ATOM   6466  C CA   . THR A 1 441 ? 22.877  -37.202  -13.688 1.00 64.62  ? 485 THR A CA   1 
ATOM   6467  C C    . THR A 1 441 ? 21.709  -37.155  -12.710 1.00 62.12  ? 485 THR A C    1 
ATOM   6468  O O    . THR A 1 441 ? 20.570  -36.873  -13.099 1.00 70.49  ? 485 THR A O    1 
ATOM   6469  C CB   . THR A 1 441 ? 23.328  -38.645  -13.924 1.00 64.93  ? 485 THR A CB   1 
ATOM   6470  O OG1  . THR A 1 441 ? 24.259  -38.682  -15.015 1.00 55.07  ? 485 THR A OG1  1 
ATOM   6471  C CG2  . THR A 1 441 ? 22.144  -39.556  -14.244 1.00 58.05  ? 485 THR A CG2  1 
ATOM   6472  H H    . THR A 1 441 ? 24.664  -36.867  -12.910 1.00 78.05  ? 485 THR A H    1 
ATOM   6473  H HA   . THR A 1 441 ? 22.574  -36.839  -14.535 1.00 77.55  ? 485 THR A HA   1 
ATOM   6474  H HB   . THR A 1 441 ? 23.761  -38.980  -13.123 1.00 77.92  ? 485 THR A HB   1 
ATOM   6475  H HG1  . THR A 1 441 ? 24.930  -38.209  -14.837 1.00 66.09  ? 485 THR A HG1  1 
ATOM   6476  H HG21 . THR A 1 441 ? 22.454  -40.464  -14.390 1.00 69.67  ? 485 THR A HG21 1 
ATOM   6477  H HG22 . THR A 1 441 ? 21.515  -39.553  -13.506 1.00 69.67  ? 485 THR A HG22 1 
ATOM   6478  H HG23 . THR A 1 441 ? 21.693  -39.245  -15.044 1.00 69.67  ? 485 THR A HG23 1 
ATOM   6479  N N    . ALA A 1 442 ? 21.974  -37.432  -11.431 1.00 68.44  ? 486 ALA A N    1 
ATOM   6480  C CA   . ALA A 1 442 ? 20.907  -37.453  -10.436 1.00 82.52  ? 486 ALA A CA   1 
ATOM   6481  C C    . ALA A 1 442 ? 20.129  -36.144  -10.413 1.00 81.52  ? 486 ALA A C    1 
ATOM   6482  O O    . ALA A 1 442 ? 18.923  -36.142  -10.139 1.00 79.57  ? 486 ALA A O    1 
ATOM   6483  C CB   . ALA A 1 442 ? 21.490  -37.746  -9.054  1.00 70.71  ? 486 ALA A CB   1 
ATOM   6484  H H    . ALA A 1 442 ? 22.756  -37.609  -11.119 1.00 82.13  ? 486 ALA A H    1 
ATOM   6485  H HA   . ALA A 1 442 ? 20.286  -38.165  -10.656 1.00 99.03  ? 486 ALA A HA   1 
ATOM   6486  H HB1  . ALA A 1 442 ? 20.770  -37.758  -8.404  1.00 84.86  ? 486 ALA A HB1  1 
ATOM   6487  H HB2  . ALA A 1 442 ? 21.931  -38.610  -9.074  1.00 84.86  ? 486 ALA A HB2  1 
ATOM   6488  H HB3  . ALA A 1 442 ? 22.129  -37.053  -8.828  1.00 84.86  ? 486 ALA A HB3  1 
ATOM   6489  N N    . ILE A 1 443 ? 20.795  -35.025  -10.702 1.00 81.93  ? 487 ILE A N    1 
ATOM   6490  C CA   . ILE A 1 443 ? 20.119  -33.731  -10.691 1.00 78.55  ? 487 ILE A CA   1 
ATOM   6491  C C    . ILE A 1 443 ? 19.245  -33.578  -11.931 1.00 88.22  ? 487 ILE A C    1 
ATOM   6492  O O    . ILE A 1 443 ? 18.068  -33.209  -11.840 1.00 96.45  ? 487 ILE A O    1 
ATOM   6493  C CB   . ILE A 1 443 ? 21.151  -32.592  -10.578 1.00 84.26  ? 487 ILE A CB   1 
ATOM   6494  C CG1  . ILE A 1 443 ? 21.783  -32.598  -9.183  1.00 75.46  ? 487 ILE A CG1  1 
ATOM   6495  C CG2  . ILE A 1 443 ? 20.506  -31.235  -10.872 1.00 74.70  ? 487 ILE A CG2  1 
ATOM   6496  C CD1  . ILE A 1 443 ? 22.950  -31.641  -9.023  1.00 65.88  ? 487 ILE A CD1  1 
ATOM   6497  H H    . ILE A 1 443 ? 21.630  -34.989  -10.905 1.00 98.32  ? 487 ILE A H    1 
ATOM   6498  H HA   . ILE A 1 443 ? 19.541  -33.687  -9.914  1.00 94.26  ? 487 ILE A HA   1 
ATOM   6499  H HB   . ILE A 1 443 ? 21.850  -32.747  -11.232 1.00 101.11 ? 487 ILE A HB   1 
ATOM   6500  H HG12 . ILE A 1 443 ? 21.107  -32.349  -8.534  1.00 90.55  ? 487 ILE A HG12 1 
ATOM   6501  H HG13 . ILE A 1 443 ? 22.107  -33.492  -8.993  1.00 90.55  ? 487 ILE A HG13 1 
ATOM   6502  H HG21 . ILE A 1 443 ? 21.180  -30.542  -10.792 1.00 89.64  ? 487 ILE A HG21 1 
ATOM   6503  H HG22 . ILE A 1 443 ? 20.145  -31.245  -11.772 1.00 89.64  ? 487 ILE A HG22 1 
ATOM   6504  H HG23 . ILE A 1 443 ? 19.794  -31.079  -10.232 1.00 89.64  ? 487 ILE A HG23 1 
ATOM   6505  H HD11 . ILE A 1 443 ? 23.290  -31.707  -8.117  1.00 79.05  ? 487 ILE A HD11 1 
ATOM   6506  H HD12 . ILE A 1 443 ? 23.645  -31.882  -9.656  1.00 79.05  ? 487 ILE A HD12 1 
ATOM   6507  H HD13 . ILE A 1 443 ? 22.643  -30.738  -9.197  1.00 79.05  ? 487 ILE A HD13 1 
ATOM   6508  N N    . GLU A 1 444 ? 19.806  -33.866  -13.108 0.96 82.41  ? 488 GLU A N    1 
ATOM   6509  C CA   . GLU A 1 444 ? 19.086  -33.634  -14.355 0.96 78.16  ? 488 GLU A CA   1 
ATOM   6510  C C    . GLU A 1 444 ? 17.882  -34.552  -14.518 0.96 80.47  ? 488 GLU A C    1 
ATOM   6511  O O    . GLU A 1 444 ? 17.028  -34.282  -15.370 0.96 81.97  ? 488 GLU A O    1 
ATOM   6512  C CB   . GLU A 1 444 ? 20.034  -33.798  -15.543 0.96 68.02  ? 488 GLU A CB   1 
ATOM   6513  C CG   . GLU A 1 444 ? 21.038  -32.664  -15.675 0.96 81.18  ? 488 GLU A CG   1 
ATOM   6514  C CD   . GLU A 1 444 ? 21.913  -32.796  -16.904 0.96 88.31  ? 488 GLU A CD   1 
ATOM   6515  O OE1  . GLU A 1 444 ? 21.852  -33.851  -17.570 0.96 101.10 ? 488 GLU A OE1  1 
ATOM   6516  O OE2  . GLU A 1 444 ? 22.661  -31.842  -17.207 0.96 90.26  ? 488 GLU A OE2  1 
ATOM   6517  H H    . GLU A 1 444 ? 20.595  -34.192  -13.208 0.96 98.90  ? 488 GLU A H    1 
ATOM   6518  H HA   . GLU A 1 444 ? 18.762  -32.720  -14.360 0.96 93.80  ? 488 GLU A HA   1 
ATOM   6519  H HB2  . GLU A 1 444 ? 20.530  -34.625  -15.438 0.96 81.63  ? 488 GLU A HB2  1 
ATOM   6520  H HB3  . GLU A 1 444 ? 19.510  -33.829  -16.360 0.96 81.63  ? 488 GLU A HB3  1 
ATOM   6521  H HG2  . GLU A 1 444 ? 20.559  -31.823  -15.737 0.96 97.42  ? 488 GLU A HG2  1 
ATOM   6522  H HG3  . GLU A 1 444 ? 21.615  -32.661  -14.895 0.96 97.42  ? 488 GLU A HG3  1 
ATOM   6523  N N    . LEU A 1 445 ? 17.792  -35.626  -13.736 1.00 78.98  ? 489 LEU A N    1 
ATOM   6524  C CA   . LEU A 1 445 ? 16.599  -36.461  -13.724 1.00 83.18  ? 489 LEU A CA   1 
ATOM   6525  C C    . LEU A 1 445 ? 15.586  -36.025  -12.673 1.00 88.08  ? 489 LEU A C    1 
ATOM   6526  O O    . LEU A 1 445 ? 14.480  -36.573  -12.637 1.00 95.07  ? 489 LEU A O    1 
ATOM   6527  C CB   . LEU A 1 445 ? 16.976  -37.929  -13.490 1.00 84.12  ? 489 LEU A CB   1 
ATOM   6528  C CG   . LEU A 1 445 ? 17.373  -38.718  -14.742 1.00 82.54  ? 489 LEU A CG   1 
ATOM   6529  C CD1  . LEU A 1 445 ? 18.632  -38.149  -15.381 1.00 83.21  ? 489 LEU A CD1  1 
ATOM   6530  C CD2  . LEU A 1 445 ? 17.558  -40.192  -14.414 1.00 76.58  ? 489 LEU A CD2  1 
ATOM   6531  H H    . LEU A 1 445 ? 18.412  -35.892  -13.202 1.00 94.77  ? 489 LEU A H    1 
ATOM   6532  H HA   . LEU A 1 445 ? 16.168  -36.401  -14.591 1.00 99.82  ? 489 LEU A HA   1 
ATOM   6533  H HB2  . LEU A 1 445 ? 17.728  -37.958  -12.878 1.00 100.94 ? 489 LEU A HB2  1 
ATOM   6534  H HB3  . LEU A 1 445 ? 16.217  -38.381  -13.091 1.00 100.94 ? 489 LEU A HB3  1 
ATOM   6535  H HG   . LEU A 1 445 ? 16.657  -38.649  -15.392 1.00 99.06  ? 489 LEU A HG   1 
ATOM   6536  H HD11 . LEU A 1 445 ? 18.850  -38.673  -16.167 1.00 99.85  ? 489 LEU A HD11 1 
ATOM   6537  H HD12 . LEU A 1 445 ? 18.469  -37.227  -15.632 1.00 99.85  ? 489 LEU A HD12 1 
ATOM   6538  H HD13 . LEU A 1 445 ? 19.359  -38.195  -14.740 1.00 99.85  ? 489 LEU A HD13 1 
ATOM   6539  H HD21 . LEU A 1 445 ? 17.808  -40.666  -15.223 1.00 91.90  ? 489 LEU A HD21 1 
ATOM   6540  H HD22 . LEU A 1 445 ? 18.257  -40.282  -13.748 1.00 91.90  ? 489 LEU A HD22 1 
ATOM   6541  H HD23 . LEU A 1 445 ? 16.723  -40.545  -14.069 1.00 91.90  ? 489 LEU A HD23 1 
ATOM   6542  N N    . GLY A 1 446 ? 15.934  -35.058  -11.826 1.00 82.45  ? 490 GLY A N    1 
ATOM   6543  C CA   . GLY A 1 446 ? 15.008  -34.557  -10.832 1.00 80.15  ? 490 GLY A CA   1 
ATOM   6544  C C    . GLY A 1 446 ? 14.809  -35.455  -9.635  1.00 88.52  ? 490 GLY A C    1 
ATOM   6545  O O    . GLY A 1 446 ? 13.790  -35.335  -8.949  1.00 97.66  ? 490 GLY A O    1 
ATOM   6546  H H    . GLY A 1 446 ? 16.705  -34.678  -11.812 1.00 98.94  ? 490 GLY A H    1 
ATOM   6547  H HA2  . GLY A 1 446 ? 15.325  -33.698  -10.511 1.00 96.18  ? 490 GLY A HA2  1 
ATOM   6548  H HA3  . GLY A 1 446 ? 14.143  -34.420  -11.249 1.00 96.18  ? 490 GLY A HA3  1 
ATOM   6549  N N    . TYR A 1 447 ? 15.754  -36.355  -9.357  1.00 93.27  ? 491 TYR A N    1 
ATOM   6550  C CA   . TYR A 1 447 ? 15.626  -37.254  -8.217  1.00 94.76  ? 491 TYR A CA   1 
ATOM   6551  C C    . TYR A 1 447 ? 16.072  -36.618  -6.908  1.00 86.45  ? 491 TYR A C    1 
ATOM   6552  O O    . TYR A 1 447 ? 15.711  -37.121  -5.838  1.00 80.65  ? 491 TYR A O    1 
ATOM   6553  C CB   . TYR A 1 447 ? 16.440  -38.530  -8.457  1.00 88.92  ? 491 TYR A CB   1 
ATOM   6554  C CG   . TYR A 1 447 ? 15.957  -39.384  -9.612  1.00 84.68  ? 491 TYR A CG   1 
ATOM   6555  C CD1  . TYR A 1 447 ? 14.620  -39.395  -9.989  1.00 85.05  ? 491 TYR A CD1  1 
ATOM   6556  C CD2  . TYR A 1 447 ? 16.843  -40.182  -10.323 1.00 90.07  ? 491 TYR A CD2  1 
ATOM   6557  C CE1  . TYR A 1 447 ? 14.181  -40.176  -11.042 1.00 86.34  ? 491 TYR A CE1  1 
ATOM   6558  C CE2  . TYR A 1 447 ? 16.413  -40.966  -11.376 1.00 104.16 ? 491 TYR A CE2  1 
ATOM   6559  C CZ   . TYR A 1 447 ? 15.081  -40.960  -11.731 1.00 92.41  ? 491 TYR A CZ   1 
ATOM   6560  O OH   . TYR A 1 447 ? 14.648  -41.739  -12.780 1.00 62.62  ? 491 TYR A OH   1 
ATOM   6561  H H    . TYR A 1 447 ? 16.475  -36.463  -9.813  1.00 111.93 ? 491 TYR A H    1 
ATOM   6562  H HA   . TYR A 1 447 ? 14.695  -37.508  -8.122  1.00 113.72 ? 491 TYR A HA   1 
ATOM   6563  H HB2  . TYR A 1 447 ? 17.359  -38.280  -8.641  1.00 106.71 ? 491 TYR A HB2  1 
ATOM   6564  H HB3  . TYR A 1 447 ? 16.405  -39.075  -7.655  1.00 106.71 ? 491 TYR A HB3  1 
ATOM   6565  H HD1  . TYR A 1 447 ? 14.010  -38.868  -9.526  1.00 102.06 ? 491 TYR A HD1  1 
ATOM   6566  H HD2  . TYR A 1 447 ? 17.742  -40.190  -10.086 1.00 108.09 ? 491 TYR A HD2  1 
ATOM   6567  H HE1  . TYR A 1 447 ? 13.283  -40.174  -11.283 1.00 103.61 ? 491 TYR A HE1  1 
ATOM   6568  H HE2  . TYR A 1 447 ? 17.019  -41.495  -11.843 1.00 125.00 ? 491 TYR A HE2  1 
ATOM   6569  H HH   . TYR A 1 447 ? 15.294  -42.162  -13.110 1.00 75.15  ? 491 TYR A HH   1 
ATOM   6570  N N    . LEU A 1 448 ? 16.836  -35.532  -6.962  1.00 76.86  ? 492 LEU A N    1 
ATOM   6571  C CA   . LEU A 1 448 ? 17.379  -34.933  -5.752  1.00 81.99  ? 492 LEU A CA   1 
ATOM   6572  C C    . LEU A 1 448 ? 18.100  -33.648  -6.125  1.00 83.32  ? 492 LEU A C    1 
ATOM   6573  O O    . LEU A 1 448 ? 18.464  -33.434  -7.284  1.00 79.65  ? 492 LEU A O    1 
ATOM   6574  C CB   . LEU A 1 448 ? 18.330  -35.894  -5.032  1.00 85.57  ? 492 LEU A CB   1 
ATOM   6575  C CG   . LEU A 1 448 ? 19.422  -36.517  -5.909  1.00 77.99  ? 492 LEU A CG   1 
ATOM   6576  C CD1  . LEU A 1 448 ? 20.735  -35.764  -5.765  1.00 66.85  ? 492 LEU A CD1  1 
ATOM   6577  C CD2  . LEU A 1 448 ? 19.597  -37.989  -5.578  1.00 75.87  ? 492 LEU A CD2  1 
ATOM   6578  H H    . LEU A 1 448 ? 17.053  -35.124  -7.687  1.00 92.23  ? 492 LEU A H    1 
ATOM   6579  H HA   . LEU A 1 448 ? 16.653  -34.712  -5.148  1.00 98.39  ? 492 LEU A HA   1 
ATOM   6580  H HB2  . LEU A 1 448 ? 18.772  -35.411  -4.316  1.00 102.69 ? 492 LEU A HB2  1 
ATOM   6581  H HB3  . LEU A 1 448 ? 17.807  -36.621  -4.659  1.00 102.69 ? 492 LEU A HB3  1 
ATOM   6582  H HG   . LEU A 1 448 ? 19.148  -36.454  -6.837  1.00 93.59  ? 492 LEU A HG   1 
ATOM   6583  H HD11 . LEU A 1 448 ? 21.402  -36.183  -6.331  1.00 80.23  ? 492 LEU A HD11 1 
ATOM   6584  H HD12 . LEU A 1 448 ? 20.602  -34.843  -6.037  1.00 80.23  ? 492 LEU A HD12 1 
ATOM   6585  H HD13 . LEU A 1 448 ? 21.019  -35.799  -4.838  1.00 80.23  ? 492 LEU A HD13 1 
ATOM   6586  H HD21 . LEU A 1 448 ? 20.292  -38.359  -6.144  1.00 91.05  ? 492 LEU A HD21 1 
ATOM   6587  H HD22 . LEU A 1 448 ? 19.850  -38.075  -4.645  1.00 91.05  ? 492 LEU A HD22 1 
ATOM   6588  H HD23 . LEU A 1 448 ? 18.759  -38.450  -5.738  1.00 91.05  ? 492 LEU A HD23 1 
ATOM   6589  N N    . THR A 1 449 ? 18.303  -32.798  -5.124  1.00 80.50  ? 493 THR A N    1 
ATOM   6590  C CA   . THR A 1 449 ? 19.013  -31.543  -5.308  1.00 88.50  ? 493 THR A CA   1 
ATOM   6591  C C    . THR A 1 449 ? 20.506  -31.742  -5.058  1.00 82.57  ? 493 THR A C    1 
ATOM   6592  O O    . THR A 1 449 ? 20.937  -32.723  -4.446  1.00 71.00  ? 493 THR A O    1 
ATOM   6593  C CB   . THR A 1 449 ? 18.463  -30.450  -4.383  1.00 79.76  ? 493 THR A CB   1 
ATOM   6594  O OG1  . THR A 1 449 ? 19.315  -29.298  -4.444  1.00 95.77  ? 493 THR A OG1  1 
ATOM   6595  C CG2  . THR A 1 449 ? 18.366  -30.926  -2.936  1.00 74.91  ? 493 THR A CG2  1 
ATOM   6596  H H    . THR A 1 449 ? 18.034  -32.930  -4.318  1.00 96.60  ? 493 THR A H    1 
ATOM   6597  H HA   . THR A 1 449 ? 18.899  -31.247  -6.225  1.00 106.20 ? 493 THR A HA   1 
ATOM   6598  H HB   . THR A 1 449 ? 17.573  -30.202  -4.679  1.00 95.72  ? 493 THR A HB   1 
ATOM   6599  H HG1  . THR A 1 449 ? 19.019  -28.695  -3.939  1.00 114.93 ? 493 THR A HG1  1 
ATOM   6600  H HG21 . THR A 1 449 ? 18.016  -30.215  -2.376  1.00 89.90  ? 493 THR A HG21 1 
ATOM   6601  H HG22 . THR A 1 449 ? 17.776  -31.693  -2.878  1.00 89.90  ? 493 THR A HG22 1 
ATOM   6602  H HG23 . THR A 1 449 ? 19.245  -31.179  -2.611  1.00 89.90  ? 493 THR A HG23 1 
ATOM   6603  N N    . ALA A 1 450 ? 21.300  -30.794  -5.562  1.00 85.17  ? 494 ALA A N    1 
ATOM   6604  C CA   . ALA A 1 450 ? 22.747  -30.870  -5.385  1.00 70.74  ? 494 ALA A CA   1 
ATOM   6605  C C    . ALA A 1 450 ? 23.119  -30.911  -3.908  1.00 81.24  ? 494 ALA A C    1 
ATOM   6606  O O    . ALA A 1 450 ? 24.076  -31.590  -3.518  1.00 67.39  ? 494 ALA A O    1 
ATOM   6607  C CB   . ALA A 1 450 ? 23.421  -29.683  -6.072  1.00 72.22  ? 494 ALA A CB   1 
ATOM   6608  H H    . ALA A 1 450 ? 21.029  -30.108  -6.003  1.00 102.21 ? 494 ALA A H    1 
ATOM   6609  H HA   . ALA A 1 450 ? 23.074  -31.683  -5.799  1.00 84.89  ? 494 ALA A HA   1 
ATOM   6610  H HB1  . ALA A 1 450 ? 24.381  -29.748  -5.945  1.00 86.66  ? 494 ALA A HB1  1 
ATOM   6611  H HB2  . ALA A 1 450 ? 23.210  -29.705  -7.019  1.00 86.66  ? 494 ALA A HB2  1 
ATOM   6612  H HB3  . ALA A 1 450 ? 23.090  -28.860  -5.678  1.00 86.66  ? 494 ALA A HB3  1 
ATOM   6613  N N    . GLU A 1 451 ? 22.367  -30.194  -3.070  1.00 98.19  ? 495 GLU A N    1 
ATOM   6614  C CA   . GLU A 1 451 ? 22.652  -30.171  -1.640  1.00 86.26  ? 495 GLU A CA   1 
ATOM   6615  C C    . GLU A 1 451 ? 22.257  -31.472  -0.955  1.00 82.89  ? 495 GLU A C    1 
ATOM   6616  O O    . GLU A 1 451 ? 22.793  -31.781  0.115   1.00 81.54  ? 495 GLU A O    1 
ATOM   6617  C CB   . GLU A 1 451 ? 21.929  -28.992  -0.981  1.00 90.24  ? 495 GLU A CB   1 
ATOM   6618  C CG   . GLU A 1 451 ? 22.491  -27.622  -1.359  1.00 83.41  ? 495 GLU A CG   1 
ATOM   6619  C CD   . GLU A 1 451 ? 22.241  -27.256  -2.811  1.00 102.41 ? 495 GLU A CD   1 
ATOM   6620  O OE1  . GLU A 1 451 ? 21.198  -27.670  -3.361  1.00 110.33 ? 495 GLU A OE1  1 
ATOM   6621  O OE2  . GLU A 1 451 ? 23.090  -26.559  -3.406  1.00 92.94  ? 495 GLU A OE2  1 
ATOM   6622  H H    . GLU A 1 451 ? 21.692  -29.717  -3.305  1.00 117.83 ? 495 GLU A H    1 
ATOM   6623  H HA   . GLU A 1 451 ? 23.605  -30.045  -1.512  1.00 103.51 ? 495 GLU A HA   1 
ATOM   6624  H HB2  . GLU A 1 451 ? 20.996  -29.012  -1.246  1.00 108.29 ? 495 GLU A HB2  1 
ATOM   6625  H HB3  . GLU A 1 451 ? 21.998  -29.084  -0.018  1.00 108.29 ? 495 GLU A HB3  1 
ATOM   6626  H HG2  . GLU A 1 451 ? 22.072  -26.946  -0.804  1.00 100.10 ? 495 GLU A HG2  1 
ATOM   6627  H HG3  . GLU A 1 451 ? 23.450  -27.624  -1.212  1.00 100.10 ? 495 GLU A HG3  1 
ATOM   6628  N N    . GLN A 1 452 ? 21.343  -32.242  -1.548  1.00 72.80  ? 496 GLN A N    1 
ATOM   6629  C CA   . GLN A 1 452 ? 21.007  -33.558  -1.019  1.00 73.06  ? 496 GLN A CA   1 
ATOM   6630  C C    . GLN A 1 452 ? 22.087  -34.573  -1.370  1.00 74.25  ? 496 GLN A C    1 
ATOM   6631  O O    . GLN A 1 452 ? 22.430  -35.432  -0.550  1.00 67.39  ? 496 GLN A O    1 
ATOM   6632  C CB   . GLN A 1 452 ? 19.657  -34.023  -1.566  1.00 71.62  ? 496 GLN A CB   1 
ATOM   6633  C CG   . GLN A 1 452 ? 18.444  -33.515  -0.803  1.00 71.38  ? 496 GLN A CG   1 
ATOM   6634  C CD   . GLN A 1 452 ? 17.140  -33.885  -1.488  1.00 84.12  ? 496 GLN A CD   1 
ATOM   6635  O OE1  . GLN A 1 452 ? 17.090  -34.042  -2.708  1.00 70.20  ? 496 GLN A OE1  1 
ATOM   6636  N NE2  . GLN A 1 452 ? 16.079  -34.032  -0.703  1.00 86.55  ? 496 GLN A NE2  1 
ATOM   6637  H H    . GLN A 1 452 ? 20.906  -32.023  -2.255  1.00 87.36  ? 496 GLN A H    1 
ATOM   6638  H HA   . GLN A 1 452 ? 20.941  -33.507  -0.052  1.00 87.67  ? 496 GLN A HA   1 
ATOM   6639  H HB2  . GLN A 1 452 ? 19.575  -33.718  -2.483  1.00 85.94  ? 496 GLN A HB2  1 
ATOM   6640  H HB3  . GLN A 1 452 ? 19.632  -34.993  -1.542  1.00 85.94  ? 496 GLN A HB3  1 
ATOM   6641  H HG2  . GLN A 1 452 ? 18.440  -33.905  0.085   1.00 85.66  ? 496 GLN A HG2  1 
ATOM   6642  H HG3  . GLN A 1 452 ? 18.489  -32.548  -0.742  1.00 85.66  ? 496 GLN A HG3  1 
ATOM   6643  H HE21 . GLN A 1 452 ? 16.153  -33.918  0.146   1.00 103.86 ? 496 GLN A HE21 1 
ATOM   6644  H HE22 . GLN A 1 452 ? 15.317  -34.241  -1.044  1.00 103.86 ? 496 GLN A HE22 1 
ATOM   6645  N N    . PHE A 1 453 ? 22.626  -34.485  -2.586  1.00 66.01  ? 497 PHE A N    1 
ATOM   6646  C CA   . PHE A 1 453 ? 23.705  -35.376  -2.991  1.00 69.59  ? 497 PHE A CA   1 
ATOM   6647  C C    . PHE A 1 453 ? 24.904  -35.233  -2.062  1.00 65.51  ? 497 PHE A C    1 
ATOM   6648  O O    . PHE A 1 453 ? 25.436  -36.227  -1.555  1.00 72.52  ? 497 PHE A O    1 
ATOM   6649  C CB   . PHE A 1 453 ? 24.102  -35.075  -4.437  1.00 62.63  ? 497 PHE A CB   1 
ATOM   6650  C CG   . PHE A 1 453 ? 24.987  -36.117  -5.053  1.00 63.91  ? 497 PHE A CG   1 
ATOM   6651  C CD1  . PHE A 1 453 ? 26.363  -36.050  -4.911  1.00 64.12  ? 497 PHE A CD1  1 
ATOM   6652  C CD2  . PHE A 1 453 ? 24.442  -37.165  -5.776  1.00 62.53  ? 497 PHE A CD2  1 
ATOM   6653  C CE1  . PHE A 1 453 ? 27.177  -37.009  -5.478  1.00 58.34  ? 497 PHE A CE1  1 
ATOM   6654  C CE2  . PHE A 1 453 ? 25.251  -38.126  -6.345  1.00 61.73  ? 497 PHE A CE2  1 
ATOM   6655  C CZ   . PHE A 1 453 ? 26.621  -38.049  -6.196  1.00 66.16  ? 497 PHE A CZ   1 
ATOM   6656  H H    . PHE A 1 453 ? 22.385  -33.921  -3.189  1.00 79.21  ? 497 PHE A H    1 
ATOM   6657  H HA   . PHE A 1 453 ? 23.395  -36.294  -2.947  1.00 83.51  ? 497 PHE A HA   1 
ATOM   6658  H HB2  . PHE A 1 453 ? 23.297  -35.013  -4.975  1.00 75.16  ? 497 PHE A HB2  1 
ATOM   6659  H HB3  . PHE A 1 453 ? 24.578  -34.230  -4.460  1.00 75.16  ? 497 PHE A HB3  1 
ATOM   6660  H HD1  . PHE A 1 453 ? 26.742  -35.352  -4.428  1.00 76.95  ? 497 PHE A HD1  1 
ATOM   6661  H HD2  . PHE A 1 453 ? 23.519  -37.221  -5.878  1.00 75.04  ? 497 PHE A HD2  1 
ATOM   6662  H HE1  . PHE A 1 453 ? 28.100  -36.955  -5.377  1.00 70.01  ? 497 PHE A HE1  1 
ATOM   6663  H HE2  . PHE A 1 453 ? 24.874  -38.825  -6.828  1.00 74.08  ? 497 PHE A HE2  1 
ATOM   6664  H HZ   . PHE A 1 453 ? 27.168  -38.696  -6.579  1.00 79.40  ? 497 PHE A HZ   1 
ATOM   6665  N N    . ASP A 1 454 ? 25.340  -33.993  -1.821  1.00 69.26  ? 498 ASP A N    1 
ATOM   6666  C CA   . ASP A 1 454 ? 26.492  -33.763  -0.957  1.00 59.65  ? 498 ASP A CA   1 
ATOM   6667  C C    . ASP A 1 454 ? 26.256  -34.286  0.454   1.00 65.74  ? 498 ASP A C    1 
ATOM   6668  O O    . ASP A 1 454 ? 27.207  -34.700  1.128   1.00 75.16  ? 498 ASP A O    1 
ATOM   6669  C CB   . ASP A 1 454 ? 26.821  -32.270  -0.918  1.00 64.38  ? 498 ASP A CB   1 
ATOM   6670  C CG   . ASP A 1 454 ? 27.234  -31.728  -2.273  1.00 63.32  ? 498 ASP A CG   1 
ATOM   6671  O OD1  . ASP A 1 454 ? 27.429  -32.537  -3.204  1.00 56.65  ? 498 ASP A OD1  1 
ATOM   6672  O OD2  . ASP A 1 454 ? 27.360  -30.493  -2.409  1.00 60.97  ? 498 ASP A OD2  1 
ATOM   6673  H H    . ASP A 1 454 ? 24.987  -33.278  -2.143  1.00 83.11  ? 498 ASP A H    1 
ATOM   6674  H HA   . ASP A 1 454 ? 27.260  -34.229  -1.324  1.00 71.59  ? 498 ASP A HA   1 
ATOM   6675  H HB2  . ASP A 1 454 ? 26.037  -31.781  -0.625  1.00 77.25  ? 498 ASP A HB2  1 
ATOM   6676  H HB3  . ASP A 1 454 ? 27.554  -32.124  -0.300  1.00 77.25  ? 498 ASP A HB3  1 
ATOM   6677  N N    . GLU A 1 455 ? 25.005  -34.279  0.918   1.00 71.62  ? 499 GLU A N    1 
ATOM   6678  C CA   . GLU A 1 455 ? 24.710  -34.724  2.276   1.00 70.75  ? 499 GLU A CA   1 
ATOM   6679  C C    . GLU A 1 455 ? 24.533  -36.236  2.349   1.00 68.69  ? 499 GLU A C    1 
ATOM   6680  O O    . GLU A 1 455 ? 24.925  -36.861  3.341   1.00 66.64  ? 499 GLU A O    1 
ATOM   6681  C CB   . GLU A 1 455 ? 23.456  -34.019  2.796   1.00 52.86  ? 499 GLU A CB   1 
ATOM   6682  H H    . GLU A 1 455 ? 24.317  -34.023  0.470   1.00 85.94  ? 499 GLU A H    1 
ATOM   6683  H HA   . GLU A 1 455 ? 25.450  -34.482  2.855   1.00 84.91  ? 499 GLU A HA   1 
ATOM   6684  N N    . TRP A 1 456 ? 23.946  -36.840  1.314   1.00 63.41  ? 500 TRP A N    1 
ATOM   6685  C CA   . TRP A 1 456 ? 23.693  -38.277  1.332   1.00 71.69  ? 500 TRP A CA   1 
ATOM   6686  C C    . TRP A 1 456 ? 24.936  -39.075  0.957   1.00 74.55  ? 500 TRP A C    1 
ATOM   6687  O O    . TRP A 1 456 ? 25.254  -40.076  1.609   1.00 76.53  ? 500 TRP A O    1 
ATOM   6688  C CB   . TRP A 1 456 ? 22.547  -38.618  0.378   1.00 69.13  ? 500 TRP A CB   1 
ATOM   6689  C CG   . TRP A 1 456 ? 21.227  -38.021  0.765   1.00 76.59  ? 500 TRP A CG   1 
ATOM   6690  C CD1  . TRP A 1 456 ? 20.862  -37.562  1.997   1.00 70.93  ? 500 TRP A CD1  1 
ATOM   6691  C CD2  . TRP A 1 456 ? 20.095  -37.818  -0.090  1.00 75.40  ? 500 TRP A CD2  1 
ATOM   6692  N NE1  . TRP A 1 456 ? 19.573  -37.089  1.963   1.00 60.43  ? 500 TRP A NE1  1 
ATOM   6693  C CE2  . TRP A 1 456 ? 19.080  -37.234  0.693   1.00 62.69  ? 500 TRP A CE2  1 
ATOM   6694  C CE3  . TRP A 1 456 ? 19.842  -38.074  -1.441  1.00 77.51  ? 500 TRP A CE3  1 
ATOM   6695  C CZ2  . TRP A 1 456 ? 17.832  -36.901  0.170   1.00 70.29  ? 500 TRP A CZ2  1 
ATOM   6696  C CZ3  . TRP A 1 456 ? 18.603  -37.743  -1.959  1.00 78.29  ? 500 TRP A CZ3  1 
ATOM   6697  C CH2  . TRP A 1 456 ? 17.614  -37.163  -1.155  1.00 73.15  ? 500 TRP A CH2  1 
ATOM   6698  H H    . TRP A 1 456 ? 23.689  -36.443  0.596   1.00 76.09  ? 500 TRP A H    1 
ATOM   6699  H HA   . TRP A 1 456 ? 23.427  -38.540  2.227   1.00 86.03  ? 500 TRP A HA   1 
ATOM   6700  H HB2  . TRP A 1 456 ? 22.771  -38.291  -0.507  1.00 82.96  ? 500 TRP A HB2  1 
ATOM   6701  H HB3  . TRP A 1 456 ? 22.439  -39.582  0.353   1.00 82.96  ? 500 TRP A HB3  1 
ATOM   6702  H HD1  . TRP A 1 456 ? 21.406  -37.572  2.752   1.00 85.12  ? 500 TRP A HD1  1 
ATOM   6703  H HE1  . TRP A 1 456 ? 19.145  -36.754  2.630   1.00 72.52  ? 500 TRP A HE1  1 
ATOM   6704  H HE3  . TRP A 1 456 ? 20.494  -38.459  -1.981  1.00 93.01  ? 500 TRP A HE3  1 
ATOM   6705  H HZ2  . TRP A 1 456 ? 17.174  -36.515  0.701   1.00 84.35  ? 500 TRP A HZ2  1 
ATOM   6706  H HZ3  . TRP A 1 456 ? 18.423  -37.909  -2.856  1.00 93.95  ? 500 TRP A HZ3  1 
ATOM   6707  H HH2  . TRP A 1 456 ? 16.790  -36.951  -1.530  1.00 87.79  ? 500 TRP A HH2  1 
ATOM   6708  N N    . VAL A 1 457 ? 25.646  -38.648  -0.085  1.00 67.97  ? 501 VAL A N    1 
ATOM   6709  C CA   . VAL A 1 457 ? 26.783  -39.392  -0.618  1.00 67.93  ? 501 VAL A CA   1 
ATOM   6710  C C    . VAL A 1 457 ? 28.037  -38.879  0.085   1.00 59.61  ? 501 VAL A C    1 
ATOM   6711  O O    . VAL A 1 457 ? 28.585  -37.836  -0.273  1.00 48.02  ? 501 VAL A O    1 
ATOM   6712  C CB   . VAL A 1 457 ? 26.883  -39.250  -2.138  1.00 60.22  ? 501 VAL A CB   1 
ATOM   6713  C CG1  . VAL A 1 457 ? 28.101  -39.989  -2.671  1.00 62.25  ? 501 VAL A CG1  1 
ATOM   6714  C CG2  . VAL A 1 457 ? 25.613  -39.771  -2.800  1.00 60.32  ? 501 VAL A CG2  1 
ATOM   6715  H H    . VAL A 1 457 ? 25.486  -37.916  -0.507  1.00 81.57  ? 501 VAL A H    1 
ATOM   6716  H HA   . VAL A 1 457 ? 26.678  -40.333  -0.407  1.00 81.52  ? 501 VAL A HA   1 
ATOM   6717  H HB   . VAL A 1 457 ? 26.977  -38.311  -2.363  1.00 72.26  ? 501 VAL A HB   1 
ATOM   6718  H HG11 . VAL A 1 457 ? 28.138  -39.881  -3.634  1.00 74.71  ? 501 VAL A HG11 1 
ATOM   6719  H HG12 . VAL A 1 457 ? 28.899  -39.615  -2.265  1.00 74.71  ? 501 VAL A HG12 1 
ATOM   6720  H HG13 . VAL A 1 457 ? 28.023  -40.929  -2.446  1.00 74.71  ? 501 VAL A HG13 1 
ATOM   6721  H HG21 . VAL A 1 457 ? 25.695  -39.672  -3.761  1.00 72.39  ? 501 VAL A HG21 1 
ATOM   6722  H HG22 . VAL A 1 457 ? 25.499  -40.706  -2.571  1.00 72.39  ? 501 VAL A HG22 1 
ATOM   6723  H HG23 . VAL A 1 457 ? 24.856  -39.257  -2.478  1.00 72.39  ? 501 VAL A HG23 1 
ATOM   6724  N N    . LYS A 1 458 ? 28.495  -39.625  1.083   1.00 57.42  ? 502 LYS A N    1 
ATOM   6725  C CA   . LYS A 1 458 ? 29.689  -39.275  1.851   1.00 52.86  ? 502 LYS A CA   1 
ATOM   6726  C C    . LYS A 1 458 ? 30.638  -40.466  1.857   1.00 40.37  ? 502 LYS A C    1 
ATOM   6727  O O    . LYS A 1 458 ? 30.372  -41.459  2.566   1.00 47.04  ? 502 LYS A O    1 
ATOM   6728  C CB   . LYS A 1 458 ? 29.319  -38.875  3.277   1.00 57.88  ? 502 LYS A CB   1 
ATOM   6729  C CG   . LYS A 1 458 ? 28.706  -37.490  3.398   1.00 61.55  ? 502 LYS A CG   1 
ATOM   6730  C CD   . LYS A 1 458 ? 28.065  -37.299  4.760   1.00 84.94  ? 502 LYS A CD   1 
ATOM   6731  C CE   . LYS A 1 458 ? 27.799  -35.835  5.060   1.00 70.54  ? 502 LYS A CE   1 
ATOM   6732  N NZ   . LYS A 1 458 ? 27.193  -35.662  6.408   1.00 70.25  ? 502 LYS A NZ   1 
ATOM   6733  H H    . LYS A 1 458 ? 28.124  -40.356  1.343   1.00 68.91  ? 502 LYS A H    1 
ATOM   6734  H HA   . LYS A 1 458 ? 30.138  -38.526  1.429   1.00 63.44  ? 502 LYS A HA   1 
ATOM   6735  H HB2  . LYS A 1 458 ? 28.675  -39.514  3.621   1.00 69.46  ? 502 LYS A HB2  1 
ATOM   6736  H HB3  . LYS A 1 458 ? 30.120  -38.892  3.823   1.00 69.46  ? 502 LYS A HB3  1 
ATOM   6737  H HG2  . LYS A 1 458 ? 29.400  -36.821  3.290   1.00 73.87  ? 502 LYS A HG2  1 
ATOM   6738  H HG3  . LYS A 1 458 ? 28.022  -37.381  2.720   1.00 73.87  ? 502 LYS A HG3  1 
ATOM   6739  H HD2  . LYS A 1 458 ? 27.218  -37.771  4.783   1.00 101.93 ? 502 LYS A HD2  1 
ATOM   6740  H HD3  . LYS A 1 458 ? 28.660  -37.645  5.444   1.00 101.93 ? 502 LYS A HD3  1 
ATOM   6741  H HE2  . LYS A 1 458 ? 28.637  -35.345  5.038   1.00 84.66  ? 502 LYS A HE2  1 
ATOM   6742  H HE3  . LYS A 1 458 ? 27.183  -35.479  4.401   1.00 84.66  ? 502 LYS A HE3  1 
ATOM   6743  H HZ1  . LYS A 1 458 ? 27.044  -34.798  6.566   1.00 84.30  ? 502 LYS A HZ1  1 
ATOM   6744  H HZ2  . LYS A 1 458 ? 26.420  -36.101  6.453   1.00 84.30  ? 502 LYS A HZ2  1 
ATOM   6745  H HZ3  . LYS A 1 458 ? 27.742  -35.979  7.032   1.00 84.30  ? 502 LYS A HZ3  1 
ATOM   6746  N N    . PRO A 1 459 ? 31.741  -40.428  1.101   1.00 43.82  ? 503 PRO A N    1 
ATOM   6747  C CA   . PRO A 1 459 ? 32.651  -41.585  1.100   1.00 46.18  ? 503 PRO A CA   1 
ATOM   6748  C C    . PRO A 1 459 ? 33.324  -41.820  2.439   1.00 33.21  ? 503 PRO A C    1 
ATOM   6749  O O    . PRO A 1 459 ? 33.684  -42.964  2.743   1.00 30.66  ? 503 PRO A O    1 
ATOM   6750  C CB   . PRO A 1 459 ? 33.675  -41.237  0.009   1.00 43.87  ? 503 PRO A CB   1 
ATOM   6751  C CG   . PRO A 1 459 ? 33.053  -40.134  -0.786  1.00 37.53  ? 503 PRO A CG   1 
ATOM   6752  C CD   . PRO A 1 459 ? 32.194  -39.380  0.171   1.00 43.56  ? 503 PRO A CD   1 
ATOM   6753  H HA   . PRO A 1 459 ? 32.170  -42.387  0.841   1.00 55.42  ? 503 PRO A HA   1 
ATOM   6754  H HB2  . PRO A 1 459 ? 34.500  -40.938  0.421   1.00 52.64  ? 503 PRO A HB2  1 
ATOM   6755  H HB3  . PRO A 1 459 ? 33.832  -42.014  -0.549  1.00 52.64  ? 503 PRO A HB3  1 
ATOM   6756  H HG2  . PRO A 1 459 ? 33.749  -39.560  -1.145  1.00 45.04  ? 503 PRO A HG2  1 
ATOM   6757  H HG3  . PRO A 1 459 ? 32.518  -40.510  -1.501  1.00 45.04  ? 503 PRO A HG3  1 
ATOM   6758  H HD2  . PRO A 1 459 ? 32.716  -38.711  0.642   1.00 52.28  ? 503 PRO A HD2  1 
ATOM   6759  H HD3  . PRO A 1 459 ? 31.438  -38.984  -0.290  1.00 52.28  ? 503 PRO A HD3  1 
ATOM   6760  N N    . LYS A 1 460 ? 33.509  -40.774  3.248   1.00 29.28  ? 504 LYS A N    1 
ATOM   6761  C CA   . LYS A 1 460 ? 34.123  -40.947  4.560   1.00 31.05  ? 504 LYS A CA   1 
ATOM   6762  C C    . LYS A 1 460 ? 33.324  -41.895  5.444   1.00 27.84  ? 504 LYS A C    1 
ATOM   6763  O O    . LYS A 1 460 ? 33.888  -42.478  6.377   1.00 31.05  ? 504 LYS A O    1 
ATOM   6764  C CB   . LYS A 1 460 ? 34.272  -39.590  5.250   1.00 24.15  ? 504 LYS A CB   1 
ATOM   6765  H H    . LYS A 1 460 ? 33.290  -39.964  3.061   1.00 35.14  ? 504 LYS A H    1 
ATOM   6766  H HA   . LYS A 1 460 ? 35.010  -41.323  4.445   1.00 37.27  ? 504 LYS A HA   1 
ATOM   6767  N N    . ASP A 1 461 ? 32.033  -42.065  5.173   1.00 36.38  ? 505 ASP A N    1 
ATOM   6768  C CA   . ASP A 1 461 ? 31.185  -42.969  5.937   1.00 35.66  ? 505 ASP A CA   1 
ATOM   6769  C C    . ASP A 1 461 ? 31.114  -44.367  5.338   1.00 39.63  ? 505 ASP A C    1 
ATOM   6770  O O    . ASP A 1 461 ? 30.348  -45.198  5.837   1.00 42.45  ? 505 ASP A O    1 
ATOM   6771  C CB   . ASP A 1 461 ? 29.768  -42.395  6.046   1.00 52.34  ? 505 ASP A CB   1 
ATOM   6772  C CG   . ASP A 1 461 ? 29.728  -41.071  6.786   1.00 53.68  ? 505 ASP A CG   1 
ATOM   6773  O OD1  . ASP A 1 461 ? 30.584  -40.852  7.668   1.00 31.29  ? 505 ASP A OD1  1 
ATOM   6774  O OD2  . ASP A 1 461 ? 28.837  -40.249  6.487   1.00 54.66  ? 505 ASP A OD2  1 
ATOM   6775  H H    . ASP A 1 461 ? 31.619  -41.659  4.537   1.00 43.66  ? 505 ASP A H    1 
ATOM   6776  H HA   . ASP A 1 461 ? 31.544  -43.049  6.835   1.00 42.79  ? 505 ASP A HA   1 
ATOM   6777  H HB2  . ASP A 1 461 ? 29.416  -42.251  5.154   1.00 62.81  ? 505 ASP A HB2  1 
ATOM   6778  H HB3  . ASP A 1 461 ? 29.208  -43.025  6.527   1.00 62.81  ? 505 ASP A HB3  1 
ATOM   6779  N N    . MET A 1 462 ? 31.886  -44.647  4.288   1.00 37.06  ? 506 MET A N    1 
ATOM   6780  C CA   . MET A 1 462 ? 31.848  -45.930  3.596   1.00 37.52  ? 506 MET A CA   1 
ATOM   6781  C C    . MET A 1 462 ? 33.145  -46.712  3.781   1.00 31.78  ? 506 MET A C    1 
ATOM   6782  O O    . MET A 1 462 ? 33.551  -47.470  2.896   1.00 27.24  ? 506 MET A O    1 
ATOM   6783  C CB   . MET A 1 462 ? 31.575  -45.719  2.108   1.00 39.29  ? 506 MET A CB   1 
ATOM   6784  C CG   . MET A 1 462 ? 30.425  -44.767  1.806   1.00 41.97  ? 506 MET A CG   1 
ATOM   6785  S SD   . MET A 1 462 ? 30.193  -44.483  0.038   1.00 51.28  ? 506 MET A SD   1 
ATOM   6786  C CE   . MET A 1 462 ? 29.748  -46.127  -0.518  1.00 39.27  ? 506 MET A CE   1 
ATOM   6787  H H    . MET A 1 462 ? 32.452  -44.094  3.951   1.00 44.47  ? 506 MET A H    1 
ATOM   6788  H HA   . MET A 1 462 ? 31.116  -46.454  3.958   1.00 45.03  ? 506 MET A HA   1 
ATOM   6789  H HB2  . MET A 1 462 ? 32.374  -45.357  1.694   1.00 47.15  ? 506 MET A HB2  1 
ATOM   6790  H HB3  . MET A 1 462 ? 31.359  -46.577  1.708   1.00 47.15  ? 506 MET A HB3  1 
ATOM   6791  H HG2  . MET A 1 462 ? 29.604  -45.141  2.160   1.00 50.37  ? 506 MET A HG2  1 
ATOM   6792  H HG3  . MET A 1 462 ? 30.607  -43.911  2.225   1.00 50.37  ? 506 MET A HG3  1 
ATOM   6793  H HE1  . MET A 1 462 ? 29.594  -46.105  -1.475  1.00 47.13  ? 506 MET A HE1  1 
ATOM   6794  H HE2  . MET A 1 462 ? 30.474  -46.737  -0.313  1.00 47.13  ? 506 MET A HE2  1 
ATOM   6795  H HE3  . MET A 1 462 ? 28.941  -46.408  -0.059  1.00 47.13  ? 506 MET A HE3  1 
ATOM   6796  N N    . LEU A 1 463 ? 33.802  -46.545  4.929   1.00 27.75  ? 507 LEU A N    1 
ATOM   6797  C CA   . LEU A 1 463 ? 35.135  -47.095  5.147   1.00 23.87  ? 507 LEU A CA   1 
ATOM   6798  C C    . LEU A 1 463 ? 35.179  -48.131  6.263   1.00 21.58  ? 507 LEU A C    1 
ATOM   6799  O O    . LEU A 1 463 ? 36.274  -48.530  6.679   1.00 26.69  ? 507 LEU A O    1 
ATOM   6800  C CB   . LEU A 1 463 ? 36.118  -45.960  5.449   1.00 21.73  ? 507 LEU A CB   1 
ATOM   6801  C CG   . LEU A 1 463 ? 36.185  -44.885  4.364   1.00 24.76  ? 507 LEU A CG   1 
ATOM   6802  C CD1  . LEU A 1 463 ? 36.990  -43.689  4.843   1.00 19.60  ? 507 LEU A CD1  1 
ATOM   6803  C CD2  . LEU A 1 463 ? 36.776  -45.456  3.082   1.00 27.49  ? 507 LEU A CD2  1 
ATOM   6804  H H    . LEU A 1 463 ? 33.491  -46.112  5.604   1.00 33.31  ? 507 LEU A H    1 
ATOM   6805  H HA   . LEU A 1 463 ? 35.428  -47.529  4.331   1.00 28.65  ? 507 LEU A HA   1 
ATOM   6806  H HB2  . LEU A 1 463 ? 35.851  -45.528  6.276   1.00 26.08  ? 507 LEU A HB2  1 
ATOM   6807  H HB3  . LEU A 1 463 ? 37.006  -46.335  5.547   1.00 26.08  ? 507 LEU A HB3  1 
ATOM   6808  H HG   . LEU A 1 463 ? 35.286  -44.579  4.168   1.00 29.72  ? 507 LEU A HG   1 
ATOM   6809  H HD11 . LEU A 1 463 ? 37.017  -43.024  4.138   1.00 23.52  ? 507 LEU A HD11 1 
ATOM   6810  H HD12 . LEU A 1 463 ? 36.565  -43.318  5.632   1.00 23.52  ? 507 LEU A HD12 1 
ATOM   6811  H HD13 . LEU A 1 463 ? 37.890  -43.980  5.058   1.00 23.52  ? 507 LEU A HD13 1 
ATOM   6812  H HD21 . LEU A 1 463 ? 36.808  -44.757  2.411   1.00 32.99  ? 507 LEU A HD21 1 
ATOM   6813  H HD22 . LEU A 1 463 ? 37.671  -45.782  3.265   1.00 32.99  ? 507 LEU A HD22 1 
ATOM   6814  H HD23 . LEU A 1 463 ? 36.215  -46.185  2.774   1.00 32.99  ? 507 LEU A HD23 1 
ATOM   6815  N N    . GLY A 1 464 ? 34.030  -48.582  6.753   1.00 25.40  ? 508 GLY A N    1 
ATOM   6816  C CA   . GLY A 1 464 ? 34.002  -49.555  7.816   1.00 31.66  ? 508 GLY A CA   1 
ATOM   6817  C C    . GLY A 1 464 ? 32.628  -50.160  8.010   1.00 29.08  ? 508 GLY A C    1 
ATOM   6818  O O    . GLY A 1 464 ? 31.654  -49.772  7.358   1.00 32.30  ? 508 GLY A O    1 
ATOM   6819  H H    . GLY A 1 464 ? 33.253  -48.334  6.480   1.00 30.48  ? 508 GLY A H    1 
ATOM   6820  H HA2  . GLY A 1 464 ? 34.626  -50.270  7.616   1.00 37.99  ? 508 GLY A HA2  1 
ATOM   6821  H HA3  . GLY A 1 464 ? 34.272  -49.134  8.646   1.00 37.99  ? 508 GLY A HA3  1 
ATOM   6822  N N    . PRO A 1 465 ? 32.528  -51.133  8.910   1.00 28.10  ? 509 PRO A N    1 
ATOM   6823  C CA   . PRO A 1 465 ? 31.215  -51.690  9.247   1.00 31.87  ? 509 PRO A CA   1 
ATOM   6824  C C    . PRO A 1 465 ? 30.434  -50.736  10.136  1.00 37.71  ? 509 PRO A C    1 
ATOM   6825  O O    . PRO A 1 465 ? 30.977  -49.792  10.713  1.00 27.22  ? 509 PRO A O    1 
ATOM   6826  C CB   . PRO A 1 465 ? 31.558  -52.988  9.983   1.00 24.30  ? 509 PRO A CB   1 
ATOM   6827  C CG   . PRO A 1 465 ? 32.885  -52.711  10.606  1.00 26.55  ? 509 PRO A CG   1 
ATOM   6828  C CD   . PRO A 1 465 ? 33.615  -51.788  9.658   1.00 22.45  ? 509 PRO A CD   1 
ATOM   6829  H HA   . PRO A 1 465 ? 30.707  -51.889  8.445   1.00 38.24  ? 509 PRO A HA   1 
ATOM   6830  H HB2  . PRO A 1 465 ? 30.888  -53.169  10.662  1.00 29.16  ? 509 PRO A HB2  1 
ATOM   6831  H HB3  . PRO A 1 465 ? 31.618  -53.720  9.351   1.00 29.16  ? 509 PRO A HB3  1 
ATOM   6832  H HG2  . PRO A 1 465 ? 32.755  -52.281  11.466  1.00 31.87  ? 509 PRO A HG2  1 
ATOM   6833  H HG3  . PRO A 1 465 ? 33.372  -53.543  10.712  1.00 31.87  ? 509 PRO A HG3  1 
ATOM   6834  H HD2  . PRO A 1 465 ? 34.127  -51.130  10.154  1.00 26.95  ? 509 PRO A HD2  1 
ATOM   6835  H HD3  . PRO A 1 465 ? 34.180  -52.298  9.057   1.00 26.95  ? 509 PRO A HD3  1 
ATOM   6836  N N    . LYS A 1 466 ? 29.135  -50.997  10.239  1.00 39.84  ? 510 LYS A N    1 
ATOM   6837  C CA   . LYS A 1 466 ? 28.250  -50.157  11.039  1.00 45.28  ? 510 LYS A CA   1 
ATOM   6838  C C    . LYS A 1 466 ? 27.505  -50.987  12.078  1.00 50.45  ? 510 LYS A C    1 
ATOM   6839  O O    . LYS A 1 466 ? 27.036  -50.461  13.088  1.00 56.44  ? 510 LYS A O    1 
ATOM   6840  C CB   . LYS A 1 466 ? 27.259  -49.420  10.137  1.00 47.22  ? 510 LYS A CB   1 
ATOM   6841  C CG   . LYS A 1 466 ? 27.912  -48.572  9.049   1.00 54.77  ? 510 LYS A CG   1 
ATOM   6842  C CD   . LYS A 1 466 ? 28.851  -47.519  9.628   1.00 50.59  ? 510 LYS A CD   1 
ATOM   6843  C CE   . LYS A 1 466 ? 29.506  -46.690  8.533   1.00 53.37  ? 510 LYS A CE   1 
ATOM   6844  N NZ   . LYS A 1 466 ? 30.645  -45.879  9.053   1.00 44.19  ? 510 LYS A NZ   1 
ATOM   6845  O OXT  . LYS A 1 466 ? 27.354  -52.200  11.934  1.00 43.52  ? 510 LYS A OXT  1 
ATOM   6846  H H    . LYS A 1 466 ? 28.740  -51.656  9.853   1.00 47.81  ? 510 LYS A H    1 
ATOM   6847  H HA   . LYS A 1 466 ? 28.781  -49.495  11.508  1.00 54.33  ? 510 LYS A HA   1 
ATOM   6848  H HB2  . LYS A 1 466 ? 26.690  -50.073  9.700   1.00 56.67  ? 510 LYS A HB2  1 
ATOM   6849  H HB3  . LYS A 1 466 ? 26.718  -48.830  10.686  1.00 56.67  ? 510 LYS A HB3  1 
ATOM   6850  H HG2  . LYS A 1 466 ? 28.428  -49.149  8.464   1.00 65.73  ? 510 LYS A HG2  1 
ATOM   6851  H HG3  . LYS A 1 466 ? 27.221  -48.116  8.544   1.00 65.73  ? 510 LYS A HG3  1 
ATOM   6852  H HD2  . LYS A 1 466 ? 28.347  -46.921  10.201  1.00 60.71  ? 510 LYS A HD2  1 
ATOM   6853  H HD3  . LYS A 1 466 ? 29.551  -47.959  10.135  1.00 60.71  ? 510 LYS A HD3  1 
ATOM   6854  H HE2  . LYS A 1 466 ? 29.846  -47.283  7.845   1.00 64.05  ? 510 LYS A HE2  1 
ATOM   6855  H HE3  . LYS A 1 466 ? 28.849  -46.084  8.157   1.00 64.05  ? 510 LYS A HE3  1 
ATOM   6856  H HZ1  . LYS A 1 466 ? 31.007  -45.406  8.392   1.00 53.03  ? 510 LYS A HZ1  1 
ATOM   6857  H HZ2  . LYS A 1 466 ? 30.358  -45.321  9.684   1.00 53.03  ? 510 LYS A HZ2  1 
ATOM   6858  H HZ3  . LYS A 1 466 ? 31.266  -46.414  9.400   1.00 53.03  ? 510 LYS A HZ3  1 
ATOM   6859  N N    . SER B 1 5   ? 15.079  -85.397  -16.132 1.00 29.89  ? 49  SER B N    1 
ATOM   6860  C CA   . SER B 1 5   ? 14.183  -84.885  -15.100 1.00 43.51  ? 49  SER B CA   1 
ATOM   6861  C C    . SER B 1 5   ? 14.737  -83.600  -14.502 1.00 31.28  ? 49  SER B C    1 
ATOM   6862  O O    . SER B 1 5   ? 15.630  -83.634  -13.655 1.00 32.08  ? 49  SER B O    1 
ATOM   6863  C CB   . SER B 1 5   ? 13.976  -85.929  -14.002 1.00 47.59  ? 49  SER B CB   1 
ATOM   6864  O OG   . SER B 1 5   ? 13.150  -85.418  -12.970 1.00 42.40  ? 49  SER B OG   1 
ATOM   6865  H HA   . SER B 1 5   ? 13.320  -84.688  -15.497 1.00 52.22  ? 49  SER B HA   1 
ATOM   6866  H HB2  . SER B 1 5   ? 13.553  -86.712  -14.386 1.00 57.11  ? 49  SER B HB2  1 
ATOM   6867  H HB3  . SER B 1 5   ? 14.838  -86.168  -13.627 1.00 57.11  ? 49  SER B HB3  1 
ATOM   6868  H HG   . SER B 1 5   ? 13.043  -85.999  -12.373 1.00 50.88  ? 49  SER B HG   1 
ATOM   6869  N N    . PHE B 1 6   ? 14.191  -82.466  -14.933 0.92 28.65  ? 50  PHE B N    1 
ATOM   6870  C CA   . PHE B 1 6   ? 14.742  -81.162  -14.601 0.92 32.55  ? 50  PHE B CA   1 
ATOM   6871  C C    . PHE B 1 6   ? 13.658  -80.246  -14.054 0.92 25.04  ? 50  PHE B C    1 
ATOM   6872  O O    . PHE B 1 6   ? 12.460  -80.485  -14.224 0.92 36.82  ? 50  PHE B O    1 
ATOM   6873  C CB   . PHE B 1 6   ? 15.384  -80.499  -15.830 0.92 38.82  ? 50  PHE B CB   1 
ATOM   6874  C CG   . PHE B 1 6   ? 16.560  -81.249  -16.385 0.92 44.25  ? 50  PHE B CG   1 
ATOM   6875  C CD1  . PHE B 1 6   ? 17.844  -80.971  -15.946 0.92 47.08  ? 50  PHE B CD1  1 
ATOM   6876  C CD2  . PHE B 1 6   ? 16.383  -82.225  -17.352 0.92 46.43  ? 50  PHE B CD2  1 
ATOM   6877  C CE1  . PHE B 1 6   ? 18.929  -81.656  -16.456 0.92 38.80  ? 50  PHE B CE1  1 
ATOM   6878  C CE2  . PHE B 1 6   ? 17.465  -82.914  -17.866 0.92 51.12  ? 50  PHE B CE2  1 
ATOM   6879  C CZ   . PHE B 1 6   ? 18.740  -82.628  -17.417 0.92 47.77  ? 50  PHE B CZ   1 
ATOM   6880  H H    . PHE B 1 6   ? 13.488  -82.428  -15.427 0.92 34.38  ? 50  PHE B H    1 
ATOM   6881  H HA   . PHE B 1 6   ? 15.425  -81.267  -13.920 0.92 39.06  ? 50  PHE B HA   1 
ATOM   6882  H HB2  . PHE B 1 6   ? 14.718  -80.432  -16.531 0.92 46.58  ? 50  PHE B HB2  1 
ATOM   6883  H HB3  . PHE B 1 6   ? 15.689  -79.612  -15.581 0.92 46.58  ? 50  PHE B HB3  1 
ATOM   6884  H HD1  . PHE B 1 6   ? 17.977  -80.317  -15.298 0.92 56.50  ? 50  PHE B HD1  1 
ATOM   6885  H HD2  . PHE B 1 6   ? 15.526  -82.420  -17.656 0.92 55.71  ? 50  PHE B HD2  1 
ATOM   6886  H HE1  . PHE B 1 6   ? 19.787  -81.462  -16.153 0.92 46.56  ? 50  PHE B HE1  1 
ATOM   6887  H HE2  . PHE B 1 6   ? 17.335  -83.568  -18.514 0.92 61.35  ? 50  PHE B HE2  1 
ATOM   6888  H HZ   . PHE B 1 6   ? 19.470  -83.090  -17.762 0.92 57.33  ? 50  PHE B HZ   1 
ATOM   6889  N N    . ARG B 1 7   ? 14.108  -79.187  -13.390 1.00 22.56  ? 51  ARG B N    1 
ATOM   6890  C CA   . ARG B 1 7   ? 13.281  -78.036  -13.075 1.00 32.73  ? 51  ARG B CA   1 
ATOM   6891  C C    . ARG B 1 7   ? 13.861  -76.826  -13.793 1.00 39.68  ? 51  ARG B C    1 
ATOM   6892  O O    . ARG B 1 7   ? 15.011  -76.838  -14.243 1.00 38.64  ? 51  ARG B O    1 
ATOM   6893  C CB   . ARG B 1 7   ? 13.209  -77.772  -11.565 1.00 23.58  ? 51  ARG B CB   1 
ATOM   6894  C CG   . ARG B 1 7   ? 14.546  -77.437  -10.909 1.00 34.80  ? 51  ARG B CG   1 
ATOM   6895  C CD   . ARG B 1 7   ? 14.350  -76.985  -9.470  1.00 34.78  ? 51  ARG B CD   1 
ATOM   6896  N NE   . ARG B 1 7   ? 15.613  -76.662  -8.811  1.00 44.27  ? 51  ARG B NE   1 
ATOM   6897  C CZ   . ARG B 1 7   ? 16.411  -77.551  -8.228  1.00 33.78  ? 51  ARG B CZ   1 
ATOM   6898  N NH1  . ARG B 1 7   ? 16.093  -78.839  -8.218  1.00 26.67  ? 51  ARG B NH1  1 
ATOM   6899  N NH2  . ARG B 1 7   ? 17.539  -77.152  -7.656  1.00 39.07  ? 51  ARG B NH2  1 
ATOM   6900  H H    . ARG B 1 7   ? 14.915  -79.114  -13.104 1.00 27.07  ? 51  ARG B H    1 
ATOM   6901  H HA   . ARG B 1 7   ? 12.381  -78.186  -13.404 1.00 39.27  ? 51  ARG B HA   1 
ATOM   6902  H HB2  . ARG B 1 7   ? 12.611  -77.024  -11.410 1.00 28.29  ? 51  ARG B HB2  1 
ATOM   6903  H HB3  . ARG B 1 7   ? 12.859  -78.565  -11.129 1.00 28.29  ? 51  ARG B HB3  1 
ATOM   6904  H HG2  . ARG B 1 7   ? 15.110  -78.226  -10.908 1.00 41.76  ? 51  ARG B HG2  1 
ATOM   6905  H HG3  . ARG B 1 7   ? 14.973  -76.718  -11.400 1.00 41.76  ? 51  ARG B HG3  1 
ATOM   6906  H HD2  . ARG B 1 7   ? 13.793  -76.191  -9.460  1.00 41.73  ? 51  ARG B HD2  1 
ATOM   6907  H HD3  . ARG B 1 7   ? 13.923  -77.698  -8.969  1.00 41.73  ? 51  ARG B HD3  1 
ATOM   6908  H HE   . ARG B 1 7   ? 15.857  -75.837  -8.799  1.00 53.13  ? 51  ARG B HE   1 
ATOM   6909  H HH11 . ARG B 1 7   ? 15.363  -79.104  -8.588  1.00 32.01  ? 51  ARG B HH11 1 
ATOM   6910  H HH12 . ARG B 1 7   ? 16.615  -79.408  -7.840  1.00 32.01  ? 51  ARG B HH12 1 
ATOM   6911  H HH21 . ARG B 1 7   ? 17.752  -76.319  -7.660  1.00 46.88  ? 51  ARG B HH21 1 
ATOM   6912  H HH22 . ARG B 1 7   ? 18.057  -77.726  -7.280  1.00 46.88  ? 51  ARG B HH22 1 
ATOM   6913  N N    . ILE B 1 8   ? 13.058  -75.773  -13.897 1.00 33.57  ? 52  ILE B N    1 
ATOM   6914  C CA   . ILE B 1 8   ? 13.442  -74.562  -14.612 1.00 37.63  ? 52  ILE B CA   1 
ATOM   6915  C C    . ILE B 1 8   ? 13.681  -73.461  -13.590 1.00 33.11  ? 52  ILE B C    1 
ATOM   6916  O O    . ILE B 1 8   ? 12.770  -73.089  -12.840 1.00 39.95  ? 52  ILE B O    1 
ATOM   6917  C CB   . ILE B 1 8   ? 12.375  -74.142  -15.633 1.00 46.98  ? 52  ILE B CB   1 
ATOM   6918  C CG1  . ILE B 1 8   ? 12.074  -75.286  -16.610 1.00 43.30  ? 52  ILE B CG1  1 
ATOM   6919  C CG2  . ILE B 1 8   ? 12.838  -72.914  -16.390 1.00 42.32  ? 52  ILE B CG2  1 
ATOM   6920  C CD1  . ILE B 1 8   ? 13.254  -75.725  -17.468 1.00 47.19  ? 52  ILE B CD1  1 
ATOM   6921  H H    . ILE B 1 8   ? 12.269  -75.736  -13.556 1.00 40.28  ? 52  ILE B H    1 
ATOM   6922  H HA   . ILE B 1 8   ? 14.272  -74.721  -15.088 1.00 45.16  ? 52  ILE B HA   1 
ATOM   6923  H HB   . ILE B 1 8   ? 11.560  -73.921  -15.155 1.00 56.38  ? 52  ILE B HB   1 
ATOM   6924  H HG12 . ILE B 1 8   ? 11.779  -76.057  -16.101 1.00 51.97  ? 52  ILE B HG12 1 
ATOM   6925  H HG13 . ILE B 1 8   ? 11.366  -75.001  -17.209 1.00 51.97  ? 52  ILE B HG13 1 
ATOM   6926  H HG21 . ILE B 1 8   ? 12.154  -72.662  -17.030 1.00 50.79  ? 52  ILE B HG21 1 
ATOM   6927  H HG22 . ILE B 1 8   ? 12.985  -72.192  -15.760 1.00 50.79  ? 52  ILE B HG22 1 
ATOM   6928  H HG23 . ILE B 1 8   ? 13.665  -73.123  -16.853 1.00 50.79  ? 52  ILE B HG23 1 
ATOM   6929  H HD11 . ILE B 1 8   ? 12.969  -76.447  -18.050 1.00 56.63  ? 52  ILE B HD11 1 
ATOM   6930  H HD12 . ILE B 1 8   ? 13.556  -74.971  -17.999 1.00 56.63  ? 52  ILE B HD12 1 
ATOM   6931  H HD13 . ILE B 1 8   ? 13.969  -76.029  -16.888 1.00 56.63  ? 52  ILE B HD13 1 
ATOM   6932  N N    . GLU B 1 9   ? 14.904  -72.942  -13.561 1.00 51.39  ? 53  GLU B N    1 
ATOM   6933  C CA   . GLU B 1 9   ? 15.254  -71.775  -12.769 1.00 42.11  ? 53  GLU B CA   1 
ATOM   6934  C C    . GLU B 1 9   ? 15.671  -70.649  -13.706 1.00 38.77  ? 53  GLU B C    1 
ATOM   6935  O O    . GLU B 1 9   ? 15.941  -70.862  -14.891 1.00 37.27  ? 53  GLU B O    1 
ATOM   6936  C CB   . GLU B 1 9   ? 16.377  -72.091  -11.771 1.00 31.62  ? 53  GLU B CB   1 
ATOM   6937  C CG   . GLU B 1 9   ? 16.051  -73.226  -10.812 1.00 39.07  ? 53  GLU B CG   1 
ATOM   6938  C CD   . GLU B 1 9   ? 16.936  -73.222  -9.578  1.00 36.03  ? 53  GLU B CD   1 
ATOM   6939  O OE1  . GLU B 1 9   ? 17.430  -72.139  -9.199  1.00 35.44  ? 53  GLU B OE1  1 
ATOM   6940  O OE2  . GLU B 1 9   ? 17.137  -74.304  -8.988  1.00 29.50  ? 53  GLU B OE2  1 
ATOM   6941  H H    . GLU B 1 9   ? 15.567  -73.262  -14.007 1.00 61.67  ? 53  GLU B H    1 
ATOM   6942  H HA   . GLU B 1 9   ? 14.476  -71.482  -12.269 1.00 50.54  ? 53  GLU B HA   1 
ATOM   6943  H HB2  . GLU B 1 9   ? 17.172  -72.341  -12.266 1.00 37.94  ? 53  GLU B HB2  1 
ATOM   6944  H HB3  . GLU B 1 9   ? 16.555  -71.298  -11.242 1.00 37.94  ? 53  GLU B HB3  1 
ATOM   6945  H HG2  . GLU B 1 9   ? 15.130  -73.139  -10.520 1.00 46.88  ? 53  GLU B HG2  1 
ATOM   6946  H HG3  . GLU B 1 9   ? 16.177  -74.072  -11.269 1.00 46.88  ? 53  GLU B HG3  1 
ATOM   6947  N N    . TYR B 1 10  ? 15.723  -69.434  -13.163 0.83 38.71  ? 54  TYR B N    1 
ATOM   6948  C CA   . TYR B 1 10  ? 15.990  -68.244  -13.959 0.83 46.86  ? 54  TYR B CA   1 
ATOM   6949  C C    . TYR B 1 10  ? 17.024  -67.368  -13.271 0.83 51.56  ? 54  TYR B C    1 
ATOM   6950  O O    . TYR B 1 10  ? 16.930  -67.117  -12.065 0.83 45.53  ? 54  TYR B O    1 
ATOM   6951  C CB   . TYR B 1 10  ? 14.708  -67.434  -14.189 0.83 46.62  ? 54  TYR B CB   1 
ATOM   6952  C CG   . TYR B 1 10  ? 13.645  -68.161  -14.977 0.83 48.61  ? 54  TYR B CG   1 
ATOM   6953  C CD1  . TYR B 1 10  ? 13.617  -68.097  -16.364 0.83 60.77  ? 54  TYR B CD1  1 
ATOM   6954  C CD2  . TYR B 1 10  ? 12.665  -68.905  -14.335 0.83 53.86  ? 54  TYR B CD2  1 
ATOM   6955  C CE1  . TYR B 1 10  ? 12.644  -68.759  -17.090 0.83 58.58  ? 54  TYR B CE1  1 
ATOM   6956  C CE2  . TYR B 1 10  ? 11.689  -69.570  -15.051 0.83 55.76  ? 54  TYR B CE2  1 
ATOM   6957  C CZ   . TYR B 1 10  ? 11.683  -69.493  -16.429 0.83 68.17  ? 54  TYR B CZ   1 
ATOM   6958  O OH   . TYR B 1 10  ? 10.712  -70.154  -17.147 0.83 76.41  ? 54  TYR B OH   1 
ATOM   6959  H H    . TYR B 1 10  ? 15.606  -69.274  -12.327 0.83 46.46  ? 54  TYR B H    1 
ATOM   6960  H HA   . TYR B 1 10  ? 16.342  -68.508  -14.823 0.83 56.24  ? 54  TYR B HA   1 
ATOM   6961  H HB2  . TYR B 1 10  ? 14.329  -67.201  -13.327 0.83 55.95  ? 54  TYR B HB2  1 
ATOM   6962  H HB3  . TYR B 1 10  ? 14.934  -66.625  -14.675 0.83 55.95  ? 54  TYR B HB3  1 
ATOM   6963  H HD1  . TYR B 1 10  ? 14.264  -67.603  -16.812 0.83 72.92  ? 54  TYR B HD1  1 
ATOM   6964  H HD2  . TYR B 1 10  ? 12.667  -68.959  -13.406 0.83 64.63  ? 54  TYR B HD2  1 
ATOM   6965  H HE1  . TYR B 1 10  ? 12.638  -68.708  -18.019 0.83 70.30  ? 54  TYR B HE1  1 
ATOM   6966  H HE2  . TYR B 1 10  ? 11.039  -70.066  -14.608 0.83 66.91  ? 54  TYR B HE2  1 
ATOM   6967  H HH   . TYR B 1 10  ? 10.194  -70.559  -16.624 0.83 91.69  ? 54  TYR B HH   1 
ATOM   6968  N N    . ASP B 1 11  ? 18.007  -66.915  -14.038 1.00 60.54  ? 55  ASP B N    1 
ATOM   6969  C CA   . ASP B 1 11  ? 18.840  -65.778  -13.676 1.00 59.14  ? 55  ASP B CA   1 
ATOM   6970  C C    . ASP B 1 11  ? 18.609  -64.676  -14.706 1.00 60.76  ? 55  ASP B C    1 
ATOM   6971  O O    . ASP B 1 11  ? 17.769  -64.800  -15.600 1.00 54.98  ? 55  ASP B O    1 
ATOM   6972  C CB   . ASP B 1 11  ? 20.319  -66.173  -13.580 1.00 51.55  ? 55  ASP B CB   1 
ATOM   6973  C CG   . ASP B 1 11  ? 20.906  -66.606  -14.911 1.00 51.15  ? 55  ASP B CG   1 
ATOM   6974  O OD1  . ASP B 1 11  ? 20.190  -66.576  -15.933 1.00 56.92  ? 55  ASP B OD1  1 
ATOM   6975  O OD2  . ASP B 1 11  ? 22.098  -66.981  -14.934 1.00 50.47  ? 55  ASP B OD2  1 
ATOM   6976  H H    . ASP B 1 11  ? 18.216  -67.261  -14.797 1.00 72.65  ? 55  ASP B H    1 
ATOM   6977  H HA   . ASP B 1 11  ? 18.561  -65.444  -12.809 1.00 70.97  ? 55  ASP B HA   1 
ATOM   6978  H HB2  . ASP B 1 11  ? 20.829  -65.411  -13.263 1.00 61.87  ? 55  ASP B HB2  1 
ATOM   6979  H HB3  . ASP B 1 11  ? 20.409  -66.912  -12.959 1.00 61.87  ? 55  ASP B HB3  1 
ATOM   6980  N N    . THR B 1 12  ? 19.368  -63.588  -14.581 0.88 69.78  ? 56  THR B N    1 
ATOM   6981  C CA   . THR B 1 12  ? 19.121  -62.422  -15.421 0.88 56.28  ? 56  THR B CA   1 
ATOM   6982  C C    . THR B 1 12  ? 19.329  -62.708  -16.904 0.88 46.01  ? 56  THR B C    1 
ATOM   6983  O O    . THR B 1 12  ? 18.833  -61.946  -17.741 0.88 50.10  ? 56  THR B O    1 
ATOM   6984  C CB   . THR B 1 12  ? 20.023  -61.265  -14.988 0.88 48.27  ? 56  THR B CB   1 
ATOM   6985  O OG1  . THR B 1 12  ? 21.397  -61.644  -15.133 0.88 69.48  ? 56  THR B OG1  1 
ATOM   6986  C CG2  . THR B 1 12  ? 19.749  -60.891  -13.538 0.88 48.94  ? 56  THR B CG2  1 
ATOM   6987  H H    . THR B 1 12  ? 20.020  -63.502  -14.028 0.88 83.74  ? 56  THR B H    1 
ATOM   6988  H HA   . THR B 1 12  ? 18.201  -62.141  -15.301 0.88 67.54  ? 56  THR B HA   1 
ATOM   6989  H HB   . THR B 1 12  ? 19.842  -60.491  -15.544 0.88 57.93  ? 56  THR B HB   1 
ATOM   6990  H HG1  . THR B 1 12  ? 21.896  -61.011  -14.897 0.88 83.38  ? 56  THR B HG1  1 
ATOM   6991  H HG21 . THR B 1 12  ? 20.324  -60.157  -13.271 0.88 58.74  ? 56  THR B HG21 1 
ATOM   6992  H HG22 . THR B 1 12  ? 18.823  -60.620  -13.435 0.88 58.74  ? 56  THR B HG22 1 
ATOM   6993  H HG23 . THR B 1 12  ? 19.920  -61.652  -12.961 0.88 58.74  ? 56  THR B HG23 1 
ATOM   6994  N N    . PHE B 1 13  ? 20.040  -63.781  -17.252 0.92 46.86  ? 57  PHE B N    1 
ATOM   6995  C CA   . PHE B 1 13  ? 20.346  -64.088  -18.643 0.92 52.83  ? 57  PHE B CA   1 
ATOM   6996  C C    . PHE B 1 13  ? 19.408  -65.119  -19.256 0.92 45.25  ? 57  PHE B C    1 
ATOM   6997  O O    . PHE B 1 13  ? 19.608  -65.501  -20.414 0.92 55.29  ? 57  PHE B O    1 
ATOM   6998  C CB   . PHE B 1 13  ? 21.795  -64.576  -18.771 0.92 55.04  ? 57  PHE B CB   1 
ATOM   6999  C CG   . PHE B 1 13  ? 22.830  -63.512  -18.507 0.92 54.92  ? 57  PHE B CG   1 
ATOM   7000  C CD1  . PHE B 1 13  ? 22.476  -62.174  -18.397 0.92 67.09  ? 57  PHE B CD1  1 
ATOM   7001  C CD2  . PHE B 1 13  ? 24.165  -63.854  -18.377 0.92 51.64  ? 57  PHE B CD2  1 
ATOM   7002  C CE1  . PHE B 1 13  ? 23.432  -61.208  -18.158 0.92 66.31  ? 57  PHE B CE1  1 
ATOM   7003  C CE2  . PHE B 1 13  ? 25.124  -62.888  -18.137 0.92 58.26  ? 57  PHE B CE2  1 
ATOM   7004  C CZ   . PHE B 1 13  ? 24.756  -61.564  -18.028 0.92 60.56  ? 57  PHE B CZ   1 
ATOM   7005  H H    . PHE B 1 13  ? 20.358  -64.350  -16.692 0.92 56.23  ? 57  PHE B H    1 
ATOM   7006  H HA   . PHE B 1 13  ? 20.264  -63.273  -19.163 0.92 63.40  ? 57  PHE B HA   1 
ATOM   7007  H HB2  . PHE B 1 13  ? 21.940  -65.293  -18.134 0.92 66.05  ? 57  PHE B HB2  1 
ATOM   7008  H HB3  . PHE B 1 13  ? 21.934  -64.906  -19.673 0.92 66.05  ? 57  PHE B HB3  1 
ATOM   7009  H HD1  . PHE B 1 13  ? 21.583  -61.927  -18.483 0.92 80.51  ? 57  PHE B HD1  1 
ATOM   7010  H HD2  . PHE B 1 13  ? 24.420  -64.745  -18.449 0.92 61.97  ? 57  PHE B HD2  1 
ATOM   7011  H HE1  . PHE B 1 13  ? 23.182  -60.315  -18.084 0.92 79.58  ? 57  PHE B HE1  1 
ATOM   7012  H HE2  . PHE B 1 13  ? 26.017  -63.132  -18.050 0.92 69.92  ? 57  PHE B HE2  1 
ATOM   7013  H HZ   . PHE B 1 13  ? 25.401  -60.913  -17.867 0.92 72.67  ? 57  PHE B HZ   1 
ATOM   7014  N N    . GLY B 1 14  ? 18.398  -65.577  -18.522 1.00 54.31  ? 58  GLY B N    1 
ATOM   7015  C CA   . GLY B 1 14  ? 17.383  -66.424  -19.114 0.83 54.47  ? 58  GLY B CA   1 
ATOM   7016  C C    . GLY B 1 14  ? 17.088  -67.716  -18.382 1.00 55.51  ? 58  GLY B C    1 
ATOM   7017  O O    . GLY B 1 14  ? 17.144  -67.784  -17.150 1.00 52.56  ? 58  GLY B O    1 
ATOM   7018  H H    . GLY B 1 14  ? 18.283  -65.412  -17.686 1.00 65.17  ? 58  GLY B H    1 
ATOM   7019  H HA2  . GLY B 1 14  ? 16.555  -65.922  -19.172 0.52 65.36  ? 58  GLY B HA2  1 
ATOM   7020  H HA3  . GLY B 1 14  ? 17.656  -66.652  -20.017 0.51 65.36  ? 58  GLY B HA3  1 
ATOM   7021  N N    . GLU B 1 15  ? 16.776  -68.751  -19.155 1.00 62.99  ? 59  GLU B N    1 
ATOM   7022  C CA   . GLU B 1 15  ? 16.261  -70.010  -18.643 1.00 50.24  ? 59  GLU B CA   1 
ATOM   7023  C C    . GLU B 1 15  ? 17.386  -71.027  -18.505 1.00 50.88  ? 59  GLU B C    1 
ATOM   7024  O O    . GLU B 1 15  ? 18.268  -71.112  -19.365 1.00 55.21  ? 59  GLU B O    1 
ATOM   7025  C CB   . GLU B 1 15  ? 15.180  -70.549  -19.584 1.00 63.54  ? 59  GLU B CB   1 
ATOM   7026  C CG   . GLU B 1 15  ? 14.491  -71.803  -19.109 1.00 65.63  ? 59  GLU B CG   1 
ATOM   7027  C CD   . GLU B 1 15  ? 13.461  -72.307  -20.101 1.00 60.31  ? 59  GLU B CD   1 
ATOM   7028  O OE1  . GLU B 1 15  ? 13.281  -71.656  -21.154 1.00 77.33  ? 59  GLU B OE1  1 
ATOM   7029  O OE2  . GLU B 1 15  ? 12.834  -73.351  -19.832 1.00 99.64  ? 59  GLU B OE2  1 
ATOM   7030  H H    . GLU B 1 15  ? 16.859  -68.744  -20.011 0.60 75.59  ? 59  GLU B H    1 
ATOM   7031  H HA   . GLU B 1 15  ? 15.865  -69.868  -17.769 0.47 60.29  ? 59  GLU B HA   1 
ATOM   7032  H HB2  . GLU B 1 15  ? 14.501  -69.866  -19.696 1.00 76.25  ? 59  GLU B HB2  1 
ATOM   7033  H HB3  . GLU B 1 15  ? 15.588  -70.746  -20.441 1.00 76.25  ? 59  GLU B HB3  1 
ATOM   7034  H HG2  . GLU B 1 15  ? 15.153  -72.500  -18.981 1.00 78.75  ? 59  GLU B HG2  1 
ATOM   7035  H HG3  . GLU B 1 15  ? 14.037  -71.617  -18.272 1.00 78.75  ? 59  GLU B HG3  1 
ATOM   7036  N N    . LEU B 1 16  ? 17.348  -71.801  -17.421 1.00 48.65  ? 60  LEU B N    1 
ATOM   7037  C CA   . LEU B 1 16  ? 18.339  -72.844  -17.185 1.00 57.32  ? 60  LEU B CA   1 
ATOM   7038  C C    . LEU B 1 16  ? 17.665  -74.074  -16.599 1.00 42.33  ? 60  LEU B C    1 
ATOM   7039  O O    . LEU B 1 16  ? 16.887  -73.968  -15.646 1.00 33.93  ? 60  LEU B O    1 
ATOM   7040  C CB   . LEU B 1 16  ? 19.449  -72.354  -16.246 1.00 42.95  ? 60  LEU B CB   1 
ATOM   7041  C CG   . LEU B 1 16  ? 20.339  -71.233  -16.787 1.00 36.48  ? 60  LEU B CG   1 
ATOM   7042  C CD1  . LEU B 1 16  ? 21.335  -70.793  -15.732 1.00 42.11  ? 60  LEU B CD1  1 
ATOM   7043  C CD2  . LEU B 1 16  ? 21.068  -71.671  -18.051 1.00 35.10  ? 60  LEU B CD2  1 
ATOM   7044  H H    . LEU B 1 16  ? 16.752  -71.740  -16.804 1.00 58.39  ? 60  LEU B H    1 
ATOM   7045  H HA   . LEU B 1 16  ? 18.745  -73.095  -18.029 1.00 68.79  ? 60  LEU B HA   1 
ATOM   7046  H HB2  . LEU B 1 16  ? 19.038  -72.029  -15.430 1.00 51.55  ? 60  LEU B HB2  1 
ATOM   7047  H HB3  . LEU B 1 16  ? 20.026  -73.106  -16.038 1.00 51.55  ? 60  LEU B HB3  1 
ATOM   7048  H HG   . LEU B 1 16  ? 19.783  -70.470  -17.011 1.00 43.78  ? 60  LEU B HG   1 
ATOM   7049  H HD11 . LEU B 1 16  ? 21.887  -70.083  -16.097 1.00 50.54  ? 60  LEU B HD11 1 
ATOM   7050  H HD12 . LEU B 1 16  ? 20.851  -70.471  -14.956 1.00 50.54  ? 60  LEU B HD12 1 
ATOM   7051  H HD13 . LEU B 1 16  ? 21.889  -71.550  -15.487 1.00 50.54  ? 60  LEU B HD13 1 
ATOM   7052  H HD21 . LEU B 1 16  ? 21.621  -70.939  -18.366 1.00 42.13  ? 60  LEU B HD21 1 
ATOM   7053  H HD22 . LEU B 1 16  ? 21.622  -72.440  -17.845 1.00 42.13  ? 60  LEU B HD22 1 
ATOM   7054  H HD23 . LEU B 1 16  ? 20.413  -71.907  -18.727 1.00 42.13  ? 60  LEU B HD23 1 
ATOM   7055  N N    . LYS B 1 17  ? 17.971  -75.234  -17.172 1.00 33.89  ? 61  LYS B N    1 
ATOM   7056  C CA   . LYS B 1 17  ? 17.474  -76.502  -16.658 1.00 27.31  ? 61  LYS B CA   1 
ATOM   7057  C C    . LYS B 1 17  ? 18.371  -76.969  -15.519 1.00 41.27  ? 61  LYS B C    1 
ATOM   7058  O O    . LYS B 1 17  ? 19.589  -77.093  -15.691 1.00 41.44  ? 61  LYS B O    1 
ATOM   7059  C CB   . LYS B 1 17  ? 17.430  -77.547  -17.772 1.00 35.80  ? 61  LYS B CB   1 
ATOM   7060  C CG   . LYS B 1 17  ? 16.463  -77.218  -18.899 1.00 27.92  ? 61  LYS B CG   1 
ATOM   7061  H H    . LYS B 1 17  ? 18.471  -75.312  -17.867 1.00 40.67  ? 61  LYS B H    1 
ATOM   7062  H HA   . LYS B 1 17  ? 16.575  -76.382  -16.313 1.00 32.77  ? 61  LYS B HA   1 
ATOM   7063  H HB2  . LYS B 1 17  ? 18.317  -77.629  -18.158 1.00 42.96  ? 61  LYS B HB2  1 
ATOM   7064  H HB3  . LYS B 1 17  ? 17.160  -78.397  -17.390 1.00 42.96  ? 61  LYS B HB3  1 
ATOM   7065  N N    . VAL B 1 18  ? 17.773  -77.223  -14.365 1.00 35.30  ? 62  VAL B N    1 
ATOM   7066  C CA   . VAL B 1 18  ? 18.476  -77.732  -13.190 1.00 27.08  ? 62  VAL B CA   1 
ATOM   7067  C C    . VAL B 1 18  ? 17.947  -79.132  -12.902 1.00 31.99  ? 62  VAL B C    1 
ATOM   7068  O O    . VAL B 1 18  ? 16.727  -79.313  -12.825 1.00 25.51  ? 62  VAL B O    1 
ATOM   7069  C CB   . VAL B 1 18  ? 18.279  -76.818  -11.966 1.00 29.74  ? 62  VAL B CB   1 
ATOM   7070  C CG1  . VAL B 1 18  ? 19.178  -77.257  -10.824 1.00 27.90  ? 62  VAL B CG1  1 
ATOM   7071  C CG2  . VAL B 1 18  ? 18.543  -75.363  -12.328 1.00 31.36  ? 62  VAL B CG2  1 
ATOM   7072  H H    . VAL B 1 18  ? 16.932  -77.106  -14.232 1.00 42.36  ? 62  VAL B H    1 
ATOM   7073  H HA   . VAL B 1 18  ? 19.425  -77.793  -13.380 1.00 32.50  ? 62  VAL B HA   1 
ATOM   7074  H HB   . VAL B 1 18  ? 17.359  -76.888  -11.665 1.00 35.69  ? 62  VAL B HB   1 
ATOM   7075  H HG11 . VAL B 1 18  ? 19.036  -76.669  -10.066 1.00 33.48  ? 62  VAL B HG11 1 
ATOM   7076  H HG12 . VAL B 1 18  ? 18.955  -78.170  -10.581 1.00 33.48  ? 62  VAL B HG12 1 
ATOM   7077  H HG13 . VAL B 1 18  ? 20.102  -77.208  -11.113 1.00 33.48  ? 62  VAL B HG13 1 
ATOM   7078  H HG21 . VAL B 1 18  ? 18.411  -74.813  -11.540 1.00 37.63  ? 62  VAL B HG21 1 
ATOM   7079  H HG22 . VAL B 1 18  ? 19.456  -75.278  -12.643 1.00 37.63  ? 62  VAL B HG22 1 
ATOM   7080  H HG23 . VAL B 1 18  ? 17.925  -75.095  -13.026 1.00 37.63  ? 62  VAL B HG23 1 
ATOM   7081  N N    . PRO B 1 19  ? 18.805  -80.139  -12.746 1.00 31.19  ? 63  PRO B N    1 
ATOM   7082  C CA   . PRO B 1 19  ? 18.294  -81.477  -12.420 1.00 25.13  ? 63  PRO B CA   1 
ATOM   7083  C C    . PRO B 1 19  ? 17.472  -81.444  -11.141 1.00 35.74  ? 63  PRO B C    1 
ATOM   7084  O O    . PRO B 1 19  ? 17.886  -80.867  -10.133 1.00 26.52  ? 63  PRO B O    1 
ATOM   7085  C CB   . PRO B 1 19  ? 19.565  -82.319  -12.259 1.00 29.80  ? 63  PRO B CB   1 
ATOM   7086  C CG   . PRO B 1 19  ? 20.614  -81.584  -13.012 1.00 28.95  ? 63  PRO B CG   1 
ATOM   7087  C CD   . PRO B 1 19  ? 20.273  -80.132  -12.882 1.00 29.01  ? 63  PRO B CD   1 
ATOM   7088  H HA   . PRO B 1 19  ? 17.757  -81.828  -13.148 1.00 30.16  ? 63  PRO B HA   1 
ATOM   7089  H HB2  . PRO B 1 19  ? 19.798  -82.384  -11.320 1.00 35.77  ? 63  PRO B HB2  1 
ATOM   7090  H HB3  . PRO B 1 19  ? 19.424  -83.200  -12.640 1.00 35.77  ? 63  PRO B HB3  1 
ATOM   7091  H HG2  . PRO B 1 19  ? 21.482  -81.766  -12.620 1.00 34.74  ? 63  PRO B HG2  1 
ATOM   7092  H HG3  . PRO B 1 19  ? 20.596  -81.856  -13.943 1.00 34.74  ? 63  PRO B HG3  1 
ATOM   7093  H HD2  . PRO B 1 19  ? 20.684  -79.757  -12.088 1.00 34.82  ? 63  PRO B HD2  1 
ATOM   7094  H HD3  . PRO B 1 19  ? 20.536  -79.650  -13.682 1.00 34.82  ? 63  PRO B HD3  1 
ATOM   7095  N N    . ASN B 1 20  ? 16.289  -82.063  -11.194 1.00 33.80  ? 64  ASN B N    1 
ATOM   7096  C CA   . ASN B 1 20  ? 15.414  -82.083  -10.027 1.00 33.78  ? 64  ASN B CA   1 
ATOM   7097  C C    . ASN B 1 20  ? 16.118  -82.652  -8.803  1.00 29.78  ? 64  ASN B C    1 
ATOM   7098  O O    . ASN B 1 20  ? 15.832  -82.233  -7.676  1.00 23.36  ? 64  ASN B O    1 
ATOM   7099  C CB   . ASN B 1 20  ? 14.149  -82.893  -10.324 1.00 41.34  ? 64  ASN B CB   1 
ATOM   7100  C CG   . ASN B 1 20  ? 13.097  -82.089  -11.062 1.00 33.40  ? 64  ASN B CG   1 
ATOM   7101  O OD1  . ASN B 1 20  ? 12.943  -80.890  -10.834 1.00 27.82  ? 64  ASN B OD1  1 
ATOM   7102  N ND2  . ASN B 1 20  ? 12.358  -82.750  -11.945 1.00 46.57  ? 64  ASN B ND2  1 
ATOM   7103  H H    . ASN B 1 20  ? 15.977  -82.472  -11.884 1.00 40.56  ? 64  ASN B H    1 
ATOM   7104  H HA   . ASN B 1 20  ? 15.145  -81.174  -9.821  1.00 40.54  ? 64  ASN B HA   1 
ATOM   7105  H HB2  . ASN B 1 20  ? 14.385  -83.655  -10.876 1.00 49.61  ? 64  ASN B HB2  1 
ATOM   7106  H HB3  . ASN B 1 20  ? 13.763  -83.195  -9.487  1.00 49.61  ? 64  ASN B HB3  1 
ATOM   7107  H HD21 . ASN B 1 20  ? 11.748  -82.338  -12.389 1.00 55.88  ? 64  ASN B HD21 1 
ATOM   7108  H HD22 . ASN B 1 20  ? 12.490  -83.590  -12.072 1.00 55.88  ? 64  ASN B HD22 1 
ATOM   7109  N N    . ASP B 1 21  ? 17.042  -83.592  -8.997  1.00 20.40  ? 65  ASP B N    1 
ATOM   7110  C CA   . ASP B 1 21  ? 17.689  -84.281  -7.889  1.00 24.51  ? 65  ASP B CA   1 
ATOM   7111  C C    . ASP B 1 21  ? 18.946  -83.571  -7.390  1.00 27.36  ? 65  ASP B C    1 
ATOM   7112  O O    . ASP B 1 21  ? 19.726  -84.176  -6.647  1.00 24.43  ? 65  ASP B O    1 
ATOM   7113  C CB   . ASP B 1 21  ? 18.034  -85.718  -8.295  1.00 29.78  ? 65  ASP B CB   1 
ATOM   7114  C CG   . ASP B 1 21  ? 19.140  -85.788  -9.334  1.00 32.14  ? 65  ASP B CG   1 
ATOM   7115  O OD1  . ASP B 1 21  ? 19.523  -84.733  -9.884  1.00 39.38  ? 65  ASP B OD1  1 
ATOM   7116  O OD2  . ASP B 1 21  ? 19.629  -86.905  -9.600  1.00 34.24  ? 65  ASP B OD2  1 
ATOM   7117  H H    . ASP B 1 21  ? 17.312  -83.850  -9.772  1.00 24.48  ? 65  ASP B H    1 
ATOM   7118  H HA   . ASP B 1 21  ? 17.065  -84.327  -7.148  1.00 29.42  ? 65  ASP B HA   1 
ATOM   7119  H HB2  . ASP B 1 21  ? 18.329  -86.206  -7.510  1.00 35.74  ? 65  ASP B HB2  1 
ATOM   7120  H HB3  . ASP B 1 21  ? 17.244  -86.139  -8.669  1.00 35.74  ? 65  ASP B HB3  1 
ATOM   7121  N N    . LYS B 1 22  ? 19.163  -82.316  -7.779  1.00 21.75  ? 66  LYS B N    1 
ATOM   7122  C CA   . LYS B 1 22  ? 20.288  -81.530  -7.294  1.00 16.25  ? 66  LYS B CA   1 
ATOM   7123  C C    . LYS B 1 22  ? 19.783  -80.334  -6.500  1.00 12.72  ? 66  LYS B C    1 
ATOM   7124  O O    . LYS B 1 22  ? 18.732  -79.763  -6.804  1.00 21.59  ? 66  LYS B O    1 
ATOM   7125  C CB   . LYS B 1 22  ? 21.180  -81.047  -8.447  1.00 29.38  ? 66  LYS B CB   1 
ATOM   7126  C CG   . LYS B 1 22  ? 21.847  -82.165  -9.243  1.00 27.64  ? 66  LYS B CG   1 
ATOM   7127  C CD   . LYS B 1 22  ? 22.739  -83.039  -8.369  1.00 26.78  ? 66  LYS B CD   1 
ATOM   7128  C CE   . LYS B 1 22  ? 23.423  -84.126  -9.185  1.00 25.50  ? 66  LYS B CE   1 
ATOM   7129  N NZ   . LYS B 1 22  ? 23.947  -85.224  -8.324  1.00 45.80  ? 66  LYS B NZ   1 
ATOM   7130  H H    . LYS B 1 22  ? 18.661  -81.892  -8.334  1.00 26.11  ? 66  LYS B H    1 
ATOM   7131  H HA   . LYS B 1 22  ? 20.828  -82.079  -6.704  1.00 19.51  ? 66  LYS B HA   1 
ATOM   7132  H HB2  . LYS B 1 22  ? 20.637  -80.530  -9.063  1.00 35.26  ? 66  LYS B HB2  1 
ATOM   7133  H HB3  . LYS B 1 22  ? 21.882  -80.486  -8.082  1.00 35.26  ? 66  LYS B HB3  1 
ATOM   7134  H HG2  . LYS B 1 22  ? 21.162  -82.729  -9.634  1.00 33.17  ? 66  LYS B HG2  1 
ATOM   7135  H HG3  . LYS B 1 22  ? 22.397  -81.775  -9.940  1.00 33.17  ? 66  LYS B HG3  1 
ATOM   7136  H HD2  . LYS B 1 22  ? 23.425  -82.489  -7.960  1.00 32.14  ? 66  LYS B HD2  1 
ATOM   7137  H HD3  . LYS B 1 22  ? 22.199  -83.466  -7.686  1.00 32.14  ? 66  LYS B HD3  1 
ATOM   7138  H HE2  . LYS B 1 22  ? 22.783  -84.508  -9.806  1.00 30.60  ? 66  LYS B HE2  1 
ATOM   7139  H HE3  . LYS B 1 22  ? 24.169  -83.739  -9.669  1.00 30.60  ? 66  LYS B HE3  1 
ATOM   7140  H HZ1  . LYS B 1 22  ? 24.541  -84.900  -7.746  1.00 54.96  ? 66  LYS B HZ1  1 
ATOM   7141  H HZ2  . LYS B 1 22  ? 23.279  -85.600  -7.871  1.00 54.96  ? 66  LYS B HZ2  1 
ATOM   7142  H HZ3  . LYS B 1 22  ? 24.341  -85.843  -8.827  1.00 54.96  ? 66  LYS B HZ3  1 
ATOM   7143  N N    . TYR B 1 23  ? 20.551  -79.960  -5.477  1.00 20.61  ? 67  TYR B N    1 
ATOM   7144  C CA   . TYR B 1 23  ? 20.222  -78.823  -4.629  1.00 18.14  ? 67  TYR B CA   1 
ATOM   7145  C C    . TYR B 1 23  ? 20.812  -77.513  -5.129  1.00 19.01  ? 67  TYR B C    1 
ATOM   7146  O O    . TYR B 1 23  ? 20.424  -76.450  -4.629  1.00 23.76  ? 67  TYR B O    1 
ATOM   7147  C CB   . TYR B 1 23  ? 20.703  -79.068  -3.193  1.00 19.74  ? 67  TYR B CB   1 
ATOM   7148  C CG   . TYR B 1 23  ? 19.957  -80.163  -2.464  1.00 20.75  ? 67  TYR B CG   1 
ATOM   7149  C CD1  . TYR B 1 23  ? 18.640  -79.985  -2.064  1.00 26.95  ? 67  TYR B CD1  1 
ATOM   7150  C CD2  . TYR B 1 23  ? 20.576  -81.368  -2.161  1.00 23.14  ? 67  TYR B CD2  1 
ATOM   7151  C CE1  . TYR B 1 23  ? 17.957  -80.981  -1.393  1.00 24.18  ? 67  TYR B CE1  1 
ATOM   7152  C CE2  . TYR B 1 23  ? 19.902  -82.370  -1.491  1.00 24.37  ? 67  TYR B CE2  1 
ATOM   7153  C CZ   . TYR B 1 23  ? 18.592  -82.171  -1.109  1.00 28.52  ? 67  TYR B CZ   1 
ATOM   7154  O OH   . TYR B 1 23  ? 17.916  -83.166  -0.440  1.00 22.94  ? 67  TYR B OH   1 
ATOM   7155  H H    . TYR B 1 23  ? 21.279  -80.358  -5.253  1.00 24.73  ? 67  TYR B H    1 
ATOM   7156  H HA   . TYR B 1 23  ? 19.257  -78.722  -4.605  1.00 21.77  ? 67  TYR B HA   1 
ATOM   7157  H HB2  . TYR B 1 23  ? 21.641  -79.315  -3.218  1.00 23.70  ? 67  TYR B HB2  1 
ATOM   7158  H HB3  . TYR B 1 23  ? 20.594  -78.248  -2.685  1.00 23.70  ? 67  TYR B HB3  1 
ATOM   7159  H HD1  . TYR B 1 23  ? 18.208  -79.184  -2.256  1.00 32.34  ? 67  TYR B HD1  1 
ATOM   7160  H HD2  . TYR B 1 23  ? 21.460  -81.506  -2.418  1.00 27.77  ? 67  TYR B HD2  1 
ATOM   7161  H HE1  . TYR B 1 23  ? 17.073  -80.849  -1.134  1.00 29.02  ? 67  TYR B HE1  1 
ATOM   7162  H HE2  . TYR B 1 23  ? 20.329  -83.173  -1.298  1.00 29.24  ? 67  TYR B HE2  1 
ATOM   7163  H HH   . TYR B 1 23  ? 17.133  -82.916  -0.268  1.00 27.53  ? 67  TYR B HH   1 
ATOM   7164  N N    . TYR B 1 24  ? 21.739  -77.550  -6.083  1.00 23.61  ? 68  TYR B N    1 
ATOM   7165  C CA   . TYR B 1 24  ? 22.267  -76.306  -6.616  1.00 25.54  ? 68  TYR B CA   1 
ATOM   7166  C C    . TYR B 1 24  ? 21.264  -75.686  -7.588  1.00 21.47  ? 68  TYR B C    1 
ATOM   7167  O O    . TYR B 1 24  ? 20.308  -76.327  -8.031  1.00 25.53  ? 68  TYR B O    1 
ATOM   7168  C CB   . TYR B 1 24  ? 23.627  -76.528  -7.283  1.00 22.65  ? 68  TYR B CB   1 
ATOM   7169  C CG   . TYR B 1 24  ? 23.671  -77.525  -8.427  1.00 15.35  ? 68  TYR B CG   1 
ATOM   7170  C CD1  . TYR B 1 24  ? 23.104  -77.231  -9.662  1.00 22.64  ? 68  TYR B CD1  1 
ATOM   7171  C CD2  . TYR B 1 24  ? 24.327  -78.742  -8.285  1.00 18.35  ? 68  TYR B CD2  1 
ATOM   7172  C CE1  . TYR B 1 24  ? 23.164  -78.133  -10.711 1.00 20.03  ? 68  TYR B CE1  1 
ATOM   7173  C CE2  . TYR B 1 24  ? 24.393  -79.649  -9.329  1.00 19.54  ? 68  TYR B CE2  1 
ATOM   7174  C CZ   . TYR B 1 24  ? 23.811  -79.339  -10.539 1.00 22.11  ? 68  TYR B CZ   1 
ATOM   7175  O OH   . TYR B 1 24  ? 23.876  -80.240  -11.579 1.00 22.77  ? 68  TYR B OH   1 
ATOM   7176  H H    . TYR B 1 24  ? 22.069  -78.265  -6.429  1.00 28.33  ? 68  TYR B H    1 
ATOM   7177  H HA   . TYR B 1 24  ? 22.395  -75.682  -5.885  1.00 30.65  ? 68  TYR B HA   1 
ATOM   7178  H HB2  . TYR B 1 24  ? 23.935  -75.677  -7.633  1.00 27.19  ? 68  TYR B HB2  1 
ATOM   7179  H HB3  . TYR B 1 24  ? 24.248  -76.840  -6.607  1.00 27.19  ? 68  TYR B HB3  1 
ATOM   7180  H HD1  . TYR B 1 24  ? 22.667  -76.419  -9.782  1.00 27.17  ? 68  TYR B HD1  1 
ATOM   7181  H HD2  . TYR B 1 24  ? 24.722  -78.955  -7.470  1.00 22.02  ? 68  TYR B HD2  1 
ATOM   7182  H HE1  . TYR B 1 24  ? 22.772  -77.925  -11.528 1.00 24.04  ? 68  TYR B HE1  1 
ATOM   7183  H HE2  . TYR B 1 24  ? 24.829  -80.462  -9.214  1.00 23.45  ? 68  TYR B HE2  1 
ATOM   7184  H HH   . TYR B 1 24  ? 23.484  -79.929  -12.254 1.00 27.33  ? 68  TYR B HH   1 
ATOM   7185  N N    . GLY B 1 25  ? 21.485  -74.412  -7.907  1.00 26.76  ? 69  GLY B N    1 
ATOM   7186  C CA   . GLY B 1 25  ? 20.516  -73.646  -8.666  1.00 22.28  ? 69  GLY B CA   1 
ATOM   7187  C C    . GLY B 1 25  ? 21.026  -73.081  -9.976  1.00 34.74  ? 69  GLY B C    1 
ATOM   7188  O O    . GLY B 1 25  ? 21.982  -73.596  -10.565 1.00 28.18  ? 69  GLY B O    1 
ATOM   7189  H H    . GLY B 1 25  ? 22.191  -73.972  -7.692  1.00 32.11  ? 69  GLY B H    1 
ATOM   7190  H HA2  . GLY B 1 25  ? 19.753  -74.212  -8.863  1.00 26.73  ? 69  GLY B HA2  1 
ATOM   7191  H HA3  . GLY B 1 25  ? 20.206  -72.904  -8.123  1.00 26.73  ? 69  GLY B HA3  1 
ATOM   7192  N N    . ALA B 1 26  ? 20.381  -72.007  -10.436 1.00 24.45  ? 70  ALA B N    1 
ATOM   7193  C CA   . ALA B 1 26  ? 20.684  -71.450  -11.751 1.00 32.31  ? 70  ALA B CA   1 
ATOM   7194  C C    . ALA B 1 26  ? 22.122  -70.951  -11.826 1.00 29.33  ? 70  ALA B C    1 
ATOM   7195  O O    . ALA B 1 26  ? 22.836  -71.231  -12.796 1.00 30.17  ? 70  ALA B O    1 
ATOM   7196  C CB   . ALA B 1 26  ? 19.707  -70.320  -12.071 1.00 40.43  ? 70  ALA B CB   1 
ATOM   7197  H H    . ALA B 1 26  ? 19.768  -71.584  -10.006 1.00 29.35  ? 70  ALA B H    1 
ATOM   7198  H HA   . ALA B 1 26  ? 20.571  -72.143  -12.420 1.00 38.78  ? 70  ALA B HA   1 
ATOM   7199  H HB1  . ALA B 1 26  ? 19.919  -69.959  -12.946 1.00 48.52  ? 70  ALA B HB1  1 
ATOM   7200  H HB2  . ALA B 1 26  ? 18.804  -70.674  -12.067 1.00 48.52  ? 70  ALA B HB2  1 
ATOM   7201  H HB3  . ALA B 1 26  ? 19.795  -69.628  -11.397 1.00 48.52  ? 70  ALA B HB3  1 
ATOM   7202  N N    . GLN B 1 27  ? 22.563  -70.199  -10.815 1.00 25.68  ? 71  GLN B N    1 
ATOM   7203  C CA   . GLN B 1 27  ? 23.917  -69.653  -10.841 1.00 29.53  ? 71  GLN B CA   1 
ATOM   7204  C C    . GLN B 1 27  ? 24.953  -70.760  -10.976 1.00 32.70  ? 71  GLN B C    1 
ATOM   7205  O O    . GLN B 1 27  ? 25.920  -70.626  -11.737 1.00 30.93  ? 71  GLN B O    1 
ATOM   7206  C CB   . GLN B 1 27  ? 24.176  -68.826  -9.582  1.00 30.99  ? 71  GLN B CB   1 
ATOM   7207  C CG   . GLN B 1 27  ? 23.292  -67.595  -9.463  1.00 40.48  ? 71  GLN B CG   1 
ATOM   7208  C CD   . GLN B 1 27  ? 23.528  -66.825  -8.177  1.00 52.89  ? 71  GLN B CD   1 
ATOM   7209  O OE1  . GLN B 1 27  ? 23.589  -67.406  -7.093  1.00 60.20  ? 71  GLN B OE1  1 
ATOM   7210  N NE2  . GLN B 1 27  ? 23.669  -65.509  -8.293  1.00 61.60  ? 71  GLN B NE2  1 
ATOM   7211  H H    . GLN B 1 27  ? 22.106  -69.994  -10.116 1.00 30.82  ? 71  GLN B H    1 
ATOM   7212  H HA   . GLN B 1 27  ? 24.005  -69.065  -11.608 1.00 35.44  ? 71  GLN B HA   1 
ATOM   7213  H HB2  . GLN B 1 27  ? 24.016  -69.383  -8.804  1.00 37.19  ? 71  GLN B HB2  1 
ATOM   7214  H HB3  . GLN B 1 27  ? 25.099  -68.529  -9.589  1.00 37.19  ? 71  GLN B HB3  1 
ATOM   7215  H HG2  . GLN B 1 27  ? 23.476  -67.000  -10.207 1.00 48.57  ? 71  GLN B HG2  1 
ATOM   7216  H HG3  . GLN B 1 27  ? 22.362  -67.870  -9.481  1.00 48.57  ? 71  GLN B HG3  1 
ATOM   7217  H HE21 . GLN B 1 27  ? 23.624  -65.138  -9.068  1.00 73.92  ? 71  GLN B HE21 1 
ATOM   7218  H HE22 . GLN B 1 27  ? 23.805  -65.028  -7.593  1.00 73.92  ? 71  GLN B HE22 1 
ATOM   7219  N N    . THR B 1 28  ? 24.769  -71.864  -10.250 1.00 23.58  ? 72  THR B N    1 
ATOM   7220  C CA   . THR B 1 28  ? 25.699  -72.982  -10.364 1.00 25.28  ? 72  THR B CA   1 
ATOM   7221  C C    . THR B 1 28  ? 25.673  -73.565  -11.770 1.00 22.52  ? 72  THR B C    1 
ATOM   7222  O O    . THR B 1 28  ? 26.724  -73.827  -12.366 1.00 29.83  ? 72  THR B O    1 
ATOM   7223  C CB   . THR B 1 28  ? 25.365  -74.055  -9.326  1.00 25.00  ? 72  THR B CB   1 
ATOM   7224  O OG1  . THR B 1 28  ? 25.480  -73.502  -8.008  1.00 25.72  ? 72  THR B OG1  1 
ATOM   7225  C CG2  . THR B 1 28  ? 26.309  -75.244  -9.448  1.00 18.49  ? 72  THR B CG2  1 
ATOM   7226  H H    . THR B 1 28  ? 24.124  -71.987  -9.694  1.00 28.30  ? 72  THR B H    1 
ATOM   7227  H HA   . THR B 1 28  ? 26.599  -72.664  -10.188 1.00 30.34  ? 72  THR B HA   1 
ATOM   7228  H HB   . THR B 1 28  ? 24.457  -74.368  -9.466  1.00 30.00  ? 72  THR B HB   1 
ATOM   7229  H HG1  . THR B 1 28  ? 24.949  -72.857  -7.919  1.00 30.86  ? 72  THR B HG1  1 
ATOM   7230  H HG21 . THR B 1 28  ? 26.085  -75.915  -8.784  1.00 22.19  ? 72  THR B HG21 1 
ATOM   7231  H HG22 . THR B 1 28  ? 26.234  -75.638  -10.331 1.00 22.19  ? 72  THR B HG22 1 
ATOM   7232  H HG23 . THR B 1 28  ? 27.225  -74.956  -9.308  1.00 22.19  ? 72  THR B HG23 1 
ATOM   7233  N N    . VAL B 1 29  ? 24.474  -73.774  -12.321 1.00 23.73  ? 73  VAL B N    1 
ATOM   7234  C CA   . VAL B 1 29  ? 24.367  -74.281  -13.687 1.00 32.02  ? 73  VAL B CA   1 
ATOM   7235  C C    . VAL B 1 29  ? 25.057  -73.332  -14.656 1.00 26.78  ? 73  VAL B C    1 
ATOM   7236  O O    . VAL B 1 29  ? 25.785  -73.764  -15.558 1.00 22.02  ? 73  VAL B O    1 
ATOM   7237  C CB   . VAL B 1 29  ? 22.890  -74.503  -14.063 1.00 35.36  ? 73  VAL B CB   1 
ATOM   7238  C CG1  . VAL B 1 29  ? 22.745  -74.833  -15.545 1.00 31.03  ? 73  VAL B CG1  1 
ATOM   7239  C CG2  . VAL B 1 29  ? 22.301  -75.625  -13.229 1.00 30.25  ? 73  VAL B CG2  1 
ATOM   7240  H H    . VAL B 1 29  ? 23.721  -73.631  -11.931 1.00 28.47  ? 73  VAL B H    1 
ATOM   7241  H HA   . VAL B 1 29  ? 24.818  -75.138  -13.739 1.00 38.43  ? 73  VAL B HA   1 
ATOM   7242  H HB   . VAL B 1 29  ? 22.387  -73.693  -13.881 1.00 42.43  ? 73  VAL B HB   1 
ATOM   7243  H HG11 . VAL B 1 29  ? 21.806  -74.966  -15.748 1.00 37.24  ? 73  VAL B HG11 1 
ATOM   7244  H HG12 . VAL B 1 29  ? 23.096  -74.095  -16.068 1.00 37.24  ? 73  VAL B HG12 1 
ATOM   7245  H HG13 . VAL B 1 29  ? 23.244  -75.642  -15.738 1.00 37.24  ? 73  VAL B HG13 1 
ATOM   7246  H HG21 . VAL B 1 29  ? 21.372  -75.750  -13.479 1.00 36.30  ? 73  VAL B HG21 1 
ATOM   7247  H HG22 . VAL B 1 29  ? 22.801  -76.439  -13.398 1.00 36.30  ? 73  VAL B HG22 1 
ATOM   7248  H HG23 . VAL B 1 29  ? 22.362  -75.387  -12.291 1.00 36.30  ? 73  VAL B HG23 1 
ATOM   7249  N N    . ARG B 1 30  ? 24.850  -72.026  -14.480 1.00 26.10  ? 74  ARG B N    1 
ATOM   7250  C CA   . ARG B 1 30  ? 25.533  -71.046  -15.318 1.00 35.69  ? 74  ARG B CA   1 
ATOM   7251  C C    . ARG B 1 30  ? 27.044  -71.223  -15.239 1.00 29.75  ? 74  ARG B C    1 
ATOM   7252  O O    . ARG B 1 30  ? 27.738  -71.217  -16.262 1.00 25.50  ? 74  ARG B O    1 
ATOM   7253  C CB   . ARG B 1 30  ? 25.129  -69.633  -14.898 1.00 30.73  ? 74  ARG B CB   1 
ATOM   7254  C CG   . ARG B 1 30  ? 25.653  -68.531  -15.808 1.00 48.44  ? 74  ARG B CG   1 
ATOM   7255  C CD   . ARG B 1 30  ? 24.958  -68.535  -17.162 1.00 60.24  ? 74  ARG B CD   1 
ATOM   7256  N NE   . ARG B 1 30  ? 23.554  -68.142  -17.069 1.00 63.81  ? 74  ARG B NE   1 
ATOM   7257  C CZ   . ARG B 1 30  ? 22.689  -68.213  -18.077 1.00 54.15  ? 74  ARG B CZ   1 
ATOM   7258  N NH1  . ARG B 1 30  ? 23.075  -68.670  -19.260 1.00 57.61  ? 74  ARG B NH1  1 
ATOM   7259  N NH2  . ARG B 1 30  ? 21.432  -67.833  -17.904 1.00 56.66  ? 74  ARG B NH2  1 
ATOM   7260  H H    . ARG B 1 30  ? 24.326  -71.687  -13.888 1.00 31.32  ? 74  ARG B H    1 
ATOM   7261  H HA   . ARG B 1 30  ? 25.263  -71.175  -16.241 1.00 42.84  ? 74  ARG B HA   1 
ATOM   7262  H HB2  . ARG B 1 30  ? 24.161  -69.575  -14.893 1.00 36.88  ? 74  ARG B HB2  1 
ATOM   7263  H HB3  . ARG B 1 30  ? 25.471  -69.465  -14.006 1.00 36.88  ? 74  ARG B HB3  1 
ATOM   7264  H HG2  . ARG B 1 30  ? 25.497  -67.670  -15.389 1.00 58.13  ? 74  ARG B HG2  1 
ATOM   7265  H HG3  . ARG B 1 30  ? 26.603  -68.664  -15.955 1.00 58.13  ? 74  ARG B HG3  1 
ATOM   7266  H HD2  . ARG B 1 30  ? 25.407  -67.910  -17.751 1.00 72.30  ? 74  ARG B HD2  1 
ATOM   7267  H HD3  . ARG B 1 30  ? 24.995  -69.430  -17.535 1.00 72.30  ? 74  ARG B HD3  1 
ATOM   7268  H HE   . ARG B 1 30  ? 23.271  -67.835  -16.317 1.00 76.57  ? 74  ARG B HE   1 
ATOM   7269  H HH11 . ARG B 1 30  ? 23.889  -68.919  -19.381 1.00 69.14  ? 74  ARG B HH11 1 
ATOM   7270  H HH12 . ARG B 1 30  ? 22.511  -68.715  -19.908 1.00 69.14  ? 74  ARG B HH12 1 
ATOM   7271  H HH21 . ARG B 1 30  ? 21.173  -67.536  -17.139 1.00 67.99  ? 74  ARG B HH21 1 
ATOM   7272  H HH22 . ARG B 1 30  ? 20.874  -67.882  -18.557 1.00 67.99  ? 74  ARG B HH22 1 
ATOM   7273  N N    . SER B 1 31  ? 27.570  -71.394  -14.024 1.00 22.00  ? 75  SER B N    1 
ATOM   7274  C CA   . SER B 1 31  ? 29.009  -71.554  -13.850 1.00 27.22  ? 75  SER B CA   1 
ATOM   7275  C C    . SER B 1 31  ? 29.526  -72.815  -14.530 1.00 23.54  ? 75  SER B C    1 
ATOM   7276  O O    . SER B 1 31  ? 30.651  -72.824  -15.040 1.00 30.28  ? 75  SER B O    1 
ATOM   7277  C CB   . SER B 1 31  ? 29.353  -71.575  -12.361 1.00 26.21  ? 75  SER B CB   1 
ATOM   7278  O OG   . SER B 1 31  ? 28.918  -70.387  -11.726 1.00 21.60  ? 75  SER B OG   1 
ATOM   7279  H H    . SER B 1 31  ? 27.118  -71.421  -13.293 1.00 26.41  ? 75  SER B H    1 
ATOM   7280  H HA   . SER B 1 31  ? 29.460  -70.794  -14.250 1.00 32.67  ? 75  SER B HA   1 
ATOM   7281  H HB2  . SER B 1 31  ? 28.913  -72.334  -11.947 1.00 31.45  ? 75  SER B HB2  1 
ATOM   7282  H HB3  . SER B 1 31  ? 30.314  -71.654  -12.261 1.00 31.45  ? 75  SER B HB3  1 
ATOM   7283  H HG   . SER B 1 31  ? 28.086  -70.306  -11.806 1.00 25.93  ? 75  SER B HG   1 
ATOM   7284  N N    . THR B 1 32  ? 28.730  -73.888  -14.546 1.00 18.80  ? 76  THR B N    1 
ATOM   7285  C CA   . THR B 1 32  ? 29.157  -75.116  -15.207 1.00 22.31  ? 76  THR B CA   1 
ATOM   7286  C C    . THR B 1 32  ? 29.245  -74.954  -16.717 1.00 24.05  ? 76  THR B C    1 
ATOM   7287  O O    . THR B 1 32  ? 29.964  -75.719  -17.368 1.00 31.67  ? 76  THR B O    1 
ATOM   7288  C CB   . THR B 1 32  ? 28.200  -76.268  -14.887 1.00 28.85  ? 76  THR B CB   1 
ATOM   7289  O OG1  . THR B 1 32  ? 26.882  -75.942  -15.343 1.00 34.63  ? 76  THR B OG1  1 
ATOM   7290  C CG2  . THR B 1 32  ? 28.170  -76.551  -13.394 1.00 28.73  ? 76  THR B CG2  1 
ATOM   7291  H H    . THR B 1 32  ? 27.950  -73.928  -14.186 1.00 22.56  ? 76  THR B H    1 
ATOM   7292  H HA   . THR B 1 32  ? 30.037  -75.359  -14.881 1.00 26.78  ? 76  THR B HA   1 
ATOM   7293  H HB   . THR B 1 32  ? 28.504  -77.069  -15.341 1.00 34.62  ? 76  THR B HB   1 
ATOM   7294  H HG1  . THR B 1 32  ? 26.610  -75.245  -14.960 1.00 41.56  ? 76  THR B HG1  1 
ATOM   7295  H HG21 . THR B 1 32  ? 27.560  -77.282  -13.208 1.00 34.48  ? 76  THR B HG21 1 
ATOM   7296  H HG22 . THR B 1 32  ? 29.056  -76.794  -13.084 1.00 34.48  ? 76  THR B HG22 1 
ATOM   7297  H HG23 . THR B 1 32  ? 27.873  -75.763  -12.913 1.00 34.48  ? 76  THR B HG23 1 
ATOM   7298  N N    . MET B 1 33  ? 28.527  -73.984  -17.288 1.00 26.37  ? 77  MET B N    1 
ATOM   7299  C CA   . MET B 1 33  ? 28.540  -73.802  -18.733 1.00 30.37  ? 77  MET B CA   1 
ATOM   7300  C C    . MET B 1 33  ? 29.718  -72.953  -19.190 1.00 24.56  ? 77  MET B C    1 
ATOM   7301  O O    . MET B 1 33  ? 30.246  -73.174  -20.286 1.00 32.51  ? 77  MET B O    1 
ATOM   7302  C CB   . MET B 1 33  ? 27.228  -73.162  -19.192 1.00 30.19  ? 77  MET B CB   1 
ATOM   7303  C CG   . MET B 1 33  ? 25.990  -73.977  -18.850 1.00 39.58  ? 77  MET B CG   1 
ATOM   7304  S SD   . MET B 1 33  ? 24.490  -73.372  -19.648 1.00 52.28  ? 77  MET B SD   1 
ATOM   7305  C CE   . MET B 1 33  ? 24.433  -71.677  -19.081 1.00 36.78  ? 77  MET B CE   1 
ATOM   7306  H H    . MET B 1 33  ? 28.031  -73.426  -16.862 1.00 31.65  ? 77  MET B H    1 
ATOM   7307  H HA   . MET B 1 33  ? 28.604  -74.674  -19.155 1.00 36.45  ? 77  MET B HA   1 
ATOM   7308  H HB2  . MET B 1 33  ? 27.138  -72.296  -18.766 1.00 36.23  ? 77  MET B HB2  1 
ATOM   7309  H HB3  . MET B 1 33  ? 27.254  -73.053  -20.155 1.00 36.23  ? 77  MET B HB3  1 
ATOM   7310  H HG2  . MET B 1 33  ? 26.130  -74.894  -19.136 1.00 47.49  ? 77  MET B HG2  1 
ATOM   7311  H HG3  . MET B 1 33  ? 25.850  -73.948  -17.891 1.00 47.49  ? 77  MET B HG3  1 
ATOM   7312  H HE1  . MET B 1 33  ? 23.650  -71.245  -19.457 1.00 44.13  ? 77  MET B HE1  1 
ATOM   7313  H HE2  . MET B 1 33  ? 24.384  -71.669  -18.113 1.00 44.13  ? 77  MET B HE2  1 
ATOM   7314  H HE3  . MET B 1 33  ? 25.237  -71.219  -19.375 1.00 44.13  ? 77  MET B HE3  1 
ATOM   7315  N N    . ASN B 1 34  ? 30.149  -71.997  -18.368 1.00 27.13  ? 78  ASN B N    1 
ATOM   7316  C CA   . ASN B 1 34  ? 31.202  -71.066  -18.750 1.00 32.22  ? 78  ASN B CA   1 
ATOM   7317  C C    . ASN B 1 34  ? 32.595  -71.513  -18.328 1.00 17.12  ? 78  ASN B C    1 
ATOM   7318  O O    . ASN B 1 34  ? 33.578  -70.925  -18.791 1.00 22.39  ? 78  ASN B O    1 
ATOM   7319  C CB   . ASN B 1 34  ? 30.922  -69.686  -18.148 1.00 34.20  ? 78  ASN B CB   1 
ATOM   7320  C CG   . ASN B 1 34  ? 29.638  -69.074  -18.665 1.00 28.45  ? 78  ASN B CG   1 
ATOM   7321  O OD1  . ASN B 1 34  ? 29.265  -69.270  -19.822 1.00 39.40  ? 78  ASN B OD1  1 
ATOM   7322  N ND2  . ASN B 1 34  ? 28.951  -68.328  -17.808 1.00 45.63  ? 78  ASN B ND2  1 
ATOM   7323  H H    . ASN B 1 34  ? 29.842  -71.869  -17.575 1.00 32.56  ? 78  ASN B H    1 
ATOM   7324  H HA   . ASN B 1 34  ? 31.201  -70.974  -19.715 1.00 38.67  ? 78  ASN B HA   1 
ATOM   7325  H HB2  . ASN B 1 34  ? 30.848  -69.770  -17.184 1.00 41.04  ? 78  ASN B HB2  1 
ATOM   7326  H HB3  . ASN B 1 34  ? 31.652  -69.088  -18.375 1.00 41.04  ? 78  ASN B HB3  1 
ATOM   7327  H HD21 . ASN B 1 34  ? 28.215  -67.958  -18.053 1.00 54.76  ? 78  ASN B HD21 1 
ATOM   7328  H HD22 . ASN B 1 34  ? 29.244  -68.214  -17.007 1.00 54.76  ? 78  ASN B HD22 1 
ATOM   7329  N N    . PHE B 1 35  ? 32.714  -72.525  -17.463 1.00 23.55  ? 79  PHE B N    1 
ATOM   7330  C CA   . PHE B 1 35  ? 34.010  -72.966  -16.946 1.00 29.59  ? 79  PHE B CA   1 
ATOM   7331  C C    . PHE B 1 35  ? 34.096  -74.488  -17.047 1.00 23.03  ? 79  PHE B C    1 
ATOM   7332  O O    . PHE B 1 35  ? 34.140  -75.198  -16.041 1.00 25.20  ? 79  PHE B O    1 
ATOM   7333  C CB   . PHE B 1 35  ? 34.217  -72.479  -15.516 1.00 20.82  ? 79  PHE B CB   1 
ATOM   7334  C CG   . PHE B 1 35  ? 34.287  -70.988  -15.403 1.00 21.75  ? 79  PHE B CG   1 
ATOM   7335  C CD1  . PHE B 1 35  ? 35.492  -70.323  -15.556 1.00 19.17  ? 79  PHE B CD1  1 
ATOM   7336  C CD2  . PHE B 1 35  ? 33.145  -70.249  -15.168 1.00 26.80  ? 79  PHE B CD2  1 
ATOM   7337  C CE1  . PHE B 1 35  ? 35.555  -68.947  -15.462 1.00 23.53  ? 79  PHE B CE1  1 
ATOM   7338  C CE2  . PHE B 1 35  ? 33.204  -68.880  -15.076 1.00 30.37  ? 79  PHE B CE2  1 
ATOM   7339  C CZ   . PHE B 1 35  ? 34.411  -68.224  -15.223 1.00 23.79  ? 79  PHE B CZ   1 
ATOM   7340  H H    . PHE B 1 35  ? 32.049  -72.977  -17.159 1.00 28.27  ? 79  PHE B H    1 
ATOM   7341  H HA   . PHE B 1 35  ? 34.714  -72.588  -17.496 1.00 35.51  ? 79  PHE B HA   1 
ATOM   7342  H HB2  . PHE B 1 35  ? 33.477  -72.785  -14.969 1.00 24.98  ? 79  PHE B HB2  1 
ATOM   7343  H HB3  . PHE B 1 35  ? 35.050  -72.843  -15.178 1.00 24.98  ? 79  PHE B HB3  1 
ATOM   7344  H HD1  . PHE B 1 35  ? 36.268  -70.809  -15.718 1.00 23.01  ? 79  PHE B HD1  1 
ATOM   7345  H HD2  . PHE B 1 35  ? 32.329  -70.682  -15.068 1.00 32.17  ? 79  PHE B HD2  1 
ATOM   7346  H HE1  . PHE B 1 35  ? 36.370  -68.510  -15.562 1.00 28.24  ? 79  PHE B HE1  1 
ATOM   7347  H HE2  . PHE B 1 35  ? 32.428  -68.393  -14.912 1.00 36.44  ? 79  PHE B HE2  1 
ATOM   7348  H HZ   . PHE B 1 35  ? 34.450  -67.297  -15.158 1.00 28.55  ? 79  PHE B HZ   1 
ATOM   7349  N N    . LYS B 1 36  ? 34.129  -74.983  -18.285 1.00 28.53  ? 80  LYS B N    1 
ATOM   7350  C CA   . LYS B 1 36  ? 34.314  -76.408  -18.553 1.00 23.70  ? 80  LYS B CA   1 
ATOM   7351  C C    . LYS B 1 36  ? 35.803  -76.638  -18.790 1.00 31.20  ? 80  LYS B C    1 
ATOM   7352  O O    . LYS B 1 36  ? 36.271  -76.811  -19.919 1.00 27.71  ? 80  LYS B O    1 
ATOM   7353  C CB   . LYS B 1 36  ? 33.475  -76.847  -19.747 1.00 33.19  ? 80  LYS B CB   1 
ATOM   7354  C CG   . LYS B 1 36  ? 32.054  -76.308  -19.747 1.00 30.16  ? 80  LYS B CG   1 
ATOM   7355  H H    . LYS B 1 36  ? 34.045  -74.506  -18.995 1.00 34.23  ? 80  LYS B H    1 
ATOM   7356  H HA   . LYS B 1 36  ? 34.041  -76.923  -17.777 1.00 28.45  ? 80  LYS B HA   1 
ATOM   7357  H HB2  . LYS B 1 36  ? 33.907  -76.540  -20.560 1.00 39.83  ? 80  LYS B HB2  1 
ATOM   7358  H HB3  . LYS B 1 36  ? 33.423  -77.816  -19.751 1.00 39.83  ? 80  LYS B HB3  1 
ATOM   7359  H HG2  . LYS B 1 36  ? 31.801  -76.084  -20.656 1.00 36.19  ? 80  LYS B HG2  1 
ATOM   7360  H HG3  . LYS B 1 36  ? 31.458  -76.988  -19.396 1.00 36.19  ? 80  LYS B HG3  1 
ATOM   7361  N N    . ILE B 1 37  ? 36.562  -76.623  -17.697 1.00 14.24  ? 81  ILE B N    1 
ATOM   7362  C CA   . ILE B 1 37  ? 38.019  -76.712  -17.751 1.00 20.16  ? 81  ILE B CA   1 
ATOM   7363  C C    . ILE B 1 37  ? 38.457  -77.894  -16.899 1.00 12.78  ? 81  ILE B C    1 
ATOM   7364  O O    . ILE B 1 37  ? 38.444  -77.816  -15.666 1.00 15.66  ? 81  ILE B O    1 
ATOM   7365  C CB   . ILE B 1 37  ? 38.695  -75.415  -17.277 1.00 20.77  ? 81  ILE B CB   1 
ATOM   7366  C CG1  . ILE B 1 37  ? 38.246  -74.232  -18.141 1.00 23.81  ? 81  ILE B CG1  1 
ATOM   7367  C CG2  . ILE B 1 37  ? 40.214  -75.564  -17.329 1.00 20.79  ? 81  ILE B CG2  1 
ATOM   7368  C CD1  . ILE B 1 37  ? 38.784  -72.885  -17.692 1.00 22.48  ? 81  ILE B CD1  1 
ATOM   7369  H H    A ILE B 1 37  ? 36.250  -76.562  -16.898 0.25 17.09  ? 81  ILE B H    1 
ATOM   7370  H H    B ILE B 1 37  ? 36.250  -76.562  -16.898 0.75 17.09  ? 81  ILE B H    1 
ATOM   7371  H HA   . ILE B 1 37  ? 38.294  -76.879  -18.666 1.00 24.19  ? 81  ILE B HA   1 
ATOM   7372  H HB   . ILE B 1 37  ? 38.431  -75.246  -16.359 1.00 24.92  ? 81  ILE B HB   1 
ATOM   7373  H HG12 . ILE B 1 37  ? 38.548  -74.381  -19.051 1.00 28.57  ? 81  ILE B HG12 1 
ATOM   7374  H HG13 . ILE B 1 37  ? 37.278  -74.184  -18.122 1.00 28.57  ? 81  ILE B HG13 1 
ATOM   7375  H HG21 . ILE B 1 37  ? 40.623  -74.737  -17.027 1.00 24.95  ? 81  ILE B HG21 1 
ATOM   7376  H HG22 . ILE B 1 37  ? 40.480  -76.295  -16.749 1.00 24.95  ? 81  ILE B HG22 1 
ATOM   7377  H HG23 . ILE B 1 37  ? 40.482  -75.751  -18.242 1.00 24.95  ? 81  ILE B HG23 1 
ATOM   7378  H HD11 . ILE B 1 37  ? 38.453  -72.197  -18.291 1.00 26.98  ? 81  ILE B HD11 1 
ATOM   7379  H HD12 . ILE B 1 37  ? 38.482  -72.710  -16.787 1.00 26.98  ? 81  ILE B HD12 1 
ATOM   7380  H HD13 . ILE B 1 37  ? 39.754  -72.907  -17.718 1.00 26.98  ? 81  ILE B HD13 1 
ATOM   7381  N N    . GLY B 1 38  ? 38.855  -78.984  -17.551 1.00 20.55  ? 82  GLY B N    1 
ATOM   7382  C CA   . GLY B 1 38  ? 39.565  -80.044  -16.868 1.00 26.71  ? 82  GLY B CA   1 
ATOM   7383  C C    . GLY B 1 38  ? 38.783  -81.301  -16.547 1.00 26.28  ? 82  GLY B C    1 
ATOM   7384  O O    . GLY B 1 38  ? 39.348  -82.401  -16.580 1.00 37.56  ? 82  GLY B O    1 
ATOM   7385  H H    . GLY B 1 38  ? 38.723  -79.129  -18.389 1.00 24.66  ? 82  GLY B H    1 
ATOM   7386  H HA2  . GLY B 1 38  ? 40.325  -80.304  -17.411 1.00 32.06  ? 82  GLY B HA2  1 
ATOM   7387  H HA3  . GLY B 1 38  ? 39.909  -79.693  -16.031 1.00 32.06  ? 82  GLY B HA3  1 
ATOM   7388  N N    . GLY B 1 39  ? 37.509  -81.165  -16.209 1.00 30.30  ? 83  GLY B N    1 
ATOM   7389  C CA   . GLY B 1 39  ? 36.688  -82.311  -15.875 1.00 35.22  ? 83  GLY B CA   1 
ATOM   7390  C C    . GLY B 1 39  ? 36.545  -82.516  -14.379 1.00 37.23  ? 83  GLY B C    1 
ATOM   7391  O O    . GLY B 1 39  ? 36.885  -81.664  -13.554 1.00 37.92  ? 83  GLY B O    1 
ATOM   7392  H H    . GLY B 1 39  ? 37.095  -80.412  -16.166 1.00 36.36  ? 83  GLY B H    1 
ATOM   7393  H HA2  . GLY B 1 39  ? 35.803  -82.195  -16.254 1.00 42.26  ? 83  GLY B HA2  1 
ATOM   7394  H HA3  . GLY B 1 39  ? 37.083  -83.111  -16.257 1.00 42.26  ? 83  GLY B HA3  1 
ATOM   7395  N N    . VAL B 1 40  ? 36.037  -83.703  -14.031 1.00 21.15  ? 84  VAL B N    1 
ATOM   7396  C CA   . VAL B 1 40  ? 35.623  -83.966  -12.656 1.00 25.35  ? 84  VAL B CA   1 
ATOM   7397  C C    . VAL B 1 40  ? 36.816  -84.004  -11.710 1.00 27.88  ? 84  VAL B C    1 
ATOM   7398  O O    . VAL B 1 40  ? 36.697  -83.614  -10.542 1.00 27.13  ? 84  VAL B O    1 
ATOM   7399  C CB   . VAL B 1 40  ? 34.810  -85.273  -12.581 1.00 39.42  ? 84  VAL B CB   1 
ATOM   7400  C CG1  . VAL B 1 40  ? 33.536  -85.149  -13.402 1.00 33.41  ? 84  VAL B CG1  1 
ATOM   7401  C CG2  . VAL B 1 40  ? 35.646  -86.465  -13.041 1.00 32.03  ? 84  VAL B CG2  1 
ATOM   7402  H H    . VAL B 1 40  ? 35.924  -84.364  -14.569 1.00 25.39  ? 84  VAL B H    1 
ATOM   7403  H HA   . VAL B 1 40  ? 35.044  -83.244  -12.365 1.00 30.42  ? 84  VAL B HA   1 
ATOM   7404  H HB   . VAL B 1 40  ? 34.554  -85.429  -11.658 1.00 47.30  ? 84  VAL B HB   1 
ATOM   7405  H HG11 . VAL B 1 40  ? 33.040  -85.981  -13.342 1.00 40.09  ? 84  VAL B HG11 1 
ATOM   7406  H HG12 . VAL B 1 40  ? 33.003  -84.419  -13.050 1.00 40.09  ? 84  VAL B HG12 1 
ATOM   7407  H HG13 . VAL B 1 40  ? 33.773  -84.971  -14.326 1.00 40.09  ? 84  VAL B HG13 1 
ATOM   7408  H HG21 . VAL B 1 40  ? 35.107  -87.269  -12.982 1.00 38.44  ? 84  VAL B HG21 1 
ATOM   7409  H HG22 . VAL B 1 40  ? 35.924  -86.319  -13.959 1.00 38.44  ? 84  VAL B HG22 1 
ATOM   7410  H HG23 . VAL B 1 40  ? 36.424  -86.545  -12.468 1.00 38.44  ? 84  VAL B HG23 1 
ATOM   7411  N N    . THR B 1 41  ? 37.977  -84.469  -12.175 1.00 24.86  ? 85  THR B N    1 
ATOM   7412  C CA   . THR B 1 41  ? 39.148  -84.493  -11.305 1.00 24.61  ? 85  THR B CA   1 
ATOM   7413  C C    . THR B 1 41  ? 39.554  -83.093  -10.864 1.00 13.45  ? 85  THR B C    1 
ATOM   7414  O O    . THR B 1 41  ? 40.331  -82.954  -9.913  1.00 27.60  ? 85  THR B O    1 
ATOM   7415  C CB   . THR B 1 41  ? 40.330  -85.171  -12.005 1.00 30.87  ? 85  THR B CB   1 
ATOM   7416  O OG1  . THR B 1 41  ? 40.759  -84.374  -13.116 1.00 43.00  ? 85  THR B OG1  1 
ATOM   7417  C CG2  . THR B 1 41  ? 39.945  -86.560  -12.499 1.00 35.53  ? 85  THR B CG2  1 
ATOM   7418  H H    . THR B 1 41  ? 38.110  -84.769  -12.971 1.00 29.84  ? 85  THR B H    1 
ATOM   7419  H HA   . THR B 1 41  ? 38.938  -85.007  -10.510 1.00 29.53  ? 85  THR B HA   1 
ATOM   7420  H HB   . THR B 1 41  ? 41.063  -85.265  -11.376 1.00 37.05  ? 85  THR B HB   1 
ATOM   7421  H HG1  . THR B 1 41  ? 41.408  -84.744  -13.501 1.00 51.60  ? 85  THR B HG1  1 
ATOM   7422  H HG21 . THR B 1 41  ? 40.702  -86.977  -12.939 1.00 42.64  ? 85  THR B HG21 1 
ATOM   7423  H HG22 . THR B 1 41  ? 39.671  -87.113  -11.751 1.00 42.64  ? 85  THR B HG22 1 
ATOM   7424  H HG23 . THR B 1 41  ? 39.210  -86.495  -13.129 1.00 42.64  ? 85  THR B HG23 1 
ATOM   7425  N N    . GLU B 1 42  ? 39.045  -82.057  -11.530 1.00 17.33  ? 86  GLU B N    1 
ATOM   7426  C CA   . GLU B 1 42  ? 39.352  -80.674  -11.198 1.00 20.29  ? 86  GLU B CA   1 
ATOM   7427  C C    . GLU B 1 42  ? 38.277  -80.022  -10.341 1.00 17.28  ? 86  GLU B C    1 
ATOM   7428  O O    . GLU B 1 42  ? 38.345  -78.813  -10.095 1.00 18.39  ? 86  GLU B O    1 
ATOM   7429  C CB   . GLU B 1 42  ? 39.551  -79.867  -12.480 1.00 16.29  ? 86  GLU B CB   1 
ATOM   7430  C CG   . GLU B 1 42  ? 40.564  -80.475  -13.426 1.00 19.92  ? 86  GLU B CG   1 
ATOM   7431  C CD   . GLU B 1 42  ? 41.886  -80.756  -12.756 1.00 20.41  ? 86  GLU B CD   1 
ATOM   7432  O OE1  . GLU B 1 42  ? 42.481  -79.796  -12.222 1.00 17.66  ? 86  GLU B OE1  1 
ATOM   7433  O OE2  . GLU B 1 42  ? 42.323  -81.924  -12.751 1.00 23.44  ? 86  GLU B OE2  1 
ATOM   7434  H H    . GLU B 1 42  ? 38.506  -82.137  -12.195 1.00 20.79  ? 86  GLU B H    1 
ATOM   7435  H HA   . GLU B 1 42  ? 40.183  -80.649  -10.699 1.00 24.35  ? 86  GLU B HA   1 
ATOM   7436  H HB2  . GLU B 1 42  ? 38.703  -79.809  -12.948 1.00 19.55  ? 86  GLU B HB2  1 
ATOM   7437  H HB3  . GLU B 1 42  ? 39.859  -78.978  -12.245 1.00 19.55  ? 86  GLU B HB3  1 
ATOM   7438  H HG2  . GLU B 1 42  ? 40.215  -81.314  -13.766 1.00 23.91  ? 86  GLU B HG2  1 
ATOM   7439  H HG3  . GLU B 1 42  ? 40.723  -79.860  -14.159 1.00 23.91  ? 86  GLU B HG3  1 
ATOM   7440  N N    . ARG B 1 43  ? 37.288  -80.785  -9.887  1.00 18.63  ? 87  ARG B N    1 
ATOM   7441  C CA   . ARG B 1 43  ? 36.257  -80.218  -9.031  1.00 22.97  ? 87  ARG B CA   1 
ATOM   7442  C C    . ARG B 1 43  ? 36.882  -79.631  -7.773  1.00 14.89  ? 87  ARG B C    1 
ATOM   7443  O O    . ARG B 1 43  ? 37.909  -80.107  -7.282  1.00 19.18  ? 87  ARG B O    1 
ATOM   7444  C CB   . ARG B 1 43  ? 35.220  -81.279  -8.669  1.00 23.47  ? 87  ARG B CB   1 
ATOM   7445  C CG   . ARG B 1 43  ? 34.252  -81.591  -9.802  1.00 20.45  ? 87  ARG B CG   1 
ATOM   7446  C CD   . ARG B 1 43  ? 33.365  -82.773  -9.456  1.00 24.66  ? 87  ARG B CD   1 
ATOM   7447  N NE   . ARG B 1 43  ? 32.577  -82.526  -8.252  1.00 46.43  ? 87  ARG B NE   1 
ATOM   7448  C CZ   . ARG B 1 43  ? 32.003  -83.476  -7.520  1.00 43.13  ? 87  ARG B CZ   1 
ATOM   7449  N NH1  . ARG B 1 43  ? 32.131  -84.754  -7.855  1.00 51.62  ? 87  ARG B NH1  1 
ATOM   7450  N NH2  . ARG B 1 43  ? 31.304  -83.147  -6.442  1.00 50.38  ? 87  ARG B NH2  1 
ATOM   7451  H H    . ARG B 1 43  ? 37.193  -81.622  -10.057 1.00 22.36  ? 87  ARG B H    1 
ATOM   7452  H HA   . ARG B 1 43  ? 35.806  -79.503  -9.507  1.00 27.56  ? 87  ARG B HA   1 
ATOM   7453  H HB2  . ARG B 1 43  ? 35.680  -82.100  -8.436  1.00 28.16  ? 87  ARG B HB2  1 
ATOM   7454  H HB3  . ARG B 1 43  ? 34.701  -80.965  -7.912  1.00 28.16  ? 87  ARG B HB3  1 
ATOM   7455  H HG2  . ARG B 1 43  ? 33.684  -80.821  -9.961  1.00 24.55  ? 87  ARG B HG2  1 
ATOM   7456  H HG3  . ARG B 1 43  ? 34.754  -81.811  -10.602 1.00 24.55  ? 87  ARG B HG3  1 
ATOM   7457  H HD2  . ARG B 1 43  ? 32.753  -82.939  -10.190 1.00 29.59  ? 87  ARG B HD2  1 
ATOM   7458  H HD3  . ARG B 1 43  ? 33.920  -83.553  -9.300  1.00 29.59  ? 87  ARG B HD3  1 
ATOM   7459  H HE   . ARG B 1 43  ? 32.476  -81.711  -7.999  1.00 55.72  ? 87  ARG B HE   1 
ATOM   7460  H HH11 . ARG B 1 43  ? 32.583  -84.972  -8.553  1.00 61.95  ? 87  ARG B HH11 1 
ATOM   7461  H HH12 . ARG B 1 43  ? 31.759  -85.363  -7.376  1.00 61.95  ? 87  ARG B HH12 1 
ATOM   7462  H HH21 . ARG B 1 43  ? 31.220  -82.321  -6.220  1.00 60.45  ? 87  ARG B HH21 1 
ATOM   7463  H HH22 . ARG B 1 43  ? 30.935  -83.761  -5.966  1.00 60.45  ? 87  ARG B HH22 1 
ATOM   7464  N N    . MET B 1 44  ? 36.258  -78.575  -7.265  1.00 15.25  ? 88  MET B N    1 
ATOM   7465  C CA   . MET B 1 44  ? 36.725  -77.943  -6.043  1.00 18.35  ? 88  MET B CA   1 
ATOM   7466  C C    . MET B 1 44  ? 36.953  -79.008  -4.968  1.00 15.62  ? 88  MET B C    1 
ATOM   7467  O O    . MET B 1 44  ? 36.071  -79.849  -4.741  1.00 19.12  ? 88  MET B O    1 
ATOM   7468  C CB   . MET B 1 44  ? 35.699  -76.914  -5.559  1.00 19.02  ? 88  MET B CB   1 
ATOM   7469  C CG   . MET B 1 44  ? 36.178  -76.034  -4.410  1.00 25.64  ? 88  MET B CG   1 
ATOM   7470  S SD   . MET B 1 44  ? 37.518  -74.911  -4.867  1.00 17.80  ? 88  MET B SD   1 
ATOM   7471  C CE   . MET B 1 44  ? 36.674  -73.789  -5.976  1.00 18.54  ? 88  MET B CE   1 
ATOM   7472  H H    . MET B 1 44  ? 35.562  -78.207  -7.610  1.00 18.30  ? 88  MET B H    1 
ATOM   7473  H HA   . MET B 1 44  ? 37.559  -77.481  -6.219  1.00 22.02  ? 88  MET B HA   1 
ATOM   7474  H HB2  . MET B 1 44  ? 35.472  -76.331  -6.300  1.00 22.83  ? 88  MET B HB2  1 
ATOM   7475  H HB3  . MET B 1 44  ? 34.906  -77.384  -5.259  1.00 22.83  ? 88  MET B HB3  1 
ATOM   7476  H HG2  . MET B 1 44  ? 35.434  -75.497  -4.096  1.00 30.77  ? 88  MET B HG2  1 
ATOM   7477  H HG3  . MET B 1 44  ? 36.499  -76.603  -3.693  1.00 30.77  ? 88  MET B HG3  1 
ATOM   7478  H HE1  . MET B 1 44  ? 37.306  -73.125  -6.294  1.00 22.25  ? 88  MET B HE1  1 
ATOM   7479  H HE2  . MET B 1 44  ? 36.319  -74.293  -6.725  1.00 22.25  ? 88  MET B HE2  1 
ATOM   7480  H HE3  . MET B 1 44  ? 35.951  -73.355  -5.497  1.00 22.25  ? 88  MET B HE3  1 
ATOM   7481  N N    . PRO B 1 45  ? 38.111  -79.021  -4.305  1.00 16.65  ? 89  PRO B N    1 
ATOM   7482  C CA   . PRO B 1 45  ? 38.363  -80.051  -3.289  1.00 18.22  ? 89  PRO B CA   1 
ATOM   7483  C C    . PRO B 1 45  ? 37.253  -80.112  -2.250  1.00 17.16  ? 89  PRO B C    1 
ATOM   7484  O O    . PRO B 1 45  ? 36.730  -79.087  -1.809  1.00 10.00  ? 89  PRO B O    1 
ATOM   7485  C CB   . PRO B 1 45  ? 39.694  -79.615  -2.668  1.00 19.97  ? 89  PRO B CB   1 
ATOM   7486  C CG   . PRO B 1 45  ? 40.376  -78.866  -3.748  1.00 24.11  ? 89  PRO B CG   1 
ATOM   7487  C CD   . PRO B 1 45  ? 39.291  -78.165  -4.518  1.00 15.11  ? 89  PRO B CD   1 
ATOM   7488  H HA   . PRO B 1 45  ? 38.468  -80.921  -3.705  1.00 21.87  ? 89  PRO B HA   1 
ATOM   7489  H HB2  . PRO B 1 45  ? 39.528  -79.043  -1.903  1.00 23.96  ? 89  PRO B HB2  1 
ATOM   7490  H HB3  . PRO B 1 45  ? 40.208  -80.396  -2.411  1.00 23.96  ? 89  PRO B HB3  1 
ATOM   7491  H HG2  . PRO B 1 45  ? 40.989  -78.222  -3.360  1.00 28.94  ? 89  PRO B HG2  1 
ATOM   7492  H HG3  . PRO B 1 45  ? 40.853  -79.487  -4.322  1.00 28.94  ? 89  PRO B HG3  1 
ATOM   7493  H HD2  . PRO B 1 45  ? 39.136  -77.280  -4.153  1.00 18.14  ? 89  PRO B HD2  1 
ATOM   7494  H HD3  . PRO B 1 45  ? 39.515  -78.127  -5.460  1.00 18.14  ? 89  PRO B HD3  1 
ATOM   7495  N N    . THR B 1 46  ? 36.901  -81.337  -1.862  1.00 19.28  ? 90  THR B N    1 
ATOM   7496  C CA   . THR B 1 46  ? 35.853  -81.527  -0.864  1.00 21.91  ? 90  THR B CA   1 
ATOM   7497  C C    . THR B 1 46  ? 36.141  -80.799  0.443   1.00 16.38  ? 90  THR B C    1 
ATOM   7498  O O    . THR B 1 46  ? 35.198  -80.228  1.019   1.00 18.89  ? 90  THR B O    1 
ATOM   7499  C CB   . THR B 1 46  ? 35.653  -83.029  -0.618  1.00 28.82  ? 90  THR B CB   1 
ATOM   7500  O OG1  . THR B 1 46  ? 35.100  -83.635  -1.794  1.00 33.10  ? 90  THR B OG1  1 
ATOM   7501  C CG2  . THR B 1 46  ? 34.716  -83.281  0.557   1.00 32.75  ? 90  THR B CG2  1 
ATOM   7502  H H    . THR B 1 46  ? 37.249  -82.066  -2.158  1.00 23.14  ? 90  THR B H    1 
ATOM   7503  H HA   . THR B 1 46  ? 35.022  -81.174  -1.218  1.00 26.29  ? 90  THR B HA   1 
ATOM   7504  H HB   . THR B 1 46  ? 36.509  -83.439  -0.419  1.00 34.59  ? 90  THR B HB   1 
ATOM   7505  H HG1  . THR B 1 46  ? 34.987  -84.458  -1.667  1.00 39.72  ? 90  THR B HG1  1 
ATOM   7506  H HG21 . THR B 1 46  ? 34.604  -84.235  0.693   1.00 39.30  ? 90  THR B HG21 1 
ATOM   7507  H HG22 . THR B 1 46  ? 35.084  -82.889  1.364   1.00 39.30  ? 90  THR B HG22 1 
ATOM   7508  H HG23 . THR B 1 46  ? 33.848  -82.885  0.380   1.00 39.30  ? 90  THR B HG23 1 
ATOM   7509  N N    . PRO B 1 47  ? 37.367  -80.787  0.970   1.00 18.40  ? 91  PRO B N    1 
ATOM   7510  C CA   . PRO B 1 47  ? 37.610  -80.040  2.213   1.00 16.46  ? 91  PRO B CA   1 
ATOM   7511  C C    . PRO B 1 47  ? 37.201  -78.579  2.134   1.00 16.70  ? 91  PRO B C    1 
ATOM   7512  O O    . PRO B 1 47  ? 36.775  -78.012  3.148   1.00 17.76  ? 91  PRO B O    1 
ATOM   7513  C CB   . PRO B 1 47  ? 39.121  -80.200  2.420   1.00 13.73  ? 91  PRO B CB   1 
ATOM   7514  C CG   . PRO B 1 47  ? 39.451  -81.481  1.747   1.00 14.49  ? 91  PRO B CG   1 
ATOM   7515  C CD   . PRO B 1 47  ? 38.553  -81.551  0.548   1.00 14.97  ? 91  PRO B CD   1 
ATOM   7516  H HA   . PRO B 1 47  ? 37.143  -80.461  2.952   1.00 19.76  ? 91  PRO B HA   1 
ATOM   7517  H HB2  . PRO B 1 47  ? 39.590  -79.460  2.004   1.00 16.48  ? 91  PRO B HB2  1 
ATOM   7518  H HB3  . PRO B 1 47  ? 39.320  -80.247  3.368   1.00 16.48  ? 91  PRO B HB3  1 
ATOM   7519  H HG2  . PRO B 1 47  ? 40.383  -81.475  1.476   1.00 17.39  ? 91  PRO B HG2  1 
ATOM   7520  H HG3  . PRO B 1 47  ? 39.275  -82.220  2.349   1.00 17.39  ? 91  PRO B HG3  1 
ATOM   7521  H HD2  . PRO B 1 47  ? 38.975  -81.127  -0.217  1.00 17.96  ? 91  PRO B HD2  1 
ATOM   7522  H HD3  . PRO B 1 47  ? 38.313  -82.471  0.358   1.00 17.96  ? 91  PRO B HD3  1 
ATOM   7523  N N    . VAL B 1 48  ? 37.311  -77.949  0.962   1.00 14.78  ? 92  VAL B N    1 
ATOM   7524  C CA   . VAL B 1 48  ? 36.838  -76.575  0.818   1.00 17.77  ? 92  VAL B CA   1 
ATOM   7525  C C    . VAL B 1 48  ? 35.323  -76.519  0.962   1.00 18.11  ? 92  VAL B C    1 
ATOM   7526  O O    . VAL B 1 48  ? 34.778  -75.614  1.607   1.00 16.20  ? 92  VAL B O    1 
ATOM   7527  C CB   . VAL B 1 48  ? 37.298  -75.988  -0.530  1.00 12.16  ? 92  VAL B CB   1 
ATOM   7528  C CG1  . VAL B 1 48  ? 36.674  -74.613  -0.768  1.00 12.06  ? 92  VAL B CG1  1 
ATOM   7529  C CG2  . VAL B 1 48  ? 38.815  -75.894  -0.577  1.00 21.35  ? 92  VAL B CG2  1 
ATOM   7530  H H    . VAL B 1 48  ? 37.649  -78.289  0.248   1.00 17.74  ? 92  VAL B H    1 
ATOM   7531  H HA   . VAL B 1 48  ? 37.224  -76.035  1.525   1.00 21.33  ? 92  VAL B HA   1 
ATOM   7532  H HB   . VAL B 1 48  ? 37.011  -76.576  -1.246  1.00 14.59  ? 92  VAL B HB   1 
ATOM   7533  H HG11 . VAL B 1 48  ? 36.982  -74.270  -1.622  1.00 14.47  ? 92  VAL B HG11 1 
ATOM   7534  H HG12 . VAL B 1 48  ? 35.708  -74.702  -0.776  1.00 14.47  ? 92  VAL B HG12 1 
ATOM   7535  H HG13 . VAL B 1 48  ? 36.946  -74.015  -0.054  1.00 14.47  ? 92  VAL B HG13 1 
ATOM   7536  H HG21 . VAL B 1 48  ? 39.082  -75.523  -1.432  1.00 25.63  ? 92  VAL B HG21 1 
ATOM   7537  H HG22 . VAL B 1 48  ? 39.118  -75.319  0.143   1.00 25.63  ? 92  VAL B HG22 1 
ATOM   7538  H HG23 . VAL B 1 48  ? 39.189  -76.783  -0.470  1.00 25.63  ? 92  VAL B HG23 1 
ATOM   7539  N N    . ILE B 1 49  ? 34.619  -77.480  0.363   1.00 18.86  ? 93  ILE B N    1 
ATOM   7540  C CA   . ILE B 1 49  ? 33.162  -77.514  0.463   1.00 20.91  ? 93  ILE B CA   1 
ATOM   7541  C C    . ILE B 1 49  ? 32.740  -77.703  1.914   1.00 15.00  ? 93  ILE B C    1 
ATOM   7542  O O    . ILE B 1 49  ? 31.885  -76.974  2.430   1.00 15.62  ? 93  ILE B O    1 
ATOM   7543  C CB   . ILE B 1 49  ? 32.589  -78.619  -0.443  1.00 17.66  ? 93  ILE B CB   1 
ATOM   7544  C CG1  . ILE B 1 49  ? 33.060  -78.425  -1.892  1.00 23.75  ? 93  ILE B CG1  1 
ATOM   7545  C CG2  . ILE B 1 49  ? 31.066  -78.642  -0.373  1.00 15.92  ? 93  ILE B CG2  1 
ATOM   7546  C CD1  . ILE B 1 49  ? 32.771  -77.048  -2.477  1.00 11.06  ? 93  ILE B CD1  1 
ATOM   7547  H H    . ILE B 1 49  ? 34.958  -78.118  -0.104  1.00 22.63  ? 93  ILE B H    1 
ATOM   7548  H HA   . ILE B 1 49  ? 32.807  -76.664  0.158   1.00 25.09  ? 93  ILE B HA   1 
ATOM   7549  H HB   . ILE B 1 49  ? 32.921  -79.474  -0.128  1.00 21.19  ? 93  ILE B HB   1 
ATOM   7550  H HG12 . ILE B 1 49  ? 34.019  -78.563  -1.926  1.00 28.50  ? 93  ILE B HG12 1 
ATOM   7551  H HG13 . ILE B 1 49  ? 32.616  -79.081  -2.452  1.00 28.50  ? 93  ILE B HG13 1 
ATOM   7552  H HG21 . ILE B 1 49  ? 30.734  -79.345  -0.952  1.00 19.10  ? 93  ILE B HG21 1 
ATOM   7553  H HG22 . ILE B 1 49  ? 30.796  -78.812  0.543   1.00 19.10  ? 93  ILE B HG22 1 
ATOM   7554  H HG23 . ILE B 1 49  ? 30.724  -77.783  -0.665  1.00 19.10  ? 93  ILE B HG23 1 
ATOM   7555  H HD11 . ILE B 1 49  ? 33.101  -77.017  -3.388  1.00 13.27  ? 93  ILE B HD11 1 
ATOM   7556  H HD12 . ILE B 1 49  ? 31.813  -76.895  -2.466  1.00 13.27  ? 93  ILE B HD12 1 
ATOM   7557  H HD13 . ILE B 1 49  ? 33.219  -76.376  -1.939  1.00 13.27  ? 93  ILE B HD13 1 
ATOM   7558  N N    . LYS B 1 50  ? 33.338  -78.682  2.597   1.00 16.77  ? 94  LYS B N    1 
ATOM   7559  C CA   . LYS B 1 50  ? 33.011  -78.894  4.002   1.00 19.28  ? 94  LYS B CA   1 
ATOM   7560  C C    . LYS B 1 50  ? 33.302  -77.645  4.825   1.00 18.84  ? 94  LYS B C    1 
ATOM   7561  O O    . LYS B 1 50  ? 32.515  -77.273  5.703   1.00 20.51  ? 94  LYS B O    1 
ATOM   7562  C CB   . LYS B 1 50  ? 33.792  -80.084  4.556   1.00 22.01  ? 94  LYS B CB   1 
ATOM   7563  C CG   . LYS B 1 50  ? 33.429  -81.423  3.936   1.00 25.10  ? 94  LYS B CG   1 
ATOM   7564  C CD   . LYS B 1 50  ? 34.239  -82.545  4.572   1.00 36.32  ? 94  LYS B CD   1 
ATOM   7565  C CE   . LYS B 1 50  ? 33.836  -83.905  4.040   1.00 36.82  ? 94  LYS B CE   1 
ATOM   7566  N NZ   . LYS B 1 50  ? 34.707  -84.988  4.575   1.00 51.13  ? 94  LYS B NZ   1 
ATOM   7567  H H    . LYS B 1 50  ? 33.924  -79.224  2.276   1.00 20.13  ? 94  LYS B H    1 
ATOM   7568  H HA   . LYS B 1 50  ? 32.065  -79.092  4.081   1.00 23.13  ? 94  LYS B HA   1 
ATOM   7569  H HB2  . LYS B 1 50  ? 34.737  -79.934  4.399   1.00 26.41  ? 94  LYS B HB2  1 
ATOM   7570  H HB3  . LYS B 1 50  ? 33.625  -80.147  5.509   1.00 26.41  ? 94  LYS B HB3  1 
ATOM   7571  H HG2  . LYS B 1 50  ? 32.488  -81.603  4.083   1.00 30.13  ? 94  LYS B HG2  1 
ATOM   7572  H HG3  . LYS B 1 50  ? 33.626  -81.403  2.987   1.00 30.13  ? 94  LYS B HG3  1 
ATOM   7573  H HD2  . LYS B 1 50  ? 35.179  -82.410  4.376   1.00 43.58  ? 94  LYS B HD2  1 
ATOM   7574  H HD3  . LYS B 1 50  ? 34.092  -82.540  5.531   1.00 43.58  ? 94  LYS B HD3  1 
ATOM   7575  H HE2  . LYS B 1 50  ? 32.922  -84.094  4.305   1.00 44.19  ? 94  LYS B HE2  1 
ATOM   7576  H HE3  . LYS B 1 50  ? 33.911  -83.905  3.073   1.00 44.19  ? 94  LYS B HE3  1 
ATOM   7577  H HZ1  . LYS B 1 50  ? 35.553  -84.840  4.341   1.00 61.36  ? 94  LYS B HZ1  1 
ATOM   7578  H HZ2  . LYS B 1 50  ? 34.653  -85.012  5.463   1.00 61.36  ? 94  LYS B HZ2  1 
ATOM   7579  H HZ3  . LYS B 1 50  ? 34.450  -85.775  4.248   1.00 61.36  ? 94  LYS B HZ3  1 
ATOM   7580  N N    . ALA B 1 51  ? 34.430  -76.985  4.555   1.00 15.16  ? 95  ALA B N    1 
ATOM   7581  C CA   . ALA B 1 51  ? 34.766  -75.770  5.289   1.00 17.20  ? 95  ALA B CA   1 
ATOM   7582  C C    . ALA B 1 51  ? 33.705  -74.698  5.086   1.00 14.09  ? 95  ALA B C    1 
ATOM   7583  O O    . ALA B 1 51  ? 33.356  -73.973  6.025   1.00 12.95  ? 95  ALA B O    1 
ATOM   7584  C CB   . ALA B 1 51  ? 36.138  -75.257  4.854   1.00 17.26  ? 95  ALA B CB   1 
ATOM   7585  H H    . ALA B 1 51  ? 35.007  -77.217  3.962   1.00 18.20  ? 95  ALA B H    1 
ATOM   7586  H HA   . ALA B 1 51  ? 34.809  -75.974  6.236   1.00 20.64  ? 95  ALA B HA   1 
ATOM   7587  H HB1  . ALA B 1 51  ? 36.345  -74.450  5.351   1.00 20.72  ? 95  ALA B HB1  1 
ATOM   7588  H HB2  . ALA B 1 51  ? 36.802  -75.939  5.038   1.00 20.72  ? 95  ALA B HB2  1 
ATOM   7589  H HB3  . ALA B 1 51  ? 36.115  -75.064  3.903   1.00 20.72  ? 95  ALA B HB3  1 
ATOM   7590  N N    . PHE B 1 52  ? 33.179  -74.581  3.864   1.00 17.17  ? 96  PHE B N    1 
ATOM   7591  C CA   . PHE B 1 52  ? 32.074  -73.661  3.625   1.00 19.37  ? 96  PHE B CA   1 
ATOM   7592  C C    . PHE B 1 52  ? 30.885  -73.989  4.519   1.00 14.70  ? 96  PHE B C    1 
ATOM   7593  O O    . PHE B 1 52  ? 30.263  -73.087  5.092   1.00 13.96  ? 96  PHE B O    1 
ATOM   7594  C CB   . PHE B 1 52  ? 31.660  -73.706  2.155   1.00 21.86  ? 96  PHE B CB   1 
ATOM   7595  C CG   . PHE B 1 52  ? 32.297  -72.636  1.310   1.00 19.47  ? 96  PHE B CG   1 
ATOM   7596  C CD1  . PHE B 1 52  ? 31.770  -71.356  1.278   1.00 20.49  ? 96  PHE B CD1  1 
ATOM   7597  C CD2  . PHE B 1 52  ? 33.411  -72.915  0.537   1.00 19.43  ? 96  PHE B CD2  1 
ATOM   7598  C CE1  . PHE B 1 52  ? 32.349  -70.374  0.498   1.00 22.07  ? 96  PHE B CE1  1 
ATOM   7599  C CE2  . PHE B 1 52  ? 33.993  -71.935  -0.243  1.00 16.77  ? 96  PHE B CE2  1 
ATOM   7600  C CZ   . PHE B 1 52  ? 33.461  -70.665  -0.262  1.00 21.22  ? 96  PHE B CZ   1 
ATOM   7601  H H    . PHE B 1 52  ? 33.441  -75.017  3.171   1.00 20.61  ? 96  PHE B H    1 
ATOM   7602  H HA   . PHE B 1 52  ? 32.363  -72.758  3.828   1.00 23.24  ? 96  PHE B HA   1 
ATOM   7603  H HB2  . PHE B 1 52  ? 31.914  -74.566  1.786   1.00 26.23  ? 96  PHE B HB2  1 
ATOM   7604  H HB3  . PHE B 1 52  ? 30.698  -73.595  2.098   1.00 26.23  ? 96  PHE B HB3  1 
ATOM   7605  H HD1  . PHE B 1 52  ? 31.020  -71.155  1.790   1.00 24.59  ? 96  PHE B HD1  1 
ATOM   7606  H HD2  . PHE B 1 52  ? 33.775  -73.771  0.547   1.00 23.32  ? 96  PHE B HD2  1 
ATOM   7607  H HE1  . PHE B 1 52  ? 31.989  -69.517  0.487   1.00 26.48  ? 96  PHE B HE1  1 
ATOM   7608  H HE2  . PHE B 1 52  ? 34.743  -72.133  -0.756  1.00 20.13  ? 96  PHE B HE2  1 
ATOM   7609  H HZ   . PHE B 1 52  ? 33.852  -70.004  -0.787  1.00 25.47  ? 96  PHE B HZ   1 
ATOM   7610  N N    . GLY B 1 53  ? 30.555  -75.276  4.650   1.00 21.06  ? 97  GLY B N    1 
ATOM   7611  C CA   . GLY B 1 53  ? 29.463  -75.664  5.528   1.00 18.47  ? 97  GLY B CA   1 
ATOM   7612  C C    . GLY B 1 53  ? 29.671  -75.194  6.955   1.00 16.03  ? 97  GLY B C    1 
ATOM   7613  O O    . GLY B 1 53  ? 28.739  -74.715  7.604   1.00 18.68  ? 97  GLY B O    1 
ATOM   7614  H H    . GLY B 1 53  ? 30.943  -75.929  4.247   1.00 25.27  ? 97  GLY B H    1 
ATOM   7615  H HA2  . GLY B 1 53  ? 28.633  -75.286  5.198   1.00 22.17  ? 97  GLY B HA2  1 
ATOM   7616  H HA3  . GLY B 1 53  ? 29.380  -76.631  5.532   1.00 22.17  ? 97  GLY B HA3  1 
ATOM   7617  N N    . ILE B 1 54  ? 30.899  -75.323  7.462   1.00 19.24  ? 98  ILE B N    1 
ATOM   7618  C CA   . ILE B 1 54  ? 31.215  -74.803  8.789   1.00 11.70  ? 98  ILE B CA   1 
ATOM   7619  C C    . ILE B 1 54  ? 30.997  -73.296  8.823   1.00 20.78  ? 98  ILE B C    1 
ATOM   7620  O O    . ILE B 1 54  ? 30.361  -72.759  9.737   1.00 17.50  ? 98  ILE B O    1 
ATOM   7621  C CB   . ILE B 1 54  ? 32.658  -75.173  9.179   1.00 15.97  ? 98  ILE B CB   1 
ATOM   7622  C CG1  . ILE B 1 54  ? 32.825  -76.695  9.224   1.00 21.23  ? 98  ILE B CG1  1 
ATOM   7623  C CG2  . ILE B 1 54  ? 33.025  -74.566  10.530  1.00 18.44  ? 98  ILE B CG2  1 
ATOM   7624  C CD1  . ILE B 1 54  ? 34.264  -77.157  9.367   1.00 18.94  ? 98  ILE B CD1  1 
ATOM   7625  H H    . ILE B 1 54  ? 31.558  -75.703  7.062   1.00 23.09  ? 98  ILE B H    1 
ATOM   7626  H HA   . ILE B 1 54  ? 30.616  -75.206  9.437   1.00 14.04  ? 98  ILE B HA   1 
ATOM   7627  H HB   . ILE B 1 54  ? 33.260  -74.816  8.507   1.00 19.17  ? 98  ILE B HB   1 
ATOM   7628  H HG12 . ILE B 1 54  ? 32.327  -77.041  9.981   1.00 25.48  ? 98  ILE B HG12 1 
ATOM   7629  H HG13 . ILE B 1 54  ? 32.475  -77.071  8.402   1.00 25.48  ? 98  ILE B HG13 1 
ATOM   7630  H HG21 . ILE B 1 54  ? 33.936  -74.814  10.750  1.00 22.13  ? 98  ILE B HG21 1 
ATOM   7631  H HG22 . ILE B 1 54  ? 32.949  -73.600  10.472  1.00 22.13  ? 98  ILE B HG22 1 
ATOM   7632  H HG23 . ILE B 1 54  ? 32.416  -74.906  11.204  1.00 22.13  ? 98  ILE B HG23 1 
ATOM   7633  H HD11 . ILE B 1 54  ? 34.283  -78.127  9.387   1.00 22.73  ? 98  ILE B HD11 1 
ATOM   7634  H HD12 . ILE B 1 54  ? 34.777  -76.832  8.611   1.00 22.73  ? 98  ILE B HD12 1 
ATOM   7635  H HD13 . ILE B 1 54  ? 34.629  -76.802  10.192  1.00 22.73  ? 98  ILE B HD13 1 
ATOM   7636  N N    . LEU B 1 55  ? 31.515  -72.594  7.813   1.00 17.05  ? 99  LEU B N    1 
ATOM   7637  C CA   . LEU B 1 55  ? 31.418  -71.139  7.786   1.00 17.63  ? 99  LEU B CA   1 
ATOM   7638  C C    . LEU B 1 55  ? 29.964  -70.685  7.732   1.00 21.65  ? 99  LEU B C    1 
ATOM   7639  O O    . LEU B 1 55  ? 29.552  -69.795  8.483   1.00 15.50  ? 99  LEU B O    1 
ATOM   7640  C CB   . LEU B 1 55  ? 32.199  -70.593  6.592   1.00 20.92  ? 99  LEU B CB   1 
ATOM   7641  C CG   . LEU B 1 55  ? 32.050  -69.095  6.320   1.00 19.70  ? 99  LEU B CG   1 
ATOM   7642  C CD1  . LEU B 1 55  ? 32.570  -68.287  7.496   1.00 19.36  ? 99  LEU B CD1  1 
ATOM   7643  C CD2  . LEU B 1 55  ? 32.769  -68.721  5.039   1.00 18.21  ? 99  LEU B CD2  1 
ATOM   7644  H H    . LEU B 1 55  ? 31.925  -72.936  7.139   1.00 20.46  ? 99  LEU B H    1 
ATOM   7645  H HA   . LEU B 1 55  ? 31.815  -70.780  8.595   1.00 21.16  ? 99  LEU B HA   1 
ATOM   7646  H HB2  . LEU B 1 55  ? 33.141  -70.768  6.738   1.00 25.11  ? 99  LEU B HB2  1 
ATOM   7647  H HB3  . LEU B 1 55  ? 31.904  -71.062  5.795   1.00 25.11  ? 99  LEU B HB3  1 
ATOM   7648  H HG   . LEU B 1 55  ? 31.109  -68.887  6.207   1.00 23.65  ? 99  LEU B HG   1 
ATOM   7649  H HD11 . LEU B 1 55  ? 32.466  -67.343  7.300   1.00 23.23  ? 99  LEU B HD11 1 
ATOM   7650  H HD12 . LEU B 1 55  ? 32.062  -68.520  8.288   1.00 23.23  ? 99  LEU B HD12 1 
ATOM   7651  H HD13 . LEU B 1 55  ? 33.508  -68.495  7.631   1.00 23.23  ? 99  LEU B HD13 1 
ATOM   7652  H HD21 . LEU B 1 55  ? 32.664  -67.769  4.884   1.00 21.86  ? 99  LEU B HD21 1 
ATOM   7653  H HD22 . LEU B 1 55  ? 33.710  -68.940  5.130   1.00 21.86  ? 99  LEU B HD22 1 
ATOM   7654  H HD23 . LEU B 1 55  ? 32.383  -69.221  4.303   1.00 21.86  ? 99  LEU B HD23 1 
ATOM   7655  N N    . LYS B 1 56  ? 29.172  -71.275  6.834   1.00 16.36  ? 100 LYS B N    1 
ATOM   7656  C CA   . LYS B 1 56  ? 27.775  -70.872  6.720   1.00 18.59  ? 100 LYS B CA   1 
ATOM   7657  C C    . LYS B 1 56  ? 26.995  -71.232  7.976   1.00 22.72  ? 100 LYS B C    1 
ATOM   7658  O O    . LYS B 1 56  ? 26.087  -70.494  8.376   1.00 19.93  ? 100 LYS B O    1 
ATOM   7659  C CB   . LYS B 1 56  ? 27.144  -71.517  5.486   1.00 21.57  ? 100 LYS B CB   1 
ATOM   7660  C CG   . LYS B 1 56  ? 27.844  -71.163  4.176   1.00 21.92  ? 100 LYS B CG   1 
ATOM   7661  C CD   . LYS B 1 56  ? 27.793  -69.668  3.889   1.00 15.83  ? 100 LYS B CD   1 
ATOM   7662  C CE   . LYS B 1 56  ? 28.471  -69.334  2.570   1.00 18.38  ? 100 LYS B CE   1 
ATOM   7663  N NZ   . LYS B 1 56  ? 28.376  -67.882  2.238   1.00 16.77  ? 100 LYS B NZ   1 
ATOM   7664  H H    . LYS B 1 56  ? 29.415  -71.896  6.291   1.00 19.63  ? 100 LYS B H    1 
ATOM   7665  H HA   . LYS B 1 56  ? 27.733  -69.910  6.608   1.00 22.31  ? 100 LYS B HA   1 
ATOM   7666  H HB2  . LYS B 1 56  ? 27.175  -72.481  5.587   1.00 25.89  ? 100 LYS B HB2  1 
ATOM   7667  H HB3  . LYS B 1 56  ? 26.222  -71.224  5.418   1.00 25.89  ? 100 LYS B HB3  1 
ATOM   7668  H HG2  . LYS B 1 56  ? 28.775  -71.428  4.231   1.00 26.30  ? 100 LYS B HG2  1 
ATOM   7669  H HG3  . LYS B 1 56  ? 27.407  -71.626  3.445   1.00 26.30  ? 100 LYS B HG3  1 
ATOM   7670  H HD2  . LYS B 1 56  ? 26.867  -69.383  3.836   1.00 19.00  ? 100 LYS B HD2  1 
ATOM   7671  H HD3  . LYS B 1 56  ? 28.252  -69.189  4.597   1.00 19.00  ? 100 LYS B HD3  1 
ATOM   7672  H HE2  . LYS B 1 56  ? 29.410  -69.570  2.627   1.00 22.06  ? 100 LYS B HE2  1 
ATOM   7673  H HE3  . LYS B 1 56  ? 28.044  -69.835  1.858   1.00 22.06  ? 100 LYS B HE3  1 
ATOM   7674  H HZ1  . LYS B 1 56  ? 28.781  -67.721  1.463   1.00 20.13  ? 100 LYS B HZ1  1 
ATOM   7675  H HZ2  . LYS B 1 56  ? 27.522  -67.641  2.174   1.00 20.13  ? 100 LYS B HZ2  1 
ATOM   7676  H HZ3  . LYS B 1 56  ? 28.766  -67.399  2.875   1.00 20.13  ? 100 LYS B HZ3  1 
ATOM   7677  N N    . ARG B 1 57  ? 27.338  -72.355  8.609   1.00 24.33  ? 101 ARG B N    1 
ATOM   7678  C CA   . ARG B 1 57  ? 26.768  -72.682  9.911   1.00 20.68  ? 101 ARG B CA   1 
ATOM   7679  C C    . ARG B 1 57  ? 27.095  -71.601  10.935  1.00 29.95  ? 101 ARG B C    1 
ATOM   7680  O O    . ARG B 1 57  ? 26.223  -71.171  11.700  1.00 25.46  ? 101 ARG B O    1 
ATOM   7681  C CB   . ARG B 1 57  ? 27.292  -74.046  10.363  1.00 29.86  ? 101 ARG B CB   1 
ATOM   7682  C CG   . ARG B 1 57  ? 27.172  -74.358  11.849  1.00 29.98  ? 101 ARG B CG   1 
ATOM   7683  C CD   . ARG B 1 57  ? 25.735  -74.500  12.300  1.00 38.04  ? 101 ARG B CD   1 
ATOM   7684  N NE   . ARG B 1 57  ? 25.658  -75.144  13.607  1.00 42.32  ? 101 ARG B NE   1 
ATOM   7685  C CZ   . ARG B 1 57  ? 25.976  -74.549  14.752  1.00 45.09  ? 101 ARG B CZ   1 
ATOM   7686  N NH1  . ARG B 1 57  ? 26.394  -73.290  14.757  1.00 49.83  ? 101 ARG B NH1  1 
ATOM   7687  N NH2  . ARG B 1 57  ? 25.879  -75.212  15.896  1.00 72.36  ? 101 ARG B NH2  1 
ATOM   7688  H H    . ARG B 1 57  ? 27.894  -72.938  8.308   1.00 29.20  ? 101 ARG B H    1 
ATOM   7689  H HA   . ARG B 1 57  ? 25.803  -72.740  9.831   1.00 24.82  ? 101 ARG B HA   1 
ATOM   7690  H HB2  . ARG B 1 57  ? 26.802  -74.733  9.884   1.00 35.84  ? 101 ARG B HB2  1 
ATOM   7691  H HB3  . ARG B 1 57  ? 28.232  -74.102  10.132  1.00 35.84  ? 101 ARG B HB3  1 
ATOM   7692  H HG2  . ARG B 1 57  ? 27.629  -75.194  12.035  1.00 35.98  ? 101 ARG B HG2  1 
ATOM   7693  H HG3  . ARG B 1 57  ? 27.577  -73.638  12.358  1.00 35.98  ? 101 ARG B HG3  1 
ATOM   7694  H HD2  . ARG B 1 57  ? 25.331  -73.620  12.368  1.00 45.65  ? 101 ARG B HD2  1 
ATOM   7695  H HD3  . ARG B 1 57  ? 25.249  -75.045  11.661  1.00 45.65  ? 101 ARG B HD3  1 
ATOM   7696  H HE   . ARG B 1 57  ? 25.362  -75.951  13.641  1.00 50.79  ? 101 ARG B HE   1 
ATOM   7697  H HH11 . ARG B 1 57  ? 26.460  -72.856  14.017  1.00 59.80  ? 101 ARG B HH11 1 
ATOM   7698  H HH12 . ARG B 1 57  ? 26.599  -72.908  15.499  1.00 59.80  ? 101 ARG B HH12 1 
ATOM   7699  H HH21 . ARG B 1 57  ? 25.608  -76.028  15.898  1.00 86.84  ? 101 ARG B HH21 1 
ATOM   7700  H HH22 . ARG B 1 57  ? 26.084  -74.825  16.636  1.00 86.84  ? 101 ARG B HH22 1 
ATOM   7701  N N    . ALA B 1 58  ? 28.347  -71.140  10.955  1.00 24.00  ? 102 ALA B N    1 
ATOM   7702  C CA   . ALA B 1 58  ? 28.750  -70.120  11.918  1.00 19.37  ? 102 ALA B CA   1 
ATOM   7703  C C    . ALA B 1 58  ? 28.044  -68.797  11.646  1.00 21.78  ? 102 ALA B C    1 
ATOM   7704  O O    . ALA B 1 58  ? 27.503  -68.169  12.564  1.00 23.88  ? 102 ALA B O    1 
ATOM   7705  C CB   . ALA B 1 58  ? 30.268  -69.943  11.880  1.00 26.42  ? 102 ALA B CB   1 
ATOM   7706  H H    . ALA B 1 58  ? 28.974  -71.399  10.427  1.00 28.81  ? 102 ALA B H    1 
ATOM   7707  H HA   . ALA B 1 58  ? 28.505  -70.413  12.809  1.00 23.25  ? 102 ALA B HA   1 
ATOM   7708  H HB1  . ALA B 1 58  ? 30.522  -69.263  12.524  1.00 31.70  ? 102 ALA B HB1  1 
ATOM   7709  H HB2  . ALA B 1 58  ? 30.690  -70.787  12.105  1.00 31.70  ? 102 ALA B HB2  1 
ATOM   7710  H HB3  . ALA B 1 58  ? 30.531  -69.669  10.987  1.00 31.70  ? 102 ALA B HB3  1 
ATOM   7711  N N    . ALA B 1 59  ? 28.037  -68.356  10.386  1.00 23.79  ? 103 ALA B N    1 
ATOM   7712  C CA   . ALA B 1 59  ? 27.395  -67.090  10.046  1.00 22.81  ? 103 ALA B CA   1 
ATOM   7713  C C    . ALA B 1 59  ? 25.912  -67.112  10.391  1.00 28.78  ? 103 ALA B C    1 
ATOM   7714  O O    . ALA B 1 59  ? 25.383  -66.145  10.951  1.00 19.69  ? 103 ALA B O    1 
ATOM   7715  C CB   . ALA B 1 59  ? 27.590  -66.786  8.561   1.00 16.20  ? 103 ALA B CB   1 
ATOM   7716  H H    . ALA B 1 59  ? 28.392  -68.768  9.719   1.00 28.55  ? 103 ALA B H    1 
ATOM   7717  H HA   . ALA B 1 59  ? 27.812  -66.378  10.556  1.00 27.37  ? 103 ALA B HA   1 
ATOM   7718  H HB1  . ALA B 1 59  ? 27.159  -65.942  8.353   1.00 19.45  ? 103 ALA B HB1  1 
ATOM   7719  H HB2  . ALA B 1 59  ? 28.540  -66.727  8.374   1.00 19.45  ? 103 ALA B HB2  1 
ATOM   7720  H HB3  . ALA B 1 59  ? 27.193  -67.499  8.038   1.00 19.45  ? 103 ALA B HB3  1 
ATOM   7721  N N    . ALA B 1 60  ? 25.223  -68.207  10.062  1.00 32.22  ? 104 ALA B N    1 
ATOM   7722  C CA   . ALA B 1 60  ? 23.786  -68.276  10.307  1.00 21.08  ? 104 ALA B CA   1 
ATOM   7723  C C    . ALA B 1 60  ? 23.470  -68.123  11.789  1.00 38.84  ? 104 ALA B C    1 
ATOM   7724  O O    . ALA B 1 60  ? 22.483  -67.475  12.158  1.00 37.70  ? 104 ALA B O    1 
ATOM   7725  C CB   . ALA B 1 60  ? 23.228  -69.594  9.771   1.00 22.09  ? 104 ALA B CB   1 
ATOM   7726  H H    . ALA B 1 60  ? 25.560  -68.912  9.703   1.00 38.67  ? 104 ALA B H    1 
ATOM   7727  H HA   . ALA B 1 60  ? 23.350  -67.551  9.831   1.00 25.30  ? 104 ALA B HA   1 
ATOM   7728  H HB1  . ALA B 1 60  ? 22.274  -69.624  9.941   1.00 26.51  ? 104 ALA B HB1  1 
ATOM   7729  H HB2  . ALA B 1 60  ? 23.397  -69.643  8.817   1.00 26.51  ? 104 ALA B HB2  1 
ATOM   7730  H HB3  . ALA B 1 60  ? 23.669  -70.330  10.223  1.00 26.51  ? 104 ALA B HB3  1 
ATOM   7731  N N    . GLU B 1 61  ? 24.296  -68.712  12.656  1.00 23.56  ? 105 GLU B N    1 
ATOM   7732  C CA   . GLU B 1 61  ? 24.056  -68.605  14.090  1.00 24.90  ? 105 GLU B CA   1 
ATOM   7733  C C    . GLU B 1 61  ? 24.308  -67.186  14.584  1.00 37.62  ? 105 GLU B C    1 
ATOM   7734  O O    . GLU B 1 61  ? 23.600  -66.697  15.473  1.00 30.93  ? 105 GLU B O    1 
ATOM   7735  C CB   . GLU B 1 61  ? 24.939  -69.602  14.841  1.00 25.67  ? 105 GLU B CB   1 
ATOM   7736  C CG   . GLU B 1 61  ? 24.608  -69.730  16.318  1.00 40.90  ? 105 GLU B CG   1 
ATOM   7737  C CD   . GLU B 1 61  ? 25.369  -70.853  16.991  1.00 42.25  ? 105 GLU B CD   1 
ATOM   7738  O OE1  . GLU B 1 61  ? 25.865  -71.746  16.275  1.00 33.97  ? 105 GLU B OE1  1 
ATOM   7739  O OE2  . GLU B 1 61  ? 25.473  -70.843  18.236  1.00 59.68  ? 105 GLU B OE2  1 
ATOM   7740  H H    . GLU B 1 61  ? 24.990  -69.171  12.441  1.00 28.27  ? 105 GLU B H    1 
ATOM   7741  H HA   . GLU B 1 61  ? 23.130  -68.827  14.273  1.00 29.88  ? 105 GLU B HA   1 
ATOM   7742  H HB2  . GLU B 1 61  ? 24.834  -70.477  14.437  1.00 30.81  ? 105 GLU B HB2  1 
ATOM   7743  H HB3  . GLU B 1 61  ? 25.863  -69.315  14.769  1.00 30.81  ? 105 GLU B HB3  1 
ATOM   7744  H HG2  . GLU B 1 61  ? 24.836  -68.901  16.766  1.00 49.09  ? 105 GLU B HG2  1 
ATOM   7745  H HG3  . GLU B 1 61  ? 23.659  -69.910  16.415  1.00 49.09  ? 105 GLU B HG3  1 
ATOM   7746  N N    . VAL B 1 62  ? 25.305  -66.509  14.014  1.00 26.20  ? 106 VAL B N    1 
ATOM   7747  C CA   . VAL B 1 62  ? 25.642  -65.158  14.450  1.00 19.60  ? 106 VAL B CA   1 
ATOM   7748  C C    . VAL B 1 62  ? 24.646  -64.141  13.903  1.00 29.64  ? 106 VAL B C    1 
ATOM   7749  O O    . VAL B 1 62  ? 24.295  -63.176  14.589  1.00 25.63  ? 106 VAL B O    1 
ATOM   7750  C CB   . VAL B 1 62  ? 27.083  -64.818  14.033  1.00 22.21  ? 106 VAL B CB   1 
ATOM   7751  C CG1  . VAL B 1 62  ? 27.403  -63.353  14.317  1.00 27.51  ? 106 VAL B CG1  1 
ATOM   7752  C CG2  . VAL B 1 62  ? 28.064  -65.721  14.756  1.00 19.55  ? 106 VAL B CG2  1 
ATOM   7753  H H    . VAL B 1 62  ? 25.798  -66.808  13.377  1.00 31.44  ? 106 VAL B H    1 
ATOM   7754  H HA   . VAL B 1 62  ? 25.598  -65.123  15.419  1.00 23.52  ? 106 VAL B HA   1 
ATOM   7755  H HB   . VAL B 1 62  ? 27.182  -64.968  13.080  1.00 26.65  ? 106 VAL B HB   1 
ATOM   7756  H HG11 . VAL B 1 62  ? 28.315  -63.170  14.043  1.00 33.01  ? 106 VAL B HG11 1 
ATOM   7757  H HG12 . VAL B 1 62  ? 26.789  -62.794  13.816  1.00 33.01  ? 106 VAL B HG12 1 
ATOM   7758  H HG13 . VAL B 1 62  ? 27.302  -63.187  15.267  1.00 33.01  ? 106 VAL B HG13 1 
ATOM   7759  H HG21 . VAL B 1 62  ? 28.966  -65.491  14.480  1.00 23.46  ? 106 VAL B HG21 1 
ATOM   7760  H HG22 . VAL B 1 62  ? 27.967  -65.590  15.712  1.00 23.46  ? 106 VAL B HG22 1 
ATOM   7761  H HG23 . VAL B 1 62  ? 27.872  -66.643  14.526  1.00 23.46  ? 106 VAL B HG23 1 
ATOM   7762  N N    . THR B 1 63  ? 24.183  -64.324  12.665  1.00 29.97  ? 107 THR B N    1 
ATOM   7763  C CA   . THR B 1 63  ? 23.335  -63.311  12.046  1.00 29.99  ? 107 THR B CA   1 
ATOM   7764  C C    . THR B 1 63  ? 21.922  -63.292  12.611  1.00 38.15  ? 107 THR B C    1 
ATOM   7765  O O    . THR B 1 63  ? 21.157  -62.380  12.279  1.00 34.52  ? 107 THR B O    1 
ATOM   7766  C CB   . THR B 1 63  ? 23.275  -63.506  10.527  1.00 35.47  ? 107 THR B CB   1 
ATOM   7767  O OG1  . THR B 1 63  ? 22.841  -64.835  10.219  1.00 35.10  ? 107 THR B OG1  1 
ATOM   7768  C CG2  . THR B 1 63  ? 24.637  -63.244  9.899   1.00 33.26  ? 107 THR B CG2  1 
ATOM   7769  H H    . THR B 1 63  ? 24.342  -65.011  12.174  1.00 35.97  ? 107 THR B H    1 
ATOM   7770  H HA   . THR B 1 63  ? 23.727  -62.439  12.213  1.00 35.99  ? 107 THR B HA   1 
ATOM   7771  H HB   . THR B 1 63  ? 22.644  -62.872  10.152  1.00 42.57  ? 107 THR B HB   1 
ATOM   7772  H HG1  . THR B 1 63  ? 23.376  -65.395  10.544  1.00 42.12  ? 107 THR B HG1  1 
ATOM   7773  H HG21 . THR B 1 63  ? 24.589  -63.370  8.938   1.00 39.91  ? 107 THR B HG21 1 
ATOM   7774  H HG22 . THR B 1 63  ? 24.918  -62.334  10.084  1.00 39.91  ? 107 THR B HG22 1 
ATOM   7775  H HG23 . THR B 1 63  ? 25.294  -63.857  10.265  1.00 39.91  ? 107 THR B HG23 1 
ATOM   7776  N N    . GLN B 1 64  ? 21.553  -64.266  13.447  1.00 41.33  ? 108 GLN B N    1 
ATOM   7777  C CA   . GLN B 1 64  ? 20.299  -64.157  14.184  1.00 39.38  ? 108 GLN B CA   1 
ATOM   7778  C C    . GLN B 1 64  ? 20.258  -62.876  15.005  1.00 48.19  ? 108 GLN B C    1 
ATOM   7779  O O    . GLN B 1 64  ? 19.176  -62.331  15.251  1.00 55.24  ? 108 GLN B O    1 
ATOM   7780  C CB   . GLN B 1 64  ? 20.110  -65.376  15.086  1.00 43.76  ? 108 GLN B CB   1 
ATOM   7781  C CG   . GLN B 1 64  ? 19.706  -66.639  14.343  1.00 38.00  ? 108 GLN B CG   1 
ATOM   7782  C CD   . GLN B 1 64  ? 19.561  -67.833  15.265  1.00 40.64  ? 108 GLN B CD   1 
ATOM   7783  O OE1  . GLN B 1 64  ? 18.480  -68.409  15.388  1.00 30.53  ? 108 GLN B OE1  1 
ATOM   7784  N NE2  . GLN B 1 64  ? 20.652  -68.212  15.920  1.00 39.20  ? 108 GLN B NE2  1 
ATOM   7785  H H    . GLN B 1 64  ? 22.001  -64.984  13.600  1.00 49.60  ? 108 GLN B H    1 
ATOM   7786  H HA   . GLN B 1 64  ? 19.563  -64.133  13.553  1.00 47.26  ? 108 GLN B HA   1 
ATOM   7787  H HB2  . GLN B 1 64  ? 20.945  -65.557  15.545  1.00 52.52  ? 108 GLN B HB2  1 
ATOM   7788  H HB3  . GLN B 1 64  ? 19.415  -65.180  15.734  1.00 52.52  ? 108 GLN B HB3  1 
ATOM   7789  H HG2  . GLN B 1 64  ? 18.853  -66.491  13.906  1.00 45.61  ? 108 GLN B HG2  1 
ATOM   7790  H HG3  . GLN B 1 64  ? 20.385  -66.850  13.684  1.00 45.61  ? 108 GLN B HG3  1 
ATOM   7791  H HE21 . GLN B 1 64  ? 21.390  -67.785  15.809  1.00 47.04  ? 108 GLN B HE21 1 
ATOM   7792  H HE22 . GLN B 1 64  ? 20.621  -68.884  16.455  1.00 47.04  ? 108 GLN B HE22 1 
ATOM   7793  N N    . ASP B 1 65  ? 21.422  -62.381  15.434  1.00 41.26  ? 109 ASP B N    1 
ATOM   7794  C CA   . ASP B 1 65  ? 21.485  -61.100  16.126  1.00 59.19  ? 109 ASP B CA   1 
ATOM   7795  C C    . ASP B 1 65  ? 21.068  -59.943  15.228  1.00 49.48  ? 109 ASP B C    1 
ATOM   7796  O O    . ASP B 1 65  ? 20.754  -58.862  15.736  1.00 50.55  ? 109 ASP B O    1 
ATOM   7797  C CB   . ASP B 1 65  ? 22.902  -60.854  16.649  1.00 58.93  ? 109 ASP B CB   1 
ATOM   7798  C CG   . ASP B 1 65  ? 23.402  -61.979  17.536  1.00 68.78  ? 109 ASP B CG   1 
ATOM   7799  O OD1  . ASP B 1 65  ? 22.646  -62.952  17.746  1.00 61.31  ? 109 ASP B OD1  1 
ATOM   7800  O OD2  . ASP B 1 65  ? 24.552  -61.889  18.020  1.00 43.54  ? 109 ASP B OD2  1 
ATOM   7801  H H    . ASP B 1 65  ? 22.183  -62.769  15.336  1.00 49.52  ? 109 ASP B H    1 
ATOM   7802  H HA   . ASP B 1 65  ? 20.883  -61.121  16.886  1.00 71.03  ? 109 ASP B HA   1 
ATOM   7803  H HB2  . ASP B 1 65  ? 23.508  -60.773  15.896  1.00 70.72  ? 109 ASP B HB2  1 
ATOM   7804  H HB3  . ASP B 1 65  ? 22.909  -60.036  17.170  1.00 70.72  ? 109 ASP B HB3  1 
ATOM   7805  N N    . TYR B 1 66  ? 21.063  -60.144  13.911  1.00 48.05  ? 110 TYR B N    1 
ATOM   7806  C CA   . TYR B 1 66  ? 20.706  -59.105  12.955  1.00 47.45  ? 110 TYR B CA   1 
ATOM   7807  C C    . TYR B 1 66  ? 19.285  -59.256  12.431  1.00 52.18  ? 110 TYR B C    1 
ATOM   7808  O O    . TYR B 1 66  ? 18.931  -58.616  11.436  1.00 58.67  ? 110 TYR B O    1 
ATOM   7809  C CB   . TYR B 1 66  ? 21.698  -59.110  11.790  1.00 52.47  ? 110 TYR B CB   1 
ATOM   7810  C CG   . TYR B 1 66  ? 23.138  -59.132  12.241  1.00 44.73  ? 110 TYR B CG   1 
ATOM   7811  C CD1  . TYR B 1 66  ? 23.544  -58.422  13.362  1.00 40.94  ? 110 TYR B CD1  1 
ATOM   7812  C CD2  . TYR B 1 66  ? 24.089  -59.879  11.560  1.00 49.95  ? 110 TYR B CD2  1 
ATOM   7813  C CE1  . TYR B 1 66  ? 24.855  -58.446  13.787  1.00 51.19  ? 110 TYR B CE1  1 
ATOM   7814  C CE2  . TYR B 1 66  ? 25.403  -59.911  11.978  1.00 51.08  ? 110 TYR B CE2  1 
ATOM   7815  C CZ   . TYR B 1 66  ? 25.780  -59.193  13.092  1.00 46.70  ? 110 TYR B CZ   1 
ATOM   7816  O OH   . TYR B 1 66  ? 27.087  -59.220  13.512  1.00 35.41  ? 110 TYR B OH   1 
ATOM   7817  H H    . TYR B 1 66  ? 21.268  -60.893  13.541  1.00 57.66  ? 110 TYR B H    1 
ATOM   7818  H HA   . TYR B 1 66  ? 20.770  -58.242  13.394  1.00 56.94  ? 110 TYR B HA   1 
ATOM   7819  H HB2  . TYR B 1 66  ? 21.542  -59.899  11.247  1.00 62.97  ? 110 TYR B HB2  1 
ATOM   7820  H HB3  . TYR B 1 66  ? 21.563  -58.310  11.258  1.00 62.97  ? 110 TYR B HB3  1 
ATOM   7821  H HD1  . TYR B 1 66  ? 22.920  -57.918  13.834  1.00 49.13  ? 110 TYR B HD1  1 
ATOM   7822  H HD2  . TYR B 1 66  ? 23.836  -60.365  10.809  1.00 59.95  ? 110 TYR B HD2  1 
ATOM   7823  H HE1  . TYR B 1 66  ? 25.113  -57.963  14.539  1.00 61.43  ? 110 TYR B HE1  1 
ATOM   7824  H HE2  . TYR B 1 66  ? 26.031  -60.413  11.511  1.00 61.30  ? 110 TYR B HE2  1 
ATOM   7825  H HH   . TYR B 1 66  ? 27.542  -59.710  13.003  1.00 42.50  ? 110 TYR B HH   1 
ATOM   7826  N N    . GLY B 1 67  ? 18.468  -60.086  13.075  1.00 46.52  ? 111 GLY B N    1 
ATOM   7827  C CA   . GLY B 1 67  ? 17.081  -60.251  12.698  1.00 44.76  ? 111 GLY B CA   1 
ATOM   7828  C C    . GLY B 1 67  ? 16.779  -61.471  11.858  1.00 50.89  ? 111 GLY B C    1 
ATOM   7829  O O    . GLY B 1 67  ? 15.617  -61.665  11.480  1.00 65.99  ? 111 GLY B O    1 
ATOM   7830  H H    . GLY B 1 67  ? 18.704  -60.571  13.744  1.00 55.82  ? 111 GLY B H    1 
ATOM   7831  H HA2  . GLY B 1 67  ? 16.542  -60.304  13.503  1.00 53.71  ? 111 GLY B HA2  1 
ATOM   7832  H HA3  . GLY B 1 67  ? 16.797  -59.469  12.199  1.00 53.71  ? 111 GLY B HA3  1 
ATOM   7833  N N    . LEU B 1 68  ? 17.778  -62.296  11.549  1.00 45.87  ? 112 LEU B N    1 
ATOM   7834  C CA   . LEU B 1 68  ? 17.519  -63.527  10.816  1.00 53.00  ? 112 LEU B CA   1 
ATOM   7835  C C    . LEU B 1 68  ? 16.529  -64.387  11.590  1.00 46.50  ? 112 LEU B C    1 
ATOM   7836  O O    . LEU B 1 68  ? 16.716  -64.653  12.780  1.00 38.96  ? 112 LEU B O    1 
ATOM   7837  C CB   . LEU B 1 68  ? 18.825  -64.290  10.578  1.00 44.88  ? 112 LEU B CB   1 
ATOM   7838  C CG   . LEU B 1 68  ? 18.713  -65.648  9.878   1.00 41.47  ? 112 LEU B CG   1 
ATOM   7839  C CD1  . LEU B 1 68  ? 18.125  -65.500  8.484   1.00 33.08  ? 112 LEU B CD1  1 
ATOM   7840  C CD2  . LEU B 1 68  ? 20.074  -66.328  9.817   1.00 35.67  ? 112 LEU B CD2  1 
ATOM   7841  H H    . LEU B 1 68  ? 18.604  -62.165  11.750  1.00 55.04  ? 112 LEU B H    1 
ATOM   7842  H HA   . LEU B 1 68  ? 17.129  -63.313  9.954   1.00 63.60  ? 112 LEU B HA   1 
ATOM   7843  H HB2  . LEU B 1 68  ? 19.405  -63.734  10.033  1.00 53.86  ? 112 LEU B HB2  1 
ATOM   7844  H HB3  . LEU B 1 68  ? 19.246  -64.445  11.438  1.00 53.86  ? 112 LEU B HB3  1 
ATOM   7845  H HG   . LEU B 1 68  ? 18.120  -66.217  10.392  1.00 49.76  ? 112 LEU B HG   1 
ATOM   7846  H HD11 . LEU B 1 68  ? 18.069  -66.376  8.071   1.00 39.70  ? 112 LEU B HD11 1 
ATOM   7847  H HD12 . LEU B 1 68  ? 17.240  -65.110  8.555   1.00 39.70  ? 112 LEU B HD12 1 
ATOM   7848  H HD13 . LEU B 1 68  ? 18.700  -64.923  7.958   1.00 39.70  ? 112 LEU B HD13 1 
ATOM   7849  H HD21 . LEU B 1 68  ? 19.978  -67.184  9.371   1.00 42.81  ? 112 LEU B HD21 1 
ATOM   7850  H HD22 . LEU B 1 68  ? 20.687  -65.763  9.322   1.00 42.81  ? 112 LEU B HD22 1 
ATOM   7851  H HD23 . LEU B 1 68  ? 20.401  -66.460  10.720  1.00 42.81  ? 112 LEU B HD23 1 
ATOM   7852  N N    . ASP B 1 69  ? 15.469  -64.811  10.912  1.00 43.49  ? 113 ASP B N    1 
ATOM   7853  C CA   . ASP B 1 69  ? 14.416  -65.565  11.575  1.00 58.38  ? 113 ASP B CA   1 
ATOM   7854  C C    . ASP B 1 69  ? 14.983  -66.869  12.137  1.00 53.65  ? 113 ASP B C    1 
ATOM   7855  O O    . ASP B 1 69  ? 15.633  -67.624  11.399  1.00 42.46  ? 113 ASP B O    1 
ATOM   7856  C CB   . ASP B 1 69  ? 13.279  -65.864  10.600  1.00 61.89  ? 113 ASP B CB   1 
ATOM   7857  C CG   . ASP B 1 69  ? 12.144  -66.628  11.249  1.00 57.99  ? 113 ASP B CG   1 
ATOM   7858  O OD1  . ASP B 1 69  ? 11.363  -66.009  12.000  1.00 61.96  ? 113 ASP B OD1  1 
ATOM   7859  O OD2  . ASP B 1 69  ? 12.038  -67.848  11.013  1.00 57.29  ? 113 ASP B OD2  1 
ATOM   7860  H H    . ASP B 1 69  ? 15.337  -64.676  10.073  1.00 52.19  ? 113 ASP B H    1 
ATOM   7861  H HA   . ASP B 1 69  ? 14.059  -65.043  12.311  1.00 70.05  ? 113 ASP B HA   1 
ATOM   7862  H HB2  . ASP B 1 69  ? 12.924  -65.027  10.262  1.00 74.27  ? 113 ASP B HB2  1 
ATOM   7863  H HB3  . ASP B 1 69  ? 13.623  -66.400  9.868   1.00 74.27  ? 113 ASP B HB3  1 
ATOM   7864  N N    . PRO B 1 70  ? 14.761  -67.175  13.422  1.00 45.20  ? 114 PRO B N    1 
ATOM   7865  C CA   . PRO B 1 70  ? 15.339  -68.414  13.977  1.00 43.68  ? 114 PRO B CA   1 
ATOM   7866  C C    . PRO B 1 70  ? 14.897  -69.674  13.253  1.00 37.08  ? 114 PRO B C    1 
ATOM   7867  O O    . PRO B 1 70  ? 15.698  -70.606  13.107  1.00 42.76  ? 114 PRO B O    1 
ATOM   7868  C CB   . PRO B 1 70  ? 14.856  -68.401  15.436  1.00 36.50  ? 114 PRO B CB   1 
ATOM   7869  C CG   . PRO B 1 70  ? 14.571  -66.972  15.734  1.00 35.80  ? 114 PRO B CG   1 
ATOM   7870  C CD   . PRO B 1 70  ? 14.069  -66.382  14.454  1.00 39.71  ? 114 PRO B CD   1 
ATOM   7871  H HA   . PRO B 1 70  ? 16.307  -68.364  13.964  1.00 52.42  ? 114 PRO B HA   1 
ATOM   7872  H HB2  . PRO B 1 70  ? 14.052  -68.937  15.520  1.00 43.80  ? 114 PRO B HB2  1 
ATOM   7873  H HB3  . PRO B 1 70  ? 15.557  -68.739  16.016  1.00 43.80  ? 114 PRO B HB3  1 
ATOM   7874  H HG2  . PRO B 1 70  ? 13.893  -66.914  16.425  1.00 42.97  ? 114 PRO B HG2  1 
ATOM   7875  H HG3  . PRO B 1 70  ? 15.386  -66.530  16.017  1.00 42.97  ? 114 PRO B HG3  1 
ATOM   7876  H HD2  . PRO B 1 70  ? 13.109  -66.497  14.382  1.00 47.66  ? 114 PRO B HD2  1 
ATOM   7877  H HD3  . PRO B 1 70  ? 14.323  -65.448  14.390  1.00 47.66  ? 114 PRO B HD3  1 
ATOM   7878  N N    . LYS B 1 71  ? 13.644  -69.736  12.796  1.00 42.22  ? 115 LYS B N    1 
ATOM   7879  C CA   . LYS B 1 71  ? 13.173  -70.934  12.107  1.00 41.61  ? 115 LYS B CA   1 
ATOM   7880  C C    . LYS B 1 71  ? 13.926  -71.145  10.799  1.00 47.95  ? 115 LYS B C    1 
ATOM   7881  O O    . LYS B 1 71  ? 14.194  -72.286  10.403  1.00 31.56  ? 115 LYS B O    1 
ATOM   7882  C CB   . LYS B 1 71  ? 11.667  -70.837  11.851  1.00 44.57  ? 115 LYS B CB   1 
ATOM   7883  C CG   . LYS B 1 71  ? 11.058  -72.089  11.239  1.00 41.72  ? 115 LYS B CG   1 
ATOM   7884  H H    . LYS B 1 71  ? 13.060  -69.110  12.870  1.00 50.67  ? 115 LYS B H    1 
ATOM   7885  H HA   . LYS B 1 71  ? 13.331  -71.706  12.672  1.00 49.93  ? 115 LYS B HA   1 
ATOM   7886  H HB2  . LYS B 1 71  ? 11.218  -70.672  12.695  1.00 53.49  ? 115 LYS B HB2  1 
ATOM   7887  H HB3  . LYS B 1 71  ? 11.502  -70.100  11.243  1.00 53.49  ? 115 LYS B HB3  1 
ATOM   7888  H HG2  . LYS B 1 71  ? 11.657  -72.837  11.390  1.00 50.07  ? 115 LYS B HG2  1 
ATOM   7889  H HG3  . LYS B 1 71  ? 10.937  -71.948  10.287  1.00 50.07  ? 115 LYS B HG3  1 
ATOM   7890  N N    . ILE B 1 72  ? 14.270  -70.057  10.113  1.00 37.97  ? 116 ILE B N    1 
ATOM   7891  C CA   . ILE B 1 72  ? 15.084  -70.162  8.908   1.00 39.59  ? 116 ILE B CA   1 
ATOM   7892  C C    . ILE B 1 72  ? 16.542  -70.410  9.270   1.00 42.28  ? 116 ILE B C    1 
ATOM   7893  O O    . ILE B 1 72  ? 17.218  -71.232  8.641   1.00 34.69  ? 116 ILE B O    1 
ATOM   7894  C CB   . ILE B 1 72  ? 14.915  -68.894  8.051   1.00 44.57  ? 116 ILE B CB   1 
ATOM   7895  C CG1  . ILE B 1 72  ? 13.486  -68.826  7.501   1.00 36.44  ? 116 ILE B CG1  1 
ATOM   7896  C CG2  . ILE B 1 72  ? 15.937  -68.868  6.912   1.00 45.89  ? 116 ILE B CG2  1 
ATOM   7897  C CD1  . ILE B 1 72  ? 13.137  -67.510  6.839   1.00 55.32  ? 116 ILE B CD1  1 
ATOM   7898  H H    . ILE B 1 72  ? 14.046  -69.253  10.322  1.00 45.56  ? 116 ILE B H    1 
ATOM   7899  H HA   . ILE B 1 72  ? 14.774  -70.918  8.385   1.00 47.51  ? 116 ILE B HA   1 
ATOM   7900  H HB   . ILE B 1 72  ? 15.064  -68.120  8.615   1.00 53.49  ? 116 ILE B HB   1 
ATOM   7901  H HG12 . ILE B 1 72  ? 13.373  -69.528  6.840   1.00 43.73  ? 116 ILE B HG12 1 
ATOM   7902  H HG13 . ILE B 1 72  ? 12.864  -68.963  8.232   1.00 43.73  ? 116 ILE B HG13 1 
ATOM   7903  H HG21 . ILE B 1 72  ? 15.807  -68.061  6.390   1.00 55.07  ? 116 ILE B HG21 1 
ATOM   7904  H HG22 . ILE B 1 72  ? 16.830  -68.878  7.290   1.00 55.07  ? 116 ILE B HG22 1 
ATOM   7905  H HG23 . ILE B 1 72  ? 15.805  -69.649  6.352   1.00 55.07  ? 116 ILE B HG23 1 
ATOM   7906  H HD11 . ILE B 1 72  ? 12.222  -67.550  6.521   1.00 66.38  ? 116 ILE B HD11 1 
ATOM   7907  H HD12 . ILE B 1 72  ? 13.231  -66.796  7.489   1.00 66.38  ? 116 ILE B HD12 1 
ATOM   7908  H HD13 . ILE B 1 72  ? 13.740  -67.362  6.095   1.00 66.38  ? 116 ILE B HD13 1 
ATOM   7909  N N    . ALA B 1 73  ? 17.047  -69.710  10.288  1.00 29.32  ? 117 ALA B N    1 
ATOM   7910  C CA   . ALA B 1 73  ? 18.429  -69.902  10.711  1.00 33.25  ? 117 ALA B CA   1 
ATOM   7911  C C    . ALA B 1 73  ? 18.684  -71.347  11.115  1.00 31.18  ? 117 ALA B C    1 
ATOM   7912  O O    . ALA B 1 73  ? 19.759  -71.895  10.847  1.00 30.45  ? 117 ALA B O    1 
ATOM   7913  C CB   . ALA B 1 73  ? 18.756  -68.960  11.868  1.00 37.15  ? 117 ALA B CB   1 
ATOM   7914  H H    . ALA B 1 73  ? 16.613  -69.124  10.744  1.00 35.19  ? 117 ALA B H    1 
ATOM   7915  H HA   . ALA B 1 73  ? 19.019  -69.688  9.972   1.00 39.91  ? 117 ALA B HA   1 
ATOM   7916  H HB1  . ALA B 1 73  ? 19.678  -69.100  12.138  1.00 44.58  ? 117 ALA B HB1  1 
ATOM   7917  H HB2  . ALA B 1 73  ? 18.633  -68.044  11.574  1.00 44.58  ? 117 ALA B HB2  1 
ATOM   7918  H HB3  . ALA B 1 73  ? 18.162  -69.153  12.610  1.00 44.58  ? 117 ALA B HB3  1 
ATOM   7919  N N    A ASN B 1 74  ? 17.703  -71.980  11.762  0.57 33.06  ? 118 ASN B N    1 
ATOM   7920  N N    B ASN B 1 74  ? 17.705  -71.987  11.758  0.43 33.08  ? 118 ASN B N    1 
ATOM   7921  C CA   A ASN B 1 74  ? 17.863  -73.365  12.191  0.57 36.03  ? 118 ASN B CA   1 
ATOM   7922  C CA   B ASN B 1 74  ? 17.890  -73.369  12.188  0.43 35.99  ? 118 ASN B CA   1 
ATOM   7923  C C    A ASN B 1 74  ? 17.952  -74.304  10.994  0.57 32.05  ? 118 ASN B C    1 
ATOM   7924  C C    B ASN B 1 74  ? 17.949  -74.315  10.994  0.43 32.08  ? 118 ASN B C    1 
ATOM   7925  O O    A ASN B 1 74  ? 18.728  -75.267  11.009  0.57 31.67  ? 118 ASN B O    1 
ATOM   7926  O O    B ASN B 1 74  ? 18.700  -75.297  11.011  0.43 31.67  ? 118 ASN B O    1 
ATOM   7927  C CB   A ASN B 1 74  ? 16.703  -73.762  13.104  0.57 39.78  ? 118 ASN B CB   1 
ATOM   7928  C CB   B ASN B 1 74  ? 16.770  -73.776  13.146  0.43 39.74  ? 118 ASN B CB   1 
ATOM   7929  C CG   A ASN B 1 74  ? 16.774  -75.210  13.546  0.57 34.17  ? 118 ASN B CG   1 
ATOM   7930  C CG   B ASN B 1 74  ? 16.891  -73.104  14.501  0.43 35.75  ? 118 ASN B CG   1 
ATOM   7931  O OD1  A ASN B 1 74  ? 16.069  -76.068  13.014  0.57 37.81  ? 118 ASN B OD1  1 
ATOM   7932  O OD1  B ASN B 1 74  ? 17.995  -72.846  14.982  0.43 35.73  ? 118 ASN B OD1  1 
ATOM   7933  N ND2  A ASN B 1 74  ? 17.629  -75.489  14.522  0.57 29.92  ? 118 ASN B ND2  1 
ATOM   7934  N ND2  B ASN B 1 74  ? 15.755  -72.817  15.124  0.43 40.96  ? 118 ASN B ND2  1 
ATOM   7935  H H    A ASN B 1 74  ? 16.942  -71.632  11.962  0.57 39.67  ? 118 ASN B H    1 
ATOM   7936  H H    B ASN B 1 74  ? 16.939  -71.648  11.954  0.43 39.70  ? 118 ASN B H    1 
ATOM   7937  H HA   A ASN B 1 74  ? 18.686  -73.446  12.697  0.57 43.24  ? 118 ASN B HA   1 
ATOM   7938  H HA   B ASN B 1 74  ? 18.731  -73.440  12.665  0.43 43.19  ? 118 ASN B HA   1 
ATOM   7939  H HB2  A ASN B 1 74  ? 16.721  -73.205  13.898  0.57 47.74  ? 118 ASN B HB2  1 
ATOM   7940  H HB2  B ASN B 1 74  ? 15.916  -73.523  12.761  0.43 47.69  ? 118 ASN B HB2  1 
ATOM   7941  H HB3  A ASN B 1 74  ? 15.867  -73.634  12.628  0.57 47.74  ? 118 ASN B HB3  1 
ATOM   7942  H HB3  B ASN B 1 74  ? 16.803  -74.735  13.282  0.43 47.69  ? 118 ASN B HB3  1 
ATOM   7943  H HD21 A ASN B 1 74  ? 18.106  -74.863  14.869  0.57 35.91  ? 118 ASN B HD21 1 
ATOM   7944  H HD21 B ASN B 1 74  ? 15.002  -73.013  14.757  0.43 49.15  ? 118 ASN B HD21 1 
ATOM   7945  H HD22 A ASN B 1 74  ? 17.707  -76.297  14.808  0.57 35.91  ? 118 ASN B HD22 1 
ATOM   7946  H HD22 B ASN B 1 74  ? 15.771  -72.436  15.895  0.43 49.15  ? 118 ASN B HD22 1 
ATOM   7947  N N    . ALA B 1 75  ? 17.167  -74.038  9.949   1.00 29.56  ? 119 ALA B N    1 
ATOM   7948  C CA   . ALA B 1 75  ? 17.215  -74.875  8.755   1.00 21.89  ? 119 ALA B CA   1 
ATOM   7949  C C    . ALA B 1 75  ? 18.514  -74.659  7.989   1.00 22.09  ? 119 ALA B C    1 
ATOM   7950  O O    . ALA B 1 75  ? 19.123  -75.620  7.505   1.00 24.76  ? 119 ALA B O    1 
ATOM   7951  C CB   . ALA B 1 75  ? 16.007  -74.588  7.864   1.00 26.27  ? 119 ALA B CB   1 
ATOM   7952  H H    . ALA B 1 75  ? 16.609  -73.384  9.911   1.00 35.47  ? 119 ALA B H    1 
ATOM   7953  H HA   . ALA B 1 75  ? 17.176  -75.807  9.021   1.00 26.28  ? 119 ALA B HA   1 
ATOM   7954  H HB1  . ALA B 1 75  ? 16.055  -75.152  7.076   1.00 31.52  ? 119 ALA B HB1  1 
ATOM   7955  H HB2  . ALA B 1 75  ? 15.196  -74.780  8.360   1.00 31.52  ? 119 ALA B HB2  1 
ATOM   7956  H HB3  . ALA B 1 75  ? 16.022  -73.653  7.603   1.00 31.52  ? 119 ALA B HB3  1 
ATOM   7957  N N    . ILE B 1 76  ? 18.954  -73.404  7.870   1.00 19.69  ? 120 ILE B N    1 
ATOM   7958  C CA   . ILE B 1 76  ? 20.248  -73.120  7.255   1.00 28.29  ? 120 ILE B CA   1 
ATOM   7959  C C    . ILE B 1 76  ? 21.356  -73.854  8.000   1.00 32.31  ? 120 ILE B C    1 
ATOM   7960  O O    . ILE B 1 76  ? 22.244  -74.462  7.391   1.00 30.67  ? 120 ILE B O    1 
ATOM   7961  C CB   . ILE B 1 76  ? 20.503  -71.602  7.220   1.00 20.14  ? 120 ILE B CB   1 
ATOM   7962  C CG1  . ILE B 1 76  ? 19.508  -70.922  6.277   1.00 30.36  ? 120 ILE B CG1  1 
ATOM   7963  C CG2  . ILE B 1 76  ? 21.943  -71.302  6.793   1.00 25.37  ? 120 ILE B CG2  1 
ATOM   7964  C CD1  . ILE B 1 76  ? 19.584  -69.409  6.281   1.00 29.26  ? 120 ILE B CD1  1 
ATOM   7965  H H    . ILE B 1 76  ? 18.526  -72.707  8.135   1.00 23.63  ? 120 ILE B H    1 
ATOM   7966  H HA   . ILE B 1 76  ? 20.239  -73.442  6.340   1.00 33.95  ? 120 ILE B HA   1 
ATOM   7967  H HB   . ILE B 1 76  ? 20.368  -71.248  8.114   1.00 24.17  ? 120 ILE B HB   1 
ATOM   7968  H HG12 . ILE B 1 76  ? 19.682  -71.224  5.372   1.00 36.44  ? 120 ILE B HG12 1 
ATOM   7969  H HG13 . ILE B 1 76  ? 18.609  -71.174  6.539   1.00 36.44  ? 120 ILE B HG13 1 
ATOM   7970  H HG21 . ILE B 1 76  ? 22.075  -70.341  6.781   1.00 30.44  ? 120 ILE B HG21 1 
ATOM   7971  H HG22 . ILE B 1 76  ? 22.552  -71.711  7.428   1.00 30.44  ? 120 ILE B HG22 1 
ATOM   7972  H HG23 . ILE B 1 76  ? 22.092  -71.668  5.908   1.00 30.44  ? 120 ILE B HG23 1 
ATOM   7973  H HD11 . ILE B 1 76  ? 18.926  -69.059  5.661   1.00 35.12  ? 120 ILE B HD11 1 
ATOM   7974  H HD12 . ILE B 1 76  ? 19.400  -69.087  7.177   1.00 35.12  ? 120 ILE B HD12 1 
ATOM   7975  H HD13 . ILE B 1 76  ? 20.474  -69.137  6.008   1.00 35.12  ? 120 ILE B HD13 1 
ATOM   7976  N N    . MET B 1 77  ? 21.321  -73.804  9.333   1.00 22.90  ? 121 MET B N    1 
ATOM   7977  C CA   . MET B 1 77  ? 22.364  -74.448  10.124  1.00 24.40  ? 121 MET B CA   1 
ATOM   7978  C C    . MET B 1 77  ? 22.360  -75.957  9.918   1.00 23.97  ? 121 MET B C    1 
ATOM   7979  O O    . MET B 1 77  ? 23.424  -76.575  9.794   1.00 25.06  ? 121 MET B O    1 
ATOM   7980  C CB   . MET B 1 77  ? 22.184  -74.101  11.602  1.00 20.72  ? 121 MET B CB   1 
ATOM   7981  C CG   . MET B 1 77  ? 22.507  -72.647  11.934  1.00 30.84  ? 121 MET B CG   1 
ATOM   7982  S SD   . MET B 1 77  ? 21.919  -72.123  13.561  1.00 40.55  ? 121 MET B SD   1 
ATOM   7983  C CE   . MET B 1 77  ? 22.640  -73.378  14.613  1.00 44.03  ? 121 MET B CE   1 
ATOM   7984  H H    . MET B 1 77  ? 20.713  -73.409  9.796   1.00 27.48  ? 121 MET B H    1 
ATOM   7985  H HA   . MET B 1 77  ? 23.225  -74.100  9.844   1.00 29.29  ? 121 MET B HA   1 
ATOM   7986  H HB2  . MET B 1 77  ? 21.261  -74.265  11.852  1.00 24.87  ? 121 MET B HB2  1 
ATOM   7987  H HB3  . MET B 1 77  ? 22.773  -74.664  12.129  1.00 24.87  ? 121 MET B HB3  1 
ATOM   7988  H HG2  . MET B 1 77  ? 23.470  -72.529  11.915  1.00 37.01  ? 121 MET B HG2  1 
ATOM   7989  H HG3  . MET B 1 77  ? 22.091  -72.075  11.270  1.00 37.01  ? 121 MET B HG3  1 
ATOM   7990  H HE1  . MET B 1 77  ? 22.390  -73.201  15.534  1.00 52.84  ? 121 MET B HE1  1 
ATOM   7991  H HE2  . MET B 1 77  ? 22.307  -74.248  14.341  1.00 52.84  ? 121 MET B HE2  1 
ATOM   7992  H HE3  . MET B 1 77  ? 23.606  -73.350  14.522  1.00 52.84  ? 121 MET B HE3  1 
ATOM   7993  N N    . LYS B 1 78  ? 21.173  -76.569  9.868   1.00 24.14  ? 122 LYS B N    1 
ATOM   7994  C CA   . LYS B 1 78  ? 21.099  -78.012  9.658   1.00 20.89  ? 122 LYS B CA   1 
ATOM   7995  C C    . LYS B 1 78  ? 21.608  -78.395  8.275   1.00 23.28  ? 122 LYS B C    1 
ATOM   7996  O O    . LYS B 1 78  ? 22.342  -79.379  8.128   1.00 20.84  ? 122 LYS B O    1 
ATOM   7997  C CB   . LYS B 1 78  ? 19.665  -78.506  9.854   1.00 25.84  ? 122 LYS B CB   1 
ATOM   7998  C CG   . LYS B 1 78  ? 19.251  -78.654  11.308  1.00 38.38  ? 122 LYS B CG   1 
ATOM   7999  C CD   . LYS B 1 78  ? 17.877  -79.290  11.430  1.00 51.77  ? 122 LYS B CD   1 
ATOM   8000  C CE   . LYS B 1 78  ? 16.785  -78.374  10.903  1.00 51.15  ? 122 LYS B CE   1 
ATOM   8001  H H    . LYS B 1 78  ? 20.411  -76.179  9.952   1.00 28.97  ? 122 LYS B H    1 
ATOM   8002  H HA   . LYS B 1 78  ? 21.659  -78.455  10.315  1.00 25.07  ? 122 LYS B HA   1 
ATOM   8003  H HB2  . LYS B 1 78  ? 19.059  -77.873  9.437   1.00 31.01  ? 122 LYS B HB2  1 
ATOM   8004  H HB3  . LYS B 1 78  ? 19.574  -79.374  9.431   1.00 31.01  ? 122 LYS B HB3  1 
ATOM   8005  H HG2  . LYS B 1 78  ? 19.891  -79.220  11.767  1.00 46.05  ? 122 LYS B HG2  1 
ATOM   8006  H HG3  . LYS B 1 78  ? 19.219  -77.778  11.723  1.00 46.05  ? 122 LYS B HG3  1 
ATOM   8007  H HD2  . LYS B 1 78  ? 17.858  -80.112  10.915  1.00 62.12  ? 122 LYS B HD2  1 
ATOM   8008  H HD3  . LYS B 1 78  ? 17.693  -79.476  12.364  1.00 62.12  ? 122 LYS B HD3  1 
ATOM   8009  H HE2  . LYS B 1 78  ? 16.097  -78.280  11.580  1.00 61.38  ? 122 LYS B HE2  1 
ATOM   8010  H HE3  . LYS B 1 78  ? 17.171  -77.507  10.700  1.00 61.38  ? 122 LYS B HE3  1 
ATOM   8011  N N    . ALA B 1 79  ? 21.227  -77.634  7.246   1.00 21.64  ? 123 ALA B N    1 
ATOM   8012  C CA   . ALA B 1 79  ? 21.717  -77.915  5.901   1.00 22.85  ? 123 ALA B CA   1 
ATOM   8013  C C    . ALA B 1 79  ? 23.215  -77.654  5.800   1.00 24.08  ? 123 ALA B C    1 
ATOM   8014  O O    . ALA B 1 79  ? 23.937  -78.399  5.128   1.00 21.54  ? 123 ALA B O    1 
ATOM   8015  C CB   . ALA B 1 79  ? 20.954  -77.076  4.877   1.00 23.67  ? 123 ALA B CB   1 
ATOM   8016  H H    . ALA B 1 79  ? 20.694  -76.961  7.301   1.00 25.97  ? 123 ALA B H    1 
ATOM   8017  H HA   . ALA B 1 79  ? 21.562  -78.851  5.698   1.00 27.42  ? 123 ALA B HA   1 
ATOM   8018  H HB1  . ALA B 1 79  ? 21.293  -77.276  3.990   1.00 28.40  ? 123 ALA B HB1  1 
ATOM   8019  H HB2  . ALA B 1 79  ? 20.011  -77.296  4.929   1.00 28.40  ? 123 ALA B HB2  1 
ATOM   8020  H HB3  . ALA B 1 79  ? 21.087  -76.136  5.078   1.00 28.40  ? 123 ALA B HB3  1 
ATOM   8021  N N    . ALA B 1 80  ? 23.699  -76.601  6.462   1.00 24.32  ? 124 ALA B N    1 
ATOM   8022  C CA   . ALA B 1 80  ? 25.133  -76.336  6.478   1.00 17.88  ? 124 ALA B CA   1 
ATOM   8023  C C    . ALA B 1 80  ? 25.888  -77.466  7.165   1.00 25.78  ? 124 ALA B C    1 
ATOM   8024  O O    . ALA B 1 80  ? 26.990  -77.833  6.742   1.00 20.79  ? 124 ALA B O    1 
ATOM   8025  C CB   . ALA B 1 80  ? 25.415  -75.004  7.171   1.00 19.23  ? 124 ALA B CB   1 
ATOM   8026  H H    . ALA B 1 80  ? 23.224  -76.035  6.903   1.00 29.19  ? 124 ALA B H    1 
ATOM   8027  H HA   . ALA B 1 80  ? 25.453  -76.273  5.564   1.00 21.46  ? 124 ALA B HA   1 
ATOM   8028  H HB1  . ALA B 1 80  ? 26.371  -74.845  7.171   1.00 23.08  ? 124 ALA B HB1  1 
ATOM   8029  H HB2  . ALA B 1 80  ? 24.962  -74.295  6.687   1.00 23.08  ? 124 ALA B HB2  1 
ATOM   8030  H HB3  . ALA B 1 80  ? 25.085  -75.047  8.082   1.00 23.08  ? 124 ALA B HB3  1 
ATOM   8031  N N    . ASP B 1 81  ? 25.309  -78.031  8.227   1.00 17.31  ? 125 ASP B N    1 
ATOM   8032  C CA   . ASP B 1 81  ? 25.942  -79.161  8.899   1.00 16.77  ? 125 ASP B CA   1 
ATOM   8033  C C    . ASP B 1 81  ? 26.077  -80.353  7.962   1.00 21.40  ? 125 ASP B C    1 
ATOM   8034  O O    . ASP B 1 81  ? 27.089  -81.062  7.991   1.00 27.29  ? 125 ASP B O    1 
ATOM   8035  C CB   . ASP B 1 81  ? 25.141  -79.550  10.143  1.00 23.16  ? 125 ASP B CB   1 
ATOM   8036  C CG   . ASP B 1 81  ? 25.324  -78.570  11.287  1.00 25.65  ? 125 ASP B CG   1 
ATOM   8037  O OD1  . ASP B 1 81  ? 26.182  -77.670  11.176  1.00 34.30  ? 125 ASP B OD1  1 
ATOM   8038  O OD2  . ASP B 1 81  ? 24.605  -78.700  12.301  1.00 34.78  ? 125 ASP B OD2  1 
ATOM   8039  H H    . ASP B 1 81  ? 24.561  -77.781  8.572   1.00 20.77  ? 125 ASP B H    1 
ATOM   8040  H HA   . ASP B 1 81  ? 26.832  -78.901  9.184   1.00 20.13  ? 125 ASP B HA   1 
ATOM   8041  H HB2  . ASP B 1 81  ? 24.198  -79.575  9.917   1.00 27.79  ? 125 ASP B HB2  1 
ATOM   8042  H HB3  . ASP B 1 81  ? 25.434  -80.423  10.447  1.00 27.79  ? 125 ASP B HB3  1 
ATOM   8043  N N    . GLU B 1 82  ? 25.066  -80.596  7.125   1.00 17.38  ? 126 GLU B N    1 
ATOM   8044  C CA   . GLU B 1 82  ? 25.145  -81.711  6.187   1.00 24.98  ? 126 GLU B CA   1 
ATOM   8045  C C    . GLU B 1 82  ? 26.250  -81.489  5.162   1.00 24.17  ? 126 GLU B C    1 
ATOM   8046  O O    . GLU B 1 82  ? 26.916  -82.444  4.744   1.00 19.03  ? 126 GLU B O    1 
ATOM   8047  C CB   . GLU B 1 82  ? 23.799  -81.912  5.490   1.00 19.80  ? 126 GLU B CB   1 
ATOM   8048  C CG   . GLU B 1 82  ? 22.680  -82.362  6.417   1.00 27.72  ? 126 GLU B CG   1 
ATOM   8049  C CD   . GLU B 1 82  ? 21.415  -82.725  5.665   1.00 29.06  ? 126 GLU B CD   1 
ATOM   8050  O OE1  . GLU B 1 82  ? 21.366  -82.491  4.438   1.00 23.27  ? 126 GLU B OE1  1 
ATOM   8051  O OE2  . GLU B 1 82  ? 20.474  -83.249  6.297   1.00 28.11  ? 126 GLU B OE2  1 
ATOM   8052  H H    . GLU B 1 82  ? 24.338  -80.139  7.082   1.00 20.86  ? 126 GLU B H    1 
ATOM   8053  H HA   . GLU B 1 82  ? 25.351  -82.522  6.678   1.00 29.98  ? 126 GLU B HA   1 
ATOM   8054  H HB2  . GLU B 1 82  ? 23.529  -81.072  5.087   1.00 23.77  ? 126 GLU B HB2  1 
ATOM   8055  H HB3  . GLU B 1 82  ? 23.903  -82.587  4.802   1.00 23.77  ? 126 GLU B HB3  1 
ATOM   8056  H HG2  . GLU B 1 82  ? 22.972  -83.145  6.910   1.00 33.26  ? 126 GLU B HG2  1 
ATOM   8057  H HG3  . GLU B 1 82  ? 22.468  -81.642  7.032   1.00 33.26  ? 126 GLU B HG3  1 
ATOM   8058  N N    . VAL B 1 83  ? 26.454  -80.238  4.743   1.00 22.52  ? 127 VAL B N    1 
ATOM   8059  C CA   . VAL B 1 83  ? 27.553  -79.927  3.834   1.00 25.56  ? 127 VAL B CA   1 
ATOM   8060  C C    . VAL B 1 83  ? 28.889  -80.176  4.523   1.00 13.69  ? 127 VAL B C    1 
ATOM   8061  O O    . VAL B 1 83  ? 29.776  -80.840  3.975   1.00 19.64  ? 127 VAL B O    1 
ATOM   8062  C CB   . VAL B 1 83  ? 27.438  -78.476  3.333   1.00 19.48  ? 127 VAL B CB   1 
ATOM   8063  C CG1  . VAL B 1 83  ? 28.646  -78.095  2.480   1.00 21.88  ? 127 VAL B CG1  1 
ATOM   8064  C CG2  . VAL B 1 83  ? 26.154  -78.290  2.537   1.00 20.64  ? 127 VAL B CG2  1 
ATOM   8065  H H    . VAL B 1 83  ? 25.975  -79.561  4.968   1.00 27.03  ? 127 VAL B H    1 
ATOM   8066  H HA   . VAL B 1 83  ? 27.501  -80.514  3.064   1.00 30.68  ? 127 VAL B HA   1 
ATOM   8067  H HB   . VAL B 1 83  ? 27.408  -77.878  4.096   1.00 23.38  ? 127 VAL B HB   1 
ATOM   8068  H HG11 . VAL B 1 83  ? 28.544  -77.178  2.180   1.00 26.25  ? 127 VAL B HG11 1 
ATOM   8069  H HG12 . VAL B 1 83  ? 29.450  -78.181  3.016   1.00 26.25  ? 127 VAL B HG12 1 
ATOM   8070  H HG13 . VAL B 1 83  ? 28.692  -78.691  1.715   1.00 26.25  ? 127 VAL B HG13 1 
ATOM   8071  H HG21 . VAL B 1 83  ? 26.102  -77.371  2.232   1.00 24.77  ? 127 VAL B HG21 1 
ATOM   8072  H HG22 . VAL B 1 83  ? 26.165  -78.892  1.777   1.00 24.77  ? 127 VAL B HG22 1 
ATOM   8073  H HG23 . VAL B 1 83  ? 25.397  -78.493  3.109   1.00 24.77  ? 127 VAL B HG23 1 
ATOM   8074  N N    . ALA B 1 84  ? 29.045  -79.653  5.741   1.00 11.65  ? 128 ALA B N    1 
ATOM   8075  C CA   . ALA B 1 84  ? 30.294  -79.831  6.474   1.00 23.78  ? 128 ALA B CA   1 
ATOM   8076  C C    . ALA B 1 84  ? 30.596  -81.302  6.727   1.00 28.41  ? 128 ALA B C    1 
ATOM   8077  O O    . ALA B 1 84  ? 31.767  -81.690  6.795   1.00 25.10  ? 128 ALA B O    1 
ATOM   8078  C CB   . ALA B 1 84  ? 30.236  -79.071  7.798   1.00 19.11  ? 128 ALA B CB   1 
ATOM   8079  H H    . ALA B 1 84  ? 28.449  -79.196  6.160   1.00 13.98  ? 128 ALA B H    1 
ATOM   8080  H HA   . ALA B 1 84  ? 31.022  -79.463  5.949   1.00 28.54  ? 128 ALA B HA   1 
ATOM   8081  H HB1  . ALA B 1 84  ? 31.073  -79.199  8.272   1.00 22.93  ? 128 ALA B HB1  1 
ATOM   8082  H HB2  . ALA B 1 84  ? 30.101  -78.128  7.615   1.00 22.93  ? 128 ALA B HB2  1 
ATOM   8083  H HB3  . ALA B 1 84  ? 29.499  -79.414  8.327   1.00 22.93  ? 128 ALA B HB3  1 
ATOM   8084  N N    . GLU B 1 85  ? 29.564  -82.130  6.864   1.00 21.57  ? 129 GLU B N    1 
ATOM   8085  C CA   . GLU B 1 85  ? 29.736  -83.540  7.185   1.00 17.73  ? 129 GLU B CA   1 
ATOM   8086  C C    . GLU B 1 85  ? 29.952  -84.409  5.953   1.00 19.82  ? 129 GLU B C    1 
ATOM   8087  O O    . GLU B 1 85  ? 30.037  -85.634  6.087   1.00 21.84  ? 129 GLU B O    1 
ATOM   8088  C CB   . GLU B 1 85  ? 28.521  -84.046  7.969   1.00 23.03  ? 129 GLU B CB   1 
ATOM   8089  C CG   . GLU B 1 85  ? 28.404  -83.439  9.361   1.00 28.57  ? 129 GLU B CG   1 
ATOM   8090  C CD   . GLU B 1 85  ? 27.070  -83.725  10.022  1.00 47.23  ? 129 GLU B CD   1 
ATOM   8091  O OE1  . GLU B 1 85  ? 26.216  -84.382  9.390   1.00 52.57  ? 129 GLU B OE1  1 
ATOM   8092  O OE2  . GLU B 1 85  ? 26.875  -83.289  11.176  1.00 51.28  ? 129 GLU B OE2  1 
ATOM   8093  H H    . GLU B 1 85  ? 28.742  -81.894  6.775   1.00 25.89  ? 129 GLU B H    1 
ATOM   8094  H HA   . GLU B 1 85  ? 30.516  -83.637  7.753   1.00 21.28  ? 129 GLU B HA   1 
ATOM   8095  H HB2  . GLU B 1 85  ? 27.715  -83.822  7.478   1.00 27.63  ? 129 GLU B HB2  1 
ATOM   8096  H HB3  . GLU B 1 85  ? 28.590  -85.008  8.069   1.00 27.63  ? 129 GLU B HB3  1 
ATOM   8097  H HG2  . GLU B 1 85  ? 29.102  -83.806  9.925   1.00 34.29  ? 129 GLU B HG2  1 
ATOM   8098  H HG3  . GLU B 1 85  ? 28.504  -82.476  9.294   1.00 34.29  ? 129 GLU B HG3  1 
ATOM   8099  N N    . GLY B 1 86  ? 30.042  -83.812  4.767   1.00 25.33  ? 130 GLY B N    1 
ATOM   8100  C CA   . GLY B 1 86  ? 30.291  -84.579  3.562   1.00 22.50  ? 130 GLY B CA   1 
ATOM   8101  C C    . GLY B 1 86  ? 29.088  -85.319  3.025   1.00 23.73  ? 130 GLY B C    1 
ATOM   8102  O O    . GLY B 1 86  ? 29.249  -86.335  2.341   1.00 24.65  ? 130 GLY B O    1 
ATOM   8103  H H    . GLY B 1 86  ? 29.963  -82.965  4.638   1.00 30.40  ? 130 GLY B H    1 
ATOM   8104  H HA2  . GLY B 1 86  ? 30.609  -83.981  2.868   1.00 27.01  ? 130 GLY B HA2  1 
ATOM   8105  H HA3  . GLY B 1 86  ? 30.987  -85.230  3.741   1.00 27.01  ? 130 GLY B HA3  1 
ATOM   8106  N N    . LYS B 1 87  ? 27.878  -84.835  3.306   1.00 20.17  ? 131 LYS B N    1 
ATOM   8107  C CA   . LYS B 1 87  ? 26.658  -85.518  2.901   1.00 32.87  ? 131 LYS B CA   1 
ATOM   8108  C C    . LYS B 1 87  ? 26.059  -84.982  1.607   1.00 28.36  ? 131 LYS B C    1 
ATOM   8109  O O    . LYS B 1 87  ? 25.151  -85.617  1.060   1.00 23.54  ? 131 LYS B O    1 
ATOM   8110  C CB   . LYS B 1 87  ? 25.610  -85.422  4.016   1.00 29.10  ? 131 LYS B CB   1 
ATOM   8111  C CG   . LYS B 1 87  ? 25.977  -86.193  5.272   1.00 32.93  ? 131 LYS B CG   1 
ATOM   8112  C CD   . LYS B 1 87  ? 24.936  -86.007  6.364   1.00 38.02  ? 131 LYS B CD   1 
ATOM   8113  C CE   . LYS B 1 87  ? 25.238  -86.882  7.570   1.00 49.28  ? 131 LYS B CE   1 
ATOM   8114  N NZ   . LYS B 1 87  ? 24.343  -86.573  8.720   1.00 64.54  ? 131 LYS B NZ   1 
ATOM   8115  H H    . LYS B 1 87  ? 27.740  -84.102  3.736   1.00 24.21  ? 131 LYS B H    1 
ATOM   8116  H HA   . LYS B 1 87  ? 26.859  -86.457  2.765   1.00 39.45  ? 131 LYS B HA   1 
ATOM   8117  H HB2  . LYS B 1 87  ? 25.501  -84.490  4.262   1.00 34.92  ? 131 LYS B HB2  1 
ATOM   8118  H HB3  . LYS B 1 87  ? 24.770  -85.776  3.686   1.00 34.92  ? 131 LYS B HB3  1 
ATOM   8119  H HG2  . LYS B 1 87  ? 26.032  -87.138  5.062   1.00 39.51  ? 131 LYS B HG2  1 
ATOM   8120  H HG3  . LYS B 1 87  ? 26.829  -85.873  5.607   1.00 39.51  ? 131 LYS B HG3  1 
ATOM   8121  H HD2  . LYS B 1 87  ? 24.936  -85.081  6.652   1.00 45.63  ? 131 LYS B HD2  1 
ATOM   8122  H HD3  . LYS B 1 87  ? 24.063  -86.253  6.020   1.00 45.63  ? 131 LYS B HD3  1 
ATOM   8123  H HE2  . LYS B 1 87  ? 25.110  -87.813  7.329   1.00 59.14  ? 131 LYS B HE2  1 
ATOM   8124  H HE3  . LYS B 1 87  ? 26.154  -86.732  7.851   1.00 59.14  ? 131 LYS B HE3  1 
ATOM   8125  H HZ1  . LYS B 1 87  ? 23.494  -86.707  8.489   1.00 77.45  ? 131 LYS B HZ1  1 
ATOM   8126  H HZ2  . LYS B 1 87  ? 24.542  -87.099  9.410   1.00 77.45  ? 131 LYS B HZ2  1 
ATOM   8127  H HZ3  . LYS B 1 87  ? 24.445  -85.723  8.965   1.00 77.45  ? 131 LYS B HZ3  1 
ATOM   8128  N N    . LEU B 1 88  ? 26.536  -83.845  1.103   1.00 23.72  ? 132 LEU B N    1 
ATOM   8129  C CA   . LEU B 1 88  ? 25.978  -83.219  -0.093  1.00 19.61  ? 132 LEU B CA   1 
ATOM   8130  C C    . LEU B 1 88  ? 27.066  -82.943  -1.122  1.00 24.73  ? 132 LEU B C    1 
ATOM   8131  O O    . LEU B 1 88  ? 27.026  -81.941  -1.841  1.00 26.30  ? 132 LEU B O    1 
ATOM   8132  C CB   . LEU B 1 88  ? 25.247  -81.929  0.270   1.00 20.88  ? 132 LEU B CB   1 
ATOM   8133  C CG   . LEU B 1 88  ? 24.055  -82.087  1.214   1.00 20.29  ? 132 LEU B CG   1 
ATOM   8134  C CD1  . LEU B 1 88  ? 23.569  -80.730  1.696   1.00 24.89  ? 132 LEU B CD1  1 
ATOM   8135  C CD2  . LEU B 1 88  ? 22.931  -82.838  0.525   1.00 24.00  ? 132 LEU B CD2  1 
ATOM   8136  H H    . LEU B 1 88  ? 27.195  -83.410  1.443   1.00 28.46  ? 132 LEU B H    1 
ATOM   8137  H HA   . LEU B 1 88  ? 25.335  -83.824  -0.493  1.00 23.54  ? 132 LEU B HA   1 
ATOM   8138  H HB2  . LEU B 1 88  ? 25.878  -81.329  0.697   1.00 25.06  ? 132 LEU B HB2  1 
ATOM   8139  H HB3  . LEU B 1 88  ? 24.918  -81.524  -0.548  1.00 25.06  ? 132 LEU B HB3  1 
ATOM   8140  H HG   . LEU B 1 88  ? 24.330  -82.601  1.989   1.00 24.35  ? 132 LEU B HG   1 
ATOM   8141  H HD11 . LEU B 1 88  ? 22.814  -80.859  2.292   1.00 29.87  ? 132 LEU B HD11 1 
ATOM   8142  H HD12 . LEU B 1 88  ? 24.291  -80.286  2.168   1.00 29.87  ? 132 LEU B HD12 1 
ATOM   8143  H HD13 . LEU B 1 88  ? 23.299  -80.201  0.929   1.00 29.87  ? 132 LEU B HD13 1 
ATOM   8144  H HD21 . LEU B 1 88  ? 22.187  -82.926  1.141   1.00 28.81  ? 132 LEU B HD21 1 
ATOM   8145  H HD22 . LEU B 1 88  ? 22.654  -82.340  -0.260  1.00 28.81  ? 132 LEU B HD22 1 
ATOM   8146  H HD23 . LEU B 1 88  ? 23.251  -83.716  0.265   1.00 28.81  ? 132 LEU B HD23 1 
ATOM   8147  N N    . ASN B 1 89  ? 28.048  -83.841  -1.224  1.00 22.04  ? 133 ASN B N    1 
ATOM   8148  C CA   . ASN B 1 89  ? 29.188  -83.588  -2.101  1.00 24.16  ? 133 ASN B CA   1 
ATOM   8149  C C    . ASN B 1 89  ? 28.802  -83.657  -3.573  1.00 22.61  ? 133 ASN B C    1 
ATOM   8150  O O    . ASN B 1 89  ? 29.405  -82.964  -4.400  1.00 26.86  ? 133 ASN B O    1 
ATOM   8151  C CB   . ASN B 1 89  ? 30.312  -84.582  -1.804  1.00 15.69  ? 133 ASN B CB   1 
ATOM   8152  C CG   . ASN B 1 89  ? 30.915  -84.388  -0.425  1.00 24.53  ? 133 ASN B CG   1 
ATOM   8153  O OD1  . ASN B 1 89  ? 30.780  -83.325  0.182   1.00 25.75  ? 133 ASN B OD1  1 
ATOM   8154  N ND2  . ASN B 1 89  ? 31.590  -85.416  0.073   1.00 17.09  ? 133 ASN B ND2  1 
ATOM   8155  H H    . ASN B 1 89  ? 28.078  -84.591  -0.804  1.00 26.45  ? 133 ASN B H    1 
ATOM   8156  H HA   . ASN B 1 89  ? 29.526  -82.696  -1.924  1.00 29.00  ? 133 ASN B HA   1 
ATOM   8157  H HB2  . ASN B 1 89  ? 29.958  -85.484  -1.853  1.00 18.83  ? 133 ASN B HB2  1 
ATOM   8158  H HB3  . ASN B 1 89  ? 31.017  -84.466  -2.460  1.00 18.83  ? 133 ASN B HB3  1 
ATOM   8159  H HD21 . ASN B 1 89  ? 31.951  -85.356  0.851   1.00 20.51  ? 133 ASN B HD21 1 
ATOM   8160  H HD22 . ASN B 1 89  ? 31.667  -86.141  -0.383  1.00 20.51  ? 133 ASN B HD22 1 
ATOM   8161  N N    . ASP B 1 90  ? 27.810  -84.477  -3.923  1.00 24.92  ? 134 ASP B N    1 
ATOM   8162  C CA   . ASP B 1 90  ? 27.400  -84.614  -5.316  1.00 22.37  ? 134 ASP B CA   1 
ATOM   8163  C C    . ASP B 1 90  ? 26.682  -83.381  -5.850  1.00 17.99  ? 134 ASP B C    1 
ATOM   8164  O O    . ASP B 1 90  ? 26.336  -83.359  -7.035  1.00 31.10  ? 134 ASP B O    1 
ATOM   8165  C CB   . ASP B 1 90  ? 26.499  -85.840  -5.478  1.00 36.01  ? 134 ASP B CB   1 
ATOM   8166  C CG   . ASP B 1 90  ? 27.189  -87.126  -5.074  1.00 45.81  ? 134 ASP B CG   1 
ATOM   8167  O OD1  . ASP B 1 90  ? 28.436  -87.174  -5.119  1.00 53.37  ? 134 ASP B OD1  1 
ATOM   8168  O OD2  . ASP B 1 90  ? 26.482  -88.089  -4.713  1.00 55.18  ? 134 ASP B OD2  1 
ATOM   8169  H H    . ASP B 1 90  ? 27.361  -84.963  -3.373  1.00 29.90  ? 134 ASP B H    1 
ATOM   8170  H HA   . ASP B 1 90  ? 28.191  -84.754  -5.861  1.00 26.85  ? 134 ASP B HA   1 
ATOM   8171  H HB2  . ASP B 1 90  ? 25.714  -85.731  -4.918  1.00 43.21  ? 134 ASP B HB2  1 
ATOM   8172  H HB3  . ASP B 1 90  ? 26.237  -85.919  -6.408  1.00 43.21  ? 134 ASP B HB3  1 
ATOM   8173  N N    . HIS B 1 91  ? 26.450  -82.365  -5.018  1.00 18.06  ? 135 HIS B N    1 
ATOM   8174  C CA   . HIS B 1 91  ? 25.759  -81.151  -5.431  1.00 20.09  ? 135 HIS B CA   1 
ATOM   8175  C C    . HIS B 1 91  ? 26.719  -79.984  -5.628  1.00 19.38  ? 135 HIS B C    1 
ATOM   8176  O O    . HIS B 1 91  ? 26.323  -78.819  -5.510  1.00 19.74  ? 135 HIS B O    1 
ATOM   8177  C CB   . HIS B 1 91  ? 24.680  -80.800  -4.409  1.00 25.46  ? 135 HIS B CB   1 
ATOM   8178  C CG   . HIS B 1 91  ? 23.765  -81.943  -4.098  1.00 28.26  ? 135 HIS B CG   1 
ATOM   8179  N ND1  . HIS B 1 91  ? 22.627  -82.205  -4.829  1.00 25.49  ? 135 HIS B ND1  1 
ATOM   8180  C CD2  . HIS B 1 91  ? 23.834  -82.909  -3.151  1.00 30.31  ? 135 HIS B CD2  1 
ATOM   8181  C CE1  . HIS B 1 91  ? 22.027  -83.275  -4.339  1.00 23.97  ? 135 HIS B CE1  1 
ATOM   8182  N NE2  . HIS B 1 91  ? 22.739  -83.721  -3.319  1.00 29.14  ? 135 HIS B NE2  1 
ATOM   8183  H H    . HIS B 1 91  ? 26.689  -82.359  -4.192  1.00 21.67  ? 135 HIS B H    1 
ATOM   8184  H HA   . HIS B 1 91  ? 25.318  -81.316  -6.280  1.00 24.11  ? 135 HIS B HA   1 
ATOM   8185  H HB2  . HIS B 1 91  ? 25.108  -80.527  -3.582  1.00 30.55  ? 135 HIS B HB2  1 
ATOM   8186  H HB3  . HIS B 1 91  ? 24.141  -80.073  -4.757  1.00 30.55  ? 135 HIS B HB3  1 
ATOM   8187  H HD2  . HIS B 1 91  ? 24.495  -83.001  -2.503  1.00 36.37  ? 135 HIS B HD2  1 
ATOM   8188  H HE1  . HIS B 1 91  ? 21.238  -83.650  -4.657  1.00 28.77  ? 135 HIS B HE1  1 
ATOM   8189  H HE2  . HIS B 1 91  ? 22.548  -84.408  -2.839  1.00 34.97  ? 135 HIS B HE2  1 
ATOM   8190  N N    . PHE B 1 92  ? 27.981  -80.283  -5.933  1.00 19.65  ? 136 PHE B N    1 
ATOM   8191  C CA   . PHE B 1 92  ? 29.003  -79.263  -6.151  1.00 18.11  ? 136 PHE B CA   1 
ATOM   8192  C C    . PHE B 1 92  ? 29.805  -79.669  -7.377  1.00 19.82  ? 136 PHE B C    1 
ATOM   8193  O O    . PHE B 1 92  ? 30.814  -80.377  -7.272  1.00 16.02  ? 136 PHE B O    1 
ATOM   8194  C CB   . PHE B 1 92  ? 29.897  -79.104  -4.922  1.00 17.90  ? 136 PHE B CB   1 
ATOM   8195  C CG   . PHE B 1 92  ? 29.164  -78.607  -3.711  1.00 15.22  ? 136 PHE B CG   1 
ATOM   8196  C CD1  . PHE B 1 92  ? 28.567  -79.497  -2.833  1.00 13.81  ? 136 PHE B CD1  1 
ATOM   8197  C CD2  . PHE B 1 92  ? 29.053  -77.251  -3.462  1.00 9.70   ? 136 PHE B CD2  1 
ATOM   8198  C CE1  . PHE B 1 92  ? 27.881  -79.041  -1.723  1.00 16.93  ? 136 PHE B CE1  1 
ATOM   8199  C CE2  . PHE B 1 92  ? 28.369  -76.789  -2.355  1.00 15.30  ? 136 PHE B CE2  1 
ATOM   8200  C CZ   . PHE B 1 92  ? 27.783  -77.685  -1.484  1.00 21.49  ? 136 PHE B CZ   1 
ATOM   8201  H H    . PHE B 1 92  ? 28.274  -81.087  -6.021  1.00 23.58  ? 136 PHE B H    1 
ATOM   8202  H HA   . PHE B 1 92  ? 28.576  -78.411  -6.331  1.00 21.73  ? 136 PHE B HA   1 
ATOM   8203  H HB2  . PHE B 1 92  ? 30.285  -79.966  -4.702  1.00 21.49  ? 136 PHE B HB2  1 
ATOM   8204  H HB3  . PHE B 1 92  ? 30.601  -78.468  -5.125  1.00 21.49  ? 136 PHE B HB3  1 
ATOM   8205  H HD1  . PHE B 1 92  ? 28.631  -80.411  -2.991  1.00 16.57  ? 136 PHE B HD1  1 
ATOM   8206  H HD2  . PHE B 1 92  ? 29.446  -76.643  -4.046  1.00 11.64  ? 136 PHE B HD2  1 
ATOM   8207  H HE1  . PHE B 1 92  ? 27.488  -79.647  -1.138  1.00 20.32  ? 136 PHE B HE1  1 
ATOM   8208  H HE2  . PHE B 1 92  ? 28.304  -75.875  -2.196  1.00 18.36  ? 136 PHE B HE2  1 
ATOM   8209  H HZ   . PHE B 1 92  ? 27.323  -77.376  -0.737  1.00 25.79  ? 136 PHE B HZ   1 
ATOM   8210  N N    . PRO B 1 93  ? 29.372  -79.251  -8.567  1.00 16.76  ? 137 PRO B N    1 
ATOM   8211  C CA   . PRO B 1 93  ? 30.035  -79.671  -9.807  1.00 18.88  ? 137 PRO B CA   1 
ATOM   8212  C C    . PRO B 1 93  ? 31.096  -78.717  -10.335 1.00 20.67  ? 137 PRO B C    1 
ATOM   8213  O O    . PRO B 1 93  ? 31.631  -78.971  -11.420 1.00 17.86  ? 137 PRO B O    1 
ATOM   8214  C CB   . PRO B 1 93  ? 28.852  -79.738  -10.783 1.00 12.80  ? 137 PRO B CB   1 
ATOM   8215  C CG   . PRO B 1 93  ? 27.988  -78.597  -10.352 1.00 19.24  ? 137 PRO B CG   1 
ATOM   8216  C CD   . PRO B 1 93  ? 28.141  -78.490  -8.846  1.00 15.78  ? 137 PRO B CD   1 
ATOM   8217  H HA   . PRO B 1 93  ? 30.418  -80.556  -9.704  1.00 22.66  ? 137 PRO B HA   1 
ATOM   8218  H HB2  . PRO B 1 93  ? 29.164  -79.615  -11.693 1.00 15.36  ? 137 PRO B HB2  1 
ATOM   8219  H HB3  . PRO B 1 93  ? 28.387  -80.584  -10.684 1.00 15.36  ? 137 PRO B HB3  1 
ATOM   8220  H HG2  . PRO B 1 93  ? 28.291  -77.782  -10.782 1.00 23.10  ? 137 PRO B HG2  1 
ATOM   8221  H HG3  . PRO B 1 93  ? 27.066  -78.783  -10.587 1.00 23.10  ? 137 PRO B HG3  1 
ATOM   8222  H HD2  . PRO B 1 93  ? 28.250  -77.563  -8.583  1.00 18.94  ? 137 PRO B HD2  1 
ATOM   8223  H HD3  . PRO B 1 93  ? 27.382  -78.899  -8.400  1.00 18.94  ? 137 PRO B HD3  1 
ATOM   8224  N N    . LEU B 1 94  ? 31.411  -77.641  -9.618  1.00 20.83  ? 138 LEU B N    1 
ATOM   8225  C CA   . LEU B 1 94  ? 32.292  -76.612  -10.150 1.00 17.46  ? 138 LEU B CA   1 
ATOM   8226  C C    . LEU B 1 94  ? 33.758  -77.006  -10.001 1.00 20.18  ? 138 LEU B C    1 
ATOM   8227  O O    . LEU B 1 94  ? 34.151  -77.696  -9.056  1.00 21.77  ? 138 LEU B O    1 
ATOM   8228  C CB   . LEU B 1 94  ? 32.030  -75.277  -9.452  1.00 17.16  ? 138 LEU B CB   1 
ATOM   8229  C CG   . LEU B 1 94  ? 30.598  -74.746  -9.568  1.00 20.37  ? 138 LEU B CG   1 
ATOM   8230  C CD1  . LEU B 1 94  ? 30.474  -73.386  -8.896  1.00 21.90  ? 138 LEU B CD1  1 
ATOM   8231  C CD2  . LEU B 1 94  ? 30.150  -74.659  -11.023 1.00 21.47  ? 138 LEU B CD2  1 
ATOM   8232  H H    . LEU B 1 94  ? 31.127  -77.486  -8.822  1.00 24.99  ? 138 LEU B H    1 
ATOM   8233  H HA   . LEU B 1 94  ? 32.108  -76.497  -11.095 1.00 20.95  ? 138 LEU B HA   1 
ATOM   8234  H HB2  . LEU B 1 94  ? 32.227  -75.381  -8.508  1.00 20.60  ? 138 LEU B HB2  1 
ATOM   8235  H HB3  . LEU B 1 94  ? 32.621  -74.609  -9.834  1.00 20.60  ? 138 LEU B HB3  1 
ATOM   8236  H HG   . LEU B 1 94  ? 30.000  -75.358  -9.111  1.00 24.44  ? 138 LEU B HG   1 
ATOM   8237  H HD11 . LEU B 1 94  ? 29.560  -73.074  -8.984  1.00 26.28  ? 138 LEU B HD11 1 
ATOM   8238  H HD12 . LEU B 1 94  ? 30.704  -73.476  -7.958  1.00 26.28  ? 138 LEU B HD12 1 
ATOM   8239  H HD13 . LEU B 1 94  ? 31.080  -72.764  -9.328  1.00 26.28  ? 138 LEU B HD13 1 
ATOM   8240  H HD21 . LEU B 1 94  ? 29.242  -74.320  -11.054 1.00 25.76  ? 138 LEU B HD21 1 
ATOM   8241  H HD22 . LEU B 1 94  ? 30.744  -74.059  -11.501 1.00 25.76  ? 138 LEU B HD22 1 
ATOM   8242  H HD23 . LEU B 1 94  ? 30.186  -75.545  -11.418 1.00 25.76  ? 138 LEU B HD23 1 
ATOM   8243  N N    . VAL B 1 95  ? 34.567  -76.549  -10.952 1.00 14.20  ? 139 VAL B N    1 
ATOM   8244  C CA   . VAL B 1 95  ? 35.981  -76.883  -10.995 1.00 20.91  ? 139 VAL B CA   1 
ATOM   8245  C C    . VAL B 1 95  ? 36.789  -75.793  -10.302 1.00 16.00  ? 139 VAL B C    1 
ATOM   8246  O O    . VAL B 1 95  ? 36.314  -74.680  -10.067 1.00 16.48  ? 139 VAL B O    1 
ATOM   8247  C CB   . VAL B 1 95  ? 36.466  -77.089  -12.446 1.00 23.49  ? 139 VAL B CB   1 
ATOM   8248  C CG1  . VAL B 1 95  ? 35.751  -78.270  -13.082 1.00 21.52  ? 139 VAL B CG1  1 
ATOM   8249  C CG2  . VAL B 1 95  ? 36.259  -75.823  -13.269 1.00 17.95  ? 139 VAL B CG2  1 
ATOM   8250  H H    . VAL B 1 95  ? 34.313  -76.034  -11.592 1.00 17.04  ? 139 VAL B H    1 
ATOM   8251  H HA   . VAL B 1 95  ? 36.123  -77.713  -10.513 1.00 25.10  ? 139 VAL B HA   1 
ATOM   8252  H HB   . VAL B 1 95  ? 37.416  -77.286  -12.435 1.00 28.19  ? 139 VAL B HB   1 
ATOM   8253  H HG11 . VAL B 1 95  ? 36.071  -78.380  -13.991 1.00 25.82  ? 139 VAL B HG11 1 
ATOM   8254  H HG12 . VAL B 1 95  ? 35.940  -79.069  -12.565 1.00 25.82  ? 139 VAL B HG12 1 
ATOM   8255  H HG13 . VAL B 1 95  ? 34.797  -78.096  -13.085 1.00 25.82  ? 139 VAL B HG13 1 
ATOM   8256  H HG21 . VAL B 1 95  ? 36.571  -75.980  -14.174 1.00 21.54  ? 139 VAL B HG21 1 
ATOM   8257  H HG22 . VAL B 1 95  ? 35.314  -75.604  -13.279 1.00 21.54  ? 139 VAL B HG22 1 
ATOM   8258  H HG23 . VAL B 1 95  ? 36.763  -75.098  -12.866 1.00 21.54  ? 139 VAL B HG23 1 
ATOM   8259  N N    . VAL B 1 96  ? 38.040  -76.128  -9.973  1.00 18.19  ? 140 VAL B N    1 
ATOM   8260  C CA   . VAL B 1 96  ? 38.971  -75.144  -9.427  1.00 9.83   ? 140 VAL B CA   1 
ATOM   8261  C C    . VAL B 1 96  ? 39.121  -73.960  -10.370 1.00 12.37  ? 140 VAL B C    1 
ATOM   8262  O O    . VAL B 1 96  ? 39.311  -72.819  -9.929  1.00 18.39  ? 140 VAL B O    1 
ATOM   8263  C CB   . VAL B 1 96  ? 40.335  -75.811  -9.154  1.00 17.12  ? 140 VAL B CB   1 
ATOM   8264  C CG1  . VAL B 1 96  ? 41.387  -74.774  -8.764  1.00 17.64  ? 140 VAL B CG1  1 
ATOM   8265  C CG2  . VAL B 1 96  ? 40.204  -76.864  -8.066  1.00 19.59  ? 140 VAL B CG2  1 
ATOM   8266  H H    . VAL B 1 96  ? 38.371  -76.917  -10.057 1.00 21.83  ? 140 VAL B H    1 
ATOM   8267  H HA   . VAL B 1 96  ? 38.624  -74.814  -8.584  1.00 11.79  ? 140 VAL B HA   1 
ATOM   8268  H HB   . VAL B 1 96  ? 40.637  -76.253  -9.963  1.00 20.55  ? 140 VAL B HB   1 
ATOM   8269  H HG11 . VAL B 1 96  ? 42.230  -75.226  -8.600  1.00 21.17  ? 140 VAL B HG11 1 
ATOM   8270  H HG12 . VAL B 1 96  ? 41.488  -74.138  -9.490  1.00 21.17  ? 140 VAL B HG12 1 
ATOM   8271  H HG13 . VAL B 1 96  ? 41.096  -74.315  -7.961  1.00 21.17  ? 140 VAL B HG13 1 
ATOM   8272  H HG21 . VAL B 1 96  ? 41.073  -77.268  -7.913  1.00 23.52  ? 140 VAL B HG21 1 
ATOM   8273  H HG22 . VAL B 1 96  ? 39.888  -76.440  -7.254  1.00 23.52  ? 140 VAL B HG22 1 
ATOM   8274  H HG23 . VAL B 1 96  ? 39.571  -77.539  -8.356  1.00 23.52  ? 140 VAL B HG23 1 
ATOM   8275  N N    . TRP B 1 97  ? 39.027  -74.206  -11.675 1.00 17.91  ? 141 TRP B N    1 
ATOM   8276  C CA   . TRP B 1 97  ? 39.397  -73.222  -12.691 1.00 17.61  ? 141 TRP B CA   1 
ATOM   8277  C C    . TRP B 1 97  ? 38.184  -72.352  -13.021 1.00 17.26  ? 141 TRP B C    1 
ATOM   8278  O O    . TRP B 1 97  ? 37.594  -72.397  -14.103 1.00 16.55  ? 141 TRP B O    1 
ATOM   8279  C CB   . TRP B 1 97  ? 39.968  -73.942  -13.903 1.00 16.55  ? 141 TRP B CB   1 
ATOM   8280  C CG   . TRP B 1 97  ? 40.883  -75.024  -13.436 1.00 15.33  ? 141 TRP B CG   1 
ATOM   8281  C CD1  . TRP B 1 97  ? 40.656  -76.368  -13.473 1.00 16.90  ? 141 TRP B CD1  1 
ATOM   8282  C CD2  . TRP B 1 97  ? 42.150  -74.848  -12.792 1.00 9.82   ? 141 TRP B CD2  1 
ATOM   8283  N NE1  . TRP B 1 97  ? 41.715  -77.042  -12.910 1.00 18.27  ? 141 TRP B NE1  1 
ATOM   8284  C CE2  . TRP B 1 97  ? 42.645  -76.130  -12.485 1.00 11.70  ? 141 TRP B CE2  1 
ATOM   8285  C CE3  . TRP B 1 97  ? 42.919  -73.728  -12.455 1.00 13.90  ? 141 TRP B CE3  1 
ATOM   8286  C CZ2  . TRP B 1 97  ? 43.876  -76.324  -11.861 1.00 18.45  ? 141 TRP B CZ2  1 
ATOM   8287  C CZ3  . TRP B 1 97  ? 44.138  -73.922  -11.837 1.00 13.02  ? 141 TRP B CZ3  1 
ATOM   8288  C CH2  . TRP B 1 97  ? 44.605  -75.209  -11.546 1.00 19.16  ? 141 TRP B CH2  1 
ATOM   8289  H H    . TRP B 1 97  ? 38.745  -74.949  -12.003 1.00 21.49  ? 141 TRP B H    1 
ATOM   8290  H HA   . TRP B 1 97  ? 40.090  -72.645  -12.333 1.00 21.13  ? 141 TRP B HA   1 
ATOM   8291  H HB2  . TRP B 1 97  ? 39.249  -74.342  -14.416 1.00 19.86  ? 141 TRP B HB2  1 
ATOM   8292  H HB3  . TRP B 1 97  ? 40.474  -73.319  -14.447 1.00 19.86  ? 141 TRP B HB3  1 
ATOM   8293  H HD1  . TRP B 1 97  ? 39.896  -76.770  -13.829 1.00 20.28  ? 141 TRP B HD1  1 
ATOM   8294  H HE1  . TRP B 1 97  ? 41.783  -77.896  -12.839 1.00 21.93  ? 141 TRP B HE1  1 
ATOM   8295  H HE3  . TRP B 1 97  ? 42.615  -72.870  -12.645 1.00 16.69  ? 141 TRP B HE3  1 
ATOM   8296  H HZ2  . TRP B 1 97  ? 44.191  -77.177  -11.669 1.00 22.14  ? 141 TRP B HZ2  1 
ATOM   8297  H HZ3  . TRP B 1 97  ? 44.658  -73.185  -11.610 1.00 15.62  ? 141 TRP B HZ3  1 
ATOM   8298  H HH2  . TRP B 1 97  ? 45.432  -75.309  -11.131 1.00 22.99  ? 141 TRP B HH2  1 
ATOM   8299  N N    . GLN B 1 98  ? 37.832  -71.531  -12.033 1.00 17.75  ? 142 GLN B N    1 
ATOM   8300  C CA   . GLN B 1 98  ? 36.663  -70.663  -12.076 1.00 17.75  ? 142 GLN B CA   1 
ATOM   8301  C C    . GLN B 1 98  ? 37.091  -69.231  -11.784 1.00 20.00  ? 142 GLN B C    1 
ATOM   8302  O O    . GLN B 1 98  ? 38.228  -68.849  -12.077 1.00 24.95  ? 142 GLN B O    1 
ATOM   8303  C CB   . GLN B 1 98  ? 35.628  -71.148  -11.058 1.00 19.56  ? 142 GLN B CB   1 
ATOM   8304  C CG   . GLN B 1 98  ? 36.144  -71.135  -9.622  1.00 19.54  ? 142 GLN B CG   1 
ATOM   8305  C CD   . GLN B 1 98  ? 35.073  -71.449  -8.602  1.00 16.11  ? 142 GLN B CD   1 
ATOM   8306  O OE1  . GLN B 1 98  ? 34.654  -70.579  -7.839  1.00 22.95  ? 142 GLN B OE1  1 
ATOM   8307  N NE2  . GLN B 1 98  ? 34.633  -72.699  -8.573  1.00 18.11  ? 142 GLN B NE2  1 
ATOM   8308  H H    . GLN B 1 98  ? 38.275  -71.459  -11.300 1.00 21.30  ? 142 GLN B H    1 
ATOM   8309  H HA   . GLN B 1 98  ? 36.266  -70.694  -12.961 1.00 21.30  ? 142 GLN B HA   1 
ATOM   8310  H HB2  . GLN B 1 98  ? 34.850  -70.570  -11.101 1.00 23.47  ? 142 GLN B HB2  1 
ATOM   8311  H HB3  . GLN B 1 98  ? 35.376  -72.059  -11.276 1.00 23.47  ? 142 GLN B HB3  1 
ATOM   8312  H HG2  . GLN B 1 98  ? 36.845  -71.799  -9.533  1.00 23.45  ? 142 GLN B HG2  1 
ATOM   8313  H HG3  . GLN B 1 98  ? 36.497  -70.253  -9.423  1.00 23.45  ? 142 GLN B HG3  1 
ATOM   8314  H HE21 . GLN B 1 98  ? 34.957  -73.282  -9.116  1.00 21.74  ? 142 GLN B HE21 1 
ATOM   8315  H HE22 . GLN B 1 98  ? 34.024  -72.928  -8.010  1.00 21.74  ? 142 GLN B HE22 1 
ATOM   8316  N N    A THR B 1 99  ? 36.189  -68.435  -11.214 0.45 22.23  ? 143 THR B N    1 
ATOM   8317  N N    B THR B 1 99  ? 36.192  -68.429  -11.219 0.55 22.22  ? 143 THR B N    1 
ATOM   8318  C CA   A THR B 1 99  ? 36.563  -67.111  -10.736 0.45 22.37  ? 143 THR B CA   1 
ATOM   8319  C CA   B THR B 1 99  ? 36.566  -67.090  -10.784 0.55 22.35  ? 143 THR B CA   1 
ATOM   8320  C C    A THR B 1 99  ? 37.727  -67.218  -9.761  0.45 21.29  ? 143 THR B C    1 
ATOM   8321  C C    B THR B 1 99  ? 37.690  -67.177  -9.757  0.55 21.32  ? 143 THR B C    1 
ATOM   8322  O O    A THR B 1 99  ? 37.735  -68.072  -8.870  0.45 19.55  ? 143 THR B O    1 
ATOM   8323  O O    B THR B 1 99  ? 37.635  -67.984  -8.826  0.55 19.54  ? 143 THR B O    1 
ATOM   8324  C CB   A THR B 1 99  ? 35.378  -66.433  -10.050 0.45 19.93  ? 143 THR B CB   1 
ATOM   8325  C CB   B THR B 1 99  ? 35.352  -66.369  -10.192 0.55 19.80  ? 143 THR B CB   1 
ATOM   8326  O OG1  A THR B 1 99  ? 34.941  -67.232  -8.944  0.45 20.07  ? 143 THR B OG1  1 
ATOM   8327  O OG1  B THR B 1 99  ? 34.277  -66.380  -11.140 0.55 34.58  ? 143 THR B OG1  1 
ATOM   8328  C CG2  A THR B 1 99  ? 34.233  -66.254  -11.023 0.45 34.05  ? 143 THR B CG2  1 
ATOM   8329  C CG2  B THR B 1 99  ? 35.688  -64.925  -9.841  0.55 22.26  ? 143 THR B CG2  1 
ATOM   8330  H H    A THR B 1 99  ? 35.362  -68.637  -11.093 0.45 26.68  ? 143 THR B H    1 
ATOM   8331  H H    B THR B 1 99  ? 35.369  -68.634  -11.077 0.55 26.67  ? 143 THR B H    1 
ATOM   8332  H HA   A THR B 1 99  ? 36.840  -66.563  -11.486 0.45 26.85  ? 143 THR B HA   1 
ATOM   8333  H HA   B THR B 1 99  ? 36.884  -66.580  -11.545 0.55 26.83  ? 143 THR B HA   1 
ATOM   8334  H HB   A THR B 1 99  ? 35.648  -65.558  -9.729  0.45 23.91  ? 143 THR B HB   1 
ATOM   8335  H HB   B THR B 1 99  ? 35.072  -66.823  -9.382  0.55 23.76  ? 143 THR B HB   1 
ATOM   8336  H HG1  A THR B 1 99  ? 34.705  -67.992  -9.214  0.45 24.09  ? 143 THR B HG1  1 
ATOM   8337  H HG1  B THR B 1 99  ? 34.512  -65.989  -11.845 0.55 41.49  ? 143 THR B HG1  1 
ATOM   8338  H HG21 A THR B 1 99  ? 34.516  -65.705  -11.771 0.45 40.87  ? 143 THR B HG21 1 
ATOM   8339  H HG21 B THR B 1 99  ? 34.909  -64.485  -9.467  0.55 26.71  ? 143 THR B HG21 1 
ATOM   8340  H HG22 A THR B 1 99  ? 33.945  -67.118  -11.358 0.45 40.87  ? 143 THR B HG22 1 
ATOM   8341  H HG22 B THR B 1 99  ? 36.406  -64.901  -9.189  0.55 26.71  ? 143 THR B HG22 1 
ATOM   8342  H HG23 A THR B 1 99  ? 33.485  -65.823  -10.580 0.45 40.87  ? 143 THR B HG23 1 
ATOM   8343  H HG23 B THR B 1 99  ? 35.969  -64.447  -10.637 0.55 26.71  ? 143 THR B HG23 1 
ATOM   8344  N N    . GLY B 1 100 ? 38.715  -66.343  -9.935  1.00 15.53  ? 144 GLY B N    1 
ATOM   8345  C CA   . GLY B 1 100 ? 39.876  -66.359  -9.064  1.00 18.95  ? 144 GLY B CA   1 
ATOM   8346  C C    . GLY B 1 100 ? 39.580  -66.043  -7.611  1.00 13.69  ? 144 GLY B C    1 
ATOM   8347  O O    . GLY B 1 100 ? 40.436  -66.293  -6.756  1.00 20.12  ? 144 GLY B O    1 
ATOM   8348  H H    . GLY B 1 100 ? 38.744  -65.746  -10.553 1.00 18.64  ? 144 GLY B H    1 
ATOM   8349  H HA2  . GLY B 1 100 ? 40.288  -67.236  -9.102  1.00 22.74  ? 144 GLY B HA2  1 
ATOM   8350  H HA3  . GLY B 1 100 ? 40.521  -65.710  -9.387  1.00 22.74  ? 144 GLY B HA3  1 
ATOM   8351  N N    . SER B 1 101 ? 38.406  -65.494  -7.311  1.00 13.25  ? 145 SER B N    1 
ATOM   8352  C CA   . SER B 1 101 ? 37.988  -65.233  -5.940  1.00 19.42  ? 145 SER B CA   1 
ATOM   8353  C C    . SER B 1 101 ? 37.191  -66.379  -5.331  1.00 19.75  ? 145 SER B C    1 
ATOM   8354  O O    . SER B 1 101 ? 36.944  -66.366  -4.120  1.00 21.28  ? 145 SER B O    1 
ATOM   8355  C CB   . SER B 1 101 ? 37.144  -63.958  -5.890  1.00 23.61  ? 145 SER B CB   1 
ATOM   8356  O OG   . SER B 1 101 ? 35.953  -64.113  -6.642  1.00 18.44  ? 145 SER B OG   1 
ATOM   8357  H H    . SER B 1 101 ? 37.822  -65.261  -7.898  1.00 15.91  ? 145 SER B H    1 
ATOM   8358  H HA   . SER B 1 101 ? 38.776  -65.092  -5.392  1.00 23.30  ? 145 SER B HA   1 
ATOM   8359  H HB2  . SER B 1 101 ? 36.913  -63.768  -4.967  1.00 28.34  ? 145 SER B HB2  1 
ATOM   8360  H HB3  . SER B 1 101 ? 37.659  -63.223  -6.260  1.00 28.34  ? 145 SER B HB3  1 
ATOM   8361  H HG   . SER B 1 101 ? 35.497  -63.407  -6.608  1.00 22.12  ? 145 SER B HG   1 
ATOM   8362  N N    . GLY B 1 102 ? 36.779  -67.358  -6.133  1.00 15.17  ? 146 GLY B N    1 
ATOM   8363  C CA   . GLY B 1 102 ? 35.941  -68.429  -5.634  1.00 19.77  ? 146 GLY B CA   1 
ATOM   8364  C C    . GLY B 1 102 ? 34.490  -68.052  -5.449  1.00 22.86  ? 146 GLY B C    1 
ATOM   8365  O O    . GLY B 1 102 ? 33.768  -68.748  -4.727  1.00 23.60  ? 146 GLY B O    1 
ATOM   8366  H H    . GLY B 1 102 ? 36.974  -67.421  -6.968  1.00 18.20  ? 146 GLY B H    1 
ATOM   8367  H HA2  . GLY B 1 102 ? 35.980  -69.176  -6.252  1.00 23.72  ? 146 GLY B HA2  1 
ATOM   8368  H HA3  . GLY B 1 102 ? 36.286  -68.728  -4.778  1.00 23.72  ? 146 GLY B HA3  1 
ATOM   8369  N N    . THR B 1 103 ? 34.039  -66.966  -6.082  1.00 22.14  ? 147 THR B N    1 
ATOM   8370  C CA   . THR B 1 103 ? 32.663  -66.509  -5.904  1.00 27.24  ? 147 THR B CA   1 
ATOM   8371  C C    . THR B 1 103 ? 31.661  -67.594  -6.274  1.00 24.44  ? 147 THR B C    1 
ATOM   8372  O O    . THR B 1 103 ? 30.640  -67.765  -5.598  1.00 20.38  ? 147 THR B O    1 
ATOM   8373  C CB   . THR B 1 103 ? 32.417  -65.256  -6.747  1.00 24.85  ? 147 THR B CB   1 
ATOM   8374  O OG1  . THR B 1 103 ? 33.236  -64.186  -6.262  1.00 37.41  ? 147 THR B OG1  1 
ATOM   8375  C CG2  . THR B 1 103 ? 30.949  -64.833  -6.699  1.00 37.99  ? 147 THR B CG2  1 
ATOM   8376  H H    . THR B 1 103 ? 34.508  -66.480  -6.615  1.00 26.57  ? 147 THR B H    1 
ATOM   8377  H HA   . THR B 1 103 ? 32.524  -66.277  -4.972  1.00 32.69  ? 147 THR B HA   1 
ATOM   8378  H HB   . THR B 1 103 ? 32.649  -65.442  -7.670  1.00 29.82  ? 147 THR B HB   1 
ATOM   8379  H HG1  . THR B 1 103 ? 34.047  -64.399  -6.313  1.00 44.90  ? 147 THR B HG1  1 
ATOM   8380  H HG21 . THR B 1 103 ? 30.815  -64.039  -7.239  1.00 45.59  ? 147 THR B HG21 1 
ATOM   8381  H HG22 . THR B 1 103 ? 30.388  -65.546  -7.043  1.00 45.59  ? 147 THR B HG22 1 
ATOM   8382  H HG23 . THR B 1 103 ? 30.689  -64.640  -5.785  1.00 45.59  ? 147 THR B HG23 1 
ATOM   8383  N N    . GLN B 1 104 ? 31.928  -68.334  -7.350  1.00 19.49  ? 148 GLN B N    1 
ATOM   8384  C CA   . GLN B 1 104 ? 30.925  -69.262  -7.855  1.00 18.90  ? 148 GLN B CA   1 
ATOM   8385  C C    . GLN B 1 104 ? 30.744  -70.456  -6.930  1.00 22.44  ? 148 GLN B C    1 
ATOM   8386  O O    . GLN B 1 104 ? 29.624  -70.960  -6.789  1.00 19.74  ? 148 GLN B O    1 
ATOM   8387  C CB   . GLN B 1 104 ? 31.295  -69.704  -9.267  1.00 19.15  ? 148 GLN B CB   1 
ATOM   8388  C CG   . GLN B 1 104 ? 31.035  -68.603  -10.279 1.00 30.59  ? 148 GLN B CG   1 
ATOM   8389  C CD   . GLN B 1 104 ? 31.836  -68.747  -11.549 1.00 43.85  ? 148 GLN B CD   1 
ATOM   8390  O OE1  . GLN B 1 104 ? 32.521  -69.747  -11.763 1.00 46.13  ? 148 GLN B OE1  1 
ATOM   8391  N NE2  . GLN B 1 104 ? 31.762  -67.732  -12.400 1.00 53.47  ? 148 GLN B NE2  1 
ATOM   8392  H H    . GLN B 1 104 ? 32.664  -68.317  -7.794  1.00 23.40  ? 148 GLN B H    1 
ATOM   8393  H HA   . GLN B 1 104 ? 30.073  -68.800  -7.905  1.00 22.68  ? 148 GLN B HA   1 
ATOM   8394  H HB2  . GLN B 1 104 ? 32.239  -69.927  -9.296  1.00 22.99  ? 148 GLN B HB2  1 
ATOM   8395  H HB3  . GLN B 1 104 ? 30.760  -70.475  -9.512  1.00 22.99  ? 148 GLN B HB3  1 
ATOM   8396  H HG2  . GLN B 1 104 ? 30.095  -68.614  -10.518 1.00 36.72  ? 148 GLN B HG2  1 
ATOM   8397  H HG3  . GLN B 1 104 ? 31.263  -67.750  -9.879  1.00 36.72  ? 148 GLN B HG3  1 
ATOM   8398  H HE21 . GLN B 1 104 ? 31.278  -67.047  -12.211 1.00 64.17  ? 148 GLN B HE21 1 
ATOM   8399  H HE22 . GLN B 1 104 ? 32.198  -67.759  -13.140 1.00 64.17  ? 148 GLN B HE22 1 
ATOM   8400  N N    . THR B 1 105 ? 31.815  -70.916  -6.281  1.00 15.72  ? 149 THR B N    1 
ATOM   8401  C CA   . THR B 1 105 ? 31.645  -71.944  -5.263  1.00 19.09  ? 149 THR B CA   1 
ATOM   8402  C C    . THR B 1 105 ? 30.895  -71.389  -4.060  1.00 16.12  ? 149 THR B C    1 
ATOM   8403  O O    . THR B 1 105 ? 30.092  -72.098  -3.440  1.00 20.24  ? 149 THR B O    1 
ATOM   8404  C CB   . THR B 1 105 ? 33.005  -72.515  -4.857  1.00 17.74  ? 149 THR B CB   1 
ATOM   8405  O OG1  . THR B 1 105 ? 33.519  -73.320  -5.930  1.00 14.63  ? 149 THR B OG1  1 
ATOM   8406  C CG2  . THR B 1 105 ? 32.890  -73.382  -3.604  1.00 17.32  ? 149 THR B CG2  1 
ATOM   8407  H H    . THR B 1 105 ? 32.625  -70.656  -6.408  1.00 18.86  ? 149 THR B H    1 
ATOM   8408  H HA   . THR B 1 105 ? 31.117  -72.669  -5.635  1.00 22.91  ? 149 THR B HA   1 
ATOM   8409  H HB   . THR B 1 105 ? 33.621  -71.788  -4.674  1.00 21.29  ? 149 THR B HB   1 
ATOM   8410  H HG1  . THR B 1 105 ? 32.990  -73.952  -6.094  1.00 17.55  ? 149 THR B HG1  1 
ATOM   8411  H HG21 . THR B 1 105 ? 33.761  -73.734  -3.363  1.00 20.78  ? 149 THR B HG21 1 
ATOM   8412  H HG22 . THR B 1 105 ? 32.549  -72.853  -2.866  1.00 20.78  ? 149 THR B HG22 1 
ATOM   8413  H HG23 . THR B 1 105 ? 32.285  -74.122  -3.767  1.00 20.78  ? 149 THR B HG23 1 
ATOM   8414  N N    . ASN B 1 106 ? 31.134  -70.121  -3.721  1.00 17.58  ? 150 ASN B N    1 
ATOM   8415  C CA   . ASN B 1 106 ? 30.342  -69.481  -2.676  1.00 20.10  ? 150 ASN B CA   1 
ATOM   8416  C C    . ASN B 1 106 ? 28.862  -69.483  -3.042  1.00 19.05  ? 150 ASN B C    1 
ATOM   8417  O O    . ASN B 1 106 ? 28.008  -69.781  -2.199  1.00 23.87  ? 150 ASN B O    1 
ATOM   8418  C CB   . ASN B 1 106 ? 30.837  -68.054  -2.430  1.00 19.09  ? 150 ASN B CB   1 
ATOM   8419  C CG   . ASN B 1 106 ? 30.029  -67.330  -1.366  1.00 19.80  ? 150 ASN B CG   1 
ATOM   8420  O OD1  . ASN B 1 106 ? 29.939  -67.779  -0.226  1.00 17.30  ? 150 ASN B OD1  1 
ATOM   8421  N ND2  . ASN B 1 106 ? 29.448  -66.195  -1.735  1.00 27.28  ? 150 ASN B ND2  1 
ATOM   8422  H H    . ASN B 1 106 ? 31.738  -69.620  -4.074  1.00 21.10  ? 150 ASN B H    1 
ATOM   8423  H HA   . ASN B 1 106 ? 30.447  -69.981  -1.851  1.00 24.12  ? 150 ASN B HA   1 
ATOM   8424  H HB2  . ASN B 1 106 ? 31.760  -68.085  -2.136  1.00 22.91  ? 150 ASN B HB2  1 
ATOM   8425  H HB3  . ASN B 1 106 ? 30.768  -67.548  -3.255  1.00 22.91  ? 150 ASN B HB3  1 
ATOM   8426  H HD21 . ASN B 1 106 ? 28.980  -65.748  -1.169  1.00 32.73  ? 150 ASN B HD21 1 
ATOM   8427  H HD22 . ASN B 1 106 ? 29.540  -65.907  -2.541  1.00 32.73  ? 150 ASN B HD22 1 
ATOM   8428  N N    . MET B 1 107 ? 28.541  -69.171  -4.302  1.00 22.75  ? 151 MET B N    1 
ATOM   8429  C CA   . MET B 1 107 ? 27.155  -69.239  -4.754  1.00 26.44  ? 151 MET B CA   1 
ATOM   8430  C C    . MET B 1 107 ? 26.668  -70.682  -4.806  1.00 24.22  ? 151 MET B C    1 
ATOM   8431  O O    . MET B 1 107 ? 25.512  -70.965  -4.472  1.00 23.28  ? 151 MET B O    1 
ATOM   8432  C CB   . MET B 1 107 ? 27.023  -68.577  -6.125  1.00 22.56  ? 151 MET B CB   1 
ATOM   8433  C CG   . MET B 1 107 ? 27.190  -67.061  -6.090  1.00 42.99  ? 151 MET B CG   1 
ATOM   8434  S SD   . MET B 1 107 ? 26.857  -66.252  -7.671  1.00 63.07  ? 151 MET B SD   1 
ATOM   8435  C CE   . MET B 1 107 ? 27.970  -67.128  -8.769  1.00 37.72  ? 151 MET B CE   1 
ATOM   8436  H H    . MET B 1 107 ? 29.101  -68.920  -4.904  1.00 27.30  ? 151 MET B H    1 
ATOM   8437  H HA   . MET B 1 107 ? 26.599  -68.745  -4.132  1.00 31.73  ? 151 MET B HA   1 
ATOM   8438  H HB2  . MET B 1 107 ? 27.703  -68.938  -6.714  1.00 27.07  ? 151 MET B HB2  1 
ATOM   8439  H HB3  . MET B 1 107 ? 26.142  -68.770  -6.482  1.00 27.07  ? 151 MET B HB3  1 
ATOM   8440  H HG2  . MET B 1 107 ? 26.577  -66.694  -5.434  1.00 51.59  ? 151 MET B HG2  1 
ATOM   8441  H HG3  . MET B 1 107 ? 28.104  -66.854  -5.838  1.00 51.59  ? 151 MET B HG3  1 
ATOM   8442  H HE1  . MET B 1 107 ? 27.875  -66.770  -9.666  1.00 45.26  ? 151 MET B HE1  1 
ATOM   8443  H HE2  . MET B 1 107 ? 28.881  -67.006  -8.458  1.00 45.26  ? 151 MET B HE2  1 
ATOM   8444  H HE3  . MET B 1 107 ? 27.742  -68.071  -8.763  1.00 45.26  ? 151 MET B HE3  1 
ATOM   8445  N N    . ASN B 1 108 ? 27.539  -71.609  -5.219  1.00 16.44  ? 152 ASN B N    1 
ATOM   8446  C CA   . ASN B 1 108 ? 27.190  -73.027  -5.181  1.00 10.06  ? 152 ASN B CA   1 
ATOM   8447  C C    . ASN B 1 108 ? 26.765  -73.442  -3.778  1.00 18.33  ? 152 ASN B C    1 
ATOM   8448  O O    . ASN B 1 108 ? 25.761  -74.143  -3.605  1.00 20.73  ? 152 ASN B O    1 
ATOM   8449  C CB   . ASN B 1 108 ? 28.379  -73.866  -5.650  1.00 17.19  ? 152 ASN B CB   1 
ATOM   8450  C CG   . ASN B 1 108 ? 28.001  -75.298  -6.035  1.00 12.91  ? 152 ASN B CG   1 
ATOM   8451  O OD1  . ASN B 1 108 ? 28.775  -75.966  -6.723  1.00 17.68  ? 152 ASN B OD1  1 
ATOM   8452  N ND2  . ASN B 1 108 ? 26.835  -75.774  -5.605  1.00 18.59  ? 152 ASN B ND2  1 
ATOM   8453  H H    . ASN B 1 108 ? 28.327  -71.443  -5.520  1.00 19.74  ? 152 ASN B H    1 
ATOM   8454  H HA   . ASN B 1 108 ? 26.448  -73.190  -5.784  1.00 12.08  ? 152 ASN B HA   1 
ATOM   8455  H HB2  . ASN B 1 108 ? 28.774  -73.442  -6.428  1.00 20.63  ? 152 ASN B HB2  1 
ATOM   8456  H HB3  . ASN B 1 108 ? 29.032  -73.913  -4.933  1.00 20.63  ? 152 ASN B HB3  1 
ATOM   8457  H HD21 . ASN B 1 108 ? 26.597  -76.576  -5.807  1.00 22.31  ? 152 ASN B HD21 1 
ATOM   8458  H HD22 . ASN B 1 108 ? 26.319  -75.280  -5.125  1.00 22.31  ? 152 ASN B HD22 1 
ATOM   8459  N N    . VAL B 1 109 ? 27.523  -73.019  -2.767  1.00 19.82  ? 153 VAL B N    1 
ATOM   8460  C CA   . VAL B 1 109 ? 27.204  -73.362  -1.384  1.00 25.18  ? 153 VAL B CA   1 
ATOM   8461  C C    . VAL B 1 109 ? 25.916  -72.678  -0.945  1.00 17.83  ? 153 VAL B C    1 
ATOM   8462  O O    . VAL B 1 109 ? 25.077  -73.282  -0.265  1.00 16.66  ? 153 VAL B O    1 
ATOM   8463  C CB   . VAL B 1 109 ? 28.386  -72.993  -0.468  1.00 15.54  ? 153 VAL B CB   1 
ATOM   8464  C CG1  . VAL B 1 109 ? 27.963  -72.942  1.002   1.00 19.52  ? 153 VAL B CG1  1 
ATOM   8465  C CG2  . VAL B 1 109 ? 29.515  -73.987  -0.664  1.00 19.72  ? 153 VAL B CG2  1 
ATOM   8466  H H    . VAL B 1 109 ? 28.227  -72.532  -2.855  1.00 23.79  ? 153 VAL B H    1 
ATOM   8467  H HA   . VAL B 1 109 ? 27.068  -74.321  -1.323  1.00 30.22  ? 153 VAL B HA   1 
ATOM   8468  H HB   . VAL B 1 109 ? 28.714  -72.114  -0.715  1.00 18.65  ? 153 VAL B HB   1 
ATOM   8469  H HG11 . VAL B 1 109 ? 28.733  -72.707  1.543   1.00 23.42  ? 153 VAL B HG11 1 
ATOM   8470  H HG12 . VAL B 1 109 ? 27.268  -72.274  1.107   1.00 23.42  ? 153 VAL B HG12 1 
ATOM   8471  H HG13 . VAL B 1 109 ? 27.627  -73.814  1.264   1.00 23.42  ? 153 VAL B HG13 1 
ATOM   8472  H HG21 . VAL B 1 109 ? 30.253  -73.746  -0.083  1.00 23.66  ? 153 VAL B HG21 1 
ATOM   8473  H HG22 . VAL B 1 109 ? 29.195  -74.876  -0.441  1.00 23.66  ? 153 VAL B HG22 1 
ATOM   8474  H HG23 . VAL B 1 109 ? 29.801  -73.961  -1.591  1.00 23.66  ? 153 VAL B HG23 1 
ATOM   8475  N N    . ASN B 1 110 ? 25.738  -71.410  -1.318  1.00 19.69  ? 154 ASN B N    1 
ATOM   8476  C CA   . ASN B 1 110 ? 24.531  -70.690  -0.928  1.00 18.68  ? 154 ASN B CA   1 
ATOM   8477  C C    . ASN B 1 110 ? 23.286  -71.341  -1.516  1.00 22.52  ? 154 ASN B C    1 
ATOM   8478  O O    . ASN B 1 110 ? 22.255  -71.448  -0.842  1.00 26.83  ? 154 ASN B O    1 
ATOM   8479  C CB   . ASN B 1 110 ? 24.632  -69.229  -1.364  1.00 24.96  ? 154 ASN B CB   1 
ATOM   8480  C CG   . ASN B 1 110 ? 25.676  -68.459  -0.581  1.00 20.01  ? 154 ASN B CG   1 
ATOM   8481  O OD1  . ASN B 1 110 ? 25.911  -68.730  0.596   1.00 30.33  ? 154 ASN B OD1  1 
ATOM   8482  N ND2  . ASN B 1 110 ? 26.309  -67.490  -1.231  1.00 24.13  ? 154 ASN B ND2  1 
ATOM   8483  H H    . ASN B 1 110 ? 26.293  -70.952  -1.789  1.00 23.63  ? 154 ASN B H    1 
ATOM   8484  H HA   . ASN B 1 110 ? 24.450  -70.709  0.038   1.00 22.41  ? 154 ASN B HA   1 
ATOM   8485  H HB2  . ASN B 1 110 ? 24.874  -69.195  -2.303  1.00 29.96  ? 154 ASN B HB2  1 
ATOM   8486  H HB3  . ASN B 1 110 ? 23.774  -68.798  -1.226  1.00 29.96  ? 154 ASN B HB3  1 
ATOM   8487  H HD21 . ASN B 1 110 ? 26.911  -67.024  -0.830  1.00 28.96  ? 154 ASN B HD21 1 
ATOM   8488  H HD22 . ASN B 1 110 ? 26.118  -67.328  -2.054  1.00 28.96  ? 154 ASN B HD22 1 
ATOM   8489  N N    . GLU B 1 111 ? 23.364  -71.794  -2.769  1.00 18.59  ? 155 GLU B N    1 
ATOM   8490  C CA   . GLU B 1 111 ? 22.198  -72.397  -3.406  1.00 20.89  ? 155 GLU B CA   1 
ATOM   8491  C C    . GLU B 1 111 ? 21.894  -73.772  -2.822  1.00 19.03  ? 155 GLU B C    1 
ATOM   8492  O O    . GLU B 1 111 ? 20.729  -74.100  -2.571  1.00 21.54  ? 155 GLU B O    1 
ATOM   8493  C CB   . GLU B 1 111 ? 22.413  -72.487  -4.916  1.00 17.01  ? 155 GLU B CB   1 
ATOM   8494  C CG   . GLU B 1 111 ? 22.407  -71.135  -5.624  1.00 17.37  ? 155 GLU B CG   1 
ATOM   8495  C CD   . GLU B 1 111 ? 22.514  -71.264  -7.134  1.00 23.32  ? 155 GLU B CD   1 
ATOM   8496  O OE1  . GLU B 1 111 ? 23.096  -72.261  -7.610  1.00 21.11  ? 155 GLU B OE1  1 
ATOM   8497  O OE2  . GLU B 1 111 ? 22.010  -70.372  -7.847  1.00 37.32  ? 155 GLU B OE2  1 
ATOM   8498  H H    . GLU B 1 111 ? 24.068  -71.764  -3.262  1.00 22.31  ? 155 GLU B H    1 
ATOM   8499  H HA   . GLU B 1 111 ? 21.426  -71.830  -3.248  1.00 25.07  ? 155 GLU B HA   1 
ATOM   8500  H HB2  . GLU B 1 111 ? 23.272  -72.905  -5.085  1.00 20.42  ? 155 GLU B HB2  1 
ATOM   8501  H HB3  . GLU B 1 111 ? 21.705  -73.026  -5.301  1.00 20.42  ? 155 GLU B HB3  1 
ATOM   8502  H HG2  . GLU B 1 111 ? 21.577  -70.676  -5.420  1.00 20.85  ? 155 GLU B HG2  1 
ATOM   8503  H HG3  . GLU B 1 111 ? 23.162  -70.612  -5.312  1.00 20.85  ? 155 GLU B HG3  1 
ATOM   8504  N N    . VAL B 1 112 ? 22.926  -74.589  -2.599  1.00 15.43  ? 156 VAL B N    1 
ATOM   8505  C CA   . VAL B 1 112 ? 22.716  -75.929  -2.052  1.00 20.42  ? 156 VAL B CA   1 
ATOM   8506  C C    . VAL B 1 112 ? 22.103  -75.841  -0.660  1.00 18.52  ? 156 VAL B C    1 
ATOM   8507  O O    . VAL B 1 112 ? 21.123  -76.527  -0.346  1.00 20.46  ? 156 VAL B O    1 
ATOM   8508  C CB   . VAL B 1 112 ? 24.041  -76.712  -2.035  1.00 16.63  ? 156 VAL B CB   1 
ATOM   8509  C CG1  . VAL B 1 112 ? 23.932  -77.970  -1.171  1.00 13.54  ? 156 VAL B CG1  1 
ATOM   8510  C CG2  . VAL B 1 112 ? 24.445  -77.084  -3.451  1.00 17.21  ? 156 VAL B CG2  1 
ATOM   8511  H H    . VAL B 1 112 ? 23.749  -74.394  -2.755  1.00 18.52  ? 156 VAL B H    1 
ATOM   8512  H HA   . VAL B 1 112 ? 22.094  -76.407  -2.622  1.00 24.51  ? 156 VAL B HA   1 
ATOM   8513  H HB   . VAL B 1 112 ? 24.737  -76.150  -1.661  1.00 19.96  ? 156 VAL B HB   1 
ATOM   8514  H HG11 . VAL B 1 112 ? 24.782  -78.436  -1.184  1.00 16.25  ? 156 VAL B HG11 1 
ATOM   8515  H HG12 . VAL B 1 112 ? 23.710  -77.710  -0.263  1.00 16.25  ? 156 VAL B HG12 1 
ATOM   8516  H HG13 . VAL B 1 112 ? 23.235  -78.541  -1.531  1.00 16.25  ? 156 VAL B HG13 1 
ATOM   8517  H HG21 . VAL B 1 112 ? 25.280  -77.576  -3.421  1.00 20.65  ? 156 VAL B HG21 1 
ATOM   8518  H HG22 . VAL B 1 112 ? 23.750  -77.634  -3.843  1.00 20.65  ? 156 VAL B HG22 1 
ATOM   8519  H HG23 . VAL B 1 112 ? 24.557  -76.272  -3.970  1.00 20.65  ? 156 VAL B HG23 1 
ATOM   8520  N N    . ILE B 1 113 ? 22.678  -74.997  0.197   1.00 17.28  ? 157 ILE B N    1 
ATOM   8521  C CA   . ILE B 1 113 ? 22.170  -74.850  1.557   1.00 21.86  ? 157 ILE B CA   1 
ATOM   8522  C C    . ILE B 1 113 ? 20.749  -74.298  1.537   1.00 21.55  ? 157 ILE B C    1 
ATOM   8523  O O    . ILE B 1 113 ? 19.883  -74.741  2.302   1.00 19.93  ? 157 ILE B O    1 
ATOM   8524  C CB   . ILE B 1 113 ? 23.125  -73.961  2.375   1.00 23.43  ? 157 ILE B CB   1 
ATOM   8525  C CG1  . ILE B 1 113 ? 24.396  -74.747  2.716   1.00 21.41  ? 157 ILE B CG1  1 
ATOM   8526  C CG2  . ILE B 1 113 ? 22.454  -73.446  3.647   1.00 25.85  ? 157 ILE B CG2  1 
ATOM   8527  C CD1  . ILE B 1 113 ? 25.528  -73.901  3.252   1.00 24.91  ? 157 ILE B CD1  1 
ATOM   8528  H H    . ILE B 1 113 ? 23.357  -74.502  0.015   1.00 20.73  ? 157 ILE B H    1 
ATOM   8529  H HA   . ILE B 1 113 ? 22.143  -75.724  1.977   1.00 26.24  ? 157 ILE B HA   1 
ATOM   8530  H HB   . ILE B 1 113 ? 23.375  -73.198  1.831   1.00 28.11  ? 157 ILE B HB   1 
ATOM   8531  H HG12 . ILE B 1 113 ? 24.179  -75.410  3.390   1.00 25.69  ? 157 ILE B HG12 1 
ATOM   8532  H HG13 . ILE B 1 113 ? 24.712  -75.189  1.913   1.00 25.69  ? 157 ILE B HG13 1 
ATOM   8533  H HG21 . ILE B 1 113 ? 23.084  -72.892  4.134   1.00 31.02  ? 157 ILE B HG21 1 
ATOM   8534  H HG22 . ILE B 1 113 ? 21.674  -72.924  3.403   1.00 31.02  ? 157 ILE B HG22 1 
ATOM   8535  H HG23 . ILE B 1 113 ? 22.188  -74.203  4.192   1.00 31.02  ? 157 ILE B HG23 1 
ATOM   8536  H HD11 . ILE B 1 113 ? 26.288  -74.474  3.441   1.00 29.90  ? 157 ILE B HD11 1 
ATOM   8537  H HD12 . ILE B 1 113 ? 25.770  -73.239  2.585   1.00 29.90  ? 157 ILE B HD12 1 
ATOM   8538  H HD13 . ILE B 1 113 ? 25.235  -73.461  4.065   1.00 29.90  ? 157 ILE B HD13 1 
ATOM   8539  N N    . SER B 1 114 ? 20.485  -73.329  0.659   1.00 22.18  ? 158 SER B N    1 
ATOM   8540  C CA   . SER B 1 114 ? 19.157  -72.729  0.589   1.00 26.40  ? 158 SER B CA   1 
ATOM   8541  C C    . SER B 1 114 ? 18.112  -73.740  0.135   1.00 20.63  ? 158 SER B C    1 
ATOM   8542  O O    . SER B 1 114 ? 17.014  -73.799  0.700   1.00 26.50  ? 158 SER B O    1 
ATOM   8543  C CB   . SER B 1 114 ? 19.178  -71.523  -0.350  1.00 23.61  ? 158 SER B CB   1 
ATOM   8544  O OG   . SER B 1 114 ? 17.898  -71.290  -0.908  1.00 41.37  ? 158 SER B OG   1 
ATOM   8545  H H    . SER B 1 114 ? 21.053  -73.005  0.100   1.00 26.62  ? 158 SER B H    1 
ATOM   8546  H HA   . SER B 1 114 ? 18.906  -72.416  1.472   1.00 31.68  ? 158 SER B HA   1 
ATOM   8547  H HB2  . SER B 1 114 ? 19.451  -70.739  0.151   1.00 28.33  ? 158 SER B HB2  1 
ATOM   8548  H HB3  . SER B 1 114 ? 19.808  -71.694  -1.067  1.00 28.33  ? 158 SER B HB3  1 
ATOM   8549  H HG   . SER B 1 114 ? 17.342  -71.140  -0.297  1.00 49.64  ? 158 SER B HG   1 
ATOM   8550  N N    . ASN B 1 115 ? 18.431  -74.544  -0.879  1.00 26.43  ? 159 ASN B N    1 
ATOM   8551  C CA   . ASN B 1 115 ? 17.458  -75.504  -1.391  1.00 24.08  ? 159 ASN B CA   1 
ATOM   8552  C C    . ASN B 1 115 ? 17.272  -76.675  -0.434  1.00 31.61  ? 159 ASN B C    1 
ATOM   8553  O O    . ASN B 1 115 ? 16.156  -77.186  -0.282  1.00 23.55  ? 159 ASN B O    1 
ATOM   8554  C CB   . ASN B 1 115 ? 17.887  -75.998  -2.769  1.00 24.99  ? 159 ASN B CB   1 
ATOM   8555  C CG   . ASN B 1 115 ? 17.507  -75.035  -3.872  1.00 26.50  ? 159 ASN B CG   1 
ATOM   8556  O OD1  . ASN B 1 115 ? 16.438  -74.427  -3.836  1.00 31.67  ? 159 ASN B OD1  1 
ATOM   8557  N ND2  . ASN B 1 115 ? 18.383  -74.886  -4.859  1.00 24.16  ? 159 ASN B ND2  1 
ATOM   8558  H H    . ASN B 1 115 ? 19.191  -74.554  -1.282  1.00 31.71  ? 159 ASN B H    1 
ATOM   8559  H HA   . ASN B 1 115 ? 16.601  -75.060  -1.487  1.00 28.90  ? 159 ASN B HA   1 
ATOM   8560  H HB2  . ASN B 1 115 ? 18.852  -76.104  -2.782  1.00 29.99  ? 159 ASN B HB2  1 
ATOM   8561  H HB3  . ASN B 1 115 ? 17.457  -76.848  -2.950  1.00 29.99  ? 159 ASN B HB3  1 
ATOM   8562  H HD21 . ASN B 1 115 ? 18.212  -74.350  -5.509  1.00 28.99  ? 159 ASN B HD21 1 
ATOM   8563  H HD22 . ASN B 1 115 ? 19.122  -75.326  -4.848  1.00 28.99  ? 159 ASN B HD22 1 
ATOM   8564  N N    . ARG B 1 116 ? 18.350  -77.122  0.214   1.00 31.07  ? 160 ARG B N    1 
ATOM   8565  C CA   . ARG B 1 116 ? 18.208  -78.163  1.227   1.00 17.18  ? 160 ARG B CA   1 
ATOM   8566  C C    . ARG B 1 116 ? 17.389  -77.660  2.408   1.00 23.57  ? 160 ARG B C    1 
ATOM   8567  O O    . ARG B 1 116 ? 16.543  -78.386  2.943   1.00 22.76  ? 160 ARG B O    1 
ATOM   8568  C CB   . ARG B 1 116 ? 19.583  -78.640  1.692   1.00 24.71  ? 160 ARG B CB   1 
ATOM   8569  C CG   . ARG B 1 116 ? 19.541  -79.702  2.785   1.00 22.59  ? 160 ARG B CG   1 
ATOM   8570  C CD   . ARG B 1 116 ? 18.954  -81.015  2.288   1.00 15.99  ? 160 ARG B CD   1 
ATOM   8571  N NE   . ARG B 1 116 ? 18.958  -82.029  3.340   1.00 22.35  ? 160 ARG B NE   1 
ATOM   8572  C CZ   . ARG B 1 116 ? 17.889  -82.672  3.807   1.00 35.97  ? 160 ARG B CZ   1 
ATOM   8573  N NH1  . ARG B 1 116 ? 16.680  -82.445  3.314   1.00 46.91  ? 160 ARG B NH1  1 
ATOM   8574  N NH2  . ARG B 1 116 ? 18.038  -83.566  4.776   1.00 20.68  ? 160 ARG B NH2  1 
ATOM   8575  H H    . ARG B 1 116 ? 19.154  -76.846  0.089   1.00 37.29  ? 160 ARG B H    1 
ATOM   8576  H HA   . ARG B 1 116 ? 17.742  -78.920  0.839   1.00 20.62  ? 160 ARG B HA   1 
ATOM   8577  H HB2  . ARG B 1 116 ? 20.054  -79.017  0.933   1.00 29.66  ? 160 ARG B HB2  1 
ATOM   8578  H HB3  . ARG B 1 116 ? 20.075  -77.879  2.038   1.00 29.66  ? 160 ARG B HB3  1 
ATOM   8579  H HG2  . ARG B 1 116 ? 20.444  -79.873  3.097   1.00 27.11  ? 160 ARG B HG2  1 
ATOM   8580  H HG3  . ARG B 1 116 ? 18.990  -79.383  3.517   1.00 27.11  ? 160 ARG B HG3  1 
ATOM   8581  H HD2  . ARG B 1 116 ? 18.037  -80.870  2.007   1.00 19.19  ? 160 ARG B HD2  1 
ATOM   8582  H HD3  . ARG B 1 116 ? 19.485  -81.343  1.546   1.00 19.19  ? 160 ARG B HD3  1 
ATOM   8583  H HE   . ARG B 1 116 ? 19.718  -82.229  3.689   1.00 26.83  ? 160 ARG B HE   1 
ATOM   8584  H HH11 . ARG B 1 116 ? 16.572  -81.866  2.687   1.00 56.30  ? 160 ARG B HH11 1 
ATOM   8585  H HH12 . ARG B 1 116 ? 16.001  -82.872  3.626   1.00 56.30  ? 160 ARG B HH12 1 
ATOM   8586  H HH21 . ARG B 1 116 ? 18.819  -83.724  5.100   1.00 24.82  ? 160 ARG B HH21 1 
ATOM   8587  H HH22 . ARG B 1 116 ? 17.354  -83.991  5.079   1.00 24.82  ? 160 ARG B HH22 1 
ATOM   8588  N N    . ALA B 1 117 ? 17.630  -76.417  2.832   1.00 18.91  ? 161 ALA B N    1 
ATOM   8589  C CA   . ALA B 1 117 ? 16.845  -75.837  3.916   1.00 24.65  ? 161 ALA B CA   1 
ATOM   8590  C C    . ALA B 1 117 ? 15.392  -75.654  3.499   1.00 33.23  ? 161 ALA B C    1 
ATOM   8591  O O    . ALA B 1 117 ? 14.475  -75.898  4.292   1.00 26.90  ? 161 ALA B O    1 
ATOM   8592  C CB   . ALA B 1 117 ? 17.452  -74.503  4.346   1.00 18.30  ? 161 ALA B CB   1 
ATOM   8593  H H    . ALA B 1 117 ? 18.236  -75.897  2.512   1.00 22.70  ? 161 ALA B H    1 
ATOM   8594  H HA   . ALA B 1 117 ? 16.866  -76.437  4.678   1.00 29.59  ? 161 ALA B HA   1 
ATOM   8595  H HB1  . ALA B 1 117 ? 16.918  -74.132  5.066   1.00 21.97  ? 161 ALA B HB1  1 
ATOM   8596  H HB2  . ALA B 1 117 ? 18.360  -74.654  4.650   1.00 21.97  ? 161 ALA B HB2  1 
ATOM   8597  H HB3  . ALA B 1 117 ? 17.452  -73.898  3.588   1.00 21.97  ? 161 ALA B HB3  1 
ATOM   8598  N N    . ILE B 1 118 ? 15.166  -75.216  2.259   1.00 21.22  ? 162 ILE B N    1 
ATOM   8599  C CA   . ILE B 1 118 ? 13.809  -75.146  1.725   1.00 19.10  ? 162 ILE B CA   1 
ATOM   8600  C C    . ILE B 1 118 ? 13.133  -76.506  1.832   1.00 25.25  ? 162 ILE B C    1 
ATOM   8601  O O    . ILE B 1 118 ? 11.986  -76.618  2.279   1.00 24.64  ? 162 ILE B O    1 
ATOM   8602  C CB   . ILE B 1 118 ? 13.839  -74.639  0.272   1.00 25.45  ? 162 ILE B CB   1 
ATOM   8603  C CG1  . ILE B 1 118 ? 14.091  -73.130  0.251   1.00 23.12  ? 162 ILE B CG1  1 
ATOM   8604  C CG2  . ILE B 1 118 ? 12.539  -74.965  -0.456  1.00 31.41  ? 162 ILE B CG2  1 
ATOM   8605  C CD1  . ILE B 1 118 ? 14.557  -72.602  -1.091  1.00 28.10  ? 162 ILE B CD1  1 
ATOM   8606  H H    . ILE B 1 118 ? 15.777  -74.956  1.713   1.00 25.46  ? 162 ILE B H    1 
ATOM   8607  H HA   . ILE B 1 118 ? 13.295  -74.514  2.252   1.00 22.92  ? 162 ILE B HA   1 
ATOM   8608  H HB   . ILE B 1 118 ? 14.569  -75.079  -0.191  1.00 30.54  ? 162 ILE B HB   1 
ATOM   8609  H HG12 . ILE B 1 118 ? 13.266  -72.673  0.479   1.00 27.75  ? 162 ILE B HG12 1 
ATOM   8610  H HG13 . ILE B 1 118 ? 14.775  -72.919  0.906   1.00 27.75  ? 162 ILE B HG13 1 
ATOM   8611  H HG21 . ILE B 1 118 ? 12.595  -74.632  -1.365  1.00 37.69  ? 162 ILE B HG21 1 
ATOM   8612  H HG22 . ILE B 1 118 ? 12.414  -75.927  -0.462  1.00 37.69  ? 162 ILE B HG22 1 
ATOM   8613  H HG23 . ILE B 1 118 ? 11.802  -74.539  0.009   1.00 37.69  ? 162 ILE B HG23 1 
ATOM   8614  H HD11 . ILE B 1 118 ? 14.694  -71.644  -1.023  1.00 33.72  ? 162 ILE B HD11 1 
ATOM   8615  H HD12 . ILE B 1 118 ? 15.389  -73.040  -1.330  1.00 33.72  ? 162 ILE B HD12 1 
ATOM   8616  H HD13 . ILE B 1 118 ? 13.879  -72.793  -1.758  1.00 33.72  ? 162 ILE B HD13 1 
ATOM   8617  N N    . GLU B 1 119 ? 13.839  -77.561  1.423   1.00 20.11  ? 163 GLU B N    1 
ATOM   8618  C CA   . GLU B 1 119 ? 13.274  -78.904  1.489   1.00 15.98  ? 163 GLU B CA   1 
ATOM   8619  C C    . GLU B 1 119 ? 12.892  -79.269  2.917   1.00 26.51  ? 163 GLU B C    1 
ATOM   8620  O O    . GLU B 1 119 ? 11.813  -79.824  3.157   1.00 36.09  ? 163 GLU B O    1 
ATOM   8621  C CB   . GLU B 1 119 ? 14.271  -79.914  0.925   1.00 19.41  ? 163 GLU B CB   1 
ATOM   8622  C CG   . GLU B 1 119 ? 13.681  -81.286  0.660   1.00 17.79  ? 163 GLU B CG   1 
ATOM   8623  C CD   . GLU B 1 119 ? 14.700  -82.253  0.091   1.00 26.01  ? 163 GLU B CD   1 
ATOM   8624  O OE1  . GLU B 1 119 ? 15.795  -82.377  0.679   1.00 27.81  ? 163 GLU B OE1  1 
ATOM   8625  O OE2  . GLU B 1 119 ? 14.411  -82.881  -0.950  1.00 37.01  ? 163 GLU B OE2  1 
ATOM   8626  H H    . GLU B 1 119 ? 14.639  -77.525  1.107   1.00 24.13  ? 163 GLU B H    1 
ATOM   8627  H HA   . GLU B 1 119 ? 12.471  -78.937  0.945   1.00 19.18  ? 163 GLU B HA   1 
ATOM   8628  H HB2  . GLU B 1 119 ? 14.617  -79.574  0.086   1.00 23.29  ? 163 GLU B HB2  1 
ATOM   8629  H HB3  . GLU B 1 119 ? 14.997  -80.023  1.560   1.00 23.29  ? 163 GLU B HB3  1 
ATOM   8630  H HG2  . GLU B 1 119 ? 13.349  -81.654  1.493   1.00 21.35  ? 163 GLU B HG2  1 
ATOM   8631  H HG3  . GLU B 1 119 ? 12.957  -81.201  0.021   1.00 21.35  ? 163 GLU B HG3  1 
ATOM   8632  N N    . MET B 1 120 ? 13.764  -78.962  3.881   1.00 30.61  ? 164 MET B N    1 
ATOM   8633  C CA   . MET B 1 120 ? 13.461  -79.259  5.277   1.00 34.35  ? 164 MET B CA   1 
ATOM   8634  C C    . MET B 1 120 ? 12.242  -78.486  5.759   1.00 26.51  ? 164 MET B C    1 
ATOM   8635  O O    . MET B 1 120 ? 11.561  -78.923  6.693   1.00 27.82  ? 164 MET B O    1 
ATOM   8636  C CB   . MET B 1 120 ? 14.668  -78.934  6.155   1.00 29.72  ? 164 MET B CB   1 
ATOM   8637  C CG   . MET B 1 120 ? 15.885  -79.795  5.884   1.00 34.81  ? 164 MET B CG   1 
ATOM   8638  S SD   . MET B 1 120 ? 17.329  -79.230  6.802   1.00 38.59  ? 164 MET B SD   1 
ATOM   8639  C CE   . MET B 1 120 ? 18.499  -80.530  6.414   1.00 36.13  ? 164 MET B CE   1 
ATOM   8640  H H    . MET B 1 120 ? 14.527  -78.588  3.753   1.00 36.74  ? 164 MET B H    1 
ATOM   8641  H HA   . MET B 1 120 ? 13.281  -80.208  5.361   1.00 41.23  ? 164 MET B HA   1 
ATOM   8642  H HB2  . MET B 1 120 ? 14.922  -78.009  6.006   1.00 35.67  ? 164 MET B HB2  1 
ATOM   8643  H HB3  . MET B 1 120 ? 14.419  -79.059  7.084   1.00 35.67  ? 164 MET B HB3  1 
ATOM   8644  H HG2  . MET B 1 120 ? 15.696  -80.708  6.151   1.00 41.78  ? 164 MET B HG2  1 
ATOM   8645  H HG3  . MET B 1 120 ? 16.096  -79.760  4.938   1.00 41.78  ? 164 MET B HG3  1 
ATOM   8646  H HE1  . MET B 1 120 ? 19.340  -80.340  6.859   1.00 43.36  ? 164 MET B HE1  1 
ATOM   8647  H HE2  . MET B 1 120 ? 18.143  -81.377  6.725   1.00 43.36  ? 164 MET B HE2  1 
ATOM   8648  H HE3  . MET B 1 120 ? 18.631  -80.559  5.454   1.00 43.36  ? 164 MET B HE3  1 
ATOM   8649  N N    . LEU B 1 121 ? 11.956  -77.340  5.145   1.00 25.64  ? 165 LEU B N    1 
ATOM   8650  C CA   . LEU B 1 121 ? 10.816  -76.514  5.516   1.00 31.74  ? 165 LEU B CA   1 
ATOM   8651  C C    . LEU B 1 121 ? 9.607   -76.747  4.617   1.00 30.15  ? 165 LEU B C    1 
ATOM   8652  O O    . LEU B 1 121 ? 8.654   -75.962  4.660   1.00 32.74  ? 165 LEU B O    1 
ATOM   8653  C CB   . LEU B 1 121 ? 11.215  -75.035  5.495   1.00 33.30  ? 165 LEU B CB   1 
ATOM   8654  C CG   . LEU B 1 121 ? 12.299  -74.618  6.495   1.00 31.15  ? 165 LEU B CG   1 
ATOM   8655  C CD1  . LEU B 1 121 ? 12.694  -73.163  6.291   1.00 33.36  ? 165 LEU B CD1  1 
ATOM   8656  C CD2  . LEU B 1 121 ? 11.844  -74.838  7.930   1.00 32.94  ? 165 LEU B CD2  1 
ATOM   8657  H H    . LEU B 1 121 ? 12.419  -77.015  4.497   1.00 30.77  ? 165 LEU B H    1 
ATOM   8658  H HA   . LEU B 1 121 ? 10.555  -76.735  6.424   1.00 38.09  ? 165 LEU B HA   1 
ATOM   8659  H HB2  . LEU B 1 121 ? 11.542  -74.820  4.607   1.00 39.96  ? 165 LEU B HB2  1 
ATOM   8660  H HB3  . LEU B 1 121 ? 10.427  -74.503  5.685   1.00 39.96  ? 165 LEU B HB3  1 
ATOM   8661  H HG   . LEU B 1 121 ? 13.088  -75.163  6.346   1.00 37.38  ? 165 LEU B HG   1 
ATOM   8662  H HD11 . LEU B 1 121 ? 13.379  -72.929  6.936   1.00 40.03  ? 165 LEU B HD11 1 
ATOM   8663  H HD12 . LEU B 1 121 ? 13.035  -73.053  5.390   1.00 40.03  ? 165 LEU B HD12 1 
ATOM   8664  H HD13 . LEU B 1 121 ? 11.912  -72.604  6.420   1.00 40.03  ? 165 LEU B HD13 1 
ATOM   8665  H HD21 . LEU B 1 121 ? 12.554  -74.564  8.531   1.00 39.53  ? 165 LEU B HD21 1 
ATOM   8666  H HD22 . LEU B 1 121 ? 11.048  -74.308  8.093   1.00 39.53  ? 165 LEU B HD22 1 
ATOM   8667  H HD23 . LEU B 1 121 ? 11.647  -75.780  8.057   1.00 39.53  ? 165 LEU B HD23 1 
ATOM   8668  N N    . GLY B 1 122 ? 9.625   -77.804  3.808   1.00 24.77  ? 166 GLY B N    1 
ATOM   8669  C CA   . GLY B 1 122 ? 8.480   -78.142  2.987   1.00 35.22  ? 166 GLY B CA   1 
ATOM   8670  C C    . GLY B 1 122 ? 8.242   -77.226  1.810   1.00 36.92  ? 166 GLY B C    1 
ATOM   8671  O O    . GLY B 1 122 ? 7.131   -77.203  1.273   1.00 46.77  ? 166 GLY B O    1 
ATOM   8672  H H    . GLY B 1 122 ? 10.293  -78.339  3.719   1.00 29.73  ? 166 GLY B H    1 
ATOM   8673  H HA2  . GLY B 1 122 ? 8.593   -79.043  2.646   1.00 42.26  ? 166 GLY B HA2  1 
ATOM   8674  H HA3  . GLY B 1 122 ? 7.683   -78.129  3.541   1.00 42.26  ? 166 GLY B HA3  1 
ATOM   8675  N N    . GLY B 1 123 ? 9.254   -76.469  1.384   1.00 31.93  ? 167 GLY B N    1 
ATOM   8676  C CA   . GLY B 1 123 ? 9.108   -75.564  0.266   1.00 27.32  ? 167 GLY B CA   1 
ATOM   8677  C C    . GLY B 1 123 ? 9.472   -76.214  -1.059  1.00 29.76  ? 167 GLY B C    1 
ATOM   8678  O O    . GLY B 1 123 ? 9.764   -77.406  -1.148  1.00 23.32  ? 167 GLY B O    1 
ATOM   8679  H H    . GLY B 1 123 ? 10.039  -76.468  1.735   1.00 38.31  ? 167 GLY B H    1 
ATOM   8680  H HA2  . GLY B 1 123 ? 8.189   -75.258  0.215   1.00 32.78  ? 167 GLY B HA2  1 
ATOM   8681  H HA3  . GLY B 1 123 ? 9.681   -74.793  0.397   1.00 32.78  ? 167 GLY B HA3  1 
ATOM   8682  N N    . GLU B 1 124 ? 9.447   -75.396  -2.108  1.00 38.41  ? 168 GLU B N    1 
ATOM   8683  C CA   . GLU B 1 124 ? 9.758   -75.839  -3.460  1.00 39.96  ? 168 GLU B CA   1 
ATOM   8684  C C    . GLU B 1 124 ? 11.218  -75.549  -3.778  1.00 32.39  ? 168 GLU B C    1 
ATOM   8685  O O    . GLU B 1 124 ? 11.695  -74.429  -3.567  1.00 31.26  ? 168 GLU B O    1 
ATOM   8686  C CB   . GLU B 1 124 ? 8.852   -75.148  -4.481  1.00 42.40  ? 168 GLU B CB   1 
ATOM   8687  C CG   . GLU B 1 124 ? 7.429   -75.678  -4.524  1.00 53.99  ? 168 GLU B CG   1 
ATOM   8688  C CD   . GLU B 1 124 ? 7.368   -77.154  -4.872  1.00 64.51  ? 168 GLU B CD   1 
ATOM   8689  O OE1  . GLU B 1 124 ? 7.085   -77.969  -3.968  1.00 64.09  ? 168 GLU B OE1  1 
ATOM   8690  O OE2  . GLU B 1 124 ? 7.617   -77.500  -6.046  1.00 61.73  ? 168 GLU B OE2  1 
ATOM   8691  H H    . GLU B 1 124 ? 9.248   -74.560  -2.058  1.00 46.10  ? 168 GLU B H    1 
ATOM   8692  H HA   . GLU B 1 124 ? 9.616   -76.797  -3.524  1.00 47.95  ? 168 GLU B HA   1 
ATOM   8693  H HB2  . GLU B 1 124 ? 8.807   -74.203  -4.266  1.00 50.88  ? 168 GLU B HB2  1 
ATOM   8694  H HB3  . GLU B 1 124 ? 9.235   -75.263  -5.364  1.00 50.88  ? 168 GLU B HB3  1 
ATOM   8695  H HG2  . GLU B 1 124 ? 7.020   -75.558  -3.652  1.00 64.79  ? 168 GLU B HG2  1 
ATOM   8696  H HG3  . GLU B 1 124 ? 6.929   -75.190  -5.196  1.00 64.79  ? 168 GLU B HG3  1 
ATOM   8697  N N    . LEU B 1 125 ? 11.921  -76.559  -4.284  1.00 32.24  ? 169 LEU B N    1 
ATOM   8698  C CA   . LEU B 1 125 ? 13.304  -76.372  -4.703  1.00 34.79  ? 169 LEU B CA   1 
ATOM   8699  C C    . LEU B 1 125 ? 13.379  -75.334  -5.814  1.00 35.21  ? 169 LEU B C    1 
ATOM   8700  O O    . LEU B 1 125 ? 12.647  -75.412  -6.805  1.00 40.91  ? 169 LEU B O    1 
ATOM   8701  C CB   . LEU B 1 125 ? 13.897  -77.699  -5.179  1.00 34.74  ? 169 LEU B CB   1 
ATOM   8702  C CG   . LEU B 1 125 ? 13.994  -78.829  -4.150  1.00 32.64  ? 169 LEU B CG   1 
ATOM   8703  C CD1  . LEU B 1 125 ? 14.438  -80.119  -4.824  1.00 40.44  ? 169 LEU B CD1  1 
ATOM   8704  C CD2  . LEU B 1 125 ? 14.949  -78.463  -3.031  1.00 39.86  ? 169 LEU B CD2  1 
ATOM   8705  H H    . LEU B 1 125 ? 11.622  -77.357  -4.395  1.00 38.69  ? 169 LEU B H    1 
ATOM   8706  H HA   . LEU B 1 125 ? 13.828  -76.054  -3.951  1.00 41.75  ? 169 LEU B HA   1 
ATOM   8707  H HB2  . LEU B 1 125 ? 13.353  -78.026  -5.912  1.00 41.69  ? 169 LEU B HB2  1 
ATOM   8708  H HB3  . LEU B 1 125 ? 14.796  -77.528  -5.500  1.00 41.69  ? 169 LEU B HB3  1 
ATOM   8709  H HG   . LEU B 1 125 ? 13.118  -78.979  -3.761  1.00 39.17  ? 169 LEU B HG   1 
ATOM   8710  H HD11 . LEU B 1 125 ? 14.492  -80.820  -4.156  1.00 48.53  ? 169 LEU B HD11 1 
ATOM   8711  H HD12 . LEU B 1 125 ? 13.789  -80.359  -5.504  1.00 48.53  ? 169 LEU B HD12 1 
ATOM   8712  H HD13 . LEU B 1 125 ? 15.308  -79.979  -5.230  1.00 48.53  ? 169 LEU B HD13 1 
ATOM   8713  H HD21 . LEU B 1 125 ? 14.988  -79.196  -2.398  1.00 47.84  ? 169 LEU B HD21 1 
ATOM   8714  H HD22 . LEU B 1 125 ? 15.828  -78.302  -3.407  1.00 47.84  ? 169 LEU B HD22 1 
ATOM   8715  H HD23 . LEU B 1 125 ? 14.625  -77.662  -2.591  1.00 47.84  ? 169 LEU B HD23 1 
ATOM   8716  N N    . GLY B 1 126 ? 14.266  -74.356  -5.643  1.00 34.05  ? 170 GLY B N    1 
ATOM   8717  C CA   . GLY B 1 126 ? 14.473  -73.324  -6.636  1.00 39.00  ? 170 GLY B CA   1 
ATOM   8718  C C    . GLY B 1 126 ? 13.630  -72.079  -6.461  1.00 37.22  ? 170 GLY B C    1 
ATOM   8719  O O    . GLY B 1 126 ? 13.810  -71.119  -7.220  1.00 44.13  ? 170 GLY B O    1 
ATOM   8720  H H    . GLY B 1 126 ? 14.765  -74.274  -4.948  1.00 40.87  ? 170 GLY B H    1 
ATOM   8721  H HA2  . GLY B 1 126 ? 15.405  -73.055  -6.619  1.00 46.80  ? 170 GLY B HA2  1 
ATOM   8722  H HA3  . GLY B 1 126 ? 14.283  -73.690  -7.514  1.00 46.80  ? 170 GLY B HA3  1 
ATOM   8723  N N    . SER B 1 127 ? 12.721  -72.058  -5.487  1.00 38.44  ? 171 SER B N    1 
ATOM   8724  C CA   . SER B 1 127 ? 11.833  -70.918  -5.300  1.00 28.24  ? 171 SER B CA   1 
ATOM   8725  C C    . SER B 1 127 ? 12.459  -69.796  -4.484  1.00 35.76  ? 171 SER B C    1 
ATOM   8726  O O    . SER B 1 127 ? 11.915  -68.687  -4.474  1.00 36.13  ? 171 SER B O    1 
ATOM   8727  C CB   . SER B 1 127 ? 10.540  -71.370  -4.615  1.00 41.55  ? 171 SER B CB   1 
ATOM   8728  O OG   . SER B 1 127 ? 10.769  -71.687  -3.251  1.00 35.29  ? 171 SER B OG   1 
ATOM   8729  H H    . SER B 1 127 ? 12.600  -72.693  -4.920  1.00 46.13  ? 171 SER B H    1 
ATOM   8730  H HA   . SER B 1 127 ? 11.599  -70.557  -6.170  1.00 33.89  ? 171 SER B HA   1 
ATOM   8731  H HB2  . SER B 1 127 ? 9.888   -70.653  -4.667  1.00 49.87  ? 171 SER B HB2  1 
ATOM   8732  H HB3  . SER B 1 127 ? 10.202  -72.158  -5.069  1.00 49.87  ? 171 SER B HB3  1 
ATOM   8733  H HG   . SER B 1 127 ? 11.332  -72.307  -3.191  1.00 42.35  ? 171 SER B HG   1 
ATOM   8734  N N    . LYS B 1 128 ? 13.573  -70.052  -3.801  1.00 30.86  ? 172 LYS B N    1 
ATOM   8735  C CA   . LYS B 1 128 ? 14.148  -69.110  -2.846  1.00 36.75  ? 172 LYS B CA   1 
ATOM   8736  C C    . LYS B 1 128 ? 13.193  -68.804  -1.697  1.00 34.74  ? 172 LYS B C    1 
ATOM   8737  O O    . LYS B 1 128 ? 13.386  -67.828  -0.968  1.00 29.78  ? 172 LYS B O    1 
ATOM   8738  C CB   . LYS B 1 128 ? 14.576  -67.806  -3.532  1.00 29.56  ? 172 LYS B CB   1 
ATOM   8739  C CG   . LYS B 1 128 ? 15.660  -67.987  -4.582  1.00 35.06  ? 172 LYS B CG   1 
ATOM   8740  C CD   . LYS B 1 128 ? 16.207  -66.648  -5.064  1.00 49.31  ? 172 LYS B CD   1 
ATOM   8741  C CE   . LYS B 1 128 ? 15.240  -65.938  -5.999  1.00 79.85  ? 172 LYS B CE   1 
ATOM   8742  N NZ   . LYS B 1 128 ? 15.082  -66.662  -7.291  1.00 82.80  ? 172 LYS B NZ   1 
ATOM   8743  H H    . LYS B 1 128 ? 14.023  -70.781  -3.877  1.00 37.04  ? 172 LYS B H    1 
ATOM   8744  H HA   . LYS B 1 128 ? 14.944  -69.511  -2.462  1.00 44.11  ? 172 LYS B HA   1 
ATOM   8745  H HB2  . LYS B 1 128 ? 13.804  -67.416  -3.970  1.00 35.47  ? 172 LYS B HB2  1 
ATOM   8746  H HB3  . LYS B 1 128 ? 14.916  -67.196  -2.859  1.00 35.47  ? 172 LYS B HB3  1 
ATOM   8747  H HG2  . LYS B 1 128 ? 16.393  -68.495  -4.200  1.00 42.07  ? 172 LYS B HG2  1 
ATOM   8748  H HG3  . LYS B 1 128 ? 15.290  -68.456  -5.346  1.00 42.07  ? 172 LYS B HG3  1 
ATOM   8749  H HD2  . LYS B 1 128 ? 16.362  -66.074  -4.297  1.00 59.17  ? 172 LYS B HD2  1 
ATOM   8750  H HD3  . LYS B 1 128 ? 17.037  -66.797  -5.543  1.00 59.17  ? 172 LYS B HD3  1 
ATOM   8751  H HE2  . LYS B 1 128 ? 14.370  -65.882  -5.575  1.00 95.82  ? 172 LYS B HE2  1 
ATOM   8752  H HE3  . LYS B 1 128 ? 15.577  -65.049  -6.190  1.00 95.82  ? 172 LYS B HE3  1 
ATOM   8753  H HZ1  . LYS B 1 128 ? 14.769  -67.482  -7.144  1.00 99.36  ? 172 LYS B HZ1  1 
ATOM   8754  H HZ2  . LYS B 1 128 ? 14.513  -66.224  -7.817  1.00 99.36  ? 172 LYS B HZ2  1 
ATOM   8755  H HZ3  . LYS B 1 128 ? 15.869  -66.722  -7.704  1.00 99.36  ? 172 LYS B HZ3  1 
ATOM   8756  N N    . ILE B 1 129 ? 12.163  -69.631  -1.516  1.00 32.57  ? 173 ILE B N    1 
ATOM   8757  C CA   . ILE B 1 129 ? 11.165  -69.447  -0.472  1.00 40.51  ? 173 ILE B CA   1 
ATOM   8758  C C    . ILE B 1 129 ? 11.167  -70.694  0.398   1.00 33.98  ? 173 ILE B C    1 
ATOM   8759  O O    . ILE B 1 129 ? 11.055  -71.803  -0.128  1.00 29.47  ? 173 ILE B O    1 
ATOM   8760  C CB   . ILE B 1 129 ? 9.751   -69.205  -1.041  1.00 46.09  ? 173 ILE B CB   1 
ATOM   8761  C CG1  . ILE B 1 129 ? 9.735   -67.986  -1.967  1.00 39.78  ? 173 ILE B CG1  1 
ATOM   8762  C CG2  . ILE B 1 129 ? 8.740   -69.033  0.092   1.00 36.50  ? 173 ILE B CG2  1 
ATOM   8763  C CD1  . ILE B 1 129 ? 10.122  -66.678  -1.295  1.00 40.45  ? 173 ILE B CD1  1 
ATOM   8764  H H    . ILE B 1 129 ? 12.021  -70.326  -2.002  1.00 39.08  ? 173 ILE B H    1 
ATOM   8765  H HA   . ILE B 1 129 ? 11.409  -68.686  0.078   1.00 48.62  ? 173 ILE B HA   1 
ATOM   8766  H HB   . ILE B 1 129 ? 9.496   -69.984  -1.560  1.00 55.31  ? 173 ILE B HB   1 
ATOM   8767  H HG12 . ILE B 1 129 ? 10.359  -68.139  -2.693  1.00 47.73  ? 173 ILE B HG12 1 
ATOM   8768  H HG13 . ILE B 1 129 ? 8.839   -67.879  -2.323  1.00 47.73  ? 173 ILE B HG13 1 
ATOM   8769  H HG21 . ILE B 1 129 ? 7.861   -68.883  -0.290  1.00 43.80  ? 173 ILE B HG21 1 
ATOM   8770  H HG22 . ILE B 1 129 ? 8.733   -69.839  0.633   1.00 43.80  ? 173 ILE B HG22 1 
ATOM   8771  H HG23 . ILE B 1 129 ? 9.000   -68.272  0.634   1.00 43.80  ? 173 ILE B HG23 1 
ATOM   8772  H HD11 . ILE B 1 129 ? 10.085  -65.963  -1.950  1.00 48.54  ? 173 ILE B HD11 1 
ATOM   8773  H HD12 . ILE B 1 129 ? 9.500   -66.497  -0.573  1.00 48.54  ? 173 ILE B HD12 1 
ATOM   8774  H HD13 . ILE B 1 129 ? 11.023  -66.758  -0.943  1.00 48.54  ? 173 ILE B HD13 1 
ATOM   8775  N N    . PRO B 1 130 ? 11.282  -70.574  1.732   1.00 26.26  ? 174 PRO B N    1 
ATOM   8776  C CA   . PRO B 1 130 ? 11.496  -69.344  2.505   1.00 28.30  ? 174 PRO B CA   1 
ATOM   8777  C C    . PRO B 1 130 ? 12.967  -68.948  2.671   1.00 34.78  ? 174 PRO B C    1 
ATOM   8778  O O    . PRO B 1 130 ? 13.236  -67.917  3.286   1.00 34.90  ? 174 PRO B O    1 
ATOM   8779  C CB   . PRO B 1 130 ? 10.882  -69.684  3.862   1.00 27.49  ? 174 PRO B CB   1 
ATOM   8780  C CG   . PRO B 1 130 ? 11.038  -71.150  3.986   1.00 22.37  ? 174 PRO B CG   1 
ATOM   8781  C CD   . PRO B 1 130 ? 10.902  -71.704  2.598   1.00 29.16  ? 174 PRO B CD   1 
ATOM   8782  H HA   . PRO B 1 130 ? 11.007  -68.606  2.108   1.00 33.96  ? 174 PRO B HA   1 
ATOM   8783  H HB2  . PRO B 1 130 ? 11.367  -69.225  4.566   1.00 32.99  ? 174 PRO B HB2  1 
ATOM   8784  H HB3  . PRO B 1 130 ? 9.944   -69.436  3.870   1.00 32.99  ? 174 PRO B HB3  1 
ATOM   8785  H HG2  . PRO B 1 130 ? 11.915  -71.353  4.349   1.00 26.84  ? 174 PRO B HG2  1 
ATOM   8786  H HG3  . PRO B 1 130 ? 10.342  -71.502  4.563   1.00 26.84  ? 174 PRO B HG3  1 
ATOM   8787  H HD2  . PRO B 1 130 ? 11.513  -72.447  2.470   1.00 35.00  ? 174 PRO B HD2  1 
ATOM   8788  H HD3  . PRO B 1 130 ? 9.984   -71.966  2.428   1.00 35.00  ? 174 PRO B HD3  1 
ATOM   8789  N N    . VAL B 1 131 ? 13.894  -69.740  2.135   1.00 36.68  ? 175 VAL B N    1 
ATOM   8790  C CA   . VAL B 1 131 ? 15.324  -69.535  2.349   1.00 34.17  ? 175 VAL B CA   1 
ATOM   8791  C C    . VAL B 1 131 ? 15.917  -68.961  1.070   1.00 20.26  ? 175 VAL B C    1 
ATOM   8792  O O    . VAL B 1 131 ? 15.964  -69.637  0.036   1.00 29.28  ? 175 VAL B O    1 
ATOM   8793  C CB   . VAL B 1 131 ? 16.036  -70.832  2.753   1.00 28.39  ? 175 VAL B CB   1 
ATOM   8794  C CG1  . VAL B 1 131 ? 17.489  -70.547  3.112   1.00 32.88  ? 175 VAL B CG1  1 
ATOM   8795  C CG2  . VAL B 1 131 ? 15.315  -71.497  3.918   1.00 35.98  ? 175 VAL B CG2  1 
ATOM   8796  H H    . VAL B 1 131 ? 13.715  -70.416  1.635   1.00 44.02  ? 175 VAL B H    1 
ATOM   8797  H HA   . VAL B 1 131 ? 15.450  -68.886  3.060   1.00 41.01  ? 175 VAL B HA   1 
ATOM   8798  H HB   . VAL B 1 131 ? 16.026  -71.446  2.002   1.00 34.07  ? 175 VAL B HB   1 
ATOM   8799  H HG11 . VAL B 1 131 ? 17.921  -71.379  3.363   1.00 39.46  ? 175 VAL B HG11 1 
ATOM   8800  H HG12 . VAL B 1 131 ? 17.935  -70.162  2.341   1.00 39.46  ? 175 VAL B HG12 1 
ATOM   8801  H HG13 . VAL B 1 131 ? 17.514  -69.924  3.854   1.00 39.46  ? 175 VAL B HG13 1 
ATOM   8802  H HG21 . VAL B 1 131 ? 15.782  -72.313  4.154   1.00 43.18  ? 175 VAL B HG21 1 
ATOM   8803  H HG22 . VAL B 1 131 ? 15.308  -70.889  4.673   1.00 43.18  ? 175 VAL B HG22 1 
ATOM   8804  H HG23 . VAL B 1 131 ? 14.405  -71.703  3.649   1.00 43.18  ? 175 VAL B HG23 1 
ATOM   8805  N N    . HIS B 1 132 ? 16.391  -67.721  1.147   1.00 24.38  ? 176 HIS B N    1 
ATOM   8806  C CA   . HIS B 1 132 ? 17.010  -67.018  0.027   1.00 34.27  ? 176 HIS B CA   1 
ATOM   8807  C C    . HIS B 1 132 ? 18.519  -67.259  0.034   1.00 40.04  ? 176 HIS B C    1 
ATOM   8808  O O    . HIS B 1 132 ? 19.152  -67.126  1.089   1.00 22.89  ? 176 HIS B O    1 
ATOM   8809  C CB   . HIS B 1 132 ? 16.730  -65.525  0.116   1.00 35.66  ? 176 HIS B CB   1 
ATOM   8810  C CG   . HIS B 1 132 ? 16.930  -64.793  -1.174  1.00 35.94  ? 176 HIS B CG   1 
ATOM   8811  N ND1  . HIS B 1 132 ? 18.172  -64.404  -1.627  1.00 38.23  ? 176 HIS B ND1  1 
ATOM   8812  C CD2  . HIS B 1 132 ? 16.042  -64.376  -2.108  1.00 46.70  ? 176 HIS B CD2  1 
ATOM   8813  C CE1  . HIS B 1 132 ? 18.041  -63.782  -2.784  1.00 47.29  ? 176 HIS B CE1  1 
ATOM   8814  N NE2  . HIS B 1 132 ? 16.759  -63.753  -3.099  1.00 39.47  ? 176 HIS B NE2  1 
ATOM   8815  H H    . HIS B 1 132 ? 16.365  -67.249  1.866   1.00 29.26  ? 176 HIS B H    1 
ATOM   8816  H HA   . HIS B 1 132 ? 16.647  -67.352  -0.808  1.00 41.13  ? 176 HIS B HA   1 
ATOM   8817  H HB2  . HIS B 1 132 ? 15.808  -65.396  0.390   1.00 42.79  ? 176 HIS B HB2  1 
ATOM   8818  H HB3  . HIS B 1 132 ? 17.326  -65.134  0.774   1.00 42.79  ? 176 HIS B HB3  1 
ATOM   8819  H HD2  . HIS B 1 132 ? 15.120  -64.493  -2.084  1.00 56.04  ? 176 HIS B HD2  1 
ATOM   8820  H HE1  . HIS B 1 132 ? 18.734  -63.425  -3.292  1.00 56.75  ? 176 HIS B HE1  1 
ATOM   8821  H HE2  . HIS B 1 132 ? 16.427  -63.398  -3.809  1.00 47.37  ? 176 HIS B HE2  1 
ATOM   8822  N N    . PRO B 1 133 ? 19.137  -67.607  -1.101  1.00 30.93  ? 177 PRO B N    1 
ATOM   8823  C CA   . PRO B 1 133 ? 20.575  -67.938  -1.064  1.00 27.44  ? 177 PRO B CA   1 
ATOM   8824  C C    . PRO B 1 133 ? 21.460  -66.783  -0.624  1.00 26.18  ? 177 PRO B C    1 
ATOM   8825  O O    . PRO B 1 133 ? 22.431  -66.999  0.111   1.00 28.05  ? 177 PRO B O    1 
ATOM   8826  C CB   . PRO B 1 133 ? 20.877  -68.357  -2.511  1.00 25.83  ? 177 PRO B CB   1 
ATOM   8827  C CG   . PRO B 1 133 ? 19.558  -68.673  -3.118  1.00 32.86  ? 177 PRO B CG   1 
ATOM   8828  C CD   . PRO B 1 133 ? 18.570  -67.777  -2.449  1.00 30.19  ? 177 PRO B CD   1 
ATOM   8829  H HA   . PRO B 1 133 ? 20.727  -68.696  -0.477  1.00 32.93  ? 177 PRO B HA   1 
ATOM   8830  H HB2  . PRO B 1 133 ? 21.302  -67.622  -2.981  1.00 31.00  ? 177 PRO B HB2  1 
ATOM   8831  H HB3  . PRO B 1 133 ? 21.450  -69.140  -2.511  1.00 31.00  ? 177 PRO B HB3  1 
ATOM   8832  H HG2  . PRO B 1 133 ? 19.588  -68.496  -4.071  1.00 39.44  ? 177 PRO B HG2  1 
ATOM   8833  H HG3  . PRO B 1 133 ? 19.339  -69.604  -2.952  1.00 39.44  ? 177 PRO B HG3  1 
ATOM   8834  H HD2  . PRO B 1 133 ? 18.523  -66.924  -2.907  1.00 36.23  ? 177 PRO B HD2  1 
ATOM   8835  H HD3  . PRO B 1 133 ? 17.702  -68.206  -2.401  1.00 36.23  ? 177 PRO B HD3  1 
ATOM   8836  N N    . ASN B 1 134 ? 21.161  -65.560  -1.059  1.00 35.85  ? 178 ASN B N    1 
ATOM   8837  C CA   . ASN B 1 134 ? 21.994  -64.399  -0.756  1.00 42.63  ? 178 ASN B CA   1 
ATOM   8838  C C    . ASN B 1 134 ? 21.524  -63.619  0.464   1.00 32.69  ? 178 ASN B C    1 
ATOM   8839  O O    . ASN B 1 134 ? 22.353  -63.199  1.275   1.00 32.07  ? 178 ASN B O    1 
ATOM   8840  C CB   . ASN B 1 134 ? 22.042  -63.456  -1.962  1.00 41.73  ? 178 ASN B CB   1 
ATOM   8841  C CG   . ASN B 1 134 ? 22.791  -62.170  -1.666  1.00 60.71  ? 178 ASN B CG   1 
ATOM   8842  O OD1  . ASN B 1 134 ? 24.022  -62.135  -1.700  1.00 60.90  ? 178 ASN B OD1  1 
ATOM   8843  N ND2  . ASN B 1 134 ? 22.052  -61.107  -1.370  1.00 67.31  ? 178 ASN B ND2  1 
ATOM   8844  H H    . ASN B 1 134 ? 20.472  -65.375  -1.538  1.00 43.03  ? 178 ASN B H    1 
ATOM   8845  H HA   . ASN B 1 134 ? 22.899  -64.702  -0.582  1.00 51.16  ? 178 ASN B HA   1 
ATOM   8846  H HB2  . ASN B 1 134 ? 22.491  -63.903  -2.696  1.00 50.08  ? 178 ASN B HB2  1 
ATOM   8847  H HB3  . ASN B 1 134 ? 21.136  -63.223  -2.219  1.00 50.08  ? 178 ASN B HB3  1 
ATOM   8848  H HD21 . ASN B 1 134 ? 22.431  -60.355  -1.195  1.00 80.77  ? 178 ASN B HD21 1 
ATOM   8849  H HD22 . ASN B 1 134 ? 21.195  -61.170  -1.354  1.00 80.77  ? 178 ASN B HD22 1 
ATOM   8850  N N    . ASP B 1 135 ? 20.216  -63.407  0.616   1.00 33.77  ? 179 ASP B N    1 
ATOM   8851  C CA   . ASP B 1 135 ? 19.721  -62.584  1.716   1.00 30.38  ? 179 ASP B CA   1 
ATOM   8852  C C    . ASP B 1 135 ? 19.823  -63.301  3.058   1.00 33.87  ? 179 ASP B C    1 
ATOM   8853  O O    . ASP B 1 135 ? 19.921  -62.644  4.101   1.00 30.13  ? 179 ASP B O    1 
ATOM   8854  C CB   . ASP B 1 135 ? 18.274  -62.172  1.451   1.00 38.09  ? 179 ASP B CB   1 
ATOM   8855  C CG   . ASP B 1 135 ? 18.126  -61.338  0.192   1.00 44.06  ? 179 ASP B CG   1 
ATOM   8856  O OD1  . ASP B 1 135 ? 19.090  -60.634  -0.174  1.00 42.83  ? 179 ASP B OD1  1 
ATOM   8857  O OD2  . ASP B 1 135 ? 17.044  -61.389  -0.430  1.00 50.46  ? 179 ASP B OD2  1 
ATOM   8858  H H    . ASP B 1 135 ? 19.603  -63.724  0.102   1.00 40.52  ? 179 ASP B H    1 
ATOM   8859  H HA   . ASP B 1 135 ? 20.256  -61.777  1.769   1.00 36.46  ? 179 ASP B HA   1 
ATOM   8860  H HB2  . ASP B 1 135 ? 17.731  -62.969  1.348   1.00 45.72  ? 179 ASP B HB2  1 
ATOM   8861  H HB3  . ASP B 1 135 ? 17.952  -61.645  2.199   1.00 45.72  ? 179 ASP B HB3  1 
ATOM   8862  N N    . HIS B 1 136 ? 19.806  -64.634  3.058   1.00 32.34  ? 180 HIS B N    1 
ATOM   8863  C CA   . HIS B 1 136 ? 19.830  -65.410  4.291   1.00 33.11  ? 180 HIS B CA   1 
ATOM   8864  C C    . HIS B 1 136 ? 21.123  -66.199  4.456   1.00 32.06  ? 180 HIS B C    1 
ATOM   8865  O O    . HIS B 1 136 ? 21.818  -66.042  5.464   1.00 34.81  ? 180 HIS B O    1 
ATOM   8866  C CB   . HIS B 1 136 ? 18.618  -66.350  4.330   1.00 29.65  ? 180 HIS B CB   1 
ATOM   8867  C CG   . HIS B 1 136 ? 17.303  -65.635  4.361   1.00 38.62  ? 180 HIS B CG   1 
ATOM   8868  N ND1  . HIS B 1 136 ? 16.159  -66.154  3.795   1.00 33.46  ? 180 HIS B ND1  1 
ATOM   8869  C CD2  . HIS B 1 136 ? 16.949  -64.443  4.896   1.00 36.42  ? 180 HIS B CD2  1 
ATOM   8870  C CE1  . HIS B 1 136 ? 15.158  -65.311  3.974   1.00 35.91  ? 180 HIS B CE1  1 
ATOM   8871  N NE2  . HIS B 1 136 ? 15.611  -64.264  4.640   1.00 39.59  ? 180 HIS B NE2  1 
ATOM   8872  H H    . HIS B 1 136 ? 19.780  -65.115  2.346   1.00 38.81  ? 180 HIS B H    1 
ATOM   8873  H HA   . HIS B 1 136 ? 19.757  -64.802  5.043   1.00 39.73  ? 180 HIS B HA   1 
ATOM   8874  H HB2  . HIS B 1 136 ? 18.631  -66.911  3.539   1.00 35.58  ? 180 HIS B HB2  1 
ATOM   8875  H HB3  . HIS B 1 136 ? 18.675  -66.901  5.126   1.00 35.58  ? 180 HIS B HB3  1 
ATOM   8876  H HD2  . HIS B 1 136 ? 17.508  -63.853  5.349   1.00 43.70  ? 180 HIS B HD2  1 
ATOM   8877  H HE1  . HIS B 1 136 ? 14.284  -65.434  3.683   1.00 43.10  ? 180 HIS B HE1  1 
ATOM   8878  H HE2  . HIS B 1 136 ? 15.144  -63.582  4.877   1.00 47.51  ? 180 HIS B HE2  1 
ATOM   8879  N N    . VAL B 1 137 ? 21.472  -67.051  3.490   1.00 27.68  ? 181 VAL B N    1 
ATOM   8880  C CA   . VAL B 1 137 ? 22.648  -67.901  3.649   1.00 32.69  ? 181 VAL B CA   1 
ATOM   8881  C C    . VAL B 1 137 ? 23.924  -67.075  3.541   1.00 26.11  ? 181 VAL B C    1 
ATOM   8882  O O    . VAL B 1 137 ? 24.917  -67.350  4.226   1.00 23.33  ? 181 VAL B O    1 
ATOM   8883  C CB   . VAL B 1 137 ? 22.627  -69.046  2.621   1.00 24.11  ? 181 VAL B CB   1 
ATOM   8884  C CG1  . VAL B 1 137 ? 23.761  -70.025  2.897   1.00 23.80  ? 181 VAL B CG1  1 
ATOM   8885  C CG2  . VAL B 1 137 ? 21.282  -69.762  2.638   1.00 25.14  ? 181 VAL B CG2  1 
ATOM   8886  H H    . VAL B 1 137 ? 21.051  -67.153  2.746   1.00 33.22  ? 181 VAL B H    1 
ATOM   8887  H HA   . VAL B 1 137 ? 22.627  -68.298  4.534   1.00 39.23  ? 181 VAL B HA   1 
ATOM   8888  H HB   . VAL B 1 137 ? 22.759  -68.677  1.733   1.00 28.93  ? 181 VAL B HB   1 
ATOM   8889  H HG11 . VAL B 1 137 ? 23.730  -70.738  2.239   1.00 28.57  ? 181 VAL B HG11 1 
ATOM   8890  H HG12 . VAL B 1 137 ? 24.607  -69.554  2.835   1.00 28.57  ? 181 VAL B HG12 1 
ATOM   8891  H HG13 . VAL B 1 137 ? 23.651  -70.392  3.788   1.00 28.57  ? 181 VAL B HG13 1 
ATOM   8892  H HG21 . VAL B 1 137 ? 21.296  -70.477  1.983   1.00 30.17  ? 181 VAL B HG21 1 
ATOM   8893  H HG22 . VAL B 1 137 ? 21.131  -70.128  3.524   1.00 30.17  ? 181 VAL B HG22 1 
ATOM   8894  H HG23 . VAL B 1 137 ? 20.583  -69.126  2.419   1.00 30.17  ? 181 VAL B HG23 1 
ATOM   8895  N N    . ASN B 1 138 ? 23.924  -66.056  2.682   1.00 25.85  ? 182 ASN B N    1 
ATOM   8896  C CA   . ASN B 1 138 ? 25.080  -65.192  2.485   1.00 28.91  ? 182 ASN B CA   1 
ATOM   8897  C C    . ASN B 1 138 ? 24.976  -63.896  3.284   1.00 24.46  ? 182 ASN B C    1 
ATOM   8898  O O    . ASN B 1 138 ? 25.673  -62.924  2.973   1.00 27.54  ? 182 ASN B O    1 
ATOM   8899  C CB   . ASN B 1 138 ? 25.253  -64.885  0.996   1.00 27.15  ? 182 ASN B CB   1 
ATOM   8900  C CG   . ASN B 1 138 ? 26.699  -64.639  0.615   1.00 28.74  ? 182 ASN B CG   1 
ATOM   8901  O OD1  . ASN B 1 138 ? 27.543  -65.525  0.743   1.00 24.60  ? 182 ASN B OD1  1 
ATOM   8902  N ND2  . ASN B 1 138 ? 26.990  -63.439  0.127   1.00 29.57  ? 182 ASN B ND2  1 
ATOM   8903  H H    . ASN B 1 138 ? 23.249  -65.842  2.193   1.00 31.02  ? 182 ASN B H    1 
ATOM   8904  H HA   . ASN B 1 138 ? 25.875  -65.661  2.785   1.00 34.69  ? 182 ASN B HA   1 
ATOM   8905  H HB2  . ASN B 1 138 ? 24.930  -65.639  0.479   1.00 32.58  ? 182 ASN B HB2  1 
ATOM   8906  H HB3  . ASN B 1 138 ? 24.745  -64.089  0.776   1.00 32.58  ? 182 ASN B HB3  1 
ATOM   8907  H HD21 . ASN B 1 138 ? 27.797  -63.252  -0.104  1.00 35.48  ? 182 ASN B HD21 1 
ATOM   8908  H HD22 . ASN B 1 138 ? 26.370  -62.848  0.041   1.00 35.48  ? 182 ASN B HD22 1 
ATOM   8909  N N    . LYS B 1 139 ? 24.132  -63.872  4.314   1.00 28.71  ? 183 LYS B N    1 
ATOM   8910  C CA   . LYS B 1 139 ? 23.872  -62.648  5.062   1.00 25.90  ? 183 LYS B CA   1 
ATOM   8911  C C    . LYS B 1 139 ? 25.142  -62.136  5.732   1.00 31.41  ? 183 LYS B C    1 
ATOM   8912  O O    . LYS B 1 139 ? 25.893  -62.903  6.342   1.00 29.78  ? 183 LYS B O    1 
ATOM   8913  C CB   . LYS B 1 139 ? 22.786  -62.910  6.107   1.00 36.70  ? 183 LYS B CB   1 
ATOM   8914  C CG   . LYS B 1 139 ? 22.289  -61.677  6.839   1.00 36.83  ? 183 LYS B CG   1 
ATOM   8915  C CD   . LYS B 1 139 ? 20.932  -61.945  7.479   1.00 58.14  ? 183 LYS B CD   1 
ATOM   8916  C CE   . LYS B 1 139 ? 20.469  -60.787  8.352   1.00 53.32  ? 183 LYS B CE   1 
ATOM   8917  N NZ   . LYS B 1 139 ? 20.177  -59.561  7.560   1.00 55.47  ? 183 LYS B NZ   1 
ATOM   8918  H H    . LYS B 1 139 ? 23.696  -64.557  4.600   1.00 34.45  ? 183 LYS B H    1 
ATOM   8919  H HA   . LYS B 1 139 ? 23.551  -61.964  4.455   1.00 31.09  ? 183 LYS B HA   1 
ATOM   8920  H HB2  . LYS B 1 139 ? 22.023  -63.315  5.665   1.00 44.04  ? 183 LYS B HB2  1 
ATOM   8921  H HB3  . LYS B 1 139 ? 23.139  -63.523  6.772   1.00 44.04  ? 183 LYS B HB3  1 
ATOM   8922  H HG2  . LYS B 1 139 ? 22.917  -61.442  7.540   1.00 44.20  ? 183 LYS B HG2  1 
ATOM   8923  H HG3  . LYS B 1 139 ? 22.193  -60.945  6.210   1.00 44.20  ? 183 LYS B HG3  1 
ATOM   8924  H HD2  . LYS B 1 139 ? 20.272  -62.079  6.781   1.00 69.77  ? 183 LYS B HD2  1 
ATOM   8925  H HD3  . LYS B 1 139 ? 20.993  -62.736  8.036   1.00 69.77  ? 183 LYS B HD3  1 
ATOM   8926  H HE2  . LYS B 1 139 ? 19.658  -61.045  8.817   1.00 63.99  ? 183 LYS B HE2  1 
ATOM   8927  H HE3  . LYS B 1 139 ? 21.166  -60.574  8.991   1.00 63.99  ? 183 LYS B HE3  1 
ATOM   8928  H HZ1  . LYS B 1 139 ? 20.909  -59.298  7.127   1.00 66.56  ? 183 LYS B HZ1  1 
ATOM   8929  H HZ2  . LYS B 1 139 ? 19.534  -59.727  6.967   1.00 66.56  ? 183 LYS B HZ2  1 
ATOM   8930  H HZ3  . LYS B 1 139 ? 19.910  -58.906  8.100   1.00 66.56  ? 183 LYS B HZ3  1 
ATOM   8931  N N    . SER B 1 140 ? 25.375  -60.827  5.617   1.00 28.05  ? 184 SER B N    1 
ATOM   8932  C CA   . SER B 1 140 ? 26.520  -60.150  6.223   1.00 34.04  ? 184 SER B CA   1 
ATOM   8933  C C    . SER B 1 140 ? 27.845  -60.627  5.642   1.00 40.65  ? 184 SER B C    1 
ATOM   8934  O O    . SER B 1 140 ? 28.908  -60.390  6.228   1.00 34.31  ? 184 SER B O    1 
ATOM   8935  C CB   . SER B 1 140 ? 26.529  -60.324  7.746   1.00 43.45  ? 184 SER B CB   1 
ATOM   8936  O OG   . SER B 1 140 ? 25.354  -59.785  8.327   1.00 47.30  ? 184 SER B OG   1 
ATOM   8937  H H    . SER B 1 140 ? 24.864  -60.293  5.177   1.00 33.67  ? 184 SER B H    1 
ATOM   8938  H HA   . SER B 1 140 ? 26.448  -59.201  6.039   1.00 40.84  ? 184 SER B HA   1 
ATOM   8939  H HB2  . SER B 1 140 ? 26.579  -61.269  7.955   1.00 52.15  ? 184 SER B HB2  1 
ATOM   8940  H HB3  . SER B 1 140 ? 27.301  -59.863  8.111   1.00 52.15  ? 184 SER B HB3  1 
ATOM   8941  H HG   . SER B 1 140 ? 25.373  -59.888  9.160   1.00 56.76  ? 184 SER B HG   1 
ATOM   8942  N N    . GLN B 1 141 ? 27.802  -61.289  4.491   1.00 33.70  ? 185 GLN B N    1 
ATOM   8943  C CA   . GLN B 1 141 ? 28.980  -61.861  3.867   1.00 31.93  ? 185 GLN B CA   1 
ATOM   8944  C C    . GLN B 1 141 ? 29.178  -61.251  2.487   1.00 32.33  ? 185 GLN B C    1 
ATOM   8945  O O    . GLN B 1 141 ? 28.245  -60.727  1.871   1.00 37.86  ? 185 GLN B O    1 
ATOM   8946  C CB   . GLN B 1 141 ? 28.857  -63.386  3.752   1.00 30.29  ? 185 GLN B CB   1 
ATOM   8947  C CG   . GLN B 1 141 ? 28.704  -64.089  5.090   1.00 26.22  ? 185 GLN B CG   1 
ATOM   8948  C CD   . GLN B 1 141 ? 28.106  -65.471  4.958   1.00 33.25  ? 185 GLN B CD   1 
ATOM   8949  O OE1  . GLN B 1 141 ? 28.702  -66.364  4.355   1.00 25.46  ? 185 GLN B OE1  1 
ATOM   8950  N NE2  . GLN B 1 141 ? 26.915  -65.655  5.520   1.00 22.61  ? 185 GLN B NE2  1 
ATOM   8951  H H    . GLN B 1 141 ? 27.079  -61.421  4.044   1.00 40.45  ? 185 GLN B H    1 
ATOM   8952  H HA   . GLN B 1 141 ? 29.761  -61.658  4.405   1.00 38.31  ? 185 GLN B HA   1 
ATOM   8953  H HB2  . GLN B 1 141 ? 28.078  -63.598  3.215   1.00 36.36  ? 185 GLN B HB2  1 
ATOM   8954  H HB3  . GLN B 1 141 ? 29.656  -63.733  3.325   1.00 36.36  ? 185 GLN B HB3  1 
ATOM   8955  H HG2  . GLN B 1 141 ? 29.578  -64.178  5.502   1.00 31.47  ? 185 GLN B HG2  1 
ATOM   8956  H HG3  . GLN B 1 141 ? 28.121  -63.562  5.659   1.00 31.47  ? 185 GLN B HG3  1 
ATOM   8957  H HE21 . GLN B 1 141 ? 26.529  -65.006  5.930   1.00 27.14  ? 185 GLN B HE21 1 
ATOM   8958  H HE22 . GLN B 1 141 ? 26.532  -66.423  5.472   1.00 27.14  ? 185 GLN B HE22 1 
ATOM   8959  N N    . SER B 1 142 ? 30.412  -61.328  2.009   1.00 39.51  ? 186 SER B N    1 
ATOM   8960  C CA   . SER B 1 142 ? 30.772  -60.847  0.689   1.00 32.81  ? 186 SER B CA   1 
ATOM   8961  C C    . SER B 1 142 ? 31.226  -62.012  -0.175  1.00 30.52  ? 186 SER B C    1 
ATOM   8962  O O    . SER B 1 142 ? 31.627  -63.069  0.322   1.00 32.23  ? 186 SER B O    1 
ATOM   8963  C CB   . SER B 1 142 ? 31.892  -59.803  0.759   1.00 39.28  ? 186 SER B CB   1 
ATOM   8964  O OG   . SER B 1 142 ? 32.426  -59.534  -0.528  1.00 46.99  ? 186 SER B OG   1 
ATOM   8965  H H    . SER B 1 142 ? 31.074  -61.664  2.444   1.00 47.42  ? 186 SER B H    1 
ATOM   8966  H HA   . SER B 1 142 ? 29.997  -60.439  0.272   1.00 39.37  ? 186 SER B HA   1 
ATOM   8967  H HB2  . SER B 1 142 ? 31.534  -58.981  1.129   1.00 47.14  ? 186 SER B HB2  1 
ATOM   8968  H HB3  . SER B 1 142 ? 32.601  -60.140  1.329   1.00 47.14  ? 186 SER B HB3  1 
ATOM   8969  H HG   . SER B 1 142 ? 31.822  -59.240  -1.034  1.00 56.39  ? 186 SER B HG   1 
ATOM   8970  N N    A SER B 1 143 ? 31.161  -61.806  -1.481  0.57 41.58  ? 187 SER B N    1 
ATOM   8971  N N    B SER B 1 143 ? 31.162  -61.802  -1.480  0.43 41.55  ? 187 SER B N    1 
ATOM   8972  C CA   A SER B 1 143 ? 31.682  -62.777  -2.434  0.57 44.47  ? 187 SER B CA   1 
ATOM   8973  C CA   B SER B 1 143 ? 31.681  -62.764  -2.441  0.43 44.39  ? 187 SER B CA   1 
ATOM   8974  C C    A SER B 1 143 ? 33.212  -62.797  -2.481  0.57 45.63  ? 187 SER B C    1 
ATOM   8975  C C    B SER B 1 143 ? 33.210  -62.769  -2.502  0.43 45.55  ? 187 SER B C    1 
ATOM   8976  O O    A SER B 1 143 ? 33.767  -63.477  -3.356  0.57 52.52  ? 187 SER B O    1 
ATOM   8977  O O    B SER B 1 143 ? 33.763  -63.409  -3.408  0.43 52.36  ? 187 SER B O    1 
ATOM   8978  C CB   A SER B 1 143 ? 31.117  -62.480  -3.825  0.57 41.26  ? 187 SER B CB   1 
ATOM   8979  C CB   B SER B 1 143 ? 31.098  -62.463  -3.823  0.43 41.22  ? 187 SER B CB   1 
ATOM   8980  O OG   A SER B 1 143 ? 31.328  -61.124  -4.178  0.57 29.57  ? 187 SER B OG   1 
ATOM   8981  O OG   B SER B 1 143 ? 29.685  -62.573  -3.814  0.43 37.33  ? 187 SER B OG   1 
ATOM   8982  H H    A SER B 1 143 ? 30.817  -61.107  -1.846  0.57 49.90  ? 187 SER B H    1 
ATOM   8983  H H    B SER B 1 143 ? 30.818  -61.101  -1.840  0.43 49.86  ? 187 SER B H    1 
ATOM   8984  H HA   A SER B 1 143 ? 31.382  -63.662  -2.175  0.57 53.36  ? 187 SER B HA   1 
ATOM   8985  H HA   B SER B 1 143 ? 31.391  -63.652  -2.182  0.43 53.27  ? 187 SER B HA   1 
ATOM   8986  H HB2  A SER B 1 143 ? 31.562  -63.047  -4.474  0.57 49.52  ? 187 SER B HB2  1 
ATOM   8987  H HB2  B SER B 1 143 ? 31.343  -61.560  -4.079  0.43 49.46  ? 187 SER B HB2  1 
ATOM   8988  H HB3  A SER B 1 143 ? 30.165  -62.661  -3.824  0.57 49.52  ? 187 SER B HB3  1 
ATOM   8989  H HB3  B SER B 1 143 ? 31.460  -63.098  -4.462  0.43 49.46  ? 187 SER B HB3  1 
ATOM   8990  H HG   A SER B 1 143 ? 31.014  -60.974  -4.942  0.57 35.48  ? 187 SER B HG   1 
ATOM   8991  H HG   B SER B 1 143 ? 29.358  -62.028  -3.264  0.43 44.80  ? 187 SER B HG   1 
ATOM   8992  N N    . ASN B 1 144 ? 33.895  -62.090  -1.578  1.00 33.78  ? 188 ASN B N    1 
ATOM   8993  C CA   . ASN B 1 144 ? 35.350  -61.984  -1.611  1.00 24.71  ? 188 ASN B CA   1 
ATOM   8994  C C    . ASN B 1 144 ? 36.010  -62.427  -0.309  1.00 23.17  ? 188 ASN B C    1 
ATOM   8995  O O    . ASN B 1 144 ? 37.167  -62.858  -0.318  1.00 25.10  ? 188 ASN B O    1 
ATOM   8996  C CB   . ASN B 1 144 ? 35.762  -60.542  -1.921  1.00 22.31  ? 188 ASN B CB   1 
ATOM   8997  C CG   . ASN B 1 144 ? 35.527  -60.163  -3.369  1.00 24.47  ? 188 ASN B CG   1 
ATOM   8998  O OD1  . ASN B 1 144 ? 35.318  -61.023  -4.227  1.00 21.14  ? 188 ASN B OD1  1 
ATOM   8999  N ND2  . ASN B 1 144 ? 35.573  -58.865  -3.651  1.00 28.09  ? 188 ASN B ND2  1 
ATOM   9000  H H    A ASN B 1 144 ? 33.531  -61.657  -0.930  0.57 40.54  ? 188 ASN B H    1 
ATOM   9001  H H    B ASN B 1 144 ? 33.533  -61.677  -0.916  0.43 40.54  ? 188 ASN B H    1 
ATOM   9002  H HA   . ASN B 1 144 ? 35.689  -62.550  -2.323  1.00 29.65  ? 188 ASN B HA   1 
ATOM   9003  H HB2  . ASN B 1 144 ? 35.244  -59.939  -1.365  1.00 26.78  ? 188 ASN B HB2  1 
ATOM   9004  H HB3  . ASN B 1 144 ? 36.708  -60.437  -1.733  1.00 26.78  ? 188 ASN B HB3  1 
ATOM   9005  H HD21 . ASN B 1 144 ? 35.447  -58.596  -4.458  1.00 33.71  ? 188 ASN B HD21 1 
ATOM   9006  H HD22 . ASN B 1 144 ? 35.730  -58.295  -3.027  1.00 33.71  ? 188 ASN B HD22 1 
ATOM   9007  N N    . ASP B 1 145 ? 35.306  -62.313  0.817   1.00 25.28  ? 189 ASP B N    1 
ATOM   9008  C CA   . ASP B 1 145 ? 35.880  -62.655  2.112   1.00 20.01  ? 189 ASP B CA   1 
ATOM   9009  C C    . ASP B 1 145 ? 35.432  -64.018  2.624   1.00 18.14  ? 189 ASP B C    1 
ATOM   9010  O O    . ASP B 1 145 ? 35.883  -64.438  3.693   1.00 26.42  ? 189 ASP B O    1 
ATOM   9011  C CB   . ASP B 1 145 ? 35.536  -61.580  3.151   1.00 24.22  ? 189 ASP B CB   1 
ATOM   9012  C CG   . ASP B 1 145 ? 34.058  -61.534  3.480   1.00 23.35  ? 189 ASP B CG   1 
ATOM   9013  O OD1  . ASP B 1 145 ? 33.266  -62.200  2.780   1.00 36.19  ? 189 ASP B OD1  1 
ATOM   9014  O OD2  . ASP B 1 145 ? 33.688  -60.834  4.445   1.00 22.51  ? 189 ASP B OD2  1 
ATOM   9015  H H    . ASP B 1 145 ? 34.491  -62.039  0.855   1.00 30.33  ? 189 ASP B H    1 
ATOM   9016  H HA   . ASP B 1 145 ? 36.846  -62.679  2.024   1.00 24.02  ? 189 ASP B HA   1 
ATOM   9017  H HB2  . ASP B 1 145 ? 36.020  -61.767  3.970   1.00 29.07  ? 189 ASP B HB2  1 
ATOM   9018  H HB3  . ASP B 1 145 ? 35.793  -60.712  2.804   1.00 29.07  ? 189 ASP B HB3  1 
ATOM   9019  N N    . THR B 1 146 ? 34.569  -64.721  1.892   1.00 17.27  ? 190 THR B N    1 
ATOM   9020  C CA   . THR B 1 146 ? 34.094  -66.026  2.338   1.00 23.15  ? 190 THR B CA   1 
ATOM   9021  C C    . THR B 1 146 ? 35.011  -67.152  1.875   1.00 18.80  ? 190 THR B C    1 
ATOM   9022  O O    . THR B 1 146 ? 35.364  -68.032  2.667   1.00 18.49  ? 190 THR B O    1 
ATOM   9023  C CB   . THR B 1 146 ? 32.666  -66.275  1.842   1.00 18.01  ? 190 THR B CB   1 
ATOM   9024  O OG1  . THR B 1 146 ? 32.566  -65.937  0.454   1.00 30.43  ? 190 THR B OG1  1 
ATOM   9025  C CG2  . THR B 1 146 ? 31.674  -65.454  2.646   1.00 28.85  ? 190 THR B CG2  1 
ATOM   9026  H H    . THR B 1 146 ? 34.245  -64.465  1.138   1.00 20.72  ? 190 THR B H    1 
ATOM   9027  H HA   . THR B 1 146 ? 34.077  -66.037  3.307   1.00 27.78  ? 190 THR B HA   1 
ATOM   9028  H HB   . THR B 1 146 ? 32.448  -67.213  1.958   1.00 21.62  ? 190 THR B HB   1 
ATOM   9029  H HG1  . THR B 1 146 ? 32.758  -65.127  0.341   1.00 36.52  ? 190 THR B HG1  1 
ATOM   9030  H HG21 . THR B 1 146 ? 30.773  -65.617  2.326   1.00 34.62  ? 190 THR B HG21 1 
ATOM   9031  H HG22 . THR B 1 146 ? 31.724  -65.698  3.583   1.00 34.62  ? 190 THR B HG22 1 
ATOM   9032  H HG23 . THR B 1 146 ? 31.874  -64.509  2.555   1.00 34.62  ? 190 THR B HG23 1 
ATOM   9033  N N    . PHE B 1 147 ? 35.406  -67.144  0.604   1.00 19.12  ? 191 PHE B N    1 
ATOM   9034  C CA   . PHE B 1 147 ? 36.302  -68.189  0.114   1.00 22.67  ? 191 PHE B CA   1 
ATOM   9035  C C    . PHE B 1 147 ? 37.643  -68.170  0.832   1.00 12.53  ? 191 PHE B C    1 
ATOM   9036  O O    . PHE B 1 147 ? 38.118  -69.247  1.234   1.00 17.29  ? 191 PHE B O    1 
ATOM   9037  C CB   . PHE B 1 147 ? 36.477  -68.057  -1.402  1.00 28.10  ? 191 PHE B CB   1 
ATOM   9038  C CG   . PHE B 1 147 ? 37.092  -69.267  -2.044  1.00 23.45  ? 191 PHE B CG   1 
ATOM   9039  C CD1  . PHE B 1 147 ? 38.467  -69.397  -2.136  1.00 11.74  ? 191 PHE B CD1  1 
ATOM   9040  C CD2  . PHE B 1 147 ? 36.294  -70.280  -2.548  1.00 20.29  ? 191 PHE B CD2  1 
ATOM   9041  C CE1  . PHE B 1 147 ? 39.033  -70.510  -2.721  1.00 14.86  ? 191 PHE B CE1  1 
ATOM   9042  C CE2  . PHE B 1 147 ? 36.857  -71.397  -3.137  1.00 17.83  ? 191 PHE B CE2  1 
ATOM   9043  C CZ   . PHE B 1 147 ? 38.227  -71.512  -3.222  1.00 19.22  ? 191 PHE B CZ   1 
ATOM   9044  H H    . PHE B 1 147 ? 35.176  -66.559  0.017   1.00 22.94  ? 191 PHE B H    1 
ATOM   9045  H HA   . PHE B 1 147 ? 35.892  -69.051  0.286   1.00 27.20  ? 191 PHE B HA   1 
ATOM   9046  H HB2  . PHE B 1 147 ? 35.607  -67.915  -1.806  1.00 33.73  ? 191 PHE B HB2  1 
ATOM   9047  H HB3  . PHE B 1 147 ? 37.053  -67.298  -1.586  1.00 33.73  ? 191 PHE B HB3  1 
ATOM   9048  H HD1  . PHE B 1 147 ? 39.015  -68.726  -1.800  1.00 14.09  ? 191 PHE B HD1  1 
ATOM   9049  H HD2  . PHE B 1 147 ? 35.368  -70.207  -2.492  1.00 24.35  ? 191 PHE B HD2  1 
ATOM   9050  H HE1  . PHE B 1 147 ? 39.958  -70.585  -2.779  1.00 17.83  ? 191 PHE B HE1  1 
ATOM   9051  H HE2  . PHE B 1 147 ? 36.312  -72.071  -3.474  1.00 21.40  ? 191 PHE B HE2  1 
ATOM   9052  H HZ   . PHE B 1 147 ? 38.609  -72.262  -3.618  1.00 23.07  ? 191 PHE B HZ   1 
ATOM   9053  N N    . PRO B 1 148 ? 38.301  -67.022  1.031   1.00 18.11  ? 192 PRO B N    1 
ATOM   9054  C CA   . PRO B 1 148 ? 39.548  -67.042  1.815   1.00 16.09  ? 192 PRO B CA   1 
ATOM   9055  C C    . PRO B 1 148 ? 39.363  -67.648  3.191   1.00 14.85  ? 192 PRO B C    1 
ATOM   9056  O O    . PRO B 1 148 ? 40.240  -68.376  3.675   1.00 19.16  ? 192 PRO B O    1 
ATOM   9057  C CB   . PRO B 1 148 ? 39.944  -65.560  1.898   1.00 16.21  ? 192 PRO B CB   1 
ATOM   9058  C CG   . PRO B 1 148 ? 39.187  -64.878  0.824   1.00 27.52  ? 192 PRO B CG   1 
ATOM   9059  C CD   . PRO B 1 148 ? 37.934  -65.661  0.606   1.00 16.73  ? 192 PRO B CD   1 
ATOM   9060  H HA   . PRO B 1 148 ? 40.237  -67.531  1.339   1.00 19.31  ? 192 PRO B HA   1 
ATOM   9061  H HB2  . PRO B 1 148 ? 39.697  -65.206  2.767   1.00 19.46  ? 192 PRO B HB2  1 
ATOM   9062  H HB3  . PRO B 1 148 ? 40.899  -65.470  1.752   1.00 19.46  ? 192 PRO B HB3  1 
ATOM   9063  H HG2  . PRO B 1 148 ? 38.975  -63.974  1.105   1.00 33.02  ? 192 PRO B HG2  1 
ATOM   9064  H HG3  . PRO B 1 148 ? 39.720  -64.864  0.014   1.00 33.02  ? 192 PRO B HG3  1 
ATOM   9065  H HD2  . PRO B 1 148 ? 37.218  -65.315  1.162   1.00 20.08  ? 192 PRO B HD2  1 
ATOM   9066  H HD3  . PRO B 1 148 ? 37.690  -65.655  -0.332  1.00 20.08  ? 192 PRO B HD3  1 
ATOM   9067  N N    . THR B 1 149 ? 38.236  -67.356  3.841   1.00 19.85  ? 193 THR B N    1 
ATOM   9068  C CA   . THR B 1 149 ? 37.936  -67.971  5.128   1.00 17.58  ? 193 THR B CA   1 
ATOM   9069  C C    . THR B 1 149 ? 37.816  -69.482  4.989   1.00 13.47  ? 193 THR B C    1 
ATOM   9070  O O    . THR B 1 149 ? 38.417  -70.242  5.758   1.00 15.98  ? 193 THR B O    1 
ATOM   9071  C CB   . THR B 1 149 ? 36.645  -67.379  5.697   1.00 16.90  ? 193 THR B CB   1 
ATOM   9072  O OG1  . THR B 1 149 ? 36.792  -65.961  5.850   1.00 14.91  ? 193 THR B OG1  1 
ATOM   9073  C CG2  . THR B 1 149 ? 36.309  -67.995  7.049   1.00 22.73  ? 193 THR B CG2  1 
ATOM   9074  H H    . THR B 1 149 ? 37.635  -66.809  3.559   1.00 23.82  ? 193 THR B H    1 
ATOM   9075  H HA   . THR B 1 149 ? 38.657  -67.780  5.749   1.00 21.10  ? 193 THR B HA   1 
ATOM   9076  H HB   . THR B 1 149 ? 35.912  -67.562  5.088   1.00 20.29  ? 193 THR B HB   1 
ATOM   9077  H HG1  . THR B 1 149 ? 36.952  -65.606  5.106   1.00 17.90  ? 193 THR B HG1  1 
ATOM   9078  H HG21 . THR B 1 149 ? 35.489  -67.609  7.394   1.00 27.28  ? 193 THR B HG21 1 
ATOM   9079  H HG22 . THR B 1 149 ? 36.192  -68.954  6.955   1.00 27.28  ? 193 THR B HG22 1 
ATOM   9080  H HG23 . THR B 1 149 ? 37.028  -67.825  7.678   1.00 27.28  ? 193 THR B HG23 1 
ATOM   9081  N N    . ALA B 1 150 ? 37.043  -69.936  4.001   1.00 17.45  ? 194 ALA B N    1 
ATOM   9082  C CA   . ALA B 1 150 ? 36.817  -71.366  3.832   1.00 15.56  ? 194 ALA B CA   1 
ATOM   9083  C C    . ALA B 1 150 ? 38.124  -72.111  3.590   1.00 14.11  ? 194 ALA B C    1 
ATOM   9084  O O    . ALA B 1 150 ? 38.332  -73.204  4.130   1.00 16.93  ? 194 ALA B O    1 
ATOM   9085  C CB   . ALA B 1 150 ? 35.844  -71.608  2.679   1.00 21.67  ? 194 ALA B CB   1 
ATOM   9086  H H    . ALA B 1 150 ? 36.643  -69.441  3.423   1.00 20.94  ? 194 ALA B H    1 
ATOM   9087  H HA   . ALA B 1 150 ? 36.417  -71.720  4.641   1.00 18.68  ? 194 ALA B HA   1 
ATOM   9088  H HB1  . ALA B 1 150 ? 35.704  -72.563  2.579   1.00 26.00  ? 194 ALA B HB1  1 
ATOM   9089  H HB2  . ALA B 1 150 ? 35.002  -71.170  2.879   1.00 26.00  ? 194 ALA B HB2  1 
ATOM   9090  H HB3  . ALA B 1 150 ? 36.222  -71.242  1.864   1.00 26.00  ? 194 ALA B HB3  1 
ATOM   9091  N N    . MET B 1 151 ? 39.021  -71.541  2.782   1.00 13.12  ? 195 MET B N    1 
ATOM   9092  C CA   . MET B 1 151 ? 40.237  -72.270  2.437   1.00 23.31  ? 195 MET B CA   1 
ATOM   9093  C C    . MET B 1 151 ? 41.222  -72.302  3.600   1.00 16.70  ? 195 MET B C    1 
ATOM   9094  O O    . MET B 1 151 ? 42.022  -73.240  3.702   1.00 20.52  ? 195 MET B O    1 
ATOM   9095  C CB   . MET B 1 151 ? 40.887  -71.677  1.181   1.00 22.31  ? 195 MET B CB   1 
ATOM   9096  C CG   . MET B 1 151 ? 41.242  -70.217  1.221   1.00 22.25  ? 195 MET B CG   1 
ATOM   9097  S SD   . MET B 1 151 ? 41.829  -69.685  -0.411  1.00 23.91  ? 195 MET B SD   1 
ATOM   9098  C CE   . MET B 1 151 ? 42.779  -68.237  0.026   1.00 23.69  ? 195 MET B CE   1 
ATOM   9099  H H    . MET B 1 151 ? 38.951  -70.759  2.432   1.00 15.74  ? 195 MET B H    1 
ATOM   9100  H HA   . MET B 1 151 ? 39.990  -73.184  2.226   1.00 27.98  ? 195 MET B HA   1 
ATOM   9101  H HB2  . MET B 1 151 ? 41.707  -72.165  1.007   1.00 26.77  ? 195 MET B HB2  1 
ATOM   9102  H HB3  . MET B 1 151 ? 40.277  -71.802  0.438   1.00 26.77  ? 195 MET B HB3  1 
ATOM   9103  H HG2  . MET B 1 151 ? 40.456  -69.697  1.452   1.00 26.70  ? 195 MET B HG2  1 
ATOM   9104  H HG3  . MET B 1 151 ? 41.950  -70.071  1.868   1.00 26.70  ? 195 MET B HG3  1 
ATOM   9105  H HE1  . MET B 1 151 ? 43.155  -67.852  -0.780  1.00 28.43  ? 195 MET B HE1  1 
ATOM   9106  H HE2  . MET B 1 151 ? 42.195  -67.596  0.459   1.00 28.43  ? 195 MET B HE2  1 
ATOM   9107  H HE3  . MET B 1 151 ? 43.491  -68.498  0.631   1.00 28.43  ? 195 MET B HE3  1 
ATOM   9108  N N    . HIS B 1 152 ? 41.173  -71.311  4.495   1.00 13.93  ? 196 HIS B N    1 
ATOM   9109  C CA   . HIS B 1 152 ? 41.982  -71.385  5.710   1.00 18.61  ? 196 HIS B CA   1 
ATOM   9110  C C    . HIS B 1 152 ? 41.408  -72.400  6.692   1.00 18.55  ? 196 HIS B C    1 
ATOM   9111  O O    . HIS B 1 152 ? 42.160  -73.124  7.355   1.00 16.15  ? 196 HIS B O    1 
ATOM   9112  C CB   . HIS B 1 152 ? 42.091  -70.008  6.362   1.00 15.69  ? 196 HIS B CB   1 
ATOM   9113  C CG   . HIS B 1 152 ? 43.211  -69.174  5.823   1.00 14.86  ? 196 HIS B CG   1 
ATOM   9114  N ND1  . HIS B 1 152 ? 43.679  -68.050  6.468   1.00 14.01  ? 196 HIS B ND1  1 
ATOM   9115  C CD2  . HIS B 1 152 ? 43.960  -69.305  4.703   1.00 14.58  ? 196 HIS B CD2  1 
ATOM   9116  C CE1  . HIS B 1 152 ? 44.668  -67.523  5.769   1.00 14.25  ? 196 HIS B CE1  1 
ATOM   9117  N NE2  . HIS B 1 152 ? 44.858  -68.266  4.693   1.00 16.64  ? 196 HIS B NE2  1 
ATOM   9118  H H    . HIS B 1 152 ? 40.692  -70.602  4.423   1.00 16.72  ? 196 HIS B H    1 
ATOM   9119  H HA   . HIS B 1 152 ? 42.877  -71.674  5.473   1.00 22.33  ? 196 HIS B HA   1 
ATOM   9120  H HB2  . HIS B 1 152 ? 41.263  -69.525  6.213   1.00 18.84  ? 196 HIS B HB2  1 
ATOM   9121  H HB3  . HIS B 1 152 ? 42.238  -70.123  7.313   1.00 18.84  ? 196 HIS B HB3  1 
ATOM   9122  H HD1  . HIS B 1 152 ? 43.375  -67.740  7.210   1.00 16.82  ? 196 HIS B HD1  1 
ATOM   9123  H HD2  . HIS B 1 152 ? 43.882  -69.973  4.061   1.00 17.49  ? 196 HIS B HD2  1 
ATOM   9124  H HE1  . HIS B 1 152 ? 45.147  -66.759  5.994   1.00 17.10  ? 196 HIS B HE1  1 
ATOM   9125  N N    . ILE B 1 153 ? 40.080  -72.465  6.808   1.00 11.52  ? 197 ILE B N    1 
ATOM   9126  C CA   . ILE B 1 153 ? 39.456  -73.520  7.603   1.00 16.11  ? 197 ILE B CA   1 
ATOM   9127  C C    . ILE B 1 153 ? 39.843  -74.888  7.054   1.00 12.28  ? 197 ILE B C    1 
ATOM   9128  O O    . ILE B 1 153 ? 40.263  -75.782  7.799   1.00 13.81  ? 197 ILE B O    1 
ATOM   9129  C CB   . ILE B 1 153 ? 37.928  -73.335  7.635   1.00 15.38  ? 197 ILE B CB   1 
ATOM   9130  C CG1  . ILE B 1 153 ? 37.572  -72.081  8.433   1.00 13.31  ? 197 ILE B CG1  1 
ATOM   9131  C CG2  . ILE B 1 153 ? 37.235  -74.558  8.241   1.00 14.50  ? 197 ILE B CG2  1 
ATOM   9132  C CD1  . ILE B 1 153 ? 36.133  -71.643  8.281   1.00 21.48  ? 197 ILE B CD1  1 
ATOM   9133  H H    . ILE B 1 153 ? 39.527  -71.918  6.441   1.00 13.82  ? 197 ILE B H    1 
ATOM   9134  H HA   . ILE B 1 153 ? 39.782  -73.462  8.514   1.00 19.33  ? 197 ILE B HA   1 
ATOM   9135  H HB   . ILE B 1 153 ? 37.612  -73.220  6.725   1.00 18.46  ? 197 ILE B HB   1 
ATOM   9136  H HG12 . ILE B 1 153 ? 37.731  -72.256  9.374   1.00 15.97  ? 197 ILE B HG12 1 
ATOM   9137  H HG13 . ILE B 1 153 ? 38.137  -71.351  8.135   1.00 15.97  ? 197 ILE B HG13 1 
ATOM   9138  H HG21 . ILE B 1 153 ? 36.277  -74.408  8.245   1.00 17.40  ? 197 ILE B HG21 1 
ATOM   9139  H HG22 . ILE B 1 153 ? 37.445  -75.338  7.703   1.00 17.40  ? 197 ILE B HG22 1 
ATOM   9140  H HG23 . ILE B 1 153 ? 37.555  -74.685  9.148   1.00 17.40  ? 197 ILE B HG23 1 
ATOM   9141  H HD11 . ILE B 1 153 ? 35.988  -70.846  8.815   1.00 25.78  ? 197 ILE B HD11 1 
ATOM   9142  H HD12 . ILE B 1 153 ? 35.959  -71.451  7.347   1.00 25.78  ? 197 ILE B HD12 1 
ATOM   9143  H HD13 . ILE B 1 153 ? 35.552  -72.357  8.587   1.00 25.78  ? 197 ILE B HD13 1 
ATOM   9144  N N    . ALA B 1 154 ? 39.713  -75.070  5.739   1.00 19.39  ? 198 ALA B N    1 
ATOM   9145  C CA   . ALA B 1 154 ? 40.059  -76.350  5.131   1.00 18.82  ? 198 ALA B CA   1 
ATOM   9146  C C    . ALA B 1 154 ? 41.534  -76.675  5.330   1.00 19.51  ? 198 ALA B C    1 
ATOM   9147  O O    . ALA B 1 154 ? 41.888  -77.810  5.670   1.00 15.50  ? 198 ALA B O    1 
ATOM   9148  C CB   . ALA B 1 154 ? 39.712  -76.335  3.644   1.00 11.76  ? 198 ALA B CB   1 
ATOM   9149  H H    . ALA B 1 154 ? 39.430  -74.475  5.185   1.00 23.27  ? 198 ALA B H    1 
ATOM   9150  H HA   . ALA B 1 154 ? 39.539  -77.051  5.554   1.00 22.58  ? 198 ALA B HA   1 
ATOM   9151  H HB1  . ALA B 1 154 ? 39.948  -77.193  3.256   1.00 14.12  ? 198 ALA B HB1  1 
ATOM   9152  H HB2  . ALA B 1 154 ? 38.760  -76.178  3.544   1.00 14.12  ? 198 ALA B HB2  1 
ATOM   9153  H HB3  . ALA B 1 154 ? 40.212  -75.627  3.210   1.00 14.12  ? 198 ALA B HB3  1 
ATOM   9154  N N    . ALA B 1 155 ? 42.412  -75.693  5.121   1.00 14.58  ? 199 ALA B N    1 
ATOM   9155  C CA   . ALA B 1 155 ? 43.841  -75.930  5.296   1.00 16.32  ? 199 ALA B CA   1 
ATOM   9156  C C    . ALA B 1 155 ? 44.156  -76.359  6.725   1.00 14.33  ? 199 ALA B C    1 
ATOM   9157  O O    . ALA B 1 155 ? 44.900  -77.321  6.948   1.00 18.63  ? 199 ALA B O    1 
ATOM   9158  C CB   . ALA B 1 155 ? 44.628  -74.674  4.922   1.00 12.45  ? 199 ALA B CB   1 
ATOM   9159  H H    . ALA B 1 155 ? 42.208  -74.892  4.882   1.00 17.49  ? 199 ALA B H    1 
ATOM   9160  H HA   . ALA B 1 155 ? 44.117  -76.645  4.701   1.00 19.58  ? 199 ALA B HA   1 
ATOM   9161  H HB1  . ALA B 1 155 ? 45.574  -74.847  5.043   1.00 14.94  ? 199 ALA B HB1  1 
ATOM   9162  H HB2  . ALA B 1 155 ? 44.447  -74.453  3.994   1.00 14.94  ? 199 ALA B HB2  1 
ATOM   9163  H HB3  . ALA B 1 155 ? 44.348  -73.944  5.496   1.00 14.94  ? 199 ALA B HB3  1 
ATOM   9164  N N    . ALA B 1 156 ? 43.590  -75.658  7.710   1.00 9.73   ? 200 ALA B N    1 
ATOM   9165  C CA   . ALA B 1 156 ? 43.866  -75.985  9.106   1.00 11.99  ? 200 ALA B CA   1 
ATOM   9166  C C    . ALA B 1 156 ? 43.353  -77.374  9.464   1.00 14.04  ? 200 ALA B C    1 
ATOM   9167  O O    . ALA B 1 156 ? 44.056  -78.152  10.120  1.00 15.75  ? 200 ALA B O    1 
ATOM   9168  C CB   . ALA B 1 156 ? 43.244  -74.932  10.023  1.00 19.09  ? 200 ALA B CB   1 
ATOM   9169  H H    . ALA B 1 156 ? 43.051  -74.998  7.597   1.00 11.68  ? 200 ALA B H    1 
ATOM   9170  H HA   . ALA B 1 156 ? 44.826  -75.976  9.247   1.00 14.39  ? 200 ALA B HA   1 
ATOM   9171  H HB1  . ALA B 1 156 ? 43.437  -75.164  10.945  1.00 22.91  ? 200 ALA B HB1  1 
ATOM   9172  H HB2  . ALA B 1 156 ? 43.627  -74.065  9.813   1.00 22.91  ? 200 ALA B HB2  1 
ATOM   9173  H HB3  . ALA B 1 156 ? 42.285  -74.915  9.879   1.00 22.91  ? 200 ALA B HB3  1 
ATOM   9174  N N    . ILE B 1 157 ? 42.131  -77.705  9.044   1.00 11.20  ? 201 ILE B N    1 
ATOM   9175  C CA   . ILE B 1 157 ? 41.572  -79.021  9.346   1.00 15.44  ? 201 ILE B CA   1 
ATOM   9176  C C    . ILE B 1 157 ? 42.422  -80.118  8.715   1.00 14.90  ? 201 ILE B C    1 
ATOM   9177  O O    . ILE B 1 157 ? 42.709  -81.143  9.347   1.00 12.75  ? 201 ILE B O    1 
ATOM   9178  C CB   . ILE B 1 157 ? 40.104  -79.094  8.881   1.00 19.98  ? 201 ILE B CB   1 
ATOM   9179  C CG1  . ILE B 1 157 ? 39.234  -78.186  9.760   1.00 13.42  ? 201 ILE B CG1  1 
ATOM   9180  C CG2  . ILE B 1 157 ? 39.584  -80.531  8.921   1.00 14.04  ? 201 ILE B CG2  1 
ATOM   9181  C CD1  . ILE B 1 157 ? 37.802  -78.047  9.298   1.00 17.90  ? 201 ILE B CD1  1 
ATOM   9182  H H    . ILE B 1 157 ? 41.612  -77.192  8.588   1.00 13.44  ? 201 ILE B H    1 
ATOM   9183  H HA   . ILE B 1 157 ? 41.585  -79.152  10.307  1.00 18.53  ? 201 ILE B HA   1 
ATOM   9184  H HB   . ILE B 1 157 ? 40.054  -78.775  7.966   1.00 23.98  ? 201 ILE B HB   1 
ATOM   9185  H HG12 . ILE B 1 157 ? 39.218  -78.548  10.660  1.00 16.11  ? 201 ILE B HG12 1 
ATOM   9186  H HG13 . ILE B 1 157 ? 39.626  -77.299  9.773   1.00 16.11  ? 201 ILE B HG13 1 
ATOM   9187  H HG21 . ILE B 1 157 ? 38.661  -80.541  8.624   1.00 16.86  ? 201 ILE B HG21 1 
ATOM   9188  H HG22 . ILE B 1 157 ? 40.128  -81.079  8.334   1.00 16.86  ? 201 ILE B HG22 1 
ATOM   9189  H HG23 . ILE B 1 157 ? 39.643  -80.862  9.831   1.00 16.86  ? 201 ILE B HG23 1 
ATOM   9190  H HD11 . ILE B 1 157 ? 37.330  -77.459  9.909   1.00 21.48  ? 201 ILE B HD11 1 
ATOM   9191  H HD12 . ILE B 1 157 ? 37.795  -77.671  8.404   1.00 21.48  ? 201 ILE B HD12 1 
ATOM   9192  H HD13 . ILE B 1 157 ? 37.386  -78.923  9.293   1.00 21.48  ? 201 ILE B HD13 1 
ATOM   9193  N N    . GLU B 1 158 ? 42.846  -79.921  7.466   1.00 14.75  ? 202 GLU B N    1 
ATOM   9194  C CA   . GLU B 1 158 ? 43.615  -80.953  6.779   1.00 11.68  ? 202 GLU B CA   1 
ATOM   9195  C C    . GLU B 1 158 ? 44.984  -81.143  7.421   1.00 15.12  ? 202 GLU B C    1 
ATOM   9196  O O    . GLU B 1 158 ? 45.492  -82.268  7.490   1.00 15.28  ? 202 GLU B O    1 
ATOM   9197  C CB   . GLU B 1 158 ? 43.763  -80.598  5.300   1.00 15.46  ? 202 GLU B CB   1 
ATOM   9198  C CG   . GLU B 1 158 ? 43.955  -81.801  4.392   1.00 25.71  ? 202 GLU B CG   1 
ATOM   9199  C CD   . GLU B 1 158 ? 42.689  -82.628  4.245   1.00 23.34  ? 202 GLU B CD   1 
ATOM   9200  O OE1  . GLU B 1 158 ? 41.656  -82.253  4.842   1.00 30.76  ? 202 GLU B OE1  1 
ATOM   9201  O OE2  . GLU B 1 158 ? 42.728  -83.652  3.531   1.00 35.76  ? 202 GLU B OE2  1 
ATOM   9202  H H    . GLU B 1 158 ? 42.703  -79.211  7.003   1.00 17.70  ? 202 GLU B H    1 
ATOM   9203  H HA   . GLU B 1 158 ? 43.137  -81.795  6.838   1.00 14.02  ? 202 GLU B HA   1 
ATOM   9204  H HB2  . GLU B 1 158 ? 42.963  -80.133  5.009   1.00 18.55  ? 202 GLU B HB2  1 
ATOM   9205  H HB3  . GLU B 1 158 ? 44.535  -80.021  5.193   1.00 18.55  ? 202 GLU B HB3  1 
ATOM   9206  H HG2  . GLU B 1 158 ? 44.217  -81.493  3.510   1.00 30.85  ? 202 GLU B HG2  1 
ATOM   9207  H HG3  . GLU B 1 158 ? 44.646  -82.371  4.764   1.00 30.85  ? 202 GLU B HG3  1 
ATOM   9208  N N    . VAL B 1 159 ? 45.598  -80.055  7.891   1.00 12.23  ? 203 VAL B N    1 
ATOM   9209  C CA   . VAL B 1 159 ? 46.881  -80.163  8.581   1.00 22.28  ? 203 VAL B CA   1 
ATOM   9210  C C    . VAL B 1 159 ? 46.735  -80.984  9.857   1.00 16.40  ? 203 VAL B C    1 
ATOM   9211  O O    . VAL B 1 159 ? 47.559  -81.859  10.148  1.00 17.59  ? 203 VAL B O    1 
ATOM   9212  C CB   . VAL B 1 159 ? 47.444  -78.760  8.876   1.00 17.41  ? 203 VAL B CB   1 
ATOM   9213  C CG1  . VAL B 1 159 ? 48.560  -78.818  9.922   1.00 15.95  ? 203 VAL B CG1  1 
ATOM   9214  C CG2  . VAL B 1 159 ? 47.958  -78.124  7.597   1.00 14.67  ? 203 VAL B CG2  1 
ATOM   9215  H H    . VAL B 1 159 ? 45.296  -79.253  7.823   1.00 14.68  ? 203 VAL B H    1 
ATOM   9216  H HA   . VAL B 1 159 ? 47.510  -80.621  8.003   1.00 26.74  ? 203 VAL B HA   1 
ATOM   9217  H HB   . VAL B 1 159 ? 46.733  -78.200  9.226   1.00 20.90  ? 203 VAL B HB   1 
ATOM   9218  H HG11 . VAL B 1 159 ? 48.889  -77.919  10.081  1.00 19.14  ? 203 VAL B HG11 1 
ATOM   9219  H HG12 . VAL B 1 159 ? 48.203  -79.191  10.743  1.00 19.14  ? 203 VAL B HG12 1 
ATOM   9220  H HG13 . VAL B 1 159 ? 49.277  -79.379  9.587   1.00 19.14  ? 203 VAL B HG13 1 
ATOM   9221  H HG21 . VAL B 1 159 ? 48.309  -77.243  7.802   1.00 17.61  ? 203 VAL B HG21 1 
ATOM   9222  H HG22 . VAL B 1 159 ? 48.660  -78.683  7.228   1.00 17.61  ? 203 VAL B HG22 1 
ATOM   9223  H HG23 . VAL B 1 159 ? 47.226  -78.051  6.965   1.00 17.61  ? 203 VAL B HG23 1 
ATOM   9224  N N    . HIS B 1 160 ? 45.686  -80.720  10.636  1.00 15.23  ? 204 HIS B N    1 
ATOM   9225  C CA   . HIS B 1 160 ? 45.570  -81.329  11.956  1.00 17.76  ? 204 HIS B CA   1 
ATOM   9226  C C    . HIS B 1 160 ? 44.988  -82.736  11.909  1.00 14.96  ? 204 HIS B C    1 
ATOM   9227  O O    . HIS B 1 160 ? 45.264  -83.541  12.805  1.00 21.95  ? 204 HIS B O    1 
ATOM   9228  C CB   . HIS B 1 160 ? 44.720  -80.439  12.864  1.00 18.87  ? 204 HIS B CB   1 
ATOM   9229  C CG   . HIS B 1 160 ? 45.449  -79.236  13.372  1.00 33.71  ? 204 HIS B CG   1 
ATOM   9230  N ND1  . HIS B 1 160 ? 46.216  -79.259  14.517  1.00 48.15  ? 204 HIS B ND1  1 
ATOM   9231  C CD2  . HIS B 1 160 ? 45.541  -77.977  12.883  1.00 34.70  ? 204 HIS B CD2  1 
ATOM   9232  C CE1  . HIS B 1 160 ? 46.743  -78.065  14.716  1.00 48.77  ? 204 HIS B CE1  1 
ATOM   9233  N NE2  . HIS B 1 160 ? 46.349  -77.268  13.739  1.00 42.34  ? 204 HIS B NE2  1 
ATOM   9234  H H    . HIS B 1 160 ? 45.036  -80.197  10.426  1.00 18.28  ? 204 HIS B H    1 
ATOM   9235  H HA   . HIS B 1 160 ? 46.455  -81.390  12.348  1.00 21.32  ? 204 HIS B HA   1 
ATOM   9236  H HB2  . HIS B 1 160 ? 43.947  -80.130  12.365  1.00 22.65  ? 204 HIS B HB2  1 
ATOM   9237  H HB3  . HIS B 1 160 ? 44.431  -80.958  13.631  1.00 22.65  ? 204 HIS B HB3  1 
ATOM   9238  H HD2  . HIS B 1 160 ? 45.130  -77.652  12.115  1.00 41.65  ? 204 HIS B HD2  1 
ATOM   9239  H HE1  . HIS B 1 160 ? 47.297  -77.825  15.424  1.00 58.53  ? 204 HIS B HE1  1 
ATOM   9240  H HE2  . HIS B 1 160 ? 46.563  -76.440  13.653  1.00 50.81  ? 204 HIS B HE2  1 
ATOM   9241  N N    A GLU B 1 161 ? 44.192  -83.051  10.886  0.58 17.16  ? 205 GLU B N    1 
ATOM   9242  N N    B GLU B 1 161 ? 44.198  -83.058  10.883  0.42 17.14  ? 205 GLU B N    1 
ATOM   9243  C CA   A GLU B 1 161 ? 43.540  -84.351  10.784  0.58 19.48  ? 205 GLU B CA   1 
ATOM   9244  C CA   B GLU B 1 161 ? 43.547  -84.359  10.802  0.42 19.49  ? 205 GLU B CA   1 
ATOM   9245  C C    A GLU B 1 161 ? 44.265  -85.327  9.871   0.58 18.09  ? 205 GLU B C    1 
ATOM   9246  C C    B GLU B 1 161 ? 44.236  -85.328  9.850   0.42 18.09  ? 205 GLU B C    1 
ATOM   9247  O O    A GLU B 1 161 ? 44.155  -86.540  10.072  0.58 16.82  ? 205 GLU B O    1 
ATOM   9248  O O    B GLU B 1 161 ? 44.065  -86.542  10.004  0.42 16.89  ? 205 GLU B O    1 
ATOM   9249  C CB   A GLU B 1 161 ? 42.103  -84.184  10.277  0.58 20.11  ? 205 GLU B CB   1 
ATOM   9250  C CB   B GLU B 1 161 ? 42.085  -84.190  10.370  0.42 20.18  ? 205 GLU B CB   1 
ATOM   9251  C CG   A GLU B 1 161 ? 41.178  -83.483  11.253  0.58 24.43  ? 205 GLU B CG   1 
ATOM   9252  C CG   B GLU B 1 161 ? 41.226  -83.420  11.366  0.42 24.26  ? 205 GLU B CG   1 
ATOM   9253  C CD   A GLU B 1 161 ? 39.729  -83.534  10.814  0.58 25.90  ? 205 GLU B CD   1 
ATOM   9254  C CD   B GLU B 1 161 ? 41.010  -84.174  12.667  0.42 23.76  ? 205 GLU B CD   1 
ATOM   9255  O OE1  A GLU B 1 161 ? 39.468  -83.964  9.671   0.58 24.85  ? 205 GLU B OE1  1 
ATOM   9256  O OE1  B GLU B 1 161 ? 41.012  -85.422  12.644  0.42 30.41  ? 205 GLU B OE1  1 
ATOM   9257  O OE2  A GLU B 1 161 ? 38.852  -83.148  11.613  0.58 32.11  ? 205 GLU B OE2  1 
ATOM   9258  O OE2  B GLU B 1 161 ? 40.839  -83.516  13.714  0.42 32.64  ? 205 GLU B OE2  1 
ATOM   9259  H H    A GLU B 1 161 ? 44.015  -82.521  10.233  0.58 20.60  ? 205 GLU B H    1 
ATOM   9260  H H    B GLU B 1 161 ? 44.025  -82.537  10.222  0.42 20.57  ? 205 GLU B H    1 
ATOM   9261  H HA   A GLU B 1 161 ? 43.498  -84.748  11.668  0.58 23.38  ? 205 GLU B HA   1 
ATOM   9262  H HA   B GLU B 1 161 ? 43.550  -84.762  11.684  0.42 23.39  ? 205 GLU B HA   1 
ATOM   9263  H HB2  A GLU B 1 161 ? 42.120  -83.662  9.460   0.58 24.13  ? 205 GLU B HB2  1 
ATOM   9264  H HB2  B GLU B 1 161 ? 42.063  -83.710  9.528   0.42 24.22  ? 205 GLU B HB2  1 
ATOM   9265  H HB3  A GLU B 1 161 ? 41.733  -85.062  10.097  0.58 24.13  ? 205 GLU B HB3  1 
ATOM   9266  H HB3  B GLU B 1 161 ? 41.690  -85.069  10.257  0.42 24.22  ? 205 GLU B HB3  1 
ATOM   9267  H HG2  A GLU B 1 161 ? 41.245  -83.915  12.119  0.58 29.31  ? 205 GLU B HG2  1 
ATOM   9268  H HG2  B GLU B 1 161 ? 41.663  -82.580  11.576  0.42 29.12  ? 205 GLU B HG2  1 
ATOM   9269  H HG3  A GLU B 1 161 ? 41.438  -82.552  11.325  0.58 29.31  ? 205 GLU B HG3  1 
ATOM   9270  H HG3  B GLU B 1 161 ? 40.357  -83.252  10.969  0.42 29.12  ? 205 GLU B HG3  1 
ATOM   9271  N N    . VAL B 1 162 ? 45.004  -84.833  8.878   1.00 17.66  ? 206 VAL B N    1 
ATOM   9272  C CA   . VAL B 1 162 ? 45.619  -85.695  7.872   1.00 14.84  ? 206 VAL B CA   1 
ATOM   9273  C C    . VAL B 1 162 ? 47.137  -85.578  7.904   1.00 16.03  ? 206 VAL B C    1 
ATOM   9274  O O    . VAL B 1 162 ? 47.841  -86.582  8.043   1.00 15.79  ? 206 VAL B O    1 
ATOM   9275  C CB   . VAL B 1 162 ? 45.084  -85.363  6.467   1.00 21.13  ? 206 VAL B CB   1 
ATOM   9276  C CG1  . VAL B 1 162 ? 45.693  -86.297  5.427   1.00 14.21  ? 206 VAL B CG1  1 
ATOM   9277  C CG2  . VAL B 1 162 ? 43.568  -85.460  6.441   1.00 16.17  ? 206 VAL B CG2  1 
ATOM   9278  H H    . VAL B 1 162 ? 45.175  -83.997  8.773   1.00 21.19  ? 206 VAL B H    1 
ATOM   9279  H HA   . VAL B 1 162 ? 45.389  -86.617  8.067   1.00 17.81  ? 206 VAL B HA   1 
ATOM   9280  H HB   . VAL B 1 162 ? 45.332  -84.454  6.238   1.00 25.36  ? 206 VAL B HB   1 
ATOM   9281  H HG11 . VAL B 1 162 ? 45.341  -86.069  4.552   1.00 17.05  ? 206 VAL B HG11 1 
ATOM   9282  H HG12 . VAL B 1 162 ? 46.657  -86.191  5.434   1.00 17.05  ? 206 VAL B HG12 1 
ATOM   9283  H HG13 . VAL B 1 162 ? 45.460  -87.212  5.649   1.00 17.05  ? 206 VAL B HG13 1 
ATOM   9284  H HG21 . VAL B 1 162 ? 43.253  -85.247  5.549   1.00 19.41  ? 206 VAL B HG21 1 
ATOM   9285  H HG22 . VAL B 1 162 ? 43.305  -86.362  6.679   1.00 19.41  ? 206 VAL B HG22 1 
ATOM   9286  H HG23 . VAL B 1 162 ? 43.201  -84.829  7.080   1.00 19.41  ? 206 VAL B HG23 1 
ATOM   9287  N N    . LEU B 1 163 ? 47.655  -84.358  7.765   1.00 16.04  ? 207 LEU B N    1 
ATOM   9288  C CA   . LEU B 1 163 ? 49.088  -84.191  7.550   1.00 18.54  ? 207 LEU B CA   1 
ATOM   9289  C C    . LEU B 1 163 ? 49.884  -84.552  8.799   1.00 11.80  ? 207 LEU B C    1 
ATOM   9290  O O    . LEU B 1 163 ? 50.745  -85.439  8.768   1.00 17.44  ? 207 LEU B O    1 
ATOM   9291  C CB   . LEU B 1 163 ? 49.387  -82.757  7.111   1.00 10.56  ? 207 LEU B CB   1 
ATOM   9292  C CG   . LEU B 1 163 ? 50.860  -82.406  6.904   1.00 11.77  ? 207 LEU B CG   1 
ATOM   9293  C CD1  . LEU B 1 163 ? 51.556  -83.431  6.022   1.00 16.05  ? 207 LEU B CD1  1 
ATOM   9294  C CD2  . LEU B 1 163 ? 50.985  -81.015  6.304   1.00 11.02  ? 207 LEU B CD2  1 
ATOM   9295  H H    . LEU B 1 163 ? 47.206  -83.625  7.791   1.00 19.25  ? 207 LEU B H    1 
ATOM   9296  H HA   . LEU B 1 163 ? 49.369  -84.785  6.836   1.00 22.25  ? 207 LEU B HA   1 
ATOM   9297  H HB2  . LEU B 1 163 ? 48.931  -82.595  6.270   1.00 12.68  ? 207 LEU B HB2  1 
ATOM   9298  H HB3  . LEU B 1 163 ? 49.039  -82.154  7.786   1.00 12.68  ? 207 LEU B HB3  1 
ATOM   9299  H HG   . LEU B 1 163 ? 51.306  -82.401  7.765   1.00 14.13  ? 207 LEU B HG   1 
ATOM   9300  H HD11 . LEU B 1 163 ? 52.486  -83.174  5.915   1.00 19.26  ? 207 LEU B HD11 1 
ATOM   9301  H HD12 . LEU B 1 163 ? 51.500  -84.302  6.446   1.00 19.26  ? 207 LEU B HD12 1 
ATOM   9302  H HD13 . LEU B 1 163 ? 51.117  -83.454  5.158   1.00 19.26  ? 207 LEU B HD13 1 
ATOM   9303  H HD21 . LEU B 1 163 ? 51.924  -80.808  6.179   1.00 13.22  ? 207 LEU B HD21 1 
ATOM   9304  H HD22 . LEU B 1 163 ? 50.526  -80.997  5.450   1.00 13.22  ? 207 LEU B HD22 1 
ATOM   9305  H HD23 . LEU B 1 163 ? 50.582  -80.373  6.909   1.00 13.22  ? 207 LEU B HD23 1 
ATOM   9306  N N    . LEU B 1 164 ? 49.613  -83.870  9.915   1.00 9.85   ? 208 LEU B N    1 
ATOM   9307  C CA   . LEU B 1 164 ? 50.399  -84.118  11.124  1.00 14.52  ? 208 LEU B CA   1 
ATOM   9308  C C    . LEU B 1 164 ? 50.180  -85.525  11.662  1.00 19.27  ? 208 LEU B C    1 
ATOM   9309  O O    . LEU B 1 164 ? 51.172  -86.195  11.998  1.00 17.87  ? 208 LEU B O    1 
ATOM   9310  C CB   . LEU B 1 164 ? 50.089  -83.047  12.174  1.00 9.04   ? 208 LEU B CB   1 
ATOM   9311  C CG   . LEU B 1 164 ? 50.641  -81.652  11.878  1.00 14.65  ? 208 LEU B CG   1 
ATOM   9312  C CD1  . LEU B 1 164 ? 50.068  -80.643  12.853  1.00 17.69  ? 208 LEU B CD1  1 
ATOM   9313  C CD2  . LEU B 1 164 ? 52.163  -81.634  11.939  1.00 21.64  ? 208 LEU B CD2  1 
ATOM   9314  H H    . LEU B 1 164 ? 48.998  -83.275  9.997   1.00 11.83  ? 208 LEU B H    1 
ATOM   9315  H HA   . LEU B 1 164 ? 51.339  -84.039  10.899  1.00 17.42  ? 208 LEU B HA   1 
ATOM   9316  H HB2  . LEU B 1 164 ? 49.126  -82.967  12.255  1.00 10.85  ? 208 LEU B HB2  1 
ATOM   9317  H HB3  . LEU B 1 164 ? 50.462  -83.333  13.022  1.00 10.85  ? 208 LEU B HB3  1 
ATOM   9318  H HG   . LEU B 1 164 ? 50.374  -81.390  10.983  1.00 17.59  ? 208 LEU B HG   1 
ATOM   9319  H HD11 . LEU B 1 164 ? 50.430  -79.766  12.648  1.00 21.23  ? 208 LEU B HD11 1 
ATOM   9320  H HD12 . LEU B 1 164 ? 49.102  -80.631  12.763  1.00 21.23  ? 208 LEU B HD12 1 
ATOM   9321  H HD13 . LEU B 1 164 ? 50.313  -80.900  13.755  1.00 21.23  ? 208 LEU B HD13 1 
ATOM   9322  H HD21 . LEU B 1 164 ? 52.475  -80.736  11.746  1.00 25.97  ? 208 LEU B HD21 1 
ATOM   9323  H HD22 . LEU B 1 164 ? 52.446  -81.900  12.827  1.00 25.97  ? 208 LEU B HD22 1 
ATOM   9324  H HD23 . LEU B 1 164 ? 52.512  -82.254  11.280  1.00 25.97  ? 208 LEU B HD23 1 
ATOM   9325  N N    . PRO B 1 165 ? 48.952  -86.035  11.775  1.00 18.06  ? 209 PRO B N    1 
ATOM   9326  C CA   . PRO B 1 165 ? 48.791  -87.439  12.187  1.00 15.97  ? 209 PRO B CA   1 
ATOM   9327  C C    . PRO B 1 165 ? 49.584  -88.417  11.333  1.00 20.56  ? 209 PRO B C    1 
ATOM   9328  O O    . PRO B 1 165 ? 50.164  -89.371  11.868  1.00 16.87  ? 209 PRO B O    1 
ATOM   9329  C CB   . PRO B 1 165 ? 47.279  -87.660  12.058  1.00 17.23  ? 209 PRO B CB   1 
ATOM   9330  C CG   . PRO B 1 165 ? 46.695  -86.317  12.297  1.00 22.68  ? 209 PRO B CG   1 
ATOM   9331  C CD   . PRO B 1 165 ? 47.655  -85.341  11.678  1.00 23.82  ? 209 PRO B CD   1 
ATOM   9332  H HA   . PRO B 1 165 ? 49.050  -87.546  13.116  1.00 19.17  ? 209 PRO B HA   1 
ATOM   9333  H HB2  . PRO B 1 165 ? 47.066  -87.975  11.166  1.00 20.67  ? 209 PRO B HB2  1 
ATOM   9334  H HB3  . PRO B 1 165 ? 46.979  -88.292  12.730  1.00 20.67  ? 209 PRO B HB3  1 
ATOM   9335  H HG2  . PRO B 1 165 ? 45.826  -86.259  11.870  1.00 27.22  ? 209 PRO B HG2  1 
ATOM   9336  H HG3  . PRO B 1 165 ? 46.618  -86.161  13.252  1.00 27.22  ? 209 PRO B HG3  1 
ATOM   9337  H HD2  . PRO B 1 165 ? 47.425  -85.183  10.749  1.00 28.59  ? 209 PRO B HD2  1 
ATOM   9338  H HD3  . PRO B 1 165 ? 47.674  -84.515  12.186  1.00 28.59  ? 209 PRO B HD3  1 
ATOM   9339  N N    . GLY B 1 166 ? 49.625  -88.208  10.017  1.00 20.41  ? 210 GLY B N    1 
ATOM   9340  C CA   . GLY B 1 166 ? 50.416  -89.083  9.165   1.00 18.50  ? 210 GLY B CA   1 
ATOM   9341  C C    . GLY B 1 166 ? 51.901  -88.981  9.455   1.00 14.52  ? 210 GLY B C    1 
ATOM   9342  O O    . GLY B 1 166 ? 52.601  -89.993  9.549   1.00 14.93  ? 210 GLY B O    1 
ATOM   9343  H H    . GLY B 1 166 ? 49.211  -87.578  9.602   1.00 24.49  ? 210 GLY B H    1 
ATOM   9344  H HA2  . GLY B 1 166 ? 50.138  -90.003  9.301   1.00 22.20  ? 210 GLY B HA2  1 
ATOM   9345  H HA3  . GLY B 1 166 ? 50.267  -88.850  8.235   1.00 22.20  ? 210 GLY B HA3  1 
ATOM   9346  N N    . LEU B 1 167 ? 52.403  -87.754  9.601   1.00 12.97  ? 211 LEU B N    1 
ATOM   9347  C CA   . LEU B 1 167 ? 53.808  -87.574  9.944   1.00 16.90  ? 211 LEU B CA   1 
ATOM   9348  C C    . LEU B 1 167 ? 54.121  -88.129  11.325  1.00 17.11  ? 211 LEU B C    1 
ATOM   9349  O O    . LEU B 1 167 ? 55.218  -88.654  11.548  1.00 14.72  ? 211 LEU B O    1 
ATOM   9350  C CB   . LEU B 1 167 ? 54.179  -86.093  9.867   1.00 14.95  ? 211 LEU B CB   1 
ATOM   9351  C CG   . LEU B 1 167 ? 54.213  -85.494  8.461   1.00 14.01  ? 211 LEU B CG   1 
ATOM   9352  C CD1  . LEU B 1 167 ? 54.419  -83.987  8.523   1.00 17.27  ? 211 LEU B CD1  1 
ATOM   9353  C CD2  . LEU B 1 167 ? 55.305  -86.142  7.620   1.00 10.68  ? 211 LEU B CD2  1 
ATOM   9354  H H    . LEU B 1 167 ? 51.958  -87.024  9.509   1.00 15.57  ? 211 LEU B H    1 
ATOM   9355  H HA   . LEU B 1 167 ? 54.353  -88.052  9.299   1.00 20.28  ? 211 LEU B HA   1 
ATOM   9356  H HB2  . LEU B 1 167 ? 53.532  -85.587  10.383  1.00 17.95  ? 211 LEU B HB2  1 
ATOM   9357  H HB3  . LEU B 1 167 ? 55.062  -85.978  10.253  1.00 17.95  ? 211 LEU B HB3  1 
ATOM   9358  H HG   . LEU B 1 167 ? 53.362  -85.661  8.026   1.00 16.81  ? 211 LEU B HG   1 
ATOM   9359  H HD11 . LEU B 1 167 ? 54.436  -83.633  7.620   1.00 20.73  ? 211 LEU B HD11 1 
ATOM   9360  H HD12 . LEU B 1 167 ? 53.688  -83.589  9.020   1.00 20.73  ? 211 LEU B HD12 1 
ATOM   9361  H HD13 . LEU B 1 167 ? 55.262  -83.802  8.967   1.00 20.73  ? 211 LEU B HD13 1 
ATOM   9362  H HD21 . LEU B 1 167 ? 55.301  -85.743  6.736   1.00 12.82  ? 211 LEU B HD21 1 
ATOM   9363  H HD22 . LEU B 1 167 ? 56.162  -85.993  8.048   1.00 12.82  ? 211 LEU B HD22 1 
ATOM   9364  H HD23 . LEU B 1 167 ? 55.129  -87.094  7.554   1.00 12.82  ? 211 LEU B HD23 1 
ATOM   9365  N N    . GLN B 1 168 ? 53.175  -88.026  12.262  1.00 15.57  ? 212 GLN B N    1 
ATOM   9366  C CA   . GLN B 1 168 ? 53.408  -88.553  13.603  1.00 19.25  ? 212 GLN B CA   1 
ATOM   9367  C C    . GLN B 1 168 ? 53.572  -90.067  13.573  1.00 12.25  ? 212 GLN B C    1 
ATOM   9368  O O    . GLN B 1 168 ? 54.453  -90.615  14.245  1.00 15.43  ? 212 GLN B O    1 
ATOM   9369  C CB   . GLN B 1 168 ? 52.261  -88.159  14.532  1.00 17.54  ? 212 GLN B CB   1 
ATOM   9370  C CG   . GLN B 1 168 ? 52.477  -88.560  15.988  1.00 14.60  ? 212 GLN B CG   1 
ATOM   9371  C CD   . GLN B 1 168 ? 53.612  -87.800  16.649  1.00 18.59  ? 212 GLN B CD   1 
ATOM   9372  O OE1  . GLN B 1 168 ? 53.575  -86.574  16.749  1.00 18.79  ? 212 GLN B OE1  1 
ATOM   9373  N NE2  . GLN B 1 168 ? 54.624  -88.526  17.108  1.00 18.04  ? 212 GLN B NE2  1 
ATOM   9374  H H    . GLN B 1 168 ? 52.405  -87.661  12.148  1.00 18.68  ? 212 GLN B H    1 
ATOM   9375  H HA   . GLN B 1 168 ? 54.225  -88.169  13.956  1.00 23.11  ? 212 GLN B HA   1 
ATOM   9376  H HB2  . GLN B 1 168 ? 52.152  -87.196  14.504  1.00 21.06  ? 212 GLN B HB2  1 
ATOM   9377  H HB3  . GLN B 1 168 ? 51.448  -88.590  14.225  1.00 21.06  ? 212 GLN B HB3  1 
ATOM   9378  H HG2  . GLN B 1 168 ? 51.665  -88.380  16.488  1.00 17.52  ? 212 GLN B HG2  1 
ATOM   9379  H HG3  . GLN B 1 168 ? 52.687  -89.506  16.027  1.00 17.52  ? 212 GLN B HG3  1 
ATOM   9380  H HE21 . GLN B 1 168 ? 54.613  -89.382  17.023  1.00 21.65  ? 212 GLN B HE21 1 
ATOM   9381  H HE22 . GLN B 1 168 ? 55.291  -88.141  17.491  1.00 21.65  ? 212 GLN B HE22 1 
ATOM   9382  N N    . LYS B 1 169 ? 52.735  -90.762  12.798  1.00 18.40  ? 213 LYS B N    1 
ATOM   9383  C CA   . LYS B 1 169 ? 52.881  -92.208  12.673  1.00 16.35  ? 213 LYS B CA   1 
ATOM   9384  C C    . LYS B 1 169 ? 54.239  -92.571  12.090  1.00 17.12  ? 213 LYS B C    1 
ATOM   9385  O O    . LYS B 1 169 ? 54.895  -93.510  12.557  1.00 20.00  ? 213 LYS B O    1 
ATOM   9386  C CB   . LYS B 1 169 ? 51.763  -92.784  11.804  1.00 23.97  ? 213 LYS B CB   1 
ATOM   9387  C CG   . LYS B 1 169 ? 50.432  -92.962  12.514  1.00 30.58  ? 213 LYS B CG   1 
ATOM   9388  C CD   . LYS B 1 169 ? 49.530  -93.919  11.741  1.00 49.13  ? 213 LYS B CD   1 
ATOM   9389  C CE   . LYS B 1 169 ? 48.205  -94.150  12.451  1.00 53.34  ? 213 LYS B CE   1 
ATOM   9390  N NZ   . LYS B 1 169 ? 47.333  -92.944  12.419  1.00 67.01  ? 213 LYS B NZ   1 
ATOM   9391  H H    . LYS B 1 169 ? 52.087  -90.424  12.344  1.00 22.08  ? 213 LYS B H    1 
ATOM   9392  H HA   . LYS B 1 169 ? 52.814  -92.610  13.553  1.00 19.63  ? 213 LYS B HA   1 
ATOM   9393  H HB2  . LYS B 1 169 ? 51.617  -92.188  11.053  1.00 28.76  ? 213 LYS B HB2  1 
ATOM   9394  H HB3  . LYS B 1 169 ? 52.040  -93.655  11.479  1.00 28.76  ? 213 LYS B HB3  1 
ATOM   9395  H HG2  . LYS B 1 169 ? 50.584  -93.331  13.398  1.00 36.70  ? 213 LYS B HG2  1 
ATOM   9396  H HG3  . LYS B 1 169 ? 49.984  -92.104  12.579  1.00 36.70  ? 213 LYS B HG3  1 
ATOM   9397  H HD2  . LYS B 1 169 ? 49.342  -93.544  10.866  1.00 58.95  ? 213 LYS B HD2  1 
ATOM   9398  H HD3  . LYS B 1 169 ? 49.977  -94.775  11.650  1.00 58.95  ? 213 LYS B HD3  1 
ATOM   9399  H HE2  . LYS B 1 169 ? 47.733  -94.876  12.015  1.00 64.01  ? 213 LYS B HE2  1 
ATOM   9400  H HE3  . LYS B 1 169 ? 48.377  -94.373  13.379  1.00 64.01  ? 213 LYS B HE3  1 
ATOM   9401  H HZ1  . LYS B 1 169 ? 47.155  -92.720  11.576  1.00 80.41  ? 213 LYS B HZ1  1 
ATOM   9402  H HZ2  . LYS B 1 169 ? 46.568  -93.112  12.842  1.00 80.41  ? 213 LYS B HZ2  1 
ATOM   9403  H HZ3  . LYS B 1 169 ? 47.742  -92.263  12.819  1.00 80.41  ? 213 LYS B HZ3  1 
ATOM   9404  N N    . LEU B 1 170 ? 54.676  -91.839  11.064  1.00 17.26  ? 214 LEU B N    1 
ATOM   9405  C CA   . LEU B 1 170 ? 55.970  -92.120  10.455  1.00 15.70  ? 214 LEU B CA   1 
ATOM   9406  C C    . LEU B 1 170 ? 57.104  -91.845  11.431  1.00 17.89  ? 214 LEU B C    1 
ATOM   9407  O O    . LEU B 1 170 ? 58.052  -92.633  11.527  1.00 11.62  ? 214 LEU B O    1 
ATOM   9408  C CB   . LEU B 1 170 ? 56.137  -91.290  9.184   1.00 20.76  ? 214 LEU B CB   1 
ATOM   9409  C CG   . LEU B 1 170 ? 57.498  -91.377  8.494   1.00 12.60  ? 214 LEU B CG   1 
ATOM   9410  C CD1  . LEU B 1 170 ? 57.815  -92.811  8.098   1.00 20.83  ? 214 LEU B CD1  1 
ATOM   9411  C CD2  . LEU B 1 170 ? 57.528  -90.457  7.280   1.00 22.91  ? 214 LEU B CD2  1 
ATOM   9412  H H    . LEU B 1 170 ? 54.247  -91.185  10.708  1.00 20.72  ? 214 LEU B H    1 
ATOM   9413  H HA   . LEU B 1 170 ? 56.007  -93.057  10.209  1.00 18.85  ? 214 LEU B HA   1 
ATOM   9414  H HB2  . LEU B 1 170 ? 55.469  -91.579  8.542   1.00 24.92  ? 214 LEU B HB2  1 
ATOM   9415  H HB3  . LEU B 1 170 ? 55.986  -90.358  9.407   1.00 24.92  ? 214 LEU B HB3  1 
ATOM   9416  H HG   . LEU B 1 170 ? 58.184  -91.079  9.111   1.00 15.13  ? 214 LEU B HG   1 
ATOM   9417  H HD11 . LEU B 1 170 ? 58.682  -92.834  7.663   1.00 25.00  ? 214 LEU B HD11 1 
ATOM   9418  H HD12 . LEU B 1 170 ? 57.829  -93.363  8.896   1.00 25.00  ? 214 LEU B HD12 1 
ATOM   9419  H HD13 . LEU B 1 170 ? 57.130  -93.129  7.488   1.00 25.00  ? 214 LEU B HD13 1 
ATOM   9420  H HD21 . LEU B 1 170 ? 58.398  -90.525  6.855   1.00 27.50  ? 214 LEU B HD21 1 
ATOM   9421  H HD22 . LEU B 1 170 ? 56.834  -90.730  6.660   1.00 27.50  ? 214 LEU B HD22 1 
ATOM   9422  H HD23 . LEU B 1 170 ? 57.372  -89.545  7.572   1.00 27.50  ? 214 LEU B HD23 1 
ATOM   9423  N N    . HIS B 1 171 ? 57.026  -90.730  12.160  1.00 17.14  ? 215 HIS B N    1 
ATOM   9424  C CA   . HIS B 1 171 ? 58.027  -90.437  13.179  1.00 16.45  ? 215 HIS B CA   1 
ATOM   9425  C C    . HIS B 1 171 ? 58.129  -91.576  14.184  1.00 14.95  ? 215 HIS B C    1 
ATOM   9426  O O    . HIS B 1 171 ? 59.228  -92.041  14.506  1.00 19.74  ? 215 HIS B O    1 
ATOM   9427  C CB   . HIS B 1 171 ? 57.677  -89.129  13.888  1.00 15.41  ? 215 HIS B CB   1 
ATOM   9428  C CG   . HIS B 1 171 ? 58.464  -88.888  15.139  1.00 15.16  ? 215 HIS B CG   1 
ATOM   9429  N ND1  . HIS B 1 171 ? 58.119  -89.442  16.353  1.00 21.76  ? 215 HIS B ND1  1 
ATOM   9430  C CD2  . HIS B 1 171 ? 59.574  -88.147  15.366  1.00 17.08  ? 215 HIS B CD2  1 
ATOM   9431  C CE1  . HIS B 1 171 ? 58.985  -89.056  17.273  1.00 18.59  ? 215 HIS B CE1  1 
ATOM   9432  N NE2  . HIS B 1 171 ? 59.878  -88.269  16.700  1.00 17.99  ? 215 HIS B NE2  1 
ATOM   9433  H H    . HIS B 1 171 ? 56.410  -90.135  12.083  1.00 20.57  ? 215 HIS B H    1 
ATOM   9434  H HA   . HIS B 1 171 ? 58.892  -90.329  12.755  1.00 19.74  ? 215 HIS B HA   1 
ATOM   9435  H HB2  . HIS B 1 171 ? 57.849  -88.390  13.284  1.00 18.49  ? 215 HIS B HB2  1 
ATOM   9436  H HB3  . HIS B 1 171 ? 56.737  -89.145  14.128  1.00 18.49  ? 215 HIS B HB3  1 
ATOM   9437  H HD1  . HIS B 1 171 ? 57.446  -89.960  16.490  1.00 26.12  ? 215 HIS B HD1  1 
ATOM   9438  H HD2  . HIS B 1 171 ? 60.044  -87.650  14.736  1.00 20.49  ? 215 HIS B HD2  1 
ATOM   9439  H HE1  . HIS B 1 171 ? 58.969  -89.297  18.171  1.00 22.31  ? 215 HIS B HE1  1 
ATOM   9440  N N    . ASP B 1 172 ? 56.985  -92.045  14.686  1.00 16.66  ? 216 ASP B N    1 
ATOM   9441  C CA   . ASP B 1 172 ? 56.996  -93.072  15.720  1.00 21.35  ? 216 ASP B CA   1 
ATOM   9442  C C    . ASP B 1 172 ? 57.553  -94.388  15.189  1.00 22.26  ? 216 ASP B C    1 
ATOM   9443  O O    . ASP B 1 172 ? 58.340  -95.055  15.870  1.00 15.85  ? 216 ASP B O    1 
ATOM   9444  C CB   . ASP B 1 172 ? 55.585  -93.263  16.277  1.00 15.35  ? 216 ASP B CB   1 
ATOM   9445  C CG   . ASP B 1 172 ? 55.028  -91.994  16.901  1.00 22.13  ? 216 ASP B CG   1 
ATOM   9446  O OD1  . ASP B 1 172 ? 55.828  -91.100  17.249  1.00 24.80  ? 216 ASP B OD1  1 
ATOM   9447  O OD2  . ASP B 1 172 ? 53.792  -91.892  17.047  1.00 27.10  ? 216 ASP B OD2  1 
ATOM   9448  H H    . ASP B 1 172 ? 56.200  -91.786  14.446  1.00 19.99  ? 216 ASP B H    1 
ATOM   9449  H HA   . ASP B 1 172 ? 57.567  -92.779  16.448  1.00 25.62  ? 216 ASP B HA   1 
ATOM   9450  H HB2  . ASP B 1 172 ? 54.993  -93.528  15.556  1.00 18.43  ? 216 ASP B HB2  1 
ATOM   9451  H HB3  . ASP B 1 172 ? 55.604  -93.950  16.961  1.00 18.43  ? 216 ASP B HB3  1 
ATOM   9452  N N    . ALA B 1 173 ? 57.163  -94.777  13.973  1.00 17.43  ? 217 ALA B N    1 
ATOM   9453  C CA   . ALA B 1 173 ? 57.647  -96.034  13.413  1.00 15.69  ? 217 ALA B CA   1 
ATOM   9454  C C    . ALA B 1 173 ? 59.145  -95.981  13.141  1.00 16.97  ? 217 ALA B C    1 
ATOM   9455  O O    . ALA B 1 173 ? 59.864  -96.951  13.406  1.00 20.52  ? 217 ALA B O    1 
ATOM   9456  C CB   . ALA B 1 173 ? 56.880  -96.366  12.134  1.00 14.24  ? 217 ALA B CB   1 
ATOM   9457  H H    . ALA B 1 173 ? 56.629  -94.338  13.462  1.00 20.92  ? 217 ALA B H    1 
ATOM   9458  H HA   . ALA B 1 173 ? 57.485  -96.746  14.052  1.00 18.83  ? 217 ALA B HA   1 
ATOM   9459  H HB1  . ALA B 1 173 ? 57.213  -97.203  11.775  1.00 17.09  ? 217 ALA B HB1  1 
ATOM   9460  H HB2  . ALA B 1 173 ? 55.937  -96.448  12.345  1.00 17.09  ? 217 ALA B HB2  1 
ATOM   9461  H HB3  . ALA B 1 173 ? 57.015  -95.653  11.491  1.00 17.09  ? 217 ALA B HB3  1 
ATOM   9462  N N    . LEU B 1 174 ? 59.635  -94.859  12.609  1.00 24.02  ? 218 LEU B N    1 
ATOM   9463  C CA   . LEU B 1 174 ? 61.072  -94.706  12.412  1.00 17.20  ? 218 LEU B CA   1 
ATOM   9464  C C    . LEU B 1 174 ? 61.812  -94.741  13.742  1.00 22.69  ? 218 LEU B C    1 
ATOM   9465  O O    . LEU B 1 174 ? 62.907  -95.307  13.839  1.00 20.06  ? 218 LEU B O    1 
ATOM   9466  C CB   . LEU B 1 174 ? 61.365  -93.398  11.681  1.00 18.62  ? 218 LEU B CB   1 
ATOM   9467  C CG   . LEU B 1 174 ? 60.920  -93.316  10.222  1.00 21.97  ? 218 LEU B CG   1 
ATOM   9468  C CD1  . LEU B 1 174 ? 60.913  -91.867  9.760   1.00 22.95  ? 218 LEU B CD1  1 
ATOM   9469  C CD2  . LEU B 1 174 ? 61.830  -94.157  9.342   1.00 21.37  ? 218 LEU B CD2  1 
ATOM   9470  H H    . LEU B 1 174 ? 59.164  -94.185  12.359  1.00 28.82  ? 218 LEU B H    1 
ATOM   9471  H HA   . LEU B 1 174 ? 61.398  -95.437  11.865  1.00 20.64  ? 218 LEU B HA   1 
ATOM   9472  H HB2  . LEU B 1 174 ? 60.921  -92.678  12.157  1.00 22.35  ? 218 LEU B HB2  1 
ATOM   9473  H HB3  . LEU B 1 174 ? 62.323  -93.249  11.697  1.00 22.35  ? 218 LEU B HB3  1 
ATOM   9474  H HG   . LEU B 1 174 ? 60.017  -93.663  10.144  1.00 26.37  ? 218 LEU B HG   1 
ATOM   9475  H HD11 . LEU B 1 174 ? 60.628  -91.833  8.833   1.00 27.54  ? 218 LEU B HD11 1 
ATOM   9476  H HD12 . LEU B 1 174 ? 60.297  -91.362  10.314  1.00 27.54  ? 218 LEU B HD12 1 
ATOM   9477  H HD13 . LEU B 1 174 ? 61.808  -91.504  9.845   1.00 27.54  ? 218 LEU B HD13 1 
ATOM   9478  H HD21 . LEU B 1 174 ? 61.529  -94.090  8.423   1.00 25.65  ? 218 LEU B HD21 1 
ATOM   9479  H HD22 . LEU B 1 174 ? 62.738  -93.825  9.419   1.00 25.65  ? 218 LEU B HD22 1 
ATOM   9480  H HD23 . LEU B 1 174 ? 61.788  -95.080  9.638   1.00 25.65  ? 218 LEU B HD23 1 
ATOM   9481  N N    . ASP B 1 175 ? 61.231  -94.133  14.778  1.00 20.26  ? 219 ASP B N    1 
ATOM   9482  C CA   . ASP B 1 175 ? 61.873  -94.132  16.087  1.00 24.87  ? 219 ASP B CA   1 
ATOM   9483  C C    . ASP B 1 175 ? 61.959  -95.542  16.658  1.00 22.60  ? 219 ASP B C    1 
ATOM   9484  O O    . ASP B 1 175 ? 62.997  -95.934  17.202  1.00 15.36  ? 219 ASP B O    1 
ATOM   9485  C CB   . ASP B 1 175 ? 61.112  -93.208  17.037  1.00 30.53  ? 219 ASP B CB   1 
ATOM   9486  C CG   . ASP B 1 175 ? 61.847  -92.977  18.341  1.00 27.92  ? 219 ASP B CG   1 
ATOM   9487  O OD1  . ASP B 1 175 ? 62.953  -92.397  18.309  1.00 29.89  ? 219 ASP B OD1  1 
ATOM   9488  O OD2  . ASP B 1 175 ? 61.315  -93.371  19.398  1.00 38.39  ? 219 ASP B OD2  1 
ATOM   9489  H H    . ASP B 1 175 ? 60.477  -93.722  14.747  1.00 24.32  ? 219 ASP B H    1 
ATOM   9490  H HA   . ASP B 1 175 ? 62.776  -93.790  15.996  1.00 29.85  ? 219 ASP B HA   1 
ATOM   9491  H HB2  . ASP B 1 175 ? 60.985  -92.347  16.608  1.00 36.64  ? 219 ASP B HB2  1 
ATOM   9492  H HB3  . ASP B 1 175 ? 60.251  -93.606  17.244  1.00 36.64  ? 219 ASP B HB3  1 
ATOM   9493  N N    . ALA B 1 176 ? 60.884  -96.323  16.531  1.00 21.33  ? 220 ALA B N    1 
ATOM   9494  C CA   . ALA B 1 176 ? 60.909  -97.699  17.016  1.00 18.43  ? 220 ALA B CA   1 
ATOM   9495  C C    . ALA B 1 176 ? 61.987  -98.512  16.310  1.00 24.67  ? 220 ALA B C    1 
ATOM   9496  O O    . ALA B 1 176 ? 62.679  -99.319  16.942  1.00 20.77  ? 220 ALA B O    1 
ATOM   9497  C CB   . ALA B 1 176 ? 59.538  -98.343  16.826  1.00 10.78  ? 220 ALA B CB   1 
ATOM   9498  H H    . ALA B 1 176 ? 60.140  -96.083  16.172  1.00 25.59  ? 220 ALA B H    1 
ATOM   9499  H HA   . ALA B 1 176 ? 61.110  -97.695  17.965  1.00 22.12  ? 220 ALA B HA   1 
ATOM   9500  H HB1  . ALA B 1 176 ? 59.571  -99.256  17.152  1.00 12.94  ? 220 ALA B HB1  1 
ATOM   9501  H HB2  . ALA B 1 176 ? 58.879  -97.836  17.325  1.00 12.94  ? 220 ALA B HB2  1 
ATOM   9502  H HB3  . ALA B 1 176 ? 59.316  -98.338  15.881  1.00 12.94  ? 220 ALA B HB3  1 
ATOM   9503  N N    . LYS B 1 177 ? 62.147  -98.311  15.000  1.00 19.23  ? 221 LYS B N    1 
ATOM   9504  C CA   . LYS B 1 177 ? 63.184  -99.026  14.263  1.00 18.33  ? 221 LYS B CA   1 
ATOM   9505  C C    . LYS B 1 177 ? 64.572  -98.518  14.629  1.00 17.98  ? 221 LYS B C    1 
ATOM   9506  O O    . LYS B 1 177 ? 65.530  -99.299  14.684  1.00 25.83  ? 221 LYS B O    1 
ATOM   9507  C CB   . LYS B 1 177 ? 62.941  -98.897  12.759  1.00 20.67  ? 221 LYS B CB   1 
ATOM   9508  C CG   . LYS B 1 177 ? 61.736  -99.683  12.267  1.00 26.46  ? 221 LYS B CG   1 
ATOM   9509  C CD   . LYS B 1 177 ? 62.018  -101.182 12.240  1.00 20.23  ? 221 LYS B CD   1 
ATOM   9510  C CE   . LYS B 1 177 ? 60.738  -101.984 12.126  1.00 19.58  ? 221 LYS B CE   1 
ATOM   9511  N NZ   . LYS B 1 177 ? 60.996  -103.448 12.167  1.00 33.33  ? 221 LYS B NZ   1 
ATOM   9512  H H    . LYS B 1 177 ? 61.674  -97.774  14.523  1.00 23.08  ? 221 LYS B H    1 
ATOM   9513  H HA   . LYS B 1 177 ? 63.141  -99.967  14.492  1.00 22.00  ? 221 LYS B HA   1 
ATOM   9514  H HB2  . LYS B 1 177 ? 62.793  -97.962  12.545  1.00 24.80  ? 221 LYS B HB2  1 
ATOM   9515  H HB3  . LYS B 1 177 ? 63.722  -99.223  12.286  1.00 24.80  ? 221 LYS B HB3  1 
ATOM   9516  H HG2  . LYS B 1 177 ? 60.987  -99.526  12.863  1.00 31.75  ? 221 LYS B HG2  1 
ATOM   9517  H HG3  . LYS B 1 177 ? 61.514  -99.399  11.367  1.00 31.75  ? 221 LYS B HG3  1 
ATOM   9518  H HD2  . LYS B 1 177 ? 62.576  -101.389 11.474  1.00 24.27  ? 221 LYS B HD2  1 
ATOM   9519  H HD3  . LYS B 1 177 ? 62.466  -101.438 13.061  1.00 24.27  ? 221 LYS B HD3  1 
ATOM   9520  H HE2  . LYS B 1 177 ? 60.153  -101.759 12.867  1.00 23.49  ? 221 LYS B HE2  1 
ATOM   9521  H HE3  . LYS B 1 177 ? 60.305  -101.776 11.284  1.00 23.49  ? 221 LYS B HE3  1 
ATOM   9522  H HZ1  . LYS B 1 177 ? 60.229  -103.894 12.098  1.00 40.00  ? 221 LYS B HZ1  1 
ATOM   9523  H HZ2  . LYS B 1 177 ? 61.527  -103.682 11.492  1.00 40.00  ? 221 LYS B HZ2  1 
ATOM   9524  H HZ3  . LYS B 1 177 ? 61.390  -103.666 12.935  1.00 40.00  ? 221 LYS B HZ3  1 
ATOM   9525  N N    . SER B 1 178 ? 64.702  -97.215  14.885  1.00 15.93  ? 222 SER B N    1 
ATOM   9526  C CA   . SER B 1 178 ? 65.975  -96.679  15.353  1.00 23.61  ? 222 SER B CA   1 
ATOM   9527  C C    . SER B 1 178 ? 66.441  -97.396  16.614  1.00 31.64  ? 222 SER B C    1 
ATOM   9528  O O    . SER B 1 178 ? 67.638  -97.658  16.783  1.00 31.99  ? 222 SER B O    1 
ATOM   9529  C CB   . SER B 1 178 ? 65.849  -95.178  15.608  1.00 23.12  ? 222 SER B CB   1 
ATOM   9530  O OG   . SER B 1 178 ? 66.999  -94.674  16.265  1.00 29.49  ? 222 SER B OG   1 
ATOM   9531  H H    . SER B 1 178 ? 64.077  -96.631  14.797  1.00 19.12  ? 222 SER B H    1 
ATOM   9532  H HA   . SER B 1 178 ? 66.646  -96.813  14.665  1.00 28.34  ? 222 SER B HA   1 
ATOM   9533  H HB2  . SER B 1 178 ? 65.746  -94.721  14.759  1.00 27.75  ? 222 SER B HB2  1 
ATOM   9534  H HB3  . SER B 1 178 ? 65.072  -95.017  16.167  1.00 27.75  ? 222 SER B HB3  1 
ATOM   9535  H HG   . SER B 1 178 ? 67.681  -94.805  15.792  1.00 35.39  ? 222 SER B HG   1 
ATOM   9536  N N    . LYS B 1 179 ? 65.507  -97.725  17.509  1.00 28.04  ? 223 LYS B N    1 
ATOM   9537  C CA   . LYS B 1 179 ? 65.864  -98.414  18.745  1.00 33.20  ? 223 LYS B CA   1 
ATOM   9538  C C    . LYS B 1 179 ? 66.109  -99.897  18.501  1.00 26.67  ? 223 LYS B C    1 
ATOM   9539  O O    . LYS B 1 179 ? 67.053  -100.473 19.054  1.00 33.05  ? 223 LYS B O    1 
ATOM   9540  C CB   . LYS B 1 179 ? 64.764  -98.223  19.788  1.00 23.29  ? 223 LYS B CB   1 
ATOM   9541  C CG   . LYS B 1 179 ? 64.463  -96.764  20.103  1.00 25.35  ? 223 LYS B CG   1 
ATOM   9542  C CD   . LYS B 1 179 ? 63.514  -96.627  21.284  1.00 31.08  ? 223 LYS B CD   1 
ATOM   9543  C CE   . LYS B 1 179 ? 62.939  -95.224  21.373  1.00 33.64  ? 223 LYS B CE   1 
ATOM   9544  N NZ   . LYS B 1 179 ? 63.989  -94.170  21.285  1.00 48.42  ? 223 LYS B NZ   1 
ATOM   9545  H H    . LYS B 1 179 ? 64.668  -97.561  17.424  1.00 33.65  ? 223 LYS B H    1 
ATOM   9546  H HA   . LYS B 1 179 ? 66.682  -98.029  19.097  1.00 39.85  ? 223 LYS B HA   1 
ATOM   9547  H HB2  . LYS B 1 179 ? 63.947  -98.630  19.459  1.00 27.95  ? 223 LYS B HB2  1 
ATOM   9548  H HB3  . LYS B 1 179 ? 65.037  -98.655  20.613  1.00 27.95  ? 223 LYS B HB3  1 
ATOM   9549  H HG2  . LYS B 1 179 ? 65.290  -96.309  20.324  1.00 30.42  ? 223 LYS B HG2  1 
ATOM   9550  H HG3  . LYS B 1 179 ? 64.048  -96.350  19.330  1.00 30.42  ? 223 LYS B HG3  1 
ATOM   9551  H HD2  . LYS B 1 179 ? 62.779  -97.251  21.178  1.00 37.30  ? 223 LYS B HD2  1 
ATOM   9552  H HD3  . LYS B 1 179 ? 63.995  -96.811  22.105  1.00 37.30  ? 223 LYS B HD3  1 
ATOM   9553  H HE2  . LYS B 1 179 ? 62.317  -95.090  20.641  1.00 40.38  ? 223 LYS B HE2  1 
ATOM   9554  H HE3  . LYS B 1 179 ? 62.481  -95.122  22.222  1.00 40.38  ? 223 LYS B HE3  1 
ATOM   9555  H HZ1  . LYS B 1 179 ? 64.422  -94.236  20.510  1.00 58.11  ? 223 LYS B HZ1  1 
ATOM   9556  H HZ2  . LYS B 1 179 ? 63.616  -93.364  21.341  1.00 58.11  ? 223 LYS B HZ2  1 
ATOM   9557  H HZ3  . LYS B 1 179 ? 64.572  -94.266  21.951  1.00 58.11  ? 223 LYS B HZ3  1 
ATOM   9558  N N    . GLU B 1 180 ? 65.270  -100.528 17.678  1.00 18.22  ? 224 GLU B N    1 
ATOM   9559  C CA   . GLU B 1 180 ? 65.468  -101.933 17.343  1.00 20.39  ? 224 GLU B CA   1 
ATOM   9560  C C    . GLU B 1 180 ? 66.813  -102.163 16.663  1.00 28.06  ? 224 GLU B C    1 
ATOM   9561  O O    . GLU B 1 180 ? 67.378  -103.258 16.765  1.00 25.84  ? 224 GLU B O    1 
ATOM   9562  C CB   . GLU B 1 180 ? 64.325  -102.412 16.447  1.00 24.91  ? 224 GLU B CB   1 
ATOM   9563  C CG   . GLU B 1 180 ? 64.416  -103.871 16.017  1.00 39.09  ? 224 GLU B CG   1 
ATOM   9564  C CD   . GLU B 1 180 ? 63.306  -104.264 15.059  1.00 37.87  ? 224 GLU B CD   1 
ATOM   9565  O OE1  . GLU B 1 180 ? 62.308  -103.518 14.961  1.00 30.83  ? 224 GLU B OE1  1 
ATOM   9566  O OE2  . GLU B 1 180 ? 63.434  -105.317 14.400  1.00 43.15  ? 224 GLU B OE2  1 
ATOM   9567  H H    . GLU B 1 180 ? 64.585  -100.166 17.304  1.00 21.87  ? 224 GLU B H    1 
ATOM   9568  H HA   . GLU B 1 180 ? 65.451  -102.457 18.159  1.00 24.47  ? 224 GLU B HA   1 
ATOM   9569  H HB2  . GLU B 1 180 ? 63.489  -102.299 16.926  1.00 29.89  ? 224 GLU B HB2  1 
ATOM   9570  H HB3  . GLU B 1 180 ? 64.315  -101.870 15.642  1.00 29.89  ? 224 GLU B HB3  1 
ATOM   9571  H HG2  . GLU B 1 180 ? 65.264  -104.017 15.571  1.00 46.91  ? 224 GLU B HG2  1 
ATOM   9572  H HG3  . GLU B 1 180 ? 64.350  -104.437 16.802  1.00 46.91  ? 224 GLU B HG3  1 
ATOM   9573  N N    . PHE B 1 181 ? 67.340  -101.152 15.970  1.00 22.73  ? 225 PHE B N    1 
ATOM   9574  C CA   . PHE B 1 181 ? 68.603  -101.256 15.250  1.00 29.23  ? 225 PHE B CA   1 
ATOM   9575  C C    . PHE B 1 181 ? 69.750  -100.550 15.967  1.00 21.48  ? 225 PHE B C    1 
ATOM   9576  O O    . PHE B 1 181 ? 70.794  -100.302 15.354  1.00 25.58  ? 225 PHE B O    1 
ATOM   9577  C CB   . PHE B 1 181 ? 68.455  -100.682 13.839  1.00 24.61  ? 225 PHE B CB   1 
ATOM   9578  C CG   . PHE B 1 181 ? 67.442  -101.392 12.981  1.00 19.07  ? 225 PHE B CG   1 
ATOM   9579  C CD1  . PHE B 1 181 ? 67.039  -102.687 13.265  1.00 24.78  ? 225 PHE B CD1  1 
ATOM   9580  C CD2  . PHE B 1 181 ? 66.896  -100.756 11.875  1.00 19.64  ? 225 PHE B CD2  1 
ATOM   9581  C CE1  . PHE B 1 181 ? 66.110  -103.330 12.466  1.00 27.69  ? 225 PHE B CE1  1 
ATOM   9582  C CE2  . PHE B 1 181 ? 65.969  -101.393 11.076  1.00 19.95  ? 225 PHE B CE2  1 
ATOM   9583  C CZ   . PHE B 1 181 ? 65.575  -102.681 11.370  1.00 28.91  ? 225 PHE B CZ   1 
ATOM   9584  H H    . PHE B 1 181 ? 66.972  -100.377 15.903  1.00 27.27  ? 225 PHE B H    1 
ATOM   9585  H HA   . PHE B 1 181 ? 68.838  -102.194 15.166  1.00 35.08  ? 225 PHE B HA   1 
ATOM   9586  H HB2  . PHE B 1 181 ? 68.183  -99.753  13.908  1.00 29.53  ? 225 PHE B HB2  1 
ATOM   9587  H HB3  . PHE B 1 181 ? 69.313  -100.738 13.389  1.00 29.53  ? 225 PHE B HB3  1 
ATOM   9588  H HD1  . PHE B 1 181 ? 67.396  -103.129 14.001  1.00 29.74  ? 225 PHE B HD1  1 
ATOM   9589  H HD2  . PHE B 1 181 ? 67.158  -99.887  11.671  1.00 23.57  ? 225 PHE B HD2  1 
ATOM   9590  H HE1  . PHE B 1 181 ? 65.846  -104.199 12.666  1.00 33.23  ? 225 PHE B HE1  1 
ATOM   9591  H HE2  . PHE B 1 181 ? 65.611  -100.954 10.338  1.00 23.94  ? 225 PHE B HE2  1 
ATOM   9592  H HZ   . PHE B 1 181 ? 64.950  -103.112 10.832  1.00 34.70  ? 225 PHE B HZ   1 
ATOM   9593  N N    . ALA B 1 182 ? 69.584  -100.228 17.251  1.00 26.88  ? 226 ALA B N    1 
ATOM   9594  C CA   . ALA B 1 182 ? 70.568  -99.405  17.943  1.00 25.10  ? 226 ALA B CA   1 
ATOM   9595  C C    . ALA B 1 182 ? 71.923  -100.088 18.080  1.00 21.14  ? 226 ALA B C    1 
ATOM   9596  O O    . ALA B 1 182 ? 72.925  -99.402  18.310  1.00 25.63  ? 226 ALA B O    1 
ATOM   9597  C CB   . ALA B 1 182 ? 70.047  -99.021  19.327  1.00 19.03  ? 226 ALA B CB   1 
ATOM   9598  H H    . ALA B 1 182 ? 68.917  -100.472 17.736  1.00 32.26  ? 226 ALA B H    1 
ATOM   9599  H HA   . ALA B 1 182 ? 70.700  -98.587  17.439  1.00 30.13  ? 226 ALA B HA   1 
ATOM   9600  H HB1  . ALA B 1 182 ? 70.713  -98.475  19.774  1.00 22.84  ? 226 ALA B HB1  1 
ATOM   9601  H HB2  . ALA B 1 182 ? 69.222  -98.521  19.226  1.00 22.84  ? 226 ALA B HB2  1 
ATOM   9602  H HB3  . ALA B 1 182 ? 69.885  -99.829  19.838  1.00 22.84  ? 226 ALA B HB3  1 
ATOM   9603  N N    . GLN B 1 183 ? 71.985  -101.413 17.944  1.00 20.95  ? 227 GLN B N    1 
ATOM   9604  C CA   . GLN B 1 183 ? 73.230  -102.149 18.115  1.00 31.28  ? 227 GLN B CA   1 
ATOM   9605  C C    . GLN B 1 183 ? 73.760  -102.754 16.823  1.00 35.73  ? 227 GLN B C    1 
ATOM   9606  O O    . GLN B 1 183 ? 74.812  -103.401 16.848  1.00 29.68  ? 227 GLN B O    1 
ATOM   9607  C CB   . GLN B 1 183 ? 73.048  -103.263 19.153  1.00 29.28  ? 227 GLN B CB   1 
ATOM   9608  C CG   . GLN B 1 183 ? 72.699  -102.766 20.546  1.00 31.37  ? 227 GLN B CG   1 
ATOM   9609  C CD   . GLN B 1 183 ? 72.682  -103.882 21.570  1.00 40.93  ? 227 GLN B CD   1 
ATOM   9610  O OE1  . GLN B 1 183 ? 73.458  -104.834 21.479  1.00 83.25  ? 227 GLN B OE1  1 
ATOM   9611  N NE2  . GLN B 1 183 ? 71.789  -103.778 22.547  1.00 76.10  ? 227 GLN B NE2  1 
ATOM   9612  H H    . GLN B 1 183 ? 71.310  -101.910 17.752  1.00 25.14  ? 227 GLN B H    1 
ATOM   9613  H HA   . GLN B 1 183 ? 73.906  -101.540 18.453  1.00 37.54  ? 227 GLN B HA   1 
ATOM   9614  H HB2  . GLN B 1 183 ? 72.332  -103.847 18.860  1.00 35.14  ? 227 GLN B HB2  1 
ATOM   9615  H HB3  . GLN B 1 183 ? 73.875  -103.766 19.218  1.00 35.14  ? 227 GLN B HB3  1 
ATOM   9616  H HG2  . GLN B 1 183 ? 73.359  -102.112 20.825  1.00 37.64  ? 227 GLN B HG2  1 
ATOM   9617  H HG3  . GLN B 1 183 ? 71.818  -102.361 20.527  1.00 37.64  ? 227 GLN B HG3  1 
ATOM   9618  H HE21 . GLN B 1 183 ? 71.260  -103.101 22.576  1.00 91.32  ? 227 GLN B HE21 1 
ATOM   9619  H HE22 . GLN B 1 183 ? 71.741  -104.387 23.152  1.00 91.32  ? 227 GLN B HE22 1 
ATOM   9620  N N    . ILE B 1 184 ? 73.073  -102.568 15.700  1.00 28.38  ? 228 ILE B N    1 
ATOM   9621  C CA   . ILE B 1 184 ? 73.506  -103.135 14.428  1.00 22.85  ? 228 ILE B CA   1 
ATOM   9622  C C    . ILE B 1 184 ? 74.471  -102.147 13.783  1.00 23.34  ? 228 ILE B C    1 
ATOM   9623  O O    . ILE B 1 184 ? 74.065  -101.082 13.314  1.00 26.78  ? 228 ILE B O    1 
ATOM   9624  C CB   . ILE B 1 184 ? 72.317  -103.439 13.508  1.00 23.21  ? 228 ILE B CB   1 
ATOM   9625  C CG1  . ILE B 1 184 ? 71.350  -104.403 14.203  1.00 22.37  ? 228 ILE B CG1  1 
ATOM   9626  C CG2  . ILE B 1 184 ? 72.811  -104.033 12.191  1.00 25.45  ? 228 ILE B CG2  1 
ATOM   9627  C CD1  . ILE B 1 184 ? 70.071  -104.656 13.438  1.00 29.62  ? 228 ILE B CD1  1 
ATOM   9628  H H    . ILE B 1 184 ? 72.346  -102.113 15.649  1.00 34.05  ? 228 ILE B H    1 
ATOM   9629  H HA   . ILE B 1 184 ? 73.983  -103.964 14.592  1.00 27.42  ? 228 ILE B HA   1 
ATOM   9630  H HB   . ILE B 1 184 ? 71.849  -102.610 13.320  1.00 27.86  ? 228 ILE B HB   1 
ATOM   9631  H HG12 . ILE B 1 184 ? 71.795  -105.256 14.324  1.00 26.85  ? 228 ILE B HG12 1 
ATOM   9632  H HG13 . ILE B 1 184 ? 71.109  -104.033 15.067  1.00 26.85  ? 228 ILE B HG13 1 
ATOM   9633  H HG21 . ILE B 1 184 ? 72.046  -104.219 11.623  1.00 30.55  ? 228 ILE B HG21 1 
ATOM   9634  H HG22 . ILE B 1 184 ? 73.398  -103.395 11.758  1.00 30.55  ? 228 ILE B HG22 1 
ATOM   9635  H HG23 . ILE B 1 184 ? 73.293  -104.854 12.376  1.00 30.55  ? 228 ILE B HG23 1 
ATOM   9636  H HD11 . ILE B 1 184 ? 69.518  -105.273 13.943  1.00 35.55  ? 228 ILE B HD11 1 
ATOM   9637  H HD12 . ILE B 1 184 ? 69.603  -103.815 13.317  1.00 35.55  ? 228 ILE B HD12 1 
ATOM   9638  H HD13 . ILE B 1 184 ? 70.290  -105.039 12.574  1.00 35.55  ? 228 ILE B HD13 1 
ATOM   9639  N N    . ILE B 1 185 ? 75.748  -102.510 13.748  1.00 16.24  ? 229 ILE B N    1 
ATOM   9640  C CA   . ILE B 1 185 ? 76.791  -101.647 13.209  1.00 24.39  ? 229 ILE B CA   1 
ATOM   9641  C C    . ILE B 1 185 ? 76.953  -101.940 11.726  1.00 26.86  ? 229 ILE B C    1 
ATOM   9642  O O    . ILE B 1 185 ? 77.044  -103.102 11.313  1.00 22.39  ? 229 ILE B O    1 
ATOM   9643  C CB   . ILE B 1 185 ? 78.116  -101.851 13.961  1.00 23.19  ? 229 ILE B CB   1 
ATOM   9644  C CG1  . ILE B 1 185 ? 77.926  -101.543 15.448  1.00 24.27  ? 229 ILE B CG1  1 
ATOM   9645  C CG2  . ILE B 1 185 ? 79.211  -100.963 13.367  1.00 22.98  ? 229 ILE B CG2  1 
ATOM   9646  C CD1  . ILE B 1 185 ? 79.072  -102.000 16.317  1.00 24.65  ? 229 ILE B CD1  1 
ATOM   9647  H H    . ILE B 1 185 ? 76.041  -103.266 14.037  1.00 19.49  ? 229 ILE B H    1 
ATOM   9648  H HA   . ILE B 1 185 ? 76.523  -100.720 13.309  1.00 29.27  ? 229 ILE B HA   1 
ATOM   9649  H HB   . ILE B 1 185 ? 78.385  -102.778 13.869  1.00 27.84  ? 229 ILE B HB   1 
ATOM   9650  H HG12 . ILE B 1 185 ? 77.834  -100.584 15.560  1.00 29.12  ? 229 ILE B HG12 1 
ATOM   9651  H HG13 . ILE B 1 185 ? 77.122  -101.989 15.759  1.00 29.12  ? 229 ILE B HG13 1 
ATOM   9652  H HG21 . ILE B 1 185 ? 80.036  -101.108 13.857  1.00 27.58  ? 229 ILE B HG21 1 
ATOM   9653  H HG22 . ILE B 1 185 ? 79.335  -101.196 12.434  1.00 27.58  ? 229 ILE B HG22 1 
ATOM   9654  H HG23 . ILE B 1 185 ? 78.940  -100.034 13.443  1.00 27.58  ? 229 ILE B HG23 1 
ATOM   9655  H HD11 . ILE B 1 185 ? 78.879  -101.772 17.240  1.00 29.59  ? 229 ILE B HD11 1 
ATOM   9656  H HD12 . ILE B 1 185 ? 79.172  -102.961 16.228  1.00 29.59  ? 229 ILE B HD12 1 
ATOM   9657  H HD13 . ILE B 1 185 ? 79.884  -101.555 16.028  1.00 29.59  ? 229 ILE B HD13 1 
ATOM   9658  N N    . LYS B 1 186 ? 77.004  -100.879 10.927  1.00 19.74  ? 230 LYS B N    1 
ATOM   9659  C CA   . LYS B 1 186 ? 77.165  -100.968 9.486   1.00 18.37  ? 230 LYS B CA   1 
ATOM   9660  C C    . LYS B 1 186 ? 78.241  -99.983  9.047   1.00 16.11  ? 230 LYS B C    1 
ATOM   9661  O O    . LYS B 1 186 ? 78.717  -99.159  9.832   1.00 20.08  ? 230 LYS B O    1 
ATOM   9662  C CB   . LYS B 1 186 ? 75.837  -100.681 8.765   1.00 23.41  ? 230 LYS B CB   1 
ATOM   9663  C CG   . LYS B 1 186 ? 75.616  -99.210  8.408   1.00 28.63  ? 230 LYS B CG   1 
ATOM   9664  C CD   . LYS B 1 186 ? 74.218  -98.763  8.717   1.00 46.22  ? 230 LYS B CD   1 
ATOM   9665  C CE   . LYS B 1 186 ? 73.875  -97.518  7.924   1.00 37.41  ? 230 LYS B CE   1 
ATOM   9666  N NZ   . LYS B 1 186 ? 73.684  -97.835  6.481   1.00 26.98  ? 230 LYS B NZ   1 
ATOM   9667  H H    . LYS B 1 186 ? 76.944  -100.069 11.210  1.00 23.69  ? 230 LYS B H    1 
ATOM   9668  H HA   . LYS B 1 186 ? 77.455  -101.863 9.248   1.00 22.05  ? 230 LYS B HA   1 
ATOM   9669  H HB2  . LYS B 1 186 ? 75.815  -101.191 7.940   1.00 28.09  ? 230 LYS B HB2  1 
ATOM   9670  H HB3  . LYS B 1 186 ? 75.106  -100.957 9.340   1.00 28.09  ? 230 LYS B HB3  1 
ATOM   9671  H HG2  . LYS B 1 186 ? 76.230  -98.662  8.922   1.00 34.36  ? 230 LYS B HG2  1 
ATOM   9672  H HG3  . LYS B 1 186 ? 75.771  -99.086  7.459   1.00 34.36  ? 230 LYS B HG3  1 
ATOM   9673  H HD2  . LYS B 1 186 ? 73.593  -99.464  8.474   1.00 55.47  ? 230 LYS B HD2  1 
ATOM   9674  H HD3  . LYS B 1 186 ? 74.145  -98.556  9.662   1.00 55.47  ? 230 LYS B HD3  1 
ATOM   9675  H HE2  . LYS B 1 186 ? 73.051  -97.137  8.265   1.00 44.90  ? 230 LYS B HE2  1 
ATOM   9676  H HE3  . LYS B 1 186 ? 74.600  -96.877  8.003   1.00 44.90  ? 230 LYS B HE3  1 
ATOM   9677  H HZ1  . LYS B 1 186 ? 73.021  -98.421  6.383   1.00 32.38  ? 230 LYS B HZ1  1 
ATOM   9678  H HZ2  . LYS B 1 186 ? 73.484  -97.094  6.030   1.00 32.38  ? 230 LYS B HZ2  1 
ATOM   9679  H HZ3  . LYS B 1 186 ? 74.430  -98.185  6.145   1.00 32.38  ? 230 LYS B HZ3  1 
ATOM   9680  N N    . ILE B 1 187 ? 78.616  -100.067 7.775   1.00 18.09  ? 231 ILE B N    1 
ATOM   9681  C CA   . ILE B 1 187 ? 79.592  -99.155  7.192   1.00 20.81  ? 231 ILE B CA   1 
ATOM   9682  C C    . ILE B 1 187 ? 78.866  -97.917  6.691   1.00 25.26  ? 231 ILE B C    1 
ATOM   9683  O O    . ILE B 1 187 ? 77.911  -98.016  5.913   1.00 25.55  ? 231 ILE B O    1 
ATOM   9684  C CB   . ILE B 1 187 ? 80.374  -99.837  6.056   1.00 18.58  ? 231 ILE B CB   1 
ATOM   9685  C CG1  . ILE B 1 187 ? 81.248  -100.972 6.604   1.00 28.97  ? 231 ILE B CG1  1 
ATOM   9686  C CG2  . ILE B 1 187 ? 81.220  -98.822  5.282   1.00 20.27  ? 231 ILE B CG2  1 
ATOM   9687  C CD1  . ILE B 1 187 ? 82.324  -100.521 7.596   1.00 20.88  ? 231 ILE B CD1  1 
ATOM   9688  H H    . ILE B 1 187 ? 78.314  -100.652 7.222   1.00 21.71  ? 231 ILE B H    1 
ATOM   9689  H HA   . ILE B 1 187 ? 80.224  -98.882  7.876   1.00 24.97  ? 231 ILE B HA   1 
ATOM   9690  H HB   . ILE B 1 187 ? 79.732  -100.224 5.440   1.00 22.30  ? 231 ILE B HB   1 
ATOM   9691  H HG12 . ILE B 1 187 ? 80.678  -101.611 7.059   1.00 34.76  ? 231 ILE B HG12 1 
ATOM   9692  H HG13 . ILE B 1 187 ? 81.696  -101.405 5.861   1.00 34.76  ? 231 ILE B HG13 1 
ATOM   9693  H HG21 . ILE B 1 187 ? 81.698  -99.284  4.575   1.00 24.32  ? 231 ILE B HG21 1 
ATOM   9694  H HG22 . ILE B 1 187 ? 80.634  -98.149  4.900   1.00 24.32  ? 231 ILE B HG22 1 
ATOM   9695  H HG23 . ILE B 1 187 ? 81.850  -98.407  5.891   1.00 24.32  ? 231 ILE B HG23 1 
ATOM   9696  H HD11 . ILE B 1 187 ? 82.827  -101.297 7.890   1.00 25.06  ? 231 ILE B HD11 1 
ATOM   9697  H HD12 . ILE B 1 187 ? 82.915  -99.891  7.155   1.00 25.06  ? 231 ILE B HD12 1 
ATOM   9698  H HD13 . ILE B 1 187 ? 81.895  -100.097 8.355   1.00 25.06  ? 231 ILE B HD13 1 
ATOM   9699  N N    . GLY B 1 188 ? 79.319  -96.751  7.139   1.00 24.97  ? 232 GLY B N    1 
ATOM   9700  C CA   . GLY B 1 188 ? 78.750  -95.510  6.665   1.00 25.23  ? 232 GLY B CA   1 
ATOM   9701  C C    . GLY B 1 188 ? 79.157  -95.206  5.237   1.00 17.74  ? 232 GLY B C    1 
ATOM   9702  O O    . GLY B 1 188 ? 80.117  -95.756  4.697   1.00 22.72  ? 232 GLY B O    1 
ATOM   9703  H H    . GLY B 1 188 ? 79.951  -96.657  7.714   1.00 29.97  ? 232 GLY B H    1 
ATOM   9704  H HA2  . GLY B 1 188 ? 77.782  -95.560  6.706   1.00 30.28  ? 232 GLY B HA2  1 
ATOM   9705  H HA3  . GLY B 1 188 ? 79.045  -94.780  7.232   1.00 30.28  ? 232 GLY B HA3  1 
ATOM   9706  N N    . ARG B 1 189 ? 78.407  -94.301  4.613   1.00 14.64  ? 233 ARG B N    1 
ATOM   9707  C CA   . ARG B 1 189 ? 78.650  -93.915  3.229   1.00 17.34  ? 233 ARG B CA   1 
ATOM   9708  C C    . ARG B 1 189 ? 78.620  -92.401  3.112   1.00 18.66  ? 233 ARG B C    1 
ATOM   9709  O O    . ARG B 1 189 ? 77.600  -91.772  3.409   1.00 19.46  ? 233 ARG B O    1 
ATOM   9710  C CB   . ARG B 1 189 ? 77.619  -94.541  2.289   1.00 14.88  ? 233 ARG B CB   1 
ATOM   9711  C CG   . ARG B 1 189 ? 77.772  -96.035  2.122   1.00 20.29  ? 233 ARG B CG   1 
ATOM   9712  C CD   . ARG B 1 189 ? 76.762  -96.585  1.141   1.00 16.33  ? 233 ARG B CD   1 
ATOM   9713  N NE   . ARG B 1 189 ? 76.737  -98.045  1.155   1.00 16.88  ? 233 ARG B NE   1 
ATOM   9714  C CZ   . ARG B 1 189 ? 76.001  -98.779  1.983   1.00 18.42  ? 233 ARG B CZ   1 
ATOM   9715  N NH1  . ARG B 1 189 ? 75.214  -98.201  2.879   1.00 17.73  ? 233 ARG B NH1  1 
ATOM   9716  N NH2  . ARG B 1 189 ? 76.050  -100.100 1.915   1.00 20.07  ? 233 ARG B NH2  1 
ATOM   9717  H H    . ARG B 1 189 ? 77.743  -93.892  4.975   1.00 17.57  ? 233 ARG B H    1 
ATOM   9718  H HA   . ARG B 1 189 ? 79.531  -94.223  2.961   1.00 20.81  ? 233 ARG B HA   1 
ATOM   9719  H HB2  . ARG B 1 189 ? 76.731  -94.372  2.642   1.00 17.86  ? 233 ARG B HB2  1 
ATOM   9720  H HB3  . ARG B 1 189 ? 77.707  -94.134  1.413   1.00 17.86  ? 233 ARG B HB3  1 
ATOM   9721  H HG2  . ARG B 1 189 ? 78.661  -96.230  1.786   1.00 24.35  ? 233 ARG B HG2  1 
ATOM   9722  H HG3  . ARG B 1 189 ? 77.633  -96.469  2.978   1.00 24.35  ? 233 ARG B HG3  1 
ATOM   9723  H HD2  . ARG B 1 189 ? 75.878  -96.264  1.378   1.00 19.60  ? 233 ARG B HD2  1 
ATOM   9724  H HD3  . ARG B 1 189 ? 76.995  -96.294  0.245   1.00 19.60  ? 233 ARG B HD3  1 
ATOM   9725  H HE   . ARG B 1 189 ? 77.233  -98.458  0.587   1.00 20.26  ? 233 ARG B HE   1 
ATOM   9726  H HH11 . ARG B 1 189 ? 75.177  -97.343  2.929   1.00 21.28  ? 233 ARG B HH11 1 
ATOM   9727  H HH12 . ARG B 1 189 ? 74.741  -98.684  3.411   1.00 21.28  ? 233 ARG B HH12 1 
ATOM   9728  H HH21 . ARG B 1 189 ? 76.558  -100.482 1.336   1.00 24.09  ? 233 ARG B HH21 1 
ATOM   9729  H HH22 . ARG B 1 189 ? 75.574  -100.577 2.450   1.00 24.09  ? 233 ARG B HH22 1 
ATOM   9730  N N    . THR B 1 190 ? 79.740  -91.825  2.683   1.00 19.29  ? 234 THR B N    1 
ATOM   9731  C CA   . THR B 1 190 ? 79.840  -90.411  2.353   1.00 17.30  ? 234 THR B CA   1 
ATOM   9732  C C    . THR B 1 190 ? 80.255  -90.300  0.895   1.00 19.17  ? 234 THR B C    1 
ATOM   9733  O O    . THR B 1 190 ? 81.168  -91.005  0.452   1.00 14.54  ? 234 THR B O    1 
ATOM   9734  C CB   . THR B 1 190 ? 80.852  -89.697  3.254   1.00 15.49  ? 234 THR B CB   1 
ATOM   9735  O OG1  . THR B 1 190 ? 82.127  -90.344  3.158   1.00 23.41  ? 234 THR B OG1  1 
ATOM   9736  C CG2  . THR B 1 190 ? 80.382  -89.718  4.702   1.00 16.17  ? 234 THR B CG2  1 
ATOM   9737  H H    . THR B 1 190 ? 80.478  -92.251  2.571   1.00 23.15  ? 234 THR B H    1 
ATOM   9738  H HA   . THR B 1 190 ? 78.974  -89.988  2.462   1.00 20.77  ? 234 THR B HA   1 
ATOM   9739  H HB   . THR B 1 190 ? 80.937  -88.773  2.974   1.00 18.59  ? 234 THR B HB   1 
ATOM   9740  H HG1  . THR B 1 190 ? 82.402  -90.321  2.365   1.00 28.10  ? 234 THR B HG1  1 
ATOM   9741  H HG21 . THR B 1 190 ? 81.028  -89.264  5.266   1.00 19.41  ? 234 THR B HG21 1 
ATOM   9742  H HG22 . THR B 1 190 ? 79.526  -89.270  4.779   1.00 19.41  ? 234 THR B HG22 1 
ATOM   9743  H HG23 . THR B 1 190 ? 80.287  -90.634  5.006   1.00 19.41  ? 234 THR B HG23 1 
ATOM   9744  N N    . HIS B 1 191 ? 79.578  -89.433  0.146   1.00 18.21  ? 235 HIS B N    1 
ATOM   9745  C CA   . HIS B 1 191 ? 79.751  -89.358  -1.301  1.00 18.54  ? 235 HIS B CA   1 
ATOM   9746  C C    . HIS B 1 191 ? 79.401  -90.682  -1.979  1.00 16.71  ? 235 HIS B C    1 
ATOM   9747  O O    . HIS B 1 191 ? 79.780  -90.910  -3.132  1.00 19.58  ? 235 HIS B O    1 
ATOM   9748  C CB   . HIS B 1 191 ? 81.186  -88.954  -1.671  1.00 18.41  ? 235 HIS B CB   1 
ATOM   9749  C CG   . HIS B 1 191 ? 81.712  -87.780  -0.902  1.00 22.66  ? 235 HIS B CG   1 
ATOM   9750  N ND1  . HIS B 1 191 ? 81.674  -86.492  -1.391  1.00 17.06  ? 235 HIS B ND1  1 
ATOM   9751  C CD2  . HIS B 1 191 ? 82.310  -87.702  0.310   1.00 24.73  ? 235 HIS B CD2  1 
ATOM   9752  C CE1  . HIS B 1 191 ? 82.212  -85.670  -0.509  1.00 17.41  ? 235 HIS B CE1  1 
ATOM   9753  N NE2  . HIS B 1 191 ? 82.607  -86.379  0.532   1.00 23.03  ? 235 HIS B NE2  1 
ATOM   9754  H H    . HIS B 1 191 ? 79.006  -88.871  0.457   1.00 21.85  ? 235 HIS B H    1 
ATOM   9755  H HA   . HIS B 1 191 ? 79.153  -88.679  -1.651  1.00 22.24  ? 235 HIS B HA   1 
ATOM   9756  H HB2  . HIS B 1 191 ? 81.774  -89.706  -1.502  1.00 22.10  ? 235 HIS B HB2  1 
ATOM   9757  H HB3  . HIS B 1 191 ? 81.211  -88.724  -2.614  1.00 22.10  ? 235 HIS B HB3  1 
ATOM   9758  H HD1  . HIS B 1 191 ? 81.344  -86.259  -2.151  1.00 20.48  ? 235 HIS B HD1  1 
ATOM   9759  H HD2  . HIS B 1 191 ? 82.481  -88.411  0.888   1.00 29.67  ? 235 HIS B HD2  1 
ATOM   9760  H HE1  . HIS B 1 191 ? 82.300  -84.749  -0.606  1.00 20.90  ? 235 HIS B HE1  1 
ATOM   9761  N N    . THR B 1 192 ? 78.676  -91.555  -1.276  1.00 15.81  ? 236 THR B N    1 
ATOM   9762  C CA   . THR B 1 192 ? 78.417  -92.954  -1.623  1.00 19.56  ? 236 THR B CA   1 
ATOM   9763  C C    . THR B 1 192 ? 79.650  -93.838  -1.465  1.00 22.25  ? 236 THR B C    1 
ATOM   9764  O O    . THR B 1 192 ? 79.565  -95.044  -1.728  1.00 18.22  ? 236 THR B O    1 
ATOM   9765  C CB   . THR B 1 192 ? 77.876  -93.140  -3.051  1.00 17.89  ? 236 THR B CB   1 
ATOM   9766  O OG1  . THR B 1 192 ? 78.928  -92.961  -4.008  1.00 27.28  ? 236 THR B OG1  1 
ATOM   9767  C CG2  . THR B 1 192 ? 76.735  -92.170  -3.338  1.00 23.64  ? 236 THR B CG2  1 
ATOM   9768  H H    . THR B 1 192 ? 78.296  -91.337  -0.535  1.00 18.97  ? 236 THR B H    1 
ATOM   9769  H HA   . THR B 1 192 ? 77.741  -93.294  -1.015  1.00 23.47  ? 236 THR B HA   1 
ATOM   9770  H HB   . THR B 1 192 ? 77.526  -94.041  -3.137  1.00 21.47  ? 236 THR B HB   1 
ATOM   9771  H HG1  . THR B 1 192 ? 79.251  -92.189  -3.940  1.00 32.74  ? 236 THR B HG1  1 
ATOM   9772  H HG21 . THR B 1 192 ? 76.407  -92.302  -4.241  1.00 28.37  ? 236 THR B HG21 1 
ATOM   9773  H HG22 . THR B 1 192 ? 76.008  -92.320  -2.714  1.00 28.37  ? 236 THR B HG22 1 
ATOM   9774  H HG23 . THR B 1 192 ? 77.046  -91.256  -3.246  1.00 28.37  ? 236 THR B HG23 1 
ATOM   9775  N N    . GLN B 1 193 ? 80.786  -93.290  -1.044  1.00 21.97  ? 237 GLN B N    1 
ATOM   9776  C CA   . GLN B 1 193 ? 81.984  -94.078  -0.800  1.00 16.63  ? 237 GLN B CA   1 
ATOM   9777  C C    . GLN B 1 193 ? 81.982  -94.618  0.625   1.00 17.18  ? 237 GLN B C    1 
ATOM   9778  O O    . GLN B 1 193 ? 81.383  -94.032  1.529   1.00 16.97  ? 237 GLN B O    1 
ATOM   9779  C CB   . GLN B 1 193 ? 83.238  -93.234  -1.034  1.00 20.05  ? 237 GLN B CB   1 
ATOM   9780  C CG   . GLN B 1 193 ? 83.449  -92.836  -2.483  1.00 15.43  ? 237 GLN B CG   1 
ATOM   9781  C CD   . GLN B 1 193 ? 83.760  -94.027  -3.368  1.00 18.14  ? 237 GLN B CD   1 
ATOM   9782  O OE1  . GLN B 1 193 ? 82.994  -94.365  -4.271  1.00 22.89  ? 237 GLN B OE1  1 
ATOM   9783  N NE2  . GLN B 1 193 ? 84.893  -94.671  -3.111  1.00 22.16  ? 237 GLN B NE2  1 
ATOM   9784  H H    . GLN B 1 193 ? 80.887  -92.450  -0.890  1.00 26.37  ? 237 GLN B H    1 
ATOM   9785  H HA   . GLN B 1 193 ? 82.004  -94.830  -1.411  1.00 19.96  ? 237 GLN B HA   1 
ATOM   9786  H HB2  . GLN B 1 193 ? 83.169  -92.420  -0.510  1.00 24.06  ? 237 GLN B HB2  1 
ATOM   9787  H HB3  . GLN B 1 193 ? 84.014  -93.742  -0.751  1.00 24.06  ? 237 GLN B HB3  1 
ATOM   9788  H HG2  . GLN B 1 193 ? 82.641  -92.415  -2.817  1.00 18.52  ? 237 GLN B HG2  1 
ATOM   9789  H HG3  . GLN B 1 193 ? 84.194  -92.217  -2.537  1.00 18.52  ? 237 GLN B HG3  1 
ATOM   9790  H HE21 . GLN B 1 193 ? 85.403  -94.406  -2.472  1.00 26.59  ? 237 GLN B HE21 1 
ATOM   9791  H HE22 . GLN B 1 193 ? 85.116  -95.354  -3.584  1.00 26.59  ? 237 GLN B HE22 1 
ATOM   9792  N N    . ASP B 1 194 ? 82.661  -95.748  0.814   1.00 22.70  ? 238 ASP B N    1 
ATOM   9793  C CA   . ASP B 1 194 ? 82.764  -96.349  2.138   1.00 20.01  ? 238 ASP B CA   1 
ATOM   9794  C C    . ASP B 1 194 ? 83.328  -95.346  3.136   1.00 21.33  ? 238 ASP B C    1 
ATOM   9795  O O    . ASP B 1 194 ? 84.247  -94.583  2.825   1.00 20.35  ? 238 ASP B O    1 
ATOM   9796  C CB   . ASP B 1 194 ? 83.652  -97.593  2.090   1.00 22.86  ? 238 ASP B CB   1 
ATOM   9797  C CG   . ASP B 1 194 ? 83.082  -98.683  1.203   1.00 31.19  ? 238 ASP B CG   1 
ATOM   9798  O OD1  . ASP B 1 194 ? 81.967  -98.499  0.672   1.00 27.82  ? 238 ASP B OD1  1 
ATOM   9799  O OD2  . ASP B 1 194 ? 83.751  -99.725  1.034   1.00 27.34  ? 238 ASP B OD2  1 
ATOM   9800  H H    . ASP B 1 194 ? 83.068  -96.184  0.194   1.00 27.25  ? 238 ASP B H    1 
ATOM   9801  H HA   . ASP B 1 194 ? 81.881  -96.615  2.439   1.00 24.02  ? 238 ASP B HA   1 
ATOM   9802  H HB2  . ASP B 1 194 ? 84.523  -97.347  1.742   1.00 27.44  ? 238 ASP B HB2  1 
ATOM   9803  H HB3  . ASP B 1 194 ? 83.742  -97.952  2.987   1.00 27.44  ? 238 ASP B HB3  1 
ATOM   9804  N N    . ALA B 1 195 ? 82.772  -95.354  4.347   1.00 20.51  ? 239 ALA B N    1 
ATOM   9805  C CA   . ALA B 1 195 ? 83.163  -94.418  5.392   1.00 21.16  ? 239 ALA B CA   1 
ATOM   9806  C C    . ALA B 1 195 ? 83.176  -95.145  6.731   1.00 25.13  ? 239 ALA B C    1 
ATOM   9807  O O    . ALA B 1 195 ? 82.834  -96.327  6.825   1.00 20.14  ? 239 ALA B O    1 
ATOM   9808  C CB   . ALA B 1 195 ? 82.220  -93.210  5.434   1.00 20.62  ? 239 ALA B CB   1 
ATOM   9809  H H    . ALA B 1 195 ? 82.157  -95.903  4.589   1.00 24.61  ? 239 ALA B H    1 
ATOM   9810  H HA   . ALA B 1 195 ? 84.060  -94.096  5.213   1.00 25.39  ? 239 ALA B HA   1 
ATOM   9811  H HB1  . ALA B 1 195 ? 82.508  -92.609  6.139   1.00 24.75  ? 239 ALA B HB1  1 
ATOM   9812  H HB2  . ALA B 1 195 ? 82.251  -92.755  4.578   1.00 24.75  ? 239 ALA B HB2  1 
ATOM   9813  H HB3  . ALA B 1 195 ? 81.318  -93.520  5.612   1.00 24.75  ? 239 ALA B HB3  1 
ATOM   9814  N N    . VAL B 1 196 ? 83.571  -94.424  7.774   1.00 19.69  ? 240 VAL B N    1 
ATOM   9815  C CA   . VAL B 1 196 ? 83.680  -94.990  9.117   1.00 20.72  ? 240 VAL B CA   1 
ATOM   9816  C C    . VAL B 1 196 ? 82.318  -95.507  9.571   1.00 23.52  ? 240 VAL B C    1 
ATOM   9817  O O    . VAL B 1 196 ? 81.285  -95.091  9.027   1.00 21.58  ? 240 VAL B O    1 
ATOM   9818  C CB   . VAL B 1 196 ? 84.244  -93.963  10.112  1.00 29.84  ? 240 VAL B CB   1 
ATOM   9819  C CG1  . VAL B 1 196 ? 85.711  -93.690  9.810   1.00 23.90  ? 240 VAL B CG1  1 
ATOM   9820  C CG2  . VAL B 1 196 ? 83.433  -92.671  10.086  1.00 25.25  ? 240 VAL B CG2  1 
ATOM   9821  H H    . VAL B 1 196 ? 83.785  -93.592  7.731   1.00 23.63  ? 240 VAL B H    1 
ATOM   9822  H HA   . VAL B 1 196 ? 84.290  -95.744  9.091   1.00 24.86  ? 240 VAL B HA   1 
ATOM   9823  H HB   . VAL B 1 196 ? 84.188  -94.331  11.008  1.00 35.81  ? 240 VAL B HB   1 
ATOM   9824  H HG11 . VAL B 1 196 ? 86.049  -93.041  10.446  1.00 28.68  ? 240 VAL B HG11 1 
ATOM   9825  H HG12 . VAL B 1 196 ? 86.208  -94.519  9.887   1.00 28.68  ? 240 VAL B HG12 1 
ATOM   9826  H HG13 . VAL B 1 196 ? 85.788  -93.341  8.908   1.00 28.68  ? 240 VAL B HG13 1 
ATOM   9827  H HG21 . VAL B 1 196 ? 83.814  -92.047  10.723  1.00 30.31  ? 240 VAL B HG21 1 
ATOM   9828  H HG22 . VAL B 1 196 ? 83.467  -92.295  9.192   1.00 30.31  ? 240 VAL B HG22 1 
ATOM   9829  H HG23 . VAL B 1 196 ? 82.515  -92.871  10.327  1.00 30.31  ? 240 VAL B HG23 1 
ATOM   9830  N N    . PRO B 1 197 ? 82.263  -96.396  10.561  1.00 16.63  ? 241 PRO B N    1 
ATOM   9831  C CA   . PRO B 1 197 ? 81.003  -97.082  10.861  1.00 16.65  ? 241 PRO B CA   1 
ATOM   9832  C C    . PRO B 1 197 ? 80.001  -96.196  11.585  1.00 20.56  ? 241 PRO B C    1 
ATOM   9833  O O    . PRO B 1 197 ? 80.330  -95.160  12.166  1.00 17.67  ? 241 PRO B O    1 
ATOM   9834  C CB   . PRO B 1 197 ? 81.431  -98.257  11.754  1.00 21.61  ? 241 PRO B CB   1 
ATOM   9835  C CG   . PRO B 1 197 ? 82.932  -98.289  11.709  1.00 20.18  ? 241 PRO B CG   1 
ATOM   9836  C CD   . PRO B 1 197 ? 83.368  -96.901  11.391  1.00 17.43  ? 241 PRO B CD   1 
ATOM   9837  H HA   . PRO B 1 197 ? 80.601  -97.425  10.047  1.00 19.98  ? 241 PRO B HA   1 
ATOM   9838  H HB2  . PRO B 1 197 ? 81.122  -98.105  12.660  1.00 25.93  ? 241 PRO B HB2  1 
ATOM   9839  H HB3  . PRO B 1 197 ? 81.063  -99.082  11.402  1.00 25.93  ? 241 PRO B HB3  1 
ATOM   9840  H HG2  . PRO B 1 197 ? 83.275  -98.563  12.574  1.00 24.22  ? 241 PRO B HG2  1 
ATOM   9841  H HG3  . PRO B 1 197 ? 83.222  -98.904  11.017  1.00 24.22  ? 241 PRO B HG3  1 
ATOM   9842  H HD2  . PRO B 1 197 ? 83.452  -96.377  12.202  1.00 20.91  ? 241 PRO B HD2  1 
ATOM   9843  H HD3  . PRO B 1 197 ? 84.195  -96.913  10.884  1.00 20.91  ? 241 PRO B HD3  1 
ATOM   9844  N N    . LEU B 1 198 ? 78.748  -96.634  11.525  1.00 19.39  ? 242 LEU B N    1 
ATOM   9845  C CA   . LEU B 1 198 ? 77.681  -96.127  12.372  1.00 15.37  ? 242 LEU B CA   1 
ATOM   9846  C C    . LEU B 1 198 ? 76.613  -97.205  12.428  1.00 21.66  ? 242 LEU B C    1 
ATOM   9847  O O    . LEU B 1 198 ? 76.570  -98.101  11.581  1.00 24.73  ? 242 LEU B O    1 
ATOM   9848  C CB   . LEU B 1 198 ? 77.103  -94.803  11.854  1.00 18.61  ? 242 LEU B CB   1 
ATOM   9849  C CG   . LEU B 1 198 ? 76.184  -94.839  10.626  1.00 23.98  ? 242 LEU B CG   1 
ATOM   9850  C CD1  . LEU B 1 198 ? 75.380  -93.552  10.529  1.00 18.10  ? 242 LEU B CD1  1 
ATOM   9851  C CD2  . LEU B 1 198 ? 76.977  -95.060  9.351   1.00 18.15  ? 242 LEU B CD2  1 
ATOM   9852  H H    . LEU B 1 198 ? 78.486  -97.247  10.982  1.00 23.27  ? 242 LEU B H    1 
ATOM   9853  H HA   . LEU B 1 198 ? 78.021  -95.983  13.269  1.00 18.45  ? 242 LEU B HA   1 
ATOM   9854  H HB2  . LEU B 1 198 ? 76.592  -94.400  12.574  1.00 22.33  ? 242 LEU B HB2  1 
ATOM   9855  H HB3  . LEU B 1 198 ? 77.846  -94.221  11.631  1.00 22.33  ? 242 LEU B HB3  1 
ATOM   9856  H HG   . LEU B 1 198 ? 75.560  -95.575  10.722  1.00 28.78  ? 242 LEU B HG   1 
ATOM   9857  H HD11 . LEU B 1 198 ? 74.807  -93.596  9.747   1.00 21.73  ? 242 LEU B HD11 1 
ATOM   9858  H HD12 . LEU B 1 198 ? 74.841  -93.456  11.330  1.00 21.73  ? 242 LEU B HD12 1 
ATOM   9859  H HD13 . LEU B 1 198 ? 75.992  -92.803  10.449  1.00 21.73  ? 242 LEU B HD13 1 
ATOM   9860  H HD21 . LEU B 1 198 ? 76.366  -95.078  8.598   1.00 21.78  ? 242 LEU B HD21 1 
ATOM   9861  H HD22 . LEU B 1 198 ? 77.613  -94.335  9.245   1.00 21.78  ? 242 LEU B HD22 1 
ATOM   9862  H HD23 . LEU B 1 198 ? 77.448  -95.906  9.415   1.00 21.78  ? 242 LEU B HD23 1 
ATOM   9863  N N    . THR B 1 199 ? 75.753  -97.116  13.435  1.00 20.89  ? 243 THR B N    1 
ATOM   9864  C CA   . THR B 1 199 ? 74.687  -98.093  13.571  1.00 22.10  ? 243 THR B CA   1 
ATOM   9865  C C    . THR B 1 199 ? 73.496  -97.708  12.702  1.00 29.61  ? 243 THR B C    1 
ATOM   9866  O O    . THR B 1 199 ? 73.290  -96.535  12.371  1.00 21.15  ? 243 THR B O    1 
ATOM   9867  C CB   . THR B 1 199 ? 74.238  -98.213  15.027  1.00 23.22  ? 243 THR B CB   1 
ATOM   9868  O OG1  . THR B 1 199 ? 73.746  -96.947  15.484  1.00 21.76  ? 243 THR B OG1  1 
ATOM   9869  C CG2  . THR B 1 199 ? 75.391  -98.662  15.909  1.00 23.25  ? 243 THR B CG2  1 
ATOM   9870  H H    . THR B 1 199 ? 75.766  -96.509  14.044  1.00 25.07  ? 243 THR B H    1 
ATOM   9871  H HA   . THR B 1 199 ? 75.008  -98.960  13.279  1.00 26.52  ? 243 THR B HA   1 
ATOM   9872  H HB   . THR B 1 199 ? 73.531  -98.874  15.091  1.00 27.87  ? 243 THR B HB   1 
ATOM   9873  H HG1  . THR B 1 199 ? 73.498  -97.007  16.284  1.00 26.11  ? 243 THR B HG1  1 
ATOM   9874  H HG21 . THR B 1 199 ? 75.095  -98.734  16.830  1.00 27.91  ? 243 THR B HG21 1 
ATOM   9875  H HG22 . THR B 1 199 ? 75.717  -99.526  15.614  1.00 27.91  ? 243 THR B HG22 1 
ATOM   9876  H HG23 . THR B 1 199 ? 76.115  -98.018  15.861  1.00 27.91  ? 243 THR B HG23 1 
ATOM   9877  N N    . LEU B 1 200 ? 72.710  -98.717  12.322  1.00 26.33  ? 244 LEU B N    1 
ATOM   9878  C CA   . LEU B 1 200 ? 71.444  -98.439  11.656  1.00 28.92  ? 244 LEU B CA   1 
ATOM   9879  C C    . LEU B 1 200 ? 70.542  -97.584  12.532  1.00 18.55  ? 244 LEU B C    1 
ATOM   9880  O O    . LEU B 1 200 ? 69.782  -96.755  12.018  1.00 25.33  ? 244 LEU B O    1 
ATOM   9881  C CB   . LEU B 1 200 ? 70.741  -99.747  11.288  1.00 26.14  ? 244 LEU B CB   1 
ATOM   9882  C CG   . LEU B 1 200 ? 71.115  -100.382 9.952   1.00 32.84  ? 244 LEU B CG   1 
ATOM   9883  C CD1  . LEU B 1 200 ? 70.480  -101.760 9.834   1.00 32.63  ? 244 LEU B CD1  1 
ATOM   9884  C CD2  . LEU B 1 200 ? 70.686  -99.495  8.792   1.00 23.37  ? 244 LEU B CD2  1 
ATOM   9885  H H    . LEU B 1 200 ? 72.884  -99.552  12.436  1.00 31.60  ? 244 LEU B H    1 
ATOM   9886  H HA   . LEU B 1 200 ? 71.617  -97.951  10.836  1.00 34.71  ? 244 LEU B HA   1 
ATOM   9887  H HB2  . LEU B 1 200 ? 70.937  -100.399 11.979  1.00 31.37  ? 244 LEU B HB2  1 
ATOM   9888  H HB3  . LEU B 1 200 ? 69.786  -99.581  11.268  1.00 31.37  ? 244 LEU B HB3  1 
ATOM   9889  H HG   . LEU B 1 200 ? 72.078  -100.490 9.910   1.00 39.42  ? 244 LEU B HG   1 
ATOM   9890  H HD11 . LEU B 1 200 ? 70.727  -102.149 8.981   1.00 39.16  ? 244 LEU B HD11 1 
ATOM   9891  H HD12 . LEU B 1 200 ? 70.802  -102.318 10.559  1.00 39.16  ? 244 LEU B HD12 1 
ATOM   9892  H HD13 . LEU B 1 200 ? 69.516  -101.668 9.890   1.00 39.16  ? 244 LEU B HD13 1 
ATOM   9893  H HD21 . LEU B 1 200 ? 70.936  -99.923  7.958   1.00 28.04  ? 244 LEU B HD21 1 
ATOM   9894  H HD22 . LEU B 1 200 ? 69.725  -99.373  8.827   1.00 28.04  ? 244 LEU B HD22 1 
ATOM   9895  H HD23 . LEU B 1 200 ? 71.132  -98.636  8.870   1.00 28.04  ? 244 LEU B HD23 1 
ATOM   9896  N N    . GLY B 1 201 ? 70.616  -97.766  13.851  1.00 20.33  ? 245 GLY B N    1 
ATOM   9897  C CA   . GLY B 1 201 ? 69.822  -96.942  14.746  1.00 25.81  ? 245 GLY B CA   1 
ATOM   9898  C C    . GLY B 1 201 ? 70.232  -95.484  14.696  1.00 23.73  ? 245 GLY B C    1 
ATOM   9899  O O    . GLY B 1 201 ? 69.385  -94.588  14.733  1.00 19.68  ? 245 GLY B O    1 
ATOM   9900  H H    . GLY B 1 201 ? 71.110  -98.351  14.243  1.00 24.40  ? 245 GLY B H    1 
ATOM   9901  H HA2  . GLY B 1 201 ? 68.886  -97.007  14.502  1.00 30.98  ? 245 GLY B HA2  1 
ATOM   9902  H HA3  . GLY B 1 201 ? 69.926  -97.260  15.656  1.00 30.98  ? 245 GLY B HA3  1 
ATOM   9903  N N    . GLN B 1 202 ? 71.539  -95.227  14.612  1.00 16.24  ? 246 GLN B N    1 
ATOM   9904  C CA   . GLN B 1 202 ? 72.022  -93.858  14.472  1.00 21.96  ? 246 GLN B CA   1 
ATOM   9905  C C    . GLN B 1 202 ? 71.561  -93.251  13.153  1.00 21.80  ? 246 GLN B C    1 
ATOM   9906  O O    . GLN B 1 202 ? 71.046  -92.128  13.118  1.00 16.71  ? 246 GLN B O    1 
ATOM   9907  C CB   . GLN B 1 202 ? 73.545  -93.835  14.574  1.00 22.99  ? 246 GLN B CB   1 
ATOM   9908  C CG   . GLN B 1 202 ? 74.072  -93.875  15.998  1.00 19.04  ? 246 GLN B CG   1 
ATOM   9909  C CD   . GLN B 1 202 ? 75.573  -94.068  16.055  1.00 21.55  ? 246 GLN B CD   1 
ATOM   9910  O OE1  . GLN B 1 202 ? 76.137  -94.859  15.298  1.00 20.34  ? 246 GLN B OE1  1 
ATOM   9911  N NE2  . GLN B 1 202 ? 76.231  -93.340  16.951  1.00 29.31  ? 246 GLN B NE2  1 
ATOM   9912  H H    . GLN B 1 202 ? 72.158  -95.823  14.632  1.00 19.49  ? 246 GLN B H    1 
ATOM   9913  H HA   . GLN B 1 202 ? 71.663  -93.319  15.194  1.00 26.36  ? 246 GLN B HA   1 
ATOM   9914  H HB2  . GLN B 1 202 ? 73.900  -94.606  14.106  1.00 27.59  ? 246 GLN B HB2  1 
ATOM   9915  H HB3  . GLN B 1 202 ? 73.872  -93.021  14.160  1.00 27.59  ? 246 GLN B HB3  1 
ATOM   9916  H HG2  . GLN B 1 202 ? 73.860  -93.037  16.438  1.00 22.85  ? 246 GLN B HG2  1 
ATOM   9917  H HG3  . GLN B 1 202 ? 73.656  -94.613  16.469  1.00 22.85  ? 246 GLN B HG3  1 
ATOM   9918  H HE21 . GLN B 1 202 ? 75.803  -92.795  17.459  1.00 35.17  ? 246 GLN B HE21 1 
ATOM   9919  H HE22 . GLN B 1 202 ? 77.085  -93.414  17.022  1.00 35.17  ? 246 GLN B HE22 1 
ATOM   9920  N N    . GLU B 1 203 ? 71.745  -93.982  12.052  1.00 15.87  ? 247 GLU B N    1 
ATOM   9921  C CA   . GLU B 1 203 ? 71.280  -93.499  10.757  1.00 12.18  ? 247 GLU B CA   1 
ATOM   9922  C C    . GLU B 1 203 ? 69.780  -93.238  10.787  1.00 16.30  ? 247 GLU B C    1 
ATOM   9923  O O    . GLU B 1 203 ? 69.308  -92.197  10.315  1.00 16.22  ? 247 GLU B O    1 
ATOM   9924  C CB   . GLU B 1 203 ? 71.633  -94.511  9.667   1.00 18.76  ? 247 GLU B CB   1 
ATOM   9925  C CG   . GLU B 1 203 ? 71.399  -94.011  8.249   1.00 22.48  ? 247 GLU B CG   1 
ATOM   9926  C CD   . GLU B 1 203 ? 71.795  -95.033  7.197   1.00 28.30  ? 247 GLU B CD   1 
ATOM   9927  O OE1  . GLU B 1 203 ? 71.242  -96.152  7.214   1.00 24.79  ? 247 GLU B OE1  1 
ATOM   9928  O OE2  . GLU B 1 203 ? 72.668  -94.725  6.358   1.00 22.93  ? 247 GLU B OE2  1 
ATOM   9929  H H    . GLU B 1 203 ? 72.131  -94.750  12.030  1.00 19.05  ? 247 GLU B H    1 
ATOM   9930  H HA   . GLU B 1 203 ? 71.728  -92.664  10.550  1.00 14.62  ? 247 GLU B HA   1 
ATOM   9931  H HB2  . GLU B 1 203 ? 72.573  -94.740  9.748   1.00 22.52  ? 247 GLU B HB2  1 
ATOM   9932  H HB3  . GLU B 1 203 ? 71.091  -95.306  9.793   1.00 22.52  ? 247 GLU B HB3  1 
ATOM   9933  H HG2  . GLU B 1 203 ? 70.456  -93.813  8.135   1.00 26.98  ? 247 GLU B HG2  1 
ATOM   9934  H HG3  . GLU B 1 203 ? 71.927  -93.211  8.105   1.00 26.98  ? 247 GLU B HG3  1 
ATOM   9935  N N    . PHE B 1 204 ? 69.013  -94.172  11.353  1.00 16.82  ? 248 PHE B N    1 
ATOM   9936  C CA   . PHE B 1 204 ? 67.568  -93.993  11.429  1.00 22.34  ? 248 PHE B CA   1 
ATOM   9937  C C    . PHE B 1 204 ? 67.189  -92.845  12.355  1.00 19.31  ? 248 PHE B C    1 
ATOM   9938  O O    . PHE B 1 204 ? 66.159  -92.197  12.139  1.00 24.98  ? 248 PHE B O    1 
ATOM   9939  C CB   . PHE B 1 204 ? 66.897  -95.290  11.883  1.00 17.87  ? 248 PHE B CB   1 
ATOM   9940  C CG   . PHE B 1 204 ? 66.411  -96.143  10.748  1.00 15.92  ? 248 PHE B CG   1 
ATOM   9941  C CD1  . PHE B 1 204 ? 67.308  -96.782  9.909   1.00 18.35  ? 248 PHE B CD1  1 
ATOM   9942  C CD2  . PHE B 1 204 ? 65.055  -96.300  10.514  1.00 20.83  ? 248 PHE B CD2  1 
ATOM   9943  C CE1  . PHE B 1 204 ? 66.863  -97.563  8.861   1.00 18.37  ? 248 PHE B CE1  1 
ATOM   9944  C CE2  . PHE B 1 204 ? 64.604  -97.082  9.466   1.00 16.14  ? 248 PHE B CE2  1 
ATOM   9945  C CZ   . PHE B 1 204 ? 65.509  -97.713  8.640   1.00 17.19  ? 248 PHE B CZ   1 
ATOM   9946  H H    . PHE B 1 204 ? 69.302  -94.906  11.696  1.00 20.18  ? 248 PHE B H    1 
ATOM   9947  H HA   . PHE B 1 204 ? 67.234  -93.780  10.544  1.00 26.81  ? 248 PHE B HA   1 
ATOM   9948  H HB2  . PHE B 1 204 ? 67.536  -95.811  12.394  1.00 21.45  ? 248 PHE B HB2  1 
ATOM   9949  H HB3  . PHE B 1 204 ? 66.133  -95.070  12.438  1.00 21.45  ? 248 PHE B HB3  1 
ATOM   9950  H HD1  . PHE B 1 204 ? 68.222  -96.684  10.053  1.00 22.03  ? 248 PHE B HD1  1 
ATOM   9951  H HD2  . PHE B 1 204 ? 64.441  -95.875  11.069  1.00 25.00  ? 248 PHE B HD2  1 
ATOM   9952  H HE1  . PHE B 1 204 ? 67.475  -97.989  8.305   1.00 22.05  ? 248 PHE B HE1  1 
ATOM   9953  H HE2  . PHE B 1 204 ? 63.691  -97.182  9.319   1.00 19.38  ? 248 PHE B HE2  1 
ATOM   9954  H HZ   . PHE B 1 204 ? 65.207  -98.240  7.935   1.00 20.64  ? 248 PHE B HZ   1 
ATOM   9955  N N    . SER B 1 205 ? 68.000  -92.567  13.380  1.00 17.42  ? 249 SER B N    1 
ATOM   9956  C CA   . SER B 1 205 ? 67.685  -91.456  14.272  1.00 22.56  ? 249 SER B CA   1 
ATOM   9957  C C    . SER B 1 205 ? 67.745  -90.127  13.534  1.00 18.97  ? 249 SER B C    1 
ATOM   9958  O O    . SER B 1 205 ? 67.080  -89.166  13.934  1.00 17.08  ? 249 SER B O    1 
ATOM   9959  C CB   . SER B 1 205 ? 68.636  -91.438  15.471  1.00 20.11  ? 249 SER B CB   1 
ATOM   9960  O OG   . SER B 1 205 ? 69.912  -90.942  15.113  1.00 21.13  ? 249 SER B OG   1 
ATOM   9961  H H    . SER B 1 205 ? 68.720  -92.996  13.574  1.00 20.91  ? 249 SER B H    1 
ATOM   9962  H HA   . SER B 1 205 ? 66.783  -91.570  14.609  1.00 27.07  ? 249 SER B HA   1 
ATOM   9963  H HB2  . SER B 1 205 ? 68.260  -90.869  16.161  1.00 24.13  ? 249 SER B HB2  1 
ATOM   9964  H HB3  . SER B 1 205 ? 68.733  -92.343  15.807  1.00 24.13  ? 249 SER B HB3  1 
ATOM   9965  H HG   . SER B 1 205 ? 70.252  -91.426  14.517  1.00 25.36  ? 249 SER B HG   1 
ATOM   9966  N N    . GLY B 1 206 ? 68.536  -90.050  12.464  1.00 20.48  ? 250 GLY B N    1 
ATOM   9967  C CA   . GLY B 1 206 ? 68.518  -88.863  11.628  1.00 15.98  ? 250 GLY B CA   1 
ATOM   9968  C C    . GLY B 1 206 ? 67.193  -88.693  10.912  1.00 18.60  ? 250 GLY B C    1 
ATOM   9969  O O    . GLY B 1 206 ? 66.636  -87.592  10.869  1.00 12.40  ? 250 GLY B O    1 
ATOM   9970  H H    . GLY B 1 206 ? 69.082  -90.664  12.208  1.00 24.57  ? 250 GLY B H    1 
ATOM   9971  H HA2  . GLY B 1 206 ? 68.676  -88.078  12.175  1.00 19.18  ? 250 GLY B HA2  1 
ATOM   9972  H HA3  . GLY B 1 206 ? 69.222  -88.923  10.963  1.00 19.18  ? 250 GLY B HA3  1 
ATOM   9973  N N    . TYR B 1 207 ? 66.666  -89.782  10.344  1.00 19.06  ? 251 TYR B N    1 
ATOM   9974  C CA   . TYR B 1 207 ? 65.339  -89.732  9.740   1.00 20.01  ? 251 TYR B CA   1 
ATOM   9975  C C    . TYR B 1 207 ? 64.304  -89.266  10.755  1.00 16.97  ? 251 TYR B C    1 
ATOM   9976  O O    . TYR B 1 207 ? 63.444  -88.434  10.442  1.00 13.60  ? 251 TYR B O    1 
ATOM   9977  C CB   . TYR B 1 207 ? 64.950  -91.107  9.189   1.00 16.07  ? 251 TYR B CB   1 
ATOM   9978  C CG   . TYR B 1 207 ? 65.975  -91.762  8.282   1.00 13.60  ? 251 TYR B CG   1 
ATOM   9979  C CD1  . TYR B 1 207 ? 66.867  -91.007  7.532   1.00 15.22  ? 251 TYR B CD1  1 
ATOM   9980  C CD2  . TYR B 1 207 ? 66.044  -93.145  8.178   1.00 19.42  ? 251 TYR B CD2  1 
ATOM   9981  C CE1  . TYR B 1 207 ? 67.800  -91.615  6.704   1.00 12.54  ? 251 TYR B CE1  1 
ATOM   9982  C CE2  . TYR B 1 207 ? 66.970  -93.760  7.357   1.00 11.04  ? 251 TYR B CE2  1 
ATOM   9983  C CZ   . TYR B 1 207 ? 67.845  -92.994  6.623   1.00 15.23  ? 251 TYR B CZ   1 
ATOM   9984  O OH   . TYR B 1 207 ? 68.765  -93.614  5.807   1.00 18.18  ? 251 TYR B OH   1 
ATOM   9985  H H    . TYR B 1 207 ? 67.053  -90.549  10.297  1.00 22.87  ? 251 TYR B H    1 
ATOM   9986  H HA   . TYR B 1 207 ? 65.347  -89.101  9.003   1.00 24.01  ? 251 TYR B HA   1 
ATOM   9987  H HB2  . TYR B 1 207 ? 64.799  -91.706  9.937   1.00 19.28  ? 251 TYR B HB2  1 
ATOM   9988  H HB3  . TYR B 1 207 ? 64.130  -91.013  8.680   1.00 19.28  ? 251 TYR B HB3  1 
ATOM   9989  H HD1  . TYR B 1 207 ? 66.839  -90.079  7.585   1.00 18.27  ? 251 TYR B HD1  1 
ATOM   9990  H HD2  . TYR B 1 207 ? 65.456  -93.669  8.672   1.00 23.31  ? 251 TYR B HD2  1 
ATOM   9991  H HE1  . TYR B 1 207 ? 68.392  -91.098  6.208   1.00 15.05  ? 251 TYR B HE1  1 
ATOM   9992  H HE2  . TYR B 1 207 ? 67.002  -94.687  7.301   1.00 13.25  ? 251 TYR B HE2  1 
ATOM   9993  H HH   . TYR B 1 207 ? 69.237  -93.039  5.417   1.00 21.81  ? 251 TYR B HH   1 
ATOM   9994  N N    . VAL B 1 208 ? 64.380  -89.788  11.983  1.00 17.28  ? 252 VAL B N    1 
ATOM   9995  C CA   . VAL B 1 208 ? 63.430  -89.408  13.025  1.00 16.48  ? 252 VAL B CA   1 
ATOM   9996  C C    . VAL B 1 208 ? 63.495  -87.908  13.273  1.00 10.11  ? 252 VAL B C    1 
ATOM   9997  O O    . VAL B 1 208 ? 62.467  -87.226  13.359  1.00 14.63  ? 252 VAL B O    1 
ATOM   9998  C CB   . VAL B 1 208 ? 63.705  -90.202  14.316  1.00 24.48  ? 252 VAL B CB   1 
ATOM   9999  C CG1  . VAL B 1 208 ? 62.737  -89.794  15.417  1.00 24.55  ? 252 VAL B CG1  1 
ATOM   10000 C CG2  . VAL B 1 208 ? 63.598  -91.695  14.058  1.00 22.36  ? 252 VAL B CG2  1 
ATOM   10001 H H    . VAL B 1 208 ? 64.970  -90.362  12.234  1.00 20.73  ? 252 VAL B H    1 
ATOM   10002 H HA   . VAL B 1 208 ? 62.532  -89.623  12.727  1.00 19.77  ? 252 VAL B HA   1 
ATOM   10003 H HB   . VAL B 1 208 ? 64.606  -90.012  14.620  1.00 29.38  ? 252 VAL B HB   1 
ATOM   10004 H HG11 . VAL B 1 208 ? 62.932  -90.308  16.215  1.00 29.47  ? 252 VAL B HG11 1 
ATOM   10005 H HG12 . VAL B 1 208 ? 62.846  -88.847  15.598  1.00 29.47  ? 252 VAL B HG12 1 
ATOM   10006 H HG13 . VAL B 1 208 ? 61.830  -89.972  15.122  1.00 29.47  ? 252 VAL B HG13 1 
ATOM   10007 H HG21 . VAL B 1 208 ? 63.775  -92.171  14.885  1.00 26.83  ? 252 VAL B HG21 1 
ATOM   10008 H HG22 . VAL B 1 208 ? 62.702  -91.897  13.745  1.00 26.83  ? 252 VAL B HG22 1 
ATOM   10009 H HG23 . VAL B 1 208 ? 64.249  -91.946  13.385  1.00 26.83  ? 252 VAL B HG23 1 
ATOM   10010 N N    . GLN B 1 209 ? 64.710  -87.373  13.400  1.00 18.27  ? 253 GLN B N    1 
ATOM   10011 C CA   . GLN B 1 209 ? 64.869  -85.939  13.613  1.00 12.80  ? 253 GLN B CA   1 
ATOM   10012 C C    . GLN B 1 209 ? 64.251  -85.147  12.470  1.00 12.68  ? 253 GLN B C    1 
ATOM   10013 O O    . GLN B 1 209 ? 63.615  -84.111  12.694  1.00 15.63  ? 253 GLN B O    1 
ATOM   10014 C CB   . GLN B 1 209 ? 66.351  -85.600  13.758  1.00 14.91  ? 253 GLN B CB   1 
ATOM   10015 C CG   . GLN B 1 209 ? 66.626  -84.198  14.271  1.00 15.94  ? 253 GLN B CG   1 
ATOM   10016 C CD   . GLN B 1 209 ? 66.386  -84.071  15.761  1.00 16.68  ? 253 GLN B CD   1 
ATOM   10017 O OE1  . GLN B 1 209 ? 65.722  -84.910  16.370  1.00 21.14  ? 253 GLN B OE1  1 
ATOM   10018 N NE2  . GLN B 1 209 ? 66.933  -83.022  16.359  1.00 25.00  ? 253 GLN B NE2  1 
ATOM   10019 H H    . GLN B 1 209 ? 65.448  -87.814  13.367  1.00 21.92  ? 253 GLN B H    1 
ATOM   10020 H HA   . GLN B 1 209 ? 64.419  -85.687  14.434  1.00 15.36  ? 253 GLN B HA   1 
ATOM   10021 H HB2  . GLN B 1 209 ? 66.754  -86.225  14.380  1.00 17.89  ? 253 GLN B HB2  1 
ATOM   10022 H HB3  . GLN B 1 209 ? 66.775  -85.683  12.890  1.00 17.89  ? 253 GLN B HB3  1 
ATOM   10023 H HG2  . GLN B 1 209 ? 67.552  -83.972  14.095  1.00 19.13  ? 253 GLN B HG2  1 
ATOM   10024 H HG3  . GLN B 1 209 ? 66.038  -83.573  13.818  1.00 19.13  ? 253 GLN B HG3  1 
ATOM   10025 H HE21 . GLN B 1 209 ? 67.395  -82.459  15.902  1.00 30.00  ? 253 GLN B HE21 1 
ATOM   10026 H HE22 . GLN B 1 209 ? 66.826  -82.904  17.204  1.00 30.00  ? 253 GLN B HE22 1 
ATOM   10027 N N    . GLN B 1 210 ? 64.423  -85.625  11.235  1.00 15.72  ? 254 GLN B N    1 
ATOM   10028 C CA   . GLN B 1 210 ? 63.881  -84.915  10.082  1.00 14.24  ? 254 GLN B CA   1 
ATOM   10029 C C    . GLN B 1 210 ? 62.362  -84.842  10.139  1.00 13.61  ? 254 GLN B C    1 
ATOM   10030 O O    . GLN B 1 210 ? 61.770  -83.804  9.817   1.00 14.55  ? 254 GLN B O    1 
ATOM   10031 C CB   . GLN B 1 210 ? 64.332  -85.594  8.790   1.00 18.99  ? 254 GLN B CB   1 
ATOM   10032 C CG   . GLN B 1 210 ? 65.802  -85.421  8.474   1.00 17.04  ? 254 GLN B CG   1 
ATOM   10033 C CD   . GLN B 1 210 ? 66.186  -86.069  7.162   1.00 14.86  ? 254 GLN B CD   1 
ATOM   10034 O OE1  . GLN B 1 210 ? 66.453  -87.270  7.105   1.00 19.83  ? 254 GLN B OE1  1 
ATOM   10035 N NE2  . GLN B 1 210 ? 66.210  -85.278  6.096   1.00 10.23  ? 254 GLN B NE2  1 
ATOM   10036 H H    . GLN B 1 210 ? 64.845  -86.349  11.043  1.00 18.86  ? 254 GLN B H    1 
ATOM   10037 H HA   . GLN B 1 210 ? 64.225  -84.008  10.079  1.00 17.09  ? 254 GLN B HA   1 
ATOM   10038 H HB2  . GLN B 1 210 ? 64.156  -86.545  8.861   1.00 22.79  ? 254 GLN B HB2  1 
ATOM   10039 H HB3  . GLN B 1 210 ? 63.826  -85.223  8.050   1.00 22.79  ? 254 GLN B HB3  1 
ATOM   10040 H HG2  . GLN B 1 210 ? 66.004  -84.474  8.413   1.00 20.45  ? 254 GLN B HG2  1 
ATOM   10041 H HG3  . GLN B 1 210 ? 66.329  -85.830  9.179   1.00 20.45  ? 254 GLN B HG3  1 
ATOM   10042 H HE21 . GLN B 1 210 ? 66.013  -84.444  6.175   1.00 12.28  ? 254 GLN B HE21 1 
ATOM   10043 H HE22 . GLN B 1 210 ? 66.422  -85.598  5.327   1.00 12.28  ? 254 GLN B HE22 1 
ATOM   10044 N N    . VAL B 1 211 ? 61.709  -85.935  10.538  1.00 13.18  ? 255 VAL B N    1 
ATOM   10045 C CA   . VAL B 1 211 ? 60.252  -85.933  10.611  1.00 11.61  ? 255 VAL B CA   1 
ATOM   10046 C C    . VAL B 1 211 ? 59.784  -85.089  11.789  1.00 19.36  ? 255 VAL B C    1 
ATOM   10047 O O    . VAL B 1 211 ? 58.802  -84.345  11.684  1.00 15.31  ? 255 VAL B O    1 
ATOM   10048 C CB   . VAL B 1 211 ? 59.716  -87.373  10.691  1.00 16.48  ? 255 VAL B CB   1 
ATOM   10049 C CG1  . VAL B 1 211 ? 58.194  -87.375  10.750  1.00 14.77  ? 255 VAL B CG1  1 
ATOM   10050 C CG2  . VAL B 1 211 ? 60.198  -88.180  9.498   1.00 14.97  ? 255 VAL B CG2  1 
ATOM   10051 H H    . VAL B 1 211 ? 62.080  -86.676  10.768  1.00 15.82  ? 255 VAL B H    1 
ATOM   10052 H HA   . VAL B 1 211 ? 59.900  -85.531  9.801   1.00 13.93  ? 255 VAL B HA   1 
ATOM   10053 H HB   . VAL B 1 211 ? 60.051  -87.795  11.497  1.00 19.78  ? 255 VAL B HB   1 
ATOM   10054 H HG11 . VAL B 1 211 ? 57.882  -88.292  10.800  1.00 17.72  ? 255 VAL B HG11 1 
ATOM   10055 H HG12 . VAL B 1 211 ? 57.909  -86.885  11.537  1.00 17.72  ? 255 VAL B HG12 1 
ATOM   10056 H HG13 . VAL B 1 211 ? 57.847  -86.949  9.951   1.00 17.72  ? 255 VAL B HG13 1 
ATOM   10057 H HG21 . VAL B 1 211 ? 59.850  -89.083  9.567   1.00 17.96  ? 255 VAL B HG21 1 
ATOM   10058 H HG22 . VAL B 1 211 ? 59.876  -87.762  8.684   1.00 17.96  ? 255 VAL B HG22 1 
ATOM   10059 H HG23 . VAL B 1 211 ? 61.167  -88.198  9.500   1.00 17.96  ? 255 VAL B HG23 1 
ATOM   10060 N N    A LYS B 1 212 ? 60.477  -85.186  12.926  0.38 16.83  ? 256 LYS B N    1 
ATOM   10061 N N    B LYS B 1 212 ? 60.475  -85.187  12.927  0.62 16.83  ? 256 LYS B N    1 
ATOM   10062 C CA   A LYS B 1 212 ? 60.136  -84.350  14.073  0.38 16.54  ? 256 LYS B CA   1 
ATOM   10063 C CA   B LYS B 1 212 ? 60.135  -84.349  14.072  0.62 16.54  ? 256 LYS B CA   1 
ATOM   10064 C C    A LYS B 1 212 ? 60.208  -82.873  13.706  0.38 18.65  ? 256 LYS B C    1 
ATOM   10065 C C    B LYS B 1 212 ? 60.207  -82.873  13.704  0.62 18.64  ? 256 LYS B C    1 
ATOM   10066 O O    A LYS B 1 212 ? 59.304  -82.094  14.031  0.38 18.73  ? 256 LYS B O    1 
ATOM   10067 O O    B LYS B 1 212 ? 59.301  -82.094  14.024  0.62 18.68  ? 256 LYS B O    1 
ATOM   10068 C CB   A LYS B 1 212 ? 61.071  -84.659  15.243  0.38 20.04  ? 256 LYS B CB   1 
ATOM   10069 C CB   B LYS B 1 212 ? 61.067  -84.659  15.244  0.62 20.08  ? 256 LYS B CB   1 
ATOM   10070 C CG   A LYS B 1 212 ? 60.720  -83.918  16.527  0.38 19.20  ? 256 LYS B CG   1 
ATOM   10071 C CG   B LYS B 1 212 ? 60.782  -83.834  16.495  0.62 19.15  ? 256 LYS B CG   1 
ATOM   10072 C CD   A LYS B 1 212 ? 61.636  -84.316  17.674  0.38 27.79  ? 256 LYS B CD   1 
ATOM   10073 C CD   B LYS B 1 212 ? 61.521  -84.379  17.712  0.62 28.06  ? 256 LYS B CD   1 
ATOM   10074 C CE   A LYS B 1 212 ? 62.967  -83.585  17.612  0.38 29.12  ? 256 LYS B CE   1 
ATOM   10075 C CE   B LYS B 1 212 ? 62.818  -83.633  17.976  0.62 31.33  ? 256 LYS B CE   1 
ATOM   10076 N NZ   A LYS B 1 212 ? 63.932  -84.105  18.619  0.38 26.96  ? 256 LYS B NZ   1 
ATOM   10077 N NZ   B LYS B 1 212 ? 62.591  -82.367  18.730  0.62 33.21  ? 256 LYS B NZ   1 
ATOM   10078 H H    A LYS B 1 212 ? 61.138  -85.720  13.056  0.38 20.20  ? 256 LYS B H    1 
ATOM   10079 H H    B LYS B 1 212 ? 61.134  -85.724  13.058  0.62 20.20  ? 256 LYS B H    1 
ATOM   10080 H HA   A LYS B 1 212 ? 59.229  -84.547  14.351  0.38 19.85  ? 256 LYS B HA   1 
ATOM   10081 H HA   B LYS B 1 212 ? 59.226  -84.546  14.350  0.62 19.85  ? 256 LYS B HA   1 
ATOM   10082 H HB2  A LYS B 1 212 ? 61.031  -85.610  15.431  0.38 24.05  ? 256 LYS B HB2  1 
ATOM   10083 H HB2  B LYS B 1 212 ? 60.972  -85.595  15.479  0.62 24.10  ? 256 LYS B HB2  1 
ATOM   10084 H HB3  A LYS B 1 212 ? 61.975  -84.411  14.995  0.38 24.05  ? 256 LYS B HB3  1 
ATOM   10085 H HB3  B LYS B 1 212 ? 61.980  -84.479  14.973  0.62 24.10  ? 256 LYS B HB3  1 
ATOM   10086 H HG2  A LYS B 1 212 ? 60.814  -82.963  16.380  0.38 23.04  ? 256 LYS B HG2  1 
ATOM   10087 H HG2  B LYS B 1 212 ? 61.073  -82.920  16.348  0.62 22.98  ? 256 LYS B HG2  1 
ATOM   10088 H HG3  A LYS B 1 212 ? 59.808  -84.130  16.779  0.38 23.04  ? 256 LYS B HG3  1 
ATOM   10089 H HG3  B LYS B 1 212 ? 59.831  -83.856  16.683  0.62 22.98  ? 256 LYS B HG3  1 
ATOM   10090 H HD2  A LYS B 1 212 ? 61.208  -84.096  18.516  0.38 33.35  ? 256 LYS B HD2  1 
ATOM   10091 H HD2  B LYS B 1 212 ? 60.955  -84.288  18.495  0.62 33.68  ? 256 LYS B HD2  1 
ATOM   10092 H HD3  A LYS B 1 212 ? 61.812  -85.269  17.626  0.38 33.35  ? 256 LYS B HD3  1 
ATOM   10093 H HD3  B LYS B 1 212 ? 61.735  -85.313  17.562  0.62 33.68  ? 256 LYS B HD3  1 
ATOM   10094 H HE2  A LYS B 1 212 ? 63.356  -83.702  16.731  0.38 34.95  ? 256 LYS B HE2  1 
ATOM   10095 H HE2  B LYS B 1 212 ? 63.408  -84.196  18.502  0.62 37.60  ? 256 LYS B HE2  1 
ATOM   10096 H HE3  A LYS B 1 212 ? 62.822  -82.642  17.791  0.38 34.95  ? 256 LYS B HE3  1 
ATOM   10097 H HE3  B LYS B 1 212 ? 63.236  -83.410  17.129  0.62 37.60  ? 256 LYS B HE3  1 
ATOM   10098 H HZ1  A LYS B 1 212 ? 64.087  -84.969  18.474  0.38 32.35  ? 256 LYS B HZ1  1 
ATOM   10099 H HZ1  B LYS B 1 212 ? 62.056  -81.829  18.265  0.62 39.86  ? 256 LYS B HZ1  1 
ATOM   10100 H HZ2  A LYS B 1 212 ? 64.701  -83.660  18.561  0.38 32.35  ? 256 LYS B HZ2  1 
ATOM   10101 H HZ2  B LYS B 1 212 ? 62.213  -82.544  19.515  0.62 39.86  ? 256 LYS B HZ2  1 
ATOM   10102 H HZ3  A LYS B 1 212 ? 63.601  -84.004  19.438  0.38 32.35  ? 256 LYS B HZ3  1 
ATOM   10103 H HZ3  B LYS B 1 212 ? 63.367  -81.953  18.869  0.62 39.86  ? 256 LYS B HZ3  1 
ATOM   10104 N N    . TYR B 1 213 ? 61.282  -82.469  13.022  1.00 17.01  ? 257 TYR B N    1 
ATOM   10105 C CA   . TYR B 1 213 ? 61.418  -81.076  12.614  1.00 17.77  ? 257 TYR B CA   1 
ATOM   10106 C C    . TYR B 1 213 ? 60.399  -80.700  11.549  1.00 14.03  ? 257 TYR B C    1 
ATOM   10107 O O    . TYR B 1 213 ? 59.939  -79.554  11.516  1.00 22.69  ? 257 TYR B O    1 
ATOM   10108 C CB   . TYR B 1 213 ? 62.839  -80.813  12.108  1.00 13.95  ? 257 TYR B CB   1 
ATOM   10109 C CG   . TYR B 1 213 ? 63.892  -80.671  13.194  1.00 21.40  ? 257 TYR B CG   1 
ATOM   10110 C CD1  . TYR B 1 213 ? 63.552  -80.723  14.541  1.00 19.46  ? 257 TYR B CD1  1 
ATOM   10111 C CD2  . TYR B 1 213 ? 65.228  -80.466  12.866  1.00 20.75  ? 257 TYR B CD2  1 
ATOM   10112 C CE1  . TYR B 1 213 ? 64.510  -80.583  15.526  1.00 21.14  ? 257 TYR B CE1  1 
ATOM   10113 C CE2  . TYR B 1 213 ? 66.193  -80.326  13.847  1.00 16.48  ? 257 TYR B CE2  1 
ATOM   10114 C CZ   . TYR B 1 213 ? 65.827  -80.384  15.176  1.00 24.98  ? 257 TYR B CZ   1 
ATOM   10115 O OH   . TYR B 1 213 ? 66.774  -80.247  16.164  1.00 21.14  ? 257 TYR B OH   1 
ATOM   10116 H H    . TYR B 1 213 ? 61.933  -82.979  12.789  1.00 20.42  ? 257 TYR B H    1 
ATOM   10117 H HA   . TYR B 1 213 ? 61.266  -80.507  13.385  1.00 21.33  ? 257 TYR B HA   1 
ATOM   10118 H HB2  . TYR B 1 213 ? 63.105  -81.552  11.538  1.00 16.75  ? 257 TYR B HB2  1 
ATOM   10119 H HB3  . TYR B 1 213 ? 62.836  -79.991  11.594  1.00 16.75  ? 257 TYR B HB3  1 
ATOM   10120 H HD1  . TYR B 1 213 ? 62.664  -80.856  14.784  1.00 23.35  ? 257 TYR B HD1  1 
ATOM   10121 H HD2  . TYR B 1 213 ? 65.477  -80.425  11.971  1.00 24.90  ? 257 TYR B HD2  1 
ATOM   10122 H HE1  . TYR B 1 213 ? 64.267  -80.623  16.423  1.00 25.37  ? 257 TYR B HE1  1 
ATOM   10123 H HE2  . TYR B 1 213 ? 67.083  -80.192  13.612  1.00 19.78  ? 257 TYR B HE2  1 
ATOM   10124 H HH   . TYR B 1 213 ? 67.532  -80.132  15.821  1.00 25.37  ? 257 TYR B HH   1 
ATOM   10125 N N    . ALA B 1 214 ? 60.031  -81.641  10.679  1.00 22.22  ? 258 ALA B N    1 
ATOM   10126 C CA   . ALA B 1 214 ? 58.984  -81.365  9.701   1.00 21.13  ? 258 ALA B CA   1 
ATOM   10127 C C    . ALA B 1 214 ? 57.685  -80.980  10.397  1.00 16.90  ? 258 ALA B C    1 
ATOM   10128 O O    . ALA B 1 214 ? 57.057  -79.971  10.055  1.00 17.19  ? 258 ALA B O    1 
ATOM   10129 C CB   . ALA B 1 214 ? 58.772  -82.581  8.801   1.00 14.83  ? 258 ALA B CB   1 
ATOM   10130 H H    . ALA B 1 214 ? 60.366  -82.432  10.635  1.00 26.67  ? 258 ALA B H    1 
ATOM   10131 H HA   . ALA B 1 214 ? 59.259  -80.621  9.143   1.00 25.36  ? 258 ALA B HA   1 
ATOM   10132 H HB1  . ALA B 1 214 ? 58.073  -82.380  8.159   1.00 17.80  ? 258 ALA B HB1  1 
ATOM   10133 H HB2  . ALA B 1 214 ? 59.600  -82.780  8.338   1.00 17.80  ? 258 ALA B HB2  1 
ATOM   10134 H HB3  . ALA B 1 214 ? 58.509  -83.337  9.349   1.00 17.80  ? 258 ALA B HB3  1 
ATOM   10135 N N    . MET B 1 215 ? 57.270  -81.772  11.387  1.00 11.73  ? 259 MET B N    1 
ATOM   10136 C CA   . MET B 1 215 ? 56.057  -81.454  12.128  1.00 17.56  ? 259 MET B CA   1 
ATOM   10137 C C    . MET B 1 215 ? 56.179  -80.097  12.809  1.00 10.23  ? 259 MET B C    1 
ATOM   10138 O O    . MET B 1 215 ? 55.226  -79.309  12.818  1.00 18.20  ? 259 MET B O    1 
ATOM   10139 C CB   . MET B 1 215 ? 55.771  -82.552  13.153  1.00 9.67   ? 259 MET B CB   1 
ATOM   10140 C CG   . MET B 1 215 ? 55.587  -83.933  12.538  1.00 25.79  ? 259 MET B CG   1 
ATOM   10141 S SD   . MET B 1 215 ? 55.163  -85.207  13.745  1.00 18.81  ? 259 MET B SD   1 
ATOM   10142 C CE   . MET B 1 215 ? 53.525  -84.672  14.226  1.00 40.62  ? 259 MET B CE   1 
ATOM   10143 H H    . MET B 1 215 ? 57.669  -82.490  11.644  1.00 14.08  ? 259 MET B H    1 
ATOM   10144 H HA   . MET B 1 215 ? 55.311  -81.426  11.509  1.00 21.08  ? 259 MET B HA   1 
ATOM   10145 H HB2  . MET B 1 215 ? 56.515  -82.601  13.774  1.00 11.60  ? 259 MET B HB2  1 
ATOM   10146 H HB3  . MET B 1 215 ? 54.958  -82.329  13.631  1.00 11.60  ? 259 MET B HB3  1 
ATOM   10147 H HG2  . MET B 1 215 ? 54.871  -83.893  11.885  1.00 30.95  ? 259 MET B HG2  1 
ATOM   10148 H HG3  . MET B 1 215 ? 56.414  -84.197  12.106  1.00 30.95  ? 259 MET B HG3  1 
ATOM   10149 H HE1  . MET B 1 215 ? 53.174  -85.287  14.889  1.00 48.74  ? 259 MET B HE1  1 
ATOM   10150 H HE2  . MET B 1 215 ? 53.582  -83.779  14.601  1.00 48.74  ? 259 MET B HE2  1 
ATOM   10151 H HE3  . MET B 1 215 ? 52.952  -84.666  13.443  1.00 48.74  ? 259 MET B HE3  1 
ATOM   10152 N N    . THR B 1 216 ? 57.348  -79.807  13.382  1.00 16.13  ? 260 THR B N    1 
ATOM   10153 C CA   . THR B 1 216 ? 57.577  -78.496  13.983  1.00 12.65  ? 260 THR B CA   1 
ATOM   10154 C C    . THR B 1 216 ? 57.440  -77.389  12.946  1.00 16.28  ? 260 THR B C    1 
ATOM   10155 O O    . THR B 1 216 ? 56.794  -76.365  13.198  1.00 12.77  ? 260 THR B O    1 
ATOM   10156 C CB   . THR B 1 216 ? 58.962  -78.456  14.633  1.00 17.60  ? 260 THR B CB   1 
ATOM   10157 O OG1  . THR B 1 216 ? 59.074  -79.519  15.585  1.00 18.90  ? 260 THR B OG1  1 
ATOM   10158 C CG2  . THR B 1 216 ? 59.199  -77.128  15.342  1.00 19.48  ? 260 THR B CG2  1 
ATOM   10159 H H    . THR B 1 216 ? 58.017  -80.345  13.435  1.00 19.36  ? 260 THR B H    1 
ATOM   10160 H HA   . THR B 1 216 ? 56.914  -78.344  14.675  1.00 15.18  ? 260 THR B HA   1 
ATOM   10161 H HB   . THR B 1 216 ? 59.641  -78.563  13.949  1.00 21.12  ? 260 THR B HB   1 
ATOM   10162 H HG1  . THR B 1 216 ? 59.833  -79.502  15.946  1.00 22.68  ? 260 THR B HG1  1 
ATOM   10163 H HG21 . THR B 1 216 ? 60.080  -77.121  15.746  1.00 23.38  ? 260 THR B HG21 1 
ATOM   10164 H HG22 . THR B 1 216 ? 59.138  -76.398  14.706  1.00 23.38  ? 260 THR B HG22 1 
ATOM   10165 H HG23 . THR B 1 216 ? 58.533  -76.999  16.035  1.00 23.38  ? 260 THR B HG23 1 
ATOM   10166 N N    . ARG B 1 217 ? 58.037  -77.579  11.767  1.00 14.26  ? 261 ARG B N    1 
ATOM   10167 C CA   . ARG B 1 217 ? 57.968  -76.562  10.724  1.00 16.46  ? 261 ARG B CA   1 
ATOM   10168 C C    . ARG B 1 217 ? 56.533  -76.331  10.268  1.00 16.15  ? 261 ARG B C    1 
ATOM   10169 O O    . ARG B 1 217 ? 56.115  -75.185  10.062  1.00 14.66  ? 261 ARG B O    1 
ATOM   10170 C CB   . ARG B 1 217 ? 58.853  -76.971  9.548   1.00 17.59  ? 261 ARG B CB   1 
ATOM   10171 C CG   . ARG B 1 217 ? 60.337  -76.911  9.857   1.00 20.77  ? 261 ARG B CG   1 
ATOM   10172 C CD   . ARG B 1 217 ? 61.173  -77.478  8.729   1.00 19.47  ? 261 ARG B CD   1 
ATOM   10173 N NE   . ARG B 1 217 ? 62.599  -77.282  8.979   1.00 20.06  ? 261 ARG B NE   1 
ATOM   10174 C CZ   . ARG B 1 217 ? 63.499  -78.246  9.161   1.00 17.01  ? 261 ARG B CZ   1 
ATOM   10175 N NH1  . ARG B 1 217 ? 63.161  -79.525  9.105   1.00 19.63  ? 261 ARG B NH1  1 
ATOM   10176 N NH2  . ARG B 1 217 ? 64.763  -77.920  9.387   1.00 20.03  ? 261 ARG B NH2  1 
ATOM   10177 H H    . ARG B 1 217 ? 58.483  -78.282  11.551  1.00 17.11  ? 261 ARG B H    1 
ATOM   10178 H HA   . ARG B 1 217 ? 58.308  -75.724  11.077  1.00 19.75  ? 261 ARG B HA   1 
ATOM   10179 H HB2  . ARG B 1 217 ? 58.638  -77.883  9.297   1.00 21.11  ? 261 ARG B HB2  1 
ATOM   10180 H HB3  . ARG B 1 217 ? 58.679  -76.375  8.803   1.00 21.11  ? 261 ARG B HB3  1 
ATOM   10181 H HG2  . ARG B 1 217 ? 60.597  -75.986  9.991   1.00 24.93  ? 261 ARG B HG2  1 
ATOM   10182 H HG3  . ARG B 1 217 ? 60.517  -77.429  10.657  1.00 24.93  ? 261 ARG B HG3  1 
ATOM   10183 H HD2  . ARG B 1 217 ? 61.005  -78.431  8.653   1.00 23.37  ? 261 ARG B HD2  1 
ATOM   10184 H HD3  . ARG B 1 217 ? 60.944  -77.028  7.901   1.00 23.37  ? 261 ARG B HD3  1 
ATOM   10185 H HE   . ARG B 1 217 ? 62.883  -76.471  9.012   1.00 24.08  ? 261 ARG B HE   1 
ATOM   10186 H HH11 . ARG B 1 217 ? 62.343  -79.747  8.959   1.00 23.56  ? 261 ARG B HH11 1 
ATOM   10187 H HH12 . ARG B 1 217 ? 63.758  -80.133  9.221   1.00 23.56  ? 261 ARG B HH12 1 
ATOM   10188 H HH21 . ARG B 1 217 ? 64.994  -77.092  9.421   1.00 24.03  ? 261 ARG B HH21 1 
ATOM   10189 H HH22 . ARG B 1 217 ? 65.353  -78.536  9.499   1.00 24.03  ? 261 ARG B HH22 1 
ATOM   10190 N N    . ILE B 1 218 ? 55.762  -77.408  10.105  1.00 16.00  ? 262 ILE B N    1 
ATOM   10191 C CA   . ILE B 1 218 ? 54.367  -77.269  9.696   1.00 8.72   ? 262 ILE B CA   1 
ATOM   10192 C C    . ILE B 1 218 ? 53.578  -76.510  10.758  1.00 17.44  ? 262 ILE B C    1 
ATOM   10193 O O    . ILE B 1 218 ? 52.816  -75.587  10.450  1.00 15.49  ? 262 ILE B O    1 
ATOM   10194 C CB   . ILE B 1 218 ? 53.758  -78.652  9.405   1.00 13.25  ? 262 ILE B CB   1 
ATOM   10195 C CG1  . ILE B 1 218 ? 54.379  -79.228  8.130   1.00 18.01  ? 262 ILE B CG1  1 
ATOM   10196 C CG2  . ILE B 1 218 ? 52.241  -78.570  9.247   1.00 15.67  ? 262 ILE B CG2  1 
ATOM   10197 C CD1  . ILE B 1 218 ? 54.263  -80.724  8.017   1.00 20.87  ? 262 ILE B CD1  1 
ATOM   10198 H H    . ILE B 1 218 ? 56.020  -78.219  10.224  1.00 19.21  ? 262 ILE B H    1 
ATOM   10199 H HA   . ILE B 1 218 ? 54.332  -76.751  8.876   1.00 10.47  ? 262 ILE B HA   1 
ATOM   10200 H HB   . ILE B 1 218 ? 53.962  -79.244  10.146  1.00 15.90  ? 262 ILE B HB   1 
ATOM   10201 H HG12 . ILE B 1 218 ? 53.933  -78.838  7.362   1.00 21.62  ? 262 ILE B HG12 1 
ATOM   10202 H HG13 . ILE B 1 218 ? 55.322  -79.002  8.113   1.00 21.62  ? 262 ILE B HG13 1 
ATOM   10203 H HG21 . ILE B 1 218 ? 51.895  -79.458  9.065   1.00 18.80  ? 262 ILE B HG21 1 
ATOM   10204 H HG22 . ILE B 1 218 ? 51.857  -78.227  10.068  1.00 18.80  ? 262 ILE B HG22 1 
ATOM   10205 H HG23 . ILE B 1 218 ? 52.033  -77.976  8.509   1.00 18.80  ? 262 ILE B HG23 1 
ATOM   10206 H HD11 . ILE B 1 218 ? 54.677  -81.010  7.187   1.00 25.05  ? 262 ILE B HD11 1 
ATOM   10207 H HD12 . ILE B 1 218 ? 54.715  -81.133  8.771   1.00 25.05  ? 262 ILE B HD12 1 
ATOM   10208 H HD13 . ILE B 1 218 ? 53.325  -80.969  8.020   1.00 25.05  ? 262 ILE B HD13 1 
ATOM   10209 N N    . LYS B 1 219 ? 53.756  -76.882  12.028  1.00 12.33  ? 263 LYS B N    1 
ATOM   10210 C CA   . LYS B 1 219 ? 53.075  -76.168  13.103  1.00 16.70  ? 263 LYS B CA   1 
ATOM   10211 C C    . LYS B 1 219 ? 53.521  -74.714  13.177  1.00 11.03  ? 263 LYS B C    1 
ATOM   10212 O O    . LYS B 1 219 ? 52.719  -73.834  13.508  1.00 13.89  ? 263 LYS B O    1 
ATOM   10213 C CB   . LYS B 1 219 ? 53.323  -76.864  14.440  1.00 11.32  ? 263 LYS B CB   1 
ATOM   10214 C CG   . LYS B 1 219 ? 52.674  -78.234  14.551  1.00 21.31  ? 263 LYS B CG   1 
ATOM   10215 C CD   . LYS B 1 219 ? 53.046  -78.927  15.850  1.00 18.82  ? 263 LYS B CD   1 
ATOM   10216 C CE   . LYS B 1 219 ? 52.601  -80.381  15.846  1.00 40.70  ? 263 LYS B CE   1 
ATOM   10217 N NZ   . LYS B 1 219 ? 52.800  -81.042  17.163  1.00 49.55  ? 263 LYS B NZ   1 
ATOM   10218 H H    . LYS B 1 219 ? 54.256  -77.532  12.288  1.00 14.79  ? 263 LYS B H    1 
ATOM   10219 H HA   . LYS B 1 219 ? 52.120  -76.180  12.933  1.00 20.05  ? 263 LYS B HA   1 
ATOM   10220 H HB2  . LYS B 1 219 ? 54.279  -76.979  14.560  1.00 13.59  ? 263 LYS B HB2  1 
ATOM   10221 H HB3  . LYS B 1 219 ? 52.967  -76.310  15.152  1.00 13.59  ? 263 LYS B HB3  1 
ATOM   10222 H HG2  . LYS B 1 219 ? 51.709  -78.134  14.525  1.00 25.57  ? 263 LYS B HG2  1 
ATOM   10223 H HG3  . LYS B 1 219 ? 52.973  -78.790  13.814  1.00 25.57  ? 263 LYS B HG3  1 
ATOM   10224 H HD2  . LYS B 1 219 ? 54.009  -78.903  15.962  1.00 22.59  ? 263 LYS B HD2  1 
ATOM   10225 H HD3  . LYS B 1 219 ? 52.609  -78.477  16.590  1.00 22.59  ? 263 LYS B HD3  1 
ATOM   10226 H HE2  . LYS B 1 219 ? 51.656  -80.422  15.629  1.00 48.84  ? 263 LYS B HE2  1 
ATOM   10227 H HE3  . LYS B 1 219 ? 53.116  -80.868  15.184  1.00 48.84  ? 263 LYS B HE3  1 
ATOM   10228 H HZ1  . LYS B 1 219 ? 53.662  -81.024  17.385  1.00 59.46  ? 263 LYS B HZ1  1 
ATOM   10229 H HZ2  . LYS B 1 219 ? 52.332  -80.618  17.790  1.00 59.46  ? 263 LYS B HZ2  1 
ATOM   10230 H HZ3  . LYS B 1 219 ? 52.529  -81.889  17.123  1.00 59.46  ? 263 LYS B HZ3  1 
ATOM   10231 N N    . ALA B 1 220 ? 54.791  -74.438  12.879  1.00 14.59  ? 264 ALA B N    1 
ATOM   10232 C CA   . ALA B 1 220 ? 55.274  -73.063  12.893  1.00 12.67  ? 264 ALA B CA   1 
ATOM   10233 C C    . ALA B 1 220 ? 54.684  -72.235  11.760  1.00 21.34  ? 264 ALA B C    1 
ATOM   10234 O O    . ALA B 1 220 ? 54.746  -71.002  11.812  1.00 19.53  ? 264 ALA B O    1 
ATOM   10235 C CB   . ALA B 1 220 ? 56.799  -73.040  12.810  1.00 17.24  ? 264 ALA B CB   1 
ATOM   10236 H H    . ALA B 1 220 ? 55.385  -75.023  12.668  1.00 17.51  ? 264 ALA B H    1 
ATOM   10237 H HA   . ALA B 1 220 ? 55.014  -72.648  13.730  1.00 15.21  ? 264 ALA B HA   1 
ATOM   10238 H HB1  . ALA B 1 220 ? 57.101  -72.119  12.820  1.00 20.69  ? 264 ALA B HB1  1 
ATOM   10239 H HB2  . ALA B 1 220 ? 57.163  -73.517  13.572  1.00 20.69  ? 264 ALA B HB2  1 
ATOM   10240 H HB3  . ALA B 1 220 ? 57.076  -73.471  11.986  1.00 20.69  ? 264 ALA B HB3  1 
ATOM   10241 N N    . ALA B 1 221 ? 54.113  -72.883  10.745  1.00 16.61  ? 265 ALA B N    1 
ATOM   10242 C CA   . ALA B 1 221 ? 53.531  -72.198  9.600   1.00 17.52  ? 265 ALA B CA   1 
ATOM   10243 C C    . ALA B 1 221 ? 52.022  -72.030  9.715   1.00 15.79  ? 265 ALA B C    1 
ATOM   10244 O O    . ALA B 1 221 ? 51.385  -71.599  8.750   1.00 30.79  ? 265 ALA B O    1 
ATOM   10245 C CB   . ALA B 1 221 ? 53.870  -72.956  8.315   1.00 23.12  ? 265 ALA B CB   1 
ATOM   10246 H H    . ALA B 1 221 ? 54.050  -73.739  10.699  1.00 19.93  ? 265 ALA B H    1 
ATOM   10247 H HA   . ALA B 1 221 ? 53.923  -71.313  9.534   1.00 21.03  ? 265 ALA B HA   1 
ATOM   10248 H HB1  . ALA B 1 221 ? 53.477  -72.490  7.561   1.00 27.75  ? 265 ALA B HB1  1 
ATOM   10249 H HB2  . ALA B 1 221 ? 54.834  -72.994  8.216   1.00 27.75  ? 265 ALA B HB2  1 
ATOM   10250 H HB3  . ALA B 1 221 ? 53.508  -73.854  8.374   1.00 27.75  ? 265 ALA B HB3  1 
ATOM   10251 N N    . MET B 1 222 ? 51.438  -72.363  10.865  1.00 14.89  ? 266 MET B N    1 
ATOM   10252 C CA   . MET B 1 222 ? 49.989  -72.341  11.037  1.00 14.82  ? 266 MET B CA   1 
ATOM   10253 C C    . MET B 1 222 ? 49.440  -71.045  11.634  1.00 16.15  ? 266 MET B C    1 
ATOM   10254 O O    . MET B 1 222 ? 48.295  -70.687  11.330  1.00 18.45  ? 266 MET B O    1 
ATOM   10255 C CB   . MET B 1 222 ? 49.553  -73.515  11.918  1.00 19.17  ? 266 MET B CB   1 
ATOM   10256 C CG   . MET B 1 222 ? 49.633  -74.881  11.245  1.00 17.73  ? 266 MET B CG   1 
ATOM   10257 S SD   . MET B 1 222 ? 48.696  -74.984  9.708   1.00 22.29  ? 266 MET B SD   1 
ATOM   10258 C CE   . MET B 1 222 ? 47.059  -74.539  10.276  1.00 21.20  ? 266 MET B CE   1 
ATOM   10259 H H    . MET B 1 222 ? 51.866  -72.609  11.569  1.00 17.87  ? 266 MET B H    1 
ATOM   10260 H HA   . MET B 1 222 ? 49.580  -72.468  10.166  1.00 17.79  ? 266 MET B HA   1 
ATOM   10261 H HB2  . MET B 1 222 ? 50.122  -73.541  12.703  1.00 23.00  ? 266 MET B HB2  1 
ATOM   10262 H HB3  . MET B 1 222 ? 48.632  -73.375  12.188  1.00 23.00  ? 266 MET B HB3  1 
ATOM   10263 H HG2  . MET B 1 222 ? 50.562  -75.074  11.040  1.00 21.28  ? 266 MET B HG2  1 
ATOM   10264 H HG3  . MET B 1 222 ? 49.283  -75.551  11.852  1.00 21.28  ? 266 MET B HG3  1 
ATOM   10265 H HE1  . MET B 1 222 ? 46.448  -74.558  9.523   1.00 25.44  ? 266 MET B HE1  1 
ATOM   10266 H HE2  . MET B 1 222 ? 46.775  -75.176  10.950  1.00 25.44  ? 266 MET B HE2  1 
ATOM   10267 H HE3  . MET B 1 222 ? 47.089  -73.647  10.655  1.00 25.44  ? 266 MET B HE3  1 
ATOM   10268 N N    . PRO B 1 223 ? 50.182  -70.327  12.491  1.00 11.37  ? 267 PRO B N    1 
ATOM   10269 C CA   . PRO B 1 223 ? 49.566  -69.178  13.184  1.00 23.29  ? 267 PRO B CA   1 
ATOM   10270 C C    . PRO B 1 223 ? 48.792  -68.233  12.280  1.00 15.29  ? 267 PRO B C    1 
ATOM   10271 O O    . PRO B 1 223 ? 47.731  -67.739  12.679  1.00 15.66  ? 267 PRO B O    1 
ATOM   10272 C CB   . PRO B 1 223 ? 50.771  -68.483  13.827  1.00 22.69  ? 267 PRO B CB   1 
ATOM   10273 C CG   . PRO B 1 223 ? 51.715  -69.580  14.100  1.00 18.13  ? 267 PRO B CG   1 
ATOM   10274 C CD   . PRO B 1 223 ? 51.560  -70.557  12.966  1.00 18.82  ? 267 PRO B CD   1 
ATOM   10275 H HA   . PRO B 1 223 ? 48.975  -69.495  13.886  1.00 27.95  ? 267 PRO B HA   1 
ATOM   10276 H HB2  . PRO B 1 223 ? 51.153  -67.843  13.206  1.00 27.23  ? 267 PRO B HB2  1 
ATOM   10277 H HB3  . PRO B 1 223 ? 50.500  -68.047  14.650  1.00 27.23  ? 267 PRO B HB3  1 
ATOM   10278 H HG2  . PRO B 1 223 ? 52.620  -69.230  14.126  1.00 21.76  ? 267 PRO B HG2  1 
ATOM   10279 H HG3  . PRO B 1 223 ? 51.488  -70.000  14.944  1.00 21.76  ? 267 PRO B HG3  1 
ATOM   10280 H HD2  . PRO B 1 223 ? 52.197  -70.359  12.262  1.00 22.59  ? 267 PRO B HD2  1 
ATOM   10281 H HD3  . PRO B 1 223 ? 51.658  -71.466  13.289  1.00 22.59  ? 267 PRO B HD3  1 
ATOM   10282 N N    . ARG B 1 224 ? 49.286  -67.964  11.076  1.00 16.11  ? 268 ARG B N    1 
ATOM   10283 C CA   . ARG B 1 224 ? 48.605  -67.048  10.173  1.00 17.93  ? 268 ARG B CA   1 
ATOM   10284 C C    . ARG B 1 224 ? 47.581  -67.746  9.286   1.00 20.88  ? 268 ARG B C    1 
ATOM   10285 O O    . ARG B 1 224 ? 46.776  -67.065  8.640   1.00 14.02  ? 268 ARG B O    1 
ATOM   10286 C CB   . ARG B 1 224 ? 49.635  -66.300  9.325   1.00 22.96  ? 268 ARG B CB   1 
ATOM   10287 C CG   . ARG B 1 224 ? 50.357  -65.214  10.120  1.00 15.91  ? 268 ARG B CG   1 
ATOM   10288 C CD   . ARG B 1 224 ? 51.757  -64.951  9.606   1.00 17.99  ? 268 ARG B CD   1 
ATOM   10289 N NE   . ARG B 1 224 ? 52.639  -66.095  9.824   1.00 25.69  ? 268 ARG B NE   1 
ATOM   10290 C CZ   . ARG B 1 224 ? 53.246  -66.371  10.975  1.00 29.06  ? 268 ARG B CZ   1 
ATOM   10291 N NH1  . ARG B 1 224 ? 53.072  -65.589  12.033  1.00 31.35  ? 268 ARG B NH1  1 
ATOM   10292 N NH2  . ARG B 1 224 ? 54.027  -67.437  11.071  1.00 28.52  ? 268 ARG B NH2  1 
ATOM   10293 H H    . ARG B 1 224 ? 50.012  -68.298  10.759  1.00 19.34  ? 268 ARG B H    1 
ATOM   10294 H HA   . ARG B 1 224 ? 48.129  -66.390  10.703  1.00 21.51  ? 268 ARG B HA   1 
ATOM   10295 H HB2  . ARG B 1 224 ? 50.299  -66.930  9.003   1.00 27.55  ? 268 ARG B HB2  1 
ATOM   10296 H HB3  . ARG B 1 224 ? 49.185  -65.878  8.577   1.00 27.55  ? 268 ARG B HB3  1 
ATOM   10297 H HG2  . ARG B 1 224 ? 49.853  -64.387  10.057  1.00 19.10  ? 268 ARG B HG2  1 
ATOM   10298 H HG3  . ARG B 1 224 ? 50.424  -65.492  11.047  1.00 19.10  ? 268 ARG B HG3  1 
ATOM   10299 H HD2  . ARG B 1 224 ? 51.719  -64.775  8.652   1.00 21.59  ? 268 ARG B HD2  1 
ATOM   10300 H HD3  . ARG B 1 224 ? 52.130  -64.187  10.072  1.00 21.59  ? 268 ARG B HD3  1 
ATOM   10301 H HE   . ARG B 1 224 ? 52.775  -66.627  9.162   1.00 30.83  ? 268 ARG B HE   1 
ATOM   10302 H HH11 . ARG B 1 224 ? 52.565  -64.897  11.978  1.00 37.63  ? 268 ARG B HH11 1 
ATOM   10303 H HH12 . ARG B 1 224 ? 53.467  -65.775  12.774  1.00 37.63  ? 268 ARG B HH12 1 
ATOM   10304 H HH21 . ARG B 1 224 ? 54.144  -67.948  10.389  1.00 34.23  ? 268 ARG B HH21 1 
ATOM   10305 H HH22 . ARG B 1 224 ? 54.420  -67.617  11.815  1.00 34.23  ? 268 ARG B HH22 1 
ATOM   10306 N N    . ILE B 1 225 ? 47.585  -69.081  9.249   1.00 19.72  ? 269 ILE B N    1 
ATOM   10307 C CA   . ILE B 1 225 ? 46.476  -69.815  8.650   1.00 16.30  ? 269 ILE B CA   1 
ATOM   10308 C C    . ILE B 1 225 ? 45.213  -69.641  9.487   1.00 17.23  ? 269 ILE B C    1 
ATOM   10309 O O    . ILE B 1 225 ? 44.100  -69.611  8.948   1.00 15.61  ? 269 ILE B O    1 
ATOM   10310 C CB   . ILE B 1 225 ? 46.842  -71.305  8.497   1.00 15.31  ? 269 ILE B CB   1 
ATOM   10311 C CG1  . ILE B 1 225 ? 48.016  -71.482  7.527   1.00 16.70  ? 269 ILE B CG1  1 
ATOM   10312 C CG2  . ILE B 1 225 ? 45.632  -72.125  8.047   1.00 15.12  ? 269 ILE B CG2  1 
ATOM   10313 C CD1  . ILE B 1 225 ? 47.683  -71.227  6.070   1.00 13.89  ? 269 ILE B CD1  1 
ATOM   10314 H H    . ILE B 1 225 ? 48.214  -69.578  9.562   1.00 23.67  ? 269 ILE B H    1 
ATOM   10315 H HA   . ILE B 1 225 ? 46.301  -69.457  7.765   1.00 19.56  ? 269 ILE B HA   1 
ATOM   10316 H HB   . ILE B 1 225 ? 47.120  -71.635  9.366   1.00 18.37  ? 269 ILE B HB   1 
ATOM   10317 H HG12 . ILE B 1 225 ? 48.721  -70.864  7.779   1.00 20.04  ? 269 ILE B HG12 1 
ATOM   10318 H HG13 . ILE B 1 225 ? 48.341  -72.393  7.598   1.00 20.04  ? 269 ILE B HG13 1 
ATOM   10319 H HG21 . ILE B 1 225 ? 45.896  -73.054  7.961   1.00 18.14  ? 269 ILE B HG21 1 
ATOM   10320 H HG22 . ILE B 1 225 ? 44.929  -72.040  8.710   1.00 18.14  ? 269 ILE B HG22 1 
ATOM   10321 H HG23 . ILE B 1 225 ? 45.324  -71.788  7.192   1.00 18.14  ? 269 ILE B HG23 1 
ATOM   10322 H HD11 . ILE B 1 225 ? 48.481  -71.362  5.535   1.00 16.67  ? 269 ILE B HD11 1 
ATOM   10323 H HD12 . ILE B 1 225 ? 46.989  -71.847  5.792   1.00 16.67  ? 269 ILE B HD12 1 
ATOM   10324 H HD13 . ILE B 1 225 ? 47.369  -70.314  5.973   1.00 16.67  ? 269 ILE B HD13 1 
ATOM   10325 N N    . TYR B 1 226 ? 45.357  -69.528  10.809  1.00 13.80  ? 270 TYR B N    1 
ATOM   10326 C CA   . TYR B 1 226 ? 44.213  -69.376  11.699  1.00 14.53  ? 270 TYR B CA   1 
ATOM   10327 C C    . TYR B 1 226 ? 43.547  -68.011  11.587  1.00 18.12  ? 270 TYR B C    1 
ATOM   10328 O O    . TYR B 1 226 ? 42.455  -67.832  12.134  1.00 19.22  ? 270 TYR B O    1 
ATOM   10329 C CB   . TYR B 1 226 ? 44.650  -69.616  13.146  1.00 20.91  ? 270 TYR B CB   1 
ATOM   10330 C CG   . TYR B 1 226 ? 45.104  -71.033  13.420  1.00 15.49  ? 270 TYR B CG   1 
ATOM   10331 C CD1  . TYR B 1 226 ? 44.329  -72.118  13.035  1.00 14.91  ? 270 TYR B CD1  1 
ATOM   10332 C CD2  . TYR B 1 226 ? 46.312  -71.284  14.056  1.00 13.95  ? 270 TYR B CD2  1 
ATOM   10333 C CE1  . TYR B 1 226 ? 44.741  -73.414  13.282  1.00 13.70  ? 270 TYR B CE1  1 
ATOM   10334 C CE2  . TYR B 1 226 ? 46.731  -72.576  14.307  1.00 13.98  ? 270 TYR B CE2  1 
ATOM   10335 C CZ   . TYR B 1 226 ? 45.941  -73.636  13.917  1.00 19.49  ? 270 TYR B CZ   1 
ATOM   10336 O OH   . TYR B 1 226 ? 46.358  -74.922  14.166  1.00 25.69  ? 270 TYR B OH   1 
ATOM   10337 H H    . TYR B 1 226 ? 46.116  -69.537  11.215  1.00 16.56  ? 270 TYR B H    1 
ATOM   10338 H HA   . TYR B 1 226 ? 43.551  -70.048  11.474  1.00 17.44  ? 270 TYR B HA   1 
ATOM   10339 H HB2  . TYR B 1 226 ? 45.389  -69.023  13.352  1.00 25.09  ? 270 TYR B HB2  1 
ATOM   10340 H HB3  . TYR B 1 226 ? 43.902  -69.426  13.734  1.00 25.09  ? 270 TYR B HB3  1 
ATOM   10341 H HD1  . TYR B 1 226 ? 43.517  -71.971  12.607  1.00 17.90  ? 270 TYR B HD1  1 
ATOM   10342 H HD2  . TYR B 1 226 ? 46.846  -70.571  14.321  1.00 16.74  ? 270 TYR B HD2  1 
ATOM   10343 H HE1  . TYR B 1 226 ? 44.210  -74.131  13.020  1.00 16.44  ? 270 TYR B HE1  1 
ATOM   10344 H HE2  . TYR B 1 226 ? 47.542  -72.729  14.736  1.00 16.78  ? 270 TYR B HE2  1 
ATOM   10345 H HH   . TYR B 1 226 ? 47.102  -74.913  14.556  1.00 30.84  ? 270 TYR B HH   1 
ATOM   10346 N N    . GLU B 1 227 ? 44.169  -67.055  10.903  1.00 16.45  ? 271 GLU B N    1 
ATOM   10347 C CA   . GLU B 1 227 ? 43.549  -65.758  10.674  1.00 13.99  ? 271 GLU B CA   1 
ATOM   10348 C C    . GLU B 1 227 ? 42.528  -65.866  9.548   1.00 12.49  ? 271 GLU B C    1 
ATOM   10349 O O    . GLU B 1 227 ? 42.840  -66.365  8.463   1.00 19.05  ? 271 GLU B O    1 
ATOM   10350 C CB   . GLU B 1 227 ? 44.612  -64.716  10.335  1.00 19.25  ? 271 GLU B CB   1 
ATOM   10351 C CG   . GLU B 1 227 ? 45.604  -64.471  11.459  1.00 17.51  ? 271 GLU B CG   1 
ATOM   10352 C CD   . GLU B 1 227 ? 46.584  -63.358  11.144  1.00 28.58  ? 271 GLU B CD   1 
ATOM   10353 O OE1  . GLU B 1 227 ? 46.421  -62.699  10.095  1.00 21.58  ? 271 GLU B OE1  1 
ATOM   10354 O OE2  . GLU B 1 227 ? 47.516  -63.145  11.948  1.00 23.61  ? 271 GLU B OE2  1 
ATOM   10355 H H    . GLU B 1 227 ? 44.953  -67.134  10.560  1.00 19.75  ? 271 GLU B H    1 
ATOM   10356 H HA   . GLU B 1 227 ? 43.088  -65.474  11.479  1.00 16.79  ? 271 GLU B HA   1 
ATOM   10357 H HB2  . GLU B 1 227 ? 45.111  -65.018  9.559   1.00 23.10  ? 271 GLU B HB2  1 
ATOM   10358 H HB3  . GLU B 1 227 ? 44.174  -63.873  10.137  1.00 23.10  ? 271 GLU B HB3  1 
ATOM   10359 H HG2  . GLU B 1 227 ? 45.118  -64.225  12.261  1.00 21.02  ? 271 GLU B HG2  1 
ATOM   10360 H HG3  . GLU B 1 227 ? 46.112  -65.283  11.614  1.00 21.02  ? 271 GLU B HG3  1 
ATOM   10361 N N    . LEU B 1 228 ? 41.309  -65.402  9.809   1.00 18.27  ? 272 LEU B N    1 
ATOM   10362 C CA   . LEU B 1 228 ? 40.205  -65.528  8.869   1.00 13.51  ? 272 LEU B CA   1 
ATOM   10363 C C    . LEU B 1 228 ? 39.827  -64.165  8.308   1.00 12.60  ? 272 LEU B C    1 
ATOM   10364 O O    . LEU B 1 228 ? 39.795  -63.167  9.034   1.00 21.17  ? 272 LEU B O    1 
ATOM   10365 C CB   . LEU B 1 228 ? 38.986  -66.173  9.537   1.00 12.66  ? 272 LEU B CB   1 
ATOM   10366 C CG   . LEU B 1 228 ? 39.209  -67.566  10.129  1.00 13.60  ? 272 LEU B CG   1 
ATOM   10367 C CD1  . LEU B 1 228 ? 37.908  -68.115  10.686  1.00 18.32  ? 272 LEU B CD1  1 
ATOM   10368 C CD2  . LEU B 1 228 ? 39.793  -68.523  9.094   1.00 16.51  ? 272 LEU B CD2  1 
ATOM   10369 H H    . LEU B 1 228 ? 41.095  -65.002  10.539  1.00 21.93  ? 272 LEU B H    1 
ATOM   10370 H HA   . LEU B 1 228 ? 40.479  -66.094  8.130   1.00 16.21  ? 272 LEU B HA   1 
ATOM   10371 H HB2  . LEU B 1 228 ? 38.692  -65.595  10.258  1.00 15.19  ? 272 LEU B HB2  1 
ATOM   10372 H HB3  . LEU B 1 228 ? 38.280  -66.249  8.876   1.00 15.19  ? 272 LEU B HB3  1 
ATOM   10373 H HG   . LEU B 1 228 ? 39.842  -67.498  10.861  1.00 16.32  ? 272 LEU B HG   1 
ATOM   10374 H HD11 . LEU B 1 228 ? 38.071  -68.997  11.056  1.00 21.99  ? 272 LEU B HD11 1 
ATOM   10375 H HD12 . LEU B 1 228 ? 37.586  -67.519  11.380  1.00 21.99  ? 272 LEU B HD12 1 
ATOM   10376 H HD13 . LEU B 1 228 ? 37.257  -68.171  9.969   1.00 21.99  ? 272 LEU B HD13 1 
ATOM   10377 H HD21 . LEU B 1 228 ? 39.920  -69.393  9.506   1.00 19.82  ? 272 LEU B HD21 1 
ATOM   10378 H HD22 . LEU B 1 228 ? 39.177  -68.596  8.349   1.00 19.82  ? 272 LEU B HD22 1 
ATOM   10379 H HD23 . LEU B 1 228 ? 40.645  -68.175  8.787   1.00 19.82  ? 272 LEU B HD23 1 
ATOM   10380 N N    . ALA B 1 229 ? 39.530  -64.138  7.009   1.00 15.19  ? 273 ALA B N    1 
ATOM   10381 C CA   . ALA B 1 229 ? 39.190  -62.900  6.325   1.00 17.37  ? 273 ALA B CA   1 
ATOM   10382 C C    . ALA B 1 229 ? 37.749  -62.467  6.554   1.00 20.93  ? 273 ALA B C    1 
ATOM   10383 O O    . ALA B 1 229 ? 37.419  -61.308  6.278   1.00 11.75  ? 273 ALA B O    1 
ATOM   10384 C CB   . ALA B 1 229 ? 39.435  -63.052  4.823   1.00 16.97  ? 273 ALA B CB   1 
ATOM   10385 H H    . ALA B 1 229 ? 39.518  -64.832  6.501   1.00 18.23  ? 273 ALA B H    1 
ATOM   10386 H HA   . ALA B 1 229 ? 39.768  -62.193  6.651   1.00 20.85  ? 273 ALA B HA   1 
ATOM   10387 H HB1  . ALA B 1 229 ? 39.205  -62.221  4.380   1.00 20.37  ? 273 ALA B HB1  1 
ATOM   10388 H HB2  . ALA B 1 229 ? 40.372  -63.258  4.676   1.00 20.37  ? 273 ALA B HB2  1 
ATOM   10389 H HB3  . ALA B 1 229 ? 38.881  -63.772  4.484   1.00 20.37  ? 273 ALA B HB3  1 
ATOM   10390 N N    . ALA B 1 230 ? 36.891  -63.363  7.041   1.00 19.01  ? 274 ALA B N    1 
ATOM   10391 C CA   . ALA B 1 230 ? 35.476  -63.056  7.215   1.00 23.18  ? 274 ALA B CA   1 
ATOM   10392 C C    . ALA B 1 230 ? 35.297  -61.735  7.949   1.00 21.80  ? 274 ALA B C    1 
ATOM   10393 O O    . ALA B 1 230 ? 35.824  -61.544  9.048   1.00 15.19  ? 274 ALA B O    1 
ATOM   10394 C CB   . ALA B 1 230 ? 34.788  -64.188  7.982   1.00 17.37  ? 274 ALA B CB   1 
ATOM   10395 H H    . ALA B 1 230 ? 37.108  -64.161  7.278   1.00 22.82  ? 274 ALA B H    1 
ATOM   10396 H HA   . ALA B 1 230 ? 35.056  -62.979  6.344   1.00 27.82  ? 274 ALA B HA   1 
ATOM   10397 H HB1  . ALA B 1 230 ? 33.849  -63.970  8.090   1.00 20.85  ? 274 ALA B HB1  1 
ATOM   10398 H HB2  . ALA B 1 230 ? 34.881  -65.012  7.478   1.00 20.85  ? 274 ALA B HB2  1 
ATOM   10399 H HB3  . ALA B 1 230 ? 35.209  -64.281  8.851   1.00 20.85  ? 274 ALA B HB3  1 
ATOM   10400 N N    . GLY B 1 231 ? 34.548  -60.822  7.333   1.00 18.97  ? 275 GLY B N    1 
ATOM   10401 C CA   . GLY B 1 231 ? 34.336  -59.491  7.859   1.00 19.37  ? 275 GLY B CA   1 
ATOM   10402 C C    . GLY B 1 231 ? 34.952  -58.389  7.023   1.00 24.39  ? 275 GLY B C    1 
ATOM   10403 O O    . GLY B 1 231 ? 34.505  -57.238  7.116   1.00 25.59  ? 275 GLY B O    1 
ATOM   10404 H H    . GLY B 1 231 ? 34.144  -60.963  6.588   1.00 22.77  ? 275 GLY B H    1 
ATOM   10405 H HA2  . GLY B 1 231 ? 33.382  -59.323  7.922   1.00 23.25  ? 275 GLY B HA2  1 
ATOM   10406 H HA3  . GLY B 1 231 ? 34.712  -59.439  8.752   1.00 23.25  ? 275 GLY B HA3  1 
ATOM   10407 N N    . GLY B 1 232 ? 35.971  -58.701  6.217   1.00 16.98  ? 276 GLY B N    1 
ATOM   10408 C CA   . GLY B 1 232 ? 36.560  -57.702  5.343   1.00 21.58  ? 276 GLY B CA   1 
ATOM   10409 C C    . GLY B 1 232 ? 35.662  -57.300  4.193   1.00 16.13  ? 276 GLY B C    1 
ATOM   10410 O O    . GLY B 1 232 ? 35.900  -56.262  3.567   1.00 18.54  ? 276 GLY B O    1 
ATOM   10411 H H    . GLY B 1 232 ? 36.333  -59.480  6.163   1.00 20.38  ? 276 GLY B H    1 
ATOM   10412 H HA2  . GLY B 1 232 ? 36.765  -56.907  5.860   1.00 25.90  ? 276 GLY B HA2  1 
ATOM   10413 H HA3  . GLY B 1 232 ? 37.388  -58.048  4.975   1.00 25.90  ? 276 GLY B HA3  1 
ATOM   10414 N N    . THR B 1 233 ? 34.640  -58.102  3.906   1.00 16.29  ? 277 THR B N    1 
ATOM   10415 C CA   . THR B 1 233 ? 33.637  -57.833  2.869   1.00 22.63  ? 277 THR B CA   1 
ATOM   10416 C C    . THR B 1 233 ? 34.364  -57.593  1.543   1.00 17.99  ? 277 THR B C    1 
ATOM   10417 O O    . THR B 1 233 ? 35.275  -58.363  1.206   1.00 17.88  ? 277 THR B O    1 
ATOM   10418 C CB   . THR B 1 233 ? 32.716  -56.706  3.324   1.00 19.18  ? 277 THR B CB   1 
ATOM   10419 O OG1  . THR B 1 233 ? 33.478  -55.522  3.587   1.00 33.30  ? 277 THR B OG1  1 
ATOM   10420 C CG2  . THR B 1 233 ? 31.952  -57.116  4.578   1.00 31.43  ? 277 THR B CG2  1 
ATOM   10421 H H    . THR B 1 233 ? 34.498  -58.844  4.318   1.00 19.55  ? 277 THR B H    1 
ATOM   10422 H HA   . THR B 1 233 ? 33.089  -58.626  2.758   1.00 27.16  ? 277 THR B HA   1 
ATOM   10423 H HB   . THR B 1 233 ? 32.070  -56.521  2.624   1.00 23.02  ? 277 THR B HB   1 
ATOM   10424 H HG1  . THR B 1 233 ? 33.881  -55.279  2.891   1.00 39.96  ? 277 THR B HG1  1 
ATOM   10425 H HG21 . THR B 1 233 ? 31.369  -56.394  4.861   1.00 37.71  ? 277 THR B HG21 1 
ATOM   10426 H HG22 . THR B 1 233 ? 31.415  -57.903  4.396   1.00 37.71  ? 277 THR B HG22 1 
ATOM   10427 H HG23 . THR B 1 233 ? 32.575  -57.317  5.294   1.00 37.71  ? 277 THR B HG23 1 
ATOM   10428 N N    . ALA B 1 234 ? 34.017  -56.552  0.782   1.00 17.64  ? 278 ALA B N    1 
ATOM   10429 C CA   . ALA B 1 234 ? 34.395  -56.491  -0.627  1.00 22.69  ? 278 ALA B CA   1 
ATOM   10430 C C    . ALA B 1 234 ? 35.877  -56.184  -0.806  1.00 19.70  ? 278 ALA B C    1 
ATOM   10431 O O    . ALA B 1 234 ? 36.559  -56.833  -1.608  1.00 18.84  ? 278 ALA B O    1 
ATOM   10432 C CB   . ALA B 1 234 ? 33.542  -55.446  -1.347  1.00 29.34  ? 278 ALA B CB   1 
ATOM   10433 H H    . ALA B 1 234 ? 33.565  -55.874  1.058   1.00 21.17  ? 278 ALA B H    1 
ATOM   10434 H HA   . ALA B 1 234 ? 34.218  -57.352  -1.036  1.00 27.23  ? 278 ALA B HA   1 
ATOM   10435 H HB1  . ALA B 1 234 ? 33.802  -55.415  -2.281  1.00 35.22  ? 278 ALA B HB1  1 
ATOM   10436 H HB2  . ALA B 1 234 ? 32.607  -55.696  -1.272  1.00 35.22  ? 278 ALA B HB2  1 
ATOM   10437 H HB3  . ALA B 1 234 ? 33.687  -54.581  -0.934  1.00 35.22  ? 278 ALA B HB3  1 
ATOM   10438 N N    . VAL B 1 235 ? 36.392  -55.187  -0.088  1.00 25.54  ? 279 VAL B N    1 
ATOM   10439 C CA   . VAL B 1 235 ? 37.761  -54.719  -0.274  1.00 18.29  ? 279 VAL B CA   1 
ATOM   10440 C C    . VAL B 1 235 ? 38.574  -54.747  1.010   1.00 17.49  ? 279 VAL B C    1 
ATOM   10441 O O    . VAL B 1 235 ? 39.747  -54.362  0.991   1.00 23.46  ? 279 VAL B O    1 
ATOM   10442 C CB   . VAL B 1 235 ? 37.790  -53.303  -0.887  1.00 15.54  ? 279 VAL B CB   1 
ATOM   10443 C CG1  . VAL B 1 235 ? 37.026  -53.276  -2.204  1.00 21.04  ? 279 VAL B CG1  1 
ATOM   10444 C CG2  . VAL B 1 235 ? 37.223  -52.273  0.085   1.00 19.10  ? 279 VAL B CG2  1 
ATOM   10445 H H    . VAL B 1 235 ? 35.961  -54.760  0.522   1.00 30.65  ? 279 VAL B H    1 
ATOM   10446 H HA   . VAL B 1 235 ? 38.199  -55.313  -0.903  1.00 21.95  ? 279 VAL B HA   1 
ATOM   10447 H HB   . VAL B 1 235 ? 38.711  -53.061  -1.072  1.00 18.65  ? 279 VAL B HB   1 
ATOM   10448 H HG11 . VAL B 1 235 ? 37.058  -52.378  -2.569  1.00 25.25  ? 279 VAL B HG11 1 
ATOM   10449 H HG12 . VAL B 1 235 ? 37.440  -53.899  -2.822  1.00 25.25  ? 279 VAL B HG12 1 
ATOM   10450 H HG13 . VAL B 1 235 ? 36.105  -53.534  -2.040  1.00 25.25  ? 279 VAL B HG13 1 
ATOM   10451 H HG21 . VAL B 1 235 ? 37.256  -51.397  -0.329  1.00 22.92  ? 279 VAL B HG21 1 
ATOM   10452 H HG22 . VAL B 1 235 ? 36.305  -52.508  0.293   1.00 22.92  ? 279 VAL B HG22 1 
ATOM   10453 H HG23 . VAL B 1 235 ? 37.757  -52.277  0.895   1.00 22.92  ? 279 VAL B HG23 1 
ATOM   10454 N N    . GLY B 1 236 ? 37.996  -55.196  2.121   1.00 23.67  ? 280 GLY B N    1 
ATOM   10455 C CA   . GLY B 1 236 ? 38.687  -55.257  3.393   1.00 21.87  ? 280 GLY B CA   1 
ATOM   10456 C C    . GLY B 1 236 ? 38.198  -54.259  4.419   1.00 19.04  ? 280 GLY B C    1 
ATOM   10457 O O    . GLY B 1 236 ? 38.539  -54.395  5.601   1.00 24.98  ? 280 GLY B O    1 
ATOM   10458 H H    . GLY B 1 236 ? 37.183  -55.476  2.158   1.00 28.40  ? 280 GLY B H    1 
ATOM   10459 H HA2  . GLY B 1 236 ? 38.585  -56.146  3.767   1.00 26.25  ? 280 GLY B HA2  1 
ATOM   10460 H HA3  . GLY B 1 236 ? 39.633  -55.098  3.247   1.00 26.25  ? 280 GLY B HA3  1 
ATOM   10461 N N    . THR B 1 237 ? 37.408  -53.262  4.013   1.00 19.62  ? 281 THR B N    1 
ATOM   10462 C CA   . THR B 1 237 ? 36.924  -52.259  4.954   1.00 19.75  ? 281 THR B CA   1 
ATOM   10463 C C    . THR B 1 237 ? 35.851  -52.803  5.886   1.00 20.58  ? 281 THR B C    1 
ATOM   10464 O O    . THR B 1 237 ? 35.650  -52.243  6.967   1.00 22.53  ? 281 THR B O    1 
ATOM   10465 C CB   . THR B 1 237 ? 36.358  -51.051  4.205   1.00 24.28  ? 281 THR B CB   1 
ATOM   10466 O OG1  . THR B 1 237 ? 35.352  -51.486  3.281   1.00 20.01  ? 281 THR B OG1  1 
ATOM   10467 C CG2  . THR B 1 237 ? 37.455  -50.313  3.457   1.00 23.18  ? 281 THR B CG2  1 
ATOM   10468 H H    . THR B 1 237 ? 37.141  -53.148  3.203   1.00 23.54  ? 281 THR B H    1 
ATOM   10469 H HA   . THR B 1 237 ? 37.666  -51.954  5.498   1.00 23.70  ? 281 THR B HA   1 
ATOM   10470 H HB   . THR B 1 237 ? 35.961  -50.438  4.843   1.00 29.14  ? 281 THR B HB   1 
ATOM   10471 H HG1  . THR B 1 237 ? 35.037  -50.826  2.867   1.00 24.02  ? 281 THR B HG1  1 
ATOM   10472 H HG21 . THR B 1 237 ? 37.081  -49.551  2.987   1.00 27.82  ? 281 THR B HG21 1 
ATOM   10473 H HG22 . THR B 1 237 ? 38.128  -49.999  4.081   1.00 27.82  ? 281 THR B HG22 1 
ATOM   10474 H HG23 . THR B 1 237 ? 37.873  -50.905  2.812   1.00 27.82  ? 281 THR B HG23 1 
ATOM   10475 N N    . GLY B 1 238 ? 35.163  -53.873  5.499   1.00 24.34  ? 282 GLY B N    1 
ATOM   10476 C CA   . GLY B 1 238 ? 34.000  -54.321  6.232   1.00 24.05  ? 282 GLY B CA   1 
ATOM   10477 C C    . GLY B 1 238 ? 32.731  -53.572  5.902   1.00 30.09  ? 282 GLY B C    1 
ATOM   10478 O O    . GLY B 1 238 ? 31.744  -53.700  6.634   1.00 24.00  ? 282 GLY B O    1 
ATOM   10479 H H    . GLY B 1 238 ? 35.354  -54.354  4.812   1.00 29.21  ? 282 GLY B H    1 
ATOM   10480 H HA2  . GLY B 1 238 ? 33.852  -55.261  6.047   1.00 28.86  ? 282 GLY B HA2  1 
ATOM   10481 H HA3  . GLY B 1 238 ? 34.169  -54.224  7.183   1.00 28.86  ? 282 GLY B HA3  1 
ATOM   10482 N N    . LEU B 1 239 ? 32.727  -52.787  4.829   1.00 26.60  ? 283 LEU B N    1 
ATOM   10483 C CA   . LEU B 1 239 ? 31.522  -52.078  4.427   1.00 29.04  ? 283 LEU B CA   1 
ATOM   10484 C C    . LEU B 1 239 ? 30.370  -53.057  4.245   1.00 28.60  ? 283 LEU B C    1 
ATOM   10485 O O    . LEU B 1 239 ? 30.526  -54.107  3.616   1.00 24.28  ? 283 LEU B O    1 
ATOM   10486 C CB   . LEU B 1 239 ? 31.775  -51.310  3.129   1.00 30.33  ? 283 LEU B CB   1 
ATOM   10487 C CG   . LEU B 1 239 ? 30.593  -50.521  2.563   1.00 30.29  ? 283 LEU B CG   1 
ATOM   10488 C CD1  . LEU B 1 239 ? 30.219  -49.379  3.492   1.00 29.26  ? 283 LEU B CD1  1 
ATOM   10489 C CD2  . LEU B 1 239 ? 30.920  -50.000  1.173   1.00 26.91  ? 283 LEU B CD2  1 
ATOM   10490 H H    . LEU B 1 239 ? 33.406  -52.650  4.320   1.00 31.93  ? 283 LEU B H    1 
ATOM   10491 H HA   . LEU B 1 239 ? 31.277  -51.441  5.116   1.00 34.85  ? 283 LEU B HA   1 
ATOM   10492 H HB2  . LEU B 1 239 ? 32.495  -50.678  3.285   1.00 36.40  ? 283 LEU B HB2  1 
ATOM   10493 H HB3  . LEU B 1 239 ? 32.049  -51.946  2.449   1.00 36.40  ? 283 LEU B HB3  1 
ATOM   10494 H HG   . LEU B 1 239 ? 29.826  -51.110  2.489   1.00 36.35  ? 283 LEU B HG   1 
ATOM   10495 H HD11 . LEU B 1 239 ? 29.469  -48.896  3.112   1.00 35.12  ? 283 LEU B HD11 1 
ATOM   10496 H HD12 . LEU B 1 239 ? 29.973  -49.744  4.357   1.00 35.12  ? 283 LEU B HD12 1 
ATOM   10497 H HD13 . LEU B 1 239 ? 30.981  -48.787  3.587   1.00 35.12  ? 283 LEU B HD13 1 
ATOM   10498 H HD21 . LEU B 1 239 ? 30.158  -49.504  0.835   1.00 32.30  ? 283 LEU B HD21 1 
ATOM   10499 H HD22 . LEU B 1 239 ? 31.695  -49.420  1.228   1.00 32.30  ? 283 LEU B HD22 1 
ATOM   10500 H HD23 . LEU B 1 239 ? 31.110  -50.753  0.591   1.00 32.30  ? 283 LEU B HD23 1 
ATOM   10501 N N    . ASN B 1 240 ? 29.215  -52.710  4.812   1.00 27.94  ? 284 ASN B N    1 
ATOM   10502 C CA   . ASN B 1 240 ? 27.970  -53.459  4.667   1.00 30.94  ? 284 ASN B CA   1 
ATOM   10503 C C    . ASN B 1 240 ? 27.981  -54.790  5.413   1.00 28.76  ? 284 ASN B C    1 
ATOM   10504 O O    . ASN B 1 240 ? 27.224  -55.703  5.067   1.00 32.50  ? 284 ASN B O    1 
ATOM   10505 C CB   . ASN B 1 240 ? 27.620  -53.679  3.190   1.00 32.13  ? 284 ASN B CB   1 
ATOM   10506 C CG   . ASN B 1 240 ? 27.257  -52.383  2.486   1.00 59.42  ? 284 ASN B CG   1 
ATOM   10507 O OD1  . ASN B 1 240 ? 26.675  -51.479  3.089   1.00 39.45  ? 284 ASN B OD1  1 
ATOM   10508 N ND2  . ASN B 1 240 ? 27.605  -52.281  1.211   1.00 62.53  ? 284 ASN B ND2  1 
ATOM   10509 H H    . ASN B 1 240 ? 29.128  -52.013  5.308   1.00 33.54  ? 284 ASN B H    1 
ATOM   10510 H HA   . ASN B 1 240 ? 27.255  -52.927  5.051   1.00 37.14  ? 284 ASN B HA   1 
ATOM   10511 H HB2  . ASN B 1 240 ? 28.386  -54.064  2.736   1.00 38.56  ? 284 ASN B HB2  1 
ATOM   10512 H HB3  . ASN B 1 240 ? 26.860  -54.278  3.129   1.00 38.56  ? 284 ASN B HB3  1 
ATOM   10513 H HD21 . ASN B 1 240 ? 27.421  -51.566  0.771   1.00 75.04  ? 284 ASN B HD21 1 
ATOM   10514 H HD22 . ASN B 1 240 ? 28.016  -52.930  0.824   1.00 75.04  ? 284 ASN B HD22 1 
ATOM   10515 N N    . THR B 1 241 ? 28.823  -54.921  6.431   1.00 28.92  ? 285 THR B N    1 
ATOM   10516 C CA   . THR B 1 241 ? 28.657  -55.930  7.463   1.00 30.40  ? 285 THR B CA   1 
ATOM   10517 C C    . THR B 1 241 ? 28.602  -55.218  8.808   1.00 21.97  ? 285 THR B C    1 
ATOM   10518 O O    . THR B 1 241 ? 28.838  -54.010  8.909   1.00 38.54  ? 285 THR B O    1 
ATOM   10519 C CB   . THR B 1 241 ? 29.782  -56.980  7.433   1.00 26.73  ? 285 THR B CB   1 
ATOM   10520 O OG1  . THR B 1 241 ? 29.364  -58.155  8.139   1.00 38.00  ? 285 THR B OG1  1 
ATOM   10521 C CG2  . THR B 1 241 ? 31.069  -56.459  8.058   1.00 26.49  ? 285 THR B CG2  1 
ATOM   10522 H H    . THR B 1 241 ? 29.515  -54.423  6.547   1.00 34.71  ? 285 THR B H    1 
ATOM   10523 H HA   . THR B 1 241 ? 27.813  -56.388  7.328   1.00 36.48  ? 285 THR B HA   1 
ATOM   10524 H HB   . THR B 1 241 ? 29.970  -57.215  6.511   1.00 32.08  ? 285 THR B HB   1 
ATOM   10525 H HG1  . THR B 1 241 ? 29.975  -58.731  8.125   1.00 45.60  ? 285 THR B HG1  1 
ATOM   10526 H HG21 . THR B 1 241 ? 31.755  -57.144  8.023   1.00 31.79  ? 285 THR B HG21 1 
ATOM   10527 H HG22 . THR B 1 241 ? 31.380  -55.677  7.575   1.00 31.79  ? 285 THR B HG22 1 
ATOM   10528 H HG23 . THR B 1 241 ? 30.914  -56.217  8.985   1.00 31.79  ? 285 THR B HG23 1 
ATOM   10529 N N    . ARG B 1 242 ? 28.288  -55.972  9.852   1.00 29.78  ? 286 ARG B N    1 
ATOM   10530 C CA   . ARG B 1 242 ? 28.006  -55.392  11.156  1.00 25.84  ? 286 ARG B CA   1 
ATOM   10531 C C    . ARG B 1 242 ? 29.236  -55.419  12.053  1.00 28.17  ? 286 ARG B C    1 
ATOM   10532 O O    . ARG B 1 242 ? 30.056  -56.340  11.996  1.00 23.06  ? 286 ARG B O    1 
ATOM   10533 C CB   . ARG B 1 242 ? 26.856  -56.139  11.828  1.00 39.15  ? 286 ARG B CB   1 
ATOM   10534 C CG   . ARG B 1 242 ? 25.588  -56.195  10.986  1.00 38.87  ? 286 ARG B CG   1 
ATOM   10535 C CD   . ARG B 1 242 ? 25.016  -54.808  10.739  1.00 61.04  ? 286 ARG B CD   1 
ATOM   10536 N NE   . ARG B 1 242 ? 24.711  -54.117  11.989  1.00 59.60  ? 286 ARG B NE   1 
ATOM   10537 C CZ   . ARG B 1 242 ? 23.603  -54.305  12.701  1.00 49.83  ? 286 ARG B CZ   1 
ATOM   10538 N NH1  . ARG B 1 242 ? 22.680  -55.166  12.294  1.00 47.25  ? 286 ARG B NH1  1 
ATOM   10539 N NH2  . ARG B 1 242 ? 23.419  -53.630  13.826  1.00 45.81  ? 286 ARG B NH2  1 
ATOM   10540 H H    . ARG B 1 242 ? 28.231  -56.829  9.831   1.00 35.74  ? 286 ARG B H    1 
ATOM   10541 H HA   . ARG B 1 242 ? 27.738  -54.467  11.040  1.00 31.01  ? 286 ARG B HA   1 
ATOM   10542 H HB2  . ARG B 1 242 ? 27.135  -57.051  12.005  1.00 46.99  ? 286 ARG B HB2  1 
ATOM   10543 H HB3  . ARG B 1 242 ? 26.639  -55.694  12.662  1.00 46.99  ? 286 ARG B HB3  1 
ATOM   10544 H HG2  . ARG B 1 242 ? 25.792  -56.596  10.127  1.00 46.65  ? 286 ARG B HG2  1 
ATOM   10545 H HG3  . ARG B 1 242 ? 24.918  -56.721  11.451  1.00 46.65  ? 286 ARG B HG3  1 
ATOM   10546 H HD2  . ARG B 1 242 ? 25.664  -54.277  10.250  1.00 73.25  ? 286 ARG B HD2  1 
ATOM   10547 H HD3  . ARG B 1 242 ? 24.195  -54.887  10.229  1.00 73.25  ? 286 ARG B HD3  1 
ATOM   10548 H HE   . ARG B 1 242 ? 25.287  -53.551  12.285  1.00 71.52  ? 286 ARG B HE   1 
ATOM   10549 H HH11 . ARG B 1 242 ? 22.795  -55.608  11.565  1.00 56.70  ? 286 ARG B HH11 1 
ATOM   10550 H HH12 . ARG B 1 242 ? 21.966  -55.283  12.759  1.00 56.70  ? 286 ARG B HH12 1 
ATOM   10551 H HH21 . ARG B 1 242 ? 24.015  -53.070  14.094  1.00 54.98  ? 286 ARG B HH21 1 
ATOM   10552 H HH22 . ARG B 1 242 ? 22.704  -53.750  14.288  1.00 54.98  ? 286 ARG B HH22 1 
ATOM   10553 N N    . ILE B 1 243 ? 29.355  -54.385  12.889  1.00 20.59  ? 287 ILE B N    1 
ATOM   10554 C CA   . ILE B 1 243 ? 30.420  -54.344  13.881  1.00 27.03  ? 287 ILE B CA   1 
ATOM   10555 C C    . ILE B 1 243 ? 30.293  -55.553  14.795  1.00 32.19  ? 287 ILE B C    1 
ATOM   10556 O O    . ILE B 1 243 ? 29.211  -55.847  15.319  1.00 25.08  ? 287 ILE B O    1 
ATOM   10557 C CB   . ILE B 1 243 ? 30.361  -53.030  14.675  1.00 24.94  ? 287 ILE B CB   1 
ATOM   10558 C CG1  . ILE B 1 243 ? 30.648  -51.840  13.756  1.00 33.78  ? 287 ILE B CG1  1 
ATOM   10559 C CG2  . ILE B 1 243 ? 31.356  -53.052  15.830  1.00 22.78  ? 287 ILE B CG2  1 
ATOM   10560 C CD1  . ILE B 1 243 ? 30.353  -50.490  14.382  1.00 40.16  ? 287 ILE B CD1  1 
ATOM   10561 H H    . ILE B 1 243 ? 28.833  -53.702  12.899  1.00 24.71  ? 287 ILE B H    1 
ATOM   10562 H HA   . ILE B 1 243 ? 31.279  -54.390  13.433  1.00 32.44  ? 287 ILE B HA   1 
ATOM   10563 H HB   . ILE B 1 243 ? 29.467  -52.930  15.040  1.00 29.93  ? 287 ILE B HB   1 
ATOM   10564 H HG12 . ILE B 1 243 ? 31.587  -51.854  13.512  1.00 40.53  ? 287 ILE B HG12 1 
ATOM   10565 H HG13 . ILE B 1 243 ? 30.101  -51.922  12.959  1.00 40.53  ? 287 ILE B HG13 1 
ATOM   10566 H HG21 . ILE B 1 243 ? 31.297  -52.212  16.312  1.00 27.33  ? 287 ILE B HG21 1 
ATOM   10567 H HG22 . ILE B 1 243 ? 31.138  -53.790  16.420  1.00 27.33  ? 287 ILE B HG22 1 
ATOM   10568 H HG23 . ILE B 1 243 ? 32.250  -53.166  15.472  1.00 27.33  ? 287 ILE B HG23 1 
ATOM   10569 H HD11 . ILE B 1 243 ? 30.560  -49.793  13.740  1.00 48.19  ? 287 ILE B HD11 1 
ATOM   10570 H HD12 . ILE B 1 243 ? 29.414  -50.452  14.621  1.00 48.19  ? 287 ILE B HD12 1 
ATOM   10571 H HD13 . ILE B 1 243 ? 30.902  -50.384  15.175  1.00 48.19  ? 287 ILE B HD13 1 
ATOM   10572 N N    . GLY B 1 244 ? 31.404  -56.261  14.991  1.00 34.16  ? 288 GLY B N    1 
ATOM   10573 C CA   . GLY B 1 244 ? 31.428  -57.455  15.802  1.00 21.32  ? 288 GLY B CA   1 
ATOM   10574 C C    . GLY B 1 244 ? 31.216  -58.747  15.042  1.00 20.13  ? 288 GLY B C    1 
ATOM   10575 O O    . GLY B 1 244 ? 31.503  -59.821  15.584  1.00 24.13  ? 288 GLY B O    1 
ATOM   10576 H H    . GLY B 1 244 ? 32.169  -56.059  14.653  1.00 40.99  ? 288 GLY B H    1 
ATOM   10577 H HA2  . GLY B 1 244 ? 32.284  -57.512  16.254  1.00 25.59  ? 288 GLY B HA2  1 
ATOM   10578 H HA3  . GLY B 1 244 ? 30.736  -57.390  16.479  1.00 25.59  ? 288 GLY B HA3  1 
ATOM   10579 N N    . PHE B 1 245 ? 30.724  -58.680  13.803  1.00 20.92  ? 289 PHE B N    1 
ATOM   10580 C CA   . PHE B 1 245 ? 30.517  -59.895  13.021  1.00 22.57  ? 289 PHE B CA   1 
ATOM   10581 C C    . PHE B 1 245 ? 31.830  -60.638  12.807  1.00 24.40  ? 289 PHE B C    1 
ATOM   10582 O O    . PHE B 1 245 ? 31.903  -61.859  12.986  1.00 17.39  ? 289 PHE B O    1 
ATOM   10583 C CB   . PHE B 1 245 ? 29.874  -59.554  11.676  1.00 16.65  ? 289 PHE B CB   1 
ATOM   10584 C CG   . PHE B 1 245 ? 29.664  -60.746  10.788  1.00 23.54  ? 289 PHE B CG   1 
ATOM   10585 C CD1  . PHE B 1 245 ? 28.651  -61.652  11.049  1.00 23.55  ? 289 PHE B CD1  1 
ATOM   10586 C CD2  . PHE B 1 245 ? 30.483  -60.962  9.693   1.00 25.99  ? 289 PHE B CD2  1 
ATOM   10587 C CE1  . PHE B 1 245 ? 28.457  -62.752  10.234  1.00 31.07  ? 289 PHE B CE1  1 
ATOM   10588 C CE2  . PHE B 1 245 ? 30.294  -62.060  8.874   1.00 23.98  ? 289 PHE B CE2  1 
ATOM   10589 C CZ   . PHE B 1 245 ? 29.279  -62.956  9.145   1.00 33.22  ? 289 PHE B CZ   1 
ATOM   10590 H H    . PHE B 1 245 ? 30.506  -57.953  13.399  1.00 25.10  ? 289 PHE B H    1 
ATOM   10591 H HA   . PHE B 1 245 ? 29.914  -60.483  13.503  1.00 27.09  ? 289 PHE B HA   1 
ATOM   10592 H HB2  . PHE B 1 245 ? 29.009  -59.147  11.837  1.00 19.99  ? 289 PHE B HB2  1 
ATOM   10593 H HB3  . PHE B 1 245 ? 30.448  -58.930  11.205  1.00 19.99  ? 289 PHE B HB3  1 
ATOM   10594 H HD1  . PHE B 1 245 ? 28.094  -61.520  11.782  1.00 28.27  ? 289 PHE B HD1  1 
ATOM   10595 H HD2  . PHE B 1 245 ? 31.168  -60.362  9.506   1.00 31.19  ? 289 PHE B HD2  1 
ATOM   10596 H HE1  . PHE B 1 245 ? 27.773  -63.354  10.419  1.00 37.29  ? 289 PHE B HE1  1 
ATOM   10597 H HE2  . PHE B 1 245 ? 30.849  -62.195  8.140   1.00 28.78  ? 289 PHE B HE2  1 
ATOM   10598 H HZ   . PHE B 1 245 ? 29.150  -63.695  8.595   1.00 39.87  ? 289 PHE B HZ   1 
ATOM   10599 N N    . ALA B 1 246 ? 32.881  -59.913  12.416  1.00 18.69  ? 290 ALA B N    1 
ATOM   10600 C CA   . ALA B 1 246 ? 34.164  -60.549  12.133  1.00 21.34  ? 290 ALA B CA   1 
ATOM   10601 C C    . ALA B 1 246 ? 34.645  -61.367  13.324  1.00 18.15  ? 290 ALA B C    1 
ATOM   10602 O O    . ALA B 1 246 ? 34.989  -62.547  13.185  1.00 18.60  ? 290 ALA B O    1 
ATOM   10603 C CB   . ALA B 1 246 ? 35.202  -59.489  11.761  1.00 14.25  ? 290 ALA B CB   1 
ATOM   10604 H H    . ALA B 1 246 ? 32.875  -59.060  12.308  1.00 22.44  ? 290 ALA B H    1 
ATOM   10605 H HA   . ALA B 1 246 ? 34.062  -61.148  11.378  1.00 25.61  ? 290 ALA B HA   1 
ATOM   10606 H HB1  . ALA B 1 246 ? 36.048  -59.927  11.577  1.00 17.11  ? 290 ALA B HB1  1 
ATOM   10607 H HB2  . ALA B 1 246 ? 34.897  -59.013  10.973  1.00 17.11  ? 290 ALA B HB2  1 
ATOM   10608 H HB3  . ALA B 1 246 ? 35.303  -58.872  12.502  1.00 17.11  ? 290 ALA B HB3  1 
ATOM   10609 N N    . GLU B 1 247 ? 34.678  -60.754  14.508  1.00 17.14  ? 291 GLU B N    1 
ATOM   10610 C CA   . GLU B 1 247 ? 35.169  -61.456  15.687  1.00 22.60  ? 291 GLU B CA   1 
ATOM   10611 C C    . GLU B 1 247 ? 34.223  -62.571  16.115  1.00 16.59  ? 291 GLU B C    1 
ATOM   10612 O O    . GLU B 1 247 ? 34.675  -63.592  16.645  1.00 23.81  ? 291 GLU B O    1 
ATOM   10613 C CB   . GLU B 1 247 ? 35.381  -60.473  16.840  1.00 21.44  ? 291 GLU B CB   1 
ATOM   10614 C CG   . GLU B 1 247 ? 36.479  -59.443  16.599  1.00 28.52  ? 291 GLU B CG   1 
ATOM   10615 C CD   . GLU B 1 247 ? 36.014  -58.252  15.778  1.00 23.19  ? 291 GLU B CD   1 
ATOM   10616 O OE1  . GLU B 1 247 ? 34.825  -58.208  15.399  1.00 21.90  ? 291 GLU B OE1  1 
ATOM   10617 O OE2  . GLU B 1 247 ? 36.842  -57.356  15.513  1.00 22.30  ? 291 GLU B OE2  1 
ATOM   10618 H H    . GLU B 1 247 ? 34.426  -59.944  14.651  1.00 20.58  ? 291 GLU B H    1 
ATOM   10619 H HA   . GLU B 1 247 ? 36.027  -61.858  15.478  1.00 27.12  ? 291 GLU B HA   1 
ATOM   10620 H HB2  . GLU B 1 247 ? 34.553  -59.990  16.991  1.00 25.73  ? 291 GLU B HB2  1 
ATOM   10621 H HB3  . GLU B 1 247 ? 35.617  -60.974  17.636  1.00 25.73  ? 291 GLU B HB3  1 
ATOM   10622 H HG2  . GLU B 1 247 ? 36.792  -59.111  17.455  1.00 34.23  ? 291 GLU B HG2  1 
ATOM   10623 H HG3  . GLU B 1 247 ? 37.209  -59.867  16.122  1.00 34.23  ? 291 GLU B HG3  1 
ATOM   10624 N N    . LYS B 1 248 ? 32.918  -62.406  15.888  1.00 17.68  ? 292 LYS B N    1 
ATOM   10625 C CA   . LYS B 1 248 ? 31.955  -63.396  16.363  1.00 12.18  ? 292 LYS B CA   1 
ATOM   10626 C C    . LYS B 1 248 ? 31.935  -64.642  15.486  1.00 21.35  ? 292 LYS B C    1 
ATOM   10627 O O    . LYS B 1 248 ? 31.868  -65.763  16.003  1.00 17.52  ? 292 LYS B O    1 
ATOM   10628 C CB   . LYS B 1 248 ? 30.560  -62.780  16.440  1.00 16.98  ? 292 LYS B CB   1 
ATOM   10629 C CG   . LYS B 1 248 ? 30.369  -61.871  17.642  1.00 21.07  ? 292 LYS B CG   1 
ATOM   10630 C CD   . LYS B 1 248 ? 28.945  -61.364  17.740  1.00 26.59  ? 292 LYS B CD   1 
ATOM   10631 C CE   . LYS B 1 248 ? 28.796  -60.386  18.891  1.00 26.95  ? 292 LYS B CE   1 
ATOM   10632 N NZ   . LYS B 1 248 ? 27.565  -60.642  19.684  1.00 50.60  ? 292 LYS B NZ   1 
ATOM   10633 H H    . LYS B 1 248 ? 32.570  -61.740  15.469  1.00 21.22  ? 292 LYS B H    1 
ATOM   10634 H HA   . LYS B 1 248 ? 32.207  -63.670  17.259  1.00 14.62  ? 292 LYS B HA   1 
ATOM   10635 H HB2  . LYS B 1 248 ? 30.405  -62.254  15.640  1.00 20.37  ? 292 LYS B HB2  1 
ATOM   10636 H HB3  . LYS B 1 248 ? 29.905  -63.493  16.498  1.00 20.37  ? 292 LYS B HB3  1 
ATOM   10637 H HG2  . LYS B 1 248 ? 30.572  -62.366  18.451  1.00 25.29  ? 292 LYS B HG2  1 
ATOM   10638 H HG3  . LYS B 1 248 ? 30.959  -61.106  17.560  1.00 25.29  ? 292 LYS B HG3  1 
ATOM   10639 H HD2  . LYS B 1 248 ? 28.708  -60.907  16.918  1.00 31.91  ? 292 LYS B HD2  1 
ATOM   10640 H HD3  . LYS B 1 248 ? 28.346  -62.112  17.895  1.00 31.91  ? 292 LYS B HD3  1 
ATOM   10641 H HE2  . LYS B 1 248 ? 29.560  -60.471  19.482  1.00 32.34  ? 292 LYS B HE2  1 
ATOM   10642 H HE3  . LYS B 1 248 ? 28.745  -59.484  18.537  1.00 32.34  ? 292 LYS B HE3  1 
ATOM   10643 H HZ1  . LYS B 1 248 ? 27.505  -60.055  20.350  1.00 60.72  ? 292 LYS B HZ1  1 
ATOM   10644 H HZ2  . LYS B 1 248 ? 26.847  -60.565  19.164  1.00 60.72  ? 292 LYS B HZ2  1 
ATOM   10645 H HZ3  . LYS B 1 248 ? 27.589  -61.464  20.024  1.00 60.72  ? 292 LYS B HZ3  1 
ATOM   10646 N N    . VAL B 1 249 ? 31.982  -64.478  14.164  1.00 15.76  ? 293 VAL B N    1 
ATOM   10647 C CA   . VAL B 1 249 ? 31.949  -65.648  13.294  1.00 19.69  ? 293 VAL B CA   1 
ATOM   10648 C C    . VAL B 1 249 ? 33.239  -66.448  13.434  1.00 17.34  ? 293 VAL B C    1 
ATOM   10649 O O    . VAL B 1 249 ? 33.222  -67.683  13.400  1.00 20.24  ? 293 VAL B O    1 
ATOM   10650 C CB   . VAL B 1 249 ? 31.683  -65.232  11.833  1.00 21.00  ? 293 VAL B CB   1 
ATOM   10651 C CG1  . VAL B 1 249 ? 32.844  -64.434  11.262  1.00 23.55  ? 293 VAL B CG1  1 
ATOM   10652 C CG2  . VAL B 1 249 ? 31.395  -66.456  10.974  1.00 30.98  ? 293 VAL B CG2  1 
ATOM   10653 H H    . VAL B 1 249 ? 32.032  -63.722  13.757  1.00 18.92  ? 293 VAL B H    1 
ATOM   10654 H HA   . VAL B 1 249 ? 31.218  -66.220  13.573  1.00 23.64  ? 293 VAL B HA   1 
ATOM   10655 H HB   . VAL B 1 249 ? 30.897  -64.665  11.811  1.00 25.21  ? 293 VAL B HB   1 
ATOM   10656 H HG11 . VAL B 1 249 ? 32.639  -64.192  10.345  1.00 28.26  ? 293 VAL B HG11 1 
ATOM   10657 H HG12 . VAL B 1 249 ? 32.969  -63.633  11.796  1.00 28.26  ? 293 VAL B HG12 1 
ATOM   10658 H HG13 . VAL B 1 249 ? 33.646  -64.979  11.290  1.00 28.26  ? 293 VAL B HG13 1 
ATOM   10659 H HG21 . VAL B 1 249 ? 31.231  -66.169  10.062  1.00 37.18  ? 293 VAL B HG21 1 
ATOM   10660 H HG22 . VAL B 1 249 ? 32.163  -67.049  11.002  1.00 37.18  ? 293 VAL B HG22 1 
ATOM   10661 H HG23 . VAL B 1 249 ? 30.613  -66.910  11.324  1.00 37.18  ? 293 VAL B HG23 1 
ATOM   10662 N N    . ALA B 1 250 ? 34.373  -65.763  13.612  1.00 21.48  ? 294 ALA B N    1 
ATOM   10663 C CA   . ALA B 1 250 ? 35.639  -66.468  13.793  1.00 17.57  ? 294 ALA B CA   1 
ATOM   10664 C C    . ALA B 1 250 ? 35.639  -67.275  15.085  1.00 14.19  ? 294 ALA B C    1 
ATOM   10665 O O    . ALA B 1 250 ? 36.105  -68.421  15.112  1.00 14.83  ? 294 ALA B O    1 
ATOM   10666 C CB   . ALA B 1 250 ? 36.804  -65.478  13.787  1.00 14.51  ? 294 ALA B CB   1 
ATOM   10667 H H    . ALA B 1 250 ? 34.433  -64.905  13.631  1.00 25.77  ? 294 ALA B H    1 
ATOM   10668 H HA   . ALA B 1 250 ? 35.766  -67.085  13.055  1.00 21.08  ? 294 ALA B HA   1 
ATOM   10669 H HB1  . ALA B 1 250 ? 37.633  -65.966  13.909  1.00 17.41  ? 294 ALA B HB1  1 
ATOM   10670 H HB2  . ALA B 1 250 ? 36.816  -65.011  12.937  1.00 17.41  ? 294 ALA B HB2  1 
ATOM   10671 H HB3  . ALA B 1 250 ? 36.683  -64.845  14.512  1.00 17.41  ? 294 ALA B HB3  1 
ATOM   10672 N N    . ALA B 1 251 ? 35.123  -66.692  16.169  1.00 18.91  ? 295 ALA B N    1 
ATOM   10673 C CA   . ALA B 1 251 ? 35.026  -67.427  17.424  1.00 16.60  ? 295 ALA B CA   1 
ATOM   10674 C C    . ALA B 1 251 ? 34.057  -68.594  17.309  1.00 19.98  ? 295 ALA B C    1 
ATOM   10675 O O    . ALA B 1 251 ? 34.272  -69.643  17.928  1.00 14.91  ? 295 ALA B O    1 
ATOM   10676 C CB   . ALA B 1 251 ? 34.597  -66.489  18.551  1.00 17.30  ? 295 ALA B CB   1 
ATOM   10677 H H    . ALA B 1 251 ? 34.827  -65.885  16.202  1.00 22.69  ? 295 ALA B H    1 
ATOM   10678 H HA   . ALA B 1 251 ? 35.900  -67.784  17.649  1.00 19.92  ? 295 ALA B HA   1 
ATOM   10679 H HB1  . ALA B 1 251 ? 34.538  -66.995  19.377  1.00 20.76  ? 295 ALA B HB1  1 
ATOM   10680 H HB2  . ALA B 1 251 ? 35.255  -65.783  18.641  1.00 20.76  ? 295 ALA B HB2  1 
ATOM   10681 H HB3  . ALA B 1 251 ? 33.731  -66.110  18.332  1.00 20.76  ? 295 ALA B HB3  1 
ATOM   10682 N N    . LYS B 1 252 ? 32.993  -68.436  16.521  1.00 19.91  ? 296 LYS B N    1 
ATOM   10683 C CA   . LYS B 1 252 ? 32.070  -69.543  16.306  1.00 18.89  ? 296 LYS B CA   1 
ATOM   10684 C C    . LYS B 1 252 ? 32.733  -70.657  15.506  1.00 14.68  ? 296 LYS B C    1 
ATOM   10685 O O    . LYS B 1 252 ? 32.531  -71.842  15.796  1.00 19.38  ? 296 LYS B O    1 
ATOM   10686 C CB   . LYS B 1 252 ? 30.809  -69.045  15.602  1.00 14.28  ? 296 LYS B CB   1 
ATOM   10687 C CG   . LYS B 1 252 ? 29.739  -70.110  15.387  1.00 32.14  ? 296 LYS B CG   1 
ATOM   10688 C CD   . LYS B 1 252 ? 29.241  -70.719  16.695  1.00 39.13  ? 296 LYS B CD   1 
ATOM   10689 C CE   . LYS B 1 252 ? 28.557  -69.687  17.584  1.00 43.82  ? 296 LYS B CE   1 
ATOM   10690 N NZ   . LYS B 1 252 ? 27.980  -70.306  18.811  1.00 49.22  ? 296 LYS B NZ   1 
ATOM   10691 H H    . LYS B 1 252 ? 32.788  -67.711  16.107  1.00 23.89  ? 296 LYS B H    1 
ATOM   10692 H HA   . LYS B 1 252 ? 31.809  -69.908  17.167  1.00 22.67  ? 296 LYS B HA   1 
ATOM   10693 H HB2  . LYS B 1 252 ? 30.416  -68.336  16.135  1.00 17.14  ? 296 LYS B HB2  1 
ATOM   10694 H HB3  . LYS B 1 252 ? 31.057  -68.698  14.730  1.00 17.14  ? 296 LYS B HB3  1 
ATOM   10695 H HG2  . LYS B 1 252 ? 28.980  -69.708  14.936  1.00 38.57  ? 296 LYS B HG2  1 
ATOM   10696 H HG3  . LYS B 1 252 ? 30.108  -70.824  14.845  1.00 38.57  ? 296 LYS B HG3  1 
ATOM   10697 H HD2  . LYS B 1 252 ? 28.599  -71.419  16.496  1.00 46.96  ? 296 LYS B HD2  1 
ATOM   10698 H HD3  . LYS B 1 252 ? 29.995  -71.086  17.183  1.00 46.96  ? 296 LYS B HD3  1 
ATOM   10699 H HE2  . LYS B 1 252 ? 29.207  -69.021  17.858  1.00 52.59  ? 296 LYS B HE2  1 
ATOM   10700 H HE3  . LYS B 1 252 ? 27.836  -69.267  17.089  1.00 52.59  ? 296 LYS B HE3  1 
ATOM   10701 H HZ1  . LYS B 1 252 ? 28.624  -70.695  19.286  1.00 59.06  ? 296 LYS B HZ1  1 
ATOM   10702 H HZ2  . LYS B 1 252 ? 27.588  -69.682  19.310  1.00 59.06  ? 296 LYS B HZ2  1 
ATOM   10703 H HZ3  . LYS B 1 252 ? 27.375  -70.919  18.586  1.00 59.06  ? 296 LYS B HZ3  1 
ATOM   10704 N N    . VAL B 1 253 ? 33.535  -70.301  14.499  1.00 17.88  ? 297 VAL B N    1 
ATOM   10705 C CA   . VAL B 1 253 ? 34.279  -71.317  13.762  1.00 22.38  ? 297 VAL B CA   1 
ATOM   10706 C C    . VAL B 1 253 ? 35.262  -72.020  14.688  1.00 13.97  ? 297 VAL B C    1 
ATOM   10707 O O    . VAL B 1 253 ? 35.396  -73.250  14.660  1.00 18.49  ? 297 VAL B O    1 
ATOM   10708 C CB   . VAL B 1 253 ? 34.991  -70.690  12.548  1.00 23.99  ? 297 VAL B CB   1 
ATOM   10709 C CG1  . VAL B 1 253 ? 35.887  -71.714  11.856  1.00 17.04  ? 297 VAL B CG1  1 
ATOM   10710 C CG2  . VAL B 1 253 ? 33.972  -70.150  11.557  1.00 24.05  ? 297 VAL B CG2  1 
ATOM   10711 H H    . VAL B 1 253 ? 33.661  -69.494  14.230  1.00 21.46  ? 297 VAL B H    1 
ATOM   10712 H HA   . VAL B 1 253 ? 33.656  -71.982  13.429  1.00 26.86  ? 297 VAL B HA   1 
ATOM   10713 H HB   . VAL B 1 253 ? 35.545  -69.952  12.847  1.00 28.79  ? 297 VAL B HB   1 
ATOM   10714 H HG11 . VAL B 1 253 ? 36.321  -71.292  11.098  1.00 20.45  ? 297 VAL B HG11 1 
ATOM   10715 H HG12 . VAL B 1 253 ? 36.554  -72.026  12.488  1.00 20.45  ? 297 VAL B HG12 1 
ATOM   10716 H HG13 . VAL B 1 253 ? 35.343  -72.458  11.555  1.00 20.45  ? 297 VAL B HG13 1 
ATOM   10717 H HG21 . VAL B 1 253 ? 34.442  -69.761  10.802  1.00 28.87  ? 297 VAL B HG21 1 
ATOM   10718 H HG22 . VAL B 1 253 ? 33.408  -70.880  11.255  1.00 28.87  ? 297 VAL B HG22 1 
ATOM   10719 H HG23 . VAL B 1 253 ? 33.433  -69.474  11.996  1.00 28.87  ? 297 VAL B HG23 1 
ATOM   10720 N N    . ALA B 1 254 ? 35.962  -71.255  15.528  1.00 18.27  ? 298 ALA B N    1 
ATOM   10721 C CA   . ALA B 1 254 ? 36.889  -71.862  16.478  1.00 19.19  ? 298 ALA B CA   1 
ATOM   10722 C C    . ALA B 1 254 ? 36.173  -72.854  17.387  1.00 21.83  ? 298 ALA B C    1 
ATOM   10723 O O    . ALA B 1 254 ? 36.676  -73.956  17.636  1.00 13.93  ? 298 ALA B O    1 
ATOM   10724 C CB   . ALA B 1 254 ? 37.577  -70.776  17.306  1.00 18.70  ? 298 ALA B CB   1 
ATOM   10725 H H    . ALA B 1 254 ? 35.919  -70.397  15.566  1.00 21.92  ? 298 ALA B H    1 
ATOM   10726 H HA   . ALA B 1 254 ? 37.573  -72.344  15.988  1.00 23.03  ? 298 ALA B HA   1 
ATOM   10727 H HB1  . ALA B 1 254 ? 38.188  -71.196  17.931  1.00 22.44  ? 298 ALA B HB1