data_6EJ9
# 
_entry.id   6EJ9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.294 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6EJ9         
WWPDB D_1200006551 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6EJ9 
_pdbx_database_status.recvd_initial_deposition_date   2017-09-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Briggs, D.C.'   1 0000-0002-9793-7339 
'Hohenester, E.' 2 0000-0002-0813-7218 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Structure 
_citation.journal_id_ASTM           STRUE6 
_citation.journal_id_CSD            2005 
_citation.journal_id_ISSN           1878-4186 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            26 
_citation.language                  ? 
_citation.page_first                801 
_citation.page_last                 809.e3 
_citation.title                     
'Structural Basis for the Initiation of Glycosaminoglycan Biosynthesis by Human Xylosyltransferase 1.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.str.2018.03.014 
_citation.pdbx_database_id_PubMed   29681470 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Briggs, D.C.'   1 
primary 'Hohenester, E.' 2 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6EJ9 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     67.380 
_cell.length_a_esd                 ? 
_cell.length_b                     86.820 
_cell.length_b_esd                 ? 
_cell.length_c                     153.200 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6EJ9 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Xylosyltransferase 1' 86122.047 1   2.4.2.26 ?                     ? ? 
2 polymer     syn 'Protein AMBP'         1001.952  1   ?        'E212P, L220G, V221G' ? ? 
3 non-polymer syn 'PHOSPHATE ION'        94.971    2   ?        ?                     ? ? 
4 non-polymer syn 'SODIUM ION'           22.990    1   ?        ?                     ? ? 
5 water       nat water                  18.015    187 ?        ?                     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Peptide O-xylosyltransferase 1,Xylosyltransferase I,XylT-I' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;APLVHHHHHHALDENLYFQGALADVSRPPHARKTGGSSPETKYDQPPKCDISGKEAISALSRAKSKHCRQEIGETYCRHK
LGLLMPEKVTRFCPLEGKANKNVQWDEDSVEYMPANPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHVDKRSNYLH
RQVLQVSRQYSNVRVTPWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFINLSAADYPIRTNDQLVAFLSRYRDMNFL
KSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRRIPEGIAVDGGSDWFLLNRRFVEYVTFSTDDLVTKMKQFYSYTLLPA
ESFFHTVLENSPHCDTMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKFEAVVNQEI
IGQLDYYLYGNYPAGTPGLRSYWENVYDEPDGIHSLSDVTLTLYHSFARLGLRRAETSLHTDGENSCRYYPMGHPASVHL
YFLADRFQGFLIKHHATNLAVSKLETLETWVMPKKVFKIASPPSDFGRLQFSEVGTDWDAKERLFRNFGGLLGPMDEPVG
MQKWGKGPNVTVTVIWVDPVNVIAATYDILIESTAEFTHYKPPLNLPLRPGVWTVKILHHWVPVAETKFLVAPLTFSNRQ
PIKPEEALKLHNGPLRNAYMEQSFQSLNPVLSLPINPAQVEQARRNAASTGTALEGWLDSLVGGMWTAMDICATGPTACP
VMQTCSQTAWSSFSPDPKSELGAVKPDGRLR
;
;APLVHHHHHHALDENLYFQGALADVSRPPHARKTGGSSPETKYDQPPKCDISGKEAISALSRAKSKHCRQEIGETYCRHK
LGLLMPEKVTRFCPLEGKANKNVQWDEDSVEYMPANPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHVDKRSNYLH
RQVLQVSRQYSNVRVTPWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFINLSAADYPIRTNDQLVAFLSRYRDMNFL
KSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRRIPEGIAVDGGSDWFLLNRRFVEYVTFSTDDLVTKMKQFYSYTLLPA
ESFFHTVLENSPHCDTMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKFEAVVNQEI
IGQLDYYLYGNYPAGTPGLRSYWENVYDEPDGIHSLSDVTLTLYHSFARLGLRRAETSLHTDGENSCRYYPMGHPASVHL
YFLADRFQGFLIKHHATNLAVSKLETLETWVMPKKVFKIASPPSDFGRLQFSEVGTDWDAKERLFRNFGGLLGPMDEPVG
MQKWGKGPNVTVTVIWVDPVNVIAATYDILIESTAEFTHYKPPLNLPLRPGVWTVKILHHWVPVAETKFLVAPLTFSNRQ
PIKPEEALKLHNGPLRNAYMEQSFQSLNPVLSLPINPAQVEQARRNAASTGTALEGWLDSLVGGMWTAMDICATGPTACP
VMQTCSQTAWSSFSPDPKSELGAVKPDGRLR
;
A ? 
2 'polypeptide(L)' no no QEPEGSGGGQG QEPEGSGGGQG B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   LEU n 
1 4   VAL n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  ALA n 
1 12  LEU n 
1 13  ASP n 
1 14  GLU n 
1 15  ASN n 
1 16  LEU n 
1 17  TYR n 
1 18  PHE n 
1 19  GLN n 
1 20  GLY n 
1 21  ALA n 
1 22  LEU n 
1 23  ALA n 
1 24  ASP n 
1 25  VAL n 
1 26  SER n 
1 27  ARG n 
1 28  PRO n 
1 29  PRO n 
1 30  HIS n 
1 31  ALA n 
1 32  ARG n 
1 33  LYS n 
1 34  THR n 
1 35  GLY n 
1 36  GLY n 
1 37  SER n 
1 38  SER n 
1 39  PRO n 
1 40  GLU n 
1 41  THR n 
1 42  LYS n 
1 43  TYR n 
1 44  ASP n 
1 45  GLN n 
1 46  PRO n 
1 47  PRO n 
1 48  LYS n 
1 49  CYS n 
1 50  ASP n 
1 51  ILE n 
1 52  SER n 
1 53  GLY n 
1 54  LYS n 
1 55  GLU n 
1 56  ALA n 
1 57  ILE n 
1 58  SER n 
1 59  ALA n 
1 60  LEU n 
1 61  SER n 
1 62  ARG n 
1 63  ALA n 
1 64  LYS n 
1 65  SER n 
1 66  LYS n 
1 67  HIS n 
1 68  CYS n 
1 69  ARG n 
1 70  GLN n 
1 71  GLU n 
1 72  ILE n 
1 73  GLY n 
1 74  GLU n 
1 75  THR n 
1 76  TYR n 
1 77  CYS n 
1 78  ARG n 
1 79  HIS n 
1 80  LYS n 
1 81  LEU n 
1 82  GLY n 
1 83  LEU n 
1 84  LEU n 
1 85  MET n 
1 86  PRO n 
1 87  GLU n 
1 88  LYS n 
1 89  VAL n 
1 90  THR n 
1 91  ARG n 
1 92  PHE n 
1 93  CYS n 
1 94  PRO n 
1 95  LEU n 
1 96  GLU n 
1 97  GLY n 
1 98  LYS n 
1 99  ALA n 
1 100 ASN n 
1 101 LYS n 
1 102 ASN n 
1 103 VAL n 
1 104 GLN n 
1 105 TRP n 
1 106 ASP n 
1 107 GLU n 
1 108 ASP n 
1 109 SER n 
1 110 VAL n 
1 111 GLU n 
1 112 TYR n 
1 113 MET n 
1 114 PRO n 
1 115 ALA n 
1 116 ASN n 
1 117 PRO n 
1 118 VAL n 
1 119 ARG n 
1 120 ILE n 
1 121 ALA n 
1 122 PHE n 
1 123 VAL n 
1 124 LEU n 
1 125 VAL n 
1 126 VAL n 
1 127 HIS n 
1 128 GLY n 
1 129 ARG n 
1 130 ALA n 
1 131 SER n 
1 132 ARG n 
1 133 GLN n 
1 134 LEU n 
1 135 GLN n 
1 136 ARG n 
1 137 MET n 
1 138 PHE n 
1 139 LYS n 
1 140 ALA n 
1 141 ILE n 
1 142 TYR n 
1 143 HIS n 
1 144 LYS n 
1 145 ASP n 
1 146 HIS n 
1 147 PHE n 
1 148 TYR n 
1 149 TYR n 
1 150 ILE n 
1 151 HIS n 
1 152 VAL n 
1 153 ASP n 
1 154 LYS n 
1 155 ARG n 
1 156 SER n 
1 157 ASN n 
1 158 TYR n 
1 159 LEU n 
1 160 HIS n 
1 161 ARG n 
1 162 GLN n 
1 163 VAL n 
1 164 LEU n 
1 165 GLN n 
1 166 VAL n 
1 167 SER n 
1 168 ARG n 
1 169 GLN n 
1 170 TYR n 
1 171 SER n 
1 172 ASN n 
1 173 VAL n 
1 174 ARG n 
1 175 VAL n 
1 176 THR n 
1 177 PRO n 
1 178 TRP n 
1 179 ARG n 
1 180 MET n 
1 181 ALA n 
1 182 THR n 
1 183 ILE n 
1 184 TRP n 
1 185 GLY n 
1 186 GLY n 
1 187 ALA n 
1 188 SER n 
1 189 LEU n 
1 190 LEU n 
1 191 SER n 
1 192 THR n 
1 193 TYR n 
1 194 LEU n 
1 195 GLN n 
1 196 SER n 
1 197 MET n 
1 198 ARG n 
1 199 ASP n 
1 200 LEU n 
1 201 LEU n 
1 202 GLU n 
1 203 MET n 
1 204 THR n 
1 205 ASP n 
1 206 TRP n 
1 207 PRO n 
1 208 TRP n 
1 209 ASP n 
1 210 PHE n 
1 211 PHE n 
1 212 ILE n 
1 213 ASN n 
1 214 LEU n 
1 215 SER n 
1 216 ALA n 
1 217 ALA n 
1 218 ASP n 
1 219 TYR n 
1 220 PRO n 
1 221 ILE n 
1 222 ARG n 
1 223 THR n 
1 224 ASN n 
1 225 ASP n 
1 226 GLN n 
1 227 LEU n 
1 228 VAL n 
1 229 ALA n 
1 230 PHE n 
1 231 LEU n 
1 232 SER n 
1 233 ARG n 
1 234 TYR n 
1 235 ARG n 
1 236 ASP n 
1 237 MET n 
1 238 ASN n 
1 239 PHE n 
1 240 LEU n 
1 241 LYS n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 ARG n 
1 246 ASP n 
1 247 ASN n 
1 248 ALA n 
1 249 ARG n 
1 250 PHE n 
1 251 ILE n 
1 252 ARG n 
1 253 LYS n 
1 254 GLN n 
1 255 GLY n 
1 256 LEU n 
1 257 ASP n 
1 258 ARG n 
1 259 LEU n 
1 260 PHE n 
1 261 LEU n 
1 262 GLU n 
1 263 CYS n 
1 264 ASP n 
1 265 ALA n 
1 266 HIS n 
1 267 MET n 
1 268 TRP n 
1 269 ARG n 
1 270 LEU n 
1 271 GLY n 
1 272 ASP n 
1 273 ARG n 
1 274 ARG n 
1 275 ILE n 
1 276 PRO n 
1 277 GLU n 
1 278 GLY n 
1 279 ILE n 
1 280 ALA n 
1 281 VAL n 
1 282 ASP n 
1 283 GLY n 
1 284 GLY n 
1 285 SER n 
1 286 ASP n 
1 287 TRP n 
1 288 PHE n 
1 289 LEU n 
1 290 LEU n 
1 291 ASN n 
1 292 ARG n 
1 293 ARG n 
1 294 PHE n 
1 295 VAL n 
1 296 GLU n 
1 297 TYR n 
1 298 VAL n 
1 299 THR n 
1 300 PHE n 
1 301 SER n 
1 302 THR n 
1 303 ASP n 
1 304 ASP n 
1 305 LEU n 
1 306 VAL n 
1 307 THR n 
1 308 LYS n 
1 309 MET n 
1 310 LYS n 
1 311 GLN n 
1 312 PHE n 
1 313 TYR n 
1 314 SER n 
1 315 TYR n 
1 316 THR n 
1 317 LEU n 
1 318 LEU n 
1 319 PRO n 
1 320 ALA n 
1 321 GLU n 
1 322 SER n 
1 323 PHE n 
1 324 PHE n 
1 325 HIS n 
1 326 THR n 
1 327 VAL n 
1 328 LEU n 
1 329 GLU n 
1 330 ASN n 
1 331 SER n 
1 332 PRO n 
1 333 HIS n 
1 334 CYS n 
1 335 ASP n 
1 336 THR n 
1 337 MET n 
1 338 VAL n 
1 339 ASP n 
1 340 ASN n 
1 341 ASN n 
1 342 LEU n 
1 343 ARG n 
1 344 ILE n 
1 345 THR n 
1 346 ASN n 
1 347 TRP n 
1 348 ASN n 
1 349 ARG n 
1 350 LYS n 
1 351 LEU n 
1 352 GLY n 
1 353 CYS n 
1 354 LYS n 
1 355 CYS n 
1 356 GLN n 
1 357 TYR n 
1 358 LYS n 
1 359 HIS n 
1 360 ILE n 
1 361 VAL n 
1 362 ASP n 
1 363 TRP n 
1 364 CYS n 
1 365 GLY n 
1 366 CYS n 
1 367 SER n 
1 368 PRO n 
1 369 ASN n 
1 370 ASP n 
1 371 PHE n 
1 372 LYS n 
1 373 PRO n 
1 374 GLN n 
1 375 ASP n 
1 376 PHE n 
1 377 HIS n 
1 378 ARG n 
1 379 PHE n 
1 380 GLN n 
1 381 GLN n 
1 382 THR n 
1 383 ALA n 
1 384 ARG n 
1 385 PRO n 
1 386 THR n 
1 387 PHE n 
1 388 PHE n 
1 389 ALA n 
1 390 ARG n 
1 391 LYS n 
1 392 PHE n 
1 393 GLU n 
1 394 ALA n 
1 395 VAL n 
1 396 VAL n 
1 397 ASN n 
1 398 GLN n 
1 399 GLU n 
1 400 ILE n 
1 401 ILE n 
1 402 GLY n 
1 403 GLN n 
1 404 LEU n 
1 405 ASP n 
1 406 TYR n 
1 407 TYR n 
1 408 LEU n 
1 409 TYR n 
1 410 GLY n 
1 411 ASN n 
1 412 TYR n 
1 413 PRO n 
1 414 ALA n 
1 415 GLY n 
1 416 THR n 
1 417 PRO n 
1 418 GLY n 
1 419 LEU n 
1 420 ARG n 
1 421 SER n 
1 422 TYR n 
1 423 TRP n 
1 424 GLU n 
1 425 ASN n 
1 426 VAL n 
1 427 TYR n 
1 428 ASP n 
1 429 GLU n 
1 430 PRO n 
1 431 ASP n 
1 432 GLY n 
1 433 ILE n 
1 434 HIS n 
1 435 SER n 
1 436 LEU n 
1 437 SER n 
1 438 ASP n 
1 439 VAL n 
1 440 THR n 
1 441 LEU n 
1 442 THR n 
1 443 LEU n 
1 444 TYR n 
1 445 HIS n 
1 446 SER n 
1 447 PHE n 
1 448 ALA n 
1 449 ARG n 
1 450 LEU n 
1 451 GLY n 
1 452 LEU n 
1 453 ARG n 
1 454 ARG n 
1 455 ALA n 
1 456 GLU n 
1 457 THR n 
1 458 SER n 
1 459 LEU n 
1 460 HIS n 
1 461 THR n 
1 462 ASP n 
1 463 GLY n 
1 464 GLU n 
1 465 ASN n 
1 466 SER n 
1 467 CYS n 
1 468 ARG n 
1 469 TYR n 
1 470 TYR n 
1 471 PRO n 
1 472 MET n 
1 473 GLY n 
1 474 HIS n 
1 475 PRO n 
1 476 ALA n 
1 477 SER n 
1 478 VAL n 
1 479 HIS n 
1 480 LEU n 
1 481 TYR n 
1 482 PHE n 
1 483 LEU n 
1 484 ALA n 
1 485 ASP n 
1 486 ARG n 
1 487 PHE n 
1 488 GLN n 
1 489 GLY n 
1 490 PHE n 
1 491 LEU n 
1 492 ILE n 
1 493 LYS n 
1 494 HIS n 
1 495 HIS n 
1 496 ALA n 
1 497 THR n 
1 498 ASN n 
1 499 LEU n 
1 500 ALA n 
1 501 VAL n 
1 502 SER n 
1 503 LYS n 
1 504 LEU n 
1 505 GLU n 
1 506 THR n 
1 507 LEU n 
1 508 GLU n 
1 509 THR n 
1 510 TRP n 
1 511 VAL n 
1 512 MET n 
1 513 PRO n 
1 514 LYS n 
1 515 LYS n 
1 516 VAL n 
1 517 PHE n 
1 518 LYS n 
1 519 ILE n 
1 520 ALA n 
1 521 SER n 
1 522 PRO n 
1 523 PRO n 
1 524 SER n 
1 525 ASP n 
1 526 PHE n 
1 527 GLY n 
1 528 ARG n 
1 529 LEU n 
1 530 GLN n 
1 531 PHE n 
1 532 SER n 
1 533 GLU n 
1 534 VAL n 
1 535 GLY n 
1 536 THR n 
1 537 ASP n 
1 538 TRP n 
1 539 ASP n 
1 540 ALA n 
1 541 LYS n 
1 542 GLU n 
1 543 ARG n 
1 544 LEU n 
1 545 PHE n 
1 546 ARG n 
1 547 ASN n 
1 548 PHE n 
1 549 GLY n 
1 550 GLY n 
1 551 LEU n 
1 552 LEU n 
1 553 GLY n 
1 554 PRO n 
1 555 MET n 
1 556 ASP n 
1 557 GLU n 
1 558 PRO n 
1 559 VAL n 
1 560 GLY n 
1 561 MET n 
1 562 GLN n 
1 563 LYS n 
1 564 TRP n 
1 565 GLY n 
1 566 LYS n 
1 567 GLY n 
1 568 PRO n 
1 569 ASN n 
1 570 VAL n 
1 571 THR n 
1 572 VAL n 
1 573 THR n 
1 574 VAL n 
1 575 ILE n 
1 576 TRP n 
1 577 VAL n 
1 578 ASP n 
1 579 PRO n 
1 580 VAL n 
1 581 ASN n 
1 582 VAL n 
1 583 ILE n 
1 584 ALA n 
1 585 ALA n 
1 586 THR n 
1 587 TYR n 
1 588 ASP n 
1 589 ILE n 
1 590 LEU n 
1 591 ILE n 
1 592 GLU n 
1 593 SER n 
1 594 THR n 
1 595 ALA n 
1 596 GLU n 
1 597 PHE n 
1 598 THR n 
1 599 HIS n 
1 600 TYR n 
1 601 LYS n 
1 602 PRO n 
1 603 PRO n 
1 604 LEU n 
1 605 ASN n 
1 606 LEU n 
1 607 PRO n 
1 608 LEU n 
1 609 ARG n 
1 610 PRO n 
1 611 GLY n 
1 612 VAL n 
1 613 TRP n 
1 614 THR n 
1 615 VAL n 
1 616 LYS n 
1 617 ILE n 
1 618 LEU n 
1 619 HIS n 
1 620 HIS n 
1 621 TRP n 
1 622 VAL n 
1 623 PRO n 
1 624 VAL n 
1 625 ALA n 
1 626 GLU n 
1 627 THR n 
1 628 LYS n 
1 629 PHE n 
1 630 LEU n 
1 631 VAL n 
1 632 ALA n 
1 633 PRO n 
1 634 LEU n 
1 635 THR n 
1 636 PHE n 
1 637 SER n 
1 638 ASN n 
1 639 ARG n 
1 640 GLN n 
1 641 PRO n 
1 642 ILE n 
1 643 LYS n 
1 644 PRO n 
1 645 GLU n 
1 646 GLU n 
1 647 ALA n 
1 648 LEU n 
1 649 LYS n 
1 650 LEU n 
1 651 HIS n 
1 652 ASN n 
1 653 GLY n 
1 654 PRO n 
1 655 LEU n 
1 656 ARG n 
1 657 ASN n 
1 658 ALA n 
1 659 TYR n 
1 660 MET n 
1 661 GLU n 
1 662 GLN n 
1 663 SER n 
1 664 PHE n 
1 665 GLN n 
1 666 SER n 
1 667 LEU n 
1 668 ASN n 
1 669 PRO n 
1 670 VAL n 
1 671 LEU n 
1 672 SER n 
1 673 LEU n 
1 674 PRO n 
1 675 ILE n 
1 676 ASN n 
1 677 PRO n 
1 678 ALA n 
1 679 GLN n 
1 680 VAL n 
1 681 GLU n 
1 682 GLN n 
1 683 ALA n 
1 684 ARG n 
1 685 ARG n 
1 686 ASN n 
1 687 ALA n 
1 688 ALA n 
1 689 SER n 
1 690 THR n 
1 691 GLY n 
1 692 THR n 
1 693 ALA n 
1 694 LEU n 
1 695 GLU n 
1 696 GLY n 
1 697 TRP n 
1 698 LEU n 
1 699 ASP n 
1 700 SER n 
1 701 LEU n 
1 702 VAL n 
1 703 GLY n 
1 704 GLY n 
1 705 MET n 
1 706 TRP n 
1 707 THR n 
1 708 ALA n 
1 709 MET n 
1 710 ASP n 
1 711 ILE n 
1 712 CYS n 
1 713 ALA n 
1 714 THR n 
1 715 GLY n 
1 716 PRO n 
1 717 THR n 
1 718 ALA n 
1 719 CYS n 
1 720 PRO n 
1 721 VAL n 
1 722 MET n 
1 723 GLN n 
1 724 THR n 
1 725 CYS n 
1 726 SER n 
1 727 GLN n 
1 728 THR n 
1 729 ALA n 
1 730 TRP n 
1 731 SER n 
1 732 SER n 
1 733 PHE n 
1 734 SER n 
1 735 PRO n 
1 736 ASP n 
1 737 PRO n 
1 738 LYS n 
1 739 SER n 
1 740 GLU n 
1 741 LEU n 
1 742 GLY n 
1 743 ALA n 
1 744 VAL n 
1 745 LYS n 
1 746 PRO n 
1 747 ASP n 
1 748 GLY n 
1 749 ARG n 
1 750 LEU n 
1 751 ARG n 
2 1   GLN n 
2 2   GLU n 
2 3   PRO n 
2 4   GLU n 
2 5   GLY n 
2 6   SER n 
2 7   GLY n 
2 8   GLY n 
2 9   GLY n 
2 10  GLN n 
2 11  GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   751 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'XYLT1, XT1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               Human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            HEK293F 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pCEP-Pu 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       11 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   Human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP XYLT1_HUMAN Q86Y38 ? 1 
;DVSRPPHARKTGGSSPETKYDQPPKCDISGKEAISALSRAKSKHCRQEIGETYCRHKLGLLMPEKVTRFCPLEGKANKNV
QWDEDSVEYMPANPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHVDKRSNYLHRQVLQVSRQYSNVRVTPWRMATI
WGGASLLSTYLQSMRDLLEMTDWPWDFFINLSAADYPIRTNDQLVAFLSRYRDMNFLKSHGRDNARFIRKQGLDRLFLEC
DAHMWRLGDRRIPEGIAVDGGSDWFLLNRRFVEYVTFSTDDLVTKMKQFYSYTLLPAESFFHTVLENSPHCDTMVDNNLR
ITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKFEAVVNQEIIGQLDYYLYGNYPAGTPGLRSYW
ENVYDEPDGIHSLSDVTLTLYHSFARLGLRRAETSLHTDGENSCRYYPMGHPASVHLYFLADRFQGFLIKHHATNLAVSK
LETLETWVMPKKVFKIASPPSDFGRLQFSEVGTDWDAKERLFRNFGGLLGPMDEPVGMQKWGKGPNVTVTVIWVDPVNVI
AATYDILIESTAEFTHYKPPLNLPLRPGVWTVKILHHWVPVAETKFLVAPLTFSNRQPIKPEEALKLHNGPLRNAYMEQS
FQSLNPVLSLPINPAQVEQARRNAASTGTALEGWLDSLVGGMWTAMDICATGPTACPVMQTCSQTAWSSFSPDPKSELGA
VKPDGRLR
;
232 
2 UNP AMBP_HUMAN  P02760 ? 2 QEEEGSGGGQL 210 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6EJ9 A 24 ? 751 ? Q86Y38 232 ? 959 ? 232 959 
2 2 6EJ9 B 1  ? 11  ? P02760 210 ? 220 ? 210 220 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6EJ9 ALA A 1  ? UNP Q86Y38 ?   ?   'expression tag'      209 1  
1 6EJ9 PRO A 2  ? UNP Q86Y38 ?   ?   'expression tag'      210 2  
1 6EJ9 LEU A 3  ? UNP Q86Y38 ?   ?   'expression tag'      211 3  
1 6EJ9 VAL A 4  ? UNP Q86Y38 ?   ?   'expression tag'      212 4  
1 6EJ9 HIS A 5  ? UNP Q86Y38 ?   ?   'expression tag'      213 5  
1 6EJ9 HIS A 6  ? UNP Q86Y38 ?   ?   'expression tag'      214 6  
1 6EJ9 HIS A 7  ? UNP Q86Y38 ?   ?   'expression tag'      215 7  
1 6EJ9 HIS A 8  ? UNP Q86Y38 ?   ?   'expression tag'      216 8  
1 6EJ9 HIS A 9  ? UNP Q86Y38 ?   ?   'expression tag'      217 9  
1 6EJ9 HIS A 10 ? UNP Q86Y38 ?   ?   'expression tag'      218 10 
1 6EJ9 ALA A 11 ? UNP Q86Y38 ?   ?   'expression tag'      219 11 
1 6EJ9 LEU A 12 ? UNP Q86Y38 ?   ?   'expression tag'      220 12 
1 6EJ9 ASP A 13 ? UNP Q86Y38 ?   ?   'expression tag'      221 13 
1 6EJ9 GLU A 14 ? UNP Q86Y38 ?   ?   'expression tag'      222 14 
1 6EJ9 ASN A 15 ? UNP Q86Y38 ?   ?   'expression tag'      223 15 
1 6EJ9 LEU A 16 ? UNP Q86Y38 ?   ?   'expression tag'      224 16 
1 6EJ9 TYR A 17 ? UNP Q86Y38 ?   ?   'expression tag'      225 17 
1 6EJ9 PHE A 18 ? UNP Q86Y38 ?   ?   'expression tag'      226 18 
1 6EJ9 GLN A 19 ? UNP Q86Y38 ?   ?   'expression tag'      227 19 
1 6EJ9 GLY A 20 ? UNP Q86Y38 ?   ?   'expression tag'      228 20 
1 6EJ9 ALA A 21 ? UNP Q86Y38 ?   ?   'expression tag'      229 21 
1 6EJ9 LEU A 22 ? UNP Q86Y38 ?   ?   'expression tag'      230 22 
1 6EJ9 ALA A 23 ? UNP Q86Y38 ?   ?   'expression tag'      231 23 
2 6EJ9 PRO B 3  ? UNP P02760 GLU 212 'engineered mutation' 212 24 
2 6EJ9 GLY B 11 ? UNP P02760 LEU 220 'engineered mutation' 220 25 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'    ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6EJ9 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.57 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         52.14 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;55-65% Morpheus Precipitant mix 2 (PEG8000 and Ethylene glycol)
0.1M Bicine/Tris buffer at pH 7.5
0.1M of NPS mix (0.033M of each)
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-03-11 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9282 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I04-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9282 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I04-1 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            32.520 
_reflns.entry_id                         6EJ9 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.020 
_reflns.d_resolution_low                 75.530 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       59199 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.200 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.300 
_reflns.pdbx_Rmerge_I_obs                0.107 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.900 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             0 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.122 
_reflns.pdbx_Rpim_I_all                  0.057 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         253525 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.997 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.020 2.070  ? ? 19186 ? ? ? 4372 99.600 ? ? ? ? 1.148 ? ? ? ? ? ? ? ? 4.400 ? ? ? 1.400  1.307 0.613 ? 1 1 0.761 ? 
9.030 75.530 ? ? 3033  ? ? ? 767  98.700 ? ? ? ? 0.022 ? ? ? ? ? ? ? ? 4.000 ? ? ? 36.600 0.026 0.012 ? 2 1 0.999 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                190.700 
_refine.B_iso_mean                               49.6451 
_refine.B_iso_min                                18.220 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6EJ9 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.0200 
_refine.ls_d_res_low                             75.530 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     59105 
_refine.ls_number_reflns_R_free                  2837 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.9500 
_refine.ls_percent_reflns_R_free                 4.8000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2047 
_refine.ls_R_factor_R_free                       0.2245 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2037 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2GAK 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 25.7400 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2500 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.0200 
_refine_hist.d_res_low                        75.530 
_refine_hist.pdbx_number_atoms_ligand         11 
_refine_hist.number_atoms_solvent             187 
_refine_hist.number_atoms_total               5788 
_refine_hist.pdbx_number_residues_total       712 
_refine_hist.pdbx_B_iso_mean_ligand           92.07 
_refine_hist.pdbx_B_iso_mean_solvent          38.53 
_refine_hist.pdbx_number_atoms_protein        5590 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 5781 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.563  ? 7881 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.042  ? 845  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 1014 ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 11.199 ? 3399 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.0200 2.0548  2918 . 147 2771 99.0000  . . . 0.3523 0.0000 0.3055 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 2.0548 2.0922  2917 . 125 2792 99.0000  . . . 0.3424 0.0000 0.2941 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 2.0922 2.1325  2913 . 151 2762 99.0000  . . . 0.2837 0.0000 0.2912 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 2.1325 2.1760  2946 . 148 2798 99.0000  . . . 0.3148 0.0000 0.2788 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 2.1760 2.2233  2863 . 143 2720 98.0000  . . . 0.3052 0.0000 0.2699 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 2.2233 2.2750  2921 . 149 2772 99.0000  . . . 0.2832 0.0000 0.2692 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 2.2750 2.3319  2930 . 144 2786 99.0000  . . . 0.2761 0.0000 0.2599 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 2.3319 2.3950  2948 . 137 2811 99.0000  . . . 0.2756 0.0000 0.2281 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 2.3950 2.4655  2947 . 152 2795 100.0000 . . . 0.2596 0.0000 0.2210 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 2.4655 2.5450  2970 . 139 2831 100.0000 . . . 0.2562 0.0000 0.2199 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 2.5450 2.6360  2933 . 116 2817 100.0000 . . . 0.2318 0.0000 0.2152 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 2.6360 2.7416  2956 . 135 2821 99.0000  . . . 0.2708 0.0000 0.2129 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 2.7416 2.8663  2919 . 137 2782 99.0000  . . . 0.2328 0.0000 0.2125 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 2.8663 3.0175  2937 . 126 2811 98.0000  . . . 0.2319 0.0000 0.2087 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.0175 3.2065  3003 . 156 2847 100.0000 . . . 0.2765 0.0000 0.2134 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.2065 3.4541  2971 . 137 2834 99.0000  . . . 0.2041 0.0000 0.2059 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.4541 3.8017  2975 . 148 2827 99.0000  . . . 0.2108 0.0000 0.1874 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 3.8017 4.3517  2948 . 130 2818 97.0000  . . . 0.1916 0.0000 0.1619 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 4.3517 5.4825  3041 . 154 2887 99.0000  . . . 0.1528 0.0000 0.1475 . . . . . . 20 . . . 
'X-RAY DIFFRACTION' 5.4825 75.5867 3149 . 163 2986 98.0000  . . . 0.1863 0.0000 0.1951 . . . . . . 20 . . . 
# 
_struct.entry_id                     6EJ9 
_struct.title                        'Human Xylosyltransferase 1 in complex with peptide QEPEGSGGGQGG' 
_struct.pdbx_descriptor              'Xylosyltransferase 1 (E.C.2.4.2.26), Protein AMBP' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6EJ9 
_struct_keywords.text            'Proteoglycan, Glycosyltransferase, Golgi, Xylosyltransferase, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 53  ? ALA A 63  ? GLY A 261 ALA A 271 1 ? 11 
HELX_P HELX_P2  AA2 SER A 65  ? LEU A 81  ? SER A 273 LEU A 289 1 ? 17 
HELX_P HELX_P3  AA3 ASP A 106 ? GLU A 111 ? ASP A 314 GLU A 319 5 ? 6  
HELX_P HELX_P4  AA4 ALA A 130 ? TYR A 142 ? ALA A 338 TYR A 350 1 ? 13 
HELX_P HELX_P5  AA5 SER A 156 ? TYR A 170 ? SER A 364 TYR A 378 1 ? 15 
HELX_P HELX_P6  AA6 ALA A 187 ? MET A 203 ? ALA A 395 MET A 411 1 ? 17 
HELX_P HELX_P7  AA7 THR A 223 ? TYR A 234 ? THR A 431 TYR A 442 1 ? 12 
HELX_P HELX_P8  AA8 ASP A 246 ? GLN A 254 ? ASP A 454 GLN A 462 1 ? 9  
HELX_P HELX_P9  AA9 ARG A 292 ? SER A 301 ? ARG A 500 SER A 509 1 ? 10 
HELX_P HELX_P10 AB1 ASP A 303 ? TYR A 313 ? ASP A 511 TYR A 521 1 ? 11 
HELX_P HELX_P11 AB2 SER A 314 ? THR A 316 ? SER A 522 THR A 524 5 ? 3  
HELX_P HELX_P12 AB3 LEU A 318 ? GLU A 321 ? LEU A 526 GLU A 529 5 ? 4  
HELX_P HELX_P13 AB4 SER A 322 ? SER A 331 ? SER A 530 SER A 539 1 ? 10 
HELX_P HELX_P14 AB5 HIS A 333 ? ASP A 335 ? HIS A 541 ASP A 543 5 ? 3  
HELX_P HELX_P15 AB6 ASN A 348 ? CYS A 353 ? ASN A 556 CYS A 561 1 ? 6  
HELX_P HELX_P16 AB7 LYS A 372 ? GLN A 381 ? LYS A 580 GLN A 589 5 ? 10 
HELX_P HELX_P17 AB8 GLN A 398 ? GLY A 410 ? GLN A 606 GLY A 618 1 ? 13 
HELX_P HELX_P18 AB9 PRO A 430 ? LEU A 436 ? PRO A 638 LEU A 644 5 ? 7  
HELX_P HELX_P19 AC1 SER A 437 ? LEU A 459 ? SER A 645 LEU A 667 1 ? 23 
HELX_P HELX_P20 AC2 LYS A 643 ? ASN A 652 ? LYS A 851 ASN A 860 1 ? 10 
HELX_P HELX_P21 AC3 SER A 666 ? LEU A 671 ? SER A 874 LEU A 879 1 ? 6  
HELX_P HELX_P22 AC4 ASN A 676 ? ALA A 688 ? ASN A 884 ALA A 896 1 ? 13 
HELX_P HELX_P23 AC5 THR A 690 ? MET A 705 ? THR A 898 MET A 913 1 ? 16 
HELX_P HELX_P24 AC6 SER A 726 ? THR A 728 ? SER A 934 THR A 936 5 ? 3  
HELX_P HELX_P25 AC7 ASP A 736 ? GLU A 740 ? ASP A 944 GLU A 948 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 49  SG ? ? ? 1_555 A CYS 77  SG ? ? A CYS 257  A CYS 285  1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf2 disulf ? ? A CYS 93  SG ? ? ? 1_555 A CYS 334 SG ? ? A CYS 301  A CYS 542  1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf3 disulf ? ? A CYS 353 SG ? ? ? 1_555 A CYS 366 SG ? ? A CYS 561  A CYS 574  1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf4 disulf ? ? A CYS 355 SG ? ? ? 1_555 A CYS 364 SG ? ? A CYS 563  A CYS 572  1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf5 disulf ? ? A CYS 467 SG ? ? ? 1_555 A CYS 719 SG ? ? A CYS 675  A CYS 927  1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf6 disulf ? ? A CYS 712 SG ? ? ? 1_555 A CYS 725 SG ? ? A CYS 920  A CYS 933  1_555 ? ? ? ? ? ? ? 2.035 ? 
metalc1 metalc ? ? A SER 167 O  ? ? ? 1_555 E NA  .   NA ? ? A SER 375  A NA  1003 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc2 metalc ? ? A TYR 170 O  ? ? ? 1_555 E NA  .   NA ? ? A TYR 378  A NA  1003 1_555 ? ? ? ? ? ? ? 2.324 ? 
metalc3 metalc ? ? A VAL 173 O  ? ? ? 1_555 E NA  .   NA ? ? A VAL 381  A NA  1003 1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc4 metalc ? ? E NA  .   NA ? ? ? 1_555 F HOH .   O  ? ? A NA  1003 A HOH 1226 1_555 ? ? ? ? ? ? ? 2.779 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 390 A . ? ARG 598 A LYS 391 A ? LYS 599 A 1 5.70  
2 LEU 606 A . ? LEU 814 A PRO 607 A ? PRO 815 A 1 -4.01 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 6 ? 
AA6 ? 3 ? 
AA7 ? 2 ? 
AA8 ? 4 ? 
AA9 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? parallel      
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA5 5 6 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 173 ? VAL A 175 ? VAL A 381 VAL A 383 
AA1 2 PHE A 147 ? VAL A 152 ? PHE A 355 VAL A 360 
AA1 3 ILE A 120 ? VAL A 126 ? ILE A 328 VAL A 334 
AA1 4 PHE A 210 ? LEU A 214 ? PHE A 418 LEU A 422 
AA1 5 LEU A 289 ? ASN A 291 ? LEU A 497 ASN A 499 
AA2 1 ASP A 218 ? PRO A 220 ? ASP A 426 PRO A 428 
AA2 2 PHE A 388 ? ARG A 390 ? PHE A 596 ARG A 598 
AA2 3 ARG A 343 ? THR A 345 ? ARG A 551 THR A 553 
AA3 1 ASN A 238 ? LEU A 240 ? ASN A 446 LEU A 448 
AA3 2 MET A 337 ? ASP A 339 ? MET A 545 ASP A 547 
AA4 1 ARG A 258 ? GLU A 262 ? ARG A 466 GLU A 470 
AA4 2 MET A 267 ? ASP A 272 ? MET A 475 ASP A 480 
AA5 1 SER A 421 ? ASP A 428 ? SER A 629 ASP A 636 
AA5 2 TYR A 469 ? LEU A 483 ? TYR A 677 LEU A 691 
AA5 3 ARG A 486 ? ASN A 498 ? ARG A 694 ASN A 706 
AA5 4 LYS A 503 ? PRO A 513 ? LYS A 711 PRO A 721 
AA5 5 TRP A 706 ? ALA A 713 ? TRP A 914 ALA A 921 
AA5 6 GLN A 723 ? THR A 724 ? GLN A 931 THR A 932 
AA6 1 LEU A 529 ? GLY A 535 ? LEU A 737 GLY A 743 
AA6 2 VAL A 559 ? TRP A 564 ? VAL A 767 TRP A 772 
AA6 3 PHE A 597 ? TYR A 600 ? PHE A 805 TYR A 808 
AA7 1 TRP A 538 ? ASP A 539 ? TRP A 746 ASP A 747 
AA7 2 LEU A 544 ? PHE A 545 ? LEU A 752 PHE A 753 
AA8 1 ILE A 583 ? ILE A 591 ? ILE A 791 ILE A 799 
AA8 2 VAL A 570 ? VAL A 577 ? VAL A 778 VAL A 785 
AA8 3 GLY A 611 ? HIS A 619 ? GLY A 819 HIS A 827 
AA8 4 VAL A 622 ? VAL A 631 ? VAL A 830 VAL A 839 
AA9 1 PHE A 636 ? SER A 637 ? PHE A 844 SER A 845 
AA9 2 GLN A 640 ? PRO A 641 ? GLN A 848 PRO A 849 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ARG A 174 ? O ARG A 382 N TYR A 148 ? N TYR A 356 
AA1 2 3 O PHE A 147 ? O PHE A 355 N PHE A 122 ? N PHE A 330 
AA1 3 4 N VAL A 123 ? N VAL A 331 O ILE A 212 ? O ILE A 420 
AA1 4 5 N PHE A 211 ? N PHE A 419 O LEU A 290 ? O LEU A 498 
AA2 1 2 N TYR A 219 ? N TYR A 427 O ALA A 389 ? O ALA A 597 
AA2 2 3 O ARG A 390 ? O ARG A 598 N ILE A 344 ? N ILE A 552 
AA3 1 2 N ASN A 238 ? N ASN A 446 O VAL A 338 ? O VAL A 546 
AA4 1 2 N LEU A 261 ? N LEU A 469 O TRP A 268 ? O TRP A 476 
AA5 1 2 N GLU A 424 ? N GLU A 632 O LEU A 480 ? O LEU A 688 
AA5 2 3 N TYR A 481 ? N TYR A 689 O GLN A 488 ? O GLN A 696 
AA5 3 4 N ASN A 498 ? N ASN A 706 O LYS A 503 ? O LYS A 711 
AA5 4 5 N MET A 512 ? N MET A 720 O THR A 707 ? O THR A 915 
AA5 5 6 N ALA A 713 ? N ALA A 921 O GLN A 723 ? O GLN A 931 
AA6 1 2 N GLU A 533 ? N GLU A 741 O MET A 561 ? O MET A 769 
AA6 2 3 N GLN A 562 ? N GLN A 770 O THR A 598 ? O THR A 806 
AA7 1 2 N ASP A 539 ? N ASP A 747 O LEU A 544 ? O LEU A 752 
AA8 1 2 O ILE A 591 ? O ILE A 799 N VAL A 570 ? N VAL A 778 
AA8 2 3 N VAL A 577 ? N VAL A 785 O THR A 614 ? O THR A 822 
AA8 3 4 N VAL A 615 ? N VAL A 823 O THR A 627 ? O THR A 835 
AA9 1 2 N SER A 637 ? N SER A 845 O GLN A 640 ? O GLN A 848 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A PO4 1001 ? 2 'binding site for residue PO4 A 1001' 
AC2 Software A PO4 1002 ? 6 'binding site for residue PO4 A 1002' 
AC3 Software A NA  1003 ? 4 'binding site for residue NA A 1003'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 ARG A 390 ? ARG A 598  . ? 1_555 ? 
2  AC1 2 LYS A 391 ? LYS A 599  . ? 1_555 ? 
3  AC2 6 GLY A 128 ? GLY A 336  . ? 1_555 ? 
4  AC2 6 ARG A 129 ? ARG A 337  . ? 1_555 ? 
5  AC2 6 ARG A 155 ? ARG A 363  . ? 1_555 ? 
6  AC2 6 SER A 156 ? SER A 364  . ? 1_555 ? 
7  AC2 6 HOH F .   ? HOH A 1112 . ? 1_555 ? 
8  AC2 6 HOH F .   ? HOH A 1247 . ? 1_555 ? 
9  AC3 4 SER A 167 ? SER A 375  . ? 1_555 ? 
10 AC3 4 TYR A 170 ? TYR A 378  . ? 1_555 ? 
11 AC3 4 VAL A 173 ? VAL A 381  . ? 1_555 ? 
12 AC3 4 HOH F .   ? HOH A 1226 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6EJ9 
_atom_sites.fract_transf_matrix[1][1]   0.014841 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011518 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006527 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . ASP A 1 44  ? -31.803 25.963 44.380 1.00 189.44 ? 252  ASP A N    1 
ATOM   2     C  CA   . ASP A 1 44  ? -31.522 25.406 45.699 1.00 184.89 ? 252  ASP A CA   1 
ATOM   3     C  C    . ASP A 1 44  ? -32.104 24.002 45.835 1.00 177.86 ? 252  ASP A C    1 
ATOM   4     O  O    . ASP A 1 44  ? -33.124 23.805 46.495 1.00 183.97 ? 252  ASP A O    1 
ATOM   5     C  CB   . ASP A 1 44  ? -32.078 26.318 46.795 1.00 187.53 ? 252  ASP A CB   1 
ATOM   6     N  N    . GLN A 1 45  ? -31.446 23.029 45.210 1.00 160.63 ? 253  GLN A N    1 
ATOM   7     C  CA   . GLN A 1 45  ? -31.955 21.668 45.211 1.00 142.89 ? 253  GLN A CA   1 
ATOM   8     C  C    . GLN A 1 45  ? -31.734 21.015 46.577 1.00 139.82 ? 253  GLN A C    1 
ATOM   9     O  O    . GLN A 1 45  ? -30.747 21.305 47.258 1.00 111.37 ? 253  GLN A O    1 
ATOM   10    C  CB   . GLN A 1 45  ? -31.271 20.844 44.124 1.00 156.68 ? 253  GLN A CB   1 
ATOM   11    C  CG   . GLN A 1 45  ? -31.704 19.388 44.077 1.00 170.90 ? 253  GLN A CG   1 
ATOM   12    C  CD   . GLN A 1 45  ? -31.172 18.663 42.858 1.00 182.53 ? 253  GLN A CD   1 
ATOM   13    O  OE1  . GLN A 1 45  ? -30.764 19.288 41.879 1.00 186.90 ? 253  GLN A OE1  1 
ATOM   14    N  NE2  . GLN A 1 45  ? -31.173 17.335 42.911 1.00 186.25 ? 253  GLN A NE2  1 
ATOM   15    H  HA   . GLN A 1 45  ? -32.908 21.682 45.030 1.00 171.46 ? 253  GLN A HA   1 
ATOM   16    N  N    . PRO A 1 46  ? -32.635 20.130 47.004 1.00 129.53 ? 254  PRO A N    1 
ATOM   17    C  CA   . PRO A 1 46  ? -32.465 19.475 48.308 1.00 144.33 ? 254  PRO A CA   1 
ATOM   18    C  C    . PRO A 1 46  ? -31.295 18.509 48.290 1.00 148.74 ? 254  PRO A C    1 
ATOM   19    O  O    . PRO A 1 46  ? -30.751 18.192 47.221 1.00 154.48 ? 254  PRO A O    1 
ATOM   20    C  CB   . PRO A 1 46  ? -33.796 18.732 48.514 1.00 150.88 ? 254  PRO A CB   1 
ATOM   21    C  CG   . PRO A 1 46  ? -34.741 19.322 47.532 1.00 147.56 ? 254  PRO A CG   1 
ATOM   22    C  CD   . PRO A 1 46  ? -33.911 19.749 46.373 1.00 138.38 ? 254  PRO A CD   1 
ATOM   23    H  HA   . PRO A 1 46  ? -32.342 20.132 49.011 1.00 173.20 ? 254  PRO A HA   1 
ATOM   24    H  HB2  . PRO A 1 46  ? -33.671 17.786 48.342 1.00 181.06 ? 254  PRO A HB2  1 
ATOM   25    H  HB3  . PRO A 1 46  ? -34.112 18.876 49.420 1.00 181.06 ? 254  PRO A HB3  1 
ATOM   26    H  HG2  . PRO A 1 46  ? -35.387 18.651 47.260 1.00 177.07 ? 254  PRO A HG2  1 
ATOM   27    H  HG3  . PRO A 1 46  ? -35.189 20.085 47.930 1.00 177.07 ? 254  PRO A HG3  1 
ATOM   28    H  HD2  . PRO A 1 46  ? -33.779 19.009 45.760 1.00 166.06 ? 254  PRO A HD2  1 
ATOM   29    H  HD3  . PRO A 1 46  ? -34.313 20.513 45.931 1.00 166.06 ? 254  PRO A HD3  1 
ATOM   30    N  N    . PRO A 1 47  ? -30.887 18.009 49.453 1.00 148.18 ? 255  PRO A N    1 
ATOM   31    C  CA   . PRO A 1 47  ? -29.739 17.099 49.504 1.00 132.76 ? 255  PRO A CA   1 
ATOM   32    C  C    . PRO A 1 47  ? -30.085 15.723 48.960 1.00 101.46 ? 255  PRO A C    1 
ATOM   33    O  O    . PRO A 1 47  ? -31.252 15.352 48.809 1.00 95.58  ? 255  PRO A O    1 
ATOM   34    C  CB   . PRO A 1 47  ? -29.406 17.036 50.998 1.00 146.23 ? 255  PRO A CB   1 
ATOM   35    C  CG   . PRO A 1 47  ? -30.716 17.303 51.676 1.00 157.85 ? 255  PRO A CG   1 
ATOM   36    C  CD   . PRO A 1 47  ? -31.467 18.252 50.786 1.00 158.92 ? 255  PRO A CD   1 
ATOM   37    H  HA   . PRO A 1 47  ? -28.986 17.467 49.016 1.00 159.31 ? 255  PRO A HA   1 
ATOM   38    H  HB2  . PRO A 1 47  ? -29.074 16.153 51.224 1.00 175.47 ? 255  PRO A HB2  1 
ATOM   39    H  HB3  . PRO A 1 47  ? -28.756 17.720 51.220 1.00 175.47 ? 255  PRO A HB3  1 
ATOM   40    H  HG2  . PRO A 1 47  ? -31.205 16.471 51.775 1.00 189.42 ? 255  PRO A HG2  1 
ATOM   41    H  HG3  . PRO A 1 47  ? -30.555 17.707 52.543 1.00 189.42 ? 255  PRO A HG3  1 
ATOM   42    H  HD2  . PRO A 1 47  ? -32.413 18.039 50.787 1.00 190.70 ? 255  PRO A HD2  1 
ATOM   43    H  HD3  . PRO A 1 47  ? -31.309 19.169 51.061 1.00 190.70 ? 255  PRO A HD3  1 
ATOM   44    N  N    . LYS A 1 48  ? -29.035 14.958 48.662 1.00 91.21  ? 256  LYS A N    1 
ATOM   45    C  CA   . LYS A 1 48  ? -29.202 13.582 48.218 1.00 78.65  ? 256  LYS A CA   1 
ATOM   46    C  C    . LYS A 1 48  ? -29.567 12.638 49.355 1.00 83.83  ? 256  LYS A C    1 
ATOM   47    O  O    . LYS A 1 48  ? -29.850 11.464 49.096 1.00 87.09  ? 256  LYS A O    1 
ATOM   48    C  CB   . LYS A 1 48  ? -27.921 13.091 47.538 1.00 73.81  ? 256  LYS A CB   1 
ATOM   49    H  H    . LYS A 1 48  ? -28.216 15.216 48.710 1.00 109.45 ? 256  LYS A H    1 
ATOM   50    H  HA   . LYS A 1 48  ? -29.917 13.549 47.563 1.00 94.38  ? 256  LYS A HA   1 
ATOM   51    N  N    . CYS A 1 49  ? -29.569 13.117 50.597 1.00 85.19  ? 257  CYS A N    1 
ATOM   52    C  CA   . CYS A 1 49  ? -29.941 12.292 51.737 1.00 77.63  ? 257  CYS A CA   1 
ATOM   53    C  C    . CYS A 1 49  ? -30.432 13.202 52.853 1.00 65.36  ? 257  CYS A C    1 
ATOM   54    O  O    . CYS A 1 49  ? -30.127 14.397 52.883 1.00 64.51  ? 257  CYS A O    1 
ATOM   55    C  CB   . CYS A 1 49  ? -28.764 11.440 52.222 1.00 68.16  ? 257  CYS A CB   1 
ATOM   56    S  SG   . CYS A 1 49  ? -27.622 12.321 53.313 1.00 60.86  ? 257  CYS A SG   1 
ATOM   57    H  H    . CYS A 1 49  ? -29.357 13.924 50.805 1.00 102.23 ? 257  CYS A H    1 
ATOM   58    H  HA   . CYS A 1 49  ? -30.665 11.699 51.484 1.00 93.16  ? 257  CYS A HA   1 
ATOM   59    H  HB2  . CYS A 1 49  ? -29.112 10.677 52.711 1.00 81.80  ? 257  CYS A HB2  1 
ATOM   60    H  HB3  . CYS A 1 49  ? -28.261 11.134 51.451 1.00 81.80  ? 257  CYS A HB3  1 
ATOM   61    N  N    . ASP A 1 50  ? -31.207 12.622 53.766 1.00 61.39  ? 258  ASP A N    1 
ATOM   62    C  CA   . ASP A 1 50  ? -31.668 13.368 54.929 1.00 59.72  ? 258  ASP A CA   1 
ATOM   63    C  C    . ASP A 1 50  ? -30.478 13.765 55.796 1.00 57.78  ? 258  ASP A C    1 
ATOM   64    O  O    . ASP A 1 50  ? -29.616 12.938 56.108 1.00 49.56  ? 258  ASP A O    1 
ATOM   65    C  CB   . ASP A 1 50  ? -32.665 12.533 55.734 1.00 59.90  ? 258  ASP A CB   1 
ATOM   66    C  CG   . ASP A 1 50  ? -34.019 12.402 55.044 1.00 63.25  ? 258  ASP A CG   1 
ATOM   67    O  OD1  . ASP A 1 50  ? -34.184 12.941 53.927 1.00 63.29  ? 258  ASP A OD1  1 
ATOM   68    O  OD2  . ASP A 1 50  ? -34.925 11.763 55.623 1.00 63.11  ? 258  ASP A OD2  1 
ATOM   69    H  H    . ASP A 1 50  ? -31.477 11.806 53.735 1.00 73.67  ? 258  ASP A H    1 
ATOM   70    H  HA   . ASP A 1 50  ? -32.115 14.177 54.635 1.00 71.67  ? 258  ASP A HA   1 
ATOM   71    H  HB2  . ASP A 1 50  ? -32.304 11.641 55.858 1.00 71.89  ? 258  ASP A HB2  1 
ATOM   72    H  HB3  . ASP A 1 50  ? -32.808 12.955 56.596 1.00 71.89  ? 258  ASP A HB3  1 
ATOM   73    N  N    . ILE A 1 51  ? -30.430 15.038 56.179 1.00 56.65  ? 259  ILE A N    1 
ATOM   74    C  CA   . ILE A 1 51  ? -29.327 15.596 56.955 1.00 55.61  ? 259  ILE A CA   1 
ATOM   75    C  C    . ILE A 1 51  ? -29.856 15.912 58.348 1.00 56.15  ? 259  ILE A C    1 
ATOM   76    O  O    . ILE A 1 51  ? -30.642 16.852 58.527 1.00 56.22  ? 259  ILE A O    1 
ATOM   77    C  CB   . ILE A 1 51  ? -28.735 16.843 56.282 1.00 59.11  ? 259  ILE A CB   1 
ATOM   78    C  CG1  . ILE A 1 51  ? -28.203 16.484 54.890 1.00 60.13  ? 259  ILE A CG1  1 
ATOM   79    C  CG2  . ILE A 1 51  ? -27.619 17.446 57.140 1.00 44.60  ? 259  ILE A CG2  1 
ATOM   80    C  CD1  . ILE A 1 51  ? -27.759 17.676 54.069 1.00 58.36  ? 259  ILE A CD1  1 
ATOM   81    H  H    . ILE A 1 51  ? -31.043 15.613 55.997 1.00 67.98  ? 259  ILE A H    1 
ATOM   82    H  HA   . ILE A 1 51  ? -28.624 14.933 57.038 1.00 66.74  ? 259  ILE A HA   1 
ATOM   83    H  HB   . ILE A 1 51  ? -29.439 17.504 56.182 1.00 70.94  ? 259  ILE A HB   1 
ATOM   84    H  HG12 . ILE A 1 51  ? -27.439 15.895 54.992 1.00 72.16  ? 259  ILE A HG12 1 
ATOM   85    H  HG13 . ILE A 1 51  ? -28.903 16.030 54.397 1.00 72.16  ? 259  ILE A HG13 1 
ATOM   86    H  HG21 . ILE A 1 51  ? -27.265 18.229 56.691 1.00 53.51  ? 259  ILE A HG21 1 
ATOM   87    H  HG22 . ILE A 1 51  ? -27.984 17.694 58.003 1.00 53.51  ? 259  ILE A HG22 1 
ATOM   88    H  HG23 . ILE A 1 51  ? -26.918 16.785 57.254 1.00 53.51  ? 259  ILE A HG23 1 
ATOM   89    H  HD11 . ILE A 1 51  ? -27.438 17.364 53.208 1.00 70.03  ? 259  ILE A HD11 1 
ATOM   90    H  HD12 . ILE A 1 51  ? -28.515 18.272 53.944 1.00 70.03  ? 259  ILE A HD12 1 
ATOM   91    H  HD13 . ILE A 1 51  ? -27.048 18.137 54.540 1.00 70.03  ? 259  ILE A HD13 1 
ATOM   92    N  N    . SER A 1 52  ? -29.419 15.130 59.341 1.00 54.73  ? 260  SER A N    1 
ATOM   93    C  CA   . SER A 1 52  ? -29.897 15.270 60.709 1.00 54.98  ? 260  SER A CA   1 
ATOM   94    C  C    . SER A 1 52  ? -28.802 15.581 61.723 1.00 55.22  ? 260  SER A C    1 
ATOM   95    O  O    . SER A 1 52  ? -29.128 15.914 62.868 1.00 57.31  ? 260  SER A O    1 
ATOM   96    C  CB   . SER A 1 52  ? -30.629 13.992 61.149 1.00 52.92  ? 260  SER A CB   1 
ATOM   97    O  OG   . SER A 1 52  ? -29.812 12.847 60.968 1.00 56.18  ? 260  SER A OG   1 
ATOM   98    H  H    . SER A 1 52  ? -28.838 14.504 59.240 1.00 65.68  ? 260  SER A H    1 
ATOM   99    H  HA   . SER A 1 52  ? -30.536 15.999 60.738 1.00 65.98  ? 260  SER A HA   1 
ATOM   100   H  HB2  . SER A 1 52  ? -30.860 14.068 62.087 1.00 63.51  ? 260  SER A HB2  1 
ATOM   101   H  HB3  . SER A 1 52  ? -31.434 13.891 60.617 1.00 63.51  ? 260  SER A HB3  1 
ATOM   102   H  HG   . SER A 1 52  ? -30.225 12.158 61.212 1.00 67.42  ? 260  SER A HG   1 
ATOM   103   N  N    . GLY A 1 53  ? -27.529 15.491 61.348 1.00 52.71  ? 261  GLY A N    1 
ATOM   104   C  CA   . GLY A 1 53  ? -26.460 15.781 62.291 1.00 50.27  ? 261  GLY A CA   1 
ATOM   105   C  C    . GLY A 1 53  ? -26.448 17.253 62.671 1.00 50.06  ? 261  GLY A C    1 
ATOM   106   O  O    . GLY A 1 53  ? -26.517 18.135 61.806 1.00 50.74  ? 261  GLY A O    1 
ATOM   107   H  H    . GLY A 1 53  ? -27.262 15.266 60.561 1.00 63.26  ? 261  GLY A H    1 
ATOM   108   H  HA2  . GLY A 1 53  ? -26.582 15.253 63.096 1.00 60.32  ? 261  GLY A HA2  1 
ATOM   109   H  HA3  . GLY A 1 53  ? -25.604 15.554 61.896 1.00 60.32  ? 261  GLY A HA3  1 
ATOM   110   N  N    . LYS A 1 54  ? -26.350 17.525 63.975 1.00 49.17  ? 262  LYS A N    1 
ATOM   111   C  CA   . LYS A 1 54  ? -26.381 18.905 64.452 1.00 48.55  ? 262  LYS A CA   1 
ATOM   112   C  C    . LYS A 1 54  ? -25.250 19.734 63.852 1.00 44.72  ? 262  LYS A C    1 
ATOM   113   O  O    . LYS A 1 54  ? -25.442 20.912 63.528 1.00 43.44  ? 262  LYS A O    1 
ATOM   114   C  CB   . LYS A 1 54  ? -26.305 18.932 65.979 1.00 52.86  ? 262  LYS A CB   1 
ATOM   115   C  CG   . LYS A 1 54  ? -27.571 18.451 66.673 1.00 58.02  ? 262  LYS A CG   1 
ATOM   116   H  H    . LYS A 1 54  ? -26.265 16.935 64.594 1.00 59.01  ? 262  LYS A H    1 
ATOM   117   H  HA   . LYS A 1 54  ? -27.222 19.311 64.188 1.00 58.26  ? 262  LYS A HA   1 
ATOM   118   H  HB2  . LYS A 1 54  ? -25.576 18.359 66.264 1.00 63.43  ? 262  LYS A HB2  1 
ATOM   119   H  HB3  . LYS A 1 54  ? -26.138 19.843 66.267 1.00 63.43  ? 262  LYS A HB3  1 
ATOM   120   N  N    . GLU A 1 55  ? -24.063 19.140 63.696 1.00 46.66  ? 263  GLU A N    1 
ATOM   121   C  CA   . GLU A 1 55  ? -22.917 19.899 63.201 1.00 43.57  ? 263  GLU A CA   1 
ATOM   122   C  C    . GLU A 1 55  ? -23.080 20.261 61.728 1.00 43.82  ? 263  GLU A C    1 
ATOM   123   O  O    . GLU A 1 55  ? -22.734 21.375 61.318 1.00 43.44  ? 263  GLU A O    1 
ATOM   124   C  CB   . GLU A 1 55  ? -21.628 19.106 63.422 1.00 48.16  ? 263  GLU A CB   1 
ATOM   125   C  CG   . GLU A 1 55  ? -21.307 18.845 64.888 1.00 53.69  ? 263  GLU A CG   1 
ATOM   126   C  CD   . GLU A 1 55  ? -21.326 17.366 65.240 1.00 59.59  ? 263  GLU A CD   1 
ATOM   127   O  OE1  . GLU A 1 55  ? -20.234 16.781 65.404 1.00 61.39  ? 263  GLU A OE1  1 
ATOM   128   O  OE2  . GLU A 1 55  ? -22.432 16.790 65.347 1.00 61.64  ? 263  GLU A OE2  1 
ATOM   129   H  H    . GLU A 1 55  ? -23.900 18.313 63.867 1.00 55.99  ? 263  GLU A H    1 
ATOM   130   H  HA   . GLU A 1 55  ? -22.848 20.725 63.704 1.00 52.29  ? 263  GLU A HA   1 
ATOM   131   H  HB2  . GLU A 1 55  ? -21.711 18.246 62.979 1.00 57.79  ? 263  GLU A HB2  1 
ATOM   132   H  HB3  . GLU A 1 55  ? -20.887 19.602 63.040 1.00 57.79  ? 263  GLU A HB3  1 
ATOM   133   H  HG2  . GLU A 1 55  ? -20.422 19.188 65.083 1.00 64.43  ? 263  GLU A HG2  1 
ATOM   134   H  HG3  . GLU A 1 55  ? -21.967 19.293 65.440 1.00 64.43  ? 263  GLU A HG3  1 
ATOM   135   N  N    . ALA A 1 56  ? -23.606 19.338 60.918 1.00 44.16  ? 264  ALA A N    1 
ATOM   136   C  CA   . ALA A 1 56  ? -23.774 19.614 59.493 1.00 40.70  ? 264  ALA A CA   1 
ATOM   137   C  C    . ALA A 1 56  ? -24.846 20.669 59.250 1.00 68.82  ? 264  ALA A C    1 
ATOM   138   O  O    . ALA A 1 56  ? -24.693 21.527 58.371 1.00 39.75  ? 264  ALA A O    1 
ATOM   139   C  CB   . ALA A 1 56  ? -24.117 18.327 58.746 1.00 39.51  ? 264  ALA A CB   1 
ATOM   140   H  H    . ALA A 1 56  ? -23.870 18.558 61.165 1.00 53.00  ? 264  ALA A H    1 
ATOM   141   H  HA   . ALA A 1 56  ? -22.937 19.951 59.137 1.00 48.84  ? 264  ALA A HA   1 
ATOM   142   H  HB1  . ALA A 1 56  ? -24.224 18.528 57.803 1.00 47.41  ? 264  ALA A HB1  1 
ATOM   143   H  HB2  . ALA A 1 56  ? -23.396 17.689 58.869 1.00 47.41  ? 264  ALA A HB2  1 
ATOM   144   H  HB3  . ALA A 1 56  ? -24.943 17.965 59.104 1.00 47.41  ? 264  ALA A HB3  1 
ATOM   145   N  N    . ILE A 1 57  ? -25.943 20.618 60.008 1.00 42.28  ? 265  ILE A N    1 
ATOM   146   C  CA   . ILE A 1 57  ? -27.004 21.609 59.849 1.00 42.39  ? 265  ILE A CA   1 
ATOM   147   C  C    . ILE A 1 57  ? -26.487 22.997 60.208 1.00 41.57  ? 265  ILE A C    1 
ATOM   148   O  O    . ILE A 1 57  ? -26.808 23.988 59.540 1.00 48.63  ? 265  ILE A O    1 
ATOM   149   C  CB   . ILE A 1 57  ? -28.229 21.205 60.692 1.00 58.57  ? 265  ILE A CB   1 
ATOM   150   C  CG1  . ILE A 1 57  ? -28.936 20.017 60.037 1.00 61.24  ? 265  ILE A CG1  1 
ATOM   151   C  CG2  . ILE A 1 57  ? -29.211 22.369 60.850 1.00 58.67  ? 265  ILE A CG2  1 
ATOM   152   C  CD1  . ILE A 1 57  ? -29.569 19.058 61.018 1.00 63.39  ? 265  ILE A CD1  1 
ATOM   153   H  H    . ILE A 1 57  ? -26.095 20.026 60.613 1.00 50.74  ? 265  ILE A H    1 
ATOM   154   H  HA   . ILE A 1 57  ? -27.277 21.627 58.919 1.00 50.86  ? 265  ILE A HA   1 
ATOM   155   H  HB   . ILE A 1 57  ? -27.924 20.937 61.573 1.00 70.29  ? 265  ILE A HB   1 
ATOM   156   H  HG12 . ILE A 1 57  ? -29.637 20.352 59.457 1.00 73.49  ? 265  ILE A HG12 1 
ATOM   157   H  HG13 . ILE A 1 57  ? -28.288 19.519 59.514 1.00 73.49  ? 265  ILE A HG13 1 
ATOM   158   H  HG21 . ILE A 1 57  ? -29.965 22.075 61.385 1.00 70.41  ? 265  ILE A HG21 1 
ATOM   159   H  HG22 . ILE A 1 57  ? -28.759 23.105 61.292 1.00 70.41  ? 265  ILE A HG22 1 
ATOM   160   H  HG23 . ILE A 1 57  ? -29.516 22.646 59.972 1.00 70.41  ? 265  ILE A HG23 1 
ATOM   161   H  HD11 . ILE A 1 57  ? -29.993 18.337 60.526 1.00 76.07  ? 265  ILE A HD11 1 
ATOM   162   H  HD12 . ILE A 1 57  ? -28.880 18.701 61.600 1.00 76.07  ? 265  ILE A HD12 1 
ATOM   163   H  HD13 . ILE A 1 57  ? -30.231 19.535 61.543 1.00 76.07  ? 265  ILE A HD13 1 
ATOM   164   N  N    . SER A 1 58  ? -25.670 23.091 61.260 1.00 50.55  ? 266  SER A N    1 
ATOM   165   C  CA   . SER A 1 58  ? -25.065 24.371 61.618 1.00 53.85  ? 266  SER A CA   1 
ATOM   166   C  C    . SER A 1 58  ? -24.180 24.899 60.496 1.00 53.44  ? 266  SER A C    1 
ATOM   167   O  O    . SER A 1 58  ? -24.191 26.099 60.199 1.00 38.92  ? 266  SER A O    1 
ATOM   168   C  CB   . SER A 1 58  ? -24.255 24.226 62.906 1.00 56.33  ? 266  SER A CB   1 
ATOM   169   O  OG   . SER A 1 58  ? -23.406 25.347 63.097 1.00 57.08  ? 266  SER A OG   1 
ATOM   170   H  H    . SER A 1 58  ? -25.453 22.437 61.775 1.00 60.67  ? 266  SER A H    1 
ATOM   171   H  HA   . SER A 1 58  ? -25.769 25.019 61.777 1.00 64.63  ? 266  SER A HA   1 
ATOM   172   H  HB2  . SER A 1 58  ? -24.865 24.160 63.657 1.00 67.60  ? 266  SER A HB2  1 
ATOM   173   H  HB3  . SER A 1 58  ? -23.712 23.424 62.849 1.00 67.60  ? 266  SER A HB3  1 
ATOM   174   H  HG   . SER A 1 58  ? -22.966 25.256 63.807 1.00 68.50  ? 266  SER A HG   1 
ATOM   175   N  N    . ALA A 1 59  ? -23.397 24.020 59.867 1.00 51.93  ? 267  ALA A N    1 
ATOM   176   C  CA   . ALA A 1 59  ? -22.512 24.460 58.794 1.00 47.57  ? 267  ALA A CA   1 
ATOM   177   C  C    . ALA A 1 59  ? -23.305 24.888 57.566 1.00 46.60  ? 267  ALA A C    1 
ATOM   178   O  O    . ALA A 1 59  ? -22.939 25.859 56.892 1.00 48.53  ? 267  ALA A O    1 
ATOM   179   C  CB   . ALA A 1 59  ? -21.524 23.347 58.439 1.00 46.78  ? 267  ALA A CB   1 
ATOM   180   H  H    . ALA A 1 59  ? -23.360 23.179 60.041 1.00 62.32  ? 267  ALA A H    1 
ATOM   181   H  HA   . ALA A 1 59  ? -22.002 25.225 59.101 1.00 57.09  ? 267  ALA A HA   1 
ATOM   182   H  HB1  . ALA A 1 59  ? -20.944 23.656 57.725 1.00 56.13  ? 267  ALA A HB1  1 
ATOM   183   H  HB2  . ALA A 1 59  ? -20.996 23.132 59.224 1.00 56.13  ? 267  ALA A HB2  1 
ATOM   184   H  HB3  . ALA A 1 59  ? -22.020 22.566 58.148 1.00 56.13  ? 267  ALA A HB3  1 
ATOM   185   N  N    . LEU A 1 60  ? -24.396 24.181 57.259 1.00 44.36  ? 268  LEU A N    1 
ATOM   186   C  CA   . LEU A 1 60  ? -25.234 24.566 56.128 1.00 45.46  ? 268  LEU A CA   1 
ATOM   187   C  C    . LEU A 1 60  ? -25.924 25.902 56.366 1.00 46.36  ? 268  LEU A C    1 
ATOM   188   O  O    . LEU A 1 60  ? -26.142 26.660 55.415 1.00 46.66  ? 268  LEU A O    1 
ATOM   189   C  CB   . LEU A 1 60  ? -26.279 23.485 55.851 1.00 46.16  ? 268  LEU A CB   1 
ATOM   190   C  CG   . LEU A 1 60  ? -25.769 22.178 55.245 1.00 45.66  ? 268  LEU A CG   1 
ATOM   191   C  CD1  . LEU A 1 60  ? -26.885 21.151 55.231 1.00 49.14  ? 268  LEU A CD1  1 
ATOM   192   C  CD2  . LEU A 1 60  ? -25.230 22.398 53.838 1.00 44.07  ? 268  LEU A CD2  1 
ATOM   193   H  H    . LEU A 1 60  ? -24.667 23.485 57.686 1.00 53.23  ? 268  LEU A H    1 
ATOM   194   H  HA   . LEU A 1 60  ? -24.676 24.653 55.339 1.00 54.56  ? 268  LEU A HA   1 
ATOM   195   H  HB2  . LEU A 1 60  ? -26.714 23.263 56.689 1.00 55.40  ? 268  LEU A HB2  1 
ATOM   196   H  HB3  . LEU A 1 60  ? -26.935 23.850 55.236 1.00 55.40  ? 268  LEU A HB3  1 
ATOM   197   H  HG   . LEU A 1 60  ? -25.048 21.833 55.794 1.00 54.80  ? 268  LEU A HG   1 
ATOM   198   H  HD11 . LEU A 1 60  ? -26.550 20.327 54.845 1.00 58.97  ? 268  LEU A HD11 1 
ATOM   199   H  HD12 . LEU A 1 60  ? -27.181 20.994 56.141 1.00 58.97  ? 268  LEU A HD12 1 
ATOM   200   H  HD13 . LEU A 1 60  ? -27.620 21.492 54.698 1.00 58.97  ? 268  LEU A HD13 1 
ATOM   201   H  HD21 . LEU A 1 60  ? -24.916 21.552 53.485 1.00 52.89  ? 268  LEU A HD21 1 
ATOM   202   H  HD22 . LEU A 1 60  ? -25.942 22.747 53.279 1.00 52.89  ? 268  LEU A HD22 1 
ATOM   203   H  HD23 . LEU A 1 60  ? -24.498 23.033 53.877 1.00 52.89  ? 268  LEU A HD23 1 
ATOM   204   N  N    . SER A 1 61  ? -26.279 26.205 57.617 1.00 47.54  ? 269  SER A N    1 
ATOM   205   C  CA   . SER A 1 61  ? -26.932 27.476 57.913 1.00 51.67  ? 269  SER A CA   1 
ATOM   206   C  C    . SER A 1 61  ? -25.949 28.639 57.863 1.00 49.39  ? 269  SER A C    1 
ATOM   207   O  O    . SER A 1 61  ? -26.348 29.769 57.561 1.00 50.59  ? 269  SER A O    1 
ATOM   208   C  CB   . SER A 1 61  ? -27.603 27.416 59.284 1.00 55.31  ? 269  SER A CB   1 
ATOM   209   O  OG   . SER A 1 61  ? -26.657 27.601 60.323 1.00 56.74  ? 269  SER A OG   1 
ATOM   210   H  H    . SER A 1 61  ? -26.154 25.699 58.301 1.00 57.05  ? 269  SER A H    1 
ATOM   211   H  HA   . SER A 1 61  ? -27.620 27.637 57.249 1.00 62.01  ? 269  SER A HA   1 
ATOM   212   H  HB2  . SER A 1 61  ? -28.272 28.117 59.338 1.00 66.37  ? 269  SER A HB2  1 
ATOM   213   H  HB3  . SER A 1 61  ? -28.024 26.549 59.392 1.00 66.37  ? 269  SER A HB3  1 
ATOM   214   H  HG   . SER A 1 61  ? -26.072 27.000 60.288 1.00 68.08  ? 269  SER A HG   1 
ATOM   215   N  N    . ARG A 1 62  ? -24.671 28.391 58.155 1.00 48.74  ? 270  ARG A N    1 
ATOM   216   C  CA   . ARG A 1 62  ? -23.670 29.450 58.159 1.00 47.14  ? 270  ARG A CA   1 
ATOM   217   C  C    . ARG A 1 62  ? -22.965 29.615 56.821 1.00 50.00  ? 270  ARG A C    1 
ATOM   218   O  O    . ARG A 1 62  ? -22.428 30.696 56.552 1.00 51.15  ? 270  ARG A O    1 
ATOM   219   C  CB   . ARG A 1 62  ? -22.619 29.184 59.239 1.00 44.49  ? 270  ARG A CB   1 
ATOM   220   C  CG   . ARG A 1 62  ? -23.095 29.432 60.661 1.00 45.10  ? 270  ARG A CG   1 
ATOM   221   C  CD   . ARG A 1 62  ? -22.015 29.042 61.646 1.00 45.44  ? 270  ARG A CD   1 
ATOM   222   N  NE   . ARG A 1 62  ? -21.738 27.606 61.589 1.00 45.75  ? 270  ARG A NE   1 
ATOM   223   C  CZ   . ARG A 1 62  ? -20.539 27.056 61.751 1.00 44.26  ? 270  ARG A CZ   1 
ATOM   224   N  NH1  . ARG A 1 62  ? -19.470 27.812 61.972 1.00 46.16  ? 270  ARG A NH1  1 
ATOM   225   N  NH2  . ARG A 1 62  ? -20.404 25.737 61.680 1.00 40.73  ? 270  ARG A NH2  1 
ATOM   226   H  H    . ARG A 1 62  ? -24.361 27.614 58.355 1.00 58.49  ? 270  ARG A H    1 
ATOM   227   H  HA   . ARG A 1 62  ? -24.106 30.290 58.369 1.00 56.57  ? 270  ARG A HA   1 
ATOM   228   H  HB2  . ARG A 1 62  ? -22.342 28.257 59.180 1.00 53.39  ? 270  ARG A HB2  1 
ATOM   229   H  HB3  . ARG A 1 62  ? -21.858 29.763 59.079 1.00 53.39  ? 270  ARG A HB3  1 
ATOM   230   H  HG2  . ARG A 1 62  ? -23.293 30.374 60.777 1.00 54.12  ? 270  ARG A HG2  1 
ATOM   231   H  HG3  . ARG A 1 62  ? -23.882 28.894 60.838 1.00 54.12  ? 270  ARG A HG3  1 
ATOM   232   H  HD2  . ARG A 1 62  ? -21.198 29.519 61.433 1.00 54.53  ? 270  ARG A HD2  1 
ATOM   233   H  HD3  . ARG A 1 62  ? -22.307 29.260 62.545 1.00 54.53  ? 270  ARG A HD3  1 
ATOM   234   H  HE   . ARG A 1 62  ? -22.401 27.079 61.438 1.00 54.91  ? 270  ARG A HE   1 
ATOM   235   H  HH11 . ARG A 1 62  ? -19.551 28.667 62.019 1.00 55.39  ? 270  ARG A HH11 1 
ATOM   236   H  HH12 . ARG A 1 62  ? -18.698 27.447 62.074 1.00 55.39  ? 270  ARG A HH12 1 
ATOM   237   H  HH21 . ARG A 1 62  ? -21.092 25.241 61.534 1.00 48.88  ? 270  ARG A HH21 1 
ATOM   238   H  HH22 . ARG A 1 62  ? -19.629 25.377 61.781 1.00 48.88  ? 270  ARG A HH22 1 
ATOM   239   N  N    . ALA A 1 63  ? -22.942 28.580 55.985 1.00 53.56  ? 271  ALA A N    1 
ATOM   240   C  CA   . ALA A 1 63  ? -22.283 28.684 54.691 1.00 59.78  ? 271  ALA A CA   1 
ATOM   241   C  C    . ALA A 1 63  ? -22.947 29.765 53.846 1.00 67.50  ? 271  ALA A C    1 
ATOM   242   O  O    . ALA A 1 63  ? -24.131 30.073 54.009 1.00 69.66  ? 271  ALA A O    1 
ATOM   243   C  CB   . ALA A 1 63  ? -22.323 27.341 53.961 1.00 59.23  ? 271  ALA A CB   1 
ATOM   244   H  H    . ALA A 1 63  ? -23.299 27.813 56.143 1.00 64.27  ? 271  ALA A H    1 
ATOM   245   H  HA   . ALA A 1 63  ? -21.354 28.930 54.824 1.00 71.74  ? 271  ALA A HA   1 
ATOM   246   H  HB1  . ALA A 1 63  ? -21.879 27.435 53.104 1.00 71.08  ? 271  ALA A HB1  1 
ATOM   247   H  HB2  . ALA A 1 63  ? -21.867 26.676 54.500 1.00 71.08  ? 271  ALA A HB2  1 
ATOM   248   H  HB3  . ALA A 1 63  ? -23.249 27.082 53.829 1.00 71.08  ? 271  ALA A HB3  1 
ATOM   249   N  N    . LYS A 1 64  ? -22.171 30.344 52.932 1.00 72.14  ? 272  LYS A N    1 
ATOM   250   C  CA   . LYS A 1 64  ? -22.618 31.484 52.141 1.00 77.84  ? 272  LYS A CA   1 
ATOM   251   C  C    . LYS A 1 64  ? -22.912 31.135 50.690 1.00 80.03  ? 272  LYS A C    1 
ATOM   252   O  O    . LYS A 1 64  ? -23.965 31.512 50.167 1.00 82.64  ? 272  LYS A O    1 
ATOM   253   C  CB   . LYS A 1 64  ? -21.567 32.602 52.204 1.00 79.91  ? 272  LYS A CB   1 
ATOM   254   C  CG   . LYS A 1 64  ? -21.489 33.290 53.560 1.00 82.22  ? 272  LYS A CG   1 
ATOM   255   C  CD   . LYS A 1 64  ? -20.403 34.353 53.587 1.00 83.75  ? 272  LYS A CD   1 
ATOM   256   H  H    . LYS A 1 64  ? -21.369 30.090 52.750 1.00 86.57  ? 272  LYS A H    1 
ATOM   257   H  HA   . LYS A 1 64  ? -23.437 31.828 52.531 1.00 93.41  ? 272  LYS A HA   1 
ATOM   258   H  HB2  . LYS A 1 64  ? -20.695 32.223 52.013 1.00 95.89  ? 272  LYS A HB2  1 
ATOM   259   H  HB3  . LYS A 1 64  ? -21.786 33.275 51.542 1.00 95.89  ? 272  LYS A HB3  1 
ATOM   260   H  HG2  . LYS A 1 64  ? -22.338 33.718 53.751 1.00 98.66  ? 272  LYS A HG2  1 
ATOM   261   H  HG3  . LYS A 1 64  ? -21.285 32.631 54.242 1.00 98.66  ? 272  LYS A HG3  1 
ATOM   262   N  N    . SER A 1 65  ? -22.012 30.425 50.017 1.00 79.52  ? 273  SER A N    1 
ATOM   263   C  CA   . SER A 1 65  ? -22.185 30.124 48.604 1.00 80.11  ? 273  SER A CA   1 
ATOM   264   C  C    . SER A 1 65  ? -23.014 28.859 48.412 1.00 78.20  ? 273  SER A C    1 
ATOM   265   O  O    . SER A 1 65  ? -23.026 27.962 49.260 1.00 76.89  ? 273  SER A O    1 
ATOM   266   C  CB   . SER A 1 65  ? -20.828 29.960 47.917 1.00 79.90  ? 273  SER A CB   1 
ATOM   267   O  OG   . SER A 1 65  ? -20.128 28.841 48.429 1.00 79.06  ? 273  SER A OG   1 
ATOM   268   H  H    . SER A 1 65  ? -21.290 30.106 50.359 1.00 95.43  ? 273  SER A H    1 
ATOM   269   H  HA   . SER A 1 65  ? -22.653 30.859 48.177 1.00 96.14  ? 273  SER A HA   1 
ATOM   270   H  HB2  . SER A 1 65  ? -20.971 29.834 46.966 1.00 95.88  ? 273  SER A HB2  1 
ATOM   271   H  HB3  . SER A 1 65  ? -20.300 30.759 48.069 1.00 95.88  ? 273  SER A HB3  1 
ATOM   272   H  HG   . SER A 1 65  ? -19.997 28.936 49.253 1.00 94.88  ? 273  SER A HG   1 
ATOM   273   N  N    . LYS A 1 66  ? -23.719 28.801 47.279 1.00 76.58  ? 274  LYS A N    1 
ATOM   274   C  CA   . LYS A 1 66  ? -24.450 27.590 46.922 1.00 75.10  ? 274  LYS A CA   1 
ATOM   275   C  C    . LYS A 1 66  ? -23.494 26.425 46.696 1.00 72.21  ? 274  LYS A C    1 
ATOM   276   O  O    . LYS A 1 66  ? -23.777 25.291 47.099 1.00 69.18  ? 274  LYS A O    1 
ATOM   277   C  CB   . LYS A 1 66  ? -25.296 27.839 45.673 1.00 77.11  ? 274  LYS A CB   1 
ATOM   278   C  CG   . LYS A 1 66  ? -25.955 26.589 45.110 1.00 78.82  ? 274  LYS A CG   1 
ATOM   279   H  H    . LYS A 1 66  ? -23.788 29.442 46.709 1.00 91.90  ? 274  LYS A H    1 
ATOM   280   H  HA   . LYS A 1 66  ? -25.047 27.353 47.649 1.00 90.13  ? 274  LYS A HA   1 
ATOM   281   H  HB2  . LYS A 1 66  ? -25.999 28.470 45.893 1.00 92.53  ? 274  LYS A HB2  1 
ATOM   282   H  HB3  . LYS A 1 66  ? -24.727 28.210 44.980 1.00 92.53  ? 274  LYS A HB3  1 
ATOM   283   N  N    . HIS A 1 67  ? -22.353 26.690 46.054 1.00 73.21  ? 275  HIS A N    1 
ATOM   284   C  CA   . HIS A 1 67  ? -21.366 25.643 45.823 1.00 73.78  ? 275  HIS A CA   1 
ATOM   285   C  C    . HIS A 1 67  ? -20.871 25.039 47.130 1.00 65.32  ? 275  HIS A C    1 
ATOM   286   O  O    . HIS A 1 67  ? -20.563 23.842 47.184 1.00 60.48  ? 275  HIS A O    1 
ATOM   287   C  CB   . HIS A 1 67  ? -20.187 26.203 45.028 1.00 80.46  ? 275  HIS A CB   1 
ATOM   288   C  CG   . HIS A 1 67  ? -18.967 25.337 45.074 1.00 86.05  ? 275  HIS A CG   1 
ATOM   289   N  ND1  . HIS A 1 67  ? -18.821 24.214 44.289 1.00 88.29  ? 275  HIS A ND1  1 
ATOM   290   C  CD2  . HIS A 1 67  ? -17.842 25.423 45.822 1.00 86.15  ? 275  HIS A CD2  1 
ATOM   291   C  CE1  . HIS A 1 67  ? -17.656 23.648 44.547 1.00 87.16  ? 275  HIS A CE1  1 
ATOM   292   N  NE2  . HIS A 1 67  ? -17.042 24.362 45.473 1.00 85.42  ? 275  HIS A NE2  1 
ATOM   293   H  H    . HIS A 1 67  ? -22.132 27.462 45.746 1.00 87.85  ? 275  HIS A H    1 
ATOM   294   H  HA   . HIS A 1 67  ? -21.772 24.935 45.300 1.00 88.54  ? 275  HIS A HA   1 
ATOM   295   H  HB2  . HIS A 1 67  ? -20.451 26.295 44.099 1.00 96.56  ? 275  HIS A HB2  1 
ATOM   296   H  HB3  . HIS A 1 67  ? -19.949 27.071 45.390 1.00 96.56  ? 275  HIS A HB3  1 
ATOM   297   H  HD2  . HIS A 1 67  ? -17.646 26.078 46.451 1.00 103.39 ? 275  HIS A HD2  1 
ATOM   298   H  HE1  . HIS A 1 67  ? -17.324 22.878 44.144 1.00 104.60 ? 275  HIS A HE1  1 
ATOM   299   H  HE2  . HIS A 1 67  ? -16.267 24.191 45.804 1.00 102.51 ? 275  HIS A HE2  1 
ATOM   300   N  N    . CYS A 1 68  ? -20.782 25.845 48.188 1.00 62.05  ? 276  CYS A N    1 
ATOM   301   C  CA   . CYS A 1 68  ? -20.292 25.337 49.462 1.00 57.82  ? 276  CYS A CA   1 
ATOM   302   C  C    . CYS A 1 68  ? -21.347 24.504 50.177 1.00 52.80  ? 276  CYS A C    1 
ATOM   303   O  O    . CYS A 1 68  ? -21.032 23.444 50.732 1.00 48.39  ? 276  CYS A O    1 
ATOM   304   C  CB   . CYS A 1 68  ? -19.836 26.496 50.348 1.00 60.64  ? 276  CYS A CB   1 
ATOM   305   S  SG   . CYS A 1 68  ? -19.141 25.980 51.932 1.00 61.04  ? 276  CYS A SG   1 
ATOM   306   H  H    . CYS A 1 68  ? -20.997 26.677 48.193 1.00 74.47  ? 276  CYS A H    1 
ATOM   307   H  HA   . CYS A 1 68  ? -19.524 24.767 49.298 1.00 69.38  ? 276  CYS A HA   1 
ATOM   308   H  HB2  . CYS A 1 68  ? -19.154 27.000 49.876 1.00 72.78  ? 276  CYS A HB2  1 
ATOM   309   H  HB3  . CYS A 1 68  ? -20.598 27.067 50.531 1.00 72.78  ? 276  CYS A HB3  1 
ATOM   310   H  HG   . CYS A 1 68  ? -18.815 26.955 52.551 1.00 73.25  ? 276  CYS A HG   1 
ATOM   311   N  N    . ARG A 1 69  ? -22.599 24.965 50.179 1.00 52.42  ? 277  ARG A N    1 
ATOM   312   C  CA   . ARG A 1 69  ? -23.671 24.179 50.777 1.00 56.82  ? 277  ARG A CA   1 
ATOM   313   C  C    . ARG A 1 69  ? -23.825 22.840 50.068 1.00 53.01  ? 277  ARG A C    1 
ATOM   314   O  O    . ARG A 1 69  ? -24.087 21.815 50.709 1.00 53.30  ? 277  ARG A O    1 
ATOM   315   C  CB   . ARG A 1 69  ? -24.984 24.962 50.735 1.00 66.14  ? 277  ARG A CB   1 
ATOM   316   C  CG   . ARG A 1 69  ? -25.004 26.183 51.641 1.00 73.24  ? 277  ARG A CG   1 
ATOM   317   C  CD   . ARG A 1 69  ? -26.400 26.779 51.747 1.00 81.81  ? 277  ARG A CD   1 
ATOM   318   N  NE   . ARG A 1 69  ? -26.875 27.318 50.472 1.00 88.85  ? 277  ARG A NE   1 
ATOM   319   C  CZ   . ARG A 1 69  ? -26.768 28.591 50.099 1.00 93.32  ? 277  ARG A CZ   1 
ATOM   320   N  NH1  . ARG A 1 69  ? -26.201 29.488 50.899 1.00 93.09  ? 277  ARG A NH1  1 
ATOM   321   N  NH2  . ARG A 1 69  ? -27.235 28.974 48.917 1.00 96.70  ? 277  ARG A NH2  1 
ATOM   322   H  H    . ARG A 1 69  ? -22.847 25.718 49.845 1.00 62.90  ? 277  ARG A H    1 
ATOM   323   H  HA   . ARG A 1 69  ? -23.455 24.004 51.706 1.00 68.18  ? 277  ARG A HA   1 
ATOM   324   H  HB2  . ARG A 1 69  ? -25.137 25.265 49.827 1.00 79.37  ? 277  ARG A HB2  1 
ATOM   325   H  HB3  . ARG A 1 69  ? -25.705 24.376 51.012 1.00 79.37  ? 277  ARG A HB3  1 
ATOM   326   H  HG2  . ARG A 1 69  ? -24.715 25.927 52.530 1.00 87.89  ? 277  ARG A HG2  1 
ATOM   327   H  HG3  . ARG A 1 69  ? -24.412 26.860 51.277 1.00 87.89  ? 277  ARG A HG3  1 
ATOM   328   H  HD2  . ARG A 1 69  ? -27.019 26.087 52.030 1.00 98.17  ? 277  ARG A HD2  1 
ATOM   329   H  HD3  . ARG A 1 69  ? -26.389 27.501 52.394 1.00 98.17  ? 277  ARG A HD3  1 
ATOM   330   H  HE   . ARG A 1 69  ? -27.250 26.772 49.924 1.00 106.63 ? 277  ARG A HE   1 
ATOM   331   H  HH11 . ARG A 1 69  ? -25.897 29.248 51.666 1.00 111.71 ? 277  ARG A HH11 1 
ATOM   332   H  HH12 . ARG A 1 69  ? -26.138 30.308 50.648 1.00 111.71 ? 277  ARG A HH12 1 
ATOM   333   H  HH21 . ARG A 1 69  ? -27.603 28.400 48.394 1.00 116.04 ? 277  ARG A HH21 1 
ATOM   334   H  HH22 . ARG A 1 69  ? -27.167 29.796 48.674 1.00 116.04 ? 277  ARG A HH22 1 
ATOM   335   N  N    . GLN A 1 70  ? -23.660 22.826 48.745 1.00 51.49  ? 278  GLN A N    1 
ATOM   336   C  CA   . GLN A 1 70  ? -23.779 21.579 47.997 1.00 51.79  ? 278  GLN A CA   1 
ATOM   337   C  C    . GLN A 1 70  ? -22.662 20.609 48.361 1.00 48.93  ? 278  GLN A C    1 
ATOM   338   O  O    . GLN A 1 70  ? -22.911 19.413 48.553 1.00 47.06  ? 278  GLN A O    1 
ATOM   339   C  CB   . GLN A 1 70  ? -23.770 21.867 46.496 1.00 52.85  ? 278  GLN A CB   1 
ATOM   340   C  CG   . GLN A 1 70  ? -23.891 20.625 45.627 1.00 54.29  ? 278  GLN A CG   1 
ATOM   341   H  H    . GLN A 1 70  ? -23.482 23.517 48.264 1.00 61.78  ? 278  GLN A H    1 
ATOM   342   H  HA   . GLN A 1 70  ? -24.625 21.159 48.217 1.00 62.16  ? 278  GLN A HA   1 
ATOM   343   H  HB2  . GLN A 1 70  ? -24.517 22.449 46.285 1.00 63.43  ? 278  GLN A HB2  1 
ATOM   344   H  HB3  . GLN A 1 70  ? -22.936 22.307 46.268 1.00 63.43  ? 278  GLN A HB3  1 
ATOM   345   N  N    . GLU A 1 71  ? -21.426 21.105 48.465 1.00 47.64  ? 279  GLU A N    1 
ATOM   346   C  CA   . GLU A 1 71  ? -20.300 20.235 48.790 1.00 47.91  ? 279  GLU A CA   1 
ATOM   347   C  C    . GLU A 1 71  ? -20.390 19.730 50.226 1.00 43.78  ? 279  GLU A C    1 
ATOM   348   O  O    . GLU A 1 71  ? -20.001 18.592 50.516 1.00 42.05  ? 279  GLU A O    1 
ATOM   349   C  CB   . GLU A 1 71  ? -18.983 20.977 48.561 1.00 50.05  ? 279  GLU A CB   1 
ATOM   350   C  CG   . GLU A 1 71  ? -17.747 20.162 48.900 1.00 52.18  ? 279  GLU A CG   1 
ATOM   351   H  H    . GLU A 1 71  ? -21.217 21.932 48.352 1.00 57.17  ? 279  GLU A H    1 
ATOM   352   H  HA   . GLU A 1 71  ? -20.316 19.465 48.201 1.00 57.49  ? 279  GLU A HA   1 
ATOM   353   H  HB2  . GLU A 1 71  ? -18.925 21.228 47.626 1.00 60.07  ? 279  GLU A HB2  1 
ATOM   354   H  HB3  . GLU A 1 71  ? -18.973 21.773 49.115 1.00 60.07  ? 279  GLU A HB3  1 
ATOM   355   N  N    . ILE A 1 72  ? -20.891 20.565 51.139 1.00 40.38  ? 280  ILE A N    1 
ATOM   356   C  CA   . ILE A 1 72  ? -21.146 20.116 52.505 1.00 39.86  ? 280  ILE A CA   1 
ATOM   357   C  C    . ILE A 1 72  ? -22.140 18.960 52.500 1.00 43.47  ? 280  ILE A C    1 
ATOM   358   O  O    . ILE A 1 72  ? -21.952 17.951 53.190 1.00 43.00  ? 280  ILE A O    1 
ATOM   359   C  CB   . ILE A 1 72  ? -21.643 21.293 53.367 1.00 41.03  ? 280  ILE A CB   1 
ATOM   360   C  CG1  . ILE A 1 72  ? -20.479 22.244 53.680 1.00 41.13  ? 280  ILE A CG1  1 
ATOM   361   C  CG2  . ILE A 1 72  ? -22.300 20.796 54.658 1.00 40.16  ? 280  ILE A CG2  1 
ATOM   362   C  CD1  . ILE A 1 72  ? -20.886 23.516 54.416 1.00 41.81  ? 280  ILE A CD1  1 
ATOM   363   H  H    . ILE A 1 72  ? -21.090 21.388 50.992 1.00 48.46  ? 280  ILE A H    1 
ATOM   364   H  HA   . ILE A 1 72  ? -20.316 19.794 52.891 1.00 47.83  ? 280  ILE A HA   1 
ATOM   365   H  HB   . ILE A 1 72  ? -22.307 21.783 52.858 1.00 49.23  ? 280  ILE A HB   1 
ATOM   366   H  HG12 . ILE A 1 72  ? -19.836 21.776 54.235 1.00 49.36  ? 280  ILE A HG12 1 
ATOM   367   H  HG13 . ILE A 1 72  ? -20.061 22.508 52.846 1.00 49.36  ? 280  ILE A HG13 1 
ATOM   368   H  HG21 . ILE A 1 72  ? -22.600 21.561 55.174 1.00 48.20  ? 280  ILE A HG21 1 
ATOM   369   H  HG22 . ILE A 1 72  ? -23.057 20.233 54.431 1.00 48.20  ? 280  ILE A HG22 1 
ATOM   370   H  HG23 . ILE A 1 72  ? -21.650 20.288 55.168 1.00 48.20  ? 280  ILE A HG23 1 
ATOM   371   H  HD11 . ILE A 1 72  ? -20.096 24.056 54.573 1.00 50.18  ? 280  ILE A HD11 1 
ATOM   372   H  HD12 . ILE A 1 72  ? -21.520 24.007 53.870 1.00 50.18  ? 280  ILE A HD12 1 
ATOM   373   H  HD13 . ILE A 1 72  ? -21.295 23.273 55.261 1.00 50.18  ? 280  ILE A HD13 1 
ATOM   374   N  N    . GLY A 1 73  ? -23.214 19.092 51.719 1.00 47.02  ? 281  GLY A N    1 
ATOM   375   C  CA   . GLY A 1 73  ? -24.218 18.042 51.670 1.00 51.47  ? 281  GLY A CA   1 
ATOM   376   C  C    . GLY A 1 73  ? -23.680 16.738 51.111 1.00 54.46  ? 281  GLY A C    1 
ATOM   377   O  O    . GLY A 1 73  ? -23.964 15.662 51.642 1.00 52.28  ? 281  GLY A O    1 
ATOM   378   H  H    . GLY A 1 73  ? -23.379 19.771 51.217 1.00 56.42  ? 281  GLY A H    1 
ATOM   379   H  HA2  . GLY A 1 73  ? -24.553 17.875 52.565 1.00 61.77  ? 281  GLY A HA2  1 
ATOM   380   H  HA3  . GLY A 1 73  ? -24.959 18.330 51.114 1.00 61.77  ? 281  GLY A HA3  1 
ATOM   381   N  N    . GLU A 1 74  ? -22.899 16.815 50.030 1.00 61.59  ? 282  GLU A N    1 
ATOM   382   C  CA   . GLU A 1 74  ? -22.359 15.606 49.415 1.00 68.52  ? 282  GLU A CA   1 
ATOM   383   C  C    . GLU A 1 74  ? -21.382 14.896 50.345 1.00 58.29  ? 282  GLU A C    1 
ATOM   384   O  O    . GLU A 1 74  ? -21.403 13.664 50.452 1.00 54.47  ? 282  GLU A O    1 
ATOM   385   C  CB   . GLU A 1 74  ? -21.677 15.951 48.091 1.00 81.06  ? 282  GLU A CB   1 
ATOM   386   C  CG   . GLU A 1 74  ? -22.625 16.475 47.025 1.00 93.87  ? 282  GLU A CG   1 
ATOM   387   C  CD   . GLU A 1 74  ? -21.908 16.855 45.744 1.00 103.04 ? 282  GLU A CD   1 
ATOM   388   O  OE1  . GLU A 1 74  ? -20.661 16.785 45.715 1.00 104.85 ? 282  GLU A OE1  1 
ATOM   389   O  OE2  . GLU A 1 74  ? -22.592 17.225 44.765 1.00 108.16 ? 282  GLU A OE2  1 
ATOM   390   H  H    . GLU A 1 74  ? -22.672 17.547 49.640 1.00 73.91  ? 282  GLU A H    1 
ATOM   391   H  HA   . GLU A 1 74  ? -23.088 14.996 49.225 1.00 82.22  ? 282  GLU A HA   1 
ATOM   392   N  N    . THR A 1 75  ? -20.514 15.650 51.021 1.00 52.12  ? 283  THR A N    1 
ATOM   393   C  CA   . THR A 1 75  ? -19.568 15.036 51.948 1.00 48.80  ? 283  THR A CA   1 
ATOM   394   C  C    . THR A 1 75  ? -20.304 14.319 53.074 1.00 46.01  ? 283  THR A C    1 
ATOM   395   O  O    . THR A 1 75  ? -20.006 13.161 53.390 1.00 42.95  ? 283  THR A O    1 
ATOM   396   C  CB   . THR A 1 75  ? -18.617 16.096 52.509 1.00 45.97  ? 283  THR A CB   1 
ATOM   397   O  OG1  . THR A 1 75  ? -17.906 16.724 51.435 1.00 40.66  ? 283  THR A OG1  1 
ATOM   398   C  CG2  . THR A 1 75  ? -17.613 15.472 53.473 1.00 45.66  ? 283  THR A CG2  1 
ATOM   399   H  H    . THR A 1 75  ? -20.453 16.506 50.961 1.00 62.55  ? 283  THR A H    1 
ATOM   400   H  HA   . THR A 1 75  ? -19.038 14.379 51.470 1.00 58.56  ? 283  THR A HA   1 
ATOM   401   H  HB   . THR A 1 75  ? -19.128 16.765 52.991 1.00 55.16  ? 283  THR A HB   1 
ATOM   402   H  HG1  . THR A 1 75  ? -18.448 17.091 50.908 1.00 48.79  ? 283  THR A HG1  1 
ATOM   403   H  HG21 . THR A 1 75  ? -17.018 16.155 53.819 1.00 54.79  ? 283  THR A HG21 1 
ATOM   404   H  HG22 . THR A 1 75  ? -18.080 15.055 54.213 1.00 54.79  ? 283  THR A HG22 1 
ATOM   405   H  HG23 . THR A 1 75  ? -17.087 14.799 53.013 1.00 54.79  ? 283  THR A HG23 1 
ATOM   406   N  N    . TYR A 1 76  ? -21.276 14.998 53.689 1.00 45.58  ? 284  TYR A N    1 
ATOM   407   C  CA   . TYR A 1 76  ? -22.035 14.397 54.781 1.00 44.85  ? 284  TYR A CA   1 
ATOM   408   C  C    . TYR A 1 76  ? -22.740 13.123 54.333 1.00 46.31  ? 284  TYR A C    1 
ATOM   409   O  O    . TYR A 1 76  ? -22.719 12.112 55.045 1.00 48.00  ? 284  TYR A O    1 
ATOM   410   C  CB   . TYR A 1 76  ? -23.048 15.408 55.325 1.00 46.78  ? 284  TYR A CB   1 
ATOM   411   C  CG   . TYR A 1 76  ? -24.049 14.834 56.309 1.00 47.22  ? 284  TYR A CG   1 
ATOM   412   C  CD1  . TYR A 1 76  ? -25.209 14.211 55.866 1.00 42.76  ? 284  TYR A CD1  1 
ATOM   413   C  CD2  . TYR A 1 76  ? -23.841 14.930 57.680 1.00 45.29  ? 284  TYR A CD2  1 
ATOM   414   C  CE1  . TYR A 1 76  ? -26.126 13.688 56.757 1.00 54.15  ? 284  TYR A CE1  1 
ATOM   415   C  CE2  . TYR A 1 76  ? -24.755 14.411 58.581 1.00 47.59  ? 284  TYR A CE2  1 
ATOM   416   C  CZ   . TYR A 1 76  ? -25.897 13.793 58.112 1.00 52.87  ? 284  TYR A CZ   1 
ATOM   417   O  OH   . TYR A 1 76  ? -26.816 13.275 58.998 1.00 56.70  ? 284  TYR A OH   1 
ATOM   418   H  H    . TYR A 1 76  ? -21.511 15.801 53.493 1.00 54.70  ? 284  TYR A H    1 
ATOM   419   H  HA   . TYR A 1 76  ? -21.426 14.166 55.500 1.00 53.82  ? 284  TYR A HA   1 
ATOM   420   H  HB2  . TYR A 1 76  ? -22.565 16.117 55.777 1.00 56.14  ? 284  TYR A HB2  1 
ATOM   421   H  HB3  . TYR A 1 76  ? -23.547 15.776 54.579 1.00 56.14  ? 284  TYR A HB3  1 
ATOM   422   H  HD1  . TYR A 1 76  ? -25.368 14.137 54.953 1.00 51.30  ? 284  TYR A HD1  1 
ATOM   423   H  HD2  . TYR A 1 76  ? -23.072 15.346 57.998 1.00 54.35  ? 284  TYR A HD2  1 
ATOM   424   H  HE1  . TYR A 1 76  ? -26.897 13.273 56.444 1.00 64.98  ? 284  TYR A HE1  1 
ATOM   425   H  HE2  . TYR A 1 76  ? -24.602 14.481 59.495 1.00 57.11  ? 284  TYR A HE2  1 
ATOM   426   H  HH   . TYR A 1 76  ? -26.559 13.404 59.787 1.00 68.04  ? 284  TYR A HH   1 
ATOM   427   N  N    . CYS A 1 77  ? -23.378 13.151 53.160 1.00 41.79  ? 285  CYS A N    1 
ATOM   428   C  CA   . CYS A 1 77  ? -24.161 11.999 52.726 1.00 43.48  ? 285  CYS A CA   1 
ATOM   429   C  C    . CYS A 1 77  ? -23.269 10.834 52.315 1.00 45.41  ? 285  CYS A C    1 
ATOM   430   O  O    . CYS A 1 77  ? -23.632 9.674  52.537 1.00 44.04  ? 285  CYS A O    1 
ATOM   431   C  CB   . CYS A 1 77  ? -25.095 12.397 51.581 1.00 53.15  ? 285  CYS A CB   1 
ATOM   432   S  SG   . CYS A 1 77  ? -26.481 13.478 52.084 1.00 55.21  ? 285  CYS A SG   1 
ATOM   433   H  H    . CYS A 1 77  ? -23.372 13.812 52.610 1.00 50.14  ? 285  CYS A H    1 
ATOM   434   H  HA   . CYS A 1 77  ? -24.712 11.701 53.466 1.00 52.16  ? 285  CYS A HA   1 
ATOM   435   H  HB2  . CYS A 1 77  ? -24.580 12.871 50.910 1.00 63.78  ? 285  CYS A HB2  1 
ATOM   436   H  HB3  . CYS A 1 77  ? -25.474 11.592 51.194 1.00 63.78  ? 285  CYS A HB3  1 
ATOM   437   N  N    . ARG A 1 78  ? -22.103 11.115 51.726 1.00 41.73  ? 286  ARG A N    1 
ATOM   438   C  CA   . ARG A 1 78  ? -21.152 10.049 51.419 1.00 50.09  ? 286  ARG A CA   1 
ATOM   439   C  C    . ARG A 1 78  ? -20.643 9.390  52.696 1.00 48.06  ? 286  ARG A C    1 
ATOM   440   O  O    . ARG A 1 78  ? -20.560 8.159  52.779 1.00 47.23  ? 286  ARG A O    1 
ATOM   441   C  CB   . ARG A 1 78  ? -19.985 10.606 50.601 1.00 53.75  ? 286  ARG A CB   1 
ATOM   442   C  CG   . ARG A 1 78  ? -18.987 9.553  50.115 1.00 57.92  ? 286  ARG A CG   1 
ATOM   443   C  CD   . ARG A 1 78  ? -19.252 9.146  48.674 1.00 61.88  ? 286  ARG A CD   1 
ATOM   444   H  H    . ARG A 1 78  ? -21.843 11.902 51.498 1.00 50.07  ? 286  ARG A H    1 
ATOM   445   H  HA   . ARG A 1 78  ? -21.597 9.371  50.886 1.00 60.11  ? 286  ARG A HA   1 
ATOM   446   H  HB2  . ARG A 1 78  ? -20.342 11.056 49.819 1.00 64.50  ? 286  ARG A HB2  1 
ATOM   447   H  HB3  . ARG A 1 78  ? -19.499 11.242 51.148 1.00 64.50  ? 286  ARG A HB3  1 
ATOM   448   H  HG2  . ARG A 1 78  ? -18.089 9.916  50.168 1.00 69.51  ? 286  ARG A HG2  1 
ATOM   449   H  HG3  . ARG A 1 78  ? -19.062 8.762  50.672 1.00 69.51  ? 286  ARG A HG3  1 
ATOM   450   N  N    . HIS A 1 79  ? -20.292 10.197 53.701 1.00 39.33  ? 287  HIS A N    1 
ATOM   451   C  CA   . HIS A 1 79  ? -19.890 9.647  54.992 1.00 45.58  ? 287  HIS A CA   1 
ATOM   452   C  C    . HIS A 1 79  ? -21.040 8.904  55.657 1.00 51.06  ? 287  HIS A C    1 
ATOM   453   O  O    . HIS A 1 79  ? -20.817 7.891  56.332 1.00 50.75  ? 287  HIS A O    1 
ATOM   454   C  CB   . HIS A 1 79  ? -19.383 10.770 55.900 1.00 44.44  ? 287  HIS A CB   1 
ATOM   455   C  CG   . HIS A 1 79  ? -18.766 10.289 57.178 1.00 45.40  ? 287  HIS A CG   1 
ATOM   456   N  ND1  . HIS A 1 79  ? -17.839 9.269  57.222 1.00 44.87  ? 287  HIS A ND1  1 
ATOM   457   C  CD2  . HIS A 1 79  ? -18.934 10.699 58.458 1.00 45.40  ? 287  HIS A CD2  1 
ATOM   458   C  CE1  . HIS A 1 79  ? -17.469 9.067  58.474 1.00 44.41  ? 287  HIS A CE1  1 
ATOM   459   N  NE2  . HIS A 1 79  ? -18.118 9.921  59.244 1.00 44.66  ? 287  HIS A NE2  1 
ATOM   460   H  H    . HIS A 1 79  ? -20.280 11.056 53.660 1.00 47.19  ? 287  HIS A H    1 
ATOM   461   H  HA   . HIS A 1 79  ? -19.164 9.018  54.856 1.00 54.70  ? 287  HIS A HA   1 
ATOM   462   H  HB2  . HIS A 1 79  ? -18.711 11.279 55.421 1.00 53.33  ? 287  HIS A HB2  1 
ATOM   463   H  HB3  . HIS A 1 79  ? -20.129 11.345 56.130 1.00 53.33  ? 287  HIS A HB3  1 
ATOM   464   H  HD2  . HIS A 1 79  ? -19.499 11.377 58.751 1.00 54.48  ? 287  HIS A HD2  1 
ATOM   465   H  HE1  . HIS A 1 79  ? -16.855 8.432  58.764 1.00 53.29  ? 287  HIS A HE1  1 
ATOM   466   H  HE2  . HIS A 1 79  ? -18.043 9.981  60.099 1.00 53.59  ? 287  HIS A HE2  1 
ATOM   467   N  N    . LYS A 1 80  ? -22.272 9.387  55.469 1.00 55.89  ? 288  LYS A N    1 
ATOM   468   C  CA   . LYS A 1 80  ? -23.439 8.721  56.039 1.00 61.56  ? 288  LYS A CA   1 
ATOM   469   C  C    . LYS A 1 80  ? -23.540 7.277  55.564 1.00 58.71  ? 288  LYS A C    1 
ATOM   470   O  O    . LYS A 1 80  ? -23.881 6.381  56.346 1.00 56.97  ? 288  LYS A O    1 
ATOM   471   C  CB   . LYS A 1 80  ? -24.704 9.495  55.664 1.00 69.69  ? 288  LYS A CB   1 
ATOM   472   C  CG   . LYS A 1 80  ? -26.011 8.897  56.182 1.00 78.39  ? 288  LYS A CG   1 
ATOM   473   C  CD   . LYS A 1 80  ? -26.334 9.362  57.591 1.00 83.54  ? 288  LYS A CD   1 
ATOM   474   C  CE   . LYS A 1 80  ? -27.700 10.027 57.645 1.00 88.13  ? 288  LYS A CE   1 
ATOM   475   N  NZ   . LYS A 1 80  ? -27.986 10.612 58.983 1.00 89.71  ? 288  LYS A NZ   1 
ATOM   476   H  H    . LYS A 1 80  ? -22.454 10.096 55.017 1.00 67.07  ? 288  LYS A H    1 
ATOM   477   H  HA   . LYS A 1 80  ? -23.363 8.717  57.006 1.00 73.88  ? 288  LYS A HA   1 
ATOM   478   H  HB2  . LYS A 1 80  ? -24.633 10.394 56.022 1.00 83.63  ? 288  LYS A HB2  1 
ATOM   479   H  HB3  . LYS A 1 80  ? -24.765 9.535  54.696 1.00 83.63  ? 288  LYS A HB3  1 
ATOM   480   H  HG2  . LYS A 1 80  ? -26.738 9.169  55.600 1.00 94.07  ? 288  LYS A HG2  1 
ATOM   481   H  HG3  . LYS A 1 80  ? -25.936 7.930  56.192 1.00 94.07  ? 288  LYS A HG3  1 
ATOM   482   H  HD2  . LYS A 1 80  ? -26.342 8.598  58.189 1.00 100.25 ? 288  LYS A HD2  1 
ATOM   483   H  HD3  . LYS A 1 80  ? -25.669 10.008 57.878 1.00 100.25 ? 288  LYS A HD3  1 
ATOM   484   H  HE2  . LYS A 1 80  ? -27.733 10.741 56.990 1.00 105.75 ? 288  LYS A HE2  1 
ATOM   485   H  HE3  . LYS A 1 80  ? -28.383 9.365  57.453 1.00 105.75 ? 288  LYS A HE3  1 
ATOM   486   H  HZ1  . LYS A 1 80  ? -28.790 10.993 58.982 1.00 107.65 ? 288  LYS A HZ1  1 
ATOM   487   H  HZ2  . LYS A 1 80  ? -27.967 9.975  59.604 1.00 107.65 ? 288  LYS A HZ2  1 
ATOM   488   H  HZ3  . LYS A 1 80  ? -27.375 11.228 59.182 1.00 107.65 ? 288  LYS A HZ3  1 
ATOM   489   N  N    . LEU A 1 81  ? -23.265 7.033  54.284 1.00 59.09  ? 289  LEU A N    1 
ATOM   490   C  CA   . LEU A 1 81  ? -23.355 5.692  53.719 1.00 60.14  ? 289  LEU A CA   1 
ATOM   491   C  C    . LEU A 1 81  ? -22.092 4.870  53.937 1.00 56.53  ? 289  LEU A C    1 
ATOM   492   O  O    . LEU A 1 81  ? -22.024 3.734  53.456 1.00 56.37  ? 289  LEU A O    1 
ATOM   493   C  CB   . LEU A 1 81  ? -23.657 5.776  52.220 1.00 63.15  ? 289  LEU A CB   1 
ATOM   494   C  CG   . LEU A 1 81  ? -24.920 6.551  51.831 1.00 67.04  ? 289  LEU A CG   1 
ATOM   495   C  CD1  . LEU A 1 81  ? -25.040 6.643  50.317 1.00 68.61  ? 289  LEU A CD1  1 
ATOM   496   C  CD2  . LEU A 1 81  ? -26.171 5.917  52.430 1.00 69.06  ? 289  LEU A CD2  1 
ATOM   497   H  H    . LEU A 1 81  ? -23.021 7.633  53.719 1.00 70.91  ? 289  LEU A H    1 
ATOM   498   H  HA   . LEU A 1 81  ? -24.090 5.224  54.144 1.00 72.17  ? 289  LEU A HA   1 
ATOM   499   H  HB2  . LEU A 1 81  ? -22.907 6.206  51.781 1.00 75.78  ? 289  LEU A HB2  1 
ATOM   500   H  HB3  . LEU A 1 81  ? -23.756 4.873  51.878 1.00 75.78  ? 289  LEU A HB3  1 
ATOM   501   H  HG   . LEU A 1 81  ? -24.850 7.455  52.178 1.00 80.45  ? 289  LEU A HG   1 
ATOM   502   H  HD11 . LEU A 1 81  ? -25.845 7.137  50.094 1.00 82.34  ? 289  LEU A HD11 1 
ATOM   503   H  HD12 . LEU A 1 81  ? -24.261 7.102  49.966 1.00 82.34  ? 289  LEU A HD12 1 
ATOM   504   H  HD13 . LEU A 1 81  ? -25.090 5.746  49.950 1.00 82.34  ? 289  LEU A HD13 1 
ATOM   505   H  HD21 . LEU A 1 81  ? -26.946 6.435  52.162 1.00 82.87  ? 289  LEU A HD21 1 
ATOM   506   H  HD22 . LEU A 1 81  ? -26.252 5.008  52.103 1.00 82.87  ? 289  LEU A HD22 1 
ATOM   507   H  HD23 . LEU A 1 81  ? -26.092 5.916  53.397 1.00 82.87  ? 289  LEU A HD23 1 
ATOM   508   N  N    . GLY A 1 82  ? -21.098 5.409  54.638 1.00 54.10  ? 290  GLY A N    1 
ATOM   509   C  CA   . GLY A 1 82  ? -19.873 4.674  54.891 1.00 52.56  ? 290  GLY A CA   1 
ATOM   510   C  C    . GLY A 1 82  ? -18.964 4.538  53.691 1.00 51.03  ? 290  GLY A C    1 
ATOM   511   O  O    . GLY A 1 82  ? -18.173 3.593  53.627 1.00 52.24  ? 290  GLY A O    1 
ATOM   512   H  H    . GLY A 1 82  ? -21.112 6.199  54.976 1.00 64.92  ? 290  GLY A H    1 
ATOM   513   H  HA2  . GLY A 1 82  ? -19.376 5.120  55.595 1.00 63.08  ? 290  GLY A HA2  1 
ATOM   514   H  HA3  . GLY A 1 82  ? -20.098 3.782  55.200 1.00 63.08  ? 290  GLY A HA3  1 
ATOM   515   N  N    . LEU A 1 83  ? -19.048 5.464  52.737 1.00 49.86  ? 291  LEU A N    1 
ATOM   516   C  CA   . LEU A 1 83  ? -18.265 5.402  51.511 1.00 51.78  ? 291  LEU A CA   1 
ATOM   517   C  C    . LEU A 1 83  ? -17.157 6.444  51.445 1.00 47.34  ? 291  LEU A C    1 
ATOM   518   O  O    . LEU A 1 83  ? -16.419 6.476  50.454 1.00 43.97  ? 291  LEU A O    1 
ATOM   519   C  CB   . LEU A 1 83  ? -19.190 5.567  50.296 1.00 60.53  ? 291  LEU A CB   1 
ATOM   520   C  CG   . LEU A 1 83  ? -19.859 4.332  49.675 1.00 71.05  ? 291  LEU A CG   1 
ATOM   521   C  CD1  . LEU A 1 83  ? -19.977 3.159  50.642 1.00 74.21  ? 291  LEU A CD1  1 
ATOM   522   C  CD2  . LEU A 1 83  ? -21.236 4.712  49.149 1.00 75.66  ? 291  LEU A CD2  1 
ATOM   523   H  H    . LEU A 1 83  ? -19.563 6.151  52.781 1.00 59.84  ? 291  LEU A H    1 
ATOM   524   H  HA   . LEU A 1 83  ? -17.851 4.526  51.450 1.00 62.14  ? 291  LEU A HA   1 
ATOM   525   H  HB2  . LEU A 1 83  ? -19.906 6.169  50.553 1.00 72.63  ? 291  LEU A HB2  1 
ATOM   526   H  HB3  . LEU A 1 83  ? -18.671 5.984  49.589 1.00 72.63  ? 291  LEU A HB3  1 
ATOM   527   H  HG   . LEU A 1 83  ? -19.326 4.037  48.920 1.00 85.26  ? 291  LEU A HG   1 
ATOM   528   H  HD11 . LEU A 1 83  ? -20.406 2.417  50.187 1.00 89.06  ? 291  LEU A HD11 1 
ATOM   529   H  HD12 . LEU A 1 83  ? -19.088 2.900  50.933 1.00 89.06  ? 291  LEU A HD12 1 
ATOM   530   H  HD13 . LEU A 1 83  ? -20.509 3.432  51.406 1.00 89.06  ? 291  LEU A HD13 1 
ATOM   531   H  HD21 . LEU A 1 83  ? -21.652 3.927  48.759 1.00 90.80  ? 291  LEU A HD21 1 
ATOM   532   H  HD22 . LEU A 1 83  ? -21.775 5.042  49.885 1.00 90.80  ? 291  LEU A HD22 1 
ATOM   533   H  HD23 . LEU A 1 83  ? -21.136 5.403  48.476 1.00 90.80  ? 291  LEU A HD23 1 
ATOM   534   N  N    . LEU A 1 84  ? -17.005 7.287  52.467 1.00 45.92  ? 292  LEU A N    1 
ATOM   535   C  CA   . LEU A 1 84  ? -16.045 8.383  52.408 1.00 43.08  ? 292  LEU A CA   1 
ATOM   536   C  C    . LEU A 1 84  ? -14.720 8.070  53.093 1.00 41.23  ? 292  LEU A C    1 
ATOM   537   O  O    . LEU A 1 84  ? -13.660 8.377  52.537 1.00 40.33  ? 292  LEU A O    1 
ATOM   538   C  CB   . LEU A 1 84  ? -16.652 9.648  53.032 1.00 41.24  ? 292  LEU A CB   1 
ATOM   539   C  CG   . LEU A 1 84  ? -15.859 10.939 52.800 1.00 39.19  ? 292  LEU A CG   1 
ATOM   540   C  CD1  . LEU A 1 84  ? -15.853 11.310 51.323 1.00 38.90  ? 292  LEU A CD1  1 
ATOM   541   C  CD2  . LEU A 1 84  ? -16.423 12.084 53.636 1.00 37.27  ? 292  LEU A CD2  1 
ATOM   542   H  H    . LEU A 1 84  ? -17.446 7.243  53.204 1.00 55.11  ? 292  LEU A H    1 
ATOM   543   H  HA   . LEU A 1 84  ? -15.855 8.578  51.477 1.00 51.69  ? 292  LEU A HA   1 
ATOM   544   H  HB2  . LEU A 1 84  ? -17.538 9.779  52.661 1.00 49.49  ? 292  LEU A HB2  1 
ATOM   545   H  HB3  . LEU A 1 84  ? -16.719 9.515  53.991 1.00 49.49  ? 292  LEU A HB3  1 
ATOM   546   H  HG   . LEU A 1 84  ? -14.940 10.796 53.074 1.00 47.03  ? 292  LEU A HG   1 
ATOM   547   H  HD11 . LEU A 1 84  ? -15.346 12.129 51.206 1.00 46.68  ? 292  LEU A HD11 1 
ATOM   548   H  HD12 . LEU A 1 84  ? -15.441 10.590 50.819 1.00 46.68  ? 292  LEU A HD12 1 
ATOM   549   H  HD13 . LEU A 1 84  ? -16.767 11.441 51.027 1.00 46.68  ? 292  LEU A HD13 1 
ATOM   550   H  HD21 . LEU A 1 84  ? -15.901 12.884 53.467 1.00 44.73  ? 292  LEU A HD21 1 
ATOM   551   H  HD22 . LEU A 1 84  ? -17.348 12.232 53.385 1.00 44.73  ? 292  LEU A HD22 1 
ATOM   552   H  HD23 . LEU A 1 84  ? -16.369 11.845 54.575 1.00 44.73  ? 292  LEU A HD23 1 
ATOM   553   N  N    . MET A 1 85  ? -14.746 7.460  54.291 1.00 42.33  ? 293  MET A N    1 
ATOM   554   C  CA   . MET A 1 85  ? -13.546 7.263  55.096 1.00 40.28  ? 293  MET A CA   1 
ATOM   555   C  C    . MET A 1 85  ? -13.144 5.789  55.146 1.00 41.97  ? 293  MET A C    1 
ATOM   556   O  O    . MET A 1 85  ? -14.006 4.905  55.158 1.00 42.60  ? 293  MET A O    1 
ATOM   557   C  CB   . MET A 1 85  ? -13.763 7.758  56.532 1.00 39.00  ? 293  MET A CB   1 
ATOM   558   C  CG   . MET A 1 85  ? -13.830 9.266  56.686 1.00 38.26  ? 293  MET A CG   1 
ATOM   559   S  SD   . MET A 1 85  ? -12.231 10.076 56.470 1.00 43.58  ? 293  MET A SD   1 
ATOM   560   C  CE   . MET A 1 85  ? -12.442 10.787 54.841 1.00 35.26  ? 293  MET A CE   1 
ATOM   561   H  H    . MET A 1 85  ? -15.461 7.151  54.656 1.00 50.80  ? 293  MET A H    1 
ATOM   562   H  HA   . MET A 1 85  ? -12.819 7.775  54.709 1.00 48.34  ? 293  MET A HA   1 
ATOM   563   H  HB2  . MET A 1 85  ? -14.599 7.392  56.861 1.00 46.81  ? 293  MET A HB2  1 
ATOM   564   H  HB3  . MET A 1 85  ? -13.029 7.439  57.081 1.00 46.81  ? 293  MET A HB3  1 
ATOM   565   H  HG2  . MET A 1 85  ? -14.438 9.624  56.021 1.00 45.92  ? 293  MET A HG2  1 
ATOM   566   H  HG3  . MET A 1 85  ? -14.153 9.477  57.576 1.00 45.92  ? 293  MET A HG3  1 
ATOM   567   H  HE1  . MET A 1 85  ? -11.633 11.264 54.597 1.00 42.32  ? 293  MET A HE1  1 
ATOM   568   H  HE2  . MET A 1 85  ? -12.611 10.074 54.205 1.00 42.32  ? 293  MET A HE2  1 
ATOM   569   H  HE3  . MET A 1 85  ? -13.195 11.400 54.859 1.00 42.32  ? 293  MET A HE3  1 
ATOM   570   N  N    . PRO A 1 86  ? -11.848 5.488  55.193 1.00 42.19  ? 294  PRO A N    1 
ATOM   571   C  CA   . PRO A 1 86  ? -11.422 4.099  55.387 1.00 44.13  ? 294  PRO A CA   1 
ATOM   572   C  C    . PRO A 1 86  ? -11.595 3.649  56.829 1.00 48.72  ? 294  PRO A C    1 
ATOM   573   O  O    . PRO A 1 86  ? -11.422 4.422  57.775 1.00 48.92  ? 294  PRO A O    1 
ATOM   574   C  CB   . PRO A 1 86  ? -9.941  4.128  54.992 1.00 43.05  ? 294  PRO A CB   1 
ATOM   575   C  CG   . PRO A 1 86  ? -9.508  5.520  55.300 1.00 42.44  ? 294  PRO A CG   1 
ATOM   576   C  CD   . PRO A 1 86  ? -10.699 6.393  55.003 1.00 42.94  ? 294  PRO A CD   1 
ATOM   577   H  HA   . PRO A 1 86  ? -11.908 3.503  54.795 1.00 52.96  ? 294  PRO A HA   1 
ATOM   578   H  HB2  . PRO A 1 86  ? -9.445  3.486  55.524 1.00 51.66  ? 294  PRO A HB2  1 
ATOM   579   H  HB3  . PRO A 1 86  ? -9.848  3.938  54.045 1.00 51.66  ? 294  PRO A HB3  1 
ATOM   580   H  HG2  . PRO A 1 86  ? -9.262  5.585  56.236 1.00 50.92  ? 294  PRO A HG2  1 
ATOM   581   H  HG3  . PRO A 1 86  ? -8.759  5.761  54.732 1.00 50.92  ? 294  PRO A HG3  1 
ATOM   582   H  HD2  . PRO A 1 86  ? -10.742 7.130  55.632 1.00 51.53  ? 294  PRO A HD2  1 
ATOM   583   H  HD3  . PRO A 1 86  ? -10.666 6.709  54.087 1.00 51.53  ? 294  PRO A HD3  1 
ATOM   584   N  N    . GLU A 1 87  ? -11.933 2.368  56.986 1.00 51.85  ? 295  GLU A N    1 
ATOM   585   C  CA   . GLU A 1 87  ? -12.188 1.785  58.298 1.00 59.01  ? 295  GLU A CA   1 
ATOM   586   C  C    . GLU A 1 87  ? -11.055 0.898  58.803 1.00 53.68  ? 295  GLU A C    1 
ATOM   587   O  O    . GLU A 1 87  ? -10.896 0.754  60.020 1.00 51.34  ? 295  GLU A O    1 
ATOM   588   C  CB   . GLU A 1 87  ? -13.480 0.963  58.266 1.00 70.57  ? 295  GLU A CB   1 
ATOM   589   C  CG   . GLU A 1 87  ? -14.324 1.100  59.521 1.00 80.69  ? 295  GLU A CG   1 
ATOM   590   C  CD   . GLU A 1 87  ? -15.319 2.241  59.431 1.00 87.97  ? 295  GLU A CD   1 
ATOM   591   O  OE1  . GLU A 1 87  ? -16.061 2.307  58.428 1.00 91.37  ? 295  GLU A OE1  1 
ATOM   592   O  OE2  . GLU A 1 87  ? -15.356 3.074  60.362 1.00 89.95  ? 295  GLU A OE2  1 
ATOM   593   H  H    . GLU A 1 87  ? -12.021 1.811  56.337 1.00 62.22  ? 295  GLU A H    1 
ATOM   594   H  HA   . GLU A 1 87  ? -12.309 2.503  58.939 1.00 70.82  ? 295  GLU A HA   1 
ATOM   595   H  HB2  . GLU A 1 87  ? -14.018 1.254  57.514 1.00 84.69  ? 295  GLU A HB2  1 
ATOM   596   H  HB3  . GLU A 1 87  ? -13.251 0.026  58.164 1.00 84.69  ? 295  GLU A HB3  1 
ATOM   597   H  HG2  . GLU A 1 87  ? -14.822 0.278  59.659 1.00 96.83  ? 295  GLU A HG2  1 
ATOM   598   H  HG3  . GLU A 1 87  ? -13.742 1.267  60.278 1.00 96.83  ? 295  GLU A HG3  1 
ATOM   599   N  N    . LYS A 1 88  ? -10.276 0.288  57.911 1.00 49.56  ? 296  LYS A N    1 
ATOM   600   C  CA   . LYS A 1 88  ? -9.119  -0.500 58.312 1.00 48.78  ? 296  LYS A CA   1 
ATOM   601   C  C    . LYS A 1 88  ? -8.017  -0.317 57.278 1.00 45.77  ? 296  LYS A C    1 
ATOM   602   O  O    . LYS A 1 88  ? -8.284  -0.175 56.082 1.00 45.23  ? 296  LYS A O    1 
ATOM   603   C  CB   . LYS A 1 88  ? -9.469  -1.989 58.471 1.00 50.23  ? 296  LYS A CB   1 
ATOM   604   C  CG   . LYS A 1 88  ? -9.567  -2.765 57.167 1.00 50.95  ? 296  LYS A CG   1 
ATOM   605   C  CD   . LYS A 1 88  ? -10.020 -4.201 57.410 1.00 53.00  ? 296  LYS A CD   1 
ATOM   606   H  H    . LYS A 1 88  ? -10.401 0.317  57.061 1.00 59.47  ? 296  LYS A H    1 
ATOM   607   H  HA   . LYS A 1 88  ? -8.792  -0.173 59.164 1.00 58.53  ? 296  LYS A HA   1 
ATOM   608   H  HB2  . LYS A 1 88  ? -8.784  -2.411 59.013 1.00 60.28  ? 296  LYS A HB2  1 
ATOM   609   H  HB3  . LYS A 1 88  ? -10.327 -2.058 58.919 1.00 60.28  ? 296  LYS A HB3  1 
ATOM   610   H  HG2  . LYS A 1 88  ? -10.215 -2.335 56.586 1.00 61.14  ? 296  LYS A HG2  1 
ATOM   611   H  HG3  . LYS A 1 88  ? -8.696  -2.788 56.741 1.00 61.14  ? 296  LYS A HG3  1 
ATOM   612   N  N    . VAL A 1 89  ? -6.773  -0.321 57.752 1.00 44.70  ? 297  VAL A N    1 
ATOM   613   C  CA   . VAL A 1 89  ? -5.618  -0.013 56.915 1.00 44.17  ? 297  VAL A CA   1 
ATOM   614   C  C    . VAL A 1 89  ? -4.497  -0.990 57.234 1.00 41.19  ? 297  VAL A C    1 
ATOM   615   O  O    . VAL A 1 89  ? -4.299  -1.370 58.393 1.00 39.88  ? 297  VAL A O    1 
ATOM   616   C  CB   . VAL A 1 89  ? -5.141  1.441  57.123 1.00 46.58  ? 297  VAL A CB   1 
ATOM   617   C  CG1  . VAL A 1 89  ? -4.029  1.781  56.141 1.00 46.25  ? 297  VAL A CG1  1 
ATOM   618   C  CG2  . VAL A 1 89  ? -6.308  2.411  56.985 1.00 46.96  ? 297  VAL A CG2  1 
ATOM   619   H  H    . VAL A 1 89  ? -6.569  -0.501 58.568 1.00 53.65  ? 297  VAL A H    1 
ATOM   620   H  HA   . VAL A 1 89  ? -5.860  -0.122 55.983 1.00 53.00  ? 297  VAL A HA   1 
ATOM   621   H  HB   . VAL A 1 89  ? -4.784  1.529  58.020 1.00 55.90  ? 297  VAL A HB   1 
ATOM   622   H  HG11 . VAL A 1 89  ? -3.746  2.697  56.290 1.00 55.50  ? 297  VAL A HG11 1 
ATOM   623   H  HG12 . VAL A 1 89  ? -3.284  1.177  56.286 1.00 55.50  ? 297  VAL A HG12 1 
ATOM   624   H  HG13 . VAL A 1 89  ? -4.365  1.682  55.237 1.00 55.50  ? 297  VAL A HG13 1 
ATOM   625   H  HG21 . VAL A 1 89  ? -5.984  3.315  57.119 1.00 56.35  ? 297  VAL A HG21 1 
ATOM   626   H  HG22 . VAL A 1 89  ? -6.687  2.323  56.097 1.00 56.35  ? 297  VAL A HG22 1 
ATOM   627   H  HG23 . VAL A 1 89  ? -6.977  2.196  57.654 1.00 56.35  ? 297  VAL A HG23 1 
ATOM   628   N  N    . THR A 1 90  ? -3.750  -1.380 56.203 1.00 41.38  ? 298  THR A N    1 
ATOM   629   C  CA   . THR A 1 90  ? -2.631  -2.296 56.371 1.00 43.70  ? 298  THR A CA   1 
ATOM   630   C  C    . THR A 1 90  ? -1.410  -1.573 56.929 1.00 42.71  ? 298  THR A C    1 
ATOM   631   O  O    . THR A 1 90  ? -1.085  -0.456 56.518 1.00 42.10  ? 298  THR A O    1 
ATOM   632   C  CB   . THR A 1 90  ? -2.273  -2.952 55.036 1.00 44.88  ? 298  THR A CB   1 
ATOM   633   O  OG1  . THR A 1 90  ? -3.438  -3.566 54.471 1.00 47.26  ? 298  THR A OG1  1 
ATOM   634   C  CG2  . THR A 1 90  ? -1.194  -4.013 55.229 1.00 46.08  ? 298  THR A CG2  1 
ATOM   635   H  H    . THR A 1 90  ? -3.874  -1.124 55.392 1.00 49.66  ? 298  THR A H    1 
ATOM   636   H  HA   . THR A 1 90  ? -2.881  -2.995 56.995 1.00 52.44  ? 298  THR A HA   1 
ATOM   637   H  HB   . THR A 1 90  ? -1.935  -2.278 54.425 1.00 53.86  ? 298  THR A HB   1 
ATOM   638   H  HG1  . THR A 1 90  ? -3.246  -3.927 53.738 1.00 56.71  ? 298  THR A HG1  1 
ATOM   639   H  HG21 . THR A 1 90  ? -0.975  -4.422 54.377 1.00 55.30  ? 298  THR A HG21 1 
ATOM   640   H  HG22 . THR A 1 90  ? -0.394  -3.608 55.600 1.00 55.30  ? 298  THR A HG22 1 
ATOM   641   H  HG23 . THR A 1 90  ? -1.510  -4.700 55.837 1.00 55.30  ? 298  THR A HG23 1 
ATOM   642   N  N    . ARG A 1 91  ? -0.730  -2.228 57.866 1.00 43.84  ? 299  ARG A N    1 
ATOM   643   C  CA   . ARG A 1 91  ? 0.505   -1.729 58.459 1.00 44.19  ? 299  ARG A CA   1 
ATOM   644   C  C    . ARG A 1 91  ? 1.670   -2.529 57.892 1.00 43.25  ? 299  ARG A C    1 
ATOM   645   O  O    . ARG A 1 91  ? 1.700   -3.758 58.015 1.00 42.75  ? 299  ARG A O    1 
ATOM   646   C  CB   . ARG A 1 91  ? 0.457   -1.842 59.983 1.00 48.49  ? 299  ARG A CB   1 
ATOM   647   C  CG   . ARG A 1 91  ? 1.752   -1.486 60.696 1.00 49.98  ? 299  ARG A CG   1 
ATOM   648   C  CD   . ARG A 1 91  ? 1.559   -1.524 62.205 1.00 50.96  ? 299  ARG A CD   1 
ATOM   649   N  NE   . ARG A 1 91  ? 2.825   -1.533 62.940 1.00 50.25  ? 299  ARG A NE   1 
ATOM   650   C  CZ   . ARG A 1 91  ? 3.423   -0.454 63.439 1.00 48.93  ? 299  ARG A CZ   1 
ATOM   651   N  NH1  . ARG A 1 91  ? 2.887   0.751  63.285 1.00 48.27  ? 299  ARG A NH1  1 
ATOM   652   N  NH2  . ARG A 1 91  ? 4.569   -0.581 64.095 1.00 50.92  ? 299  ARG A NH2  1 
ATOM   653   H  H    . ARG A 1 91  ? -0.973  -2.989 58.184 1.00 52.61  ? 299  ARG A H    1 
ATOM   654   H  HA   . ARG A 1 91  ? 0.626   -0.796 58.222 1.00 53.03  ? 299  ARG A HA   1 
ATOM   655   H  HB2  . ARG A 1 91  ? -0.233  -1.246 60.315 1.00 58.20  ? 299  ARG A HB2  1 
ATOM   656   H  HB3  . ARG A 1 91  ? 0.236   -2.757 60.218 1.00 58.20  ? 299  ARG A HB3  1 
ATOM   657   H  HG2  . ARG A 1 91  ? 2.438   -2.128 60.458 1.00 59.98  ? 299  ARG A HG2  1 
ATOM   658   H  HG3  . ARG A 1 91  ? 2.024   -0.590 60.444 1.00 59.98  ? 299  ARG A HG3  1 
ATOM   659   H  HD2  . ARG A 1 91  ? 1.058   -0.739 62.479 1.00 61.15  ? 299  ARG A HD2  1 
ATOM   660   H  HD3  . ARG A 1 91  ? 1.070   -2.328 62.441 1.00 61.15  ? 299  ARG A HD3  1 
ATOM   661   H  HE   . ARG A 1 91  ? 3.211   -2.292 63.058 1.00 60.30  ? 299  ARG A HE   1 
ATOM   662   H  HH11 . ARG A 1 91  ? 2.144   0.840  62.862 1.00 57.93  ? 299  ARG A HH11 1 
ATOM   663   H  HH12 . ARG A 1 91  ? 3.283   1.442  63.610 1.00 57.93  ? 299  ARG A HH12 1 
ATOM   664   H  HH21 . ARG A 1 91  ? 4.923   -1.358 64.196 1.00 61.11  ? 299  ARG A HH21 1 
ATOM   665   H  HH22 . ARG A 1 91  ? 4.960   0.115  64.415 1.00 61.11  ? 299  ARG A HH22 1 
ATOM   666   N  N    . PHE A 1 92  ? 2.626   -1.834 57.277 1.00 42.29  ? 300  PHE A N    1 
ATOM   667   C  CA   . PHE A 1 92  ? 3.756   -2.486 56.630 1.00 43.52  ? 300  PHE A CA   1 
ATOM   668   C  C    . PHE A 1 92  ? 5.026   -2.474 57.470 1.00 47.78  ? 300  PHE A C    1 
ATOM   669   O  O    . PHE A 1 92  ? 5.984   -3.169 57.118 1.00 52.78  ? 300  PHE A O    1 
ATOM   670   C  CB   . PHE A 1 92  ? 4.036   -1.824 55.275 1.00 41.24  ? 300  PHE A CB   1 
ATOM   671   C  CG   . PHE A 1 92  ? 2.928   -1.999 54.279 1.00 41.95  ? 300  PHE A CG   1 
ATOM   672   C  CD1  . PHE A 1 92  ? 2.795   -3.185 53.575 1.00 45.00  ? 300  PHE A CD1  1 
ATOM   673   C  CD2  . PHE A 1 92  ? 2.015   -0.985 54.051 1.00 44.63  ? 300  PHE A CD2  1 
ATOM   674   C  CE1  . PHE A 1 92  ? 1.773   -3.356 52.660 1.00 45.75  ? 300  PHE A CE1  1 
ATOM   675   C  CE2  . PHE A 1 92  ? 0.989   -1.149 53.136 1.00 45.76  ? 300  PHE A CE2  1 
ATOM   676   C  CZ   . PHE A 1 92  ? 0.869   -2.338 52.440 1.00 45.42  ? 300  PHE A CZ   1 
ATOM   677   H  H    . PHE A 1 92  ? 2.640   -0.976 57.221 1.00 50.75  ? 300  PHE A H    1 
ATOM   678   H  HA   . PHE A 1 92  ? 3.524   -3.412 56.462 1.00 52.23  ? 300  PHE A HA   1 
ATOM   679   H  HB2  . PHE A 1 92  ? 4.165   -0.872 55.412 1.00 49.49  ? 300  PHE A HB2  1 
ATOM   680   H  HB3  . PHE A 1 92  ? 4.840   -2.213 54.896 1.00 49.49  ? 300  PHE A HB3  1 
ATOM   681   H  HD1  . PHE A 1 92  ? 3.401   -3.876 53.720 1.00 54.00  ? 300  PHE A HD1  1 
ATOM   682   H  HD2  . PHE A 1 92  ? 2.091   -0.184 54.517 1.00 53.55  ? 300  PHE A HD2  1 
ATOM   683   H  HE1  . PHE A 1 92  ? 1.695   -4.157 52.193 1.00 54.90  ? 300  PHE A HE1  1 
ATOM   684   H  HE2  . PHE A 1 92  ? 0.382   -0.461 52.990 1.00 54.92  ? 300  PHE A HE2  1 
ATOM   685   H  HZ   . PHE A 1 92  ? 0.181   -2.450 51.824 1.00 54.51  ? 300  PHE A HZ   1 
ATOM   686   N  N    . CYS A 1 93  ? 5.059   -1.720 58.563 1.00 47.00  ? 301  CYS A N    1 
ATOM   687   C  CA   . CYS A 1 93  ? 6.259   -1.662 59.391 1.00 48.58  ? 301  CYS A CA   1 
ATOM   688   C  C    . CYS A 1 93  ? 6.464   -2.992 60.112 1.00 50.88  ? 301  CYS A C    1 
ATOM   689   O  O    . CYS A 1 93  ? 5.520   -3.510 60.720 1.00 51.22  ? 301  CYS A O    1 
ATOM   690   C  CB   . CYS A 1 93  ? 6.148   -0.528 60.408 1.00 49.54  ? 301  CYS A CB   1 
ATOM   691   S  SG   . CYS A 1 93  ? 7.533   -0.422 61.577 1.00 54.08  ? 301  CYS A SG   1 
ATOM   692   H  H    . CYS A 1 93  ? 4.407   -1.237 58.846 1.00 56.41  ? 301  CYS A H    1 
ATOM   693   H  HA   . CYS A 1 93  ? 7.032   -1.495 58.829 1.00 58.30  ? 301  CYS A HA   1 
ATOM   694   H  HB2  . CYS A 1 93  ? 6.103   0.314  59.929 1.00 59.45  ? 301  CYS A HB2  1 
ATOM   695   H  HB3  . CYS A 1 93  ? 5.337   -0.654 60.925 1.00 59.45  ? 301  CYS A HB3  1 
ATOM   696   N  N    . PRO A 1 94  ? 7.669   -3.571 60.078 1.00 51.76  ? 302  PRO A N    1 
ATOM   697   C  CA   . PRO A 1 94  ? 7.917   -4.819 60.810 1.00 57.13  ? 302  PRO A CA   1 
ATOM   698   C  C    . PRO A 1 94  ? 8.218   -4.633 62.289 1.00 64.98  ? 302  PRO A C    1 
ATOM   699   O  O    . PRO A 1 94  ? 8.379   -5.634 62.997 1.00 62.64  ? 302  PRO A O    1 
ATOM   700   C  CB   . PRO A 1 94  ? 9.137   -5.397 60.080 1.00 52.89  ? 302  PRO A CB   1 
ATOM   701   C  CG   . PRO A 1 94  ? 9.892   -4.193 59.642 1.00 49.79  ? 302  PRO A CG   1 
ATOM   702   C  CD   . PRO A 1 94  ? 8.847   -3.159 59.291 1.00 47.88  ? 302  PRO A CD   1 
ATOM   703   H  HA   . PRO A 1 94  ? 7.166   -5.425 60.709 1.00 68.55  ? 302  PRO A HA   1 
ATOM   704   H  HB2  . PRO A 1 94  ? 9.665   -5.934 60.692 1.00 63.47  ? 302  PRO A HB2  1 
ATOM   705   H  HB3  . PRO A 1 94  ? 8.848   -5.922 59.318 1.00 63.47  ? 302  PRO A HB3  1 
ATOM   706   H  HG2  . PRO A 1 94  ? 10.452  -3.878 60.369 1.00 59.75  ? 302  PRO A HG2  1 
ATOM   707   H  HG3  . PRO A 1 94  ? 10.430  -4.411 58.865 1.00 59.75  ? 302  PRO A HG3  1 
ATOM   708   H  HD2  . PRO A 1 94  ? 9.142   -2.276 59.563 1.00 57.46  ? 302  PRO A HD2  1 
ATOM   709   H  HD3  . PRO A 1 94  ? 8.648   -3.190 58.343 1.00 57.46  ? 302  PRO A HD3  1 
ATOM   710   N  N    . LEU A 1 95  ? 8.309   -3.398 62.773 1.00 73.11  ? 303  LEU A N    1 
ATOM   711   C  CA   . LEU A 1 95  ? 8.638   -3.154 64.168 1.00 85.82  ? 303  LEU A CA   1 
ATOM   712   C  C    . LEU A 1 95  ? 7.406   -3.325 65.048 1.00 103.33 ? 303  LEU A C    1 
ATOM   713   O  O    . LEU A 1 95  ? 6.274   -3.060 64.634 1.00 102.22 ? 303  LEU A O    1 
ATOM   714   C  CB   . LEU A 1 95  ? 9.209   -1.746 64.352 1.00 80.20  ? 303  LEU A CB   1 
ATOM   715   C  CG   . LEU A 1 95  ? 10.426  -1.374 63.500 1.00 75.73  ? 303  LEU A CG   1 
ATOM   716   C  CD1  . LEU A 1 95  ? 10.867  0.050  63.803 1.00 74.26  ? 303  LEU A CD1  1 
ATOM   717   C  CD2  . LEU A 1 95  ? 11.575  -2.350 63.728 1.00 76.11  ? 303  LEU A CD2  1 
ATOM   718   H  H    . LEU A 1 95  ? 8.183   -2.683 62.311 1.00 87.73  ? 303  LEU A H    1 
ATOM   719   H  HA   . LEU A 1 95  ? 9.308   -3.794 64.455 1.00 102.99 ? 303  LEU A HA   1 
ATOM   720   H  HB2  . LEU A 1 95  ? 8.510   -1.107 64.145 1.00 96.25  ? 303  LEU A HB2  1 
ATOM   721   H  HB3  . LEU A 1 95  ? 9.469   -1.645 65.281 1.00 96.25  ? 303  LEU A HB3  1 
ATOM   722   H  HG   . LEU A 1 95  ? 10.179  -1.418 62.563 1.00 90.87  ? 303  LEU A HG   1 
ATOM   723   H  HD11 . LEU A 1 95  ? 11.637  0.265  63.254 1.00 89.12  ? 303  LEU A HD11 1 
ATOM   724   H  HD12 . LEU A 1 95  ? 10.137  0.655  63.601 1.00 89.12  ? 303  LEU A HD12 1 
ATOM   725   H  HD13 . LEU A 1 95  ? 11.101  0.114  64.742 1.00 89.12  ? 303  LEU A HD13 1 
ATOM   726   H  HD21 . LEU A 1 95  ? 12.327  -2.086 63.175 1.00 91.34  ? 303  LEU A HD21 1 
ATOM   727   H  HD22 . LEU A 1 95  ? 11.828  -2.327 64.664 1.00 91.34  ? 303  LEU A HD22 1 
ATOM   728   H  HD23 . LEU A 1 95  ? 11.284  -3.243 63.486 1.00 91.34  ? 303  LEU A HD23 1 
ATOM   729   N  N    . GLU A 1 96  ? 7.642   -3.773 66.284 1.00 120.13 ? 304  GLU A N    1 
ATOM   730   C  CA   . GLU A 1 96  ? 6.551   -3.934 67.237 1.00 131.83 ? 304  GLU A CA   1 
ATOM   731   C  C    . GLU A 1 96  ? 5.964   -2.590 67.652 1.00 131.03 ? 304  GLU A C    1 
ATOM   732   O  O    . GLU A 1 96  ? 4.772   -2.507 67.969 1.00 133.80 ? 304  GLU A O    1 
ATOM   733   C  CB   . GLU A 1 96  ? 7.042   -4.703 68.464 1.00 142.26 ? 304  GLU A CB   1 
ATOM   734   C  CG   . GLU A 1 96  ? 5.940   -5.105 69.430 1.00 146.45 ? 304  GLU A CG   1 
ATOM   735   H  H    . GLU A 1 96  ? 8.417   -3.987 66.589 1.00 144.15 ? 304  GLU A H    1 
ATOM   736   H  HA   . GLU A 1 96  ? 5.844   -4.453 66.822 1.00 158.20 ? 304  GLU A HA   1 
ATOM   737   H  HB2  . GLU A 1 96  ? 7.484   -5.514 68.167 1.00 170.71 ? 304  GLU A HB2  1 
ATOM   738   H  HB3  . GLU A 1 96  ? 7.671   -4.146 68.949 1.00 170.71 ? 304  GLU A HB3  1 
ATOM   739   N  N    . GLY A 1 97  ? 6.775   -1.533 67.655 1.00 124.98 ? 305  GLY A N    1 
ATOM   740   C  CA   . GLY A 1 97  ? 6.305   -0.211 68.024 1.00 116.15 ? 305  GLY A CA   1 
ATOM   741   C  C    . GLY A 1 97  ? 7.005   0.891  67.254 1.00 98.42  ? 305  GLY A C    1 
ATOM   742   O  O    . GLY A 1 97  ? 7.108   0.825  66.026 1.00 86.18  ? 305  GLY A O    1 
ATOM   743   H  H    . GLY A 1 97  ? 7.608   -1.561 67.444 1.00 149.98 ? 305  GLY A H    1 
ATOM   744   H  HA2  . GLY A 1 97  ? 5.353   -0.148 67.852 1.00 139.38 ? 305  GLY A HA2  1 
ATOM   745   H  HA3  . GLY A 1 97  ? 6.457   -0.068 68.971 1.00 139.38 ? 305  GLY A HA3  1 
ATOM   746   N  N    . LYS A 1 98  ? 7.488   1.909  67.962 1.00 116.47 ? 306  LYS A N    1 
ATOM   747   C  CA   . LYS A 1 98  ? 8.218   3.003  67.341 1.00 117.34 ? 306  LYS A CA   1 
ATOM   748   C  C    . LYS A 1 98  ? 9.716   2.706  67.334 1.00 128.64 ? 306  LYS A C    1 
ATOM   749   O  O    . LYS A 1 98  ? 10.204  1.807  68.021 1.00 130.89 ? 306  LYS A O    1 
ATOM   750   C  CB   . LYS A 1 98  ? 7.940   4.319  68.068 1.00 128.67 ? 306  LYS A CB   1 
ATOM   751   C  CG   . LYS A 1 98  ? 6.479   4.734  68.076 1.00 141.68 ? 306  LYS A CG   1 
ATOM   752   C  CD   . LYS A 1 98  ? 6.313   6.149  68.605 1.00 157.49 ? 306  LYS A CD   1 
ATOM   753   C  CE   . LYS A 1 98  ? 6.976   7.157  67.681 1.00 164.78 ? 306  LYS A CE   1 
ATOM   754   N  NZ   . LYS A 1 98  ? 6.909   8.542  68.222 1.00 164.11 ? 306  LYS A NZ   1 
ATOM   755   H  H    . LYS A 1 98  ? 7.402   1.988  68.814 1.00 139.76 ? 306  LYS A H    1 
ATOM   756   H  HA   . LYS A 1 98  ? 7.925   3.098  66.421 1.00 140.82 ? 306  LYS A HA   1 
ATOM   757   N  N    . ALA A 1 99  ? 10.452  3.486  66.542 1.00 135.04 ? 307  ALA A N    1 
ATOM   758   C  CA   . ALA A 1 99  ? 11.899  3.287  66.390 1.00 142.07 ? 307  ALA A CA   1 
ATOM   759   C  C    . ALA A 1 99  ? 12.664  4.164  67.378 1.00 146.05 ? 307  ALA A C    1 
ATOM   760   O  O    . ALA A 1 99  ? 13.316  3.658  68.296 1.00 147.83 ? 307  ALA A O    1 
ATOM   761   C  CB   . ALA A 1 99  ? 12.320  3.577  64.948 1.00 139.88 ? 307  ALA A CB   1 
ATOM   762   H  H    . ALA A 1 99  ? 10.139  4.139  66.080 1.00 162.05 ? 307  ALA A H    1 
ATOM   763   H  HA   . ALA A 1 99  ? 12.113  2.361  66.584 1.00 170.49 ? 307  ALA A HA   1 
ATOM   764   H  HB1  . ALA A 1 99  ? 13.277  3.441  64.866 1.00 167.86 ? 307  ALA A HB1  1 
ATOM   765   H  HB2  . ALA A 1 99  ? 11.847  2.972  64.355 1.00 167.86 ? 307  ALA A HB2  1 
ATOM   766   H  HB3  . ALA A 1 99  ? 12.096  4.495  64.733 1.00 167.86 ? 307  ALA A HB3  1 
ATOM   767   N  N    . ASN A 1 100 ? 12.597  5.482  67.189 1.00 141.47 ? 308  ASN A N    1 
ATOM   768   C  CA   . ASN A 1 100 ? 13.268  6.429  68.072 1.00 130.00 ? 308  ASN A CA   1 
ATOM   769   C  C    . ASN A 1 100 ? 14.782  6.284  67.982 1.00 122.31 ? 308  ASN A C    1 
ATOM   770   O  O    . ASN A 1 100 ? 15.441  5.962  68.976 1.00 132.97 ? 308  ASN A O    1 
ATOM   771   C  CB   . ASN A 1 100 ? 12.803  6.235  69.518 1.00 130.78 ? 308  ASN A CB   1 
ATOM   772   H  H    . ASN A 1 100 ? 12.164  5.854  66.546 1.00 169.76 ? 308  ASN A H    1 
ATOM   773   H  HA   . ASN A 1 100 ? 13.036  7.331  67.801 1.00 156.01 ? 308  ASN A HA   1 
ATOM   774   N  N    . LYS A 1 101 ? 15.336  6.521  66.796 1.00 106.99 ? 309  LYS A N    1 
ATOM   775   C  CA   . LYS A 1 101 ? 16.779  6.480  66.612 1.00 98.78  ? 309  LYS A CA   1 
ATOM   776   C  C    . LYS A 1 101 ? 17.432  7.711  67.234 1.00 92.47  ? 309  LYS A C    1 
ATOM   777   O  O    . LYS A 1 101 ? 16.856  8.803  67.261 1.00 87.30  ? 309  LYS A O    1 
ATOM   778   C  CB   . LYS A 1 101 ? 17.121  6.400  65.125 1.00 95.84  ? 309  LYS A CB   1 
ATOM   779   H  H    . LYS A 1 101 ? 14.896  6.708  66.082 1.00 128.39 ? 309  LYS A H    1 
ATOM   780   H  HA   . LYS A 1 101 ? 17.136  5.692  67.050 1.00 118.54 ? 309  LYS A HA   1 
ATOM   781   N  N    . ASN A 1 102 ? 18.650  7.526  67.731 1.00 105.67 ? 310  ASN A N    1 
ATOM   782   C  CA   . ASN A 1 102 ? 19.372  8.576  68.432 1.00 102.78 ? 310  ASN A CA   1 
ATOM   783   C  C    . ASN A 1 102 ? 20.346  9.280  67.494 1.00 113.10 ? 310  ASN A C    1 
ATOM   784   O  O    . ASN A 1 102 ? 20.871  8.684  66.550 1.00 114.41 ? 310  ASN A O    1 
ATOM   785   C  CB   . ASN A 1 102 ? 20.133  8.004  69.631 1.00 105.31 ? 310  ASN A CB   1 
ATOM   786   H  H    . ASN A 1 102 ? 19.086  6.787  67.674 1.00 126.81 ? 310  ASN A H    1 
ATOM   787   H  HA   . ASN A 1 102 ? 18.740  9.234  68.761 1.00 123.34 ? 310  ASN A HA   1 
ATOM   788   N  N    . VAL A 1 103 ? 20.579  10.560 67.769 1.00 123.14 ? 311  VAL A N    1 
ATOM   789   C  CA   . VAL A 1 103 ? 21.518  11.365 66.992 1.00 131.94 ? 311  VAL A CA   1 
ATOM   790   C  C    . VAL A 1 103 ? 22.437  12.143 67.927 1.00 136.20 ? 311  VAL A C    1 
ATOM   791   O  O    . VAL A 1 103 ? 21.978  12.788 68.870 1.00 138.42 ? 311  VAL A O    1 
ATOM   792   C  CB   . VAL A 1 103 ? 20.780  12.323 66.036 1.00 134.05 ? 311  VAL A CB   1 
ATOM   793   C  CG1  . VAL A 1 103 ? 20.189  11.555 64.864 1.00 134.16 ? 311  VAL A CG1  1 
ATOM   794   C  CG2  . VAL A 1 103 ? 19.695  13.095 66.778 1.00 136.39 ? 311  VAL A CG2  1 
ATOM   795   H  H    . VAL A 1 103 ? 20.201  10.992 68.409 1.00 147.77 ? 311  VAL A H    1 
ATOM   796   H  HA   . VAL A 1 103 ? 22.069  10.774 66.455 1.00 158.33 ? 311  VAL A HA   1 
ATOM   797   H  HB   . VAL A 1 103 ? 21.415  12.965 65.682 1.00 160.86 ? 311  VAL A HB   1 
ATOM   798   H  HG11 . VAL A 1 103 ? 19.731  12.178 64.278 1.00 160.99 ? 311  VAL A HG11 1 
ATOM   799   H  HG12 . VAL A 1 103 ? 20.905  11.113 64.383 1.00 160.99 ? 311  VAL A HG12 1 
ATOM   800   H  HG13 . VAL A 1 103 ? 19.562  10.897 65.203 1.00 160.99 ? 311  VAL A HG13 1 
ATOM   801   H  HG21 . VAL A 1 103 ? 19.248  13.689 66.154 1.00 163.67 ? 311  VAL A HG21 1 
ATOM   802   H  HG22 . VAL A 1 103 ? 19.058  12.465 67.150 1.00 163.67 ? 311  VAL A HG22 1 
ATOM   803   H  HG23 . VAL A 1 103 ? 20.106  13.611 67.489 1.00 163.67 ? 311  VAL A HG23 1 
ATOM   804   N  N    . TRP A 1 105 ? 24.488  13.512 72.232 1.00 133.37 ? 313  TRP A N    1 
ATOM   805   C  CA   . TRP A 1 105 ? 24.986  14.217 71.057 1.00 129.30 ? 313  TRP A CA   1 
ATOM   806   C  C    . TRP A 1 105 ? 26.183  15.098 71.400 1.00 133.41 ? 313  TRP A C    1 
ATOM   807   O  O    . TRP A 1 105 ? 26.188  15.781 72.425 1.00 138.33 ? 313  TRP A O    1 
ATOM   808   C  CB   . TRP A 1 105 ? 23.880  15.067 70.436 1.00 120.53 ? 313  TRP A CB   1 
ATOM   809   C  CG   . TRP A 1 105 ? 24.352  15.905 69.290 1.00 110.58 ? 313  TRP A CG   1 
ATOM   810   C  CD1  . TRP A 1 105 ? 24.895  15.461 68.119 1.00 106.27 ? 313  TRP A CD1  1 
ATOM   811   C  CD2  . TRP A 1 105 ? 24.319  17.335 69.200 1.00 103.59 ? 313  TRP A CD2  1 
ATOM   812   N  NE1  . TRP A 1 105 ? 25.204  16.526 67.307 1.00 101.90 ? 313  TRP A NE1  1 
ATOM   813   C  CE2  . TRP A 1 105 ? 24.859  17.687 67.947 1.00 100.37 ? 313  TRP A CE2  1 
ATOM   814   C  CE3  . TRP A 1 105 ? 23.885  18.351 70.057 1.00 99.89  ? 313  TRP A CE3  1 
ATOM   815   C  CZ2  . TRP A 1 105 ? 24.978  19.011 67.531 1.00 96.84  ? 313  TRP A CZ2  1 
ATOM   816   C  CZ3  . TRP A 1 105 ? 24.004  19.664 69.643 1.00 96.88  ? 313  TRP A CZ3  1 
ATOM   817   C  CH2  . TRP A 1 105 ? 24.546  19.982 68.391 1.00 95.87  ? 313  TRP A CH2  1 
ATOM   818   H  H    . TRP A 1 105 ? 24.841  13.772 72.972 1.00 160.04 ? 313  TRP A H    1 
ATOM   819   H  HA   . TRP A 1 105 ? 25.272  13.567 70.396 1.00 155.16 ? 313  TRP A HA   1 
ATOM   820   H  HB2  . TRP A 1 105 ? 23.180  14.481 70.108 1.00 144.64 ? 313  TRP A HB2  1 
ATOM   821   H  HB3  . TRP A 1 105 ? 23.523  15.662 71.114 1.00 144.64 ? 313  TRP A HB3  1 
ATOM   822   H  HD1  . TRP A 1 105 ? 25.036  14.567 67.902 1.00 127.53 ? 313  TRP A HD1  1 
ATOM   823   H  HE1  . TRP A 1 105 ? 25.555  16.472 66.524 1.00 122.28 ? 313  TRP A HE1  1 
ATOM   824   H  HE3  . TRP A 1 105 ? 23.524  18.148 70.890 1.00 119.86 ? 313  TRP A HE3  1 
ATOM   825   H  HZ2  . TRP A 1 105 ? 25.338  19.226 66.701 1.00 116.21 ? 313  TRP A HZ2  1 
ATOM   826   H  HZ3  . TRP A 1 105 ? 23.719  20.348 70.204 1.00 116.26 ? 313  TRP A HZ3  1 
ATOM   827   H  HH2  . TRP A 1 105 ? 24.614  20.875 68.139 1.00 115.04 ? 313  TRP A HH2  1 
ATOM   828   N  N    . ASP A 1 106 ? 27.191  15.082 70.532 1.00 132.02 ? 314  ASP A N    1 
ATOM   829   C  CA   . ASP A 1 106 ? 28.412  15.855 70.716 1.00 132.45 ? 314  ASP A CA   1 
ATOM   830   C  C    . ASP A 1 106 ? 28.411  17.036 69.756 1.00 125.61 ? 314  ASP A C    1 
ATOM   831   O  O    . ASP A 1 106 ? 28.128  16.872 68.565 1.00 121.86 ? 314  ASP A O    1 
ATOM   832   C  CB   . ASP A 1 106 ? 29.650  14.983 70.485 1.00 136.11 ? 314  ASP A CB   1 
ATOM   833   H  H    . ASP A 1 106 ? 27.188  14.617 69.808 1.00 158.43 ? 314  ASP A H    1 
ATOM   834   H  HA   . ASP A 1 106 ? 28.443  16.197 71.623 1.00 158.95 ? 314  ASP A HA   1 
ATOM   835   N  N    . GLU A 1 107 ? 28.731  18.223 70.277 1.00 122.35 ? 315  GLU A N    1 
ATOM   836   C  CA   . GLU A 1 107 ? 28.728  19.423 69.446 1.00 114.81 ? 315  GLU A CA   1 
ATOM   837   C  C    . GLU A 1 107 ? 29.855  19.402 68.420 1.00 111.79 ? 315  GLU A C    1 
ATOM   838   O  O    . GLU A 1 107 ? 29.738  20.035 67.364 1.00 107.50 ? 315  GLU A O    1 
ATOM   839   C  CB   . GLU A 1 107 ? 28.838  20.669 70.325 1.00 112.44 ? 315  GLU A CB   1 
ATOM   840   H  H    . GLU A 1 107 ? 28.949  18.357 71.098 1.00 146.82 ? 315  GLU A H    1 
ATOM   841   H  HA   . GLU A 1 107 ? 27.888  19.470 68.965 1.00 137.77 ? 315  GLU A HA   1 
ATOM   842   N  N    . ASP A 1 108 ? 30.946  18.689 68.706 1.00 113.65 ? 316  ASP A N    1 
ATOM   843   C  CA   . ASP A 1 108 ? 32.064  18.609 67.772 1.00 113.74 ? 316  ASP A CA   1 
ATOM   844   C  C    . ASP A 1 108 ? 31.741  17.781 66.535 1.00 115.85 ? 316  ASP A C    1 
ATOM   845   O  O    . ASP A 1 108 ? 32.504  17.829 65.564 1.00 115.26 ? 316  ASP A O    1 
ATOM   846   C  CB   . ASP A 1 108 ? 33.289  18.023 68.476 1.00 115.14 ? 316  ASP A CB   1 
ATOM   847   H  H    . ASP A 1 108 ? 31.061  18.243 69.432 1.00 136.38 ? 316  ASP A H    1 
ATOM   848   H  HA   . ASP A 1 108 ? 32.290  19.505 67.478 1.00 136.49 ? 316  ASP A HA   1 
ATOM   849   N  N    . SER A 1 109 ? 30.637  17.030 66.544 1.00 119.40 ? 317  SER A N    1 
ATOM   850   C  CA   . SER A 1 109 ? 30.257  16.227 65.387 1.00 121.41 ? 317  SER A CA   1 
ATOM   851   C  C    . SER A 1 109 ? 29.974  17.075 64.155 1.00 118.01 ? 317  SER A C    1 
ATOM   852   O  O    . SER A 1 109 ? 30.037  16.558 63.034 1.00 119.03 ? 317  SER A O    1 
ATOM   853   C  CB   . SER A 1 109 ? 29.023  15.386 65.719 1.00 124.39 ? 317  SER A CB   1 
ATOM   854   O  OG   . SER A 1 109 ? 28.180  15.244 64.587 1.00 123.69 ? 317  SER A OG   1 
ATOM   855   H  H    . SER A 1 109 ? 30.094  16.970 67.209 1.00 143.29 ? 317  SER A H    1 
ATOM   856   H  HA   . SER A 1 109 ? 30.983  15.621 65.173 1.00 145.69 ? 317  SER A HA   1 
ATOM   857   H  HB2  . SER A 1 109 ? 29.310  14.507 66.011 1.00 149.27 ? 317  SER A HB2  1 
ATOM   858   H  HB3  . SER A 1 109 ? 28.526  15.823 66.429 1.00 149.27 ? 317  SER A HB3  1 
ATOM   859   H  HG   . SER A 1 109 ? 28.598  14.866 63.964 1.00 148.43 ? 317  SER A HG   1 
ATOM   860   N  N    . VAL A 1 110 ? 29.664  18.364 64.332 1.00 113.61 ? 318  VAL A N    1 
ATOM   861   C  CA   . VAL A 1 110 ? 29.242  19.207 63.219 1.00 109.43 ? 318  VAL A CA   1 
ATOM   862   C  C    . VAL A 1 110 ? 30.398  19.983 62.602 1.00 101.50 ? 318  VAL A C    1 
ATOM   863   O  O    . VAL A 1 110 ? 30.170  20.805 61.704 1.00 98.04  ? 318  VAL A O    1 
ATOM   864   C  CB   . VAL A 1 110 ? 28.120  20.160 63.694 1.00 112.29 ? 318  VAL A CB   1 
ATOM   865   C  CG1  . VAL A 1 110 ? 28.678  21.509 64.178 1.00 114.29 ? 318  VAL A CG1  1 
ATOM   866   C  CG2  . VAL A 1 110 ? 27.079  20.349 62.606 1.00 111.48 ? 318  VAL A CG2  1 
ATOM   867   H  H    . VAL A 1 110 ? 29.692  18.771 65.090 1.00 136.33 ? 318  VAL A H    1 
ATOM   868   H  HA   . VAL A 1 110 ? 28.869  18.639 62.527 1.00 131.32 ? 318  VAL A HA   1 
ATOM   869   H  HB   . VAL A 1 110 ? 27.672  19.748 64.450 1.00 134.75 ? 318  VAL A HB   1 
ATOM   870   H  HG11 . VAL A 1 110 ? 27.941  22.070 64.465 1.00 137.15 ? 318  VAL A HG11 1 
ATOM   871   H  HG12 . VAL A 1 110 ? 29.283  21.352 64.920 1.00 137.15 ? 318  VAL A HG12 1 
ATOM   872   H  HG13 . VAL A 1 110 ? 29.153  21.934 63.447 1.00 137.15 ? 318  VAL A HG13 1 
ATOM   873   H  HG21 . VAL A 1 110 ? 26.389  20.950 62.930 1.00 133.78 ? 318  VAL A HG21 1 
ATOM   874   H  HG22 . VAL A 1 110 ? 27.507  20.729 61.823 1.00 133.78 ? 318  VAL A HG22 1 
ATOM   875   H  HG23 . VAL A 1 110 ? 26.692  19.488 62.386 1.00 133.78 ? 318  VAL A HG23 1 
ATOM   876   N  N    . GLU A 1 111 ? 31.634  19.735 63.038 1.00 95.05  ? 319  GLU A N    1 
ATOM   877   C  CA   . GLU A 1 111 ? 32.782  20.521 62.607 1.00 82.56  ? 319  GLU A CA   1 
ATOM   878   C  C    . GLU A 1 111 ? 33.545  19.904 61.439 1.00 73.50  ? 319  GLU A C    1 
ATOM   879   O  O    . GLU A 1 111 ? 34.395  20.584 60.854 1.00 76.28  ? 319  GLU A O    1 
ATOM   880   C  CB   . GLU A 1 111 ? 33.745  20.727 63.784 1.00 81.10  ? 319  GLU A CB   1 
ATOM   881   H  H    . GLU A 1 111 ? 31.832  19.107 63.591 1.00 114.06 ? 319  GLU A H    1 
ATOM   882   H  HA   . GLU A 1 111 ? 32.470  21.395 62.325 1.00 99.07  ? 319  GLU A HA   1 
ATOM   883   N  N    . TYR A 1 112 ? 33.270  18.651 61.083 1.00 61.97  ? 320  TYR A N    1 
ATOM   884   C  CA   . TYR A 1 112 ? 33.999  18.003 60.004 1.00 55.87  ? 320  TYR A CA   1 
ATOM   885   C  C    . TYR A 1 112 ? 33.540  18.541 58.648 1.00 42.44  ? 320  TYR A C    1 
ATOM   886   O  O    . TYR A 1 112 ? 32.508  19.206 58.526 1.00 40.56  ? 320  TYR A O    1 
ATOM   887   C  CB   . TYR A 1 112 ? 33.806  16.489 60.058 1.00 45.50  ? 320  TYR A CB   1 
ATOM   888   C  CG   . TYR A 1 112 ? 32.538  16.019 59.389 1.00 46.72  ? 320  TYR A CG   1 
ATOM   889   C  CD1  . TYR A 1 112 ? 31.312  16.112 60.036 1.00 47.42  ? 320  TYR A CD1  1 
ATOM   890   C  CD2  . TYR A 1 112 ? 32.564  15.483 58.108 1.00 45.96  ? 320  TYR A CD2  1 
ATOM   891   C  CE1  . TYR A 1 112 ? 30.148  15.686 59.426 1.00 43.60  ? 320  TYR A CE1  1 
ATOM   892   C  CE2  . TYR A 1 112 ? 31.405  15.053 57.490 1.00 44.78  ? 320  TYR A CE2  1 
ATOM   893   C  CZ   . TYR A 1 112 ? 30.200  15.158 58.155 1.00 43.99  ? 320  TYR A CZ   1 
ATOM   894   O  OH   . TYR A 1 112 ? 29.042  14.732 57.547 1.00 45.14  ? 320  TYR A OH   1 
ATOM   895   H  H    . TYR A 1 112 ? 32.668  18.159 61.450 1.00 74.36  ? 320  TYR A H    1 
ATOM   896   H  HA   . TYR A 1 112 ? 34.946  18.192 60.100 1.00 67.05  ? 320  TYR A HA   1 
ATOM   897   H  HB2  . TYR A 1 112 ? 34.554  16.061 59.613 1.00 54.58  ? 320  TYR A HB2  1 
ATOM   898   H  HB3  . TYR A 1 112 ? 33.773  16.211 60.987 1.00 54.58  ? 320  TYR A HB3  1 
ATOM   899   H  HD1  . TYR A 1 112 ? 31.274  16.469 60.894 1.00 56.91  ? 320  TYR A HD1  1 
ATOM   900   H  HD2  . TYR A 1 112 ? 33.375  15.413 57.658 1.00 55.16  ? 320  TYR A HD2  1 
ATOM   901   H  HE1  . TYR A 1 112 ? 29.334  15.754 59.872 1.00 52.32  ? 320  TYR A HE1  1 
ATOM   902   H  HE2  . TYR A 1 112 ? 31.437  14.697 56.632 1.00 53.74  ? 320  TYR A HE2  1 
ATOM   903   H  HH   . TYR A 1 112 ? 29.213  14.434 56.780 1.00 54.17  ? 320  TYR A HH   1 
ATOM   904   N  N    . MET A 1 113 ? 34.326  18.233 57.617 1.00 42.99  ? 321  MET A N    1 
ATOM   905   C  CA   . MET A 1 113 ? 34.041  18.667 56.252 1.00 41.46  ? 321  MET A CA   1 
ATOM   906   C  C    . MET A 1 113 ? 33.658  17.463 55.404 1.00 43.50  ? 321  MET A C    1 
ATOM   907   O  O    . MET A 1 113 ? 34.510  16.590 55.166 1.00 44.11  ? 321  MET A O    1 
ATOM   908   C  CB   . MET A 1 113 ? 35.254  19.364 55.642 1.00 45.15  ? 321  MET A CB   1 
ATOM   909   C  CG   . MET A 1 113 ? 35.610  20.698 56.266 1.00 53.17  ? 321  MET A CG   1 
ATOM   910   S  SD   . MET A 1 113 ? 37.138  21.366 55.580 1.00 60.64  ? 321  MET A SD   1 
ATOM   911   C  CE   . MET A 1 113 ? 36.880  21.151 53.813 1.00 57.41  ? 321  MET A CE   1 
ATOM   912   H  H    . MET A 1 113 ? 35.044  17.765 57.685 1.00 51.57  ? 321  MET A H    1 
ATOM   913   H  HA   . MET A 1 113 ? 33.304  19.297 56.265 1.00 49.74  ? 321  MET A HA   1 
ATOM   914   H  HB2  . MET A 1 113 ? 36.024  18.782 55.738 1.00 54.18  ? 321  MET A HB2  1 
ATOM   915   H  HB3  . MET A 1 113 ? 35.079  19.519 54.701 1.00 54.18  ? 321  MET A HB3  1 
ATOM   916   H  HG2  . MET A 1 113 ? 34.897  21.333 56.094 1.00 63.81  ? 321  MET A HG2  1 
ATOM   917   H  HG3  . MET A 1 113 ? 35.732  20.582 57.222 1.00 63.81  ? 321  MET A HG3  1 
ATOM   918   H  HE1  . MET A 1 113 ? 37.657  21.484 53.338 1.00 68.89  ? 321  MET A HE1  1 
ATOM   919   H  HE2  . MET A 1 113 ? 36.756  20.207 53.625 1.00 68.89  ? 321  MET A HE2  1 
ATOM   920   H  HE3  . MET A 1 113 ? 36.091  21.648 53.547 1.00 68.89  ? 321  MET A HE3  1 
ATOM   921   N  N    . PRO A 1 114 ? 32.426  17.374 54.902 1.00 45.11  ? 322  PRO A N    1 
ATOM   922   C  CA   . PRO A 1 114 ? 32.018  16.171 54.169 1.00 47.54  ? 322  PRO A CA   1 
ATOM   923   C  C    . PRO A 1 114 ? 32.546  16.152 52.742 1.00 46.39  ? 322  PRO A C    1 
ATOM   924   O  O    . PRO A 1 114 ? 32.649  17.186 52.077 1.00 44.39  ? 322  PRO A O    1 
ATOM   925   C  CB   . PRO A 1 114 ? 30.487  16.250 54.192 1.00 46.61  ? 322  PRO A CB   1 
ATOM   926   C  CG   . PRO A 1 114 ? 30.192  17.706 54.254 1.00 45.02  ? 322  PRO A CG   1 
ATOM   927   C  CD   . PRO A 1 114 ? 31.326  18.350 55.016 1.00 43.62  ? 322  PRO A CD   1 
ATOM   928   H  HA   . PRO A 1 114 ? 32.309  15.371 54.635 1.00 57.05  ? 322  PRO A HA   1 
ATOM   929   H  HB2  . PRO A 1 114 ? 30.125  15.859 53.381 1.00 55.93  ? 322  PRO A HB2  1 
ATOM   930   H  HB3  . PRO A 1 114 ? 30.146  15.795 54.978 1.00 55.93  ? 322  PRO A HB3  1 
ATOM   931   H  HG2  . PRO A 1 114 ? 30.144  18.063 53.354 1.00 54.02  ? 322  PRO A HG2  1 
ATOM   932   H  HG3  . PRO A 1 114 ? 29.352  17.844 54.718 1.00 54.02  ? 322  PRO A HG3  1 
ATOM   933   H  HD2  . PRO A 1 114 ? 31.577  19.190 54.601 1.00 52.35  ? 322  PRO A HD2  1 
ATOM   934   H  HD3  . PRO A 1 114 ? 31.080  18.473 55.946 1.00 52.35  ? 322  PRO A HD3  1 
ATOM   935   N  N    . ALA A 1 115 ? 32.879  14.947 52.273 1.00 44.88  ? 323  ALA A N    1 
ATOM   936   C  CA   . ALA A 1 115 ? 33.302  14.769 50.889 1.00 46.51  ? 323  ALA A CA   1 
ATOM   937   C  C    . ALA A 1 115 ? 32.122  14.769 49.925 1.00 45.49  ? 323  ALA A C    1 
ATOM   938   O  O    . ALA A 1 115 ? 32.284  15.150 48.759 1.00 46.92  ? 323  ALA A O    1 
ATOM   939   C  CB   . ALA A 1 115 ? 34.086  13.465 50.743 1.00 51.96  ? 323  ALA A CB   1 
ATOM   940   H  H    . ALA A 1 115 ? 32.868  14.222 52.736 1.00 53.86  ? 323  ALA A H    1 
ATOM   941   H  HA   . ALA A 1 115 ? 33.889  15.501 50.643 1.00 55.82  ? 323  ALA A HA   1 
ATOM   942   H  HB1  . ALA A 1 115 ? 34.359  13.363 49.818 1.00 62.36  ? 323  ALA A HB1  1 
ATOM   943   H  HB2  . ALA A 1 115 ? 34.868  13.502 51.317 1.00 62.36  ? 323  ALA A HB2  1 
ATOM   944   H  HB3  . ALA A 1 115 ? 33.518  12.724 51.005 1.00 62.36  ? 323  ALA A HB3  1 
ATOM   945   N  N    . ASN A 1 116 ? 30.942  14.355 50.385 1.00 42.74  ? 324  ASN A N    1 
ATOM   946   C  CA   . ASN A 1 116 ? 29.736  14.287 49.558 1.00 44.37  ? 324  ASN A CA   1 
ATOM   947   C  C    . ASN A 1 116 ? 28.604  15.033 50.258 1.00 41.62  ? 324  ASN A C    1 
ATOM   948   O  O    . ASN A 1 116 ? 27.676  14.420 50.800 1.00 41.05  ? 324  ASN A O    1 
ATOM   949   C  CB   . ASN A 1 116 ? 29.351  12.833 49.283 1.00 49.90  ? 324  ASN A CB   1 
ATOM   950   C  CG   . ASN A 1 116 ? 28.132  12.710 48.393 1.00 52.69  ? 324  ASN A CG   1 
ATOM   951   O  OD1  . ASN A 1 116 ? 27.868  13.576 47.558 1.00 53.42  ? 324  ASN A OD1  1 
ATOM   952   N  ND2  . ASN A 1 116 ? 27.376  11.634 48.571 1.00 54.96  ? 324  ASN A ND2  1 
ATOM   953   H  H    . ASN A 1 116 ? 30.811  14.101 51.196 1.00 51.30  ? 324  ASN A H    1 
ATOM   954   H  HA   . ASN A 1 116 ? 29.907  14.722 48.707 1.00 53.25  ? 324  ASN A HA   1 
ATOM   955   H  HB2  . ASN A 1 116 ? 30.091  12.387 48.842 1.00 59.89  ? 324  ASN A HB2  1 
ATOM   956   H  HB3  . ASN A 1 116 ? 29.153  12.393 50.125 1.00 59.89  ? 324  ASN A HB3  1 
ATOM   957   H  HD21 . ASN A 1 116 ? 26.673  11.518 48.091 1.00 65.95  ? 324  ASN A HD21 1 
ATOM   958   H  HD22 . ASN A 1 116 ? 27.592  11.051 49.165 1.00 65.95  ? 324  ASN A HD22 1 
ATOM   959   N  N    . PRO A 1 117 ? 28.647  16.364 50.261 1.00 38.44  ? 325  PRO A N    1 
ATOM   960   C  CA   . PRO A 1 117 ? 27.631  17.130 50.997 1.00 39.81  ? 325  PRO A CA   1 
ATOM   961   C  C    . PRO A 1 117 ? 26.244  17.004 50.379 1.00 39.34  ? 325  PRO A C    1 
ATOM   962   O  O    . PRO A 1 117 ? 26.087  16.922 49.158 1.00 40.45  ? 325  PRO A O    1 
ATOM   963   C  CB   . PRO A 1 117 ? 28.149  18.573 50.924 1.00 39.80  ? 325  PRO A CB   1 
ATOM   964   C  CG   . PRO A 1 117 ? 29.082  18.597 49.754 1.00 39.61  ? 325  PRO A CG   1 
ATOM   965   C  CD   . PRO A 1 117 ? 29.692  17.228 49.688 1.00 38.96  ? 325  PRO A CD   1 
ATOM   966   H  HA   . PRO A 1 117 ? 27.598  16.846 51.924 1.00 47.77  ? 325  PRO A HA   1 
ATOM   967   H  HB2  . PRO A 1 117 ? 27.405  19.180 50.782 1.00 47.76  ? 325  PRO A HB2  1 
ATOM   968   H  HB3  . PRO A 1 117 ? 28.620  18.793 51.743 1.00 47.76  ? 325  PRO A HB3  1 
ATOM   969   H  HG2  . PRO A 1 117 ? 28.583  18.787 48.944 1.00 47.53  ? 325  PRO A HG2  1 
ATOM   970   H  HG3  . PRO A 1 117 ? 29.766  19.269 49.898 1.00 47.53  ? 325  PRO A HG3  1 
ATOM   971   H  HD2  . PRO A 1 117 ? 29.869  16.980 48.767 1.00 46.75  ? 325  PRO A HD2  1 
ATOM   972   H  HD3  . PRO A 1 117 ? 30.497  17.190 50.229 1.00 46.75  ? 325  PRO A HD3  1 
ATOM   973   N  N    . VAL A 1 118 ? 25.228  16.993 51.245 1.00 36.85  ? 326  VAL A N    1 
ATOM   974   C  CA   . VAL A 1 118 ? 23.849  16.967 50.777 1.00 33.90  ? 326  VAL A CA   1 
ATOM   975   C  C    . VAL A 1 118 ? 23.493  18.309 50.153 1.00 32.74  ? 326  VAL A C    1 
ATOM   976   O  O    . VAL A 1 118 ? 24.005  19.367 50.548 1.00 32.38  ? 326  VAL A O    1 
ATOM   977   C  CB   . VAL A 1 118 ? 22.870  16.625 51.918 1.00 35.90  ? 326  VAL A CB   1 
ATOM   978   C  CG1  . VAL A 1 118 ? 23.100  15.213 52.421 1.00 37.01  ? 326  VAL A CG1  1 
ATOM   979   C  CG2  . VAL A 1 118 ? 22.980  17.638 53.060 1.00 36.07  ? 326  VAL A CG2  1 
ATOM   980   H  H    . VAL A 1 118 ? 25.313  17.000 52.100 1.00 44.22  ? 326  VAL A H    1 
ATOM   981   H  HA   . VAL A 1 118 ? 23.760  16.285 50.093 1.00 40.68  ? 326  VAL A HA   1 
ATOM   982   H  HB   . VAL A 1 118 ? 21.965  16.670 51.573 1.00 43.08  ? 326  VAL A HB   1 
ATOM   983   H  HG11 . VAL A 1 118 ? 22.472  15.028 53.136 1.00 44.41  ? 326  VAL A HG11 1 
ATOM   984   H  HG12 . VAL A 1 118 ? 22.962  14.592 51.689 1.00 44.41  ? 326  VAL A HG12 1 
ATOM   985   H  HG13 . VAL A 1 118 ? 24.009  15.140 52.751 1.00 44.41  ? 326  VAL A HG13 1 
ATOM   986   H  HG21 . VAL A 1 118 ? 22.353  17.395 53.759 1.00 43.29  ? 326  VAL A HG21 1 
ATOM   987   H  HG22 . VAL A 1 118 ? 23.885  17.625 53.407 1.00 43.29  ? 326  VAL A HG22 1 
ATOM   988   H  HG23 . VAL A 1 118 ? 22.769  18.522 52.719 1.00 43.29  ? 326  VAL A HG23 1 
ATOM   989   N  N    . ARG A 1 119 ? 22.609  18.264 49.163 1.00 32.54  ? 327  ARG A N    1 
ATOM   990   C  CA   . ARG A 1 119 ? 22.003  19.452 48.581 1.00 33.85  ? 327  ARG A CA   1 
ATOM   991   C  C    . ARG A 1 119 ? 20.533  19.474 48.977 1.00 33.33  ? 327  ARG A C    1 
ATOM   992   O  O    . ARG A 1 119 ? 19.850  18.446 48.897 1.00 34.55  ? 327  ARG A O    1 
ATOM   993   C  CB   . ARG A 1 119 ? 22.175  19.460 47.060 1.00 36.31  ? 327  ARG A CB   1 
ATOM   994   C  CG   . ARG A 1 119 ? 23.632  19.336 46.626 1.00 38.45  ? 327  ARG A CG   1 
ATOM   995   C  CD   . ARG A 1 119 ? 23.796  19.249 45.116 1.00 39.28  ? 327  ARG A CD   1 
ATOM   996   N  NE   . ARG A 1 119 ? 23.497  20.513 44.441 1.00 39.49  ? 327  ARG A NE   1 
ATOM   997   C  CZ   . ARG A 1 119 ? 23.660  20.718 43.137 1.00 38.70  ? 327  ARG A CZ   1 
ATOM   998   N  NH1  . ARG A 1 119 ? 24.123  19.747 42.362 1.00 38.72  ? 327  ARG A NH1  1 
ATOM   999   N  NH2  . ARG A 1 119 ? 23.362  21.893 42.603 1.00 39.05  ? 327  ARG A NH2  1 
ATOM   1000  H  H    . ARG A 1 119 ? 22.336  17.532 48.802 1.00 39.05  ? 327  ARG A H    1 
ATOM   1001  H  HA   . ARG A 1 119 ? 22.431  20.244 48.943 1.00 40.62  ? 327  ARG A HA   1 
ATOM   1002  H  HB2  . ARG A 1 119 ? 21.685  18.712 46.683 1.00 43.57  ? 327  ARG A HB2  1 
ATOM   1003  H  HB3  . ARG A 1 119 ? 21.828  20.295 46.708 1.00 43.57  ? 327  ARG A HB3  1 
ATOM   1004  H  HG2  . ARG A 1 119 ? 24.121  20.114 46.937 1.00 46.15  ? 327  ARG A HG2  1 
ATOM   1005  H  HG3  . ARG A 1 119 ? 24.009  18.531 47.015 1.00 46.15  ? 327  ARG A HG3  1 
ATOM   1006  H  HD2  . ARG A 1 119 ? 24.713  19.009 44.911 1.00 47.13  ? 327  ARG A HD2  1 
ATOM   1007  H  HD3  . ARG A 1 119 ? 23.191  18.574 44.770 1.00 47.13  ? 327  ARG A HD3  1 
ATOM   1008  H  HE   . ARG A 1 119 ? 23.254  21.180 44.926 1.00 47.39  ? 327  ARG A HE   1 
ATOM   1009  H  HH11 . ARG A 1 119 ? 24.317  18.981 42.702 1.00 46.46  ? 327  ARG A HH11 1 
ATOM   1010  H  HH12 . ARG A 1 119 ? 24.227  19.882 41.519 1.00 46.46  ? 327  ARG A HH12 1 
ATOM   1011  H  HH21 . ARG A 1 119 ? 23.063  22.528 43.100 1.00 46.87  ? 327  ARG A HH21 1 
ATOM   1012  H  HH22 . ARG A 1 119 ? 23.470  22.022 41.760 1.00 46.87  ? 327  ARG A HH22 1 
ATOM   1013  N  N    . ILE A 1 120 ? 20.051  20.637 49.410 1.00 31.25  ? 328  ILE A N    1 
ATOM   1014  C  CA   . ILE A 1 120 ? 18.777  20.756 50.110 1.00 31.77  ? 328  ILE A CA   1 
ATOM   1015  C  C    . ILE A 1 120 ? 17.771  21.482 49.229 1.00 29.82  ? 328  ILE A C    1 
ATOM   1016  O  O    . ILE A 1 120 ? 18.096  22.491 48.591 1.00 28.54  ? 328  ILE A O    1 
ATOM   1017  C  CB   . ILE A 1 120 ? 18.951  21.495 51.452 1.00 32.83  ? 328  ILE A CB   1 
ATOM   1018  C  CG1  . ILE A 1 120 ? 19.903  20.723 52.372 1.00 35.74  ? 328  ILE A CG1  1 
ATOM   1019  C  CG2  . ILE A 1 120 ? 17.602  21.700 52.130 1.00 33.70  ? 328  ILE A CG2  1 
ATOM   1020  C  CD1  . ILE A 1 120 ? 20.340  21.500 53.607 1.00 37.69  ? 328  ILE A CD1  1 
ATOM   1021  H  H    . ILE A 1 120 ? 20.456  21.389 49.308 1.00 37.51  ? 328  ILE A H    1 
ATOM   1022  H  HA   . ILE A 1 120 ? 18.432  19.869 50.296 1.00 38.13  ? 328  ILE A HA   1 
ATOM   1023  H  HB   . ILE A 1 120 ? 19.339  22.366 51.274 1.00 39.39  ? 328  ILE A HB   1 
ATOM   1024  H  HG12 . ILE A 1 120 ? 19.458  19.915 52.673 1.00 42.90  ? 328  ILE A HG12 1 
ATOM   1025  H  HG13 . ILE A 1 120 ? 20.701  20.491 51.871 1.00 42.90  ? 328  ILE A HG13 1 
ATOM   1026  H  HG21 . ILE A 1 120 ? 17.739  22.166 52.970 1.00 40.45  ? 328  ILE A HG21 1 
ATOM   1027  H  HG22 . ILE A 1 120 ? 17.034  22.227 51.548 1.00 40.45  ? 328  ILE A HG22 1 
ATOM   1028  H  HG23 . ILE A 1 120 ? 17.197  20.834 52.294 1.00 40.45  ? 328  ILE A HG23 1 
ATOM   1029  H  HD11 . ILE A 1 120 ? 20.937  20.946 54.134 1.00 45.23  ? 328  ILE A HD11 1 
ATOM   1030  H  HD12 . ILE A 1 120 ? 20.799  22.307 53.326 1.00 45.23  ? 328  ILE A HD12 1 
ATOM   1031  H  HD13 . ILE A 1 120 ? 19.555  21.730 54.129 1.00 45.23  ? 328  ILE A HD13 1 
ATOM   1032  N  N    . ALA A 1 121 ? 16.542  20.967 49.207 1.00 26.52  ? 329  ALA A N    1 
ATOM   1033  C  CA   . ALA A 1 121 ? 15.396  21.664 48.632 1.00 27.03  ? 329  ALA A CA   1 
ATOM   1034  C  C    . ALA A 1 121 ? 14.625  22.319 49.772 1.00 28.17  ? 329  ALA A C    1 
ATOM   1035  O  O    . ALA A 1 121 ? 13.993  21.629 50.580 1.00 25.92  ? 329  ALA A O    1 
ATOM   1036  C  CB   . ALA A 1 121 ? 14.501  20.705 47.849 1.00 26.43  ? 329  ALA A CB   1 
ATOM   1037  H  H    . ALA A 1 121 ? 16.344  20.195 49.528 1.00 31.82  ? 329  ALA A H    1 
ATOM   1038  H  HA   . ALA A 1 121 ? 15.707  22.358 48.029 1.00 32.44  ? 329  ALA A HA   1 
ATOM   1039  H  HB1  . ALA A 1 121 ? 13.752  21.201 47.482 1.00 31.72  ? 329  ALA A HB1  1 
ATOM   1040  H  HB2  . ALA A 1 121 ? 15.017  20.306 47.132 1.00 31.72  ? 329  ALA A HB2  1 
ATOM   1041  H  HB3  . ALA A 1 121 ? 14.178  20.014 48.449 1.00 31.72  ? 329  ALA A HB3  1 
ATOM   1042  N  N    . PHE A 1 122 ? 14.699  23.646 49.848 1.00 26.77  ? 330  PHE A N    1 
ATOM   1043  C  CA   . PHE A 1 122 ? 13.893  24.421 50.782 1.00 28.36  ? 330  PHE A CA   1 
ATOM   1044  C  C    . PHE A 1 122 ? 12.560  24.768 50.133 1.00 25.69  ? 330  PHE A C    1 
ATOM   1045  O  O    . PHE A 1 122 ? 12.531  25.365 49.051 1.00 26.41  ? 330  PHE A O    1 
ATOM   1046  C  CB   . PHE A 1 122 ? 14.603  25.715 51.183 1.00 28.74  ? 330  PHE A CB   1 
ATOM   1047  C  CG   . PHE A 1 122 ? 15.819  25.519 52.037 1.00 28.78  ? 330  PHE A CG   1 
ATOM   1048  C  CD1  . PHE A 1 122 ? 15.720  25.542 53.418 1.00 28.31  ? 330  PHE A CD1  1 
ATOM   1049  C  CD2  . PHE A 1 122 ? 17.069  25.351 51.463 1.00 30.02  ? 330  PHE A CD2  1 
ATOM   1050  C  CE1  . PHE A 1 122 ? 16.842  25.377 54.210 1.00 31.01  ? 330  PHE A CE1  1 
ATOM   1051  C  CE2  . PHE A 1 122 ? 18.187  25.189 52.247 1.00 32.64  ? 330  PHE A CE2  1 
ATOM   1052  C  CZ   . PHE A 1 122 ? 18.073  25.203 53.625 1.00 32.06  ? 330  PHE A CZ   1 
ATOM   1053  H  H    . PHE A 1 122 ? 15.219  24.126 49.360 1.00 32.12  ? 330  PHE A H    1 
ATOM   1054  H  HA   . PHE A 1 122 ? 13.723  23.898 51.581 1.00 34.04  ? 330  PHE A HA   1 
ATOM   1055  H  HB2  . PHE A 1 122 ? 14.881  26.179 50.378 1.00 34.49  ? 330  PHE A HB2  1 
ATOM   1056  H  HB3  . PHE A 1 122 ? 13.981  26.269 51.680 1.00 34.49  ? 330  PHE A HB3  1 
ATOM   1057  H  HD1  . PHE A 1 122 ? 14.889  25.659 53.818 1.00 33.97  ? 330  PHE A HD1  1 
ATOM   1058  H  HD2  . PHE A 1 122 ? 17.152  25.341 50.536 1.00 36.03  ? 330  PHE A HD2  1 
ATOM   1059  H  HE1  . PHE A 1 122 ? 16.764  25.386 55.136 1.00 37.21  ? 330  PHE A HE1  1 
ATOM   1060  H  HE2  . PHE A 1 122 ? 19.020  25.070 51.851 1.00 39.17  ? 330  PHE A HE2  1 
ATOM   1061  H  HZ   . PHE A 1 122 ? 18.829  25.091 54.156 1.00 38.47  ? 330  PHE A HZ   1 
ATOM   1062  N  N    . VAL A 1 123 ? 11.462  24.414 50.796 1.00 23.70  ? 331  VAL A N    1 
ATOM   1063  C  CA   . VAL A 1 123 ? 10.127  24.831 50.380 1.00 24.52  ? 331  VAL A CA   1 
ATOM   1064  C  C    . VAL A 1 123 ? 9.671   25.924 51.341 1.00 26.74  ? 331  VAL A C    1 
ATOM   1065  O  O    . VAL A 1 123 ? 9.476   25.678 52.536 1.00 27.06  ? 331  VAL A O    1 
ATOM   1066  C  CB   . VAL A 1 123 ? 9.141   23.658 50.352 1.00 26.56  ? 331  VAL A CB   1 
ATOM   1067  C  CG1  . VAL A 1 123 ? 7.719   24.152 50.112 1.00 25.24  ? 331  VAL A CG1  1 
ATOM   1068  C  CG2  . VAL A 1 123 ? 9.539   22.672 49.264 1.00 29.49  ? 331  VAL A CG2  1 
ATOM   1069  H  H    . VAL A 1 123 ? 11.466  23.923 51.502 1.00 28.44  ? 331  VAL A H    1 
ATOM   1070  H  HA   . VAL A 1 123 ? 10.173  25.210 49.489 1.00 29.42  ? 331  VAL A HA   1 
ATOM   1071  H  HB   . VAL A 1 123 ? 9.164   23.198 51.206 1.00 31.87  ? 331  VAL A HB   1 
ATOM   1072  H  HG11 . VAL A 1 123 ? 7.119   23.390 50.099 1.00 30.29  ? 331  VAL A HG11 1 
ATOM   1073  H  HG12 . VAL A 1 123 ? 7.471   24.758 50.827 1.00 30.29  ? 331  VAL A HG12 1 
ATOM   1074  H  HG13 . VAL A 1 123 ? 7.686   24.614 49.259 1.00 30.29  ? 331  VAL A HG13 1 
ATOM   1075  H  HG21 . VAL A 1 123 ? 8.907   21.936 49.258 1.00 35.40  ? 331  VAL A HG21 1 
ATOM   1076  H  HG22 . VAL A 1 123 ? 9.526   23.126 48.407 1.00 35.40  ? 331  VAL A HG22 1 
ATOM   1077  H  HG23 . VAL A 1 123 ? 10.431  22.340 49.449 1.00 35.40  ? 331  VAL A HG23 1 
ATOM   1078  N  N    . LEU A 1 124 ? 9.497   27.132 50.819 1.00 27.56  ? 332  LEU A N    1 
ATOM   1079  C  CA   . LEU A 1 124 ? 9.097   28.283 51.620 1.00 27.43  ? 332  LEU A CA   1 
ATOM   1080  C  C    . LEU A 1 124 ? 7.614   28.552 51.392 1.00 26.09  ? 332  LEU A C    1 
ATOM   1081  O  O    . LEU A 1 124 ? 7.204   28.882 50.275 1.00 29.31  ? 332  LEU A O    1 
ATOM   1082  C  CB   . LEU A 1 124 ? 9.930   29.514 51.258 1.00 27.12  ? 332  LEU A CB   1 
ATOM   1083  C  CG   . LEU A 1 124 ? 11.455  29.365 51.298 1.00 33.02  ? 332  LEU A CG   1 
ATOM   1084  C  CD1  . LEU A 1 124 ? 12.124  30.703 51.028 1.00 34.57  ? 332  LEU A CD1  1 
ATOM   1085  C  CD2  . LEU A 1 124 ? 11.928  28.801 52.624 1.00 34.64  ? 332  LEU A CD2  1 
ATOM   1086  H  H    . LEU A 1 124 ? 9.608   27.315 49.986 1.00 33.07  ? 332  LEU A H    1 
ATOM   1087  H  HA   . LEU A 1 124 ? 9.233   28.086 52.560 1.00 32.91  ? 332  LEU A HA   1 
ATOM   1088  H  HB2  . LEU A 1 124 ? 9.694   29.783 50.357 1.00 32.54  ? 332  LEU A HB2  1 
ATOM   1089  H  HB3  . LEU A 1 124 ? 9.697   30.226 51.874 1.00 32.54  ? 332  LEU A HB3  1 
ATOM   1090  H  HG   . LEU A 1 124 ? 11.728  28.750 50.599 1.00 39.63  ? 332  LEU A HG   1 
ATOM   1091  H  HD11 . LEU A 1 124 ? 13.086  30.587 51.058 1.00 41.49  ? 332  LEU A HD11 1 
ATOM   1092  H  HD12 . LEU A 1 124 ? 11.855  31.018 50.151 1.00 41.49  ? 332  LEU A HD12 1 
ATOM   1093  H  HD13 . LEU A 1 124 ? 11.846  31.337 51.707 1.00 41.49  ? 332  LEU A HD13 1 
ATOM   1094  H  HD21 . LEU A 1 124 ? 12.894  28.723 52.607 1.00 41.57  ? 332  LEU A HD21 1 
ATOM   1095  H  HD22 . LEU A 1 124 ? 11.656  29.400 53.336 1.00 41.57  ? 332  LEU A HD22 1 
ATOM   1096  H  HD23 . LEU A 1 124 ? 11.527  27.927 52.756 1.00 41.57  ? 332  LEU A HD23 1 
ATOM   1097  N  N    . VAL A 1 125 ? 6.818   28.398 52.445 1.00 23.83  ? 333  VAL A N    1 
ATOM   1098  C  CA   . VAL A 1 125 ? 5.380   28.646 52.410 1.00 25.86  ? 333  VAL A CA   1 
ATOM   1099  C  C    . VAL A 1 125 ? 5.144   29.931 53.192 1.00 22.50  ? 333  VAL A C    1 
ATOM   1100  O  O    . VAL A 1 125 ? 5.314   29.957 54.417 1.00 22.33  ? 333  VAL A O    1 
ATOM   1101  C  CB   . VAL A 1 125 ? 4.586   27.466 52.993 1.00 30.56  ? 333  VAL A CB   1 
ATOM   1102  C  CG1  . VAL A 1 125 ? 3.138   27.850 53.256 1.00 35.87  ? 333  VAL A CG1  1 
ATOM   1103  C  CG2  . VAL A 1 125 ? 4.637   26.279 52.047 1.00 33.31  ? 333  VAL A CG2  1 
ATOM   1104  H  H    . VAL A 1 125 ? 7.098   28.142 53.217 1.00 28.60  ? 333  VAL A H    1 
ATOM   1105  H  HA   . VAL A 1 125 ? 5.096   28.786 51.492 1.00 31.04  ? 333  VAL A HA   1 
ATOM   1106  H  HB   . VAL A 1 125 ? 4.985   27.199 53.836 1.00 36.67  ? 333  VAL A HB   1 
ATOM   1107  H  HG11 . VAL A 1 125 ? 2.670   27.084 53.622 1.00 43.05  ? 333  VAL A HG11 1 
ATOM   1108  H  HG12 . VAL A 1 125 ? 3.116   28.585 53.888 1.00 43.05  ? 333  VAL A HG12 1 
ATOM   1109  H  HG13 . VAL A 1 125 ? 2.727   28.120 52.420 1.00 43.05  ? 333  VAL A HG13 1 
ATOM   1110  H  HG21 . VAL A 1 125 ? 4.131   25.546 52.433 1.00 39.97  ? 333  VAL A HG21 1 
ATOM   1111  H  HG22 . VAL A 1 125 ? 4.249   26.537 51.196 1.00 39.97  ? 333  VAL A HG22 1 
ATOM   1112  H  HG23 . VAL A 1 125 ? 5.562   26.013 51.924 1.00 39.97  ? 333  VAL A HG23 1 
ATOM   1113  N  N    . VAL A 1 126 ? 4.750   30.999 52.492 1.00 23.19  ? 334  VAL A N    1 
ATOM   1114  C  CA   . VAL A 1 126 ? 4.781   32.344 53.052 1.00 24.40  ? 334  VAL A CA   1 
ATOM   1115  C  C    . VAL A 1 126 ? 3.482   33.084 52.755 1.00 23.53  ? 334  VAL A C    1 
ATOM   1116  O  O    . VAL A 1 126 ? 2.753   32.770 51.811 1.00 22.49  ? 334  VAL A O    1 
ATOM   1117  C  CB   . VAL A 1 126 ? 5.986   33.147 52.515 1.00 26.89  ? 334  VAL A CB   1 
ATOM   1118  C  CG1  . VAL A 1 126 ? 7.290   32.448 52.885 1.00 27.87  ? 334  VAL A CG1  1 
ATOM   1119  C  CG2  . VAL A 1 126 ? 5.886   33.319 51.003 1.00 25.11  ? 334  VAL A CG2  1 
ATOM   1120  H  H    . VAL A 1 126 ? 4.458   30.966 51.684 1.00 27.83  ? 334  VAL A H    1 
ATOM   1121  H  HA   . VAL A 1 126 ? 4.873   32.280 54.016 1.00 29.28  ? 334  VAL A HA   1 
ATOM   1122  H  HB   . VAL A 1 126 ? 5.988   34.028 52.920 1.00 32.27  ? 334  VAL A HB   1 
ATOM   1123  H  HG11 . VAL A 1 126 ? 8.034   32.966 52.540 1.00 33.45  ? 334  VAL A HG11 1 
ATOM   1124  H  HG12 . VAL A 1 126 ? 7.351   32.385 53.851 1.00 33.45  ? 334  VAL A HG12 1 
ATOM   1125  H  HG13 . VAL A 1 126 ? 7.295   31.561 52.494 1.00 33.45  ? 334  VAL A HG13 1 
ATOM   1126  H  HG21 . VAL A 1 126 ? 6.653   33.826 50.692 1.00 30.14  ? 334  VAL A HG21 1 
ATOM   1127  H  HG22 . VAL A 1 126 ? 5.876   32.444 50.586 1.00 30.14  ? 334  VAL A HG22 1 
ATOM   1128  H  HG23 . VAL A 1 126 ? 5.067   33.795 50.793 1.00 30.14  ? 334  VAL A HG23 1 
ATOM   1129  N  N    . HIS A 1 127 ? 3.203   34.086 53.587 1.00 24.49  ? 335  HIS A N    1 
ATOM   1130  C  CA   . HIS A 1 127 ? 2.054   34.963 53.400 1.00 18.22  ? 335  HIS A CA   1 
ATOM   1131  C  C    . HIS A 1 127 ? 2.315   36.252 54.173 1.00 20.10  ? 335  HIS A C    1 
ATOM   1132  O  O    . HIS A 1 127 ? 3.266   36.346 54.953 1.00 20.07  ? 335  HIS A O    1 
ATOM   1133  C  CB   . HIS A 1 127 ? 0.753   34.290 53.862 1.00 28.17  ? 335  HIS A CB   1 
ATOM   1134  C  CG   . HIS A 1 127 ? 0.609   34.218 55.350 1.00 34.44  ? 335  HIS A CG   1 
ATOM   1135  N  ND1  . HIS A 1 127 ? 1.129   33.185 56.100 1.00 36.32  ? 335  HIS A ND1  1 
ATOM   1136  C  CD2  . HIS A 1 127 ? 0.013   35.059 56.230 1.00 36.49  ? 335  HIS A CD2  1 
ATOM   1137  C  CE1  . HIS A 1 127 ? 0.858   33.391 57.377 1.00 38.90  ? 335  HIS A CE1  1 
ATOM   1138  N  NE2  . HIS A 1 127 ? 0.181   34.521 57.483 1.00 38.39  ? 335  HIS A NE2  1 
ATOM   1139  H  H    . HIS A 1 127 ? 3.675   34.279 54.279 1.00 29.38  ? 335  HIS A H    1 
ATOM   1140  H  HA   . HIS A 1 127 ? 1.967   35.184 52.460 1.00 21.85  ? 335  HIS A HA   1 
ATOM   1141  H  HB2  . HIS A 1 127 ? 0.000   34.793 53.515 1.00 33.81  ? 335  HIS A HB2  1 
ATOM   1142  H  HB3  . HIS A 1 127 ? 0.731   33.383 53.518 1.00 33.81  ? 335  HIS A HB3  1 
ATOM   1143  H  HD1  . HIS A 1 127 ? 1.563   32.513 55.786 1.00 43.59  ? 335  HIS A HD1  1 
ATOM   1144  H  HD2  . HIS A 1 127 ? -0.427  35.852 56.024 1.00 43.79  ? 335  HIS A HD2  1 
ATOM   1145  H  HE1  . HIS A 1 127 ? 1.100   32.833 58.081 1.00 46.68  ? 335  HIS A HE1  1 
ATOM   1146  N  N    . GLY A 1 128 ? 1.465   37.246 53.946 1.00 24.80  ? 336  GLY A N    1 
ATOM   1147  C  CA   . GLY A 1 128 ? 1.560   38.508 54.664 1.00 23.23  ? 336  GLY A CA   1 
ATOM   1148  C  C    . GLY A 1 128 ? 2.326   39.577 53.906 1.00 23.35  ? 336  GLY A C    1 
ATOM   1149  O  O    . GLY A 1 128 ? 2.491   39.528 52.684 1.00 24.73  ? 336  GLY A O    1 
ATOM   1150  H  H    . GLY A 1 128 ? 0.821   37.214 53.378 1.00 29.76  ? 336  GLY A H    1 
ATOM   1151  H  HA2  . GLY A 1 128 ? 0.667   38.842 54.842 1.00 27.88  ? 336  GLY A HA2  1 
ATOM   1152  H  HA3  . GLY A 1 128 ? 2.005   38.360 55.513 1.00 27.88  ? 336  GLY A HA3  1 
ATOM   1153  N  N    . ARG A 1 129 ? 2.817   40.563 54.668 1.00 25.44  ? 337  ARG A N    1 
ATOM   1154  C  CA   . ARG A 1 129 ? 3.437   41.757 54.103 1.00 24.31  ? 337  ARG A CA   1 
ATOM   1155  C  C    . ARG A 1 129 ? 4.941   41.867 54.346 1.00 26.94  ? 337  ARG A C    1 
ATOM   1156  O  O    . ARG A 1 129 ? 5.564   42.796 53.817 1.00 28.43  ? 337  ARG A O    1 
ATOM   1157  C  CB   . ARG A 1 129 ? 2.774   43.021 54.678 1.00 23.49  ? 337  ARG A CB   1 
ATOM   1158  C  CG   . ARG A 1 129 ? 1.247   43.015 54.730 1.00 28.79  ? 337  ARG A CG   1 
ATOM   1159  C  CD   . ARG A 1 129 ? 0.599   42.998 53.346 1.00 30.75  ? 337  ARG A CD   1 
ATOM   1160  N  NE   . ARG A 1 129 ? 1.003   44.135 52.520 1.00 28.62  ? 337  ARG A NE   1 
ATOM   1161  C  CZ   . ARG A 1 129 ? 0.384   44.511 51.403 1.00 28.32  ? 337  ARG A CZ   1 
ATOM   1162  N  NH1  . ARG A 1 129 ? -0.681  43.850 50.970 1.00 27.16  ? 337  ARG A NH1  1 
ATOM   1163  N  NH2  . ARG A 1 129 ? 0.827   45.558 50.719 1.00 27.48  ? 337  ARG A NH2  1 
ATOM   1164  H  H    . ARG A 1 129 ? 2.800   40.558 55.527 1.00 30.53  ? 337  ARG A H    1 
ATOM   1165  H  HA   . ARG A 1 129 ? 3.293   41.758 53.144 1.00 29.17  ? 337  ARG A HA   1 
ATOM   1166  H  HB2  . ARG A 1 129 ? 3.093   43.146 55.585 1.00 28.19  ? 337  ARG A HB2  1 
ATOM   1167  H  HB3  . ARG A 1 129 ? 3.041   43.779 54.135 1.00 28.19  ? 337  ARG A HB3  1 
ATOM   1168  H  HG2  . ARG A 1 129 ? 0.952   42.224 55.208 1.00 34.55  ? 337  ARG A HG2  1 
ATOM   1169  H  HG3  . ARG A 1 129 ? 0.945   43.813 55.192 1.00 34.55  ? 337  ARG A HG3  1 
ATOM   1170  H  HD2  . ARG A 1 129 ? 0.860   42.185 52.885 1.00 36.90  ? 337  ARG A HD2  1 
ATOM   1171  H  HD3  . ARG A 1 129 ? -0.365  43.028 53.448 1.00 36.90  ? 337  ARG A HD3  1 
ATOM   1172  H  HE   . ARG A 1 129 ? 1.686   44.592 52.773 1.00 34.34  ? 337  ARG A HE   1 
ATOM   1173  H  HH11 . ARG A 1 129 ? -0.974  43.171 51.409 1.00 32.59  ? 337  ARG A HH11 1 
ATOM   1174  H  HH12 . ARG A 1 129 ? -1.077  44.099 50.249 1.00 32.59  ? 337  ARG A HH12 1 
ATOM   1175  H  HH21 . ARG A 1 129 ? 1.516   45.992 50.995 1.00 32.98  ? 337  ARG A HH21 1 
ATOM   1176  H  HH22 . ARG A 1 129 ? 0.425   45.802 49.999 1.00 32.98  ? 337  ARG A HH22 1 
ATOM   1177  N  N    . ALA A 1 130 ? 5.544   40.964 55.119 1.00 27.42  ? 338  ALA A N    1 
ATOM   1178  C  CA   . ALA A 1 130 ? 6.901   41.179 55.635 1.00 26.19  ? 338  ALA A CA   1 
ATOM   1179  C  C    . ALA A 1 130 ? 7.966   40.709 54.639 1.00 25.85  ? 338  ALA A C    1 
ATOM   1180  O  O    . ALA A 1 130 ? 8.798   39.849 54.925 1.00 28.24  ? 338  ALA A O    1 
ATOM   1181  C  CB   . ALA A 1 130 ? 7.062   40.484 56.982 1.00 29.46  ? 338  ALA A CB   1 
ATOM   1182  H  H    . ALA A 1 130 ? 5.192   40.218 55.360 1.00 32.91  ? 338  ALA A H    1 
ATOM   1183  H  HA   . ALA A 1 130 ? 7.031   42.130 55.777 1.00 31.42  ? 338  ALA A HA   1 
ATOM   1184  H  HB1  . ALA A 1 130 ? 7.962   40.636 57.310 1.00 35.35  ? 338  ALA A HB1  1 
ATOM   1185  H  HB2  . ALA A 1 130 ? 6.416   40.852 57.606 1.00 35.35  ? 338  ALA A HB2  1 
ATOM   1186  H  HB3  . ALA A 1 130 ? 6.907   39.534 56.867 1.00 35.35  ? 338  ALA A HB3  1 
ATOM   1187  N  N    . SER A 1 131 ? 7.958   41.337 53.461 1.00 26.44  ? 339  SER A N    1 
ATOM   1188  C  CA   . SER A 1 131 ? 8.876   40.943 52.395 1.00 23.98  ? 339  SER A CA   1 
ATOM   1189  C  C    . SER A 1 131 ? 10.335  41.187 52.777 1.00 25.22  ? 339  SER A C    1 
ATOM   1190  O  O    . SER A 1 131 ? 11.214  40.392 52.426 1.00 24.65  ? 339  SER A O    1 
ATOM   1191  C  CB   . SER A 1 131 ? 8.535   41.698 51.110 1.00 27.32  ? 339  SER A CB   1 
ATOM   1192  O  OG   . SER A 1 131 ? 8.588   43.108 51.314 1.00 25.21  ? 339  SER A OG   1 
ATOM   1193  H  H    . SER A 1 131 ? 7.434   41.988 53.257 1.00 31.73  ? 339  SER A H    1 
ATOM   1194  H  HA   . SER A 1 131 ? 8.768   39.995 52.222 1.00 28.78  ? 339  SER A HA   1 
ATOM   1195  H  HB2  . SER A 1 131 ? 9.175   41.455 50.422 1.00 32.78  ? 339  SER A HB2  1 
ATOM   1196  H  HB3  . SER A 1 131 ? 7.639   41.454 50.829 1.00 32.78  ? 339  SER A HB3  1 
ATOM   1197  H  HG   . SER A 1 131 ? 9.360   43.335 51.557 1.00 30.26  ? 339  SER A HG   1 
ATOM   1198  N  N    . ARG A 1 132 ? 10.622  42.288 53.477 1.00 25.18  ? 340  ARG A N    1 
ATOM   1199  C  CA   . ARG A 1 132 ? 12.015  42.592 53.792 1.00 23.60  ? 340  ARG A CA   1 
ATOM   1200  C  C    . ARG A 1 132 ? 12.584  41.623 54.822 1.00 28.44  ? 340  ARG A C    1 
ATOM   1201  O  O    . ARG A 1 132 ? 13.785  41.336 54.795 1.00 27.17  ? 340  ARG A O    1 
ATOM   1202  C  CB   . ARG A 1 132 ? 12.155  44.037 54.277 1.00 23.33  ? 340  ARG A CB   1 
ATOM   1203  C  CG   . ARG A 1 132 ? 11.924  45.070 53.171 1.00 23.64  ? 340  ARG A CG   1 
ATOM   1204  C  CD   . ARG A 1 132 ? 12.577  46.405 53.472 1.00 26.02  ? 340  ARG A CD   1 
ATOM   1205  N  NE   . ARG A 1 132 ? 12.144  47.445 52.541 1.00 25.43  ? 340  ARG A NE   1 
ATOM   1206  C  CZ   . ARG A 1 132 ? 12.724  48.636 52.420 1.00 30.37  ? 340  ARG A CZ   1 
ATOM   1207  N  NH1  . ARG A 1 132 ? 13.779  48.943 53.165 1.00 29.14  ? 340  ARG A NH1  1 
ATOM   1208  N  NH2  . ARG A 1 132 ? 12.247  49.526 51.554 1.00 34.50  ? 340  ARG A NH2  1 
ATOM   1209  H  H    . ARG A 1 132 ? 10.048  42.857 53.771 1.00 30.22  ? 340  ARG A H    1 
ATOM   1210  H  HA   . ARG A 1 132 ? 12.541  42.503 52.982 1.00 28.32  ? 340  ARG A HA   1 
ATOM   1211  H  HB2  . ARG A 1 132 ? 11.504  44.199 54.977 1.00 28.00  ? 340  ARG A HB2  1 
ATOM   1212  H  HB3  . ARG A 1 132 ? 13.052  44.167 54.624 1.00 28.00  ? 340  ARG A HB3  1 
ATOM   1213  H  HG2  . ARG A 1 132 ? 12.297  44.734 52.341 1.00 28.37  ? 340  ARG A HG2  1 
ATOM   1214  H  HG3  . ARG A 1 132 ? 10.971  45.219 53.071 1.00 28.37  ? 340  ARG A HG3  1 
ATOM   1215  H  HD2  . ARG A 1 132 ? 12.337  46.683 54.370 1.00 31.22  ? 340  ARG A HD2  1 
ATOM   1216  H  HD3  . ARG A 1 132 ? 13.540  46.313 53.397 1.00 31.22  ? 340  ARG A HD3  1 
ATOM   1217  H  HE   . ARG A 1 132 ? 11.468  47.276 52.038 1.00 30.51  ? 340  ARG A HE   1 
ATOM   1218  H  HH11 . ARG A 1 132 ? 14.088  48.372 53.729 1.00 34.97  ? 340  ARG A HH11 1 
ATOM   1219  H  HH12 . ARG A 1 132 ? 14.154  49.713 53.084 1.00 34.97  ? 340  ARG A HH12 1 
ATOM   1220  H  HH21 . ARG A 1 132 ? 11.566  49.330 51.067 1.00 41.40  ? 340  ARG A HH21 1 
ATOM   1221  H  HH22 . ARG A 1 132 ? 12.627  50.293 51.472 1.00 41.40  ? 340  ARG A HH22 1 
ATOM   1222  N  N    . GLN A 1 133 ? 11.755  41.105 55.729 1.00 26.06  ? 341  GLN A N    1 
ATOM   1223  C  CA   . GLN A 1 133 ? 12.249  40.092 56.659 1.00 29.08  ? 341  GLN A CA   1 
ATOM   1224  C  C    . GLN A 1 133 ? 12.460  38.755 55.955 1.00 27.35  ? 341  GLN A C    1 
ATOM   1225  O  O    . GLN A 1 133 ? 13.433  38.047 56.238 1.00 29.73  ? 341  GLN A O    1 
ATOM   1226  C  CB   . GLN A 1 133 ? 11.288  39.935 57.838 1.00 30.21  ? 341  GLN A CB   1 
ATOM   1227  C  CG   . GLN A 1 133 ? 11.617  38.770 58.776 1.00 33.49  ? 341  GLN A CG   1 
ATOM   1228  C  CD   . GLN A 1 133 ? 13.008  38.858 59.385 1.00 33.95  ? 341  GLN A CD   1 
ATOM   1229  O  OE1  . GLN A 1 133 ? 13.585  39.942 59.509 1.00 33.26  ? 341  GLN A OE1  1 
ATOM   1230  N  NE2  . GLN A 1 133 ? 13.555  37.708 59.769 1.00 29.78  ? 341  GLN A NE2  1 
ATOM   1231  H  H    . GLN A 1 133 ? 10.927  41.315 55.825 1.00 31.28  ? 341  GLN A H    1 
ATOM   1232  H  HA   . GLN A 1 133 ? 13.106  40.381 57.011 1.00 34.90  ? 341  GLN A HA   1 
ATOM   1233  H  HB2  . GLN A 1 133 ? 11.306  40.750 58.364 1.00 36.25  ? 341  GLN A HB2  1 
ATOM   1234  H  HB3  . GLN A 1 133 ? 10.394  39.790 57.491 1.00 36.25  ? 341  GLN A HB3  1 
ATOM   1235  H  HG2  . GLN A 1 133 ? 10.974  38.761 59.502 1.00 40.19  ? 341  GLN A HG2  1 
ATOM   1236  H  HG3  . GLN A 1 133 ? 11.562  37.940 58.277 1.00 40.19  ? 341  GLN A HG3  1 
ATOM   1237  H  HE21 . GLN A 1 133 ? 13.123  36.971 59.667 1.00 35.74  ? 341  GLN A HE21 1 
ATOM   1238  H  HE22 . GLN A 1 133 ? 14.340  37.701 60.119 1.00 35.74  ? 341  GLN A HE22 1 
ATOM   1239  N  N    . LEU A 1 134 ? 11.558  38.387 55.041 1.00 27.06  ? 342  LEU A N    1 
ATOM   1240  C  CA   . LEU A 1 134 ? 11.766  37.166 54.265 1.00 26.77  ? 342  LEU A CA   1 
ATOM   1241  C  C    . LEU A 1 134 ? 13.050  37.257 53.453 1.00 27.21  ? 342  LEU A C    1 
ATOM   1242  O  O    . LEU A 1 134 ? 13.804  36.282 53.354 1.00 27.23  ? 342  LEU A O    1 
ATOM   1243  C  CB   . LEU A 1 134 ? 10.566  36.913 53.351 1.00 22.13  ? 342  LEU A CB   1 
ATOM   1244  C  CG   . LEU A 1 134 ? 10.678  35.746 52.364 1.00 26.25  ? 342  LEU A CG   1 
ATOM   1245  C  CD1  . LEU A 1 134 ? 10.838  34.420 53.101 1.00 26.09  ? 342  LEU A CD1  1 
ATOM   1246  C  CD2  . LEU A 1 134 ? 9.466   35.710 51.442 1.00 26.59  ? 342  LEU A CD2  1 
ATOM   1247  H  H    . LEU A 1 134 ? 10.836  38.815 54.856 1.00 32.47  ? 342  LEU A H    1 
ATOM   1248  H  HA   . LEU A 1 134 ? 11.846  36.414 54.872 1.00 32.13  ? 342  LEU A HA   1 
ATOM   1249  H  HB2  . LEU A 1 134 ? 9.792   36.741 53.910 1.00 26.56  ? 342  LEU A HB2  1 
ATOM   1250  H  HB3  . LEU A 1 134 ? 10.410  37.715 52.828 1.00 26.56  ? 342  LEU A HB3  1 
ATOM   1251  H  HG   . LEU A 1 134 ? 11.466  35.876 51.814 1.00 31.50  ? 342  LEU A HG   1 
ATOM   1252  H  HD11 . LEU A 1 134 ? 10.906  33.704 52.450 1.00 31.31  ? 342  LEU A HD11 1 
ATOM   1253  H  HD12 . LEU A 1 134 ? 11.642  34.454 53.641 1.00 31.31  ? 342  LEU A HD12 1 
ATOM   1254  H  HD13 . LEU A 1 134 ? 10.063  34.279 53.668 1.00 31.31  ? 342  LEU A HD13 1 
ATOM   1255  H  HD21 . LEU A 1 134 ? 9.559   34.965 50.828 1.00 31.91  ? 342  LEU A HD21 1 
ATOM   1256  H  HD22 . LEU A 1 134 ? 8.665   35.599 51.978 1.00 31.91  ? 342  LEU A HD22 1 
ATOM   1257  H  HD23 . LEU A 1 134 ? 9.421   36.543 50.947 1.00 31.91  ? 342  LEU A HD23 1 
ATOM   1258  N  N    . GLN A 1 135 ? 13.316  38.426 52.865 1.00 26.18  ? 343  GLN A N    1 
ATOM   1259  C  CA   . GLN A 1 135 ? 14.562  38.632 52.133 1.00 26.11  ? 343  GLN A CA   1 
ATOM   1260  C  C    . GLN A 1 135 ? 15.768  38.486 53.054 1.00 25.55  ? 343  GLN A C    1 
ATOM   1261  O  O    . GLN A 1 135 ? 16.792  37.918 52.660 1.00 24.18  ? 343  GLN A O    1 
ATOM   1262  C  CB   . GLN A 1 135 ? 14.551  40.010 51.460 1.00 27.84  ? 343  GLN A CB   1 
ATOM   1263  C  CG   . GLN A 1 135 ? 13.665  40.076 50.212 1.00 31.46  ? 343  GLN A CG   1 
ATOM   1264  C  CD   . GLN A 1 135 ? 13.302  41.496 49.784 1.00 37.58  ? 343  GLN A CD   1 
ATOM   1265  O  OE1  . GLN A 1 135 ? 12.271  41.712 49.140 1.00 39.40  ? 343  GLN A OE1  1 
ATOM   1266  N  NE2  . GLN A 1 135 ? 14.144  42.466 50.134 1.00 36.73  ? 343  GLN A NE2  1 
ATOM   1267  H  H    . GLN A 1 135 ? 12.794  39.110 52.876 1.00 31.42  ? 343  GLN A H    1 
ATOM   1268  H  HA   . GLN A 1 135 ? 14.634  37.960 51.438 1.00 31.33  ? 343  GLN A HA   1 
ATOM   1269  H  HB2  . GLN A 1 135 ? 14.220  40.665 52.094 1.00 33.41  ? 343  GLN A HB2  1 
ATOM   1270  H  HB3  . GLN A 1 135 ? 15.456  40.236 51.194 1.00 33.41  ? 343  GLN A HB3  1 
ATOM   1271  H  HG2  . GLN A 1 135 ? 14.134  39.655 49.474 1.00 37.75  ? 343  GLN A HG2  1 
ATOM   1272  H  HG3  . GLN A 1 135 ? 12.839  39.600 50.390 1.00 37.75  ? 343  GLN A HG3  1 
ATOM   1273  H  HE21 . GLN A 1 135 ? 14.853  42.279 50.582 1.00 44.08  ? 343  GLN A HE21 1 
ATOM   1274  H  HE22 . GLN A 1 135 ? 13.977  43.280 49.912 1.00 44.08  ? 343  GLN A HE22 1 
ATOM   1275  N  N    . ARG A 1 136 ? 15.661  38.986 54.287 1.00 26.30  ? 344  ARG A N    1 
ATOM   1276  C  CA   . ARG A 1 136 ? 16.756  38.860 55.244 1.00 24.76  ? 344  ARG A CA   1 
ATOM   1277  C  C    . ARG A 1 136 ? 17.014  37.397 55.591 1.00 26.78  ? 344  ARG A C    1 
ATOM   1278  O  O    . ARG A 1 136 ? 18.165  36.943 55.613 1.00 25.12  ? 344  ARG A O    1 
ATOM   1279  C  CB   . ARG A 1 136 ? 16.438  39.669 56.504 1.00 26.77  ? 344  ARG A CB   1 
ATOM   1280  C  CG   . ARG A 1 136 ? 17.609  39.833 57.461 1.00 25.62  ? 344  ARG A CG   1 
ATOM   1281  C  CD   . ARG A 1 136 ? 17.221  40.669 58.676 1.00 25.18  ? 344  ARG A CD   1 
ATOM   1282  N  NE   . ARG A 1 136 ? 18.385  41.089 59.451 1.00 27.09  ? 344  ARG A NE   1 
ATOM   1283  C  CZ   . ARG A 1 136 ? 18.337  41.912 60.495 1.00 29.95  ? 344  ARG A CZ   1 
ATOM   1284  N  NH1  . ARG A 1 136 ? 17.177  42.417 60.902 1.00 29.87  ? 344  ARG A NH1  1 
ATOM   1285  N  NH2  . ARG A 1 136 ? 19.455  42.236 61.133 1.00 27.05  ? 344  ARG A NH2  1 
ATOM   1286  H  H    . ARG A 1 136 ? 14.970  39.399 54.591 1.00 31.56  ? 344  ARG A H    1 
ATOM   1287  H  HA   . ARG A 1 136 ? 17.565  39.223 54.850 1.00 29.71  ? 344  ARG A HA   1 
ATOM   1288  H  HB2  . ARG A 1 136 ? 16.148  40.556 56.238 1.00 32.12  ? 344  ARG A HB2  1 
ATOM   1289  H  HB3  . ARG A 1 136 ? 15.723  39.224 56.986 1.00 32.12  ? 344  ARG A HB3  1 
ATOM   1290  H  HG2  . ARG A 1 136 ? 17.894  38.959 57.771 1.00 30.74  ? 344  ARG A HG2  1 
ATOM   1291  H  HG3  . ARG A 1 136 ? 18.337  40.281 57.003 1.00 30.74  ? 344  ARG A HG3  1 
ATOM   1292  H  HD2  . ARG A 1 136 ? 16.754  41.465 58.378 1.00 30.22  ? 344  ARG A HD2  1 
ATOM   1293  H  HD3  . ARG A 1 136 ? 16.648  40.142 59.255 1.00 30.22  ? 344  ARG A HD3  1 
ATOM   1294  H  HE   . ARG A 1 136 ? 19.154  40.784 59.216 1.00 32.51  ? 344  ARG A HE   1 
ATOM   1295  H  HH11 . ARG A 1 136 ? 16.450  42.211 60.491 1.00 35.85  ? 344  ARG A HH11 1 
ATOM   1296  H  HH12 . ARG A 1 136 ? 17.153  42.949 61.577 1.00 35.85  ? 344  ARG A HH12 1 
ATOM   1297  H  HH21 . ARG A 1 136 ? 20.208  41.912 60.872 1.00 32.45  ? 344  ARG A HH21 1 
ATOM   1298  H  HH22 . ARG A 1 136 ? 19.426  42.768 61.808 1.00 32.45  ? 344  ARG A HH22 1 
ATOM   1299  N  N    . MET A 1 137 ? 15.949  36.637 55.860 1.00 27.64  ? 345  MET A N    1 
ATOM   1300  C  CA   . MET A 1 137 ? 16.113  35.221 56.180 1.00 30.13  ? 345  MET A CA   1 
ATOM   1301  C  C    . MET A 1 137 ? 16.635  34.441 54.979 1.00 28.42  ? 345  MET A C    1 
ATOM   1302  O  O    . MET A 1 137 ? 17.527  33.596 55.118 1.00 29.21  ? 345  MET A O    1 
ATOM   1303  C  CB   . MET A 1 137 ? 14.786  34.640 56.665 1.00 33.38  ? 345  MET A CB   1 
ATOM   1304  C  CG   . MET A 1 137 ? 14.885  33.196 57.133 1.00 35.86  ? 345  MET A CG   1 
ATOM   1305  S  SD   . MET A 1 137 ? 14.342  32.025 55.877 1.00 42.19  ? 345  MET A SD   1 
ATOM   1306  C  CE   . MET A 1 137 ? 12.573  32.069 56.132 1.00 34.79  ? 345  MET A CE   1 
ATOM   1307  H  H    . MET A 1 137 ? 15.134  36.913 55.862 1.00 33.17  ? 345  MET A H    1 
ATOM   1308  H  HA   . MET A 1 137 ? 16.753  35.140 56.905 1.00 36.16  ? 345  MET A HA   1 
ATOM   1309  H  HB2  . MET A 1 137 ? 14.464  35.172 57.410 1.00 40.06  ? 345  MET A HB2  1 
ATOM   1310  H  HB3  . MET A 1 137 ? 14.146  34.672 55.937 1.00 40.06  ? 345  MET A HB3  1 
ATOM   1311  H  HG2  . MET A 1 137 ? 15.809  32.997 57.351 1.00 43.04  ? 345  MET A HG2  1 
ATOM   1312  H  HG3  . MET A 1 137 ? 14.325  33.078 57.916 1.00 43.04  ? 345  MET A HG3  1 
ATOM   1313  H  HE1  . MET A 1 137 ? 12.149  31.466 55.502 1.00 41.75  ? 345  MET A HE1  1 
ATOM   1314  H  HE2  . MET A 1 137 ? 12.379  31.790 57.041 1.00 41.75  ? 345  MET A HE2  1 
ATOM   1315  H  HE3  . MET A 1 137 ? 12.256  32.975 55.989 1.00 41.75  ? 345  MET A HE3  1 
ATOM   1316  N  N    . PHE A 1 138 ? 16.085  34.705 53.792 1.00 28.77  ? 346  PHE A N    1 
ATOM   1317  C  CA   . PHE A 1 138 ? 16.581  34.072 52.575 1.00 31.10  ? 346  PHE A CA   1 
ATOM   1318  C  C    . PHE A 1 138 ? 18.077  34.305 52.408 1.00 32.28  ? 346  PHE A C    1 
ATOM   1319  O  O    . PHE A 1 138 ? 18.821  33.397 52.014 1.00 29.57  ? 346  PHE A O    1 
ATOM   1320  C  CB   . PHE A 1 138 ? 15.805  34.618 51.374 1.00 30.79  ? 346  PHE A CB   1 
ATOM   1321  C  CG   . PHE A 1 138 ? 16.306  34.136 50.048 1.00 31.27  ? 346  PHE A CG   1 
ATOM   1322  C  CD1  . PHE A 1 138 ? 15.861  32.938 49.518 1.00 31.45  ? 346  PHE A CD1  1 
ATOM   1323  C  CD2  . PHE A 1 138 ? 17.205  34.893 49.317 1.00 31.64  ? 346  PHE A CD2  1 
ATOM   1324  C  CE1  . PHE A 1 138 ? 16.314  32.497 48.290 1.00 30.86  ? 346  PHE A CE1  1 
ATOM   1325  C  CE2  . PHE A 1 138 ? 17.661  34.456 48.088 1.00 31.43  ? 346  PHE A CE2  1 
ATOM   1326  C  CZ   . PHE A 1 138 ? 17.213  33.255 47.575 1.00 31.14  ? 346  PHE A CZ   1 
ATOM   1327  H  H    . PHE A 1 138 ? 15.428  35.245 53.668 1.00 34.52  ? 346  PHE A H    1 
ATOM   1328  H  HA   . PHE A 1 138 ? 16.427  33.115 52.627 1.00 37.32  ? 346  PHE A HA   1 
ATOM   1329  H  HB2  . PHE A 1 138 ? 14.877  34.347 51.455 1.00 36.95  ? 346  PHE A HB2  1 
ATOM   1330  H  HB3  . PHE A 1 138 ? 15.866  35.586 51.379 1.00 36.95  ? 346  PHE A HB3  1 
ATOM   1331  H  HD1  . PHE A 1 138 ? 15.254  32.421 49.997 1.00 37.75  ? 346  PHE A HD1  1 
ATOM   1332  H  HD2  . PHE A 1 138 ? 17.509  35.702 49.659 1.00 37.97  ? 346  PHE A HD2  1 
ATOM   1333  H  HE1  . PHE A 1 138 ? 16.011  31.688 47.947 1.00 37.03  ? 346  PHE A HE1  1 
ATOM   1334  H  HE2  . PHE A 1 138 ? 18.269  34.971 47.608 1.00 37.72  ? 346  PHE A HE2  1 
ATOM   1335  H  HZ   . PHE A 1 138 ? 17.519  32.959 46.748 1.00 37.37  ? 346  PHE A HZ   1 
ATOM   1336  N  N    . LYS A 1 139 ? 18.531  35.522 52.708 1.00 29.49  ? 347  LYS A N    1 
ATOM   1337  C  CA   . LYS A 1 139 ? 19.954  35.838 52.652 1.00 31.30  ? 347  LYS A CA   1 
ATOM   1338  C  C    . LYS A 1 139 ? 20.755  34.939 53.586 1.00 28.94  ? 347  LYS A C    1 
ATOM   1339  O  O    . LYS A 1 139 ? 21.864  34.508 53.248 1.00 28.50  ? 347  LYS A O    1 
ATOM   1340  C  CB   . LYS A 1 139 ? 20.155  37.311 53.019 1.00 34.38  ? 347  LYS A CB   1 
ATOM   1341  C  CG   . LYS A 1 139 ? 21.425  37.951 52.506 1.00 35.56  ? 347  LYS A CG   1 
ATOM   1342  C  CD   . LYS A 1 139 ? 21.538  39.379 53.026 1.00 35.70  ? 347  LYS A CD   1 
ATOM   1343  C  CE   . LYS A 1 139 ? 22.587  40.178 52.280 1.00 39.70  ? 347  LYS A CE   1 
ATOM   1344  N  NZ   . LYS A 1 139 ? 22.733  41.546 52.849 1.00 43.26  ? 347  LYS A NZ   1 
ATOM   1345  H  H    . LYS A 1 139 ? 18.034  36.182 52.947 1.00 35.39  ? 347  LYS A H    1 
ATOM   1346  H  HA   . LYS A 1 139 ? 20.277  35.703 51.747 1.00 37.57  ? 347  LYS A HA   1 
ATOM   1347  H  HB2  . LYS A 1 139 ? 19.410  37.820 52.662 1.00 41.26  ? 347  LYS A HB2  1 
ATOM   1348  H  HB3  . LYS A 1 139 ? 20.163  37.387 53.986 1.00 41.26  ? 347  LYS A HB3  1 
ATOM   1349  H  HG2  . LYS A 1 139 ? 22.192  37.447 52.819 1.00 42.68  ? 347  LYS A HG2  1 
ATOM   1350  H  HG3  . LYS A 1 139 ? 21.407  37.977 51.536 1.00 42.68  ? 347  LYS A HG3  1 
ATOM   1351  H  HD2  . LYS A 1 139 ? 20.684  39.826 52.917 1.00 42.84  ? 347  LYS A HD2  1 
ATOM   1352  H  HD3  . LYS A 1 139 ? 21.786  39.357 53.964 1.00 42.84  ? 347  LYS A HD3  1 
ATOM   1353  H  HE2  . LYS A 1 139 ? 23.443  39.727 52.349 1.00 47.64  ? 347  LYS A HE2  1 
ATOM   1354  H  HE3  . LYS A 1 139 ? 22.324  40.261 51.350 1.00 47.64  ? 347  LYS A HE3  1 
ATOM   1355  H  HZ1  . LYS A 1 139 ? 21.959  41.982 52.794 1.00 51.92  ? 347  LYS A HZ1  1 
ATOM   1356  H  HZ2  . LYS A 1 139 ? 22.977  41.496 53.703 1.00 51.92  ? 347  LYS A HZ2  1 
ATOM   1357  H  HZ3  . LYS A 1 139 ? 23.353  41.998 52.397 1.00 51.92  ? 347  LYS A HZ3  1 
ATOM   1358  N  N    . ALA A 1 140 ? 20.207  34.642 54.765 1.00 26.24  ? 348  ALA A N    1 
ATOM   1359  C  CA   . ALA A 1 140 ? 20.964  33.896 55.763 1.00 27.69  ? 348  ALA A CA   1 
ATOM   1360  C  C    . ALA A 1 140 ? 21.085  32.418 55.404 1.00 27.44  ? 348  ALA A C    1 
ATOM   1361  O  O    . ALA A 1 140 ? 22.088  31.783 55.751 1.00 29.39  ? 348  ALA A O    1 
ATOM   1362  C  CB   . ALA A 1 140 ? 20.312  34.064 57.138 1.00 26.65  ? 348  ALA A CB   1 
ATOM   1363  H  H    . ALA A 1 140 ? 19.411  34.858 55.007 1.00 31.49  ? 348  ALA A H    1 
ATOM   1364  H  HA   . ALA A 1 140 ? 21.860  34.263 55.814 1.00 33.23  ? 348  ALA A HA   1 
ATOM   1365  H  HB1  . ALA A 1 140 ? 20.824  33.564 57.793 1.00 31.98  ? 348  ALA A HB1  1 
ATOM   1366  H  HB2  . ALA A 1 140 ? 20.305  35.006 57.371 1.00 31.98  ? 348  ALA A HB2  1 
ATOM   1367  H  HB3  . ALA A 1 140 ? 19.403  33.726 57.099 1.00 31.98  ? 348  ALA A HB3  1 
ATOM   1368  N  N    . ILE A 1 141 ? 20.095  31.856 54.704 1.00 26.06  ? 349  ILE A N    1 
ATOM   1369  C  CA   . ILE A 1 141 ? 20.077  30.426 54.407 1.00 27.96  ? 349  ILE A CA   1 
ATOM   1370  C  C    . ILE A 1 141 ? 20.532  30.108 52.990 1.00 29.53  ? 349  ILE A C    1 
ATOM   1371  O  O    . ILE A 1 141 ? 20.599  28.925 52.628 1.00 32.10  ? 349  ILE A O    1 
ATOM   1372  C  CB   . ILE A 1 141 ? 18.673  29.825 54.641 1.00 25.42  ? 349  ILE A CB   1 
ATOM   1373  C  CG1  . ILE A 1 141 ? 17.650  30.398 53.651 1.00 25.23  ? 349  ILE A CG1  1 
ATOM   1374  C  CG2  . ILE A 1 141 ? 18.220  30.079 56.070 1.00 27.78  ? 349  ILE A CG2  1 
ATOM   1375  C  CD1  . ILE A 1 141 ? 16.349  29.610 53.597 1.00 29.21  ? 349  ILE A CD1  1 
ATOM   1376  H  H    . ILE A 1 141 ? 19.420  32.287 54.390 1.00 31.28  ? 349  ILE A H    1 
ATOM   1377  H  HA   . ILE A 1 141 ? 20.688  29.981 55.014 1.00 33.55  ? 349  ILE A HA   1 
ATOM   1378  H  HB   . ILE A 1 141 ? 18.726  28.867 54.504 1.00 30.51  ? 349  ILE A HB   1 
ATOM   1379  H  HG12 . ILE A 1 141 ? 17.436  31.307 53.912 1.00 30.28  ? 349  ILE A HG12 1 
ATOM   1380  H  HG13 . ILE A 1 141 ? 18.037  30.393 52.762 1.00 30.28  ? 349  ILE A HG13 1 
ATOM   1381  H  HG21 . ILE A 1 141 ? 17.338  29.693 56.194 1.00 33.34  ? 349  ILE A HG21 1 
ATOM   1382  H  HG22 . ILE A 1 141 ? 18.851  29.665 56.680 1.00 33.34  ? 349  ILE A HG22 1 
ATOM   1383  H  HG23 . ILE A 1 141 ? 18.188  31.036 56.226 1.00 33.34  ? 349  ILE A HG23 1 
ATOM   1384  H  HD11 . ILE A 1 141 ? 15.754  30.027 52.954 1.00 35.06  ? 349  ILE A HD11 1 
ATOM   1385  H  HD12 . ILE A 1 141 ? 16.543  28.699 53.326 1.00 35.06  ? 349  ILE A HD12 1 
ATOM   1386  H  HD13 . ILE A 1 141 ? 15.941  29.614 54.477 1.00 35.06  ? 349  ILE A HD13 1 
ATOM   1387  N  N    . TYR A 1 142 ? 20.840  31.111 52.173 1.00 29.25  ? 350  TYR A N    1 
ATOM   1388  C  CA   . TYR A 1 142 ? 21.118  30.853 50.767 1.00 30.21  ? 350  TYR A CA   1 
ATOM   1389  C  C    . TYR A 1 142 ? 22.501  30.242 50.566 1.00 30.48  ? 350  TYR A C    1 
ATOM   1390  O  O    . TYR A 1 142 ? 23.490  30.681 51.163 1.00 29.70  ? 350  TYR A O    1 
ATOM   1391  C  CB   . TYR A 1 142 ? 21.015  32.133 49.938 1.00 30.31  ? 350  TYR A CB   1 
ATOM   1392  C  CG   . TYR A 1 142 ? 21.282  31.883 48.470 1.00 27.87  ? 350  TYR A CG   1 
ATOM   1393  C  CD1  . TYR A 1 142 ? 20.253  31.530 47.609 1.00 26.91  ? 350  TYR A CD1  1 
ATOM   1394  C  CD2  . TYR A 1 142 ? 22.570  31.973 47.949 1.00 30.71  ? 350  TYR A CD2  1 
ATOM   1395  C  CE1  . TYR A 1 142 ? 20.493  31.284 46.268 1.00 29.85  ? 350  TYR A CE1  1 
ATOM   1396  C  CE2  . TYR A 1 142 ? 22.821  31.731 46.609 1.00 32.77  ? 350  TYR A CE2  1 
ATOM   1397  C  CZ   . TYR A 1 142 ? 21.778  31.384 45.774 1.00 34.75  ? 350  TYR A CZ   1 
ATOM   1398  O  OH   . TYR A 1 142 ? 22.015  31.141 44.440 1.00 38.17  ? 350  TYR A OH   1 
ATOM   1399  H  H    . TYR A 1 142 ? 20.894  31.937 52.405 1.00 35.11  ? 350  TYR A H    1 
ATOM   1400  H  HA   . TYR A 1 142 ? 20.463  30.224 50.428 1.00 36.25  ? 350  TYR A HA   1 
ATOM   1401  H  HB2  . TYR A 1 142 ? 20.119  32.496 50.024 1.00 36.37  ? 350  TYR A HB2  1 
ATOM   1402  H  HB3  . TYR A 1 142 ? 21.668  32.774 50.259 1.00 36.37  ? 350  TYR A HB3  1 
ATOM   1403  H  HD1  . TYR A 1 142 ? 19.386  31.459 47.939 1.00 32.29  ? 350  TYR A HD1  1 
ATOM   1404  H  HD2  . TYR A 1 142 ? 23.275  32.204 48.511 1.00 36.86  ? 350  TYR A HD2  1 
ATOM   1405  H  HE1  . TYR A 1 142 ? 19.792  31.052 45.703 1.00 35.82  ? 350  TYR A HE1  1 
ATOM   1406  H  HE2  . TYR A 1 142 ? 23.686  31.798 46.275 1.00 39.33  ? 350  TYR A HE2  1 
ATOM   1407  H  HH   . TYR A 1 142 ? 21.296  30.945 44.052 1.00 45.81  ? 350  TYR A HH   1 
ATOM   1408  N  N    . HIS A 1 143 ? 22.559  29.228 49.704 1.00 31.06  ? 351  HIS A N    1 
ATOM   1409  C  CA   . HIS A 1 143 ? 23.814  28.734 49.160 1.00 33.20  ? 351  HIS A CA   1 
ATOM   1410  C  C    . HIS A 1 143 ? 23.560  28.271 47.733 1.00 31.46  ? 351  HIS A C    1 
ATOM   1411  O  O    . HIS A 1 143 ? 22.492  27.732 47.433 1.00 28.55  ? 351  HIS A O    1 
ATOM   1412  C  CB   . HIS A 1 143 ? 24.399  27.587 49.993 1.00 34.00  ? 351  HIS A CB   1 
ATOM   1413  C  CG   . HIS A 1 143 ? 25.811  27.246 49.627 1.00 35.83  ? 351  HIS A CG   1 
ATOM   1414  N  ND1  . HIS A 1 143 ? 26.129  26.246 48.734 1.00 37.72  ? 351  HIS A ND1  1 
ATOM   1415  C  CD2  . HIS A 1 143 ? 26.988  27.785 50.024 1.00 37.53  ? 351  HIS A CD2  1 
ATOM   1416  C  CE1  . HIS A 1 143 ? 27.441  26.178 48.600 1.00 36.98  ? 351  HIS A CE1  1 
ATOM   1417  N  NE2  . HIS A 1 143 ? 27.987  27.101 49.373 1.00 37.87  ? 351  HIS A NE2  1 
ATOM   1418  H  H    . HIS A 1 143 ? 21.868  28.803 49.417 1.00 37.27  ? 351  HIS A H    1 
ATOM   1419  H  HA   . HIS A 1 143 ? 24.462  29.456 49.137 1.00 39.84  ? 351  HIS A HA   1 
ATOM   1420  H  HB2  . HIS A 1 143 ? 24.387  27.841 50.929 1.00 40.81  ? 351  HIS A HB2  1 
ATOM   1421  H  HB3  . HIS A 1 143 ? 23.857  26.794 49.859 1.00 40.81  ? 351  HIS A HB3  1 
ATOM   1422  H  HD2  . HIS A 1 143 ? 27.101  28.484 50.626 1.00 45.04  ? 351  HIS A HD2  1 
ATOM   1423  H  HE1  . HIS A 1 143 ? 27.903  25.582 48.056 1.00 44.37  ? 351  HIS A HE1  1 
ATOM   1424  H  HE2  . HIS A 1 143 ? 28.830  27.249 49.455 1.00 45.44  ? 351  HIS A HE2  1 
ATOM   1425  N  N    . LYS A 1 144 ? 24.554  28.471 46.861 1.00 31.45  ? 352  LYS A N    1 
ATOM   1426  C  CA   . LYS A 1 144 ? 24.365  28.205 45.439 1.00 35.03  ? 352  LYS A CA   1 
ATOM   1427  C  C    . LYS A 1 144 ? 24.120  26.730 45.137 1.00 34.21  ? 352  LYS A C    1 
ATOM   1428  O  O    . LYS A 1 144 ? 23.607  26.414 44.058 1.00 33.21  ? 352  LYS A O    1 
ATOM   1429  C  CB   . LYS A 1 144 ? 25.577  28.697 44.641 1.00 42.75  ? 352  LYS A CB   1 
ATOM   1430  C  CG   . LYS A 1 144 ? 26.877  27.943 44.910 1.00 51.68  ? 352  LYS A CG   1 
ATOM   1431  C  CD   . LYS A 1 144 ? 27.882  28.181 43.791 1.00 58.87  ? 352  LYS A CD   1 
ATOM   1432  C  CE   . LYS A 1 144 ? 29.187  27.434 44.032 1.00 64.52  ? 352  LYS A CE   1 
ATOM   1433  N  NZ   . LYS A 1 144 ? 29.005  25.953 44.035 1.00 68.33  ? 352  LYS A NZ   1 
ATOM   1434  H  H    . LYS A 1 144 ? 25.338  28.758 47.069 1.00 37.74  ? 352  LYS A H    1 
ATOM   1435  H  HA   . LYS A 1 144 ? 23.590  28.701 45.131 1.00 42.04  ? 352  LYS A HA   1 
ATOM   1436  H  HB2  . LYS A 1 144 ? 25.380  28.610 43.696 1.00 51.30  ? 352  LYS A HB2  1 
ATOM   1437  H  HB3  . LYS A 1 144 ? 25.730  29.630 44.857 1.00 51.30  ? 352  LYS A HB3  1 
ATOM   1438  H  HG2  . LYS A 1 144 ? 27.265  28.257 45.742 1.00 62.02  ? 352  LYS A HG2  1 
ATOM   1439  H  HG3  . LYS A 1 144 ? 26.693  26.992 44.961 1.00 62.02  ? 352  LYS A HG3  1 
ATOM   1440  H  HD2  . LYS A 1 144 ? 27.505  27.870 42.953 1.00 70.65  ? 352  LYS A HD2  1 
ATOM   1441  H  HD3  . LYS A 1 144 ? 28.081  29.129 43.737 1.00 70.65  ? 352  LYS A HD3  1 
ATOM   1442  H  HE2  . LYS A 1 144 ? 29.815  27.658 43.327 1.00 77.42  ? 352  LYS A HE2  1 
ATOM   1443  H  HE3  . LYS A 1 144 ? 29.547  27.694 44.894 1.00 77.42  ? 352  LYS A HE3  1 
ATOM   1444  H  HZ1  . LYS A 1 144 ? 29.786  25.550 44.177 1.00 82.00  ? 352  LYS A HZ1  1 
ATOM   1445  H  HZ2  . LYS A 1 144 ? 28.436  25.718 44.678 1.00 82.00  ? 352  LYS A HZ2  1 
ATOM   1446  H  HZ3  . LYS A 1 144 ? 28.680  25.685 43.250 1.00 82.00  ? 352  LYS A HZ3  1 
ATOM   1447  N  N    . ASP A 1 145 ? 24.472  25.826 46.052 1.00 34.87  ? 353  ASP A N    1 
ATOM   1448  C  CA   . ASP A 1 145 ? 24.298  24.395 45.829 1.00 39.37  ? 353  ASP A CA   1 
ATOM   1449  C  C    . ASP A 1 145 ? 22.945  23.872 46.296 1.00 34.42  ? 353  ASP A C    1 
ATOM   1450  O  O    . ASP A 1 145 ? 22.621  22.713 46.016 1.00 37.65  ? 353  ASP A O    1 
ATOM   1451  C  CB   . ASP A 1 145 ? 25.408  23.610 46.537 1.00 43.10  ? 353  ASP A CB   1 
ATOM   1452  C  CG   . ASP A 1 145 ? 26.767  23.811 45.892 1.00 46.90  ? 353  ASP A CG   1 
ATOM   1453  O  OD1  . ASP A 1 145 ? 26.813  24.139 44.687 1.00 47.77  ? 353  ASP A OD1  1 
ATOM   1454  O  OD2  . ASP A 1 145 ? 27.789  23.633 46.589 1.00 47.68  ? 353  ASP A OD2  1 
ATOM   1455  H  H    . ASP A 1 145 ? 24.818  26.020 46.815 1.00 41.85  ? 353  ASP A H    1 
ATOM   1456  H  HA   . ASP A 1 145 ? 24.371  24.217 44.878 1.00 47.25  ? 353  ASP A HA   1 
ATOM   1457  H  HB2  . ASP A 1 145 ? 25.467  23.906 47.459 1.00 51.72  ? 353  ASP A HB2  1 
ATOM   1458  H  HB3  . ASP A 1 145 ? 25.197  22.664 46.504 1.00 51.72  ? 353  ASP A HB3  1 
ATOM   1459  N  N    . HIS A 1 146 ? 22.155  24.683 46.997 1.00 31.14  ? 354  HIS A N    1 
ATOM   1460  C  CA   . HIS A 1 146 ? 20.824  24.284 47.421 1.00 30.39  ? 354  HIS A CA   1 
ATOM   1461  C  C    . HIS A 1 146 ? 19.787  24.760 46.401 1.00 30.35  ? 354  HIS A C    1 
ATOM   1462  O  O    . HIS A 1 146 ? 20.116  25.351 45.369 1.00 30.49  ? 354  HIS A O    1 
ATOM   1463  C  CB   . HIS A 1 146 ? 20.520  24.836 48.815 1.00 30.61  ? 354  HIS A CB   1 
ATOM   1464  C  CG   . HIS A 1 146 ? 21.456  24.352 49.877 1.00 30.17  ? 354  HIS A CG   1 
ATOM   1465  N  ND1  . HIS A 1 146 ? 21.894  23.046 49.947 1.00 30.60  ? 354  HIS A ND1  1 
ATOM   1466  C  CD2  . HIS A 1 146 ? 22.039  24.999 50.915 1.00 30.96  ? 354  HIS A CD2  1 
ATOM   1467  C  CE1  . HIS A 1 146 ? 22.703  22.909 50.982 1.00 31.52  ? 354  HIS A CE1  1 
ATOM   1468  N  NE2  . HIS A 1 146 ? 22.807  24.079 51.587 1.00 31.85  ? 354  HIS A NE2  1 
ATOM   1469  H  H    . HIS A 1 146 ? 22.373  25.478 47.240 1.00 37.37  ? 354  HIS A H    1 
ATOM   1470  H  HA   . HIS A 1 146 ? 20.781  23.316 47.465 1.00 36.47  ? 354  HIS A HA   1 
ATOM   1471  H  HB2  . HIS A 1 146 ? 20.579  25.804 48.787 1.00 36.74  ? 354  HIS A HB2  1 
ATOM   1472  H  HB3  . HIS A 1 146 ? 19.622  24.570 49.067 1.00 36.74  ? 354  HIS A HB3  1 
ATOM   1473  H  HD2  . HIS A 1 146 ? 21.935  25.897 51.134 1.00 37.15  ? 354  HIS A HD2  1 
ATOM   1474  H  HE1  . HIS A 1 146 ? 23.127  22.123 51.241 1.00 37.83  ? 354  HIS A HE1  1 
ATOM   1475  H  HE2  . HIS A 1 146 ? 23.281  24.239 52.286 1.00 38.22  ? 354  HIS A HE2  1 
ATOM   1476  N  N    . PHE A 1 147 ? 18.513  24.502 46.700 1.00 30.59  ? 355  PHE A N    1 
ATOM   1477  C  CA   . PHE A 1 147 ? 17.401  24.875 45.836 1.00 29.07  ? 355  PHE A CA   1 
ATOM   1478  C  C    . PHE A 1 147 ? 16.282  25.455 46.692 1.00 30.01  ? 355  PHE A C    1 
ATOM   1479  O  O    . PHE A 1 147 ? 16.076  25.033 47.833 1.00 32.22  ? 355  PHE A O    1 
ATOM   1480  C  CB   . PHE A 1 147 ? 16.877  23.670 45.037 1.00 28.31  ? 355  PHE A CB   1 
ATOM   1481  C  CG   . PHE A 1 147 ? 17.962  22.747 44.542 1.00 29.05  ? 355  PHE A CG   1 
ATOM   1482  C  CD1  . PHE A 1 147 ? 18.379  21.673 45.314 1.00 32.36  ? 355  PHE A CD1  1 
ATOM   1483  C  CD2  . PHE A 1 147 ? 18.560  22.948 43.309 1.00 28.95  ? 355  PHE A CD2  1 
ATOM   1484  C  CE1  . PHE A 1 147 ? 19.376  20.820 44.866 1.00 31.52  ? 355  PHE A CE1  1 
ATOM   1485  C  CE2  . PHE A 1 147 ? 19.560  22.093 42.856 1.00 29.84  ? 355  PHE A CE2  1 
ATOM   1486  C  CZ   . PHE A 1 147 ? 19.965  21.034 43.639 1.00 31.34  ? 355  PHE A CZ   1 
ATOM   1487  H  H    . PHE A 1 147 ? 18.265  24.100 47.420 1.00 36.71  ? 355  PHE A H    1 
ATOM   1488  H  HA   . PHE A 1 147 ? 17.693  25.555 45.209 1.00 34.88  ? 355  PHE A HA   1 
ATOM   1489  H  HB2  . PHE A 1 147 ? 16.284  23.153 45.604 1.00 33.98  ? 355  PHE A HB2  1 
ATOM   1490  H  HB3  . PHE A 1 147 ? 16.390  23.996 44.263 1.00 33.98  ? 355  PHE A HB3  1 
ATOM   1491  H  HD1  . PHE A 1 147 ? 17.987  21.525 46.144 1.00 38.84  ? 355  PHE A HD1  1 
ATOM   1492  H  HD2  . PHE A 1 147 ? 18.291  23.662 42.778 1.00 34.74  ? 355  PHE A HD2  1 
ATOM   1493  H  HE1  . PHE A 1 147 ? 19.647  20.105 45.394 1.00 37.83  ? 355  PHE A HE1  1 
ATOM   1494  H  HE2  . PHE A 1 147 ? 19.956  22.237 42.028 1.00 35.81  ? 355  PHE A HE2  1 
ATOM   1495  H  HZ   . PHE A 1 147 ? 20.632  20.461 43.337 1.00 37.61  ? 355  PHE A HZ   1 
ATOM   1496  N  N    . TYR A 1 148 ? 15.556  26.429 46.132 1.00 25.39  ? 356  TYR A N    1 
ATOM   1497  C  CA   . TYR A 1 148 ? 14.534  27.169 46.868 1.00 25.71  ? 356  TYR A CA   1 
ATOM   1498  C  C    . TYR A 1 148 ? 13.266  27.269 46.026 1.00 27.61  ? 356  TYR A C    1 
ATOM   1499  O  O    . TYR A 1 148 ? 13.303  27.788 44.906 1.00 26.18  ? 356  TYR A O    1 
ATOM   1500  C  CB   . TYR A 1 148 ? 15.066  28.555 47.262 1.00 27.90  ? 356  TYR A CB   1 
ATOM   1501  C  CG   . TYR A 1 148 ? 16.367  28.439 48.028 1.00 27.17  ? 356  TYR A CG   1 
ATOM   1502  C  CD1  . TYR A 1 148 ? 17.569  28.241 47.360 1.00 26.00  ? 356  TYR A CD1  1 
ATOM   1503  C  CD2  . TYR A 1 148 ? 16.391  28.477 49.416 1.00 27.46  ? 356  TYR A CD2  1 
ATOM   1504  C  CE1  . TYR A 1 148 ? 18.754  28.100 48.046 1.00 25.65  ? 356  TYR A CE1  1 
ATOM   1505  C  CE2  . TYR A 1 148 ? 17.579  28.339 50.114 1.00 28.10  ? 356  TYR A CE2  1 
ATOM   1506  C  CZ   . TYR A 1 148 ? 18.758  28.147 49.420 1.00 26.17  ? 356  TYR A CZ   1 
ATOM   1507  O  OH   . TYR A 1 148 ? 19.951  28.000 50.095 1.00 28.89  ? 356  TYR A OH   1 
ATOM   1508  H  H    . TYR A 1 148 ? 15.641  26.681 45.314 1.00 30.47  ? 356  TYR A H    1 
ATOM   1509  H  HA   . TYR A 1 148 ? 14.317  26.687 47.682 1.00 30.85  ? 356  TYR A HA   1 
ATOM   1510  H  HB2  . TYR A 1 148 ? 15.228  29.077 46.461 1.00 33.48  ? 356  TYR A HB2  1 
ATOM   1511  H  HB3  . TYR A 1 148 ? 14.416  28.999 47.829 1.00 33.48  ? 356  TYR A HB3  1 
ATOM   1512  H  HD1  . TYR A 1 148 ? 17.572  28.201 46.431 1.00 31.20  ? 356  TYR A HD1  1 
ATOM   1513  H  HD2  . TYR A 1 148 ? 15.596  28.599 49.885 1.00 32.95  ? 356  TYR A HD2  1 
ATOM   1514  H  HE1  . TYR A 1 148 ? 19.549  27.972 47.581 1.00 30.79  ? 356  TYR A HE1  1 
ATOM   1515  H  HE2  . TYR A 1 148 ? 17.583  28.369 51.043 1.00 33.72  ? 356  TYR A HE2  1 
ATOM   1516  H  HH   . TYR A 1 148 ? 19.820  28.047 50.924 1.00 34.67  ? 356  TYR A HH   1 
ATOM   1517  N  N    . TYR A 1 149 ? 12.150  26.776 46.575 1.00 28.64  ? 357  TYR A N    1 
ATOM   1518  C  CA   . TYR A 1 149 ? 10.868  26.672 45.872 1.00 27.62  ? 357  TYR A CA   1 
ATOM   1519  C  C    . TYR A 1 149 ? 9.803   27.324 46.747 1.00 27.55  ? 357  TYR A C    1 
ATOM   1520  O  O    . TYR A 1 149 ? 9.494   26.816 47.830 1.00 27.88  ? 357  TYR A O    1 
ATOM   1521  C  CB   . TYR A 1 149 ? 10.535  25.204 45.588 1.00 28.53  ? 357  TYR A CB   1 
ATOM   1522  C  CG   . TYR A 1 149 ? 9.469   24.928 44.537 1.00 28.43  ? 357  TYR A CG   1 
ATOM   1523  C  CD1  . TYR A 1 149 ? 9.392   25.676 43.369 1.00 29.51  ? 357  TYR A CD1  1 
ATOM   1524  C  CD2  . TYR A 1 149 ? 8.566   23.880 44.701 1.00 27.28  ? 357  TYR A CD2  1 
ATOM   1525  C  CE1  . TYR A 1 149 ? 8.431   25.408 42.408 1.00 27.58  ? 357  TYR A CE1  1 
ATOM   1526  C  CE2  . TYR A 1 149 ? 7.604   23.603 43.744 1.00 23.27  ? 357  TYR A CE2  1 
ATOM   1527  C  CZ   . TYR A 1 149 ? 7.543   24.368 42.599 1.00 27.55  ? 357  TYR A CZ   1 
ATOM   1528  O  OH   . TYR A 1 149 ? 6.586   24.098 41.645 1.00 29.50  ? 357  TYR A OH   1 
ATOM   1529  H  H    . TYR A 1 149 ? 12.111  26.485 47.383 1.00 34.37  ? 357  TYR A H    1 
ATOM   1530  H  HA   . TYR A 1 149 ? 10.916  27.150 45.030 1.00 33.14  ? 357  TYR A HA   1 
ATOM   1531  H  HB2  . TYR A 1 149 ? 11.347  24.762 45.293 1.00 34.24  ? 357  TYR A HB2  1 
ATOM   1532  H  HB3  . TYR A 1 149 ? 10.233  24.797 46.415 1.00 34.24  ? 357  TYR A HB3  1 
ATOM   1533  H  HD1  . TYR A 1 149 ? 9.989   26.377 43.235 1.00 35.42  ? 357  TYR A HD1  1 
ATOM   1534  H  HD2  . TYR A 1 149 ? 8.605   23.361 45.472 1.00 32.73  ? 357  TYR A HD2  1 
ATOM   1535  H  HE1  . TYR A 1 149 ? 8.388   25.922 41.634 1.00 33.10  ? 357  TYR A HE1  1 
ATOM   1536  H  HE2  . TYR A 1 149 ? 7.004   22.904 43.873 1.00 27.93  ? 357  TYR A HE2  1 
ATOM   1537  H  HH   . TYR A 1 149 ? 6.116   23.445 41.886 1.00 35.40  ? 357  TYR A HH   1 
ATOM   1538  N  N    . ILE A 1 150 ? 9.229   28.434 46.278 1.00 25.00  ? 358  ILE A N    1 
ATOM   1539  C  CA   . ILE A 1 150 ? 8.508   29.379 47.133 1.00 25.75  ? 358  ILE A CA   1 
ATOM   1540  C  C    . ILE A 1 150 ? 7.032   29.403 46.744 1.00 25.24  ? 358  ILE A C    1 
ATOM   1541  O  O    . ILE A 1 150 ? 6.684   29.805 45.625 1.00 22.94  ? 358  ILE A O    1 
ATOM   1542  C  CB   . ILE A 1 150 ? 9.116   30.789 47.040 1.00 29.11  ? 358  ILE A CB   1 
ATOM   1543  C  CG1  . ILE A 1 150 ? 10.622  30.737 47.324 1.00 30.84  ? 358  ILE A CG1  1 
ATOM   1544  C  CG2  . ILE A 1 150 ? 8.425   31.739 48.014 1.00 27.76  ? 358  ILE A CG2  1 
ATOM   1545  C  CD1  . ILE A 1 150 ? 11.358  32.046 47.050 1.00 32.85  ? 358  ILE A CD1  1 
ATOM   1546  H  H    . ILE A 1 150 ? 9.245   28.666 45.450 1.00 30.00  ? 358  ILE A H    1 
ATOM   1547  H  HA   . ILE A 1 150 ? 8.571   29.084 48.055 1.00 30.91  ? 358  ILE A HA   1 
ATOM   1548  H  HB   . ILE A 1 150 ? 8.984   31.123 46.139 1.00 34.93  ? 358  ILE A HB   1 
ATOM   1549  H  HG12 . ILE A 1 150 ? 10.754  30.515 48.259 1.00 37.02  ? 358  ILE A HG12 1 
ATOM   1550  H  HG13 . ILE A 1 150 ? 11.020  30.052 46.765 1.00 37.02  ? 358  ILE A HG13 1 
ATOM   1551  H  HG21 . ILE A 1 150 ? 8.826   32.619 47.935 1.00 33.32  ? 358  ILE A HG21 1 
ATOM   1552  H  HG22 . ILE A 1 150 ? 7.481   31.785 47.794 1.00 33.32  ? 358  ILE A HG22 1 
ATOM   1553  H  HG23 . ILE A 1 150 ? 8.539   31.403 48.917 1.00 33.32  ? 358  ILE A HG23 1 
ATOM   1554  H  HD11 . ILE A 1 150 ? 12.299  31.928 47.254 1.00 39.43  ? 358  ILE A HD11 1 
ATOM   1555  H  HD12 . ILE A 1 150 ? 11.249  32.279 46.114 1.00 39.43  ? 358  ILE A HD12 1 
ATOM   1556  H  HD13 . ILE A 1 150 ? 10.982  32.743 47.611 1.00 39.43  ? 358  ILE A HD13 1 
ATOM   1557  N  N    . HIS A 1 151 ? 6.168   29.003 47.679 1.00 24.82  ? 359  HIS A N    1 
ATOM   1558  C  CA   . HIS A 1 151 ? 4.719   29.080 47.524 1.00 22.53  ? 359  HIS A CA   1 
ATOM   1559  C  C    . HIS A 1 151 ? 4.202   30.303 48.276 1.00 27.29  ? 359  HIS A C    1 
ATOM   1560  O  O    . HIS A 1 151 ? 4.379   30.405 49.496 1.00 25.11  ? 359  HIS A O    1 
ATOM   1561  C  CB   . HIS A 1 151 ? 4.041   27.812 48.052 1.00 23.05  ? 359  HIS A CB   1 
ATOM   1562  C  CG   . HIS A 1 151 ? 2.545   27.895 48.079 1.00 23.54  ? 359  HIS A CG   1 
ATOM   1563  N  ND1  . HIS A 1 151 ? 1.844   28.387 49.160 1.00 23.30  ? 359  HIS A ND1  1 
ATOM   1564  C  CD2  . HIS A 1 151 ? 1.618   27.558 47.152 1.00 25.74  ? 359  HIS A CD2  1 
ATOM   1565  C  CE1  . HIS A 1 151 ? 0.551   28.348 48.897 1.00 24.18  ? 359  HIS A CE1  1 
ATOM   1566  N  NE2  . HIS A 1 151 ? 0.386   27.849 47.686 1.00 24.26  ? 359  HIS A NE2  1 
ATOM   1567  H  H    . HIS A 1 151 ? 6.409   28.673 48.436 1.00 29.79  ? 359  HIS A H    1 
ATOM   1568  H  HA   . HIS A 1 151 ? 4.498   29.180 46.585 1.00 27.04  ? 359  HIS A HA   1 
ATOM   1569  H  HB2  . HIS A 1 151 ? 4.287   27.066 47.483 1.00 27.66  ? 359  HIS A HB2  1 
ATOM   1570  H  HB3  . HIS A 1 151 ? 4.346   27.649 48.958 1.00 27.66  ? 359  HIS A HB3  1 
ATOM   1571  H  HD1  . HIS A 1 151 ? 2.195   28.676 49.890 1.00 27.96  ? 359  HIS A HD1  1 
ATOM   1572  H  HD2  . HIS A 1 151 ? 1.783   27.198 46.311 1.00 30.89  ? 359  HIS A HD2  1 
ATOM   1573  H  HE1  . HIS A 1 151 ? -0.129  28.622 49.470 1.00 29.02  ? 359  HIS A HE1  1 
ATOM   1574  N  N    . VAL A 1 152 ? 3.562   31.221 47.554 1.00 26.58  ? 360  VAL A N    1 
ATOM   1575  C  CA   . VAL A 1 152 ? 2.982   32.426 48.141 1.00 24.57  ? 360  VAL A CA   1 
ATOM   1576  C  C    . VAL A 1 152 ? 1.470   32.267 48.191 1.00 26.05  ? 360  VAL A C    1 
ATOM   1577  O  O    . VAL A 1 152 ? 0.837   31.942 47.179 1.00 26.75  ? 360  VAL A O    1 
ATOM   1578  C  CB   . VAL A 1 152 ? 3.368   33.690 47.352 1.00 27.35  ? 360  VAL A CB   1 
ATOM   1579  C  CG1  . VAL A 1 152 ? 2.813   34.923 48.048 1.00 22.28  ? 360  VAL A CG1  1 
ATOM   1580  C  CG2  . VAL A 1 152 ? 4.880   33.789 47.209 1.00 18.56  ? 360  VAL A CG2  1 
ATOM   1581  H  H    . VAL A 1 152 ? 3.449   31.166 46.704 1.00 31.90  ? 360  VAL A H    1 
ATOM   1582  H  HA   . VAL A 1 152 ? 3.307   32.526 49.049 1.00 29.48  ? 360  VAL A HA   1 
ATOM   1583  H  HB   . VAL A 1 152 ? 2.981   33.643 46.464 1.00 32.82  ? 360  VAL A HB   1 
ATOM   1584  H  HG11 . VAL A 1 152 ? 3.063   35.711 47.541 1.00 26.74  ? 360  VAL A HG11 1 
ATOM   1585  H  HG12 . VAL A 1 152 ? 1.846   34.852 48.093 1.00 26.74  ? 360  VAL A HG12 1 
ATOM   1586  H  HG13 . VAL A 1 152 ? 3.183   34.974 48.943 1.00 26.74  ? 360  VAL A HG13 1 
ATOM   1587  H  HG21 . VAL A 1 152 ? 5.097   34.592 46.709 1.00 22.26  ? 360  VAL A HG21 1 
ATOM   1588  H  HG22 . VAL A 1 152 ? 5.278   33.831 48.092 1.00 22.26  ? 360  VAL A HG22 1 
ATOM   1589  H  HG23 . VAL A 1 152 ? 5.204   33.007 46.736 1.00 22.26  ? 360  VAL A HG23 1 
ATOM   1590  N  N    . ASP A 1 153 ? 0.897   32.502 49.370 1.00 29.53  ? 361  ASP A N    1 
ATOM   1591  C  CA   . ASP A 1 153 ? -0.548  32.444 49.557 1.00 31.31  ? 361  ASP A CA   1 
ATOM   1592  C  C    . ASP A 1 153 ? -1.266  33.241 48.476 1.00 30.75  ? 361  ASP A C    1 
ATOM   1593  O  O    . ASP A 1 153 ? -0.899  34.382 48.179 1.00 25.22  ? 361  ASP A O    1 
ATOM   1594  C  CB   . ASP A 1 153 ? -0.908  32.986 50.944 1.00 35.19  ? 361  ASP A CB   1 
ATOM   1595  C  CG   . ASP A 1 153 ? -2.378  32.784 51.301 1.00 39.33  ? 361  ASP A CG   1 
ATOM   1596  O  OD1  . ASP A 1 153 ? -3.262  33.155 50.500 1.00 37.99  ? 361  ASP A OD1  1 
ATOM   1597  O  OD2  . ASP A 1 153 ? -2.652  32.248 52.395 1.00 41.44  ? 361  ASP A OD2  1 
ATOM   1598  H  H    . ASP A 1 153 ? 1.331   32.699 50.086 1.00 35.44  ? 361  ASP A H    1 
ATOM   1599  H  HA   . ASP A 1 153 ? -0.842  31.522 49.502 1.00 37.58  ? 361  ASP A HA   1 
ATOM   1600  H  HB2  . ASP A 1 153 ? -0.373  32.526 51.610 1.00 42.23  ? 361  ASP A HB2  1 
ATOM   1601  H  HB3  . ASP A 1 153 ? -0.722  33.937 50.969 1.00 42.23  ? 361  ASP A HB3  1 
ATOM   1602  N  N    . LYS A 1 154 ? -2.303  32.626 47.898 1.00 28.53  ? 362  LYS A N    1 
ATOM   1603  C  CA   . LYS A 1 154 ? -3.084  33.267 46.842 1.00 29.25  ? 362  LYS A CA   1 
ATOM   1604  C  C    . LYS A 1 154 ? -3.535  34.668 47.225 1.00 29.05  ? 362  LYS A C    1 
ATOM   1605  O  O    . LYS A 1 154 ? -3.695  35.531 46.352 1.00 24.81  ? 362  LYS A O    1 
ATOM   1606  C  CB   . LYS A 1 154 ? -4.315  32.420 46.518 1.00 33.99  ? 362  LYS A CB   1 
ATOM   1607  C  CG   . LYS A 1 154 ? -4.482  32.112 45.050 1.00 38.82  ? 362  LYS A CG   1 
ATOM   1608  C  CD   . LYS A 1 154 ? -4.989  33.304 44.265 1.00 37.33  ? 362  LYS A CD   1 
ATOM   1609  C  CE   . LYS A 1 154 ? -4.182  33.500 42.990 1.00 35.10  ? 362  LYS A CE   1 
ATOM   1610  N  NZ   . LYS A 1 154 ? -4.999  34.026 41.863 1.00 31.50  ? 362  LYS A NZ   1 
ATOM   1611  H  H    . LYS A 1 154 ? -2.573  31.836 48.101 1.00 34.23  ? 362  LYS A H    1 
ATOM   1612  H  HA   . LYS A 1 154 ? -2.542  33.333 46.040 1.00 35.10  ? 362  LYS A HA   1 
ATOM   1613  H  HB2  . LYS A 1 154 ? -4.245  31.576 46.991 1.00 40.79  ? 362  LYS A HB2  1 
ATOM   1614  H  HB3  . LYS A 1 154 ? -5.107  32.896 46.813 1.00 40.79  ? 362  LYS A HB3  1 
ATOM   1615  H  HG2  . LYS A 1 154 ? -3.625  31.850 44.681 1.00 46.59  ? 362  LYS A HG2  1 
ATOM   1616  H  HG3  . LYS A 1 154 ? -5.123  31.390 44.949 1.00 46.59  ? 362  LYS A HG3  1 
ATOM   1617  H  HD2  . LYS A 1 154 ? -5.916  33.158 44.020 1.00 44.80  ? 362  LYS A HD2  1 
ATOM   1618  H  HD3  . LYS A 1 154 ? -4.905  34.105 44.806 1.00 44.80  ? 362  LYS A HD3  1 
ATOM   1619  H  HE2  . LYS A 1 154 ? -3.468  34.133 43.163 1.00 42.12  ? 362  LYS A HE2  1 
ATOM   1620  H  HE3  . LYS A 1 154 ? -3.810  32.647 42.718 1.00 42.12  ? 362  LYS A HE3  1 
ATOM   1621  H  HZ1  . LYS A 1 154 ? -4.490  34.126 41.140 1.00 37.80  ? 362  LYS A HZ1  1 
ATOM   1622  H  HZ2  . LYS A 1 154 ? -5.660  33.460 41.677 1.00 37.80  ? 362  LYS A HZ2  1 
ATOM   1623  H  HZ3  . LYS A 1 154 ? -5.347  34.815 42.083 1.00 37.80  ? 362  LYS A HZ3  1 
ATOM   1624  N  N    . ARG A 1 155 ? -3.766  34.907 48.510 1.00 29.03  ? 363  ARG A N    1 
ATOM   1625  C  CA   . ARG A 1 155 ? -4.303  36.177 48.981 1.00 31.26  ? 363  ARG A CA   1 
ATOM   1626  C  C    . ARG A 1 155 ? -3.223  37.222 49.255 1.00 31.96  ? 363  ARG A C    1 
ATOM   1627  O  O    . ARG A 1 155 ? -3.557  38.330 49.689 1.00 32.54  ? 363  ARG A O    1 
ATOM   1628  C  CB   . ARG A 1 155 ? -5.138  35.939 50.248 1.00 31.35  ? 363  ARG A CB   1 
ATOM   1629  C  CG   . ARG A 1 155 ? -6.307  34.959 50.044 1.00 35.56  ? 363  ARG A CG   1 
ATOM   1630  C  CD   . ARG A 1 155 ? -6.860  34.429 51.366 1.00 35.36  ? 363  ARG A CD   1 
ATOM   1631  N  NE   . ARG A 1 155 ? -5.843  33.721 52.142 1.00 35.50  ? 363  ARG A NE   1 
ATOM   1632  C  CZ   . ARG A 1 155 ? -5.979  33.370 53.418 1.00 35.59  ? 363  ARG A CZ   1 
ATOM   1633  N  NH1  . ARG A 1 155 ? -7.094  33.658 54.078 1.00 35.78  ? 363  ARG A NH1  1 
ATOM   1634  N  NH2  . ARG A 1 155 ? -4.991  32.735 54.039 1.00 33.71  ? 363  ARG A NH2  1 
ATOM   1635  H  H    . ARG A 1 155 ? -3.618  34.340 49.139 1.00 34.84  ? 363  ARG A H    1 
ATOM   1636  H  HA   . ARG A 1 155 ? -4.894  36.536 48.300 1.00 37.52  ? 363  ARG A HA   1 
ATOM   1637  H  HB2  . ARG A 1 155 ? -4.562  35.575 50.938 1.00 37.62  ? 363  ARG A HB2  1 
ATOM   1638  H  HB3  . ARG A 1 155 ? -5.508  36.786 50.542 1.00 37.62  ? 363  ARG A HB3  1 
ATOM   1639  H  HG2  . ARG A 1 155 ? -7.025  35.415 49.578 1.00 42.68  ? 363  ARG A HG2  1 
ATOM   1640  H  HG3  . ARG A 1 155 ? -5.999  34.202 49.521 1.00 42.68  ? 363  ARG A HG3  1 
ATOM   1641  H  HD2  . ARG A 1 155 ? -7.181  35.173 51.897 1.00 42.43  ? 363  ARG A HD2  1 
ATOM   1642  H  HD3  . ARG A 1 155 ? -7.585  33.811 51.183 1.00 42.43  ? 363  ARG A HD3  1 
ATOM   1643  H  HE   . ARG A 1 155 ? -5.107  33.517 51.747 1.00 42.61  ? 363  ARG A HE   1 
ATOM   1644  H  HH11 . ARG A 1 155 ? -7.735  34.071 53.681 1.00 42.93  ? 363  ARG A HH11 1 
ATOM   1645  H  HH12 . ARG A 1 155 ? -7.177  33.429 54.903 1.00 42.93  ? 363  ARG A HH12 1 
ATOM   1646  H  HH21 . ARG A 1 155 ? -4.268  32.546 53.614 1.00 40.46  ? 363  ARG A HH21 1 
ATOM   1647  H  HH22 . ARG A 1 155 ? -5.079  32.506 54.863 1.00 40.46  ? 363  ARG A HH22 1 
ATOM   1648  N  N    . SER A 1 156 ? -1.952  36.913 49.002 1.00 26.30  ? 364  SER A N    1 
ATOM   1649  C  CA   . SER A 1 156 ? -0.834  37.817 49.293 1.00 25.59  ? 364  SER A CA   1 
ATOM   1650  C  C    . SER A 1 156 ? -0.162  38.229 47.983 1.00 22.88  ? 364  SER A C    1 
ATOM   1651  O  O    . SER A 1 156 ? 0.974   37.836 47.701 1.00 21.63  ? 364  SER A O    1 
ATOM   1652  C  CB   . SER A 1 156 ? 0.169   37.147 50.245 1.00 28.68  ? 364  SER A CB   1 
ATOM   1653  O  OG   . SER A 1 156 ? -0.421  36.873 51.502 1.00 28.91  ? 364  SER A OG   1 
ATOM   1654  H  H    . SER A 1 156 ? -1.704  36.167 48.654 1.00 31.56  ? 364  SER A H    1 
ATOM   1655  H  HA   . SER A 1 156 ? -1.174  38.617 49.724 1.00 30.71  ? 364  SER A HA   1 
ATOM   1656  H  HB2  . SER A 1 156 ? 0.468   36.313 49.850 1.00 34.42  ? 364  SER A HB2  1 
ATOM   1657  H  HB3  . SER A 1 156 ? 0.924   37.741 50.376 1.00 34.42  ? 364  SER A HB3  1 
ATOM   1658  H  HG   . SER A 1 156 ? -0.685  37.587 51.857 1.00 34.69  ? 364  SER A HG   1 
ATOM   1659  N  N    . ASN A 1 157 ? -0.853  39.052 47.191 1.00 24.19  ? 365  ASN A N    1 
ATOM   1660  C  CA   . ASN A 1 157 ? -0.334  39.399 45.871 1.00 25.10  ? 365  ASN A CA   1 
ATOM   1661  C  C    . ASN A 1 157 ? 0.892   40.305 45.963 1.00 29.18  ? 365  ASN A C    1 
ATOM   1662  O  O    . ASN A 1 157 ? 1.832   40.155 45.173 1.00 25.08  ? 365  ASN A O    1 
ATOM   1663  C  CB   . ASN A 1 157 ? -1.435  40.043 45.029 1.00 27.59  ? 365  ASN A CB   1 
ATOM   1664  C  CG   . ASN A 1 157 ? -2.410  39.017 44.471 1.00 30.90  ? 365  ASN A CG   1 
ATOM   1665  O  OD1  . ASN A 1 157 ? -2.059  37.851 44.279 1.00 26.12  ? 365  ASN A OD1  1 
ATOM   1666  N  ND2  . ASN A 1 157 ? -3.639  39.446 44.208 1.00 28.32  ? 365  ASN A ND2  1 
ATOM   1667  H  H    . ASN A 1 157 ? -1.607  39.414 47.390 1.00 29.03  ? 365  ASN A H    1 
ATOM   1668  H  HA   . ASN A 1 157 ? -0.061  38.583 45.423 1.00 30.13  ? 365  ASN A HA   1 
ATOM   1669  H  HB2  . ASN A 1 157 ? -1.935  40.664 45.582 1.00 33.11  ? 365  ASN A HB2  1 
ATOM   1670  H  HB3  . ASN A 1 157 ? -1.031  40.512 44.282 1.00 33.11  ? 365  ASN A HB3  1 
ATOM   1671  H  HD21 . ASN A 1 157 ? -4.225  38.902 43.891 1.00 33.99  ? 365  ASN A HD21 1 
ATOM   1672  H  HD22 . ASN A 1 157 ? -3.848  40.267 44.355 1.00 33.99  ? 365  ASN A HD22 1 
ATOM   1673  N  N    . TYR A 1 158 ? 0.913   41.249 46.912 1.00 27.87  ? 366  TYR A N    1 
ATOM   1674  C  CA   . TYR A 1 158 ? 2.094   42.099 47.064 1.00 27.06  ? 366  TYR A CA   1 
ATOM   1675  C  C    . TYR A 1 158 ? 3.344   41.264 47.324 1.00 25.75  ? 366  TYR A C    1 
ATOM   1676  O  O    . TYR A 1 158 ? 4.380   41.459 46.679 1.00 24.81  ? 366  TYR A O    1 
ATOM   1677  C  CB   . TYR A 1 158 ? 1.906   43.110 48.197 1.00 25.27  ? 366  TYR A CB   1 
ATOM   1678  C  CG   . TYR A 1 158 ? 3.224   43.744 48.606 1.00 26.00  ? 366  TYR A CG   1 
ATOM   1679  C  CD1  . TYR A 1 158 ? 3.802   44.745 47.839 1.00 24.57  ? 366  TYR A CD1  1 
ATOM   1680  C  CD2  . TYR A 1 158 ? 3.902   43.318 49.742 1.00 27.74  ? 366  TYR A CD2  1 
ATOM   1681  C  CE1  . TYR A 1 158 ? 5.013   45.315 48.197 1.00 27.30  ? 366  TYR A CE1  1 
ATOM   1682  C  CE2  . TYR A 1 158 ? 5.115   43.879 50.109 1.00 23.80  ? 366  TYR A CE2  1 
ATOM   1683  C  CZ   . TYR A 1 158 ? 5.666   44.876 49.331 1.00 28.65  ? 366  TYR A CZ   1 
ATOM   1684  O  OH   . TYR A 1 158 ? 6.868   45.441 49.692 1.00 27.03  ? 366  TYR A OH   1 
ATOM   1685  H  H    . TYR A 1 158 ? 0.275   41.412 47.465 1.00 33.44  ? 366  TYR A H    1 
ATOM   1686  H  HA   . TYR A 1 158 ? 2.232   42.594 46.242 1.00 32.47  ? 366  TYR A HA   1 
ATOM   1687  H  HB2  . TYR A 1 158 ? 1.309   43.814 47.901 1.00 30.33  ? 366  TYR A HB2  1 
ATOM   1688  H  HB3  . TYR A 1 158 ? 1.534   42.658 48.971 1.00 30.33  ? 366  TYR A HB3  1 
ATOM   1689  H  HD1  . TYR A 1 158 ? 3.367   45.041 47.072 1.00 29.49  ? 366  TYR A HD1  1 
ATOM   1690  H  HD2  . TYR A 1 158 ? 3.535   42.643 50.266 1.00 33.29  ? 366  TYR A HD2  1 
ATOM   1691  H  HE1  . TYR A 1 158 ? 5.385   45.988 47.674 1.00 32.76  ? 366  TYR A HE1  1 
ATOM   1692  H  HE2  . TYR A 1 158 ? 5.554   43.585 50.875 1.00 28.56  ? 366  TYR A HE2  1 
ATOM   1693  H  HH   . TYR A 1 158 ? 7.153   45.083 50.396 1.00 32.43  ? 366  TYR A HH   1 
ATOM   1694  N  N    . LEU A 1 159 ? 3.273   40.337 48.283 1.00 24.13  ? 367  LEU A N    1 
ATOM   1695  C  CA   . LEU A 1 159 ? 4.439   39.514 48.592 1.00 26.46  ? 367  LEU A CA   1 
ATOM   1696  C  C    . LEU A 1 159 ? 4.859   38.684 47.385 1.00 25.48  ? 367  LEU A C    1 
ATOM   1697  O  O    . LEU A 1 159 ? 6.054   38.458 47.163 1.00 29.51  ? 367  LEU A O    1 
ATOM   1698  C  CB   . LEU A 1 159 ? 4.140   38.613 49.792 1.00 25.34  ? 367  LEU A CB   1 
ATOM   1699  C  CG   . LEU A 1 159 ? 5.272   37.743 50.341 1.00 25.21  ? 367  LEU A CG   1 
ATOM   1700  C  CD1  . LEU A 1 159 ? 6.473   38.572 50.774 1.00 26.99  ? 367  LEU A CD1  1 
ATOM   1701  C  CD2  . LEU A 1 159 ? 4.753   36.919 51.508 1.00 27.42  ? 367  LEU A CD2  1 
ATOM   1702  H  H    . LEU A 1 159 ? 2.576   40.170 48.759 1.00 28.96  ? 367  LEU A H    1 
ATOM   1703  H  HA   . LEU A 1 159 ? 5.180   40.093 48.830 1.00 31.76  ? 367  LEU A HA   1 
ATOM   1704  H  HB2  . LEU A 1 159 ? 3.841   39.178 50.521 1.00 30.41  ? 367  LEU A HB2  1 
ATOM   1705  H  HB3  . LEU A 1 159 ? 3.420   38.013 49.541 1.00 30.41  ? 367  LEU A HB3  1 
ATOM   1706  H  HG   . LEU A 1 159 ? 5.565   37.131 49.648 1.00 30.26  ? 367  LEU A HG   1 
ATOM   1707  H  HD11 . LEU A 1 159 ? 7.161   37.978 51.113 1.00 32.39  ? 367  LEU A HD11 1 
ATOM   1708  H  HD12 . LEU A 1 159 ? 6.809   39.064 50.009 1.00 32.39  ? 367  LEU A HD12 1 
ATOM   1709  H  HD13 . LEU A 1 159 ? 6.196   39.189 51.469 1.00 32.39  ? 367  LEU A HD13 1 
ATOM   1710  H  HD21 . LEU A 1 159 ? 5.475   36.369 51.852 1.00 32.91  ? 367  LEU A HD21 1 
ATOM   1711  H  HD22 . LEU A 1 159 ? 4.435   37.519 52.200 1.00 32.91  ? 367  LEU A HD22 1 
ATOM   1712  H  HD23 . LEU A 1 159 ? 4.027   36.356 51.198 1.00 32.91  ? 367  LEU A HD23 1 
ATOM   1713  N  N    . HIS A 1 160 ? 3.890   38.231 46.587 1.00 23.68  ? 368  HIS A N    1 
ATOM   1714  C  CA   . HIS A 1 160 ? 4.209   37.418 45.417 1.00 24.75  ? 368  HIS A CA   1 
ATOM   1715  C  C    . HIS A 1 160 ? 5.055   38.202 44.422 1.00 27.18  ? 368  HIS A C    1 
ATOM   1716  O  O    . HIS A 1 160 ? 6.060   37.697 43.910 1.00 25.96  ? 368  HIS A O    1 
ATOM   1717  C  CB   . HIS A 1 160 ? 2.921   36.923 44.760 1.00 25.93  ? 368  HIS A CB   1 
ATOM   1718  C  CG   . HIS A 1 160 ? 3.146   36.003 43.601 1.00 24.30  ? 368  HIS A CG   1 
ATOM   1719  N  ND1  . HIS A 1 160 ? 2.975   36.399 42.292 1.00 24.83  ? 368  HIS A ND1  1 
ATOM   1720  C  CD2  . HIS A 1 160 ? 3.523   34.701 43.554 1.00 24.46  ? 368  HIS A CD2  1 
ATOM   1721  C  CE1  . HIS A 1 160 ? 3.239   35.383 41.489 1.00 26.70  ? 368  HIS A CE1  1 
ATOM   1722  N  NE2  . HIS A 1 160 ? 3.573   34.341 42.230 1.00 24.25  ? 368  HIS A NE2  1 
ATOM   1723  H  H    . HIS A 1 160 ? 3.051   38.380 46.701 1.00 28.42  ? 368  HIS A H    1 
ATOM   1724  H  HA   . HIS A 1 160 ? 4.720   36.642 45.700 1.00 29.71  ? 368  HIS A HA   1 
ATOM   1725  H  HB2  . HIS A 1 160 ? 2.397   36.445 45.421 1.00 31.12  ? 368  HIS A HB2  1 
ATOM   1726  H  HB3  . HIS A 1 160 ? 2.422   37.690 44.437 1.00 31.12  ? 368  HIS A HB3  1 
ATOM   1727  H  HD1  . HIS A 1 160 ? 2.735   37.185 42.038 1.00 29.80  ? 368  HIS A HD1  1 
ATOM   1728  H  HD2  . HIS A 1 160 ? 3.712   34.155 44.283 1.00 29.35  ? 368  HIS A HD2  1 
ATOM   1729  H  HE1  . HIS A 1 160 ? 3.197   35.398 40.560 1.00 32.05  ? 368  HIS A HE1  1 
ATOM   1730  N  N    . ARG A 1 161 ? 4.663   39.449 44.143 1.00 28.17  ? 369  ARG A N    1 
ATOM   1731  C  CA   . ARG A 1 161 ? 5.431   40.284 43.226 1.00 31.35  ? 369  ARG A CA   1 
ATOM   1732  C  C    . ARG A 1 161 ? 6.860   40.483 43.718 1.00 30.35  ? 369  ARG A C    1 
ATOM   1733  O  O    . ARG A 1 161 ? 7.799   40.538 42.915 1.00 31.56  ? 369  ARG A O    1 
ATOM   1734  C  CB   . ARG A 1 161 ? 4.738   41.638 43.041 1.00 31.17  ? 369  ARG A CB   1 
ATOM   1735  C  CG   . ARG A 1 161 ? 3.371   41.556 42.376 1.00 32.47  ? 369  ARG A CG   1 
ATOM   1736  C  CD   . ARG A 1 161 ? 2.889   42.925 41.913 1.00 36.19  ? 369  ARG A CD   1 
ATOM   1737  N  NE   . ARG A 1 161 ? 2.657   43.840 43.031 1.00 35.23  ? 369  ARG A NE   1 
ATOM   1738  C  CZ   . ARG A 1 161 ? 1.519   43.919 43.717 1.00 31.09  ? 369  ARG A CZ   1 
ATOM   1739  N  NH1  . ARG A 1 161 ? 0.493   43.137 43.410 1.00 29.84  ? 369  ARG A NH1  1 
ATOM   1740  N  NH2  . ARG A 1 161 ? 1.407   44.783 44.719 1.00 31.74  ? 369  ARG A NH2  1 
ATOM   1741  H  H    . ARG A 1 161 ? 3.964   39.828 44.470 1.00 33.81  ? 369  ARG A H    1 
ATOM   1742  H  HA   . ARG A 1 161 ? 5.471   39.847 42.360 1.00 37.62  ? 369  ARG A HA   1 
ATOM   1743  H  HB2  . ARG A 1 161 ? 4.618   42.047 43.913 1.00 37.40  ? 369  ARG A HB2  1 
ATOM   1744  H  HB3  . ARG A 1 161 ? 5.301   42.202 42.489 1.00 37.40  ? 369  ARG A HB3  1 
ATOM   1745  H  HG2  . ARG A 1 161 ? 3.427   40.975 41.601 1.00 38.97  ? 369  ARG A HG2  1 
ATOM   1746  H  HG3  . ARG A 1 161 ? 2.727   41.206 43.012 1.00 38.97  ? 369  ARG A HG3  1 
ATOM   1747  H  HD2  . ARG A 1 161 ? 3.561   43.319 41.335 1.00 43.43  ? 369  ARG A HD2  1 
ATOM   1748  H  HD3  . ARG A 1 161 ? 2.054   42.821 41.430 1.00 43.43  ? 369  ARG A HD3  1 
ATOM   1749  H  HE   . ARG A 1 161 ? 3.300   44.362 43.261 1.00 42.28  ? 369  ARG A HE   1 
ATOM   1750  H  HH11 . ARG A 1 161 ? 0.559   42.575 42.762 1.00 35.81  ? 369  ARG A HH11 1 
ATOM   1751  H  HH12 . ARG A 1 161 ? -0.239  43.193 43.857 1.00 35.81  ? 369  ARG A HH12 1 
ATOM   1752  H  HH21 . ARG A 1 161 ? 2.069   45.293 44.923 1.00 38.09  ? 369  ARG A HH21 1 
ATOM   1753  H  HH22 . ARG A 1 161 ? 0.672   44.834 45.162 1.00 38.09  ? 369  ARG A HH22 1 
ATOM   1754  N  N    . GLN A 1 162 ? 7.049   40.611 45.033 1.00 29.26  ? 370  GLN A N    1 
ATOM   1755  C  CA   . GLN A 1 162 ? 8.400   40.783 45.557 1.00 29.84  ? 370  GLN A CA   1 
ATOM   1756  C  C    . GLN A 1 162 ? 9.202   39.493 45.431 1.00 28.55  ? 370  GLN A C    1 
ATOM   1757  O  O    . GLN A 1 162 ? 10.409  39.529 45.164 1.00 26.09  ? 370  GLN A O    1 
ATOM   1758  C  CB   . GLN A 1 162 ? 8.354   41.245 47.014 1.00 28.42  ? 370  GLN A CB   1 
ATOM   1759  C  CG   . GLN A 1 162 ? 7.593   42.551 47.239 1.00 29.53  ? 370  GLN A CG   1 
ATOM   1760  C  CD   . GLN A 1 162 ? 8.148   43.705 46.420 1.00 33.20  ? 370  GLN A CD   1 
ATOM   1761  O  OE1  . GLN A 1 162 ? 7.558   44.109 45.421 1.00 36.05  ? 370  GLN A OE1  1 
ATOM   1762  N  NE2  . GLN A 1 162 ? 9.283   44.244 46.847 1.00 34.33  ? 370  GLN A NE2  1 
ATOM   1763  H  H    . GLN A 1 162 ? 6.428   40.601 45.628 1.00 35.12  ? 370  GLN A H    1 
ATOM   1764  H  HA   . GLN A 1 162 ? 8.853   41.467 45.040 1.00 35.81  ? 370  GLN A HA   1 
ATOM   1765  H  HB2  . GLN A 1 162 ? 7.921   40.558 47.544 1.00 34.11  ? 370  GLN A HB2  1 
ATOM   1766  H  HB3  . GLN A 1 162 ? 9.262   41.376 47.327 1.00 34.11  ? 370  GLN A HB3  1 
ATOM   1767  H  HG2  . GLN A 1 162 ? 6.665   42.423 46.986 1.00 35.44  ? 370  GLN A HG2  1 
ATOM   1768  H  HG3  . GLN A 1 162 ? 7.652   42.793 48.176 1.00 35.44  ? 370  GLN A HG3  1 
ATOM   1769  H  HE21 . GLN A 1 162 ? 9.667   43.935 47.551 1.00 41.20  ? 370  GLN A HE21 1 
ATOM   1770  H  HE22 . GLN A 1 162 ? 9.636   44.900 46.417 1.00 41.20  ? 370  GLN A HE22 1 
ATOM   1771  N  N    . VAL A 1 163 ? 8.546   38.345 45.620 1.00 25.92  ? 371  VAL A N    1 
ATOM   1772  C  CA   . VAL A 1 163 ? 9.221   37.056 45.491 1.00 28.55  ? 371  VAL A CA   1 
ATOM   1773  C  C    . VAL A 1 163 ? 9.593   36.779 44.039 1.00 28.75  ? 371  VAL A C    1 
ATOM   1774  O  O    . VAL A 1 163 ? 10.619  36.142 43.767 1.00 29.27  ? 371  VAL A O    1 
ATOM   1775  C  CB   . VAL A 1 163 ? 8.333   35.939 46.077 1.00 28.73  ? 371  VAL A CB   1 
ATOM   1776  C  CG1  . VAL A 1 163 ? 8.860   34.559 45.715 1.00 32.87  ? 371  VAL A CG1  1 
ATOM   1777  C  CG2  . VAL A 1 163 ? 8.252   36.077 47.589 1.00 28.30  ? 371  VAL A CG2  1 
ATOM   1778  H  H    . VAL A 1 163 ? 7.712   38.288 45.824 1.00 31.10  ? 371  VAL A H    1 
ATOM   1779  H  HA   . VAL A 1 163 ? 10.042  37.081 46.006 1.00 34.26  ? 371  VAL A HA   1 
ATOM   1780  H  HB   . VAL A 1 163 ? 7.436   36.024 45.718 1.00 34.48  ? 371  VAL A HB   1 
ATOM   1781  H  HG11 . VAL A 1 163 ? 8.276   33.887 46.101 1.00 39.44  ? 371  VAL A HG11 1 
ATOM   1782  H  HG12 . VAL A 1 163 ? 8.874   34.470 44.749 1.00 39.44  ? 371  VAL A HG12 1 
ATOM   1783  H  HG13 . VAL A 1 163 ? 9.757   34.461 46.070 1.00 39.44  ? 371  VAL A HG13 1 
ATOM   1784  H  HG21 . VAL A 1 163 ? 7.691   35.368 47.940 1.00 33.96  ? 371  VAL A HG21 1 
ATOM   1785  H  HG22 . VAL A 1 163 ? 9.145   36.007 47.960 1.00 33.96  ? 371  VAL A HG22 1 
ATOM   1786  H  HG23 . VAL A 1 163 ? 7.869   36.941 47.807 1.00 33.96  ? 371  VAL A HG23 1 
ATOM   1787  N  N    . LEU A 1 164 ? 8.776   37.236 43.085 1.00 29.33  ? 372  LEU A N    1 
ATOM   1788  C  CA   . LEU A 1 164 ? 9.122   37.074 41.675 1.00 32.57  ? 372  LEU A CA   1 
ATOM   1789  C  C    . LEU A 1 164 ? 10.440  37.758 41.339 1.00 37.00  ? 372  LEU A C    1 
ATOM   1790  O  O    . LEU A 1 164 ? 11.185  37.278 40.477 1.00 35.42  ? 372  LEU A O    1 
ATOM   1791  C  CB   . LEU A 1 164 ? 8.010   37.631 40.783 1.00 32.05  ? 372  LEU A CB   1 
ATOM   1792  C  CG   . LEU A 1 164 ? 6.792   36.745 40.525 1.00 29.68  ? 372  LEU A CG   1 
ATOM   1793  C  CD1  . LEU A 1 164 ? 5.715   37.530 39.788 1.00 30.22  ? 372  LEU A CD1  1 
ATOM   1794  C  CD2  . LEU A 1 164 ? 7.177   35.503 39.730 1.00 30.82  ? 372  LEU A CD2  1 
ATOM   1795  H  H    . LEU A 1 164 ? 8.027   37.635 43.227 1.00 35.20  ? 372  LEU A H    1 
ATOM   1796  H  HA   . LEU A 1 164 ? 9.217   36.128 41.481 1.00 39.09  ? 372  LEU A HA   1 
ATOM   1797  H  HB2  . LEU A 1 164 ? 7.683   38.449 41.188 1.00 38.46  ? 372  LEU A HB2  1 
ATOM   1798  H  HB3  . LEU A 1 164 ? 8.397   37.838 39.918 1.00 38.46  ? 372  LEU A HB3  1 
ATOM   1799  H  HG   . LEU A 1 164 ? 6.425   36.456 41.375 1.00 35.62  ? 372  LEU A HG   1 
ATOM   1800  H  HD11 . LEU A 1 164 ? 4.952   36.951 39.634 1.00 36.26  ? 372  LEU A HD11 1 
ATOM   1801  H  HD12 . LEU A 1 164 ? 5.450   38.289 40.332 1.00 36.26  ? 372  LEU A HD12 1 
ATOM   1802  H  HD13 . LEU A 1 164 ? 6.073   37.838 38.941 1.00 36.26  ? 372  LEU A HD13 1 
ATOM   1803  H  HD21 . LEU A 1 164 ? 6.384   34.964 39.583 1.00 36.98  ? 372  LEU A HD21 1 
ATOM   1804  H  HD22 . LEU A 1 164 ? 7.553   35.777 38.879 1.00 36.98  ? 372  LEU A HD22 1 
ATOM   1805  H  HD23 . LEU A 1 164 ? 7.834   34.997 40.234 1.00 36.98  ? 372  LEU A HD23 1 
ATOM   1806  N  N    . GLN A 1 165 ? 10.741  38.883 41.991 1.00 38.85  ? 373  GLN A N    1 
ATOM   1807  C  CA   . GLN A 1 165 ? 12.010  39.556 41.739 1.00 44.84  ? 373  GLN A CA   1 
ATOM   1808  C  C    . GLN A 1 165 ? 13.193  38.710 42.190 1.00 39.92  ? 373  GLN A C    1 
ATOM   1809  O  O    . GLN A 1 165 ? 14.267  38.773 41.580 1.00 40.70  ? 373  GLN A O    1 
ATOM   1810  C  CB   . GLN A 1 165 ? 12.031  40.918 42.434 1.00 57.28  ? 373  GLN A CB   1 
ATOM   1811  C  CG   . GLN A 1 165 ? 11.141  41.957 41.771 1.00 71.81  ? 373  GLN A CG   1 
ATOM   1812  C  CD   . GLN A 1 165 ? 11.456  42.137 40.294 1.00 85.38  ? 373  GLN A CD   1 
ATOM   1813  O  OE1  . GLN A 1 165 ? 10.552  42.248 39.465 1.00 90.37  ? 373  GLN A OE1  1 
ATOM   1814  N  NE2  . GLN A 1 165 ? 12.743  42.160 39.959 1.00 90.07  ? 373  GLN A NE2  1 
ATOM   1815  H  H    . GLN A 1 165 ? 10.237  39.267 42.573 1.00 46.63  ? 373  GLN A H    1 
ATOM   1816  H  HA   . GLN A 1 165 ? 12.100  39.707 40.785 1.00 53.82  ? 373  GLN A HA   1 
ATOM   1817  H  HB2  . GLN A 1 165 ? 11.727  40.807 43.348 1.00 68.73  ? 373  GLN A HB2  1 
ATOM   1818  H  HB3  . GLN A 1 165 ? 12.940  41.258 42.428 1.00 68.73  ? 373  GLN A HB3  1 
ATOM   1819  H  HG2  . GLN A 1 165 ? 10.216  41.678 41.849 1.00 86.17  ? 373  GLN A HG2  1 
ATOM   1820  H  HG3  . GLN A 1 165 ? 11.269  42.812 42.212 1.00 86.17  ? 373  GLN A HG3  1 
ATOM   1821  H  HE21 . GLN A 1 165 ? 13.347  42.078 40.566 1.00 108.09 ? 373  GLN A HE21 1 
ATOM   1822  H  HE22 . GLN A 1 165 ? 12.972  42.259 39.136 1.00 108.09 ? 373  GLN A HE22 1 
ATOM   1823  N  N    . VAL A 1 166 ? 13.021  37.913 43.244 1.00 37.31  ? 374  VAL A N    1 
ATOM   1824  C  CA   . VAL A 1 166 ? 14.096  37.035 43.691 1.00 33.75  ? 374  VAL A CA   1 
ATOM   1825  C  C    . VAL A 1 166 ? 14.277  35.880 42.715 1.00 37.17  ? 374  VAL A C    1 
ATOM   1826  O  O    . VAL A 1 166 ? 15.400  35.559 42.309 1.00 41.89  ? 374  VAL A O    1 
ATOM   1827  C  CB   . VAL A 1 166 ? 13.816  36.527 45.117 1.00 31.67  ? 374  VAL A CB   1 
ATOM   1828  C  CG1  . VAL A 1 166 ? 14.953  35.625 45.603 1.00 28.00  ? 374  VAL A CG1  1 
ATOM   1829  C  CG2  . VAL A 1 166 ? 13.619  37.697 46.063 1.00 31.78  ? 374  VAL A CG2  1 
ATOM   1830  H  H    . VAL A 1 166 ? 12.300  37.863 43.710 1.00 44.77  ? 374  VAL A H    1 
ATOM   1831  H  HA   . VAL A 1 166 ? 14.925  37.539 43.713 1.00 40.50  ? 374  VAL A HA   1 
ATOM   1832  H  HB   . VAL A 1 166 ? 12.999  36.004 45.112 1.00 38.00  ? 374  VAL A HB   1 
ATOM   1833  H  HG11 . VAL A 1 166 ? 14.752  35.319 46.501 1.00 33.61  ? 374  VAL A HG11 1 
ATOM   1834  H  HG12 . VAL A 1 166 ? 15.031  34.865 45.004 1.00 33.61  ? 374  VAL A HG12 1 
ATOM   1835  H  HG13 . VAL A 1 166 ? 15.780  36.132 45.603 1.00 33.61  ? 374  VAL A HG13 1 
ATOM   1836  H  HG21 . VAL A 1 166 ? 13.444  37.356 46.954 1.00 38.14  ? 374  VAL A HG21 1 
ATOM   1837  H  HG22 . VAL A 1 166 ? 14.424  38.237 46.067 1.00 38.14  ? 374  VAL A HG22 1 
ATOM   1838  H  HG23 . VAL A 1 166 ? 12.866  38.226 45.757 1.00 38.14  ? 374  VAL A HG23 1 
ATOM   1839  N  N    . SER A 1 167 ? 13.175  35.235 42.323 1.00 33.00  ? 375  SER A N    1 
ATOM   1840  C  CA   . SER A 1 167 ? 13.285  34.075 41.446 1.00 35.98  ? 375  SER A CA   1 
ATOM   1841  C  C    . SER A 1 167 ? 13.884  34.450 40.098 1.00 37.46  ? 375  SER A C    1 
ATOM   1842  O  O    . SER A 1 167 ? 14.512  33.611 39.445 1.00 36.49  ? 375  SER A O    1 
ATOM   1843  C  CB   . SER A 1 167 ? 11.916  33.416 41.261 1.00 37.46  ? 375  SER A CB   1 
ATOM   1844  O  OG   . SER A 1 167 ? 11.018  34.265 40.569 1.00 38.21  ? 375  SER A OG   1 
ATOM   1845  H  H    . SER A 1 167 ? 12.372  35.445 42.546 1.00 39.60  ? 375  SER A H    1 
ATOM   1846  H  HA   . SER A 1 167 ? 13.873  33.425 41.861 1.00 43.17  ? 375  SER A HA   1 
ATOM   1847  H  HB2  . SER A 1 167 ? 12.028  32.597 40.753 1.00 44.96  ? 375  SER A HB2  1 
ATOM   1848  H  HB3  . SER A 1 167 ? 11.545  33.213 42.134 1.00 44.96  ? 375  SER A HB3  1 
ATOM   1849  H  HG   . SER A 1 167 ? 10.908  34.978 40.998 1.00 45.85  ? 375  SER A HG   1 
ATOM   1850  N  N    . ARG A 1 168 ? 13.715  35.702 39.668 1.00 39.45  ? 376  ARG A N    1 
ATOM   1851  C  CA   . ARG A 1 168 ? 14.289  36.126 38.397 1.00 45.94  ? 376  ARG A CA   1 
ATOM   1852  C  C    . ARG A 1 168 ? 15.796  36.331 38.477 1.00 41.12  ? 376  ARG A C    1 
ATOM   1853  O  O    . ARG A 1 168 ? 16.467  36.278 37.441 1.00 41.34  ? 376  ARG A O    1 
ATOM   1854  C  CB   . ARG A 1 168 ? 13.619  37.415 37.922 1.00 60.56  ? 376  ARG A CB   1 
ATOM   1855  C  CG   . ARG A 1 168 ? 12.225  37.208 37.354 1.00 75.06  ? 376  ARG A CG   1 
ATOM   1856  C  CD   . ARG A 1 168 ? 11.456  38.519 37.304 1.00 89.89  ? 376  ARG A CD   1 
ATOM   1857  N  NE   . ARG A 1 168 ? 10.086  38.334 36.830 1.00 102.38 ? 376  ARG A NE   1 
ATOM   1858  C  CZ   . ARG A 1 168 ? 9.091   39.187 37.058 1.00 111.46 ? 376  ARG A CZ   1 
ATOM   1859  N  NH1  . ARG A 1 168 ? 9.299   40.289 37.768 1.00 114.07 ? 376  ARG A NH1  1 
ATOM   1860  N  NH2  . ARG A 1 168 ? 7.880   38.930 36.583 1.00 114.81 ? 376  ARG A NH2  1 
ATOM   1861  H  H    . ARG A 1 168 ? 13.280  36.313 40.088 1.00 47.34  ? 376  ARG A H    1 
ATOM   1862  H  HA   . ARG A 1 168 ? 14.118  35.440 37.733 1.00 55.13  ? 376  ARG A HA   1 
ATOM   1863  H  HB2  . ARG A 1 168 ? 13.546  38.024 38.673 1.00 72.68  ? 376  ARG A HB2  1 
ATOM   1864  H  HB3  . ARG A 1 168 ? 14.166  37.813 37.227 1.00 72.68  ? 376  ARG A HB3  1 
ATOM   1865  H  HG2  . ARG A 1 168 ? 12.293  36.859 36.452 1.00 90.07  ? 376  ARG A HG2  1 
ATOM   1866  H  HG3  . ARG A 1 168 ? 11.736  36.589 37.919 1.00 90.07  ? 376  ARG A HG3  1 
ATOM   1867  H  HD2  . ARG A 1 168 ? 11.419  38.900 38.195 1.00 107.87 ? 376  ARG A HD2  1 
ATOM   1868  H  HD3  . ARG A 1 168 ? 11.905  39.128 36.698 1.00 107.87 ? 376  ARG A HD3  1 
ATOM   1869  H  HE   . ARG A 1 168 ? 9.912   37.627 36.374 1.00 122.86 ? 376  ARG A HE   1 
ATOM   1870  H  HH11 . ARG A 1 168 ? 10.083  40.459 38.078 1.00 136.88 ? 376  ARG A HH11 1 
ATOM   1871  H  HH12 . ARG A 1 168 ? 8.651   40.835 37.913 1.00 136.88 ? 376  ARG A HH12 1 
ATOM   1872  H  HH21 . ARG A 1 168 ? 7.740   38.216 36.125 1.00 137.78 ? 376  ARG A HH21 1 
ATOM   1873  H  HH22 . ARG A 1 168 ? 7.235   39.479 36.733 1.00 137.78 ? 376  ARG A HH22 1 
ATOM   1874  N  N    . GLN A 1 169 ? 16.344  36.552 39.672 1.00 40.25  ? 377  GLN A N    1 
ATOM   1875  C  CA   . GLN A 1 169 ? 17.768  36.834 39.816 1.00 42.12  ? 377  GLN A CA   1 
ATOM   1876  C  C    . GLN A 1 169 ? 18.627  35.579 39.920 1.00 37.19  ? 377  GLN A C    1 
ATOM   1877  O  O    . GLN A 1 169 ? 19.811  35.624 39.566 1.00 36.86  ? 377  GLN A O    1 
ATOM   1878  C  CB   . GLN A 1 169 ? 18.013  37.702 41.056 1.00 48.42  ? 377  GLN A CB   1 
ATOM   1879  C  CG   . GLN A 1 169 ? 17.457  39.117 40.960 1.00 59.59  ? 377  GLN A CG   1 
ATOM   1880  C  CD   . GLN A 1 169 ? 17.667  39.916 42.237 1.00 67.78  ? 377  GLN A CD   1 
ATOM   1881  O  OE1  . GLN A 1 169 ? 18.693  39.782 42.907 1.00 69.92  ? 377  GLN A OE1  1 
ATOM   1882  N  NE2  . GLN A 1 169 ? 16.689  40.746 42.585 1.00 71.28  ? 377  GLN A NE2  1 
ATOM   1883  H  H    . GLN A 1 169 ? 15.911  36.543 40.414 1.00 48.30  ? 377  GLN A H    1 
ATOM   1884  H  HA   . GLN A 1 169 ? 18.067  37.334 39.040 1.00 50.55  ? 377  GLN A HA   1 
ATOM   1885  H  HB2  . GLN A 1 169 ? 17.597  37.274 41.820 1.00 58.10  ? 377  GLN A HB2  1 
ATOM   1886  H  HB3  . GLN A 1 169 ? 18.970  37.772 41.201 1.00 58.10  ? 377  GLN A HB3  1 
ATOM   1887  H  HG2  . GLN A 1 169 ? 17.904  39.584 40.236 1.00 71.51  ? 377  GLN A HG2  1 
ATOM   1888  H  HG3  . GLN A 1 169 ? 16.504  39.071 40.787 1.00 71.51  ? 377  GLN A HG3  1 
ATOM   1889  H  HE21 . GLN A 1 169 ? 15.986  40.813 42.094 1.00 85.54  ? 377  GLN A HE21 1 
ATOM   1890  H  HE22 . GLN A 1 169 ? 16.760  41.219 43.300 1.00 85.54  ? 377  GLN A HE22 1 
ATOM   1891  N  N    . TYR A 1 170 ? 18.074  34.463 40.394 1.00 30.97  ? 378  TYR A N    1 
ATOM   1892  C  CA   . TYR A 1 170 ? 18.870  33.283 40.709 1.00 31.84  ? 378  TYR A CA   1 
ATOM   1893  C  C    . TYR A 1 170 ? 18.285  32.047 40.039 1.00 32.28  ? 378  TYR A C    1 
ATOM   1894  O  O    . TYR A 1 170 ? 17.067  31.839 40.049 1.00 27.44  ? 378  TYR A O    1 
ATOM   1895  C  CB   . TYR A 1 170 ? 18.952  33.079 42.229 1.00 29.22  ? 378  TYR A CB   1 
ATOM   1896  C  CG   . TYR A 1 170 ? 19.387  34.331 42.964 1.00 30.76  ? 378  TYR A CG   1 
ATOM   1897  C  CD1  . TYR A 1 170 ? 20.724  34.707 43.008 1.00 31.32  ? 378  TYR A CD1  1 
ATOM   1898  C  CD2  . TYR A 1 170 ? 18.459  35.144 43.601 1.00 30.45  ? 378  TYR A CD2  1 
ATOM   1899  C  CE1  . TYR A 1 170 ? 21.127  35.855 43.673 1.00 31.42  ? 378  TYR A CE1  1 
ATOM   1900  C  CE2  . TYR A 1 170 ? 18.851  36.295 44.269 1.00 31.86  ? 378  TYR A CE2  1 
ATOM   1901  C  CZ   . TYR A 1 170 ? 20.186  36.645 44.301 1.00 32.73  ? 378  TYR A CZ   1 
ATOM   1902  O  OH   . TYR A 1 170 ? 20.578  37.789 44.963 1.00 33.15  ? 378  TYR A OH   1 
ATOM   1903  H  H    . TYR A 1 170 ? 17.232  34.366 40.542 1.00 37.16  ? 378  TYR A H    1 
ATOM   1904  H  HA   . TYR A 1 170 ? 19.771  33.409 40.373 1.00 38.21  ? 378  TYR A HA   1 
ATOM   1905  H  HB2  . TYR A 1 170 ? 18.077  32.824 42.562 1.00 35.06  ? 378  TYR A HB2  1 
ATOM   1906  H  HB3  . TYR A 1 170 ? 19.597  32.380 42.420 1.00 35.06  ? 378  TYR A HB3  1 
ATOM   1907  H  HD1  . TYR A 1 170 ? 21.361  34.177 42.586 1.00 37.59  ? 378  TYR A HD1  1 
ATOM   1908  H  HD2  . TYR A 1 170 ? 17.559  34.912 43.581 1.00 36.54  ? 378  TYR A HD2  1 
ATOM   1909  H  HE1  . TYR A 1 170 ? 22.026  36.092 43.695 1.00 37.71  ? 378  TYR A HE1  1 
ATOM   1910  H  HE2  . TYR A 1 170 ? 18.218  36.828 44.693 1.00 38.24  ? 378  TYR A HE2  1 
ATOM   1911  H  HH   . TYR A 1 170 ? 21.411  37.884 44.905 1.00 39.79  ? 378  TYR A HH   1 
ATOM   1912  N  N    . SER A 1 171 ? 19.168  31.223 39.464 1.00 36.39  ? 379  SER A N    1 
ATOM   1913  C  CA   . SER A 1 171 ? 18.732  30.042 38.727 1.00 40.10  ? 379  SER A CA   1 
ATOM   1914  C  C    . SER A 1 171 ? 18.263  28.919 39.641 1.00 34.69  ? 379  SER A C    1 
ATOM   1915  O  O    . SER A 1 171 ? 17.520  28.042 39.190 1.00 36.25  ? 379  SER A O    1 
ATOM   1916  C  CB   . SER A 1 171 ? 19.865  29.530 37.831 1.00 45.48  ? 379  SER A CB   1 
ATOM   1917  O  OG   . SER A 1 171 ? 20.976  29.103 38.600 1.00 46.56  ? 379  SER A OG   1 
ATOM   1918  H  H    . SER A 1 171 ? 20.021  31.329 39.489 1.00 43.67  ? 379  SER A H    1 
ATOM   1919  H  HA   . SER A 1 171 ? 17.989  30.288 38.154 1.00 48.12  ? 379  SER A HA   1 
ATOM   1920  H  HB2  . SER A 1 171 ? 19.538  28.782 37.308 1.00 54.57  ? 379  SER A HB2  1 
ATOM   1921  H  HB3  . SER A 1 171 ? 20.147  30.247 37.242 1.00 54.57  ? 379  SER A HB3  1 
ATOM   1922  H  HG   . SER A 1 171 ? 21.586  28.826 38.093 1.00 55.87  ? 379  SER A HG   1 
ATOM   1923  N  N    . ASN A 1 172 ? 18.675  28.921 40.909 1.00 32.13  ? 380  ASN A N    1 
ATOM   1924  C  CA   . ASN A 1 172 ? 18.246  27.907 41.861 1.00 30.58  ? 380  ASN A CA   1 
ATOM   1925  C  C    . ASN A 1 172 ? 17.076  28.371 42.730 1.00 29.58  ? 380  ASN A C    1 
ATOM   1926  O  O    . ASN A 1 172 ? 16.887  27.845 43.832 1.00 24.74  ? 380  ASN A O    1 
ATOM   1927  C  CB   . ASN A 1 172 ? 19.427  27.477 42.735 1.00 31.75  ? 380  ASN A CB   1 
ATOM   1928  C  CG   . ASN A 1 172 ? 19.983  28.605 43.573 1.00 33.06  ? 380  ASN A CG   1 
ATOM   1929  O  OD1  . ASN A 1 172 ? 19.991  29.766 43.157 1.00 35.37  ? 380  ASN A OD1  1 
ATOM   1930  N  ND2  . ASN A 1 172 ? 20.465  28.267 44.763 1.00 31.55  ? 380  ASN A ND2  1 
ATOM   1931  H  H    . ASN A 1 172 ? 19.208  29.507 41.242 1.00 38.56  ? 380  ASN A H    1 
ATOM   1932  H  HA   . ASN A 1 172 ? 17.950  27.127 41.366 1.00 36.70  ? 380  ASN A HA   1 
ATOM   1933  H  HB2  . ASN A 1 172 ? 19.134  26.774 43.336 1.00 38.11  ? 380  ASN A HB2  1 
ATOM   1934  H  HB3  . ASN A 1 172 ? 20.139  27.149 42.164 1.00 38.11  ? 380  ASN A HB3  1 
ATOM   1935  H  HD21 . ASN A 1 172 ? 20.794  28.870 45.281 1.00 37.86  ? 380  ASN A HD21 1 
ATOM   1936  H  HD22 . ASN A 1 172 ? 20.444  27.446 45.018 1.00 37.86  ? 380  ASN A HD22 1 
ATOM   1937  N  N    . VAL A 1 173 ? 16.285  29.336 42.256 1.00 28.34  ? 381  VAL A N    1 
ATOM   1938  C  CA   . VAL A 1 173 ? 15.088  29.789 42.959 1.00 28.87  ? 381  VAL A CA   1 
ATOM   1939  C  C    . VAL A 1 173 ? 13.921  29.780 41.981 1.00 28.57  ? 381  VAL A C    1 
ATOM   1940  O  O    . VAL A 1 173 ? 14.007  30.377 40.901 1.00 31.15  ? 381  VAL A O    1 
ATOM   1941  C  CB   . VAL A 1 173 ? 15.269  31.194 43.564 1.00 29.15  ? 381  VAL A CB   1 
ATOM   1942  C  CG1  . VAL A 1 173 ? 14.035  31.588 44.361 1.00 28.66  ? 381  VAL A CG1  1 
ATOM   1943  C  CG2  . VAL A 1 173 ? 16.509  31.244 44.443 1.00 29.19  ? 381  VAL A CG2  1 
ATOM   1944  H  H    . VAL A 1 173 ? 16.426  29.750 41.516 1.00 34.01  ? 381  VAL A H    1 
ATOM   1945  H  HA   . VAL A 1 173 ? 14.887  29.171 43.679 1.00 34.64  ? 381  VAL A HA   1 
ATOM   1946  H  HB   . VAL A 1 173 ? 15.382  31.837 42.846 1.00 34.98  ? 381  VAL A HB   1 
ATOM   1947  H  HG11 . VAL A 1 173 ? 14.169  32.474 44.732 1.00 34.40  ? 381  VAL A HG11 1 
ATOM   1948  H  HG12 . VAL A 1 173 ? 13.266  31.590 43.770 1.00 34.40  ? 381  VAL A HG12 1 
ATOM   1949  H  HG13 . VAL A 1 173 ? 13.903  30.946 45.075 1.00 34.40  ? 381  VAL A HG13 1 
ATOM   1950  H  HG21 . VAL A 1 173 ? 16.599  32.137 44.811 1.00 35.03  ? 381  VAL A HG21 1 
ATOM   1951  H  HG22 . VAL A 1 173 ? 16.412  30.599 45.161 1.00 35.03  ? 381  VAL A HG22 1 
ATOM   1952  H  HG23 . VAL A 1 173 ? 17.286  31.027 43.905 1.00 35.03  ? 381  VAL A HG23 1 
ATOM   1953  N  N    . ARG A 1 174 ? 12.831  29.112 42.363 1.00 25.84  ? 382  ARG A N    1 
ATOM   1954  C  CA   . ARG A 1 174 ? 11.619  29.055 41.558 1.00 25.89  ? 382  ARG A CA   1 
ATOM   1955  C  C    . ARG A 1 174 ? 10.400  29.288 42.442 1.00 26.38  ? 382  ARG A C    1 
ATOM   1956  O  O    . ARG A 1 174 ? 10.427  29.051 43.652 1.00 27.48  ? 382  ARG A O    1 
ATOM   1957  C  CB   . ARG A 1 174 ? 11.496  27.704 40.830 1.00 26.86  ? 382  ARG A CB   1 
ATOM   1958  C  CG   . ARG A 1 174 ? 12.544  27.503 39.752 1.00 28.78  ? 382  ARG A CG   1 
ATOM   1959  C  CD   . ARG A 1 174 ? 12.534  26.094 39.165 1.00 30.92  ? 382  ARG A CD   1 
ATOM   1960  N  NE   . ARG A 1 174 ? 13.533  25.977 38.106 1.00 34.12  ? 382  ARG A NE   1 
ATOM   1961  C  CZ   . ARG A 1 174 ? 14.042  24.833 37.659 1.00 34.75  ? 382  ARG A CZ   1 
ATOM   1962  N  NH1  . ARG A 1 174 ? 13.663  23.672 38.178 1.00 34.38  ? 382  ARG A NH1  1 
ATOM   1963  N  NH2  . ARG A 1 174 ? 14.947  24.856 36.691 1.00 34.78  ? 382  ARG A NH2  1 
ATOM   1964  H  H    . ARG A 1 174 ? 12.772  28.676 43.102 1.00 31.01  ? 382  ARG A H    1 
ATOM   1965  H  HA   . ARG A 1 174 ? 11.647  29.757 40.890 1.00 31.07  ? 382  ARG A HA   1 
ATOM   1966  H  HB2  . ARG A 1 174 ? 11.593  26.988 41.477 1.00 32.23  ? 382  ARG A HB2  1 
ATOM   1967  H  HB3  . ARG A 1 174 ? 10.623  27.653 40.409 1.00 32.23  ? 382  ARG A HB3  1 
ATOM   1968  H  HG2  . ARG A 1 174 ? 12.378  28.129 39.030 1.00 34.54  ? 382  ARG A HG2  1 
ATOM   1969  H  HG3  . ARG A 1 174 ? 13.422  27.662 40.133 1.00 34.54  ? 382  ARG A HG3  1 
ATOM   1970  H  HD2  . ARG A 1 174 ? 12.747  25.452 39.861 1.00 37.10  ? 382  ARG A HD2  1 
ATOM   1971  H  HD3  . ARG A 1 174 ? 11.661  25.907 38.787 1.00 37.10  ? 382  ARG A HD3  1 
ATOM   1972  H  HE   . ARG A 1 174 ? 13.812  26.705 37.743 1.00 40.94  ? 382  ARG A HE   1 
ATOM   1973  H  HH11 . ARG A 1 174 ? 13.078  23.653 38.808 1.00 41.26  ? 382  ARG A HH11 1 
ATOM   1974  H  HH12 . ARG A 1 174 ? 14.001  22.938 37.882 1.00 41.26  ? 382  ARG A HH12 1 
ATOM   1975  H  HH21 . ARG A 1 174 ? 15.196  25.606 36.353 1.00 41.74  ? 382  ARG A HH21 1 
ATOM   1976  H  HH22 . ARG A 1 174 ? 15.282  24.120 36.398 1.00 41.74  ? 382  ARG A HH22 1 
ATOM   1977  N  N    . VAL A 1 175 ? 9.323   29.764 41.819 1.00 29.28  ? 383  VAL A N    1 
ATOM   1978  C  CA   . VAL A 1 175 ? 8.054   29.993 42.499 1.00 28.78  ? 383  VAL A CA   1 
ATOM   1979  C  C    . VAL A 1 175 ? 7.042   28.976 41.989 1.00 27.41  ? 383  VAL A C    1 
ATOM   1980  O  O    . VAL A 1 175 ? 7.071   28.573 40.821 1.00 28.13  ? 383  VAL A O    1 
ATOM   1981  C  CB   . VAL A 1 175 ? 7.537   31.432 42.284 1.00 35.44  ? 383  VAL A CB   1 
ATOM   1982  C  CG1  . VAL A 1 175 ? 8.611   32.444 42.673 1.00 34.71  ? 383  VAL A CG1  1 
ATOM   1983  C  CG2  . VAL A 1 175 ? 7.094   31.642 40.839 1.00 36.49  ? 383  VAL A CG2  1 
ATOM   1984  H  H    . VAL A 1 175 ? 9.305   29.967 40.983 1.00 35.14  ? 383  VAL A H    1 
ATOM   1985  H  HA   . VAL A 1 175 ? 8.172   29.852 43.451 1.00 34.54  ? 383  VAL A HA   1 
ATOM   1986  H  HB   . VAL A 1 175 ? 6.768   31.578 42.856 1.00 42.53  ? 383  VAL A HB   1 
ATOM   1987  H  HG11 . VAL A 1 175 ? 8.266   33.340 42.531 1.00 41.65  ? 383  VAL A HG11 1 
ATOM   1988  H  HG12 . VAL A 1 175 ? 8.836   32.321 43.609 1.00 41.65  ? 383  VAL A HG12 1 
ATOM   1989  H  HG13 . VAL A 1 175 ? 9.395   32.300 42.121 1.00 41.65  ? 383  VAL A HG13 1 
ATOM   1990  H  HG21 . VAL A 1 175 ? 6.776   32.553 40.736 1.00 43.79  ? 383  VAL A HG21 1 
ATOM   1991  H  HG22 . VAL A 1 175 ? 7.850   31.487 40.252 1.00 43.79  ? 383  VAL A HG22 1 
ATOM   1992  H  HG23 . VAL A 1 175 ? 6.381   31.017 40.634 1.00 43.79  ? 383  VAL A HG23 1 
ATOM   1993  N  N    . THR A 1 176 ? 6.141   28.561 42.869 1.00 25.56  ? 384  THR A N    1 
ATOM   1994  C  CA   . THR A 1 176 ? 5.084   27.640 42.458 1.00 26.01  ? 384  THR A CA   1 
ATOM   1995  C  C    . THR A 1 176 ? 4.119   28.368 41.524 1.00 27.44  ? 384  THR A C    1 
ATOM   1996  O  O    . THR A 1 176 ? 3.655   29.467 41.861 1.00 27.06  ? 384  THR A O    1 
ATOM   1997  C  CB   . THR A 1 176 ? 4.337   27.086 43.671 1.00 24.51  ? 384  THR A CB   1 
ATOM   1998  O  OG1  . THR A 1 176 ? 3.703   28.150 44.391 1.00 25.01  ? 384  THR A OG1  1 
ATOM   1999  C  CG2  . THR A 1 176 ? 5.289   26.355 44.605 1.00 28.87  ? 384  THR A CG2  1 
ATOM   2000  H  H    . THR A 1 176 ? 6.116   28.791 43.697 1.00 30.68  ? 384  THR A H    1 
ATOM   2001  H  HA   . THR A 1 176 ? 5.476   26.897 41.973 1.00 31.21  ? 384  THR A HA   1 
ATOM   2002  H  HB   . THR A 1 176 ? 3.662   26.456 43.372 1.00 29.42  ? 384  THR A HB   1 
ATOM   2003  H  HG1  . THR A 1 176 ? 3.155   28.547 43.894 1.00 30.01  ? 384  THR A HG1  1 
ATOM   2004  H  HG21 . THR A 1 176 ? 4.803   26.009 45.369 1.00 34.64  ? 384  THR A HG21 1 
ATOM   2005  H  HG22 . THR A 1 176 ? 5.709   25.617 44.137 1.00 34.64  ? 384  THR A HG22 1 
ATOM   2006  H  HG23 . THR A 1 176 ? 5.977   26.963 44.918 1.00 34.64  ? 384  THR A HG23 1 
ATOM   2007  N  N    . PRO A 1 177 ? 3.805   27.815 40.345 1.00 25.59  ? 385  PRO A N    1 
ATOM   2008  C  CA   . PRO A 1 177 ? 2.837   28.497 39.468 1.00 28.13  ? 385  PRO A CA   1 
ATOM   2009  C  C    . PRO A 1 177 ? 1.424   28.449 40.014 1.00 31.48  ? 385  PRO A C    1 
ATOM   2010  O  O    . PRO A 1 177 ? 0.647   29.387 39.797 1.00 27.99  ? 385  PRO A O    1 
ATOM   2011  C  CB   . PRO A 1 177 ? 2.951   27.735 38.137 1.00 30.58  ? 385  PRO A CB   1 
ATOM   2012  C  CG   . PRO A 1 177 ? 4.124   26.809 38.283 1.00 30.69  ? 385  PRO A CG   1 
ATOM   2013  C  CD   . PRO A 1 177 ? 4.299   26.565 39.741 1.00 28.54  ? 385  PRO A CD   1 
ATOM   2014  H  HA   . PRO A 1 177 ? 3.098   29.422 39.332 1.00 33.76  ? 385  PRO A HA   1 
ATOM   2015  H  HB2  . PRO A 1 177 ? 2.137   27.231 37.982 1.00 36.70  ? 385  PRO A HB2  1 
ATOM   2016  H  HB3  . PRO A 1 177 ? 3.104   28.365 37.415 1.00 36.70  ? 385  PRO A HB3  1 
ATOM   2017  H  HG2  . PRO A 1 177 ? 3.937   25.976 37.821 1.00 36.83  ? 385  PRO A HG2  1 
ATOM   2018  H  HG3  . PRO A 1 177 ? 4.916   27.230 37.913 1.00 36.83  ? 385  PRO A HG3  1 
ATOM   2019  H  HD2  . PRO A 1 177 ? 3.758   25.813 40.027 1.00 34.25  ? 385  PRO A HD2  1 
ATOM   2020  H  HD3  . PRO A 1 177 ? 5.236   26.433 39.953 1.00 34.25  ? 385  PRO A HD3  1 
ATOM   2021  N  N    . TRP A 1 178 ? 1.071   27.366 40.697 1.00 29.22  ? 386  TRP A N    1 
ATOM   2022  C  CA   . TRP A 1 178 ? -0.186  27.268 41.421 1.00 28.39  ? 386  TRP A CA   1 
ATOM   2023  C  C    . TRP A 1 178 ? -0.039  27.909 42.798 1.00 24.49  ? 386  TRP A C    1 
ATOM   2024  O  O    . TRP A 1 178 ? 1.044   27.920 43.386 1.00 27.64  ? 386  TRP A O    1 
ATOM   2025  C  CB   . TRP A 1 178 ? -0.610  25.802 41.557 1.00 29.87  ? 386  TRP A CB   1 
ATOM   2026  C  CG   . TRP A 1 178 ? 0.494   24.924 42.060 1.00 27.57  ? 386  TRP A CG   1 
ATOM   2027  C  CD1  . TRP A 1 178 ? 1.424   24.262 41.312 1.00 27.41  ? 386  TRP A CD1  1 
ATOM   2028  C  CD2  . TRP A 1 178 ? 0.797   24.631 43.427 1.00 27.00  ? 386  TRP A CD2  1 
ATOM   2029  N  NE1  . TRP A 1 178 ? 2.288   23.574 42.130 1.00 27.03  ? 386  TRP A NE1  1 
ATOM   2030  C  CE2  . TRP A 1 178 ? 1.922   23.783 43.434 1.00 26.63  ? 386  TRP A CE2  1 
ATOM   2031  C  CE3  . TRP A 1 178 ? 0.224   25.001 44.646 1.00 24.14  ? 386  TRP A CE3  1 
ATOM   2032  C  CZ2  . TRP A 1 178 ? 2.486   23.302 44.612 1.00 28.52  ? 386  TRP A CZ2  1 
ATOM   2033  C  CZ3  . TRP A 1 178 ? 0.782   24.520 45.813 1.00 23.37  ? 386  TRP A CZ3  1 
ATOM   2034  C  CH2  . TRP A 1 178 ? 1.902   23.681 45.789 1.00 24.91  ? 386  TRP A CH2  1 
ATOM   2035  H  H    . TRP A 1 178 ? 1.556   26.658 40.756 1.00 35.06  ? 386  TRP A H    1 
ATOM   2036  H  HA   . TRP A 1 178 ? -0.877  27.743 40.934 1.00 34.07  ? 386  TRP A HA   1 
ATOM   2037  H  HB2  . TRP A 1 178 ? -1.348  25.743 42.183 1.00 35.85  ? 386  TRP A HB2  1 
ATOM   2038  H  HB3  . TRP A 1 178 ? -0.884  25.470 40.688 1.00 35.85  ? 386  TRP A HB3  1 
ATOM   2039  H  HD1  . TRP A 1 178 ? 1.470   24.281 40.383 1.00 32.89  ? 386  TRP A HD1  1 
ATOM   2040  H  HE1  . TRP A 1 178 ? 2.948   23.089 41.867 1.00 32.44  ? 386  TRP A HE1  1 
ATOM   2041  H  HE3  . TRP A 1 178 ? -0.517  25.561 44.671 1.00 28.97  ? 386  TRP A HE3  1 
ATOM   2042  H  HZ2  . TRP A 1 178 ? 3.226   22.739 44.600 1.00 34.23  ? 386  TRP A HZ2  1 
ATOM   2043  H  HZ3  . TRP A 1 178 ? 0.410   24.762 46.630 1.00 28.05  ? 386  TRP A HZ3  1 
ATOM   2044  H  HH2  . TRP A 1 178 ? 2.255   23.371 46.592 1.00 29.89  ? 386  TRP A HH2  1 
ATOM   2045  N  N    . ARG A 1 179 ? -1.144  28.450 43.307 1.00 24.49  ? 387  ARG A N    1 
ATOM   2046  C  CA   . ARG A 1 179 ? -1.156  29.159 44.583 1.00 26.67  ? 387  ARG A CA   1 
ATOM   2047  C  C    . ARG A 1 179 ? -2.482  28.883 45.275 1.00 28.07  ? 387  ARG A C    1 
ATOM   2048  O  O    . ARG A 1 179 ? -3.543  29.191 44.726 1.00 32.38  ? 387  ARG A O    1 
ATOM   2049  C  CB   . ARG A 1 179 ? -0.964  30.672 44.387 1.00 24.72  ? 387  ARG A CB   1 
ATOM   2050  C  CG   . ARG A 1 179 ? 0.386   31.080 43.808 1.00 21.71  ? 387  ARG A CG   1 
ATOM   2051  C  CD   . ARG A 1 179 ? 0.385   32.551 43.400 1.00 24.86  ? 387  ARG A CD   1 
ATOM   2052  N  NE   . ARG A 1 179 ? 0.140   33.447 44.534 1.00 23.10  ? 387  ARG A NE   1 
ATOM   2053  C  CZ   . ARG A 1 179 ? -0.244  34.715 44.419 1.00 25.55  ? 387  ARG A CZ   1 
ATOM   2054  N  NH1  . ARG A 1 179 ? -0.437  35.250 43.221 1.00 24.02  ? 387  ARG A NH1  1 
ATOM   2055  N  NH2  . ARG A 1 179 ? -0.443  35.452 45.505 1.00 26.88  ? 387  ARG A NH2  1 
ATOM   2056  H  H    . ARG A 1 179 ? -1.914  28.418 42.924 1.00 29.39  ? 387  ARG A H    1 
ATOM   2057  H  HA   . ARG A 1 179 ? -0.439  28.828 45.145 1.00 32.01  ? 387  ARG A HA   1 
ATOM   2058  H  HB2  . ARG A 1 179 ? -1.651  30.995 43.783 1.00 29.66  ? 387  ARG A HB2  1 
ATOM   2059  H  HB3  . ARG A 1 179 ? -1.057  31.109 45.248 1.00 29.66  ? 387  ARG A HB3  1 
ATOM   2060  H  HG2  . ARG A 1 179 ? 1.076   30.949 44.477 1.00 26.05  ? 387  ARG A HG2  1 
ATOM   2061  H  HG3  . ARG A 1 179 ? 0.573   30.545 43.021 1.00 26.05  ? 387  ARG A HG3  1 
ATOM   2062  H  HD2  . ARG A 1 179 ? 1.249   32.776 43.021 1.00 29.84  ? 387  ARG A HD2  1 
ATOM   2063  H  HD3  . ARG A 1 179 ? -0.315  32.698 42.745 1.00 29.84  ? 387  ARG A HD3  1 
ATOM   2064  H  HE   . ARG A 1 179 ? 0.252   33.132 45.326 1.00 27.72  ? 387  ARG A HE   1 
ATOM   2065  H  HH11 . ARG A 1 179 ? -0.311  34.778 42.514 1.00 28.83  ? 387  ARG A HH11 1 
ATOM   2066  H  HH12 . ARG A 1 179 ? -0.687  36.070 43.152 1.00 28.83  ? 387  ARG A HH12 1 
ATOM   2067  H  HH21 . ARG A 1 179 ? -0.321  35.110 46.285 1.00 32.26  ? 387  ARG A HH21 1 
ATOM   2068  H  HH22 . ARG A 1 179 ? -0.693  36.271 45.429 1.00 32.26  ? 387  ARG A HH22 1 
ATOM   2069  N  N    . MET A 1 180 ? -2.421  28.310 46.473 1.00 28.55  ? 388  MET A N    1 
ATOM   2070  C  CA   . MET A 1 180 ? -3.603  28.021 47.272 1.00 30.47  ? 388  MET A CA   1 
ATOM   2071  C  C    . MET A 1 180 ? -3.762  29.060 48.377 1.00 27.07  ? 388  MET A C    1 
ATOM   2072  O  O    . MET A 1 180 ? -2.809  29.739 48.766 1.00 29.99  ? 388  MET A O    1 
ATOM   2073  C  CB   . MET A 1 180 ? -3.513  26.620 47.894 1.00 31.30  ? 388  MET A CB   1 
ATOM   2074  C  CG   . MET A 1 180 ? -3.159  25.506 46.912 1.00 35.96  ? 388  MET A CG   1 
ATOM   2075  S  SD   . MET A 1 180 ? -3.419  23.841 47.582 1.00 43.33  ? 388  MET A SD   1 
ATOM   2076  C  CE   . MET A 1 180 ? -5.208  23.791 47.650 1.00 45.88  ? 388  MET A CE   1 
ATOM   2077  H  H    . MET A 1 180 ? -1.686  28.074 46.853 1.00 34.26  ? 388  MET A H    1 
ATOM   2078  H  HA   . MET A 1 180 ? -4.385  28.045 46.699 1.00 36.57  ? 388  MET A HA   1 
ATOM   2079  H  HB2  . MET A 1 180 ? -2.831  26.631 48.583 1.00 37.57  ? 388  MET A HB2  1 
ATOM   2080  H  HB3  . MET A 1 180 ? -4.372  26.401 48.288 1.00 37.57  ? 388  MET A HB3  1 
ATOM   2081  H  HG2  . MET A 1 180 ? -3.712  25.598 46.121 1.00 43.16  ? 388  MET A HG2  1 
ATOM   2082  H  HG3  . MET A 1 180 ? -2.223  25.587 46.671 1.00 43.16  ? 388  MET A HG3  1 
ATOM   2083  H  HE1  . MET A 1 180 ? -5.487  22.930 48.000 1.00 55.05  ? 388  MET A HE1  1 
ATOM   2084  H  HE2  . MET A 1 180 ? -5.522  24.502 48.231 1.00 55.05  ? 388  MET A HE2  1 
ATOM   2085  H  HE3  . MET A 1 180 ? -5.562  23.914 46.755 1.00 55.05  ? 388  MET A HE3  1 
ATOM   2086  N  N    . ALA A 1 181 ? -4.988  29.171 48.890 1.00 30.68  ? 389  ALA A N    1 
ATOM   2087  C  CA   . ALA A 1 181 ? -5.272  30.032 50.040 1.00 30.79  ? 389  ALA A CA   1 
ATOM   2088  C  C    . ALA A 1 181 ? -5.168  29.179 51.300 1.00 33.52  ? 389  ALA A C    1 
ATOM   2089  O  O    . ALA A 1 181 ? -6.154  28.622 51.783 1.00 36.37  ? 389  ALA A O    1 
ATOM   2090  C  CB   . ALA A 1 181 ? -6.645  30.680 49.905 1.00 33.37  ? 389  ALA A CB   1 
ATOM   2091  H  H    . ALA A 1 181 ? -5.677  28.754 48.588 1.00 36.82  ? 389  ALA A H    1 
ATOM   2092  H  HA   . ALA A 1 181 ? -4.606  30.735 50.090 1.00 36.95  ? 389  ALA A HA   1 
ATOM   2093  H  HB1  . ALA A 1 181 ? -6.806  31.243 50.678 1.00 40.05  ? 389  ALA A HB1  1 
ATOM   2094  H  HB2  . ALA A 1 181 ? -6.662  31.215 49.096 1.00 40.05  ? 389  ALA A HB2  1 
ATOM   2095  H  HB3  . ALA A 1 181 ? -7.319  29.984 49.856 1.00 40.05  ? 389  ALA A HB3  1 
ATOM   2096  N  N    . THR A 1 182 ? -3.954  29.091 51.849 1.00 34.33  ? 390  THR A N    1 
ATOM   2097  C  CA   . THR A 1 182 ? -3.641  28.150 52.929 1.00 35.55  ? 390  THR A CA   1 
ATOM   2098  C  C    . THR A 1 182 ? -4.057  28.737 54.277 1.00 37.17  ? 390  THR A C    1 
ATOM   2099  O  O    . THR A 1 182 ? -3.242  29.222 55.066 1.00 39.97  ? 390  THR A O    1 
ATOM   2100  C  CB   . THR A 1 182 ? -2.156  27.801 52.921 1.00 35.47  ? 390  THR A CB   1 
ATOM   2101  O  OG1  . THR A 1 182 ? -1.372  28.997 52.796 1.00 37.99  ? 390  THR A OG1  1 
ATOM   2102  C  CG2  . THR A 1 182 ? -1.825  26.848 51.773 1.00 36.57  ? 390  THR A CG2  1 
ATOM   2103  H  H    . THR A 1 182 ? -3.284  29.574 51.609 1.00 41.20  ? 390  THR A H    1 
ATOM   2104  H  HA   . THR A 1 182 ? -4.142  27.332 52.790 1.00 42.67  ? 390  THR A HA   1 
ATOM   2105  H  HB   . THR A 1 182 ? -1.929  27.358 53.754 1.00 42.57  ? 390  THR A HB   1 
ATOM   2106  H  HG1  . THR A 1 182 ? -1.529  29.512 53.441 1.00 45.59  ? 390  THR A HG1  1 
ATOM   2107  H  HG21 . THR A 1 182 ? -0.879  26.635 51.781 1.00 43.88  ? 390  THR A HG21 1 
ATOM   2108  H  HG22 . THR A 1 182 ? -2.334  26.028 51.866 1.00 43.88  ? 390  THR A HG22 1 
ATOM   2109  H  HG23 . THR A 1 182 ? -2.048  27.263 50.925 1.00 43.88  ? 390  THR A HG23 1 
ATOM   2110  N  N    . ILE A 1 183 ? -5.360  28.658 54.557 1.00 35.85  ? 391  ILE A N    1 
ATOM   2111  C  CA   . ILE A 1 183 ? -5.866  29.121 55.844 1.00 35.45  ? 391  ILE A CA   1 
ATOM   2112  C  C    . ILE A 1 183 ? -5.257  28.289 56.971 1.00 36.65  ? 391  ILE A C    1 
ATOM   2113  O  O    . ILE A 1 183 ? -4.842  27.138 56.784 1.00 33.97  ? 391  ILE A O    1 
ATOM   2114  C  CB   . ILE A 1 183 ? -7.400  29.060 55.889 1.00 34.32  ? 391  ILE A CB   1 
ATOM   2115  C  CG1  . ILE A 1 183 ? -7.885  27.622 55.651 1.00 30.46  ? 391  ILE A CG1  1 
ATOM   2116  C  CG2  . ILE A 1 183 ? -7.996  30.019 54.863 1.00 34.42  ? 391  ILE A CG2  1 
ATOM   2117  C  CD1  . ILE A 1 183 ? -9.385  27.452 55.764 1.00 31.14  ? 391  ILE A CD1  1 
ATOM   2118  H  H    . ILE A 1 183 ? -5.961  28.346 54.026 1.00 43.03  ? 391  ILE A H    1 
ATOM   2119  H  HA   . ILE A 1 183 ? -5.599  30.044 55.974 1.00 42.55  ? 391  ILE A HA   1 
ATOM   2120  H  HB   . ILE A 1 183 ? -7.691  29.338 56.771 1.00 41.19  ? 391  ILE A HB   1 
ATOM   2121  H  HG12 . ILE A 1 183 ? -7.623  27.348 54.759 1.00 36.55  ? 391  ILE A HG12 1 
ATOM   2122  H  HG13 . ILE A 1 183 ? -7.472  27.041 56.308 1.00 36.55  ? 391  ILE A HG13 1 
ATOM   2123  H  HG21 . ILE A 1 183 ? -8.964  29.966 54.907 1.00 41.30  ? 391  ILE A HG21 1 
ATOM   2124  H  HG22 . ILE A 1 183 ? -7.704  30.921 55.068 1.00 41.30  ? 391  ILE A HG22 1 
ATOM   2125  H  HG23 . ILE A 1 183 ? -7.690  29.765 53.978 1.00 41.30  ? 391  ILE A HG23 1 
ATOM   2126  H  HD11 . ILE A 1 183 ? -9.610  26.522 55.602 1.00 37.37  ? 391  ILE A HD11 1 
ATOM   2127  H  HD12 . ILE A 1 183 ? -9.666  27.710 56.656 1.00 37.37  ? 391  ILE A HD12 1 
ATOM   2128  H  HD13 . ILE A 1 183 ? -9.817  28.017 55.104 1.00 37.37  ? 391  ILE A HD13 1 
ATOM   2129  N  N    . TRP A 1 184 ? -5.219  28.882 58.163 1.00 36.37  ? 392  TRP A N    1 
ATOM   2130  C  CA   . TRP A 1 184 ? -4.693  28.179 59.328 1.00 37.05  ? 392  TRP A CA   1 
ATOM   2131  C  C    . TRP A 1 184 ? -5.507  26.918 59.594 1.00 32.50  ? 392  TRP A C    1 
ATOM   2132  O  O    . TRP A 1 184 ? -6.739  26.959 59.658 1.00 28.82  ? 392  TRP A O    1 
ATOM   2133  C  CB   . TRP A 1 184 ? -4.715  29.092 60.556 1.00 37.83  ? 392  TRP A CB   1 
ATOM   2134  C  CG   . TRP A 1 184 ? -4.073  28.479 61.772 1.00 37.52  ? 392  TRP A CG   1 
ATOM   2135  C  CD1  . TRP A 1 184 ? -2.793  28.669 62.207 1.00 38.41  ? 392  TRP A CD1  1 
ATOM   2136  C  CD2  . TRP A 1 184 ? -4.682  27.575 62.704 1.00 36.56  ? 392  TRP A CD2  1 
ATOM   2137  N  NE1  . TRP A 1 184 ? -2.568  27.938 63.350 1.00 36.15  ? 392  TRP A NE1  1 
ATOM   2138  C  CE2  . TRP A 1 184 ? -3.712  27.260 63.675 1.00 35.58  ? 392  TRP A CE2  1 
ATOM   2139  C  CE3  . TRP A 1 184 ? -5.952  27.001 62.809 1.00 38.63  ? 392  TRP A CE3  1 
ATOM   2140  C  CZ2  . TRP A 1 184 ? -3.973  26.400 64.737 1.00 35.67  ? 392  TRP A CZ2  1 
ATOM   2141  C  CZ3  . TRP A 1 184 ? -6.207  26.147 63.864 1.00 40.82  ? 392  TRP A CZ3  1 
ATOM   2142  C  CH2  . TRP A 1 184 ? -5.222  25.853 64.812 1.00 40.16  ? 392  TRP A CH2  1 
ATOM   2143  H  H    . TRP A 1 184 ? -5.488  29.683 58.322 1.00 43.64  ? 392  TRP A H    1 
ATOM   2144  H  HA   . TRP A 1 184 ? -3.774  27.919 59.158 1.00 44.46  ? 392  TRP A HA   1 
ATOM   2145  H  HB2  . TRP A 1 184 ? -4.237  29.910 60.347 1.00 45.40  ? 392  TRP A HB2  1 
ATOM   2146  H  HB3  . TRP A 1 184 ? -5.637  29.297 60.777 1.00 45.40  ? 392  TRP A HB3  1 
ATOM   2147  H  HD1  . TRP A 1 184 ? -2.164  29.212 61.790 1.00 46.10  ? 392  TRP A HD1  1 
ATOM   2148  H  HE1  . TRP A 1 184 ? -1.830  27.914 63.791 1.00 43.38  ? 392  TRP A HE1  1 
ATOM   2149  H  HE3  . TRP A 1 184 ? -6.611  27.190 62.182 1.00 46.36  ? 392  TRP A HE3  1 
ATOM   2150  H  HZ2  . TRP A 1 184 ? -3.320  26.202 65.370 1.00 42.81  ? 392  TRP A HZ2  1 
ATOM   2151  H  HZ3  . TRP A 1 184 ? -7.049  25.759 63.945 1.00 48.98  ? 392  TRP A HZ3  1 
ATOM   2152  H  HH2  . TRP A 1 184 ? -5.423  25.276 65.513 1.00 48.19  ? 392  TRP A HH2  1 
ATOM   2153  N  N    . GLY A 1 185 ? -4.812  25.793 59.753 1.00 32.47  ? 393  GLY A N    1 
ATOM   2154  C  CA   . GLY A 1 185 ? -5.458  24.523 60.003 1.00 28.41  ? 393  GLY A CA   1 
ATOM   2155  C  C    . GLY A 1 185 ? -6.112  23.888 58.797 1.00 27.90  ? 393  GLY A C    1 
ATOM   2156  O  O    . GLY A 1 185 ? -6.715  22.815 58.933 1.00 27.40  ? 393  GLY A O    1 
ATOM   2157  H  H    . GLY A 1 185 ? -3.953  25.747 59.720 1.00 38.96  ? 393  GLY A H    1 
ATOM   2158  H  HA2  . GLY A 1 185 ? -4.801  23.898 60.348 1.00 34.09  ? 393  GLY A HA2  1 
ATOM   2159  H  HA3  . GLY A 1 185 ? -6.140  24.645 60.682 1.00 34.09  ? 393  GLY A HA3  1 
ATOM   2160  N  N    . GLY A 1 186 ? -6.002  24.499 57.621 1.00 28.91  ? 394  GLY A N    1 
ATOM   2161  C  CA   . GLY A 1 186 ? -6.735  24.012 56.471 1.00 27.72  ? 394  GLY A CA   1 
ATOM   2162  C  C    . GLY A 1 186 ? -6.173  22.714 55.924 1.00 31.51  ? 394  GLY A C    1 
ATOM   2163  O  O    . GLY A 1 186 ? -4.982  22.416 56.039 1.00 28.53  ? 394  GLY A O    1 
ATOM   2164  H  H    . GLY A 1 186 ? -5.513  25.190 57.469 1.00 34.69  ? 394  GLY A H    1 
ATOM   2165  H  HA2  . GLY A 1 186 ? -7.662  23.865 56.719 1.00 33.26  ? 394  GLY A HA2  1 
ATOM   2166  H  HA3  . GLY A 1 186 ? -6.709  24.678 55.767 1.00 33.26  ? 394  GLY A HA3  1 
ATOM   2167  N  N    . ALA A 1 187 ? -7.069  21.925 55.322 1.00 27.68  ? 395  ALA A N    1 
ATOM   2168  C  CA   . ALA A 1 187 ? -6.648  20.737 54.592 1.00 25.76  ? 395  ALA A CA   1 
ATOM   2169  C  C    . ALA A 1 187 ? -5.705  21.091 53.451 1.00 27.88  ? 395  ALA A C    1 
ATOM   2170  O  O    . ALA A 1 187 ? -4.872  20.268 53.051 1.00 26.78  ? 395  ALA A O    1 
ATOM   2171  C  CB   . ALA A 1 187 ? -7.873  19.994 54.057 1.00 29.12  ? 395  ALA A CB   1 
ATOM   2172  H  H    . ALA A 1 187 ? -7.918  22.059 55.323 1.00 33.21  ? 395  ALA A H    1 
ATOM   2173  H  HA   . ALA A 1 187 ? -6.177  20.143 55.197 1.00 30.92  ? 395  ALA A HA   1 
ATOM   2174  H  HB1  . ALA A 1 187 ? -7.578  19.206 53.574 1.00 34.95  ? 395  ALA A HB1  1 
ATOM   2175  H  HB2  . ALA A 1 187 ? -8.435  19.734 54.804 1.00 34.95  ? 395  ALA A HB2  1 
ATOM   2176  H  HB3  . ALA A 1 187 ? -8.364  20.583 53.462 1.00 34.95  ? 395  ALA A HB3  1 
ATOM   2177  N  N    . SER A 1 188 ? -5.806  22.316 52.931 1.00 27.58  ? 396  SER A N    1 
ATOM   2178  C  CA   . SER A 1 188 ? -5.025  22.721 51.767 1.00 29.10  ? 396  SER A CA   1 
ATOM   2179  C  C    . SER A 1 188 ? -3.525  22.750 52.034 1.00 28.96  ? 396  SER A C    1 
ATOM   2180  O  O    . SER A 1 188 ? -2.742  22.640 51.083 1.00 28.30  ? 396  SER A O    1 
ATOM   2181  C  CB   . SER A 1 188 ? -5.494  24.098 51.288 1.00 33.83  ? 396  SER A CB   1 
ATOM   2182  O  OG   . SER A 1 188 ? -5.638  24.989 52.383 1.00 33.98  ? 396  SER A OG   1 
ATOM   2183  H  H    . SER A 1 188 ? -6.322  22.932 53.237 1.00 33.09  ? 396  SER A H    1 
ATOM   2184  H  HA   . SER A 1 188 ? -5.185  22.088 51.049 1.00 34.92  ? 396  SER A HA   1 
ATOM   2185  H  HB2  . SER A 1 188 ? -4.838  24.458 50.671 1.00 40.59  ? 396  SER A HB2  1 
ATOM   2186  H  HB3  . SER A 1 188 ? -6.351  24.003 50.844 1.00 40.59  ? 396  SER A HB3  1 
ATOM   2187  H  HG   . SER A 1 188 ? -4.902  25.080 52.778 1.00 40.78  ? 396  SER A HG   1 
ATOM   2188  N  N    . LEU A 1 189 ? -3.096  22.893 53.291 1.00 27.12  ? 397  LEU A N    1 
ATOM   2189  C  CA   . LEU A 1 189 ? -1.661  22.914 53.556 1.00 29.05  ? 397  LEU A CA   1 
ATOM   2190  C  C    . LEU A 1 189 ? -1.007  21.576 53.226 1.00 26.54  ? 397  LEU A C    1 
ATOM   2191  O  O    . LEU A 1 189 ? 0.145   21.549 52.778 1.00 24.35  ? 397  LEU A O    1 
ATOM   2192  C  CB   . LEU A 1 189 ? -1.379  23.293 55.013 1.00 31.93  ? 397  LEU A CB   1 
ATOM   2193  C  CG   . LEU A 1 189 ? 0.112   23.372 55.368 1.00 34.22  ? 397  LEU A CG   1 
ATOM   2194  C  CD1  . LEU A 1 189 ? 0.814   24.458 54.551 1.00 33.20  ? 397  LEU A CD1  1 
ATOM   2195  C  CD2  . LEU A 1 189 ? 0.324   23.604 56.855 1.00 33.69  ? 397  LEU A CD2  1 
ATOM   2196  H  H    . LEU A 1 189 ? -3.598  22.976 53.985 1.00 32.54  ? 397  LEU A H    1 
ATOM   2197  H  HA   . LEU A 1 189 ? -1.252  23.589 52.992 1.00 34.87  ? 397  LEU A HA   1 
ATOM   2198  H  HB2  . LEU A 1 189 ? -1.771  24.163 55.189 1.00 38.32  ? 397  LEU A HB2  1 
ATOM   2199  H  HB3  . LEU A 1 189 ? -1.785  22.628 55.591 1.00 38.32  ? 397  LEU A HB3  1 
ATOM   2200  H  HG   . LEU A 1 189 ? 0.527   22.525 55.143 1.00 41.06  ? 397  LEU A HG   1 
ATOM   2201  H  HD11 . LEU A 1 189 ? 1.752   24.482 54.798 1.00 39.84  ? 397  LEU A HD11 1 
ATOM   2202  H  HD12 . LEU A 1 189 ? 0.726   24.250 53.608 1.00 39.84  ? 397  LEU A HD12 1 
ATOM   2203  H  HD13 . LEU A 1 189 ? 0.400   25.314 54.742 1.00 39.84  ? 397  LEU A HD13 1 
ATOM   2204  H  HD21 . LEU A 1 189 ? 1.276   23.648 57.035 1.00 40.43  ? 397  LEU A HD21 1 
ATOM   2205  H  HD22 . LEU A 1 189 ? -0.099  24.440 57.108 1.00 40.43  ? 397  LEU A HD22 1 
ATOM   2206  H  HD23 . LEU A 1 189 ? -0.073  22.870 57.349 1.00 40.43  ? 397  LEU A HD23 1 
ATOM   2207  N  N    . LEU A 1 190 ? -1.706  20.459 53.437 1.00 26.44  ? 398  LEU A N    1 
ATOM   2208  C  CA   . LEU A 1 190 ? -1.142  19.172 53.034 1.00 28.31  ? 398  LEU A CA   1 
ATOM   2209  C  C    . LEU A 1 190 ? -1.145  19.030 51.517 1.00 29.38  ? 398  LEU A C    1 
ATOM   2210  O  O    . LEU A 1 190 ? -0.186  18.509 50.936 1.00 30.32  ? 398  LEU A O    1 
ATOM   2211  C  CB   . LEU A 1 190 ? -1.911  18.018 53.679 1.00 27.04  ? 398  LEU A CB   1 
ATOM   2212  C  CG   . LEU A 1 190 ? -1.454  16.614 53.248 1.00 25.77  ? 398  LEU A CG   1 
ATOM   2213  C  CD1  . LEU A 1 190 ? 0.022   16.382 53.561 1.00 26.86  ? 398  LEU A CD1  1 
ATOM   2214  C  CD2  . LEU A 1 190 ? -2.317  15.534 53.902 1.00 26.03  ? 398  LEU A CD2  1 
ATOM   2215  H  H    . LEU A 1 190 ? -2.484  20.419 53.801 1.00 31.72  ? 398  LEU A H    1 
ATOM   2216  H  HA   . LEU A 1 190 ? -0.222  19.124 53.336 1.00 33.97  ? 398  LEU A HA   1 
ATOM   2217  H  HB2  . LEU A 1 190 ? -1.807  18.077 54.641 1.00 32.44  ? 398  LEU A HB2  1 
ATOM   2218  H  HB3  . LEU A 1 190 ? -2.849  18.104 53.447 1.00 32.44  ? 398  LEU A HB3  1 
ATOM   2219  H  HG   . LEU A 1 190 ? -1.565  16.535 52.288 1.00 30.92  ? 398  LEU A HG   1 
ATOM   2220  H  HD11 . LEU A 1 190 ? 0.268   15.489 53.275 1.00 32.24  ? 398  LEU A HD11 1 
ATOM   2221  H  HD12 . LEU A 1 190 ? 0.552   17.040 53.085 1.00 32.24  ? 398  LEU A HD12 1 
ATOM   2222  H  HD13 . LEU A 1 190 ? 0.160   16.474 54.517 1.00 32.24  ? 398  LEU A HD13 1 
ATOM   2223  H  HD21 . LEU A 1 190 ? -2.005  14.662 53.612 1.00 31.24  ? 398  LEU A HD21 1 
ATOM   2224  H  HD22 . LEU A 1 190 ? -2.240  15.609 54.866 1.00 31.24  ? 398  LEU A HD22 1 
ATOM   2225  H  HD23 . LEU A 1 190 ? -3.240  15.662 53.633 1.00 31.24  ? 398  LEU A HD23 1 
ATOM   2226  N  N    . SER A 1 191 ? -2.216  19.480 50.860 1.00 31.76  ? 399  SER A N    1 
ATOM   2227  C  CA   . SER A 1 191 ? -2.229  19.500 49.401 1.00 34.09  ? 399  SER A CA   1 
ATOM   2228  C  C    . SER A 1 191 ? -1.052  20.301 48.859 1.00 32.42  ? 399  SER A C    1 
ATOM   2229  O  O    . SER A 1 191 ? -0.429  19.910 47.864 1.00 30.12  ? 399  SER A O    1 
ATOM   2230  C  CB   . SER A 1 191 ? -3.550  20.083 48.897 1.00 37.24  ? 399  SER A CB   1 
ATOM   2231  O  OG   . SER A 1 191 ? -4.656  19.451 49.520 1.00 38.17  ? 399  SER A OG   1 
ATOM   2232  H  H    . SER A 1 191 ? -2.935  19.774 51.230 1.00 38.11  ? 399  SER A H    1 
ATOM   2233  H  HA   . SER A 1 191 ? -2.154  18.592 49.070 1.00 40.91  ? 399  SER A HA   1 
ATOM   2234  H  HB2  . SER A 1 191 ? -3.574  21.031 49.100 1.00 44.69  ? 399  SER A HB2  1 
ATOM   2235  H  HB3  . SER A 1 191 ? -3.609  19.947 47.939 1.00 44.69  ? 399  SER A HB3  1 
ATOM   2236  H  HG   . SER A 1 191 ? -5.374  19.780 49.234 1.00 45.80  ? 399  SER A HG   1 
ATOM   2237  N  N    . THR A 1 192 ? -0.726  21.421 49.511 1.00 27.68  ? 400  THR A N    1 
ATOM   2238  C  CA   . THR A 1 192 ? 0.398   22.244 49.077 1.00 25.61  ? 400  THR A CA   1 
ATOM   2239  C  C    . THR A 1 192 ? 1.710   21.471 49.164 1.00 24.17  ? 400  THR A C    1 
ATOM   2240  O  O    . THR A 1 192 ? 2.490   21.444 48.206 1.00 27.06  ? 400  THR A O    1 
ATOM   2241  C  CB   . THR A 1 192 ? 0.466   23.523 49.920 1.00 26.16  ? 400  THR A CB   1 
ATOM   2242  O  OG1  . THR A 1 192 ? -0.646  24.371 49.601 1.00 27.63  ? 400  THR A OG1  1 
ATOM   2243  C  CG2  . THR A 1 192 ? 1.766   24.292 49.667 1.00 25.51  ? 400  THR A CG2  1 
ATOM   2244  H  H    . THR A 1 192 ? -1.139  21.722 50.203 1.00 33.22  ? 400  THR A H    1 
ATOM   2245  H  HA   . THR A 1 192 ? 0.263   22.502 48.151 1.00 30.73  ? 400  THR A HA   1 
ATOM   2246  H  HB   . THR A 1 192 ? 0.430   23.288 50.860 1.00 31.40  ? 400  THR A HB   1 
ATOM   2247  H  HG1  . THR A 1 192 ? -1.367  23.972 49.764 1.00 33.15  ? 400  THR A HG1  1 
ATOM   2248  H  HG21 . THR A 1 192 ? 1.787   25.096 50.210 1.00 30.62  ? 400  THR A HG21 1 
ATOM   2249  H  HG22 . THR A 1 192 ? 2.529   23.738 49.895 1.00 30.62  ? 400  THR A HG22 1 
ATOM   2250  H  HG23 . THR A 1 192 ? 1.827   24.542 48.732 1.00 30.62  ? 400  THR A HG23 1 
ATOM   2251  N  N    . TYR A 1 193 ? 1.976   20.840 50.310 1.00 22.20  ? 401  TYR A N    1 
ATOM   2252  C  CA   . TYR A 1 193 ? 3.223   20.098 50.466 1.00 25.44  ? 401  TYR A CA   1 
ATOM   2253  C  C    . TYR A 1 193 ? 3.304   18.940 49.480 1.00 26.43  ? 401  TYR A C    1 
ATOM   2254  O  O    . TYR A 1 193 ? 4.345   18.727 48.851 1.00 29.76  ? 401  TYR A O    1 
ATOM   2255  C  CB   . TYR A 1 193 ? 3.363   19.589 51.903 1.00 27.13  ? 401  TYR A CB   1 
ATOM   2256  C  CG   . TYR A 1 193 ? 3.695   20.665 52.920 1.00 29.00  ? 401  TYR A CG   1 
ATOM   2257  C  CD1  . TYR A 1 193 ? 4.586   21.690 52.617 1.00 30.41  ? 401  TYR A CD1  1 
ATOM   2258  C  CD2  . TYR A 1 193 ? 3.116   20.658 54.182 1.00 28.12  ? 401  TYR A CD2  1 
ATOM   2259  C  CE1  . TYR A 1 193 ? 4.892   22.676 53.542 1.00 28.23  ? 401  TYR A CE1  1 
ATOM   2260  C  CE2  . TYR A 1 193 ? 3.416   21.644 55.116 1.00 27.90  ? 401  TYR A CE2  1 
ATOM   2261  C  CZ   . TYR A 1 193 ? 4.304   22.650 54.789 1.00 29.63  ? 401  TYR A CZ   1 
ATOM   2262  O  OH   . TYR A 1 193 ? 4.603   23.638 55.709 1.00 30.99  ? 401  TYR A OH   1 
ATOM   2263  H  H    . TYR A 1 193 ? 1.460   20.828 50.998 1.00 26.64  ? 401  TYR A H    1 
ATOM   2264  H  HA   . TYR A 1 193 ? 3.967   20.694 50.287 1.00 30.53  ? 401  TYR A HA   1 
ATOM   2265  H  HB2  . TYR A 1 193 ? 2.525   19.181 52.171 1.00 32.56  ? 401  TYR A HB2  1 
ATOM   2266  H  HB3  . TYR A 1 193 ? 4.072   18.928 51.931 1.00 32.56  ? 401  TYR A HB3  1 
ATOM   2267  H  HD1  . TYR A 1 193 ? 4.985   21.713 51.777 1.00 36.49  ? 401  TYR A HD1  1 
ATOM   2268  H  HD2  . TYR A 1 193 ? 2.516   19.983 54.406 1.00 33.74  ? 401  TYR A HD2  1 
ATOM   2269  H  HE1  . TYR A 1 193 ? 5.488   23.354 53.322 1.00 33.88  ? 401  TYR A HE1  1 
ATOM   2270  H  HE2  . TYR A 1 193 ? 3.019   21.627 55.957 1.00 33.48  ? 401  TYR A HE2  1 
ATOM   2271  H  HH   . TYR A 1 193 ? 4.180   23.504 56.422 1.00 37.19  ? 401  TYR A HH   1 
ATOM   2272  N  N    . LEU A 1 194 ? 2.214   18.183 49.327 1.00 26.93  ? 402  LEU A N    1 
ATOM   2273  C  CA   . LEU A 1 194 ? 2.237   17.015 48.449 1.00 29.90  ? 402  LEU A CA   1 
ATOM   2274  C  C    . LEU A 1 194 ? 2.473   17.418 46.999 1.00 26.91  ? 402  LEU A C    1 
ATOM   2275  O  O    . LEU A 1 194 ? 3.275   16.796 46.293 1.00 26.00  ? 402  LEU A O    1 
ATOM   2276  C  CB   . LEU A 1 194 ? 0.928   16.230 48.585 1.00 26.06  ? 402  LEU A CB   1 
ATOM   2277  C  CG   . LEU A 1 194 ? 0.731   15.492 49.911 1.00 26.84  ? 402  LEU A CG   1 
ATOM   2278  C  CD1  . LEU A 1 194 ? -0.638  14.820 49.956 1.00 27.06  ? 402  LEU A CD1  1 
ATOM   2279  C  CD2  . LEU A 1 194 ? 1.838   14.465 50.131 1.00 26.85  ? 402  LEU A CD2  1 
ATOM   2280  H  H    . LEU A 1 194 ? 1.460   18.323 49.716 1.00 32.31  ? 402  LEU A H    1 
ATOM   2281  H  HA   . LEU A 1 194 ? 2.964   16.432 48.719 1.00 35.88  ? 402  LEU A HA   1 
ATOM   2282  H  HB2  . LEU A 1 194 ? 0.188   16.850 48.485 1.00 31.28  ? 402  LEU A HB2  1 
ATOM   2283  H  HB3  . LEU A 1 194 ? 0.893   15.569 47.876 1.00 31.28  ? 402  LEU A HB3  1 
ATOM   2284  H  HG   . LEU A 1 194 ? 0.771   16.134 50.637 1.00 32.21  ? 402  LEU A HG   1 
ATOM   2285  H  HD11 . LEU A 1 194 ? -0.736  14.361 50.805 1.00 32.48  ? 402  LEU A HD11 1 
ATOM   2286  H  HD12 . LEU A 1 194 ? -1.326  15.498 49.866 1.00 32.48  ? 402  LEU A HD12 1 
ATOM   2287  H  HD13 . LEU A 1 194 ? -0.702  14.184 49.227 1.00 32.48  ? 402  LEU A HD13 1 
ATOM   2288  H  HD21 . LEU A 1 194 ? 1.686   14.014 50.976 1.00 32.22  ? 402  LEU A HD21 1 
ATOM   2289  H  HD22 . LEU A 1 194 ? 1.820   13.822 49.405 1.00 32.22  ? 402  LEU A HD22 1 
ATOM   2290  H  HD23 . LEU A 1 194 ? 2.693   14.922 50.147 1.00 32.22  ? 402  LEU A HD23 1 
ATOM   2291  N  N    . GLN A 1 195 ? 1.774   18.452 46.530 1.00 23.64  ? 403  GLN A N    1 
ATOM   2292  C  CA   . GLN A 1 195 ? 1.990   18.914 45.163 1.00 25.50  ? 403  GLN A CA   1 
ATOM   2293  C  C    . GLN A 1 195 ? 3.407   19.445 44.982 1.00 23.58  ? 403  GLN A C    1 
ATOM   2294  O  O    . GLN A 1 195 ? 4.032   19.220 43.940 1.00 25.19  ? 403  GLN A O    1 
ATOM   2295  C  CB   . GLN A 1 195 ? 0.962   19.986 44.795 1.00 25.77  ? 403  GLN A CB   1 
ATOM   2296  C  CG   . GLN A 1 195 ? 1.064   20.462 43.348 1.00 29.19  ? 403  GLN A CG   1 
ATOM   2297  C  CD   . GLN A 1 195 ? 0.731   19.361 42.356 1.00 35.43  ? 403  GLN A CD   1 
ATOM   2298  O  OE1  . GLN A 1 195 ? -0.297  18.699 42.476 1.00 36.23  ? 403  GLN A OE1  1 
ATOM   2299  N  NE2  . GLN A 1 195 ? 1.607   19.153 41.380 1.00 37.10  ? 403  GLN A NE2  1 
ATOM   2300  H  H    . GLN A 1 195 ? 1.183   18.893 46.973 1.00 28.37  ? 403  GLN A H    1 
ATOM   2301  H  HA   . GLN A 1 195 ? 1.872   18.166 44.557 1.00 30.61  ? 403  GLN A HA   1 
ATOM   2302  H  HB2  . GLN A 1 195 ? 0.072   19.624 44.927 1.00 30.93  ? 403  GLN A HB2  1 
ATOM   2303  H  HB3  . GLN A 1 195 ? 1.093   20.755 45.371 1.00 30.93  ? 403  GLN A HB3  1 
ATOM   2304  H  HG2  . GLN A 1 195 ? 0.440   21.192 43.209 1.00 35.03  ? 403  GLN A HG2  1 
ATOM   2305  H  HG3  . GLN A 1 195 ? 1.970   20.760 43.175 1.00 35.03  ? 403  GLN A HG3  1 
ATOM   2306  H  HE21 . GLN A 1 195 ? 2.317   19.635 41.329 1.00 44.53  ? 403  GLN A HE21 1 
ATOM   2307  H  HE22 . GLN A 1 195 ? 1.461   18.539 40.795 1.00 44.53  ? 403  GLN A HE22 1 
ATOM   2308  N  N    . SER A 1 196 ? 3.939   20.150 45.983 1.00 23.11  ? 404  SER A N    1 
ATOM   2309  C  CA   . SER A 1 196 ? 5.293   20.677 45.850 1.00 25.49  ? 404  SER A CA   1 
ATOM   2310  C  C    . SER A 1 196 ? 6.321   19.552 45.815 1.00 23.96  ? 404  SER A C    1 
ATOM   2311  O  O    . SER A 1 196 ? 7.358   19.685 45.155 1.00 23.59  ? 404  SER A O    1 
ATOM   2312  C  CB   . SER A 1 196 ? 5.606   21.657 46.983 1.00 25.89  ? 404  SER A CB   1 
ATOM   2313  O  OG   . SER A 1 196 ? 5.788   20.991 48.222 1.00 27.02  ? 404  SER A OG   1 
ATOM   2314  H  H    . SER A 1 196 ? 3.548   20.331 46.728 1.00 27.73  ? 404  SER A H    1 
ATOM   2315  H  HA   . SER A 1 196 ? 5.357   21.163 45.012 1.00 30.59  ? 404  SER A HA   1 
ATOM   2316  H  HB2  . SER A 1 196 ? 6.420   22.138 46.765 1.00 31.07  ? 404  SER A HB2  1 
ATOM   2317  H  HB3  . SER A 1 196 ? 4.869   22.281 47.070 1.00 31.07  ? 404  SER A HB3  1 
ATOM   2318  H  HG   . SER A 1 196 ? 5.091   20.571 48.428 1.00 32.42  ? 404  SER A HG   1 
ATOM   2319  N  N    . MET A 1 197 ? 6.044   18.436 46.498 1.00 23.37  ? 405  MET A N    1 
ATOM   2320  C  CA   . MET A 1 197 ? 6.954   17.294 46.458 1.00 25.54  ? 405  MET A CA   1 
ATOM   2321  C  C    . MET A 1 197 ? 6.945   16.634 45.085 1.00 27.52  ? 405  MET A C    1 
ATOM   2322  O  O    . MET A 1 197 ? 8.002   16.271 44.557 1.00 30.80  ? 405  MET A O    1 
ATOM   2323  C  CB   . MET A 1 197 ? 6.572   16.284 47.542 1.00 24.94  ? 405  MET A CB   1 
ATOM   2324  C  CG   . MET A 1 197 ? 6.834   16.760 48.965 1.00 26.99  ? 405  MET A CG   1 
ATOM   2325  S  SD   . MET A 1 197 ? 6.067   15.711 50.230 1.00 35.55  ? 405  MET A SD   1 
ATOM   2326  C  CE   . MET A 1 197 ? 6.658   16.501 51.723 1.00 36.33  ? 405  MET A CE   1 
ATOM   2327  H  H    . MET A 1 197 ? 5.344   18.318 46.984 1.00 28.05  ? 405  MET A H    1 
ATOM   2328  H  HA   . MET A 1 197 ? 7.853   17.605 46.648 1.00 30.65  ? 405  MET A HA   1 
ATOM   2329  H  HB2  . MET A 1 197 ? 5.625   16.090 47.466 1.00 29.94  ? 405  MET A HB2  1 
ATOM   2330  H  HB3  . MET A 1 197 ? 7.084   15.472 47.404 1.00 29.94  ? 405  MET A HB3  1 
ATOM   2331  H  HG2  . MET A 1 197 ? 7.791   16.766 49.123 1.00 32.38  ? 405  MET A HG2  1 
ATOM   2332  H  HG3  . MET A 1 197 ? 6.478   17.657 49.067 1.00 32.38  ? 405  MET A HG3  1 
ATOM   2333  H  HE1  . MET A 1 197 ? 6.310   16.024 52.492 1.00 43.60  ? 405  MET A HE1  1 
ATOM   2334  H  HE2  . MET A 1 197 ? 7.628   16.478 51.729 1.00 43.60  ? 405  MET A HE2  1 
ATOM   2335  H  HE3  . MET A 1 197 ? 6.349   17.421 51.736 1.00 43.60  ? 405  MET A HE3  1 
ATOM   2336  N  N    . ARG A 1 198 ? 5.758   16.465 44.496 1.00 30.04  ? 406  ARG A N    1 
ATOM   2337  C  CA   . ARG A 1 198 ? 5.664   15.936 43.139 1.00 31.80  ? 406  ARG A CA   1 
ATOM   2338  C  C    . ARG A 1 198 ? 6.410   16.827 42.151 1.00 30.48  ? 406  ARG A C    1 
ATOM   2339  O  O    . ARG A 1 198 ? 7.183   16.338 41.319 1.00 25.96  ? 406  ARG A O    1 
ATOM   2340  C  CB   . ARG A 1 198 ? 4.194   15.797 42.739 1.00 34.52  ? 406  ARG A CB   1 
ATOM   2341  C  CG   . ARG A 1 198 ? 3.974   15.131 41.386 1.00 41.79  ? 406  ARG A CG   1 
ATOM   2342  C  CD   . ARG A 1 198 ? 2.496   14.848 41.127 1.00 48.05  ? 406  ARG A CD   1 
ATOM   2343  N  NE   . ARG A 1 198 ? 1.918   13.975 42.148 1.00 52.72  ? 406  ARG A NE   1 
ATOM   2344  C  CZ   . ARG A 1 198 ? 1.881   12.645 42.079 1.00 54.19  ? 406  ARG A CZ   1 
ATOM   2345  N  NH1  . ARG A 1 198 ? 2.385   12.006 41.030 1.00 53.91  ? 406  ARG A NH1  1 
ATOM   2346  N  NH2  . ARG A 1 198 ? 1.335   11.950 43.069 1.00 53.67  ? 406  ARG A NH2  1 
ATOM   2347  H  H    . ARG A 1 198 ? 5.001   16.648 44.859 1.00 36.05  ? 406  ARG A H    1 
ATOM   2348  H  HA   . ARG A 1 198 ? 6.068   15.055 43.114 1.00 38.16  ? 406  ARG A HA   1 
ATOM   2349  H  HB2  . ARG A 1 198 ? 3.739   15.261 43.408 1.00 41.43  ? 406  ARG A HB2  1 
ATOM   2350  H  HB3  . ARG A 1 198 ? 3.796   16.681 42.702 1.00 41.43  ? 406  ARG A HB3  1 
ATOM   2351  H  HG2  . ARG A 1 198 ? 4.298   15.719 40.685 1.00 50.15  ? 406  ARG A HG2  1 
ATOM   2352  H  HG3  . ARG A 1 198 ? 4.453   14.288 41.363 1.00 50.15  ? 406  ARG A HG3  1 
ATOM   2353  H  HD2  . ARG A 1 198 ? 2.006   15.686 41.132 1.00 57.66  ? 406  ARG A HD2  1 
ATOM   2354  H  HD3  . ARG A 1 198 ? 2.402   14.412 40.266 1.00 57.66  ? 406  ARG A HD3  1 
ATOM   2355  H  HE   . ARG A 1 198 ? 1.576   14.347 42.844 1.00 63.27  ? 406  ARG A HE   1 
ATOM   2356  H  HH11 . ARG A 1 198 ? 2.742   12.450 40.386 1.00 64.69  ? 406  ARG A HH11 1 
ATOM   2357  H  HH12 . ARG A 1 198 ? 2.356   11.147 40.995 1.00 64.69  ? 406  ARG A HH12 1 
ATOM   2358  H  HH21 . ARG A 1 198 ? 1.005   12.358 43.750 1.00 64.41  ? 406  ARG A HH21 1 
ATOM   2359  H  HH22 . ARG A 1 198 ? 1.307   11.092 43.027 1.00 64.41  ? 406  ARG A HH22 1 
ATOM   2360  N  N    . ASP A 1 199 ? 6.182   18.143 42.224 1.00 29.99  ? 407  ASP A N    1 
ATOM   2361  C  CA   . ASP A 1 199 ? 6.901   19.078 41.360 1.00 31.60  ? 407  ASP A CA   1 
ATOM   2362  C  C    . ASP A 1 199 ? 8.410   18.899 41.491 1.00 30.04  ? 407  ASP A C    1 
ATOM   2363  O  O    . ASP A 1 199 ? 9.128   18.794 40.491 1.00 30.52  ? 407  ASP A O    1 
ATOM   2364  C  CB   . ASP A 1 199 ? 6.520   20.522 41.704 1.00 32.22  ? 407  ASP A CB   1 
ATOM   2365  C  CG   . ASP A 1 199 ? 5.073   20.855 41.375 1.00 31.97  ? 407  ASP A CG   1 
ATOM   2366  O  OD1  . ASP A 1 199 ? 4.371   20.009 40.786 1.00 28.52  ? 407  ASP A OD1  1 
ATOM   2367  O  OD2  . ASP A 1 199 ? 4.639   21.983 41.710 1.00 30.60  ? 407  ASP A OD2  1 
ATOM   2368  H  H    . ASP A 1 199 ? 5.621   18.514 42.760 1.00 35.99  ? 407  ASP A H    1 
ATOM   2369  H  HA   . ASP A 1 199 ? 6.655   18.912 40.437 1.00 37.92  ? 407  ASP A HA   1 
ATOM   2370  H  HB2  . ASP A 1 199 ? 6.650   20.664 42.655 1.00 38.66  ? 407  ASP A HB2  1 
ATOM   2371  H  HB3  . ASP A 1 199 ? 7.087   21.126 41.199 1.00 38.66  ? 407  ASP A HB3  1 
ATOM   2372  N  N    . LEU A 1 200 ? 8.909   18.868 42.729 1.00 29.21  ? 408  LEU A N    1 
ATOM   2373  C  CA   . LEU A 1 200 ? 10.351  18.829 42.949 1.00 29.22  ? 408  LEU A CA   1 
ATOM   2374  C  C    . LEU A 1 200 ? 10.959  17.524 42.447 1.00 27.15  ? 408  LEU A C    1 
ATOM   2375  O  O    . LEU A 1 200 ? 12.075  17.519 41.918 1.00 26.13  ? 408  LEU A O    1 
ATOM   2376  C  CB   . LEU A 1 200 ? 10.659  19.022 44.433 1.00 29.56  ? 408  LEU A CB   1 
ATOM   2377  C  CG   . LEU A 1 200 ? 10.496  20.435 44.990 1.00 29.98  ? 408  LEU A CG   1 
ATOM   2378  C  CD1  . LEU A 1 200 ? 10.594  20.403 46.503 1.00 29.49  ? 408  LEU A CD1  1 
ATOM   2379  C  CD2  . LEU A 1 200 ? 11.541  21.380 44.408 1.00 30.28  ? 408  LEU A CD2  1 
ATOM   2380  H  H    . LEU A 1 200 ? 8.438   18.868 43.449 1.00 35.05  ? 408  LEU A H    1 
ATOM   2381  H  HA   . LEU A 1 200 ? 10.764  19.558 42.461 1.00 35.07  ? 408  LEU A HA   1 
ATOM   2382  H  HB2  . LEU A 1 200 ? 10.070  18.443 44.942 1.00 35.47  ? 408  LEU A HB2  1 
ATOM   2383  H  HB3  . LEU A 1 200 ? 11.580  18.758 44.588 1.00 35.47  ? 408  LEU A HB3  1 
ATOM   2384  H  HG   . LEU A 1 200 ? 9.618   20.771 44.751 1.00 35.97  ? 408  LEU A HG   1 
ATOM   2385  H  HD11 . LEU A 1 200 ? 10.489  21.304 46.845 1.00 35.39  ? 408  LEU A HD11 1 
ATOM   2386  H  HD12 . LEU A 1 200 ? 9.892   19.832 46.852 1.00 35.39  ? 408  LEU A HD12 1 
ATOM   2387  H  HD13 . LEU A 1 200 ? 11.462  20.052 46.755 1.00 35.39  ? 408  LEU A HD13 1 
ATOM   2388  H  HD21 . LEU A 1 200 ? 11.409  22.265 44.781 1.00 36.33  ? 408  LEU A HD21 1 
ATOM   2389  H  HD22 . LEU A 1 200 ? 12.425  21.052 44.637 1.00 36.33  ? 408  LEU A HD22 1 
ATOM   2390  H  HD23 . LEU A 1 200 ? 11.438  21.408 43.444 1.00 36.33  ? 408  LEU A HD23 1 
ATOM   2391  N  N    . LEU A 1 201 ? 10.248  16.408 42.604 1.00 29.68  ? 409  LEU A N    1 
ATOM   2392  C  CA   . LEU A 1 201 ? 10.778  15.134 42.128 1.00 30.19  ? 409  LEU A CA   1 
ATOM   2393  C  C    . LEU A 1 201 ? 10.863  15.094 40.607 1.00 31.38  ? 409  LEU A C    1 
ATOM   2394  O  O    . LEU A 1 201 ? 11.721  14.396 40.056 1.00 31.98  ? 409  LEU A O    1 
ATOM   2395  C  CB   . LEU A 1 201 ? 9.921   13.978 42.643 1.00 29.52  ? 409  LEU A CB   1 
ATOM   2396  C  CG   . LEU A 1 201 ? 10.088  13.642 44.126 1.00 27.18  ? 409  LEU A CG   1 
ATOM   2397  C  CD1  . LEU A 1 201 ? 8.952   12.750 44.591 1.00 25.71  ? 409  LEU A CD1  1 
ATOM   2398  C  CD2  . LEU A 1 201 ? 11.431  12.970 44.384 1.00 28.89  ? 409  LEU A CD2  1 
ATOM   2399  H  H    . LEU A 1 201 ? 9.473   16.361 42.976 1.00 35.62  ? 409  LEU A H    1 
ATOM   2400  H  HA   . LEU A 1 201 ? 11.676  15.018 42.478 1.00 36.23  ? 409  LEU A HA   1 
ATOM   2401  H  HB2  . LEU A 1 201 ? 8.988   14.201 42.498 1.00 35.42  ? 409  LEU A HB2  1 
ATOM   2402  H  HB3  . LEU A 1 201 ? 10.145  13.181 42.137 1.00 35.42  ? 409  LEU A HB3  1 
ATOM   2403  H  HG   . LEU A 1 201 ? 10.058  14.462 44.642 1.00 32.62  ? 409  LEU A HG   1 
ATOM   2404  H  HD11 . LEU A 1 201 ? 9.074   12.547 45.531 1.00 30.86  ? 409  LEU A HD11 1 
ATOM   2405  H  HD12 . LEU A 1 201 ? 8.111   13.215 44.459 1.00 30.86  ? 409  LEU A HD12 1 
ATOM   2406  H  HD13 . LEU A 1 201 ? 8.961   11.930 44.072 1.00 30.86  ? 409  LEU A HD13 1 
ATOM   2407  H  HD21 . LEU A 1 201 ? 11.506  12.770 45.330 1.00 34.67  ? 409  LEU A HD21 1 
ATOM   2408  H  HD22 . LEU A 1 201 ? 11.478  12.150 43.867 1.00 34.67  ? 409  LEU A HD22 1 
ATOM   2409  H  HD23 . LEU A 1 201 ? 12.142  13.573 44.115 1.00 34.67  ? 409  LEU A HD23 1 
ATOM   2410  N  N    . GLU A 1 202 ? 9.995   15.831 39.912 1.00 33.19  ? 410  GLU A N    1 
ATOM   2411  C  CA   . GLU A 1 202 ? 10.030  15.841 38.454 1.00 41.27  ? 410  GLU A CA   1 
ATOM   2412  C  C    . GLU A 1 202 ? 11.039  16.837 37.896 1.00 38.82  ? 410  GLU A C    1 
ATOM   2413  O  O    . GLU A 1 202 ? 11.382  16.752 36.712 1.00 36.33  ? 410  GLU A O    1 
ATOM   2414  C  CB   . GLU A 1 202 ? 8.634   16.136 37.901 1.00 54.46  ? 410  GLU A CB   1 
ATOM   2415  C  CG   . GLU A 1 202 ? 7.662   14.975 38.091 1.00 67.21  ? 410  GLU A CG   1 
ATOM   2416  C  CD   . GLU A 1 202 ? 6.220   15.353 37.807 1.00 76.30  ? 410  GLU A CD   1 
ATOM   2417  O  OE1  . GLU A 1 202 ? 5.969   16.516 37.426 1.00 79.30  ? 410  GLU A OE1  1 
ATOM   2418  O  OE2  . GLU A 1 202 ? 5.336   14.484 37.968 1.00 79.21  ? 410  GLU A OE2  1 
ATOM   2419  H  H    . GLU A 1 202 ? 9.385   16.327 40.258 1.00 39.83  ? 410  GLU A H    1 
ATOM   2420  H  HA   . GLU A 1 202 ? 10.287  14.959 38.144 1.00 49.52  ? 410  GLU A HA   1 
ATOM   2421  H  HB2  . GLU A 1 202 ? 8.270   16.910 38.360 1.00 65.35  ? 410  GLU A HB2  1 
ATOM   2422  H  HB3  . GLU A 1 202 ? 8.702   16.317 36.950 1.00 65.35  ? 410  GLU A HB3  1 
ATOM   2423  H  HG2  . GLU A 1 202 ? 7.907   14.257 37.487 1.00 80.65  ? 410  GLU A HG2  1 
ATOM   2424  H  HG3  . GLU A 1 202 ? 7.715   14.667 39.009 1.00 80.65  ? 410  GLU A HG3  1 
ATOM   2425  N  N    . MET A 1 203 ? 11.528  17.768 38.716 1.00 37.26  ? 411  MET A N    1 
ATOM   2426  C  CA   . MET A 1 203 ? 12.602  18.660 38.297 1.00 39.15  ? 411  MET A CA   1 
ATOM   2427  C  C    . MET A 1 203 ? 13.916  17.895 38.233 1.00 39.45  ? 411  MET A C    1 
ATOM   2428  O  O    . MET A 1 203 ? 14.643  17.791 39.226 1.00 38.06  ? 411  MET A O    1 
ATOM   2429  C  CB   . MET A 1 203 ? 12.719  19.851 39.248 1.00 38.72  ? 411  MET A CB   1 
ATOM   2430  C  CG   . MET A 1 203 ? 11.534  20.790 39.184 1.00 37.66  ? 411  MET A CG   1 
ATOM   2431  S  SD   . MET A 1 203 ? 11.617  22.106 40.413 1.00 39.40  ? 411  MET A SD   1 
ATOM   2432  C  CE   . MET A 1 203 ? 9.982   22.806 40.227 1.00 40.22  ? 411  MET A CE   1 
ATOM   2433  H  H    . MET A 1 203 ? 11.253  17.901 39.520 1.00 44.71  ? 411  MET A H    1 
ATOM   2434  H  HA   . MET A 1 203 ? 12.396  19.005 37.414 1.00 46.98  ? 411  MET A HA   1 
ATOM   2435  H  HB2  . MET A 1 203 ? 12.789  19.520 40.158 1.00 46.46  ? 411  MET A HB2  1 
ATOM   2436  H  HB3  . MET A 1 203 ? 13.514  20.357 39.020 1.00 46.46  ? 411  MET A HB3  1 
ATOM   2437  H  HG2  . MET A 1 203 ? 11.505  21.202 38.306 1.00 45.19  ? 411  MET A HG2  1 
ATOM   2438  H  HG3  . MET A 1 203 ? 10.721  20.285 39.341 1.00 45.19  ? 411  MET A HG3  1 
ATOM   2439  H  HE1  . MET A 1 203 ? 9.884   23.546 40.846 1.00 48.27  ? 411  MET A HE1  1 
ATOM   2440  H  HE2  . MET A 1 203 ? 9.876   23.120 39.315 1.00 48.27  ? 411  MET A HE2  1 
ATOM   2441  H  HE3  . MET A 1 203 ? 9.322   22.122 40.421 1.00 48.27  ? 411  MET A HE3  1 
ATOM   2442  N  N    . THR A 1 204 ? 14.221  17.359 37.054 1.00 43.58  ? 412  THR A N    1 
ATOM   2443  C  CA   . THR A 1 204 ? 15.386  16.498 36.895 1.00 47.14  ? 412  THR A CA   1 
ATOM   2444  C  C    . THR A 1 204 ? 16.692  17.256 37.096 1.00 44.43  ? 412  THR A C    1 
ATOM   2445  O  O    . THR A 1 204 ? 17.695  16.658 37.502 1.00 43.48  ? 412  THR A O    1 
ATOM   2446  C  CB   . THR A 1 204 ? 15.335  15.843 35.512 1.00 54.66  ? 412  THR A CB   1 
ATOM   2447  O  OG1  . THR A 1 204 ? 14.807  14.517 35.637 1.00 56.92  ? 412  THR A OG1  1 
ATOM   2448  C  CG2  . THR A 1 204 ? 16.712  15.798 34.848 1.00 59.30  ? 412  THR A CG2  1 
ATOM   2449  H  H    . THR A 1 204 ? 13.770  17.479 36.332 1.00 52.29  ? 412  THR A H    1 
ATOM   2450  H  HA   . THR A 1 204 ? 15.347  15.792 37.559 1.00 56.57  ? 412  THR A HA   1 
ATOM   2451  H  HB   . THR A 1 204 ? 14.747  16.362 34.941 1.00 65.60  ? 412  THR A HB   1 
ATOM   2452  H  HG1  . THR A 1 204 ? 14.775  14.148 34.882 1.00 68.31  ? 412  THR A HG1  1 
ATOM   2453  H  HG21 . THR A 1 204 ? 16.646  15.378 33.976 1.00 71.16  ? 412  THR A HG21 1 
ATOM   2454  H  HG22 . THR A 1 204 ? 17.057  16.698 34.739 1.00 71.16  ? 412  THR A HG22 1 
ATOM   2455  H  HG23 . THR A 1 204 ? 17.328  15.288 35.397 1.00 71.16  ? 412  THR A HG23 1 
ATOM   2456  N  N    . ASP A 1 205 ? 16.706  18.559 36.821 1.00 41.67  ? 413  ASP A N    1 
ATOM   2457  C  CA   . ASP A 1 205 ? 17.927  19.350 36.925 1.00 40.07  ? 413  ASP A CA   1 
ATOM   2458  C  C    . ASP A 1 205 ? 18.249  19.781 38.353 1.00 38.27  ? 413  ASP A C    1 
ATOM   2459  O  O    . ASP A 1 205 ? 19.238  20.493 38.554 1.00 38.67  ? 413  ASP A O    1 
ATOM   2460  C  CB   . ASP A 1 205 ? 17.824  20.586 36.025 1.00 41.12  ? 413  ASP A CB   1 
ATOM   2461  C  CG   . ASP A 1 205 ? 16.652  21.485 36.392 1.00 40.80  ? 413  ASP A CG   1 
ATOM   2462  O  OD1  . ASP A 1 205 ? 15.680  20.989 36.999 1.00 40.31  ? 413  ASP A OD1  1 
ATOM   2463  O  OD2  . ASP A 1 205 ? 16.701  22.690 36.062 1.00 42.59  ? 413  ASP A OD2  1 
ATOM   2464  H  H    . ASP A 1 205 ? 16.018  19.010 36.572 1.00 50.00  ? 413  ASP A H    1 
ATOM   2465  H  HA   . ASP A 1 205 ? 18.671  18.815 36.606 1.00 48.09  ? 413  ASP A HA   1 
ATOM   2466  H  HB2  . ASP A 1 205 ? 18.638  21.106 36.108 1.00 49.35  ? 413  ASP A HB2  1 
ATOM   2467  H  HB3  . ASP A 1 205 ? 17.705  20.299 35.106 1.00 49.35  ? 413  ASP A HB3  1 
ATOM   2468  N  N    . TRP A 1 206 ? 17.450  19.373 39.342 1.00 37.26  ? 414  TRP A N    1 
ATOM   2469  C  CA   . TRP A 1 206 ? 17.659  19.729 40.746 1.00 34.04  ? 414  TRP A CA   1 
ATOM   2470  C  C    . TRP A 1 206 ? 17.853  18.452 41.556 1.00 33.78  ? 414  TRP A C    1 
ATOM   2471  O  O    . TRP A 1 206 ? 16.884  17.906 42.104 1.00 32.23  ? 414  TRP A O    1 
ATOM   2472  C  CB   . TRP A 1 206 ? 16.478  20.533 41.290 1.00 31.99  ? 414  TRP A CB   1 
ATOM   2473  C  CG   . TRP A 1 206 ? 16.471  21.986 40.921 1.00 34.02  ? 414  TRP A CG   1 
ATOM   2474  C  CD1  . TRP A 1 206 ? 17.264  22.612 40.001 1.00 36.57  ? 414  TRP A CD1  1 
ATOM   2475  C  CD2  . TRP A 1 206 ? 15.626  23.001 41.479 1.00 31.78  ? 414  TRP A CD2  1 
ATOM   2476  N  NE1  . TRP A 1 206 ? 16.961  23.954 39.952 1.00 35.05  ? 414  TRP A NE1  1 
ATOM   2477  C  CE2  . TRP A 1 206 ? 15.960  24.218 40.850 1.00 31.92  ? 414  TRP A CE2  1 
ATOM   2478  C  CE3  . TRP A 1 206 ? 14.621  22.999 42.450 1.00 27.48  ? 414  TRP A CE3  1 
ATOM   2479  C  CZ2  . TRP A 1 206 ? 15.323  25.417 41.160 1.00 30.76  ? 414  TRP A CZ2  1 
ATOM   2480  C  CZ3  . TRP A 1 206 ? 13.988  24.193 42.756 1.00 29.00  ? 414  TRP A CZ3  1 
ATOM   2481  C  CH2  . TRP A 1 206 ? 14.345  25.384 42.115 1.00 28.36  ? 414  TRP A CH2  1 
ATOM   2482  H  H    . TRP A 1 206 ? 16.761  18.875 39.218 1.00 44.71  ? 414  TRP A H    1 
ATOM   2483  H  HA   . TRP A 1 206 ? 18.461  20.269 40.826 1.00 40.85  ? 414  TRP A HA   1 
ATOM   2484  H  HB2  . TRP A 1 206 ? 15.657  20.142 40.951 1.00 38.39  ? 414  TRP A HB2  1 
ATOM   2485  H  HB3  . TRP A 1 206 ? 16.488  20.477 42.258 1.00 38.39  ? 414  TRP A HB3  1 
ATOM   2486  H  HD1  . TRP A 1 206 ? 17.913  22.193 39.483 1.00 43.88  ? 414  TRP A HD1  1 
ATOM   2487  H  HE1  . TRP A 1 206 ? 17.339  24.534 39.441 1.00 42.06  ? 414  TRP A HE1  1 
ATOM   2488  H  HE3  . TRP A 1 206 ? 14.381  22.211 42.882 1.00 32.98  ? 414  TRP A HE3  1 
ATOM   2489  H  HZ2  . TRP A 1 206 ? 15.556  26.211 40.734 1.00 36.91  ? 414  TRP A HZ2  1 
ATOM   2490  H  HZ3  . TRP A 1 206 ? 13.318  24.203 43.401 1.00 34.80  ? 414  TRP A HZ3  1 
ATOM   2491  H  HH2  . TRP A 1 206 ? 13.902  26.171 42.339 1.00 34.03  ? 414  TRP A HH2  1 
ATOM   2492  N  N    . PRO A 1 207 ? 19.089  17.940 41.669 1.00 34.71  ? 415  PRO A N    1 
ATOM   2493  C  CA   . PRO A 1 207 ? 19.328  16.694 42.439 1.00 37.85  ? 415  PRO A CA   1 
ATOM   2494  C  C    . PRO A 1 207 ? 19.476  16.914 43.945 1.00 37.01  ? 415  PRO A C    1 
ATOM   2495  O  O    . PRO A 1 207 ? 20.568  16.960 44.511 1.00 38.76  ? 415  PRO A O    1 
ATOM   2496  C  CB   . PRO A 1 207 ? 20.620  16.163 41.813 1.00 40.59  ? 415  PRO A CB   1 
ATOM   2497  C  CG   . PRO A 1 207 ? 21.360  17.398 41.399 1.00 39.11  ? 415  PRO A CG   1 
ATOM   2498  C  CD   . PRO A 1 207 ? 20.311  18.410 40.990 1.00 36.94  ? 415  PRO A CD   1 
ATOM   2499  H  HA   . PRO A 1 207 ? 18.613  16.059 42.278 1.00 45.43  ? 415  PRO A HA   1 
ATOM   2500  H  HB2  . PRO A 1 207 ? 21.125  15.663 42.473 1.00 48.71  ? 415  PRO A HB2  1 
ATOM   2501  H  HB3  . PRO A 1 207 ? 20.412  15.611 41.044 1.00 48.71  ? 415  PRO A HB3  1 
ATOM   2502  H  HG2  . PRO A 1 207 ? 21.879  17.730 42.148 1.00 46.94  ? 415  PRO A HG2  1 
ATOM   2503  H  HG3  . PRO A 1 207 ? 21.940  17.190 40.650 1.00 46.94  ? 415  PRO A HG3  1 
ATOM   2504  H  HD2  . PRO A 1 207 ? 20.554  19.294 41.307 1.00 44.33  ? 415  PRO A HD2  1 
ATOM   2505  H  HD3  . PRO A 1 207 ? 20.187  18.400 40.028 1.00 44.33  ? 415  PRO A HD3  1 
ATOM   2506  N  N    . TRP A 1 208 ? 18.337  17.038 44.622 1.00 33.78  ? 416  TRP A N    1 
ATOM   2507  C  CA   . TRP A 1 208 ? 18.307  17.316 46.051 1.00 30.07  ? 416  TRP A CA   1 
ATOM   2508  C  C    . TRP A 1 208 ? 18.212  16.024 46.861 1.00 33.47  ? 416  TRP A C    1 
ATOM   2509  O  O    . TRP A 1 208 ? 17.783  14.976 46.369 1.00 36.65  ? 416  TRP A O    1 
ATOM   2510  C  CB   . TRP A 1 208 ? 17.138  18.245 46.398 1.00 29.45  ? 416  TRP A CB   1 
ATOM   2511  C  CG   . TRP A 1 208 ? 15.787  17.762 45.935 1.00 29.12  ? 416  TRP A CG   1 
ATOM   2512  C  CD1  . TRP A 1 208 ? 15.225  17.958 44.706 1.00 31.23  ? 416  TRP A CD1  1 
ATOM   2513  C  CD2  . TRP A 1 208 ? 14.830  17.013 46.697 1.00 28.38  ? 416  TRP A CD2  1 
ATOM   2514  N  NE1  . TRP A 1 208 ? 13.982  17.374 44.653 1.00 29.50  ? 416  TRP A NE1  1 
ATOM   2515  C  CE2  . TRP A 1 208 ? 13.714  16.791 45.864 1.00 28.43  ? 416  TRP A CE2  1 
ATOM   2516  C  CE3  . TRP A 1 208 ? 14.808  16.507 48.002 1.00 27.17  ? 416  TRP A CE3  1 
ATOM   2517  C  CZ2  . TRP A 1 208 ? 12.592  16.084 46.291 1.00 26.41  ? 416  TRP A CZ2  1 
ATOM   2518  C  CZ3  . TRP A 1 208 ? 13.692  15.810 48.425 1.00 26.40  ? 416  TRP A CZ3  1 
ATOM   2519  C  CH2  . TRP A 1 208 ? 12.600  15.603 47.571 1.00 26.31  ? 416  TRP A CH2  1 
ATOM   2520  H  H    . TRP A 1 208 ? 17.556  16.964 44.269 1.00 40.53  ? 416  TRP A H    1 
ATOM   2521  H  HA   . TRP A 1 208 ? 19.130  17.765 46.301 1.00 36.09  ? 416  TRP A HA   1 
ATOM   2522  H  HB2  . TRP A 1 208 ? 17.099  18.345 47.362 1.00 35.35  ? 416  TRP A HB2  1 
ATOM   2523  H  HB3  . TRP A 1 208 ? 17.298  19.109 45.988 1.00 35.35  ? 416  TRP A HB3  1 
ATOM   2524  H  HD1  . TRP A 1 208 ? 15.626  18.418 44.004 1.00 37.48  ? 416  TRP A HD1  1 
ATOM   2525  H  HE1  . TRP A 1 208 ? 13.456  17.379 43.973 1.00 35.41  ? 416  TRP A HE1  1 
ATOM   2526  H  HE3  . TRP A 1 208 ? 15.529  16.641 48.574 1.00 32.60  ? 416  TRP A HE3  1 
ATOM   2527  H  HZ2  . TRP A 1 208 ? 11.866  15.946 45.727 1.00 31.69  ? 416  TRP A HZ2  1 
ATOM   2528  H  HZ3  . TRP A 1 208 ? 13.667  15.469 49.290 1.00 31.68  ? 416  TRP A HZ3  1 
ATOM   2529  H  HH2  . TRP A 1 208 ? 11.863  15.129 47.883 1.00 31.57  ? 416  TRP A HH2  1 
ATOM   2530  N  N    . ASP A 1 209 ? 18.620  16.119 48.127 1.00 34.96  ? 417  ASP A N    1 
ATOM   2531  C  CA   . ASP A 1 209 ? 18.680  14.982 49.036 1.00 36.81  ? 417  ASP A CA   1 
ATOM   2532  C  C    . ASP A 1 209 ? 17.737  15.094 50.226 1.00 35.48  ? 417  ASP A C    1 
ATOM   2533  O  O    . ASP A 1 209 ? 17.316  14.062 50.759 1.00 33.72  ? 417  ASP A O    1 
ATOM   2534  C  CB   . ASP A 1 209 ? 20.115  14.803 49.565 1.00 39.53  ? 417  ASP A CB   1 
ATOM   2535  C  CG   . ASP A 1 209 ? 21.137  14.643 48.449 1.00 40.63  ? 417  ASP A CG   1 
ATOM   2536  O  OD1  . ASP A 1 209 ? 20.957  13.742 47.604 1.00 39.32  ? 417  ASP A OD1  1 
ATOM   2537  O  OD2  . ASP A 1 209 ? 22.114  15.426 48.411 1.00 38.11  ? 417  ASP A OD2  1 
ATOM   2538  H  H    . ASP A 1 209 ? 18.874  16.856 48.490 1.00 41.96  ? 417  ASP A H    1 
ATOM   2539  H  HA   . ASP A 1 209 ? 18.443  14.179 48.545 1.00 44.18  ? 417  ASP A HA   1 
ATOM   2540  H  HB2  . ASP A 1 209 ? 20.359  15.584 50.086 1.00 47.44  ? 417  ASP A HB2  1 
ATOM   2541  H  HB3  . ASP A 1 209 ? 20.150  14.008 50.120 1.00 47.44  ? 417  ASP A HB3  1 
ATOM   2542  N  N    . PHE A 1 210 ? 17.400  16.309 50.658 1.00 29.69  ? 418  PHE A N    1 
ATOM   2543  C  CA   . PHE A 1 210 ? 16.517  16.531 51.793 1.00 27.72  ? 418  PHE A CA   1 
ATOM   2544  C  C    . PHE A 1 210 ? 15.465  17.575 51.443 1.00 29.28  ? 418  PHE A C    1 
ATOM   2545  O  O    . PHE A 1 210 ? 15.678  18.430 50.579 1.00 28.31  ? 418  PHE A O    1 
ATOM   2546  C  CB   . PHE A 1 210 ? 17.290  16.995 53.034 1.00 31.36  ? 418  PHE A CB   1 
ATOM   2547  C  CG   . PHE A 1 210 ? 17.669  15.882 53.969 1.00 32.00  ? 418  PHE A CG   1 
ATOM   2548  C  CD1  . PHE A 1 210 ? 16.735  15.344 54.839 1.00 31.73  ? 418  PHE A CD1  1 
ATOM   2549  C  CD2  . PHE A 1 210 ? 18.961  15.384 53.990 1.00 33.50  ? 418  PHE A CD2  1 
ATOM   2550  C  CE1  . PHE A 1 210 ? 17.080  14.324 55.707 1.00 34.21  ? 418  PHE A CE1  1 
ATOM   2551  C  CE2  . PHE A 1 210 ? 19.311  14.364 54.855 1.00 35.32  ? 418  PHE A CE2  1 
ATOM   2552  C  CZ   . PHE A 1 210 ? 18.368  13.834 55.714 1.00 35.89  ? 418  PHE A CZ   1 
ATOM   2553  H  H    . PHE A 1 210 ? 17.681  17.038 50.298 1.00 35.63  ? 418  PHE A H    1 
ATOM   2554  H  HA   . PHE A 1 210 ? 16.062  15.702 52.011 1.00 33.26  ? 418  PHE A HA   1 
ATOM   2555  H  HB2  . PHE A 1 210 ? 18.107  17.432 52.747 1.00 37.63  ? 418  PHE A HB2  1 
ATOM   2556  H  HB3  . PHE A 1 210 ? 16.739  17.622 53.529 1.00 37.63  ? 418  PHE A HB3  1 
ATOM   2557  H  HD1  . PHE A 1 210 ? 15.864  15.671 54.838 1.00 38.08  ? 418  PHE A HD1  1 
ATOM   2558  H  HD2  . PHE A 1 210 ? 19.600  15.737 53.413 1.00 40.21  ? 418  PHE A HD2  1 
ATOM   2559  H  HE1  . PHE A 1 210 ? 16.444  13.969 56.284 1.00 41.06  ? 418  PHE A HE1  1 
ATOM   2560  H  HE2  . PHE A 1 210 ? 20.181  14.035 54.859 1.00 42.38  ? 418  PHE A HE2  1 
ATOM   2561  H  HZ   . PHE A 1 210 ? 18.602  13.148 56.296 1.00 43.07  ? 418  PHE A HZ   1 
ATOM   2562  N  N    . PHE A 1 211 ? 14.329  17.490 52.138 1.00 29.48  ? 419  PHE A N    1 
ATOM   2563  C  CA   . PHE A 1 211 ? 13.204  18.410 52.002 1.00 29.20  ? 419  PHE A CA   1 
ATOM   2564  C  C    . PHE A 1 211 ? 13.026  19.140 53.329 1.00 31.36  ? 419  PHE A C    1 
ATOM   2565  O  O    . PHE A 1 211 ? 12.941  18.497 54.379 1.00 31.13  ? 419  PHE A O    1 
ATOM   2566  C  CB   . PHE A 1 211 ? 11.930  17.631 51.625 1.00 28.91  ? 419  PHE A CB   1 
ATOM   2567  C  CG   . PHE A 1 211 ? 10.685  18.477 51.506 1.00 28.96  ? 419  PHE A CG   1 
ATOM   2568  C  CD1  . PHE A 1 211 ? 10.022  18.937 52.633 1.00 27.63  ? 419  PHE A CD1  1 
ATOM   2569  C  CD2  . PHE A 1 211 ? 10.155  18.770 50.262 1.00 28.37  ? 419  PHE A CD2  1 
ATOM   2570  C  CE1  . PHE A 1 211 ? 8.878   19.700 52.520 1.00 30.93  ? 419  PHE A CE1  1 
ATOM   2571  C  CE2  . PHE A 1 211 ? 9.012   19.524 50.144 1.00 30.60  ? 419  PHE A CE2  1 
ATOM   2572  C  CZ   . PHE A 1 211 ? 8.369   19.993 51.274 1.00 31.50  ? 419  PHE A CZ   1 
ATOM   2573  H  H    . PHE A 1 211 ? 14.185  16.875 52.722 1.00 35.38  ? 419  PHE A H    1 
ATOM   2574  H  HA   . PHE A 1 211 ? 13.391  19.061 51.308 1.00 35.05  ? 419  PHE A HA   1 
ATOM   2575  H  HB2  . PHE A 1 211 ? 12.074  17.198 50.770 1.00 34.70  ? 419  PHE A HB2  1 
ATOM   2576  H  HB3  . PHE A 1 211 ? 11.764  16.960 52.306 1.00 34.70  ? 419  PHE A HB3  1 
ATOM   2577  H  HD1  . PHE A 1 211 ? 10.363  18.745 53.477 1.00 33.16  ? 419  PHE A HD1  1 
ATOM   2578  H  HD2  . PHE A 1 211 ? 10.583  18.461 49.497 1.00 34.05  ? 419  PHE A HD2  1 
ATOM   2579  H  HE1  . PHE A 1 211 ? 8.448   20.011 53.284 1.00 37.12  ? 419  PHE A HE1  1 
ATOM   2580  H  HE2  . PHE A 1 211 ? 8.672   19.722 49.301 1.00 36.72  ? 419  PHE A HE2  1 
ATOM   2581  H  HZ   . PHE A 1 211 ? 7.597   20.505 51.193 1.00 37.81  ? 419  PHE A HZ   1 
ATOM   2582  N  N    . ILE A 1 212 ? 12.982  20.473 53.289 1.00 27.25  ? 420  ILE A N    1 
ATOM   2583  C  CA   . ILE A 1 212 ? 12.827  21.283 54.498 1.00 27.17  ? 420  ILE A CA   1 
ATOM   2584  C  C    . ILE A 1 212 ? 11.811  22.385 54.228 1.00 30.87  ? 420  ILE A C    1 
ATOM   2585  O  O    . ILE A 1 212 ? 11.951  23.137 53.256 1.00 26.61  ? 420  ILE A O    1 
ATOM   2586  C  CB   . ILE A 1 212 ? 14.161  21.905 54.961 1.00 30.49  ? 420  ILE A CB   1 
ATOM   2587  C  CG1  . ILE A 1 212 ? 15.223  20.823 55.179 1.00 35.25  ? 420  ILE A CG1  1 
ATOM   2588  C  CG2  . ILE A 1 212 ? 13.949  22.712 56.246 1.00 29.26  ? 420  ILE A CG2  1 
ATOM   2589  C  CD1  . ILE A 1 212 ? 16.590  21.366 55.589 1.00 38.44  ? 420  ILE A CD1  1 
ATOM   2590  H  H    . ILE A 1 212 ? 13.041  20.936 52.567 1.00 32.70  ? 420  ILE A H    1 
ATOM   2591  H  HA   . ILE A 1 212 ? 12.487  20.725 55.215 1.00 32.60  ? 420  ILE A HA   1 
ATOM   2592  H  HB   . ILE A 1 212 ? 14.475  22.507 54.269 1.00 36.59  ? 420  ILE A HB   1 
ATOM   2593  H  HG12 . ILE A 1 212 ? 14.920  20.225 55.880 1.00 42.31  ? 420  ILE A HG12 1 
ATOM   2594  H  HG13 . ILE A 1 212 ? 15.338  20.328 54.353 1.00 42.31  ? 420  ILE A HG13 1 
ATOM   2595  H  HG21 . ILE A 1 212 ? 14.796  23.095 56.522 1.00 35.11  ? 420  ILE A HG21 1 
ATOM   2596  H  HG22 . ILE A 1 212 ? 13.307  23.419 56.072 1.00 35.11  ? 420  ILE A HG22 1 
ATOM   2597  H  HG23 . ILE A 1 212 ? 13.611  22.122 56.938 1.00 35.11  ? 420  ILE A HG23 1 
ATOM   2598  H  HD11 . ILE A 1 212 ? 17.202  20.623 55.707 1.00 46.13  ? 420  ILE A HD11 1 
ATOM   2599  H  HD12 . ILE A 1 212 ? 16.916  21.958 54.893 1.00 46.13  ? 420  ILE A HD12 1 
ATOM   2600  H  HD13 . ILE A 1 212 ? 16.498  21.855 56.422 1.00 46.13  ? 420  ILE A HD13 1 
ATOM   2601  N  N    . ASN A 1 213 ? 10.809  22.502 55.101 1.00 26.31  ? 421  ASN A N    1 
ATOM   2602  C  CA   . ASN A 1 213 ? 9.791   23.538 54.987 1.00 27.04  ? 421  ASN A CA   1 
ATOM   2603  C  C    . ASN A 1 213 ? 10.036  24.648 56.006 1.00 28.21  ? 421  ASN A C    1 
ATOM   2604  O  O    . ASN A 1 213 ? 10.439  24.384 57.144 1.00 26.06  ? 421  ASN A O    1 
ATOM   2605  C  CB   . ASN A 1 213 ? 8.385   22.954 55.171 1.00 23.89  ? 421  ASN A CB   1 
ATOM   2606  C  CG   . ASN A 1 213 ? 8.252   22.095 56.419 1.00 30.70  ? 421  ASN A CG   1 
ATOM   2607  O  OD1  . ASN A 1 213 ? 9.239   21.586 56.954 1.00 34.84  ? 421  ASN A OD1  1 
ATOM   2608  N  ND2  . ASN A 1 213 ? 7.019   21.911 56.875 1.00 32.77  ? 421  ASN A ND2  1 
ATOM   2609  H  H    . ASN A 1 213 ? 10.699  21.983 55.777 1.00 31.57  ? 421  ASN A H    1 
ATOM   2610  H  HA   . ASN A 1 213 ? 9.838   23.930 54.101 1.00 32.45  ? 421  ASN A HA   1 
ATOM   2611  H  HB2  . ASN A 1 213 ? 7.748   23.682 55.240 1.00 28.67  ? 421  ASN A HB2  1 
ATOM   2612  H  HB3  . ASN A 1 213 ? 8.172   22.400 54.403 1.00 28.67  ? 421  ASN A HB3  1 
ATOM   2613  H  HD21 . ASN A 1 213 ? 6.886   21.432 57.577 1.00 39.32  ? 421  ASN A HD21 1 
ATOM   2614  H  HD22 . ASN A 1 213 ? 6.353   22.278 56.473 1.00 39.32  ? 421  ASN A HD22 1 
ATOM   2615  N  N    . LEU A 1 214 ? 9.790   25.891 55.583 1.00 28.94  ? 422  LEU A N    1 
ATOM   2616  C  CA   . LEU A 1 214 ? 9.989   27.076 56.412 1.00 25.44  ? 422  LEU A CA   1 
ATOM   2617  C  C    . LEU A 1 214 ? 8.929   28.117 56.067 1.00 23.86  ? 422  LEU A C    1 
ATOM   2618  O  O    . LEU A 1 214 ? 8.429   28.163 54.939 1.00 21.84  ? 422  LEU A O    1 
ATOM   2619  C  CB   . LEU A 1 214 ? 11.385  27.694 56.210 1.00 27.97  ? 422  LEU A CB   1 
ATOM   2620  C  CG   . LEU A 1 214 ? 12.640  26.867 56.504 1.00 28.92  ? 422  LEU A CG   1 
ATOM   2621  C  CD1  . LEU A 1 214 ? 13.865  27.562 55.926 1.00 29.34  ? 422  LEU A CD1  1 
ATOM   2622  C  CD2  . LEU A 1 214 ? 12.823  26.632 57.996 1.00 29.89  ? 422  LEU A CD2  1 
ATOM   2623  H  H    . LEU A 1 214 ? 9.499   26.075 54.795 1.00 34.73  ? 422  LEU A H    1 
ATOM   2624  H  HA   . LEU A 1 214 ? 9.891   26.836 57.347 1.00 30.53  ? 422  LEU A HA   1 
ATOM   2625  H  HB2  . LEU A 1 214 ? 11.449  27.969 55.282 1.00 33.57  ? 422  LEU A HB2  1 
ATOM   2626  H  HB3  . LEU A 1 214 ? 11.438  28.482 56.772 1.00 33.57  ? 422  LEU A HB3  1 
ATOM   2627  H  HG   . LEU A 1 214 ? 12.556  26.002 56.072 1.00 34.71  ? 422  LEU A HG   1 
ATOM   2628  H  HD11 . LEU A 1 214 ? 14.651  27.027 56.120 1.00 35.21  ? 422  LEU A HD11 1 
ATOM   2629  H  HD12 . LEU A 1 214 ? 13.754  27.651 54.967 1.00 35.21  ? 422  LEU A HD12 1 
ATOM   2630  H  HD13 . LEU A 1 214 ? 13.952  28.438 56.333 1.00 35.21  ? 422  LEU A HD13 1 
ATOM   2631  H  HD21 . LEU A 1 214 ? 13.626  26.106 58.136 1.00 35.88  ? 422  LEU A HD21 1 
ATOM   2632  H  HD22 . LEU A 1 214 ? 12.905  27.489 58.442 1.00 35.88  ? 422  LEU A HD22 1 
ATOM   2633  H  HD23 . LEU A 1 214 ? 12.051  26.153 58.336 1.00 35.88  ? 422  LEU A HD23 1 
ATOM   2634  N  N    . SER A 1 215 ? 8.597   28.958 57.046 1.00 23.97  ? 423  SER A N    1 
ATOM   2635  C  CA   . SER A 1 215 ? 7.708   30.096 56.852 1.00 26.04  ? 423  SER A CA   1 
ATOM   2636  C  C    . SER A 1 215 ? 8.517   31.390 56.896 1.00 24.23  ? 423  SER A C    1 
ATOM   2637  O  O    . SER A 1 215 ? 9.721   31.392 57.160 1.00 24.62  ? 423  SER A O    1 
ATOM   2638  C  CB   . SER A 1 215 ? 6.610   30.117 57.919 1.00 29.26  ? 423  SER A CB   1 
ATOM   2639  O  OG   . SER A 1 215 ? 7.104   30.642 59.144 1.00 32.77  ? 423  SER A OG   1 
ATOM   2640  H  H    . SER A 1 215 ? 8.885   28.885 57.853 1.00 28.76  ? 423  SER A H    1 
ATOM   2641  H  HA   . SER A 1 215 ? 7.286   30.029 55.982 1.00 31.26  ? 423  SER A HA   1 
ATOM   2642  H  HB2  . SER A 1 215 ? 5.880   30.674 57.608 1.00 35.11  ? 423  SER A HB2  1 
ATOM   2643  H  HB3  . SER A 1 215 ? 6.297   29.211 58.067 1.00 35.11  ? 423  SER A HB3  1 
ATOM   2644  H  HG   . SER A 1 215 ? 7.739   30.169 59.424 1.00 39.32  ? 423  SER A HG   1 
ATOM   2645  N  N    . ALA A 1 216 ? 7.836   32.510 56.648 1.00 29.07  ? 424  ALA A N    1 
ATOM   2646  C  CA   . ALA A 1 216 ? 8.484   33.812 56.772 1.00 30.05  ? 424  ALA A CA   1 
ATOM   2647  C  C    . ALA A 1 216 ? 8.784   34.181 58.219 1.00 30.41  ? 424  ALA A C    1 
ATOM   2648  O  O    . ALA A 1 216 ? 9.426   35.210 58.456 1.00 32.83  ? 424  ALA A O    1 
ATOM   2649  C  CB   . ALA A 1 216 ? 7.612   34.895 56.131 1.00 36.98  ? 424  ALA A CB   1 
ATOM   2650  H  H    . ALA A 1 216 ? 7.010   32.542 56.410 1.00 34.89  ? 424  ALA A H    1 
ATOM   2651  H  HA   . ALA A 1 216 ? 9.326   33.787 56.292 1.00 36.06  ? 424  ALA A HA   1 
ATOM   2652  H  HB1  . ALA A 1 216 ? 8.057   35.752 56.223 1.00 44.38  ? 424  ALA A HB1  1 
ATOM   2653  H  HB2  . ALA A 1 216 ? 7.487   34.685 55.193 1.00 44.38  ? 424  ALA A HB2  1 
ATOM   2654  H  HB3  . ALA A 1 216 ? 6.754   34.917 56.583 1.00 44.38  ? 424  ALA A HB3  1 
ATOM   2655  N  N    . ALA A 1 217 ? 8.347   33.371 59.184 1.00 30.67  ? 425  ALA A N    1 
ATOM   2656  C  CA   . ALA A 1 217 ? 8.595   33.618 60.598 1.00 32.03  ? 425  ALA A CA   1 
ATOM   2657  C  C    . ALA A 1 217 ? 9.636   32.672 61.197 1.00 32.26  ? 425  ALA A C    1 
ATOM   2658  O  O    . ALA A 1 217 ? 9.801   32.646 62.423 1.00 31.94  ? 425  ALA A O    1 
ATOM   2659  C  CB   . ALA A 1 217 ? 7.283   33.516 61.379 1.00 33.32  ? 425  ALA A CB   1 
ATOM   2660  H  H    . ALA A 1 217 ? 7.893   32.656 59.037 1.00 36.81  ? 425  ALA A H    1 
ATOM   2661  H  HA   . ALA A 1 217 ? 8.928   34.523 60.701 1.00 38.44  ? 425  ALA A HA   1 
ATOM   2662  H  HB1  . ALA A 1 217 ? 7.462   33.682 62.318 1.00 39.98  ? 425  ALA A HB1  1 
ATOM   2663  H  HB2  . ALA A 1 217 ? 6.661   34.177 61.038 1.00 39.98  ? 425  ALA A HB2  1 
ATOM   2664  H  HB3  . ALA A 1 217 ? 6.916   32.625 61.264 1.00 39.98  ? 425  ALA A HB3  1 
ATOM   2665  N  N    . ASP A 1 218 ? 10.343  31.903 60.372 1.00 31.32  ? 426  ASP A N    1 
ATOM   2666  C  CA   . ASP A 1 218 ? 11.441  31.051 60.814 1.00 31.24  ? 426  ASP A CA   1 
ATOM   2667  C  C    . ASP A 1 218 ? 12.783  31.767 60.638 1.00 27.48  ? 426  ASP A C    1 
ATOM   2668  O  O    . ASP A 1 218 ? 12.894  32.743 59.892 1.00 25.89  ? 426  ASP A O    1 
ATOM   2669  C  CB   . ASP A 1 218 ? 11.451  29.735 60.027 1.00 32.96  ? 426  ASP A CB   1 
ATOM   2670  C  CG   . ASP A 1 218 ? 10.342  28.774 60.454 1.00 34.33  ? 426  ASP A CG   1 
ATOM   2671  O  OD1  . ASP A 1 218 ? 9.183   28.944 60.017 1.00 32.73  ? 426  ASP A OD1  1 
ATOM   2672  O  OD2  . ASP A 1 218 ? 10.637  27.838 61.227 1.00 35.63  ? 426  ASP A OD2  1 
ATOM   2673  H  H    . ASP A 1 218 ? 10.200  31.859 59.525 1.00 37.58  ? 426  ASP A H    1 
ATOM   2674  H  HA   . ASP A 1 218 ? 11.327  30.843 61.755 1.00 37.49  ? 426  ASP A HA   1 
ATOM   2675  H  HB2  . ASP A 1 218 ? 11.330  29.930 59.084 1.00 39.55  ? 426  ASP A HB2  1 
ATOM   2676  H  HB3  . ASP A 1 218 ? 12.302  29.290 60.166 1.00 39.55  ? 426  ASP A HB3  1 
ATOM   2677  N  N    . TYR A 1 219 ? 13.805  31.273 61.343 1.00 23.10  ? 427  TYR A N    1 
ATOM   2678  C  CA   . TYR A 1 219 ? 15.175  31.755 61.178 1.00 28.21  ? 427  TYR A CA   1 
ATOM   2679  C  C    . TYR A 1 219 ? 16.151  30.649 61.554 1.00 28.27  ? 427  TYR A C    1 
ATOM   2680  O  O    . TYR A 1 219 ? 15.869  29.861 62.466 1.00 27.47  ? 427  TYR A O    1 
ATOM   2681  C  CB   . TYR A 1 219 ? 15.461  32.997 62.040 1.00 29.94  ? 427  TYR A CB   1 
ATOM   2682  C  CG   . TYR A 1 219 ? 16.338  34.029 61.357 1.00 30.25  ? 427  TYR A CG   1 
ATOM   2683  C  CD1  . TYR A 1 219 ? 15.796  34.924 60.444 1.00 30.78  ? 427  TYR A CD1  1 
ATOM   2684  C  CD2  . TYR A 1 219 ? 17.702  34.117 61.629 1.00 31.90  ? 427  TYR A CD2  1 
ATOM   2685  C  CE1  . TYR A 1 219 ? 16.577  35.869 59.814 1.00 29.88  ? 427  TYR A CE1  1 
ATOM   2686  C  CE2  . TYR A 1 219 ? 18.499  35.064 60.997 1.00 31.73  ? 427  TYR A CE2  1 
ATOM   2687  C  CZ   . TYR A 1 219 ? 17.922  35.940 60.091 1.00 32.20  ? 427  TYR A CZ   1 
ATOM   2688  O  OH   . TYR A 1 219 ? 18.683  36.892 59.453 1.00 33.18  ? 427  TYR A OH   1 
ATOM   2689  H  H    . TYR A 1 219 ? 13.727  30.650 61.931 1.00 27.72  ? 427  TYR A H    1 
ATOM   2690  H  HA   . TYR A 1 219 ? 15.323  31.988 60.249 1.00 33.85  ? 427  TYR A HA   1 
ATOM   2691  H  HB2  . TYR A 1 219 ? 14.619  33.424 62.261 1.00 35.93  ? 427  TYR A HB2  1 
ATOM   2692  H  HB3  . TYR A 1 219 ? 15.911  32.717 62.852 1.00 35.93  ? 427  TYR A HB3  1 
ATOM   2693  H  HD1  . TYR A 1 219 ? 14.887  34.882 60.250 1.00 36.93  ? 427  TYR A HD1  1 
ATOM   2694  H  HD2  . TYR A 1 219 ? 18.087  33.527 62.237 1.00 38.28  ? 427  TYR A HD2  1 
ATOM   2695  H  HE1  . TYR A 1 219 ? 16.195  36.458 59.204 1.00 35.86  ? 427  TYR A HE1  1 
ATOM   2696  H  HE2  . TYR A 1 219 ? 19.408  35.114 61.185 1.00 38.08  ? 427  TYR A HE2  1 
ATOM   2697  H  HH   . TYR A 1 219 ? 19.483  36.835 59.704 1.00 39.82  ? 427  TYR A HH   1 
ATOM   2698  N  N    . PRO A 1 220 ? 17.303  30.568 60.888 1.00 29.41  ? 428  PRO A N    1 
ATOM   2699  C  CA   . PRO A 1 220 ? 18.323  29.602 61.311 1.00 30.62  ? 428  PRO A CA   1 
ATOM   2700  C  C    . PRO A 1 220 ? 18.993  30.024 62.610 1.00 31.72  ? 428  PRO A C    1 
ATOM   2701  O  O    . PRO A 1 220 ? 19.131  31.213 62.909 1.00 30.43  ? 428  PRO A O    1 
ATOM   2702  C  CB   . PRO A 1 220 ? 19.322  29.609 60.149 1.00 28.44  ? 428  PRO A CB   1 
ATOM   2703  C  CG   . PRO A 1 220 ? 19.162  30.960 59.533 1.00 29.12  ? 428  PRO A CG   1 
ATOM   2704  C  CD   . PRO A 1 220 ? 17.697  31.268 59.650 1.00 26.73  ? 428  PRO A CD   1 
ATOM   2705  H  HA   . PRO A 1 220 ? 17.940  28.717 61.411 1.00 36.75  ? 428  PRO A HA   1 
ATOM   2706  H  HB2  . PRO A 1 220 ? 20.223  29.488 60.488 1.00 34.13  ? 428  PRO A HB2  1 
ATOM   2707  H  HB3  . PRO A 1 220 ? 19.094  28.911 59.515 1.00 34.13  ? 428  PRO A HB3  1 
ATOM   2708  H  HG2  . PRO A 1 220 ? 19.690  31.609 60.026 1.00 34.95  ? 428  PRO A HG2  1 
ATOM   2709  H  HG3  . PRO A 1 220 ? 19.434  30.931 58.603 1.00 34.95  ? 428  PRO A HG3  1 
ATOM   2710  H  HD2  . PRO A 1 220 ? 17.558  32.223 59.742 1.00 32.08  ? 428  PRO A HD2  1 
ATOM   2711  H  HD3  . PRO A 1 220 ? 17.214  30.908 58.890 1.00 32.08  ? 428  PRO A HD3  1 
ATOM   2712  N  N    . ILE A 1 221 ? 19.404  29.024 63.391 1.00 29.68  ? 429  ILE A N    1 
ATOM   2713  C  CA   . ILE A 1 221 ? 20.194  29.252 64.592 1.00 33.79  ? 429  ILE A CA   1 
ATOM   2714  C  C    . ILE A 1 221 ? 21.543  28.547 64.526 1.00 32.46  ? 429  ILE A C    1 
ATOM   2715  O  O    . ILE A 1 221 ? 22.258  28.484 65.527 1.00 29.91  ? 429  ILE A O    1 
ATOM   2716  C  CB   . ILE A 1 221 ? 19.416  28.847 65.861 1.00 36.52  ? 429  ILE A CB   1 
ATOM   2717  C  CG1  . ILE A 1 221 ? 18.962  27.388 65.789 1.00 36.34  ? 429  ILE A CG1  1 
ATOM   2718  C  CG2  . ILE A 1 221 ? 18.215  29.771 66.046 1.00 36.63  ? 429  ILE A CG2  1 
ATOM   2719  C  CD1  . ILE A 1 221 ? 18.373  26.875 67.089 1.00 36.09  ? 429  ILE A CD1  1 
ATOM   2720  H  H    . ILE A 1 221 ? 19.235  28.195 63.241 1.00 35.61  ? 429  ILE A H    1 
ATOM   2721  H  HA   . ILE A 1 221 ? 20.372  30.203 64.659 1.00 40.55  ? 429  ILE A HA   1 
ATOM   2722  H  HB   . ILE A 1 221 ? 20.003  28.949 66.627 1.00 43.82  ? 429  ILE A HB   1 
ATOM   2723  H  HG12 . ILE A 1 221 ? 18.284  27.304 65.101 1.00 43.62  ? 429  ILE A HG12 1 
ATOM   2724  H  HG13 . ILE A 1 221 ? 19.726  26.832 65.569 1.00 43.62  ? 429  ILE A HG13 1 
ATOM   2725  H  HG21 . ILE A 1 221 ? 17.734  29.507 66.846 1.00 43.96  ? 429  ILE A HG21 1 
ATOM   2726  H  HG22 . ILE A 1 221 ? 18.530  30.684 66.135 1.00 43.96  ? 429  ILE A HG22 1 
ATOM   2727  H  HG23 . ILE A 1 221 ? 17.636  29.695 65.272 1.00 43.96  ? 429  ILE A HG23 1 
ATOM   2728  H  HD11 . ILE A 1 221 ? 18.109  25.949 66.971 1.00 43.31  ? 429  ILE A HD11 1 
ATOM   2729  H  HD12 . ILE A 1 221 ? 19.044  26.942 67.787 1.00 43.31  ? 429  ILE A HD12 1 
ATOM   2730  H  HD13 . ILE A 1 221 ? 17.600  27.414 67.319 1.00 43.31  ? 429  ILE A HD13 1 
ATOM   2731  N  N    . ARG A 1 222 ? 21.908  28.022 63.357 1.00 32.69  ? 430  ARG A N    1 
ATOM   2732  C  CA   . ARG A 1 222 ? 23.257  27.536 63.110 1.00 33.21  ? 430  ARG A CA   1 
ATOM   2733  C  C    . ARG A 1 222 ? 23.594  27.804 61.650 1.00 31.53  ? 430  ARG A C    1 
ATOM   2734  O  O    . ARG A 1 222 ? 22.706  28.006 60.816 1.00 33.92  ? 430  ARG A O    1 
ATOM   2735  C  CB   . ARG A 1 222 ? 23.400  26.045 63.444 1.00 35.32  ? 430  ARG A CB   1 
ATOM   2736  C  CG   . ARG A 1 222 ? 23.444  25.734 64.936 1.00 41.16  ? 430  ARG A CG   1 
ATOM   2737  C  CD   . ARG A 1 222 ? 23.681  24.244 65.183 1.00 47.90  ? 430  ARG A CD   1 
ATOM   2738  N  NE   . ARG A 1 222 ? 23.837  23.923 66.603 1.00 54.61  ? 430  ARG A NE   1 
ATOM   2739  C  CZ   . ARG A 1 222 ? 25.003  23.794 67.233 1.00 61.40  ? 430  ARG A CZ   1 
ATOM   2740  N  NH1  . ARG A 1 222 ? 26.149  23.956 66.583 1.00 64.02  ? 430  ARG A NH1  1 
ATOM   2741  N  NH2  . ARG A 1 222 ? 25.025  23.498 68.526 1.00 64.68  ? 430  ARG A NH2  1 
ATOM   2742  H  H    . ARG A 1 222 ? 21.380  27.936 62.683 1.00 39.23  ? 430  ARG A H    1 
ATOM   2743  H  HA   . ARG A 1 222 ? 23.882  28.031 63.662 1.00 39.86  ? 430  ARG A HA   1 
ATOM   2744  H  HB2  . ARG A 1 222 ? 22.644  25.568 63.066 1.00 42.39  ? 430  ARG A HB2  1 
ATOM   2745  H  HB3  . ARG A 1 222 ? 24.223  25.716 63.050 1.00 42.39  ? 430  ARG A HB3  1 
ATOM   2746  H  HG2  . ARG A 1 222 ? 24.169  26.231 65.347 1.00 49.39  ? 430  ARG A HG2  1 
ATOM   2747  H  HG3  . ARG A 1 222 ? 22.597  25.979 65.341 1.00 49.39  ? 430  ARG A HG3  1 
ATOM   2748  H  HD2  . ARG A 1 222 ? 22.923  23.743 64.843 1.00 57.49  ? 430  ARG A HD2  1 
ATOM   2749  H  HD3  . ARG A 1 222 ? 24.491  23.973 64.724 1.00 57.49  ? 430  ARG A HD3  1 
ATOM   2750  H  HE   . ARG A 1 222 ? 23.121  23.809 67.066 1.00 65.54  ? 430  ARG A HE   1 
ATOM   2751  H  HH11 . ARG A 1 222 ? 26.145  24.147 65.745 1.00 76.82  ? 430  ARG A HH11 1 
ATOM   2752  H  HH12 . ARG A 1 222 ? 26.896  23.870 67.001 1.00 76.82  ? 430  ARG A HH12 1 
ATOM   2753  H  HH21 . ARG A 1 222 ? 24.287  23.391 68.955 1.00 77.62  ? 430  ARG A HH21 1 
ATOM   2754  H  HH22 . ARG A 1 222 ? 25.776  23.414 68.935 1.00 77.62  ? 430  ARG A HH22 1 
ATOM   2755  N  N    . THR A 1 223 ? 24.890  27.819 61.352 1.00 31.29  ? 431  THR A N    1 
ATOM   2756  C  CA   . THR A 1 223 ? 25.351  28.154 60.013 1.00 34.95  ? 431  THR A CA   1 
ATOM   2757  C  C    . THR A 1 223 ? 24.984  27.058 59.015 1.00 37.26  ? 431  THR A C    1 
ATOM   2758  O  O    . THR A 1 223 ? 24.715  25.907 59.373 1.00 36.08  ? 431  THR A O    1 
ATOM   2759  C  CB   . THR A 1 223 ? 26.865  28.359 59.997 1.00 39.30  ? 431  THR A CB   1 
ATOM   2760  O  OG1  . THR A 1 223 ? 27.514  27.134 60.356 1.00 41.10  ? 431  THR A OG1  1 
ATOM   2761  C  CG2  . THR A 1 223 ? 27.280  29.457 60.968 1.00 38.10  ? 431  THR A CG2  1 
ATOM   2762  H  H    . THR A 1 223 ? 25.520  27.640 61.909 1.00 37.55  ? 431  THR A H    1 
ATOM   2763  H  HA   . THR A 1 223 ? 24.929  28.979 59.727 1.00 41.94  ? 431  THR A HA   1 
ATOM   2764  H  HB   . THR A 1 223 ? 27.144  28.620 59.105 1.00 47.16  ? 431  THR A HB   1 
ATOM   2765  H  HG1  . THR A 1 223 ? 28.347  27.238 60.349 1.00 49.33  ? 431  THR A HG1  1 
ATOM   2766  H  HG21 . THR A 1 223 ? 28.243  29.573 60.945 1.00 45.72  ? 431  THR A HG21 1 
ATOM   2767  H  HG22 . THR A 1 223 ? 26.855  30.294 60.724 1.00 45.72  ? 431  THR A HG22 1 
ATOM   2768  H  HG23 . THR A 1 223 ? 27.014  29.219 61.870 1.00 45.72  ? 431  THR A HG23 1 
ATOM   2769  N  N    . ASN A 1 224 ? 24.989  27.437 57.735 1.00 36.03  ? 432  ASN A N    1 
ATOM   2770  C  CA   . ASN A 1 224 ? 24.707  26.476 56.675 1.00 35.20  ? 432  ASN A CA   1 
ATOM   2771  C  C    . ASN A 1 224 ? 25.739  25.353 56.658 1.00 36.78  ? 432  ASN A C    1 
ATOM   2772  O  O    . ASN A 1 224 ? 25.394  24.189 56.425 1.00 40.49  ? 432  ASN A O    1 
ATOM   2773  C  CB   . ASN A 1 224 ? 24.665  27.192 55.326 1.00 34.09  ? 432  ASN A CB   1 
ATOM   2774  C  CG   . ASN A 1 224 ? 24.587  26.229 54.159 1.00 35.92  ? 432  ASN A CG   1 
ATOM   2775  O  OD1  . ASN A 1 224 ? 23.566  25.578 53.946 1.00 31.99  ? 432  ASN A OD1  1 
ATOM   2776  N  ND2  . ASN A 1 224 ? 25.668  26.139 53.391 1.00 41.00  ? 432  ASN A ND2  1 
ATOM   2777  H  H    . ASN A 1 224 ? 25.150  28.236 57.459 1.00 43.24  ? 432  ASN A H    1 
ATOM   2778  H  HA   . ASN A 1 224 ? 23.836  26.080 56.832 1.00 42.24  ? 432  ASN A HA   1 
ATOM   2779  H  HB2  . ASN A 1 224 ? 23.883  27.765 55.295 1.00 40.91  ? 432  ASN A HB2  1 
ATOM   2780  H  HB3  . ASN A 1 224 ? 25.470  27.723 55.224 1.00 40.91  ? 432  ASN A HB3  1 
ATOM   2781  H  HD21 . ASN A 1 224 ? 25.672  25.607 52.715 1.00 49.20  ? 432  ASN A HD21 1 
ATOM   2782  H  HD22 . ASN A 1 224 ? 26.364  26.612 53.571 1.00 49.20  ? 432  ASN A HD22 1 
ATOM   2783  N  N    . ASP A 1 225 ? 27.011  25.680 56.905 1.00 36.03  ? 433  ASP A N    1 
ATOM   2784  C  CA   . ASP A 1 225 ? 28.044  24.648 56.937 1.00 38.32  ? 433  ASP A CA   1 
ATOM   2785  C  C    . ASP A 1 225 ? 27.733  23.584 57.985 1.00 39.13  ? 433  ASP A C    1 
ATOM   2786  O  O    . ASP A 1 225 ? 27.935  22.387 57.747 1.00 39.26  ? 433  ASP A O    1 
ATOM   2787  C  CB   . ASP A 1 225 ? 29.411  25.275 57.214 1.00 42.44  ? 433  ASP A CB   1 
ATOM   2788  C  CG   . ASP A 1 225 ? 29.958  26.049 56.026 1.00 43.45  ? 433  ASP A CG   1 
ATOM   2789  O  OD1  . ASP A 1 225 ? 29.478  25.835 54.892 1.00 44.12  ? 433  ASP A OD1  1 
ATOM   2790  O  OD2  . ASP A 1 225 ? 30.880  26.866 56.227 1.00 45.47  ? 433  ASP A OD2  1 
ATOM   2791  H  H    . ASP A 1 225 ? 27.295  26.477 57.054 1.00 43.24  ? 433  ASP A H    1 
ATOM   2792  H  HA   . ASP A 1 225 ? 28.084  24.213 56.071 1.00 45.99  ? 433  ASP A HA   1 
ATOM   2793  H  HB2  . ASP A 1 225 ? 29.332  25.889 57.961 1.00 50.93  ? 433  ASP A HB2  1 
ATOM   2794  H  HB3  . ASP A 1 225 ? 30.044  24.571 57.430 1.00 50.93  ? 433  ASP A HB3  1 
ATOM   2795  N  N    . GLN A 1 226 ? 27.251  24.003 59.157 1.00 39.28  ? 434  GLN A N    1 
ATOM   2796  C  CA   . GLN A 1 226 ? 26.951  23.046 60.216 1.00 41.15  ? 434  GLN A CA   1 
ATOM   2797  C  C    . GLN A 1 226 ? 25.721  22.212 59.874 1.00 38.53  ? 434  GLN A C    1 
ATOM   2798  O  O    . GLN A 1 226 ? 25.666  21.019 60.193 1.00 37.99  ? 434  GLN A O    1 
ATOM   2799  C  CB   . GLN A 1 226 ? 26.756  23.781 61.542 1.00 44.56  ? 434  GLN A CB   1 
ATOM   2800  C  CG   . GLN A 1 226 ? 28.010  24.482 62.043 1.00 48.26  ? 434  GLN A CG   1 
ATOM   2801  C  CD   . GLN A 1 226 ? 27.780  25.255 63.326 1.00 52.21  ? 434  GLN A CD   1 
ATOM   2802  O  OE1  . GLN A 1 226 ? 26.669  25.711 63.601 1.00 53.14  ? 434  GLN A OE1  1 
ATOM   2803  N  NE2  . GLN A 1 226 ? 28.834  25.410 64.120 1.00 54.08  ? 434  GLN A NE2  1 
ATOM   2804  H  H    . GLN A 1 226 ? 27.093  24.823 59.359 1.00 47.14  ? 434  GLN A H    1 
ATOM   2805  H  HA   . GLN A 1 226 ? 27.702  22.441 60.317 1.00 49.38  ? 434  GLN A HA   1 
ATOM   2806  H  HB2  . GLN A 1 226 ? 26.066  24.453 61.429 1.00 53.48  ? 434  GLN A HB2  1 
ATOM   2807  H  HB3  . GLN A 1 226 ? 26.484  23.141 62.218 1.00 53.48  ? 434  GLN A HB3  1 
ATOM   2808  H  HG2  . GLN A 1 226 ? 28.696  23.818 62.213 1.00 57.92  ? 434  GLN A HG2  1 
ATOM   2809  H  HG3  . GLN A 1 226 ? 28.314  25.107 61.367 1.00 57.92  ? 434  GLN A HG3  1 
ATOM   2810  H  HE21 . GLN A 1 226 ? 29.595  25.078 63.895 1.00 64.89  ? 434  GLN A HE21 1 
ATOM   2811  H  HE22 . GLN A 1 226 ? 28.756  25.841 64.860 1.00 64.89  ? 434  GLN A HE22 1 
ATOM   2812  N  N    . LEU A 1 227 ? 24.723  22.823 59.229 1.00 34.51  ? 435  LEU A N    1 
ATOM   2813  C  CA   . LEU A 1 227 ? 23.543  22.075 58.803 1.00 35.04  ? 435  LEU A CA   1 
ATOM   2814  C  C    . LEU A 1 227 ? 23.918  20.995 57.795 1.00 33.99  ? 435  LEU A C    1 
ATOM   2815  O  O    . LEU A 1 227 ? 23.495  19.837 57.915 1.00 32.27  ? 435  LEU A O    1 
ATOM   2816  C  CB   . LEU A 1 227 ? 22.509  23.038 58.211 1.00 36.26  ? 435  LEU A CB   1 
ATOM   2817  C  CG   . LEU A 1 227 ? 21.247  22.427 57.595 1.00 34.76  ? 435  LEU A CG   1 
ATOM   2818  C  CD1  . LEU A 1 227 ? 20.352  21.820 58.669 1.00 33.59  ? 435  LEU A CD1  1 
ATOM   2819  C  CD2  . LEU A 1 227 ? 20.494  23.470 56.789 1.00 34.17  ? 435  LEU A CD2  1 
ATOM   2820  H  H    . LEU A 1 227 ? 24.707  23.659 59.030 1.00 41.42  ? 435  LEU A H    1 
ATOM   2821  H  HA   . LEU A 1 227 ? 23.145  21.643 59.575 1.00 42.05  ? 435  LEU A HA   1 
ATOM   2822  H  HB2  . LEU A 1 227 ? 22.219  23.638 58.916 1.00 43.52  ? 435  LEU A HB2  1 
ATOM   2823  H  HB3  . LEU A 1 227 ? 22.944  23.553 57.514 1.00 43.52  ? 435  LEU A HB3  1 
ATOM   2824  H  HG   . LEU A 1 227 ? 21.507  21.716 56.990 1.00 41.71  ? 435  LEU A HG   1 
ATOM   2825  H  HD11 . LEU A 1 227 ? 19.564  21.444 58.247 1.00 40.31  ? 435  LEU A HD11 1 
ATOM   2826  H  HD12 . LEU A 1 227 ? 20.844  21.125 59.132 1.00 40.31  ? 435  LEU A HD12 1 
ATOM   2827  H  HD13 . LEU A 1 227 ? 20.093  22.516 59.293 1.00 40.31  ? 435  LEU A HD13 1 
ATOM   2828  H  HD21 . LEU A 1 227 ? 19.700  23.062 56.409 1.00 41.00  ? 435  LEU A HD21 1 
ATOM   2829  H  HD22 . LEU A 1 227 ? 20.243  24.201 57.375 1.00 41.00  ? 435  LEU A HD22 1 
ATOM   2830  H  HD23 . LEU A 1 227 ? 21.070  23.797 56.080 1.00 41.00  ? 435  LEU A HD23 1 
ATOM   2831  N  N    . VAL A 1 228 ? 24.717  21.356 56.789 1.00 33.23  ? 436  VAL A N    1 
ATOM   2832  C  CA   . VAL A 1 228 ? 25.098  20.396 55.758 1.00 34.83  ? 436  VAL A CA   1 
ATOM   2833  C  C    . VAL A 1 228 ? 25.895  19.249 56.365 1.00 34.37  ? 436  VAL A C    1 
ATOM   2834  O  O    . VAL A 1 228 ? 25.661  18.076 56.048 1.00 35.86  ? 436  VAL A O    1 
ATOM   2835  C  CB   . VAL A 1 228 ? 25.876  21.105 54.633 1.00 36.83  ? 436  VAL A CB   1 
ATOM   2836  C  CG1  . VAL A 1 228 ? 26.416  20.098 53.623 1.00 37.68  ? 436  VAL A CG1  1 
ATOM   2837  C  CG2  . VAL A 1 228 ? 24.974  22.122 53.939 1.00 35.48  ? 436  VAL A CG2  1 
ATOM   2838  H  H    . VAL A 1 228 ? 25.048  22.143 56.684 1.00 39.87  ? 436  VAL A H    1 
ATOM   2839  H  HA   . VAL A 1 228 ? 24.292  20.021 55.369 1.00 41.79  ? 436  VAL A HA   1 
ATOM   2840  H  HB   . VAL A 1 228 ? 26.628  21.581 55.018 1.00 44.19  ? 436  VAL A HB   1 
ATOM   2841  H  HG11 . VAL A 1 228 ? 26.899  20.574 52.930 1.00 45.22  ? 436  VAL A HG11 1 
ATOM   2842  H  HG12 . VAL A 1 228 ? 27.012  19.483 54.079 1.00 45.22  ? 436  VAL A HG12 1 
ATOM   2843  H  HG13 . VAL A 1 228 ? 25.673  19.611 53.234 1.00 45.22  ? 436  VAL A HG13 1 
ATOM   2844  H  HG21 . VAL A 1 228 ? 25.477  22.560 53.234 1.00 42.58  ? 436  VAL A HG21 1 
ATOM   2845  H  HG22 . VAL A 1 228 ? 24.209  21.660 53.562 1.00 42.58  ? 436  VAL A HG22 1 
ATOM   2846  H  HG23 . VAL A 1 228 ? 24.678  22.777 54.590 1.00 42.58  ? 436  VAL A HG23 1 
ATOM   2847  N  N    . ALA A 1 229 ? 26.839  19.562 57.257 1.00 32.31  ? 437  ALA A N    1 
ATOM   2848  C  CA   . ALA A 1 229 ? 27.661  18.512 57.851 1.00 36.20  ? 437  ALA A CA   1 
ATOM   2849  C  C    . ALA A 1 229 ? 26.807  17.525 58.637 1.00 36.85  ? 437  ALA A C    1 
ATOM   2850  O  O    . ALA A 1 229 ? 27.024  16.310 58.566 1.00 35.67  ? 437  ALA A O    1 
ATOM   2851  C  CB   . ALA A 1 229 ? 28.735  19.126 58.751 1.00 41.00  ? 437  ALA A CB   1 
ATOM   2852  H  H    . ALA A 1 229 ? 27.018  20.358 57.528 1.00 38.77  ? 437  ALA A H    1 
ATOM   2853  H  HA   . ALA A 1 229 ? 28.108  18.023 57.143 1.00 43.45  ? 437  ALA A HA   1 
ATOM   2854  H  HB1  . ALA A 1 229 ? 29.269  18.414 59.136 1.00 49.20  ? 437  ALA A HB1  1 
ATOM   2855  H  HB2  . ALA A 1 229 ? 29.296  19.711 58.219 1.00 49.20  ? 437  ALA A HB2  1 
ATOM   2856  H  HB3  . ALA A 1 229 ? 28.303  19.634 59.456 1.00 49.20  ? 437  ALA A HB3  1 
ATOM   2857  N  N    . PHE A 1 230 ? 25.824  18.029 59.384 1.00 35.16  ? 438  PHE A N    1 
ATOM   2858  C  CA   . PHE A 1 230 ? 24.973  17.157 60.188 1.00 34.80  ? 438  PHE A CA   1 
ATOM   2859  C  C    . PHE A 1 230 ? 24.127  16.246 59.304 1.00 35.00  ? 438  PHE A C    1 
ATOM   2860  O  O    . PHE A 1 230 ? 24.061  15.029 59.530 1.00 34.35  ? 438  PHE A O    1 
ATOM   2861  C  CB   . PHE A 1 230 ? 24.088  18.010 61.100 1.00 34.68  ? 438  PHE A CB   1 
ATOM   2862  C  CG   . PHE A 1 230 ? 23.196  17.212 62.011 1.00 32.62  ? 438  PHE A CG   1 
ATOM   2863  C  CD1  . PHE A 1 230 ? 23.661  16.755 63.233 1.00 34.96  ? 438  PHE A CD1  1 
ATOM   2864  C  CD2  . PHE A 1 230 ? 21.891  16.933 61.651 1.00 31.89  ? 438  PHE A CD2  1 
ATOM   2865  C  CE1  . PHE A 1 230 ? 22.841  16.025 64.075 1.00 36.11  ? 438  PHE A CE1  1 
ATOM   2866  C  CE2  . PHE A 1 230 ? 21.064  16.204 62.490 1.00 33.50  ? 438  PHE A CE2  1 
ATOM   2867  C  CZ   . PHE A 1 230 ? 21.540  15.751 63.702 1.00 35.54  ? 438  PHE A CZ   1 
ATOM   2868  H  H    . PHE A 1 230 ? 25.632  18.865 59.442 1.00 42.19  ? 438  PHE A H    1 
ATOM   2869  H  HA   . PHE A 1 230 ? 25.532  16.598 60.749 1.00 41.76  ? 438  PHE A HA   1 
ATOM   2870  H  HB2  . PHE A 1 230 ? 24.657  18.565 61.656 1.00 41.62  ? 438  PHE A HB2  1 
ATOM   2871  H  HB3  . PHE A 1 230 ? 23.521  18.571 60.548 1.00 41.62  ? 438  PHE A HB3  1 
ATOM   2872  H  HD1  . PHE A 1 230 ? 24.536  16.937 63.489 1.00 41.95  ? 438  PHE A HD1  1 
ATOM   2873  H  HD2  . PHE A 1 230 ? 21.565  17.236 60.835 1.00 38.28  ? 438  PHE A HD2  1 
ATOM   2874  H  HE1  . PHE A 1 230 ? 23.165  15.721 64.892 1.00 43.33  ? 438  PHE A HE1  1 
ATOM   2875  H  HE2  . PHE A 1 230 ? 20.188  16.020 62.235 1.00 40.20  ? 438  PHE A HE2  1 
ATOM   2876  H  HZ   . PHE A 1 230 ? 20.986  15.261 64.266 1.00 42.65  ? 438  PHE A HZ   1 
ATOM   2877  N  N    . LEU A 1 231 ? 23.483  16.814 58.281 1.00 27.51  ? 439  LEU A N    1 
ATOM   2878  C  CA   . LEU A 1 231 ? 22.591  16.028 57.434 1.00 30.88  ? 439  LEU A CA   1 
ATOM   2879  C  C    . LEU A 1 231 ? 23.363  15.084 56.520 1.00 35.25  ? 439  LEU A C    1 
ATOM   2880  O  O    . LEU A 1 231 ? 22.837  14.032 56.134 1.00 35.02  ? 439  LEU A O    1 
ATOM   2881  C  CB   . LEU A 1 231 ? 21.695  16.954 56.606 1.00 31.84  ? 439  LEU A CB   1 
ATOM   2882  C  CG   . LEU A 1 231 ? 20.684  17.807 57.377 1.00 28.45  ? 439  LEU A CG   1 
ATOM   2883  C  CD1  . LEU A 1 231 ? 19.900  18.684 56.413 1.00 31.12  ? 439  LEU A CD1  1 
ATOM   2884  C  CD2  . LEU A 1 231 ? 19.734  16.948 58.197 1.00 33.82  ? 439  LEU A CD2  1 
ATOM   2885  H  H    . LEU A 1 231 ? 23.545  17.642 58.061 1.00 33.01  ? 439  LEU A H    1 
ATOM   2886  H  HA   . LEU A 1 231 ? 22.017  15.488 58.000 1.00 37.05  ? 439  LEU A HA   1 
ATOM   2887  H  HB2  . LEU A 1 231 ? 22.265  17.564 56.112 1.00 38.21  ? 439  LEU A HB2  1 
ATOM   2888  H  HB3  . LEU A 1 231 ? 21.192  16.409 55.981 1.00 38.21  ? 439  LEU A HB3  1 
ATOM   2889  H  HG   . LEU A 1 231 ? 21.164  18.389 57.987 1.00 34.15  ? 439  LEU A HG   1 
ATOM   2890  H  HD11 . LEU A 1 231 ? 19.265  19.216 56.917 1.00 37.35  ? 439  LEU A HD11 1 
ATOM   2891  H  HD12 . LEU A 1 231 ? 20.518  19.263 55.940 1.00 37.35  ? 439  LEU A HD12 1 
ATOM   2892  H  HD13 . LEU A 1 231 ? 19.430  18.116 55.782 1.00 37.35  ? 439  LEU A HD13 1 
ATOM   2893  H  HD21 . LEU A 1 231 ? 19.113  17.526 58.668 1.00 40.59  ? 439  LEU A HD21 1 
ATOM   2894  H  HD22 . LEU A 1 231 ? 19.250  16.356 57.601 1.00 40.59  ? 439  LEU A HD22 1 
ATOM   2895  H  HD23 . LEU A 1 231 ? 20.250  16.428 58.834 1.00 40.59  ? 439  LEU A HD23 1 
ATOM   2896  N  N    . SER A 1 232 ? 24.601  15.438 56.162 1.00 36.29  ? 440  SER A N    1 
ATOM   2897  C  CA   . SER A 1 232 ? 25.436  14.534 55.381 1.00 38.93  ? 440  SER A CA   1 
ATOM   2898  C  C    . SER A 1 232 ? 25.800  13.291 56.180 1.00 39.94  ? 440  SER A C    1 
ATOM   2899  O  O    . SER A 1 232 ? 26.042  12.227 55.599 1.00 41.77  ? 440  SER A O    1 
ATOM   2900  C  CB   . SER A 1 232 ? 26.703  15.257 54.919 1.00 39.56  ? 440  SER A CB   1 
ATOM   2901  O  OG   . SER A 1 232 ? 26.386  16.380 54.116 1.00 34.32  ? 440  SER A OG   1 
ATOM   2902  H  H    . SER A 1 232 ? 24.973  16.188 56.358 1.00 43.56  ? 440  SER A H    1 
ATOM   2903  H  HA   . SER A 1 232 ? 24.947  14.252 54.593 1.00 46.72  ? 440  SER A HA   1 
ATOM   2904  H  HB2  . SER A 1 232 ? 27.197  15.556 55.699 1.00 47.48  ? 440  SER A HB2  1 
ATOM   2905  H  HB3  . SER A 1 232 ? 27.245  14.642 54.401 1.00 47.48  ? 440  SER A HB3  1 
ATOM   2906  H  HG   . SER A 1 232 ? 25.916  16.923 54.554 1.00 41.19  ? 440  SER A HG   1 
ATOM   2907  N  N    . ARG A 1 233 ? 25.834  13.407 57.509 1.00 37.41  ? 441  ARG A N    1 
ATOM   2908  C  CA   . ARG A 1 233 ? 26.133  12.266 58.365 1.00 39.41  ? 441  ARG A CA   1 
ATOM   2909  C  C    . ARG A 1 233 ? 24.917  11.369 58.578 1.00 39.11  ? 441  ARG A C    1 
ATOM   2910  O  O    . ARG A 1 233 ? 25.080  10.173 58.844 1.00 38.76  ? 441  ARG A O    1 
ATOM   2911  C  CB   . ARG A 1 233 ? 26.664  12.762 59.712 1.00 37.52  ? 441  ARG A CB   1 
ATOM   2912  C  CG   . ARG A 1 233 ? 26.947  11.663 60.716 1.00 39.75  ? 441  ARG A CG   1 
ATOM   2913  H  H    . ARG A 1 233 ? 25.686  14.138 57.937 1.00 44.90  ? 441  ARG A H    1 
ATOM   2914  H  HA   . ARG A 1 233 ? 26.828  11.733 57.948 1.00 47.29  ? 441  ARG A HA   1 
ATOM   2915  H  HB2  . ARG A 1 233 ? 27.492  13.244 59.561 1.00 45.02  ? 441  ARG A HB2  1 
ATOM   2916  H  HB3  . ARG A 1 233 ? 26.007  13.358 60.105 1.00 45.02  ? 441  ARG A HB3  1 
ATOM   2917  H  HG2  . ARG A 1 233 ? 26.113  11.390 61.129 1.00 47.70  ? 441  ARG A HG2  1 
ATOM   2918  H  HG3  . ARG A 1 233 ? 27.351  10.911 60.255 1.00 47.70  ? 441  ARG A HG3  1 
ATOM   2919  N  N    . TYR A 1 234 ? 23.705  11.913 58.457 1.00 36.18  ? 442  TYR A N    1 
ATOM   2920  C  CA   . TYR A 1 234 ? 22.470  11.192 58.757 1.00 37.22  ? 442  TYR A CA   1 
ATOM   2921  C  C    . TYR A 1 234 ? 21.508  11.204 57.574 1.00 35.57  ? 442  TYR A C    1 
ATOM   2922  O  O    . TYR A 1 234 ? 20.299  11.384 57.739 1.00 31.76  ? 442  TYR A O    1 
ATOM   2923  C  CB   . TYR A 1 234 ? 21.788  11.786 59.988 1.00 33.26  ? 442  TYR A CB   1 
ATOM   2924  C  CG   . TYR A 1 234 ? 22.594  11.649 61.254 1.00 35.90  ? 442  TYR A CG   1 
ATOM   2925  C  CD1  . TYR A 1 234 ? 22.841  10.400 61.806 1.00 36.04  ? 442  TYR A CD1  1 
ATOM   2926  C  CD2  . TYR A 1 234 ? 23.106  12.765 61.900 1.00 36.99  ? 442  TYR A CD2  1 
ATOM   2927  C  CE1  . TYR A 1 234 ? 23.577  10.264 62.964 1.00 39.36  ? 442  TYR A CE1  1 
ATOM   2928  C  CE2  . TYR A 1 234 ? 23.841  12.641 63.061 1.00 38.88  ? 442  TYR A CE2  1 
ATOM   2929  C  CZ   . TYR A 1 234 ? 24.074  11.386 63.590 1.00 40.71  ? 442  TYR A CZ   1 
ATOM   2930  O  OH   . TYR A 1 234 ? 24.812  11.252 64.745 1.00 44.15  ? 442  TYR A OH   1 
ATOM   2931  H  H    . TYR A 1 234 ? 23.570  12.721 58.195 1.00 43.42  ? 442  TYR A H    1 
ATOM   2932  H  HA   . TYR A 1 234 ? 22.688  10.267 58.955 1.00 44.67  ? 442  TYR A HA   1 
ATOM   2933  H  HB2  . TYR A 1 234 ? 21.635  12.732 59.834 1.00 39.91  ? 442  TYR A HB2  1 
ATOM   2934  H  HB3  . TYR A 1 234 ? 20.941  11.334 60.125 1.00 39.91  ? 442  TYR A HB3  1 
ATOM   2935  H  HD1  . TYR A 1 234 ? 22.506  9.641  61.386 1.00 43.25  ? 442  TYR A HD1  1 
ATOM   2936  H  HD2  . TYR A 1 234 ? 22.949  13.611 61.546 1.00 44.39  ? 442  TYR A HD2  1 
ATOM   2937  H  HE1  . TYR A 1 234 ? 23.735  9.420  63.322 1.00 47.24  ? 442  TYR A HE1  1 
ATOM   2938  H  HE2  . TYR A 1 234 ? 24.180  13.397 63.484 1.00 46.66  ? 442  TYR A HE2  1 
ATOM   2939  H  HH   . TYR A 1 234 ? 25.052  12.007 65.021 1.00 52.98  ? 442  TYR A HH   1 
ATOM   2940  N  N    . ARG A 1 235 ? 22.022  10.981 56.364 1.00 35.94  ? 443  ARG A N    1 
ATOM   2941  C  CA   . ARG A 1 235 ? 21.224  11.259 55.176 1.00 38.34  ? 443  ARG A CA   1 
ATOM   2942  C  C    . ARG A 1 235 ? 20.099  10.257 54.948 1.00 38.64  ? 443  ARG A C    1 
ATOM   2943  O  O    . ARG A 1 235 ? 19.227  10.521 54.113 1.00 38.40  ? 443  ARG A O    1 
ATOM   2944  C  CB   . ARG A 1 235 ? 22.123  11.315 53.941 1.00 42.85  ? 443  ARG A CB   1 
ATOM   2945  C  CG   . ARG A 1 235 ? 22.684  9.984  53.487 1.00 48.43  ? 443  ARG A CG   1 
ATOM   2946  C  CD   . ARG A 1 235 ? 23.448  10.171 52.190 1.00 51.89  ? 443  ARG A CD   1 
ATOM   2947  N  NE   . ARG A 1 235 ? 24.662  10.960 52.386 1.00 53.65  ? 443  ARG A NE   1 
ATOM   2948  C  CZ   . ARG A 1 235 ? 25.129  11.864 51.528 1.00 57.97  ? 443  ARG A CZ   1 
ATOM   2949  N  NH1  . ARG A 1 235 ? 24.482  12.133 50.399 1.00 59.65  ? 443  ARG A NH1  1 
ATOM   2950  N  NH2  . ARG A 1 235 ? 26.248  12.518 51.810 1.00 60.40  ? 443  ARG A NH2  1 
ATOM   2951  H  H    . ARG A 1 235 ? 22.811  10.676 56.208 1.00 43.13  ? 443  ARG A H    1 
ATOM   2952  H  HA   . ARG A 1 235 ? 20.817  12.133 55.279 1.00 46.02  ? 443  ARG A HA   1 
ATOM   2953  H  HB2  . ARG A 1 235 ? 21.610  11.681 53.203 1.00 51.42  ? 443  ARG A HB2  1 
ATOM   2954  H  HB3  . ARG A 1 235 ? 22.874  11.897 54.133 1.00 51.42  ? 443  ARG A HB3  1 
ATOM   2955  H  HG2  . ARG A 1 235 ? 23.294  9.641  54.160 1.00 58.12  ? 443  ARG A HG2  1 
ATOM   2956  H  HG3  . ARG A 1 235 ? 21.958  9.359  53.333 1.00 58.12  ? 443  ARG A HG3  1 
ATOM   2957  H  HD2  . ARG A 1 235 ? 23.704  9.302  51.842 1.00 62.27  ? 443  ARG A HD2  1 
ATOM   2958  H  HD3  . ARG A 1 235 ? 22.884  10.635 51.551 1.00 62.27  ? 443  ARG A HD3  1 
ATOM   2959  H  HE   . ARG A 1 235 ? 25.109  10.830 53.109 1.00 64.38  ? 443  ARG A HE   1 
ATOM   2960  H  HH11 . ARG A 1 235 ? 23.756  11.713 50.209 1.00 71.58  ? 443  ARG A HH11 1 
ATOM   2961  H  HH12 . ARG A 1 235 ? 24.793  12.722 49.855 1.00 71.58  ? 443  ARG A HH12 1 
ATOM   2962  H  HH21 . ARG A 1 235 ? 26.670  12.352 52.541 1.00 72.48  ? 443  ARG A HH21 1 
ATOM   2963  H  HH22 . ARG A 1 235 ? 26.551  13.107 51.262 1.00 72.48  ? 443  ARG A HH22 1 
ATOM   2964  N  N    . ASP A 1 236 ? 20.084  9.129  55.657 1.00 39.15  ? 444  ASP A N    1 
ATOM   2965  C  CA   . ASP A 1 236 ? 19.014  8.150  55.525 1.00 36.57  ? 444  ASP A CA   1 
ATOM   2966  C  C    . ASP A 1 236 ? 17.958  8.276  56.619 1.00 35.21  ? 444  ASP A C    1 
ATOM   2967  O  O    . ASP A 1 236 ? 17.083  7.408  56.722 1.00 34.99  ? 444  ASP A O    1 
ATOM   2968  C  CB   . ASP A 1 236 ? 19.596  6.735  55.520 1.00 40.37  ? 444  ASP A CB   1 
ATOM   2969  C  CG   . ASP A 1 236 ? 20.430  6.456  54.285 1.00 43.12  ? 444  ASP A CG   1 
ATOM   2970  O  OD1  . ASP A 1 236 ? 20.149  7.061  53.228 1.00 44.45  ? 444  ASP A OD1  1 
ATOM   2971  O  OD2  . ASP A 1 236 ? 21.366  5.634  54.369 1.00 47.27  ? 444  ASP A OD2  1 
ATOM   2972  H  H    . ASP A 1 236 ? 20.690  8.908  56.225 1.00 46.98  ? 444  ASP A H    1 
ATOM   2973  H  HA   . ASP A 1 236 ? 18.571  8.288  54.673 1.00 43.88  ? 444  ASP A HA   1 
ATOM   2974  H  HB2  . ASP A 1 236 ? 20.165  6.624  56.298 1.00 48.44  ? 444  ASP A HB2  1 
ATOM   2975  H  HB3  . ASP A 1 236 ? 18.870  6.093  55.544 1.00 48.44  ? 444  ASP A HB3  1 
ATOM   2976  N  N    . MET A 1 237 ? 18.007  9.337  57.421 1.00 33.70  ? 445  MET A N    1 
ATOM   2977  C  CA   . MET A 1 237 ? 17.068  9.552  58.512 1.00 33.74  ? 445  MET A CA   1 
ATOM   2978  C  C    . MET A 1 237 ? 15.965  10.528 58.105 1.00 33.87  ? 445  MET A C    1 
ATOM   2979  O  O    . MET A 1 237 ? 16.096  11.296 57.148 1.00 31.33  ? 445  MET A O    1 
ATOM   2980  C  CB   . MET A 1 237 ? 17.790  10.096 59.749 1.00 38.33  ? 445  MET A CB   1 
ATOM   2981  C  CG   . MET A 1 237 ? 18.897  9.209  60.300 1.00 44.33  ? 445  MET A CG   1 
ATOM   2982  S  SD   . MET A 1 237 ? 18.292  7.655  60.988 1.00 50.26  ? 445  MET A SD   1 
ATOM   2983  C  CE   . MET A 1 237 ? 18.546  6.551  59.604 1.00 54.59  ? 445  MET A CE   1 
ATOM   2984  H  H    . MET A 1 237 ? 18.594  9.961  57.348 1.00 40.44  ? 445  MET A H    1 
ATOM   2985  H  HA   . MET A 1 237 ? 16.664  8.703  58.751 1.00 40.49  ? 445  MET A HA   1 
ATOM   2986  H  HB2  . MET A 1 237 ? 18.188  10.951 59.522 1.00 46.00  ? 445  MET A HB2  1 
ATOM   2987  H  HB3  . MET A 1 237 ? 17.138  10.220 60.456 1.00 46.00  ? 445  MET A HB3  1 
ATOM   2988  H  HG2  . MET A 1 237 ? 19.515  8.997  59.583 1.00 53.20  ? 445  MET A HG2  1 
ATOM   2989  H  HG3  . MET A 1 237 ? 19.360  9.687  61.005 1.00 53.20  ? 445  MET A HG3  1 
ATOM   2990  H  HE1  . MET A 1 237 ? 18.253  5.661  59.853 1.00 65.51  ? 445  MET A HE1  1 
ATOM   2991  H  HE2  . MET A 1 237 ? 18.030  6.870  58.847 1.00 65.51  ? 445  MET A HE2  1 
ATOM   2992  H  HE3  . MET A 1 237 ? 19.490  6.538  59.379 1.00 65.51  ? 445  MET A HE3  1 
ATOM   2993  N  N    . ASN A 1 238 ? 14.867  10.484 58.857 1.00 31.49  ? 446  ASN A N    1 
ATOM   2994  C  CA   . ASN A 1 238 ? 13.772  11.436 58.738 1.00 29.51  ? 446  ASN A CA   1 
ATOM   2995  C  C    . ASN A 1 238 ? 13.543  12.083 60.097 1.00 31.81  ? 446  ASN A C    1 
ATOM   2996  O  O    . ASN A 1 238 ? 13.604  11.407 61.129 1.00 35.30  ? 446  ASN A O    1 
ATOM   2997  C  CB   . ASN A 1 238 ? 12.480  10.758 58.249 1.00 27.41  ? 446  ASN A CB   1 
ATOM   2998  C  CG   . ASN A 1 238 ? 12.557  10.331 56.799 1.00 28.49  ? 446  ASN A CG   1 
ATOM   2999  O  OD1  . ASN A 1 238 ? 12.551  11.164 55.893 1.00 26.46  ? 446  ASN A OD1  1 
ATOM   3000  N  ND2  . ASN A 1 238 ? 12.621  9.024  56.568 1.00 33.86  ? 446  ASN A ND2  1 
ATOM   3001  H  H    . ASN A 1 238 ? 14.733  9.889  59.463 1.00 37.79  ? 446  ASN A H    1 
ATOM   3002  H  HA   . ASN A 1 238 ? 14.014  12.130 58.104 1.00 35.42  ? 446  ASN A HA   1 
ATOM   3003  H  HB2  . ASN A 1 238 ? 12.316  9.967  58.787 1.00 32.89  ? 446  ASN A HB2  1 
ATOM   3004  H  HB3  . ASN A 1 238 ? 11.743  11.381 58.340 1.00 32.89  ? 446  ASN A HB3  1 
ATOM   3005  H  HD21 . ASN A 1 238 ? 12.665  8.731  55.761 1.00 40.64  ? 446  ASN A HD21 1 
ATOM   3006  H  HD22 . ASN A 1 238 ? 12.621  8.471  57.227 1.00 40.64  ? 446  ASN A HD22 1 
ATOM   3007  N  N    . PHE A 1 239 ? 13.268  13.387 60.096 1.00 31.26  ? 447  PHE A N    1 
ATOM   3008  C  CA   . PHE A 1 239 ? 13.232  14.190 61.319 1.00 30.49  ? 447  PHE A CA   1 
ATOM   3009  C  C    . PHE A 1 239 ? 11.825  14.757 61.523 1.00 30.09  ? 447  PHE A C    1 
ATOM   3010  O  O    . PHE A 1 239 ? 11.429  15.727 60.866 1.00 26.76  ? 447  PHE A O    1 
ATOM   3011  C  CB   . PHE A 1 239 ? 14.295  15.290 61.256 1.00 28.92  ? 447  PHE A CB   1 
ATOM   3012  C  CG   . PHE A 1 239 ? 15.706  14.756 61.217 1.00 29.96  ? 447  PHE A CG   1 
ATOM   3013  C  CD1  . PHE A 1 239 ? 16.327  14.484 60.007 1.00 29.45  ? 447  PHE A CD1  1 
ATOM   3014  C  CD2  . PHE A 1 239 ? 16.398  14.500 62.390 1.00 31.70  ? 447  PHE A CD2  1 
ATOM   3015  C  CE1  . PHE A 1 239 ? 17.616  13.983 59.969 1.00 31.22  ? 447  PHE A CE1  1 
ATOM   3016  C  CE2  . PHE A 1 239 ? 17.690  13.997 62.360 1.00 33.83  ? 447  PHE A CE2  1 
ATOM   3017  C  CZ   . PHE A 1 239 ? 18.299  13.737 61.148 1.00 33.64  ? 447  PHE A CZ   1 
ATOM   3018  H  H    . PHE A 1 239 ? 13.094  13.838 59.385 1.00 37.51  ? 447  PHE A H    1 
ATOM   3019  H  HA   . PHE A 1 239 ? 13.437  13.620 62.077 1.00 36.59  ? 447  PHE A HA   1 
ATOM   3020  H  HB2  . PHE A 1 239 ? 14.153  15.817 60.454 1.00 34.70  ? 447  PHE A HB2  1 
ATOM   3021  H  HB3  . PHE A 1 239 ? 14.211  15.853 62.041 1.00 34.70  ? 447  PHE A HB3  1 
ATOM   3022  H  HD1  . PHE A 1 239 ? 15.874  14.646 59.212 1.00 35.34  ? 447  PHE A HD1  1 
ATOM   3023  H  HD2  . PHE A 1 239 ? 15.992  14.672 63.209 1.00 38.04  ? 447  PHE A HD2  1 
ATOM   3024  H  HE1  . PHE A 1 239 ? 18.023  13.809 59.151 1.00 37.46  ? 447  PHE A HE1  1 
ATOM   3025  H  HE2  . PHE A 1 239 ? 18.145  13.835 63.155 1.00 40.59  ? 447  PHE A HE2  1 
ATOM   3026  H  HZ   . PHE A 1 239 ? 19.167  13.402 61.125 1.00 40.37  ? 447  PHE A HZ   1 
ATOM   3027  N  N    . LEU A 1 240 ? 11.081  14.141 62.444 1.00 29.28  ? 448  LEU A N    1 
ATOM   3028  C  CA   . LEU A 1 240 ? 9.730   14.543 62.816 1.00 29.50  ? 448  LEU A CA   1 
ATOM   3029  C  C    . LEU A 1 240 ? 9.612   14.487 64.332 1.00 28.80  ? 448  LEU A C    1 
ATOM   3030  O  O    . LEU A 1 240 ? 10.108  13.546 64.956 1.00 35.51  ? 448  LEU A O    1 
ATOM   3031  C  CB   . LEU A 1 240 ? 8.673   13.618 62.188 1.00 30.58  ? 448  LEU A CB   1 
ATOM   3032  C  CG   . LEU A 1 240 ? 8.508   13.601 60.668 1.00 34.88  ? 448  LEU A CG   1 
ATOM   3033  C  CD1  . LEU A 1 240 ? 8.151   12.206 60.184 1.00 37.50  ? 448  LEU A CD1  1 
ATOM   3034  C  CD2  . LEU A 1 240 ? 7.433   14.580 60.241 1.00 34.92  ? 448  LEU A CD2  1 
ATOM   3035  H  H    . LEU A 1 240 ? 11.355  13.455 62.885 1.00 35.14  ? 448  LEU A H    1 
ATOM   3036  H  HA   . LEU A 1 240 ? 9.565   15.452 62.521 1.00 35.40  ? 448  LEU A HA   1 
ATOM   3037  H  HB2  . LEU A 1 240 ? 8.881   12.709 62.456 1.00 36.70  ? 448  LEU A HB2  1 
ATOM   3038  H  HB3  . LEU A 1 240 ? 7.810   13.864 62.559 1.00 36.70  ? 448  LEU A HB3  1 
ATOM   3039  H  HG   . LEU A 1 240 ? 9.344   13.864 60.252 1.00 41.86  ? 448  LEU A HG   1 
ATOM   3040  H  HD11 . LEU A 1 240 ? 8.053   12.224 59.219 1.00 45.00  ? 448  LEU A HD11 1 
ATOM   3041  H  HD12 . LEU A 1 240 ? 8.861   11.594 60.434 1.00 45.00  ? 448  LEU A HD12 1 
ATOM   3042  H  HD13 . LEU A 1 240 ? 7.317   11.933 60.597 1.00 45.00  ? 448  LEU A HD13 1 
ATOM   3043  H  HD21 . LEU A 1 240 ? 7.347   14.552 59.275 1.00 41.91  ? 448  LEU A HD21 1 
ATOM   3044  H  HD22 . LEU A 1 240 ? 6.594   14.328 60.656 1.00 41.91  ? 448  LEU A HD22 1 
ATOM   3045  H  HD23 . LEU A 1 240 ? 7.689   15.472 60.524 1.00 41.91  ? 448  LEU A HD23 1 
ATOM   3046  N  N    . LYS A 1 241 ? 8.947   15.477 64.925 1.00 27.94  ? 449  LYS A N    1 
ATOM   3047  C  CA   . LYS A 1 241 ? 8.791   15.550 66.374 1.00 26.56  ? 449  LYS A CA   1 
ATOM   3048  C  C    . LYS A 1 241 ? 7.358   15.214 66.765 1.00 28.92  ? 449  LYS A C    1 
ATOM   3049  O  O    . LYS A 1 241 ? 6.409   15.798 66.228 1.00 28.38  ? 449  LYS A O    1 
ATOM   3050  C  CB   . LYS A 1 241 ? 9.162   16.937 66.906 1.00 30.10  ? 449  LYS A CB   1 
ATOM   3051  C  CG   . LYS A 1 241 ? 9.172   17.020 68.431 1.00 30.93  ? 449  LYS A CG   1 
ATOM   3052  C  CD   . LYS A 1 241 ? 10.393  16.326 69.017 1.00 37.25  ? 449  LYS A CD   1 
ATOM   3053  C  CE   . LYS A 1 241 ? 10.269  16.130 70.523 1.00 43.70  ? 449  LYS A CE   1 
ATOM   3054  N  NZ   . LYS A 1 241 ? 9.244   15.104 70.870 1.00 49.90  ? 449  LYS A NZ   1 
ATOM   3055  H  H    . LYS A 1 241 ? 8.574   16.127 64.503 1.00 33.53  ? 449  LYS A H    1 
ATOM   3056  H  HA   . LYS A 1 241 ? 9.378   14.899 66.790 1.00 31.87  ? 449  LYS A HA   1 
ATOM   3057  H  HB2  . LYS A 1 241 ? 10.050  17.167 66.589 1.00 36.12  ? 449  LYS A HB2  1 
ATOM   3058  H  HB3  . LYS A 1 241 ? 8.517   17.582 66.577 1.00 36.12  ? 449  LYS A HB3  1 
ATOM   3059  H  HG2  . LYS A 1 241 ? 9.193   17.952 68.700 1.00 37.12  ? 449  LYS A HG2  1 
ATOM   3060  H  HG3  . LYS A 1 241 ? 8.378   16.587 68.780 1.00 37.12  ? 449  LYS A HG3  1 
ATOM   3061  H  HD2  . LYS A 1 241 ? 10.491  15.453 68.606 1.00 44.71  ? 449  LYS A HD2  1 
ATOM   3062  H  HD3  . LYS A 1 241 ? 11.180  16.866 68.846 1.00 44.71  ? 449  LYS A HD3  1 
ATOM   3063  H  HE2  . LYS A 1 241 ? 11.123  15.836 70.877 1.00 52.44  ? 449  LYS A HE2  1 
ATOM   3064  H  HE3  . LYS A 1 241 ? 10.008  16.969 70.933 1.00 52.44  ? 449  LYS A HE3  1 
ATOM   3065  H  HZ1  . LYS A 1 241 ? 9.194   15.012 71.753 1.00 59.88  ? 449  LYS A HZ1  1 
ATOM   3066  H  HZ2  . LYS A 1 241 ? 8.448   15.353 70.559 1.00 59.88  ? 449  LYS A HZ2  1 
ATOM   3067  H  HZ3  . LYS A 1 241 ? 9.464   14.321 70.508 1.00 59.88  ? 449  LYS A HZ3  1 
ATOM   3068  N  N    . SER A 1 242 ? 7.210   14.293 67.716 1.00 33.74  ? 450  SER A N    1 
ATOM   3069  C  CA   . SER A 1 242 ? 5.910   13.861 68.204 1.00 39.62  ? 450  SER A CA   1 
ATOM   3070  C  C    . SER A 1 242 ? 5.430   14.759 69.345 1.00 42.15  ? 450  SER A C    1 
ATOM   3071  O  O    . SER A 1 242 ? 6.194   15.523 69.939 1.00 45.41  ? 450  SER A O    1 
ATOM   3072  C  CB   . SER A 1 242 ? 5.971   12.405 68.662 1.00 42.97  ? 450  SER A CB   1 
ATOM   3073  O  OG   . SER A 1 242 ? 6.297   11.554 67.580 1.00 43.74  ? 450  SER A OG   1 
ATOM   3074  H  H    . SER A 1 242 ? 7.868   13.895 68.101 1.00 40.50  ? 450  SER A H    1 
ATOM   3075  H  HA   . SER A 1 242 ? 5.264   13.922 67.482 1.00 47.55  ? 450  SER A HA   1 
ATOM   3076  H  HB2  . SER A 1 242 ? 6.650   12.318 69.349 1.00 51.57  ? 450  SER A HB2  1 
ATOM   3077  H  HB3  . SER A 1 242 ? 5.105   12.149 69.017 1.00 51.57  ? 450  SER A HB3  1 
ATOM   3078  H  HG   . SER A 1 242 ? 6.328   10.756 67.841 1.00 52.49  ? 450  SER A HG   1 
ATOM   3079  N  N    . HIS A 1 243 ? 4.137   14.638 69.660 1.00 39.51  ? 451  HIS A N    1 
ATOM   3080  C  CA   . HIS A 1 243 ? 3.494   15.586 70.568 1.00 40.41  ? 451  HIS A CA   1 
ATOM   3081  C  C    . HIS A 1 243 ? 4.143   15.581 71.949 1.00 43.57  ? 451  HIS A C    1 
ATOM   3082  O  O    . HIS A 1 243 ? 4.387   16.646 72.528 1.00 45.18  ? 451  HIS A O    1 
ATOM   3083  C  CB   . HIS A 1 243 ? 1.995   15.286 70.671 1.00 38.17  ? 451  HIS A CB   1 
ATOM   3084  C  CG   . HIS A 1 243 ? 1.673   13.843 70.907 1.00 34.83  ? 451  HIS A CG   1 
ATOM   3085  N  ND1  . HIS A 1 243 ? 1.740   13.258 72.153 1.00 37.43  ? 451  HIS A ND1  1 
ATOM   3086  C  CD2  . HIS A 1 243 ? 1.269   12.869 70.057 1.00 34.32  ? 451  HIS A CD2  1 
ATOM   3087  C  CE1  . HIS A 1 243 ? 1.401   11.984 72.059 1.00 37.05  ? 451  HIS A CE1  1 
ATOM   3088  N  NE2  . HIS A 1 243 ? 1.109   11.723 70.798 1.00 36.65  ? 451  HIS A NE2  1 
ATOM   3089  H  H    . HIS A 1 243 ? 3.616   14.021 69.364 1.00 47.42  ? 451  HIS A H    1 
ATOM   3090  H  HA   . HIS A 1 243 ? 3.591   16.479 70.202 1.00 48.50  ? 451  HIS A HA   1 
ATOM   3091  H  HB2  . HIS A 1 243 ? 1.625   15.796 71.409 1.00 45.81  ? 451  HIS A HB2  1 
ATOM   3092  H  HB3  . HIS A 1 243 ? 1.567   15.552 69.843 1.00 45.81  ? 451  HIS A HB3  1 
ATOM   3093  H  HD2  . HIS A 1 243 ? 1.130   12.959 69.141 1.00 41.19  ? 451  HIS A HD2  1 
ATOM   3094  H  HE1  . HIS A 1 243 ? 1.369   11.376 72.762 1.00 44.46  ? 451  HIS A HE1  1 
ATOM   3095  H  HE2  . HIS A 1 243 ? 0.859   10.960 70.490 1.00 43.98  ? 451  HIS A HE2  1 
ATOM   3096  N  N    . GLY A 1 244 ? 4.425   14.402 72.495 1.00 44.40  ? 452  GLY A N    1 
ATOM   3097  C  CA   . GLY A 1 244 ? 5.048   14.315 73.803 1.00 52.08  ? 452  GLY A CA   1 
ATOM   3098  C  C    . GLY A 1 244 ? 4.057   14.340 74.951 1.00 59.21  ? 452  GLY A C    1 
ATOM   3099  O  O    . GLY A 1 244 ? 4.280   15.015 75.961 1.00 58.80  ? 452  GLY A O    1 
ATOM   3100  H  H    . GLY A 1 244 ? 4.265   13.642 72.127 1.00 53.28  ? 452  GLY A H    1 
ATOM   3101  H  HA2  . GLY A 1 244 ? 5.556   13.491 73.860 1.00 62.50  ? 452  GLY A HA2  1 
ATOM   3102  H  HA3  . GLY A 1 244 ? 5.660   15.059 73.915 1.00 62.50  ? 452  GLY A HA3  1 
ATOM   3103  N  N    . ARG A 1 245 ? 2.965   13.597 74.814 1.00 64.67  ? 453  ARG A N    1 
ATOM   3104  C  CA   . ARG A 1 245 ? 1.918   13.563 75.827 1.00 69.09  ? 453  ARG A CA   1 
ATOM   3105  C  C    . ARG A 1 245 ? 1.155   12.250 75.665 1.00 71.62  ? 453  ARG A C    1 
ATOM   3106  O  O    . ARG A 1 245 ? 1.650   11.310 75.033 1.00 72.46  ? 453  ARG A O    1 
ATOM   3107  C  CB   . ARG A 1 245 ? 1.012   14.800 75.702 1.00 68.78  ? 453  ARG A CB   1 
ATOM   3108  H  H    . ARG A 1 245 ? 2.806   13.095 74.133 1.00 77.60  ? 453  ARG A H    1 
ATOM   3109  H  HA   . ARG A 1 245 ? 2.324   13.572 76.707 1.00 82.91  ? 453  ARG A HA   1 
ATOM   3110  N  N    . ASP A 1 246 ? -0.044  12.182 76.238 1.00 72.06  ? 454  ASP A N    1 
ATOM   3111  C  CA   . ASP A 1 246 ? -0.883  11.003 76.075 1.00 70.48  ? 454  ASP A CA   1 
ATOM   3112  C  C    . ASP A 1 246 ? -1.480  10.991 74.674 1.00 60.20  ? 454  ASP A C    1 
ATOM   3113  O  O    . ASP A 1 246 ? -2.069  11.982 74.230 1.00 57.15  ? 454  ASP A O    1 
ATOM   3114  C  CB   . ASP A 1 246 ? -1.989  10.987 77.129 1.00 77.88  ? 454  ASP A CB   1 
ATOM   3115  C  CG   . ASP A 1 246 ? -2.912  9.793  76.988 1.00 83.02  ? 454  ASP A CG   1 
ATOM   3116  O  OD1  . ASP A 1 246 ? -2.502  8.670  77.357 1.00 85.69  ? 454  ASP A OD1  1 
ATOM   3117  O  OD2  . ASP A 1 246 ? -4.048  9.976  76.505 1.00 83.74  ? 454  ASP A OD2  1 
ATOM   3118  H  H    . ASP A 1 246 ? -0.391  12.801 76.722 1.00 86.47  ? 454  ASP A H    1 
ATOM   3119  H  HA   . ASP A 1 246 ? -0.343  10.204 76.185 1.00 84.58  ? 454  ASP A HA   1 
ATOM   3120  H  HB2  . ASP A 1 246 ? -1.585  10.953 78.010 1.00 93.46  ? 454  ASP A HB2  1 
ATOM   3121  H  HB3  . ASP A 1 246 ? -2.523  11.792 77.039 1.00 93.46  ? 454  ASP A HB3  1 
ATOM   3122  N  N    . ASN A 1 247 ? -1.327  9.866  73.973 1.00 54.34  ? 455  ASN A N    1 
ATOM   3123  C  CA   . ASN A 1 247 ? -1.735  9.818  72.573 1.00 51.22  ? 455  ASN A CA   1 
ATOM   3124  C  C    . ASN A 1 247 ? -3.248  9.928  72.430 1.00 49.79  ? 455  ASN A C    1 
ATOM   3125  O  O    . ASN A 1 247 ? -3.744  10.543 71.478 1.00 48.76  ? 455  ASN A O    1 
ATOM   3126  C  CB   . ASN A 1 247 ? -1.223  8.536  71.918 1.00 51.45  ? 455  ASN A CB   1 
ATOM   3127  C  CG   . ASN A 1 247 ? -1.265  8.603  70.404 1.00 50.96  ? 455  ASN A CG   1 
ATOM   3128  O  OD1  . ASN A 1 247 ? -0.455  9.291  69.779 1.00 49.50  ? 455  ASN A OD1  1 
ATOM   3129  N  ND2  . ASN A 1 247 ? -2.213  7.891  69.805 1.00 50.48  ? 455  ASN A ND2  1 
ATOM   3130  H  H    . ASN A 1 247 ? -0.997  9.133  74.279 1.00 65.21  ? 455  ASN A H    1 
ATOM   3131  H  HA   . ASN A 1 247 ? -1.337  10.569 72.105 1.00 61.47  ? 455  ASN A HA   1 
ATOM   3132  H  HB2  . ASN A 1 247 ? -0.303  8.388  72.188 1.00 61.74  ? 455  ASN A HB2  1 
ATOM   3133  H  HB3  . ASN A 1 247 ? -1.777  7.792  72.202 1.00 61.74  ? 455  ASN A HB3  1 
ATOM   3134  H  HD21 . ASN A 1 247 ? -2.278  7.896  68.947 1.00 60.58  ? 455  ASN A HD21 1 
ATOM   3135  H  HD22 . ASN A 1 247 ? -2.761  7.423  70.274 1.00 60.58  ? 455  ASN A HD22 1 
ATOM   3136  N  N    . ALA A 1 248 ? -4.002  9.346  73.365 1.00 50.32  ? 456  ALA A N    1 
ATOM   3137  C  CA   . ALA A 1 248 ? -5.455  9.458  73.306 1.00 51.38  ? 456  ALA A CA   1 
ATOM   3138  C  C    . ALA A 1 248 ? -5.900  10.907 73.462 1.00 50.41  ? 456  ALA A C    1 
ATOM   3139  O  O    . ALA A 1 248 ? -6.843  11.350 72.796 1.00 50.38  ? 456  ALA A O    1 
ATOM   3140  C  CB   . ALA A 1 248 ? -6.097  8.579  74.379 1.00 55.13  ? 456  ALA A CB   1 
ATOM   3141  H  H    . ALA A 1 248 ? -3.702  8.890  74.030 1.00 60.38  ? 456  ALA A H    1 
ATOM   3142  H  HA   . ALA A 1 248 ? -5.760  9.143  72.440 1.00 61.66  ? 456  ALA A HA   1 
ATOM   3143  H  HB1  . ALA A 1 248 ? -7.061  8.666  74.324 1.00 66.16  ? 456  ALA A HB1  1 
ATOM   3144  H  HB2  . ALA A 1 248 ? -5.839  7.656  74.227 1.00 66.16  ? 456  ALA A HB2  1 
ATOM   3145  H  HB3  . ALA A 1 248 ? -5.787  8.869  75.251 1.00 66.16  ? 456  ALA A HB3  1 
ATOM   3146  N  N    . ARG A 1 249 ? -5.231  11.663 74.336 1.00 48.25  ? 457  ARG A N    1 
ATOM   3147  C  CA   . ARG A 1 249 ? -5.568  13.073 74.498 1.00 46.44  ? 457  ARG A CA   1 
ATOM   3148  C  C    . ARG A 1 249 ? -5.163  13.878 73.269 1.00 44.33  ? 457  ARG A C    1 
ATOM   3149  O  O    . ARG A 1 249 ? -5.879  14.799 72.861 1.00 45.54  ? 457  ARG A O    1 
ATOM   3150  C  CB   . ARG A 1 249 ? -4.896  13.635 75.751 1.00 46.54  ? 457  ARG A CB   1 
ATOM   3151  H  H    . ARG A 1 249 ? -4.590  11.386 74.838 1.00 57.90  ? 457  ARG A H    1 
ATOM   3152  H  HA   . ARG A 1 249 ? -6.527  13.158 74.609 1.00 55.74  ? 457  ARG A HA   1 
ATOM   3153  N  N    . PHE A 1 250 ? -4.018  13.546 72.664 1.00 41.55  ? 458  PHE A N    1 
ATOM   3154  C  CA   . PHE A 1 250 ? -3.599  14.235 71.448 1.00 40.15  ? 458  PHE A CA   1 
ATOM   3155  C  C    . PHE A 1 250 ? -4.657  14.113 70.359 1.00 37.99  ? 458  PHE A C    1 
ATOM   3156  O  O    . PHE A 1 250 ? -4.985  15.098 69.687 1.00 33.64  ? 458  PHE A O    1 
ATOM   3157  C  CB   . PHE A 1 250 ? -2.259  13.677 70.963 1.00 39.94  ? 458  PHE A CB   1 
ATOM   3158  C  CG   . PHE A 1 250 ? -1.789  14.266 69.659 1.00 37.05  ? 458  PHE A CG   1 
ATOM   3159  C  CD1  . PHE A 1 250 ? -1.248  15.541 69.612 1.00 37.71  ? 458  PHE A CD1  1 
ATOM   3160  C  CD2  . PHE A 1 250 ? -1.882  13.541 68.482 1.00 36.96  ? 458  PHE A CD2  1 
ATOM   3161  C  CE1  . PHE A 1 250 ? -0.816  16.085 68.415 1.00 35.51  ? 458  PHE A CE1  1 
ATOM   3162  C  CE2  . PHE A 1 250 ? -1.449  14.076 67.283 1.00 35.19  ? 458  PHE A CE2  1 
ATOM   3163  C  CZ   . PHE A 1 250 ? -0.915  15.351 67.250 1.00 36.39  ? 458  PHE A CZ   1 
ATOM   3164  H  H    . PHE A 1 250 ? -3.477  12.935 72.935 1.00 49.87  ? 458  PHE A H    1 
ATOM   3165  H  HA   . PHE A 1 250 ? -3.479  15.177 71.645 1.00 48.18  ? 458  PHE A HA   1 
ATOM   3166  H  HB2  . PHE A 1 250 ? -1.582  13.863 71.633 1.00 47.93  ? 458  PHE A HB2  1 
ATOM   3167  H  HB3  . PHE A 1 250 ? -2.345  12.719 70.841 1.00 47.93  ? 458  PHE A HB3  1 
ATOM   3168  H  HD1  . PHE A 1 250 ? -1.180  16.040 70.394 1.00 45.25  ? 458  PHE A HD1  1 
ATOM   3169  H  HD2  . PHE A 1 250 ? -2.241  12.683 68.499 1.00 44.36  ? 458  PHE A HD2  1 
ATOM   3170  H  HE1  . PHE A 1 250 ? -0.456  16.942 68.396 1.00 42.62  ? 458  PHE A HE1  1 
ATOM   3171  H  HE2  . PHE A 1 250 ? -1.518  13.580 66.500 1.00 42.23  ? 458  PHE A HE2  1 
ATOM   3172  H  HZ   . PHE A 1 250 ? -0.624  15.714 66.444 1.00 43.67  ? 458  PHE A HZ   1 
ATOM   3173  N  N    . ILE A 1 251 ? -5.209  12.911 70.177 1.00 38.18  ? 459  ILE A N    1 
ATOM   3174  C  CA   . ILE A 1 251 ? -6.220  12.697 69.145 1.00 38.27  ? 459  ILE A CA   1 
ATOM   3175  C  C    . ILE A 1 251 ? -7.426  13.603 69.372 1.00 36.72  ? 459  ILE A C    1 
ATOM   3176  O  O    . ILE A 1 251 ? -7.946  14.214 68.429 1.00 34.79  ? 459  ILE A O    1 
ATOM   3177  C  CB   . ILE A 1 251 ? -6.621  11.209 69.108 1.00 41.60  ? 459  ILE A CB   1 
ATOM   3178  C  CG1  . ILE A 1 251 ? -5.493  10.387 68.475 1.00 42.94  ? 459  ILE A CG1  1 
ATOM   3179  C  CG2  . ILE A 1 251 ? -7.936  11.009 68.345 1.00 43.09  ? 459  ILE A CG2  1 
ATOM   3180  C  CD1  . ILE A 1 251 ? -5.539  8.914  68.808 1.00 44.72  ? 459  ILE A CD1  1 
ATOM   3181  H  H    . ILE A 1 251 ? -5.016  12.210 70.636 1.00 45.81  ? 459  ILE A H    1 
ATOM   3182  H  HA   . ILE A 1 251 ? -5.839  12.922 68.282 1.00 45.92  ? 459  ILE A HA   1 
ATOM   3183  H  HB   . ILE A 1 251 ? -6.747  10.904 70.020 1.00 49.92  ? 459  ILE A HB   1 
ATOM   3184  H  HG12 . ILE A 1 251 ? -5.549  10.473 67.510 1.00 51.53  ? 459  ILE A HG12 1 
ATOM   3185  H  HG13 . ILE A 1 251 ? -4.643  10.734 68.785 1.00 51.53  ? 459  ILE A HG13 1 
ATOM   3186  H  HG21 . ILE A 1 251 ? -8.157  10.064 68.341 1.00 51.71  ? 459  ILE A HG21 1 
ATOM   3187  H  HG22 . ILE A 1 251 ? -8.637  11.511 68.788 1.00 51.71  ? 459  ILE A HG22 1 
ATOM   3188  H  HG23 . ILE A 1 251 ? -7.824  11.326 67.435 1.00 51.71  ? 459  ILE A HG23 1 
ATOM   3189  H  HD11 . ILE A 1 251 ? -4.796  8.469  68.371 1.00 53.66  ? 459  ILE A HD11 1 
ATOM   3190  H  HD12 . ILE A 1 251 ? -5.470  8.806  69.770 1.00 53.66  ? 459  ILE A HD12 1 
ATOM   3191  H  HD13 . ILE A 1 251 ? -6.378  8.545  68.493 1.00 53.66  ? 459  ILE A HD13 1 
ATOM   3192  N  N    . ARG A 1 252 ? -7.896  13.700 70.617 1.00 38.42  ? 460  ARG A N    1 
ATOM   3193  C  CA   . ARG A 1 252 ? -9.088  14.500 70.889 1.00 43.47  ? 460  ARG A CA   1 
ATOM   3194  C  C    . ARG A 1 252 ? -8.803  15.994 70.760 1.00 40.27  ? 460  ARG A C    1 
ATOM   3195  O  O    . ARG A 1 252 ? -9.629  16.741 70.224 1.00 39.16  ? 460  ARG A O    1 
ATOM   3196  C  CB   . ARG A 1 252 ? -9.637  14.163 72.276 1.00 53.44  ? 460  ARG A CB   1 
ATOM   3197  C  CG   . ARG A 1 252 ? -10.180 12.735 72.385 1.00 62.98  ? 460  ARG A CG   1 
ATOM   3198  C  CD   . ARG A 1 252 ? -10.889 12.481 73.711 1.00 74.50  ? 460  ARG A CD   1 
ATOM   3199  N  NE   . ARG A 1 252 ? -10.286 13.224 74.819 1.00 82.78  ? 460  ARG A NE   1 
ATOM   3200  C  CZ   . ARG A 1 252 ? -9.371  12.740 75.656 1.00 86.14  ? 460  ARG A CZ   1 
ATOM   3201  N  NH1  . ARG A 1 252 ? -8.929  11.493 75.538 1.00 85.18  ? 460  ARG A NH1  1 
ATOM   3202  N  NH2  . ARG A 1 252 ? -8.895  13.513 76.625 1.00 88.07  ? 460  ARG A NH2  1 
ATOM   3203  H  H    . ARG A 1 252 ? -7.551  13.321 71.307 1.00 46.10  ? 460  ARG A H    1 
ATOM   3204  H  HA   . ARG A 1 252 ? -9.770  14.273 70.238 1.00 52.16  ? 460  ARG A HA   1 
ATOM   3205  H  HB2  . ARG A 1 252 ? -8.926  14.262 72.928 1.00 64.13  ? 460  ARG A HB2  1 
ATOM   3206  H  HB3  . ARG A 1 252 ? -10.362 14.774 72.484 1.00 64.13  ? 460  ARG A HB3  1 
ATOM   3207  H  HG2  . ARG A 1 252 ? -10.816 12.582 71.669 1.00 75.58  ? 460  ARG A HG2  1 
ATOM   3208  H  HG3  . ARG A 1 252 ? -9.442  12.110 72.313 1.00 75.58  ? 460  ARG A HG3  1 
ATOM   3209  H  HD2  . ARG A 1 252 ? -11.816 12.756 73.633 1.00 89.40  ? 460  ARG A HD2  1 
ATOM   3210  H  HD3  . ARG A 1 252 ? -10.840 11.535 73.921 1.00 89.40  ? 460  ARG A HD3  1 
ATOM   3211  H  HE   . ARG A 1 252 ? -10.543 14.036 74.938 1.00 99.34  ? 460  ARG A HE   1 
ATOM   3212  H  HH11 . ARG A 1 252 ? -9.232  10.986 74.913 1.00 102.22 ? 460  ARG A HH11 1 
ATOM   3213  H  HH12 . ARG A 1 252 ? -8.338  11.192 76.086 1.00 102.22 ? 460  ARG A HH12 1 
ATOM   3214  H  HH21 . ARG A 1 252 ? -9.178  14.321 76.708 1.00 105.69 ? 460  ARG A HH21 1 
ATOM   3215  H  HH22 . ARG A 1 252 ? -8.305  13.205 77.169 1.00 105.69 ? 460  ARG A HH22 1 
ATOM   3216  N  N    . LYS A 1 253 ? -7.640  16.452 71.234 1.00 41.58  ? 461  LYS A N    1 
ATOM   3217  C  CA   . LYS A 1 253 ? -7.320  17.876 71.151 1.00 46.19  ? 461  LYS A CA   1 
ATOM   3218  C  C    . LYS A 1 253 ? -7.162  18.327 69.703 1.00 41.30  ? 461  LYS A C    1 
ATOM   3219  O  O    . LYS A 1 253 ? -7.547  19.449 69.353 1.00 39.87  ? 461  LYS A O    1 
ATOM   3220  C  CB   . LYS A 1 253 ? -6.048  18.183 71.944 1.00 51.84  ? 461  LYS A CB   1 
ATOM   3221  C  CG   . LYS A 1 253 ? -6.205  18.061 73.452 1.00 57.73  ? 461  LYS A CG   1 
ATOM   3222  C  CD   . LYS A 1 253 ? -4.949  18.514 74.182 1.00 61.17  ? 461  LYS A CD   1 
ATOM   3223  C  CE   . LYS A 1 253 ? -4.674  19.993 73.952 1.00 64.16  ? 461  LYS A CE   1 
ATOM   3224  N  NZ   . LYS A 1 253 ? -5.777  20.856 74.463 1.00 66.89  ? 461  LYS A NZ   1 
ATOM   3225  H  H    . LYS A 1 253 ? -7.031  15.967 71.601 1.00 49.90  ? 461  LYS A H    1 
ATOM   3226  H  HA   . LYS A 1 253 ? -8.046  18.384 71.543 1.00 55.43  ? 461  LYS A HA   1 
ATOM   3227  N  N    . GLN A 1 254 ? -6.589  17.475 68.850 1.00 37.55  ? 462  GLN A N    1 
ATOM   3228  C  CA   . GLN A 1 254 ? -6.424  17.794 67.437 1.00 33.69  ? 462  GLN A CA   1 
ATOM   3229  C  C    . GLN A 1 254 ? -7.719  17.674 66.645 1.00 34.05  ? 462  GLN A C    1 
ATOM   3230  O  O    . GLN A 1 254 ? -7.747  18.062 65.473 1.00 33.21  ? 462  GLN A O    1 
ATOM   3231  C  CB   . GLN A 1 254 ? -5.375  16.871 66.804 1.00 33.47  ? 462  GLN A CB   1 
ATOM   3232  C  CG   . GLN A 1 254 ? -3.980  16.983 67.394 1.00 33.98  ? 462  GLN A CG   1 
ATOM   3233  C  CD   . GLN A 1 254 ? -3.231  18.216 66.917 1.00 33.41  ? 462  GLN A CD   1 
ATOM   3234  O  OE1  . GLN A 1 254 ? -2.964  19.130 67.695 1.00 36.19  ? 462  GLN A OE1  1 
ATOM   3235  N  NE2  . GLN A 1 254 ? -2.879  18.240 65.636 1.00 30.60  ? 462  GLN A NE2  1 
ATOM   3236  H  H    . GLN A 1 254 ? -6.288  16.700 69.070 1.00 45.06  ? 462  GLN A H    1 
ATOM   3237  H  HA   . GLN A 1 254 ? -6.107  18.707 67.356 1.00 40.42  ? 462  GLN A HA   1 
ATOM   3238  H  HB2  . GLN A 1 254 ? -5.666  15.952 66.915 1.00 40.16  ? 462  GLN A HB2  1 
ATOM   3239  H  HB3  . GLN A 1 254 ? -5.311  17.079 65.859 1.00 40.16  ? 462  GLN A HB3  1 
ATOM   3240  H  HG2  . GLN A 1 254 ? -4.048  17.030 68.360 1.00 40.78  ? 462  GLN A HG2  1 
ATOM   3241  H  HG3  . GLN A 1 254 ? -3.465  16.202 67.136 1.00 40.78  ? 462  GLN A HG3  1 
ATOM   3242  H  HE21 . GLN A 1 254 ? -3.082  17.581 65.122 1.00 36.72  ? 462  GLN A HE21 1 
ATOM   3243  H  HE22 . GLN A 1 254 ? -2.453  18.917 65.320 1.00 36.72  ? 462  GLN A HE22 1 
ATOM   3244  N  N    . GLY A 1 255 ? -8.782  17.141 67.243 1.00 36.55  ? 463  GLY A N    1 
ATOM   3245  C  CA   . GLY A 1 255 ? -9.988  16.854 66.488 1.00 35.42  ? 463  GLY A CA   1 
ATOM   3246  C  C    . GLY A 1 255 ? -9.784  15.831 65.394 1.00 34.63  ? 463  GLY A C    1 
ATOM   3247  O  O    . GLY A 1 255 ? -10.483 15.874 64.376 1.00 35.02  ? 463  GLY A O    1 
ATOM   3248  H  H    . GLY A 1 255 ? -8.826  16.939 68.078 1.00 43.86  ? 463  GLY A H    1 
ATOM   3249  H  HA2  . GLY A 1 255 ? -10.671 16.522 67.091 1.00 42.50  ? 463  GLY A HA2  1 
ATOM   3250  H  HA3  . GLY A 1 255 ? -10.313 17.673 66.082 1.00 42.50  ? 463  GLY A HA3  1 
ATOM   3251  N  N    . LEU A 1 256 ? -8.835  14.907 65.572 1.00 32.60  ? 464  LEU A N    1 
ATOM   3252  C  CA   . LEU A 1 256 ? -8.585  13.898 64.546 1.00 32.93  ? 464  LEU A CA   1 
ATOM   3253  C  C    . LEU A 1 256 ? -9.769  12.950 64.390 1.00 32.15  ? 464  LEU A C    1 
ATOM   3254  O  O    . LEU A 1 256 ? -9.973  12.392 63.305 1.00 32.45  ? 464  LEU A O    1 
ATOM   3255  C  CB   . LEU A 1 256 ? -7.311  13.116 64.874 1.00 36.65  ? 464  LEU A CB   1 
ATOM   3256  C  CG   . LEU A 1 256 ? -6.037  13.643 64.209 1.00 40.52  ? 464  LEU A CG   1 
ATOM   3257  C  CD1  . LEU A 1 256 ? -4.794  13.151 64.940 1.00 42.32  ? 464  LEU A CD1  1 
ATOM   3258  C  CD2  . LEU A 1 256 ? -5.997  13.223 62.744 1.00 39.83  ? 464  LEU A CD2  1 
ATOM   3259  H  H    . LEU A 1 256 ? -8.331  14.845 66.266 1.00 39.12  ? 464  LEU A H    1 
ATOM   3260  H  HA   . LEU A 1 256 ? -8.449  14.344 63.696 1.00 39.51  ? 464  LEU A HA   1 
ATOM   3261  H  HB2  . LEU A 1 256 ? -7.171  13.143 65.834 1.00 43.99  ? 464  LEU A HB2  1 
ATOM   3262  H  HB3  . LEU A 1 256 ? -7.431  12.197 64.589 1.00 43.99  ? 464  LEU A HB3  1 
ATOM   3263  H  HG   . LEU A 1 256 ? -6.041  14.612 64.243 1.00 48.63  ? 464  LEU A HG   1 
ATOM   3264  H  HD11 . LEU A 1 256 ? -4.007  13.502 64.494 1.00 50.79  ? 464  LEU A HD11 1 
ATOM   3265  H  HD12 . LEU A 1 256 ? -4.823  13.465 65.857 1.00 50.79  ? 464  LEU A HD12 1 
ATOM   3266  H  HD13 . LEU A 1 256 ? -4.780  12.182 64.922 1.00 50.79  ? 464  LEU A HD13 1 
ATOM   3267  H  HD21 . LEU A 1 256 ? -5.184  13.565 62.340 1.00 47.80  ? 464  LEU A HD21 1 
ATOM   3268  H  HD22 . LEU A 1 256 ? -6.010  12.254 62.693 1.00 47.80  ? 464  LEU A HD22 1 
ATOM   3269  H  HD23 . LEU A 1 256 ? -6.772  13.589 62.290 1.00 47.80  ? 464  LEU A HD23 1 
ATOM   3270  N  N    . ASP A 1 257 ? -10.560 12.760 65.445 1.00 31.95  ? 465  ASP A N    1 
ATOM   3271  C  CA   . ASP A 1 257 ? -11.744 11.915 65.376 1.00 33.69  ? 465  ASP A CA   1 
ATOM   3272  C  C    . ASP A 1 257 ? -12.981 12.671 64.889 1.00 33.94  ? 465  ASP A C    1 
ATOM   3273  O  O    . ASP A 1 257 ? -14.105 12.191 65.083 1.00 35.26  ? 465  ASP A O    1 
ATOM   3274  C  CB   . ASP A 1 257 ? -12.018 11.275 66.741 1.00 39.64  ? 465  ASP A CB   1 
ATOM   3275  C  CG   . ASP A 1 257 ? -12.174 12.296 67.852 1.00 45.21  ? 465  ASP A CG   1 
ATOM   3276  O  OD1  . ASP A 1 257 ? -11.938 13.500 67.610 1.00 44.82  ? 465  ASP A OD1  1 
ATOM   3277  O  OD2  . ASP A 1 257 ? -12.535 11.887 68.976 1.00 47.58  ? 465  ASP A OD2  1 
ATOM   3278  H  H    . ASP A 1 257 ? -10.429 13.114 66.217 1.00 38.35  ? 465  ASP A H    1 
ATOM   3279  H  HA   . ASP A 1 257 ? -11.574 11.198 64.746 1.00 40.42  ? 465  ASP A HA   1 
ATOM   3280  H  HB2  . ASP A 1 257 ? -12.839 10.761 66.689 1.00 47.57  ? 465  ASP A HB2  1 
ATOM   3281  H  HB3  . ASP A 1 257 ? -11.277 10.693 66.971 1.00 47.57  ? 465  ASP A HB3  1 
ATOM   3282  N  N    . ARG A 1 258 ? -12.799 13.830 64.255 1.00 34.87  ? 466  ARG A N    1 
ATOM   3283  C  CA   . ARG A 1 258 ? -13.894 14.618 63.707 1.00 37.50  ? 466  ARG A CA   1 
ATOM   3284  C  C    . ARG A 1 258 ? -13.683 14.823 62.211 1.00 36.48  ? 466  ARG A C    1 
ATOM   3285  O  O    . ARG A 1 258 ? -12.549 14.915 61.734 1.00 37.40  ? 466  ARG A O    1 
ATOM   3286  C  CB   . ARG A 1 258 ? -14.005 15.986 64.401 1.00 38.83  ? 466  ARG A CB   1 
ATOM   3287  C  CG   . ARG A 1 258 ? -13.839 15.943 65.916 1.00 42.82  ? 466  ARG A CG   1 
ATOM   3288  C  CD   . ARG A 1 258 ? -14.950 15.156 66.594 1.00 49.72  ? 466  ARG A CD   1 
ATOM   3289  N  NE   . ARG A 1 258 ? -15.880 16.032 67.300 1.00 55.22  ? 466  ARG A NE   1 
ATOM   3290  C  CZ   . ARG A 1 258 ? -15.752 16.405 68.571 1.00 57.65  ? 466  ARG A CZ   1 
ATOM   3291  N  NH1  . ARG A 1 258 ? -14.728 15.979 69.301 1.00 56.24  ? 466  ARG A NH1  1 
ATOM   3292  N  NH2  . ARG A 1 258 ? -16.655 17.209 69.115 1.00 60.99  ? 466  ARG A NH2  1 
ATOM   3293  H  H    . ARG A 1 258 ? -12.027 14.186 64.128 1.00 41.84  ? 466  ARG A H    1 
ATOM   3294  H  HA   . ARG A 1 258 ? -14.729 14.141 63.835 1.00 45.00  ? 466  ARG A HA   1 
ATOM   3295  H  HB2  . ARG A 1 258 ? -13.317 16.571 64.046 1.00 46.59  ? 466  ARG A HB2  1 
ATOM   3296  H  HB3  . ARG A 1 258 ? -14.880 16.359 64.212 1.00 46.59  ? 466  ARG A HB3  1 
ATOM   3297  H  HG2  . ARG A 1 258 ? -12.994 15.518 66.131 1.00 51.38  ? 466  ARG A HG2  1 
ATOM   3298  H  HG3  . ARG A 1 258 ? -13.855 16.849 66.263 1.00 51.38  ? 466  ARG A HG3  1 
ATOM   3299  H  HD2  . ARG A 1 258 ? -15.448 14.664 65.922 1.00 59.66  ? 466  ARG A HD2  1 
ATOM   3300  H  HD3  . ARG A 1 258 ? -14.561 14.544 67.238 1.00 59.66  ? 466  ARG A HD3  1 
ATOM   3301  H  HE   . ARG A 1 258 ? -16.560 16.328 66.864 1.00 66.26  ? 466  ARG A HE   1 
ATOM   3302  H  HH11 . ARG A 1 258 ? -14.139 15.458 68.953 1.00 67.49  ? 466  ARG A HH11 1 
ATOM   3303  H  HH12 . ARG A 1 258 ? -14.654 16.225 70.122 1.00 67.49  ? 466  ARG A HH12 1 
ATOM   3304  H  HH21 . ARG A 1 258 ? -17.321 17.488 68.647 1.00 73.20  ? 466  ARG A HH21 1 
ATOM   3305  H  HH22 . ARG A 1 258 ? -16.576 17.451 69.937 1.00 73.20  ? 466  ARG A HH22 1 
ATOM   3306  N  N    . LEU A 1 259 ? -14.788 14.899 61.475 1.00 36.21  ? 467  LEU A N    1 
ATOM   3307  C  CA   . LEU A 1 259 ? -14.747 15.085 60.031 1.00 34.33  ? 467  LEU A CA   1 
ATOM   3308  C  C    . LEU A 1 259 ? -14.818 16.572 59.701 1.00 33.85  ? 467  LEU A C    1 
ATOM   3309  O  O    . LEU A 1 259 ? -15.724 17.270 60.164 1.00 35.36  ? 467  LEU A O    1 
ATOM   3310  C  CB   . LEU A 1 259 ? -15.905 14.336 59.367 1.00 36.55  ? 467  LEU A CB   1 
ATOM   3311  C  CG   . LEU A 1 259 ? -15.908 14.298 57.838 1.00 37.85  ? 467  LEU A CG   1 
ATOM   3312  C  CD1  . LEU A 1 259 ? -14.715 13.508 57.314 1.00 37.67  ? 467  LEU A CD1  1 
ATOM   3313  C  CD2  . LEU A 1 259 ? -17.209 13.709 57.317 1.00 39.38  ? 467  LEU A CD2  1 
ATOM   3314  H  H    . LEU A 1 259 ? -15.584 14.843 61.795 1.00 43.46  ? 467  LEU A H    1 
ATOM   3315  H  HA   . LEU A 1 259 ? -13.913 14.733 59.683 1.00 41.19  ? 467  LEU A HA   1 
ATOM   3316  H  HB2  . LEU A 1 259 ? -15.888 13.417 59.677 1.00 43.87  ? 467  LEU A HB2  1 
ATOM   3317  H  HB3  . LEU A 1 259 ? -16.735 14.753 59.646 1.00 43.87  ? 467  LEU A HB3  1 
ATOM   3318  H  HG   . LEU A 1 259 ? -15.835 15.205 57.501 1.00 45.43  ? 467  LEU A HG   1 
ATOM   3319  H  HD11 . LEU A 1 259 ? -14.742 13.501 56.345 1.00 45.20  ? 467  LEU A HD11 1 
ATOM   3320  H  HD12 . LEU A 1 259 ? -13.898 13.932 57.620 1.00 45.20  ? 467  LEU A HD12 1 
ATOM   3321  H  HD13 . LEU A 1 259 ? -14.764 12.601 57.654 1.00 45.20  ? 467  LEU A HD13 1 
ATOM   3322  H  HD21 . LEU A 1 259 ? -17.184 13.697 56.348 1.00 47.26  ? 467  LEU A HD21 1 
ATOM   3323  H  HD22 . LEU A 1 259 ? -17.304 12.806 57.658 1.00 47.26  ? 467  LEU A HD22 1 
ATOM   3324  H  HD23 . LEU A 1 259 ? -17.947 14.258 57.623 1.00 47.26  ? 467  LEU A HD23 1 
ATOM   3325  N  N    . PHE A 1 260 ? -13.858 17.050 58.906 1.00 32.10  ? 468  PHE A N    1 
ATOM   3326  C  CA   . PHE A 1 260 ? -13.779 18.446 58.497 1.00 31.79  ? 468  PHE A CA   1 
ATOM   3327  C  C    . PHE A 1 260 ? -13.804 18.560 56.976 1.00 31.14  ? 468  PHE A C    1 
ATOM   3328  O  O    . PHE A 1 260 ? -13.421 17.633 56.256 1.00 32.91  ? 468  PHE A O    1 
ATOM   3329  C  CB   . PHE A 1 260 ? -12.500 19.117 59.025 1.00 32.10  ? 468  PHE A CB   1 
ATOM   3330  C  CG   . PHE A 1 260 ? -12.567 19.520 60.472 1.00 30.84  ? 468  PHE A CG   1 
ATOM   3331  C  CD1  . PHE A 1 260 ? -12.199 18.635 61.473 1.00 31.08  ? 468  PHE A CD1  1 
ATOM   3332  C  CD2  . PHE A 1 260 ? -12.977 20.793 60.827 1.00 32.73  ? 468  PHE A CD2  1 
ATOM   3333  C  CE1  . PHE A 1 260 ? -12.252 19.010 62.801 1.00 33.01  ? 468  PHE A CE1  1 
ATOM   3334  C  CE2  . PHE A 1 260 ? -13.030 21.175 62.152 1.00 34.63  ? 468  PHE A CE2  1 
ATOM   3335  C  CZ   . PHE A 1 260 ? -12.669 20.283 63.141 1.00 33.97  ? 468  PHE A CZ   1 
ATOM   3336  H  H    . PHE A 1 260 ? -13.224 16.566 58.584 1.00 38.52  ? 468  PHE A H    1 
ATOM   3337  H  HA   . PHE A 1 260 ? -14.543 18.927 58.851 1.00 38.15  ? 468  PHE A HA   1 
ATOM   3338  H  HB2  . PHE A 1 260 ? -11.760 18.497 58.926 1.00 38.52  ? 468  PHE A HB2  1 
ATOM   3339  H  HB3  . PHE A 1 260 ? -12.329 19.916 58.503 1.00 38.52  ? 468  PHE A HB3  1 
ATOM   3340  H  HD1  . PHE A 1 260 ? -11.919 17.777 61.248 1.00 37.30  ? 468  PHE A HD1  1 
ATOM   3341  H  HD2  . PHE A 1 260 ? -13.222 21.399 60.165 1.00 39.28  ? 468  PHE A HD2  1 
ATOM   3342  H  HE1  . PHE A 1 260 ? -12.007 18.407 63.465 1.00 39.61  ? 468  PHE A HE1  1 
ATOM   3343  H  HE2  . PHE A 1 260 ? -13.312 22.032 62.379 1.00 41.55  ? 468  PHE A HE2  1 
ATOM   3344  H  HZ   . PHE A 1 260 ? -12.706 20.538 64.035 1.00 40.76  ? 468  PHE A HZ   1 
ATOM   3345  N  N    . LEU A 1 261 ? -14.244 19.724 56.493 1.00 31.39  ? 469  LEU A N    1 
ATOM   3346  C  CA   . LEU A 1 261 ? -14.245 20.038 55.067 1.00 31.71  ? 469  LEU A CA   1 
ATOM   3347  C  C    . LEU A 1 261 ? -13.812 21.483 54.863 1.00 33.18  ? 469  LEU A C    1 
ATOM   3348  O  O    . LEU A 1 261 ? -14.345 22.388 55.512 1.00 32.82  ? 469  LEU A O    1 
ATOM   3349  C  CB   . LEU A 1 261 ? -15.632 19.821 54.450 1.00 35.92  ? 469  LEU A CB   1 
ATOM   3350  C  CG   . LEU A 1 261 ? -15.800 20.255 52.989 1.00 37.50  ? 469  LEU A CG   1 
ATOM   3351  C  CD1  . LEU A 1 261 ? -15.037 19.329 52.054 1.00 38.76  ? 469  LEU A CD1  1 
ATOM   3352  C  CD2  . LEU A 1 261 ? -17.271 20.302 52.620 1.00 38.43  ? 469  LEU A CD2  1 
ATOM   3353  H  H    . LEU A 1 261 ? -14.552 20.360 56.984 1.00 37.68  ? 469  LEU A H    1 
ATOM   3354  H  HA   . LEU A 1 261 ? -13.613 19.461 54.610 1.00 38.05  ? 469  LEU A HA   1 
ATOM   3355  H  HB2  . LEU A 1 261 ? -15.840 18.875 54.495 1.00 43.11  ? 469  LEU A HB2  1 
ATOM   3356  H  HB3  . LEU A 1 261 ? -16.279 20.318 54.975 1.00 43.11  ? 469  LEU A HB3  1 
ATOM   3357  H  HG   . LEU A 1 261 ? -15.439 21.149 52.884 1.00 45.00  ? 469  LEU A HG   1 
ATOM   3358  H  HD11 . LEU A 1 261 ? -15.164 19.630 51.140 1.00 46.51  ? 469  LEU A HD11 1 
ATOM   3359  H  HD12 . LEU A 1 261 ? -14.095 19.355 52.283 1.00 46.51  ? 469  LEU A HD12 1 
ATOM   3360  H  HD13 . LEU A 1 261 ? -15.379 18.427 52.156 1.00 46.51  ? 469  LEU A HD13 1 
ATOM   3361  H  HD21 . LEU A 1 261 ? -17.355 20.578 51.694 1.00 46.12  ? 469  LEU A HD21 1 
ATOM   3362  H  HD22 . LEU A 1 261 ? -17.654 19.418 52.738 1.00 46.12  ? 469  LEU A HD22 1 
ATOM   3363  H  HD23 . LEU A 1 261 ? -17.722 20.937 53.198 1.00 46.12  ? 469  LEU A HD23 1 
ATOM   3364  N  N    . GLU A 1 262 ? -12.863 21.699 53.950 1.00 32.03  ? 470  GLU A N    1 
ATOM   3365  C  CA   . GLU A 1 262 ? -12.413 23.044 53.608 1.00 34.32  ? 470  GLU A CA   1 
ATOM   3366  C  C    . GLU A 1 262 ? -13.214 23.559 52.418 1.00 39.97  ? 470  GLU A C    1 
ATOM   3367  O  O    . GLU A 1 262 ? -13.219 22.938 51.348 1.00 37.97  ? 470  GLU A O    1 
ATOM   3368  C  CB   . GLU A 1 262 ? -10.919 23.065 53.286 1.00 35.01  ? 470  GLU A CB   1 
ATOM   3369  C  CG   . GLU A 1 262 ? -10.406 24.454 52.913 1.00 34.74  ? 470  GLU A CG   1 
ATOM   3370  C  CD   . GLU A 1 262 ? -8.893  24.556 52.918 1.00 38.00  ? 470  GLU A CD   1 
ATOM   3371  O  OE1  . GLU A 1 262 ? -8.229  23.670 53.500 1.00 40.17  ? 470  GLU A OE1  1 
ATOM   3372  O  OE2  . GLU A 1 262 ? -8.364  25.528 52.338 1.00 40.33  ? 470  GLU A OE2  1 
ATOM   3373  H  H    . GLU A 1 262 ? -12.463 21.076 53.513 1.00 38.44  ? 470  GLU A H    1 
ATOM   3374  H  HA   . GLU A 1 262 ? -12.570 23.636 54.360 1.00 41.19  ? 470  GLU A HA   1 
ATOM   3375  H  HB2  . GLU A 1 262 ? -10.425 22.763 54.064 1.00 42.02  ? 470  GLU A HB2  1 
ATOM   3376  H  HB3  . GLU A 1 262 ? -10.750 22.473 52.536 1.00 42.02  ? 470  GLU A HB3  1 
ATOM   3377  H  HG2  . GLU A 1 262 ? -10.716 24.675 52.021 1.00 41.70  ? 470  GLU A HG2  1 
ATOM   3378  H  HG3  . GLU A 1 262 ? -10.750 25.098 53.551 1.00 41.70  ? 470  GLU A HG3  1 
ATOM   3379  N  N    . CYS A 1 263 ? -13.884 24.696 52.602 1.00 37.21  ? 471  CYS A N    1 
ATOM   3380  C  CA   . CYS A 1 263 ? -14.650 25.308 51.528 1.00 43.79  ? 471  CYS A CA   1 
ATOM   3381  C  C    . CYS A 1 263 ? -14.917 26.765 51.883 1.00 42.26  ? 471  CYS A C    1 
ATOM   3382  O  O    . CYS A 1 263 ? -15.210 27.082 53.038 1.00 41.06  ? 471  CYS A O    1 
ATOM   3383  C  CB   . CYS A 1 263 ? -15.965 24.557 51.297 1.00 51.65  ? 471  CYS A CB   1 
ATOM   3384  S  SG   . CYS A 1 263 ? -16.668 24.810 49.665 1.00 58.04  ? 471  CYS A SG   1 
ATOM   3385  H  H    . CYS A 1 263 ? -13.909 25.131 53.344 1.00 44.65  ? 471  CYS A H    1 
ATOM   3386  H  HA   . CYS A 1 263 ? -14.133 25.282 50.707 1.00 52.54  ? 471  CYS A HA   1 
ATOM   3387  H  HB2  . CYS A 1 263 ? -15.805 23.607 51.407 1.00 61.98  ? 471  CYS A HB2  1 
ATOM   3388  H  HB3  . CYS A 1 263 ? -16.615 24.859 51.950 1.00 61.98  ? 471  CYS A HB3  1 
ATOM   3389  H  HG   . CYS A 1 263 ? -17.689 24.186 49.579 1.00 69.65  ? 471  CYS A HG   1 
ATOM   3390  N  N    . ASP A 1 264 ? -14.810 27.644 50.884 1.00 40.96  ? 472  ASP A N    1 
ATOM   3391  C  CA   . ASP A 1 264 ? -14.989 29.085 51.083 1.00 41.61  ? 472  ASP A CA   1 
ATOM   3392  C  C    . ASP A 1 264 ? -14.015 29.626 52.130 1.00 38.17  ? 472  ASP A C    1 
ATOM   3393  O  O    . ASP A 1 264 ? -14.371 30.461 52.964 1.00 41.65  ? 472  ASP A O    1 
ATOM   3394  C  CB   . ASP A 1 264 ? -16.436 29.415 51.467 1.00 42.67  ? 472  ASP A CB   1 
ATOM   3395  C  CG   . ASP A 1 264 ? -17.369 29.463 50.267 1.00 43.82  ? 472  ASP A CG   1 
ATOM   3396  O  OD1  . ASP A 1 264 ? -16.872 29.472 49.121 1.00 45.23  ? 472  ASP A OD1  1 
ATOM   3397  O  OD2  . ASP A 1 264 ? -18.603 29.493 50.470 1.00 43.90  ? 472  ASP A OD2  1 
ATOM   3398  H  H    . ASP A 1 264 ? -14.631 27.428 50.071 1.00 49.15  ? 472  ASP A H    1 
ATOM   3399  H  HA   . ASP A 1 264 ? -14.798 29.537 50.246 1.00 49.93  ? 472  ASP A HA   1 
ATOM   3400  H  HB2  . ASP A 1 264 ? -16.765 28.735 52.075 1.00 51.21  ? 472  ASP A HB2  1 
ATOM   3401  H  HB3  . ASP A 1 264 ? -16.458 30.284 51.898 1.00 51.21  ? 472  ASP A HB3  1 
ATOM   3402  N  N    . ALA A 1 265 ? -12.769 29.151 52.082 1.00 34.28  ? 473  ALA A N    1 
ATOM   3403  C  CA   . ALA A 1 265 ? -11.722 29.599 53.002 1.00 35.06  ? 473  ALA A CA   1 
ATOM   3404  C  C    . ALA A 1 265 ? -12.144 29.418 54.460 1.00 35.86  ? 473  ALA A C    1 
ATOM   3405  O  O    . ALA A 1 265 ? -11.882 30.269 55.313 1.00 31.79  ? 473  ALA A O    1 
ATOM   3406  C  CB   . ALA A 1 265 ? -11.335 31.054 52.728 1.00 38.37  ? 473  ALA A CB   1 
ATOM   3407  H  H    . ALA A 1 265 ? -12.502 28.560 51.517 1.00 41.14  ? 473  ALA A H    1 
ATOM   3408  H  HA   . ALA A 1 265 ? -10.932 29.055 52.857 1.00 42.07  ? 473  ALA A HA   1 
ATOM   3409  H  HB1  . ALA A 1 265 ? -10.641 31.320 53.352 1.00 46.05  ? 473  ALA A HB1  1 
ATOM   3410  H  HB2  . ALA A 1 265 ? -11.007 31.127 51.818 1.00 46.05  ? 473  ALA A HB2  1 
ATOM   3411  H  HB3  . ALA A 1 265 ? -12.117 31.616 52.844 1.00 46.05  ? 473  ALA A HB3  1 
ATOM   3412  N  N    . HIS A 1 266 ? -12.788 28.289 54.749 1.00 36.51  ? 474  HIS A N    1 
ATOM   3413  C  CA   . HIS A 1 266 ? -13.237 27.958 56.094 1.00 34.63  ? 474  HIS A CA   1 
ATOM   3414  C  C    . HIS A 1 266 ? -13.176 26.446 56.267 1.00 34.30  ? 474  HIS A C    1 
ATOM   3415  O  O    . HIS A 1 266 ? -13.414 25.694 55.318 1.00 31.30  ? 474  HIS A O    1 
ATOM   3416  C  CB   . HIS A 1 266 ? -14.664 28.465 56.339 1.00 37.67  ? 474  HIS A CB   1 
ATOM   3417  C  CG   . HIS A 1 266 ? -15.118 28.350 57.760 1.00 38.08  ? 474  HIS A CG   1 
ATOM   3418  N  ND1  . HIS A 1 266 ? -15.047 29.400 58.650 1.00 37.77  ? 474  HIS A ND1  1 
ATOM   3419  C  CD2  . HIS A 1 266 ? -15.657 27.312 58.444 1.00 38.04  ? 474  HIS A CD2  1 
ATOM   3420  C  CE1  . HIS A 1 266 ? -15.520 29.014 59.822 1.00 39.11  ? 474  HIS A CE1  1 
ATOM   3421  N  NE2  . HIS A 1 266 ? -15.896 27.751 59.724 1.00 39.65  ? 474  HIS A NE2  1 
ATOM   3422  H  H    . HIS A 1 266 ? -12.980 27.685 54.167 1.00 43.81  ? 474  HIS A H    1 
ATOM   3423  H  HA   . HIS A 1 266 ? -12.647 28.369 56.745 1.00 41.56  ? 474  HIS A HA   1 
ATOM   3424  H  HB2  . HIS A 1 266 ? -14.709 29.402 56.089 1.00 45.21  ? 474  HIS A HB2  1 
ATOM   3425  H  HB3  . HIS A 1 266 ? -15.276 27.950 55.790 1.00 45.21  ? 474  HIS A HB3  1 
ATOM   3426  H  HD2  . HIS A 1 266 ? -15.831 26.462 58.110 1.00 45.65  ? 474  HIS A HD2  1 
ATOM   3427  H  HE1  . HIS A 1 266 ? -15.577 29.541 60.586 1.00 46.93  ? 474  HIS A HE1  1 
ATOM   3428  H  HE2  . HIS A 1 266 ? -16.235 27.280 60.358 1.00 47.59  ? 474  HIS A HE2  1 
ATOM   3429  N  N    . MET A 1 267 ? -12.854 26.004 57.486 1.00 31.47  ? 475  MET A N    1 
ATOM   3430  C  CA   . MET A 1 267 ? -12.849 24.584 57.834 1.00 32.26  ? 475  MET A CA   1 
ATOM   3431  C  C    . MET A 1 267 ? -14.124 24.262 58.609 1.00 34.41  ? 475  MET A C    1 
ATOM   3432  O  O    . MET A 1 267 ? -14.256 24.626 59.783 1.00 34.36  ? 475  MET A O    1 
ATOM   3433  C  CB   . MET A 1 267 ? -11.607 24.226 58.646 1.00 31.87  ? 475  MET A CB   1 
ATOM   3434  C  CG   . MET A 1 267 ? -10.349 24.093 57.805 1.00 32.44  ? 475  MET A CG   1 
ATOM   3435  S  SD   . MET A 1 267 ? -10.392 22.629 56.747 1.00 34.31  ? 475  MET A SD   1 
ATOM   3436  C  CE   . MET A 1 267 ? -9.667  21.399 57.829 1.00 32.25  ? 475  MET A CE   1 
ATOM   3437  H  H    . MET A 1 267 ? -12.632 26.518 58.139 1.00 37.77  ? 475  MET A H    1 
ATOM   3438  H  HA   . MET A 1 267 ? -12.835 24.059 57.018 1.00 38.71  ? 475  MET A HA   1 
ATOM   3439  H  HB2  . MET A 1 267 ? -11.452 24.921 59.304 1.00 38.25  ? 475  MET A HB2  1 
ATOM   3440  H  HB3  . MET A 1 267 ? -11.757 23.378 59.091 1.00 38.25  ? 475  MET A HB3  1 
ATOM   3441  H  HG2  . MET A 1 267 ? -10.262 24.874 57.237 1.00 38.93  ? 475  MET A HG2  1 
ATOM   3442  H  HG3  . MET A 1 267 ? -9.580  24.019 58.392 1.00 38.93  ? 475  MET A HG3  1 
ATOM   3443  H  HE1  . MET A 1 267 ? -9.635  20.549 57.364 1.00 38.71  ? 475  MET A HE1  1 
ATOM   3444  H  HE2  . MET A 1 267 ? -8.770  21.680 58.069 1.00 38.71  ? 475  MET A HE2  1 
ATOM   3445  H  HE3  . MET A 1 267 ? -10.214 21.320 58.627 1.00 38.71  ? 475  MET A HE3  1 
ATOM   3446  N  N    . TRP A 1 268 ? -15.056 23.571 57.953 1.00 37.90  ? 476  TRP A N    1 
ATOM   3447  C  CA   . TRP A 1 268 ? -16.352 23.248 58.538 1.00 35.92  ? 476  TRP A CA   1 
ATOM   3448  C  C    . TRP A 1 268 ? -16.298 21.881 59.210 1.00 34.10  ? 476  TRP A C    1 
ATOM   3449  O  O    . TRP A 1 268 ? -15.855 20.904 58.599 1.00 31.46  ? 476  TRP A O    1 
ATOM   3450  C  CB   . TRP A 1 268 ? -17.443 23.252 57.465 1.00 37.21  ? 476  TRP A CB   1 
ATOM   3451  C  CG   . TRP A 1 268 ? -17.491 24.506 56.652 1.00 38.56  ? 476  TRP A CG   1 
ATOM   3452  C  CD1  . TRP A 1 268 ? -16.892 24.725 55.445 1.00 38.77  ? 476  TRP A CD1  1 
ATOM   3453  C  CD2  . TRP A 1 268 ? -18.176 25.721 56.987 1.00 39.05  ? 476  TRP A CD2  1 
ATOM   3454  N  NE1  . TRP A 1 268 ? -17.160 26.003 55.009 1.00 39.94  ? 476  TRP A NE1  1 
ATOM   3455  C  CE2  . TRP A 1 268 ? -17.947 26.633 55.938 1.00 39.56  ? 476  TRP A CE2  1 
ATOM   3456  C  CE3  . TRP A 1 268 ? -18.959 26.124 58.072 1.00 38.39  ? 476  TRP A CE3  1 
ATOM   3457  C  CZ2  . TRP A 1 268 ? -18.473 27.924 55.943 1.00 39.66  ? 476  TRP A CZ2  1 
ATOM   3458  C  CZ3  . TRP A 1 268 ? -19.479 27.406 58.075 1.00 40.58  ? 476  TRP A CZ3  1 
ATOM   3459  C  CH2  . TRP A 1 268 ? -19.234 28.290 57.019 1.00 40.76  ? 476  TRP A CH2  1 
ATOM   3460  H  H    . TRP A 1 268 ? -14.957 23.274 57.151 1.00 45.49  ? 476  TRP A H    1 
ATOM   3461  H  HA   . TRP A 1 268 ? -16.578 23.911 59.209 1.00 43.10  ? 476  TRP A HA   1 
ATOM   3462  H  HB2  . TRP A 1 268 ? -17.287 22.512 56.858 1.00 44.65  ? 476  TRP A HB2  1 
ATOM   3463  H  HB3  . TRP A 1 268 ? -18.306 23.146 57.896 1.00 44.65  ? 476  TRP A HB3  1 
ATOM   3464  H  HD1  . TRP A 1 268 ? -16.376 24.103 54.986 1.00 46.53  ? 476  TRP A HD1  1 
ATOM   3465  H  HE1  . TRP A 1 268 ? -16.881 26.349 54.273 1.00 47.93  ? 476  TRP A HE1  1 
ATOM   3466  H  HE3  . TRP A 1 268 ? -19.125 25.543 58.779 1.00 46.07  ? 476  TRP A HE3  1 
ATOM   3467  H  HZ2  . TRP A 1 268 ? -18.313 28.514 55.242 1.00 47.59  ? 476  TRP A HZ2  1 
ATOM   3468  H  HZ3  . TRP A 1 268 ? -20.002 27.685 58.792 1.00 48.70  ? 476  TRP A HZ3  1 
ATOM   3469  H  HH2  . TRP A 1 268 ? -19.599 29.145 57.048 1.00 48.92  ? 476  TRP A HH2  1 
ATOM   3470  N  N    . ARG A 1 269 ? -16.767 21.809 60.456 1.00 35.48  ? 477  ARG A N    1 
ATOM   3471  C  CA   . ARG A 1 269 ? -16.859 20.543 61.175 1.00 37.99  ? 477  ARG A CA   1 
ATOM   3472  C  C    . ARG A 1 269 ? -18.216 19.905 60.899 1.00 36.92  ? 477  ARG A C    1 
ATOM   3473  O  O    . ARG A 1 269 ? -19.257 20.531 61.121 1.00 35.18  ? 477  ARG A O    1 
ATOM   3474  C  CB   . ARG A 1 269 ? -16.665 20.746 62.678 1.00 39.36  ? 477  ARG A CB   1 
ATOM   3475  C  CG   . ARG A 1 269 ? -16.464 19.437 63.440 1.00 43.78  ? 477  ARG A CG   1 
ATOM   3476  C  CD   . ARG A 1 269 ? -16.032 19.653 64.885 1.00 48.43  ? 477  ARG A CD   1 
ATOM   3477  N  NE   . ARG A 1 269 ? -17.170 19.808 65.792 1.00 52.76  ? 477  ARG A NE   1 
ATOM   3478  C  CZ   . ARG A 1 269 ? -17.494 20.927 66.435 1.00 55.67  ? 477  ARG A CZ   1 
ATOM   3479  N  NH1  . ARG A 1 269 ? -16.772 22.033 66.300 1.00 55.48  ? 477  ARG A NH1  1 
ATOM   3480  N  NH2  . ARG A 1 269 ? -18.552 20.938 67.232 1.00 58.52  ? 477  ARG A NH2  1 
ATOM   3481  H  H    . ARG A 1 269 ? -17.041 22.487 60.908 1.00 42.58  ? 477  ARG A H    1 
ATOM   3482  H  HA   . ARG A 1 269 ? -16.168 19.942 60.856 1.00 45.59  ? 477  ARG A HA   1 
ATOM   3483  H  HB2  . ARG A 1 269 ? -15.881 21.299 62.823 1.00 47.24  ? 477  ARG A HB2  1 
ATOM   3484  H  HB3  . ARG A 1 269 ? -17.450 21.185 63.041 1.00 47.24  ? 477  ARG A HB3  1 
ATOM   3485  H  HG2  . ARG A 1 269 ? -17.300 18.945 63.447 1.00 52.54  ? 477  ARG A HG2  1 
ATOM   3486  H  HG3  . ARG A 1 269 ? -15.776 18.917 62.996 1.00 52.54  ? 477  ARG A HG3  1 
ATOM   3487  H  HD2  . ARG A 1 269 ? -15.515 18.887 65.179 1.00 58.12  ? 477  ARG A HD2  1 
ATOM   3488  H  HD3  . ARG A 1 269 ? -15.493 20.458 64.938 1.00 58.12  ? 477  ARG A HD3  1 
ATOM   3489  H  HE   . ARG A 1 269 ? -17.670 19.120 65.920 1.00 63.31  ? 477  ARG A HE   1 
ATOM   3490  H  HH11 . ARG A 1 269 ? -16.082 22.037 65.785 1.00 66.58  ? 477  ARG A HH11 1 
ATOM   3491  H  HH12 . ARG A 1 269 ? -16.995 22.747 66.724 1.00 66.58  ? 477  ARG A HH12 1 
ATOM   3492  H  HH21 . ARG A 1 269 ? -19.026 20.226 67.328 1.00 70.23  ? 477  ARG A HH21 1 
ATOM   3493  H  HH22 . ARG A 1 269 ? -18.767 21.657 67.652 1.00 70.23  ? 477  ARG A HH22 1 
ATOM   3494  N  N    . LEU A 1 270 ? -18.200 18.656 60.422 1.00 38.49  ? 478  LEU A N    1 
ATOM   3495  C  CA   . LEU A 1 270 ? -19.407 18.003 59.927 1.00 41.16  ? 478  LEU A CA   1 
ATOM   3496  C  C    . LEU A 1 270 ? -19.860 16.804 60.748 1.00 44.18  ? 478  LEU A C    1 
ATOM   3497  O  O    . LEU A 1 270 ? -20.943 16.271 60.477 1.00 44.41  ? 478  LEU A O    1 
ATOM   3498  C  CB   . LEU A 1 270 ? -19.206 17.549 58.473 1.00 40.07  ? 478  LEU A CB   1 
ATOM   3499  C  CG   . LEU A 1 270 ? -18.823 18.635 57.463 1.00 41.38  ? 478  LEU A CG   1 
ATOM   3500  C  CD1  . LEU A 1 270 ? -18.882 18.071 56.053 1.00 43.01  ? 478  LEU A CD1  1 
ATOM   3501  C  CD2  . LEU A 1 270 ? -19.717 19.864 57.588 1.00 41.95  ? 478  LEU A CD2  1 
ATOM   3502  H  H    . LEU A 1 270 ? -17.495 18.165 60.376 1.00 46.19  ? 478  LEU A H    1 
ATOM   3503  H  HA   . LEU A 1 270 ? -20.130 18.650 59.934 1.00 49.39  ? 478  LEU A HA   1 
ATOM   3504  H  HB2  . LEU A 1 270 ? -18.502 16.882 58.458 1.00 48.08  ? 478  LEU A HB2  1 
ATOM   3505  H  HB3  . LEU A 1 270 ? -20.033 17.149 58.163 1.00 48.08  ? 478  LEU A HB3  1 
ATOM   3506  H  HG   . LEU A 1 270 ? -17.910 18.913 57.634 1.00 49.66  ? 478  LEU A HG   1 
ATOM   3507  H  HD11 . LEU A 1 270 ? -18.637 18.769 55.425 1.00 51.62  ? 478  LEU A HD11 1 
ATOM   3508  H  HD12 . LEU A 1 270 ? -18.260 17.330 55.984 1.00 51.62  ? 478  LEU A HD12 1 
ATOM   3509  H  HD13 . LEU A 1 270 ? -19.784 17.765 55.873 1.00 51.62  ? 478  LEU A HD13 1 
ATOM   3510  H  HD21 . LEU A 1 270 ? -19.628 20.229 58.483 1.00 50.34  ? 478  LEU A HD21 1 
ATOM   3511  H  HD22 . LEU A 1 270 ? -19.440 20.524 56.933 1.00 50.34  ? 478  LEU A HD22 1 
ATOM   3512  H  HD23 . LEU A 1 270 ? -20.637 19.603 57.427 1.00 50.34  ? 478  LEU A HD23 1 
ATOM   3513  N  N    . GLY A 1 271 ? -19.085 16.358 61.721 1.00 46.75  ? 479  GLY A N    1 
ATOM   3514  C  CA   . GLY A 1 271 ? -19.507 15.266 62.571 1.00 49.61  ? 479  GLY A CA   1 
ATOM   3515  C  C    . GLY A 1 271 ? -18.320 14.446 63.030 1.00 50.80  ? 479  GLY A C    1 
ATOM   3516  O  O    . GLY A 1 271 ? -17.171 14.860 62.911 1.00 46.72  ? 479  GLY A O    1 
ATOM   3517  H  H    . GLY A 1 271 ? -18.307 16.674 61.909 1.00 56.10  ? 479  GLY A H    1 
ATOM   3518  H  HA2  . GLY A 1 271 ? -19.965 15.616 63.351 1.00 59.54  ? 479  GLY A HA2  1 
ATOM   3519  H  HA3  . GLY A 1 271 ? -20.116 14.689 62.085 1.00 59.54  ? 479  GLY A HA3  1 
ATOM   3520  N  N    . ASP A 1 272 ? -18.633 13.266 63.558 1.00 55.32  ? 480  ASP A N    1 
ATOM   3521  C  CA   . ASP A 1 272 ? -17.639 12.357 64.104 1.00 58.62  ? 480  ASP A CA   1 
ATOM   3522  C  C    . ASP A 1 272 ? -17.200 11.336 63.057 1.00 52.55  ? 480  ASP A C    1 
ATOM   3523  O  O    . ASP A 1 272 ? -17.827 11.163 62.010 1.00 51.21  ? 480  ASP A O    1 
ATOM   3524  C  CB   . ASP A 1 272 ? -18.193 11.634 65.333 1.00 69.13  ? 480  ASP A CB   1 
ATOM   3525  C  CG   . ASP A 1 272 ? -18.525 12.581 66.469 1.00 77.60  ? 480  ASP A CG   1 
ATOM   3526  O  OD1  . ASP A 1 272 ? -17.866 13.637 66.575 1.00 78.79  ? 480  ASP A OD1  1 
ATOM   3527  O  OD2  . ASP A 1 272 ? -19.445 12.270 67.256 1.00 81.55  ? 480  ASP A OD2  1 
ATOM   3528  H  H    . ASP A 1 272 ? -19.437 12.965 63.611 1.00 66.39  ? 480  ASP A H    1 
ATOM   3529  H  HA   . ASP A 1 272 ? -16.859 12.864 64.378 1.00 70.35  ? 480  ASP A HA   1 
ATOM   3530  H  HB2  . ASP A 1 272 ? -19.006 11.166 65.085 1.00 82.96  ? 480  ASP A HB2  1 
ATOM   3531  H  HB3  . ASP A 1 272 ? -17.531 11.001 65.654 1.00 82.96  ? 480  ASP A HB3  1 
ATOM   3532  N  N    . ARG A 1 273 ? -16.101 10.650 63.362 1.00 48.06  ? 481  ARG A N    1 
ATOM   3533  C  CA   . ARG A 1 273 ? -15.612 9.565  62.525 1.00 45.75  ? 481  ARG A CA   1 
ATOM   3534  C  C    . ARG A 1 273 ? -14.706 8.682  63.368 1.00 46.92  ? 481  ARG A C    1 
ATOM   3535  O  O    . ARG A 1 273 ? -14.165 9.111  64.391 1.00 48.18  ? 481  ARG A O    1 
ATOM   3536  C  CB   . ARG A 1 273 ? -14.858 10.089 61.301 1.00 42.52  ? 481  ARG A CB   1 
ATOM   3537  C  CG   . ARG A 1 273 ? -13.615 10.887 61.651 1.00 40.31  ? 481  ARG A CG   1 
ATOM   3538  C  CD   . ARG A 1 273 ? -12.783 11.184 60.428 1.00 39.44  ? 481  ARG A CD   1 
ATOM   3539  N  NE   . ARG A 1 273 ? -11.595 11.955 60.773 1.00 38.32  ? 481  ARG A NE   1 
ATOM   3540  C  CZ   . ARG A 1 273 ? -10.797 12.537 59.887 1.00 36.40  ? 481  ARG A CZ   1 
ATOM   3541  N  NH1  . ARG A 1 273 ? -11.058 12.440 58.589 1.00 36.15  ? 481  ARG A NH1  1 
ATOM   3542  N  NH2  . ARG A 1 273 ? -9.740  13.221 60.301 1.00 34.62  ? 481  ARG A NH2  1 
ATOM   3543  H  H    . ARG A 1 273 ? -15.618 10.798 64.057 1.00 57.68  ? 481  ARG A H    1 
ATOM   3544  H  HA   . ARG A 1 273 ? -16.361 9.032  62.218 1.00 54.91  ? 481  ARG A HA   1 
ATOM   3545  H  HB2  . ARG A 1 273 ? -14.584 9.335  60.755 1.00 51.02  ? 481  ARG A HB2  1 
ATOM   3546  H  HB3  . ARG A 1 273 ? -15.449 10.667 60.793 1.00 51.02  ? 481  ARG A HB3  1 
ATOM   3547  H  HG2  . ARG A 1 273 ? -13.878 11.730 62.051 1.00 48.37  ? 481  ARG A HG2  1 
ATOM   3548  H  HG3  . ARG A 1 273 ? -13.071 10.376 62.271 1.00 48.37  ? 481  ARG A HG3  1 
ATOM   3549  H  HD2  . ARG A 1 273 ? -12.497 10.349 60.024 1.00 47.33  ? 481  ARG A HD2  1 
ATOM   3550  H  HD3  . ARG A 1 273 ? -13.310 11.700 59.799 1.00 47.33  ? 481  ARG A HD3  1 
ATOM   3551  H  HE   . ARG A 1 273 ? -11.399 12.039 61.606 1.00 45.99  ? 481  ARG A HE   1 
ATOM   3552  H  HH11 . ARG A 1 273 ? -11.745 11.997 58.321 1.00 43.38  ? 481  ARG A HH11 1 
ATOM   3553  H  HH12 . ARG A 1 273 ? -10.540 12.819 58.017 1.00 43.38  ? 481  ARG A HH12 1 
ATOM   3554  H  HH21 . ARG A 1 273 ? -9.571  13.285 61.142 1.00 41.55  ? 481  ARG A HH21 1 
ATOM   3555  H  HH22 . ARG A 1 273 ? -9.221  13.600 59.729 1.00 41.55  ? 481  ARG A HH22 1 
ATOM   3556  N  N    . ARG A 1 274 ? -14.537 7.446  62.917 1.00 46.32  ? 482  ARG A N    1 
ATOM   3557  C  CA   . ARG A 1 274 ? -13.717 6.479  63.629 1.00 46.38  ? 482  ARG A CA   1 
ATOM   3558  C  C    . ARG A 1 274 ? -12.270 6.561  63.166 1.00 45.17  ? 482  ARG A C    1 
ATOM   3559  O  O    . ARG A 1 274 ? -11.992 6.797  61.986 1.00 44.39  ? 482  ARG A O    1 
ATOM   3560  C  CB   . ARG A 1 274 ? -14.250 5.060  63.419 1.00 46.12  ? 482  ARG A CB   1 
ATOM   3561  C  CG   . ARG A 1 274 ? -15.654 4.846  63.958 1.00 46.67  ? 482  ARG A CG   1 
ATOM   3562  H  H    . ARG A 1 274 ? -14.889 7.140  62.194 1.00 55.58  ? 482  ARG A H    1 
ATOM   3563  H  HA   . ARG A 1 274 ? -13.744 6.676  64.579 1.00 55.65  ? 482  ARG A HA   1 
ATOM   3564  H  HB2  . ARG A 1 274 ? -14.266 4.870  62.468 1.00 55.34  ? 482  ARG A HB2  1 
ATOM   3565  H  HB3  . ARG A 1 274 ? -13.661 4.435  63.869 1.00 55.34  ? 482  ARG A HB3  1 
ATOM   3566  H  HG2  . ARG A 1 274 ? -15.682 4.005  64.440 1.00 56.01  ? 482  ARG A HG2  1 
ATOM   3567  H  HG3  . ARG A 1 274 ? -15.879 5.578  64.553 1.00 56.01  ? 482  ARG A HG3  1 
ATOM   3568  N  N    . ILE A 1 275 ? -11.354 6.380  64.107 1.00 45.32  ? 483  ILE A N    1 
ATOM   3569  C  CA   . ILE A 1 275 ? -9.944  6.189  63.756 1.00 44.85  ? 483  ILE A CA   1 
ATOM   3570  C  C    . ILE A 1 275 ? -9.795  4.843  63.053 1.00 45.58  ? 483  ILE A C    1 
ATOM   3571  O  O    . ILE A 1 275 ? -10.312 3.831  63.555 1.00 48.10  ? 483  ILE A O    1 
ATOM   3572  C  CB   . ILE A 1 275 ? -9.070  6.250  65.010 1.00 44.55  ? 483  ILE A CB   1 
ATOM   3573  C  CG1  . ILE A 1 275 ? -9.276  7.577  65.749 1.00 45.11  ? 483  ILE A CG1  1 
ATOM   3574  C  CG2  . ILE A 1 275 ? -7.600  6.059  64.649 1.00 42.39  ? 483  ILE A CG2  1 
ATOM   3575  C  CD1  . ILE A 1 275 ? -8.912  8.810  64.937 1.00 42.69  ? 483  ILE A CD1  1 
ATOM   3576  H  H    . ILE A 1 275 ? -11.516 6.363  64.952 1.00 54.39  ? 483  ILE A H    1 
ATOM   3577  H  HA   . ILE A 1 275 ? -9.662  6.889  63.147 1.00 53.82  ? 483  ILE A HA   1 
ATOM   3578  H  HB   . ILE A 1 275 ? -9.335  5.528  65.602 1.00 53.46  ? 483  ILE A HB   1 
ATOM   3579  H  HG12 . ILE A 1 275 ? -10.211 7.653  65.996 1.00 54.13  ? 483  ILE A HG12 1 
ATOM   3580  H  HG13 . ILE A 1 275 ? -8.726  7.577  66.548 1.00 54.13  ? 483  ILE A HG13 1 
ATOM   3581  H  HG21 . ILE A 1 275 ? -7.068  6.102  65.459 1.00 50.87  ? 483  ILE A HG21 1 
ATOM   3582  H  HG22 . ILE A 1 275 ? -7.489  5.193  64.226 1.00 50.87  ? 483  ILE A HG22 1 
ATOM   3583  H  HG23 . ILE A 1 275 ? -7.331  6.763  64.038 1.00 50.87  ? 483  ILE A HG23 1 
ATOM   3584  H  HD11 . ILE A 1 275 ? -9.072  9.601  65.475 1.00 51.23  ? 483  ILE A HD11 1 
ATOM   3585  H  HD12 . ILE A 1 275 ? -7.975  8.760  64.691 1.00 51.23  ? 483  ILE A HD12 1 
ATOM   3586  H  HD13 . ILE A 1 275 ? -9.463  8.836  64.139 1.00 51.23  ? 483  ILE A HD13 1 
ATOM   3587  N  N    . PRO A 1 276 ? -9.117  4.767  61.908 1.00 46.20  ? 484  PRO A N    1 
ATOM   3588  C  CA   . PRO A 1 276 ? -8.990  3.473  61.225 1.00 47.15  ? 484  PRO A CA   1 
ATOM   3589  C  C    . PRO A 1 276 ? -8.254  2.461  62.092 1.00 46.60  ? 484  PRO A C    1 
ATOM   3590  O  O    . PRO A 1 276 ? -7.328  2.803  62.831 1.00 45.75  ? 484  PRO A O    1 
ATOM   3591  C  CB   . PRO A 1 276 ? -8.200  3.812  59.955 1.00 46.77  ? 484  PRO A CB   1 
ATOM   3592  C  CG   . PRO A 1 276 ? -8.322  5.289  59.792 1.00 46.14  ? 484  PRO A CG   1 
ATOM   3593  C  CD   . PRO A 1 276 ? -8.437  5.845  61.170 1.00 44.93  ? 484  PRO A CD   1 
ATOM   3594  H  HA   . PRO A 1 276 ? -9.863  3.126  60.985 1.00 56.58  ? 484  PRO A HA   1 
ATOM   3595  H  HB2  . PRO A 1 276 ? -7.272  3.556  60.071 1.00 56.13  ? 484  PRO A HB2  1 
ATOM   3596  H  HB3  . PRO A 1 276 ? -8.590  3.350  59.196 1.00 56.13  ? 484  PRO A HB3  1 
ATOM   3597  H  HG2  . PRO A 1 276 ? -7.529  5.633  59.350 1.00 55.37  ? 484  PRO A HG2  1 
ATOM   3598  H  HG3  . PRO A 1 276 ? -9.116  5.494  59.274 1.00 55.37  ? 484  PRO A HG3  1 
ATOM   3599  H  HD2  . PRO A 1 276 ? -7.557  6.009  61.544 1.00 53.92  ? 484  PRO A HD2  1 
ATOM   3600  H  HD3  . PRO A 1 276 ? -8.979  6.649  61.167 1.00 53.92  ? 484  PRO A HD3  1 
ATOM   3601  N  N    . GLU A 1 277 ? -8.673  1.206  61.992 1.00 47.14  ? 485  GLU A N    1 
ATOM   3602  C  CA   . GLU A 1 277 ? -8.068  0.131  62.763 1.00 47.12  ? 485  GLU A CA   1 
ATOM   3603  C  C    . GLU A 1 277 ? -6.836  -0.418 62.049 1.00 43.14  ? 485  GLU A C    1 
ATOM   3604  O  O    . GLU A 1 277 ? -6.696  -0.319 60.828 1.00 41.61  ? 485  GLU A O    1 
ATOM   3605  C  CB   . GLU A 1 277 ? -9.077  -0.995 63.000 1.00 48.80  ? 485  GLU A CB   1 
ATOM   3606  H  H    . GLU A 1 277 ? -9.314  0.949  61.478 1.00 56.56  ? 485  GLU A H    1 
ATOM   3607  H  HA   . GLU A 1 277 ? -7.790  0.476  63.626 1.00 56.55  ? 485  GLU A HA   1 
ATOM   3608  N  N    . GLY A 1 278 ? -5.935  -1.001 62.838 1.00 42.74  ? 486  GLY A N    1 
ATOM   3609  C  CA   . GLY A 1 278 ? -4.776  -1.683 62.307 1.00 41.33  ? 486  GLY A CA   1 
ATOM   3610  C  C    . GLY A 1 278 ? -3.521  -0.844 62.196 1.00 36.84  ? 486  GLY A C    1 
ATOM   3611  O  O    . GLY A 1 278 ? -2.454  -1.397 61.902 1.00 35.53  ? 486  GLY A O    1 
ATOM   3612  H  H    . GLY A 1 278 ? -5.980  -1.012 63.697 1.00 51.29  ? 486  GLY A H    1 
ATOM   3613  H  HA2  . GLY A 1 278 ? -4.574  -2.444 62.874 1.00 49.60  ? 486  GLY A HA2  1 
ATOM   3614  H  HA3  . GLY A 1 278 ? -4.988  -2.018 61.422 1.00 49.60  ? 486  GLY A HA3  1 
ATOM   3615  N  N    . ILE A 1 279 ? -3.604  0.468  62.418 1.00 35.90  ? 487  ILE A N    1 
ATOM   3616  C  CA   . ILE A 1 279 ? -2.449  1.345  62.309 1.00 37.35  ? 487  ILE A CA   1 
ATOM   3617  C  C    . ILE A 1 279 ? -2.312  2.156  63.588 1.00 39.81  ? 487  ILE A C    1 
ATOM   3618  O  O    . ILE A 1 279 ? -3.278  2.378  64.321 1.00 43.41  ? 487  ILE A O    1 
ATOM   3619  C  CB   . ILE A 1 279 ? -2.540  2.290  61.091 1.00 35.08  ? 487  ILE A CB   1 
ATOM   3620  C  CG1  . ILE A 1 279 ? -3.889  3.016  61.082 1.00 38.66  ? 487  ILE A CG1  1 
ATOM   3621  C  CG2  . ILE A 1 279 ? -2.322  1.513  59.804 1.00 33.02  ? 487  ILE A CG2  1 
ATOM   3622  C  CD1  . ILE A 1 279 ? -3.974  4.145  60.071 1.00 38.61  ? 487  ILE A CD1  1 
ATOM   3623  H  H    . ILE A 1 279 ? -4.330  0.875  62.637 1.00 43.08  ? 487  ILE A H    1 
ATOM   3624  H  HA   . ILE A 1 279 ? -1.650  0.805  62.209 1.00 44.83  ? 487  ILE A HA   1 
ATOM   3625  H  HB   . ILE A 1 279 ? -1.838  2.955  61.168 1.00 42.09  ? 487  ILE A HB   1 
ATOM   3626  H  HG12 . ILE A 1 279 ? -4.586  2.376  60.870 1.00 46.40  ? 487  ILE A HG12 1 
ATOM   3627  H  HG13 . ILE A 1 279 ? -4.046  3.394  61.961 1.00 46.40  ? 487  ILE A HG13 1 
ATOM   3628  H  HG21 . ILE A 1 279 ? -2.383  2.123  59.053 1.00 39.63  ? 487  ILE A HG21 1 
ATOM   3629  H  HG22 . ILE A 1 279 ? -1.443  1.104  59.828 1.00 39.63  ? 487  ILE A HG22 1 
ATOM   3630  H  HG23 . ILE A 1 279 ? -3.004  0.827  59.730 1.00 39.63  ? 487  ILE A HG23 1 
ATOM   3631  H  HD11 . ILE A 1 279 ? -4.852  4.553  60.126 1.00 46.34  ? 487  ILE A HD11 1 
ATOM   3632  H  HD12 . ILE A 1 279 ? -3.290  4.803  60.274 1.00 46.34  ? 487  ILE A HD12 1 
ATOM   3633  H  HD13 . ILE A 1 279 ? -3.831  3.784  59.182 1.00 46.34  ? 487  ILE A HD13 1 
ATOM   3634  N  N    . ALA A 1 280 ? -1.085  2.595  63.849 1.00 39.85  ? 488  ALA A N    1 
ATOM   3635  C  CA   . ALA A 1 280 ? -0.807  3.514  64.942 1.00 40.74  ? 488  ALA A CA   1 
ATOM   3636  C  C    . ALA A 1 280 ? -0.860  4.939  64.412 1.00 38.84  ? 488  ALA A C    1 
ATOM   3637  O  O    . ALA A 1 280 ? -0.186  5.267  63.430 1.00 37.94  ? 488  ALA A O    1 
ATOM   3638  C  CB   . ALA A 1 280 ? 0.562   3.227  65.561 1.00 41.70  ? 488  ALA A CB   1 
ATOM   3639  H  H    . ALA A 1 280 ? -0.387  2.371  63.399 1.00 47.82  ? 488  ALA A H    1 
ATOM   3640  H  HA   . ALA A 1 280 ? -1.483  3.414  65.630 1.00 48.89  ? 488  ALA A HA   1 
ATOM   3641  H  HB1  . ALA A 1 280 ? 0.719   3.853  66.284 1.00 50.05  ? 488  ALA A HB1  1 
ATOM   3642  H  HB2  . ALA A 1 280 ? 0.570   2.318  65.901 1.00 50.05  ? 488  ALA A HB2  1 
ATOM   3643  H  HB3  . ALA A 1 280 ? 1.244   3.331  64.879 1.00 50.05  ? 488  ALA A HB3  1 
ATOM   3644  N  N    . VAL A 1 281 ? -1.668  5.778  65.054 1.00 40.71  ? 489  VAL A N    1 
ATOM   3645  C  CA   . VAL A 1 281 ? -1.832  7.173  64.662 1.00 37.67  ? 489  VAL A CA   1 
ATOM   3646  C  C    . VAL A 1 281 ? -0.986  8.035  65.588 1.00 35.28  ? 489  VAL A C    1 
ATOM   3647  O  O    . VAL A 1 281 ? -1.056  7.892  66.815 1.00 37.70  ? 489  VAL A O    1 
ATOM   3648  C  CB   . VAL A 1 281 ? -3.311  7.592  64.711 1.00 42.27  ? 489  VAL A CB   1 
ATOM   3649  C  CG1  . VAL A 1 281 ? -3.472  9.042  64.282 1.00 40.25  ? 489  VAL A CG1  1 
ATOM   3650  C  CG2  . VAL A 1 281 ? -4.147  6.676  63.829 1.00 44.22  ? 489  VAL A CG2  1 
ATOM   3651  H  H    . VAL A 1 281 ? -2.143  5.556  65.736 1.00 48.85  ? 489  VAL A H    1 
ATOM   3652  H  HA   . VAL A 1 281 ? -1.510  7.292  63.755 1.00 45.21  ? 489  VAL A HA   1 
ATOM   3653  H  HB   . VAL A 1 281 ? -3.634  7.510  65.622 1.00 50.73  ? 489  VAL A HB   1 
ATOM   3654  H  HG11 . VAL A 1 281 ? -4.411  9.280  64.322 1.00 48.30  ? 489  VAL A HG11 1 
ATOM   3655  H  HG12 . VAL A 1 281 ? -2.961  9.607  64.883 1.00 48.30  ? 489  VAL A HG12 1 
ATOM   3656  H  HG13 . VAL A 1 281 ? -3.143  9.140  63.375 1.00 48.30  ? 489  VAL A HG13 1 
ATOM   3657  H  HG21 . VAL A 1 281 ? -5.074  6.956  63.874 1.00 53.06  ? 489  VAL A HG21 1 
ATOM   3658  H  HG22 . VAL A 1 281 ? -3.825  6.738  62.916 1.00 53.06  ? 489  VAL A HG22 1 
ATOM   3659  H  HG23 . VAL A 1 281 ? -4.060  5.765  64.150 1.00 53.06  ? 489  VAL A HG23 1 
ATOM   3660  N  N    . ASP A 1 282 ? -0.190  8.932  65.004 1.00 33.01  ? 490  ASP A N    1 
ATOM   3661  C  CA   . ASP A 1 282 ? 0.711   9.789  65.761 1.00 34.38  ? 490  ASP A CA   1 
ATOM   3662  C  C    . ASP A 1 282 ? 0.749   11.165 65.106 1.00 32.12  ? 490  ASP A C    1 
ATOM   3663  O  O    . ASP A 1 282 ? 0.176   11.385 64.035 1.00 30.55  ? 490  ASP A O    1 
ATOM   3664  C  CB   . ASP A 1 282 ? 2.122   9.186  65.836 1.00 38.22  ? 490  ASP A CB   1 
ATOM   3665  C  CG   . ASP A 1 282 ? 2.946   9.750  66.984 1.00 43.51  ? 490  ASP A CG   1 
ATOM   3666  O  OD1  . ASP A 1 282 ? 2.369   10.402 67.880 1.00 45.26  ? 490  ASP A OD1  1 
ATOM   3667  O  OD2  . ASP A 1 282 ? 4.177   9.538  66.989 1.00 45.52  ? 490  ASP A OD2  1 
ATOM   3668  H  H    . ASP A 1 282 ? -0.156  9.061  64.154 1.00 39.61  ? 490  ASP A H    1 
ATOM   3669  H  HA   . ASP A 1 282 ? 0.374   9.890  66.664 1.00 41.26  ? 490  ASP A HA   1 
ATOM   3670  H  HB2  . ASP A 1 282 ? 2.049   8.227  65.963 1.00 45.87  ? 490  ASP A HB2  1 
ATOM   3671  H  HB3  . ASP A 1 282 ? 2.592   9.376  65.009 1.00 45.87  ? 490  ASP A HB3  1 
ATOM   3672  N  N    . GLY A 1 283 ? 1.430   12.098 65.760 1.00 31.54  ? 491  GLY A N    1 
ATOM   3673  C  CA   . GLY A 1 283 ? 1.537   13.442 65.224 1.00 28.29  ? 491  GLY A CA   1 
ATOM   3674  C  C    . GLY A 1 283 ? 2.266   14.352 66.187 1.00 30.66  ? 491  GLY A C    1 
ATOM   3675  O  O    . GLY A 1 283 ? 2.692   13.943 67.273 1.00 33.12  ? 491  GLY A O    1 
ATOM   3676  H  H    . GLY A 1 283 ? 1.836   11.978 66.509 1.00 37.85  ? 491  GLY A H    1 
ATOM   3677  H  HA2  . GLY A 1 283 ? 2.021   13.423 64.384 1.00 33.96  ? 491  GLY A HA2  1 
ATOM   3678  H  HA3  . GLY A 1 283 ? 0.650   13.803 65.065 1.00 33.96  ? 491  GLY A HA3  1 
ATOM   3679  N  N    . GLY A 1 284 ? 2.402   15.607 65.765 1.00 30.44  ? 492  GLY A N    1 
ATOM   3680  C  CA   . GLY A 1 284 ? 3.103   16.613 66.540 1.00 33.12  ? 492  GLY A CA   1 
ATOM   3681  C  C    . GLY A 1 284 ? 3.279   17.907 65.769 1.00 31.18  ? 492  GLY A C    1 
ATOM   3682  O  O    . GLY A 1 284 ? 2.294   18.555 65.405 1.00 32.85  ? 492  GLY A O    1 
ATOM   3683  H  H    . GLY A 1 284 ? 2.089   15.900 65.020 1.00 36.53  ? 492  GLY A H    1 
ATOM   3684  H  HA2  . GLY A 1 284 ? 2.606   16.802 67.351 1.00 39.75  ? 492  GLY A HA2  1 
ATOM   3685  H  HA3  . GLY A 1 284 ? 3.980   16.279 66.786 1.00 39.75  ? 492  GLY A HA3  1 
ATOM   3686  N  N    . SER A 1 285 ? 4.526   18.292 65.508 1.00 32.23  ? 493  SER A N    1 
ATOM   3687  C  CA   . SER A 1 285 ? 4.810   19.516 64.768 1.00 31.07  ? 493  SER A CA   1 
ATOM   3688  C  C    . SER A 1 285 ? 4.748   19.262 63.266 1.00 28.97  ? 493  SER A C    1 
ATOM   3689  O  O    . SER A 1 285 ? 5.161   18.202 62.787 1.00 29.03  ? 493  SER A O    1 
ATOM   3690  C  CB   . SER A 1 285 ? 6.193   20.051 65.147 1.00 29.96  ? 493  SER A CB   1 
ATOM   3691  O  OG   . SER A 1 285 ? 6.645   21.026 64.219 1.00 30.86  ? 493  SER A OG   1 
ATOM   3692  H  H    . SER A 1 285 ? 5.228   17.859 65.751 1.00 38.68  ? 493  SER A H    1 
ATOM   3693  H  HA   . SER A 1 285 ? 4.149   20.190 64.992 1.00 37.29  ? 493  SER A HA   1 
ATOM   3694  H  HB2  . SER A 1 285 ? 6.143   20.456 66.027 1.00 35.96  ? 493  SER A HB2  1 
ATOM   3695  H  HB3  . SER A 1 285 ? 6.823   19.313 65.158 1.00 35.96  ? 493  SER A HB3  1 
ATOM   3696  H  HG   . SER A 1 285 ? 6.110   21.673 64.199 1.00 37.04  ? 493  SER A HG   1 
ATOM   3697  N  N    . ASP A 1 286 ? 4.235   20.243 62.517 1.00 27.59  ? 494  ASP A N    1 
ATOM   3698  C  CA   . ASP A 1 286 ? 4.236   20.160 61.062 1.00 29.34  ? 494  ASP A CA   1 
ATOM   3699  C  C    . ASP A 1 286 ? 5.443   20.855 60.426 1.00 28.64  ? 494  ASP A C    1 
ATOM   3700  O  O    . ASP A 1 286 ? 5.396   21.191 59.236 1.00 28.11  ? 494  ASP A O    1 
ATOM   3701  C  CB   . ASP A 1 286 ? 2.925   20.709 60.485 1.00 33.71  ? 494  ASP A CB   1 
ATOM   3702  C  CG   . ASP A 1 286 ? 2.604   22.125 60.940 1.00 39.31  ? 494  ASP A CG   1 
ATOM   3703  O  OD1  . ASP A 1 286 ? 3.467   22.805 61.536 1.00 40.19  ? 494  ASP A OD1  1 
ATOM   3704  O  OD2  . ASP A 1 286 ? 1.457   22.554 60.692 1.00 38.83  ? 494  ASP A OD2  1 
ATOM   3705  H  H    . ASP A 1 286 ? 3.882   20.963 62.829 1.00 33.10  ? 494  ASP A H    1 
ATOM   3706  H  HA   . ASP A 1 286 ? 4.286   19.223 60.816 1.00 35.21  ? 494  ASP A HA   1 
ATOM   3707  H  HB2  . ASP A 1 286 ? 2.988   20.715 59.517 1.00 40.46  ? 494  ASP A HB2  1 
ATOM   3708  H  HB3  . ASP A 1 286 ? 2.195   20.134 60.764 1.00 40.46  ? 494  ASP A HB3  1 
ATOM   3709  N  N    . TRP A 1 287 ? 6.524   21.053 61.184 1.00 28.31  ? 495  TRP A N    1 
ATOM   3710  C  CA   . TRP A 1 287 ? 7.810   21.499 60.654 1.00 26.70  ? 495  TRP A CA   1 
ATOM   3711  C  C    . TRP A 1 287 ? 8.797   20.339 60.767 1.00 25.74  ? 495  TRP A C    1 
ATOM   3712  O  O    . TRP A 1 287 ? 8.999   19.800 61.862 1.00 27.09  ? 495  TRP A O    1 
ATOM   3713  C  CB   . TRP A 1 287 ? 8.297   22.738 61.409 1.00 26.33  ? 495  TRP A CB   1 
ATOM   3714  C  CG   . TRP A 1 287 ? 7.263   23.830 61.373 1.00 23.98  ? 495  TRP A CG   1 
ATOM   3715  C  CD1  . TRP A 1 287 ? 6.445   24.227 62.394 1.00 24.50  ? 495  TRP A CD1  1 
ATOM   3716  C  CD2  . TRP A 1 287 ? 6.902   24.625 60.238 1.00 25.05  ? 495  TRP A CD2  1 
ATOM   3717  N  NE1  . TRP A 1 287 ? 5.604   25.231 61.964 1.00 26.68  ? 495  TRP A NE1  1 
ATOM   3718  C  CE2  . TRP A 1 287 ? 5.863   25.489 60.643 1.00 24.91  ? 495  TRP A CE2  1 
ATOM   3719  C  CE3  . TRP A 1 287 ? 7.357   24.689 58.918 1.00 23.95  ? 495  TRP A CE3  1 
ATOM   3720  C  CZ2  . TRP A 1 287 ? 5.284   26.413 59.779 1.00 27.35  ? 495  TRP A CZ2  1 
ATOM   3721  C  CZ3  . TRP A 1 287 ? 6.779   25.604 58.060 1.00 25.03  ? 495  TRP A CZ3  1 
ATOM   3722  C  CH2  . TRP A 1 287 ? 5.752   26.455 58.494 1.00 27.23  ? 495  TRP A CH2  1 
ATOM   3723  H  H    . TRP A 1 287 ? 6.534   20.930 62.035 1.00 33.98  ? 495  TRP A H    1 
ATOM   3724  H  HA   . TRP A 1 287 ? 7.711   21.729 59.717 1.00 32.05  ? 495  TRP A HA   1 
ATOM   3725  H  HB2  . TRP A 1 287 ? 8.465   22.506 62.336 1.00 31.60  ? 495  TRP A HB2  1 
ATOM   3726  H  HB3  . TRP A 1 287 ? 9.108   23.071 60.992 1.00 31.60  ? 495  TRP A HB3  1 
ATOM   3727  H  HD1  . TRP A 1 287 ? 6.453   23.870 63.253 1.00 29.41  ? 495  TRP A HD1  1 
ATOM   3728  H  HE1  . TRP A 1 287 ? 5.013   25.630 62.445 1.00 32.01  ? 495  TRP A HE1  1 
ATOM   3729  H  HE3  . TRP A 1 287 ? 8.036   24.126 58.622 1.00 28.75  ? 495  TRP A HE3  1 
ATOM   3730  H  HZ2  . TRP A 1 287 ? 4.605   26.981 60.064 1.00 32.82  ? 495  TRP A HZ2  1 
ATOM   3731  H  HZ3  . TRP A 1 287 ? 7.075   25.657 57.180 1.00 30.04  ? 495  TRP A HZ3  1 
ATOM   3732  H  HH2  . TRP A 1 287 ? 5.383   27.063 57.895 1.00 32.68  ? 495  TRP A HH2  1 
ATOM   3733  N  N    . PHE A 1 288 ? 9.395   19.940 59.639 1.00 25.12  ? 496  PHE A N    1 
ATOM   3734  C  CA   . PHE A 1 288 ? 10.130  18.677 59.581 1.00 26.09  ? 496  PHE A CA   1 
ATOM   3735  C  C    . PHE A 1 288 ? 11.238  18.739 58.530 1.00 26.52  ? 496  PHE A C    1 
ATOM   3736  O  O    . PHE A 1 288 ? 11.410  19.739 57.828 1.00 27.72  ? 496  PHE A O    1 
ATOM   3737  C  CB   . PHE A 1 288 ? 9.172   17.518 59.283 1.00 27.98  ? 496  PHE A CB   1 
ATOM   3738  C  CG   . PHE A 1 288 ? 8.172   17.819 58.198 1.00 29.33  ? 496  PHE A CG   1 
ATOM   3739  C  CD1  . PHE A 1 288 ? 8.581   17.994 56.886 1.00 30.69  ? 496  PHE A CD1  1 
ATOM   3740  C  CD2  . PHE A 1 288 ? 6.824   17.920 58.491 1.00 28.98  ? 496  PHE A CD2  1 
ATOM   3741  C  CE1  . PHE A 1 288 ? 7.662   18.270 55.891 1.00 31.79  ? 496  PHE A CE1  1 
ATOM   3742  C  CE2  . PHE A 1 288 ? 5.901   18.195 57.500 1.00 30.29  ? 496  PHE A CE2  1 
ATOM   3743  C  CZ   . PHE A 1 288 ? 6.323   18.372 56.197 1.00 30.41  ? 496  PHE A CZ   1 
ATOM   3744  H  H    . PHE A 1 288 ? 9.389   20.381 58.901 1.00 30.15  ? 496  PHE A H    1 
ATOM   3745  H  HA   . PHE A 1 288 ? 10.543  18.511 60.443 1.00 31.31  ? 496  PHE A HA   1 
ATOM   3746  H  HB2  . PHE A 1 288 ? 9.691   16.748 59.002 1.00 33.58  ? 496  PHE A HB2  1 
ATOM   3747  H  HB3  . PHE A 1 288 ? 8.678   17.305 60.090 1.00 33.58  ? 496  PHE A HB3  1 
ATOM   3748  H  HD1  . PHE A 1 288 ? 9.484   17.929 56.674 1.00 36.83  ? 496  PHE A HD1  1 
ATOM   3749  H  HD2  . PHE A 1 288 ? 6.535   17.804 59.368 1.00 34.78  ? 496  PHE A HD2  1 
ATOM   3750  H  HE1  . PHE A 1 288 ? 7.949   18.388 55.014 1.00 38.15  ? 496  PHE A HE1  1 
ATOM   3751  H  HE2  . PHE A 1 288 ? 4.998   18.262 57.710 1.00 36.35  ? 496  PHE A HE2  1 
ATOM   3752  H  HZ   . PHE A 1 288 ? 5.704   18.556 55.528 1.00 36.50  ? 496  PHE A HZ   1 
ATOM   3753  N  N    . LEU A 1 289 ? 12.001  17.644 58.442 1.00 27.63  ? 497  LEU A N    1 
ATOM   3754  C  CA   . LEU A 1 289 ? 13.007  17.436 57.400 1.00 27.15  ? 497  LEU A CA   1 
ATOM   3755  C  C    . LEU A 1 289 ? 12.909  15.989 56.935 1.00 29.48  ? 497  LEU A C    1 
ATOM   3756  O  O    . LEU A 1 289 ? 13.093  15.071 57.740 1.00 25.78  ? 497  LEU A O    1 
ATOM   3757  C  CB   . LEU A 1 289 ? 14.427  17.724 57.904 1.00 30.65  ? 497  LEU A CB   1 
ATOM   3758  C  CG   . LEU A 1 289 ? 14.763  19.092 58.501 1.00 30.54  ? 497  LEU A CG   1 
ATOM   3759  C  CD1  . LEU A 1 289 ? 14.348  19.171 59.959 1.00 29.02  ? 497  LEU A CD1  1 
ATOM   3760  C  CD2  . LEU A 1 289 ? 16.254  19.371 58.357 1.00 32.04  ? 497  LEU A CD2  1 
ATOM   3761  H  H    . LEU A 1 289 ? 11.951  16.987 58.995 1.00 33.16  ? 497  LEU A H    1 
ATOM   3762  H  HA   . LEU A 1 289 ? 12.821  18.018 56.646 1.00 32.58  ? 497  LEU A HA   1 
ATOM   3763  H  HB2  . LEU A 1 289 ? 14.632  17.068 58.589 1.00 36.78  ? 497  LEU A HB2  1 
ATOM   3764  H  HB3  . LEU A 1 289 ? 15.033  17.594 57.158 1.00 36.78  ? 497  LEU A HB3  1 
ATOM   3765  H  HG   . LEU A 1 289 ? 14.280  19.777 58.014 1.00 36.65  ? 497  LEU A HG   1 
ATOM   3766  H  HD11 . LEU A 1 289 ? 14.820  18.487 60.459 1.00 34.83  ? 497  LEU A HD11 1 
ATOM   3767  H  HD12 . LEU A 1 289 ? 14.575  20.049 60.304 1.00 34.83  ? 497  LEU A HD12 1 
ATOM   3768  H  HD13 . LEU A 1 289 ? 13.391  19.028 60.023 1.00 34.83  ? 497  LEU A HD13 1 
ATOM   3769  H  HD21 . LEU A 1 289 ? 16.451  20.240 58.740 1.00 38.45  ? 497  LEU A HD21 1 
ATOM   3770  H  HD22 . LEU A 1 289 ? 16.751  18.683 58.827 1.00 38.45  ? 497  LEU A HD22 1 
ATOM   3771  H  HD23 . LEU A 1 289 ? 16.487  19.363 57.416 1.00 38.45  ? 497  LEU A HD23 1 
ATOM   3772  N  N    . LEU A 1 290 ? 12.635  15.782 55.646 1.00 29.66  ? 498  LEU A N    1 
ATOM   3773  C  CA   . LEU A 1 290 ? 12.412  14.451 55.087 1.00 26.78  ? 498  LEU A CA   1 
ATOM   3774  C  C    . LEU A 1 290 ? 13.381  14.190 53.941 1.00 30.80  ? 498  LEU A C    1 
ATOM   3775  O  O    . LEU A 1 290 ? 13.579  15.055 53.079 1.00 31.18  ? 498  LEU A O    1 
ATOM   3776  C  CB   . LEU A 1 290 ? 10.973  14.309 54.579 1.00 27.62  ? 498  LEU A CB   1 
ATOM   3777  C  CG   . LEU A 1 290 ? 9.858   14.660 55.566 1.00 26.99  ? 498  LEU A CG   1 
ATOM   3778  C  CD1  . LEU A 1 290 ? 8.506   14.674 54.866 1.00 30.84  ? 498  LEU A CD1  1 
ATOM   3779  C  CD2  . LEU A 1 290 ? 9.846   13.684 56.730 1.00 28.98  ? 498  LEU A CD2  1 
ATOM   3780  H  H    . LEU A 1 290 ? 12.573  16.412 55.064 1.00 35.59  ? 498  LEU A H    1 
ATOM   3781  H  HA   . LEU A 1 290 ? 12.562  13.783 55.774 1.00 32.14  ? 498  LEU A HA   1 
ATOM   3782  H  HB2  . LEU A 1 290 ? 10.865  14.887 53.807 1.00 33.14  ? 498  LEU A HB2  1 
ATOM   3783  H  HB3  . LEU A 1 290 ? 10.837  13.387 54.309 1.00 33.14  ? 498  LEU A HB3  1 
ATOM   3784  H  HG   . LEU A 1 290 ? 10.020  15.548 55.922 1.00 32.39  ? 498  LEU A HG   1 
ATOM   3785  H  HD11 . LEU A 1 290 ? 7.819   14.899 55.512 1.00 37.02  ? 498  LEU A HD11 1 
ATOM   3786  H  HD12 . LEU A 1 290 ? 8.525   15.337 54.157 1.00 37.02  ? 498  LEU A HD12 1 
ATOM   3787  H  HD13 . LEU A 1 290 ? 8.336   13.795 54.492 1.00 37.02  ? 498  LEU A HD13 1 
ATOM   3788  H  HD21 . LEU A 1 290 ? 9.132   13.929 57.339 1.00 34.78  ? 498  LEU A HD21 1 
ATOM   3789  H  HD22 . LEU A 1 290 ? 9.698   12.789 56.388 1.00 34.78  ? 498  LEU A HD22 1 
ATOM   3790  H  HD23 . LEU A 1 290 ? 10.700  13.727 57.186 1.00 34.78  ? 498  LEU A HD23 1 
ATOM   3791  N  N    . ASN A 1 291 ? 13.974  12.993 53.919 1.00 30.59  ? 499  ASN A N    1 
ATOM   3792  C  CA   . ASN A 1 291 ? 14.922  12.663 52.865 1.00 31.63  ? 499  ASN A CA   1 
ATOM   3793  C  C    . ASN A 1 291 ? 14.190  12.251 51.589 1.00 30.54  ? 499  ASN A C    1 
ATOM   3794  O  O    . ASN A 1 291 ? 13.002  11.922 51.598 1.00 29.25  ? 499  ASN A O    1 
ATOM   3795  C  CB   . ASN A 1 291 ? 15.895  11.558 53.311 1.00 32.28  ? 499  ASN A CB   1 
ATOM   3796  C  CG   . ASN A 1 291 ? 15.210  10.232 53.615 1.00 35.78  ? 499  ASN A CG   1 
ATOM   3797  O  OD1  . ASN A 1 291 ? 14.382  9.743  52.845 1.00 33.54  ? 499  ASN A OD1  1 
ATOM   3798  N  ND2  . ASN A 1 291 ? 15.573  9.636  54.744 1.00 38.21  ? 499  ASN A ND2  1 
ATOM   3799  H  H    . ASN A 1 291 ? 13.844  12.368 54.495 1.00 36.71  ? 499  ASN A H    1 
ATOM   3800  H  HA   . ASN A 1 291 ? 15.447  13.453 52.662 1.00 37.96  ? 499  ASN A HA   1 
ATOM   3801  H  HB2  . ASN A 1 291 ? 16.541  11.404 52.604 1.00 38.74  ? 499  ASN A HB2  1 
ATOM   3802  H  HB3  . ASN A 1 291 ? 16.351  11.848 54.117 1.00 38.74  ? 499  ASN A HB3  1 
ATOM   3803  H  HD21 . ASN A 1 291 ? 15.220  8.884  54.966 1.00 45.85  ? 499  ASN A HD21 1 
ATOM   3804  H  HD22 . ASN A 1 291 ? 16.157  10.005 55.257 1.00 45.85  ? 499  ASN A HD22 1 
ATOM   3805  N  N    . ARG A 1 292 ? 14.927  12.282 50.475 1.00 31.62  ? 500  ARG A N    1 
ATOM   3806  C  CA   . ARG A 1 292 ? 14.304  12.126 49.164 1.00 30.74  ? 500  ARG A CA   1 
ATOM   3807  C  C    . ARG A 1 292 ? 13.638  10.765 49.015 1.00 30.43  ? 500  ARG A C    1 
ATOM   3808  O  O    . ARG A 1 292 ? 12.598  10.654 48.356 1.00 26.92  ? 500  ARG A O    1 
ATOM   3809  C  CB   . ARG A 1 292 ? 15.349  12.328 48.064 1.00 31.89  ? 500  ARG A CB   1 
ATOM   3810  C  CG   . ARG A 1 292 ? 14.791  12.285 46.643 1.00 28.88  ? 500  ARG A CG   1 
ATOM   3811  C  CD   . ARG A 1 292 ? 15.902  12.257 45.602 1.00 29.73  ? 500  ARG A CD   1 
ATOM   3812  N  NE   . ARG A 1 292 ? 15.369  12.265 44.240 1.00 31.12  ? 500  ARG A NE   1 
ATOM   3813  C  CZ   . ARG A 1 292 ? 15.248  13.349 43.477 1.00 32.06  ? 500  ARG A CZ   1 
ATOM   3814  N  NH1  . ARG A 1 292 ? 15.635  14.537 43.920 1.00 31.82  ? 500  ARG A NH1  1 
ATOM   3815  N  NH2  . ARG A 1 292 ? 14.739  13.244 42.256 1.00 27.96  ? 500  ARG A NH2  1 
ATOM   3816  H  H    . ARG A 1 292 ? 15.780  12.392 50.454 1.00 37.94  ? 500  ARG A H    1 
ATOM   3817  H  HA   . ARG A 1 292 ? 13.621  12.806 49.057 1.00 36.89  ? 500  ARG A HA   1 
ATOM   3818  H  HB2  . ARG A 1 292 ? 15.768  13.194 48.189 1.00 38.27  ? 500  ARG A HB2  1 
ATOM   3819  H  HB3  . ARG A 1 292 ? 16.018  11.629 48.138 1.00 38.27  ? 500  ARG A HB3  1 
ATOM   3820  H  HG2  . ARG A 1 292 ? 14.254  11.484 46.535 1.00 34.66  ? 500  ARG A HG2  1 
ATOM   3821  H  HG3  . ARG A 1 292 ? 14.250  13.074 46.488 1.00 34.66  ? 500  ARG A HG3  1 
ATOM   3822  H  HD2  . ARG A 1 292 ? 16.463  13.041 45.712 1.00 35.67  ? 500  ARG A HD2  1 
ATOM   3823  H  HD3  . ARG A 1 292 ? 16.428  11.450 45.717 1.00 35.67  ? 500  ARG A HD3  1 
ATOM   3824  H  HE   . ARG A 1 292 ? 15.114  11.514 43.908 1.00 37.35  ? 500  ARG A HE   1 
ATOM   3825  H  HH11 . ARG A 1 292 ? 15.964  14.615 44.711 1.00 38.18  ? 500  ARG A HH11 1 
ATOM   3826  H  HH12 . ARG A 1 292 ? 15.555  15.231 43.418 1.00 38.18  ? 500  ARG A HH12 1 
ATOM   3827  H  HH21 . ARG A 1 292 ? 14.488  12.477 41.959 1.00 33.56  ? 500  ARG A HH21 1 
ATOM   3828  H  HH22 . ARG A 1 292 ? 14.666  13.943 41.759 1.00 33.56  ? 500  ARG A HH22 1 
ATOM   3829  N  N    . ARG A 1 293 ? 14.222  9.723  49.611 1.00 32.34  ? 501  ARG A N    1 
ATOM   3830  C  CA   . ARG A 1 293 ? 13.681  8.376  49.452 1.00 34.77  ? 501  ARG A CA   1 
ATOM   3831  C  C    . ARG A 1 293 ? 12.276  8.269  50.034 1.00 30.69  ? 501  ARG A C    1 
ATOM   3832  O  O    . ARG A 1 293 ? 11.402  7.620  49.447 1.00 27.45  ? 501  ARG A O    1 
ATOM   3833  C  CB   . ARG A 1 293 ? 14.626  7.362  50.103 1.00 46.37  ? 501  ARG A CB   1 
ATOM   3834  C  CG   . ARG A 1 293 ? 14.229  5.907  49.920 1.00 59.32  ? 501  ARG A CG   1 
ATOM   3835  C  CD   . ARG A 1 293 ? 15.464  5.017  49.847 1.00 76.56  ? 501  ARG A CD   1 
ATOM   3836  N  NE   . ARG A 1 293 ? 15.161  3.610  50.099 1.00 90.79  ? 501  ARG A NE   1 
ATOM   3837  C  CZ   . ARG A 1 293 ? 14.556  2.802  49.233 1.00 98.21  ? 501  ARG A CZ   1 
ATOM   3838  N  NH1  . ARG A 1 293 ? 14.168  3.256  48.048 1.00 100.02 ? 501  ARG A NH1  1 
ATOM   3839  N  NH2  . ARG A 1 293 ? 14.329  1.535  49.557 1.00 100.30 ? 501  ARG A NH2  1 
ATOM   3840  H  H    . ARG A 1 293 ? 14.923  9.769  50.107 1.00 38.81  ? 501  ARG A H    1 
ATOM   3841  H  HA   . ARG A 1 293 ? 13.628  8.169  48.505 1.00 41.72  ? 501  ARG A HA   1 
ATOM   3842  H  HB2  . ARG A 1 293 ? 15.511  7.474  49.721 1.00 55.65  ? 501  ARG A HB2  1 
ATOM   3843  H  HB3  . ARG A 1 293 ? 14.659  7.538  51.056 1.00 55.65  ? 501  ARG A HB3  1 
ATOM   3844  H  HG2  . ARG A 1 293 ? 13.690  5.623  50.674 1.00 71.19  ? 501  ARG A HG2  1 
ATOM   3845  H  HG3  . ARG A 1 293 ? 13.732  5.811  49.092 1.00 71.19  ? 501  ARG A HG3  1 
ATOM   3846  H  HD2  . ARG A 1 293 ? 15.852  5.086  48.961 1.00 91.88  ? 501  ARG A HD2  1 
ATOM   3847  H  HD3  . ARG A 1 293 ? 16.105  5.310  50.514 1.00 91.88  ? 501  ARG A HD3  1 
ATOM   3848  H  HE   . ARG A 1 293 ? 15.389  3.281  50.860 1.00 108.95 ? 501  ARG A HE   1 
ATOM   3849  H  HH11 . ARG A 1 293 ? 14.313  4.077  47.833 1.00 120.03 ? 501  ARG A HH11 1 
ATOM   3850  H  HH12 . ARG A 1 293 ? 13.776  2.730  47.492 1.00 120.03 ? 501  ARG A HH12 1 
ATOM   3851  H  HH21 . ARG A 1 293 ? 14.576  1.237  50.325 1.00 120.36 ? 501  ARG A HH21 1 
ATOM   3852  H  HH22 . ARG A 1 293 ? 13.935  1.012  49.000 1.00 120.36 ? 501  ARG A HH22 1 
ATOM   3853  N  N    . PHE A 1 294 ? 12.030  8.912  51.179 1.00 27.43  ? 502  PHE A N    1 
ATOM   3854  C  CA   . PHE A 1 294 ? 10.700  8.865  51.778 1.00 27.28  ? 502  PHE A CA   1 
ATOM   3855  C  C    . PHE A 1 294 ? 9.718   9.759  51.027 1.00 28.51  ? 502  PHE A C    1 
ATOM   3856  O  O    . PHE A 1 294 ? 8.537   9.417  50.902 1.00 25.97  ? 502  PHE A O    1 
ATOM   3857  C  CB   . PHE A 1 294 ? 10.774  9.260  53.256 1.00 29.96  ? 502  PHE A CB   1 
ATOM   3858  C  CG   . PHE A 1 294 ? 9.439   9.269  53.957 1.00 31.40  ? 502  PHE A CG   1 
ATOM   3859  C  CD1  . PHE A 1 294 ? 8.670   8.122  54.031 1.00 32.54  ? 502  PHE A CD1  1 
ATOM   3860  C  CD2  . PHE A 1 294 ? 8.967   10.423 54.562 1.00 30.93  ? 502  PHE A CD2  1 
ATOM   3861  C  CE1  . PHE A 1 294 ? 7.448   8.127  54.677 1.00 33.87  ? 502  PHE A CE1  1 
ATOM   3862  C  CE2  . PHE A 1 294 ? 7.742   10.436 55.211 1.00 33.80  ? 502  PHE A CE2  1 
ATOM   3863  C  CZ   . PHE A 1 294 ? 6.983   9.286  55.270 1.00 33.82  ? 502  PHE A CZ   1 
ATOM   3864  H  H    . PHE A 1 294 ? 12.607  9.373  51.620 1.00 32.92  ? 502  PHE A H    1 
ATOM   3865  H  HA   . PHE A 1 294 ? 10.368  7.955  51.731 1.00 32.74  ? 502  PHE A HA   1 
ATOM   3866  H  HB2  . PHE A 1 294 ? 11.347  8.629  53.719 1.00 35.96  ? 502  PHE A HB2  1 
ATOM   3867  H  HB3  . PHE A 1 294 ? 11.149  10.153 53.321 1.00 35.96  ? 502  PHE A HB3  1 
ATOM   3868  H  HD1  . PHE A 1 294 ? 8.975   7.339  53.633 1.00 39.05  ? 502  PHE A HD1  1 
ATOM   3869  H  HD2  . PHE A 1 294 ? 9.473   11.202 54.523 1.00 37.12  ? 502  PHE A HD2  1 
ATOM   3870  H  HE1  . PHE A 1 294 ? 6.939   7.350  54.715 1.00 40.64  ? 502  PHE A HE1  1 
ATOM   3871  H  HE2  . PHE A 1 294 ? 7.434   11.219 55.609 1.00 40.57  ? 502  PHE A HE2  1 
ATOM   3872  H  HZ   . PHE A 1 294 ? 6.162   9.291  55.706 1.00 40.59  ? 502  PHE A HZ   1 
ATOM   3873  N  N    . VAL A 1 295 ? 10.181  10.905 50.516 1.00 29.35  ? 503  VAL A N    1 
ATOM   3874  C  CA   . VAL A 1 295 ? 9.301   11.754 49.716 1.00 26.10  ? 503  VAL A CA   1 
ATOM   3875  C  C    . VAL A 1 295 ? 8.860   11.016 48.459 1.00 29.93  ? 503  VAL A C    1 
ATOM   3876  O  O    . VAL A 1 295 ? 7.704   11.125 48.032 1.00 28.23  ? 503  VAL A O    1 
ATOM   3877  C  CB   . VAL A 1 295 ? 9.996   13.086 49.377 1.00 24.94  ? 503  VAL A CB   1 
ATOM   3878  C  CG1  . VAL A 1 295 ? 9.127   13.920 48.450 1.00 27.50  ? 503  VAL A CG1  1 
ATOM   3879  C  CG2  . VAL A 1 295 ? 10.312  13.864 50.651 1.00 23.66  ? 503  VAL A CG2  1 
ATOM   3880  H  H    . VAL A 1 295 ? 10.980  11.205 50.617 1.00 35.22  ? 503  VAL A H    1 
ATOM   3881  H  HA   . VAL A 1 295 ? 8.507   11.958 50.235 1.00 31.32  ? 503  VAL A HA   1 
ATOM   3882  H  HB   . VAL A 1 295 ? 10.832  12.901 48.921 1.00 29.93  ? 503  VAL A HB   1 
ATOM   3883  H  HG11 . VAL A 1 295 ? 9.585   14.752 48.252 1.00 33.00  ? 503  VAL A HG11 1 
ATOM   3884  H  HG12 . VAL A 1 295 ? 8.972   13.424 47.632 1.00 33.00  ? 503  VAL A HG12 1 
ATOM   3885  H  HG13 . VAL A 1 295 ? 8.283   14.104 48.891 1.00 33.00  ? 503  VAL A HG13 1 
ATOM   3886  H  HG21 . VAL A 1 295 ? 10.749  14.697 50.412 1.00 28.40  ? 503  VAL A HG21 1 
ATOM   3887  H  HG22 . VAL A 1 295 ? 9.485   14.047 51.123 1.00 28.40  ? 503  VAL A HG22 1 
ATOM   3888  H  HG23 . VAL A 1 295 ? 10.900  13.330 51.209 1.00 28.40  ? 503  VAL A HG23 1 
ATOM   3889  N  N    . GLU A 1 296 ? 9.774   10.260 47.844 1.00 25.63  ? 504  GLU A N    1 
ATOM   3890  C  CA   . GLU A 1 296 ? 9.417   9.436  46.691 1.00 28.92  ? 504  GLU A CA   1 
ATOM   3891  C  C    . GLU A 1 296 ? 8.310   8.451  47.050 1.00 29.52  ? 504  GLU A C    1 
ATOM   3892  O  O    . GLU A 1 296 ? 7.322   8.311  46.320 1.00 28.12  ? 504  GLU A O    1 
ATOM   3893  C  CB   . GLU A 1 296 ? 10.654  8.686  46.180 1.00 28.53  ? 504  GLU A CB   1 
ATOM   3894  C  CG   . GLU A 1 296 ? 11.681  9.561  45.477 1.00 37.58  ? 504  GLU A CG   1 
ATOM   3895  C  CD   . GLU A 1 296 ? 13.010  8.854  45.233 1.00 47.28  ? 504  GLU A CD   1 
ATOM   3896  O  OE1  . GLU A 1 296 ? 13.812  9.361  44.417 1.00 52.29  ? 504  GLU A OE1  1 
ATOM   3897  O  OE2  . GLU A 1 296 ? 13.258  7.797  45.855 1.00 51.29  ? 504  GLU A OE2  1 
ATOM   3898  H  H    . GLU A 1 296 ? 10.601  10.209 48.074 1.00 30.76  ? 504  GLU A H    1 
ATOM   3899  H  HA   . GLU A 1 296 ? 9.094   10.008 45.978 1.00 34.71  ? 504  GLU A HA   1 
ATOM   3900  H  HB2  . GLU A 1 296 ? 11.095  8.264  46.935 1.00 34.24  ? 504  GLU A HB2  1 
ATOM   3901  H  HB3  . GLU A 1 296 ? 10.366  8.007  45.550 1.00 34.24  ? 504  GLU A HB3  1 
ATOM   3902  H  HG2  . GLU A 1 296 ? 11.326  9.833  44.616 1.00 45.10  ? 504  GLU A HG2  1 
ATOM   3903  H  HG3  . GLU A 1 296 ? 11.856  10.342 46.024 1.00 45.10  ? 504  GLU A HG3  1 
ATOM   3904  N  N    . TYR A 1 297 ? 8.468   7.752  48.177 1.00 31.93  ? 505  TYR A N    1 
ATOM   3905  C  CA   . TYR A 1 297 ? 7.453   6.807  48.633 1.00 29.33  ? 505  TYR A CA   1 
ATOM   3906  C  C    . TYR A 1 297 ? 6.098   7.485  48.800 1.00 30.59  ? 505  TYR A C    1 
ATOM   3907  O  O    . TYR A 1 297 ? 5.082   7.003  48.287 1.00 29.90  ? 505  TYR A O    1 
ATOM   3908  C  CB   . TYR A 1 297 ? 7.905   6.170  49.948 1.00 30.98  ? 505  TYR A CB   1 
ATOM   3909  C  CG   . TYR A 1 297 ? 6.869   5.292  50.611 1.00 31.80  ? 505  TYR A CG   1 
ATOM   3910  C  CD1  . TYR A 1 297 ? 6.623   4.004  50.153 1.00 34.95  ? 505  TYR A CD1  1 
ATOM   3911  C  CD2  . TYR A 1 297 ? 6.147   5.746  51.704 1.00 32.21  ? 505  TYR A CD2  1 
ATOM   3912  C  CE1  . TYR A 1 297 ? 5.680   3.198  50.760 1.00 34.81  ? 505  TYR A CE1  1 
ATOM   3913  C  CE2  . TYR A 1 297 ? 5.205   4.948  52.320 1.00 34.62  ? 505  TYR A CE2  1 
ATOM   3914  C  CZ   . TYR A 1 297 ? 4.974   3.674  51.845 1.00 34.92  ? 505  TYR A CZ   1 
ATOM   3915  O  OH   . TYR A 1 297 ? 4.029   2.877  52.455 1.00 33.25  ? 505  TYR A OH   1 
ATOM   3916  H  H    . TYR A 1 297 ? 9.154   7.808  48.692 1.00 38.32  ? 505  TYR A H    1 
ATOM   3917  H  HA   . TYR A 1 297 ? 7.358   6.102  47.974 1.00 35.20  ? 505  TYR A HA   1 
ATOM   3918  H  HB2  . TYR A 1 297 ? 8.687   5.622  49.775 1.00 37.18  ? 505  TYR A HB2  1 
ATOM   3919  H  HB3  . TYR A 1 297 ? 8.134   6.877  50.572 1.00 37.18  ? 505  TYR A HB3  1 
ATOM   3920  H  HD1  . TYR A 1 297 ? 7.098   3.680  49.422 1.00 41.94  ? 505  TYR A HD1  1 
ATOM   3921  H  HD2  . TYR A 1 297 ? 6.300   6.604  52.028 1.00 38.66  ? 505  TYR A HD2  1 
ATOM   3922  H  HE1  . TYR A 1 297 ? 5.524   2.339  50.441 1.00 41.78  ? 505  TYR A HE1  1 
ATOM   3923  H  HE2  . TYR A 1 297 ? 4.726   5.269  53.050 1.00 41.55  ? 505  TYR A HE2  1 
ATOM   3924  H  HH   . TYR A 1 297 ? 3.987   2.134  52.068 1.00 39.90  ? 505  TYR A HH   1 
ATOM   3925  N  N    . VAL A 1 298 ? 6.061   8.603  49.526 1.00 28.75  ? 506  VAL A N    1 
ATOM   3926  C  CA   . VAL A 1 298 ? 4.792   9.288  49.766 1.00 30.80  ? 506  VAL A CA   1 
ATOM   3927  C  C    . VAL A 1 298 ? 4.131   9.669  48.448 1.00 30.52  ? 506  VAL A C    1 
ATOM   3928  O  O    . VAL A 1 298 ? 2.905   9.588  48.304 1.00 29.50  ? 506  VAL A O    1 
ATOM   3929  C  CB   . VAL A 1 298 ? 5.012   10.523 50.662 1.00 30.63  ? 506  VAL A CB   1 
ATOM   3930  C  CG1  . VAL A 1 298 ? 3.779   11.416 50.670 1.00 33.01  ? 506  VAL A CG1  1 
ATOM   3931  C  CG2  . VAL A 1 298 ? 5.357   10.092 52.078 1.00 32.39  ? 506  VAL A CG2  1 
ATOM   3932  H  H    . VAL A 1 298 ? 6.745   8.980  49.886 1.00 34.50  ? 506  VAL A H    1 
ATOM   3933  H  HA   . VAL A 1 298 ? 4.194   8.685  50.234 1.00 36.96  ? 506  VAL A HA   1 
ATOM   3934  H  HB   . VAL A 1 298 ? 5.756   11.039 50.314 1.00 36.76  ? 506  VAL A HB   1 
ATOM   3935  H  HG11 . VAL A 1 298 ? 3.948   12.182 51.241 1.00 39.62  ? 506  VAL A HG11 1 
ATOM   3936  H  HG12 . VAL A 1 298 ? 3.597   11.711 49.765 1.00 39.62  ? 506  VAL A HG12 1 
ATOM   3937  H  HG13 . VAL A 1 298 ? 3.025   10.909 51.011 1.00 39.62  ? 506  VAL A HG13 1 
ATOM   3938  H  HG21 . VAL A 1 298 ? 5.491   10.883 52.624 1.00 38.87  ? 506  VAL A HG21 1 
ATOM   3939  H  HG22 . VAL A 1 298 ? 4.625   9.564  52.434 1.00 38.87  ? 506  VAL A HG22 1 
ATOM   3940  H  HG23 . VAL A 1 298 ? 6.169   9.562  52.057 1.00 38.87  ? 506  VAL A HG23 1 
ATOM   3941  N  N    . THR A 1 299 ? 4.930   10.086 47.464 1.00 32.93  ? 507  THR A N    1 
ATOM   3942  C  CA   . THR A 1 299 ? 4.375   10.659 46.243 1.00 30.75  ? 507  THR A CA   1 
ATOM   3943  C  C    . THR A 1 299 ? 3.883   9.588  45.270 1.00 32.64  ? 507  THR A C    1 
ATOM   3944  O  O    . THR A 1 299 ? 2.827   9.757  44.650 1.00 33.70  ? 507  THR A O    1 
ATOM   3945  C  CB   . THR A 1 299 ? 5.424   11.550 45.568 1.00 30.31  ? 507  THR A CB   1 
ATOM   3946  O  OG1  . THR A 1 299 ? 5.825   12.592 46.469 1.00 25.84  ? 507  THR A OG1  1 
ATOM   3947  C  CG2  . THR A 1 299 ? 4.869   12.181 44.294 1.00 30.97  ? 507  THR A CG2  1 
ATOM   3948  H  H    . THR A 1 299 ? 5.789   10.048 47.482 1.00 39.51  ? 507  THR A H    1 
ATOM   3949  H  HA   . THR A 1 299 ? 3.618   11.217 46.476 1.00 36.90  ? 507  THR A HA   1 
ATOM   3950  H  HB   . THR A 1 299 ? 6.197   11.014 45.331 1.00 36.37  ? 507  THR A HB   1 
ATOM   3951  H  HG1  . THR A 1 299 ? 6.155   12.259 47.166 1.00 31.02  ? 507  THR A HG1  1 
ATOM   3952  H  HG21 . THR A 1 299 ? 5.544   12.741 43.880 1.00 37.16  ? 507  THR A HG21 1 
ATOM   3953  H  HG22 . THR A 1 299 ? 4.607   11.488 43.668 1.00 37.16  ? 507  THR A HG22 1 
ATOM   3954  H  HG23 . THR A 1 299 ? 4.094   12.725 44.505 1.00 37.16  ? 507  THR A HG23 1 
ATOM   3955  N  N    . PHE A 1 300 ? 4.620   8.484  45.117 1.00 30.89  ? 508  PHE A N    1 
ATOM   3956  C  CA   . PHE A 1 300 ? 4.350   7.527  44.045 1.00 32.76  ? 508  PHE A CA   1 
ATOM   3957  C  C    . PHE A 1 300 ? 3.841   6.170  44.514 1.00 32.21  ? 508  PHE A C    1 
ATOM   3958  O  O    . PHE A 1 300 ? 3.437   5.360  43.670 1.00 32.54  ? 508  PHE A O    1 
ATOM   3959  C  CB   . PHE A 1 300 ? 5.615   7.307  43.198 1.00 33.03  ? 508  PHE A CB   1 
ATOM   3960  C  CG   . PHE A 1 300 ? 6.031   8.518  42.402 1.00 35.39  ? 508  PHE A CG   1 
ATOM   3961  C  CD1  . PHE A 1 300 ? 5.189   9.057  41.443 1.00 37.06  ? 508  PHE A CD1  1 
ATOM   3962  C  CD2  . PHE A 1 300 ? 7.267   9.110  42.608 1.00 35.88  ? 508  PHE A CD2  1 
ATOM   3963  C  CE1  . PHE A 1 300 ? 5.569   10.170 40.709 1.00 40.27  ? 508  PHE A CE1  1 
ATOM   3964  C  CE2  . PHE A 1 300 ? 7.653   10.223 41.877 1.00 38.17  ? 508  PHE A CE2  1 
ATOM   3965  C  CZ   . PHE A 1 300 ? 6.803   10.753 40.928 1.00 38.97  ? 508  PHE A CZ   1 
ATOM   3966  H  H    . PHE A 1 300 ? 5.282   8.268  45.621 1.00 37.07  ? 508  PHE A H    1 
ATOM   3967  H  HA   . PHE A 1 300 ? 3.672   7.905  43.463 1.00 39.31  ? 508  PHE A HA   1 
ATOM   3968  H  HB2  . PHE A 1 300 ? 6.349   7.072  43.786 1.00 39.64  ? 508  PHE A HB2  1 
ATOM   3969  H  HB3  . PHE A 1 300 ? 5.450   6.584  42.572 1.00 39.64  ? 508  PHE A HB3  1 
ATOM   3970  H  HD1  . PHE A 1 300 ? 4.357   8.670  41.293 1.00 44.47  ? 508  PHE A HD1  1 
ATOM   3971  H  HD2  . PHE A 1 300 ? 7.844   8.759  43.248 1.00 43.06  ? 508  PHE A HD2  1 
ATOM   3972  H  HE1  . PHE A 1 300 ? 4.994   10.524 40.069 1.00 48.32  ? 508  PHE A HE1  1 
ATOM   3973  H  HE2  . PHE A 1 300 ? 8.484   10.612 42.026 1.00 45.80  ? 508  PHE A HE2  1 
ATOM   3974  H  HZ   . PHE A 1 300 ? 7.061   11.498 40.436 1.00 46.77  ? 508  PHE A HZ   1 
ATOM   3975  N  N    . SER A 1 301 ? 3.848   5.885  45.812 1.00 34.54  ? 509  SER A N    1 
ATOM   3976  C  CA   . SER A 1 301 ? 3.370   4.588  46.274 1.00 38.56  ? 509  SER A CA   1 
ATOM   3977  C  C    . SER A 1 301 ? 1.864   4.474  46.075 1.00 37.61  ? 509  SER A C    1 
ATOM   3978  O  O    . SER A 1 301 ? 1.121   5.437  46.277 1.00 34.97  ? 509  SER A O    1 
ATOM   3979  C  CB   . SER A 1 301 ? 3.714   4.381  47.747 1.00 39.43  ? 509  SER A CB   1 
ATOM   3980  O  OG   . SER A 1 301 ? 3.205   3.140  48.211 1.00 43.33  ? 509  SER A OG   1 
ATOM   3981  H  H    . SER A 1 301 ? 4.119   6.414  46.434 1.00 41.46  ? 509  SER A H    1 
ATOM   3982  H  HA   . SER A 1 301 ? 3.799   3.887  45.759 1.00 46.27  ? 509  SER A HA   1 
ATOM   3983  H  HB2  . SER A 1 301 ? 4.679   4.385  47.850 1.00 47.32  ? 509  SER A HB2  1 
ATOM   3984  H  HB3  . SER A 1 301 ? 3.321   5.098  48.268 1.00 47.32  ? 509  SER A HB3  1 
ATOM   3985  H  HG   . SER A 1 301 ? 3.538   2.509  47.767 1.00 52.00  ? 509  SER A HG   1 
ATOM   3986  N  N    . THR A 1 302 ? 1.415   3.284  45.672 1.00 39.20  ? 510  THR A N    1 
ATOM   3987  C  CA   . THR A 1 302 ? -0.007  2.989  45.541 1.00 38.20  ? 510  THR A CA   1 
ATOM   3988  C  C    . THR A 1 302 ? -0.469  1.927  46.533 1.00 37.72  ? 510  THR A C    1 
ATOM   3989  O  O    . THR A 1 302 ? -1.535  1.335  46.344 1.00 38.86  ? 510  THR A O    1 
ATOM   3990  C  CB   . THR A 1 302 ? -0.339  2.541  44.116 1.00 40.84  ? 510  THR A CB   1 
ATOM   3991  O  OG1  . THR A 1 302 ? 0.501   1.440  43.745 1.00 40.86  ? 510  THR A OG1  1 
ATOM   3992  C  CG2  . THR A 1 302 ? -0.147  3.685  43.131 1.00 42.34  ? 510  THR A CG2  1 
ATOM   3993  H  H    . THR A 1 302 ? 1.924   2.622  45.467 1.00 47.04  ? 510  THR A H    1 
ATOM   3994  H  HA   . THR A 1 302 ? -0.510  3.799  45.721 1.00 45.84  ? 510  THR A HA   1 
ATOM   3995  H  HB   . THR A 1 302 ? -1.267  2.261  44.078 1.00 49.02  ? 510  THR A HB   1 
ATOM   3996  H  HG1  . THR A 1 302 ? 0.321   1.192  42.963 1.00 49.03  ? 510  THR A HG1  1 
ATOM   3997  H  HG21 . THR A 1 302 ? -0.361  3.387  42.233 1.00 50.81  ? 510  THR A HG21 1 
ATOM   3998  H  HG22 . THR A 1 302 ? -0.729  4.424  43.365 1.00 50.81  ? 510  THR A HG22 1 
ATOM   3999  H  HG23 . THR A 1 302 ? 0.774   3.989  43.152 1.00 50.81  ? 510  THR A HG23 1 
ATOM   4000  N  N    . ASP A 1 303 ? 0.301   1.676  47.589 1.00 37.76  ? 511  ASP A N    1 
ATOM   4001  C  CA   . ASP A 1 303 ? -0.079  0.635  48.529 1.00 39.60  ? 511  ASP A CA   1 
ATOM   4002  C  C    . ASP A 1 303 ? -1.255  1.098  49.392 1.00 39.16  ? 511  ASP A C    1 
ATOM   4003  O  O    . ASP A 1 303 ? -1.669  2.263  49.370 1.00 37.86  ? 511  ASP A O    1 
ATOM   4004  C  CB   . ASP A 1 303 ? 1.120   0.217  49.390 1.00 37.97  ? 511  ASP A CB   1 
ATOM   4005  C  CG   . ASP A 1 303 ? 1.580   1.305  50.353 1.00 38.29  ? 511  ASP A CG   1 
ATOM   4006  O  OD1  . ASP A 1 303 ? 0.776   2.185  50.728 1.00 36.76  ? 511  ASP A OD1  1 
ATOM   4007  O  OD2  . ASP A 1 303 ? 2.767   1.271  50.743 1.00 38.74  ? 511  ASP A OD2  1 
ATOM   4008  H  H    . ASP A 1 303 ? 1.033   2.086  47.778 1.00 45.31  ? 511  ASP A H    1 
ATOM   4009  H  HA   . ASP A 1 303 ? -0.369  -0.144 48.030 1.00 47.52  ? 511  ASP A HA   1 
ATOM   4010  H  HB2  . ASP A 1 303 ? 0.873   -0.560 49.915 1.00 45.56  ? 511  ASP A HB2  1 
ATOM   4011  H  HB3  . ASP A 1 303 ? 1.864   0.000  48.808 1.00 45.56  ? 511  ASP A HB3  1 
ATOM   4012  N  N    . ASP A 1 304 ? -1.793  0.152  50.166 1.00 37.45  ? 512  ASP A N    1 
ATOM   4013  C  CA   . ASP A 1 304 ? -3.000  0.401  50.949 1.00 36.85  ? 512  ASP A CA   1 
ATOM   4014  C  C    . ASP A 1 304 ? -2.819  1.551  51.936 1.00 36.14  ? 512  ASP A C    1 
ATOM   4015  O  O    . ASP A 1 304 ? -3.771  2.295  52.198 1.00 37.37  ? 512  ASP A O    1 
ATOM   4016  C  CB   . ASP A 1 304 ? -3.393  -0.882 51.686 1.00 39.16  ? 512  ASP A CB   1 
ATOM   4017  C  CG   . ASP A 1 304 ? -4.787  -0.819 52.280 1.00 43.86  ? 512  ASP A CG   1 
ATOM   4018  O  OD1  . ASP A 1 304 ? -5.765  -0.694 51.510 1.00 43.87  ? 512  ASP A OD1  1 
ATOM   4019  O  OD2  . ASP A 1 304 ? -4.906  -0.916 53.520 1.00 45.54  ? 512  ASP A OD2  1 
ATOM   4020  H  H    . ASP A 1 304 ? -1.476  -0.643 50.253 1.00 44.95  ? 512  ASP A H    1 
ATOM   4021  H  HA   . ASP A 1 304 ? -3.723  0.634  50.347 1.00 44.22  ? 512  ASP A HA   1 
ATOM   4022  H  HB2  . ASP A 1 304 ? -3.366  -1.624 51.062 1.00 46.99  ? 512  ASP A HB2  1 
ATOM   4023  H  HB3  . ASP A 1 304 ? -2.766  -1.034 52.410 1.00 46.99  ? 512  ASP A HB3  1 
ATOM   4024  N  N    . LEU A 1 305 ? -1.616  1.718  52.490 1.00 35.60  ? 513  LEU A N    1 
ATOM   4025  C  CA   . LEU A 1 305 ? -1.409  2.728  53.527 1.00 34.09  ? 513  LEU A CA   1 
ATOM   4026  C  C    . LEU A 1 305 ? -1.449  4.141  52.948 1.00 32.50  ? 513  LEU A C    1 
ATOM   4027  O  O    . LEU A 1 305 ? -2.156  5.014  53.465 1.00 33.27  ? 513  LEU A O    1 
ATOM   4028  C  CB   . LEU A 1 305 ? -0.079  2.470  54.240 1.00 36.29  ? 513  LEU A CB   1 
ATOM   4029  C  CG   . LEU A 1 305 ? 0.405   3.543  55.225 1.00 35.08  ? 513  LEU A CG   1 
ATOM   4030  C  CD1  . LEU A 1 305 ? -0.563  3.704  56.389 1.00 33.40  ? 513  LEU A CD1  1 
ATOM   4031  C  CD2  . LEU A 1 305 ? 1.799   3.208  55.729 1.00 35.33  ? 513  LEU A CD2  1 
ATOM   4032  H  H    . LEU A 1 305 ? -0.914  1.266  52.287 1.00 42.73  ? 513  LEU A H    1 
ATOM   4033  H  HA   . LEU A 1 305 ? -2.119  2.655  54.184 1.00 40.91  ? 513  LEU A HA   1 
ATOM   4034  H  HB2  . LEU A 1 305 ? -0.160  1.642  54.738 1.00 43.54  ? 513  LEU A HB2  1 
ATOM   4035  H  HB3  . LEU A 1 305 ? 0.611   2.371  53.565 1.00 43.54  ? 513  LEU A HB3  1 
ATOM   4036  H  HG   . LEU A 1 305 ? 0.454   4.393  54.760 1.00 42.10  ? 513  LEU A HG   1 
ATOM   4037  H  HD11 . LEU A 1 305 ? -0.225  4.388  56.988 1.00 40.08  ? 513  LEU A HD11 1 
ATOM   4038  H  HD12 . LEU A 1 305 ? -1.431  3.966  56.044 1.00 40.08  ? 513  LEU A HD12 1 
ATOM   4039  H  HD13 . LEU A 1 305 ? -0.634  2.859  56.859 1.00 40.08  ? 513  LEU A HD13 1 
ATOM   4040  H  HD21 . LEU A 1 305 ? 2.085   3.898  56.348 1.00 42.39  ? 513  LEU A HD21 1 
ATOM   4041  H  HD22 . LEU A 1 305 ? 1.774   2.349  56.178 1.00 42.39  ? 513  LEU A HD22 1 
ATOM   4042  H  HD23 . LEU A 1 305 ? 2.407   3.169  54.974 1.00 42.39  ? 513  LEU A HD23 1 
ATOM   4043  N  N    . VAL A 1 306 ? -0.692  4.390  51.878 1.00 33.02  ? 514  VAL A N    1 
ATOM   4044  C  CA   . VAL A 1 306 ? -0.596  5.744  51.334 1.00 32.13  ? 514  VAL A CA   1 
ATOM   4045  C  C    . VAL A 1 306 ? -1.912  6.156  50.685 1.00 30.78  ? 514  VAL A C    1 
ATOM   4046  O  O    . VAL A 1 306 ? -2.326  7.319  50.771 1.00 33.34  ? 514  VAL A O    1 
ATOM   4047  C  CB   . VAL A 1 306 ? 0.582   5.832  50.345 1.00 30.96  ? 514  VAL A CB   1 
ATOM   4048  C  CG1  . VAL A 1 306 ? 0.649   7.206  49.683 1.00 32.35  ? 514  VAL A CG1  1 
ATOM   4049  C  CG2  . VAL A 1 306 ? 1.886   5.528  51.061 1.00 32.67  ? 514  VAL A CG2  1 
ATOM   4050  H  H    . VAL A 1 306 ? -0.229  3.801  51.455 1.00 39.63  ? 514  VAL A H    1 
ATOM   4051  H  HA   . VAL A 1 306 ? -0.419  6.361  52.062 1.00 38.56  ? 514  VAL A HA   1 
ATOM   4052  H  HB   . VAL A 1 306 ? 0.461   5.168  49.649 1.00 37.16  ? 514  VAL A HB   1 
ATOM   4053  H  HG11 . VAL A 1 306 ? 1.401   7.224  49.070 1.00 38.82  ? 514  VAL A HG11 1 
ATOM   4054  H  HG12 . VAL A 1 306 ? -0.177  7.363  49.200 1.00 38.82  ? 514  VAL A HG12 1 
ATOM   4055  H  HG13 . VAL A 1 306 ? 0.766   7.881  50.369 1.00 38.82  ? 514  VAL A HG13 1 
ATOM   4056  H  HG21 . VAL A 1 306 ? 2.616   5.588  50.424 1.00 39.20  ? 514  VAL A HG21 1 
ATOM   4057  H  HG22 . VAL A 1 306 ? 2.014   6.174  51.772 1.00 39.20  ? 514  VAL A HG22 1 
ATOM   4058  H  HG23 . VAL A 1 306 ? 1.842   4.632  51.430 1.00 39.20  ? 514  VAL A HG23 1 
ATOM   4059  N  N    . THR A 1 307 ? -2.584  5.215  50.020 1.00 31.56  ? 515  THR A N    1 
ATOM   4060  C  CA   . THR A 1 307 ? -3.852  5.516  49.362 1.00 34.97  ? 515  THR A CA   1 
ATOM   4061  C  C    . THR A 1 307 ? -4.904  5.953  50.374 1.00 33.45  ? 515  THR A C    1 
ATOM   4062  O  O    . THR A 1 307 ? -5.530  7.009  50.223 1.00 33.58  ? 515  THR A O    1 
ATOM   4063  C  CB   . THR A 1 307 ? -4.340  4.286  48.588 1.00 43.55  ? 515  THR A CB   1 
ATOM   4064  O  OG1  . THR A 1 307 ? -3.378  3.927  47.589 1.00 44.03  ? 515  THR A OG1  1 
ATOM   4065  C  CG2  . THR A 1 307 ? -5.685  4.561  47.915 1.00 47.92  ? 515  THR A CG2  1 
ATOM   4066  H  H    . THR A 1 307 ? -2.327  4.399  49.936 1.00 37.87  ? 515  THR A H    1 
ATOM   4067  H  HA   . THR A 1 307 ? -3.719  6.240  48.730 1.00 41.96  ? 515  THR A HA   1 
ATOM   4068  H  HB   . THR A 1 307 ? -4.455  3.545  49.203 1.00 52.27  ? 515  THR A HB   1 
ATOM   4069  H  HG1  . THR A 1 307 ? -2.641  3.748  47.951 1.00 52.84  ? 515  THR A HG1  1 
ATOM   4070  H  HG21 . THR A 1 307 ? -5.979  3.775  47.429 1.00 57.51  ? 515  THR A HG21 1 
ATOM   4071  H  HG22 . THR A 1 307 ? -6.350  4.787  48.584 1.00 57.51  ? 515  THR A HG22 1 
ATOM   4072  H  HG23 . THR A 1 307 ? -5.599  5.301  47.293 1.00 57.51  ? 515  THR A HG23 1 
ATOM   4073  N  N    . LYS A 1 308 ? -5.121  5.142  51.410 1.00 31.80  ? 516  LYS A N    1 
ATOM   4074  C  CA   . LYS A 1 308 ? -6.189  5.425  52.361 1.00 30.09  ? 516  LYS A CA   1 
ATOM   4075  C  C    . LYS A 1 308 ? -5.868  6.633  53.237 1.00 32.71  ? 516  LYS A C    1 
ATOM   4076  O  O    . LYS A 1 308 ? -6.785  7.350  53.654 1.00 35.01  ? 516  LYS A O    1 
ATOM   4077  C  CB   . LYS A 1 308 ? -6.460  4.183  53.212 1.00 32.38  ? 516  LYS A CB   1 
ATOM   4078  C  CG   . LYS A 1 308 ? -7.097  3.045  52.419 1.00 33.51  ? 516  LYS A CG   1 
ATOM   4079  C  CD   . LYS A 1 308 ? -7.282  1.787  53.250 1.00 36.08  ? 516  LYS A CD   1 
ATOM   4080  C  CE   . LYS A 1 308 ? -8.148  0.767  52.517 1.00 38.87  ? 516  LYS A CE   1 
ATOM   4081  N  NZ   . LYS A 1 308 ? -8.222  -0.529 53.248 1.00 41.76  ? 516  LYS A NZ   1 
ATOM   4082  H  H    . LYS A 1 308 ? -4.668  4.431  51.582 1.00 38.16  ? 516  LYS A H    1 
ATOM   4083  H  HA   . LYS A 1 308 ? -6.999  5.627  51.866 1.00 36.11  ? 516  LYS A HA   1 
ATOM   4084  H  HB2  . LYS A 1 308 ? -5.620  3.861  53.576 1.00 38.86  ? 516  LYS A HB2  1 
ATOM   4085  H  HB3  . LYS A 1 308 ? -7.064  4.421  53.933 1.00 38.86  ? 516  LYS A HB3  1 
ATOM   4086  H  HG2  . LYS A 1 308 ? -7.970  3.328  52.104 1.00 40.21  ? 516  LYS A HG2  1 
ATOM   4087  H  HG3  . LYS A 1 308 ? -6.527  2.826  51.665 1.00 40.21  ? 516  LYS A HG3  1 
ATOM   4088  H  HD2  . LYS A 1 308 ? -6.416  1.386  53.422 1.00 43.29  ? 516  LYS A HD2  1 
ATOM   4089  H  HD3  . LYS A 1 308 ? -7.720  2.016  54.085 1.00 43.29  ? 516  LYS A HD3  1 
ATOM   4090  H  HE2  . LYS A 1 308 ? -9.049  1.117  52.430 1.00 46.64  ? 516  LYS A HE2  1 
ATOM   4091  H  HE3  . LYS A 1 308 ? -7.769  0.598  51.641 1.00 46.64  ? 516  LYS A HE3  1 
ATOM   4092  H  HZ1  . LYS A 1 308 ? -7.407  -0.875 53.337 1.00 50.11  ? 516  LYS A HZ1  1 
ATOM   4093  H  HZ2  . LYS A 1 308 ? -8.573  -0.402 54.056 1.00 50.11  ? 516  LYS A HZ2  1 
ATOM   4094  H  HZ3  . LYS A 1 308 ? -8.732  -1.103 52.798 1.00 50.11  ? 516  LYS A HZ3  1 
ATOM   4095  N  N    . MET A 1 309 ? -4.588  6.888  53.522 1.00 30.52  ? 517  MET A N    1 
ATOM   4096  C  CA   . MET A 1 309 ? -4.245  8.042  54.350 1.00 29.92  ? 517  MET A CA   1 
ATOM   4097  C  C    . MET A 1 309 ? -4.404  9.350  53.587 1.00 29.67  ? 517  MET A C    1 
ATOM   4098  O  O    . MET A 1 309 ? -4.754  10.375 54.186 1.00 27.80  ? 517  MET A O    1 
ATOM   4099  C  CB   . MET A 1 309 ? -2.819  7.914  54.883 1.00 29.54  ? 517  MET A CB   1 
ATOM   4100  C  CG   . MET A 1 309 ? -2.638  6.841  55.951 1.00 33.39  ? 517  MET A CG   1 
ATOM   4101  S  SD   . MET A 1 309 ? -3.664  7.094  57.413 1.00 38.76  ? 517  MET A SD   1 
ATOM   4102  C  CE   . MET A 1 309 ? -5.103  6.097  57.022 1.00 36.25  ? 517  MET A CE   1 
ATOM   4103  H  H    . MET A 1 309 ? -3.917  6.421  53.255 1.00 36.63  ? 517  MET A H    1 
ATOM   4104  H  HA   . MET A 1 309 ? -4.841  8.058  55.115 1.00 35.90  ? 517  MET A HA   1 
ATOM   4105  H  HB2  . MET A 1 309 ? -2.230  7.695  54.144 1.00 35.45  ? 517  MET A HB2  1 
ATOM   4106  H  HB3  . MET A 1 309 ? -2.555  8.763  55.271 1.00 35.45  ? 517  MET A HB3  1 
ATOM   4107  H  HG2  . MET A 1 309 ? -2.870  5.979  55.571 1.00 40.08  ? 517  MET A HG2  1 
ATOM   4108  H  HG3  . MET A 1 309 ? -1.711  6.836  56.235 1.00 40.08  ? 517  MET A HG3  1 
ATOM   4109  H  HE1  . MET A 1 309 ? -5.737  6.158  57.753 1.00 43.51  ? 517  MET A HE1  1 
ATOM   4110  H  HE2  . MET A 1 309 ? -5.506  6.432  56.205 1.00 43.51  ? 517  MET A HE2  1 
ATOM   4111  H  HE3  . MET A 1 309 ? -4.825  5.176  56.900 1.00 43.51  ? 517  MET A HE3  1 
ATOM   4112  N  N    . LYS A 1 310 ? -4.154  9.344  52.277 1.00 30.79  ? 518  LYS A N    1 
ATOM   4113  C  CA   . LYS A 1 310 ? -4.409  10.543 51.486 1.00 32.02  ? 518  LYS A CA   1 
ATOM   4114  C  C    . LYS A 1 310 ? -5.896  10.871 51.440 1.00 30.44  ? 518  LYS A C    1 
ATOM   4115  O  O    . LYS A 1 310 ? -6.269  12.050 51.424 1.00 30.30  ? 518  LYS A O    1 
ATOM   4116  C  CB   . LYS A 1 310 ? -3.847  10.371 50.075 1.00 32.12  ? 518  LYS A CB   1 
ATOM   4117  C  CG   . LYS A 1 310 ? -2.335  10.471 50.016 1.00 31.99  ? 518  LYS A CG   1 
ATOM   4118  C  CD   . LYS A 1 310 ? -1.796  10.230 48.616 1.00 34.41  ? 518  LYS A CD   1 
ATOM   4119  C  CE   . LYS A 1 310 ? -0.304  10.532 48.550 1.00 34.34  ? 518  LYS A CE   1 
ATOM   4120  N  NZ   . LYS A 1 310 ? 0.275   10.252 47.207 1.00 33.61  ? 518  LYS A NZ   1 
ATOM   4121  H  H    . LYS A 1 310 ? -3.844  8.676  51.834 1.00 36.95  ? 518  LYS A H    1 
ATOM   4122  H  HA   . LYS A 1 310 ? -3.953  11.293 51.898 1.00 38.43  ? 518  LYS A HA   1 
ATOM   4123  H  HB2  . LYS A 1 310 ? -4.102  9.497  49.740 1.00 38.55  ? 518  LYS A HB2  1 
ATOM   4124  H  HB3  . LYS A 1 310 ? -4.214  11.064 49.504 1.00 38.55  ? 518  LYS A HB3  1 
ATOM   4125  H  HG2  . LYS A 1 310 ? -2.064  11.360 50.295 1.00 38.39  ? 518  LYS A HG2  1 
ATOM   4126  H  HG3  . LYS A 1 310 ? -1.949  9.805  50.606 1.00 38.39  ? 518  LYS A HG3  1 
ATOM   4127  H  HD2  . LYS A 1 310 ? -1.932  9.301  48.374 1.00 41.29  ? 518  LYS A HD2  1 
ATOM   4128  H  HD3  . LYS A 1 310 ? -2.254  10.813 47.990 1.00 41.29  ? 518  LYS A HD3  1 
ATOM   4129  H  HE2  . LYS A 1 310 ? -0.162  11.471 48.749 1.00 41.22  ? 518  LYS A HE2  1 
ATOM   4130  H  HE3  . LYS A 1 310 ? 0.160   9.980  49.199 1.00 41.22  ? 518  LYS A HE3  1 
ATOM   4131  H  HZ1  . LYS A 1 310 ? 0.164   9.393  47.001 1.00 40.33  ? 518  LYS A HZ1  1 
ATOM   4132  H  HZ2  . LYS A 1 310 ? -0.129  10.751 46.591 1.00 40.33  ? 518  LYS A HZ2  1 
ATOM   4133  H  HZ3  . LYS A 1 310 ? 1.145   10.439 47.206 1.00 40.33  ? 518  LYS A HZ3  1 
ATOM   4134  N  N    . GLN A 1 311 ? -6.759  9.853  51.429 1.00 32.10  ? 519  GLN A N    1 
ATOM   4135  C  CA   . GLN A 1 311 ? -8.197  10.095 51.490 1.00 33.60  ? 519  GLN A CA   1 
ATOM   4136  C  C    . GLN A 1 311 ? -8.604  10.598 52.871 1.00 33.28  ? 519  GLN A C    1 
ATOM   4137  O  O    . GLN A 1 311 ? -9.367  11.564 52.994 1.00 33.17  ? 519  GLN A O    1 
ATOM   4138  C  CB   . GLN A 1 311 ? -8.955  8.813  51.134 1.00 37.50  ? 519  GLN A CB   1 
ATOM   4139  C  CG   . GLN A 1 311 ? -10.477 8.919  51.227 1.00 39.80  ? 519  GLN A CG   1 
ATOM   4140  C  CD   . GLN A 1 311 ? -11.075 9.852  50.185 1.00 43.05  ? 519  GLN A CD   1 
ATOM   4141  O  OE1  . GLN A 1 311 ? -10.374 10.364 49.311 1.00 44.13  ? 519  GLN A OE1  1 
ATOM   4142  N  NE2  . GLN A 1 311 ? -12.381 10.074 50.274 1.00 44.49  ? 519  GLN A NE2  1 
ATOM   4143  H  H    . GLN A 1 311 ? -6.539  9.022  51.387 1.00 38.52  ? 519  GLN A H    1 
ATOM   4144  H  HA   . GLN A 1 311 ? -8.433  10.776 50.840 1.00 40.33  ? 519  GLN A HA   1 
ATOM   4145  H  HB2  . GLN A 1 311 ? -8.733  8.566  50.222 1.00 45.00  ? 519  GLN A HB2  1 
ATOM   4146  H  HB3  . GLN A 1 311 ? -8.673  8.109  51.739 1.00 45.00  ? 519  GLN A HB3  1 
ATOM   4147  H  HG2  . GLN A 1 311 ? -10.862 8.039  51.096 1.00 47.77  ? 519  GLN A HG2  1 
ATOM   4148  H  HG3  . GLN A 1 311 ? -10.716 9.258  52.103 1.00 47.77  ? 519  GLN A HG3  1 
ATOM   4149  H  HE21 . GLN A 1 311 ? -12.839 9.699  50.897 1.00 53.39  ? 519  GLN A HE21 1 
ATOM   4150  H  HE22 . GLN A 1 311 ? -12.768 10.594 49.709 1.00 53.39  ? 519  GLN A HE22 1 
ATOM   4151  N  N    . PHE A 1 312 ? -8.098  9.949  53.922 1.00 31.94  ? 520  PHE A N    1 
ATOM   4152  C  CA   . PHE A 1 312 ? -8.436  10.332 55.291 1.00 32.84  ? 520  PHE A CA   1 
ATOM   4153  C  C    . PHE A 1 312 ? -8.048  11.781 55.575 1.00 32.33  ? 520  PHE A C    1 
ATOM   4154  O  O    . PHE A 1 312 ? -8.846  12.561 56.110 1.00 31.72  ? 520  PHE A O    1 
ATOM   4155  C  CB   . PHE A 1 312 ? -7.732  9.379  56.260 1.00 32.72  ? 520  PHE A CB   1 
ATOM   4156  C  CG   . PHE A 1 312 ? -8.137  9.542  57.700 1.00 33.39  ? 520  PHE A CG   1 
ATOM   4157  C  CD1  . PHE A 1 312 ? -9.197  8.818  58.221 1.00 34.33  ? 520  PHE A CD1  1 
ATOM   4158  C  CD2  . PHE A 1 312 ? -7.433  10.390 58.543 1.00 35.14  ? 520  PHE A CD2  1 
ATOM   4159  C  CE1  . PHE A 1 312 ? -9.564  8.953  59.549 1.00 34.44  ? 520  PHE A CE1  1 
ATOM   4160  C  CE2  . PHE A 1 312 ? -7.797  10.530 59.872 1.00 33.13  ? 520  PHE A CE2  1 
ATOM   4161  C  CZ   . PHE A 1 312 ? -8.863  9.809  60.375 1.00 33.67  ? 520  PHE A CZ   1 
ATOM   4162  H  H    . PHE A 1 312 ? -7.556  9.284  53.868 1.00 38.33  ? 520  PHE A H    1 
ATOM   4163  H  HA   . PHE A 1 312 ? -9.394  10.244 55.421 1.00 39.41  ? 520  PHE A HA   1 
ATOM   4164  H  HB2  . PHE A 1 312 ? -7.934  8.467  56.000 1.00 39.26  ? 520  PHE A HB2  1 
ATOM   4165  H  HB3  . PHE A 1 312 ? -6.776  9.531  56.205 1.00 39.26  ? 520  PHE A HB3  1 
ATOM   4166  H  HD1  . PHE A 1 312 ? -9.674  8.241  57.669 1.00 41.20  ? 520  PHE A HD1  1 
ATOM   4167  H  HD2  . PHE A 1 312 ? -6.716  10.878 58.209 1.00 42.17  ? 520  PHE A HD2  1 
ATOM   4168  H  HE1  . PHE A 1 312 ? -10.283 8.467  59.884 1.00 41.33  ? 520  PHE A HE1  1 
ATOM   4169  H  HE2  . PHE A 1 312 ? -7.323  11.107 60.427 1.00 39.76  ? 520  PHE A HE2  1 
ATOM   4170  H  HZ   . PHE A 1 312 ? -9.109  9.901  61.267 1.00 40.40  ? 520  PHE A HZ   1 
ATOM   4171  N  N    . TYR A 1 313 ? -6.824  12.162 55.222 1.00 30.53  ? 521  TYR A N    1 
ATOM   4172  C  CA   . TYR A 1 313 ? -6.312  13.483 55.562 1.00 29.70  ? 521  TYR A CA   1 
ATOM   4173  C  C    . TYR A 1 313 ? -6.766  14.575 54.601 1.00 28.75  ? 521  TYR A C    1 
ATOM   4174  O  O    . TYR A 1 313 ? -6.385  15.736 54.789 1.00 27.62  ? 521  TYR A O    1 
ATOM   4175  C  CB   . TYR A 1 313 ? -4.783  13.434 55.642 1.00 26.91  ? 521  TYR A CB   1 
ATOM   4176  C  CG   . TYR A 1 313 ? -4.312  12.859 56.956 1.00 29.62  ? 521  TYR A CG   1 
ATOM   4177  C  CD1  . TYR A 1 313 ? -4.157  13.670 58.070 1.00 30.04  ? 521  TYR A CD1  1 
ATOM   4178  C  CD2  . TYR A 1 313 ? -4.059  11.503 57.095 1.00 30.60  ? 521  TYR A CD2  1 
ATOM   4179  C  CE1  . TYR A 1 313 ? -3.747  13.150 59.279 1.00 31.79  ? 521  TYR A CE1  1 
ATOM   4180  C  CE2  . TYR A 1 313 ? -3.646  10.973 58.303 1.00 32.67  ? 521  TYR A CE2  1 
ATOM   4181  C  CZ   . TYR A 1 313 ? -3.494  11.801 59.391 1.00 32.47  ? 521  TYR A CZ   1 
ATOM   4182  O  OH   . TYR A 1 313 ? -3.084  11.277 60.595 1.00 34.78  ? 521  TYR A OH   1 
ATOM   4183  H  H    . TYR A 1 313 ? -6.270  11.672 54.784 1.00 36.64  ? 521  TYR A H    1 
ATOM   4184  H  HA   . TYR A 1 313 ? -6.640  13.720 56.444 1.00 35.64  ? 521  TYR A HA   1 
ATOM   4185  H  HB2  . TYR A 1 313 ? -4.444  12.874 54.926 1.00 32.30  ? 521  TYR A HB2  1 
ATOM   4186  H  HB3  . TYR A 1 313 ? -4.430  14.334 55.560 1.00 32.30  ? 521  TYR A HB3  1 
ATOM   4187  H  HD1  . TYR A 1 313 ? -4.329  14.581 58.000 1.00 36.05  ? 521  TYR A HD1  1 
ATOM   4188  H  HD2  . TYR A 1 313 ? -4.163  10.941 56.361 1.00 36.72  ? 521  TYR A HD2  1 
ATOM   4189  H  HE1  . TYR A 1 313 ? -3.642  13.708 60.015 1.00 38.15  ? 521  TYR A HE1  1 
ATOM   4190  H  HE2  . TYR A 1 313 ? -3.475  10.062 58.380 1.00 39.20  ? 521  TYR A HE2  1 
ATOM   4191  H  HH   . TYR A 1 313 ? -2.966  10.449 60.523 1.00 41.73  ? 521  TYR A HH   1 
ATOM   4192  N  N    . SER A 1 314 ? -7.574  14.244 53.590 1.00 32.77  ? 522  SER A N    1 
ATOM   4193  C  CA   . SER A 1 314 ? -8.217  15.273 52.778 1.00 32.77  ? 522  SER A CA   1 
ATOM   4194  C  C    . SER A 1 314 ? -9.340  15.977 53.531 1.00 31.72  ? 522  SER A C    1 
ATOM   4195  O  O    . SER A 1 314 ? -9.738  17.078 53.135 1.00 29.02  ? 522  SER A O    1 
ATOM   4196  C  CB   . SER A 1 314 ? -8.776  14.664 51.488 1.00 33.43  ? 522  SER A CB   1 
ATOM   4197  O  OG   . SER A 1 314 ? -7.742  14.188 50.643 1.00 35.29  ? 522  SER A OG   1 
ATOM   4198  H  H    . SER A 1 314 ? -7.763  13.437 53.358 1.00 39.33  ? 522  SER A H    1 
ATOM   4199  H  HA   . SER A 1 314 ? -7.556  15.939 52.533 1.00 39.33  ? 522  SER A HA   1 
ATOM   4200  H  HB2  . SER A 1 314 ? -9.358  13.923 51.718 1.00 40.12  ? 522  SER A HB2  1 
ATOM   4201  H  HB3  . SER A 1 314 ? -9.280  15.344 51.014 1.00 40.12  ? 522  SER A HB3  1 
ATOM   4202  H  HG   . SER A 1 314 ? -7.297  13.596 51.038 1.00 42.36  ? 522  SER A HG   1 
ATOM   4203  N  N    . TYR A 1 315 ? -9.856  15.367 54.597 1.00 30.71  ? 523  TYR A N    1 
ATOM   4204  C  CA   . TYR A 1 315 ? -10.966 15.893 55.384 1.00 32.91  ? 523  TYR A CA   1 
ATOM   4205  C  C    . TYR A 1 315 ? -10.574 16.021 56.852 1.00 32.37  ? 523  TYR A C    1 
ATOM   4206  O  O    . TYR A 1 315 ? -11.342 15.672 57.753 1.00 35.79  ? 523  TYR A O    1 
ATOM   4207  C  CB   . TYR A 1 315 ? -12.199 15.001 55.235 1.00 32.22  ? 523  TYR A CB   1 
ATOM   4208  C  CG   . TYR A 1 315 ? -12.678 14.861 53.808 1.00 33.81  ? 523  TYR A CG   1 
ATOM   4209  C  CD1  . TYR A 1 315 ? -13.607 15.745 53.279 1.00 35.23  ? 523  TYR A CD1  1 
ATOM   4210  C  CD2  . TYR A 1 315 ? -12.193 13.850 52.988 1.00 35.40  ? 523  TYR A CD2  1 
ATOM   4211  C  CE1  . TYR A 1 315 ? -14.045 15.627 51.973 1.00 36.16  ? 523  TYR A CE1  1 
ATOM   4212  C  CE2  . TYR A 1 315 ? -12.623 13.723 51.679 1.00 36.63  ? 523  TYR A CE2  1 
ATOM   4213  C  CZ   . TYR A 1 315 ? -13.551 14.614 51.178 1.00 36.92  ? 523  TYR A CZ   1 
ATOM   4214  O  OH   . TYR A 1 315 ? -13.983 14.498 49.878 1.00 36.56  ? 523  TYR A OH   1 
ATOM   4215  H  H    . TYR A 1 315 ? -9.565  14.614 54.894 1.00 36.86  ? 523  TYR A H    1 
ATOM   4216  H  HA   . TYR A 1 315 ? -11.194 16.778 55.056 1.00 39.50  ? 523  TYR A HA   1 
ATOM   4217  H  HB2  . TYR A 1 315 ? -11.986 14.115 55.565 1.00 38.67  ? 523  TYR A HB2  1 
ATOM   4218  H  HB3  . TYR A 1 315 ? -12.925 15.381 55.756 1.00 38.67  ? 523  TYR A HB3  1 
ATOM   4219  H  HD1  . TYR A 1 315 ? -13.942 16.429 53.812 1.00 42.28  ? 523  TYR A HD1  1 
ATOM   4220  H  HD2  . TYR A 1 315 ? -11.568 13.249 53.323 1.00 42.48  ? 523  TYR A HD2  1 
ATOM   4221  H  HE1  . TYR A 1 315 ? -14.669 16.227 51.632 1.00 43.39  ? 523  TYR A HE1  1 
ATOM   4222  H  HE2  . TYR A 1 315 ? -12.291 13.041 51.142 1.00 43.96  ? 523  TYR A HE2  1 
ATOM   4223  H  HH   . TYR A 1 315 ? -14.540 15.102 49.705 1.00 43.88  ? 523  TYR A HH   1 
ATOM   4224  N  N    . THR A 1 316 ? -9.370  16.529 57.107 1.00 29.07  ? 524  THR A N    1 
ATOM   4225  C  CA   . THR A 1 316 ? -8.791  16.565 58.443 1.00 30.75  ? 524  THR A CA   1 
ATOM   4226  C  C    . THR A 1 316 ? -8.312  17.974 58.775 1.00 29.11  ? 524  THR A C    1 
ATOM   4227  O  O    . THR A 1 316 ? -7.746  18.664 57.923 1.00 28.62  ? 524  THR A O    1 
ATOM   4228  C  CB   . THR A 1 316 ? -7.617  15.573 58.549 1.00 31.14  ? 524  THR A CB   1 
ATOM   4229  O  OG1  . THR A 1 316 ? -8.104  14.233 58.389 1.00 33.16  ? 524  THR A OG1  1 
ATOM   4230  C  CG2  . THR A 1 316 ? -6.900  15.693 59.889 1.00 31.04  ? 524  THR A CG2  1 
ATOM   4231  H  H    . THR A 1 316 ? -8.858  16.867 56.504 1.00 34.88  ? 524  THR A H    1 
ATOM   4232  H  HA   . THR A 1 316 ? -9.465  16.311 59.093 1.00 36.90  ? 524  THR A HA   1 
ATOM   4233  H  HB   . THR A 1 316 ? -6.976  15.763 57.846 1.00 37.37  ? 524  THR A HB   1 
ATOM   4234  H  HG1  . THR A 1 316 ? -7.468  13.688 58.446 1.00 39.79  ? 524  THR A HG1  1 
ATOM   4235  H  HG21 . THR A 1 316 ? -6.167  15.059 59.931 1.00 37.25  ? 524  THR A HG21 1 
ATOM   4236  H  HG22 . THR A 1 316 ? -6.547  16.591 59.997 1.00 37.25  ? 524  THR A HG22 1 
ATOM   4237  H  HG23 . THR A 1 316 ? -7.518  15.508 60.613 1.00 37.25  ? 524  THR A HG23 1 
ATOM   4238  N  N    . LEU A 1 317 ? -8.535  18.388 60.022 1.00 32.00  ? 525  LEU A N    1 
ATOM   4239  C  CA   . LEU A 1 317 ? -7.980  19.636 60.534 1.00 31.28  ? 525  LEU A CA   1 
ATOM   4240  C  C    . LEU A 1 317 ? -6.503  19.455 60.877 1.00 31.51  ? 525  LEU A C    1 
ATOM   4241  O  O    . LEU A 1 317 ? -6.097  18.411 61.399 1.00 29.54  ? 525  LEU A O    1 
ATOM   4242  C  CB   . LEU A 1 317 ? -8.758  20.083 61.774 1.00 33.03  ? 525  LEU A CB   1 
ATOM   4243  C  CG   . LEU A 1 317 ? -8.324  21.373 62.477 1.00 34.57  ? 525  LEU A CG   1 
ATOM   4244  C  CD1  . LEU A 1 317 ? -8.781  22.596 61.693 1.00 30.92  ? 525  LEU A CD1  1 
ATOM   4245  C  CD2  . LEU A 1 317 ? -8.861  21.409 63.904 1.00 38.25  ? 525  LEU A CD2  1 
ATOM   4246  H  H    . LEU A 1 317 ? -9.011  17.958 60.595 1.00 38.40  ? 525  LEU A H    1 
ATOM   4247  H  HA   . LEU A 1 317 ? -8.056  20.326 59.857 1.00 37.54  ? 525  LEU A HA   1 
ATOM   4248  H  HB2  . LEU A 1 317 ? -9.686  20.201 61.516 1.00 39.64  ? 525  LEU A HB2  1 
ATOM   4249  H  HB3  . LEU A 1 317 ? -8.702  19.372 62.432 1.00 39.64  ? 525  LEU A HB3  1 
ATOM   4250  H  HG   . LEU A 1 317 ? -7.355  21.395 62.523 1.00 41.49  ? 525  LEU A HG   1 
ATOM   4251  H  HD11 . LEU A 1 317 ? -8.493  23.396 62.160 1.00 37.10  ? 525  LEU A HD11 1 
ATOM   4252  H  HD12 . LEU A 1 317 ? -8.386  22.569 60.808 1.00 37.10  ? 525  LEU A HD12 1 
ATOM   4253  H  HD13 . LEU A 1 317 ? -9.748  22.583 61.625 1.00 37.10  ? 525  LEU A HD13 1 
ATOM   4254  H  HD21 . LEU A 1 317 ? -8.575  22.233 64.329 1.00 45.90  ? 525  LEU A HD21 1 
ATOM   4255  H  HD22 . LEU A 1 317 ? -9.830  21.370 63.877 1.00 45.90  ? 525  LEU A HD22 1 
ATOM   4256  H  HD23 . LEU A 1 317 ? -8.513  20.646 64.392 1.00 45.90  ? 525  LEU A HD23 1 
ATOM   4257  N  N    . LEU A 1 318 ? -5.698  20.477 60.584 1.00 30.14  ? 526  LEU A N    1 
ATOM   4258  C  CA   . LEU A 1 318 ? -4.262  20.452 60.831 1.00 27.26  ? 526  LEU A CA   1 
ATOM   4259  C  C    . LEU A 1 318 ? -3.612  19.176 60.278 1.00 28.78  ? 526  LEU A C    1 
ATOM   4260  O  O    . LEU A 1 318 ? -2.917  18.465 61.000 1.00 25.72  ? 526  LEU A O    1 
ATOM   4261  C  CB   . LEU A 1 318 ? -3.972  20.586 62.319 1.00 27.58  ? 526  LEU A CB   1 
ATOM   4262  C  CG   . LEU A 1 318 ? -4.252  21.956 62.935 1.00 28.93  ? 526  LEU A CG   1 
ATOM   4263  C  CD1  . LEU A 1 318 ? -4.419  21.835 64.444 1.00 30.21  ? 526  LEU A CD1  1 
ATOM   4264  C  CD2  . LEU A 1 318 ? -3.130  22.927 62.589 1.00 27.97  ? 526  LEU A CD2  1 
ATOM   4265  H  H    . LEU A 1 318 ? -5.971  21.213 60.233 1.00 36.17  ? 526  LEU A H    1 
ATOM   4266  H  HA   . LEU A 1 318 ? -3.855  21.210 60.381 1.00 32.71  ? 526  LEU A HA   1 
ATOM   4267  H  HB2  . LEU A 1 318 ? -4.515  19.938 62.795 1.00 33.10  ? 526  LEU A HB2  1 
ATOM   4268  H  HB3  . LEU A 1 318 ? -3.033  20.389 62.466 1.00 33.10  ? 526  LEU A HB3  1 
ATOM   4269  H  HG   . LEU A 1 318 ? -5.078  22.307 62.568 1.00 34.72  ? 526  LEU A HG   1 
ATOM   4270  H  HD11 . LEU A 1 318 ? -4.596  22.715 64.813 1.00 36.25  ? 526  LEU A HD11 1 
ATOM   4271  H  HD12 . LEU A 1 318 ? -5.163  21.242 64.632 1.00 36.25  ? 526  LEU A HD12 1 
ATOM   4272  H  HD13 . LEU A 1 318 ? -3.603  21.474 64.823 1.00 36.25  ? 526  LEU A HD13 1 
ATOM   4273  H  HD21 . LEU A 1 318 ? -3.325  23.789 62.988 1.00 33.56  ? 526  LEU A HD21 1 
ATOM   4274  H  HD22 . LEU A 1 318 ? -2.294  22.581 62.940 1.00 33.56  ? 526  LEU A HD22 1 
ATOM   4275  H  HD23 . LEU A 1 318 ? -3.074  23.013 61.625 1.00 33.56  ? 526  LEU A HD23 1 
ATOM   4276  N  N    . PRO A 1 319 ? -3.801  18.886 58.987 1.00 26.07  ? 527  PRO A N    1 
ATOM   4277  C  CA   . PRO A 1 319 ? -3.377  17.571 58.473 1.00 27.55  ? 527  PRO A CA   1 
ATOM   4278  C  C    . PRO A 1 319 ? -1.875  17.349 58.516 1.00 29.48  ? 527  PRO A C    1 
ATOM   4279  O  O    . PRO A 1 319 ? -1.432  16.227 58.792 1.00 27.52  ? 527  PRO A O    1 
ATOM   4280  C  CB   . PRO A 1 319 ? -3.907  17.582 57.034 1.00 26.35  ? 527  PRO A CB   1 
ATOM   4281  C  CG   . PRO A 1 319 ? -3.891  19.050 56.664 1.00 25.58  ? 527  PRO A CG   1 
ATOM   4282  C  CD   . PRO A 1 319 ? -4.316  19.760 57.919 1.00 23.97  ? 527  PRO A CD   1 
ATOM   4283  H  HA   . PRO A 1 319 ? -3.817  16.862 58.967 1.00 33.07  ? 527  PRO A HA   1 
ATOM   4284  H  HB2  . PRO A 1 319 ? -3.316  17.072 56.459 1.00 31.62  ? 527  PRO A HB2  1 
ATOM   4285  H  HB3  . PRO A 1 319 ? -4.810  17.228 57.010 1.00 31.62  ? 527  PRO A HB3  1 
ATOM   4286  H  HG2  . PRO A 1 319 ? -2.994  19.314 56.405 1.00 30.70  ? 527  PRO A HG2  1 
ATOM   4287  H  HG3  . PRO A 1 319 ? -4.521  19.214 55.945 1.00 30.70  ? 527  PRO A HG3  1 
ATOM   4288  H  HD2  . PRO A 1 319 ? -3.902  20.636 57.969 1.00 28.76  ? 527  PRO A HD2  1 
ATOM   4289  H  HD3  . PRO A 1 319 ? -5.283  19.818 57.965 1.00 28.76  ? 527  PRO A HD3  1 
ATOM   4290  N  N    . ALA A 1 320 ? -1.072  18.380 58.242 1.00 30.15  ? 528  ALA A N    1 
ATOM   4291  C  CA   . ALA A 1 320 ? 0.375   18.203 58.210 1.00 29.77  ? 528  ALA A CA   1 
ATOM   4292  C  C    . ALA A 1 320 ? 0.974   17.954 59.587 1.00 31.41  ? 528  ALA A C    1 
ATOM   4293  O  O    . ALA A 1 320 ? 2.161   17.621 59.673 1.00 30.56  ? 528  ALA A O    1 
ATOM   4294  C  CB   . ALA A 1 320 ? 1.053   19.424 57.579 1.00 29.95  ? 528  ALA A CB   1 
ATOM   4295  H  H    . ALA A 1 320 ? -1.338  19.180 58.073 1.00 36.19  ? 528  ALA A H    1 
ATOM   4296  H  HA   . ALA A 1 320 ? 0.581   17.434 57.656 1.00 35.72  ? 528  ALA A HA   1 
ATOM   4297  H  HB1  . ALA A 1 320 ? 2.012   19.282 57.570 1.00 35.94  ? 528  ALA A HB1  1 
ATOM   4298  H  HB2  . ALA A 1 320 ? 0.725   19.533 56.673 1.00 35.94  ? 528  ALA A HB2  1 
ATOM   4299  H  HB3  . ALA A 1 320 ? 0.840   20.210 58.106 1.00 35.94  ? 528  ALA A HB3  1 
ATOM   4300  N  N    . GLU A 1 321 ? 0.202   18.118 60.660 1.00 29.46  ? 529  GLU A N    1 
ATOM   4301  C  CA   . GLU A 1 321 ? 0.688   17.773 61.988 1.00 28.93  ? 529  GLU A CA   1 
ATOM   4302  C  C    . GLU A 1 321 ? 0.537   16.292 62.291 1.00 31.91  ? 529  GLU A C    1 
ATOM   4303  O  O    . GLU A 1 321 ? 0.986   15.849 63.349 1.00 32.58  ? 529  GLU A O    1 
ATOM   4304  C  CB   . GLU A 1 321 ? -0.034  18.592 63.058 1.00 31.67  ? 529  GLU A CB   1 
ATOM   4305  C  CG   . GLU A 1 321 ? 0.324   20.074 62.995 1.00 34.34  ? 529  GLU A CG   1 
ATOM   4306  C  CD   . GLU A 1 321 ? -0.015  20.848 64.258 1.00 39.22  ? 529  GLU A CD   1 
ATOM   4307  O  OE1  . GLU A 1 321 ? -0.917  20.428 65.008 1.00 40.05  ? 529  GLU A OE1  1 
ATOM   4308  O  OE2  . GLU A 1 321 ? 0.626   21.892 64.509 1.00 41.09  ? 529  GLU A OE2  1 
ATOM   4309  H  H    . GLU A 1 321 ? -0.601  18.425 60.644 1.00 35.35  ? 529  GLU A H    1 
ATOM   4310  H  HA   . GLU A 1 321 ? 1.632   17.989 62.038 1.00 34.72  ? 529  GLU A HA   1 
ATOM   4311  H  HB2  . GLU A 1 321 ? -0.991  18.508 62.930 1.00 38.01  ? 529  GLU A HB2  1 
ATOM   4312  H  HB3  . GLU A 1 321 ? 0.216   18.260 63.934 1.00 38.01  ? 529  GLU A HB3  1 
ATOM   4313  H  HG2  . GLU A 1 321 ? 1.278   20.159 62.843 1.00 41.21  ? 529  GLU A HG2  1 
ATOM   4314  H  HG3  . GLU A 1 321 ? -0.162  20.481 62.260 1.00 41.21  ? 529  GLU A HG3  1 
ATOM   4315  N  N    . SER A 1 322 ? -0.061  15.518 61.390 1.00 30.00  ? 530  SER A N    1 
ATOM   4316  C  CA   . SER A 1 322 ? -0.288  14.099 61.668 1.00 30.67  ? 530  SER A CA   1 
ATOM   4317  C  C    . SER A 1 322 ? -0.026  13.147 60.501 1.00 30.24  ? 530  SER A C    1 
ATOM   4318  O  O    . SER A 1 322 ? 0.407   12.017 60.748 1.00 30.76  ? 530  SER A O    1 
ATOM   4319  C  CB   . SER A 1 322 ? -1.732  13.922 62.150 1.00 32.74  ? 530  SER A CB   1 
ATOM   4320  O  OG   . SER A 1 322 ? -2.021  12.641 62.678 1.00 44.04  ? 530  SER A OG   1 
ATOM   4321  H  H    . SER A 1 322 ? -0.341  15.782 60.621 1.00 36.01  ? 530  SER A H    1 
ATOM   4322  H  HA   . SER A 1 322 ? 0.297   13.833 62.395 1.00 36.81  ? 530  SER A HA   1 
ATOM   4323  H  HB2  . SER A 1 322 ? -1.905  14.581 62.841 1.00 39.29  ? 530  SER A HB2  1 
ATOM   4324  H  HB3  . SER A 1 322 ? -2.325  14.082 61.399 1.00 39.29  ? 530  SER A HB3  1 
ATOM   4325  H  HG   . SER A 1 322 ? -2.824  12.607 62.924 1.00 52.85  ? 530  SER A HG   1 
ATOM   4326  N  N    . PHE A 1 323 ? -0.251  13.551 59.251 1.00 29.55  ? 531  PHE A N    1 
ATOM   4327  C  CA   . PHE A 1 323 ? -0.151  12.642 58.108 1.00 29.67  ? 531  PHE A CA   1 
ATOM   4328  C  C    . PHE A 1 323 ? 1.248   12.043 57.961 1.00 30.49  ? 531  PHE A C    1 
ATOM   4329  O  O    . PHE A 1 323 ? 1.389   10.832 57.773 1.00 28.42  ? 531  PHE A O    1 
ATOM   4330  C  CB   . PHE A 1 323 ? -0.581  13.395 56.844 1.00 26.03  ? 531  PHE A CB   1 
ATOM   4331  C  CG   . PHE A 1 323 ? -0.261  12.692 55.550 1.00 25.62  ? 531  PHE A CG   1 
ATOM   4332  C  CD1  . PHE A 1 323 ? 0.951   12.912 54.908 1.00 25.37  ? 531  PHE A CD1  1 
ATOM   4333  C  CD2  . PHE A 1 323 ? -1.191  11.853 54.952 1.00 28.48  ? 531  PHE A CD2  1 
ATOM   4334  C  CE1  . PHE A 1 323 ? 1.247   12.281 53.709 1.00 24.63  ? 531  PHE A CE1  1 
ATOM   4335  C  CE2  . PHE A 1 323 ? -0.904  11.216 53.751 1.00 27.99  ? 531  PHE A CE2  1 
ATOM   4336  C  CZ   . PHE A 1 323 ? 0.314   11.438 53.126 1.00 26.22  ? 531  PHE A CZ   1 
ATOM   4337  H  H    . PHE A 1 323 ? -0.466  14.356 59.036 1.00 35.46  ? 531  PHE A H    1 
ATOM   4338  H  HA   . PHE A 1 323 ? -0.772  11.909 58.239 1.00 35.61  ? 531  PHE A HA   1 
ATOM   4339  H  HB2  . PHE A 1 323 ? -1.542  13.528 56.876 1.00 31.24  ? 531  PHE A HB2  1 
ATOM   4340  H  HB3  . PHE A 1 323 ? -0.133  14.255 56.829 1.00 31.24  ? 531  PHE A HB3  1 
ATOM   4341  H  HD1  . PHE A 1 323 ? 1.579   13.478 55.295 1.00 30.44  ? 531  PHE A HD1  1 
ATOM   4342  H  HD2  . PHE A 1 323 ? -2.009  11.703 55.367 1.00 34.18  ? 531  PHE A HD2  1 
ATOM   4343  H  HE1  . PHE A 1 323 ? 2.065   12.430 53.293 1.00 29.55  ? 531  PHE A HE1  1 
ATOM   4344  H  HE2  . PHE A 1 323 ? -1.531  10.649 53.362 1.00 33.60  ? 531  PHE A HE2  1 
ATOM   4345  H  HZ   . PHE A 1 323 ? 0.510   11.012 52.323 1.00 31.46  ? 531  PHE A HZ   1 
ATOM   4346  N  N    . PHE A 1 324 ? 2.300   12.866 58.035 1.00 27.33  ? 532  PHE A N    1 
ATOM   4347  C  CA   . PHE A 1 324 ? 3.642   12.338 57.784 1.00 28.12  ? 532  PHE A CA   1 
ATOM   4348  C  C    . PHE A 1 324 ? 4.123   11.439 58.921 1.00 26.99  ? 532  PHE A C    1 
ATOM   4349  O  O    . PHE A 1 324 ? 4.809   10.441 58.669 1.00 26.08  ? 532  PHE A O    1 
ATOM   4350  C  CB   . PHE A 1 324 ? 4.637   13.474 57.533 1.00 31.17  ? 532  PHE A CB   1 
ATOM   4351  C  CG   . PHE A 1 324 ? 4.354   14.250 56.270 1.00 27.88  ? 532  PHE A CG   1 
ATOM   4352  C  CD1  . PHE A 1 324 ? 4.719   13.744 55.031 1.00 24.87  ? 532  PHE A CD1  1 
ATOM   4353  C  CD2  . PHE A 1 324 ? 3.710   15.469 56.324 1.00 26.33  ? 532  PHE A CD2  1 
ATOM   4354  C  CE1  . PHE A 1 324 ? 4.448   14.446 53.869 1.00 26.03  ? 532  PHE A CE1  1 
ATOM   4355  C  CE2  . PHE A 1 324 ? 3.436   16.180 55.166 1.00 25.87  ? 532  PHE A CE2  1 
ATOM   4356  C  CZ   . PHE A 1 324 ? 3.806   15.667 53.938 1.00 24.53  ? 532  PHE A CZ   1 
ATOM   4357  H  H    . PHE A 1 324 ? 2.265   13.705 58.222 1.00 32.80  ? 532  PHE A H    1 
ATOM   4358  H  HA   . PHE A 1 324 ? 3.611   11.796 56.980 1.00 33.75  ? 532  PHE A HA   1 
ATOM   4359  H  HB2  . PHE A 1 324 ? 4.600   14.094 58.278 1.00 37.40  ? 532  PHE A HB2  1 
ATOM   4360  H  HB3  . PHE A 1 324 ? 5.529   13.100 57.459 1.00 37.40  ? 532  PHE A HB3  1 
ATOM   4361  H  HD1  . PHE A 1 324 ? 5.149   12.921 54.980 1.00 29.85  ? 532  PHE A HD1  1 
ATOM   4362  H  HD2  . PHE A 1 324 ? 3.457   15.819 57.148 1.00 31.60  ? 532  PHE A HD2  1 
ATOM   4363  H  HE1  . PHE A 1 324 ? 4.700   14.097 53.044 1.00 31.24  ? 532  PHE A HE1  1 
ATOM   4364  H  HE2  . PHE A 1 324 ? 3.005   17.002 55.216 1.00 31.04  ? 532  PHE A HE2  1 
ATOM   4365  H  HZ   . PHE A 1 324 ? 3.626   16.144 53.160 1.00 29.44  ? 532  PHE A HZ   1 
ATOM   4366  N  N    . HIS A 1 325 ? 3.763   11.752 60.169 1.00 29.53  ? 533  HIS A N    1 
ATOM   4367  C  CA   . HIS A 1 325 ? 4.072   10.846 61.274 1.00 32.13  ? 533  HIS A CA   1 
ATOM   4368  C  C    . HIS A 1 325 ? 3.387   9.497  61.081 1.00 29.58  ? 533  HIS A C    1 
ATOM   4369  O  O    . HIS A 1 325 ? 4.012   8.442  61.229 1.00 29.52  ? 533  HIS A O    1 
ATOM   4370  C  CB   . HIS A 1 325 ? 3.640   11.456 62.609 1.00 35.43  ? 533  HIS A CB   1 
ATOM   4371  C  CG   . HIS A 1 325 ? 4.252   12.789 62.906 1.00 35.24  ? 533  HIS A CG   1 
ATOM   4372  N  ND1  . HIS A 1 325 ? 3.897   13.938 62.233 1.00 33.36  ? 533  HIS A ND1  1 
ATOM   4373  C  CD2  . HIS A 1 325 ? 5.169   13.161 63.830 1.00 35.30  ? 533  HIS A CD2  1 
ATOM   4374  C  CE1  . HIS A 1 325 ? 4.582   14.959 62.719 1.00 33.43  ? 533  HIS A CE1  1 
ATOM   4375  N  NE2  . HIS A 1 325 ? 5.361   14.514 63.689 1.00 33.33  ? 533  HIS A NE2  1 
ATOM   4376  H  H    . HIS A 1 325 ? 3.347   12.469 60.398 1.00 35.44  ? 533  HIS A H    1 
ATOM   4377  H  HA   . HIS A 1 325 ? 5.030   10.698 61.305 1.00 38.56  ? 533  HIS A HA   1 
ATOM   4378  H  HB2  . HIS A 1 325 ? 2.676   11.569 62.602 1.00 42.52  ? 533  HIS A HB2  1 
ATOM   4379  H  HB3  . HIS A 1 325 ? 3.892   10.850 63.323 1.00 42.52  ? 533  HIS A HB3  1 
ATOM   4380  H  HD2  . HIS A 1 325 ? 5.595   12.604 64.441 1.00 42.36  ? 533  HIS A HD2  1 
ATOM   4381  H  HE1  . HIS A 1 325 ? 4.527   15.840 62.427 1.00 40.12  ? 533  HIS A HE1  1 
ATOM   4382  H  HE2  . HIS A 1 325 ? 5.902   14.993 64.155 1.00 40.00  ? 533  HIS A HE2  1 
ATOM   4383  N  N    . THR A 1 326 ? 2.091   9.515  60.764 1.00 30.92  ? 534  THR A N    1 
ATOM   4384  C  CA   . THR A 1 326 ? 1.323   8.274  60.702 1.00 29.48  ? 534  THR A CA   1 
ATOM   4385  C  C    . THR A 1 326 ? 1.791   7.388  59.554 1.00 31.05  ? 534  THR A C    1 
ATOM   4386  O  O    . THR A 1 326 ? 1.904   6.167  59.711 1.00 30.84  ? 534  THR A O    1 
ATOM   4387  C  CB   . THR A 1 326 ? -0.169  8.595  60.572 1.00 31.25  ? 534  THR A CB   1 
ATOM   4388  O  OG1  . THR A 1 326 ? -0.615  9.262  61.760 1.00 30.04  ? 534  THR A OG1  1 
ATOM   4389  C  CG2  . THR A 1 326 ? -1.001  7.331  60.367 1.00 33.02  ? 534  THR A CG2  1 
ATOM   4390  H  H    . THR A 1 326 ? 1.640   10.224 60.582 1.00 37.11  ? 534  THR A H    1 
ATOM   4391  H  HA   . THR A 1 326 ? 1.451   7.783  61.528 1.00 35.38  ? 534  THR A HA   1 
ATOM   4392  H  HB   . THR A 1 326 ? -0.306  9.177  59.807 1.00 37.51  ? 534  THR A HB   1 
ATOM   4393  H  HG1  . THR A 1 326 ? -0.185  9.976  61.867 1.00 36.04  ? 534  THR A HG1  1 
ATOM   4394  H  HG21 . THR A 1 326 ? -1.940  7.561  60.288 1.00 39.63  ? 534  THR A HG21 1 
ATOM   4395  H  HG22 . THR A 1 326 ? -0.718  6.876  59.559 1.00 39.63  ? 534  THR A HG22 1 
ATOM   4396  H  HG23 . THR A 1 326 ? -0.885  6.733  61.122 1.00 39.63  ? 534  THR A HG23 1 
ATOM   4397  N  N    . VAL A 1 327 ? 2.068   7.981  58.392 1.00 29.02  ? 535  VAL A N    1 
ATOM   4398  C  CA   . VAL A 1 327 ? 2.555   7.195  57.261 1.00 30.36  ? 535  VAL A CA   1 
ATOM   4399  C  C    . VAL A 1 327 ? 3.916   6.589  57.584 1.00 33.34  ? 535  VAL A C    1 
ATOM   4400  O  O    . VAL A 1 327 ? 4.126   5.378  57.438 1.00 34.18  ? 535  VAL A O    1 
ATOM   4401  C  CB   . VAL A 1 327 ? 2.604   8.060  55.989 1.00 29.55  ? 535  VAL A CB   1 
ATOM   4402  C  CG1  . VAL A 1 327 ? 3.276   7.306  54.843 1.00 27.94  ? 535  VAL A CG1  1 
ATOM   4403  C  CG2  . VAL A 1 327 ? 1.200   8.482  55.589 1.00 29.15  ? 535  VAL A CG2  1 
ATOM   4404  H  H    . VAL A 1 327 ? 1.984   8.822  58.236 1.00 34.82  ? 535  VAL A H    1 
ATOM   4405  H  HA   . VAL A 1 327 ? 1.937   6.465  57.099 1.00 36.44  ? 535  VAL A HA   1 
ATOM   4406  H  HB   . VAL A 1 327 ? 3.121   8.861  56.168 1.00 35.46  ? 535  VAL A HB   1 
ATOM   4407  H  HG11 . VAL A 1 327 ? 3.292   7.875  54.057 1.00 33.53  ? 535  VAL A HG11 1 
ATOM   4408  H  HG12 . VAL A 1 327 ? 4.181   7.076  55.104 1.00 33.53  ? 535  VAL A HG12 1 
ATOM   4409  H  HG13 . VAL A 1 327 ? 2.770   6.499  54.657 1.00 33.53  ? 535  VAL A HG13 1 
ATOM   4410  H  HG21 . VAL A 1 327 ? 1.250   9.025  54.787 1.00 34.98  ? 535  VAL A HG21 1 
ATOM   4411  H  HG22 . VAL A 1 327 ? 0.668   7.688  55.420 1.00 34.98  ? 535  VAL A HG22 1 
ATOM   4412  H  HG23 . VAL A 1 327 ? 0.807   8.995  56.313 1.00 34.98  ? 535  VAL A HG23 1 
ATOM   4413  N  N    . LEU A 1 328 ? 4.860   7.419  58.039 1.00 27.83  ? 536  LEU A N    1 
ATOM   4414  C  CA   . LEU A 1 328 ? 6.221   6.937  58.273 1.00 30.16  ? 536  LEU A CA   1 
ATOM   4415  C  C    . LEU A 1 328 ? 6.239   5.777  59.263 1.00 33.61  ? 536  LEU A C    1 
ATOM   4416  O  O    . LEU A 1 328 ? 6.872   4.743  59.012 1.00 29.46  ? 536  LEU A O    1 
ATOM   4417  C  CB   . LEU A 1 328 ? 7.105   8.080  58.776 1.00 34.42  ? 536  LEU A CB   1 
ATOM   4418  C  CG   . LEU A 1 328 ? 8.567   7.737  59.082 1.00 35.24  ? 536  LEU A CG   1 
ATOM   4419  C  CD1  . LEU A 1 328 ? 9.266   7.122  57.880 1.00 36.93  ? 536  LEU A CD1  1 
ATOM   4420  C  CD2  . LEU A 1 328 ? 9.316   8.985  59.541 1.00 36.61  ? 536  LEU A CD2  1 
ATOM   4421  H  H    . LEU A 1 328 ? 4.740   8.252  58.215 1.00 33.40  ? 536  LEU A H    1 
ATOM   4422  H  HA   . LEU A 1 328 ? 6.591   6.620  57.435 1.00 36.20  ? 536  LEU A HA   1 
ATOM   4423  H  HB2  . LEU A 1 328 ? 7.110   8.778  58.102 1.00 41.31  ? 536  LEU A HB2  1 
ATOM   4424  H  HB3  . LEU A 1 328 ? 6.715   8.427  59.593 1.00 41.31  ? 536  LEU A HB3  1 
ATOM   4425  H  HG   . LEU A 1 328 ? 8.594   7.091  59.805 1.00 42.30  ? 536  LEU A HG   1 
ATOM   4426  H  HD11 . LEU A 1 328 ? 10.185  6.921  58.118 1.00 44.31  ? 536  LEU A HD11 1 
ATOM   4427  H  HD12 . LEU A 1 328 ? 8.804   6.307  57.629 1.00 44.31  ? 536  LEU A HD12 1 
ATOM   4428  H  HD13 . LEU A 1 328 ? 9.245   7.755  57.145 1.00 44.31  ? 536  LEU A HD13 1 
ATOM   4429  H  HD21 . LEU A 1 328 ? 10.237  8.749  59.730 1.00 43.94  ? 536  LEU A HD21 1 
ATOM   4430  H  HD22 . LEU A 1 328 ? 9.282   9.650  58.835 1.00 43.94  ? 536  LEU A HD22 1 
ATOM   4431  H  HD23 . LEU A 1 328 ? 8.892   9.330  60.342 1.00 43.94  ? 536  LEU A HD23 1 
ATOM   4432  N  N    . GLU A 1 329 ? 5.558   5.932  60.402 1.00 29.31  ? 537  GLU A N    1 
ATOM   4433  C  CA   . GLU A 1 329 ? 5.625   4.914  61.448 1.00 30.85  ? 537  GLU A CA   1 
ATOM   4434  C  C    . GLU A 1 329 ? 5.007   3.591  61.017 1.00 31.69  ? 537  GLU A C    1 
ATOM   4435  O  O    . GLU A 1 329 ? 5.379   2.543  61.560 1.00 30.80  ? 537  GLU A O    1 
ATOM   4436  C  CB   . GLU A 1 329 ? 4.940   5.417  62.719 1.00 32.93  ? 537  GLU A CB   1 
ATOM   4437  C  CG   . GLU A 1 329 ? 5.731   6.494  63.447 1.00 37.26  ? 537  GLU A CG   1 
ATOM   4438  C  CD   . GLU A 1 329 ? 4.953   7.138  64.581 1.00 44.01  ? 537  GLU A CD   1 
ATOM   4439  O  OE1  . GLU A 1 329 ? 3.969   6.529  65.053 1.00 48.22  ? 537  GLU A OE1  1 
ATOM   4440  O  OE2  . GLU A 1 329 ? 5.324   8.257  64.997 1.00 46.35  ? 537  GLU A OE2  1 
ATOM   4441  H  H    . GLU A 1 329 ? 5.060   6.608  60.590 1.00 35.17  ? 537  GLU A H    1 
ATOM   4442  H  HA   . GLU A 1 329 ? 6.557   4.748  61.661 1.00 37.02  ? 537  GLU A HA   1 
ATOM   4443  H  HB2  . GLU A 1 329 ? 4.076   5.790  62.483 1.00 39.52  ? 537  GLU A HB2  1 
ATOM   4444  H  HB3  . GLU A 1 329 ? 4.822   4.671  63.328 1.00 39.52  ? 537  GLU A HB3  1 
ATOM   4445  H  HG2  . GLU A 1 329 ? 6.533   6.097  63.823 1.00 44.71  ? 537  GLU A HG2  1 
ATOM   4446  H  HG3  . GLU A 1 329 ? 5.971   7.190  62.816 1.00 44.71  ? 537  GLU A HG3  1 
ATOM   4447  N  N    . ASN A 1 330 ? 4.089   3.609  60.053 1.00 30.40  ? 538  ASN A N    1 
ATOM   4448  C  CA   . ASN A 1 330 ? 3.425   2.399  59.588 1.00 33.71  ? 538  ASN A CA   1 
ATOM   4449  C  C    . ASN A 1 330 ? 3.946   1.910  58.242 1.00 33.70  ? 538  ASN A C    1 
ATOM   4450  O  O    . ASN A 1 330 ? 3.452   0.896  57.735 1.00 30.66  ? 538  ASN A O    1 
ATOM   4451  C  CB   . ASN A 1 330 ? 1.915   2.635  59.503 1.00 32.52  ? 538  ASN A CB   1 
ATOM   4452  C  CG   . ASN A 1 330 ? 1.277   2.798  60.869 1.00 33.15  ? 538  ASN A CG   1 
ATOM   4453  O  OD1  . ASN A 1 330 ? 1.106   1.826  61.607 1.00 32.70  ? 538  ASN A OD1  1 
ATOM   4454  N  ND2  . ASN A 1 330 ? 0.921   4.030  61.215 1.00 34.46  ? 538  ASN A ND2  1 
ATOM   4455  H  H    . ASN A 1 330 ? 3.830   4.323  59.648 1.00 36.48  ? 538  ASN A H    1 
ATOM   4456  H  HA   . ASN A 1 330 ? 3.578   1.694  60.236 1.00 40.46  ? 538  ASN A HA   1 
ATOM   4457  H  HB2  . ASN A 1 330 ? 1.748   3.444  58.995 1.00 39.02  ? 538  ASN A HB2  1 
ATOM   4458  H  HB3  . ASN A 1 330 ? 1.499   1.875  59.066 1.00 39.02  ? 538  ASN A HB3  1 
ATOM   4459  H  HD21 . ASN A 1 330 ? 0.556   4.174  61.980 1.00 41.36  ? 538  ASN A HD21 1 
ATOM   4460  H  HD22 . ASN A 1 330 ? 1.056   4.684  60.673 1.00 41.36  ? 538  ASN A HD22 1 
ATOM   4461  N  N    . SER A 1 331 ? 4.935   2.594  57.661 1.00 30.86  ? 539  SER A N    1 
ATOM   4462  C  CA   . SER A 1 331 ? 5.474   2.252  56.348 1.00 31.51  ? 539  SER A CA   1 
ATOM   4463  C  C    . SER A 1 331 ? 6.702   1.356  56.471 1.00 33.14  ? 539  SER A C    1 
ATOM   4464  O  O    . SER A 1 331 ? 7.141   1.052  57.587 1.00 32.93  ? 539  SER A O    1 
ATOM   4465  C  CB   . SER A 1 331 ? 5.848   3.523  55.590 1.00 31.79  ? 539  SER A CB   1 
ATOM   4466  O  OG   . SER A 1 331 ? 6.985   4.124  56.181 1.00 29.43  ? 539  SER A OG   1 
ATOM   4467  H  H    . SER A 1 331 ? 5.318   3.275  58.019 1.00 37.03  ? 539  SER A H    1 
ATOM   4468  H  HA   . SER A 1 331 ? 4.799   1.778  55.837 1.00 37.82  ? 539  SER A HA   1 
ATOM   4469  H  HB2  . SER A 1 331 ? 6.051   3.296  54.669 1.00 38.15  ? 539  SER A HB2  1 
ATOM   4470  H  HB3  . SER A 1 331 ? 5.105   4.145  55.625 1.00 38.15  ? 539  SER A HB3  1 
ATOM   4471  H  HG   . SER A 1 331 ? 7.190   4.824  55.764 1.00 35.32  ? 539  SER A HG   1 
ATOM   4472  N  N    . PRO A 1 332 ? 7.286   0.917  55.350 1.00 31.81  ? 540  PRO A N    1 
ATOM   4473  C  CA   . PRO A 1 332 ? 8.562   0.186  55.420 1.00 36.57  ? 540  PRO A CA   1 
ATOM   4474  C  C    . PRO A 1 332 ? 9.738   1.037  55.870 1.00 33.81  ? 540  PRO A C    1 
ATOM   4475  O  O    . PRO A 1 332 ? 10.810  0.480  56.136 1.00 31.84  ? 540  PRO A O    1 
ATOM   4476  C  CB   . PRO A 1 332 ? 8.767   -0.310 53.981 1.00 35.98  ? 540  PRO A CB   1 
ATOM   4477  C  CG   . PRO A 1 332 ? 7.416   -0.280 53.364 1.00 35.17  ? 540  PRO A CG   1 
ATOM   4478  C  CD   . PRO A 1 332 ? 6.698   0.861  54.001 1.00 33.21  ? 540  PRO A CD   1 
ATOM   4479  H  HA   . PRO A 1 332 ? 8.478   -0.579 56.011 1.00 43.88  ? 540  PRO A HA   1 
ATOM   4480  H  HB2  . PRO A 1 332 ? 9.371   0.288  53.513 1.00 43.17  ? 540  PRO A HB2  1 
ATOM   4481  H  HB3  . PRO A 1 332 ? 9.119   -1.213 53.994 1.00 43.17  ? 540  PRO A HB3  1 
ATOM   4482  H  HG2  . PRO A 1 332 ? 7.499   -0.139 52.408 1.00 42.21  ? 540  PRO A HG2  1 
ATOM   4483  H  HG3  . PRO A 1 332 ? 6.958   -1.116 53.546 1.00 42.21  ? 540  PRO A HG3  1 
ATOM   4484  H  HD2  . PRO A 1 332 ? 6.876   1.684  53.520 1.00 39.85  ? 540  PRO A HD2  1 
ATOM   4485  H  HD3  . PRO A 1 332 ? 5.747   0.677  54.054 1.00 39.85  ? 540  PRO A HD3  1 
ATOM   4486  N  N    . HIS A 1 333 ? 9.584   2.359  55.953 1.00 36.55  ? 541  HIS A N    1 
ATOM   4487  C  CA   . HIS A 1 333 ? 10.662  3.246  56.367 1.00 37.30  ? 541  HIS A CA   1 
ATOM   4488  C  C    . HIS A 1 333 ? 10.581  3.609  57.848 1.00 35.79  ? 541  HIS A C    1 
ATOM   4489  O  O    . HIS A 1 333 ? 11.227  4.571  58.278 1.00 36.35  ? 541  HIS A O    1 
ATOM   4490  C  CB   . HIS A 1 333 ? 10.652  4.518  55.517 1.00 39.06  ? 541  HIS A CB   1 
ATOM   4491  C  CG   . HIS A 1 333 ? 10.820  4.269  54.050 1.00 42.98  ? 541  HIS A CG   1 
ATOM   4492  N  ND1  . HIS A 1 333 ? 9.765   4.294  53.164 1.00 44.18  ? 541  HIS A ND1  1 
ATOM   4493  C  CD2  . HIS A 1 333 ? 11.922  3.990  53.314 1.00 45.75  ? 541  HIS A CD2  1 
ATOM   4494  C  CE1  . HIS A 1 333 ? 10.209  4.042  51.946 1.00 44.59  ? 541  HIS A CE1  1 
ATOM   4495  N  NE2  . HIS A 1 333 ? 11.515  3.853  52.009 1.00 45.54  ? 541  HIS A NE2  1 
ATOM   4496  H  H    . HIS A 1 333 ? 8.850   2.769  55.770 1.00 43.87  ? 541  HIS A H    1 
ATOM   4497  H  HA   . HIS A 1 333 ? 11.509  2.797  56.219 1.00 44.77  ? 541  HIS A HA   1 
ATOM   4498  H  HB2  . HIS A 1 333 ? 9.804   4.972  55.645 1.00 46.87  ? 541  HIS A HB2  1 
ATOM   4499  H  HB3  . HIS A 1 333 ? 11.379  5.092  55.805 1.00 46.87  ? 541  HIS A HB3  1 
ATOM   4500  H  HD2  . HIS A 1 333 ? 12.792  3.907  53.632 1.00 54.91  ? 541  HIS A HD2  1 
ATOM   4501  H  HE1  . HIS A 1 333 ? 9.690   4.003  51.175 1.00 53.52  ? 541  HIS A HE1  1 
ATOM   4502  H  HE2  . HIS A 1 333 ? 12.027  3.674  51.342 1.00 54.65  ? 541  HIS A HE2  1 
ATOM   4503  N  N    . CYS A 1 334 ? 9.816   2.851  58.640 1.00 32.68  ? 542  CYS A N    1 
ATOM   4504  C  CA   . CYS A 1 334 ? 9.572   3.240  60.026 1.00 34.20  ? 542  CYS A CA   1 
ATOM   4505  C  C    . CYS A 1 334 ? 10.861  3.329  60.836 1.00 36.20  ? 542  CYS A C    1 
ATOM   4506  O  O    . CYS A 1 334 ? 10.943  4.122  61.781 1.00 35.39  ? 542  CYS A O    1 
ATOM   4507  C  CB   . CYS A 1 334 ? 8.600   2.263  60.688 1.00 36.93  ? 542  CYS A CB   1 
ATOM   4508  S  SG   . CYS A 1 334 ? 9.028   0.514  60.544 1.00 43.54  ? 542  CYS A SG   1 
ATOM   4509  H  H    . CYS A 1 334 ? 9.434   2.118  58.401 1.00 39.22  ? 542  CYS A H    1 
ATOM   4510  H  HA   . CYS A 1 334 ? 9.159   4.118  60.033 1.00 41.04  ? 542  CYS A HA   1 
ATOM   4511  H  HB2  . CYS A 1 334 ? 8.551   2.474  61.633 1.00 44.31  ? 542  CYS A HB2  1 
ATOM   4512  H  HB3  . CYS A 1 334 ? 7.725   2.382  60.285 1.00 44.31  ? 542  CYS A HB3  1 
ATOM   4513  N  N    . ASP A 1 335 ? 11.875  2.545  60.487 1.00 35.29  ? 543  ASP A N    1 
ATOM   4514  C  CA   . ASP A 1 335 ? 13.096  2.505  61.282 1.00 39.19  ? 543  ASP A CA   1 
ATOM   4515  C  C    . ASP A 1 335 ? 14.058  3.646  60.962 1.00 37.55  ? 543  ASP A C    1 
ATOM   4516  O  O    . ASP A 1 335 ? 15.201  3.622  61.433 1.00 38.94  ? 543  ASP A O    1 
ATOM   4517  C  CB   . ASP A 1 335 ? 13.801  1.159  61.091 1.00 40.51  ? 543  ASP A CB   1 
ATOM   4518  C  CG   . ASP A 1 335 ? 14.715  0.813  62.251 1.00 48.04  ? 543  ASP A CG   1 
ATOM   4519  O  OD1  . ASP A 1 335 ? 14.323  1.069  63.410 1.00 49.45  ? 543  ASP A OD1  1 
ATOM   4520  O  OD2  . ASP A 1 335 ? 15.815  0.273  62.008 1.00 50.43  ? 543  ASP A OD2  1 
ATOM   4521  H  H    . ASP A 1 335 ? 11.882  2.029  59.798 1.00 42.35  ? 543  ASP A H    1 
ATOM   4522  H  HA   . ASP A 1 335 ? 12.855  2.580  62.219 1.00 47.03  ? 543  ASP A HA   1 
ATOM   4523  H  HB2  . ASP A 1 335 ? 13.133  0.459  61.016 1.00 48.61  ? 543  ASP A HB2  1 
ATOM   4524  H  HB3  . ASP A 1 335 ? 14.338  1.194  60.285 1.00 48.61  ? 543  ASP A HB3  1 
ATOM   4525  N  N    . THR A 1 336 ? 13.629  4.638  60.185 1.00 34.53  ? 544  THR A N    1 
ATOM   4526  C  CA   . THR A 1 336 ? 14.441  5.811  59.893 1.00 35.51  ? 544  THR A CA   1 
ATOM   4527  C  C    . THR A 1 336 ? 14.024  7.038  60.695 1.00 35.74  ? 544  THR A C    1 
ATOM   4528  O  O    . THR A 1 336 ? 14.626  8.102  60.524 1.00 37.07  ? 544  THR A O    1 
ATOM   4529  C  CB   . THR A 1 336 ? 14.372  6.148  58.398 1.00 32.53  ? 544  THR A CB   1 
ATOM   4530  O  OG1  . THR A 1 336 ? 13.060  6.628  58.069 1.00 32.26  ? 544  THR A OG1  1 
ATOM   4531  C  CG2  . THR A 1 336 ? 14.695  4.929  57.549 1.00 33.29  ? 544  THR A CG2  1 
ATOM   4532  H  H    . THR A 1 336 ? 12.856  4.652  59.809 1.00 41.43  ? 544  THR A H    1 
ATOM   4533  H  HA   . THR A 1 336 ? 15.366  5.613  60.111 1.00 42.61  ? 544  THR A HA   1 
ATOM   4534  H  HB   . THR A 1 336 ? 15.023  6.838  58.196 1.00 39.04  ? 544  THR A HB   1 
ATOM   4535  H  HG1  . THR A 1 336 ? 12.487  6.039  58.245 1.00 38.71  ? 544  THR A HG1  1 
ATOM   4536  H  HG21 . THR A 1 336 ? 14.647  5.158  56.608 1.00 39.95  ? 544  THR A HG21 1 
ATOM   4537  H  HG22 . THR A 1 336 ? 15.589  4.612  57.751 1.00 39.95  ? 544  THR A HG22 1 
ATOM   4538  H  HG23 . THR A 1 336 ? 14.059  4.220  57.733 1.00 39.95  ? 544  THR A HG23 1 
ATOM   4539  N  N    . MET A 1 337 ? 13.020  6.922  61.564 1.00 34.68  ? 545  MET A N    1 
ATOM   4540  C  CA   . MET A 1 337 ? 12.464  8.093  62.232 1.00 35.85  ? 545  MET A CA   1 
ATOM   4541  C  C    . MET A 1 337 ? 13.322  8.512  63.422 1.00 33.45  ? 545  MET A C    1 
ATOM   4542  O  O    . MET A 1 337 ? 13.675  7.688  64.272 1.00 32.63  ? 545  MET A O    1 
ATOM   4543  C  CB   . MET A 1 337 ? 11.034  7.817  62.698 1.00 37.33  ? 545  MET A CB   1 
ATOM   4544  C  CG   . MET A 1 337 ? 10.332  9.053  63.276 1.00 39.92  ? 545  MET A CG   1 
ATOM   4545  S  SD   . MET A 1 337 ? 8.562   8.815  63.543 1.00 48.02  ? 545  MET A SD   1 
ATOM   4546  C  CE   . MET A 1 337 ? 8.132   10.325 64.415 1.00 50.52  ? 545  MET A CE   1 
ATOM   4547  H  H    . MET A 1 337 ? 12.646  6.179  61.783 1.00 41.62  ? 545  MET A H    1 
ATOM   4548  H  HA   . MET A 1 337 ? 12.432  8.826  61.598 1.00 43.02  ? 545  MET A HA   1 
ATOM   4549  H  HB2  . MET A 1 337 ? 10.513  7.504  61.942 1.00 44.79  ? 545  MET A HB2  1 
ATOM   4550  H  HB3  . MET A 1 337 ? 11.055  7.137  63.389 1.00 44.79  ? 545  MET A HB3  1 
ATOM   4551  H  HG2  . MET A 1 337 ? 10.735  9.272  64.130 1.00 47.91  ? 545  MET A HG2  1 
ATOM   4552  H  HG3  . MET A 1 337 ? 10.443  9.793  62.659 1.00 47.91  ? 545  MET A HG3  1 
ATOM   4553  H  HE1  . MET A 1 337 ? 7.183   10.312 64.618 1.00 60.63  ? 545  MET A HE1  1 
ATOM   4554  H  HE2  . MET A 1 337 ? 8.645   10.372 65.237 1.00 60.63  ? 545  MET A HE2  1 
ATOM   4555  H  HE3  . MET A 1 337 ? 8.340   11.086 63.851 1.00 60.63  ? 545  MET A HE3  1 
ATOM   4556  N  N    . VAL A 1 338 ? 13.648  9.803  63.476 1.00 33.11  ? 546  VAL A N    1 
ATOM   4557  C  CA   . VAL A 1 338 ? 14.261  10.435 64.639 1.00 34.76  ? 546  VAL A CA   1 
ATOM   4558  C  C    . VAL A 1 338 ? 13.221  11.359 65.260 1.00 33.70  ? 546  VAL A C    1 
ATOM   4559  O  O    . VAL A 1 338 ? 12.663  12.224 64.571 1.00 31.93  ? 546  VAL A O    1 
ATOM   4560  C  CB   . VAL A 1 338 ? 15.530  11.219 64.258 1.00 35.86  ? 546  VAL A CB   1 
ATOM   4561  C  CG1  . VAL A 1 338 ? 16.156  11.859 65.490 1.00 36.94  ? 546  VAL A CG1  1 
ATOM   4562  C  CG2  . VAL A 1 338 ? 16.535  10.314 63.559 1.00 38.57  ? 546  VAL A CG2  1 
ATOM   4563  H  H    . VAL A 1 338 ? 13.519  10.350 62.825 1.00 39.74  ? 546  VAL A H    1 
ATOM   4564  H  HA   . VAL A 1 338 ? 14.500  9.757  65.290 1.00 41.72  ? 546  VAL A HA   1 
ATOM   4565  H  HB   . VAL A 1 338 ? 15.289  11.929 63.643 1.00 43.03  ? 546  VAL A HB   1 
ATOM   4566  H  HG11 . VAL A 1 338 ? 16.952  12.346 65.223 1.00 44.33  ? 546  VAL A HG11 1 
ATOM   4567  H  HG12 . VAL A 1 338 ? 15.515  12.467 65.890 1.00 44.33  ? 546  VAL A HG12 1 
ATOM   4568  H  HG13 . VAL A 1 338 ? 16.391  11.162 66.123 1.00 44.33  ? 546  VAL A HG13 1 
ATOM   4569  H  HG21 . VAL A 1 338 ? 17.322  10.833 63.331 1.00 46.29  ? 546  VAL A HG21 1 
ATOM   4570  H  HG22 . VAL A 1 338 ? 16.777  9.590  64.157 1.00 46.29  ? 546  VAL A HG22 1 
ATOM   4571  H  HG23 . VAL A 1 338 ? 16.129  9.956  62.753 1.00 46.29  ? 546  VAL A HG23 1 
ATOM   4572  N  N    . ASP A 1 339 ? 12.961  11.183 66.558 1.00 30.98  ? 547  ASP A N    1 
ATOM   4573  C  CA   . ASP A 1 339 ? 11.952  11.981 67.258 1.00 33.03  ? 547  ASP A CA   1 
ATOM   4574  C  C    . ASP A 1 339 ? 12.526  13.347 67.650 1.00 31.66  ? 547  ASP A C    1 
ATOM   4575  O  O    . ASP A 1 339 ? 12.636  13.708 68.821 1.00 32.19  ? 547  ASP A O    1 
ATOM   4576  C  CB   . ASP A 1 339 ? 11.431  11.229 68.476 1.00 38.16  ? 547  ASP A CB   1 
ATOM   4577  C  CG   . ASP A 1 339 ? 10.215  11.897 69.099 1.00 41.26  ? 547  ASP A CG   1 
ATOM   4578  O  OD1  . ASP A 1 339 ? 9.684   12.858 68.502 1.00 40.73  ? 547  ASP A OD1  1 
ATOM   4579  O  OD2  . ASP A 1 339 ? 9.791   11.462 70.190 1.00 43.36  ? 547  ASP A OD2  1 
ATOM   4580  H  H    . ASP A 1 339 ? 13.356  10.605 67.057 1.00 37.18  ? 547  ASP A H    1 
ATOM   4581  H  HA   . ASP A 1 339 ? 11.203  12.134 66.660 1.00 39.63  ? 547  ASP A HA   1 
ATOM   4582  H  HB2  . ASP A 1 339 ? 11.177  10.332 68.209 1.00 45.80  ? 547  ASP A HB2  1 
ATOM   4583  H  HB3  . ASP A 1 339 ? 12.130  11.191 69.147 1.00 45.80  ? 547  ASP A HB3  1 
ATOM   4584  N  N    . ASN A 1 340 ? 12.888  14.111 66.622 1.00 30.83  ? 548  ASN A N    1 
ATOM   4585  C  CA   . ASN A 1 340 ? 13.460  15.442 66.781 1.00 28.46  ? 548  ASN A CA   1 
ATOM   4586  C  C    . ASN A 1 340 ? 13.390  16.148 65.435 1.00 31.52  ? 548  ASN A C    1 
ATOM   4587  O  O    . ASN A 1 340 ? 13.944  15.655 64.447 1.00 30.01  ? 548  ASN A O    1 
ATOM   4588  C  CB   . ASN A 1 340 ? 14.903  15.356 67.291 1.00 32.64  ? 548  ASN A CB   1 
ATOM   4589  C  CG   . ASN A 1 340 ? 15.572  16.718 67.424 1.00 35.37  ? 548  ASN A CG   1 
ATOM   4590  O  OD1  . ASN A 1 340 ? 14.921  17.763 67.352 1.00 29.94  ? 548  ASN A OD1  1 
ATOM   4591  N  ND2  . ASN A 1 340 ? 16.886  16.707 67.633 1.00 34.05  ? 548  ASN A ND2  1 
ATOM   4592  H  H    . ASN A 1 340 ? 12.809  13.872 65.800 1.00 36.99  ? 548  ASN A H    1 
ATOM   4593  H  HA   . ASN A 1 340 ? 12.935  15.947 67.423 1.00 34.16  ? 548  ASN A HA   1 
ATOM   4594  H  HB2  . ASN A 1 340 ? 14.904  14.936 68.165 1.00 39.17  ? 548  ASN A HB2  1 
ATOM   4595  H  HB3  . ASN A 1 340 ? 15.426  14.826 66.668 1.00 39.17  ? 548  ASN A HB3  1 
ATOM   4596  H  HD21 . ASN A 1 340 ? 17.314  17.447 67.717 1.00 40.87  ? 548  ASN A HD21 1 
ATOM   4597  H  HD22 . ASN A 1 340 ? 17.307  15.958 67.680 1.00 40.87  ? 548  ASN A HD22 1 
ATOM   4598  N  N    . ASN A 1 341 ? 12.692  17.282 65.371 1.00 26.21  ? 549  ASN A N    1 
ATOM   4599  C  CA   . ASN A 1 341 ? 12.542  18.015 64.122 1.00 27.24  ? 549  ASN A CA   1 
ATOM   4600  C  C    . ASN A 1 341 ? 13.615  19.081 63.933 1.00 29.01  ? 549  ASN A C    1 
ATOM   4601  O  O    . ASN A 1 341 ? 13.535  19.861 62.978 1.00 26.84  ? 549  ASN A O    1 
ATOM   4602  C  CB   . ASN A 1 341 ? 11.148  18.650 64.045 1.00 24.71  ? 549  ASN A CB   1 
ATOM   4603  C  CG   . ASN A 1 341 ? 10.917  19.702 65.113 1.00 25.58  ? 549  ASN A CG   1 
ATOM   4604  O  OD1  . ASN A 1 341 ? 11.715  19.862 66.037 1.00 29.39  ? 549  ASN A OD1  1 
ATOM   4605  N  ND2  . ASN A 1 341 ? 9.811   20.426 64.991 1.00 28.13  ? 549  ASN A ND2  1 
ATOM   4606  H  H    . ASN A 1 341 ? 12.296  17.647 66.041 1.00 31.46  ? 549  ASN A H    1 
ATOM   4607  H  HA   . ASN A 1 341 ? 12.620  17.388 63.385 1.00 32.69  ? 549  ASN A HA   1 
ATOM   4608  H  HB2  . ASN A 1 341 ? 11.042  19.074 63.179 1.00 29.66  ? 549  ASN A HB2  1 
ATOM   4609  H  HB3  . ASN A 1 341 ? 10.479  17.956 64.158 1.00 29.66  ? 549  ASN A HB3  1 
ATOM   4610  H  HD21 . ASN A 1 341 ? 9.631   21.036 65.569 1.00 33.75  ? 549  ASN A HD21 1 
ATOM   4611  H  HD22 . ASN A 1 341 ? 9.276   20.286 64.332 1.00 33.75  ? 549  ASN A HD22 1 
ATOM   4612  N  N    . LEU A 1 342 ? 14.612  19.126 64.819 1.00 30.12  ? 550  LEU A N    1 
ATOM   4613  C  CA   . LEU A 1 342 ? 15.725  20.072 64.725 1.00 30.56  ? 550  LEU A CA   1 
ATOM   4614  C  C    . LEU A 1 342 ? 15.247  21.523 64.782 1.00 32.15  ? 550  LEU A C    1 
ATOM   4615  O  O    . LEU A 1 342 ? 15.907  22.424 64.253 1.00 30.28  ? 550  LEU A O    1 
ATOM   4616  C  CB   . LEU A 1 342 ? 16.551  19.828 63.456 1.00 30.11  ? 550  LEU A CB   1 
ATOM   4617  C  CG   . LEU A 1 342 ? 17.007  18.384 63.195 1.00 33.00  ? 550  LEU A CG   1 
ATOM   4618  C  CD1  . LEU A 1 342 ? 17.805  18.294 61.903 1.00 33.88  ? 550  LEU A CD1  1 
ATOM   4619  C  CD2  . LEU A 1 342 ? 17.821  17.831 64.355 1.00 34.48  ? 550  LEU A CD2  1 
ATOM   4620  H  H    . LEU A 1 342 ? 14.666  18.605 65.501 1.00 36.14  ? 550  LEU A H    1 
ATOM   4621  H  HA   . LEU A 1 342 ? 16.311  19.929 65.484 1.00 36.67  ? 550  LEU A HA   1 
ATOM   4622  H  HB2  . LEU A 1 342 ? 16.019  20.103 62.692 1.00 36.13  ? 550  LEU A HB2  1 
ATOM   4623  H  HB3  . LEU A 1 342 ? 17.349  20.377 63.504 1.00 36.13  ? 550  LEU A HB3  1 
ATOM   4624  H  HG   . LEU A 1 342 ? 16.221  17.824 63.095 1.00 39.60  ? 550  LEU A HG   1 
ATOM   4625  H  HD11 . LEU A 1 342 ? 18.079  17.374 61.765 1.00 40.66  ? 550  LEU A HD11 1 
ATOM   4626  H  HD12 . LEU A 1 342 ? 17.246  18.587 61.166 1.00 40.66  ? 550  LEU A HD12 1 
ATOM   4627  H  HD13 . LEU A 1 342 ? 18.586  18.865 61.974 1.00 40.66  ? 550  LEU A HD13 1 
ATOM   4628  H  HD21 . LEU A 1 342 ? 18.087  16.922 64.148 1.00 41.38  ? 550  LEU A HD21 1 
ATOM   4629  H  HD22 . LEU A 1 342 ? 18.607  18.386 64.481 1.00 41.38  ? 550  LEU A HD22 1 
ATOM   4630  H  HD23 . LEU A 1 342 ? 17.276  17.843 65.157 1.00 41.38  ? 550  LEU A HD23 1 
ATOM   4631  N  N    . ARG A 1 343 ? 14.107  21.765 65.433 1.00 31.08  ? 551  ARG A N    1 
ATOM   4632  C  CA   . ARG A 1 343 ? 13.567  23.106 65.617 1.00 31.73  ? 551  ARG A CA   1 
ATOM   4633  C  C    . ARG A 1 343 ? 13.393  23.413 67.098 1.00 32.09  ? 551  ARG A C    1 
ATOM   4634  O  O    . ARG A 1 343 ? 13.137  22.519 67.910 1.00 32.09  ? 551  ARG A O    1 
ATOM   4635  C  CB   . ARG A 1 343 ? 12.193  23.285 64.951 1.00 31.64  ? 551  ARG A CB   1 
ATOM   4636  C  CG   . ARG A 1 343 ? 12.041  22.707 63.567 1.00 34.26  ? 551  ARG A CG   1 
ATOM   4637  C  CD   . ARG A 1 343 ? 12.742  23.532 62.516 1.00 37.98  ? 551  ARG A CD   1 
ATOM   4638  N  NE   . ARG A 1 343 ? 12.485  22.977 61.190 1.00 39.83  ? 551  ARG A NE   1 
ATOM   4639  C  CZ   . ARG A 1 343 ? 11.668  23.502 60.284 1.00 35.22  ? 551  ARG A CZ   1 
ATOM   4640  N  NH1  . ARG A 1 343 ? 11.014  24.636 60.522 1.00 35.71  ? 551  ARG A NH1  1 
ATOM   4641  N  NH2  . ARG A 1 343 ? 11.515  22.886 59.118 1.00 34.50  ? 551  ARG A NH2  1 
ATOM   4642  H  H    . ARG A 1 343 ? 13.620  21.150 65.785 1.00 37.30  ? 551  ARG A H    1 
ATOM   4643  H  HA   . ARG A 1 343 ? 14.179  23.756 65.238 1.00 38.07  ? 551  ARG A HA   1 
ATOM   4644  H  HB2  . ARG A 1 343 ? 11.525  22.864 65.514 1.00 37.97  ? 551  ARG A HB2  1 
ATOM   4645  H  HB3  . ARG A 1 343 ? 12.007  24.235 64.888 1.00 37.97  ? 551  ARG A HB3  1 
ATOM   4646  H  HG2  . ARG A 1 343 ? 12.421  21.815 63.552 1.00 41.12  ? 551  ARG A HG2  1 
ATOM   4647  H  HG3  . ARG A 1 343 ? 11.098  22.671 63.341 1.00 41.12  ? 551  ARG A HG3  1 
ATOM   4648  H  HD2  . ARG A 1 343 ? 12.406  24.441 62.540 1.00 45.58  ? 551  ARG A HD2  1 
ATOM   4649  H  HD3  . ARG A 1 343 ? 13.698  23.517 62.677 1.00 45.58  ? 551  ARG A HD3  1 
ATOM   4650  H  HE   . ARG A 1 343 ? 12.895  22.251 60.979 1.00 47.80  ? 551  ARG A HE   1 
ATOM   4651  H  HH11 . ARG A 1 343 ? 11.108  25.037 61.277 1.00 42.86  ? 551  ARG A HH11 1 
ATOM   4652  H  HH12 . ARG A 1 343 ? 10.492  24.965 59.923 1.00 42.86  ? 551  ARG A HH12 1 
ATOM   4653  H  HH21 . ARG A 1 343 ? 11.940  22.155 58.959 1.00 41.40  ? 551  ARG A HH21 1 
ATOM   4654  H  HH22 . ARG A 1 343 ? 10.995  23.220 58.520 1.00 41.40  ? 551  ARG A HH22 1 
ATOM   4655  N  N    . ILE A 1 344 ? 13.520  24.692 67.437 1.00 29.81  ? 552  ILE A N    1 
ATOM   4656  C  CA   . ILE A 1 344 ? 13.031  25.230 68.702 1.00 31.90  ? 552  ILE A CA   1 
ATOM   4657  C  C    . ILE A 1 344 ? 11.765  26.024 68.402 1.00 33.48  ? 552  ILE A C    1 
ATOM   4658  O  O    . ILE A 1 344 ? 11.805  27.001 67.644 1.00 32.46  ? 552  ILE A O    1 
ATOM   4659  C  CB   . ILE A 1 344 ? 14.082  26.116 69.389 1.00 33.57  ? 552  ILE A CB   1 
ATOM   4660  C  CG1  . ILE A 1 344 ? 15.359  25.318 69.665 1.00 37.59  ? 552  ILE A CG1  1 
ATOM   4661  C  CG2  . ILE A 1 344 ? 13.511  26.700 70.685 1.00 32.56  ? 552  ILE A CG2  1 
ATOM   4662  C  CD1  . ILE A 1 344 ? 16.498  26.149 70.228 1.00 38.65  ? 552  ILE A CD1  1 
ATOM   4663  H  H    . ILE A 1 344 ? 13.896  25.283 66.937 1.00 35.78  ? 552  ILE A H    1 
ATOM   4664  H  HA   . ILE A 1 344 ? 12.804  24.500 69.299 1.00 38.28  ? 552  ILE A HA   1 
ATOM   4665  H  HB   . ILE A 1 344 ? 14.302  26.849 68.793 1.00 40.28  ? 552  ILE A HB   1 
ATOM   4666  H  HG12 . ILE A 1 344 ? 15.157  24.619 70.307 1.00 45.11  ? 552  ILE A HG12 1 
ATOM   4667  H  HG13 . ILE A 1 344 ? 15.664  24.922 68.834 1.00 45.11  ? 552  ILE A HG13 1 
ATOM   4668  H  HG21 . ILE A 1 344 ? 14.186  27.255 71.105 1.00 39.07  ? 552  ILE A HG21 1 
ATOM   4669  H  HG22 . ILE A 1 344 ? 12.729  27.233 70.473 1.00 39.07  ? 552  ILE A HG22 1 
ATOM   4670  H  HG23 . ILE A 1 344 ? 13.265  25.972 71.278 1.00 39.07  ? 552  ILE A HG23 1 
ATOM   4671  H  HD11 . ILE A 1 344 ? 17.266  25.574 70.374 1.00 46.38  ? 552  ILE A HD11 1 
ATOM   4672  H  HD12 . ILE A 1 344 ? 16.724  26.847 69.593 1.00 46.38  ? 552  ILE A HD12 1 
ATOM   4673  H  HD13 . ILE A 1 344 ? 16.216  26.544 71.068 1.00 46.38  ? 552  ILE A HD13 1 
ATOM   4674  N  N    . THR A 1 345 ? 10.644  25.613 68.993 1.00 34.59  ? 553  THR A N    1 
ATOM   4675  C  CA   . THR A 1 345 ? 9.369   26.305 68.845 1.00 33.86  ? 553  THR A CA   1 
ATOM   4676  C  C    . THR A 1 345 ? 9.017   26.979 70.165 1.00 33.03  ? 553  THR A C    1 
ATOM   4677  O  O    . THR A 1 345 ? 9.080   26.349 71.225 1.00 30.02  ? 553  THR A O    1 
ATOM   4678  C  CB   . THR A 1 345 ? 8.262   25.333 68.421 1.00 33.30  ? 553  THR A CB   1 
ATOM   4679  O  OG1  . THR A 1 345 ? 8.603   24.743 67.161 1.00 32.64  ? 553  THR A OG1  1 
ATOM   4680  C  CG2  . THR A 1 345 ? 6.924   26.051 68.282 1.00 29.92  ? 553  THR A CG2  1 
ATOM   4681  H  H    . THR A 1 345 ? 10.598  24.917 69.497 1.00 41.51  ? 553  THR A H    1 
ATOM   4682  H  HA   . THR A 1 345 ? 9.451   26.990 68.163 1.00 40.64  ? 553  THR A HA   1 
ATOM   4683  H  HB   . THR A 1 345 ? 8.169   24.636 69.090 1.00 39.96  ? 553  THR A HB   1 
ATOM   4684  H  HG1  . THR A 1 345 ? 9.328   24.325 67.226 1.00 39.17  ? 553  THR A HG1  1 
ATOM   4685  H  HG21 . THR A 1 345 ? 6.236   25.422 68.013 1.00 35.90  ? 553  THR A HG21 1 
ATOM   4686  H  HG22 . THR A 1 345 ? 6.672   26.451 69.129 1.00 35.90  ? 553  THR A HG22 1 
ATOM   4687  H  HG23 . THR A 1 345 ? 6.991   26.749 67.611 1.00 35.90  ? 553  THR A HG23 1 
ATOM   4688  N  N    . ASN A 1 346 ? 8.648   28.260 70.096 1.00 33.23  ? 554  ASN A N    1 
ATOM   4689  C  CA   . ASN A 1 346 ? 8.478   29.085 71.295 1.00 31.37  ? 554  ASN A CA   1 
ATOM   4690  C  C    . ASN A 1 346 ? 7.035   29.003 71.797 1.00 30.99  ? 554  ASN A C    1 
ATOM   4691  O  O    . ASN A 1 346 ? 6.287   29.983 71.814 1.00 31.24  ? 554  ASN A O    1 
ATOM   4692  C  CB   . ASN A 1 346 ? 8.878   30.527 71.002 1.00 31.20  ? 554  ASN A CB   1 
ATOM   4693  C  CG   . ASN A 1 346 ? 8.978   31.373 72.258 1.00 32.42  ? 554  ASN A CG   1 
ATOM   4694  O  OD1  . ASN A 1 346 ? 9.182   30.852 73.357 1.00 33.19  ? 554  ASN A OD1  1 
ATOM   4695  N  ND2  . ASN A 1 346 ? 8.837   32.686 72.103 1.00 34.38  ? 554  ASN A ND2  1 
ATOM   4696  H  H    . ASN A 1 346 ? 8.488   28.677 69.362 1.00 39.88  ? 554  ASN A H    1 
ATOM   4697  H  HA   . ASN A 1 346 ? 9.058   28.749 71.996 1.00 37.65  ? 554  ASN A HA   1 
ATOM   4698  H  HB2  . ASN A 1 346 ? 9.744   30.532 70.566 1.00 37.45  ? 554  ASN A HB2  1 
ATOM   4699  H  HB3  . ASN A 1 346 ? 8.211   30.928 70.423 1.00 37.45  ? 554  ASN A HB3  1 
ATOM   4700  H  HD21 . ASN A 1 346 ? 8.887   33.207 72.785 1.00 41.26  ? 554  ASN A HD21 1 
ATOM   4701  H  HD22 . ASN A 1 346 ? 8.696   33.014 71.321 1.00 41.26  ? 554  ASN A HD22 1 
ATOM   4702  N  N    . TRP A 1 347 ? 6.653   27.804 72.238 1.00 29.97  ? 555  TRP A N    1 
ATOM   4703  C  CA   . TRP A 1 347 ? 5.324   27.615 72.805 1.00 31.89  ? 555  TRP A CA   1 
ATOM   4704  C  C    . TRP A 1 347 ? 5.219   28.317 74.155 1.00 32.51  ? 555  TRP A C    1 
ATOM   4705  O  O    . TRP A 1 347 ? 6.094   28.175 75.013 1.00 34.73  ? 555  TRP A O    1 
ATOM   4706  C  CB   . TRP A 1 347 ? 5.004   26.125 72.962 1.00 35.03  ? 555  TRP A CB   1 
ATOM   4707  C  CG   . TRP A 1 347 ? 4.682   25.440 71.663 1.00 34.28  ? 555  TRP A CG   1 
ATOM   4708  C  CD1  . TRP A 1 347 ? 5.442   24.509 71.015 1.00 34.48  ? 555  TRP A CD1  1 
ATOM   4709  C  CD2  . TRP A 1 347 ? 3.516   25.639 70.853 1.00 32.71  ? 555  TRP A CD2  1 
ATOM   4710  N  NE1  . TRP A 1 347 ? 4.821   24.116 69.852 1.00 33.29  ? 555  TRP A NE1  1 
ATOM   4711  C  CE2  . TRP A 1 347 ? 3.637   24.794 69.731 1.00 32.53  ? 555  TRP A CE2  1 
ATOM   4712  C  CE3  . TRP A 1 347 ? 2.381   26.448 70.969 1.00 32.90  ? 555  TRP A CE3  1 
ATOM   4713  C  CZ2  . TRP A 1 347 ? 2.667   24.738 68.731 1.00 32.05  ? 555  TRP A CZ2  1 
ATOM   4714  C  CZ3  . TRP A 1 347 ? 1.420   26.391 69.974 1.00 32.91  ? 555  TRP A CZ3  1 
ATOM   4715  C  CH2  . TRP A 1 347 ? 1.568   25.543 68.872 1.00 32.01  ? 555  TRP A CH2  1 
ATOM   4716  H  H    . TRP A 1 347 ? 7.139   27.094 72.219 1.00 35.96  ? 555  TRP A H    1 
ATOM   4717  H  HA   . TRP A 1 347 ? 4.665   28.004 72.209 1.00 38.27  ? 555  TRP A HA   1 
ATOM   4718  H  HB2  . TRP A 1 347 ? 5.773   25.679 73.351 1.00 42.04  ? 555  TRP A HB2  1 
ATOM   4719  H  HB3  . TRP A 1 347 ? 4.236   26.030 73.547 1.00 42.04  ? 555  TRP A HB3  1 
ATOM   4720  H  HD1  . TRP A 1 347 ? 6.262   24.188 71.316 1.00 41.38  ? 555  TRP A HD1  1 
ATOM   4721  H  HE1  . TRP A 1 347 ? 5.125   23.538 69.293 1.00 39.95  ? 555  TRP A HE1  1 
ATOM   4722  H  HE3  . TRP A 1 347 ? 2.276   27.015 71.698 1.00 39.48  ? 555  TRP A HE3  1 
ATOM   4723  H  HZ2  . TRP A 1 347 ? 2.762   24.175 67.998 1.00 38.46  ? 555  TRP A HZ2  1 
ATOM   4724  H  HZ3  . TRP A 1 347 ? 0.661   26.925 70.042 1.00 39.49  ? 555  TRP A HZ3  1 
ATOM   4725  H  HH2  . TRP A 1 347 ? 0.905   25.524 68.221 1.00 38.41  ? 555  TRP A HH2  1 
ATOM   4726  N  N    . ASN A 1 348 ? 4.137   29.087 74.335 1.00 34.46  ? 556  ASN A N    1 
ATOM   4727  C  CA   . ASN A 1 348 ? 3.805   29.734 75.609 1.00 38.94  ? 556  ASN A CA   1 
ATOM   4728  C  C    . ASN A 1 348 ? 2.274   29.762 75.674 1.00 39.87  ? 556  ASN A C    1 
ATOM   4729  O  O    . ASN A 1 348 ? 1.623   30.788 75.450 1.00 37.67  ? 556  ASN A O    1 
ATOM   4730  C  CB   . ASN A 1 348 ? 4.406   31.134 75.729 1.00 40.25  ? 556  ASN A CB   1 
ATOM   4731  C  CG   . ASN A 1 348 ? 4.237   31.730 77.117 1.00 43.48  ? 556  ASN A CG   1 
ATOM   4732  O  OD1  . ASN A 1 348 ? 3.419   31.267 77.912 1.00 45.20  ? 556  ASN A OD1  1 
ATOM   4733  N  ND2  . ASN A 1 348 ? 5.011   32.769 77.411 1.00 44.10  ? 556  ASN A ND2  1 
ATOM   4734  H  H    . ASN A 1 348 ? 3.566   29.252 73.714 1.00 41.36  ? 556  ASN A H    1 
ATOM   4735  H  HA   . ASN A 1 348 ? 4.135   29.193 76.344 1.00 46.73  ? 556  ASN A HA   1 
ATOM   4736  H  HB2  . ASN A 1 348 ? 5.356   31.087 75.536 1.00 48.31  ? 556  ASN A HB2  1 
ATOM   4737  H  HB3  . ASN A 1 348 ? 3.967   31.722 75.094 1.00 48.31  ? 556  ASN A HB3  1 
ATOM   4738  H  HD21 . ASN A 1 348 ? 4.954   33.142 78.183 1.00 52.93  ? 556  ASN A HD21 1 
ATOM   4739  H  HD22 . ASN A 1 348 ? 5.571   33.066 76.830 1.00 52.93  ? 556  ASN A HD22 1 
ATOM   4740  N  N    . ARG A 1 349 ? 1.694   28.601 75.986 1.00 38.84  ? 557  ARG A N    1 
ATOM   4741  C  CA   . ARG A 1 349 ? 0.259   28.405 75.824 1.00 40.27  ? 557  ARG A CA   1 
ATOM   4742  C  C    . ARG A 1 349 ? -0.564  29.237 76.797 1.00 41.93  ? 557  ARG A C    1 
ATOM   4743  O  O    . ARG A 1 349 ? -1.764  29.419 76.567 1.00 44.72  ? 557  ARG A O    1 
ATOM   4744  C  CB   . ARG A 1 349 ? -0.072  26.919 75.965 1.00 42.82  ? 557  ARG A CB   1 
ATOM   4745  C  CG   . ARG A 1 349 ? 0.480   26.095 74.812 1.00 42.12  ? 557  ARG A CG   1 
ATOM   4746  C  CD   . ARG A 1 349 ? 0.456   24.603 75.085 1.00 43.56  ? 557  ARG A CD   1 
ATOM   4747  N  NE   . ARG A 1 349 ? 1.311   23.888 74.140 1.00 43.13  ? 557  ARG A NE   1 
ATOM   4748  C  CZ   . ARG A 1 349 ? 0.948   23.551 72.907 1.00 43.19  ? 557  ARG A CZ   1 
ATOM   4749  N  NH1  . ARG A 1 349 ? -0.263  23.858 72.459 1.00 46.38  ? 557  ARG A NH1  1 
ATOM   4750  N  NH2  . ARG A 1 349 ? 1.795   22.906 72.119 1.00 42.46  ? 557  ARG A NH2  1 
ATOM   4751  H  H    . ARG A 1 349 ? 2.112   27.914 76.292 1.00 46.61  ? 557  ARG A H    1 
ATOM   4752  H  HA   . ARG A 1 349 ? 0.011   28.676 74.926 1.00 48.33  ? 557  ARG A HA   1 
ATOM   4753  H  HB2  . ARG A 1 349 ? 0.316   26.584 76.789 1.00 51.38  ? 557  ARG A HB2  1 
ATOM   4754  H  HB3  . ARG A 1 349 ? -1.036  26.808 75.981 1.00 51.38  ? 557  ARG A HB3  1 
ATOM   4755  H  HG2  . ARG A 1 349 ? -0.055  26.263 74.020 1.00 50.55  ? 557  ARG A HG2  1 
ATOM   4756  H  HG3  . ARG A 1 349 ? 1.401   26.355 74.651 1.00 50.55  ? 557  ARG A HG3  1 
ATOM   4757  H  HD2  . ARG A 1 349 ? 0.784   24.434 75.982 1.00 52.27  ? 557  ARG A HD2  1 
ATOM   4758  H  HD3  . ARG A 1 349 ? -0.451  24.272 74.988 1.00 52.27  ? 557  ARG A HD3  1 
ATOM   4759  H  HE   . ARG A 1 349 ? 2.102   23.670 74.399 1.00 51.76  ? 557  ARG A HE   1 
ATOM   4760  H  HH11 . ARG A 1 349 ? -0.816  24.278 72.967 1.00 55.65  ? 557  ARG A HH11 1 
ATOM   4761  H  HH12 . ARG A 1 349 ? -0.494  23.638 71.661 1.00 55.65  ? 557  ARG A HH12 1 
ATOM   4762  H  HH21 . ARG A 1 349 ? 2.581   22.704 72.405 1.00 50.95  ? 557  ARG A HH21 1 
ATOM   4763  H  HH22 . ARG A 1 349 ? 1.559   22.687 71.321 1.00 50.95  ? 557  ARG A HH22 1 
ATOM   4764  N  N    . LYS A 1 350 ? 0.043   29.752 77.869 1.00 42.06  ? 558  LYS A N    1 
ATOM   4765  C  CA   . LYS A 1 350 ? -0.651  30.736 78.694 1.00 44.02  ? 558  LYS A CA   1 
ATOM   4766  C  C    . LYS A 1 350 ? -1.052  31.957 77.877 1.00 42.11  ? 558  LYS A C    1 
ATOM   4767  O  O    . LYS A 1 350 ? -2.033  32.633 78.210 1.00 43.32  ? 558  LYS A O    1 
ATOM   4768  C  CB   . LYS A 1 350 ? 0.232   31.155 79.871 1.00 47.49  ? 558  LYS A CB   1 
ATOM   4769  C  CG   . LYS A 1 350 ? -0.005  30.358 81.144 1.00 52.93  ? 558  LYS A CG   1 
ATOM   4770  C  CD   . LYS A 1 350 ? 0.968   30.759 82.243 1.00 55.18  ? 558  LYS A CD   1 
ATOM   4771  H  H    . LYS A 1 350 ? 0.836   29.552 78.133 1.00 50.47  ? 558  LYS A H    1 
ATOM   4772  H  HA   . LYS A 1 350 ? -1.458  30.335 79.052 1.00 52.83  ? 558  LYS A HA   1 
ATOM   4773  H  HB2  . LYS A 1 350 ? 1.161   31.040 79.619 1.00 56.99  ? 558  LYS A HB2  1 
ATOM   4774  H  HB3  . LYS A 1 350 ? 0.060   32.089 80.071 1.00 56.99  ? 558  LYS A HB3  1 
ATOM   4775  H  HG2  . LYS A 1 350 ? -0.907  30.523 81.462 1.00 63.52  ? 558  LYS A HG2  1 
ATOM   4776  H  HG3  . LYS A 1 350 ? 0.118   29.414 80.958 1.00 63.52  ? 558  LYS A HG3  1 
ATOM   4777  N  N    . LEU A 1 351 ? -0.314  32.252 76.808 1.00 40.15  ? 559  LEU A N    1 
ATOM   4778  C  CA   . LEU A 1 351 ? -0.594  33.384 75.930 1.00 36.61  ? 559  LEU A CA   1 
ATOM   4779  C  C    . LEU A 1 351 ? -1.091  32.975 74.553 1.00 35.20  ? 559  LEU A C    1 
ATOM   4780  O  O    . LEU A 1 351 ? -1.942  33.662 73.983 1.00 36.49  ? 559  LEU A O    1 
ATOM   4781  C  CB   . LEU A 1 351 ? 0.666   34.245 75.763 1.00 34.57  ? 559  LEU A CB   1 
ATOM   4782  C  CG   . LEU A 1 351 ? 1.211   34.938 77.015 1.00 38.29  ? 559  LEU A CG   1 
ATOM   4783  C  CD1  . LEU A 1 351 ? 2.495   35.678 76.683 1.00 38.81  ? 559  LEU A CD1  1 
ATOM   4784  C  CD2  . LEU A 1 351 ? 0.183   35.893 77.612 1.00 42.04  ? 559  LEU A CD2  1 
ATOM   4785  H  H    . LEU A 1 351 ? 0.374   31.797 76.565 1.00 48.18  ? 559  LEU A H    1 
ATOM   4786  H  HA   . LEU A 1 351 ? -1.278  33.936 76.340 1.00 43.93  ? 559  LEU A HA   1 
ATOM   4787  H  HB2  . LEU A 1 351 ? 1.374   33.678 75.420 1.00 41.49  ? 559  LEU A HB2  1 
ATOM   4788  H  HB3  . LEU A 1 351 ? 0.472   34.940 75.114 1.00 41.49  ? 559  LEU A HB3  1 
ATOM   4789  H  HG   . LEU A 1 351 ? 1.417   34.266 77.683 1.00 45.96  ? 559  LEU A HG   1 
ATOM   4790  H  HD11 . LEU A 1 351 ? 2.826   36.110 77.485 1.00 46.58  ? 559  LEU A HD11 1 
ATOM   4791  H  HD12 . LEU A 1 351 ? 3.150   35.041 76.356 1.00 46.58  ? 559  LEU A HD12 1 
ATOM   4792  H  HD13 . LEU A 1 351 ? 2.309   36.342 76.001 1.00 46.58  ? 559  LEU A HD13 1 
ATOM   4793  H  HD21 . LEU A 1 351 ? 0.563   36.312 78.401 1.00 50.45  ? 559  LEU A HD21 1 
ATOM   4794  H  HD22 . LEU A 1 351 ? -0.040  36.569 76.953 1.00 50.45  ? 559  LEU A HD22 1 
ATOM   4795  H  HD23 . LEU A 1 351 ? -0.611  35.391 77.854 1.00 50.45  ? 559  LEU A HD23 1 
ATOM   4796  N  N    . GLY A 1 352 ? -0.590  31.868 74.006 1.00 33.14  ? 560  GLY A N    1 
ATOM   4797  C  CA   . GLY A 1 352 ? -0.881  31.481 72.639 1.00 33.73  ? 560  GLY A CA   1 
ATOM   4798  C  C    . GLY A 1 352 ? -2.147  30.683 72.416 1.00 38.71  ? 560  GLY A C    1 
ATOM   4799  O  O    . GLY A 1 352 ? -2.521  30.464 71.259 1.00 35.98  ? 560  GLY A O    1 
ATOM   4800  H  H    . GLY A 1 352 ? -0.072  31.319 74.419 1.00 39.77  ? 560  GLY A H    1 
ATOM   4801  H  HA2  . GLY A 1 352 ? -0.942  32.284 72.098 1.00 40.48  ? 560  GLY A HA2  1 
ATOM   4802  H  HA3  . GLY A 1 352 ? -0.139  30.954 72.303 1.00 40.48  ? 560  GLY A HA3  1 
ATOM   4803  N  N    . CYS A 1 353 ? -2.818  30.235 73.476 1.00 47.27  ? 561  CYS A N    1 
ATOM   4804  C  CA   . CYS A 1 353 ? -4.067  29.477 73.364 1.00 54.58  ? 561  CYS A CA   1 
ATOM   4805  C  C    . CYS A 1 353 ? -5.215  30.394 73.778 1.00 58.05  ? 561  CYS A C    1 
ATOM   4806  O  O    . CYS A 1 353 ? -5.604  30.436 74.946 1.00 58.76  ? 561  CYS A O    1 
ATOM   4807  C  CB   . CYS A 1 353 ? -4.043  28.217 74.228 1.00 58.54  ? 561  CYS A CB   1 
ATOM   4808  S  SG   . CYS A 1 353 ? -2.869  26.939 73.720 1.00 58.41  ? 561  CYS A SG   1 
ATOM   4809  H  H    . CYS A 1 353 ? -2.566  30.360 74.288 1.00 56.73  ? 561  CYS A H    1 
ATOM   4810  H  HA   . CYS A 1 353 ? -4.203  29.213 72.441 1.00 65.50  ? 561  CYS A HA   1 
ATOM   4811  H  HB2  . CYS A 1 353 ? -3.817  28.473 75.136 1.00 70.25  ? 561  CYS A HB2  1 
ATOM   4812  H  HB3  . CYS A 1 353 ? -4.927  27.820 74.215 1.00 70.25  ? 561  CYS A HB3  1 
ATOM   4813  N  N    . LYS A 1 354 ? -5.762  31.127 72.806 1.00 61.53  ? 562  LYS A N    1 
ATOM   4814  C  CA   . LYS A 1 354 ? -6.895  32.011 73.055 1.00 70.75  ? 562  LYS A CA   1 
ATOM   4815  C  C    . LYS A 1 354 ? -8.054  31.720 72.107 1.00 70.05  ? 562  LYS A C    1 
ATOM   4816  O  O    . LYS A 1 354 ? -8.950  32.557 71.963 1.00 67.53  ? 562  LYS A O    1 
ATOM   4817  C  CB   . LYS A 1 354 ? -6.473  33.477 72.932 1.00 77.54  ? 562  LYS A CB   1 
ATOM   4818  C  CG   . LYS A 1 354 ? -5.308  33.878 73.833 1.00 83.70  ? 562  LYS A CG   1 
ATOM   4819  C  CD   . LYS A 1 354 ? -5.760  34.183 75.252 1.00 89.51  ? 562  LYS A CD   1 
ATOM   4820  C  CE   . LYS A 1 354 ? -4.580  34.572 76.133 1.00 91.24  ? 562  LYS A CE   1 
ATOM   4821  N  NZ   . LYS A 1 354 ? -5.006  34.959 77.506 1.00 93.41  ? 562  LYS A NZ   1 
ATOM   4822  H  H    . LYS A 1 354 ? -5.491  31.127 71.990 1.00 73.84  ? 562  LYS A H    1 
ATOM   4823  H  HA   . LYS A 1 354 ? -7.210  31.868 73.961 1.00 84.91  ? 562  LYS A HA   1 
ATOM   4824  H  HB2  . LYS A 1 354 ? -6.207  33.648 72.014 1.00 93.05  ? 562  LYS A HB2  1 
ATOM   4825  H  HB3  . LYS A 1 354 ? -7.229  34.039 73.162 1.00 93.05  ? 562  LYS A HB3  1 
ATOM   4826  H  HG2  . LYS A 1 354 ? -4.669  33.149 73.869 1.00 100.44 ? 562  LYS A HG2  1 
ATOM   4827  H  HG3  . LYS A 1 354 ? -4.886  34.673 73.472 1.00 100.44 ? 562  LYS A HG3  1 
ATOM   4828  H  HD2  . LYS A 1 354 ? -6.387  34.923 75.237 1.00 107.41 ? 562  LYS A HD2  1 
ATOM   4829  H  HD3  . LYS A 1 354 ? -6.177  33.394 75.632 1.00 107.41 ? 562  LYS A HD3  1 
ATOM   4830  H  HE2  . LYS A 1 354 ? -3.975  33.818 76.206 1.00 109.49 ? 562  LYS A HE2  1 
ATOM   4831  H  HE3  . LYS A 1 354 ? -4.122  35.329 75.735 1.00 109.49 ? 562  LYS A HE3  1 
ATOM   4832  H  HZ1  . LYS A 1 354 ? -4.295  35.180 77.994 1.00 112.10 ? 562  LYS A HZ1  1 
ATOM   4833  H  HZ2  . LYS A 1 354 ? -5.559  35.655 77.468 1.00 112.10 ? 562  LYS A HZ2  1 
ATOM   4834  H  HZ3  . LYS A 1 354 ? -5.425  34.278 77.897 1.00 112.10 ? 562  LYS A HZ3  1 
ATOM   4835  N  N    . CYS A 1 355 ? -8.056  30.550 71.466 1.00 69.83  ? 563  CYS A N    1 
ATOM   4836  C  CA   . CYS A 1 355 ? -9.065  30.198 70.468 1.00 66.04  ? 563  CYS A CA   1 
ATOM   4837  C  C    . CYS A 1 355 ? -9.245  31.343 69.471 1.00 64.49  ? 563  CYS A C    1 
ATOM   4838  O  O    . CYS A 1 355 ? -10.358 31.786 69.180 1.00 62.55  ? 563  CYS A O    1 
ATOM   4839  C  CB   . CYS A 1 355 ? -10.394 29.830 71.138 1.00 65.15  ? 563  CYS A CB   1 
ATOM   4840  S  SG   . CYS A 1 355 ? -11.533 28.878 70.083 1.00 64.62  ? 563  CYS A SG   1 
ATOM   4841  H  H    . CYS A 1 355 ? -7.472  29.932 71.596 1.00 83.80  ? 563  CYS A H    1 
ATOM   4842  H  HA   . CYS A 1 355 ? -8.758  29.422 69.974 1.00 79.25  ? 563  CYS A HA   1 
ATOM   4843  H  HB2  . CYS A 1 355 ? -10.206 29.296 71.926 1.00 78.18  ? 563  CYS A HB2  1 
ATOM   4844  H  HB3  . CYS A 1 355 ? -10.847 30.648 71.398 1.00 78.18  ? 563  CYS A HB3  1 
ATOM   4845  N  N    . GLN A 1 356 ? -8.119  31.825 68.942 1.00 67.45  ? 564  GLN A N    1 
ATOM   4846  C  CA   . GLN A 1 356 ? -8.104  33.025 68.112 1.00 71.56  ? 564  GLN A CA   1 
ATOM   4847  C  C    . GLN A 1 356 ? -8.419  32.755 66.645 1.00 70.77  ? 564  GLN A C    1 
ATOM   4848  O  O    . GLN A 1 356 ? -8.402  33.701 65.848 1.00 68.39  ? 564  GLN A O    1 
ATOM   4849  C  CB   . GLN A 1 356 ? -6.742  33.725 68.220 1.00 72.29  ? 564  GLN A CB   1 
ATOM   4850  C  CG   . GLN A 1 356 ? -5.542  32.882 67.787 1.00 70.95  ? 564  GLN A CG   1 
ATOM   4851  C  CD   . GLN A 1 356 ? -4.881  32.155 68.946 1.00 71.71  ? 564  GLN A CD   1 
ATOM   4852  O  OE1  . GLN A 1 356 ? -5.556  31.613 69.822 1.00 73.64  ? 564  GLN A OE1  1 
ATOM   4853  N  NE2  . GLN A 1 356 ? -3.552  32.147 68.958 1.00 70.33  ? 564  GLN A NE2  1 
ATOM   4854  H  H    . GLN A 1 356 ? -7.344  31.469 69.051 1.00 80.95  ? 564  GLN A H    1 
ATOM   4855  H  HA   . GLN A 1 356 ? -8.776  33.639 68.447 1.00 85.87  ? 564  GLN A HA   1 
ATOM   4856  H  HB2  . GLN A 1 356 ? -6.758  34.518 67.661 1.00 86.75  ? 564  GLN A HB2  1 
ATOM   4857  H  HB3  . GLN A 1 356 ? -6.600  33.982 69.144 1.00 86.75  ? 564  GLN A HB3  1 
ATOM   4858  H  HG2  . GLN A 1 356 ? -5.838  32.217 67.146 1.00 85.14  ? 564  GLN A HG2  1 
ATOM   4859  H  HG3  . GLN A 1 356 ? -4.879  33.462 67.381 1.00 85.14  ? 564  GLN A HG3  1 
ATOM   4860  H  HE21 . GLN A 1 356 ? -3.113  32.537 68.330 1.00 84.40  ? 564  GLN A HE21 1 
ATOM   4861  H  HE22 . GLN A 1 356 ? -3.130  31.749 69.594 1.00 84.40  ? 564  GLN A HE22 1 
ATOM   4862  N  N    . TYR A 1 357 ? -8.705  31.508 66.265 1.00 70.11  ? 565  TYR A N    1 
ATOM   4863  C  CA   . TYR A 1 357 ? -9.039  31.168 64.887 1.00 68.86  ? 565  TYR A CA   1 
ATOM   4864  C  C    . TYR A 1 357 ? -10.486 30.705 64.739 1.00 65.02  ? 565  TYR A C    1 
ATOM   4865  O  O    . TYR A 1 357 ? -10.826 30.060 63.742 1.00 63.46  ? 565  TYR A O    1 
ATOM   4866  C  CB   . TYR A 1 357 ? -8.087  30.092 64.362 1.00 72.32  ? 565  TYR A CB   1 
ATOM   4867  C  CG   . TYR A 1 357 ? -6.626  30.482 64.428 1.00 76.15  ? 565  TYR A CG   1 
ATOM   4868  C  CD1  . TYR A 1 357 ? -6.084  31.374 63.512 1.00 78.60  ? 565  TYR A CD1  1 
ATOM   4869  C  CD2  . TYR A 1 357 ? -5.790  29.957 65.405 1.00 78.40  ? 565  TYR A CD2  1 
ATOM   4870  C  CE1  . TYR A 1 357 ? -4.751  31.738 63.570 1.00 81.26  ? 565  TYR A CE1  1 
ATOM   4871  C  CE2  . TYR A 1 357 ? -4.455  30.314 65.471 1.00 81.37  ? 565  TYR A CE2  1 
ATOM   4872  C  CZ   . TYR A 1 357 ? -3.941  31.205 64.551 1.00 83.79  ? 565  TYR A CZ   1 
ATOM   4873  O  OH   . TYR A 1 357 ? -2.611  31.565 64.609 1.00 86.62  ? 565  TYR A OH   1 
ATOM   4874  H  H    . TYR A 1 357 ? -8.711  30.833 66.798 1.00 84.14  ? 565  TYR A H    1 
ATOM   4875  H  HA   . TYR A 1 357 ? -8.925  31.958 64.335 1.00 82.64  ? 565  TYR A HA   1 
ATOM   4876  H  HB2  . TYR A 1 357 ? -8.203  29.287 64.891 1.00 86.78  ? 565  TYR A HB2  1 
ATOM   4877  H  HB3  . TYR A 1 357 ? -8.303  29.910 63.434 1.00 86.78  ? 565  TYR A HB3  1 
ATOM   4878  H  HD1  . TYR A 1 357 ? -6.628  31.737 62.851 1.00 94.32  ? 565  TYR A HD1  1 
ATOM   4879  H  HD2  . TYR A 1 357 ? -6.134  29.359 66.028 1.00 94.09  ? 565  TYR A HD2  1 
ATOM   4880  H  HE1  . TYR A 1 357 ? -4.403  32.337 62.950 1.00 97.51  ? 565  TYR A HE1  1 
ATOM   4881  H  HE2  . TYR A 1 357 ? -3.908  29.955 66.132 1.00 97.64  ? 565  TYR A HE2  1 
ATOM   4882  H  HH   . TYR A 1 357 ? -2.235  31.171 65.248 1.00 103.95 ? 565  TYR A HH   1 
ATOM   4883  N  N    . LYS A 1 358 ? -11.347 31.029 65.709 1.00 63.40  ? 566  LYS A N    1 
ATOM   4884  C  CA   . LYS A 1 358 ? -12.721 30.534 65.686 1.00 61.36  ? 566  LYS A CA   1 
ATOM   4885  C  C    . LYS A 1 358 ? -13.477 31.008 64.451 1.00 61.06  ? 566  LYS A C    1 
ATOM   4886  O  O    . LYS A 1 358 ? -14.419 30.340 64.007 1.00 61.34  ? 566  LYS A O    1 
ATOM   4887  C  CB   . LYS A 1 358 ? -13.456 30.976 66.952 1.00 60.68  ? 566  LYS A CB   1 
ATOM   4888  H  H    . LYS A 1 358 ? -11.160 31.529 66.383 1.00 76.08  ? 566  LYS A H    1 
ATOM   4889  H  HA   . LYS A 1 358 ? -12.706 29.565 65.673 1.00 73.63  ? 566  LYS A HA   1 
ATOM   4890  N  N    . HIS A 1 359 ? -13.095 32.155 63.891 1.00 59.90  ? 567  HIS A N    1 
ATOM   4891  C  CA   . HIS A 1 359 ? -13.732 32.659 62.680 1.00 60.52  ? 567  HIS A CA   1 
ATOM   4892  C  C    . HIS A 1 359 ? -13.215 31.987 61.414 1.00 48.62  ? 567  HIS A C    1 
ATOM   4893  O  O    . HIS A 1 359 ? -13.802 32.186 60.345 1.00 44.48  ? 567  HIS A O    1 
ATOM   4894  C  CB   . HIS A 1 359 ? -13.538 34.177 62.573 1.00 71.99  ? 567  HIS A CB   1 
ATOM   4895  C  CG   . HIS A 1 359 ? -12.104 34.605 62.489 1.00 82.59  ? 567  HIS A CG   1 
ATOM   4896  N  ND1  . HIS A 1 359 ? -11.203 34.400 63.513 1.00 85.40  ? 567  HIS A ND1  1 
ATOM   4897  C  CD2  . HIS A 1 359 ? -11.420 35.242 61.509 1.00 84.97  ? 567  HIS A CD2  1 
ATOM   4898  C  CE1  . HIS A 1 359 ? -10.024 34.882 63.163 1.00 85.31  ? 567  HIS A CE1  1 
ATOM   4899  N  NE2  . HIS A 1 359 ? -10.128 35.399 61.952 1.00 83.97  ? 567  HIS A NE2  1 
ATOM   4900  H  H    . HIS A 1 359 ? -12.468 32.660 64.194 1.00 71.88  ? 567  HIS A H    1 
ATOM   4901  H  HA   . HIS A 1 359 ? -14.685 32.487 62.736 1.00 72.63  ? 567  HIS A HA   1 
ATOM   4902  H  HB2  . HIS A 1 359 ? -13.988 34.494 61.774 1.00 86.39  ? 567  HIS A HB2  1 
ATOM   4903  H  HB3  . HIS A 1 359 ? -13.926 34.597 63.357 1.00 86.39  ? 567  HIS A HB3  1 
ATOM   4904  H  HD2  . HIS A 1 359 ? -11.759 35.516 60.688 1.00 101.97 ? 567  HIS A HD2  1 
ATOM   4905  H  HE1  . HIS A 1 359 ? -9.253  34.863 63.682 1.00 102.37 ? 567  HIS A HE1  1 
ATOM   4906  H  HE2  . HIS A 1 359 ? -9.491  35.774 61.512 1.00 100.77 ? 567  HIS A HE2  1 
ATOM   4907  N  N    . ILE A 1 360 ? -12.148 31.194 61.510 1.00 43.11  ? 568  ILE A N    1 
ATOM   4908  C  CA   . ILE A 1 360 ? -11.576 30.520 60.356 1.00 40.87  ? 568  ILE A CA   1 
ATOM   4909  C  C    . ILE A 1 360 ? -11.818 29.012 60.385 1.00 40.19  ? 568  ILE A C    1 
ATOM   4910  O  O    . ILE A 1 360 ? -11.928 28.396 59.318 1.00 37.96  ? 568  ILE A O    1 
ATOM   4911  C  CB   . ILE A 1 360 ? -10.065 30.824 60.256 1.00 42.53  ? 568  ILE A CB   1 
ATOM   4912  C  CG1  . ILE A 1 360 ? -9.817  32.338 60.262 1.00 44.54  ? 568  ILE A CG1  1 
ATOM   4913  C  CG2  . ILE A 1 360 ? -9.474  30.203 58.994 1.00 42.92  ? 568  ILE A CG2  1 
ATOM   4914  C  CD1  . ILE A 1 360 ? -8.355  32.720 60.434 1.00 44.63  ? 568  ILE A CD1  1 
ATOM   4915  H  H    . ILE A 1 360 ? -11.734 31.031 62.246 1.00 51.74  ? 568  ILE A H    1 
ATOM   4916  H  HA   . ILE A 1 360 ? -11.998 30.868 59.556 1.00 49.05  ? 568  ILE A HA   1 
ATOM   4917  H  HB   . ILE A 1 360 ? -9.621  30.437 61.026 1.00 51.04  ? 568  ILE A HB   1 
ATOM   4918  H  HG12 . ILE A 1 360 ? -10.124 32.708 59.419 1.00 53.45  ? 568  ILE A HG12 1 
ATOM   4919  H  HG13 . ILE A 1 360 ? -10.315 32.732 60.995 1.00 53.45  ? 568  ILE A HG13 1 
ATOM   4920  H  HG21 . ILE A 1 360 ? -8.527  30.408 58.956 1.00 51.50  ? 568  ILE A HG21 1 
ATOM   4921  H  HG22 . ILE A 1 360 ? -9.604  29.242 59.026 1.00 51.50  ? 568  ILE A HG22 1 
ATOM   4922  H  HG23 . ILE A 1 360 ? -9.925  30.573 58.220 1.00 51.50  ? 568  ILE A HG23 1 
ATOM   4923  H  HD11 . ILE A 1 360 ? -8.279  33.687 60.428 1.00 53.56  ? 568  ILE A HD11 1 
ATOM   4924  H  HD12 . ILE A 1 360 ? -8.034  32.367 61.278 1.00 53.56  ? 568  ILE A HD12 1 
ATOM   4925  H  HD13 . ILE A 1 360 ? -7.843  32.343 59.701 1.00 53.56  ? 568  ILE A HD13 1 
ATOM   4926  N  N    . VAL A 1 361 ? -11.898 28.402 61.566 1.00 38.15  ? 569  VAL A N    1 
ATOM   4927  C  CA   . VAL A 1 361 ? -12.114 26.967 61.696 1.00 37.28  ? 569  VAL A CA   1 
ATOM   4928  C  C    . VAL A 1 361 ? -13.132 26.728 62.802 1.00 36.65  ? 569  VAL A C    1 
ATOM   4929  O  O    . VAL A 1 361 ? -13.298 27.551 63.708 1.00 36.42  ? 569  VAL A O    1 
ATOM   4930  C  CB   . VAL A 1 361 ? -10.793 26.211 61.984 1.00 36.51  ? 569  VAL A CB   1 
ATOM   4931  C  CG1  . VAL A 1 361 ? -9.740  26.565 60.946 1.00 35.83  ? 569  VAL A CG1  1 
ATOM   4932  C  CG2  . VAL A 1 361 ? -10.272 26.522 63.383 1.00 36.58  ? 569  VAL A CG2  1 
ATOM   4933  H  H    . VAL A 1 361 ? -11.827 28.808 62.321 1.00 45.78  ? 569  VAL A H    1 
ATOM   4934  H  HA   . VAL A 1 361 ? -12.483 26.625 60.866 1.00 44.73  ? 569  VAL A HA   1 
ATOM   4935  H  HB   . VAL A 1 361 ? -10.957 25.257 61.930 1.00 43.81  ? 569  VAL A HB   1 
ATOM   4936  H  HG11 . VAL A 1 361 ? -8.924  26.081 61.147 1.00 43.00  ? 569  VAL A HG11 1 
ATOM   4937  H  HG12 . VAL A 1 361 ? -10.067 26.315 60.068 1.00 43.00  ? 569  VAL A HG12 1 
ATOM   4938  H  HG13 . VAL A 1 361 ? -9.575  27.521 60.978 1.00 43.00  ? 569  VAL A HG13 1 
ATOM   4939  H  HG21 . VAL A 1 361 ? -9.447  26.034 63.528 1.00 43.89  ? 569  VAL A HG21 1 
ATOM   4940  H  HG22 . VAL A 1 361 ? -10.109 27.476 63.454 1.00 43.89  ? 569  VAL A HG22 1 
ATOM   4941  H  HG23 . VAL A 1 361 ? -10.937 26.250 64.035 1.00 43.89  ? 569  VAL A HG23 1 
ATOM   4942  N  N    . ASP A 1 362 ? -13.828 25.594 62.715 1.00 37.74  ? 570  ASP A N    1 
ATOM   4943  C  CA   . ASP A 1 362 ? -14.785 25.184 63.744 1.00 39.14  ? 570  ASP A CA   1 
ATOM   4944  C  C    . ASP A 1 362 ? -14.069 24.394 64.844 1.00 38.47  ? 570  ASP A C    1 
ATOM   4945  O  O    . ASP A 1 362 ? -14.349 23.221 65.100 1.00 37.20  ? 570  ASP A O    1 
ATOM   4946  C  CB   . ASP A 1 362 ? -15.912 24.363 63.121 1.00 41.22  ? 570  ASP A CB   1 
ATOM   4947  C  CG   . ASP A 1 362 ? -16.845 25.193 62.246 1.00 43.43  ? 570  ASP A CG   1 
ATOM   4948  O  OD1  . ASP A 1 362 ? -16.784 26.443 62.289 1.00 40.53  ? 570  ASP A OD1  1 
ATOM   4949  O  OD2  . ASP A 1 362 ? -17.649 24.580 61.510 1.00 42.99  ? 570  ASP A OD2  1 
ATOM   4950  H  H    . ASP A 1 362 ? -13.762 25.038 62.062 1.00 45.29  ? 570  ASP A H    1 
ATOM   4951  H  HA   . ASP A 1 362 ? -15.176 25.975 64.147 1.00 46.96  ? 570  ASP A HA   1 
ATOM   4952  H  HB2  . ASP A 1 362 ? -15.525 23.667 62.568 1.00 49.47  ? 570  ASP A HB2  1 
ATOM   4953  H  HB3  . ASP A 1 362 ? -16.441 23.967 63.830 1.00 49.47  ? 570  ASP A HB3  1 
ATOM   4954  N  N    . TRP A 1 363 ? -13.127 25.067 65.500 1.00 35.79  ? 571  TRP A N    1 
ATOM   4955  C  CA   . TRP A 1 363 ? -12.259 24.438 66.489 1.00 36.12  ? 571  TRP A CA   1 
ATOM   4956  C  C    . TRP A 1 363 ? -11.448 25.543 67.159 1.00 38.55  ? 571  TRP A C    1 
ATOM   4957  O  O    . TRP A 1 363 ? -11.417 26.682 66.688 1.00 40.67  ? 571  TRP A O    1 
ATOM   4958  C  CB   . TRP A 1 363 ? -11.348 23.393 65.829 1.00 33.84  ? 571  TRP A CB   1 
ATOM   4959  C  CG   . TRP A 1 363 ? -10.845 22.309 66.740 1.00 32.48  ? 571  TRP A CG   1 
ATOM   4960  C  CD1  . TRP A 1 363 ? -9.579  22.174 67.230 1.00 30.52  ? 571  TRP A CD1  1 
ATOM   4961  C  CD2  . TRP A 1 363 ? -11.593 21.197 67.250 1.00 35.41  ? 571  TRP A CD2  1 
ATOM   4962  N  NE1  . TRP A 1 363 ? -9.492  21.054 68.017 1.00 34.32  ? 571  TRP A NE1  1 
ATOM   4963  C  CE2  . TRP A 1 363 ? -10.715 20.436 68.047 1.00 35.47  ? 571  TRP A CE2  1 
ATOM   4964  C  CE3  . TRP A 1 363 ? -12.919 20.775 67.115 1.00 38.77  ? 571  TRP A CE3  1 
ATOM   4965  C  CZ2  . TRP A 1 363 ? -11.119 19.276 68.706 1.00 39.13  ? 571  TRP A CZ2  1 
ATOM   4966  C  CZ3  . TRP A 1 363 ? -13.320 19.624 67.771 1.00 40.43  ? 571  TRP A CZ3  1 
ATOM   4967  C  CH2  . TRP A 1 363 ? -12.423 18.887 68.555 1.00 41.38  ? 571  TRP A CH2  1 
ATOM   4968  H  H    . TRP A 1 363 ? -12.970 25.905 65.387 1.00 42.96  ? 571  TRP A H    1 
ATOM   4969  H  HA   . TRP A 1 363 ? -12.798 23.997 67.164 1.00 43.34  ? 571  TRP A HA   1 
ATOM   4970  H  HB2  . TRP A 1 363 ? -11.842 22.965 65.112 1.00 40.61  ? 571  TRP A HB2  1 
ATOM   4971  H  HB3  . TRP A 1 363 ? -10.574 23.848 65.463 1.00 40.61  ? 571  TRP A HB3  1 
ATOM   4972  H  HD1  . TRP A 1 363 ? -8.876  22.757 67.055 1.00 36.62  ? 571  TRP A HD1  1 
ATOM   4973  H  HE1  . TRP A 1 363 ? -8.786  20.784 68.426 1.00 41.19  ? 571  TRP A HE1  1 
ATOM   4974  H  HE3  . TRP A 1 363 ? -13.520 21.259 66.595 1.00 46.52  ? 571  TRP A HE3  1 
ATOM   4975  H  HZ2  . TRP A 1 363 ? -10.527 18.786 69.229 1.00 46.96  ? 571  TRP A HZ2  1 
ATOM   4976  H  HZ3  . TRP A 1 363 ? -14.200 19.333 67.687 1.00 48.52  ? 571  TRP A HZ3  1 
ATOM   4977  H  HH2  . TRP A 1 363 ? -12.720 18.117 68.985 1.00 49.66  ? 571  TRP A HH2  1 
ATOM   4978  N  N    . CYS A 1 364 ? -10.800 25.198 68.269 1.00 39.66  ? 572  CYS A N    1 
ATOM   4979  C  CA   . CYS A 1 364 ? -9.905  26.109 68.974 1.00 42.40  ? 572  CYS A CA   1 
ATOM   4980  C  C    . CYS A 1 364 ? -8.461  25.686 68.740 1.00 37.73  ? 572  CYS A C    1 
ATOM   4981  O  O    . CYS A 1 364 ? -8.131  24.502 68.860 1.00 40.27  ? 572  CYS A O    1 
ATOM   4982  C  CB   . CYS A 1 364 ? -10.203 26.138 70.475 1.00 50.98  ? 572  CYS A CB   1 
ATOM   4983  S  SG   . CYS A 1 364 ? -11.701 27.037 70.953 1.00 61.50  ? 572  CYS A SG   1 
ATOM   4984  H  H    . CYS A 1 364 ? -10.864 24.425 68.640 1.00 47.60  ? 572  CYS A H    1 
ATOM   4985  H  HA   . CYS A 1 364 ? -10.020 27.006 68.623 1.00 50.89  ? 572  CYS A HA   1 
ATOM   4986  H  HB2  . CYS A 1 364 ? -10.300 25.224 70.787 1.00 61.18  ? 572  CYS A HB2  1 
ATOM   4987  H  HB3  . CYS A 1 364 ? -9.455  26.557 70.929 1.00 61.18  ? 572  CYS A HB3  1 
ATOM   4988  N  N    . GLY A 1 365 ? -7.601  26.657 68.417 1.00 34.41  ? 573  GLY A N    1 
ATOM   4989  C  CA   . GLY A 1 365 ? -6.213  26.379 68.128 1.00 36.51  ? 573  GLY A CA   1 
ATOM   4990  C  C    . GLY A 1 365 ? -5.279  27.291 68.906 1.00 37.90  ? 573  GLY A C    1 
ATOM   4991  O  O    . GLY A 1 365 ? -5.698  28.281 69.512 1.00 39.10  ? 573  GLY A O    1 
ATOM   4992  H  H    . GLY A 1 365 ? -7.810  27.489 68.360 1.00 41.29  ? 573  GLY A H    1 
ATOM   4993  H  HA2  . GLY A 1 365 ? -6.010  25.459 68.361 1.00 43.82  ? 573  GLY A HA2  1 
ATOM   4994  H  HA3  . GLY A 1 365 ? -6.046  26.503 67.181 1.00 43.82  ? 573  GLY A HA3  1 
ATOM   4995  N  N    . CYS A 1 366 ? -3.995  26.934 68.867 1.00 39.76  ? 574  CYS A N    1 
ATOM   4996  C  CA   . CYS A 1 366 ? -2.937  27.658 69.559 1.00 41.74  ? 574  CYS A CA   1 
ATOM   4997  C  C    . CYS A 1 366 ? -1.825  27.994 68.574 1.00 37.08  ? 574  CYS A C    1 
ATOM   4998  O  O    . CYS A 1 366 ? -1.695  27.371 67.517 1.00 37.31  ? 574  CYS A O    1 
ATOM   4999  C  CB   . CYS A 1 366 ? -2.361  26.833 70.721 1.00 47.71  ? 574  CYS A CB   1 
ATOM   5000  S  SG   . CYS A 1 366 ? -3.569  26.246 71.936 1.00 54.86  ? 574  CYS A SG   1 
ATOM   5001  H  H    . CYS A 1 366 ? -3.706  26.253 68.429 1.00 47.71  ? 574  CYS A H    1 
ATOM   5002  H  HA   . CYS A 1 366 ? -3.293  28.486 69.917 1.00 50.10  ? 574  CYS A HA   1 
ATOM   5003  H  HB2  . CYS A 1 366 ? -1.917  26.053 70.352 1.00 57.25  ? 574  CYS A HB2  1 
ATOM   5004  H  HB3  . CYS A 1 366 ? -1.714  27.379 71.194 1.00 57.25  ? 574  CYS A HB3  1 
ATOM   5005  N  N    . SER A 1 367 ? -1.005  28.978 68.936 1.00 34.92  ? 575  SER A N    1 
ATOM   5006  C  CA   . SER A 1 367 ? 0.106   29.394 68.092 1.00 35.01  ? 575  SER A CA   1 
ATOM   5007  C  C    . SER A 1 367 ? 1.324   29.710 68.948 1.00 31.44  ? 575  SER A C    1 
ATOM   5008  O  O    . SER A 1 367 ? 1.181   30.188 70.080 1.00 31.93  ? 575  SER A O    1 
ATOM   5009  C  CB   . SER A 1 367 ? -0.255  30.627 67.248 1.00 40.75  ? 575  SER A CB   1 
ATOM   5010  O  OG   . SER A 1 367 ? -1.114  30.268 66.179 1.00 44.16  ? 575  SER A OG   1 
ATOM   5011  H  H    . SER A 1 367 ? -1.074  29.422 69.669 1.00 41.91  ? 575  SER A H    1 
ATOM   5012  H  HA   . SER A 1 367 ? 0.338   28.671 67.490 1.00 42.02  ? 575  SER A HA   1 
ATOM   5013  H  HB2  . SER A 1 367 ? -0.705  31.276 67.811 1.00 48.90  ? 575  SER A HB2  1 
ATOM   5014  H  HB3  . SER A 1 367 ? 0.559   31.011 66.885 1.00 48.90  ? 575  SER A HB3  1 
ATOM   5015  H  HG   . SER A 1 367 ? -0.736  29.705 65.683 1.00 52.99  ? 575  SER A HG   1 
ATOM   5016  N  N    . PRO A 1 368 ? 2.530   29.458 68.438 1.00 31.69  ? 576  PRO A N    1 
ATOM   5017  C  CA   . PRO A 1 368 ? 3.738   29.844 69.178 1.00 31.55  ? 576  PRO A CA   1 
ATOM   5018  C  C    . PRO A 1 368 ? 3.903   31.357 69.246 1.00 29.94  ? 576  PRO A C    1 
ATOM   5019  O  O    . PRO A 1 368 ? 3.410   32.109 68.403 1.00 27.05  ? 576  PRO A O    1 
ATOM   5020  C  CB   . PRO A 1 368 ? 4.877   29.204 68.374 1.00 33.14  ? 576  PRO A CB   1 
ATOM   5021  C  CG   . PRO A 1 368 ? 4.228   28.189 67.495 1.00 31.28  ? 576  PRO A CG   1 
ATOM   5022  C  CD   . PRO A 1 368 ? 2.856   28.689 67.223 1.00 30.72  ? 576  PRO A CD   1 
ATOM   5023  H  HA   . PRO A 1 368 ? 3.724   29.475 70.075 1.00 37.87  ? 576  PRO A HA   1 
ATOM   5024  H  HB2  . PRO A 1 368 ? 5.322   29.882 67.841 1.00 39.77  ? 576  PRO A HB2  1 
ATOM   5025  H  HB3  . PRO A 1 368 ? 5.505   28.779 68.979 1.00 39.77  ? 576  PRO A HB3  1 
ATOM   5026  H  HG2  . PRO A 1 368 ? 4.730   28.108 66.669 1.00 37.54  ? 576  PRO A HG2  1 
ATOM   5027  H  HG3  . PRO A 1 368 ? 4.193   27.337 67.956 1.00 37.54  ? 576  PRO A HG3  1 
ATOM   5028  H  HD2  . PRO A 1 368 ? 2.854   29.268 66.445 1.00 36.86  ? 576  PRO A HD2  1 
ATOM   5029  H  HD3  . PRO A 1 368 ? 2.240   27.947 67.117 1.00 36.86  ? 576  PRO A HD3  1 
ATOM   5030  N  N    . ASN A 1 369 ? 4.623   31.797 70.273 1.00 33.12  ? 577  ASN A N    1 
ATOM   5031  C  CA   . ASN A 1 369 ? 4.893   33.213 70.474 1.00 31.03  ? 577  ASN A CA   1 
ATOM   5032  C  C    . ASN A 1 369 ? 6.150   33.643 69.716 1.00 29.42  ? 577  ASN A C    1 
ATOM   5033  O  O    . ASN A 1 369 ? 6.954   32.823 69.267 1.00 27.30  ? 577  ASN A O    1 
ATOM   5034  C  CB   . ASN A 1 369 ? 5.049   33.520 71.963 1.00 33.68  ? 577  ASN A CB   1 
ATOM   5035  C  CG   . ASN A 1 369 ? 3.720   33.716 72.663 1.00 36.91  ? 577  ASN A CG   1 
ATOM   5036  O  OD1  . ASN A 1 369 ? 2.976   32.762 72.890 1.00 36.22  ? 577  ASN A OD1  1 
ATOM   5037  N  ND2  . ASN A 1 369 ? 3.420   34.962 73.022 1.00 37.87  ? 577  ASN A ND2  1 
ATOM   5038  H  H    . ASN A 1 369 ? 4.969   31.288 70.874 1.00 39.75  ? 577  ASN A H    1 
ATOM   5039  H  HA   . ASN A 1 369 ? 4.145   33.730 70.136 1.00 37.23  ? 577  ASN A HA   1 
ATOM   5040  H  HB2  . ASN A 1 369 ? 5.508   32.781 72.392 1.00 40.42  ? 577  ASN A HB2  1 
ATOM   5041  H  HB3  . ASN A 1 369 ? 5.565   34.336 72.065 1.00 40.42  ? 577  ASN A HB3  1 
ATOM   5042  H  HD21 . ASN A 1 369 ? 2.677   35.127 73.424 1.00 45.45  ? 577  ASN A HD21 1 
ATOM   5043  H  HD22 . ASN A 1 369 ? 3.966   35.603 72.849 1.00 45.45  ? 577  ASN A HD22 1 
ATOM   5044  N  N    . ASP A 1 370 ? 6.310   34.960 69.584 1.00 28.70  ? 578  ASP A N    1 
ATOM   5045  C  CA   . ASP A 1 370 ? 7.503   35.540 68.979 1.00 30.50  ? 578  ASP A CA   1 
ATOM   5046  C  C    . ASP A 1 370 ? 8.622   35.650 70.007 1.00 30.87  ? 578  ASP A C    1 
ATOM   5047  O  O    . ASP A 1 370 ? 8.391   36.028 71.159 1.00 34.54  ? 578  ASP A O    1 
ATOM   5048  C  CB   . ASP A 1 370 ? 7.201   36.931 68.412 1.00 32.03  ? 578  ASP A CB   1 
ATOM   5049  C  CG   . ASP A 1 370 ? 6.176   36.906 67.289 1.00 34.89  ? 578  ASP A CG   1 
ATOM   5050  O  OD1  . ASP A 1 370 ? 6.055   35.867 66.608 1.00 35.17  ? 578  ASP A OD1  1 
ATOM   5051  O  OD2  . ASP A 1 370 ? 5.495   37.936 67.081 1.00 34.67  ? 578  ASP A OD2  1 
ATOM   5052  H  H    . ASP A 1 370 ? 5.733   35.543 69.840 1.00 34.45  ? 578  ASP A H    1 
ATOM   5053  H  HA   . ASP A 1 370 ? 7.806   34.971 68.254 1.00 36.61  ? 578  ASP A HA   1 
ATOM   5054  H  HB2  . ASP A 1 370 ? 6.853   37.493 69.122 1.00 38.43  ? 578  ASP A HB2  1 
ATOM   5055  H  HB3  . ASP A 1 370 ? 8.021   37.313 68.060 1.00 38.43  ? 578  ASP A HB3  1 
ATOM   5056  N  N    . PHE A 1 371 ? 9.842   35.334 69.578 1.00 30.19  ? 579  PHE A N    1 
ATOM   5057  C  CA   . PHE A 1 371 ? 11.005  35.459 70.448 1.00 29.33  ? 579  PHE A CA   1 
ATOM   5058  C  C    . PHE A 1 371 ? 11.297  36.922 70.768 1.00 31.18  ? 579  PHE A C    1 
ATOM   5059  O  O    . PHE A 1 371 ? 11.005  37.825 69.979 1.00 30.94  ? 579  PHE A O    1 
ATOM   5060  C  CB   . PHE A 1 371 ? 12.238  34.835 69.796 1.00 28.48  ? 579  PHE A CB   1 
ATOM   5061  C  CG   . PHE A 1 371 ? 12.233  33.331 69.786 1.00 28.23  ? 579  PHE A CG   1 
ATOM   5062  C  CD1  . PHE A 1 371 ? 12.379  32.616 70.961 1.00 30.58  ? 579  PHE A CD1  1 
ATOM   5063  C  CD2  . PHE A 1 371 ? 12.110  32.636 68.595 1.00 29.73  ? 579  PHE A CD2  1 
ATOM   5064  C  CE1  . PHE A 1 371 ? 12.389  31.232 70.953 1.00 30.39  ? 579  PHE A CE1  1 
ATOM   5065  C  CE2  . PHE A 1 371 ? 12.119  31.249 68.579 1.00 30.17  ? 579  PHE A CE2  1 
ATOM   5066  C  CZ   . PHE A 1 371 ? 12.259  30.548 69.761 1.00 28.45  ? 579  PHE A CZ   1 
ATOM   5067  H  H    . PHE A 1 371 ? 10.022  35.046 68.788 1.00 36.23  ? 579  PHE A H    1 
ATOM   5068  H  HA   . PHE A 1 371 ? 10.832  34.993 71.281 1.00 35.19  ? 579  PHE A HA   1 
ATOM   5069  H  HB2  . PHE A 1 371 ? 12.289  35.136 68.875 1.00 34.18  ? 579  PHE A HB2  1 
ATOM   5070  H  HB3  . PHE A 1 371 ? 13.026  35.124 70.280 1.00 34.18  ? 579  PHE A HB3  1 
ATOM   5071  H  HD1  . PHE A 1 371 ? 12.467  33.071 71.767 1.00 36.70  ? 579  PHE A HD1  1 
ATOM   5072  H  HD2  . PHE A 1 371 ? 12.016  33.104 67.797 1.00 35.68  ? 579  PHE A HD2  1 
ATOM   5073  H  HE1  . PHE A 1 371 ? 12.483  30.763 71.750 1.00 36.47  ? 579  PHE A HE1  1 
ATOM   5074  H  HE2  . PHE A 1 371 ? 12.031  30.792 67.774 1.00 36.21  ? 579  PHE A HE2  1 
ATOM   5075  H  HZ   . PHE A 1 371 ? 12.264  29.618 69.754 1.00 34.14  ? 579  PHE A HZ   1 
ATOM   5076  N  N    . LYS A 1 372 ? 11.894  37.140 71.935 1.00 30.75  ? 580  LYS A N    1 
ATOM   5077  C  CA   . LYS A 1 372 ? 12.320  38.446 72.419 1.00 35.34  ? 580  LYS A CA   1 
ATOM   5078  C  C    . LYS A 1 372 ? 13.791  38.377 72.793 1.00 35.60  ? 580  LYS A C    1 
ATOM   5079  O  O    . LYS A 1 372 ? 14.368  37.289 72.890 1.00 34.13  ? 580  LYS A O    1 
ATOM   5080  C  CB   . LYS A 1 372 ? 11.481  38.878 73.636 1.00 37.20  ? 580  LYS A CB   1 
ATOM   5081  C  CG   . LYS A 1 372 ? 9.987   38.994 73.370 1.00 37.80  ? 580  LYS A CG   1 
ATOM   5082  C  CD   . LYS A 1 372 ? 9.646   40.271 72.628 1.00 39.61  ? 580  LYS A CD   1 
ATOM   5083  C  CE   . LYS A 1 372 ? 8.158   40.365 72.320 1.00 38.19  ? 580  LYS A CE   1 
ATOM   5084  N  NZ   . LYS A 1 372 ? 7.338   40.653 73.528 1.00 41.00  ? 580  LYS A NZ   1 
ATOM   5085  H  H    . LYS A 1 372 ? 12.071  36.509 72.492 1.00 36.90  ? 580  LYS A H    1 
ATOM   5086  H  HA   . LYS A 1 372 ? 12.209  39.106 71.716 1.00 42.41  ? 580  LYS A HA   1 
ATOM   5087  H  HB2  . LYS A 1 372 ? 11.604  38.226 74.343 1.00 44.64  ? 580  LYS A HB2  1 
ATOM   5088  H  HB3  . LYS A 1 372 ? 11.794  39.746 73.935 1.00 44.64  ? 580  LYS A HB3  1 
ATOM   5089  H  HG2  . LYS A 1 372 ? 9.700   38.242 72.827 1.00 45.36  ? 580  LYS A HG2  1 
ATOM   5090  H  HG3  . LYS A 1 372 ? 9.511   38.997 74.215 1.00 45.36  ? 580  LYS A HG3  1 
ATOM   5091  H  HD2  . LYS A 1 372 ? 9.891   41.033 73.176 1.00 47.53  ? 580  LYS A HD2  1 
ATOM   5092  H  HD3  . LYS A 1 372 ? 10.132  40.292 71.789 1.00 47.53  ? 580  LYS A HD3  1 
ATOM   5093  H  HE2  . LYS A 1 372 ? 8.013   41.080 71.681 1.00 45.83  ? 580  LYS A HE2  1 
ATOM   5094  H  HE3  . LYS A 1 372 ? 7.859   39.521 71.948 1.00 45.83  ? 580  LYS A HE3  1 
ATOM   5095  H  HZ1  . LYS A 1 372 ? 7.446   40.007 74.130 1.00 49.20  ? 580  LYS A HZ1  1 
ATOM   5096  H  HZ2  . LYS A 1 372 ? 7.587   41.428 73.887 1.00 49.20  ? 580  LYS A HZ2  1 
ATOM   5097  H  HZ3  . LYS A 1 372 ? 6.477   40.700 73.306 1.00 49.20  ? 580  LYS A HZ3  1 
ATOM   5098  N  N    . PRO A 1 373 ? 14.438  39.527 73.017 1.00 37.41  ? 581  PRO A N    1 
ATOM   5099  C  CA   . PRO A 1 373 ? 15.886  39.504 73.297 1.00 39.60  ? 581  PRO A CA   1 
ATOM   5100  C  C    . PRO A 1 373 ? 16.280  38.640 74.486 1.00 43.47  ? 581  PRO A C    1 
ATOM   5101  O  O    . PRO A 1 373 ? 17.353  38.023 74.460 1.00 42.61  ? 581  PRO A O    1 
ATOM   5102  C  CB   . PRO A 1 373 ? 16.214  40.982 73.544 1.00 41.25  ? 581  PRO A CB   1 
ATOM   5103  C  CG   . PRO A 1 373 ? 15.182  41.725 72.769 1.00 38.98  ? 581  PRO A CG   1 
ATOM   5104  C  CD   . PRO A 1 373 ? 13.930  40.905 72.886 1.00 39.30  ? 581  PRO A CD   1 
ATOM   5105  H  HA   . PRO A 1 373 ? 16.370  39.200 72.513 1.00 47.52  ? 581  PRO A HA   1 
ATOM   5106  H  HB2  . PRO A 1 373 ? 16.144  41.181 74.491 1.00 49.50  ? 581  PRO A HB2  1 
ATOM   5107  H  HB3  . PRO A 1 373 ? 17.104  41.181 73.213 1.00 49.50  ? 581  PRO A HB3  1 
ATOM   5108  H  HG2  . PRO A 1 373 ? 15.052  42.604 73.158 1.00 46.78  ? 581  PRO A HG2  1 
ATOM   5109  H  HG3  . PRO A 1 373 ? 15.459  41.798 71.843 1.00 46.78  ? 581  PRO A HG3  1 
ATOM   5110  H  HD2  . PRO A 1 373 ? 13.432  41.159 73.678 1.00 47.16  ? 581  PRO A HD2  1 
ATOM   5111  H  HD3  . PRO A 1 373 ? 13.392  40.993 72.083 1.00 47.16  ? 581  PRO A HD3  1 
ATOM   5112  N  N    . GLN A 1 374 ? 15.451  38.570 75.529 1.00 46.23  ? 582  GLN A N    1 
ATOM   5113  C  CA   . GLN A 1 374 ? 15.789  37.754 76.690 1.00 49.79  ? 582  GLN A CA   1 
ATOM   5114  C  C    . GLN A 1 374 ? 15.856  36.265 76.369 1.00 43.88  ? 582  GLN A C    1 
ATOM   5115  O  O    . GLN A 1 374 ? 16.268  35.483 77.233 1.00 44.40  ? 582  GLN A O    1 
ATOM   5116  C  CB   . GLN A 1 374 ? 14.772  37.986 77.810 1.00 58.77  ? 582  GLN A CB   1 
ATOM   5117  C  CG   . GLN A 1 374 ? 13.346  37.580 77.459 1.00 65.08  ? 582  GLN A CG   1 
ATOM   5118  C  CD   . GLN A 1 374 ? 12.429  38.772 77.254 1.00 71.98  ? 582  GLN A CD   1 
ATOM   5119  O  OE1  . GLN A 1 374 ? 12.859  39.835 76.801 1.00 73.04  ? 582  GLN A OE1  1 
ATOM   5120  N  NE2  . GLN A 1 374 ? 11.156  38.600 77.591 1.00 74.87  ? 582  GLN A NE2  1 
ATOM   5121  H  H    . GLN A 1 374 ? 14.698  38.981 75.588 1.00 55.48  ? 582  GLN A H    1 
ATOM   5122  H  HA   . GLN A 1 374 ? 16.660  38.025 77.019 1.00 59.75  ? 582  GLN A HA   1 
ATOM   5123  H  HB2  . GLN A 1 374 ? 15.042  37.471 78.586 1.00 70.53  ? 582  GLN A HB2  1 
ATOM   5124  H  HB3  . GLN A 1 374 ? 14.764  38.930 78.031 1.00 70.53  ? 582  GLN A HB3  1 
ATOM   5125  H  HG2  . GLN A 1 374 ? 13.357  37.065 76.637 1.00 78.09  ? 582  GLN A HG2  1 
ATOM   5126  H  HG3  . GLN A 1 374 ? 12.983  37.044 78.181 1.00 78.09  ? 582  GLN A HG3  1 
ATOM   5127  H  HE21 . GLN A 1 374 ? 10.893  37.844 77.905 1.00 89.84  ? 582  GLN A HE21 1 
ATOM   5128  H  HE22 . GLN A 1 374 ? 10.595  39.244 77.495 1.00 89.84  ? 582  GLN A HE22 1 
ATOM   5129  N  N    . ASP A 1 375 ? 15.461  35.853 75.165 1.00 37.76  ? 583  ASP A N    1 
ATOM   5130  C  CA   . ASP A 1 375 ? 15.452  34.448 74.781 1.00 37.23  ? 583  ASP A CA   1 
ATOM   5131  C  C    . ASP A 1 375 ? 16.728  34.011 74.073 1.00 35.99  ? 583  ASP A C    1 
ATOM   5132  O  O    . ASP A 1 375 ? 16.856  32.827 73.738 1.00 37.09  ? 583  ASP A O    1 
ATOM   5133  C  CB   . ASP A 1 375 ? 14.250  34.163 73.871 1.00 37.77  ? 583  ASP A CB   1 
ATOM   5134  C  CG   . ASP A 1 375 ? 12.919  34.351 74.580 1.00 42.46  ? 583  ASP A CG   1 
ATOM   5135  O  OD1  . ASP A 1 375 ? 12.797  33.913 75.744 1.00 46.07  ? 583  ASP A OD1  1 
ATOM   5136  O  OD2  . ASP A 1 375 ? 11.995  34.937 73.973 1.00 42.37  ? 583  ASP A OD2  1 
ATOM   5137  H  H    . ASP A 1 375 ? 15.190  36.381 74.544 1.00 45.32  ? 583  ASP A H    1 
ATOM   5138  H  HA   . ASP A 1 375 ? 15.355  33.906 75.580 1.00 44.68  ? 583  ASP A HA   1 
ATOM   5139  H  HB2  . ASP A 1 375 ? 14.275  34.770 73.115 1.00 45.32  ? 583  ASP A HB2  1 
ATOM   5140  H  HB3  . ASP A 1 375 ? 14.298  33.245 73.562 1.00 45.32  ? 583  ASP A HB3  1 
ATOM   5141  N  N    . PHE A 1 376 ? 17.676  34.925 73.846 1.00 33.74  ? 584  PHE A N    1 
ATOM   5142  C  CA   . PHE A 1 376 ? 18.830  34.603 73.012 1.00 37.08  ? 584  PHE A CA   1 
ATOM   5143  C  C    . PHE A 1 376 ? 19.595  33.397 73.547 1.00 42.09  ? 584  PHE A C    1 
ATOM   5144  O  O    . PHE A 1 376 ? 20.123  32.595 72.767 1.00 42.08  ? 584  PHE A O    1 
ATOM   5145  C  CB   . PHE A 1 376 ? 19.760  35.811 72.902 1.00 40.92  ? 584  PHE A CB   1 
ATOM   5146  C  CG   . PHE A 1 376 ? 20.992  35.540 72.089 1.00 42.78  ? 584  PHE A CG   1 
ATOM   5147  C  CD1  . PHE A 1 376 ? 20.962  35.644 70.710 1.00 43.74  ? 584  PHE A CD1  1 
ATOM   5148  C  CD2  . PHE A 1 376 ? 22.173  35.158 72.702 1.00 46.40  ? 584  PHE A CD2  1 
ATOM   5149  C  CE1  . PHE A 1 376 ? 22.088  35.384 69.957 1.00 46.87  ? 584  PHE A CE1  1 
ATOM   5150  C  CE2  . PHE A 1 376 ? 23.304  34.897 71.954 1.00 49.85  ? 584  PHE A CE2  1 
ATOM   5151  C  CZ   . PHE A 1 376 ? 23.261  35.011 70.579 1.00 50.05  ? 584  PHE A CZ   1 
ATOM   5152  H  H    . PHE A 1 376 ? 17.672  35.725 74.160 1.00 40.49  ? 584  PHE A H    1 
ATOM   5153  H  HA   . PHE A 1 376 ? 18.519  34.385 72.119 1.00 44.50  ? 584  PHE A HA   1 
ATOM   5154  H  HB2  . PHE A 1 376 ? 19.280  36.540 72.481 1.00 49.10  ? 584  PHE A HB2  1 
ATOM   5155  H  HB3  . PHE A 1 376 ? 20.043  36.072 73.793 1.00 49.10  ? 584  PHE A HB3  1 
ATOM   5156  H  HD1  . PHE A 1 376 ? 20.174  35.895 70.285 1.00 52.49  ? 584  PHE A HD1  1 
ATOM   5157  H  HD2  . PHE A 1 376 ? 22.206  35.080 73.628 1.00 55.68  ? 584  PHE A HD2  1 
ATOM   5158  H  HE1  . PHE A 1 376 ? 22.057  35.462 69.031 1.00 56.24  ? 584  PHE A HE1  1 
ATOM   5159  H  HE2  . PHE A 1 376 ? 24.094  34.646 72.377 1.00 59.83  ? 584  PHE A HE2  1 
ATOM   5160  H  HZ   . PHE A 1 376 ? 24.022  34.837 70.074 1.00 60.06  ? 584  PHE A HZ   1 
ATOM   5161  N  N    . HIS A 1 377 ? 19.670  33.249 74.872 1.00 48.33  ? 585  HIS A N    1 
ATOM   5162  C  CA   . HIS A 1 377 ? 20.432  32.146 75.448 1.00 56.91  ? 585  HIS A CA   1 
ATOM   5163  C  C    . HIS A 1 377 ? 19.842  30.786 75.094 1.00 54.12  ? 585  HIS A C    1 
ATOM   5164  O  O    . HIS A 1 377 ? 20.557  29.780 75.151 1.00 52.53  ? 585  HIS A O    1 
ATOM   5165  C  CB   . HIS A 1 377 ? 20.509  32.293 76.968 1.00 67.60  ? 585  HIS A CB   1 
ATOM   5166  C  CG   . HIS A 1 377 ? 19.219  32.005 77.669 1.00 74.82  ? 585  HIS A CG   1 
ATOM   5167  N  ND1  . HIS A 1 377 ? 18.249  32.964 77.868 1.00 76.62  ? 585  HIS A ND1  1 
ATOM   5168  C  CD2  . HIS A 1 377 ? 18.739  30.864 78.219 1.00 77.43  ? 585  HIS A CD2  1 
ATOM   5169  C  CE1  . HIS A 1 377 ? 17.227  32.426 78.509 1.00 77.53  ? 585  HIS A CE1  1 
ATOM   5170  N  NE2  . HIS A 1 377 ? 17.498  31.153 78.734 1.00 77.33  ? 585  HIS A NE2  1 
ATOM   5171  H  H    . HIS A 1 377 ? 19.295  33.766 75.448 1.00 57.99  ? 585  HIS A H    1 
ATOM   5172  H  HA   . HIS A 1 377 ? 21.337  32.176 75.100 1.00 68.30  ? 585  HIS A HA   1 
ATOM   5173  H  HB2  . HIS A 1 377 ? 21.175  31.676 77.308 1.00 81.12  ? 585  HIS A HB2  1 
ATOM   5174  H  HB3  . HIS A 1 377 ? 20.765  33.204 77.181 1.00 81.12  ? 585  HIS A HB3  1 
ATOM   5175  H  HD2  . HIS A 1 377 ? 19.168  30.040 78.243 1.00 92.92  ? 585  HIS A HD2  1 
ATOM   5176  H  HE1  . HIS A 1 377 ? 16.448  32.869 78.760 1.00 93.03  ? 585  HIS A HE1  1 
ATOM   5177  H  HE2  . HIS A 1 377 ? 16.983  30.596 79.138 1.00 92.79  ? 585  HIS A HE2  1 
ATOM   5178  N  N    . ARG A 1 378 ? 18.558  30.730 74.733 1.00 52.13  ? 586  ARG A N    1 
ATOM   5179  C  CA   . ARG A 1 378 ? 17.935  29.460 74.382 1.00 51.61  ? 586  ARG A CA   1 
ATOM   5180  C  C    . ARG A 1 378 ? 18.467  28.897 73.072 1.00 48.22  ? 586  ARG A C    1 
ATOM   5181  O  O    . ARG A 1 378 ? 18.364  27.687 72.845 1.00 46.50  ? 586  ARG A O    1 
ATOM   5182  C  CB   . ARG A 1 378 ? 16.419  29.629 74.294 1.00 53.33  ? 586  ARG A CB   1 
ATOM   5183  C  CG   . ARG A 1 378 ? 15.767  30.015 75.611 1.00 58.47  ? 586  ARG A CG   1 
ATOM   5184  C  CD   . ARG A 1 378 ? 14.288  30.316 75.436 1.00 60.79  ? 586  ARG A CD   1 
ATOM   5185  N  NE   . ARG A 1 378 ? 13.549  29.183 74.885 1.00 61.28  ? 586  ARG A NE   1 
ATOM   5186  C  CZ   . ARG A 1 378 ? 12.260  29.217 74.563 1.00 62.62  ? 586  ARG A CZ   1 
ATOM   5187  N  NH1  . ARG A 1 378 ? 11.559  30.331 74.734 1.00 64.93  ? 586  ARG A NH1  1 
ATOM   5188  N  NH2  . ARG A 1 378 ? 11.669  28.138 74.067 1.00 61.54  ? 586  ARG A NH2  1 
ATOM   5189  H  H    . ARG A 1 378 ? 18.033  31.409 74.685 1.00 62.56  ? 586  ARG A H    1 
ATOM   5190  H  HA   . ARG A 1 378 ? 18.123  28.815 75.081 1.00 61.94  ? 586  ARG A HA   1 
ATOM   5191  H  HB2  . ARG A 1 378 ? 16.219  30.326 73.649 1.00 64.00  ? 586  ARG A HB2  1 
ATOM   5192  H  HB3  . ARG A 1 378 ? 16.027  28.791 74.003 1.00 64.00  ? 586  ARG A HB3  1 
ATOM   5193  H  HG2  . ARG A 1 378 ? 15.855  29.280 76.238 1.00 70.17  ? 586  ARG A HG2  1 
ATOM   5194  H  HG3  . ARG A 1 378 ? 16.200  30.809 75.961 1.00 70.17  ? 586  ARG A HG3  1 
ATOM   5195  H  HD2  . ARG A 1 378 ? 13.904  30.534 76.300 1.00 72.95  ? 586  ARG A HD2  1 
ATOM   5196  H  HD3  . ARG A 1 378 ? 14.186  31.066 74.828 1.00 72.95  ? 586  ARG A HD3  1 
ATOM   5197  H  HE   . ARG A 1 378 ? 13.971  28.441 74.779 1.00 73.54  ? 586  ARG A HE   1 
ATOM   5198  H  HH11 . ARG A 1 378 ? 11.938  31.033 75.055 1.00 77.92  ? 586  ARG A HH11 1 
ATOM   5199  H  HH12 . ARG A 1 378 ? 10.725  30.350 74.524 1.00 77.92  ? 586  ARG A HH12 1 
ATOM   5200  H  HH21 . ARG A 1 378 ? 12.120  27.414 73.955 1.00 73.85  ? 586  ARG A HH21 1 
ATOM   5201  H  HH22 . ARG A 1 378 ? 10.835  28.162 73.859 1.00 73.85  ? 586  ARG A HH22 1 
ATOM   5202  N  N    . PHE A 1 379 ? 19.033  29.742 72.209 1.00 46.29  ? 587  PHE A N    1 
ATOM   5203  C  CA   . PHE A 1 379 ? 19.549  29.277 70.929 1.00 44.67  ? 587  PHE A CA   1 
ATOM   5204  C  C    . PHE A 1 379 ? 20.901  28.583 71.057 1.00 52.13  ? 587  PHE A C    1 
ATOM   5205  O  O    . PHE A 1 379 ? 21.315  27.889 70.121 1.00 50.55  ? 587  PHE A O    1 
ATOM   5206  C  CB   . PHE A 1 379 ? 19.666  30.455 69.957 1.00 39.35  ? 587  PHE A CB   1 
ATOM   5207  C  CG   . PHE A 1 379 ? 18.383  31.231 69.779 1.00 36.70  ? 587  PHE A CG   1 
ATOM   5208  C  CD1  . PHE A 1 379 ? 17.157  30.584 69.773 1.00 35.87  ? 587  PHE A CD1  1 
ATOM   5209  C  CD2  . PHE A 1 379 ? 18.407  32.606 69.623 1.00 36.56  ? 587  PHE A CD2  1 
ATOM   5210  C  CE1  . PHE A 1 379 ? 15.981  31.294 69.611 1.00 34.90  ? 587  PHE A CE1  1 
ATOM   5211  C  CE2  . PHE A 1 379 ? 17.233  33.322 69.459 1.00 37.53  ? 587  PHE A CE2  1 
ATOM   5212  C  CZ   . PHE A 1 379 ? 16.019  32.664 69.455 1.00 37.13  ? 587  PHE A CZ   1 
ATOM   5213  H  H    . PHE A 1 379 ? 19.128  30.586 72.343 1.00 55.55  ? 587  PHE A H    1 
ATOM   5214  H  HA   . PHE A 1 379 ? 18.923  28.640 70.551 1.00 53.61  ? 587  PHE A HA   1 
ATOM   5215  H  HB2  . PHE A 1 379 ? 20.339  31.069 70.291 1.00 47.22  ? 587  PHE A HB2  1 
ATOM   5216  H  HB3  . PHE A 1 379 ? 19.932  30.118 69.088 1.00 47.22  ? 587  PHE A HB3  1 
ATOM   5217  H  HD1  . PHE A 1 379 ? 17.125  29.661 69.878 1.00 43.04  ? 587  PHE A HD1  1 
ATOM   5218  H  HD2  . PHE A 1 379 ? 19.222  33.054 69.625 1.00 43.87  ? 587  PHE A HD2  1 
ATOM   5219  H  HE1  . PHE A 1 379 ? 15.165  30.848 69.608 1.00 41.89  ? 587  PHE A HE1  1 
ATOM   5220  H  HE2  . PHE A 1 379 ? 17.262  34.246 69.354 1.00 45.04  ? 587  PHE A HE2  1 
ATOM   5221  H  HZ   . PHE A 1 379 ? 15.229  33.143 69.346 1.00 44.56  ? 587  PHE A HZ   1 
ATOM   5222  N  N    . GLN A 1 380 ? 21.588  28.740 72.190 1.00 59.58  ? 588  GLN A N    1 
ATOM   5223  C  CA   . GLN A 1 380 ? 22.929  28.201 72.379 1.00 71.12  ? 588  GLN A CA   1 
ATOM   5224  C  C    . GLN A 1 380 ? 22.941  26.864 73.114 1.00 71.60  ? 588  GLN A C    1 
ATOM   5225  O  O    . GLN A 1 380 ? 24.022  26.361 73.438 1.00 71.19  ? 588  GLN A O    1 
ATOM   5226  C  CB   . GLN A 1 380 ? 23.793  29.209 73.137 1.00 81.59  ? 588  GLN A CB   1 
ATOM   5227  C  CG   . GLN A 1 380 ? 23.831  30.594 72.509 1.00 86.54  ? 588  GLN A CG   1 
ATOM   5228  C  CD   . GLN A 1 380 ? 24.713  31.557 73.279 1.00 92.04  ? 588  GLN A CD   1 
ATOM   5229  O  OE1  . GLN A 1 380 ? 24.303  32.117 74.296 1.00 94.55  ? 588  GLN A OE1  1 
ATOM   5230  N  NE2  . GLN A 1 380 ? 25.934  31.755 72.795 1.00 93.62  ? 588  GLN A NE2  1 
ATOM   5231  H  H    . GLN A 1 380 ? 21.289  29.164 72.875 1.00 71.50  ? 588  GLN A H    1 
ATOM   5232  H  HA   . GLN A 1 380 ? 23.333  28.062 71.508 1.00 85.34  ? 588  GLN A HA   1 
ATOM   5233  H  HB2  . GLN A 1 380 ? 23.444  29.303 74.037 1.00 97.91  ? 588  GLN A HB2  1 
ATOM   5234  H  HB3  . GLN A 1 380 ? 24.703  28.875 73.172 1.00 97.91  ? 588  GLN A HB3  1 
ATOM   5235  H  HG2  . GLN A 1 380 ? 24.179  30.523 71.607 1.00 103.85 ? 588  GLN A HG2  1 
ATOM   5236  H  HG3  . GLN A 1 380 ? 22.932  30.958 72.491 1.00 103.85 ? 588  GLN A HG3  1 
ATOM   5237  H  HE21 . GLN A 1 380 ? 26.186  31.346 72.082 1.00 112.34 ? 588  GLN A HE21 1 
ATOM   5238  H  HE22 . GLN A 1 380 ? 26.473  32.292 73.196 1.00 112.34 ? 588  GLN A HE22 1 
ATOM   5239  N  N    . GLN A 1 381 ? 21.779  26.277 73.386 1.00 74.39  ? 589  GLN A N    1 
ATOM   5240  C  CA   . GLN A 1 381 ? 21.734  24.996 74.080 1.00 80.62  ? 589  GLN A CA   1 
ATOM   5241  C  C    . GLN A 1 381 ? 22.306  23.887 73.200 1.00 81.61  ? 589  GLN A C    1 
ATOM   5242  O  O    . GLN A 1 381 ? 22.192  23.916 71.972 1.00 75.02  ? 589  GLN A O    1 
ATOM   5243  C  CB   . GLN A 1 381 ? 20.298  24.658 74.486 1.00 83.35  ? 589  GLN A CB   1 
ATOM   5244  C  CG   . GLN A 1 381 ? 19.332  24.457 73.319 1.00 83.32  ? 589  GLN A CG   1 
ATOM   5245  C  CD   . GLN A 1 381 ? 19.391  23.056 72.726 1.00 81.42  ? 589  GLN A CD   1 
ATOM   5246  O  OE1  . GLN A 1 381 ? 19.624  22.076 73.436 1.00 81.84  ? 589  GLN A OE1  1 
ATOM   5247  N  NE2  . GLN A 1 381 ? 19.184  22.959 71.418 1.00 77.45  ? 589  GLN A NE2  1 
ATOM   5248  H  H    . GLN A 1 381 ? 21.007  26.597 73.180 1.00 89.27  ? 589  GLN A H    1 
ATOM   5249  H  HA   . GLN A 1 381 ? 22.272  25.052 74.885 1.00 96.75  ? 589  GLN A HA   1 
ATOM   5250  H  HB2  . GLN A 1 381 ? 20.308  23.837 75.003 1.00 100.03 ? 589  GLN A HB2  1 
ATOM   5251  H  HB3  . GLN A 1 381 ? 19.952  25.382 75.032 1.00 100.03 ? 589  GLN A HB3  1 
ATOM   5252  H  HG2  . GLN A 1 381 ? 18.427  24.612 73.629 1.00 99.99  ? 589  GLN A HG2  1 
ATOM   5253  H  HG3  . GLN A 1 381 ? 19.553  25.088 72.616 1.00 99.99  ? 589  GLN A HG3  1 
ATOM   5254  H  HE21 . GLN A 1 381 ? 19.024  23.665 70.954 1.00 92.95  ? 589  GLN A HE21 1 
ATOM   5255  H  HE22 . GLN A 1 381 ? 19.207  22.189 71.035 1.00 92.95  ? 589  GLN A HE22 1 
ATOM   5256  N  N    . THR A 1 382 ? 22.925  22.895 73.846 1.00 89.63  ? 590  THR A N    1 
ATOM   5257  C  CA   . THR A 1 382 ? 23.516  21.758 73.147 1.00 93.95  ? 590  THR A CA   1 
ATOM   5258  C  C    . THR A 1 382 ? 22.963  20.425 73.642 1.00 94.30  ? 590  THR A C    1 
ATOM   5259  O  O    . THR A 1 382 ? 23.572  19.378 73.399 1.00 97.51  ? 590  THR A O    1 
ATOM   5260  C  CB   . THR A 1 382 ? 25.041  21.776 73.283 1.00 100.26 ? 590  THR A CB   1 
ATOM   5261  O  OG1  . THR A 1 382 ? 25.406  22.123 74.626 1.00 103.51 ? 590  THR A OG1  1 
ATOM   5262  C  CG2  . THR A 1 382 ? 25.657  22.772 72.306 1.00 101.78 ? 590  THR A CG2  1 
ATOM   5263  H  H    . THR A 1 382 ? 23.014  22.861 74.701 1.00 107.55 ? 590  THR A H    1 
ATOM   5264  H  HA   . THR A 1 382 ? 23.304  21.831 72.204 1.00 112.75 ? 590  THR A HA   1 
ATOM   5265  H  HB   . THR A 1 382 ? 25.390  20.895 73.076 1.00 120.31 ? 590  THR A HB   1 
ATOM   5266  H  HG1  . THR A 1 382 ? 26.242  22.133 74.703 1.00 124.22 ? 590  THR A HG1  1 
ATOM   5267  H  HG21 . THR A 1 382 ? 26.623  22.774 72.401 1.00 122.14 ? 590  THR A HG21 1 
ATOM   5268  H  HG22 . THR A 1 382 ? 25.430  22.526 71.396 1.00 122.14 ? 590  THR A HG22 1 
ATOM   5269  H  HG23 . THR A 1 382 ? 25.320  23.663 72.485 1.00 122.14 ? 590  THR A HG23 1 
ATOM   5270  N  N    . ALA A 1 383 ? 21.820  20.436 74.331 1.00 93.26  ? 591  ALA A N    1 
ATOM   5271  C  CA   . ALA A 1 383 ? 21.206  19.188 74.771 1.00 96.02  ? 591  ALA A CA   1 
ATOM   5272  C  C    . ALA A 1 383 ? 20.902  18.285 73.580 1.00 92.96  ? 591  ALA A C    1 
ATOM   5273  O  O    . ALA A 1 383 ? 21.353  17.136 73.521 1.00 94.42  ? 591  ALA A O    1 
ATOM   5274  C  CB   . ALA A 1 383 ? 19.935  19.483 75.568 1.00 98.92  ? 591  ALA A CB   1 
ATOM   5275  H  H    . ALA A 1 383 ? 21.387  21.145 74.552 1.00 111.92 ? 591  ALA A H    1 
ATOM   5276  H  HA   . ALA A 1 383 ? 21.824  18.719 75.353 1.00 115.22 ? 591  ALA A HA   1 
ATOM   5277  H  HB1  . ALA A 1 383 ? 19.539  18.645 75.853 1.00 118.70 ? 591  ALA A HB1  1 
ATOM   5278  H  HB2  . ALA A 1 383 ? 20.165  20.020 76.342 1.00 118.70 ? 591  ALA A HB2  1 
ATOM   5279  H  HB3  . ALA A 1 383 ? 19.313  19.968 75.002 1.00 118.70 ? 591  ALA A HB3  1 
ATOM   5280  N  N    . ARG A 1 384 ? 20.137  18.791 72.623 1.00 87.60  ? 592  ARG A N    1 
ATOM   5281  C  CA   . ARG A 1 384 ? 19.830  18.089 71.388 1.00 82.08  ? 592  ARG A CA   1 
ATOM   5282  C  C    . ARG A 1 384 ? 20.211  18.965 70.206 1.00 68.78  ? 592  ARG A C    1 
ATOM   5283  O  O    . ARG A 1 384 ? 20.380  20.180 70.352 1.00 68.04  ? 592  ARG A O    1 
ATOM   5284  C  CB   . ARG A 1 384 ? 18.341  17.720 71.307 1.00 88.44  ? 592  ARG A CB   1 
ATOM   5285  C  CG   . ARG A 1 384 ? 17.399  18.853 71.684 1.00 94.63  ? 592  ARG A CG   1 
ATOM   5286  C  CD   . ARG A 1 384 ? 16.112  18.810 70.873 1.00 98.64  ? 592  ARG A CD   1 
ATOM   5287  N  NE   . ARG A 1 384 ? 15.257  19.963 71.159 1.00 100.58 ? 592  ARG A NE   1 
ATOM   5288  C  CZ   . ARG A 1 384 ? 14.388  20.494 70.302 1.00 97.63  ? 592  ARG A CZ   1 
ATOM   5289  N  NH1  . ARG A 1 384 ? 14.247  19.990 69.080 1.00 96.26  ? 592  ARG A NH1  1 
ATOM   5290  N  NH2  . ARG A 1 384 ? 13.661  21.544 70.667 1.00 94.86  ? 592  ARG A NH2  1 
ATOM   5291  H  H    . ARG A 1 384 ? 19.772  19.568 72.669 1.00 105.12 ? 592  ARG A H    1 
ATOM   5292  H  HA   . ARG A 1 384 ? 20.351  17.271 71.344 1.00 98.50  ? 592  ARG A HA   1 
ATOM   5293  H  HB2  . ARG A 1 384 ? 18.135  17.455 70.397 1.00 106.13 ? 592  ARG A HB2  1 
ATOM   5294  H  HB3  . ARG A 1 384 ? 18.170  16.980 71.911 1.00 106.13 ? 592  ARG A HB3  1 
ATOM   5295  H  HG2  . ARG A 1 384 ? 17.169  18.777 72.623 1.00 113.56 ? 592  ARG A HG2  1 
ATOM   5296  H  HG3  . ARG A 1 384 ? 17.837  19.701 71.513 1.00 113.56 ? 592  ARG A HG3  1 
ATOM   5297  H  HD2  . ARG A 1 384 ? 16.328  18.819 69.928 1.00 118.38 ? 592  ARG A HD2  1 
ATOM   5298  H  HD3  . ARG A 1 384 ? 15.620  18.004 71.097 1.00 118.38 ? 592  ARG A HD3  1 
ATOM   5299  H  HE   . ARG A 1 384 ? 15.320  20.323 71.937 1.00 120.70 ? 592  ARG A HE   1 
ATOM   5300  H  HH11 . ARG A 1 384 ? 14.716  19.311 68.839 1.00 115.51 ? 592  ARG A HH11 1 
ATOM   5301  H  HH12 . ARG A 1 384 ? 13.684  20.341 68.533 1.00 115.51 ? 592  ARG A HH12 1 
ATOM   5302  H  HH21 . ARG A 1 384 ? 13.749  21.875 71.456 1.00 113.83 ? 592  ARG A HH21 1 
ATOM   5303  H  HH22 . ARG A 1 384 ? 13.100  21.891 70.115 1.00 113.83 ? 592  ARG A HH22 1 
ATOM   5304  N  N    . PRO A 1 385 ? 20.375  18.376 69.020 1.00 56.32  ? 593  PRO A N    1 
ATOM   5305  C  CA   . PRO A 1 385 ? 20.696  19.188 67.836 1.00 46.58  ? 593  PRO A CA   1 
ATOM   5306  C  C    . PRO A 1 385 ? 19.484  19.968 67.342 1.00 40.15  ? 593  PRO A C    1 
ATOM   5307  O  O    . PRO A 1 385 ? 18.380  19.429 67.228 1.00 31.74  ? 593  PRO A O    1 
ATOM   5308  C  CB   . PRO A 1 385 ? 21.161  18.150 66.805 1.00 48.52  ? 593  PRO A CB   1 
ATOM   5309  C  CG   . PRO A 1 385 ? 20.575  16.856 67.263 1.00 50.47  ? 593  PRO A CG   1 
ATOM   5310  C  CD   . PRO A 1 385 ? 20.510  16.932 68.758 1.00 53.47  ? 593  PRO A CD   1 
ATOM   5311  H  HA   . PRO A 1 385 ? 21.422  19.801 68.029 1.00 55.90  ? 593  PRO A HA   1 
ATOM   5312  H  HB2  . PRO A 1 385 ? 20.823  18.388 65.927 1.00 58.23  ? 593  PRO A HB2  1 
ATOM   5313  H  HB3  . PRO A 1 385 ? 22.130  18.106 66.800 1.00 58.23  ? 593  PRO A HB3  1 
ATOM   5314  H  HG2  . PRO A 1 385 ? 19.686  16.752 66.889 1.00 60.57  ? 593  PRO A HG2  1 
ATOM   5315  H  HG3  . PRO A 1 385 ? 21.148  16.125 66.985 1.00 60.57  ? 593  PRO A HG3  1 
ATOM   5316  H  HD2  . PRO A 1 385 ? 19.732  16.455 69.088 1.00 64.16  ? 593  PRO A HD2  1 
ATOM   5317  H  HD3  . PRO A 1 385 ? 21.329  16.592 69.150 1.00 64.16  ? 593  PRO A HD3  1 
ATOM   5318  N  N    . THR A 1 386 ? 19.705  21.249 67.048 1.00 35.40  ? 594  THR A N    1 
ATOM   5319  C  CA   . THR A 1 386 ? 18.670  22.129 66.523 1.00 34.92  ? 594  THR A CA   1 
ATOM   5320  C  C    . THR A 1 386 ? 19.317  23.119 65.565 1.00 31.31  ? 594  THR A C    1 
ATOM   5321  O  O    . THR A 1 386 ? 20.418  23.609 65.825 1.00 33.76  ? 594  THR A O    1 
ATOM   5322  C  CB   . THR A 1 386 ? 17.948  22.891 67.641 1.00 35.75  ? 594  THR A CB   1 
ATOM   5323  O  OG1  . THR A 1 386 ? 18.911  23.566 68.460 1.00 37.21  ? 594  THR A OG1  1 
ATOM   5324  C  CG2  . THR A 1 386 ? 17.124  21.946 68.500 1.00 36.02  ? 594  THR A CG2  1 
ATOM   5325  H  H    . THR A 1 386 ? 20.466  21.637 67.146 1.00 42.48  ? 594  THR A H    1 
ATOM   5326  H  HA   . THR A 1 386 ? 18.017  21.606 66.033 1.00 41.90  ? 594  THR A HA   1 
ATOM   5327  H  HB   . THR A 1 386 ? 17.348  23.544 67.247 1.00 42.90  ? 594  THR A HB   1 
ATOM   5328  H  HG1  . THR A 1 386 ? 18.522  23.986 69.074 1.00 44.65  ? 594  THR A HG1  1 
ATOM   5329  H  HG21 . THR A 1 386 ? 16.674  22.443 69.201 1.00 43.23  ? 594  THR A HG21 1 
ATOM   5330  H  HG22 . THR A 1 386 ? 16.459  21.498 67.955 1.00 43.23  ? 594  THR A HG22 1 
ATOM   5331  H  HG23 . THR A 1 386 ? 17.700  21.280 68.906 1.00 43.23  ? 594  THR A HG23 1 
ATOM   5332  N  N    . PHE A 1 387 ? 18.624  23.417 64.465 1.00 27.64  ? 595  PHE A N    1 
ATOM   5333  C  CA   . PHE A 1 387 ? 19.177  24.280 63.432 1.00 30.16  ? 595  PHE A CA   1 
ATOM   5334  C  C    . PHE A 1 387 ? 18.269  25.433 63.015 1.00 28.02  ? 595  PHE A C    1 
ATOM   5335  O  O    . PHE A 1 387 ? 18.762  26.364 62.367 1.00 27.48  ? 595  PHE A O    1 
ATOM   5336  C  CB   . PHE A 1 387 ? 19.545  23.447 62.193 1.00 28.47  ? 595  PHE A CB   1 
ATOM   5337  C  CG   . PHE A 1 387 ? 20.668  22.466 62.438 1.00 30.80  ? 595  PHE A CG   1 
ATOM   5338  C  CD1  . PHE A 1 387 ? 20.405  21.191 62.908 1.00 29.48  ? 595  PHE A CD1  1 
ATOM   5339  C  CD2  . PHE A 1 387 ? 21.987  22.831 62.213 1.00 30.26  ? 595  PHE A CD2  1 
ATOM   5340  C  CE1  . PHE A 1 387 ? 21.435  20.293 63.139 1.00 32.91  ? 595  PHE A CE1  1 
ATOM   5341  C  CE2  . PHE A 1 387 ? 23.020  21.938 62.441 1.00 33.06  ? 595  PHE A CE2  1 
ATOM   5342  C  CZ   . PHE A 1 387 ? 22.743  20.668 62.906 1.00 31.97  ? 595  PHE A CZ   1 
ATOM   5343  H  H    . PHE A 1 387 ? 17.831  23.130 64.296 1.00 33.17  ? 595  PHE A H    1 
ATOM   5344  H  HA   . PHE A 1 387 ? 19.998  24.669 63.771 1.00 36.19  ? 595  PHE A HA   1 
ATOM   5345  H  HB2  . PHE A 1 387 ? 18.765  22.942 61.913 1.00 34.16  ? 595  PHE A HB2  1 
ATOM   5346  H  HB3  . PHE A 1 387 ? 19.822  24.046 61.483 1.00 34.16  ? 595  PHE A HB3  1 
ATOM   5347  H  HD1  . PHE A 1 387 ? 19.525  20.932 63.066 1.00 35.37  ? 595  PHE A HD1  1 
ATOM   5348  H  HD2  . PHE A 1 387 ? 22.180  23.685 61.900 1.00 36.31  ? 595  PHE A HD2  1 
ATOM   5349  H  HE1  . PHE A 1 387 ? 21.246  19.438 63.451 1.00 39.49  ? 595  PHE A HE1  1 
ATOM   5350  H  HE2  . PHE A 1 387 ? 23.900  22.195 62.283 1.00 39.68  ? 595  PHE A HE2  1 
ATOM   5351  H  HZ   . PHE A 1 387 ? 23.435  20.066 63.060 1.00 38.37  ? 595  PHE A HZ   1 
ATOM   5352  N  N    . PHE A 1 388 ? 16.981  25.418 63.368 1.00 30.33  ? 596  PHE A N    1 
ATOM   5353  C  CA   . PHE A 1 388 ? 16.071  26.519 63.059 1.00 28.40  ? 596  PHE A CA   1 
ATOM   5354  C  C    . PHE A 1 388 ? 15.199  26.808 64.274 1.00 29.58  ? 596  PHE A C    1 
ATOM   5355  O  O    . PHE A 1 388 ? 15.178  26.048 65.246 1.00 30.03  ? 596  PHE A O    1 
ATOM   5356  C  CB   . PHE A 1 388 ? 15.191  26.204 61.841 1.00 26.75  ? 596  PHE A CB   1 
ATOM   5357  C  CG   . PHE A 1 388 ? 15.967  25.956 60.581 1.00 28.27  ? 596  PHE A CG   1 
ATOM   5358  C  CD1  . PHE A 1 388 ? 16.408  24.682 60.261 1.00 30.22  ? 596  PHE A CD1  1 
ATOM   5359  C  CD2  . PHE A 1 388 ? 16.263  26.997 59.720 1.00 28.25  ? 596  PHE A CD2  1 
ATOM   5360  C  CE1  . PHE A 1 388 ? 17.126  24.454 59.104 1.00 28.23  ? 596  PHE A CE1  1 
ATOM   5361  C  CE2  . PHE A 1 388 ? 16.980  26.775 58.563 1.00 28.34  ? 596  PHE A CE2  1 
ATOM   5362  C  CZ   . PHE A 1 388 ? 17.412  25.503 58.253 1.00 28.62  ? 596  PHE A CZ   1 
ATOM   5363  H  H    . PHE A 1 388 ? 16.607  24.771 63.793 1.00 36.40  ? 596  PHE A H    1 
ATOM   5364  H  HA   . PHE A 1 388 ? 16.589  27.314 62.861 1.00 34.09  ? 596  PHE A HA   1 
ATOM   5365  H  HB2  . PHE A 1 388 ? 14.669  25.408 62.029 1.00 32.10  ? 596  PHE A HB2  1 
ATOM   5366  H  HB3  . PHE A 1 388 ? 14.599  26.955 61.680 1.00 32.10  ? 596  PHE A HB3  1 
ATOM   5367  H  HD1  . PHE A 1 388 ? 16.218  23.972 60.831 1.00 36.27  ? 596  PHE A HD1  1 
ATOM   5368  H  HD2  . PHE A 1 388 ? 15.975  27.857 59.924 1.00 33.91  ? 596  PHE A HD2  1 
ATOM   5369  H  HE1  . PHE A 1 388 ? 17.416  23.594 58.897 1.00 33.88  ? 596  PHE A HE1  1 
ATOM   5370  H  HE2  . PHE A 1 388 ? 17.171  27.483 57.992 1.00 34.01  ? 596  PHE A HE2  1 
ATOM   5371  H  HZ   . PHE A 1 388 ? 17.895  25.353 57.473 1.00 34.34  ? 596  PHE A HZ   1 
ATOM   5372  N  N    . ALA A 1 389 ? 14.466  27.921 64.213 1.00 28.12  ? 597  ALA A N    1 
ATOM   5373  C  CA   . ALA A 1 389 ? 13.584  28.302 65.308 1.00 25.96  ? 597  ALA A CA   1 
ATOM   5374  C  C    . ALA A 1 389 ? 12.470  29.196 64.780 1.00 25.47  ? 597  ALA A C    1 
ATOM   5375  O  O    . ALA A 1 389 ? 12.604  29.837 63.735 1.00 27.24  ? 597  ALA A O    1 
ATOM   5376  C  CB   . ALA A 1 389 ? 14.358  29.010 66.424 1.00 26.61  ? 597  ALA A CB   1 
ATOM   5377  H  H    . ALA A 1 389 ? 14.463  28.468 63.549 1.00 33.74  ? 597  ALA A H    1 
ATOM   5378  H  HA   . ALA A 1 389 ? 13.179  27.504 65.682 1.00 31.16  ? 597  ALA A HA   1 
ATOM   5379  H  HB1  . ALA A 1 389 ? 13.741  29.248 67.133 1.00 31.93  ? 597  ALA A HB1  1 
ATOM   5380  H  HB2  . ALA A 1 389 ? 15.039  28.409 66.765 1.00 31.93  ? 597  ALA A HB2  1 
ATOM   5381  H  HB3  . ALA A 1 389 ? 14.772  29.809 66.062 1.00 31.93  ? 597  ALA A HB3  1 
ATOM   5382  N  N    . ARG A 1 390 ? 11.363  29.228 65.526 1.00 26.11  ? 598  ARG A N    1 
ATOM   5383  C  CA   . ARG A 1 390 ? 10.229  30.085 65.204 1.00 26.45  ? 598  ARG A CA   1 
ATOM   5384  C  C    . ARG A 1 390 ? 9.461   30.374 66.491 1.00 27.12  ? 598  ARG A C    1 
ATOM   5385  O  O    . ARG A 1 390 ? 9.486   29.565 67.423 1.00 27.30  ? 598  ARG A O    1 
ATOM   5386  C  CB   . ARG A 1 390 ? 9.317   29.431 64.151 1.00 28.73  ? 598  ARG A CB   1 
ATOM   5387  C  CG   . ARG A 1 390 ? 8.520   28.218 64.638 1.00 30.53  ? 598  ARG A CG   1 
ATOM   5388  C  CD   . ARG A 1 390 ? 7.824   27.489 63.481 1.00 28.16  ? 598  ARG A CD   1 
ATOM   5389  N  NE   . ARG A 1 390 ? 7.200   28.412 62.534 1.00 30.59  ? 598  ARG A NE   1 
ATOM   5390  C  CZ   . ARG A 1 390 ? 5.924   28.790 62.558 1.00 35.39  ? 598  ARG A CZ   1 
ATOM   5391  N  NH1  . ARG A 1 390 ? 5.089   28.324 63.481 1.00 36.41  ? 598  ARG A NH1  1 
ATOM   5392  N  NH2  . ARG A 1 390 ? 5.477   29.644 61.644 1.00 36.23  ? 598  ARG A NH2  1 
ATOM   5393  H  H    . ARG A 1 390 ? 11.248  28.754 66.233 1.00 31.33  ? 598  ARG A H    1 
ATOM   5394  H  HA   . ARG A 1 390 ? 10.553  30.926 64.847 1.00 31.75  ? 598  ARG A HA   1 
ATOM   5395  H  HB2  . ARG A 1 390 ? 8.680   30.094 63.842 1.00 34.48  ? 598  ARG A HB2  1 
ATOM   5396  H  HB3  . ARG A 1 390 ? 9.867   29.139 63.407 1.00 34.48  ? 598  ARG A HB3  1 
ATOM   5397  H  HG2  . ARG A 1 390 ? 9.122   27.593 65.071 1.00 36.64  ? 598  ARG A HG2  1 
ATOM   5398  H  HG3  . ARG A 1 390 ? 7.839   28.514 65.262 1.00 36.64  ? 598  ARG A HG3  1 
ATOM   5399  H  HD2  . ARG A 1 390 ? 8.480   26.962 62.999 1.00 33.80  ? 598  ARG A HD2  1 
ATOM   5400  H  HD3  . ARG A 1 390 ? 7.132   26.913 63.840 1.00 33.80  ? 598  ARG A HD3  1 
ATOM   5401  H  HE   . ARG A 1 390 ? 7.697   28.736 61.912 1.00 36.71  ? 598  ARG A HE   1 
ATOM   5402  H  HH11 . ARG A 1 390 ? 5.371   27.773 64.077 1.00 43.69  ? 598  ARG A HH11 1 
ATOM   5403  H  HH12 . ARG A 1 390 ? 4.266   28.576 63.483 1.00 43.69  ? 598  ARG A HH12 1 
ATOM   5404  H  HH21 . ARG A 1 390 ? 6.011   29.947 61.042 1.00 43.48  ? 598  ARG A HH21 1 
ATOM   5405  H  HH22 . ARG A 1 390 ? 4.653   29.888 61.651 1.00 43.48  ? 598  ARG A HH22 1 
ATOM   5406  N  N    . LYS A 1 391 ? 8.772   31.521 66.558 1.00 27.10  ? 599  LYS A N    1 
ATOM   5407  C  CA   . LYS A 1 391 ? 8.585   32.485 65.463 1.00 25.20  ? 599  LYS A CA   1 
ATOM   5408  C  C    . LYS A 1 391 ? 9.324   33.806 65.701 1.00 26.07  ? 599  LYS A C    1 
ATOM   5409  O  O    . LYS A 1 391 ? 9.634   34.164 66.836 1.00 26.80  ? 599  LYS A O    1 
ATOM   5410  C  CB   . LYS A 1 391 ? 7.093   32.781 65.280 1.00 27.35  ? 599  LYS A CB   1 
ATOM   5411  C  CG   . LYS A 1 391 ? 6.260   31.572 64.886 1.00 29.56  ? 599  LYS A CG   1 
ATOM   5412  C  CD   . LYS A 1 391 ? 4.765   31.882 64.904 1.00 31.62  ? 599  LYS A CD   1 
ATOM   5413  C  CE   . LYS A 1 391 ? 4.384   32.916 63.857 1.00 37.19  ? 599  LYS A CE   1 
ATOM   5414  N  NZ   . LYS A 1 391 ? 2.909   33.128 63.792 1.00 41.33  ? 599  LYS A NZ   1 
ATOM   5415  H  H    . LYS A 1 391 ? 8.377   31.776 67.278 1.00 32.53  ? 599  LYS A H    1 
ATOM   5416  H  HA   . LYS A 1 391 ? 8.919   32.098 64.639 1.00 30.25  ? 599  LYS A HA   1 
ATOM   5417  H  HB2  . LYS A 1 391 ? 6.739   33.123 66.116 1.00 32.82  ? 599  LYS A HB2  1 
ATOM   5418  H  HB3  . LYS A 1 391 ? 6.992   33.449 64.584 1.00 32.82  ? 599  LYS A HB3  1 
ATOM   5419  H  HG2  . LYS A 1 391 ? 6.501   31.298 63.987 1.00 35.47  ? 599  LYS A HG2  1 
ATOM   5420  H  HG3  . LYS A 1 391 ? 6.427   30.851 65.512 1.00 35.47  ? 599  LYS A HG3  1 
ATOM   5421  H  HD2  . LYS A 1 391 ? 4.269   31.069 64.721 1.00 37.94  ? 599  LYS A HD2  1 
ATOM   5422  H  HD3  . LYS A 1 391 ? 4.523   32.232 65.776 1.00 37.94  ? 599  LYS A HD3  1 
ATOM   5423  H  HE2  . LYS A 1 391 ? 4.802   33.763 64.079 1.00 44.63  ? 599  LYS A HE2  1 
ATOM   5424  H  HE3  . LYS A 1 391 ? 4.685   32.613 62.986 1.00 44.63  ? 599  LYS A HE3  1 
ATOM   5425  H  HZ1  . LYS A 1 391 ? 2.501   32.364 63.585 1.00 49.60  ? 599  LYS A HZ1  1 
ATOM   5426  H  HZ2  . LYS A 1 391 ? 2.607   33.411 64.580 1.00 49.60  ? 599  LYS A HZ2  1 
ATOM   5427  H  HZ3  . LYS A 1 391 ? 2.716   33.736 63.172 1.00 49.60  ? 599  LYS A HZ3  1 
ATOM   5428  N  N    . PHE A 1 392 ? 9.579   34.527 64.607 1.00 26.29  ? 600  PHE A N    1 
ATOM   5429  C  CA   . PHE A 1 392 ? 10.180  35.853 64.629 1.00 27.97  ? 600  PHE A CA   1 
ATOM   5430  C  C    . PHE A 1 392 ? 9.300   36.801 63.822 1.00 28.54  ? 600  PHE A C    1 
ATOM   5431  O  O    . PHE A 1 392 ? 8.824   36.441 62.741 1.00 30.76  ? 600  PHE A O    1 
ATOM   5432  C  CB   . PHE A 1 392 ? 11.600  35.851 64.029 1.00 27.30  ? 600  PHE A CB   1 
ATOM   5433  C  CG   . PHE A 1 392 ? 12.586  34.983 64.765 1.00 25.86  ? 600  PHE A CG   1 
ATOM   5434  C  CD1  . PHE A 1 392 ? 12.746  33.646 64.427 1.00 26.67  ? 600  PHE A CD1  1 
ATOM   5435  C  CD2  . PHE A 1 392 ? 13.368  35.508 65.778 1.00 24.70  ? 600  PHE A CD2  1 
ATOM   5436  C  CE1  . PHE A 1 392 ? 13.656  32.855 65.092 1.00 26.64  ? 600  PHE A CE1  1 
ATOM   5437  C  CE2  . PHE A 1 392 ? 14.279  34.719 66.450 1.00 29.29  ? 600  PHE A CE2  1 
ATOM   5438  C  CZ   . PHE A 1 392 ? 14.425  33.391 66.106 1.00 28.50  ? 600  PHE A CZ   1 
ATOM   5439  H  H    . PHE A 1 392 ? 9.404   34.253 63.811 1.00 31.56  ? 600  PHE A H    1 
ATOM   5440  H  HA   . PHE A 1 392 ? 10.229  36.176 65.542 1.00 33.57  ? 600  PHE A HA   1 
ATOM   5441  H  HB2  . PHE A 1 392 ? 11.551  35.530 63.115 1.00 32.76  ? 600  PHE A HB2  1 
ATOM   5442  H  HB3  . PHE A 1 392 ? 11.943  36.759 64.038 1.00 32.76  ? 600  PHE A HB3  1 
ATOM   5443  H  HD1  . PHE A 1 392 ? 12.232  33.280 63.745 1.00 32.00  ? 600  PHE A HD1  1 
ATOM   5444  H  HD2  . PHE A 1 392 ? 13.274  36.403 66.014 1.00 29.64  ? 600  PHE A HD2  1 
ATOM   5445  H  HE1  . PHE A 1 392 ? 13.752  31.959 64.860 1.00 31.97  ? 600  PHE A HE1  1 
ATOM   5446  H  HE2  . PHE A 1 392 ? 14.796  35.083 67.132 1.00 35.16  ? 600  PHE A HE2  1 
ATOM   5447  H  HZ   . PHE A 1 392 ? 15.038  32.857 66.558 1.00 34.20  ? 600  PHE A HZ   1 
ATOM   5448  N  N    . GLU A 1 393 ? 9.087   38.010 64.346 1.00 26.75  ? 601  GLU A N    1 
ATOM   5449  C  CA   . GLU A 1 393 ? 8.329   39.049 63.648 1.00 28.50  ? 601  GLU A CA   1 
ATOM   5450  C  C    . GLU A 1 393 ? 9.016   40.392 63.858 1.00 28.47  ? 601  GLU A C    1 
ATOM   5451  O  O    . GLU A 1 393 ? 9.163   40.840 64.999 1.00 25.86  ? 601  GLU A O    1 
ATOM   5452  C  CB   . GLU A 1 393 ? 6.881   39.115 64.145 1.00 29.99  ? 601  GLU A CB   1 
ATOM   5453  C  CG   . GLU A 1 393 ? 5.913   38.173 63.442 1.00 32.24  ? 601  GLU A CG   1 
ATOM   5454  C  CD   . GLU A 1 393 ? 4.461   38.476 63.784 1.00 35.42  ? 601  GLU A CD   1 
ATOM   5455  O  OE1  . GLU A 1 393 ? 4.028   38.143 64.911 1.00 35.42  ? 601  GLU A OE1  1 
ATOM   5456  O  OE2  . GLU A 1 393 ? 3.756   39.063 62.929 1.00 33.71  ? 601  GLU A OE2  1 
ATOM   5457  H  H    . GLU A 1 393 ? 9.377   38.256 65.117 1.00 32.10  ? 601  GLU A H    1 
ATOM   5458  H  HA   . GLU A 1 393 ? 8.317   38.856 62.697 1.00 34.21  ? 601  GLU A HA   1 
ATOM   5459  H  HB2  . GLU A 1 393 ? 6.870   38.894 65.089 1.00 35.99  ? 601  GLU A HB2  1 
ATOM   5460  H  HB3  . GLU A 1 393 ? 6.553   40.019 64.019 1.00 35.99  ? 601  GLU A HB3  1 
ATOM   5461  H  HG2  . GLU A 1 393 ? 6.022   38.265 62.482 1.00 38.69  ? 601  GLU A HG2  1 
ATOM   5462  H  HG3  . GLU A 1 393 ? 6.103   37.262 63.713 1.00 38.69  ? 601  GLU A HG3  1 
ATOM   5463  N  N    . ALA A 1 394 ? 9.416   41.042 62.758 1.00 26.55  ? 602  ALA A N    1 
ATOM   5464  C  CA   . ALA A 1 394 ? 10.165  42.291 62.866 1.00 29.33  ? 602  ALA A CA   1 
ATOM   5465  C  C    . ALA A 1 394 ? 9.290   43.448 63.341 1.00 27.99  ? 602  ALA A C    1 
ATOM   5466  O  O    . ALA A 1 394 ? 9.806   44.410 63.921 1.00 28.34  ? 602  ALA A O    1 
ATOM   5467  C  CB   . ALA A 1 394 ? 10.813  42.634 61.522 1.00 25.04  ? 602  ALA A CB   1 
ATOM   5468  H  H    . ALA A 1 394 ? 9.268   40.782 61.952 1.00 31.86  ? 602  ALA A H    1 
ATOM   5469  H  HA   . ALA A 1 394 ? 10.876  42.173 63.515 1.00 35.20  ? 602  ALA A HA   1 
ATOM   5470  H  HB1  . ALA A 1 394 ? 11.305  43.465 61.612 1.00 30.05  ? 602  ALA A HB1  1 
ATOM   5471  H  HB2  . ALA A 1 394 ? 11.416  41.917 61.271 1.00 30.05  ? 602  ALA A HB2  1 
ATOM   5472  H  HB3  . ALA A 1 394 ? 10.118  42.732 60.852 1.00 30.05  ? 602  ALA A HB3  1 
ATOM   5473  N  N    . VAL A 1 395 ? 7.974   43.387 63.111 1.00 28.47  ? 603  VAL A N    1 
ATOM   5474  C  CA   . VAL A 1 395 ? 7.091   44.424 63.649 1.00 30.59  ? 603  VAL A CA   1 
ATOM   5475  C  C    . VAL A 1 395 ? 6.820   44.239 65.132 1.00 32.00  ? 603  VAL A C    1 
ATOM   5476  O  O    . VAL A 1 395 ? 6.311   45.166 65.777 1.00 32.64  ? 603  VAL A O    1 
ATOM   5477  C  CB   . VAL A 1 395 ? 5.742   44.489 62.906 1.00 34.27  ? 603  VAL A CB   1 
ATOM   5478  C  CG1  . VAL A 1 395 ? 5.954   44.906 61.455 1.00 35.22  ? 603  VAL A CG1  1 
ATOM   5479  C  CG2  . VAL A 1 395 ? 4.999   43.153 62.986 1.00 33.91  ? 603  VAL A CG2  1 
ATOM   5480  H  H    . VAL A 1 395 ? 7.577   42.772 62.658 1.00 34.17  ? 603  VAL A H    1 
ATOM   5481  H  HA   . VAL A 1 395 ? 7.525   45.284 63.538 1.00 36.71  ? 603  VAL A HA   1 
ATOM   5482  H  HB   . VAL A 1 395 ? 5.185   45.162 63.328 1.00 41.12  ? 603  VAL A HB   1 
ATOM   5483  H  HG11 . VAL A 1 395 ? 5.095   44.940 61.007 1.00 42.27  ? 603  VAL A HG11 1 
ATOM   5484  H  HG12 . VAL A 1 395 ? 6.372   45.782 61.436 1.00 42.27  ? 603  VAL A HG12 1 
ATOM   5485  H  HG13 . VAL A 1 395 ? 6.529   44.256 61.020 1.00 42.27  ? 603  VAL A HG13 1 
ATOM   5486  H  HG21 . VAL A 1 395 ? 4.158   43.231 62.509 1.00 40.69  ? 603  VAL A HG21 1 
ATOM   5487  H  HG22 . VAL A 1 395 ? 5.547   42.463 62.581 1.00 40.69  ? 603  VAL A HG22 1 
ATOM   5488  H  HG23 . VAL A 1 395 ? 4.833   42.941 63.918 1.00 40.69  ? 603  VAL A HG23 1 
ATOM   5489  N  N    . VAL A 1 396 ? 7.150   43.078 65.690 1.00 29.44  ? 604  VAL A N    1 
ATOM   5490  C  CA   . VAL A 1 396 ? 6.999   42.811 67.119 1.00 31.58  ? 604  VAL A CA   1 
ATOM   5491  C  C    . VAL A 1 396 ? 8.314   43.011 67.861 1.00 32.84  ? 604  VAL A C    1 
ATOM   5492  O  O    . VAL A 1 396 ? 8.360   43.693 68.885 1.00 32.48  ? 604  VAL A O    1 
ATOM   5493  C  CB   . VAL A 1 396 ? 6.443   41.385 67.338 1.00 35.14  ? 604  VAL A CB   1 
ATOM   5494  C  CG1  . VAL A 1 396 ? 6.345   41.060 68.827 1.00 36.94  ? 604  VAL A CG1  1 
ATOM   5495  C  CG2  . VAL A 1 396 ? 5.081   41.238 66.672 1.00 35.17  ? 604  VAL A CG2  1 
ATOM   5496  H  H    . VAL A 1 396 ? 7.471   42.412 65.251 1.00 35.33  ? 604  VAL A H    1 
ATOM   5497  H  HA   . VAL A 1 396 ? 6.356   43.438 67.486 1.00 37.90  ? 604  VAL A HA   1 
ATOM   5498  H  HB   . VAL A 1 396 ? 7.046   40.745 66.931 1.00 42.17  ? 604  VAL A HB   1 
ATOM   5499  H  HG11 . VAL A 1 396 ? 5.993   40.161 68.931 1.00 44.33  ? 604  VAL A HG11 1 
ATOM   5500  H  HG12 . VAL A 1 396 ? 7.229   41.117 69.222 1.00 44.33  ? 604  VAL A HG12 1 
ATOM   5501  H  HG13 . VAL A 1 396 ? 5.751   41.698 69.251 1.00 44.33  ? 604  VAL A HG13 1 
ATOM   5502  H  HG21 . VAL A 1 396 ? 4.752   40.338 66.823 1.00 42.20  ? 604  VAL A HG21 1 
ATOM   5503  H  HG22 . VAL A 1 396 ? 4.470   41.884 67.060 1.00 42.20  ? 604  VAL A HG22 1 
ATOM   5504  H  HG23 . VAL A 1 396 ? 5.176   41.402 65.721 1.00 42.20  ? 604  VAL A HG23 1 
ATOM   5505  N  N    . ASN A 1 397 ? 9.398   42.412 67.368 1.00 33.54  ? 605  ASN A N    1 
ATOM   5506  C  CA   . ASN A 1 397 ? 10.715  42.633 67.963 1.00 34.31  ? 605  ASN A CA   1 
ATOM   5507  C  C    . ASN A 1 397 ? 11.780  42.235 66.952 1.00 34.70  ? 605  ASN A C    1 
ATOM   5508  O  O    . ASN A 1 397 ? 11.924  41.048 66.638 1.00 33.08  ? 605  ASN A O    1 
ATOM   5509  C  CB   . ASN A 1 397 ? 10.873  41.847 69.257 1.00 36.51  ? 605  ASN A CB   1 
ATOM   5510  C  CG   . ASN A 1 397 ? 12.160  42.190 69.985 1.00 37.61  ? 605  ASN A CG   1 
ATOM   5511  O  OD1  . ASN A 1 397 ? 13.238  41.714 69.626 1.00 35.95  ? 605  ASN A OD1  1 
ATOM   5512  N  ND2  . ASN A 1 397 ? 12.054  43.031 71.008 1.00 38.95  ? 605  ASN A ND2  1 
ATOM   5513  H  H    . ASN A 1 397 ? 9.398   41.877 66.695 1.00 40.25  ? 605  ASN A H    1 
ATOM   5514  H  HA   . ASN A 1 397 ? 10.822  43.576 68.164 1.00 41.17  ? 605  ASN A HA   1 
ATOM   5515  H  HB2  . ASN A 1 397 ? 10.130  42.051 69.846 1.00 43.81  ? 605  ASN A HB2  1 
ATOM   5516  H  HB3  . ASN A 1 397 ? 10.886  40.899 69.053 1.00 43.81  ? 605  ASN A HB3  1 
ATOM   5517  H  HD21 . ASN A 1 397 ? 12.755  43.257 71.453 1.00 46.74  ? 605  ASN A HD21 1 
ATOM   5518  H  HD22 . ASN A 1 397 ? 11.285  43.345 71.229 1.00 46.74  ? 605  ASN A HD22 1 
ATOM   5519  N  N    . GLN A 1 398 ? 12.532  43.222 66.464 1.00 32.35  ? 606  GLN A N    1 
ATOM   5520  C  CA   . GLN A 1 398 ? 13.619  42.967 65.528 1.00 31.82  ? 606  GLN A CA   1 
ATOM   5521  C  C    . GLN A 1 398 ? 14.972  42.828 66.215 1.00 30.25  ? 606  GLN A C    1 
ATOM   5522  O  O    . GLN A 1 398 ? 15.880  42.216 65.640 1.00 31.16  ? 606  GLN A O    1 
ATOM   5523  C  CB   . GLN A 1 398 ? 13.691  44.095 64.488 1.00 31.44  ? 606  GLN A CB   1 
ATOM   5524  C  CG   . GLN A 1 398 ? 14.701  43.846 63.373 1.00 28.55  ? 606  GLN A CG   1 
ATOM   5525  C  CD   . GLN A 1 398 ? 14.761  44.979 62.364 1.00 31.00  ? 606  GLN A CD   1 
ATOM   5526  O  OE1  . GLN A 1 398 ? 14.364  44.819 61.209 1.00 30.55  ? 606  GLN A OE1  1 
ATOM   5527  N  NE2  . GLN A 1 398 ? 15.273  46.127 62.792 1.00 28.96  ? 606  GLN A NE2  1 
ATOM   5528  H  H    . GLN A 1 398 ? 12.430  44.052 66.663 1.00 38.83  ? 606  GLN A H    1 
ATOM   5529  H  HA   . GLN A 1 398 ? 13.438  42.139 65.057 1.00 38.19  ? 606  GLN A HA   1 
ATOM   5530  H  HB2  . GLN A 1 398 ? 12.818  44.198 64.079 1.00 37.74  ? 606  GLN A HB2  1 
ATOM   5531  H  HB3  . GLN A 1 398 ? 13.942  44.917 64.937 1.00 37.74  ? 606  GLN A HB3  1 
ATOM   5532  H  HG2  . GLN A 1 398 ? 15.583  43.746 63.764 1.00 34.27  ? 606  GLN A HG2  1 
ATOM   5533  H  HG3  . GLN A 1 398 ? 14.455  43.036 62.900 1.00 34.27  ? 606  GLN A HG3  1 
ATOM   5534  H  HE21 . GLN A 1 398 ? 15.542  46.201 63.605 1.00 34.76  ? 606  GLN A HE21 1 
ATOM   5535  H  HE22 . GLN A 1 398 ? 15.330  46.799 62.258 1.00 34.76  ? 606  GLN A HE22 1 
ATOM   5536  N  N    . GLU A 1 399 ? 15.127  43.374 67.426 1.00 28.46  ? 607  GLU A N    1 
ATOM   5537  C  CA   . GLU A 1 399 ? 16.413  43.306 68.115 1.00 30.93  ? 607  GLU A CA   1 
ATOM   5538  C  C    . GLU A 1 399 ? 16.934  41.875 68.191 1.00 31.29  ? 607  GLU A C    1 
ATOM   5539  O  O    . GLU A 1 399 ? 18.129  41.632 67.986 1.00 31.87  ? 607  GLU A O    1 
ATOM   5540  C  CB   . GLU A 1 399 ? 16.295  43.898 69.521 1.00 33.72  ? 607  GLU A CB   1 
ATOM   5541  C  CG   . GLU A 1 399 ? 17.630  43.991 70.258 1.00 38.18  ? 607  GLU A CG   1 
ATOM   5542  C  CD   . GLU A 1 399 ? 17.506  44.599 71.643 1.00 42.58  ? 607  GLU A CD   1 
ATOM   5543  O  OE1  . GLU A 1 399 ? 16.396  45.034 72.012 1.00 46.25  ? 607  GLU A OE1  1 
ATOM   5544  O  OE2  . GLU A 1 399 ? 18.522  44.639 72.367 1.00 46.14  ? 607  GLU A OE2  1 
ATOM   5545  H  H    . GLU A 1 399 ? 14.510  43.784 67.862 1.00 34.15  ? 607  GLU A H    1 
ATOM   5546  H  HA   . GLU A 1 399 ? 17.062  43.834 67.623 1.00 37.12  ? 607  GLU A HA   1 
ATOM   5547  H  HB2  . GLU A 1 399 ? 15.929  44.794 69.455 1.00 40.46  ? 607  GLU A HB2  1 
ATOM   5548  H  HB3  . GLU A 1 399 ? 15.703  43.339 70.048 1.00 40.46  ? 607  GLU A HB3  1 
ATOM   5549  H  HG2  . GLU A 1 399 ? 17.998  43.099 70.355 1.00 45.81  ? 607  GLU A HG2  1 
ATOM   5550  H  HG3  . GLU A 1 399 ? 18.236  44.545 69.742 1.00 45.81  ? 607  GLU A HG3  1 
ATOM   5551  N  N    . ILE A 1 400 ? 16.056  40.912 68.487 1.00 30.12  ? 608  ILE A N    1 
ATOM   5552  C  CA   . ILE A 1 400 ? 16.522  39.535 68.634 1.00 28.73  ? 608  ILE A CA   1 
ATOM   5553  C  C    . ILE A 1 400 ? 16.935  38.963 67.286 1.00 29.13  ? 608  ILE A C    1 
ATOM   5554  O  O    . ILE A 1 400 ? 17.857  38.141 67.211 1.00 32.56  ? 608  ILE A O    1 
ATOM   5555  C  CB   . ILE A 1 400 ? 15.453  38.655 69.313 1.00 30.14  ? 608  ILE A CB   1 
ATOM   5556  C  CG1  . ILE A 1 400 ? 15.963  37.215 69.477 1.00 32.03  ? 608  ILE A CG1  1 
ATOM   5557  C  CG2  . ILE A 1 400 ? 14.161  38.641 68.506 1.00 27.55  ? 608  ILE A CG2  1 
ATOM   5558  C  CD1  . ILE A 1 400 ? 17.251  37.088 70.275 1.00 36.05  ? 608  ILE A CD1  1 
ATOM   5559  H  H    . ILE A 1 400 ? 15.212  41.027 68.604 1.00 36.15  ? 608  ILE A H    1 
ATOM   5560  H  HA   . ILE A 1 400 ? 17.307  39.534 69.205 1.00 34.48  ? 608  ILE A HA   1 
ATOM   5561  H  HB   . ILE A 1 400 ? 15.266  39.018 70.192 1.00 36.17  ? 608  ILE A HB   1 
ATOM   5562  H  HG12 . ILE A 1 400 ? 15.282  36.696 69.932 1.00 38.44  ? 608  ILE A HG12 1 
ATOM   5563  H  HG13 . ILE A 1 400 ? 16.124  36.841 68.596 1.00 38.44  ? 608  ILE A HG13 1 
ATOM   5564  H  HG21 . ILE A 1 400 ? 13.513  38.079 68.959 1.00 33.06  ? 608  ILE A HG21 1 
ATOM   5565  H  HG22 . ILE A 1 400 ? 13.823  39.547 68.436 1.00 33.06  ? 608  ILE A HG22 1 
ATOM   5566  H  HG23 . ILE A 1 400 ? 14.345  38.286 67.622 1.00 33.06  ? 608  ILE A HG23 1 
ATOM   5567  H  HD11 . ILE A 1 400 ? 17.498  36.151 70.328 1.00 43.26  ? 608  ILE A HD11 1 
ATOM   5568  H  HD12 . ILE A 1 400 ? 17.950  37.589 69.827 1.00 43.26  ? 608  ILE A HD12 1 
ATOM   5569  H  HD13 . ILE A 1 400 ? 17.107  37.443 71.165 1.00 43.26  ? 608  ILE A HD13 1 
ATOM   5570  N  N    . ILE A 1 401 ? 16.271  39.372 66.203 1.00 29.04  ? 609  ILE A N    1 
ATOM   5571  C  CA   . ILE A 1 401 ? 16.688  38.927 64.875 1.00 28.62  ? 609  ILE A CA   1 
ATOM   5572  C  C    . ILE A 1 401 ? 18.102  39.414 64.588 1.00 32.57  ? 609  ILE A C    1 
ATOM   5573  O  O    . ILE A 1 401 ? 18.957  38.656 64.113 1.00 32.91  ? 609  ILE A O    1 
ATOM   5574  C  CB   . ILE A 1 401 ? 15.692  39.410 63.805 1.00 30.25  ? 609  ILE A CB   1 
ATOM   5575  C  CG1  . ILE A 1 401 ? 14.286  38.883 64.113 1.00 31.15  ? 609  ILE A CG1  1 
ATOM   5576  C  CG2  . ILE A 1 401 ? 16.140  38.954 62.414 1.00 28.16  ? 609  ILE A CG2  1 
ATOM   5577  C  CD1  . ILE A 1 401 ? 13.195  39.461 63.227 1.00 29.72  ? 609  ILE A CD1  1 
ATOM   5578  H  H    . ILE A 1 401 ? 15.589  39.896 66.209 1.00 34.84  ? 609  ILE A H    1 
ATOM   5579  H  HA   . ILE A 1 401 ? 16.697  37.957 64.857 1.00 34.35  ? 609  ILE A HA   1 
ATOM   5580  H  HB   . ILE A 1 401 ? 15.669  40.380 63.820 1.00 36.30  ? 609  ILE A HB   1 
ATOM   5581  H  HG12 . ILE A 1 401 ? 14.282  37.920 63.996 1.00 37.38  ? 609  ILE A HG12 1 
ATOM   5582  H  HG13 . ILE A 1 401 ? 14.066  39.102 65.032 1.00 37.38  ? 609  ILE A HG13 1 
ATOM   5583  H  HG21 . ILE A 1 401 ? 15.500  39.269 61.757 1.00 33.79  ? 609  ILE A HG21 1 
ATOM   5584  H  HG22 . ILE A 1 401 ? 17.017  39.326 62.228 1.00 33.79  ? 609  ILE A HG22 1 
ATOM   5585  H  HG23 . ILE A 1 401 ? 16.182  37.985 62.398 1.00 33.79  ? 609  ILE A HG23 1 
ATOM   5586  H  HD11 . ILE A 1 401 ? 12.342  39.077 63.486 1.00 35.67  ? 609  ILE A HD11 1 
ATOM   5587  H  HD12 . ILE A 1 401 ? 13.173  40.424 63.340 1.00 35.67  ? 609  ILE A HD12 1 
ATOM   5588  H  HD13 . ILE A 1 401 ? 13.390  39.240 62.303 1.00 35.67  ? 609  ILE A HD13 1 
ATOM   5589  N  N    . GLY A 1 402 ? 18.372  40.686 64.887 1.00 31.36  ? 610  GLY A N    1 
ATOM   5590  C  CA   . GLY A 1 402 ? 19.714  41.215 64.697 1.00 31.70  ? 610  GLY A CA   1 
ATOM   5591  C  C    . GLY A 1 402 ? 20.759  40.457 65.495 1.00 33.24  ? 610  GLY A C    1 
ATOM   5592  O  O    . GLY A 1 402 ? 21.802  40.070 64.964 1.00 34.09  ? 610  GLY A O    1 
ATOM   5593  H  H    . GLY A 1 402 ? 17.803  41.252 65.196 1.00 37.64  ? 610  GLY A H    1 
ATOM   5594  H  HA2  . GLY A 1 402 ? 19.950  41.164 63.757 1.00 38.04  ? 610  GLY A HA2  1 
ATOM   5595  H  HA3  . GLY A 1 402 ? 19.735  42.145 64.969 1.00 38.04  ? 610  GLY A HA3  1 
ATOM   5596  N  N    . GLN A 1 403 ? 20.496  40.241 66.788 1.00 33.22  ? 611  GLN A N    1 
ATOM   5597  C  CA   . GLN A 1 403 ? 21.444  39.511 67.626 1.00 34.43  ? 611  GLN A CA   1 
ATOM   5598  C  C    . GLN A 1 403 ? 21.789  38.162 67.013 1.00 31.88  ? 611  GLN A C    1 
ATOM   5599  O  O    . GLN A 1 403 ? 22.951  37.741 67.023 1.00 30.08  ? 611  GLN A O    1 
ATOM   5600  C  CB   . GLN A 1 403 ? 20.871  39.298 69.029 1.00 37.11  ? 611  GLN A CB   1 
ATOM   5601  C  CG   . GLN A 1 403 ? 20.579  40.561 69.811 1.00 44.22  ? 611  GLN A CG   1 
ATOM   5602  C  CD   . GLN A 1 403 ? 19.869  40.265 71.119 1.00 50.83  ? 611  GLN A CD   1 
ATOM   5603  O  OE1  . GLN A 1 403 ? 18.834  40.858 71.424 1.00 54.30  ? 611  GLN A OE1  1 
ATOM   5604  N  NE2  . GLN A 1 403 ? 20.420  39.337 71.897 1.00 52.44  ? 611  GLN A NE2  1 
ATOM   5605  H  H    . GLN A 1 403 ? 19.786  40.504 67.197 1.00 39.87  ? 611  GLN A H    1 
ATOM   5606  H  HA   . GLN A 1 403 ? 22.262  40.026 67.706 1.00 41.32  ? 611  GLN A HA   1 
ATOM   5607  H  HB2  . GLN A 1 403 ? 20.039  38.806 68.949 1.00 44.54  ? 611  GLN A HB2  1 
ATOM   5608  H  HB3  . GLN A 1 403 ? 21.507  38.777 69.544 1.00 44.54  ? 611  GLN A HB3  1 
ATOM   5609  H  HG2  . GLN A 1 403 ? 21.414  41.010 70.015 1.00 53.06  ? 611  GLN A HG2  1 
ATOM   5610  H  HG3  . GLN A 1 403 ? 20.008  41.139 69.281 1.00 53.06  ? 611  GLN A HG3  1 
ATOM   5611  H  HE21 . GLN A 1 403 ? 21.143  38.943 71.650 1.00 62.93  ? 611  GLN A HE21 1 
ATOM   5612  H  HE22 . GLN A 1 403 ? 20.055  39.134 72.649 1.00 62.93  ? 611  GLN A HE22 1 
ATOM   5613  N  N    . LEU A 1 404 ? 20.784  37.472 66.478 1.00 32.42  ? 612  LEU A N    1 
ATOM   5614  C  CA   . LEU A 1 404 ? 20.983  36.119 65.974 1.00 33.46  ? 612  LEU A CA   1 
ATOM   5615  C  C    . LEU A 1 404 ? 21.777  36.123 64.673 1.00 34.41  ? 612  LEU A C    1 
ATOM   5616  O  O    . LEU A 1 404 ? 22.680  35.298 64.487 1.00 31.45  ? 612  LEU A O    1 
ATOM   5617  C  CB   . LEU A 1 404 ? 19.621  35.450 65.789 1.00 31.29  ? 612  LEU A CB   1 
ATOM   5618  C  CG   . LEU A 1 404 ? 19.552  34.019 65.267 1.00 32.89  ? 612  LEU A CG   1 
ATOM   5619  C  CD1  . LEU A 1 404 ? 20.475  33.101 66.056 1.00 34.01  ? 612  LEU A CD1  1 
ATOM   5620  C  CD2  . LEU A 1 404 ? 18.111  33.540 65.345 1.00 32.64  ? 612  LEU A CD2  1 
ATOM   5621  H  H    . LEU A 1 404 ? 19.980  37.765 66.395 1.00 38.91  ? 612  LEU A H    1 
ATOM   5622  H  HA   . LEU A 1 404 ? 21.483  35.607 66.629 1.00 40.16  ? 612  LEU A HA   1 
ATOM   5623  H  HB2  . LEU A 1 404 ? 19.174  35.452 66.651 1.00 37.54  ? 612  LEU A HB2  1 
ATOM   5624  H  HB3  . LEU A 1 404 ? 19.108  35.995 65.171 1.00 37.54  ? 612  LEU A HB3  1 
ATOM   5625  H  HG   . LEU A 1 404 ? 19.828  34.004 64.338 1.00 39.47  ? 612  LEU A HG   1 
ATOM   5626  H  HD11 . LEU A 1 404 ? 20.406  32.202 65.698 1.00 40.82  ? 612  LEU A HD11 1 
ATOM   5627  H  HD12 . LEU A 1 404 ? 21.386  33.422 65.972 1.00 40.82  ? 612  LEU A HD12 1 
ATOM   5628  H  HD13 . LEU A 1 404 ? 20.206  33.108 66.988 1.00 40.82  ? 612  LEU A HD13 1 
ATOM   5629  H  HD21 . LEU A 1 404 ? 18.063  32.629 65.014 1.00 39.18  ? 612  LEU A HD21 1 
ATOM   5630  H  HD22 . LEU A 1 404 ? 17.818  33.572 66.269 1.00 39.18  ? 612  LEU A HD22 1 
ATOM   5631  H  HD23 . LEU A 1 404 ? 17.556  34.120 64.801 1.00 39.18  ? 612  LEU A HD23 1 
ATOM   5632  N  N    . ASP A 1 405 ? 21.469  37.059 63.771 1.00 35.42  ? 613  ASP A N    1 
ATOM   5633  C  CA   . ASP A 1 405 ? 22.133  37.092 62.471 1.00 34.51  ? 613  ASP A CA   1 
ATOM   5634  C  C    . ASP A 1 405 ? 23.603  37.474 62.605 1.00 33.87  ? 613  ASP A C    1 
ATOM   5635  O  O    . ASP A 1 405 ? 24.458  36.913 61.910 1.00 36.74  ? 613  ASP A O    1 
ATOM   5636  C  CB   . ASP A 1 405 ? 21.406  38.067 61.544 1.00 34.76  ? 613  ASP A CB   1 
ATOM   5637  C  CG   . ASP A 1 405 ? 21.837  37.930 60.096 1.00 36.91  ? 613  ASP A CG   1 
ATOM   5638  O  OD1  . ASP A 1 405 ? 21.315  37.031 59.399 1.00 35.62  ? 613  ASP A OD1  1 
ATOM   5639  O  OD2  . ASP A 1 405 ? 22.696  38.723 59.655 1.00 36.63  ? 613  ASP A OD2  1 
ATOM   5640  H  H    . ASP A 1 405 ? 20.885  37.679 63.888 1.00 42.50  ? 613  ASP A H    1 
ATOM   5641  H  HA   . ASP A 1 405 ? 22.088  36.209 62.072 1.00 41.42  ? 613  ASP A HA   1 
ATOM   5642  H  HB2  . ASP A 1 405 ? 20.452  37.896 61.591 1.00 41.72  ? 613  ASP A HB2  1 
ATOM   5643  H  HB3  . ASP A 1 405 ? 21.595  38.974 61.829 1.00 41.72  ? 613  ASP A HB3  1 
ATOM   5644  N  N    . TYR A 1 406 ? 23.917  38.428 63.487 1.00 34.30  ? 614  TYR A N    1 
ATOM   5645  C  CA   . TYR A 1 406 ? 25.308  38.834 63.675 1.00 35.88  ? 614  TYR A CA   1 
ATOM   5646  C  C    . TYR A 1 406 ? 26.099  37.777 64.435 1.00 37.72  ? 614  TYR A C    1 
ATOM   5647  O  O    . TYR A 1 406 ? 27.296  37.602 64.188 1.00 33.79  ? 614  TYR A O    1 
ATOM   5648  C  CB   . TYR A 1 406 ? 25.379  40.170 64.418 1.00 36.75  ? 614  TYR A CB   1 
ATOM   5649  C  CG   . TYR A 1 406 ? 24.444  41.234 63.884 1.00 35.92  ? 614  TYR A CG   1 
ATOM   5650  C  CD1  . TYR A 1 406 ? 24.136  41.309 62.532 1.00 34.59  ? 614  TYR A CD1  1 
ATOM   5651  C  CD2  . TYR A 1 406 ? 23.864  42.162 64.738 1.00 37.63  ? 614  TYR A CD2  1 
ATOM   5652  C  CE1  . TYR A 1 406 ? 23.275  42.279 62.048 1.00 32.93  ? 614  TYR A CE1  1 
ATOM   5653  C  CE2  . TYR A 1 406 ? 23.002  43.135 64.262 1.00 36.73  ? 614  TYR A CE2  1 
ATOM   5654  C  CZ   . TYR A 1 406 ? 22.711  43.188 62.919 1.00 35.59  ? 614  TYR A CZ   1 
ATOM   5655  O  OH   . TYR A 1 406 ? 21.852  44.155 62.449 1.00 38.31  ? 614  TYR A OH   1 
ATOM   5656  H  H    . TYR A 1 406 ? 23.352  38.847 63.981 1.00 41.16  ? 614  TYR A H    1 
ATOM   5657  H  HA   . TYR A 1 406 ? 25.722  38.951 62.806 1.00 43.06  ? 614  TYR A HA   1 
ATOM   5658  H  HB2  . TYR A 1 406 ? 25.153  40.020 65.349 1.00 44.10  ? 614  TYR A HB2  1 
ATOM   5659  H  HB3  . TYR A 1 406 ? 26.284  40.514 64.353 1.00 44.10  ? 614  TYR A HB3  1 
ATOM   5660  H  HD1  . TYR A 1 406 ? 24.513  40.696 61.943 1.00 41.51  ? 614  TYR A HD1  1 
ATOM   5661  H  HD2  . TYR A 1 406 ? 24.056  42.128 65.647 1.00 45.16  ? 614  TYR A HD2  1 
ATOM   5662  H  HE1  . TYR A 1 406 ? 23.077  42.317 61.141 1.00 39.51  ? 614  TYR A HE1  1 
ATOM   5663  H  HE2  . TYR A 1 406 ? 22.621  43.748 64.848 1.00 44.07  ? 614  TYR A HE2  1 
ATOM   5664  H  HH   . TYR A 1 406 ? 21.760  44.078 61.618 1.00 45.97  ? 614  TYR A HH   1 
ATOM   5665  N  N    . TYR A 1 407 ? 25.451  37.071 65.364 1.00 39.96  ? 615  TYR A N    1 
ATOM   5666  C  CA   . TYR A 1 407 ? 26.113  35.979 66.069 1.00 42.26  ? 615  TYR A CA   1 
ATOM   5667  C  C    . TYR A 1 407 ? 26.531  34.870 65.113 1.00 39.46  ? 615  TYR A C    1 
ATOM   5668  O  O    . TYR A 1 407 ? 27.579  34.245 65.306 1.00 42.06  ? 615  TYR A O    1 
ATOM   5669  C  CB   . TYR A 1 407 ? 25.181  35.433 67.153 1.00 48.46  ? 615  TYR A CB   1 
ATOM   5670  C  CG   . TYR A 1 407 ? 25.649  34.159 67.829 1.00 59.77  ? 615  TYR A CG   1 
ATOM   5671  C  CD1  . TYR A 1 407 ? 26.620  34.189 68.821 1.00 66.65  ? 615  TYR A CD1  1 
ATOM   5672  C  CD2  . TYR A 1 407 ? 25.097  32.930 67.492 1.00 64.42  ? 615  TYR A CD2  1 
ATOM   5673  C  CE1  . TYR A 1 407 ? 27.040  33.027 69.448 1.00 72.15  ? 615  TYR A CE1  1 
ATOM   5674  C  CE2  . TYR A 1 407 ? 25.511  31.763 68.114 1.00 69.79  ? 615  TYR A CE2  1 
ATOM   5675  C  CZ   . TYR A 1 407 ? 26.480  31.820 69.091 1.00 74.61  ? 615  TYR A CZ   1 
ATOM   5676  O  OH   . TYR A 1 407 ? 26.893  30.663 69.710 1.00 80.15  ? 615  TYR A OH   1 
ATOM   5677  H  H    . TYR A 1 407 ? 24.635  37.204 65.601 1.00 47.96  ? 615  TYR A H    1 
ATOM   5678  H  HA   . TYR A 1 407 ? 26.912  36.319 66.502 1.00 50.71  ? 615  TYR A HA   1 
ATOM   5679  H  HB2  . TYR A 1 407 ? 25.081  36.109 67.842 1.00 58.16  ? 615  TYR A HB2  1 
ATOM   5680  H  HB3  . TYR A 1 407 ? 24.317  35.250 66.752 1.00 58.16  ? 615  TYR A HB3  1 
ATOM   5681  H  HD1  . TYR A 1 407 ? 26.999  35.002 69.065 1.00 79.98  ? 615  TYR A HD1  1 
ATOM   5682  H  HD2  . TYR A 1 407 ? 24.442  32.890 66.834 1.00 77.31  ? 615  TYR A HD2  1 
ATOM   5683  H  HE1  . TYR A 1 407 ? 27.695  33.062 70.107 1.00 86.58  ? 615  TYR A HE1  1 
ATOM   5684  H  HE2  . TYR A 1 407 ? 25.135  30.947 67.874 1.00 83.75  ? 615  TYR A HE2  1 
ATOM   5685  H  HH   . TYR A 1 407 ? 26.474  30.005 69.399 1.00 96.19  ? 615  TYR A HH   1 
ATOM   5686  N  N    . LEU A 1 408 ? 25.737  34.622 64.072 1.00 39.39  ? 616  LEU A N    1 
ATOM   5687  C  CA   . LEU A 1 408 ? 26.013  33.537 63.139 1.00 37.61  ? 616  LEU A CA   1 
ATOM   5688  C  C    . LEU A 1 408 ? 26.983  33.938 62.035 1.00 37.61  ? 616  LEU A C    1 
ATOM   5689  O  O    . LEU A 1 408 ? 27.870  33.154 61.684 1.00 35.80  ? 616  LEU A O    1 
ATOM   5690  C  CB   . LEU A 1 408 ? 24.714  33.042 62.501 1.00 32.22  ? 616  LEU A CB   1 
ATOM   5691  C  CG   . LEU A 1 408 ? 23.690  32.362 63.411 1.00 33.66  ? 616  LEU A CG   1 
ATOM   5692  C  CD1  . LEU A 1 408 ? 22.438  32.042 62.619 1.00 32.23  ? 616  LEU A CD1  1 
ATOM   5693  C  CD2  . LEU A 1 408 ? 24.263  31.100 64.040 1.00 32.68  ? 616  LEU A CD2  1 
ATOM   5694  H  H    . LEU A 1 408 ? 25.028  35.072 63.885 1.00 47.27  ? 616  LEU A H    1 
ATOM   5695  H  HA   . LEU A 1 408 ? 26.407  32.797 63.627 1.00 45.14  ? 616  LEU A HA   1 
ATOM   5696  H  HB2  . LEU A 1 408 ? 24.271  33.804 62.096 1.00 38.67  ? 616  LEU A HB2  1 
ATOM   5697  H  HB3  . LEU A 1 408 ? 24.945  32.404 61.808 1.00 38.67  ? 616  LEU A HB3  1 
ATOM   5698  H  HG   . LEU A 1 408 ? 23.447  32.971 64.126 1.00 40.39  ? 616  LEU A HG   1 
ATOM   5699  H  HD11 . LEU A 1 408 ? 21.796  31.612 63.205 1.00 38.68  ? 616  LEU A HD11 1 
ATOM   5700  H  HD12 . LEU A 1 408 ? 22.066  32.867 62.269 1.00 38.68  ? 616  LEU A HD12 1 
ATOM   5701  H  HD13 . LEU A 1 408 ? 22.670  31.448 61.888 1.00 38.68  ? 616  LEU A HD13 1 
ATOM   5702  H  HD21 . LEU A 1 408 ? 23.589  30.697 64.608 1.00 39.22  ? 616  LEU A HD21 1 
ATOM   5703  H  HD22 . LEU A 1 408 ? 24.514  30.483 63.335 1.00 39.22  ? 616  LEU A HD22 1 
ATOM   5704  H  HD23 . LEU A 1 408 ? 25.043  31.336 64.566 1.00 39.22  ? 616  LEU A HD23 1 
ATOM   5705  N  N    A TYR A 1 409 ? 26.840  35.143 61.476 0.60 43.90  ? 617  TYR A N    1 
ATOM   5706  N  N    B TYR A 1 409 ? 26.832  35.143 61.479 0.40 43.87  ? 617  TYR A N    1 
ATOM   5707  C  CA   A TYR A 1 409 ? 27.641  35.541 60.324 0.60 39.45  ? 617  TYR A CA   1 
ATOM   5708  C  CA   B TYR A 1 409 ? 27.599  35.563 60.312 0.40 40.85  ? 617  TYR A CA   1 
ATOM   5709  C  C    A TYR A 1 409 ? 28.342  36.879 60.532 0.60 43.53  ? 617  TYR A C    1 
ATOM   5710  C  C    B TYR A 1 409 ? 28.417  36.827 60.551 0.40 43.66  ? 617  TYR A C    1 
ATOM   5711  O  O    A TYR A 1 409 ? 28.796  37.488 59.560 0.60 41.90  ? 617  TYR A O    1 
ATOM   5712  O  O    B TYR A 1 409 ? 29.040  37.330 59.609 0.40 42.23  ? 617  TYR A O    1 
ATOM   5713  C  CB   A TYR A 1 409 ? 26.771  35.579 59.066 0.60 42.95  ? 617  TYR A CB   1 
ATOM   5714  C  CB   B TYR A 1 409 ? 26.663  35.778 59.120 0.40 43.17  ? 617  TYR A CB   1 
ATOM   5715  C  CG   A TYR A 1 409 ? 26.206  34.222 58.699 0.60 44.42  ? 617  TYR A CG   1 
ATOM   5716  C  CG   B TYR A 1 409 ? 25.584  34.729 59.002 0.40 43.04  ? 617  TYR A CG   1 
ATOM   5717  C  CD1  A TYR A 1 409 ? 27.035  33.209 58.237 0.60 44.91  ? 617  TYR A CD1  1 
ATOM   5718  C  CD1  B TYR A 1 409 ? 25.858  33.479 58.465 0.40 46.03  ? 617  TYR A CD1  1 
ATOM   5719  C  CD2  A TYR A 1 409 ? 24.849  33.953 58.821 0.60 45.11  ? 617  TYR A CD2  1 
ATOM   5720  C  CD2  B TYR A 1 409 ? 24.289  34.990 59.427 0.40 42.15  ? 617  TYR A CD2  1 
ATOM   5721  C  CE1  A TYR A 1 409 ? 26.529  31.965 57.904 0.60 43.62  ? 617  TYR A CE1  1 
ATOM   5722  C  CE1  B TYR A 1 409 ? 24.872  32.517 58.357 0.40 42.19  ? 617  TYR A CE1  1 
ATOM   5723  C  CE2  A TYR A 1 409 ? 24.333  32.711 58.490 0.60 42.84  ? 617  TYR A CE2  1 
ATOM   5724  C  CE2  B TYR A 1 409 ? 23.298  34.038 59.323 0.40 41.46  ? 617  TYR A CE2  1 
ATOM   5725  C  CZ   A TYR A 1 409 ? 25.179  31.721 58.034 0.60 46.69  ? 617  TYR A CZ   1 
ATOM   5726  C  CZ   B TYR A 1 409 ? 23.593  32.804 58.788 0.40 40.69  ? 617  TYR A CZ   1 
ATOM   5727  O  OH   A TYR A 1 409 ? 24.679  30.482 57.699 0.60 39.20  ? 617  TYR A OH   1 
ATOM   5728  O  OH   B TYR A 1 409 ? 22.604  31.858 58.685 0.40 45.64  ? 617  TYR A OH   1 
ATOM   5729  H  H    A TYR A 1 409 ? 26.287  35.743 61.746 0.60 52.68  ? 617  TYR A H    1 
ATOM   5730  H  H    B TYR A 1 409 ? 26.283  35.740 61.766 0.40 52.64  ? 617  TYR A H    1 
ATOM   5731  H  HA   A TYR A 1 409 ? 28.329  34.871 60.183 0.60 47.34  ? 617  TYR A HA   1 
ATOM   5732  H  HA   B TYR A 1 409 ? 28.217  34.854 60.077 0.40 49.02  ? 617  TYR A HA   1 
ATOM   5733  H  HB2  A TYR A 1 409 ? 26.027  36.183 59.215 0.60 51.54  ? 617  TYR A HB2  1 
ATOM   5734  H  HB2  B TYR A 1 409 ? 26.229  36.641 59.214 0.40 51.80  ? 617  TYR A HB2  1 
ATOM   5735  H  HB3  A TYR A 1 409 ? 27.308  35.892 58.320 0.60 51.54  ? 617  TYR A HB3  1 
ATOM   5736  H  HB3  B TYR A 1 409 ? 27.186  35.759 58.303 0.40 51.80  ? 617  TYR A HB3  1 
ATOM   5737  H  HD1  A TYR A 1 409 ? 27.947  33.368 58.150 0.60 53.89  ? 617  TYR A HD1  1 
ATOM   5738  H  HD1  B TYR A 1 409 ? 26.720  33.284 58.175 0.40 55.23  ? 617  TYR A HD1  1 
ATOM   5739  H  HD2  A TYR A 1 409 ? 24.277  34.618 59.130 0.60 54.14  ? 617  TYR A HD2  1 
ATOM   5740  H  HD2  B TYR A 1 409 ? 24.086  35.822 59.789 0.40 50.58  ? 617  TYR A HD2  1 
ATOM   5741  H  HE1  A TYR A 1 409 ? 27.098  31.297 57.596 0.60 52.35  ? 617  TYR A HE1  1 
ATOM   5742  H  HE1  B TYR A 1 409 ? 25.068  31.683 57.996 0.40 50.63  ? 617  TYR A HE1  1 
ATOM   5743  H  HE2  A TYR A 1 409 ? 23.422  32.545 58.576 0.60 51.41  ? 617  TYR A HE2  1 
ATOM   5744  H  HE2  B TYR A 1 409 ? 22.435  34.227 59.613 0.40 49.76  ? 617  TYR A HE2  1 
ATOM   5745  H  HH   A TYR A 1 409 ? 23.849  30.464 57.823 0.60 47.04  ? 617  TYR A HH   1 
ATOM   5746  H  HH   B TYR A 1 409 ? 22.912  31.155 58.344 0.40 54.78  ? 617  TYR A HH   1 
ATOM   5747  N  N    . GLY A 1 410 ? 28.442  37.351 61.772 1.00 42.32  ? 618  GLY A N    1 
ATOM   5748  C  CA   . GLY A 1 410 ? 29.246  38.516 62.084 1.00 38.52  ? 618  GLY A CA   1 
ATOM   5749  C  C    . GLY A 1 410 ? 28.550  39.837 61.798 1.00 38.62  ? 618  GLY A C    1 
ATOM   5750  O  O    . GLY A 1 410 ? 27.525  39.918 61.117 1.00 35.96  ? 618  GLY A O    1 
ATOM   5751  H  H    . GLY A 1 410 ? 28.022  37.026 62.448 1.00 50.79  ? 618  GLY A H    1 
ATOM   5752  H  HA2  . GLY A 1 410 ? 29.484  38.496 63.024 1.00 46.23  ? 618  GLY A HA2  1 
ATOM   5753  H  HA3  . GLY A 1 410 ? 30.064  38.486 61.563 1.00 46.23  ? 618  GLY A HA3  1 
ATOM   5754  N  N    . ASN A 1 411 ? 29.141  40.901 62.336 1.00 41.11  ? 619  ASN A N    1 
ATOM   5755  C  CA   . ASN A 1 411 ? 28.590  42.234 62.172 1.00 40.53  ? 619  ASN A CA   1 
ATOM   5756  C  C    . ASN A 1 411 ? 28.742  42.713 60.731 1.00 39.30  ? 619  ASN A C    1 
ATOM   5757  O  O    . ASN A 1 411 ? 29.594  42.239 59.974 1.00 37.84  ? 619  ASN A O    1 
ATOM   5758  C  CB   . ASN A 1 411 ? 29.283  43.221 63.115 1.00 44.29  ? 619  ASN A CB   1 
ATOM   5759  C  CG   . ASN A 1 411 ? 28.838  43.066 64.557 1.00 45.32  ? 619  ASN A CG   1 
ATOM   5760  O  OD1  . ASN A 1 411 ? 27.691  42.715 64.831 1.00 44.86  ? 619  ASN A OD1  1 
ATOM   5761  N  ND2  . ASN A 1 411 ? 29.745  43.336 65.489 1.00 46.71  ? 619  ASN A ND2  1 
ATOM   5762  H  H    . ASN A 1 411 ? 29.863  40.873 62.802 1.00 49.33  ? 619  ASN A H    1 
ATOM   5763  H  HA   . ASN A 1 411 ? 27.644  42.219 62.389 1.00 48.63  ? 619  ASN A HA   1 
ATOM   5764  H  HB2  . ASN A 1 411 ? 30.241  43.073 63.079 1.00 53.15  ? 619  ASN A HB2  1 
ATOM   5765  H  HB3  . ASN A 1 411 ? 29.076  44.126 62.834 1.00 53.15  ? 619  ASN A HB3  1 
ATOM   5766  H  HD21 . ASN A 1 411 ? 29.541  43.263 66.321 1.00 56.05  ? 619  ASN A HD21 1 
ATOM   5767  H  HD22 . ASN A 1 411 ? 30.537  43.580 65.259 1.00 56.05  ? 619  ASN A HD22 1 
ATOM   5768  N  N    . TYR A 1 412 ? 27.891  43.664 60.355 1.00 40.11  ? 620  TYR A N    1 
ATOM   5769  C  CA   . TYR A 1 412 ? 28.080  44.397 59.117 1.00 42.19  ? 620  TYR A CA   1 
ATOM   5770  C  C    . TYR A 1 412 ? 29.164  45.457 59.307 1.00 44.54  ? 620  TYR A C    1 
ATOM   5771  O  O    . TYR A 1 412 ? 29.476  45.841 60.436 1.00 45.97  ? 620  TYR A O    1 
ATOM   5772  C  CB   . TYR A 1 412 ? 26.772  45.052 58.679 1.00 39.80  ? 620  TYR A CB   1 
ATOM   5773  C  CG   . TYR A 1 412 ? 25.890  44.163 57.836 1.00 38.86  ? 620  TYR A CG   1 
ATOM   5774  C  CD1  . TYR A 1 412 ? 24.988  43.285 58.424 1.00 36.61  ? 620  TYR A CD1  1 
ATOM   5775  C  CD2  . TYR A 1 412 ? 25.956  44.203 56.448 1.00 39.32  ? 620  TYR A CD2  1 
ATOM   5776  C  CE1  . TYR A 1 412 ? 24.180  42.466 57.654 1.00 34.41  ? 620  TYR A CE1  1 
ATOM   5777  C  CE2  . TYR A 1 412 ? 25.151  43.386 55.669 1.00 37.75  ? 620  TYR A CE2  1 
ATOM   5778  C  CZ   . TYR A 1 412 ? 24.267  42.521 56.278 1.00 35.51  ? 620  TYR A CZ   1 
ATOM   5779  O  OH   . TYR A 1 412 ? 23.466  41.709 55.510 1.00 34.80  ? 620  TYR A OH   1 
ATOM   5780  H  H    . TYR A 1 412 ? 27.196  43.901 60.803 1.00 48.14  ? 620  TYR A H    1 
ATOM   5781  H  HA   . TYR A 1 412 ? 28.366  43.787 58.420 1.00 50.63  ? 620  TYR A HA   1 
ATOM   5782  H  HB2  . TYR A 1 412 ? 26.269  45.303 59.470 1.00 47.76  ? 620  TYR A HB2  1 
ATOM   5783  H  HB3  . TYR A 1 412 ? 26.979  45.844 58.158 1.00 47.76  ? 620  TYR A HB3  1 
ATOM   5784  H  HD1  . TYR A 1 412 ? 24.929  43.243 59.351 1.00 43.93  ? 620  TYR A HD1  1 
ATOM   5785  H  HD2  . TYR A 1 412 ? 26.554  44.784 56.035 1.00 47.19  ? 620  TYR A HD2  1 
ATOM   5786  H  HE1  . TYR A 1 412 ? 23.582  41.881 58.061 1.00 41.29  ? 620  TYR A HE1  1 
ATOM   5787  H  HE2  . TYR A 1 412 ? 25.207  43.422 54.742 1.00 45.30  ? 620  TYR A HE2  1 
ATOM   5788  H  HH   . TYR A 1 412 ? 22.978  41.237 56.004 1.00 41.76  ? 620  TYR A HH   1 
ATOM   5789  N  N    . PRO A 1 413 ? 29.753  45.949 58.217 1.00 45.22  ? 621  PRO A N    1 
ATOM   5790  C  CA   . PRO A 1 413 ? 30.817  46.953 58.352 1.00 46.71  ? 621  PRO A CA   1 
ATOM   5791  C  C    . PRO A 1 413 ? 30.320  48.211 59.047 1.00 45.51  ? 621  PRO A C    1 
ATOM   5792  O  O    . PRO A 1 413 ? 29.140  48.562 58.979 1.00 45.54  ? 621  PRO A O    1 
ATOM   5793  C  CB   . PRO A 1 413 ? 31.225  47.245 56.901 1.00 47.67  ? 621  PRO A CB   1 
ATOM   5794  C  CG   . PRO A 1 413 ? 30.701  46.100 56.101 1.00 48.71  ? 621  PRO A CG   1 
ATOM   5795  C  CD   . PRO A 1 413 ? 29.471  45.629 56.807 1.00 45.47  ? 621  PRO A CD   1 
ATOM   5796  H  HA   . PRO A 1 413 ? 31.574  46.588 58.836 1.00 56.05  ? 621  PRO A HA   1 
ATOM   5797  H  HB2  . PRO A 1 413 ? 30.821  48.078 56.610 1.00 57.20  ? 621  PRO A HB2  1 
ATOM   5798  H  HB3  . PRO A 1 413 ? 32.191  47.292 56.837 1.00 57.20  ? 621  PRO A HB3  1 
ATOM   5799  H  HG2  . PRO A 1 413 ? 30.484  46.403 55.206 1.00 58.45  ? 621  PRO A HG2  1 
ATOM   5800  H  HG3  . PRO A 1 413 ? 31.366  45.395 56.070 1.00 58.45  ? 621  PRO A HG3  1 
ATOM   5801  H  HD2  . PRO A 1 413 ? 28.693  46.118 56.497 1.00 54.57  ? 621  PRO A HD2  1 
ATOM   5802  H  HD3  . PRO A 1 413 ? 29.360  44.672 56.693 1.00 54.57  ? 621  PRO A HD3  1 
ATOM   5803  N  N    . ALA A 1 414 ? 31.241  48.897 59.720 1.00 47.78  ? 622  ALA A N    1 
ATOM   5804  C  CA   . ALA A 1 414 ? 30.901  50.157 60.365 1.00 49.04  ? 622  ALA A CA   1 
ATOM   5805  C  C    . ALA A 1 414 ? 30.382  51.150 59.333 1.00 50.25  ? 622  ALA A C    1 
ATOM   5806  O  O    . ALA A 1 414 ? 30.888  51.226 58.210 1.00 51.55  ? 622  ALA A O    1 
ATOM   5807  C  CB   . ALA A 1 414 ? 32.120  50.732 61.089 1.00 50.96  ? 622  ALA A CB   1 
ATOM   5808  H  H    . ALA A 1 414 ? 32.061  48.655 59.816 1.00 57.34  ? 622  ALA A H    1 
ATOM   5809  H  HA   . ALA A 1 414 ? 30.202  50.004 61.020 1.00 58.84  ? 622  ALA A HA   1 
ATOM   5810  H  HB1  . ALA A 1 414 ? 31.870  51.569 61.511 1.00 61.15  ? 622  ALA A HB1  1 
ATOM   5811  H  HB2  . ALA A 1 414 ? 32.416  50.098 61.761 1.00 61.15  ? 622  ALA A HB2  1 
ATOM   5812  H  HB3  . ALA A 1 414 ? 32.827  50.884 60.443 1.00 61.15  ? 622  ALA A HB3  1 
ATOM   5813  N  N    . GLY A 1 415 ? 29.359  51.909 59.716 1.00 50.01  ? 623  GLY A N    1 
ATOM   5814  C  CA   . GLY A 1 415 ? 28.727  52.845 58.813 1.00 48.32  ? 623  GLY A CA   1 
ATOM   5815  C  C    . GLY A 1 415 ? 27.619  52.265 57.959 1.00 46.84  ? 623  GLY A C    1 
ATOM   5816  O  O    . GLY A 1 415 ? 27.038  52.999 57.149 1.00 46.95  ? 623  GLY A O    1 
ATOM   5817  H  H    . GLY A 1 415 ? 29.014  51.895 60.503 1.00 60.02  ? 623  GLY A H    1 
ATOM   5818  H  HA2  . GLY A 1 415 ? 28.354  53.576 59.329 1.00 57.99  ? 623  GLY A HA2  1 
ATOM   5819  H  HA3  . GLY A 1 415 ? 29.400  53.211 58.218 1.00 57.99  ? 623  GLY A HA3  1 
ATOM   5820  N  N    . THR A 1 416 ? 27.309  50.980 58.106 1.00 43.55  ? 624  THR A N    1 
ATOM   5821  C  CA   . THR A 1 416 ? 26.209  50.387 57.352 1.00 43.26  ? 624  THR A CA   1 
ATOM   5822  C  C    . THR A 1 416 ? 24.888  50.992 57.821 1.00 41.81  ? 624  THR A C    1 
ATOM   5823  O  O    . THR A 1 416 ? 24.596  50.963 59.023 1.00 39.49  ? 624  THR A O    1 
ATOM   5824  C  CB   . THR A 1 416 ? 26.183  48.869 57.532 1.00 42.36  ? 624  THR A CB   1 
ATOM   5825  O  OG1  . THR A 1 416 ? 27.447  48.314 57.146 1.00 44.33  ? 624  THR A OG1  1 
ATOM   5826  C  CG2  . THR A 1 416 ? 25.086  48.243 56.680 1.00 40.87  ? 624  THR A CG2  1 
ATOM   5827  H  H    . THR A 1 416 ? 27.716  50.435 58.631 1.00 52.27  ? 624  THR A H    1 
ATOM   5828  H  HA   . THR A 1 416 ? 26.320  50.584 56.408 1.00 51.92  ? 624  THR A HA   1 
ATOM   5829  H  HB   . THR A 1 416 ? 26.008  48.657 58.462 1.00 50.83  ? 624  THR A HB   1 
ATOM   5830  H  HG1  . THR A 1 416 ? 28.060  48.636 57.621 1.00 53.20  ? 624  THR A HG1  1 
ATOM   5831  H  HG21 . THR A 1 416 ? 25.080  47.281 56.803 1.00 49.04  ? 624  THR A HG21 1 
ATOM   5832  H  HG22 . THR A 1 416 ? 24.222  48.600 56.939 1.00 49.04  ? 624  THR A HG22 1 
ATOM   5833  H  HG23 . THR A 1 416 ? 25.241  48.441 55.743 1.00 49.04  ? 624  THR A HG23 1 
ATOM   5834  N  N    . PRO A 1 417 ? 24.067  51.535 56.923 1.00 42.09  ? 625  PRO A N    1 
ATOM   5835  C  CA   . PRO A 1 417 ? 22.825  52.188 57.343 1.00 40.43  ? 625  PRO A CA   1 
ATOM   5836  C  C    . PRO A 1 417 ? 21.653  51.223 57.475 1.00 36.35  ? 625  PRO A C    1 
ATOM   5837  O  O    . PRO A 1 417 ? 21.631  50.134 56.898 1.00 34.43  ? 625  PRO A O    1 
ATOM   5838  C  CB   . PRO A 1 417 ? 22.570  53.183 56.204 1.00 40.43  ? 625  PRO A CB   1 
ATOM   5839  C  CG   . PRO A 1 417 ? 23.080  52.466 55.001 1.00 39.36  ? 625  PRO A CG   1 
ATOM   5840  C  CD   . PRO A 1 417 ? 24.281  51.669 55.470 1.00 41.10  ? 625  PRO A CD   1 
ATOM   5841  H  HA   . PRO A 1 417 ? 22.952  52.668 58.176 1.00 48.52  ? 625  PRO A HA   1 
ATOM   5842  H  HB2  . PRO A 1 417 ? 21.619  53.362 56.125 1.00 48.51  ? 625  PRO A HB2  1 
ATOM   5843  H  HB3  . PRO A 1 417 ? 23.068  54.001 56.359 1.00 48.51  ? 625  PRO A HB3  1 
ATOM   5844  H  HG2  . PRO A 1 417 ? 22.391  51.875 54.659 1.00 47.23  ? 625  PRO A HG2  1 
ATOM   5845  H  HG3  . PRO A 1 417 ? 23.341  53.111 54.325 1.00 47.23  ? 625  PRO A HG3  1 
ATOM   5846  H  HD2  . PRO A 1 417 ? 24.292  50.795 55.048 1.00 49.32  ? 625  PRO A HD2  1 
ATOM   5847  H  HD3  . PRO A 1 417 ? 25.100  52.158 55.293 1.00 49.32  ? 625  PRO A HD3  1 
ATOM   5848  N  N    . GLY A 1 418 ? 20.665  51.657 58.258 1.00 33.31  ? 626  GLY A N    1 
ATOM   5849  C  CA   . GLY A 1 418 ? 19.383  50.983 58.338 1.00 34.45  ? 626  GLY A CA   1 
ATOM   5850  C  C    . GLY A 1 418 ? 19.352  49.712 59.157 1.00 33.49  ? 626  GLY A C    1 
ATOM   5851  O  O    . GLY A 1 418 ? 18.340  49.003 59.123 1.00 30.62  ? 626  GLY A O    1 
ATOM   5852  H  H    . GLY A 1 418 ? 20.720  52.354 58.759 1.00 39.98  ? 626  GLY A H    1 
ATOM   5853  H  HA2  . GLY A 1 418 ? 18.734  51.594 58.718 1.00 41.35  ? 626  GLY A HA2  1 
ATOM   5854  H  HA3  . GLY A 1 418 ? 19.092  50.762 57.439 1.00 41.35  ? 626  GLY A HA3  1 
ATOM   5855  N  N    . LEU A 1 419 ? 20.413  49.404 59.904 1.00 36.18  ? 627  LEU A N    1 
ATOM   5856  C  CA   . LEU A 1 419 ? 20.462  48.133 60.623 1.00 38.04  ? 627  LEU A CA   1 
ATOM   5857  C  C    . LEU A 1 419 ? 19.409  48.052 61.722 1.00 40.82  ? 627  LEU A C    1 
ATOM   5858  O  O    . LEU A 1 419 ? 18.920  46.958 62.024 1.00 43.65  ? 627  LEU A O    1 
ATOM   5859  C  CB   . LEU A 1 419 ? 21.856  47.917 61.211 1.00 39.16  ? 627  LEU A CB   1 
ATOM   5860  C  CG   . LEU A 1 419 ? 22.978  47.680 60.197 1.00 42.44  ? 627  LEU A CG   1 
ATOM   5861  C  CD1  . LEU A 1 419 ? 24.318  47.571 60.906 1.00 45.78  ? 627  LEU A CD1  1 
ATOM   5862  C  CD2  . LEU A 1 419 ? 22.717  46.429 59.363 1.00 42.10  ? 627  LEU A CD2  1 
ATOM   5863  H  H    . LEU A 1 419 ? 21.105  49.904 60.010 1.00 43.42  ? 627  LEU A H    1 
ATOM   5864  H  HA   . LEU A 1 419 ? 20.290  47.414 59.995 1.00 45.65  ? 627  LEU A HA   1 
ATOM   5865  H  HB2  . LEU A 1 419 ? 22.094  48.701 61.729 1.00 46.99  ? 627  LEU A HB2  1 
ATOM   5866  H  HB3  . LEU A 1 419 ? 21.824  47.142 61.794 1.00 46.99  ? 627  LEU A HB3  1 
ATOM   5867  H  HG   . LEU A 1 419 ? 23.021  48.438 59.593 1.00 50.93  ? 627  LEU A HG   1 
ATOM   5868  H  HD11 . LEU A 1 419 ? 25.013  47.421 60.246 1.00 54.94  ? 627  LEU A HD11 1 
ATOM   5869  H  HD12 . LEU A 1 419 ? 24.489  48.396 61.386 1.00 54.94  ? 627  LEU A HD12 1 
ATOM   5870  H  HD13 . LEU A 1 419 ? 24.286  46.826 61.528 1.00 54.94  ? 627  LEU A HD13 1 
ATOM   5871  H  HD21 . LEU A 1 419 ? 23.446  46.312 58.734 1.00 50.52  ? 627  LEU A HD21 1 
ATOM   5872  H  HD22 . LEU A 1 419 ? 22.662  45.662 59.954 1.00 50.52  ? 627  LEU A HD22 1 
ATOM   5873  H  HD23 . LEU A 1 419 ? 21.880  46.539 58.884 1.00 50.52  ? 627  LEU A HD23 1 
ATOM   5874  N  N    . ARG A 1 420 ? 19.044  49.179 62.329 1.00 40.94  ? 628  ARG A N    1 
ATOM   5875  C  CA   . ARG A 1 420 ? 18.069  49.194 63.412 1.00 44.47  ? 628  ARG A CA   1 
ATOM   5876  C  C    . ARG A 1 420 ? 16.679  49.627 62.954 1.00 39.16  ? 628  ARG A C    1 
ATOM   5877  O  O    . ARG A 1 420 ? 15.779  49.765 63.791 1.00 33.68  ? 628  ARG A O    1 
ATOM   5878  C  CB   . ARG A 1 420 ? 18.564  50.102 64.542 1.00 56.38  ? 628  ARG A CB   1 
ATOM   5879  C  CG   . ARG A 1 420 ? 19.304  49.355 65.653 1.00 67.58  ? 628  ARG A CG   1 
ATOM   5880  C  CD   . ARG A 1 420 ? 20.374  50.213 66.320 1.00 80.32  ? 628  ARG A CD   1 
ATOM   5881  N  NE   . ARG A 1 420 ? 19.983  51.620 66.411 1.00 93.66  ? 628  ARG A NE   1 
ATOM   5882  C  CZ   . ARG A 1 420 ? 19.582  52.238 67.521 1.00 103.32 ? 628  ARG A CZ   1 
ATOM   5883  N  NH1  . ARG A 1 420 ? 19.511  51.592 68.680 1.00 107.98 ? 628  ARG A NH1  1 
ATOM   5884  N  NH2  . ARG A 1 420 ? 19.252  53.522 67.469 1.00 104.78 ? 628  ARG A NH2  1 
ATOM   5885  H  H    . ARG A 1 420 ? 19.351  49.956 62.128 1.00 49.13  ? 628  ARG A H    1 
ATOM   5886  H  HA   . ARG A 1 420 ? 17.992  48.296 63.770 1.00 53.37  ? 628  ARG A HA   1 
ATOM   5887  H  HB2  . ARG A 1 420 ? 19.173  50.760 64.171 1.00 67.66  ? 628  ARG A HB2  1 
ATOM   5888  H  HB3  . ARG A 1 420 ? 17.801  50.548 64.942 1.00 67.66  ? 628  ARG A HB3  1 
ATOM   5889  H  HG2  . ARG A 1 420 ? 18.667  49.086 66.334 1.00 81.10  ? 628  ARG A HG2  1 
ATOM   5890  H  HG3  . ARG A 1 420 ? 19.737  48.573 65.276 1.00 81.10  ? 628  ARG A HG3  1 
ATOM   5891  H  HD2  . ARG A 1 420 ? 20.529  49.884 67.219 1.00 96.38  ? 628  ARG A HD2  1 
ATOM   5892  H  HD3  . ARG A 1 420 ? 21.191  50.160 65.800 1.00 96.38  ? 628  ARG A HD3  1 
ATOM   5893  H  HE   . ARG A 1 420 ? 20.016  52.087 65.690 1.00 112.39 ? 628  ARG A HE   1 
ATOM   5894  H  HH11 . ARG A 1 420 ? 19.723  50.759 68.722 1.00 129.58 ? 628  ARG A HH11 1 
ATOM   5895  H  HH12 . ARG A 1 420 ? 19.251  52.006 69.388 1.00 129.58 ? 628  ARG A HH12 1 
ATOM   5896  H  HH21 . ARG A 1 420 ? 19.297  53.947 66.723 1.00 125.74 ? 628  ARG A HH21 1 
ATOM   5897  H  HH22 . ARG A 1 420 ? 18.994  53.928 68.182 1.00 125.74 ? 628  ARG A HH22 1 
ATOM   5898  N  N    . SER A 1 421 ? 16.477  49.826 61.654 1.00 33.10  ? 629  SER A N    1 
ATOM   5899  C  CA   . SER A 1 421 ? 15.195  50.244 61.102 1.00 31.28  ? 629  SER A CA   1 
ATOM   5900  C  C    . SER A 1 421 ? 14.459  49.059 60.478 1.00 27.56  ? 629  SER A C    1 
ATOM   5901  O  O    . SER A 1 421 ? 15.050  48.025 60.161 1.00 28.82  ? 629  SER A O    1 
ATOM   5902  C  CB   . SER A 1 421 ? 15.399  51.337 60.049 1.00 30.71  ? 629  SER A CB   1 
ATOM   5903  O  OG   . SER A 1 421 ? 16.194  52.396 60.558 1.00 34.62  ? 629  SER A OG   1 
ATOM   5904  H  H    . SER A 1 421 ? 17.087  49.722 61.056 1.00 39.72  ? 629  SER A H    1 
ATOM   5905  H  HA   . SER A 1 421 ? 14.643  50.605 61.813 1.00 37.54  ? 629  SER A HA   1 
ATOM   5906  H  HB2  . SER A 1 421 ? 15.843  50.952 59.278 1.00 36.86  ? 629  SER A HB2  1 
ATOM   5907  H  HB3  . SER A 1 421 ? 14.533  51.689 59.790 1.00 36.86  ? 629  SER A HB3  1 
ATOM   5908  H  HG   . SER A 1 421 ? 16.296  52.986 59.970 1.00 41.55  ? 629  SER A HG   1 
ATOM   5909  N  N    . TYR A 1 422 ? 13.150  49.226 60.299 1.00 28.57  ? 630  TYR A N    1 
ATOM   5910  C  CA   . TYR A 1 422 ? 12.351  48.235 59.591 1.00 28.80  ? 630  TYR A CA   1 
ATOM   5911  C  C    . TYR A 1 422 ? 11.232  48.927 58.825 1.00 28.25  ? 630  TYR A C    1 
ATOM   5912  O  O    . TYR A 1 422 ? 10.567  49.824 59.351 1.00 24.62  ? 630  TYR A O    1 
ATOM   5913  C  CB   . TYR A 1 422 ? 11.762  47.185 60.540 1.00 28.95  ? 630  TYR A CB   1 
ATOM   5914  C  CG   . TYR A 1 422 ? 10.992  46.122 59.796 1.00 28.98  ? 630  TYR A CG   1 
ATOM   5915  C  CD1  . TYR A 1 422 ? 11.635  45.281 58.898 1.00 28.67  ? 630  TYR A CD1  1 
ATOM   5916  C  CD2  . TYR A 1 422 ? 9.622   45.974 59.967 1.00 28.94  ? 630  TYR A CD2  1 
ATOM   5917  C  CE1  . TYR A 1 422 ? 10.941  44.319 58.200 1.00 28.95  ? 630  TYR A CE1  1 
ATOM   5918  C  CE2  . TYR A 1 422 ? 8.917   45.009 59.270 1.00 29.31  ? 630  TYR A CE2  1 
ATOM   5919  C  CZ   . TYR A 1 422 ? 9.582   44.187 58.387 1.00 28.75  ? 630  TYR A CZ   1 
ATOM   5920  O  OH   . TYR A 1 422 ? 8.886   43.227 57.688 1.00 28.96  ? 630  TYR A OH   1 
ATOM   5921  H  H    . TYR A 1 422 ? 12.703  49.905 60.579 1.00 34.28  ? 630  TYR A H    1 
ATOM   5922  H  HA   . TYR A 1 422 ? 12.914  47.776 58.949 1.00 34.56  ? 630  TYR A HA   1 
ATOM   5923  H  HB2  . TYR A 1 422 ? 12.483  46.753 61.025 1.00 34.74  ? 630  TYR A HB2  1 
ATOM   5924  H  HB3  . TYR A 1 422 ? 11.156  47.620 61.160 1.00 34.74  ? 630  TYR A HB3  1 
ATOM   5925  H  HD1  . TYR A 1 422 ? 12.551  45.370 58.766 1.00 34.41  ? 630  TYR A HD1  1 
ATOM   5926  H  HD2  . TYR A 1 422 ? 9.172   46.531 60.560 1.00 34.73  ? 630  TYR A HD2  1 
ATOM   5927  H  HE1  . TYR A 1 422 ? 11.387  43.762 57.603 1.00 34.74  ? 630  TYR A HE1  1 
ATOM   5928  H  HE2  . TYR A 1 422 ? 8.000   44.918 59.394 1.00 35.18  ? 630  TYR A HE2  1 
ATOM   5929  H  HH   . TYR A 1 422 ? 8.072   43.254 57.896 1.00 34.75  ? 630  TYR A HH   1 
ATOM   5930  N  N    . TRP A 1 423 ? 11.033  48.494 57.580 1.00 27.13  ? 631  TRP A N    1 
ATOM   5931  C  CA   . TRP A 1 423 ? 10.024  49.042 56.680 1.00 28.07  ? 631  TRP A CA   1 
ATOM   5932  C  C    . TRP A 1 423 ? 9.129   47.906 56.194 1.00 24.79  ? 631  TRP A C    1 
ATOM   5933  O  O    . TRP A 1 423 ? 9.636   46.871 55.747 1.00 26.47  ? 631  TRP A O    1 
ATOM   5934  C  CB   . TRP A 1 423 ? 10.679  49.733 55.475 1.00 26.03  ? 631  TRP A CB   1 
ATOM   5935  C  CG   . TRP A 1 423 ? 11.495  50.989 55.767 1.00 26.58  ? 631  TRP A CG   1 
ATOM   5936  C  CD1  . TRP A 1 423 ? 11.034  52.277 55.802 1.00 26.62  ? 631  TRP A CD1  1 
ATOM   5937  C  CD2  . TRP A 1 423 ? 12.907  51.065 56.021 1.00 26.76  ? 631  TRP A CD2  1 
ATOM   5938  N  NE1  . TRP A 1 423 ? 12.068  53.147 56.070 1.00 25.64  ? 631  TRP A NE1  1 
ATOM   5939  C  CE2  . TRP A 1 423 ? 13.227  52.428 56.210 1.00 29.09  ? 631  TRP A CE2  1 
ATOM   5940  C  CE3  . TRP A 1 423 ? 13.930  50.114 56.111 1.00 29.39  ? 631  TRP A CE3  1 
ATOM   5941  C  CZ2  . TRP A 1 423 ? 14.525  52.860 56.489 1.00 29.71  ? 631  TRP A CZ2  1 
ATOM   5942  C  CZ3  . TRP A 1 423 ? 15.220  50.547 56.387 1.00 30.17  ? 631  TRP A CZ3  1 
ATOM   5943  C  CH2  . TRP A 1 423 ? 15.504  51.907 56.571 1.00 32.03  ? 631  TRP A CH2  1 
ATOM   5944  H  H    . TRP A 1 423 ? 11.489  47.858 57.224 1.00 32.56  ? 631  TRP A H    1 
ATOM   5945  H  HA   . TRP A 1 423 ? 9.478   49.689 57.154 1.00 33.68  ? 631  TRP A HA   1 
ATOM   5946  H  HB2  . TRP A 1 423 ? 11.274  49.097 55.048 1.00 31.24  ? 631  TRP A HB2  1 
ATOM   5947  H  HB3  . TRP A 1 423 ? 9.978   49.984 54.853 1.00 31.24  ? 631  TRP A HB3  1 
ATOM   5948  H  HD1  . TRP A 1 423 ? 10.150  52.529 55.662 1.00 31.95  ? 631  TRP A HD1  1 
ATOM   5949  H  HE1  . TRP A 1 423 ? 11.998  54.001 56.143 1.00 30.77  ? 631  TRP A HE1  1 
ATOM   5950  H  HE3  . TRP A 1 423 ? 13.750  49.210 55.989 1.00 35.26  ? 631  TRP A HE3  1 
ATOM   5951  H  HZ2  . TRP A 1 423 ? 14.717  53.762 56.612 1.00 35.66  ? 631  TRP A HZ2  1 
ATOM   5952  H  HZ3  . TRP A 1 423 ? 15.908  49.924 56.450 1.00 36.21  ? 631  TRP A HZ3  1 
ATOM   5953  H  HH2  . TRP A 1 423 ? 16.378  52.168 56.756 1.00 38.43  ? 631  TRP A HH2  1 
ATOM   5954  N  N    . GLU A 1 424 ? 7.808   48.096 56.263 1.00 24.81  ? 632  GLU A N    1 
ATOM   5955  C  CA   . GLU A 1 424 ? 6.858   47.063 55.840 1.00 24.50  ? 632  GLU A CA   1 
ATOM   5956  C  C    . GLU A 1 424 ? 5.721   47.691 55.045 1.00 27.25  ? 632  GLU A C    1 
ATOM   5957  O  O    . GLU A 1 424 ? 4.963   48.508 55.577 1.00 26.12  ? 632  GLU A O    1 
ATOM   5958  C  CB   . GLU A 1 424 ? 6.303   46.294 57.045 1.00 23.72  ? 632  GLU A CB   1 
ATOM   5959  C  CG   . GLU A 1 424 ? 5.419   45.102 56.669 1.00 25.58  ? 632  GLU A CG   1 
ATOM   5960  C  CD   . GLU A 1 424 ? 5.247   44.115 57.812 1.00 28.61  ? 632  GLU A CD   1 
ATOM   5961  O  OE1  . GLU A 1 424 ? 6.260   43.527 58.255 1.00 31.76  ? 632  GLU A OE1  1 
ATOM   5962  O  OE2  . GLU A 1 424 ? 4.103   43.934 58.274 1.00 28.49  ? 632  GLU A OE2  1 
ATOM   5963  H  H    . GLU A 1 424 ? 7.437   48.816 56.551 1.00 29.78  ? 632  GLU A H    1 
ATOM   5964  H  HA   . GLU A 1 424 ? 7.314   46.430 55.264 1.00 29.40  ? 632  GLU A HA   1 
ATOM   5965  H  HB2  . GLU A 1 424 ? 7.046   45.958 57.570 1.00 28.46  ? 632  GLU A HB2  1 
ATOM   5966  H  HB3  . GLU A 1 424 ? 5.769   46.900 57.583 1.00 28.46  ? 632  GLU A HB3  1 
ATOM   5967  H  HG2  . GLU A 1 424 ? 4.540   45.426 56.418 1.00 30.70  ? 632  GLU A HG2  1 
ATOM   5968  H  HG3  . GLU A 1 424 ? 5.825   44.631 55.924 1.00 30.70  ? 632  GLU A HG3  1 
ATOM   5969  N  N    . ASN A 1 425 ? 5.596   47.286 53.781 1.00 26.36  ? 633  ASN A N    1 
ATOM   5970  C  CA   . ASN A 1 425 ? 4.552   47.799 52.897 1.00 27.47  ? 633  ASN A CA   1 
ATOM   5971  C  C    . ASN A 1 425 ? 3.176   47.298 53.326 1.00 27.00  ? 633  ASN A C    1 
ATOM   5972  O  O    . ASN A 1 425 ? 2.970   46.093 53.489 1.00 28.71  ? 633  ASN A O    1 
ATOM   5973  C  CB   . ASN A 1 425 ? 4.839   47.357 51.462 1.00 26.26  ? 633  ASN A CB   1 
ATOM   5974  C  CG   . ASN A 1 425 ? 3.871   47.946 50.453 1.00 25.75  ? 633  ASN A CG   1 
ATOM   5975  O  OD1  . ASN A 1 425 ? 2.671   47.675 50.486 1.00 26.19  ? 633  ASN A OD1  1 
ATOM   5976  N  ND2  . ASN A 1 425 ? 4.401   48.726 49.522 1.00 23.85  ? 633  ASN A ND2  1 
ATOM   5977  H  H    . ASN A 1 425 ? 6.111   46.707 53.408 1.00 31.63  ? 633  ASN A H    1 
ATOM   5978  H  HA   . ASN A 1 425 ? 4.550   48.768 52.927 1.00 32.97  ? 633  ASN A HA   1 
ATOM   5979  H  HB2  . ASN A 1 425 ? 5.735   47.641 51.219 1.00 31.51  ? 633  ASN A HB2  1 
ATOM   5980  H  HB3  . ASN A 1 425 ? 4.773   46.391 51.411 1.00 31.51  ? 633  ASN A HB3  1 
ATOM   5981  H  HD21 . ASN A 1 425 ? 3.898   49.083 48.923 1.00 28.62  ? 633  ASN A HD21 1 
ATOM   5982  H  HD22 . ASN A 1 425 ? 5.246   48.887 49.527 1.00 28.62  ? 633  ASN A HD22 1 
ATOM   5983  N  N    . VAL A 1 426 ? 2.225   48.220 53.493 1.00 25.61  ? 634  VAL A N    1 
ATOM   5984  C  CA   . VAL A 1 426 ? 0.854   47.862 53.839 1.00 25.80  ? 634  VAL A CA   1 
ATOM   5985  C  C    . VAL A 1 426 ? -0.163  48.342 52.813 1.00 24.97  ? 634  VAL A C    1 
ATOM   5986  O  O    . VAL A 1 426 ? -1.351  48.046 52.960 1.00 26.64  ? 634  VAL A O    1 
ATOM   5987  C  CB   . VAL A 1 426 ? 0.469   48.367 55.245 1.00 28.08  ? 634  VAL A CB   1 
ATOM   5988  C  CG1  . VAL A 1 426 ? 1.263   47.610 56.308 1.00 27.71  ? 634  VAL A CG1  1 
ATOM   5989  C  CG2  . VAL A 1 426 ? 0.677   49.873 55.365 1.00 26.93  ? 634  VAL A CG2  1 
ATOM   5990  H  H    . VAL A 1 426 ? 2.353   49.066 53.409 1.00 30.73  ? 634  VAL A H    1 
ATOM   5991  H  HA   . VAL A 1 426 ? 0.796   46.894 53.861 1.00 30.97  ? 634  VAL A HA   1 
ATOM   5992  H  HB   . VAL A 1 426 ? -0.472  48.186 55.394 1.00 33.70  ? 634  VAL A HB   1 
ATOM   5993  H  HG11 . VAL A 1 426 ? 1.009   47.939 57.184 1.00 33.26  ? 634  VAL A HG11 1 
ATOM   5994  H  HG12 . VAL A 1 426 ? 1.061   46.664 56.238 1.00 33.26  ? 634  VAL A HG12 1 
ATOM   5995  H  HG13 . VAL A 1 426 ? 2.210   47.758 56.160 1.00 33.26  ? 634  VAL A HG13 1 
ATOM   5996  H  HG21 . VAL A 1 426 ? 0.427   50.156 56.259 1.00 32.32  ? 634  VAL A HG21 1 
ATOM   5997  H  HG22 . VAL A 1 426 ? 1.612   50.076 55.203 1.00 32.32  ? 634  VAL A HG22 1 
ATOM   5998  H  HG23 . VAL A 1 426 ? 0.122   50.321 54.708 1.00 32.32  ? 634  VAL A HG23 1 
ATOM   5999  N  N    . TYR A 1 427 ? 0.257   49.077 51.785 1.00 25.18  ? 635  TYR A N    1 
ATOM   6000  C  CA   . TYR A 1 427 ? -0.582  49.287 50.611 1.00 26.47  ? 635  TYR A CA   1 
ATOM   6001  C  C    . TYR A 1 427 ? 0.308   49.499 49.398 1.00 24.24  ? 635  TYR A C    1 
ATOM   6002  O  O    . TYR A 1 427 ? 1.274   50.264 49.464 1.00 24.62  ? 635  TYR A O    1 
ATOM   6003  C  CB   . TYR A 1 427 ? -1.530  50.484 50.752 1.00 27.01  ? 635  TYR A CB   1 
ATOM   6004  C  CG   . TYR A 1 427 ? -2.260  50.732 49.447 1.00 27.12  ? 635  TYR A CG   1 
ATOM   6005  C  CD1  . TYR A 1 427 ? -3.166  49.797 48.957 1.00 24.45  ? 635  TYR A CD1  1 
ATOM   6006  C  CD2  . TYR A 1 427 ? -2.012  51.865 48.682 1.00 25.87  ? 635  TYR A CD2  1 
ATOM   6007  C  CE1  . TYR A 1 427 ? -3.817  49.990 47.762 1.00 23.15  ? 635  TYR A CE1  1 
ATOM   6008  C  CE2  . TYR A 1 427 ? -2.668  52.070 47.475 1.00 24.81  ? 635  TYR A CE2  1 
ATOM   6009  C  CZ   . TYR A 1 427 ? -3.567  51.128 47.023 1.00 24.58  ? 635  TYR A CZ   1 
ATOM   6010  O  OH   . TYR A 1 427 ? -4.220  51.314 45.828 1.00 24.00  ? 635  TYR A OH   1 
ATOM   6011  H  H    . TYR A 1 427 ? 1.024   49.463 51.744 1.00 30.22  ? 635  TYR A H    1 
ATOM   6012  H  HA   . TYR A 1 427 ? -1.119  48.494 50.457 1.00 31.77  ? 635  TYR A HA   1 
ATOM   6013  H  HB2  . TYR A 1 427 ? -2.187  50.298 51.441 1.00 32.41  ? 635  TYR A HB2  1 
ATOM   6014  H  HB3  . TYR A 1 427 ? -1.019  51.278 50.974 1.00 32.41  ? 635  TYR A HB3  1 
ATOM   6015  H  HD1  . TYR A 1 427 ? -3.337  49.028 49.450 1.00 29.35  ? 635  TYR A HD1  1 
ATOM   6016  H  HD2  . TYR A 1 427 ? -1.404  52.499 48.986 1.00 31.05  ? 635  TYR A HD2  1 
ATOM   6017  H  HE1  . TYR A 1 427 ? -4.426  49.358 47.454 1.00 27.78  ? 635  TYR A HE1  1 
ATOM   6018  H  HE2  . TYR A 1 427 ? -2.499  52.835 46.974 1.00 29.77  ? 635  TYR A HE2  1 
ATOM   6019  H  HH   . TYR A 1 427 ? -3.981  52.040 45.479 1.00 28.80  ? 635  TYR A HH   1 
ATOM   6020  N  N    . ASP A 1 428 ? -0.036  48.835 48.294 1.00 23.71  ? 636  ASP A N    1 
ATOM   6021  C  CA   . ASP A 1 428 ? 0.719   48.913 47.050 1.00 28.05  ? 636  ASP A CA   1 
ATOM   6022  C  C    . ASP A 1 428 ? -0.256  49.102 45.896 1.00 29.38  ? 636  ASP A C    1 
ATOM   6023  O  O    . ASP A 1 428 ? -1.173  48.293 45.712 1.00 26.48  ? 636  ASP A O    1 
ATOM   6024  C  CB   . ASP A 1 428 ? 1.572   47.653 46.833 1.00 30.69  ? 636  ASP A CB   1 
ATOM   6025  C  CG   . ASP A 1 428 ? 2.770   47.902 45.925 1.00 32.70  ? 636  ASP A CG   1 
ATOM   6026  O  OD1  . ASP A 1 428 ? 3.452   48.930 46.114 1.00 32.11  ? 636  ASP A OD1  1 
ATOM   6027  O  OD2  . ASP A 1 428 ? 3.044   47.060 45.039 1.00 32.77  ? 636  ASP A OD2  1 
ATOM   6028  H  H    . ASP A 1 428 ? -0.723  48.320 48.243 1.00 28.45  ? 636  ASP A H    1 
ATOM   6029  H  HA   . ASP A 1 428 ? 1.311   49.681 47.080 1.00 33.66  ? 636  ASP A HA   1 
ATOM   6030  H  HB2  . ASP A 1 428 ? 1.904   47.345 47.690 1.00 36.83  ? 636  ASP A HB2  1 
ATOM   6031  H  HB3  . ASP A 1 428 ? 1.023   46.967 46.423 1.00 36.83  ? 636  ASP A HB3  1 
ATOM   6032  N  N    . GLU A 1 429 ? -0.031  50.156 45.112 1.00 29.07  ? 637  GLU A N    1 
ATOM   6033  C  CA   . GLU A 1 429 ? -0.974  50.576 44.077 1.00 30.56  ? 637  GLU A CA   1 
ATOM   6034  C  C    . GLU A 1 429 ? -1.508  49.447 43.200 1.00 28.25  ? 637  GLU A C    1 
ATOM   6035  O  O    . GLU A 1 429 ? -2.718  49.446 42.918 1.00 25.00  ? 637  GLU A O    1 
ATOM   6036  C  CB   . GLU A 1 429 ? -0.297  51.642 43.203 1.00 32.49  ? 637  GLU A CB   1 
ATOM   6037  C  CG   . GLU A 1 429 ? -1.250  52.502 42.404 1.00 36.97  ? 637  GLU A CG   1 
ATOM   6038  C  CD   . GLU A 1 429 ? -0.521  53.524 41.546 1.00 41.23  ? 637  GLU A CD   1 
ATOM   6039  O  OE1  . GLU A 1 429 ? -1.179  54.463 41.054 1.00 43.56  ? 637  GLU A OE1  1 
ATOM   6040  O  OE2  . GLU A 1 429 ? 0.709   53.385 41.367 1.00 42.55  ? 637  GLU A OE2  1 
ATOM   6041  H  H    . GLU A 1 429 ? 0.672   50.650 45.161 1.00 34.89  ? 637  GLU A H    1 
ATOM   6042  H  HA   . GLU A 1 429 ? -1.737  50.994 44.509 1.00 36.68  ? 637  GLU A HA   1 
ATOM   6043  H  HB2  . GLU A 1 429 ? 0.219   52.231 43.776 1.00 38.99  ? 637  GLU A HB2  1 
ATOM   6044  H  HB3  . GLU A 1 429 ? 0.294   51.198 42.575 1.00 38.99  ? 637  GLU A HB3  1 
ATOM   6045  H  HG2  . GLU A 1 429 ? -1.774  51.935 41.818 1.00 44.36  ? 637  GLU A HG2  1 
ATOM   6046  H  HG3  . GLU A 1 429 ? -1.833  52.981 43.014 1.00 44.36  ? 637  GLU A HG3  1 
ATOM   6047  N  N    . PRO A 1 430 ? -0.700  48.492 42.723 1.00 30.23  ? 638  PRO A N    1 
ATOM   6048  C  CA   . PRO A 1 430 ? -1.238  47.467 41.813 1.00 30.31  ? 638  PRO A CA   1 
ATOM   6049  C  C    . PRO A 1 430 ? -2.450  46.722 42.357 1.00 28.88  ? 638  PRO A C    1 
ATOM   6050  O  O    . PRO A 1 430 ? -3.217  46.142 41.580 1.00 32.61  ? 638  PRO A O    1 
ATOM   6051  C  CB   . PRO A 1 430 ? -0.045  46.523 41.613 1.00 32.11  ? 638  PRO A CB   1 
ATOM   6052  C  CG   . PRO A 1 430 ? 1.149   47.394 41.801 1.00 31.20  ? 638  PRO A CG   1 
ATOM   6053  C  CD   . PRO A 1 430 ? 0.761   48.373 42.880 1.00 30.07  ? 638  PRO A CD   1 
ATOM   6054  H  HA   . PRO A 1 430 ? -1.469  47.868 40.961 1.00 36.38  ? 638  PRO A HA   1 
ATOM   6055  H  HB2  . PRO A 1 430 ? -0.067  45.818 42.280 1.00 38.53  ? 638  PRO A HB2  1 
ATOM   6056  H  HB3  . PRO A 1 430 ? -0.065  46.152 40.717 1.00 38.53  ? 638  PRO A HB3  1 
ATOM   6057  H  HG2  . PRO A 1 430 ? 1.905   46.855 42.082 1.00 37.45  ? 638  PRO A HG2  1 
ATOM   6058  H  HG3  . PRO A 1 430 ? 1.348   47.858 40.973 1.00 37.45  ? 638  PRO A HG3  1 
ATOM   6059  H  HD2  . PRO A 1 430 ? 0.980   48.016 43.755 1.00 36.09  ? 638  PRO A HD2  1 
ATOM   6060  H  HD3  . PRO A 1 430 ? 1.189   49.230 42.728 1.00 36.09  ? 638  PRO A HD3  1 
ATOM   6061  N  N    . ASP A 1 431 ? -2.645  46.727 43.674 1.00 25.74  ? 639  ASP A N    1 
ATOM   6062  C  CA   . ASP A 1 431 ? -3.769  46.017 44.275 1.00 27.86  ? 639  ASP A CA   1 
ATOM   6063  C  C    . ASP A 1 431 ? -5.055  46.843 44.309 1.00 29.06  ? 639  ASP A C    1 
ATOM   6064  O  O    . ASP A 1 431 ? -6.129  46.276 44.544 1.00 27.63  ? 639  ASP A O    1 
ATOM   6065  C  CB   . ASP A 1 431 ? -3.389  45.555 45.687 1.00 24.28  ? 639  ASP A CB   1 
ATOM   6066  C  CG   . ASP A 1 431 ? -2.194  44.600 45.685 1.00 26.13  ? 639  ASP A CG   1 
ATOM   6067  O  OD1  . ASP A 1 431 ? -2.141  43.714 44.803 1.00 27.55  ? 639  ASP A OD1  1 
ATOM   6068  O  OD2  . ASP A 1 431 ? -1.302  44.740 46.547 1.00 24.23  ? 639  ASP A OD2  1 
ATOM   6069  H  H    . ASP A 1 431 ? -2.142  47.133 44.240 1.00 30.88  ? 639  ASP A H    1 
ATOM   6070  H  HA   . ASP A 1 431 ? -3.947  45.223 43.747 1.00 33.44  ? 639  ASP A HA   1 
ATOM   6071  H  HB2  . ASP A 1 431 ? -3.154  46.329 46.222 1.00 29.14  ? 639  ASP A HB2  1 
ATOM   6072  H  HB3  . ASP A 1 431 ? -4.143  45.092 46.084 1.00 29.14  ? 639  ASP A HB3  1 
ATOM   6073  N  N    . GLY A 1 432 ? -4.984  48.146 44.076 1.00 29.33  ? 640  GLY A N    1 
ATOM   6074  C  CA   . GLY A 1 432 ? -6.193  48.935 43.855 1.00 28.71  ? 640  GLY A CA   1 
ATOM   6075  C  C    . GLY A 1 432 ? -6.805  49.461 45.139 1.00 31.25  ? 640  GLY A C    1 
ATOM   6076  O  O    . GLY A 1 432 ? -6.725  48.850 46.204 1.00 31.47  ? 640  GLY A O    1 
ATOM   6077  H  H    . GLY A 1 432 ? -4.253  48.598 44.040 1.00 35.20  ? 640  GLY A H    1 
ATOM   6078  H  HA2  . GLY A 1 432 ? -5.983  49.692 43.286 1.00 34.45  ? 640  GLY A HA2  1 
ATOM   6079  H  HA3  . GLY A 1 432 ? -6.855  48.389 43.404 1.00 34.45  ? 640  GLY A HA3  1 
ATOM   6080  N  N    . ILE A 1 433 ? -7.452  50.626 45.026 1.00 31.25  ? 641  ILE A N    1 
ATOM   6081  C  CA   . ILE A 1 433 ? -8.023  51.279 46.201 1.00 30.01  ? 641  ILE A CA   1 
ATOM   6082  C  C    . ILE A 1 433 ? -9.192  50.494 46.776 1.00 31.41  ? 641  ILE A C    1 
ATOM   6083  O  O    . ILE A 1 433 ? -9.538  50.673 47.949 1.00 31.14  ? 641  ILE A O    1 
ATOM   6084  C  CB   . ILE A 1 433 ? -8.460  52.721 45.872 1.00 32.82  ? 641  ILE A CB   1 
ATOM   6085  C  CG1  . ILE A 1 433 ? -9.519  52.737 44.763 1.00 37.00  ? 641  ILE A CG1  1 
ATOM   6086  C  CG2  . ILE A 1 433 ? -7.251  53.552 45.477 1.00 32.38  ? 641  ILE A CG2  1 
ATOM   6087  C  CD1  . ILE A 1 433 ? -10.152 54.102 44.537 1.00 39.67  ? 641  ILE A CD1  1 
ATOM   6088  H  H    . ILE A 1 433 ? -7.572  51.052 44.288 1.00 37.51  ? 641  ILE A H    1 
ATOM   6089  H  HA   . ILE A 1 433 ? -7.339  51.329 46.887 1.00 36.01  ? 641  ILE A HA   1 
ATOM   6090  H  HB   . ILE A 1 433 ? -8.850  53.111 46.671 1.00 39.39  ? 641  ILE A HB   1 
ATOM   6091  H  HG12 . ILE A 1 433 ? -9.104  52.462 43.930 1.00 44.40  ? 641  ILE A HG12 1 
ATOM   6092  H  HG13 . ILE A 1 433 ? -10.228 52.118 44.998 1.00 44.40  ? 641  ILE A HG13 1 
ATOM   6093  H  HG21 . ILE A 1 433 ? -7.542  54.455 45.273 1.00 38.86  ? 641  ILE A HG21 1 
ATOM   6094  H  HG22 . ILE A 1 433 ? -6.622  53.565 46.215 1.00 38.86  ? 641  ILE A HG22 1 
ATOM   6095  H  HG23 . ILE A 1 433 ? -6.837  53.154 44.695 1.00 38.86  ? 641  ILE A HG23 1 
ATOM   6096  H  HD11 . ILE A 1 433 ? -10.807 54.033 43.826 1.00 47.60  ? 641  ILE A HD11 1 
ATOM   6097  H  HD12 . ILE A 1 433 ? -10.583 54.389 45.358 1.00 47.60  ? 641  ILE A HD12 1 
ATOM   6098  H  HD13 . ILE A 1 433 ? -9.458  54.734 44.289 1.00 47.60  ? 641  ILE A HD13 1 
ATOM   6099  N  N    . HIS A 1 434 ? -9.820  49.622 45.992 1.00 33.62  ? 642  HIS A N    1 
ATOM   6100  C  CA   . HIS A 1 434 ? -10.893 48.818 46.554 1.00 40.00  ? 642  HIS A CA   1 
ATOM   6101  C  C    . HIS A 1 434 ? -10.385 47.766 47.531 1.00 37.46  ? 642  HIS A C    1 
ATOM   6102  O  O    . HIS A 1 434 ? -11.193 47.205 48.277 1.00 36.66  ? 642  HIS A O    1 
ATOM   6103  C  CB   . HIS A 1 434 ? -11.703 48.178 45.427 1.00 48.53  ? 642  HIS A CB   1 
ATOM   6104  C  CG   . HIS A 1 434 ? -12.637 49.138 44.757 1.00 57.02  ? 642  HIS A CG   1 
ATOM   6105  N  ND1  . HIS A 1 434 ? -13.920 49.365 45.209 1.00 59.74  ? 642  HIS A ND1  1 
ATOM   6106  C  CD2  . HIS A 1 434 ? -12.466 49.953 43.689 1.00 59.56  ? 642  HIS A CD2  1 
ATOM   6107  C  CE1  . HIS A 1 434 ? -14.503 50.266 44.439 1.00 61.45  ? 642  HIS A CE1  1 
ATOM   6108  N  NE2  . HIS A 1 434 ? -13.642 50.640 43.510 1.00 61.12  ? 642  HIS A NE2  1 
ATOM   6109  H  H    . HIS A 1 434 ? -9.649  49.481 45.160 1.00 40.34  ? 642  HIS A H    1 
ATOM   6110  H  HA   . HIS A 1 434 ? -11.491 49.404 47.044 1.00 48.00  ? 642  HIS A HA   1 
ATOM   6111  H  HB2  . HIS A 1 434 ? -11.092 47.837 44.755 1.00 58.24  ? 642  HIS A HB2  1 
ATOM   6112  H  HB3  . HIS A 1 434 ? -12.232 47.452 45.793 1.00 58.24  ? 642  HIS A HB3  1 
ATOM   6113  H  HD2  . HIS A 1 434 ? -11.698 50.028 43.170 1.00 71.47  ? 642  HIS A HD2  1 
ATOM   6114  H  HE1  . HIS A 1 434 ? -15.372 50.584 44.536 1.00 73.74  ? 642  HIS A HE1  1 
ATOM   6115  H  HE2  . HIS A 1 434 ? -13.794 51.218 42.891 1.00 73.34  ? 642  HIS A HE2  1 
ATOM   6116  N  N    . SER A 1 435 ? -9.074  47.512 47.573 1.00 36.55  ? 643  SER A N    1 
ATOM   6117  C  CA   . SER A 1 435 ? -8.503  46.650 48.600 1.00 34.41  ? 643  SER A CA   1 
ATOM   6118  C  C    . SER A 1 435 ? -8.243  47.393 49.904 1.00 34.62  ? 643  SER A C    1 
ATOM   6119  O  O    . SER A 1 435 ? -8.011  46.748 50.932 1.00 30.89  ? 643  SER A O    1 
ATOM   6120  C  CB   . SER A 1 435 ? -7.201  46.018 48.100 1.00 33.33  ? 643  SER A CB   1 
ATOM   6121  O  OG   . SER A 1 435 ? -6.156  46.972 48.033 1.00 33.85  ? 643  SER A OG   1 
ATOM   6122  H  H    . SER A 1 435 ? -8.499  47.828 47.017 1.00 43.86  ? 643  SER A H    1 
ATOM   6123  H  HA   . SER A 1 435 ? -9.128  45.932 48.788 1.00 41.30  ? 643  SER A HA   1 
ATOM   6124  H  HB2  . SER A 1 435 ? -6.941  45.310 48.710 1.00 39.99  ? 643  SER A HB2  1 
ATOM   6125  H  HB3  . SER A 1 435 ? -7.350  45.652 47.214 1.00 39.99  ? 643  SER A HB3  1 
ATOM   6126  H  HG   . SER A 1 435 ? -6.366  47.592 47.507 1.00 40.63  ? 643  SER A HG   1 
ATOM   6127  N  N    . LEU A 1 436 ? -8.261  48.725 49.883 1.00 33.35  ? 644  LEU A N    1 
ATOM   6128  C  CA   . LEU A 1 436 ? -8.283  49.514 51.103 1.00 33.15  ? 644  LEU A CA   1 
ATOM   6129  C  C    . LEU A 1 436 ? -9.714  49.585 51.629 1.00 34.35  ? 644  LEU A C    1 
ATOM   6130  O  O    . LEU A 1 436 ? -10.657 49.085 51.010 1.00 36.04  ? 644  LEU A O    1 
ATOM   6131  C  CB   . LEU A 1 436 ? -7.727  50.916 50.845 1.00 31.19  ? 644  LEU A CB   1 
ATOM   6132  C  CG   . LEU A 1 436 ? -6.239  51.009 50.490 1.00 32.66  ? 644  LEU A CG   1 
ATOM   6133  C  CD1  . LEU A 1 436 ? -5.918  52.335 49.806 1.00 31.98  ? 644  LEU A CD1  1 
ATOM   6134  C  CD2  . LEU A 1 436 ? -5.377  50.834 51.733 1.00 32.03  ? 644  LEU A CD2  1 
ATOM   6135  H  H    . LEU A 1 436 ? -8.260  49.196 49.164 1.00 40.03  ? 644  LEU A H    1 
ATOM   6136  H  HA   . LEU A 1 436 ? -7.730  49.085 51.775 1.00 39.78  ? 644  LEU A HA   1 
ATOM   6137  H  HB2  . LEU A 1 436 ? -8.223  51.307 50.109 1.00 37.43  ? 644  LEU A HB2  1 
ATOM   6138  H  HB3  . LEU A 1 436 ? -7.865  51.449 51.643 1.00 37.43  ? 644  LEU A HB3  1 
ATOM   6139  H  HG   . LEU A 1 436 ? -6.018  50.295 49.871 1.00 39.20  ? 644  LEU A HG   1 
ATOM   6140  H  HD11 . LEU A 1 436 ? -4.971  52.361 49.596 1.00 38.38  ? 644  LEU A HD11 1 
ATOM   6141  H  HD12 . LEU A 1 436 ? -6.440  52.405 48.992 1.00 38.38  ? 644  LEU A HD12 1 
ATOM   6142  H  HD13 . LEU A 1 436 ? -6.143  53.062 50.408 1.00 38.38  ? 644  LEU A HD13 1 
ATOM   6143  H  HD21 . LEU A 1 436 ? -4.442  50.897 51.481 1.00 38.44  ? 644  LEU A HD21 1 
ATOM   6144  H  HD22 . LEU A 1 436 ? -5.596  51.532 52.370 1.00 38.44  ? 644  LEU A HD22 1 
ATOM   6145  H  HD23 . LEU A 1 436 ? -5.557  49.964 52.122 1.00 38.44  ? 644  LEU A HD23 1 
ATOM   6146  N  N    . SER A 1 437 ? -9.884  50.208 52.789 1.00 35.03  ? 645  SER A N    1 
ATOM   6147  C  CA   . SER A 1 437 ? -11.204 50.536 53.305 1.00 36.49  ? 645  SER A CA   1 
ATOM   6148  C  C    . SER A 1 437 ? -11.446 52.032 53.151 1.00 35.44  ? 645  SER A C    1 
ATOM   6149  O  O    . SER A 1 437 ? -10.539 52.805 52.827 1.00 34.23  ? 645  SER A O    1 
ATOM   6150  C  CB   . SER A 1 437 ? -11.344 50.122 54.773 1.00 38.25  ? 645  SER A CB   1 
ATOM   6151  O  OG   . SER A 1 437 ? -10.679 51.039 55.626 1.00 39.49  ? 645  SER A OG   1 
ATOM   6152  H  H    . SER A 1 437 ? -9.240  50.455 53.302 1.00 42.03  ? 645  SER A H    1 
ATOM   6153  H  HA   . SER A 1 437 ? -11.877 50.064 52.789 1.00 43.80  ? 645  SER A HA   1 
ATOM   6154  H  HB2  . SER A 1 437 ? -12.285 50.100 55.006 1.00 45.90  ? 645  SER A HB2  1 
ATOM   6155  H  HB3  . SER A 1 437 ? -10.953 49.242 54.891 1.00 45.90  ? 645  SER A HB3  1 
ATOM   6156  H  HG   . SER A 1 437 ? -10.764 50.799 56.427 1.00 47.39  ? 645  SER A HG   1 
ATOM   6157  N  N    . ASP A 1 438 ? -12.695 52.439 53.382 1.00 36.61  ? 646  ASP A N    1 
ATOM   6158  C  CA   . ASP A 1 438 ? -13.007 53.863 53.357 1.00 36.98  ? 646  ASP A CA   1 
ATOM   6159  C  C    . ASP A 1 438 ? -12.226 54.613 54.429 1.00 34.76  ? 646  ASP A C    1 
ATOM   6160  O  O    . ASP A 1 438 ? -11.868 55.780 54.235 1.00 35.26  ? 646  ASP A O    1 
ATOM   6161  C  CB   . ASP A 1 438 ? -14.513 54.075 53.531 1.00 38.21  ? 646  ASP A CB   1 
ATOM   6162  C  CG   . ASP A 1 438 ? -15.316 53.639 52.308 1.00 43.56  ? 646  ASP A CG   1 
ATOM   6163  O  OD1  . ASP A 1 438 ? -14.811 53.778 51.173 1.00 43.60  ? 646  ASP A OD1  1 
ATOM   6164  O  OD2  . ASP A 1 438 ? -16.459 53.161 52.481 1.00 44.91  ? 646  ASP A OD2  1 
ATOM   6165  H  H    . ASP A 1 438 ? -13.363 51.924 53.550 1.00 43.93  ? 646  ASP A H    1 
ATOM   6166  H  HA   . ASP A 1 438 ? -12.752 54.225 52.494 1.00 44.38  ? 646  ASP A HA   1 
ATOM   6167  H  HB2  . ASP A 1 438 ? -14.819 53.557 54.292 1.00 45.86  ? 646  ASP A HB2  1 
ATOM   6168  H  HB3  . ASP A 1 438 ? -14.684 55.018 53.681 1.00 45.86  ? 646  ASP A HB3  1 
ATOM   6169  N  N    . VAL A 1 439 ? -11.933 53.957 55.553 1.00 33.50  ? 647  VAL A N    1 
ATOM   6170  C  CA   . VAL A 1 439 ? -11.181 54.603 56.628 1.00 34.68  ? 647  VAL A CA   1 
ATOM   6171  C  C    . VAL A 1 439 ? -9.738  54.849 56.198 1.00 31.78  ? 647  VAL A C    1 
ATOM   6172  O  O    . VAL A 1 439 ? -9.247  55.983 56.238 1.00 29.85  ? 647  VAL A O    1 
ATOM   6173  C  CB   . VAL A 1 439 ? -11.247 53.759 57.913 1.00 35.27  ? 647  VAL A CB   1 
ATOM   6174  C  CG1  . VAL A 1 439 ? -10.371 54.361 59.005 1.00 33.31  ? 647  VAL A CG1  1 
ATOM   6175  C  CG2  . VAL A 1 439 ? -12.689 53.639 58.395 1.00 37.20  ? 647  VAL A CG2  1 
ATOM   6176  H  H    . VAL A 1 439 ? -12.158 53.143 55.717 1.00 40.20  ? 647  VAL A H    1 
ATOM   6177  H  HA   . VAL A 1 439 ? -11.585 55.464 56.818 1.00 41.61  ? 647  VAL A HA   1 
ATOM   6178  H  HB   . VAL A 1 439 ? -10.919 52.866 57.723 1.00 42.33  ? 647  VAL A HB   1 
ATOM   6179  H  HG11 . VAL A 1 439 ? -10.434 53.809 59.800 1.00 39.98  ? 647  VAL A HG11 1 
ATOM   6180  H  HG12 . VAL A 1 439 ? -9.453  54.390 58.693 1.00 39.98  ? 647  VAL A HG12 1 
ATOM   6181  H  HG13 . VAL A 1 439 ? -10.683 55.259 59.200 1.00 39.98  ? 647  VAL A HG13 1 
ATOM   6182  H  HG21 . VAL A 1 439 ? -12.707 53.105 59.204 1.00 44.65  ? 647  VAL A HG21 1 
ATOM   6183  H  HG22 . VAL A 1 439 ? -13.035 54.527 58.577 1.00 44.65  ? 647  VAL A HG22 1 
ATOM   6184  H  HG23 . VAL A 1 439 ? -13.218 53.212 57.704 1.00 44.65  ? 647  VAL A HG23 1 
ATOM   6185  N  N    . THR A 1 440 ? -9.031  53.791 55.790 1.00 30.75  ? 648  THR A N    1 
ATOM   6186  C  CA   . THR A 1 440 ? -7.613  53.945 55.473 1.00 28.65  ? 648  THR A CA   1 
ATOM   6187  C  C    . THR A 1 440 ? -7.413  54.807 54.233 1.00 30.72  ? 648  THR A C    1 
ATOM   6188  O  O    . THR A 1 440 ? -6.462  55.598 54.169 1.00 32.23  ? 648  THR A O    1 
ATOM   6189  C  CB   . THR A 1 440 ? -6.946  52.576 55.299 1.00 29.46  ? 648  THR A CB   1 
ATOM   6190  O  OG1  . THR A 1 440 ? -7.702  51.765 54.390 1.00 31.04  ? 648  THR A OG1  1 
ATOM   6191  C  CG2  . THR A 1 440 ? -6.841  51.872 56.638 1.00 31.02  ? 648  THR A CG2  1 
ATOM   6192  H  H    . THR A 1 440 ? -9.340  52.995 55.692 1.00 36.90  ? 648  THR A H    1 
ATOM   6193  H  HA   . THR A 1 440 ? -7.177  54.392 56.215 1.00 34.39  ? 648  THR A HA   1 
ATOM   6194  H  HB   . THR A 1 440 ? -6.050  52.699 54.950 1.00 35.36  ? 648  THR A HB   1 
ATOM   6195  H  HG1  . THR A 1 440 ? -7.332  51.016 54.298 1.00 37.25  ? 648  THR A HG1  1 
ATOM   6196  H  HG21 . THR A 1 440 ? -6.418  51.007 56.525 1.00 37.22  ? 648  THR A HG21 1 
ATOM   6197  H  HG22 . THR A 1 440 ? -6.310  52.405 57.251 1.00 37.22  ? 648  THR A HG22 1 
ATOM   6198  H  HG23 . THR A 1 440 ? -7.725  51.745 57.016 1.00 37.22  ? 648  THR A HG23 1 
ATOM   6199  N  N    . LEU A 1 441 ? -8.301  54.687 53.245 1.00 29.64  ? 649  LEU A N    1 
ATOM   6200  C  CA   . LEU A 1 441 ? -8.218  55.554 52.075 1.00 31.70  ? 649  LEU A CA   1 
ATOM   6201  C  C    . LEU A 1 441 ? -8.377  57.018 52.473 1.00 31.66  ? 649  LEU A C    1 
ATOM   6202  O  O    . LEU A 1 441 ? -7.600  57.878 52.043 1.00 30.09  ? 649  LEU A O    1 
ATOM   6203  C  CB   . LEU A 1 441 ? -9.276  55.152 51.045 1.00 35.71  ? 649  LEU A CB   1 
ATOM   6204  C  CG   . LEU A 1 441 ? -9.286  55.936 49.727 1.00 36.24  ? 649  LEU A CG   1 
ATOM   6205  C  CD1  . LEU A 1 441 ? -7.996  55.718 48.944 1.00 33.96  ? 649  LEU A CD1  1 
ATOM   6206  C  CD2  . LEU A 1 441 ? -10.494 55.553 48.881 1.00 37.41  ? 649  LEU A CD2  1 
ATOM   6207  H  H    . LEU A 1 441 ? -8.950  54.122 53.230 1.00 35.57  ? 649  LEU A H    1 
ATOM   6208  H  HA   . LEU A 1 441 ? -7.345  55.448 51.665 1.00 38.04  ? 649  LEU A HA   1 
ATOM   6209  H  HB2  . LEU A 1 441 ? -9.142  54.217 50.822 1.00 42.85  ? 649  LEU A HB2  1 
ATOM   6210  H  HB3  . LEU A 1 441 ? -10.151 55.261 51.451 1.00 42.85  ? 649  LEU A HB3  1 
ATOM   6211  H  HG   . LEU A 1 441 ? -9.353  56.882 49.928 1.00 43.49  ? 649  LEU A HG   1 
ATOM   6212  H  HD11 . LEU A 1 441 ? -8.038  56.227 48.120 1.00 40.75  ? 649  LEU A HD11 1 
ATOM   6213  H  HD12 . LEU A 1 441 ? -7.246  56.018 49.482 1.00 40.75  ? 649  LEU A HD12 1 
ATOM   6214  H  HD13 . LEU A 1 441 ? -7.904  54.773 48.745 1.00 40.75  ? 649  LEU A HD13 1 
ATOM   6215  H  HD21 . LEU A 1 441 ? -10.475 56.062 48.056 1.00 44.89  ? 649  LEU A HD21 1 
ATOM   6216  H  HD22 . LEU A 1 441 ? -10.453 54.604 48.686 1.00 44.89  ? 649  LEU A HD22 1 
ATOM   6217  H  HD23 . LEU A 1 441 ? -11.302 55.755 49.377 1.00 44.89  ? 649  LEU A HD23 1 
ATOM   6218  N  N    . THR A 1 442 ? -9.380  57.319 53.306 1.00 32.28  ? 650  THR A N    1 
ATOM   6219  C  CA   . THR A 1 442 ? -9.595  58.693 53.756 1.00 30.53  ? 650  THR A CA   1 
ATOM   6220  C  C    . THR A 1 442 ? -8.357  59.247 54.451 1.00 28.24  ? 650  THR A C    1 
ATOM   6221  O  O    . THR A 1 442 ? -7.919  60.366 54.166 1.00 31.04  ? 650  THR A O    1 
ATOM   6222  C  CB   . THR A 1 442 ? -10.805 58.755 54.695 1.00 30.87  ? 650  THR A CB   1 
ATOM   6223  O  OG1  . THR A 1 442 ? -12.009 58.503 53.957 1.00 32.11  ? 650  THR A OG1  1 
ATOM   6224  C  CG2  . THR A 1 442 ? -10.910 60.125 55.376 1.00 29.38  ? 650  THR A CG2  1 
ATOM   6225  H  H    . THR A 1 442 ? -9.942  56.749 53.620 1.00 38.74  ? 650  THR A H    1 
ATOM   6226  H  HA   . THR A 1 442 ? -9.783  59.253 52.986 1.00 36.63  ? 650  THR A HA   1 
ATOM   6227  H  HB   . THR A 1 442 ? -10.708 58.081 55.386 1.00 37.04  ? 650  THR A HB   1 
ATOM   6228  H  HG1  . THR A 1 442 ? -11.975 57.741 53.604 1.00 38.53  ? 650  THR A HG1  1 
ATOM   6229  H  HG21 . THR A 1 442 ? -11.680 60.144 55.965 1.00 35.26  ? 650  THR A HG21 1 
ATOM   6230  H  HG22 . THR A 1 442 ? -10.110 60.298 55.898 1.00 35.26  ? 650  THR A HG22 1 
ATOM   6231  H  HG23 . THR A 1 442 ? -11.007 60.821 54.708 1.00 35.26  ? 650  THR A HG23 1 
ATOM   6232  N  N    . LEU A 1 443 ? -7.777  58.473 55.371 1.00 27.86  ? 651  LEU A N    1 
ATOM   6233  C  CA   . LEU A 1 443 ? -6.691  58.982 56.203 1.00 30.80  ? 651  LEU A CA   1 
ATOM   6234  C  C    . LEU A 1 443 ? -5.365  59.037 55.450 1.00 29.21  ? 651  LEU A C    1 
ATOM   6235  O  O    . LEU A 1 443 ? -4.588  59.981 55.633 1.00 26.25  ? 651  LEU A O    1 
ATOM   6236  C  CB   . LEU A 1 443 ? -6.564  58.128 57.465 1.00 34.59  ? 651  LEU A CB   1 
ATOM   6237  C  CG   . LEU A 1 443 ? -7.634  58.449 58.514 1.00 37.00  ? 651  LEU A CG   1 
ATOM   6238  C  CD1  . LEU A 1 443 ? -7.755  57.343 59.543 1.00 34.81  ? 651  LEU A CD1  1 
ATOM   6239  C  CD2  . LEU A 1 443 ? -7.323  59.775 59.200 1.00 40.04  ? 651  LEU A CD2  1 
ATOM   6240  H  H    . LEU A 1 443 ? -7.993  57.656 55.531 1.00 33.44  ? 651  LEU A H    1 
ATOM   6241  H  HA   . LEU A 1 443 ? -6.909  59.886 56.479 1.00 36.96  ? 651  LEU A HA   1 
ATOM   6242  H  HB2  . LEU A 1 443 ? -6.653  57.193 57.224 1.00 41.51  ? 651  LEU A HB2  1 
ATOM   6243  H  HB3  . LEU A 1 443 ? -5.695  58.286 57.867 1.00 41.51  ? 651  LEU A HB3  1 
ATOM   6244  H  HG   . LEU A 1 443 ? -8.492  58.538 58.070 1.00 44.40  ? 651  LEU A HG   1 
ATOM   6245  H  HD11 . LEU A 1 443 ? -8.440  57.584 60.186 1.00 41.77  ? 651  LEU A HD11 1 
ATOM   6246  H  HD12 . LEU A 1 443 ? -7.999  56.519 59.092 1.00 41.77  ? 651  LEU A HD12 1 
ATOM   6247  H  HD13 . LEU A 1 443 ? -6.902  57.235 59.992 1.00 41.77  ? 651  LEU A HD13 1 
ATOM   6248  H  HD21 . LEU A 1 443 ? -8.012  59.959 59.858 1.00 48.04  ? 651  LEU A HD21 1 
ATOM   6249  H  HD22 . LEU A 1 443 ? -6.458  59.711 59.634 1.00 48.04  ? 651  LEU A HD22 1 
ATOM   6250  H  HD23 . LEU A 1 443 ? -7.307  60.479 58.532 1.00 48.04  ? 651  LEU A HD23 1 
ATOM   6251  N  N    . TYR A 1 444 ? -5.080  58.041 54.608 1.00 28.06  ? 652  TYR A N    1 
ATOM   6252  C  CA   . TYR A 1 444 ? -3.878  58.109 53.784 1.00 29.31  ? 652  TYR A CA   1 
ATOM   6253  C  C    . TYR A 1 444 ? -3.892  59.353 52.902 1.00 27.97  ? 652  TYR A C    1 
ATOM   6254  O  O    . TYR A 1 444 ? -2.855  59.998 52.706 1.00 32.84  ? 652  TYR A O    1 
ATOM   6255  C  CB   . TYR A 1 444 ? -3.748  56.847 52.926 1.00 28.48  ? 652  TYR A CB   1 
ATOM   6256  C  CG   . TYR A 1 444 ? -3.477  55.557 53.693 1.00 26.64  ? 652  TYR A CG   1 
ATOM   6257  C  CD1  . TYR A 1 444 ? -3.005  55.575 54.999 1.00 24.77  ? 652  TYR A CD1  1 
ATOM   6258  C  CD2  . TYR A 1 444 ? -3.700  54.318 53.097 1.00 27.38  ? 652  TYR A CD2  1 
ATOM   6259  C  CE1  . TYR A 1 444 ? -2.758  54.390 55.692 1.00 28.95  ? 652  TYR A CE1  1 
ATOM   6260  C  CE2  . TYR A 1 444 ? -3.453  53.135 53.778 1.00 30.33  ? 652  TYR A CE2  1 
ATOM   6261  C  CZ   . TYR A 1 444 ? -2.986  53.176 55.073 1.00 30.79  ? 652  TYR A CZ   1 
ATOM   6262  O  OH   . TYR A 1 444 ? -2.745  51.999 55.751 1.00 31.86  ? 652  TYR A OH   1 
ATOM   6263  H  H    . TYR A 1 444 ? -5.556  57.333 54.498 1.00 33.67  ? 652  TYR A H    1 
ATOM   6264  H  HA   . TYR A 1 444 ? -3.101  58.160 54.362 1.00 35.17  ? 652  TYR A HA   1 
ATOM   6265  H  HB2  . TYR A 1 444 ? -4.574  56.724 52.433 1.00 34.18  ? 652  TYR A HB2  1 
ATOM   6266  H  HB3  . TYR A 1 444 ? -3.015  56.974 52.303 1.00 34.18  ? 652  TYR A HB3  1 
ATOM   6267  H  HD1  . TYR A 1 444 ? -2.849  56.391 55.417 1.00 29.72  ? 652  TYR A HD1  1 
ATOM   6268  H  HD2  . TYR A 1 444 ? -4.014  54.284 52.222 1.00 32.86  ? 652  TYR A HD2  1 
ATOM   6269  H  HE1  . TYR A 1 444 ? -2.441  54.417 56.566 1.00 34.74  ? 652  TYR A HE1  1 
ATOM   6270  H  HE2  . TYR A 1 444 ? -3.608  52.317 53.363 1.00 36.40  ? 652  TYR A HE2  1 
ATOM   6271  H  HH   . TYR A 1 444 ? -2.925  51.342 55.259 1.00 38.24  ? 652  TYR A HH   1 
ATOM   6272  N  N    . HIS A 1 445 ? -5.058  59.706 52.359 1.00 27.72  ? 653  HIS A N    1 
ATOM   6273  C  CA   . HIS A 1 445 ? -5.171  60.940 51.584 1.00 32.25  ? 653  HIS A CA   1 
ATOM   6274  C  C    . HIS A 1 445 ? -4.843  62.159 52.437 1.00 30.21  ? 653  HIS A C    1 
ATOM   6275  O  O    . HIS A 1 445 ? -4.189  63.098 51.968 1.00 34.17  ? 653  HIS A O    1 
ATOM   6276  C  CB   . HIS A 1 445 ? -6.580  61.071 51.010 1.00 33.65  ? 653  HIS A CB   1 
ATOM   6277  C  CG   . HIS A 1 445 ? -6.726  60.527 49.626 1.00 35.23  ? 653  HIS A CG   1 
ATOM   6278  N  ND1  . HIS A 1 445 ? -6.618  61.317 48.501 1.00 36.26  ? 653  HIS A ND1  1 
ATOM   6279  C  CD2  . HIS A 1 445 ? -6.985  59.275 49.184 1.00 35.95  ? 653  HIS A CD2  1 
ATOM   6280  C  CE1  . HIS A 1 445 ? -6.800  60.573 47.426 1.00 37.20  ? 653  HIS A CE1  1 
ATOM   6281  N  NE2  . HIS A 1 445 ? -7.023  59.330 47.812 1.00 36.71  ? 653  HIS A NE2  1 
ATOM   6282  H  H    . HIS A 1 445 ? -5.787  59.255 52.423 1.00 33.27  ? 653  HIS A H    1 
ATOM   6283  H  HA   . HIS A 1 445 ? -4.544  60.910 50.845 1.00 38.70  ? 653  HIS A HA   1 
ATOM   6284  H  HB2  . HIS A 1 445 ? -7.197  60.590 51.583 1.00 40.38  ? 653  HIS A HB2  1 
ATOM   6285  H  HB3  . HIS A 1 445 ? -6.820  62.011 50.985 1.00 40.38  ? 653  HIS A HB3  1 
ATOM   6286  H  HD2  . HIS A 1 445 ? -7.111  58.518 49.710 1.00 43.14  ? 653  HIS A HD2  1 
ATOM   6287  H  HE1  . HIS A 1 445 ? -6.773  60.872 46.546 1.00 44.64  ? 653  HIS A HE1  1 
ATOM   6288  H  HE2  . HIS A 1 445 ? -7.169  58.662 47.290 1.00 44.06  ? 653  HIS A HE2  1 
ATOM   6289  N  N    . SER A 1 446 ? -5.297  62.163 53.691 1.00 26.79  ? 654  SER A N    1 
ATOM   6290  C  CA   . SER A 1 446 ? -5.093  63.319 54.559 1.00 29.03  ? 654  SER A CA   1 
ATOM   6291  C  C    . SER A 1 446 ? -3.635  63.440 54.996 1.00 28.13  ? 654  SER A C    1 
ATOM   6292  O  O    . SER A 1 446 ? -3.112  64.553 55.121 1.00 30.54  ? 654  SER A O    1 
ATOM   6293  C  CB   . SER A 1 446 ? -6.020  63.221 55.771 1.00 28.11  ? 654  SER A CB   1 
ATOM   6294  O  OG   . SER A 1 446 ? -5.927  64.372 56.598 1.00 32.86  ? 654  SER A OG   1 
ATOM   6295  H  H    . SER A 1 446 ? -5.723  61.513 54.060 1.00 32.15  ? 654  SER A H    1 
ATOM   6296  H  HA   . SER A 1 446 ? -5.325  64.124 54.069 1.00 34.84  ? 654  SER A HA   1 
ATOM   6297  H  HB2  . SER A 1 446 ? -6.934  63.133 55.460 1.00 33.73  ? 654  SER A HB2  1 
ATOM   6298  H  HB3  . SER A 1 446 ? -5.773  62.441 56.292 1.00 33.73  ? 654  SER A HB3  1 
ATOM   6299  H  HG   . SER A 1 446 ? -6.140  65.057 56.161 1.00 39.44  ? 654  SER A HG   1 
ATOM   6300  N  N    . PHE A 1 447 ? -2.967  62.311 55.246 1.00 31.74  ? 655  PHE A N    1 
ATOM   6301  C  CA   . PHE A 1 447 ? -1.544  62.349 55.576 1.00 28.72  ? 655  PHE A CA   1 
ATOM   6302  C  C    . PHE A 1 447 ? -0.734  62.953 54.437 1.00 27.44  ? 655  PHE A C    1 
ATOM   6303  O  O    . PHE A 1 447 ? 0.222   63.704 54.673 1.00 26.57  ? 655  PHE A O    1 
ATOM   6304  C  CB   . PHE A 1 447 ? -1.021  60.940 55.877 1.00 31.36  ? 655  PHE A CB   1 
ATOM   6305  C  CG   . PHE A 1 447 ? -1.627  60.294 57.094 1.00 31.96  ? 655  PHE A CG   1 
ATOM   6306  C  CD1  . PHE A 1 447 ? -2.114  61.050 58.147 1.00 35.48  ? 655  PHE A CD1  1 
ATOM   6307  C  CD2  . PHE A 1 447 ? -1.686  58.912 57.185 1.00 31.47  ? 655  PHE A CD2  1 
ATOM   6308  C  CE1  . PHE A 1 447 ? -2.660  60.438 59.262 1.00 36.44  ? 655  PHE A CE1  1 
ATOM   6309  C  CE2  . PHE A 1 447 ? -2.230  58.298 58.294 1.00 33.07  ? 655  PHE A CE2  1 
ATOM   6310  C  CZ   . PHE A 1 447 ? -2.717  59.060 59.334 1.00 36.01  ? 655  PHE A CZ   1 
ATOM   6311  H  H    . PHE A 1 447 ? -3.310  61.522 55.231 1.00 38.10  ? 655  PHE A H    1 
ATOM   6312  H  HA   . PHE A 1 447 ? -1.413  62.897 56.366 1.00 34.47  ? 655  PHE A HA   1 
ATOM   6313  H  HB2  . PHE A 1 447 ? -1.212  60.370 55.116 1.00 37.63  ? 655  PHE A HB2  1 
ATOM   6314  H  HB3  . PHE A 1 447 ? -0.063  60.989 56.016 1.00 37.63  ? 655  PHE A HB3  1 
ATOM   6315  H  HD1  . PHE A 1 447 ? -2.078  61.978 58.102 1.00 42.58  ? 655  PHE A HD1  1 
ATOM   6316  H  HD2  . PHE A 1 447 ? -1.360  58.392 56.487 1.00 37.76  ? 655  PHE A HD2  1 
ATOM   6317  H  HE1  . PHE A 1 447 ? -2.988  60.954 59.962 1.00 43.73  ? 655  PHE A HE1  1 
ATOM   6318  H  HE2  . PHE A 1 447 ? -2.267  57.369 58.340 1.00 39.69  ? 655  PHE A HE2  1 
ATOM   6319  H  HZ   . PHE A 1 447 ? -3.084  58.648 60.082 1.00 43.21  ? 655  PHE A HZ   1 
ATOM   6320  N  N    . ALA A 1 448 ? -1.085  62.612 53.194 1.00 26.49  ? 656  ALA A N    1 
ATOM   6321  C  CA   . ALA A 1 448 ? -0.374  63.162 52.046 1.00 29.51  ? 656  ALA A CA   1 
ATOM   6322  C  C    . ALA A 1 448 ? -0.542  64.675 51.970 1.00 29.46  ? 656  ALA A C    1 
ATOM   6323  O  O    . ALA A 1 448 ? 0.426   65.403 51.722 1.00 30.57  ? 656  ALA A O    1 
ATOM   6324  C  CB   . ALA A 1 448 ? -0.866  62.499 50.760 1.00 30.65  ? 656  ALA A CB   1 
ATOM   6325  H  H    . ALA A 1 448 ? -1.723  62.072 52.994 1.00 31.79  ? 656  ALA A H    1 
ATOM   6326  H  HA   . ALA A 1 448 ? 0.572   62.971 52.139 1.00 35.42  ? 656  ALA A HA   1 
ATOM   6327  H  HB1  . ALA A 1 448 ? -0.384  62.875 50.007 1.00 36.78  ? 656  ALA A HB1  1 
ATOM   6328  H  HB2  . ALA A 1 448 ? -0.701  61.544 50.815 1.00 36.78  ? 656  ALA A HB2  1 
ATOM   6329  H  HB3  . ALA A 1 448 ? -1.816  62.666 50.662 1.00 36.78  ? 656  ALA A HB3  1 
ATOM   6330  N  N    . ARG A 1 449 ? -1.764  65.169 52.185 1.00 31.21  ? 657  ARG A N    1 
ATOM   6331  C  CA   . ARG A 1 449 ? -1.984  66.612 52.181 1.00 32.98  ? 657  ARG A CA   1 
ATOM   6332  C  C    . ARG A 1 449 ? -1.218  67.284 53.314 1.00 32.90  ? 657  ARG A C    1 
ATOM   6333  O  O    . ARG A 1 449 ? -0.701  68.395 53.150 1.00 31.51  ? 657  ARG A O    1 
ATOM   6334  C  CB   . ARG A 1 449 ? -3.478  66.918 52.284 1.00 34.48  ? 657  ARG A CB   1 
ATOM   6335  C  CG   . ARG A 1 449 ? -4.272  66.551 51.039 1.00 34.71  ? 657  ARG A CG   1 
ATOM   6336  C  CD   . ARG A 1 449 ? -5.678  67.130 51.080 1.00 36.47  ? 657  ARG A CD   1 
ATOM   6337  N  NE   . ARG A 1 449 ? -6.465  66.587 52.184 1.00 37.15  ? 657  ARG A NE   1 
ATOM   6338  C  CZ   . ARG A 1 449 ? -7.268  65.529 52.094 1.00 35.81  ? 657  ARG A CZ   1 
ATOM   6339  N  NH1  . ARG A 1 449 ? -7.408  64.882 50.944 1.00 29.05  ? 657  ARG A NH1  1 
ATOM   6340  N  NH2  . ARG A 1 449 ? -7.938  65.118 53.163 1.00 37.70  ? 657  ARG A NH2  1 
ATOM   6341  H  H    . ARG A 1 449 ? -2.468  64.698 52.334 1.00 37.45  ? 657  ARG A H    1 
ATOM   6342  H  HA   . ARG A 1 449 ? -1.661  66.978 51.343 1.00 39.58  ? 657  ARG A HA   1 
ATOM   6343  H  HB2  . ARG A 1 449 ? -3.848  66.419 53.029 1.00 41.38  ? 657  ARG A HB2  1 
ATOM   6344  H  HB3  . ARG A 1 449 ? -3.592  67.869 52.438 1.00 41.38  ? 657  ARG A HB3  1 
ATOM   6345  H  HG2  . ARG A 1 449 ? -3.821  66.904 50.256 1.00 41.65  ? 657  ARG A HG2  1 
ATOM   6346  H  HG3  . ARG A 1 449 ? -4.343  65.586 50.978 1.00 41.65  ? 657  ARG A HG3  1 
ATOM   6347  H  HD2  . ARG A 1 449 ? -5.622  68.092 51.193 1.00 43.77  ? 657  ARG A HD2  1 
ATOM   6348  H  HD3  . ARG A 1 449 ? -6.134  66.917 50.251 1.00 43.77  ? 657  ARG A HD3  1 
ATOM   6349  H  HE   . ARG A 1 449 ? -6.405  66.978 52.948 1.00 44.58  ? 657  ARG A HE   1 
ATOM   6350  H  HH11 . ARG A 1 449 ? -6.977  65.143 50.248 1.00 34.87  ? 657  ARG A HH11 1 
ATOM   6351  H  HH12 . ARG A 1 449 ? -7.930  64.200 50.895 1.00 34.87  ? 657  ARG A HH12 1 
ATOM   6352  H  HH21 . ARG A 1 449 ? -7.851  65.534 53.911 1.00 45.24  ? 657  ARG A HH21 1 
ATOM   6353  H  HH22 . ARG A 1 449 ? -8.458  64.436 53.108 1.00 45.24  ? 657  ARG A HH22 1 
ATOM   6354  N  N    . LEU A 1 450 ? -1.125  66.620 54.468 1.00 32.07  ? 658  LEU A N    1 
ATOM   6355  C  CA   . LEU A 1 450 ? -0.355  67.172 55.579 1.00 35.03  ? 658  LEU A CA   1 
ATOM   6356  C  C    . LEU A 1 450 ? 1.109   67.353 55.191 1.00 33.66  ? 658  LEU A C    1 
ATOM   6357  O  O    . LEU A 1 450 ? 1.761   68.309 55.626 1.00 29.90  ? 658  LEU A O    1 
ATOM   6358  C  CB   . LEU A 1 450 ? -0.478  66.259 56.802 1.00 35.76  ? 658  LEU A CB   1 
ATOM   6359  C  CG   . LEU A 1 450 ? 0.047   66.815 58.128 1.00 36.51  ? 658  LEU A CG   1 
ATOM   6360  C  CD1  . LEU A 1 450 ? -0.832  67.955 58.633 1.00 37.00  ? 658  LEU A CD1  1 
ATOM   6361  C  CD2  . LEU A 1 450 ? 0.152   65.709 59.171 1.00 37.17  ? 658  LEU A CD2  1 
ATOM   6362  H  H    . LEU A 1 450 ? -1.493  65.860 54.630 1.00 38.49  ? 658  LEU A H    1 
ATOM   6363  H  HA   . LEU A 1 450 ? -0.714  68.041 55.814 1.00 42.04  ? 658  LEU A HA   1 
ATOM   6364  H  HB2  . LEU A 1 450 ? -1.416  66.050 56.930 1.00 42.92  ? 658  LEU A HB2  1 
ATOM   6365  H  HB3  . LEU A 1 450 ? 0.011   65.441 56.620 1.00 42.92  ? 658  LEU A HB3  1 
ATOM   6366  H  HG   . LEU A 1 450 ? 0.938   67.171 57.985 1.00 43.82  ? 658  LEU A HG   1 
ATOM   6367  H  HD11 . LEU A 1 450 ? -0.473  68.283 59.472 1.00 44.41  ? 658  LEU A HD11 1 
ATOM   6368  H  HD12 . LEU A 1 450 ? -0.836  68.666 57.973 1.00 44.41  ? 658  LEU A HD12 1 
ATOM   6369  H  HD13 . LEU A 1 450 ? -1.734  67.623 58.766 1.00 44.41  ? 658  LEU A HD13 1 
ATOM   6370  H  HD21 . LEU A 1 450 ? 0.486   66.088 60.000 1.00 44.60  ? 658  LEU A HD21 1 
ATOM   6371  H  HD22 . LEU A 1 450 ? -0.727  65.326 59.314 1.00 44.60  ? 658  LEU A HD22 1 
ATOM   6372  H  HD23 . LEU A 1 450 ? 0.762   65.028 58.849 1.00 44.60  ? 658  LEU A HD23 1 
ATOM   6373  N  N    . GLY A 1 451 ? 1.640   66.442 54.372 1.00 30.03  ? 659  GLY A N    1 
ATOM   6374  C  CA   . GLY A 1 451 ? 3.017   66.572 53.925 1.00 29.63  ? 659  GLY A CA   1 
ATOM   6375  C  C    . GLY A 1 451 ? 3.208   67.700 52.927 1.00 30.96  ? 659  GLY A C    1 
ATOM   6376  O  O    . GLY A 1 451 ? 4.215   68.411 52.970 1.00 33.63  ? 659  GLY A O    1 
ATOM   6377  H  H    . GLY A 1 451 ? 1.228   65.752 54.068 1.00 36.04  ? 659  GLY A H    1 
ATOM   6378  H  HA2  . GLY A 1 451 ? 3.589   66.741 54.689 1.00 35.55  ? 659  GLY A HA2  1 
ATOM   6379  H  HA3  . GLY A 1 451 ? 3.299   65.743 53.507 1.00 35.55  ? 659  GLY A HA3  1 
ATOM   6380  N  N    . LEU A 1 452 ? 2.252   67.875 52.009 1.00 29.43  ? 660  LEU A N    1 
ATOM   6381  C  CA   . LEU A 1 452 ? 2.336   68.987 51.065 1.00 29.97  ? 660  LEU A CA   1 
ATOM   6382  C  C    . LEU A 1 452 ? 2.309   70.325 51.791 1.00 30.82  ? 660  LEU A C    1 
ATOM   6383  O  O    . LEU A 1 452 ? 2.980   71.279 51.377 1.00 33.08  ? 660  LEU A O    1 
ATOM   6384  C  CB   . LEU A 1 452 ? 1.193   68.915 50.048 1.00 29.69  ? 660  LEU A CB   1 
ATOM   6385  C  CG   . LEU A 1 452 ? 1.124   67.677 49.144 1.00 29.78  ? 660  LEU A CG   1 
ATOM   6386  C  CD1  . LEU A 1 452 ? -0.009  67.814 48.133 1.00 29.73  ? 660  LEU A CD1  1 
ATOM   6387  C  CD2  . LEU A 1 452 ? 2.444   67.449 48.431 1.00 29.45  ? 660  LEU A CD2  1 
ATOM   6388  H  H    . LEU A 1 452 ? 1.559   67.374 51.916 1.00 35.32  ? 660  LEU A H    1 
ATOM   6389  H  HA   . LEU A 1 452 ? 3.173   68.926 50.579 1.00 35.96  ? 660  LEU A HA   1 
ATOM   6390  H  HB2  . LEU A 1 452 ? 0.355   68.957 50.536 1.00 35.63  ? 660  LEU A HB2  1 
ATOM   6391  H  HB3  . LEU A 1 452 ? 1.260   69.688 49.466 1.00 35.63  ? 660  LEU A HB3  1 
ATOM   6392  H  HG   . LEU A 1 452 ? 0.942   66.898 49.692 1.00 35.74  ? 660  LEU A HG   1 
ATOM   6393  H  HD11 . LEU A 1 452 ? -0.031  67.021 47.575 1.00 35.67  ? 660  LEU A HD11 1 
ATOM   6394  H  HD12 . LEU A 1 452 ? -0.848  67.907 48.610 1.00 35.67  ? 660  LEU A HD12 1 
ATOM   6395  H  HD13 . LEU A 1 452 ? 0.150   68.600 47.586 1.00 35.67  ? 660  LEU A HD13 1 
ATOM   6396  H  HD21 . LEU A 1 452 ? 2.367   66.662 47.870 1.00 35.34  ? 660  LEU A HD21 1 
ATOM   6397  H  HD22 . LEU A 1 452 ? 2.646   68.226 47.887 1.00 35.34  ? 660  LEU A HD22 1 
ATOM   6398  H  HD23 . LEU A 1 452 ? 3.141   67.318 49.093 1.00 35.34  ? 660  LEU A HD23 1 
ATOM   6399  N  N    . ARG A 1 453 ? 1.530   70.420 52.872 1.00 32.38  ? 661  ARG A N    1 
ATOM   6400  C  CA   . ARG A 1 453 ? 1.478   71.664 53.634 1.00 31.92  ? 661  ARG A CA   1 
ATOM   6401  C  C    . ARG A 1 453 ? 2.802   71.928 54.342 1.00 32.60  ? 661  ARG A C    1 
ATOM   6402  O  O    . ARG A 1 453 ? 3.225   73.084 54.466 1.00 32.18  ? 661  ARG A O    1 
ATOM   6403  C  CB   . ARG A 1 453 ? 0.322   71.625 54.637 1.00 36.64  ? 661  ARG A CB   1 
ATOM   6404  C  CG   . ARG A 1 453 ? -1.058  71.593 53.980 1.00 42.95  ? 661  ARG A CG   1 
ATOM   6405  C  CD   . ARG A 1 453 ? -2.183  72.013 54.927 1.00 44.66  ? 661  ARG A CD   1 
ATOM   6406  N  NE   . ARG A 1 453 ? -2.446  71.042 55.991 1.00 43.22  ? 661  ARG A NE   1 
ATOM   6407  C  CZ   . ARG A 1 453 ? -3.211  69.960 55.857 1.00 41.69  ? 661  ARG A CZ   1 
ATOM   6408  N  NH1  . ARG A 1 453 ? -3.792  69.680 54.695 1.00 40.80  ? 661  ARG A NH1  1 
ATOM   6409  N  NH2  . ARG A 1 453 ? -3.393  69.147 56.890 1.00 40.42  ? 661  ARG A NH2  1 
ATOM   6410  H  H    . ARG A 1 453 ? 1.033   69.789 53.179 1.00 38.86  ? 661  ARG A H    1 
ATOM   6411  H  HA   . ARG A 1 453 ? 1.316   72.400 53.023 1.00 38.31  ? 661  ARG A HA   1 
ATOM   6412  H  HB2  . ARG A 1 453 ? 0.409   70.829 55.185 1.00 43.97  ? 661  ARG A HB2  1 
ATOM   6413  H  HB3  . ARG A 1 453 ? 0.366   72.416 55.197 1.00 43.97  ? 661  ARG A HB3  1 
ATOM   6414  H  HG2  . ARG A 1 453 ? -1.060  72.200 53.224 1.00 51.54  ? 661  ARG A HG2  1 
ATOM   6415  H  HG3  . ARG A 1 453 ? -1.242  70.689 53.679 1.00 51.54  ? 661  ARG A HG3  1 
ATOM   6416  H  HD2  . ARG A 1 453 ? -1.943  72.854 55.345 1.00 53.60  ? 661  ARG A HD2  1 
ATOM   6417  H  HD3  . ARG A 1 453 ? -3.000  72.121 54.414 1.00 53.60  ? 661  ARG A HD3  1 
ATOM   6418  H  HE   . ARG A 1 453 ? -2.081  71.180 56.757 1.00 51.87  ? 661  ARG A HE   1 
ATOM   6419  H  HH11 . ARG A 1 453 ? -3.680  70.204 54.022 1.00 48.96  ? 661  ARG A HH11 1 
ATOM   6420  H  HH12 . ARG A 1 453 ? -4.282  68.978 54.617 1.00 48.96  ? 661  ARG A HH12 1 
ATOM   6421  H  HH21 . ARG A 1 453 ? -3.018  69.319 57.644 1.00 48.51  ? 661  ARG A HH21 1 
ATOM   6422  H  HH22 . ARG A 1 453 ? -3.883  68.445 56.803 1.00 48.51  ? 661  ARG A HH22 1 
ATOM   6423  N  N    . ARG A 1 454 ? 3.473   70.871 54.811 1.00 31.93  ? 662  ARG A N    1 
ATOM   6424  C  CA   . ARG A 1 454 ? 4.803   71.042 55.388 1.00 39.37  ? 662  ARG A CA   1 
ATOM   6425  C  C    . ARG A 1 454 ? 5.790   71.560 54.349 1.00 38.48  ? 662  ARG A C    1 
ATOM   6426  O  O    . ARG A 1 454 ? 6.595   72.453 54.639 1.00 36.80  ? 662  ARG A O    1 
ATOM   6427  C  CB   . ARG A 1 454 ? 5.300   69.723 55.988 1.00 44.85  ? 662  ARG A CB   1 
ATOM   6428  C  CG   . ARG A 1 454 ? 6.825   69.624 56.081 1.00 57.69  ? 662  ARG A CG   1 
ATOM   6429  C  CD   . ARG A 1 454 ? 7.305   69.035 57.389 1.00 69.86  ? 662  ARG A CD   1 
ATOM   6430  N  NE   . ARG A 1 454 ? 8.753   69.193 57.523 1.00 79.84  ? 662  ARG A NE   1 
ATOM   6431  C  CZ   . ARG A 1 454 ? 9.411   69.208 58.679 1.00 87.00  ? 662  ARG A CZ   1 
ATOM   6432  N  NH1  . ARG A 1 454 ? 8.759   69.081 59.828 1.00 89.59  ? 662  ARG A NH1  1 
ATOM   6433  N  NH2  . ARG A 1 454 ? 10.729  69.359 58.686 1.00 89.74  ? 662  ARG A NH2  1 
ATOM   6434  H  H    . ARG A 1 454 ? 3.184   70.061 54.805 1.00 38.31  ? 662  ARG A H    1 
ATOM   6435  H  HA   . ARG A 1 454 ? 4.753   71.695 56.104 1.00 47.24  ? 662  ARG A HA   1 
ATOM   6436  H  HB2  . ARG A 1 454 ? 4.942   69.632 56.884 1.00 53.83  ? 662  ARG A HB2  1 
ATOM   6437  H  HB3  . ARG A 1 454 ? 4.989   68.990 55.433 1.00 53.83  ? 662  ARG A HB3  1 
ATOM   6438  H  HG2  . ARG A 1 454 ? 7.148   69.059 55.363 1.00 69.23  ? 662  ARG A HG2  1 
ATOM   6439  H  HG3  . ARG A 1 454 ? 7.203   70.513 55.998 1.00 69.23  ? 662  ARG A HG3  1 
ATOM   6440  H  HD2  . ARG A 1 454 ? 6.876   69.495 58.127 1.00 83.83  ? 662  ARG A HD2  1 
ATOM   6441  H  HD3  . ARG A 1 454 ? 7.096   68.088 57.412 1.00 83.83  ? 662  ARG A HD3  1 
ATOM   6442  H  HE   . ARG A 1 454 ? 9.213   69.283 56.802 1.00 95.81  ? 662  ARG A HE   1 
ATOM   6443  H  HH11 . ARG A 1 454 ? 7.904   68.984 59.829 1.00 107.51 ? 662  ARG A HH11 1 
ATOM   6444  H  HH12 . ARG A 1 454 ? 9.191   69.093 60.571 1.00 107.51 ? 662  ARG A HH12 1 
ATOM   6445  H  HH21 . ARG A 1 454 ? 11.156  69.443 57.944 1.00 107.69 ? 662  ARG A HH21 1 
ATOM   6446  H  HH22 . ARG A 1 454 ? 11.157  69.370 59.432 1.00 107.69 ? 662  ARG A HH22 1 
ATOM   6447  N  N    . ALA A 1 455 ? 5.762   70.998 53.139 1.00 37.92  ? 663  ALA A N    1 
ATOM   6448  C  CA   . ALA A 1 455 ? 6.658   71.476 52.092 1.00 37.46  ? 663  ALA A CA   1 
ATOM   6449  C  C    . ALA A 1 455 ? 6.480   72.970 51.862 1.00 40.35  ? 663  ALA A C    1 
ATOM   6450  O  O    . ALA A 1 455 ? 7.462   73.706 51.710 1.00 41.14  ? 663  ALA A O    1 
ATOM   6451  C  CB   . ALA A 1 455 ? 6.410   70.703 50.797 1.00 36.02  ? 663  ALA A CB   1 
ATOM   6452  H  H    . ALA A 1 455 ? 5.244   70.353 52.905 1.00 45.50  ? 663  ALA A H    1 
ATOM   6453  H  HA   . ALA A 1 455 ? 7.575   71.320 52.364 1.00 44.95  ? 663  ALA A HA   1 
ATOM   6454  H  HB1  . ALA A 1 455 ? 7.013   71.033 50.113 1.00 43.23  ? 663  ALA A HB1  1 
ATOM   6455  H  HB2  . ALA A 1 455 ? 6.574   69.760 50.957 1.00 43.23  ? 663  ALA A HB2  1 
ATOM   6456  H  HB3  . ALA A 1 455 ? 5.490   70.838 50.521 1.00 43.23  ? 663  ALA A HB3  1 
ATOM   6457  N  N    . GLU A 1 456 ? 5.233   73.440 51.851 1.00 43.41  ? 664  GLU A N    1 
ATOM   6458  C  CA   . GLU A 1 456 ? 4.977   74.839 51.527 1.00 46.93  ? 664  GLU A CA   1 
ATOM   6459  C  C    . GLU A 1 456 ? 5.499   75.771 52.616 1.00 44.49  ? 664  GLU A C    1 
ATOM   6460  O  O    . GLU A 1 456 ? 6.101   76.808 52.313 1.00 42.49  ? 664  GLU A O    1 
ATOM   6461  C  CB   . GLU A 1 456 ? 3.481   75.060 51.307 1.00 54.53  ? 664  GLU A CB   1 
ATOM   6462  C  CG   . GLU A 1 456 ? 3.124   76.500 50.952 1.00 64.86  ? 664  GLU A CG   1 
ATOM   6463  C  CD   . GLU A 1 456 ? 1.638   76.698 50.739 1.00 72.46  ? 664  GLU A CD   1 
ATOM   6464  O  OE1  . GLU A 1 456 ? 0.852   75.826 51.166 1.00 73.99  ? 664  GLU A OE1  1 
ATOM   6465  O  OE2  . GLU A 1 456 ? 1.259   77.726 50.140 1.00 77.04  ? 664  GLU A OE2  1 
ATOM   6466  H  H    . GLU A 1 456 ? 4.530   72.977 52.024 1.00 52.10  ? 664  GLU A H    1 
ATOM   6467  H  HA   . GLU A 1 456 ? 5.436   75.059 50.701 1.00 56.32  ? 664  GLU A HA   1 
ATOM   6468  H  HB2  . GLU A 1 456 ? 3.184   74.492 50.579 1.00 65.43  ? 664  GLU A HB2  1 
ATOM   6469  H  HB3  . GLU A 1 456 ? 3.007   74.828 52.121 1.00 65.43  ? 664  GLU A HB3  1 
ATOM   6470  H  HG2  . GLU A 1 456 ? 3.403   77.082 51.676 1.00 77.83  ? 664  GLU A HG2  1 
ATOM   6471  H  HG3  . GLU A 1 456 ? 3.580   76.746 50.133 1.00 77.83  ? 664  GLU A HG3  1 
ATOM   6472  N  N    . THR A 1 457 ? 5.279   75.426 53.885 1.00 43.33  ? 665  THR A N    1 
ATOM   6473  C  CA   . THR A 1 457 ? 5.674   76.303 54.981 1.00 45.86  ? 665  THR A CA   1 
ATOM   6474  C  C    . THR A 1 457 ? 7.164   76.235 55.295 1.00 43.08  ? 665  THR A C    1 
ATOM   6475  O  O    . THR A 1 457 ? 7.668   77.113 56.004 1.00 42.71  ? 665  THR A O    1 
ATOM   6476  C  CB   . THR A 1 457 ? 4.878   75.966 56.248 1.00 47.74  ? 665  THR A CB   1 
ATOM   6477  O  OG1  . THR A 1 457 ? 5.166   74.626 56.659 1.00 47.28  ? 665  THR A OG1  1 
ATOM   6478  C  CG2  . THR A 1 457 ? 3.382   76.105 56.002 1.00 48.08  ? 665  THR A CG2  1 
ATOM   6479  H  H    . THR A 1 457 ? 4.903   74.694 54.135 1.00 52.00  ? 665  THR A H    1 
ATOM   6480  H  HA   . THR A 1 457 ? 5.466   77.218 54.737 1.00 55.04  ? 665  THR A HA   1 
ATOM   6481  H  HB   . THR A 1 457 ? 5.128   76.580 56.957 1.00 57.29  ? 665  THR A HB   1 
ATOM   6482  H  HG1  . THR A 1 457 ? 4.954   74.087 56.051 1.00 56.74  ? 665  THR A HG1  1 
ATOM   6483  H  HG21 . THR A 1 457 ? 2.891   75.889 56.810 1.00 57.70  ? 665  THR A HG21 1 
ATOM   6484  H  HG22 . THR A 1 457 ? 3.172   77.015 55.739 1.00 57.70  ? 665  THR A HG22 1 
ATOM   6485  H  HG23 . THR A 1 457 ? 3.105   75.501 55.295 1.00 57.70  ? 665  THR A HG23 1 
ATOM   6486  N  N    . SER A 1 458 ? 7.879   75.230 54.787 1.00 41.04  ? 666  SER A N    1 
ATOM   6487  C  CA   . SER A 1 458 ? 9.300   75.094 55.076 1.00 44.56  ? 666  SER A CA   1 
ATOM   6488  C  C    . SER A 1 458 ? 10.171  76.012 54.229 1.00 46.89  ? 666  SER A C    1 
ATOM   6489  O  O    . SER A 1 458 ? 11.347  76.194 54.560 1.00 46.20  ? 666  SER A O    1 
ATOM   6490  C  CB   . SER A 1 458 ? 9.743   73.642 54.873 1.00 47.37  ? 666  SER A CB   1 
ATOM   6491  O  OG   . SER A 1 458 ? 9.747   73.294 53.499 1.00 51.38  ? 666  SER A OG   1 
ATOM   6492  H  H    . SER A 1 458 ? 7.563   74.617 54.273 1.00 49.24  ? 666  SER A H    1 
ATOM   6493  H  HA   . SER A 1 458 ? 9.450   75.321 56.007 1.00 53.48  ? 666  SER A HA   1 
ATOM   6494  H  HB2  . SER A 1 458 ? 10.640  73.534 55.227 1.00 56.85  ? 666  SER A HB2  1 
ATOM   6495  H  HB3  . SER A 1 458 ? 9.129   73.056 55.343 1.00 56.85  ? 666  SER A HB3  1 
ATOM   6496  H  HG   . SER A 1 458 ? 9.991   72.496 53.405 1.00 61.66  ? 666  SER A HG   1 
ATOM   6497  N  N    . LEU A 1 459 ? 9.636   76.588 53.156 1.00 48.50  ? 667  LEU A N    1 
ATOM   6498  C  CA   . LEU A 1 459 ? 10.374  77.532 52.329 1.00 49.27  ? 667  LEU A CA   1 
ATOM   6499  C  C    . LEU A 1 459 ? 10.047  78.949 52.776 1.00 54.99  ? 667  LEU A C    1 
ATOM   6500  O  O    . LEU A 1 459 ? 8.873   79.332 52.842 1.00 52.86  ? 667  LEU A O    1 
ATOM   6501  C  CB   . LEU A 1 459 ? 10.039  77.356 50.847 1.00 46.95  ? 667  LEU A CB   1 
ATOM   6502  C  CG   . LEU A 1 459 ? 10.840  78.238 49.880 1.00 49.50  ? 667  LEU A CG   1 
ATOM   6503  C  CD1  . LEU A 1 459 ? 12.325  77.895 49.924 1.00 47.79  ? 667  LEU A CD1  1 
ATOM   6504  C  CD2  . LEU A 1 459 ? 10.306  78.110 48.463 1.00 52.24  ? 667  LEU A CD2  1 
ATOM   6505  H  H    . LEU A 1 459 ? 8.832   76.445 52.884 1.00 58.20  ? 667  LEU A H    1 
ATOM   6506  H  HA   . LEU A 1 459 ? 11.326  77.386 52.447 1.00 59.13  ? 667  LEU A HA   1 
ATOM   6507  H  HB2  . LEU A 1 459 ? 10.205  76.432 50.602 1.00 56.34  ? 667  LEU A HB2  1 
ATOM   6508  H  HB3  . LEU A 1 459 ? 9.100   77.561 50.718 1.00 56.34  ? 667  LEU A HB3  1 
ATOM   6509  H  HG   . LEU A 1 459 ? 10.742  79.164 50.151 1.00 59.40  ? 667  LEU A HG   1 
ATOM   6510  H  HD11 . LEU A 1 459 ? 12.799  78.470 49.303 1.00 57.35  ? 667  LEU A HD11 1 
ATOM   6511  H  HD12 . LEU A 1 459 ? 12.655  78.037 50.825 1.00 57.35  ? 667  LEU A HD12 1 
ATOM   6512  H  HD13 . LEU A 1 459 ? 12.441  76.966 49.670 1.00 57.35  ? 667  LEU A HD13 1 
ATOM   6513  H  HD21 . LEU A 1 459 ? 10.830  78.677 47.876 1.00 62.69  ? 667  LEU A HD21 1 
ATOM   6514  H  HD22 . LEU A 1 459 ? 10.378  77.185 48.181 1.00 62.69  ? 667  LEU A HD22 1 
ATOM   6515  H  HD23 . LEU A 1 459 ? 9.376   78.388 48.450 1.00 62.69  ? 667  LEU A HD23 1 
ATOM   6516  N  N    . HIS A 1 460 ? 11.082  79.720 53.080 1.00 62.76  ? 668  HIS A N    1 
ATOM   6517  C  CA   . HIS A 1 460 ? 10.930  81.087 53.561 1.00 74.49  ? 668  HIS A CA   1 
ATOM   6518  C  C    . HIS A 1 460 ? 11.387  82.026 52.451 1.00 73.08  ? 668  HIS A C    1 
ATOM   6519  O  O    . HIS A 1 460 ? 12.588  82.150 52.188 1.00 71.83  ? 668  HIS A O    1 
ATOM   6520  C  CB   . HIS A 1 460 ? 11.723  81.290 54.850 1.00 86.50  ? 668  HIS A CB   1 
ATOM   6521  C  CG   . HIS A 1 460 ? 11.350  80.327 55.936 1.00 94.73  ? 668  HIS A CG   1 
ATOM   6522  N  ND1  . HIS A 1 460 ? 12.158  80.080 57.025 1.00 97.18  ? 668  HIS A ND1  1 
ATOM   6523  C  CD2  . HIS A 1 460 ? 10.255  79.547 56.097 1.00 95.96  ? 668  HIS A CD2  1 
ATOM   6524  C  CE1  . HIS A 1 460 ? 11.577  79.190 57.810 1.00 96.20  ? 668  HIS A CE1  1 
ATOM   6525  N  NE2  . HIS A 1 460 ? 10.420  78.851 57.269 1.00 94.89  ? 668  HIS A NE2  1 
ATOM   6526  H  H    . HIS A 1 460 ? 11.901  79.469 53.014 1.00 75.31  ? 668  HIS A H    1 
ATOM   6527  H  HA   . HIS A 1 460 ? 9.994   81.263 53.745 1.00 89.39  ? 668  HIS A HA   1 
ATOM   6528  H  HB2  . HIS A 1 460 ? 12.666  81.173 54.659 1.00 103.81 ? 668  HIS A HB2  1 
ATOM   6529  H  HB3  . HIS A 1 460 ? 11.561  82.188 55.179 1.00 103.81 ? 668  HIS A HB3  1 
ATOM   6530  H  HD2  . HIS A 1 460 ? 9.527   79.493 55.521 1.00 115.15 ? 668  HIS A HD2  1 
ATOM   6531  H  HE1  . HIS A 1 460 ? 11.922  78.859 58.607 1.00 115.44 ? 668  HIS A HE1  1 
ATOM   6532  H  HE2  . HIS A 1 460 ? 9.861   78.286 57.598 1.00 113.87 ? 668  HIS A HE2  1 
ATOM   6533  N  N    . THR A 1 461 ? 10.424  82.667 51.791 1.00 73.38  ? 669  THR A N    1 
ATOM   6534  C  CA   . THR A 1 461 ? 10.707  83.565 50.682 1.00 74.44  ? 669  THR A CA   1 
ATOM   6535  C  C    . THR A 1 461 ? 9.616   84.622 50.609 1.00 72.62  ? 669  THR A C    1 
ATOM   6536  O  O    . THR A 1 461 ? 8.513   84.441 51.133 1.00 68.22  ? 669  THR A O    1 
ATOM   6537  C  CB   . THR A 1 461 ? 10.795  82.813 49.347 1.00 73.90  ? 669  THR A CB   1 
ATOM   6538  O  OG1  . THR A 1 461 ? 10.937  83.754 48.275 1.00 76.85  ? 669  THR A OG1  1 
ATOM   6539  C  CG2  . THR A 1 461 ? 9.542   81.978 49.118 1.00 71.38  ? 669  THR A CG2  1 
ATOM   6540  H  H    . THR A 1 461 ? 9.586   82.595 51.972 1.00 88.05  ? 669  THR A H    1 
ATOM   6541  H  HA   . THR A 1 461 ? 11.555  84.011 50.838 1.00 89.33  ? 669  THR A HA   1 
ATOM   6542  H  HB   . THR A 1 461 ? 11.562  82.219 49.361 1.00 88.68  ? 669  THR A HB   1 
ATOM   6543  H  HG1  . THR A 1 461 ? 10.986  83.347 47.541 1.00 92.22  ? 669  THR A HG1  1 
ATOM   6544  H  HG21 . THR A 1 461 ? 9.608   81.507 48.273 1.00 85.66  ? 669  THR A HG21 1 
ATOM   6545  H  HG22 . THR A 1 461 ? 9.440   81.330 49.833 1.00 85.66  ? 669  THR A HG22 1 
ATOM   6546  H  HG23 . THR A 1 461 ? 8.760   82.552 49.099 1.00 85.66  ? 669  THR A HG23 1 
ATOM   6547  N  N    . ASP A 1 462 ? 9.936   85.732 49.943 1.00 74.95  ? 670  ASP A N    1 
ATOM   6548  C  CA   . ASP A 1 462 ? 8.981   86.812 49.720 1.00 78.64  ? 670  ASP A CA   1 
ATOM   6549  C  C    . ASP A 1 462 ? 8.506   86.873 48.274 1.00 81.26  ? 670  ASP A C    1 
ATOM   6550  O  O    . ASP A 1 462 ? 7.839   87.841 47.890 1.00 82.25  ? 670  ASP A O    1 
ATOM   6551  C  CB   . ASP A 1 462 ? 9.592   88.155 50.128 1.00 79.38  ? 670  ASP A CB   1 
ATOM   6552  C  CG   . ASP A 1 462 ? 10.473  88.755 49.045 1.00 78.39  ? 670  ASP A CG   1 
ATOM   6553  O  OD1  . ASP A 1 462 ? 11.074  87.989 48.260 1.00 75.28  ? 670  ASP A OD1  1 
ATOM   6554  O  OD2  . ASP A 1 462 ? 10.567  90.001 48.981 1.00 79.05  ? 670  ASP A OD2  1 
ATOM   6555  H  H    . ASP A 1 462 ? 10.712  85.884 49.607 1.00 89.94  ? 670  ASP A H    1 
ATOM   6556  H  HA   . ASP A 1 462 ? 8.204   86.659 50.280 1.00 94.37  ? 670  ASP A HA   1 
ATOM   6557  H  HB2  . ASP A 1 462 ? 8.877   88.783 50.315 1.00 95.26  ? 670  ASP A HB2  1 
ATOM   6558  H  HB3  . ASP A 1 462 ? 10.137  88.027 50.921 1.00 95.26  ? 670  ASP A HB3  1 
ATOM   6559  N  N    . GLY A 1 463 ? 8.845   85.874 47.464 1.00 80.98  ? 671  GLY A N    1 
ATOM   6560  C  CA   . GLY A 1 463 ? 8.388   85.810 46.090 1.00 80.74  ? 671  GLY A CA   1 
ATOM   6561  C  C    . GLY A 1 463 ? 7.537   84.582 45.849 1.00 75.24  ? 671  GLY A C    1 
ATOM   6562  O  O    . GLY A 1 463 ? 6.854   84.109 46.761 1.00 73.28  ? 671  GLY A O    1 
ATOM   6563  H  H    . GLY A 1 463 ? 9.346   85.214 47.695 1.00 97.18  ? 671  GLY A H    1 
ATOM   6564  H  HA2  . GLY A 1 463 ? 7.862   86.598 45.884 1.00 96.89  ? 671  GLY A HA2  1 
ATOM   6565  H  HA3  . GLY A 1 463 ? 9.152   85.781 45.493 1.00 96.89  ? 671  GLY A HA3  1 
ATOM   6566  N  N    . GLU A 1 464 ? 7.566   84.057 44.627 1.00 71.34  ? 672  GLU A N    1 
ATOM   6567  C  CA   . GLU A 1 464 ? 6.818   82.846 44.322 1.00 66.39  ? 672  GLU A CA   1 
ATOM   6568  C  C    . GLU A 1 464 ? 7.374   81.673 45.117 1.00 56.58  ? 672  GLU A C    1 
ATOM   6569  O  O    . GLU A 1 464 ? 8.586   81.441 45.145 1.00 51.79  ? 672  GLU A O    1 
ATOM   6570  C  CB   . GLU A 1 464 ? 6.876   82.546 42.824 1.00 71.50  ? 672  GLU A CB   1 
ATOM   6571  C  CG   . GLU A 1 464 ? 6.154   81.261 42.425 1.00 76.91  ? 672  GLU A CG   1 
ATOM   6572  C  CD   . GLU A 1 464 ? 6.163   81.022 40.927 1.00 82.64  ? 672  GLU A CD   1 
ATOM   6573  O  OE1  . GLU A 1 464 ? 7.183   81.338 40.279 1.00 84.80  ? 672  GLU A OE1  1 
ATOM   6574  O  OE2  . GLU A 1 464 ? 5.147   80.521 40.398 1.00 84.23  ? 672  GLU A OE2  1 
ATOM   6575  H  H    . GLU A 1 464 ? 8.008   84.380 43.964 1.00 85.61  ? 672  GLU A H    1 
ATOM   6576  H  HA   . GLU A 1 464 ? 5.889   82.971 44.572 1.00 79.67  ? 672  GLU A HA   1 
ATOM   6577  H  HB2  . GLU A 1 464 ? 6.464   83.280 42.341 1.00 85.80  ? 672  GLU A HB2  1 
ATOM   6578  H  HB3  . GLU A 1 464 ? 7.805   82.459 42.558 1.00 85.80  ? 672  GLU A HB3  1 
ATOM   6579  H  HG2  . GLU A 1 464 ? 6.591   80.507 42.851 1.00 92.29  ? 672  GLU A HG2  1 
ATOM   6580  H  HG3  . GLU A 1 464 ? 5.230   81.315 42.715 1.00 92.29  ? 672  GLU A HG3  1 
ATOM   6581  N  N    . ASN A 1 465 ? 6.480   80.930 45.764 1.00 54.32  ? 673  ASN A N    1 
ATOM   6582  C  CA   . ASN A 1 465 ? 6.858   79.764 46.554 1.00 48.62  ? 673  ASN A CA   1 
ATOM   6583  C  C    . ASN A 1 465 ? 6.927   78.555 45.628 1.00 47.42  ? 673  ASN A C    1 
ATOM   6584  O  O    . ASN A 1 465 ? 5.898   78.085 45.131 1.00 46.35  ? 673  ASN A O    1 
ATOM   6585  C  CB   . ASN A 1 465 ? 5.859   79.541 47.686 1.00 45.51  ? 673  ASN A CB   1 
ATOM   6586  C  CG   . ASN A 1 465 ? 6.266   78.410 48.617 1.00 47.25  ? 673  ASN A CG   1 
ATOM   6587  O  OD1  . ASN A 1 465 ? 6.831   77.401 48.189 1.00 46.13  ? 673  ASN A OD1  1 
ATOM   6588  N  ND2  . ASN A 1 465 ? 5.977   78.575 49.903 1.00 47.94  ? 673  ASN A ND2  1 
ATOM   6589  H  H    . ASN A 1 465 ? 5.634   81.085 45.760 1.00 65.19  ? 673  ASN A H    1 
ATOM   6590  H  HA   . ASN A 1 465 ? 7.736   79.905 46.941 1.00 58.34  ? 673  ASN A HA   1 
ATOM   6591  H  HB2  . ASN A 1 465 ? 5.792   80.353 48.213 1.00 54.62  ? 673  ASN A HB2  1 
ATOM   6592  H  HB3  . ASN A 1 465 ? 4.995   79.320 47.306 1.00 54.62  ? 673  ASN A HB3  1 
ATOM   6593  H  HD21 . ASN A 1 465 ? 6.186   77.966 50.472 1.00 57.53  ? 673  ASN A HD21 1 
ATOM   6594  H  HD22 . ASN A 1 465 ? 5.582   79.293 50.166 1.00 57.53  ? 673  ASN A HD22 1 
ATOM   6595  N  N    . SER A 1 466 ? 8.138   78.048 45.399 1.00 49.63  ? 674  SER A N    1 
ATOM   6596  C  CA   . SER A 1 466 ? 8.353   76.889 44.545 1.00 49.42  ? 674  SER A CA   1 
ATOM   6597  C  C    . SER A 1 466 ? 8.190   75.568 45.292 1.00 45.18  ? 674  SER A C    1 
ATOM   6598  O  O    . SER A 1 466 ? 8.708   74.539 44.839 1.00 41.93  ? 674  SER A O    1 
ATOM   6599  C  CB   . SER A 1 466 ? 9.741   76.960 43.907 1.00 53.25  ? 674  SER A CB   1 
ATOM   6600  O  OG   . SER A 1 466 ? 10.744  77.079 44.899 1.00 55.76  ? 674  SER A OG   1 
ATOM   6601  H  H    . SER A 1 466 ? 8.862   78.367 45.735 1.00 59.56  ? 674  SER A H    1 
ATOM   6602  H  HA   . SER A 1 466 ? 7.699   76.905 43.829 1.00 59.31  ? 674  SER A HA   1 
ATOM   6603  H  HB2  . SER A 1 466 ? 9.896   76.151 43.396 1.00 63.91  ? 674  SER A HB2  1 
ATOM   6604  H  HB3  . SER A 1 466 ? 9.781   77.734 43.324 1.00 63.91  ? 674  SER A HB3  1 
ATOM   6605  H  HG   . SER A 1 466 ? 11.501  77.117 44.538 1.00 66.91  ? 674  SER A HG   1 
ATOM   6606  N  N    . CYS A 1 467 ? 7.487   75.574 46.427 1.00 41.73  ? 675  CYS A N    1 
ATOM   6607  C  CA   . CYS A 1 467 ? 7.170   74.346 47.149 1.00 40.93  ? 675  CYS A CA   1 
ATOM   6608  C  C    . CYS A 1 467 ? 5.671   74.232 47.417 1.00 39.55  ? 675  CYS A C    1 
ATOM   6609  O  O    . CYS A 1 467 ? 5.266   73.554 48.367 1.00 36.07  ? 675  CYS A O    1 
ATOM   6610  C  CB   . CYS A 1 467 ? 7.967   74.271 48.456 1.00 42.47  ? 675  CYS A CB   1 
ATOM   6611  S  SG   . CYS A 1 467 ? 9.779   74.385 48.235 1.00 46.14  ? 675  CYS A SG   1 
ATOM   6612  H  H    . CYS A 1 467 ? 7.180   76.285 46.801 1.00 50.08  ? 675  CYS A H    1 
ATOM   6613  H  HA   . CYS A 1 467 ? 7.430   73.589 46.601 1.00 49.12  ? 675  CYS A HA   1 
ATOM   6614  H  HB2  . CYS A 1 467 ? 7.693   75.004 49.030 1.00 50.97  ? 675  CYS A HB2  1 
ATOM   6615  H  HB3  . CYS A 1 467 ? 7.775   73.425 48.890 1.00 50.97  ? 675  CYS A HB3  1 
ATOM   6616  N  N    . ARG A 1 468 ? 4.844   74.892 46.602 1.00 41.15  ? 676  ARG A N    1 
ATOM   6617  C  CA   . ARG A 1 468 ? 3.394   74.738 46.648 1.00 41.79  ? 676  ARG A CA   1 
ATOM   6618  C  C    . ARG A 1 468 ? 2.967   73.639 45.682 1.00 35.79  ? 676  ARG A C    1 
ATOM   6619  O  O    . ARG A 1 468 ? 3.346   73.661 44.506 1.00 34.56  ? 676  ARG A O    1 
ATOM   6620  C  CB   . ARG A 1 468 ? 2.696   76.048 46.279 1.00 47.86  ? 676  ARG A CB   1 
ATOM   6621  C  CG   . ARG A 1 468 ? 2.753   77.116 47.351 1.00 54.98  ? 676  ARG A CG   1 
ATOM   6622  C  CD   . ARG A 1 468 ? 2.111   78.423 46.889 1.00 62.52  ? 676  ARG A CD   1 
ATOM   6623  N  NE   . ARG A 1 468 ? 0.676   78.284 46.627 1.00 65.68  ? 676  ARG A NE   1 
ATOM   6624  C  CZ   . ARG A 1 468 ? 0.105   78.340 45.425 1.00 66.82  ? 676  ARG A CZ   1 
ATOM   6625  N  NH1  . ARG A 1 468 ? 0.829   78.540 44.329 1.00 65.29  ? 676  ARG A NH1  1 
ATOM   6626  N  NH2  . ARG A 1 468 ? -1.212  78.203 45.317 1.00 68.11  ? 676  ARG A NH2  1 
ATOM   6627  H  H    . ARG A 1 468 ? 5.110   75.447 46.001 1.00 49.38  ? 676  ARG A H    1 
ATOM   6628  H  HA   . ARG A 1 468 ? 3.122   74.484 47.544 1.00 50.15  ? 676  ARG A HA   1 
ATOM   6629  H  HB2  . ARG A 1 468 ? 3.115   76.409 45.482 1.00 57.44  ? 676  ARG A HB2  1 
ATOM   6630  H  HB3  . ARG A 1 468 ? 1.761   75.861 46.100 1.00 57.44  ? 676  ARG A HB3  1 
ATOM   6631  H  HG2  . ARG A 1 468 ? 2.276   76.806 48.136 1.00 65.97  ? 676  ARG A HG2  1 
ATOM   6632  H  HG3  . ARG A 1 468 ? 3.680   77.296 47.572 1.00 65.97  ? 676  ARG A HG3  1 
ATOM   6633  H  HD2  . ARG A 1 468 ? 2.226   79.094 47.580 1.00 75.03  ? 676  ARG A HD2  1 
ATOM   6634  H  HD3  . ARG A 1 468 ? 2.539   78.714 46.069 1.00 75.03  ? 676  ARG A HD3  1 
ATOM   6635  H  HE   . ARG A 1 468 ? 0.161   78.155 47.304 1.00 78.82  ? 676  ARG A HE   1 
ATOM   6636  H  HH11 . ARG A 1 468 ? 1.682   78.632 44.388 1.00 78.34  ? 676  ARG A HH11 1 
ATOM   6637  H  HH12 . ARG A 1 468 ? 0.445   78.575 43.560 1.00 78.34  ? 676  ARG A HH12 1 
ATOM   6638  H  HH21 . ARG A 1 468 ? -1.689  78.074 46.020 1.00 81.73  ? 676  ARG A HH21 1 
ATOM   6639  H  HH22 . ARG A 1 468 ? -1.586  78.239 44.543 1.00 81.73  ? 676  ARG A HH22 1 
ATOM   6640  N  N    . TYR A 1 469 ? 2.159   72.698 46.169 1.00 33.86  ? 677  TYR A N    1 
ATOM   6641  C  CA   . TYR A 1 469 ? 1.761   71.533 45.390 1.00 36.58  ? 677  TYR A CA   1 
ATOM   6642  C  C    . TYR A 1 469 ? 0.244   71.383 45.369 1.00 35.87  ? 677  TYR A C    1 
ATOM   6643  O  O    . TYR A 1 469 ? -0.467  71.883 46.246 1.00 36.74  ? 677  TYR A O    1 
ATOM   6644  C  CB   . TYR A 1 469 ? 2.378   70.244 45.951 1.00 31.62  ? 677  TYR A CB   1 
ATOM   6645  C  CG   . TYR A 1 469 ? 3.872   70.150 45.770 1.00 34.29  ? 677  TYR A CG   1 
ATOM   6646  C  CD1  . TYR A 1 469 ? 4.739   70.708 46.700 1.00 33.49  ? 677  TYR A CD1  1 
ATOM   6647  C  CD2  . TYR A 1 469 ? 4.417   69.494 44.672 1.00 33.57  ? 677  TYR A CD2  1 
ATOM   6648  C  CE1  . TYR A 1 469 ? 6.108   70.620 46.540 1.00 34.02  ? 677  TYR A CE1  1 
ATOM   6649  C  CE2  . TYR A 1 469 ? 5.785   69.404 44.502 1.00 33.01  ? 677  TYR A CE2  1 
ATOM   6650  C  CZ   . TYR A 1 469 ? 6.623   69.968 45.440 1.00 35.13  ? 677  TYR A CZ   1 
ATOM   6651  O  OH   . TYR A 1 469 ? 7.985   69.884 45.278 1.00 37.91  ? 677  TYR A OH   1 
ATOM   6652  H  H    . TYR A 1 469 ? 1.825   72.714 46.962 1.00 40.64  ? 677  TYR A H    1 
ATOM   6653  H  HA   . TYR A 1 469 ? 2.066   71.642 44.476 1.00 43.89  ? 677  TYR A HA   1 
ATOM   6654  H  HB2  . TYR A 1 469 ? 2.192   70.198 46.902 1.00 37.94  ? 677  TYR A HB2  1 
ATOM   6655  H  HB3  . TYR A 1 469 ? 1.977   69.485 45.500 1.00 37.94  ? 677  TYR A HB3  1 
ATOM   6656  H  HD1  . TYR A 1 469 ? 4.392   71.149 47.443 1.00 40.19  ? 677  TYR A HD1  1 
ATOM   6657  H  HD2  . TYR A 1 469 ? 3.852   69.114 44.039 1.00 40.28  ? 677  TYR A HD2  1 
ATOM   6658  H  HE1  . TYR A 1 469 ? 6.678   71.001 47.169 1.00 40.82  ? 677  TYR A HE1  1 
ATOM   6659  H  HE2  . TYR A 1 469 ? 6.137   68.965 43.763 1.00 39.61  ? 677  TYR A HE2  1 
ATOM   6660  H  HH   . TYR A 1 469 ? 8.165   69.465 44.573 1.00 45.49  ? 677  TYR A HH   1 
ATOM   6661  N  N    . TYR A 1 470 ? -0.237  70.667 44.353 1.00 35.74  ? 678  TYR A N    1 
ATOM   6662  C  CA   . TYR A 1 470 ? -1.633  70.259 44.250 1.00 33.84  ? 678  TYR A CA   1 
ATOM   6663  C  C    . TYR A 1 470 ? -1.690  68.738 44.153 1.00 36.78  ? 678  TYR A C    1 
ATOM   6664  O  O    . TYR A 1 470 ? -1.047  68.159 43.259 1.00 35.95  ? 678  TYR A O    1 
ATOM   6665  C  CB   . TYR A 1 470 ? -2.304  70.900 43.033 1.00 36.72  ? 678  TYR A CB   1 
ATOM   6666  C  CG   . TYR A 1 470 ? -3.778  70.581 42.911 1.00 38.70  ? 678  TYR A CG   1 
ATOM   6667  C  CD1  . TYR A 1 470 ? -4.729  71.335 43.584 1.00 43.01  ? 678  TYR A CD1  1 
ATOM   6668  C  CD2  . TYR A 1 470 ? -4.218  69.525 42.123 1.00 41.84  ? 678  TYR A CD2  1 
ATOM   6669  C  CE1  . TYR A 1 470 ? -6.078  71.048 43.476 1.00 45.56  ? 678  TYR A CE1  1 
ATOM   6670  C  CE2  . TYR A 1 470 ? -5.563  69.229 42.009 1.00 44.87  ? 678  TYR A CE2  1 
ATOM   6671  C  CZ   . TYR A 1 470 ? -6.490  69.993 42.688 1.00 47.31  ? 678  TYR A CZ   1 
ATOM   6672  O  OH   . TYR A 1 470 ? -7.831  69.702 42.578 1.00 50.44  ? 678  TYR A OH   1 
ATOM   6673  H  H    . TYR A 1 470 ? 0.244   70.398 43.692 1.00 42.89  ? 678  TYR A H    1 
ATOM   6674  H  HA   . TYR A 1 470 ? -2.111  70.535 45.048 1.00 40.61  ? 678  TYR A HA   1 
ATOM   6675  H  HB2  . TYR A 1 470 ? -2.214  71.863 43.098 1.00 44.07  ? 678  TYR A HB2  1 
ATOM   6676  H  HB3  . TYR A 1 470 ? -1.864  70.581 42.230 1.00 44.07  ? 678  TYR A HB3  1 
ATOM   6677  H  HD1  . TYR A 1 470 ? -4.454  72.046 44.116 1.00 51.61  ? 678  TYR A HD1  1 
ATOM   6678  H  HD2  . TYR A 1 470 ? -3.596  69.007 41.664 1.00 50.21  ? 678  TYR A HD2  1 
ATOM   6679  H  HE1  . TYR A 1 470 ? -6.704  71.562 43.934 1.00 54.68  ? 678  TYR A HE1  1 
ATOM   6680  H  HE2  . TYR A 1 470 ? -5.843  68.518 41.478 1.00 53.85  ? 678  TYR A HE2  1 
ATOM   6681  H  HH   . TYR A 1 470 ? -7.941  69.041 42.071 1.00 60.53  ? 678  TYR A HH   1 
ATOM   6682  N  N    . PRO A 1 471 ? -2.427  68.044 45.022 1.00 36.15  ? 679  PRO A N    1 
ATOM   6683  C  CA   . PRO A 1 471 ? -2.403  66.575 44.999 1.00 36.70  ? 679  PRO A CA   1 
ATOM   6684  C  C    . PRO A 1 471 ? -3.097  66.001 43.772 1.00 34.48  ? 679  PRO A C    1 
ATOM   6685  O  O    . PRO A 1 471 ? -4.084  66.545 43.271 1.00 37.59  ? 679  PRO A O    1 
ATOM   6686  C  CB   . PRO A 1 471 ? -3.141  66.190 46.286 1.00 36.33  ? 679  PRO A CB   1 
ATOM   6687  C  CG   . PRO A 1 471 ? -4.039  67.347 46.560 1.00 37.51  ? 679  PRO A CG   1 
ATOM   6688  C  CD   . PRO A 1 471 ? -3.285  68.563 46.102 1.00 37.64  ? 679  PRO A CD   1 
ATOM   6689  H  HA   . PRO A 1 471 ? -1.490  66.249 45.039 1.00 44.04  ? 679  PRO A HA   1 
ATOM   6690  H  HB2  . PRO A 1 471 ? -3.656  65.381 46.140 1.00 43.60  ? 679  PRO A HB2  1 
ATOM   6691  H  HB3  . PRO A 1 471 ? -2.504  66.069 47.007 1.00 43.60  ? 679  PRO A HB3  1 
ATOM   6692  H  HG2  . PRO A 1 471 ? -4.862  67.247 46.058 1.00 45.02  ? 679  PRO A HG2  1 
ATOM   6693  H  HG3  . PRO A 1 471 ? -4.223  67.398 47.511 1.00 45.02  ? 679  PRO A HG3  1 
ATOM   6694  H  HD2  . PRO A 1 471 ? -3.897  69.231 45.756 1.00 45.17  ? 679  PRO A HD2  1 
ATOM   6695  H  HD3  . PRO A 1 471 ? -2.743  68.917 46.824 1.00 45.17  ? 679  PRO A HD3  1 
ATOM   6696  N  N    . MET A 1 472 ? -2.569  64.872 43.300 1.00 35.47  ? 680  MET A N    1 
ATOM   6697  C  CA   . MET A 1 472 ? -3.039  64.225 42.080 1.00 36.22  ? 680  MET A CA   1 
ATOM   6698  C  C    . MET A 1 472 ? -3.241  62.740 42.345 1.00 34.09  ? 680  MET A C    1 
ATOM   6699  O  O    . MET A 1 472 ? -2.305  62.049 42.759 1.00 34.80  ? 680  MET A O    1 
ATOM   6700  C  CB   . MET A 1 472 ? -2.037  64.421 40.939 1.00 39.40  ? 680  MET A CB   1 
ATOM   6701  C  CG   . MET A 1 472 ? -1.736  65.875 40.619 1.00 43.65  ? 680  MET A CG   1 
ATOM   6702  S  SD   . MET A 1 472 ? -3.061  66.668 39.700 1.00 47.46  ? 680  MET A SD   1 
ATOM   6703  C  CE   . MET A 1 472 ? -2.882  65.882 38.101 1.00 51.16  ? 680  MET A CE   1 
ATOM   6704  H  H    . MET A 1 472 ? -1.922  64.452 43.681 1.00 42.57  ? 680  MET A H    1 
ATOM   6705  H  HA   . MET A 1 472 ? -3.884  64.620 41.813 1.00 43.46  ? 680  MET A HA   1 
ATOM   6706  H  HB2  . MET A 1 472 ? -1.201  63.994 41.183 1.00 47.29  ? 680  MET A HB2  1 
ATOM   6707  H  HB3  . MET A 1 472 ? -2.394  64.010 40.137 1.00 47.29  ? 680  MET A HB3  1 
ATOM   6708  H  HG2  . MET A 1 472 ? -1.613  66.363 41.448 1.00 52.38  ? 680  MET A HG2  1 
ATOM   6709  H  HG3  . MET A 1 472 ? -0.929  65.921 40.083 1.00 52.38  ? 680  MET A HG3  1 
ATOM   6710  H  HE1  . MET A 1 472 ? -3.557  66.233 37.500 1.00 61.40  ? 680  MET A HE1  1 
ATOM   6711  H  HE2  . MET A 1 472 ? -1.996  66.073 37.754 1.00 61.40  ? 680  MET A HE2  1 
ATOM   6712  H  HE3  . MET A 1 472 ? -2.997  64.924 38.206 1.00 61.40  ? 680  MET A HE3  1 
ATOM   6713  N  N    . GLY A 1 473 ? -4.455  62.251 42.101 1.00 35.33  ? 681  GLY A N    1 
ATOM   6714  C  CA   . GLY A 1 473 ? -4.702  60.822 42.164 1.00 36.56  ? 681  GLY A CA   1 
ATOM   6715  C  C    . GLY A 1 473 ? -4.745  60.291 43.589 1.00 35.67  ? 681  GLY A C    1 
ATOM   6716  O  O    . GLY A 1 473 ? -5.029  61.006 44.555 1.00 35.24  ? 681  GLY A O    1 
ATOM   6717  H  H    . GLY A 1 473 ? -5.144  62.725 41.899 1.00 42.40  ? 681  GLY A H    1 
ATOM   6718  H  HA2  . GLY A 1 473 ? -5.550  60.623 41.738 1.00 43.87  ? 681  GLY A HA2  1 
ATOM   6719  H  HA3  . GLY A 1 473 ? -4.001  60.353 41.684 1.00 43.87  ? 681  GLY A HA3  1 
ATOM   6720  N  N    . HIS A 1 474 ? -4.451  59.004 43.706 1.00 34.65  ? 682  HIS A N    1 
ATOM   6721  C  CA   . HIS A 1 474 ? -4.485  58.305 44.977 1.00 36.01  ? 682  HIS A CA   1 
ATOM   6722  C  C    . HIS A 1 474 ? -3.081  57.910 45.415 1.00 34.71  ? 682  HIS A C    1 
ATOM   6723  O  O    . HIS A 1 474 ? -2.147  57.888 44.605 1.00 36.28  ? 682  HIS A O    1 
ATOM   6724  C  CB   . HIS A 1 474 ? -5.366  57.050 44.878 1.00 37.40  ? 682  HIS A CB   1 
ATOM   6725  C  CG   . HIS A 1 474 ? -6.783  57.337 44.484 1.00 35.35  ? 682  HIS A CG   1 
ATOM   6726  N  ND1  . HIS A 1 474 ? -7.746  57.717 45.393 1.00 34.82  ? 682  HIS A ND1  1 
ATOM   6727  C  CD2  . HIS A 1 474 ? -7.400  57.295 43.279 1.00 35.74  ? 682  HIS A CD2  1 
ATOM   6728  C  CE1  . HIS A 1 474 ? -8.894  57.903 44.766 1.00 34.90  ? 682  HIS A CE1  1 
ATOM   6729  N  NE2  . HIS A 1 474 ? -8.711  57.654 43.483 1.00 37.65  ? 682  HIS A NE2  1 
ATOM   6730  H  H    . HIS A 1 474 ? -4.223  58.504 43.045 1.00 41.59  ? 682  HIS A H    1 
ATOM   6731  H  HA   . HIS A 1 474 ? -4.862  58.889 45.654 1.00 43.21  ? 682  HIS A HA   1 
ATOM   6732  H  HB2  . HIS A 1 474 ? -4.988  56.454 44.212 1.00 44.88  ? 682  HIS A HB2  1 
ATOM   6733  H  HB3  . HIS A 1 474 ? -5.382  56.610 45.742 1.00 44.88  ? 682  HIS A HB3  1 
ATOM   6734  H  HD2  . HIS A 1 474 ? -7.009  57.070 42.466 1.00 42.89  ? 682  HIS A HD2  1 
ATOM   6735  H  HE1  . HIS A 1 474 ? -9.694  58.163 45.162 1.00 41.88  ? 682  HIS A HE1  1 
ATOM   6736  H  HE2  . HIS A 1 474 ? -9.316  57.705 42.873 1.00 45.18  ? 682  HIS A HE2  1 
ATOM   6737  N  N    . PRO A 1 475 ? -2.889  57.599 46.696 1.00 34.74  ? 683  PRO A N    1 
ATOM   6738  C  CA   . PRO A 1 475 ? -1.561  57.175 47.156 1.00 30.87  ? 683  PRO A CA   1 
ATOM   6739  C  C    . PRO A 1 475 ? -1.040  55.993 46.353 1.00 31.84  ? 683  PRO A C    1 
ATOM   6740  O  O    . PRO A 1 475 ? -1.794  55.098 45.966 1.00 36.26  ? 683  PRO A O    1 
ATOM   6741  C  CB   . PRO A 1 475 ? -1.799  56.802 48.622 1.00 31.59  ? 683  PRO A CB   1 
ATOM   6742  C  CG   . PRO A 1 475 ? -2.954  57.667 49.028 1.00 35.79  ? 683  PRO A CG   1 
ATOM   6743  C  CD   . PRO A 1 475 ? -3.842  57.715 47.814 1.00 35.83  ? 683  PRO A CD   1 
ATOM   6744  H  HA   . PRO A 1 475 ? -0.930  57.909 47.104 1.00 37.05  ? 683  PRO A HA   1 
ATOM   6745  H  HB2  . PRO A 1 475 ? -2.030  55.862 48.691 1.00 37.91  ? 683  PRO A HB2  1 
ATOM   6746  H  HB3  . PRO A 1 475 ? -1.010  57.006 49.148 1.00 37.91  ? 683  PRO A HB3  1 
ATOM   6747  H  HG2  . PRO A 1 475 ? -3.418  57.264 49.779 1.00 42.95  ? 683  PRO A HG2  1 
ATOM   6748  H  HG3  . PRO A 1 475 ? -2.634  58.554 49.256 1.00 42.95  ? 683  PRO A HG3  1 
ATOM   6749  H  HD2  . PRO A 1 475 ? -4.458  56.965 47.814 1.00 43.00  ? 683  PRO A HD2  1 
ATOM   6750  H  HD3  . PRO A 1 475 ? -4.313  58.563 47.771 1.00 43.00  ? 683  PRO A HD3  1 
ATOM   6751  N  N    . ALA A 1 476 ? 0.268   56.000 46.105 1.00 28.27  ? 684  ALA A N    1 
ATOM   6752  C  CA   . ALA A 1 476 ? 0.902   54.940 45.336 1.00 30.04  ? 684  ALA A CA   1 
ATOM   6753  C  C    . ALA A 1 476 ? 1.411   53.804 46.212 1.00 30.29  ? 684  ALA A C    1 
ATOM   6754  O  O    . ALA A 1 476 ? 1.405   52.649 45.773 1.00 31.38  ? 684  ALA A O    1 
ATOM   6755  C  CB   . ALA A 1 476 ? 2.061   55.507 44.513 1.00 31.51  ? 684  ALA A CB   1 
ATOM   6756  H  H    . ALA A 1 476 ? 0.810   56.611 46.374 1.00 33.92  ? 684  ALA A H    1 
ATOM   6757  H  HA   . ALA A 1 476 ? 0.252   54.571 44.718 1.00 36.05  ? 684  ALA A HA   1 
ATOM   6758  H  HB1  . ALA A 1 476 ? 2.470   54.788 44.007 1.00 37.81  ? 684  ALA A HB1  1 
ATOM   6759  H  HB2  . ALA A 1 476 ? 1.716   56.183 43.908 1.00 37.81  ? 684  ALA A HB2  1 
ATOM   6760  H  HB3  . ALA A 1 476 ? 2.711   55.902 45.114 1.00 37.81  ? 684  ALA A HB3  1 
ATOM   6761  N  N    . SER A 1 477 ? 1.853   54.102 47.433 1.00 28.68  ? 685  SER A N    1 
ATOM   6762  C  CA   . SER A 1 477 ? 2.241   53.066 48.381 1.00 29.56  ? 685  SER A CA   1 
ATOM   6763  C  C    . SER A 1 477 ? 2.235   53.659 49.782 1.00 29.92  ? 685  SER A C    1 
ATOM   6764  O  O    . SER A 1 477 ? 2.349   54.875 49.964 1.00 28.78  ? 685  SER A O    1 
ATOM   6765  C  CB   . SER A 1 477 ? 3.618   52.477 48.054 1.00 26.96  ? 685  SER A CB   1 
ATOM   6766  O  OG   . SER A 1 477 ? 4.664   53.380 48.375 1.00 28.32  ? 685  SER A OG   1 
ATOM   6767  H  H    . SER A 1 477 ? 1.937   54.902 47.735 1.00 34.42  ? 685  SER A H    1 
ATOM   6768  H  HA   . SER A 1 477 ? 1.590   52.348 48.354 1.00 35.47  ? 685  SER A HA   1 
ATOM   6769  H  HB2  . SER A 1 477 ? 3.740   51.662 48.566 1.00 32.35  ? 685  SER A HB2  1 
ATOM   6770  H  HB3  . SER A 1 477 ? 3.656   52.278 47.105 1.00 32.35  ? 685  SER A HB3  1 
ATOM   6771  H  HG   . SER A 1 477 ? 5.408   53.037 48.187 1.00 33.99  ? 685  SER A HG   1 
ATOM   6772  N  N    . VAL A 1 478 ? 2.093   52.777 50.769 1.00 26.90  ? 686  VAL A N    1 
ATOM   6773  C  CA   . VAL A 1 478 ? 2.161   53.137 52.180 1.00 25.85  ? 686  VAL A CA   1 
ATOM   6774  C  C    . VAL A 1 478 ? 3.036   52.109 52.887 1.00 25.40  ? 686  VAL A C    1 
ATOM   6775  O  O    . VAL A 1 478 ? 2.872   50.903 52.673 1.00 24.43  ? 686  VAL A O    1 
ATOM   6776  C  CB   . VAL A 1 478 ? 0.762   53.191 52.826 1.00 26.83  ? 686  VAL A CB   1 
ATOM   6777  C  CG1  . VAL A 1 478 ? 0.864   53.529 54.310 1.00 26.69  ? 686  VAL A CG1  1 
ATOM   6778  C  CG2  . VAL A 1 478 ? -0.124  54.199 52.110 1.00 28.44  ? 686  VAL A CG2  1 
ATOM   6779  H  H    . VAL A 1 478 ? 1.952   51.939 50.639 1.00 32.28  ? 686  VAL A H    1 
ATOM   6780  H  HA   . VAL A 1 478 ? 2.576   54.009 52.272 1.00 31.03  ? 686  VAL A HA   1 
ATOM   6781  H  HB   . VAL A 1 478 ? 0.346   52.318 52.747 1.00 32.19  ? 686  VAL A HB   1 
ATOM   6782  H  HG11 . VAL A 1 478 ? -0.028  53.556 54.689 1.00 32.03  ? 686  VAL A HG11 1 
ATOM   6783  H  HG12 . VAL A 1 478 ? 1.392   52.847 54.753 1.00 32.03  ? 686  VAL A HG12 1 
ATOM   6784  H  HG13 . VAL A 1 478 ? 1.292   54.394 54.407 1.00 32.03  ? 686  VAL A HG13 1 
ATOM   6785  H  HG21 . VAL A 1 478 ? -0.995  54.212 52.536 1.00 34.14  ? 686  VAL A HG21 1 
ATOM   6786  H  HG22 . VAL A 1 478 ? 0.286   55.076 52.167 1.00 34.14  ? 686  VAL A HG22 1 
ATOM   6787  H  HG23 . VAL A 1 478 ? -0.213  53.936 51.180 1.00 34.14  ? 686  VAL A HG23 1 
ATOM   6788  N  N    . HIS A 1 479 ? 3.953   52.584 53.730 1.00 24.87  ? 687  HIS A N    1 
ATOM   6789  C  CA   . HIS A 1 479 ? 4.830   51.730 54.521 1.00 25.22  ? 687  HIS A CA   1 
ATOM   6790  C  C    . HIS A 1 479 ? 4.678   52.035 56.007 1.00 27.22  ? 687  HIS A C    1 
ATOM   6791  O  O    . HIS A 1 479 ? 4.471   53.187 56.404 1.00 30.68  ? 687  HIS A O    1 
ATOM   6792  C  CB   . HIS A 1 479 ? 6.315   51.922 54.149 1.00 24.58  ? 687  HIS A CB   1 
ATOM   6793  C  CG   . HIS A 1 479 ? 6.717   51.299 52.848 1.00 23.44  ? 687  HIS A CG   1 
ATOM   6794  N  ND1  . HIS A 1 479 ? 6.525   51.919 51.632 1.00 24.89  ? 687  HIS A ND1  1 
ATOM   6795  C  CD2  . HIS A 1 479 ? 7.332   50.121 52.577 1.00 25.63  ? 687  HIS A CD2  1 
ATOM   6796  C  CE1  . HIS A 1 479 ? 6.989   51.144 50.667 1.00 25.83  ? 687  HIS A CE1  1 
ATOM   6797  N  NE2  . HIS A 1 479 ? 7.487   50.049 51.214 1.00 26.26  ? 687  HIS A NE2  1 
ATOM   6798  H  H    . HIS A 1 479 ? 4.087   53.423 53.862 1.00 29.84  ? 687  HIS A H    1 
ATOM   6799  H  HA   . HIS A 1 479 ? 4.595   50.800 54.373 1.00 30.26  ? 687  HIS A HA   1 
ATOM   6800  H  HB2  . HIS A 1 479 ? 6.498   52.873 54.088 1.00 29.50  ? 687  HIS A HB2  1 
ATOM   6801  H  HB3  . HIS A 1 479 ? 6.862   51.528 54.845 1.00 29.50  ? 687  HIS A HB3  1 
ATOM   6802  H  HD1  . HIS A 1 479 ? 6.154   52.686 51.519 1.00 29.87  ? 687  HIS A HD1  1 
ATOM   6803  H  HD2  . HIS A 1 479 ? 7.595   49.481 53.197 1.00 30.75  ? 687  HIS A HD2  1 
ATOM   6804  H  HE1  . HIS A 1 479 ? 6.970   51.338 49.758 1.00 31.00  ? 687  HIS A HE1  1 
ATOM   6805  N  N    . LEU A 1 480 ? 4.800   50.992 56.826 1.00 23.70  ? 688  LEU A N    1 
ATOM   6806  C  CA   . LEU A 1 480 ? 5.064   51.164 58.248 1.00 25.73  ? 688  LEU A CA   1 
ATOM   6807  C  C    . LEU A 1 480 ? 6.556   51.393 58.457 1.00 26.69  ? 688  LEU A C    1 
ATOM   6808  O  O    . LEU A 1 480 ? 7.386   50.801 57.762 1.00 23.94  ? 688  LEU A O    1 
ATOM   6809  C  CB   . LEU A 1 480 ? 4.620   49.934 59.044 1.00 30.15  ? 688  LEU A CB   1 
ATOM   6810  C  CG   . LEU A 1 480 ? 3.176   49.441 58.927 1.00 29.26  ? 688  LEU A CG   1 
ATOM   6811  C  CD1  . LEU A 1 480 ? 3.050   48.056 59.566 1.00 29.64  ? 688  LEU A CD1  1 
ATOM   6812  C  CD2  . LEU A 1 480 ? 2.222   50.406 59.585 1.00 27.81  ? 688  LEU A CD2  1 
ATOM   6813  H  H    . LEU A 1 480 ? 4.733   50.171 56.579 1.00 28.44  ? 688  LEU A H    1 
ATOM   6814  H  HA   . LEU A 1 480 ? 4.582   51.939 58.579 1.00 30.88  ? 688  LEU A HA   1 
ATOM   6815  H  HB2  . LEU A 1 480 ? 5.187   49.194 58.777 1.00 36.18  ? 688  LEU A HB2  1 
ATOM   6816  H  HB3  . LEU A 1 480 ? 4.773   50.122 59.983 1.00 36.18  ? 688  LEU A HB3  1 
ATOM   6817  H  HG   . LEU A 1 480 ? 2.937   49.367 57.990 1.00 35.11  ? 688  LEU A HG   1 
ATOM   6818  H  HD11 . LEU A 1 480 ? 2.131   47.755 59.486 1.00 35.57  ? 688  LEU A HD11 1 
ATOM   6819  H  HD12 . LEU A 1 480 ? 3.641   47.441 59.104 1.00 35.57  ? 688  LEU A HD12 1 
ATOM   6820  H  HD13 . LEU A 1 480 ? 3.298   48.116 60.501 1.00 35.57  ? 688  LEU A HD13 1 
ATOM   6821  H  HD21 . LEU A 1 480 ? 1.318   50.066 59.494 1.00 33.37  ? 688  LEU A HD21 1 
ATOM   6822  H  HD22 . LEU A 1 480 ? 2.453   50.487 60.523 1.00 33.37  ? 688  LEU A HD22 1 
ATOM   6823  H  HD23 . LEU A 1 480 ? 2.297   51.269 59.149 1.00 33.37  ? 688  LEU A HD23 1 
ATOM   6824  N  N    . TYR A 1 481 ? 6.897   52.250 59.421 1.00 27.44  ? 689  TYR A N    1 
ATOM   6825  C  CA   . TYR A 1 481 ? 8.286   52.619 59.691 1.00 28.26  ? 689  TYR A CA   1 
ATOM   6826  C  C    . TYR A 1 481 ? 8.585   52.401 61.169 1.00 28.57  ? 689  TYR A C    1 
ATOM   6827  O  O    . TYR A 1 481 ? 7.936   53.004 62.030 1.00 27.29  ? 689  TYR A O    1 
ATOM   6828  C  CB   . TYR A 1 481 ? 8.545   54.080 59.288 1.00 31.37  ? 689  TYR A CB   1 
ATOM   6829  C  CG   . TYR A 1 481 ? 9.937   54.606 59.589 1.00 30.42  ? 689  TYR A CG   1 
ATOM   6830  C  CD1  . TYR A 1 481 ? 11.061  53.800 59.452 1.00 32.49  ? 689  TYR A CD1  1 
ATOM   6831  C  CD2  . TYR A 1 481 ? 10.127  55.926 59.988 1.00 31.34  ? 689  TYR A CD2  1 
ATOM   6832  C  CE1  . TYR A 1 481 ? 12.335  54.291 59.725 1.00 29.96  ? 689  TYR A CE1  1 
ATOM   6833  C  CE2  . TYR A 1 481 ? 11.388  56.421 60.260 1.00 29.86  ? 689  TYR A CE2  1 
ATOM   6834  C  CZ   . TYR A 1 481 ? 12.489  55.602 60.126 1.00 32.09  ? 689  TYR A CZ   1 
ATOM   6835  O  OH   . TYR A 1 481 ? 13.746  56.101 60.395 1.00 33.63  ? 689  TYR A OH   1 
ATOM   6836  H  H    . TYR A 1 481 ? 6.331   52.638 59.939 1.00 32.93  ? 689  TYR A H    1 
ATOM   6837  H  HA   . TYR A 1 481 ? 8.876   52.050 59.173 1.00 33.91  ? 689  TYR A HA   1 
ATOM   6838  H  HB2  . TYR A 1 481 ? 8.402   54.164 58.333 1.00 37.64  ? 689  TYR A HB2  1 
ATOM   6839  H  HB3  . TYR A 1 481 ? 7.913   54.644 59.760 1.00 37.64  ? 689  TYR A HB3  1 
ATOM   6840  H  HD1  . TYR A 1 481 ? 10.959  52.915 59.184 1.00 38.99  ? 689  TYR A HD1  1 
ATOM   6841  H  HD2  . TYR A 1 481 ? 9.389   56.484 60.083 1.00 37.61  ? 689  TYR A HD2  1 
ATOM   6842  H  HE1  . TYR A 1 481 ? 13.078  53.739 59.634 1.00 35.96  ? 689  TYR A HE1  1 
ATOM   6843  H  HE2  . TYR A 1 481 ? 11.495  57.305 60.530 1.00 35.83  ? 689  TYR A HE2  1 
ATOM   6844  H  HH   . TYR A 1 481 ? 13.692  56.906 60.627 1.00 40.36  ? 689  TYR A HH   1 
ATOM   6845  N  N    . PHE A 1 482 ? 9.564   51.541 61.459 1.00 28.25  ? 690  PHE A N    1 
ATOM   6846  C  CA   . PHE A 1 482 ? 10.014  51.275 62.818 1.00 28.23  ? 690  PHE A CA   1 
ATOM   6847  C  C    . PHE A 1 482 ? 11.486  51.643 62.965 1.00 30.92  ? 690  PHE A C    1 
ATOM   6848  O  O    . PHE A 1 482 ? 12.275  51.502 62.024 1.00 29.63  ? 690  PHE A O    1 
ATOM   6849  C  CB   . PHE A 1 482 ? 9.830   49.793 63.198 1.00 28.27  ? 690  PHE A CB   1 
ATOM   6850  C  CG   . PHE A 1 482 ? 8.396   49.349 63.285 1.00 27.16  ? 690  PHE A CG   1 
ATOM   6851  C  CD1  . PHE A 1 482 ? 7.707   48.956 62.150 1.00 27.02  ? 690  PHE A CD1  1 
ATOM   6852  C  CD2  . PHE A 1 482 ? 7.745   49.298 64.508 1.00 27.54  ? 690  PHE A CD2  1 
ATOM   6853  C  CE1  . PHE A 1 482 ? 6.387   48.529 62.232 1.00 26.65  ? 690  PHE A CE1  1 
ATOM   6854  C  CE2  . PHE A 1 482 ? 6.434   48.874 64.596 1.00 28.78  ? 690  PHE A CE2  1 
ATOM   6855  C  CZ   . PHE A 1 482 ? 5.751   48.491 63.457 1.00 27.51  ? 690  PHE A CZ   1 
ATOM   6856  H  H    . PHE A 1 482 ? 9.991   51.089 60.865 1.00 33.90  ? 690  PHE A H    1 
ATOM   6857  H  HA   . PHE A 1 482 ? 9.500   51.815 63.439 1.00 33.88  ? 690  PHE A HA   1 
ATOM   6858  H  HB2  . PHE A 1 482 ? 10.269  49.244 62.529 1.00 33.92  ? 690  PHE A HB2  1 
ATOM   6859  H  HB3  . PHE A 1 482 ? 10.238  49.641 64.065 1.00 33.92  ? 690  PHE A HB3  1 
ATOM   6860  H  HD1  . PHE A 1 482 ? 8.132   48.980 61.323 1.00 32.43  ? 690  PHE A HD1  1 
ATOM   6861  H  HD2  . PHE A 1 482 ? 8.198   49.553 65.279 1.00 33.06  ? 690  PHE A HD2  1 
ATOM   6862  H  HE1  . PHE A 1 482 ? 5.932   48.273 61.462 1.00 31.98  ? 690  PHE A HE1  1 
ATOM   6863  H  HE2  . PHE A 1 482 ? 6.009   48.850 65.423 1.00 34.54  ? 690  PHE A HE2  1 
ATOM   6864  H  HZ   . PHE A 1 482 ? 4.867   48.208 63.515 1.00 33.02  ? 690  PHE A HZ   1 
ATOM   6865  N  N    . LEU A 1 483 ? 11.855  52.113 64.158 1.00 30.96  ? 691  LEU A N    1 
ATOM   6866  C  CA   . LEU A 1 483 ? 13.249  52.410 64.481 1.00 31.24  ? 691  LEU A CA   1 
ATOM   6867  C  C    . LEU A 1 483 ? 13.536  51.936 65.897 1.00 31.70  ? 691  LEU A C    1 
ATOM   6868  O  O    . LEU A 1 483 ? 12.914  52.415 66.851 1.00 31.56  ? 691  LEU A O    1 
ATOM   6869  C  CB   . LEU A 1 483 ? 13.553  53.907 64.347 1.00 32.43  ? 691  LEU A CB   1 
ATOM   6870  C  CG   . LEU A 1 483 ? 14.970  54.361 64.721 1.00 33.19  ? 691  LEU A CG   1 
ATOM   6871  C  CD1  . LEU A 1 483 ? 16.029  53.657 63.880 1.00 34.08  ? 691  LEU A CD1  1 
ATOM   6872  C  CD2  . LEU A 1 483 ? 15.102  55.877 64.579 1.00 33.91  ? 691  LEU A CD2  1 
ATOM   6873  H  H    . LEU A 1 483 ? 11.309  52.269 64.804 1.00 37.16  ? 691  LEU A H    1 
ATOM   6874  H  HA   . LEU A 1 483 ? 13.830  51.925 63.874 1.00 37.49  ? 691  LEU A HA   1 
ATOM   6875  H  HB2  . LEU A 1 483 ? 13.405  54.164 63.424 1.00 38.91  ? 691  LEU A HB2  1 
ATOM   6876  H  HB3  . LEU A 1 483 ? 12.937  54.393 64.917 1.00 38.91  ? 691  LEU A HB3  1 
ATOM   6877  H  HG   . LEU A 1 483 ? 15.134  54.136 65.650 1.00 39.84  ? 691  LEU A HG   1 
ATOM   6878  H  HD11 . LEU A 1 483 ? 16.906  53.972 64.148 1.00 40.89  ? 691  LEU A HD11 1 
ATOM   6879  H  HD12 . LEU A 1 483 ? 15.962  52.700 64.025 1.00 40.89  ? 691  LEU A HD12 1 
ATOM   6880  H  HD13 . LEU A 1 483 ? 15.875  53.861 62.944 1.00 40.89  ? 691  LEU A HD13 1 
ATOM   6881  H  HD21 . LEU A 1 483 ? 16.004  56.139 64.820 1.00 40.69  ? 691  LEU A HD21 1 
ATOM   6882  H  HD22 . LEU A 1 483 ? 14.920  56.124 63.659 1.00 40.69  ? 691  LEU A HD22 1 
ATOM   6883  H  HD23 . LEU A 1 483 ? 14.463  56.306 65.170 1.00 40.69  ? 691  LEU A HD23 1 
ATOM   6884  N  N    . ALA A 1 484 ? 14.476  50.998 66.029 1.00 29.70  ? 692  ALA A N    1 
ATOM   6885  C  CA   . ALA A 1 484 ? 14.876  50.463 67.330 1.00 29.99  ? 692  ALA A CA   1 
ATOM   6886  C  C    . ALA A 1 484 ? 13.674  49.893 68.078 1.00 28.88  ? 692  ALA A C    1 
ATOM   6887  O  O    . ALA A 1 484 ? 13.536  50.063 69.292 1.00 28.54  ? 692  ALA A O    1 
ATOM   6888  C  CB   . ALA A 1 484 ? 15.587  51.529 68.168 1.00 35.88  ? 692  ALA A CB   1 
ATOM   6889  H  H    . ALA A 1 484 ? 14.904  50.651 65.368 1.00 35.65  ? 692  ALA A H    1 
ATOM   6890  H  HA   . ALA A 1 484 ? 15.502  49.737 67.186 1.00 35.99  ? 692  ALA A HA   1 
ATOM   6891  H  HB1  . ALA A 1 484 ? 15.838  51.144 69.022 1.00 43.06  ? 692  ALA A HB1  1 
ATOM   6892  H  HB2  . ALA A 1 484 ? 16.379  51.827 67.693 1.00 43.06  ? 692  ALA A HB2  1 
ATOM   6893  H  HB3  . ALA A 1 484 ? 14.984  52.276 68.306 1.00 43.06  ? 692  ALA A HB3  1 
ATOM   6894  N  N    . ASP A 1 485 ? 12.799  49.207 67.339 1.00 30.07  ? 693  ASP A N    1 
ATOM   6895  C  CA   . ASP A 1 485 ? 11.598  48.565 67.866 1.00 33.20  ? 693  ASP A CA   1 
ATOM   6896  C  C    . ASP A 1 485 ? 10.587  49.566 68.415 1.00 35.05  ? 693  ASP A C    1 
ATOM   6897  O  O    . ASP A 1 485 ? 9.747   49.208 69.246 1.00 32.86  ? 693  ASP A O    1 
ATOM   6898  C  CB   . ASP A 1 485 ? 11.955  47.517 68.932 1.00 37.75  ? 693  ASP A CB   1 
ATOM   6899  C  CG   . ASP A 1 485 ? 12.452  46.210 68.320 1.00 38.33  ? 693  ASP A CG   1 
ATOM   6900  O  OD1  . ASP A 1 485 ? 11.967  45.852 67.227 1.00 35.82  ? 693  ASP A OD1  1 
ATOM   6901  O  OD2  . ASP A 1 485 ? 13.323  45.541 68.923 1.00 39.64  ? 693  ASP A OD2  1 
ATOM   6902  H  H    . ASP A 1 485 ? 12.888  49.098 66.491 1.00 36.09  ? 693  ASP A H    1 
ATOM   6903  H  HA   . ASP A 1 485 ? 11.165  48.094 67.137 1.00 39.84  ? 693  ASP A HA   1 
ATOM   6904  H  HB2  . ASP A 1 485 ? 12.658  47.869 69.501 1.00 45.31  ? 693  ASP A HB2  1 
ATOM   6905  H  HB3  . ASP A 1 485 ? 11.166  47.321 69.461 1.00 45.31  ? 693  ASP A HB3  1 
ATOM   6906  N  N    . ARG A 1 486 ? 10.637  50.815 67.954 1.00 33.74  ? 694  ARG A N    1 
ATOM   6907  C  CA   . ARG A 1 486 ? 9.633   51.823 68.274 1.00 33.37  ? 694  ARG A CA   1 
ATOM   6908  C  C    . ARG A 1 486 ? 8.926   52.240 66.992 1.00 29.52  ? 694  ARG A C    1 
ATOM   6909  O  O    . ARG A 1 486 ? 9.581   52.586 66.003 1.00 28.86  ? 694  ARG A O    1 
ATOM   6910  C  CB   . ARG A 1 486 ? 10.266  53.047 68.945 1.00 33.48  ? 694  ARG A CB   1 
ATOM   6911  C  CG   . ARG A 1 486 ? 11.083  52.735 70.190 1.00 36.09  ? 694  ARG A CG   1 
ATOM   6912  C  CD   . ARG A 1 486 ? 10.208  52.238 71.328 1.00 35.74  ? 694  ARG A CD   1 
ATOM   6913  H  H    . ARG A 1 486 ? 11.261  51.108 67.440 1.00 40.49  ? 694  ARG A H    1 
ATOM   6914  H  HA   . ARG A 1 486 ? 8.977   51.445 68.879 1.00 40.04  ? 694  ARG A HA   1 
ATOM   6915  H  HB2  . ARG A 1 486 ? 10.856  53.479 68.307 1.00 40.18  ? 694  ARG A HB2  1 
ATOM   6916  H  HB3  . ARG A 1 486 ? 9.559   53.659 69.203 1.00 40.18  ? 694  ARG A HB3  1 
ATOM   6917  H  HG2  . ARG A 1 486 ? 11.731  52.044 69.981 1.00 43.31  ? 694  ARG A HG2  1 
ATOM   6918  H  HG3  . ARG A 1 486 ? 11.536  53.540 70.485 1.00 43.31  ? 694  ARG A HG3  1 
ATOM   6919  H  HD2  . ARG A 1 486 ? 9.310   52.582 71.209 1.00 42.89  ? 694  ARG A HD2  1 
ATOM   6920  H  HD3  . ARG A 1 486 ? 10.196  51.268 71.316 1.00 42.89  ? 694  ARG A HD3  1 
ATOM   6921  N  N    . PHE A 1 487 ? 7.594   52.216 67.016 1.00 29.77  ? 695  PHE A N    1 
ATOM   6922  C  CA   . PHE A 1 487 ? 6.804   52.603 65.853 1.00 29.69  ? 695  PHE A CA   1 
ATOM   6923  C  C    . PHE A 1 487 ? 6.951   54.098 65.586 1.00 29.82  ? 695  PHE A C    1 
ATOM   6924  O  O    . PHE A 1 487 ? 6.726   54.924 66.476 1.00 31.35  ? 695  PHE A O    1 
ATOM   6925  C  CB   . PHE A 1 487 ? 5.337   52.235 66.078 1.00 30.88  ? 695  PHE A CB   1 
ATOM   6926  C  CG   . PHE A 1 487 ? 4.423   52.625 64.947 1.00 30.84  ? 695  PHE A CG   1 
ATOM   6927  C  CD1  . PHE A 1 487 ? 4.623   52.126 63.671 1.00 31.26  ? 695  PHE A CD1  1 
ATOM   6928  C  CD2  . PHE A 1 487 ? 3.351   53.471 65.169 1.00 31.84  ? 695  PHE A CD2  1 
ATOM   6929  C  CE1  . PHE A 1 487 ? 3.780   52.481 62.632 1.00 29.34  ? 695  PHE A CE1  1 
ATOM   6930  C  CE2  . PHE A 1 487 ? 2.500   53.827 64.136 1.00 30.73  ? 695  PHE A CE2  1 
ATOM   6931  C  CZ   . PHE A 1 487 ? 2.715   53.330 62.866 1.00 30.40  ? 695  PHE A CZ   1 
ATOM   6932  H  H    . PHE A 1 487 ? 7.125   51.978 67.696 1.00 35.73  ? 695  PHE A H    1 
ATOM   6933  H  HA   . PHE A 1 487 ? 7.124   52.121 65.074 1.00 35.63  ? 695  PHE A HA   1 
ATOM   6934  H  HB2  . PHE A 1 487 ? 5.271   51.274 66.193 1.00 37.06  ? 695  PHE A HB2  1 
ATOM   6935  H  HB3  . PHE A 1 487 ? 5.023   52.683 66.879 1.00 37.06  ? 695  PHE A HB3  1 
ATOM   6936  H  HD1  . PHE A 1 487 ? 5.338   51.555 63.507 1.00 37.51  ? 695  PHE A HD1  1 
ATOM   6937  H  HD2  . PHE A 1 487 ? 3.202   53.809 66.022 1.00 38.21  ? 695  PHE A HD2  1 
ATOM   6938  H  HE1  . PHE A 1 487 ? 3.926   52.143 61.778 1.00 35.21  ? 695  PHE A HE1  1 
ATOM   6939  H  HE2  . PHE A 1 487 ? 1.786   54.401 64.297 1.00 36.88  ? 695  PHE A HE2  1 
ATOM   6940  H  HZ   . PHE A 1 487 ? 2.147   53.568 62.170 1.00 36.48  ? 695  PHE A HZ   1 
ATOM   6941  N  N    . GLN A 1 488 ? 7.329   54.446 64.354 1.00 28.71  ? 696  GLN A N    1 
ATOM   6942  C  CA   . GLN A 1 488 ? 7.588   55.833 63.984 1.00 30.98  ? 696  GLN A CA   1 
ATOM   6943  C  C    . GLN A 1 488 ? 6.473   56.468 63.162 1.00 30.22  ? 696  GLN A C    1 
ATOM   6944  O  O    . GLN A 1 488 ? 6.448   57.698 63.034 1.00 32.35  ? 696  GLN A O    1 
ATOM   6945  C  CB   . GLN A 1 488 ? 8.899   55.930 63.192 1.00 33.57  ? 696  GLN A CB   1 
ATOM   6946  C  CG   . GLN A 1 488 ? 10.122  55.378 63.919 1.00 35.68  ? 696  GLN A CG   1 
ATOM   6947  C  CD   . GLN A 1 488 ? 10.553  56.233 65.098 1.00 35.42  ? 696  GLN A CD   1 
ATOM   6948  O  OE1  . GLN A 1 488 ? 10.936  57.390 64.935 1.00 34.88  ? 696  GLN A OE1  1 
ATOM   6949  N  NE2  . GLN A 1 488 ? 10.492  55.662 66.294 1.00 36.70  ? 696  GLN A NE2  1 
ATOM   6950  H  H    . GLN A 1 488 ? 7.442   53.888 63.710 1.00 34.45  ? 696  GLN A H    1 
ATOM   6951  H  HA   . GLN A 1 488 ? 7.692   56.356 64.794 1.00 37.18  ? 696  GLN A HA   1 
ATOM   6952  H  HB2  . GLN A 1 488 ? 8.800   55.433 62.365 1.00 40.29  ? 696  GLN A HB2  1 
ATOM   6953  H  HB3  . GLN A 1 488 ? 9.072   56.863 62.993 1.00 40.29  ? 696  GLN A HB3  1 
ATOM   6954  H  HG2  . GLN A 1 488 ? 9.916   54.491 64.252 1.00 42.82  ? 696  GLN A HG2  1 
ATOM   6955  H  HG3  . GLN A 1 488 ? 10.864  55.333 63.296 1.00 42.82  ? 696  GLN A HG3  1 
ATOM   6956  H  HE21 . GLN A 1 488 ? 10.218  54.850 66.369 1.00 44.04  ? 696  GLN A HE21 1 
ATOM   6957  H  HE22 . GLN A 1 488 ? 10.725  56.104 66.994 1.00 44.04  ? 696  GLN A HE22 1 
ATOM   6958  N  N    . GLY A 1 489 ? 5.561   55.672 62.596 1.00 28.41  ? 697  GLY A N    1 
ATOM   6959  C  CA   . GLY A 1 489 ? 4.442   56.188 61.833 1.00 27.57  ? 697  GLY A CA   1 
ATOM   6960  C  C    . GLY A 1 489 ? 4.391   55.600 60.430 1.00 27.53  ? 697  GLY A C    1 
ATOM   6961  O  O    . GLY A 1 489 ? 4.892   54.496 60.181 1.00 28.92  ? 697  GLY A O    1 
ATOM   6962  H  H    . GLY A 1 489 ? 5.576   54.814 62.647 1.00 34.10  ? 697  GLY A H    1 
ATOM   6963  H  HA2  . GLY A 1 489 ? 3.613   55.975 62.288 1.00 33.09  ? 697  GLY A HA2  1 
ATOM   6964  H  HA3  . GLY A 1 489 ? 4.516   57.153 61.761 1.00 33.09  ? 697  GLY A HA3  1 
ATOM   6965  N  N    . PHE A 1 490 ? 3.777   56.354 59.520 1.00 25.87  ? 698  PHE A N    1 
ATOM   6966  C  CA   . PHE A 1 490 ? 3.548   55.921 58.149 1.00 27.28  ? 698  PHE A CA   1 
ATOM   6967  C  C    . PHE A 1 490 ? 4.400   56.717 57.168 1.00 25.63  ? 698  PHE A C    1 
ATOM   6968  O  O    . PHE A 1 490 ? 4.650   57.912 57.358 1.00 30.63  ? 698  PHE A O    1 
ATOM   6969  C  CB   . PHE A 1 490 ? 2.077   56.091 57.748 1.00 30.86  ? 698  PHE A CB   1 
ATOM   6970  C  CG   . PHE A 1 490 ? 1.123   55.201 58.492 1.00 31.54  ? 698  PHE A CG   1 
ATOM   6971  C  CD1  . PHE A 1 490 ? 0.954   53.877 58.120 1.00 32.37  ? 698  PHE A CD1  1 
ATOM   6972  C  CD2  . PHE A 1 490 ? 0.365   55.700 59.539 1.00 32.78  ? 698  PHE A CD2  1 
ATOM   6973  C  CE1  . PHE A 1 490 ? 0.061   53.057 58.796 1.00 30.81  ? 698  PHE A CE1  1 
ATOM   6974  C  CE2  . PHE A 1 490 ? -0.531  54.889 60.216 1.00 33.46  ? 698  PHE A CE2  1 
ATOM   6975  C  CZ   . PHE A 1 490 ? -0.681  53.563 59.843 1.00 33.17  ? 698  PHE A CZ   1 
ATOM   6976  H  H    . PHE A 1 490 ? 3.476   57.143 59.681 1.00 31.05  ? 698  PHE A H    1 
ATOM   6977  H  HA   . PHE A 1 490 ? 3.781   54.983 58.065 1.00 32.74  ? 698  PHE A HA   1 
ATOM   6978  H  HB2  . PHE A 1 490 ? 1.814   57.009 57.915 1.00 37.04  ? 698  PHE A HB2  1 
ATOM   6979  H  HB3  . PHE A 1 490 ? 1.988   55.892 56.802 1.00 37.04  ? 698  PHE A HB3  1 
ATOM   6980  H  HD1  . PHE A 1 490 ? 1.453   53.531 57.415 1.00 38.84  ? 698  PHE A HD1  1 
ATOM   6981  H  HD2  . PHE A 1 490 ? 0.463   56.589 59.793 1.00 39.34  ? 698  PHE A HD2  1 
ATOM   6982  H  HE1  . PHE A 1 490 ? -0.038  52.168 58.542 1.00 36.97  ? 698  PHE A HE1  1 
ATOM   6983  H  HE2  . PHE A 1 490 ? -1.028  55.233 60.923 1.00 40.16  ? 698  PHE A HE2  1 
ATOM   6984  H  HZ   . PHE A 1 490 ? -1.280  53.015 60.297 1.00 39.81  ? 698  PHE A HZ   1 
ATOM   6985  N  N    . LEU A 1 491 ? 4.811   56.046 56.096 1.00 25.26  ? 699  LEU A N    1 
ATOM   6986  C  CA   . LEU A 1 491 ? 5.431   56.685 54.941 1.00 26.10  ? 699  LEU A CA   1 
ATOM   6987  C  C    . LEU A 1 491 ? 4.482   56.541 53.756 1.00 27.55  ? 699  LEU A C    1 
ATOM   6988  O  O    . LEU A 1 491 ? 4.136   55.418 53.372 1.00 26.20  ? 699  LEU A O    1 
ATOM   6989  C  CB   . LEU A 1 491 ? 6.789   56.058 54.622 1.00 27.04  ? 699  LEU A CB   1 
ATOM   6990  C  CG   . LEU A 1 491 ? 7.764   55.852 55.785 1.00 27.50  ? 699  LEU A CG   1 
ATOM   6991  C  CD1  . LEU A 1 491 ? 9.039   55.197 55.285 1.00 27.08  ? 699  LEU A CD1  1 
ATOM   6992  C  CD2  . LEU A 1 491 ? 8.084   57.164 56.489 1.00 30.79  ? 699  LEU A CD2  1 
ATOM   6993  H  H    . LEU A 1 491 ? 4.738   55.193 56.013 1.00 30.31  ? 699  LEU A H    1 
ATOM   6994  H  HA   . LEU A 1 491 ? 5.561   57.629 55.121 1.00 31.33  ? 699  LEU A HA   1 
ATOM   6995  H  HB2  . LEU A 1 491 ? 6.631   55.186 54.227 1.00 32.45  ? 699  LEU A HB2  1 
ATOM   6996  H  HB3  . LEU A 1 491 ? 7.236   56.624 53.973 1.00 32.45  ? 699  LEU A HB3  1 
ATOM   6997  H  HG   . LEU A 1 491 ? 7.358   55.257 56.434 1.00 33.00  ? 699  LEU A HG   1 
ATOM   6998  H  HD11 . LEU A 1 491 ? 9.645   55.074 56.032 1.00 32.50  ? 699  LEU A HD11 1 
ATOM   6999  H  HD12 . LEU A 1 491 ? 8.818   54.337 54.892 1.00 32.50  ? 699  LEU A HD12 1 
ATOM   7000  H  HD13 . LEU A 1 491 ? 9.448   55.770 54.618 1.00 32.50  ? 699  LEU A HD13 1 
ATOM   7001  H  HD21 . LEU A 1 491 ? 8.702   56.989 57.216 1.00 36.95  ? 699  LEU A HD21 1 
ATOM   7002  H  HD22 . LEU A 1 491 ? 8.487   57.774 55.852 1.00 36.95  ? 699  LEU A HD22 1 
ATOM   7003  H  HD23 . LEU A 1 491 ? 7.262   57.543 56.837 1.00 36.95  ? 699  LEU A HD23 1 
ATOM   7004  N  N    . ILE A 1 492 ? 4.059   57.669 53.184 1.00 23.26  ? 700  ILE A N    1 
ATOM   7005  C  CA   . ILE A 1 492 ? 3.104   57.691 52.079 1.00 23.09  ? 700  ILE A CA   1 
ATOM   7006  C  C    . ILE A 1 492 ? 3.816   58.214 50.839 1.00 25.22  ? 700  ILE A C    1 
ATOM   7007  O  O    . ILE A 1 492 ? 4.351   59.332 50.845 1.00 25.36  ? 700  ILE A O    1 
ATOM   7008  C  CB   . ILE A 1 492 ? 1.872   58.556 52.400 1.00 29.23  ? 700  ILE A CB   1 
ATOM   7009  C  CG1  . ILE A 1 492 ? 1.258   58.162 53.746 1.00 34.87  ? 700  ILE A CG1  1 
ATOM   7010  C  CG2  . ILE A 1 492 ? 0.821   58.433 51.296 1.00 29.14  ? 700  ILE A CG2  1 
ATOM   7011  C  CD1  . ILE A 1 492 ? 1.805   58.951 54.918 1.00 36.58  ? 700  ILE A CD1  1 
ATOM   7012  H  H    . ILE A 1 492 ? 4.318   58.452 53.427 1.00 27.91  ? 700  ILE A H    1 
ATOM   7013  H  HA   . ILE A 1 492 ? 2.802   56.787 51.898 1.00 27.71  ? 700  ILE A HA   1 
ATOM   7014  H  HB   . ILE A 1 492 ? 2.154   59.483 52.451 1.00 35.08  ? 700  ILE A HB   1 
ATOM   7015  H  HG12 . ILE A 1 492 ? 0.300   58.310 53.709 1.00 41.85  ? 700  ILE A HG12 1 
ATOM   7016  H  HG13 . ILE A 1 492 ? 1.439   57.223 53.910 1.00 41.85  ? 700  ILE A HG13 1 
ATOM   7017  H  HG21 . ILE A 1 492 ? 0.059   58.987 51.524 1.00 34.97  ? 700  ILE A HG21 1 
ATOM   7018  H  HG22 . ILE A 1 492 ? 1.208   58.730 50.458 1.00 34.97  ? 700  ILE A HG22 1 
ATOM   7019  H  HG23 . ILE A 1 492 ? 0.547   57.505 51.224 1.00 34.97  ? 700  ILE A HG23 1 
ATOM   7020  H  HD11 . ILE A 1 492 ? 1.372   58.647 55.731 1.00 43.90  ? 700  ILE A HD11 1 
ATOM   7021  H  HD12 . ILE A 1 492 ? 2.762   58.804 54.978 1.00 43.90  ? 700  ILE A HD12 1 
ATOM   7022  H  HD13 . ILE A 1 492 ? 1.622   59.893 54.777 1.00 43.90  ? 700  ILE A HD13 1 
ATOM   7023  N  N    . LYS A 1 493 ? 3.817   57.415 49.775 1.00 23.61  ? 701  LYS A N    1 
ATOM   7024  C  CA   . LYS A 1 493 ? 4.287   57.862 48.471 1.00 28.13  ? 701  LYS A CA   1 
ATOM   7025  C  C    . LYS A 1 493 ? 3.093   58.338 47.652 1.00 28.20  ? 701  LYS A C    1 
ATOM   7026  O  O    . LYS A 1 493 ? 2.074   57.644 47.577 1.00 26.61  ? 701  LYS A O    1 
ATOM   7027  C  CB   . LYS A 1 493 ? 5.023   56.739 47.735 1.00 29.39  ? 701  LYS A CB   1 
ATOM   7028  C  CG   . LYS A 1 493 ? 5.544   57.157 46.364 1.00 29.18  ? 701  LYS A CG   1 
ATOM   7029  C  CD   . LYS A 1 493 ? 6.401   56.085 45.702 1.00 36.41  ? 701  LYS A CD   1 
ATOM   7030  C  CE   . LYS A 1 493 ? 5.568   54.955 45.139 1.00 40.21  ? 701  LYS A CE   1 
ATOM   7031  N  NZ   . LYS A 1 493 ? 6.339   54.155 44.146 1.00 45.05  ? 701  LYS A NZ   1 
ATOM   7032  H  H    . LYS A 1 493 ? 3.547   56.598 49.785 1.00 28.33  ? 701  LYS A H    1 
ATOM   7033  H  HA   . LYS A 1 493 ? 4.898   58.606 48.585 1.00 33.76  ? 701  LYS A HA   1 
ATOM   7034  H  HB2  . LYS A 1 493 ? 5.781   56.458 48.269 1.00 35.27  ? 701  LYS A HB2  1 
ATOM   7035  H  HB3  . LYS A 1 493 ? 4.414   55.995 47.608 1.00 35.27  ? 701  LYS A HB3  1 
ATOM   7036  H  HG2  . LYS A 1 493 ? 4.790   57.340 45.781 1.00 35.01  ? 701  LYS A HG2  1 
ATOM   7037  H  HG3  . LYS A 1 493 ? 6.087   57.955 46.463 1.00 35.01  ? 701  LYS A HG3  1 
ATOM   7038  H  HD2  . LYS A 1 493 ? 6.901   56.483 44.973 1.00 43.70  ? 701  LYS A HD2  1 
ATOM   7039  H  HD3  . LYS A 1 493 ? 7.009   55.713 46.360 1.00 43.70  ? 701  LYS A HD3  1 
ATOM   7040  H  HE2  . LYS A 1 493 ? 5.297   54.366 45.861 1.00 48.25  ? 701  LYS A HE2  1 
ATOM   7041  H  HE3  . LYS A 1 493 ? 4.788   55.322 44.694 1.00 48.25  ? 701  LYS A HE3  1 
ATOM   7042  H  HZ1  . LYS A 1 493 ? 5.832   53.497 43.827 1.00 54.06  ? 701  LYS A HZ1  1 
ATOM   7043  H  HZ2  . LYS A 1 493 ? 6.596   54.675 43.472 1.00 54.06  ? 701  LYS A HZ2  1 
ATOM   7044  H  HZ3  . LYS A 1 493 ? 7.060   53.805 44.533 1.00 54.06  ? 701  LYS A HZ3  1 
ATOM   7045  N  N    . HIS A 1 494 ? 3.222   59.513 47.034 1.00 27.41  ? 702  HIS A N    1 
ATOM   7046  C  CA   . HIS A 1 494 ? 2.097   60.120 46.332 1.00 26.61  ? 702  HIS A CA   1 
ATOM   7047  C  C    . HIS A 1 494 ? 2.607   61.077 45.260 1.00 31.03  ? 702  HIS A C    1 
ATOM   7048  O  O    . HIS A 1 494 ? 3.758   61.521 45.292 1.00 31.66  ? 702  HIS A O    1 
ATOM   7049  C  CB   . HIS A 1 494 ? 1.166   60.847 47.311 1.00 31.88  ? 702  HIS A CB   1 
ATOM   7050  C  CG   . HIS A 1 494 ? 1.869   61.809 48.220 1.00 34.52  ? 702  HIS A CG   1 
ATOM   7051  N  ND1  . HIS A 1 494 ? 1.727   63.176 48.110 1.00 32.47  ? 702  HIS A ND1  1 
ATOM   7052  C  CD2  . HIS A 1 494 ? 2.718   61.602 49.255 1.00 32.21  ? 702  HIS A CD2  1 
ATOM   7053  C  CE1  . HIS A 1 494 ? 2.457   63.769 49.037 1.00 34.08  ? 702  HIS A CE1  1 
ATOM   7054  N  NE2  . HIS A 1 494 ? 3.070   62.836 49.745 1.00 34.07  ? 702  HIS A NE2  1 
ATOM   7055  H  H    . HIS A 1 494 ? 3.947   59.975 47.008 1.00 32.90  ? 702  HIS A H    1 
ATOM   7056  H  HA   . HIS A 1 494 ? 1.586   59.422 45.893 1.00 31.93  ? 702  HIS A HA   1 
ATOM   7057  H  HB2  . HIS A 1 494 ? 0.508   61.346 46.803 1.00 38.26  ? 702  HIS A HB2  1 
ATOM   7058  H  HB3  . HIS A 1 494 ? 0.721   60.187 47.866 1.00 38.26  ? 702  HIS A HB3  1 
ATOM   7059  H  HD1  . HIS A 1 494 ? 1.238   63.579 47.528 1.00 38.97  ? 702  HIS A HD1  1 
ATOM   7060  H  HD2  . HIS A 1 494 ? 3.009   60.779 49.574 1.00 38.66  ? 702  HIS A HD2  1 
ATOM   7061  H  HE1  . HIS A 1 494 ? 2.529   64.687 49.169 1.00 40.89  ? 702  HIS A HE1  1 
ATOM   7062  N  N    . HIS A 1 495 ? 1.726   61.390 44.309 1.00 28.48  ? 703  HIS A N    1 
ATOM   7063  C  CA   . HIS A 1 495 ? 2.035   62.290 43.205 1.00 28.45  ? 703  HIS A CA   1 
ATOM   7064  C  C    . HIS A 1 495 ? 1.361   63.640 43.420 1.00 28.56  ? 703  HIS A C    1 
ATOM   7065  O  O    . HIS A 1 495 ? 0.278   63.726 44.005 1.00 29.45  ? 703  HIS A O    1 
ATOM   7066  C  CB   . HIS A 1 495 ? 1.574   61.712 41.862 1.00 32.02  ? 703  HIS A CB   1 
ATOM   7067  C  CG   . HIS A 1 495 ? 1.925   60.269 41.665 1.00 33.33  ? 703  HIS A CG   1 
ATOM   7068  N  ND1  . HIS A 1 495 ? 3.207   59.843 41.391 1.00 32.86  ? 703  HIS A ND1  1 
ATOM   7069  C  CD2  . HIS A 1 495 ? 1.156   59.155 41.689 1.00 32.77  ? 703  HIS A CD2  1 
ATOM   7070  C  CE1  . HIS A 1 495 ? 3.213   58.528 41.259 1.00 32.86  ? 703  HIS A CE1  1 
ATOM   7071  N  NE2  . HIS A 1 495 ? 1.981   58.086 41.435 1.00 32.07  ? 703  HIS A NE2  1 
ATOM   7072  H  H    . HIS A 1 495 ? 0.922   61.084 44.285 1.00 34.18  ? 703  HIS A H    1 
ATOM   7073  H  HA   . HIS A 1 495 ? 2.994   62.431 43.164 1.00 34.14  ? 703  HIS A HA   1 
ATOM   7074  H  HB2  . HIS A 1 495 ? 0.609   61.792 41.803 1.00 38.42  ? 703  HIS A HB2  1 
ATOM   7075  H  HB3  . HIS A 1 495 ? 1.990   62.217 41.146 1.00 38.42  ? 703  HIS A HB3  1 
ATOM   7076  H  HD2  . HIS A 1 495 ? 0.240   59.120 41.849 1.00 39.32  ? 703  HIS A HD2  1 
ATOM   7077  H  HE1  . HIS A 1 495 ? 3.958   58.003 41.075 1.00 39.44  ? 703  HIS A HE1  1 
ATOM   7078  H  HE2  . HIS A 1 495 ? 1.735   57.263 41.399 1.00 38.49  ? 703  HIS A HE2  1 
ATOM   7079  N  N    . ALA A 1 496 ? 2.004   64.697 42.923 1.00 30.23  ? 704  ALA A N    1 
ATOM   7080  C  CA   . ALA A 1 496 ? 1.481   66.046 43.086 1.00 30.27  ? 704  ALA A CA   1 
ATOM   7081  C  C    . ALA A 1 496 ? 2.090   66.954 42.027 1.00 33.36  ? 704  ALA A C    1 
ATOM   7082  O  O    . ALA A 1 496 ? 3.207   66.721 41.559 1.00 35.91  ? 704  ALA A O    1 
ATOM   7083  C  CB   . ALA A 1 496 ? 1.780   66.591 44.486 1.00 30.06  ? 704  ALA A CB   1 
ATOM   7084  H  H    . ALA A 1 496 ? 2.744   64.656 42.488 1.00 36.28  ? 704  ALA A H    1 
ATOM   7085  H  HA   . ALA A 1 496 ? 0.519   66.035 42.963 1.00 36.32  ? 704  ALA A HA   1 
ATOM   7086  H  HB1  . ALA A 1 496 ? 1.419   67.488 44.558 1.00 36.07  ? 704  ALA A HB1  1 
ATOM   7087  H  HB2  . ALA A 1 496 ? 1.365   66.012 45.144 1.00 36.07  ? 704  ALA A HB2  1 
ATOM   7088  H  HB3  . ALA A 1 496 ? 2.740   66.608 44.619 1.00 36.07  ? 704  ALA A HB3  1 
ATOM   7089  N  N    . THR A 1 497 ? 1.344   67.992 41.655 1.00 33.62  ? 705  THR A N    1 
ATOM   7090  C  CA   . THR A 1 497 ? 1.816   68.976 40.690 1.00 32.85  ? 705  THR A CA   1 
ATOM   7091  C  C    . THR A 1 497 ? 2.520   70.108 41.429 1.00 33.63  ? 705  THR A C    1 
ATOM   7092  O  O    . THR A 1 497 ? 1.909   70.786 42.262 1.00 34.52  ? 705  THR A O    1 
ATOM   7093  C  CB   . THR A 1 497 ? 0.661   69.534 39.856 1.00 36.59  ? 705  THR A CB   1 
ATOM   7094  O  OG1  . THR A 1 497 ? 0.138   68.509 39.002 1.00 38.34  ? 705  THR A OG1  1 
ATOM   7095  C  CG2  . THR A 1 497 ? 1.128   70.712 38.996 1.00 34.83  ? 705  THR A CG2  1 
ATOM   7096  H  H    . THR A 1 497 ? 0.552   68.149 41.953 1.00 40.35  ? 705  THR A H    1 
ATOM   7097  H  HA   . THR A 1 497 ? 2.454   68.559 40.090 1.00 39.42  ? 705  THR A HA   1 
ATOM   7098  H  HB   . THR A 1 497 ? -0.041  69.847 40.448 1.00 43.91  ? 705  THR A HB   1 
ATOM   7099  H  HG1  . THR A 1 497 ? -0.143  67.866 39.463 1.00 46.01  ? 705  THR A HG1  1 
ATOM   7100  H  HG21 . THR A 1 497 ? 0.386   71.055 38.473 1.00 41.80  ? 705  THR A HG21 1 
ATOM   7101  H  HG22 . THR A 1 497 ? 1.468   71.422 39.563 1.00 41.80  ? 705  THR A HG22 1 
ATOM   7102  H  HG23 . THR A 1 497 ? 1.831   70.425 38.393 1.00 41.80  ? 705  THR A HG23 1 
ATOM   7103  N  N    . ASN A 1 498 ? 3.796   70.314 41.121 1.00 33.85  ? 706  ASN A N    1 
ATOM   7104  C  CA   . ASN A 1 498 ? 4.491   71.508 41.585 1.00 34.77  ? 706  ASN A CA   1 
ATOM   7105  C  C    . ASN A 1 498 ? 3.950   72.716 40.824 1.00 35.37  ? 706  ASN A C    1 
ATOM   7106  O  O    . ASN A 1 498 ? 4.112   72.811 39.604 1.00 35.85  ? 706  ASN A O    1 
ATOM   7107  C  CB   . ASN A 1 498 ? 5.995   71.359 41.380 1.00 35.05  ? 706  ASN A CB   1 
ATOM   7108  C  CG   . ASN A 1 498 ? 6.776   72.542 41.925 1.00 35.27  ? 706  ASN A CG   1 
ATOM   7109  O  OD1  . ASN A 1 498 ? 6.648   73.663 41.432 1.00 36.06  ? 706  ASN A OD1  1 
ATOM   7110  N  ND2  . ASN A 1 498 ? 7.594   72.296 42.941 1.00 34.60  ? 706  ASN A ND2  1 
ATOM   7111  H  H    . ASN A 1 498 ? 4.279   69.782 40.648 1.00 40.62  ? 706  ASN A H    1 
ATOM   7112  H  HA   . ASN A 1 498 ? 4.319   71.637 42.531 1.00 41.73  ? 706  ASN A HA   1 
ATOM   7113  H  HB2  . ASN A 1 498 ? 6.300   70.561 41.839 1.00 42.06  ? 706  ASN A HB2  1 
ATOM   7114  H  HB3  . ASN A 1 498 ? 6.180   71.289 40.430 1.00 42.06  ? 706  ASN A HB3  1 
ATOM   7115  H  HD21 . ASN A 1 498 ? 8.058   72.934 43.284 1.00 41.52  ? 706  ASN A HD21 1 
ATOM   7116  H  HD22 . ASN A 1 498 ? 7.658   71.500 43.259 1.00 41.52  ? 706  ASN A HD22 1 
ATOM   7117  N  N    . LEU A 1 499 ? 3.303   73.637 41.542 1.00 35.46  ? 707  LEU A N    1 
ATOM   7118  C  CA   . LEU A 1 499 ? 2.523   74.689 40.895 1.00 39.04  ? 707  LEU A CA   1 
ATOM   7119  C  C    . LEU A 1 499 ? 3.375   75.795 40.284 1.00 42.98  ? 707  LEU A C    1 
ATOM   7120  O  O    . LEU A 1 499 ? 2.912   76.467 39.355 1.00 40.50  ? 707  LEU A O    1 
ATOM   7121  C  CB   . LEU A 1 499 ? 1.547   75.306 41.897 1.00 42.91  ? 707  LEU A CB   1 
ATOM   7122  C  CG   . LEU A 1 499 ? 0.420   74.384 42.360 1.00 45.38  ? 707  LEU A CG   1 
ATOM   7123  C  CD1  . LEU A 1 499 ? -0.252  74.954 43.594 1.00 46.81  ? 707  LEU A CD1  1 
ATOM   7124  C  CD2  . LEU A 1 499 ? -0.597  74.168 41.245 1.00 46.74  ? 707  LEU A CD2  1 
ATOM   7125  H  H    . LEU A 1 499 ? 3.301   73.673 42.401 1.00 42.56  ? 707  LEU A H    1 
ATOM   7126  H  HA   . LEU A 1 499 ? 2.001   74.292 40.181 1.00 46.85  ? 707  LEU A HA   1 
ATOM   7127  H  HB2  . LEU A 1 499 ? 2.044   75.578 42.684 1.00 51.49  ? 707  LEU A HB2  1 
ATOM   7128  H  HB3  . LEU A 1 499 ? 1.137   76.084 41.487 1.00 51.49  ? 707  LEU A HB3  1 
ATOM   7129  H  HG   . LEU A 1 499 ? 0.796   73.520 42.595 1.00 54.46  ? 707  LEU A HG   1 
ATOM   7130  H  HD11 . LEU A 1 499 ? -0.962  74.354 43.872 1.00 56.17  ? 707  LEU A HD11 1 
ATOM   7131  H  HD12 . LEU A 1 499 ? 0.406   75.037 44.302 1.00 56.17  ? 707  LEU A HD12 1 
ATOM   7132  H  HD13 . LEU A 1 499 ? -0.619  75.825 43.379 1.00 56.17  ? 707  LEU A HD13 1 
ATOM   7133  H  HD21 . LEU A 1 499 ? -1.298  73.580 41.566 1.00 56.09  ? 707  LEU A HD21 1 
ATOM   7134  H  HD22 . LEU A 1 499 ? -0.973  75.026 40.992 1.00 56.09  ? 707  LEU A HD22 1 
ATOM   7135  H  HD23 . LEU A 1 499 ? -0.150  73.765 40.484 1.00 56.09  ? 707  LEU A HD23 1 
ATOM   7136  N  N    . ALA A 1 500 ? 4.596   76.013 40.778 1.00 46.74  ? 708  ALA A N    1 
ATOM   7137  C  CA   . ALA A 1 500 ? 5.420   77.086 40.229 1.00 44.58  ? 708  ALA A CA   1 
ATOM   7138  C  C    . ALA A 1 500 ? 5.916   76.742 38.829 1.00 40.45  ? 708  ALA A C    1 
ATOM   7139  O  O    . ALA A 1 500 ? 5.923   77.600 37.940 1.00 40.97  ? 708  ALA A O    1 
ATOM   7140  C  CB   . ALA A 1 500 ? 6.597   77.375 41.160 1.00 46.86  ? 708  ALA A CB   1 
ATOM   7141  H  H    . ALA A 1 500 ? 4.961   75.564 41.415 1.00 56.09  ? 708  ALA A H    1 
ATOM   7142  H  HA   . ALA A 1 500 ? 4.885   77.892 40.166 1.00 53.49  ? 708  ALA A HA   1 
ATOM   7143  H  HB1  . ALA A 1 500 ? 7.132   78.089 40.780 1.00 56.23  ? 708  ALA A HB1  1 
ATOM   7144  H  HB2  . ALA A 1 500 ? 6.254   77.643 42.027 1.00 56.23  ? 708  ALA A HB2  1 
ATOM   7145  H  HB3  . ALA A 1 500 ? 7.133   76.571 41.250 1.00 56.23  ? 708  ALA A HB3  1 
ATOM   7146  N  N    . VAL A 1 501 ? 6.333   75.492 38.612 1.00 39.98  ? 709  VAL A N    1 
ATOM   7147  C  CA   . VAL A 1 501 ? 6.785   75.054 37.294 1.00 39.14  ? 709  VAL A CA   1 
ATOM   7148  C  C    . VAL A 1 501 ? 5.736   74.225 36.561 1.00 41.42  ? 709  VAL A C    1 
ATOM   7149  O  O    . VAL A 1 501 ? 5.931   73.911 35.375 1.00 41.81  ? 709  VAL A O    1 
ATOM   7150  C  CB   . VAL A 1 501 ? 8.109   74.261 37.394 1.00 38.49  ? 709  VAL A CB   1 
ATOM   7151  C  CG1  . VAL A 1 501 ? 9.218   75.153 37.944 1.00 38.89  ? 709  VAL A CG1  1 
ATOM   7152  C  CG2  . VAL A 1 501 ? 7.940   73.021 38.262 1.00 37.25  ? 709  VAL A CG2  1 
ATOM   7153  H  H    . VAL A 1 501 ? 6.364   74.879 39.215 1.00 47.98  ? 709  VAL A H    1 
ATOM   7154  H  HA   . VAL A 1 501 ? 6.960   75.841 36.755 1.00 46.97  ? 709  VAL A HA   1 
ATOM   7155  H  HB   . VAL A 1 501 ? 8.370   73.972 36.506 1.00 46.19  ? 709  VAL A HB   1 
ATOM   7156  H  HG11 . VAL A 1 501 ? 10.039  74.638 37.998 1.00 46.67  ? 709  VAL A HG11 1 
ATOM   7157  H  HG12 . VAL A 1 501 ? 9.340   75.908 37.348 1.00 46.67  ? 709  VAL A HG12 1 
ATOM   7158  H  HG13 . VAL A 1 501 ? 8.964   75.465 38.826 1.00 46.67  ? 709  VAL A HG13 1 
ATOM   7159  H  HG21 . VAL A 1 501 ? 8.786   72.548 38.303 1.00 44.70  ? 709  VAL A HG21 1 
ATOM   7160  H  HG22 . VAL A 1 501 ? 7.669   73.293 39.152 1.00 44.70  ? 709  VAL A HG22 1 
ATOM   7161  H  HG23 . VAL A 1 501 ? 7.261   72.451 37.869 1.00 44.70  ? 709  VAL A HG23 1 
ATOM   7162  N  N    . SER A 1 502 ? 4.635   73.860 37.220 1.00 39.28  ? 710  SER A N    1 
ATOM   7163  C  CA   . SER A 1 502 ? 3.528   73.162 36.569 1.00 37.73  ? 710  SER A CA   1 
ATOM   7164  C  C    . SER A 1 502 ? 3.977   71.796 36.051 1.00 38.74  ? 710  SER A C    1 
ATOM   7165  O  O    . SER A 1 502 ? 3.721   71.423 34.904 1.00 37.35  ? 710  SER A O    1 
ATOM   7166  C  CB   . SER A 1 502 ? 2.939   74.011 35.440 1.00 40.02  ? 710  SER A CB   1 
ATOM   7167  O  OG   . SER A 1 502 ? 2.624   75.319 35.895 1.00 40.01  ? 710  SER A OG   1 
ATOM   7168  H  H    . SER A 1 502 ? 4.505   74.009 38.057 1.00 47.14  ? 710  SER A H    1 
ATOM   7169  H  HA   . SER A 1 502 ? 2.826   73.013 37.223 1.00 45.28  ? 710  SER A HA   1 
ATOM   7170  H  HB2  . SER A 1 502 ? 3.589   74.076 34.723 1.00 48.03  ? 710  SER A HB2  1 
ATOM   7171  H  HB3  . SER A 1 502 ? 2.129   73.587 35.116 1.00 48.03  ? 710  SER A HB3  1 
ATOM   7172  H  HG   . SER A 1 502 ? 2.303   75.773 35.265 1.00 48.02  ? 710  SER A HG   1 
ATOM   7173  N  N    . LYS A 1 503 ? 4.653   71.044 36.920 1.00 37.53  ? 711  LYS A N    1 
ATOM   7174  C  CA   . LYS A 1 503 ? 5.185   69.732 36.582 1.00 39.26  ? 711  LYS A CA   1 
ATOM   7175  C  C    . LYS A 1 503 ? 4.803   68.726 37.657 1.00 36.15  ? 711  LYS A C    1 
ATOM   7176  O  O    . LYS A 1 503 ? 4.793   69.048 38.848 1.00 33.59  ? 711  LYS A O    1 
ATOM   7177  C  CB   . LYS A 1 503 ? 6.710   69.763 36.436 1.00 44.93  ? 711  LYS A CB   1 
ATOM   7178  C  CG   . LYS A 1 503 ? 7.201   70.370 35.138 1.00 52.87  ? 711  LYS A CG   1 
ATOM   7179  C  CD   . LYS A 1 503 ? 8.712   70.555 35.159 1.00 58.25  ? 711  LYS A CD   1 
ATOM   7180  C  CE   . LYS A 1 503 ? 9.221   71.103 33.837 1.00 63.74  ? 711  LYS A CE   1 
ATOM   7181  N  NZ   . LYS A 1 503 ? 10.488  71.867 33.999 1.00 67.57  ? 711  LYS A NZ   1 
ATOM   7182  H  H    . LYS A 1 503 ? 4.819   71.282 37.730 1.00 45.04  ? 711  LYS A H    1 
ATOM   7183  H  HA   . LYS A 1 503 ? 4.804   69.438 35.740 1.00 47.12  ? 711  LYS A HA   1 
ATOM   7184  H  HB2  . LYS A 1 503 ? 7.081   70.285 37.164 1.00 53.92  ? 711  LYS A HB2  1 
ATOM   7185  H  HB3  . LYS A 1 503 ? 7.045   68.854 36.481 1.00 53.92  ? 711  LYS A HB3  1 
ATOM   7186  H  HG2  . LYS A 1 503 ? 6.976   69.780 34.401 1.00 63.45  ? 711  LYS A HG2  1 
ATOM   7187  H  HG3  . LYS A 1 503 ? 6.789   71.239 35.013 1.00 63.45  ? 711  LYS A HG3  1 
ATOM   7188  H  HD2  . LYS A 1 503 ? 8.948   71.183 35.860 1.00 69.90  ? 711  LYS A HD2  1 
ATOM   7189  H  HD3  . LYS A 1 503 ? 9.138   69.698 35.318 1.00 69.90  ? 711  LYS A HD3  1 
ATOM   7190  H  HE2  . LYS A 1 503 ? 9.389   70.365 33.230 1.00 76.49  ? 711  LYS A HE2  1 
ATOM   7191  H  HE3  . LYS A 1 503 ? 8.554   71.699 33.461 1.00 76.49  ? 711  LYS A HE3  1 
ATOM   7192  H  HZ1  . LYS A 1 503 ? 10.761  72.175 33.210 1.00 81.08  ? 711  LYS A HZ1  1 
ATOM   7193  H  HZ2  . LYS A 1 503 ? 10.360  72.555 34.549 1.00 81.08  ? 711  LYS A HZ2  1 
ATOM   7194  H  HZ3  . LYS A 1 503 ? 11.120  71.340 34.339 1.00 81.08  ? 711  LYS A HZ3  1 
ATOM   7195  N  N    . LEU A 1 504 ? 4.499   67.506 37.226 1.00 35.57  ? 712  LEU A N    1 
ATOM   7196  C  CA   . LEU A 1 504 ? 4.189   66.438 38.164 1.00 36.52  ? 712  LEU A CA   1 
ATOM   7197  C  C    . LEU A 1 504 ? 5.458   65.972 38.866 1.00 36.45  ? 712  LEU A C    1 
ATOM   7198  O  O    . LEU A 1 504 ? 6.535   65.922 38.267 1.00 37.32  ? 712  LEU A O    1 
ATOM   7199  C  CB   . LEU A 1 504 ? 3.536   65.261 37.430 1.00 40.36  ? 712  LEU A CB   1 
ATOM   7200  C  CG   . LEU A 1 504 ? 2.168   64.700 37.849 1.00 46.99  ? 712  LEU A CG   1 
ATOM   7201  C  CD1  . LEU A 1 504 ? 1.615   65.293 39.137 1.00 49.07  ? 712  LEU A CD1  1 
ATOM   7202  C  CD2  . LEU A 1 504 ? 1.172   64.890 36.715 1.00 52.39  ? 712  LEU A CD2  1 
ATOM   7203  H  H    . LEU A 1 504 ? 4.466   67.273 36.399 1.00 42.68  ? 712  LEU A H    1 
ATOM   7204  H  HA   . LEU A 1 504 ? 3.568   66.766 38.834 1.00 43.82  ? 712  LEU A HA   1 
ATOM   7205  H  HB2  . LEU A 1 504 ? 3.445   65.522 36.500 1.00 48.44  ? 712  LEU A HB2  1 
ATOM   7206  H  HB3  . LEU A 1 504 ? 4.156   64.517 37.479 1.00 48.44  ? 712  LEU A HB3  1 
ATOM   7207  H  HG   . LEU A 1 504 ? 2.263   63.746 37.991 1.00 56.39  ? 712  LEU A HG   1 
ATOM   7208  H  HD11 . LEU A 1 504 ? 0.755   64.887 39.327 1.00 58.88  ? 712  LEU A HD11 1 
ATOM   7209  H  HD12 . LEU A 1 504 ? 2.235   65.110 39.860 1.00 58.88  ? 712  LEU A HD12 1 
ATOM   7210  H  HD13 . LEU A 1 504 ? 1.511   66.251 39.024 1.00 58.88  ? 712  LEU A HD13 1 
ATOM   7211  H  HD21 . LEU A 1 504 ? 0.312   64.533 36.987 1.00 62.87  ? 712  LEU A HD21 1 
ATOM   7212  H  HD22 . LEU A 1 504 ? 1.091   65.837 36.520 1.00 62.87  ? 712  LEU A HD22 1 
ATOM   7213  H  HD23 . LEU A 1 504 ? 1.493   64.417 35.931 1.00 62.87  ? 712  LEU A HD23 1 
ATOM   7214  N  N    . GLU A 1 505 ? 5.325   65.633 40.148 1.00 33.35  ? 713  GLU A N    1 
ATOM   7215  C  CA   . GLU A 1 505 ? 6.438   65.137 40.946 1.00 33.50  ? 713  GLU A CA   1 
ATOM   7216  C  C    . GLU A 1 505 ? 5.944   64.003 41.835 1.00 32.69  ? 713  GLU A C    1 
ATOM   7217  O  O    . GLU A 1 505 ? 4.768   63.954 42.207 1.00 32.79  ? 713  GLU A O    1 
ATOM   7218  C  CB   . GLU A 1 505 ? 7.061   66.258 41.803 1.00 34.45  ? 713  GLU A CB   1 
ATOM   7219  C  CG   . GLU A 1 505 ? 7.616   67.425 40.985 1.00 38.19  ? 713  GLU A CG   1 
ATOM   7220  C  CD   . GLU A 1 505 ? 8.334   68.473 41.832 1.00 42.31  ? 713  GLU A CD   1 
ATOM   7221  O  OE1  . GLU A 1 505 ? 8.414   68.305 43.068 1.00 42.31  ? 713  GLU A OE1  1 
ATOM   7222  O  OE2  . GLU A 1 505 ? 8.822   69.470 41.255 1.00 43.96  ? 713  GLU A OE2  1 
ATOM   7223  H  H    . GLU A 1 505 ? 4.585   65.683 40.583 1.00 40.02  ? 713  GLU A H    1 
ATOM   7224  H  HA   . GLU A 1 505 ? 7.124   64.786 40.357 1.00 40.21  ? 713  GLU A HA   1 
ATOM   7225  H  HB2  . GLU A 1 505 ? 6.381   66.611 42.398 1.00 41.34  ? 713  GLU A HB2  1 
ATOM   7226  H  HB3  . GLU A 1 505 ? 7.791   65.886 42.322 1.00 41.34  ? 713  GLU A HB3  1 
ATOM   7227  H  HG2  . GLU A 1 505 ? 8.251   67.081 40.338 1.00 45.84  ? 713  GLU A HG2  1 
ATOM   7228  H  HG3  . GLU A 1 505 ? 6.883   67.864 40.526 1.00 45.84  ? 713  GLU A HG3  1 
ATOM   7229  N  N    . THR A 1 506 ? 6.852   63.088 42.169 1.00 31.54  ? 714  THR A N    1 
ATOM   7230  C  CA   . THR A 1 506 ? 6.552   61.953 43.036 1.00 30.96  ? 714  THR A CA   1 
ATOM   7231  C  C    . THR A 1 506 ? 7.300   62.116 44.353 1.00 30.80  ? 714  THR A C    1 
ATOM   7232  O  O    . THR A 1 506 ? 8.524   62.286 44.358 1.00 34.45  ? 714  THR A O    1 
ATOM   7233  C  CB   . THR A 1 506 ? 6.937   60.630 42.369 1.00 32.39  ? 714  THR A CB   1 
ATOM   7234  O  OG1  . THR A 1 506 ? 6.232   60.498 41.129 1.00 34.46  ? 714  THR A OG1  1 
ATOM   7235  C  CG2  . THR A 1 506 ? 6.591   59.447 43.272 1.00 30.94  ? 714  THR A CG2  1 
ATOM   7236  H  H    . THR A 1 506 ? 7.668   63.105 41.898 1.00 37.85  ? 714  THR A H    1 
ATOM   7237  H  HA   . THR A 1 506 ? 5.601   61.935 43.225 1.00 37.16  ? 714  THR A HA   1 
ATOM   7238  H  HB   . THR A 1 506 ? 7.892   60.619 42.200 1.00 38.87  ? 714  THR A HB   1 
ATOM   7239  H  HG1  . THR A 1 506 ? 5.403   60.507 41.267 1.00 41.35  ? 714  THR A HG1  1 
ATOM   7240  H  HG21 . THR A 1 506 ? 6.839   58.616 42.838 1.00 37.13  ? 714  THR A HG21 1 
ATOM   7241  H  HG22 . THR A 1 506 ? 7.070   59.520 44.112 1.00 37.13  ? 714  THR A HG22 1 
ATOM   7242  H  HG23 . THR A 1 506 ? 5.638   59.437 43.452 1.00 37.13  ? 714  THR A HG23 1 
ATOM   7243  N  N    . LEU A 1 507 ? 6.564   62.049 45.461 1.00 29.57  ? 715  LEU A N    1 
ATOM   7244  C  CA   . LEU A 1 507 ? 7.085   62.380 46.779 1.00 30.67  ? 715  LEU A CA   1 
ATOM   7245  C  C    . LEU A 1 507 ? 6.747   61.274 47.771 1.00 28.45  ? 715  LEU A C    1 
ATOM   7246  O  O    . LEU A 1 507 ? 5.856   60.455 47.533 1.00 29.52  ? 715  LEU A O    1 
ATOM   7247  C  CB   . LEU A 1 507 ? 6.500   63.706 47.280 1.00 31.38  ? 715  LEU A CB   1 
ATOM   7248  C  CG   . LEU A 1 507 ? 6.453   64.844 46.257 1.00 33.21  ? 715  LEU A CG   1 
ATOM   7249  C  CD1  . LEU A 1 507 ? 5.607   65.983 46.785 1.00 33.32  ? 715  LEU A CD1  1 
ATOM   7250  C  CD2  . LEU A 1 507 ? 7.848   65.332 45.921 1.00 34.53  ? 715  LEU A CD2  1 
ATOM   7251  H  H    . LEU A 1 507 ? 5.738   61.809 45.471 1.00 35.49  ? 715  LEU A H    1 
ATOM   7252  H  HA   . LEU A 1 507 ? 8.050   62.467 46.733 1.00 36.81  ? 715  LEU A HA   1 
ATOM   7253  H  HB2  . LEU A 1 507 ? 5.591   63.546 47.578 1.00 37.66  ? 715  LEU A HB2  1 
ATOM   7254  H  HB3  . LEU A 1 507 ? 7.035   64.013 48.029 1.00 37.66  ? 715  LEU A HB3  1 
ATOM   7255  H  HG   . LEU A 1 507 ? 6.043   64.519 45.440 1.00 39.86  ? 715  LEU A HG   1 
ATOM   7256  H  HD11 . LEU A 1 507 ? 5.588   66.694 46.125 1.00 39.99  ? 715  LEU A HD11 1 
ATOM   7257  H  HD12 . LEU A 1 507 ? 4.708   65.659 46.949 1.00 39.99  ? 715  LEU A HD12 1 
ATOM   7258  H  HD13 . LEU A 1 507 ? 5.998   66.309 47.611 1.00 39.99  ? 715  LEU A HD13 1 
ATOM   7259  H  HD21 . LEU A 1 507 ? 7.783   66.050 45.273 1.00 41.44  ? 715  LEU A HD21 1 
ATOM   7260  H  HD22 . LEU A 1 507 ? 8.272   65.655 46.731 1.00 41.44  ? 715  LEU A HD22 1 
ATOM   7261  H  HD23 . LEU A 1 507 ? 8.358   64.596 45.550 1.00 41.44  ? 715  LEU A HD23 1 
ATOM   7262  N  N    . GLU A 1 508 ? 7.470   61.261 48.896 1.00 32.15  ? 716  GLU A N    1 
ATOM   7263  C  CA   . GLU A 1 508 ? 7.139   60.412 50.037 1.00 31.98  ? 716  GLU A CA   1 
ATOM   7264  C  C    . GLU A 1 508 ? 7.104   61.267 51.298 1.00 30.69  ? 716  GLU A C    1 
ATOM   7265  O  O    . GLU A 1 508 ? 8.025   62.054 51.546 1.00 27.38  ? 716  GLU A O    1 
ATOM   7266  C  CB   . GLU A 1 508 ? 8.134   59.252 50.209 1.00 33.69  ? 716  GLU A CB   1 
ATOM   7267  C  CG   . GLU A 1 508 ? 7.659   58.182 51.214 1.00 33.10  ? 716  GLU A CG   1 
ATOM   7268  C  CD   . GLU A 1 508 ? 8.505   56.904 51.204 1.00 33.54  ? 716  GLU A CD   1 
ATOM   7269  O  OE1  . GLU A 1 508 ? 7.985   55.840 50.795 1.00 31.03  ? 716  GLU A OE1  1 
ATOM   7270  O  OE2  . GLU A 1 508 ? 9.682   56.958 51.615 1.00 31.45  ? 716  GLU A OE2  1 
ATOM   7271  H  H    . GLU A 1 508 ? 8.169   61.746 49.020 1.00 38.58  ? 716  GLU A H    1 
ATOM   7272  H  HA   . GLU A 1 508 ? 6.256   60.034 49.905 1.00 38.38  ? 716  GLU A HA   1 
ATOM   7273  H  HB2  . GLU A 1 508 ? 8.263   58.819 49.351 1.00 40.43  ? 716  GLU A HB2  1 
ATOM   7274  H  HB3  . GLU A 1 508 ? 8.978   59.607 50.529 1.00 40.43  ? 716  GLU A HB3  1 
ATOM   7275  H  HG2  . GLU A 1 508 ? 7.696   58.555 52.109 1.00 39.72  ? 716  GLU A HG2  1 
ATOM   7276  H  HG3  . GLU A 1 508 ? 6.746   57.935 50.999 1.00 39.72  ? 716  GLU A HG3  1 
ATOM   7277  N  N    . THR A 1 509 ? 6.037   61.117 52.081 1.00 27.75  ? 717  THR A N    1 
ATOM   7278  C  CA   . THR A 1 509 ? 5.836   61.864 53.316 1.00 28.36  ? 717  THR A CA   1 
ATOM   7279  C  C    . THR A 1 509 ? 5.919   60.929 54.516 1.00 27.49  ? 717  THR A C    1 
ATOM   7280  O  O    . THR A 1 509 ? 5.404   59.807 54.479 1.00 25.91  ? 717  THR A O    1 
ATOM   7281  C  CB   . THR A 1 509 ? 4.475   62.572 53.316 1.00 28.09  ? 717  THR A CB   1 
ATOM   7282  O  OG1  . THR A 1 509 ? 4.470   63.612 52.329 1.00 30.18  ? 717  THR A OG1  1 
ATOM   7283  C  CG2  . THR A 1 509 ? 4.166   63.179 54.681 1.00 32.62  ? 717  THR A CG2  1 
ATOM   7284  H  H    . THR A 1 509 ? 5.396   60.570 51.909 1.00 33.30  ? 717  THR A H    1 
ATOM   7285  H  HA   . THR A 1 509 ? 6.531   62.535 53.402 1.00 34.04  ? 717  THR A HA   1 
ATOM   7286  H  HB   . THR A 1 509 ? 3.780   61.929 53.105 1.00 33.71  ? 717  THR A HB   1 
ATOM   7287  H  HG1  . THR A 1 509 ? 4.609   63.287 51.568 1.00 36.22  ? 717  THR A HG1  1 
ATOM   7288  H  HG21 . THR A 1 509 ? 3.303   63.622 54.659 1.00 39.15  ? 717  THR A HG21 1 
ATOM   7289  H  HG22 . THR A 1 509 ? 4.147   62.483 55.356 1.00 39.15  ? 717  THR A HG22 1 
ATOM   7290  H  HG23 . THR A 1 509 ? 4.847   63.829 54.917 1.00 39.15  ? 717  THR A HG23 1 
ATOM   7291  N  N    . TRP A 1 510 ? 6.551   61.412 55.581 1.00 28.45  ? 718  TRP A N    1 
ATOM   7292  C  CA   . TRP A 1 510 ? 6.629   60.720 56.861 1.00 29.21  ? 718  TRP A CA   1 
ATOM   7293  C  C    . TRP A 1 510 ? 5.726   61.440 57.856 1.00 28.18  ? 718  TRP A C    1 
ATOM   7294  O  O    . TRP A 1 510 ? 5.968   62.608 58.185 1.00 27.79  ? 718  TRP A O    1 
ATOM   7295  C  CB   . TRP A 1 510 ? 8.077   60.688 57.356 1.00 26.76  ? 718  TRP A CB   1 
ATOM   7296  C  CG   . TRP A 1 510 ? 8.282   60.181 58.760 1.00 26.25  ? 718  TRP A CG   1 
ATOM   7297  C  CD1  . TRP A 1 510 ? 7.402   59.465 59.524 1.00 28.09  ? 718  TRP A CD1  1 
ATOM   7298  C  CD2  . TRP A 1 510 ? 9.455   60.358 59.564 1.00 28.86  ? 718  TRP A CD2  1 
ATOM   7299  N  NE1  . TRP A 1 510 ? 7.954   59.191 60.752 1.00 27.75  ? 718  TRP A NE1  1 
ATOM   7300  C  CE2  . TRP A 1 510 ? 9.215   59.730 60.801 1.00 29.70  ? 718  TRP A CE2  1 
ATOM   7301  C  CE3  . TRP A 1 510 ? 10.687  60.991 59.356 1.00 30.96  ? 718  TRP A CE3  1 
ATOM   7302  C  CZ2  . TRP A 1 510 ? 10.162  59.714 61.826 1.00 30.68  ? 718  TRP A CZ2  1 
ATOM   7303  C  CZ3  . TRP A 1 510 ? 11.625  60.972 60.376 1.00 31.73  ? 718  TRP A CZ3  1 
ATOM   7304  C  CH2  . TRP A 1 510 ? 11.357  60.339 61.594 1.00 31.69  ? 718  TRP A CH2  1 
ATOM   7305  H  H    . TRP A 1 510 ? 6.958   62.170 55.584 1.00 34.14  ? 718  TRP A H    1 
ATOM   7306  H  HA   . TRP A 1 510 ? 6.315   59.808 56.759 1.00 35.06  ? 718  TRP A HA   1 
ATOM   7307  H  HB2  . TRP A 1 510 ? 8.589   60.115 56.764 1.00 32.12  ? 718  TRP A HB2  1 
ATOM   7308  H  HB3  . TRP A 1 510 ? 8.433   61.589 57.319 1.00 32.12  ? 718  TRP A HB3  1 
ATOM   7309  H  HD1  . TRP A 1 510 ? 6.550   59.205 59.254 1.00 33.71  ? 718  TRP A HD1  1 
ATOM   7310  H  HE1  . TRP A 1 510 ? 7.572   58.754 61.386 1.00 33.30  ? 718  TRP A HE1  1 
ATOM   7311  H  HE3  . TRP A 1 510 ? 10.871  61.415 58.549 1.00 37.16  ? 718  TRP A HE3  1 
ATOM   7312  H  HZ2  . TRP A 1 510 ? 9.988   59.292 62.636 1.00 36.82  ? 718  TRP A HZ2  1 
ATOM   7313  H  HZ3  . TRP A 1 510 ? 12.446  61.390 60.250 1.00 38.07  ? 718  TRP A HZ3  1 
ATOM   7314  H  HH2  . TRP A 1 510 ? 12.005  60.343 62.261 1.00 38.03  ? 718  TRP A HH2  1 
ATOM   7315  N  N    . VAL A 1 511 ? 4.688   60.749 58.327 1.00 26.72  ? 719  VAL A N    1 
ATOM   7316  C  CA   . VAL A 1 511 ? 3.807   61.266 59.370 1.00 28.90  ? 719  VAL A CA   1 
ATOM   7317  C  C    . VAL A 1 511 ? 3.966   60.404 60.615 1.00 25.19  ? 719  VAL A C    1 
ATOM   7318  O  O    . VAL A 1 511 ? 4.083   59.173 60.525 1.00 26.86  ? 719  VAL A O    1 
ATOM   7319  C  CB   . VAL A 1 511 ? 2.331   61.314 58.923 1.00 30.72  ? 719  VAL A CB   1 
ATOM   7320  C  CG1  . VAL A 1 511 ? 2.137   62.360 57.835 1.00 30.07  ? 719  VAL A CG1  1 
ATOM   7321  C  CG2  . VAL A 1 511 ? 1.859   59.943 58.453 1.00 31.11  ? 719  VAL A CG2  1 
ATOM   7322  H  H    . VAL A 1 511 ? 4.471   59.964 58.053 1.00 32.07  ? 719  VAL A H    1 
ATOM   7323  H  HA   . VAL A 1 511 ? 4.081   62.169 59.595 1.00 34.69  ? 719  VAL A HA   1 
ATOM   7324  H  HB   . VAL A 1 511 ? 1.784   61.571 59.682 1.00 36.86  ? 719  VAL A HB   1 
ATOM   7325  H  HG11 . VAL A 1 511 ? 1.203   62.371 57.572 1.00 36.09  ? 719  VAL A HG11 1 
ATOM   7326  H  HG12 . VAL A 1 511 ? 2.393   63.228 58.184 1.00 36.09  ? 719  VAL A HG12 1 
ATOM   7327  H  HG13 . VAL A 1 511 ? 2.693   62.131 57.075 1.00 36.09  ? 719  VAL A HG13 1 
ATOM   7328  H  HG21 . VAL A 1 511 ? 0.930   60.006 58.179 1.00 37.33  ? 719  VAL A HG21 1 
ATOM   7329  H  HG22 . VAL A 1 511 ? 2.406   59.660 57.704 1.00 37.33  ? 719  VAL A HG22 1 
ATOM   7330  H  HG23 . VAL A 1 511 ? 1.947   59.311 59.184 1.00 37.33  ? 719  VAL A HG23 1 
ATOM   7331  N  N    . MET A 1 512 ? 3.968   61.057 61.776 1.00 27.64  ? 720  MET A N    1 
ATOM   7332  C  CA   . MET A 1 512 ? 4.145   60.420 63.071 1.00 27.56  ? 720  MET A CA   1 
ATOM   7333  C  C    . MET A 1 512 ? 3.061   60.902 64.026 1.00 30.85  ? 720  MET A C    1 
ATOM   7334  O  O    . MET A 1 512 ? 2.736   62.097 64.039 1.00 27.35  ? 720  MET A O    1 
ATOM   7335  C  CB   . MET A 1 512 ? 5.529   60.741 63.654 1.00 31.37  ? 720  MET A CB   1 
ATOM   7336  C  CG   . MET A 1 512 ? 5.754   60.207 65.066 1.00 38.40  ? 720  MET A CG   1 
ATOM   7337  S  SD   . MET A 1 512 ? 7.340   60.709 65.760 1.00 47.93  ? 720  MET A SD   1 
ATOM   7338  C  CE   . MET A 1 512 ? 8.443   59.584 64.916 1.00 47.83  ? 720  MET A CE   1 
ATOM   7339  H  H    . MET A 1 512 ? 3.865   61.909 61.835 1.00 33.17  ? 720  MET A H    1 
ATOM   7340  H  HA   . MET A 1 512 ? 4.074   59.458 62.966 1.00 33.08  ? 720  MET A HA   1 
ATOM   7341  H  HB2  . MET A 1 512 ? 6.207   60.350 63.080 1.00 37.65  ? 720  MET A HB2  1 
ATOM   7342  H  HB3  . MET A 1 512 ? 5.640   61.704 63.682 1.00 37.65  ? 720  MET A HB3  1 
ATOM   7343  H  HG2  . MET A 1 512 ? 5.053   60.543 65.646 1.00 46.08  ? 720  MET A HG2  1 
ATOM   7344  H  HG3  . MET A 1 512 ? 5.730   59.238 65.045 1.00 46.08  ? 720  MET A HG3  1 
ATOM   7345  H  HE1  . MET A 1 512 ? 9.352   59.754 65.208 1.00 57.40  ? 720  MET A HE1  1 
ATOM   7346  H  HE2  . MET A 1 512 ? 8.191   58.672 65.133 1.00 57.40  ? 720  MET A HE2  1 
ATOM   7347  H  HE3  . MET A 1 512 ? 8.370   59.728 63.960 1.00 57.40  ? 720  MET A HE3  1 
ATOM   7348  N  N    . PRO A 1 513 ? 2.488   60.014 64.841 1.00 34.59  ? 721  PRO A N    1 
ATOM   7349  C  CA   . PRO A 1 513 ? 1.412   60.441 65.745 1.00 35.88  ? 721  PRO A CA   1 
ATOM   7350  C  C    . PRO A 1 513 ? 1.944   61.174 66.967 1.00 34.34  ? 721  PRO A C    1 
ATOM   7351  O  O    . PRO A 1 513 ? 2.995   60.836 67.517 1.00 32.41  ? 721  PRO A O    1 
ATOM   7352  C  CB   . PRO A 1 513 ? 0.741   59.120 66.139 1.00 34.52  ? 721  PRO A CB   1 
ATOM   7353  C  CG   . PRO A 1 513 ? 1.837   58.119 66.060 1.00 35.75  ? 721  PRO A CG   1 
ATOM   7354  C  CD   . PRO A 1 513 ? 2.730   58.562 64.926 1.00 35.96  ? 721  PRO A CD   1 
ATOM   7355  H  HA   . PRO A 1 513 ? 0.775   61.003 65.277 1.00 43.06  ? 721  PRO A HA   1 
ATOM   7356  H  HB2  . PRO A 1 513 ? 0.395   59.183 67.042 1.00 41.43  ? 721  PRO A HB2  1 
ATOM   7357  H  HB3  . PRO A 1 513 ? 0.034   58.909 65.510 1.00 41.43  ? 721  PRO A HB3  1 
ATOM   7358  H  HG2  . PRO A 1 513 ? 2.329   58.110 66.896 1.00 42.90  ? 721  PRO A HG2  1 
ATOM   7359  H  HG3  . PRO A 1 513 ? 1.463   57.243 65.876 1.00 42.90  ? 721  PRO A HG3  1 
ATOM   7360  H  HD2  . PRO A 1 513 ? 3.660   58.387 65.140 1.00 43.15  ? 721  PRO A HD2  1 
ATOM   7361  H  HD3  . PRO A 1 513 ? 2.468   58.127 64.100 1.00 43.15  ? 721  PRO A HD3  1 
ATOM   7362  N  N    . LYS A 1 514 ? 1.200   62.197 67.384 1.00 33.99  ? 722  LYS A N    1 
ATOM   7363  C  CA   . LYS A 1 514 ? 1.546   62.948 68.581 1.00 33.80  ? 722  LYS A CA   1 
ATOM   7364  C  C    . LYS A 1 514 ? 1.285   62.113 69.832 1.00 35.20  ? 722  LYS A C    1 
ATOM   7365  O  O    . LYS A 1 514 ? 0.363   61.294 69.879 1.00 32.72  ? 722  LYS A O    1 
ATOM   7366  C  CB   . LYS A 1 514 ? 0.738   64.247 68.641 1.00 34.82  ? 722  LYS A CB   1 
ATOM   7367  C  CG   . LYS A 1 514 ? 1.203   65.306 67.651 1.00 38.14  ? 722  LYS A CG   1 
ATOM   7368  C  CD   . LYS A 1 514 ? 0.181   66.427 67.476 1.00 42.87  ? 722  LYS A CD   1 
ATOM   7369  C  CE   . LYS A 1 514 ? 0.746   67.551 66.615 1.00 46.45  ? 722  LYS A CE   1 
ATOM   7370  N  NZ   . LYS A 1 514 ? -0.312  68.430 66.040 1.00 49.05  ? 722  LYS A NZ   1 
ATOM   7371  H  H    . LYS A 1 514 ? 0.489   62.474 66.988 1.00 40.79  ? 722  LYS A H    1 
ATOM   7372  H  HA   . LYS A 1 514 ? 2.488   63.175 68.557 1.00 40.56  ? 722  LYS A HA   1 
ATOM   7373  H  HB2  . LYS A 1 514 ? -0.191  64.047 68.447 1.00 41.79  ? 722  LYS A HB2  1 
ATOM   7374  H  HB3  . LYS A 1 514 ? 0.814   64.621 69.533 1.00 41.79  ? 722  LYS A HB3  1 
ATOM   7375  H  HG2  . LYS A 1 514 ? 2.030   65.699 67.971 1.00 45.77  ? 722  LYS A HG2  1 
ATOM   7376  H  HG3  . LYS A 1 514 ? 1.345   64.891 66.786 1.00 45.77  ? 722  LYS A HG3  1 
ATOM   7377  H  HD2  . LYS A 1 514 ? -0.610  66.075 67.040 1.00 51.44  ? 722  LYS A HD2  1 
ATOM   7378  H  HD3  . LYS A 1 514 ? -0.046  66.793 68.345 1.00 51.44  ? 722  LYS A HD3  1 
ATOM   7379  H  HE2  . LYS A 1 514 ? 1.329   68.103 67.159 1.00 55.74  ? 722  LYS A HE2  1 
ATOM   7380  H  HE3  . LYS A 1 514 ? 1.246   67.164 65.880 1.00 55.74  ? 722  LYS A HE3  1 
ATOM   7381  H  HZ1  . LYS A 1 514 ? -0.859  67.950 65.527 1.00 58.86  ? 722  LYS A HZ1  1 
ATOM   7382  H  HZ2  . LYS A 1 514 ? -0.783  68.806 66.694 1.00 58.86  ? 722  LYS A HZ2  1 
ATOM   7383  H  HZ3  . LYS A 1 514 ? 0.060   69.070 65.546 1.00 58.86  ? 722  LYS A HZ3  1 
ATOM   7384  N  N    . LYS A 1 515 ? 2.116   62.326 70.851 1.00 37.81  ? 723  LYS A N    1 
ATOM   7385  C  CA   . LYS A 1 515 ? 1.950   61.622 72.117 1.00 42.71  ? 723  LYS A CA   1 
ATOM   7386  C  C    . LYS A 1 515 ? 0.760   62.191 72.879 1.00 43.52  ? 723  LYS A C    1 
ATOM   7387  O  O    . LYS A 1 515 ? 0.608   63.412 72.992 1.00 43.36  ? 723  LYS A O    1 
ATOM   7388  C  CB   . LYS A 1 515 ? 3.223   61.732 72.954 1.00 46.25  ? 723  LYS A CB   1 
ATOM   7389  C  CG   . LYS A 1 515 ? 4.416   60.994 72.360 1.00 46.67  ? 723  LYS A CG   1 
ATOM   7390  H  H    . LYS A 1 515 ? 2.780   62.871 70.834 1.00 45.37  ? 723  LYS A H    1 
ATOM   7391  H  HA   . LYS A 1 515 ? 1.780   60.683 71.942 1.00 51.25  ? 723  LYS A HA   1 
ATOM   7392  H  HB2  . LYS A 1 515 ? 3.464   62.668 73.035 1.00 55.50  ? 723  LYS A HB2  1 
ATOM   7393  H  HB3  . LYS A 1 515 ? 3.052   61.360 73.834 1.00 55.50  ? 723  LYS A HB3  1 
ATOM   7394  N  N    . VAL A 1 516 ? -0.083  61.305 73.410 1.00 41.56  ? 724  VAL A N    1 
ATOM   7395  C  CA   . VAL A 1 516 ? -1.344  61.721 74.018 1.00 42.45  ? 724  VAL A CA   1 
ATOM   7396  C  C    . VAL A 1 516 ? -1.546  61.089 75.392 1.00 43.45  ? 724  VAL A C    1 
ATOM   7397  O  O    . VAL A 1 516 ? -2.483  61.450 76.112 1.00 44.05  ? 724  VAL A O    1 
ATOM   7398  C  CB   . VAL A 1 516 ? -2.526  61.385 73.091 1.00 44.00  ? 724  VAL A CB   1 
ATOM   7399  C  CG1  . VAL A 1 516 ? -2.483  62.254 71.844 1.00 44.17  ? 724  VAL A CG1  1 
ATOM   7400  C  CG2  . VAL A 1 516 ? -2.511  59.906 72.718 1.00 44.84  ? 724  VAL A CG2  1 
ATOM   7401  H  H    . VAL A 1 516 ? 0.053   60.456 73.430 1.00 49.87  ? 724  VAL A H    1 
ATOM   7402  H  HA   . VAL A 1 516 ? -1.327  62.683 74.137 1.00 50.95  ? 724  VAL A HA   1 
ATOM   7403  H  HB   . VAL A 1 516 ? -3.357  61.569 73.557 1.00 52.80  ? 724  VAL A HB   1 
ATOM   7404  H  HG11 . VAL A 1 516 ? -3.235  62.027 71.275 1.00 53.00  ? 724  VAL A HG11 1 
ATOM   7405  H  HG12 . VAL A 1 516 ? -2.537  63.186 72.107 1.00 53.00  ? 724  VAL A HG12 1 
ATOM   7406  H  HG13 . VAL A 1 516 ? -1.651  62.089 71.374 1.00 53.00  ? 724  VAL A HG13 1 
ATOM   7407  H  HG21 . VAL A 1 516 ? -3.263  59.720 72.135 1.00 53.81  ? 724  VAL A HG21 1 
ATOM   7408  H  HG22 . VAL A 1 516 ? -1.680  59.705 72.260 1.00 53.81  ? 724  VAL A HG22 1 
ATOM   7409  H  HG23 . VAL A 1 516 ? -2.579  59.376 73.527 1.00 53.81  ? 724  VAL A HG23 1 
ATOM   7410  N  N    . PHE A 1 517 ? -0.686  60.146 75.774 1.00 43.85  ? 725  PHE A N    1 
ATOM   7411  C  CA   . PHE A 1 517 ? -0.796  59.522 77.089 1.00 44.80  ? 725  PHE A CA   1 
ATOM   7412  C  C    . PHE A 1 517 ? -0.175  60.436 78.139 1.00 47.27  ? 725  PHE A C    1 
ATOM   7413  O  O    . PHE A 1 517 ? 0.994   60.820 78.020 1.00 47.78  ? 725  PHE A O    1 
ATOM   7414  C  CB   . PHE A 1 517 ? -0.121  58.153 77.103 1.00 42.84  ? 725  PHE A CB   1 
ATOM   7415  C  CG   . PHE A 1 517 ? -0.121  57.496 78.454 1.00 44.62  ? 725  PHE A CG   1 
ATOM   7416  C  CD1  . PHE A 1 517 ? -1.304  57.049 79.023 1.00 45.28  ? 725  PHE A CD1  1 
ATOM   7417  C  CD2  . PHE A 1 517 ? 1.059   57.322 79.156 1.00 46.27  ? 725  PHE A CD2  1 
ATOM   7418  C  CE1  . PHE A 1 517 ? -1.308  56.445 80.267 1.00 46.83  ? 725  PHE A CE1  1 
ATOM   7419  C  CE2  . PHE A 1 517 ? 1.061   56.716 80.401 1.00 47.94  ? 725  PHE A CE2  1 
ATOM   7420  C  CZ   . PHE A 1 517 ? -0.124  56.279 80.956 1.00 48.81  ? 725  PHE A CZ   1 
ATOM   7421  H  H    . PHE A 1 517 ? -0.035  59.852 75.294 1.00 52.62  ? 725  PHE A H    1 
ATOM   7422  H  HA   . PHE A 1 517 ? -1.733  59.401 77.308 1.00 53.76  ? 725  PHE A HA   1 
ATOM   7423  H  HB2  . PHE A 1 517 ? -0.589  57.567 76.487 1.00 51.41  ? 725  PHE A HB2  1 
ATOM   7424  H  HB3  . PHE A 1 517 ? 0.802   58.256 76.822 1.00 51.41  ? 725  PHE A HB3  1 
ATOM   7425  H  HD1  . PHE A 1 517 ? -2.105  57.160 78.563 1.00 54.34  ? 725  PHE A HD1  1 
ATOM   7426  H  HD2  . PHE A 1 517 ? 1.861   57.616 78.787 1.00 55.52  ? 725  PHE A HD2  1 
ATOM   7427  H  HE1  . PHE A 1 517 ? -2.108  56.150 80.638 1.00 56.20  ? 725  PHE A HE1  1 
ATOM   7428  H  HE2  . PHE A 1 517 ? 1.860   56.606 80.863 1.00 57.53  ? 725  PHE A HE2  1 
ATOM   7429  H  HZ   . PHE A 1 517 ? -0.124  55.872 81.792 1.00 58.57  ? 725  PHE A HZ   1 
ATOM   7430  N  N    . LYS A 1 518 ? -0.952  60.779 79.166 1.00 50.91  ? 726  LYS A N    1 
ATOM   7431  C  CA   . LYS A 1 518 ? -0.514  61.714 80.198 1.00 56.50  ? 726  LYS A CA   1 
ATOM   7432  C  C    . LYS A 1 518 ? -0.892  61.165 81.565 1.00 60.58  ? 726  LYS A C    1 
ATOM   7433  O  O    . LYS A 1 518 ? -2.077  60.974 81.853 1.00 58.05  ? 726  LYS A O    1 
ATOM   7434  C  CB   . LYS A 1 518 ? -1.140  63.098 79.993 1.00 58.23  ? 726  LYS A CB   1 
ATOM   7435  C  CG   . LYS A 1 518 ? -0.601  63.854 78.789 1.00 58.97  ? 726  LYS A CG   1 
ATOM   7436  H  H    . LYS A 1 518 ? -1.748  60.478 79.287 1.00 61.10  ? 726  LYS A H    1 
ATOM   7437  H  HA   . LYS A 1 518 ? 0.451   61.807 80.161 1.00 67.80  ? 726  LYS A HA   1 
ATOM   7438  H  HB2  . LYS A 1 518 ? -2.097  62.992 79.871 1.00 69.88  ? 726  LYS A HB2  1 
ATOM   7439  H  HB3  . LYS A 1 518 ? -0.969  63.637 80.781 1.00 69.88  ? 726  LYS A HB3  1 
ATOM   7440  N  N    . ILE A 1 519 ? 0.111   60.922 82.403 1.00 67.09  ? 727  ILE A N    1 
ATOM   7441  C  CA   . ILE A 1 519 ? -0.123  60.491 83.774 1.00 74.28  ? 727  ILE A CA   1 
ATOM   7442  C  C    . ILE A 1 519 ? -0.898  61.576 84.511 1.00 75.22  ? 727  ILE A C    1 
ATOM   7443  O  O    . ILE A 1 519 ? -0.347  62.624 84.847 1.00 75.59  ? 727  ILE A O    1 
ATOM   7444  C  CB   . ILE A 1 519 ? 1.209   60.165 84.487 1.00 79.82  ? 727  ILE A CB   1 
ATOM   7445  C  CG1  . ILE A 1 519 ? 1.766   58.822 83.993 1.00 80.97  ? 727  ILE A CG1  1 
ATOM   7446  C  CG2  . ILE A 1 519 ? 1.041   60.169 86.013 1.00 82.86  ? 727  ILE A CG2  1 
ATOM   7447  C  CD1  . ILE A 1 519 ? 1.009   57.597 84.490 1.00 82.37  ? 727  ILE A CD1  1 
ATOM   7448  H  H    . ILE A 1 519 ? 0.943   61.000 82.198 1.00 80.51  ? 727  ILE A H    1 
ATOM   7449  H  HA   . ILE A 1 519 ? -0.664  59.686 83.766 1.00 89.14  ? 727  ILE A HA   1 
ATOM   7450  H  HB   . ILE A 1 519 ? 1.849   60.856 84.256 1.00 95.78  ? 727  ILE A HB   1 
ATOM   7451  H  HG12 . ILE A 1 519 ? 1.735   58.813 83.024 1.00 97.17  ? 727  ILE A HG12 1 
ATOM   7452  H  HG13 . ILE A 1 519 ? 2.685   58.740 84.291 1.00 97.17  ? 727  ILE A HG13 1 
ATOM   7453  H  HG21 . ILE A 1 519 ? 1.895   59.961 86.425 1.00 99.43  ? 727  ILE A HG21 1 
ATOM   7454  H  HG22 . ILE A 1 519 ? 0.743   61.047 86.295 1.00 99.43  ? 727  ILE A HG22 1 
ATOM   7455  H  HG23 . ILE A 1 519 ? 0.383   59.500 86.259 1.00 99.43  ? 727  ILE A HG23 1 
ATOM   7456  H  HD11 . ILE A 1 519 ? 1.429   56.800 84.130 1.00 98.85  ? 727  ILE A HD11 1 
ATOM   7457  H  HD12 . ILE A 1 519 ? 1.041   57.578 85.459 1.00 98.85  ? 727  ILE A HD12 1 
ATOM   7458  H  HD13 . ILE A 1 519 ? 0.089   57.651 84.190 1.00 98.85  ? 727  ILE A HD13 1 
ATOM   7459  N  N    . PHE A 1 526 ? 2.173   57.022 93.457 1.00 81.84  ? 734  PHE A N    1 
ATOM   7460  C  CA   . PHE A 1 526 ? 3.016   55.940 92.961 1.00 78.41  ? 734  PHE A CA   1 
ATOM   7461  C  C    . PHE A 1 526 ? 2.188   54.688 92.682 1.00 73.96  ? 734  PHE A C    1 
ATOM   7462  O  O    . PHE A 1 526 ? 2.302   53.686 93.388 1.00 75.06  ? 734  PHE A O    1 
ATOM   7463  C  CB   . PHE A 1 526 ? 4.127   55.624 93.965 1.00 79.89  ? 734  PHE A CB   1 
ATOM   7464  H  H    . PHE A 1 526 ? 2.049   57.007 94.308 1.00 98.21  ? 734  PHE A H    1 
ATOM   7465  H  HA   . PHE A 1 526 ? 3.432   56.217 92.129 1.00 94.10  ? 734  PHE A HA   1 
ATOM   7466  N  N    . GLY A 1 527 ? 1.357   54.753 91.647 1.00 68.36  ? 735  GLY A N    1 
ATOM   7467  C  CA   . GLY A 1 527 ? 0.501   53.646 91.281 1.00 64.75  ? 735  GLY A CA   1 
ATOM   7468  C  C    . GLY A 1 527 ? 1.208   52.642 90.390 1.00 60.12  ? 735  GLY A C    1 
ATOM   7469  O  O    . GLY A 1 527 ? 2.417   52.700 90.156 1.00 57.62  ? 735  GLY A O    1 
ATOM   7470  H  H    . GLY A 1 527 ? 1.273   55.440 91.136 1.00 82.04  ? 735  GLY A H    1 
ATOM   7471  H  HA2  . GLY A 1 527 ? 0.203   53.189 92.083 1.00 77.70  ? 735  GLY A HA2  1 
ATOM   7472  H  HA3  . GLY A 1 527 ? -0.278  53.981 90.809 1.00 77.70  ? 735  GLY A HA3  1 
ATOM   7473  N  N    . ARG A 1 528 ? 0.417   51.700 89.876 1.00 58.53  ? 736  ARG A N    1 
ATOM   7474  C  CA   . ARG A 1 528 ? 0.925   50.623 89.037 1.00 56.51  ? 736  ARG A CA   1 
ATOM   7475  C  C    . ARG A 1 528 ? 0.765   50.892 87.546 1.00 50.70  ? 736  ARG A C    1 
ATOM   7476  O  O    . ARG A 1 528 ? 1.386   50.191 86.738 1.00 47.53  ? 736  ARG A O    1 
ATOM   7477  C  CB   . ARG A 1 528 ? 0.214   49.308 89.383 1.00 59.96  ? 736  ARG A CB   1 
ATOM   7478  C  CG   . ARG A 1 528 ? 0.381   48.863 90.825 1.00 63.72  ? 736  ARG A CG   1 
ATOM   7479  C  CD   . ARG A 1 528 ? -0.499  47.662 91.131 1.00 66.32  ? 736  ARG A CD   1 
ATOM   7480  N  NE   . ARG A 1 528 ? -0.215  46.538 90.242 1.00 66.58  ? 736  ARG A NE   1 
ATOM   7481  C  CZ   . ARG A 1 528 ? -1.003  45.477 90.099 1.00 65.97  ? 736  ARG A CZ   1 
ATOM   7482  N  NH1  . ARG A 1 528 ? -2.137  45.387 90.784 1.00 66.94  ? 736  ARG A NH1  1 
ATOM   7483  N  NH2  . ARG A 1 528 ? -0.661  44.506 89.264 1.00 64.24  ? 736  ARG A NH2  1 
ATOM   7484  H  H    . ARG A 1 528 ? -0.433  51.665 90.004 1.00 70.23  ? 736  ARG A H    1 
ATOM   7485  H  HA   . ARG A 1 528 ? 1.871   50.506 89.218 1.00 67.81  ? 736  ARG A HA   1 
ATOM   7486  H  HB2  . ARG A 1 528 ? -0.735  49.415 89.216 1.00 71.95  ? 736  ARG A HB2  1 
ATOM   7487  H  HB3  . ARG A 1 528 ? 0.568   48.605 88.815 1.00 71.95  ? 736  ARG A HB3  1 
ATOM   7488  H  HG2  . ARG A 1 528 ? 1.305   48.612 90.980 1.00 76.47  ? 736  ARG A HG2  1 
ATOM   7489  H  HG3  . ARG A 1 528 ? 0.125   49.588 91.417 1.00 76.47  ? 736  ARG A HG3  1 
ATOM   7490  H  HD2  . ARG A 1 528 ? -0.339  47.374 92.043 1.00 79.58  ? 736  ARG A HD2  1 
ATOM   7491  H  HD3  . ARG A 1 528 ? -1.429  47.911 91.016 1.00 79.58  ? 736  ARG A HD3  1 
ATOM   7492  H  HE   . ARG A 1 528 ? 0.510   46.564 89.781 1.00 79.90  ? 736  ARG A HE   1 
ATOM   7493  H  HH11 . ARG A 1 528 ? -2.363  46.016 91.325 1.00 80.33  ? 736  ARG A HH11 1 
ATOM   7494  H  HH12 . ARG A 1 528 ? -2.644  44.699 90.687 1.00 80.33  ? 736  ARG A HH12 1 
ATOM   7495  H  HH21 . ARG A 1 528 ? 0.073   44.561 88.819 1.00 77.09  ? 736  ARG A HH21 1 
ATOM   7496  H  HH22 . ARG A 1 528 ? -1.170  43.820 89.171 1.00 77.09  ? 736  ARG A HH22 1 
ATOM   7497  N  N    . LEU A 1 529 ? -0.041  51.878 87.162 1.00 48.01  ? 737  LEU A N    1 
ATOM   7498  C  CA   . LEU A 1 529 ? -0.333  52.106 85.754 1.00 47.46  ? 737  LEU A CA   1 
ATOM   7499  C  C    . LEU A 1 529 ? 0.921   52.545 85.008 1.00 49.02  ? 737  LEU A C    1 
ATOM   7500  O  O    . LEU A 1 529 ? 1.624   53.466 85.436 1.00 50.91  ? 737  LEU A O    1 
ATOM   7501  C  CB   . LEU A 1 529 ? -1.430  53.159 85.609 1.00 46.12  ? 737  LEU A CB   1 
ATOM   7502  C  CG   . LEU A 1 529 ? -1.863  53.484 84.177 1.00 43.81  ? 737  LEU A CG   1 
ATOM   7503  C  CD1  . LEU A 1 529 ? -2.448  52.255 83.490 1.00 40.70  ? 737  LEU A CD1  1 
ATOM   7504  C  CD2  . LEU A 1 529 ? -2.864  54.627 84.171 1.00 44.66  ? 737  LEU A CD2  1 
ATOM   7505  H  H    . LEU A 1 529 ? -0.430  52.427 87.698 1.00 57.61  ? 737  LEU A H    1 
ATOM   7506  H  HA   . LEU A 1 529 ? -0.650  51.280 85.355 1.00 56.96  ? 737  LEU A HA   1 
ATOM   7507  H  HB2  . LEU A 1 529 ? -2.216  52.849 86.085 1.00 55.35  ? 737  LEU A HB2  1 
ATOM   7508  H  HB3  . LEU A 1 529 ? -1.116  53.985 86.010 1.00 55.35  ? 737  LEU A HB3  1 
ATOM   7509  H  HG   . LEU A 1 529 ? -1.086  53.766 83.670 1.00 52.58  ? 737  LEU A HG   1 
ATOM   7510  H  HD11 . LEU A 1 529 ? -2.711  52.494 82.588 1.00 48.84  ? 737  LEU A HD11 1 
ATOM   7511  H  HD12 . LEU A 1 529 ? -1.774  51.558 83.465 1.00 48.84  ? 737  LEU A HD12 1 
ATOM   7512  H  HD13 . LEU A 1 529 ? -3.221  51.952 83.992 1.00 48.84  ? 737  LEU A HD13 1 
ATOM   7513  H  HD21 . LEU A 1 529 ? -3.124  54.815 83.256 1.00 53.60  ? 737  LEU A HD21 1 
ATOM   7514  H  HD22 . LEU A 1 529 ? -3.642  54.368 84.690 1.00 53.60  ? 737  LEU A HD22 1 
ATOM   7515  H  HD23 . LEU A 1 529 ? -2.450  55.411 84.565 1.00 53.60  ? 737  LEU A HD23 1 
ATOM   7516  N  N    . GLN A 1 530 ? 1.195   51.886 83.882 1.00 46.78  ? 738  GLN A N    1 
ATOM   7517  C  CA   . GLN A 1 530 ? 2.345   52.207 83.048 1.00 47.03  ? 738  GLN A CA   1 
ATOM   7518  C  C    . GLN A 1 530 ? 1.975   52.819 81.707 1.00 48.46  ? 738  GLN A C    1 
ATOM   7519  O  O    . GLN A 1 530 ? 2.717   53.665 81.205 1.00 50.37  ? 738  GLN A O    1 
ATOM   7520  C  CB   . GLN A 1 530 ? 3.185   50.949 82.795 1.00 43.96  ? 738  GLN A CB   1 
ATOM   7521  C  CG   . GLN A 1 530 ? 3.799   50.349 84.050 1.00 45.99  ? 738  GLN A CG   1 
ATOM   7522  C  CD   . GLN A 1 530 ? 4.536   49.050 83.774 1.00 46.96  ? 738  GLN A CD   1 
ATOM   7523  O  OE1  . GLN A 1 530 ? 4.317   48.404 82.749 1.00 46.35  ? 738  GLN A OE1  1 
ATOM   7524  N  NE2  . GLN A 1 530 ? 5.419   48.664 84.689 1.00 49.08  ? 738  GLN A NE2  1 
ATOM   7525  H  H    . GLN A 1 530 ? 0.719   51.239 83.577 1.00 56.14  ? 738  GLN A H    1 
ATOM   7526  H  HA   . GLN A 1 530 ? 2.903   52.845 83.520 1.00 56.44  ? 738  GLN A HA   1 
ATOM   7527  H  HB2  . GLN A 1 530 ? 2.619   50.273 82.390 1.00 52.76  ? 738  GLN A HB2  1 
ATOM   7528  H  HB3  . GLN A 1 530 ? 3.910   51.175 82.191 1.00 52.76  ? 738  GLN A HB3  1 
ATOM   7529  H  HG2  . GLN A 1 530 ? 4.432   50.980 84.426 1.00 55.19  ? 738  GLN A HG2  1 
ATOM   7530  H  HG3  . GLN A 1 530 ? 3.094   50.164 84.690 1.00 55.19  ? 738  GLN A HG3  1 
ATOM   7531  H  HE21 . GLN A 1 530 ? 5.546   49.141 85.392 1.00 58.90  ? 738  GLN A HE21 1 
ATOM   7532  H  HE22 . GLN A 1 530 ? 5.862   47.935 84.578 1.00 58.90  ? 738  GLN A HE22 1 
ATOM   7533  N  N    . PHE A 1 531 ? 0.850   52.421 81.119 1.00 47.04  ? 739  PHE A N    1 
ATOM   7534  C  CA   . PHE A 1 531 ? 0.475   52.897 79.796 1.00 45.24  ? 739  PHE A CA   1 
ATOM   7535  C  C    . PHE A 1 531 ? -1.005  52.623 79.580 1.00 43.45  ? 739  PHE A C    1 
ATOM   7536  O  O    . PHE A 1 531 ? -1.605  51.781 80.254 1.00 43.07  ? 739  PHE A O    1 
ATOM   7537  C  CB   . PHE A 1 531 ? 1.324   52.227 78.708 1.00 46.65  ? 739  PHE A CB   1 
ATOM   7538  C  CG   . PHE A 1 531 ? 1.170   52.842 77.346 1.00 47.45  ? 739  PHE A CG   1 
ATOM   7539  C  CD1  . PHE A 1 531 ? 1.572   54.147 77.111 1.00 48.22  ? 739  PHE A CD1  1 
ATOM   7540  C  CD2  . PHE A 1 531 ? 0.643   52.108 76.295 1.00 48.51  ? 739  PHE A CD2  1 
ATOM   7541  C  CE1  . PHE A 1 531 ? 1.437   54.713 75.856 1.00 48.79  ? 739  PHE A CE1  1 
ATOM   7542  C  CE2  . PHE A 1 531 ? 0.507   52.669 75.038 1.00 50.06  ? 739  PHE A CE2  1 
ATOM   7543  C  CZ   . PHE A 1 531 ? 0.903   53.975 74.820 1.00 49.49  ? 739  PHE A CZ   1 
ATOM   7544  H  H    . PHE A 1 531 ? 0.287   51.873 81.468 1.00 56.45  ? 739  PHE A H    1 
ATOM   7545  H  HA   . PHE A 1 531 ? 0.619   53.855 79.747 1.00 54.29  ? 739  PHE A HA   1 
ATOM   7546  H  HB2  . PHE A 1 531 ? 2.259   52.292 78.958 1.00 55.98  ? 739  PHE A HB2  1 
ATOM   7547  H  HB3  . PHE A 1 531 ? 1.067   51.294 78.642 1.00 55.98  ? 739  PHE A HB3  1 
ATOM   7548  H  HD1  . PHE A 1 531 ? 1.930   54.650 77.806 1.00 57.86  ? 739  PHE A HD1  1 
ATOM   7549  H  HD2  . PHE A 1 531 ? 0.372   51.230 76.438 1.00 58.21  ? 739  PHE A HD2  1 
ATOM   7550  H  HE1  . PHE A 1 531 ? 1.705   55.592 75.711 1.00 58.55  ? 739  PHE A HE1  1 
ATOM   7551  H  HE2  . PHE A 1 531 ? 0.147   52.169 74.342 1.00 60.08  ? 739  PHE A HE2  1 
ATOM   7552  H  HZ   . PHE A 1 531 ? 0.813   54.354 73.975 1.00 59.39  ? 739  PHE A HZ   1 
ATOM   7553  N  N    . SER A 1 532 ? -1.586  53.352 78.630 1.00 43.96  ? 740  SER A N    1 
ATOM   7554  C  CA   . SER A 1 532 ? -2.991  53.202 78.279 1.00 45.72  ? 740  SER A CA   1 
ATOM   7555  C  C    . SER A 1 532 ? -3.170  53.609 76.824 1.00 43.60  ? 740  SER A C    1 
ATOM   7556  O  O    . SER A 1 532 ? -2.604  54.612 76.384 1.00 44.23  ? 740  SER A O    1 
ATOM   7557  C  CB   . SER A 1 532 ? -3.887  54.049 79.189 1.00 49.00  ? 740  SER A CB   1 
ATOM   7558  O  OG   . SER A 1 532 ? -5.239  53.989 78.773 1.00 51.70  ? 740  SER A OG   1 
ATOM   7559  H  H    . SER A 1 532 ? -1.178  53.951 78.167 1.00 52.76  ? 740  SER A H    1 
ATOM   7560  H  HA   . SER A 1 532 ? -3.250  52.272 78.372 1.00 54.87  ? 740  SER A HA   1 
ATOM   7561  H  HB2  . SER A 1 532 ? -3.822  53.713 80.097 1.00 58.80  ? 740  SER A HB2  1 
ATOM   7562  H  HB3  . SER A 1 532 ? -3.588  54.971 79.155 1.00 58.80  ? 740  SER A HB3  1 
ATOM   7563  H  HG   . SER A 1 532 ? -5.717  54.457 79.280 1.00 62.05  ? 740  SER A HG   1 
ATOM   7564  N  N    . GLU A 1 533 ? -3.962  52.833 76.086 1.00 41.88  ? 741  GLU A N    1 
ATOM   7565  C  CA   . GLU A 1 533 ? -4.086  53.022 74.648 1.00 41.69  ? 741  GLU A CA   1 
ATOM   7566  C  C    . GLU A 1 533 ? -5.452  52.537 74.183 1.00 38.79  ? 741  GLU A C    1 
ATOM   7567  O  O    . GLU A 1 533 ? -6.033  51.617 74.766 1.00 37.93  ? 741  GLU A O    1 
ATOM   7568  C  CB   . GLU A 1 533 ? -2.968  52.273 73.906 1.00 44.55  ? 741  GLU A CB   1 
ATOM   7569  C  CG   . GLU A 1 533 ? -2.949  52.470 72.397 1.00 48.11  ? 741  GLU A CG   1 
ATOM   7570  C  CD   . GLU A 1 533 ? -1.820  51.700 71.722 1.00 52.62  ? 741  GLU A CD   1 
ATOM   7571  O  OE1  . GLU A 1 533 ? -1.063  51.003 72.432 1.00 53.79  ? 741  GLU A OE1  1 
ATOM   7572  O  OE2  . GLU A 1 533 ? -1.691  51.788 70.481 1.00 53.35  ? 741  GLU A OE2  1 
ATOM   7573  H  H    . GLU A 1 533 ? -4.438  52.189 76.398 1.00 50.26  ? 741  GLU A H    1 
ATOM   7574  H  HA   . GLU A 1 533 ? -4.010  53.967 74.441 1.00 50.02  ? 741  GLU A HA   1 
ATOM   7575  H  HB2  . GLU A 1 533 ? -2.113  52.575 74.251 1.00 53.46  ? 741  GLU A HB2  1 
ATOM   7576  H  HB3  . GLU A 1 533 ? -3.069  51.323 74.075 1.00 53.46  ? 741  GLU A HB3  1 
ATOM   7577  H  HG2  . GLU A 1 533 ? -3.789  52.159 72.026 1.00 57.73  ? 741  GLU A HG2  1 
ATOM   7578  H  HG3  . GLU A 1 533 ? -2.828  53.413 72.202 1.00 57.73  ? 741  GLU A HG3  1 
ATOM   7579  N  N    . VAL A 1 534 ? -5.959  53.170 73.126 1.00 35.64  ? 742  VAL A N    1 
ATOM   7580  C  CA   . VAL A 1 534 ? -7.193  52.764 72.465 1.00 35.54  ? 742  VAL A CA   1 
ATOM   7581  C  C    . VAL A 1 534 ? -6.863  52.348 71.038 1.00 35.01  ? 742  VAL A C    1 
ATOM   7582  O  O    . VAL A 1 534 ? -6.083  53.018 70.352 1.00 33.65  ? 742  VAL A O    1 
ATOM   7583  C  CB   . VAL A 1 534 ? -8.243  53.896 72.476 1.00 37.72  ? 742  VAL A CB   1 
ATOM   7584  C  CG1  . VAL A 1 534 ? -9.452  53.537 71.614 1.00 39.33  ? 742  VAL A CG1  1 
ATOM   7585  C  CG2  . VAL A 1 534 ? -8.687  54.193 73.901 1.00 39.73  ? 742  VAL A CG2  1 
ATOM   7586  H  H    . VAL A 1 534 ? -5.591  53.858 72.764 1.00 42.77  ? 742  VAL A H    1 
ATOM   7587  H  HA   . VAL A 1 534 ? -7.567  51.998 72.927 1.00 42.64  ? 742  VAL A HA   1 
ATOM   7588  H  HB   . VAL A 1 534 ? -7.844  54.702 72.112 1.00 45.26  ? 742  VAL A HB   1 
ATOM   7589  H  HG11 . VAL A 1 534 ? -10.089 54.267 71.643 1.00 47.19  ? 742  VAL A HG11 1 
ATOM   7590  H  HG12 . VAL A 1 534 ? -9.157  53.392 70.701 1.00 47.19  ? 742  VAL A HG12 1 
ATOM   7591  H  HG13 . VAL A 1 534 ? -9.859  52.728 71.962 1.00 47.19  ? 742  VAL A HG13 1 
ATOM   7592  H  HG21 . VAL A 1 534 ? -9.345  54.906 73.884 1.00 47.68  ? 742  VAL A HG21 1 
ATOM   7593  H  HG22 . VAL A 1 534 ? -9.076  53.391 74.283 1.00 47.68  ? 742  VAL A HG22 1 
ATOM   7594  H  HG23 . VAL A 1 534 ? -7.915  54.467 74.420 1.00 47.68  ? 742  VAL A HG23 1 
ATOM   7595  N  N    . GLY A 1 535 ? -7.457  51.245 70.596 1.00 32.07  ? 743  GLY A N    1 
ATOM   7596  C  CA   . GLY A 1 535 ? -7.242  50.769 69.245 1.00 32.52  ? 743  GLY A CA   1 
ATOM   7597  C  C    . GLY A 1 535 ? -8.217  49.669 68.880 1.00 33.78  ? 743  GLY A C    1 
ATOM   7598  O  O    . GLY A 1 535 ? -9.246  49.489 69.532 1.00 35.77  ? 743  GLY A O    1 
ATOM   7599  H  H    . GLY A 1 535 ? -7.989  50.757 71.063 1.00 38.49  ? 743  GLY A H    1 
ATOM   7600  H  HA2  . GLY A 1 535 ? -7.353  51.502 68.620 1.00 39.02  ? 743  GLY A HA2  1 
ATOM   7601  H  HA3  . GLY A 1 535 ? -6.339  50.424 69.161 1.00 39.02  ? 743  GLY A HA3  1 
ATOM   7602  N  N    . THR A 1 536 ? -7.884  48.932 67.818 1.00 35.32  ? 744  THR A N    1 
ATOM   7603  C  CA   . THR A 1 536 ? -8.669  47.775 67.402 1.00 35.32  ? 744  THR A CA   1 
ATOM   7604  C  C    . THR A 1 536 ? -7.730  46.657 66.969 1.00 35.22  ? 744  THR A C    1 
ATOM   7605  O  O    . THR A 1 536 ? -6.529  46.860 66.768 1.00 32.47  ? 744  THR A O    1 
ATOM   7606  C  CB   . THR A 1 536 ? -9.639  48.108 66.261 1.00 37.28  ? 744  THR A CB   1 
ATOM   7607  O  OG1  . THR A 1 536 ? -8.908  48.586 65.125 1.00 36.98  ? 744  THR A OG1  1 
ATOM   7608  C  CG2  . THR A 1 536 ? -10.655 49.155 66.699 1.00 40.85  ? 744  THR A CG2  1 
ATOM   7609  H  H    . THR A 1 536 ? -7.200  49.086 67.320 1.00 42.39  ? 744  THR A H    1 
ATOM   7610  H  HA   . THR A 1 536 ? -9.189  47.457 68.156 1.00 42.39  ? 744  THR A HA   1 
ATOM   7611  H  HB   . THR A 1 536 ? -10.123 47.305 66.011 1.00 44.74  ? 744  THR A HB   1 
ATOM   7612  H  HG1  . THR A 1 536 ? -9.437  48.769 64.499 1.00 44.38  ? 744  THR A HG1  1 
ATOM   7613  H  HG21 . THR A 1 536 ? -11.261 49.356 65.969 1.00 49.02  ? 744  THR A HG21 1 
ATOM   7614  H  HG22 . THR A 1 536 ? -11.168 48.824 67.453 1.00 49.02  ? 744  THR A HG22 1 
ATOM   7615  H  HG23 . THR A 1 536 ? -10.198 49.970 66.963 1.00 49.02  ? 744  THR A HG23 1 
ATOM   7616  N  N    . ASP A 1 537 ? -8.301  45.460 66.825 1.00 35.66  ? 745  ASP A N    1 
ATOM   7617  C  CA   . ASP A 1 537 ? -7.554  44.260 66.445 1.00 36.99  ? 745  ASP A CA   1 
ATOM   7618  C  C    . ASP A 1 537 ? -6.458  43.951 67.468 1.00 33.61  ? 745  ASP A C    1 
ATOM   7619  O  O    . ASP A 1 537 ? -5.272  43.846 67.149 1.00 34.15  ? 745  ASP A O    1 
ATOM   7620  C  CB   . ASP A 1 537 ? -6.979  44.405 65.032 1.00 42.79  ? 745  ASP A CB   1 
ATOM   7621  C  CG   . ASP A 1 537 ? -8.063  44.482 63.968 1.00 50.50  ? 745  ASP A CG   1 
ATOM   7622  O  OD1  . ASP A 1 537 ? -9.140  43.881 64.169 1.00 53.50  ? 745  ASP A OD1  1 
ATOM   7623  O  OD2  . ASP A 1 537 ? -7.841  45.146 62.933 1.00 53.87  ? 745  ASP A OD2  1 
ATOM   7624  H  H    . ASP A 1 537 ? -9.140  45.314 66.946 1.00 42.80  ? 745  ASP A H    1 
ATOM   7625  H  HA   . ASP A 1 537 ? -8.165  43.507 66.435 1.00 44.39  ? 745  ASP A HA   1 
ATOM   7626  H  HB2  . ASP A 1 537 ? -6.453  45.219 64.986 1.00 51.35  ? 745  ASP A HB2  1 
ATOM   7627  H  HB3  . ASP A 1 537 ? -6.420  43.637 64.837 1.00 51.35  ? 745  ASP A HB3  1 
ATOM   7628  N  N    . TRP A 1 538 ? -6.890  43.792 68.717 1.00 33.65  ? 746  TRP A N    1 
ATOM   7629  C  CA   . TRP A 1 538 ? -5.979  43.478 69.808 1.00 32.89  ? 746  TRP A CA   1 
ATOM   7630  C  C    . TRP A 1 538 ? -5.477  42.043 69.682 1.00 33.53  ? 746  TRP A C    1 
ATOM   7631  O  O    . TRP A 1 538 ? -6.269  41.102 69.576 1.00 34.66  ? 746  TRP A O    1 
ATOM   7632  C  CB   . TRP A 1 538 ? -6.688  43.686 71.147 1.00 33.43  ? 746  TRP A CB   1 
ATOM   7633  C  CG   . TRP A 1 538 ? -5.927  43.205 72.350 1.00 35.47  ? 746  TRP A CG   1 
ATOM   7634  C  CD1  . TRP A 1 538 ? -6.175  42.078 73.077 1.00 37.34  ? 746  TRP A CD1  1 
ATOM   7635  C  CD2  . TRP A 1 538 ? -4.805  43.844 72.975 1.00 34.97  ? 746  TRP A CD2  1 
ATOM   7636  N  NE1  . TRP A 1 538 ? -5.277  41.970 74.111 1.00 37.01  ? 746  TRP A NE1  1 
ATOM   7637  C  CE2  . TRP A 1 538 ? -4.424  43.041 74.070 1.00 36.99  ? 746  TRP A CE2  1 
ATOM   7638  C  CE3  . TRP A 1 538 ? -4.083  45.012 72.712 1.00 35.23  ? 746  TRP A CE3  1 
ATOM   7639  C  CZ2  . TRP A 1 538 ? -3.354  43.368 74.901 1.00 38.47  ? 746  TRP A CZ2  1 
ATOM   7640  C  CZ3  . TRP A 1 538 ? -3.020  45.335 73.538 1.00 35.43  ? 746  TRP A CZ3  1 
ATOM   7641  C  CH2  . TRP A 1 538 ? -2.665  44.515 74.619 1.00 37.08  ? 746  TRP A CH2  1 
ATOM   7642  H  H    . TRP A 1 538 ? -7.713  43.861 68.957 1.00 40.38  ? 746  TRP A H    1 
ATOM   7643  H  HA   . TRP A 1 538 ? -5.215  44.074 69.771 1.00 39.47  ? 746  TRP A HA   1 
ATOM   7644  H  HB2  . TRP A 1 538 ? -6.852  44.635 71.265 1.00 40.11  ? 746  TRP A HB2  1 
ATOM   7645  H  HB3  . TRP A 1 538 ? -7.533  43.211 71.126 1.00 40.11  ? 746  TRP A HB3  1 
ATOM   7646  H  HD1  . TRP A 1 538 ? -6.856  41.469 72.898 1.00 44.81  ? 746  TRP A HD1  1 
ATOM   7647  H  HE1  . TRP A 1 538 ? -5.253  41.333 74.689 1.00 44.42  ? 746  TRP A HE1  1 
ATOM   7648  H  HE3  . TRP A 1 538 ? -4.310  45.560 71.996 1.00 42.27  ? 746  TRP A HE3  1 
ATOM   7649  H  HZ2  . TRP A 1 538 ? -3.117  42.827 75.619 1.00 46.17  ? 746  TRP A HZ2  1 
ATOM   7650  H  HZ3  . TRP A 1 538 ? -2.532  46.109 73.374 1.00 42.52  ? 746  TRP A HZ3  1 
ATOM   7651  H  HH2  . TRP A 1 538 ? -1.948  44.759 75.158 1.00 44.50  ? 746  TRP A HH2  1 
ATOM   7652  N  N    . ASP A 1 539 ? -4.155  41.883 69.684 1.00 34.69  ? 747  ASP A N    1 
ATOM   7653  C  CA   . ASP A 1 539 ? -3.513  40.572 69.598 1.00 34.59  ? 747  ASP A CA   1 
ATOM   7654  C  C    . ASP A 1 539 ? -3.222  40.107 71.019 1.00 33.81  ? 747  ASP A C    1 
ATOM   7655  O  O    . ASP A 1 539 ? -2.269  40.567 71.654 1.00 35.62  ? 747  ASP A O    1 
ATOM   7656  C  CB   . ASP A 1 539 ? -2.243  40.653 68.755 1.00 32.10  ? 747  ASP A CB   1 
ATOM   7657  C  CG   . ASP A 1 539 ? -1.551  39.304 68.583 1.00 34.03  ? 747  ASP A CG   1 
ATOM   7658  O  OD1  . ASP A 1 539 ? -1.688  38.428 69.465 1.00 34.49  ? 747  ASP A OD1  1 
ATOM   7659  O  OD2  . ASP A 1 539 ? -0.853  39.128 67.560 1.00 34.17  ? 747  ASP A OD2  1 
ATOM   7660  H  H    . ASP A 1 539 ? -3.595  42.535 69.735 1.00 41.63  ? 747  ASP A H    1 
ATOM   7661  H  HA   . ASP A 1 539 ? -4.119  39.938 69.183 1.00 41.51  ? 747  ASP A HA   1 
ATOM   7662  H  HB2  . ASP A 1 539 ? -2.471  40.987 67.873 1.00 38.52  ? 747  ASP A HB2  1 
ATOM   7663  H  HB3  . ASP A 1 539 ? -1.618  41.257 69.185 1.00 38.52  ? 747  ASP A HB3  1 
ATOM   7664  N  N    . ALA A 1 540 ? -4.046  39.186 71.523 1.00 34.50  ? 748  ALA A N    1 
ATOM   7665  C  CA   . ALA A 1 540 ? -3.896  38.724 72.898 1.00 35.79  ? 748  ALA A CA   1 
ATOM   7666  C  C    . ALA A 1 540 ? -2.628  37.907 73.101 1.00 35.59  ? 748  ALA A C    1 
ATOM   7667  O  O    . ALA A 1 540 ? -2.137  37.823 74.232 1.00 36.44  ? 748  ALA A O    1 
ATOM   7668  C  CB   . ALA A 1 540 ? -5.116  37.899 73.310 1.00 36.61  ? 748  ALA A CB   1 
ATOM   7669  H  H    . ALA A 1 540 ? -4.692  38.818 71.092 1.00 41.40  ? 748  ALA A H    1 
ATOM   7670  H  HA   . ALA A 1 540 ? -3.848  39.496 73.483 1.00 42.96  ? 748  ALA A HA   1 
ATOM   7671  H  HB1  . ALA A 1 540 ? -5.000  37.600 74.226 1.00 43.93  ? 748  ALA A HB1  1 
ATOM   7672  H  HB2  . ALA A 1 540 ? -5.909  38.453 73.241 1.00 43.93  ? 748  ALA A HB2  1 
ATOM   7673  H  HB3  . ALA A 1 540 ? -5.194  37.133 72.719 1.00 43.93  ? 748  ALA A HB3  1 
ATOM   7674  N  N    . LYS A 1 541 ? -2.086  37.306 72.040 1.00 36.26  ? 749  LYS A N    1 
ATOM   7675  C  CA   . LYS A 1 541 ? -0.861  36.525 72.177 1.00 37.48  ? 749  LYS A CA   1 
ATOM   7676  C  C    . LYS A 1 541 ? 0.353   37.432 72.338 1.00 35.83  ? 749  LYS A C    1 
ATOM   7677  O  O    . LYS A 1 541 ? 1.177   37.231 73.237 1.00 36.25  ? 749  LYS A O    1 
ATOM   7678  C  CB   . LYS A 1 541 ? -0.688  35.604 70.969 1.00 38.63  ? 749  LYS A CB   1 
ATOM   7679  C  CG   . LYS A 1 541 ? 0.587   34.769 71.000 1.00 37.84  ? 749  LYS A CG   1 
ATOM   7680  C  CD   . LYS A 1 541 ? 0.601   33.715 69.897 1.00 36.86  ? 749  LYS A CD   1 
ATOM   7681  C  CE   . LYS A 1 541 ? 0.829   34.320 68.516 1.00 34.98  ? 749  LYS A CE   1 
ATOM   7682  N  NZ   . LYS A 1 541 ? 2.225   34.818 68.327 1.00 36.53  ? 749  LYS A NZ   1 
ATOM   7683  H  H    . LYS A 1 541 ? -2.405  37.335 71.242 1.00 43.51  ? 749  LYS A H    1 
ATOM   7684  H  HA   . LYS A 1 541 ? -0.927  35.970 72.970 1.00 44.98  ? 749  LYS A HA   1 
ATOM   7685  H  HB2  . LYS A 1 541 ? -1.441  34.993 70.932 1.00 46.35  ? 749  LYS A HB2  1 
ATOM   7686  H  HB3  . LYS A 1 541 ? -0.667  36.146 70.165 1.00 46.35  ? 749  LYS A HB3  1 
ATOM   7687  H  HG2  . LYS A 1 541 ? 1.353   35.351 70.873 1.00 45.41  ? 749  LYS A HG2  1 
ATOM   7688  H  HG3  . LYS A 1 541 ? 0.649   34.314 71.854 1.00 45.41  ? 749  LYS A HG3  1 
ATOM   7689  H  HD2  . LYS A 1 541 ? 1.317   33.084 70.070 1.00 44.24  ? 749  LYS A HD2  1 
ATOM   7690  H  HD3  . LYS A 1 541 ? -0.253  33.255 69.887 1.00 44.24  ? 749  LYS A HD3  1 
ATOM   7691  H  HE2  . LYS A 1 541 ? 0.658   33.643 67.842 1.00 41.98  ? 749  LYS A HE2  1 
ATOM   7692  H  HE3  . LYS A 1 541 ? 0.224   35.069 68.395 1.00 41.98  ? 749  LYS A HE3  1 
ATOM   7693  H  HZ1  . LYS A 1 541 ? 2.408   35.447 68.930 1.00 43.84  ? 749  LYS A HZ1  1 
ATOM   7694  H  HZ2  . LYS A 1 541 ? 2.803   34.147 68.425 1.00 43.84  ? 749  LYS A HZ2  1 
ATOM   7695  H  HZ3  . LYS A 1 541 ? 2.318   35.162 67.512 1.00 43.84  ? 749  LYS A HZ3  1 
ATOM   7696  N  N    . GLU A 1 542 ? 0.485   38.432 71.471 1.00 36.01  ? 750  GLU A N    1 
ATOM   7697  C  CA   . GLU A 1 542 ? 1.609   39.357 71.528 1.00 36.67  ? 750  GLU A CA   1 
ATOM   7698  C  C    . GLU A 1 542 ? 1.297   40.624 72.318 1.00 36.48  ? 750  GLU A C    1 
ATOM   7699  O  O    . GLU A 1 542 ? 2.193   41.453 72.508 1.00 38.74  ? 750  GLU A O    1 
ATOM   7700  C  CB   . GLU A 1 542 ? 2.055   39.725 70.108 1.00 38.89  ? 750  GLU A CB   1 
ATOM   7701  C  CG   . GLU A 1 542 ? 2.538   38.533 69.286 1.00 39.84  ? 750  GLU A CG   1 
ATOM   7702  C  CD   . GLU A 1 542 ? 3.675   37.781 69.956 1.00 41.05  ? 750  GLU A CD   1 
ATOM   7703  O  OE1  . GLU A 1 542 ? 4.470   38.420 70.680 1.00 39.23  ? 750  GLU A OE1  1 
ATOM   7704  O  OE2  . GLU A 1 542 ? 3.765   36.548 69.770 1.00 39.97  ? 750  GLU A OE2  1 
ATOM   7705  H  H    . GLU A 1 542 ? -0.070  38.597 70.834 1.00 43.21  ? 750  GLU A H    1 
ATOM   7706  H  HA   . GLU A 1 542 ? 2.353   38.914 71.965 1.00 44.01  ? 750  GLU A HA   1 
ATOM   7707  H  HB2  . GLU A 1 542 ? 1.307   40.125 69.639 1.00 46.67  ? 750  GLU A HB2  1 
ATOM   7708  H  HB3  . GLU A 1 542 ? 2.785   40.361 70.165 1.00 46.67  ? 750  GLU A HB3  1 
ATOM   7709  H  HG2  . GLU A 1 542 ? 1.801   37.914 69.162 1.00 47.81  ? 750  GLU A HG2  1 
ATOM   7710  H  HG3  . GLU A 1 542 ? 2.853   38.849 68.425 1.00 47.81  ? 750  GLU A HG3  1 
ATOM   7711  N  N    . ARG A 1 543 ? 0.061   40.791 72.785 1.00 39.29  ? 751  ARG A N    1 
ATOM   7712  C  CA   . ARG A 1 543 ? -0.317  41.923 73.632 1.00 40.20  ? 751  ARG A CA   1 
ATOM   7713  C  C    . ARG A 1 543 ? 0.006   43.255 72.947 1.00 40.10  ? 751  ARG A C    1 
ATOM   7714  O  O    . ARG A 1 543 ? 0.833   44.046 73.408 1.00 41.68  ? 751  ARG A O    1 
ATOM   7715  C  CB   . ARG A 1 543 ? 0.363   41.824 75.005 1.00 39.76  ? 751  ARG A CB   1 
ATOM   7716  C  CG   . ARG A 1 543 ? -0.391  40.961 76.022 1.00 42.58  ? 751  ARG A CG   1 
ATOM   7717  C  CD   . ARG A 1 543 ? 0.301   39.633 76.292 1.00 44.04  ? 751  ARG A CD   1 
ATOM   7718  N  NE   . ARG A 1 543 ? 1.663   39.806 76.799 1.00 45.39  ? 751  ARG A NE   1 
ATOM   7719  C  CZ   . ARG A 1 543 ? 2.013   39.773 78.083 1.00 46.38  ? 751  ARG A CZ   1 
ATOM   7720  N  NH1  . ARG A 1 543 ? 1.107   39.567 79.032 1.00 45.57  ? 751  ARG A NH1  1 
ATOM   7721  N  NH2  . ARG A 1 543 ? 3.285   39.944 78.421 1.00 47.55  ? 751  ARG A NH2  1 
ATOM   7722  H  H    . ARG A 1 543 ? -0.590  40.253 72.623 1.00 47.16  ? 751  ARG A H    1 
ATOM   7723  H  HA   . ARG A 1 543 ? -1.276  41.894 73.778 1.00 48.24  ? 751  ARG A HA   1 
ATOM   7724  H  HB2  . ARG A 1 543 ? 1.245   41.439 74.888 1.00 47.71  ? 751  ARG A HB2  1 
ATOM   7725  H  HB3  . ARG A 1 543 ? 0.443   42.716 75.377 1.00 47.71  ? 751  ARG A HB3  1 
ATOM   7726  H  HG2  . ARG A 1 543 ? -0.454  41.443 76.862 1.00 51.09  ? 751  ARG A HG2  1 
ATOM   7727  H  HG3  . ARG A 1 543 ? -1.279  40.772 75.680 1.00 51.09  ? 751  ARG A HG3  1 
ATOM   7728  H  HD2  . ARG A 1 543 ? -0.206  39.140 76.956 1.00 52.86  ? 751  ARG A HD2  1 
ATOM   7729  H  HD3  . ARG A 1 543 ? 0.349   39.127 75.466 1.00 52.86  ? 751  ARG A HD3  1 
ATOM   7730  H  HE   . ARG A 1 543 ? 2.286   39.940 76.222 1.00 54.46  ? 751  ARG A HE   1 
ATOM   7731  H  HH11 . ARG A 1 543 ? 0.281   39.455 78.821 1.00 54.68  ? 751  ARG A HH11 1 
ATOM   7732  H  HH12 . ARG A 1 543 ? 1.346   39.547 79.858 1.00 54.68  ? 751  ARG A HH12 1 
ATOM   7733  H  HH21 . ARG A 1 543 ? 3.877   40.077 77.812 1.00 57.06  ? 751  ARG A HH21 1 
ATOM   7734  H  HH22 . ARG A 1 543 ? 3.516   39.922 79.249 1.00 57.06  ? 751  ARG A HH22 1 
ATOM   7735  N  N    . LEU A 1 544 ? -0.674  43.491 71.828 1.00 36.68  ? 752  LEU A N    1 
ATOM   7736  C  CA   . LEU A 1 544 ? -0.513  44.727 71.075 1.00 34.57  ? 752  LEU A CA   1 
ATOM   7737  C  C    . LEU A 1 544 ? -1.649  44.839 70.068 1.00 32.90  ? 752  LEU A C    1 
ATOM   7738  O  O    . LEU A 1 544 ? -2.285  43.843 69.706 1.00 31.54  ? 752  LEU A O    1 
ATOM   7739  C  CB   . LEU A 1 544 ? 0.849   44.787 70.369 1.00 35.77  ? 752  LEU A CB   1 
ATOM   7740  C  CG   . LEU A 1 544 ? 1.250   43.601 69.482 1.00 35.52  ? 752  LEU A CG   1 
ATOM   7741  C  CD1  . LEU A 1 544 ? 0.735   43.753 68.061 1.00 32.94  ? 752  LEU A CD1  1 
ATOM   7742  C  CD2  . LEU A 1 544 ? 2.760   43.438 69.478 1.00 37.82  ? 752  LEU A CD2  1 
ATOM   7743  H  H    . LEU A 1 544 ? -1.241  42.945 71.483 1.00 44.02  ? 752  LEU A H    1 
ATOM   7744  H  HA   . LEU A 1 544 ? -0.572  45.481 71.682 1.00 41.48  ? 752  LEU A HA   1 
ATOM   7745  H  HB2  . LEU A 1 544 ? 0.859   45.577 69.806 1.00 42.92  ? 752  LEU A HB2  1 
ATOM   7746  H  HB3  . LEU A 1 544 ? 1.534   44.875 71.050 1.00 42.92  ? 752  LEU A HB3  1 
ATOM   7747  H  HG   . LEU A 1 544 ? 0.865   42.791 69.851 1.00 42.63  ? 752  LEU A HG   1 
ATOM   7748  H  HD11 . LEU A 1 544 ? 1.012   42.983 67.541 1.00 39.53  ? 752  LEU A HD11 1 
ATOM   7749  H  HD12 . LEU A 1 544 ? -0.233  43.809 68.081 1.00 39.53  ? 752  LEU A HD12 1 
ATOM   7750  H  HD13 . LEU A 1 544 ? 1.105   44.563 67.677 1.00 39.53  ? 752  LEU A HD13 1 
ATOM   7751  H  HD21 . LEU A 1 544 ? 2.994   42.685 68.914 1.00 45.39  ? 752  LEU A HD21 1 
ATOM   7752  H  HD22 . LEU A 1 544 ? 3.164   44.249 69.133 1.00 45.39  ? 752  LEU A HD22 1 
ATOM   7753  H  HD23 . LEU A 1 544 ? 3.062   43.277 70.386 1.00 45.39  ? 752  LEU A HD23 1 
ATOM   7754  N  N    . PHE A 1 545 ? -1.904  46.072 69.633 1.00 32.06  ? 753  PHE A N    1 
ATOM   7755  C  CA   . PHE A 1 545 ? -2.881  46.324 68.584 1.00 32.21  ? 753  PHE A CA   1 
ATOM   7756  C  C    . PHE A 1 545 ? -2.223  46.145 67.223 1.00 34.27  ? 753  PHE A C    1 
ATOM   7757  O  O    . PHE A 1 545 ? -1.184  46.753 66.944 1.00 32.41  ? 753  PHE A O    1 
ATOM   7758  C  CB   . PHE A 1 545 ? -3.455  47.739 68.709 1.00 31.62  ? 753  PHE A CB   1 
ATOM   7759  C  CG   . PHE A 1 545 ? -4.381  47.922 69.878 1.00 32.96  ? 753  PHE A CG   1 
ATOM   7760  C  CD1  . PHE A 1 545 ? -5.610  47.285 69.909 1.00 34.99  ? 753  PHE A CD1  1 
ATOM   7761  C  CD2  . PHE A 1 545 ? -4.031  48.742 70.939 1.00 35.87  ? 753  PHE A CD2  1 
ATOM   7762  C  CE1  . PHE A 1 545 ? -6.468  47.450 70.980 1.00 37.29  ? 753  PHE A CE1  1 
ATOM   7763  C  CE2  . PHE A 1 545 ? -4.885  48.912 72.013 1.00 36.90  ? 753  PHE A CE2  1 
ATOM   7764  C  CZ   . PHE A 1 545 ? -6.106  48.265 72.032 1.00 38.93  ? 753  PHE A CZ   1 
ATOM   7765  H  H    . PHE A 1 545 ? -1.521  46.781 69.933 1.00 38.48  ? 753  PHE A H    1 
ATOM   7766  H  HA   . PHE A 1 545 ? -3.609  45.689 68.660 1.00 38.65  ? 753  PHE A HA   1 
ATOM   7767  H  HB2  . PHE A 1 545 ? -2.721  48.365 68.813 1.00 37.95  ? 753  PHE A HB2  1 
ATOM   7768  H  HB3  . PHE A 1 545 ? -3.952  47.947 67.903 1.00 37.95  ? 753  PHE A HB3  1 
ATOM   7769  H  HD1  . PHE A 1 545 ? -5.858  46.733 69.203 1.00 41.98  ? 753  PHE A HD1  1 
ATOM   7770  H  HD2  . PHE A 1 545 ? -3.210  49.178 70.932 1.00 43.04  ? 753  PHE A HD2  1 
ATOM   7771  H  HE1  . PHE A 1 545 ? -7.289  47.014 70.990 1.00 44.76  ? 753  PHE A HE1  1 
ATOM   7772  H  HE2  . PHE A 1 545 ? -4.638  49.462 72.721 1.00 44.28  ? 753  PHE A HE2  1 
ATOM   7773  H  HZ   . PHE A 1 545 ? -6.682  48.379 72.753 1.00 46.72  ? 753  PHE A HZ   1 
ATOM   7774  N  N    . ARG A 1 546 ? -2.825  45.302 66.377 1.00 34.39  ? 754  ARG A N    1 
ATOM   7775  C  CA   . ARG A 1 546 ? -2.318  45.099 65.024 1.00 39.64  ? 754  ARG A CA   1 
ATOM   7776  C  C    . ARG A 1 546 ? -2.708  46.224 64.072 1.00 40.61  ? 754  ARG A C    1 
ATOM   7777  O  O    . ARG A 1 546 ? -2.130  46.315 62.982 1.00 39.21  ? 754  ARG A O    1 
ATOM   7778  C  CB   . ARG A 1 546 ? -2.808  43.755 64.471 1.00 42.65  ? 754  ARG A CB   1 
ATOM   7779  C  CG   . ARG A 1 546 ? -2.142  42.532 65.110 1.00 41.87  ? 754  ARG A CG   1 
ATOM   7780  C  CD   . ARG A 1 546 ? -0.761  42.228 64.522 1.00 37.84  ? 754  ARG A CD   1 
ATOM   7781  N  NE   . ARG A 1 546 ? -0.117  41.113 65.219 1.00 34.71  ? 754  ARG A NE   1 
ATOM   7782  C  CZ   . ARG A 1 546 ? 1.042   40.559 64.870 1.00 30.27  ? 754  ARG A CZ   1 
ATOM   7783  N  NH1  . ARG A 1 546 ? 1.715   40.998 63.816 1.00 29.17  ? 754  ARG A NH1  1 
ATOM   7784  N  NH2  . ARG A 1 546 ? 1.531   39.551 65.579 1.00 32.89  ? 754  ARG A NH2  1 
ATOM   7785  H  H    . ARG A 1 546 ? -3.525  44.840 66.565 1.00 41.27  ? 754  ARG A H    1 
ATOM   7786  H  HA   . ARG A 1 546 ? -1.349  45.067 65.059 1.00 47.57  ? 754  ARG A HA   1 
ATOM   7787  H  HB2  . ARG A 1 546 ? -3.763  43.685 64.625 1.00 51.18  ? 754  ARG A HB2  1 
ATOM   7788  H  HB3  . ARG A 1 546 ? -2.626  43.726 63.519 1.00 51.18  ? 754  ARG A HB3  1 
ATOM   7789  H  HG2  . ARG A 1 546 ? -2.034  42.693 66.060 1.00 50.24  ? 754  ARG A HG2  1 
ATOM   7790  H  HG3  . ARG A 1 546 ? -2.705  41.756 64.967 1.00 50.24  ? 754  ARG A HG3  1 
ATOM   7791  H  HD2  . ARG A 1 546 ? -0.856  41.987 63.587 1.00 45.41  ? 754  ARG A HD2  1 
ATOM   7792  H  HD3  . ARG A 1 546 ? -0.195  43.010 64.612 1.00 45.41  ? 754  ARG A HD3  1 
ATOM   7793  H  HE   . ARG A 1 546 ? -0.519  40.791 65.908 1.00 41.66  ? 754  ARG A HE   1 
ATOM   7794  H  HH11 . ARG A 1 546 ? 1.406   41.651 63.350 1.00 35.00  ? 754  ARG A HH11 1 
ATOM   7795  H  HH12 . ARG A 1 546 ? 2.462   40.631 63.599 1.00 35.00  ? 754  ARG A HH12 1 
ATOM   7796  H  HH21 . ARG A 1 546 ? 1.100   39.259 66.264 1.00 39.48  ? 754  ARG A HH21 1 
ATOM   7797  H  HH22 . ARG A 1 546 ? 2.278   39.190 65.355 1.00 39.48  ? 754  ARG A HH22 1 
ATOM   7798  N  N    . ASN A 1 547 ? -3.674  47.068 64.445 1.00 41.63  ? 755  ASN A N    1 
ATOM   7799  C  CA   . ASN A 1 547 ? -3.935  48.333 63.752 1.00 37.89  ? 755  ASN A CA   1 
ATOM   7800  C  C    . ASN A 1 547 ? -2.949  49.354 64.315 1.00 34.36  ? 755  ASN A C    1 
ATOM   7801  O  O    . ASN A 1 547 ? -3.246  50.125 65.232 1.00 35.89  ? 755  ASN A O    1 
ATOM   7802  C  CB   . ASN A 1 547 ? -5.389  48.759 63.941 1.00 38.64  ? 755  ASN A CB   1 
ATOM   7803  C  CG   . ASN A 1 547 ? -5.707  50.117 63.314 1.00 37.59  ? 755  ASN A CG   1 
ATOM   7804  O  OD1  . ASN A 1 547 ? -4.864  50.742 62.670 1.00 38.06  ? 755  ASN A OD1  1 
ATOM   7805  N  ND2  . ASN A 1 547 ? -6.942  50.570 63.498 1.00 33.61  ? 755  ASN A ND2  1 
ATOM   7806  H  H    . ASN A 1 547 ? -4.202  46.926 65.110 1.00 49.96  ? 755  ASN A H    1 
ATOM   7807  H  HA   . ASN A 1 547 ? -3.764  48.227 62.803 1.00 45.47  ? 755  ASN A HA   1 
ATOM   7808  H  HB2  . ASN A 1 547 ? -5.966  48.097 63.529 1.00 46.37  ? 755  ASN A HB2  1 
ATOM   7809  H  HB3  . ASN A 1 547 ? -5.578  48.816 64.891 1.00 46.37  ? 755  ASN A HB3  1 
ATOM   7810  H  HD21 . ASN A 1 547 ? -7.177  51.328 63.167 1.00 40.34  ? 755  ASN A HD21 1 
ATOM   7811  H  HD22 . ASN A 1 547 ? -7.507  50.106 63.952 1.00 40.34  ? 755  ASN A HD22 1 
ATOM   7812  N  N    . PHE A 1 548 ? -1.738  49.343 63.751 1.00 31.94  ? 756  PHE A N    1 
ATOM   7813  C  CA   . PHE A 1 548 ? -0.612  50.022 64.388 1.00 33.12  ? 756  PHE A CA   1 
ATOM   7814  C  C    . PHE A 1 548 ? -0.854  51.520 64.526 1.00 34.98  ? 756  PHE A C    1 
ATOM   7815  O  O    . PHE A 1 548 ? -0.518  52.115 65.557 1.00 36.86  ? 756  PHE A O    1 
ATOM   7816  C  CB   . PHE A 1 548 ? 0.672   49.756 63.602 1.00 33.86  ? 756  PHE A CB   1 
ATOM   7817  C  CG   . PHE A 1 548 ? 1.233   48.381 63.821 1.00 31.88  ? 756  PHE A CG   1 
ATOM   7818  C  CD1  . PHE A 1 548 ? 1.942   48.090 64.974 1.00 31.64  ? 756  PHE A CD1  1 
ATOM   7819  C  CD2  . PHE A 1 548 ? 1.041   47.379 62.886 1.00 32.94  ? 756  PHE A CD2  1 
ATOM   7820  C  CE1  . PHE A 1 548 ? 2.452   46.828 65.191 1.00 32.22  ? 756  PHE A CE1  1 
ATOM   7821  C  CE2  . PHE A 1 548 ? 1.554   46.110 63.098 1.00 32.73  ? 756  PHE A CE2  1 
ATOM   7822  C  CZ   . PHE A 1 548 ? 2.259   45.837 64.251 1.00 31.57  ? 756  PHE A CZ   1 
ATOM   7823  H  H    . PHE A 1 548 ? -1.546  48.954 63.009 1.00 38.33  ? 756  PHE A H    1 
ATOM   7824  H  HA   . PHE A 1 548 ? -0.494  49.659 65.280 1.00 39.74  ? 756  PHE A HA   1 
ATOM   7825  H  HB2  . PHE A 1 548 ? 0.485   49.854 62.655 1.00 40.63  ? 756  PHE A HB2  1 
ATOM   7826  H  HB3  . PHE A 1 548 ? 1.345   50.399 63.874 1.00 40.63  ? 756  PHE A HB3  1 
ATOM   7827  H  HD1  . PHE A 1 548 ? 2.074   48.754 65.611 1.00 37.98  ? 756  PHE A HD1  1 
ATOM   7828  H  HD2  . PHE A 1 548 ? 0.565   47.559 62.108 1.00 39.53  ? 756  PHE A HD2  1 
ATOM   7829  H  HE1  . PHE A 1 548 ? 2.929   46.646 65.968 1.00 38.66  ? 756  PHE A HE1  1 
ATOM   7830  H  HE2  . PHE A 1 548 ? 1.422   45.443 62.463 1.00 39.28  ? 756  PHE A HE2  1 
ATOM   7831  H  HZ   . PHE A 1 548 ? 2.606   44.985 64.394 1.00 37.89  ? 756  PHE A HZ   1 
ATOM   7832  N  N    . GLY A 1 549 ? -1.428  52.148 63.504 1.00 32.96  ? 757  GLY A N    1 
ATOM   7833  C  CA   . GLY A 1 549 ? -1.620  53.587 63.552 1.00 37.10  ? 757  GLY A CA   1 
ATOM   7834  C  C    . GLY A 1 549 ? -2.821  54.052 64.344 1.00 35.99  ? 757  GLY A C    1 
ATOM   7835  O  O    . GLY A 1 549 ? -2.981  55.259 64.545 1.00 31.79  ? 757  GLY A O    1 
ATOM   7836  H  H    . GLY A 1 549 ? -1.710  51.770 62.785 1.00 39.55  ? 757  GLY A H    1 
ATOM   7837  H  HA2  . GLY A 1 549 ? -0.831  53.995 63.942 1.00 44.52  ? 757  GLY A HA2  1 
ATOM   7838  H  HA3  . GLY A 1 549 ? -1.713  53.921 62.646 1.00 44.52  ? 757  GLY A HA3  1 
ATOM   7839  N  N    . GLY A 1 550 ? -3.663  53.132 64.805 1.00 36.49  ? 758  GLY A N    1 
ATOM   7840  C  CA   . GLY A 1 550 ? -4.881  53.521 65.492 1.00 34.10  ? 758  GLY A CA   1 
ATOM   7841  C  C    . GLY A 1 550 ? -5.862  54.245 64.594 1.00 31.03  ? 758  GLY A C    1 
ATOM   7842  O  O    . GLY A 1 550 ? -6.543  55.174 65.046 1.00 28.36  ? 758  GLY A O    1 
ATOM   7843  H  H    . GLY A 1 550 ? -3.550  52.283 64.732 1.00 43.79  ? 758  GLY A H    1 
ATOM   7844  H  HA2  . GLY A 1 550 ? -5.317  52.730 65.846 1.00 40.92  ? 758  GLY A HA2  1 
ATOM   7845  H  HA3  . GLY A 1 550 ? -4.659  54.105 66.234 1.00 40.92  ? 758  GLY A HA3  1 
ATOM   7846  N  N    . LEU A 1 551 ? -5.952  53.842 63.330 1.00 32.82  ? 759  LEU A N    1 
ATOM   7847  C  CA   . LEU A 1 551 ? -6.857  54.480 62.382 1.00 34.40  ? 759  LEU A CA   1 
ATOM   7848  C  C    . LEU A 1 551 ? -8.279  53.997 62.639 1.00 35.48  ? 759  LEU A C    1 
ATOM   7849  O  O    . LEU A 1 551 ? -8.539  52.788 62.631 1.00 33.10  ? 759  LEU A O    1 
ATOM   7850  C  CB   . LEU A 1 551 ? -6.426  54.167 60.951 1.00 34.45  ? 759  LEU A CB   1 
ATOM   7851  C  CG   . LEU A 1 551 ? -4.934  54.353 60.655 1.00 36.51  ? 759  LEU A CG   1 
ATOM   7852  C  CD1  . LEU A 1 551 ? -4.634  54.079 59.189 1.00 37.43  ? 759  LEU A CD1  1 
ATOM   7853  C  CD2  . LEU A 1 551 ? -4.469  55.747 61.042 1.00 35.15  ? 759  LEU A CD2  1 
ATOM   7854  H  H    . LEU A 1 551 ? -5.495  53.195 62.994 1.00 39.38  ? 759  LEU A H    1 
ATOM   7855  H  HA   . LEU A 1 551 ? -6.831  55.441 62.508 1.00 41.28  ? 759  LEU A HA   1 
ATOM   7856  H  HB2  . LEU A 1 551 ? -6.647  53.242 60.759 1.00 41.34  ? 759  LEU A HB2  1 
ATOM   7857  H  HB3  . LEU A 1 551 ? -6.916  54.749 60.349 1.00 41.34  ? 759  LEU A HB3  1 
ATOM   7858  H  HG   . LEU A 1 551 ? -4.430  53.715 61.184 1.00 43.82  ? 759  LEU A HG   1 
ATOM   7859  H  HD11 . LEU A 1 551 ? -3.685  54.205 59.032 1.00 44.92  ? 759  LEU A HD11 1 
ATOM   7860  H  HD12 . LEU A 1 551 ? -4.887  53.166 58.980 1.00 44.92  ? 759  LEU A HD12 1 
ATOM   7861  H  HD13 . LEU A 1 551 ? -5.144  54.697 58.642 1.00 44.92  ? 759  LEU A HD13 1 
ATOM   7862  H  HD21 . LEU A 1 551 ? -3.523  55.830 60.843 1.00 42.19  ? 759  LEU A HD21 1 
ATOM   7863  H  HD22 . LEU A 1 551 ? -4.973  56.400 60.534 1.00 42.19  ? 759  LEU A HD22 1 
ATOM   7864  H  HD23 . LEU A 1 551 ? -4.620  55.877 61.992 1.00 42.19  ? 759  LEU A HD23 1 
ATOM   7865  N  N    . LEU A 1 552 ? -9.201  54.939 62.856 1.00 34.13  ? 760  LEU A N    1 
ATOM   7866  C  CA   . LEU A 1 552 ? -10.571 54.611 63.228 1.00 38.91  ? 760  LEU A CA   1 
ATOM   7867  C  C    . LEU A 1 552 ? -11.559 55.510 62.502 1.00 38.25  ? 760  LEU A C    1 
ATOM   7868  O  O    . LEU A 1 552 ? -11.291 56.695 62.279 1.00 35.99  ? 760  LEU A O    1 
ATOM   7869  C  CB   . LEU A 1 552 ? -10.787 54.754 64.738 1.00 43.26  ? 760  LEU A CB   1 
ATOM   7870  C  CG   . LEU A 1 552 ? -9.989  53.794 65.615 1.00 45.47  ? 760  LEU A CG   1 
ATOM   7871  C  CD1  . LEU A 1 552 ? -10.197 54.127 67.081 1.00 46.91  ? 760  LEU A CD1  1 
ATOM   7872  C  CD2  . LEU A 1 552 ? -10.392 52.362 65.329 1.00 46.65  ? 760  LEU A CD2  1 
ATOM   7873  H  H    . LEU A 1 552 ? -9.052  55.783 62.792 1.00 40.96  ? 760  LEU A H    1 
ATOM   7874  H  HA   . LEU A 1 552 ? -10.758 53.692 62.979 1.00 46.70  ? 760  LEU A HA   1 
ATOM   7875  H  HB2  . LEU A 1 552 ? -10.543 55.656 64.998 1.00 51.92  ? 760  LEU A HB2  1 
ATOM   7876  H  HB3  . LEU A 1 552 ? -11.727 54.606 64.928 1.00 51.92  ? 760  LEU A HB3  1 
ATOM   7877  H  HG   . LEU A 1 552 ? -9.044  53.889 65.414 1.00 54.56  ? 760  LEU A HG   1 
ATOM   7878  H  HD11 . LEU A 1 552 ? -9.682  53.507 67.621 1.00 56.29  ? 760  LEU A HD11 1 
ATOM   7879  H  HD12 . LEU A 1 552 ? -9.898  55.035 67.244 1.00 56.29  ? 760  LEU A HD12 1 
ATOM   7880  H  HD13 . LEU A 1 552 ? -11.140 54.045 67.292 1.00 56.29  ? 760  LEU A HD13 1 
ATOM   7881  H  HD21 . LEU A 1 552 ? -9.874  51.769 65.896 1.00 55.99  ? 760  LEU A HD21 1 
ATOM   7882  H  HD22 . LEU A 1 552 ? -11.338 52.257 65.518 1.00 55.99  ? 760  LEU A HD22 1 
ATOM   7883  H  HD23 . LEU A 1 552 ? -10.217 52.165 64.396 1.00 55.99  ? 760  LEU A HD23 1 
ATOM   7884  N  N    . GLY A 1 553 ? -12.707 54.932 62.152 1.00 36.57  ? 761  GLY A N    1 
ATOM   7885  C  CA   . GLY A 1 553 ? -13.811 55.667 61.581 1.00 36.22  ? 761  GLY A CA   1 
ATOM   7886  C  C    . GLY A 1 553 ? -15.061 55.529 62.429 1.00 36.96  ? 761  GLY A C    1 
ATOM   7887  O  O    . GLY A 1 553 ? -15.062 54.862 63.470 1.00 37.89  ? 761  GLY A O    1 
ATOM   7888  H  H    . GLY A 1 553 ? -12.865 54.092 62.242 1.00 43.88  ? 761  GLY A H    1 
ATOM   7889  H  HA2  . GLY A 1 553 ? -13.580 56.607 61.518 1.00 43.47  ? 761  GLY A HA2  1 
ATOM   7890  H  HA3  . GLY A 1 553 ? -14.000 55.333 60.691 1.00 43.47  ? 761  GLY A HA3  1 
ATOM   7891  N  N    . PRO A 1 554 ? -16.161 56.148 61.990 1.00 37.91  ? 762  PRO A N    1 
ATOM   7892  C  CA   . PRO A 1 554 ? -17.355 56.219 62.851 1.00 41.74  ? 762  PRO A CA   1 
ATOM   7893  C  C    . PRO A 1 554 ? -18.022 54.878 63.112 1.00 44.68  ? 762  PRO A C    1 
ATOM   7894  O  O    . PRO A 1 554 ? -18.751 54.761 64.105 1.00 46.48  ? 762  PRO A O    1 
ATOM   7895  C  CB   . PRO A 1 554 ? -18.291 57.162 62.081 1.00 43.21  ? 762  PRO A CB   1 
ATOM   7896  C  CG   . PRO A 1 554 ? -17.411 57.885 61.108 1.00 41.43  ? 762  PRO A CG   1 
ATOM   7897  C  CD   . PRO A 1 554 ? -16.336 56.917 60.748 1.00 38.61  ? 762  PRO A CD   1 
ATOM   7898  H  HA   . PRO A 1 554 ? -17.126 56.627 63.701 1.00 50.09  ? 762  PRO A HA   1 
ATOM   7899  H  HB2  . PRO A 1 554 ? -18.964 56.643 61.613 1.00 51.86  ? 762  PRO A HB2  1 
ATOM   7900  H  HB3  . PRO A 1 554 ? -18.706 57.786 62.697 1.00 51.86  ? 762  PRO A HB3  1 
ATOM   7901  H  HG2  . PRO A 1 554 ? -17.925 58.132 60.324 1.00 49.72  ? 762  PRO A HG2  1 
ATOM   7902  H  HG3  . PRO A 1 554 ? -17.034 58.672 61.532 1.00 49.72  ? 762  PRO A HG3  1 
ATOM   7903  H  HD2  . PRO A 1 554 ? -16.628 56.337 60.027 1.00 46.34  ? 762  PRO A HD2  1 
ATOM   7904  H  HD3  . PRO A 1 554 ? -15.518 57.386 60.520 1.00 46.34  ? 762  PRO A HD3  1 
ATOM   7905  N  N    . MET A 1 555 ? -17.815 53.870 62.266 1.00 42.43  ? 763  MET A N    1 
ATOM   7906  C  CA   . MET A 1 555 ? -18.433 52.565 62.459 1.00 41.68  ? 763  MET A CA   1 
ATOM   7907  C  C    . MET A 1 555 ? -17.502 51.565 63.133 1.00 41.69  ? 763  MET A C    1 
ATOM   7908  O  O    . MET A 1 555 ? -17.850 50.385 63.234 1.00 40.56  ? 763  MET A O    1 
ATOM   7909  C  CB   . MET A 1 555 ? -18.912 52.000 61.120 1.00 41.08  ? 763  MET A CB   1 
ATOM   7910  C  CG   . MET A 1 555 ? -19.996 52.828 60.443 1.00 45.51  ? 763  MET A CG   1 
ATOM   7911  S  SD   . MET A 1 555 ? -21.463 53.099 61.467 1.00 52.56  ? 763  MET A SD   1 
ATOM   7912  C  CE   . MET A 1 555 ? -22.090 51.433 61.651 1.00 55.16  ? 763  MET A CE   1 
ATOM   7913  H  H    . MET A 1 555 ? -17.317 53.920 61.567 1.00 50.91  ? 763  MET A H    1 
ATOM   7914  H  HA   . MET A 1 555 ? -19.216 52.679 63.021 1.00 50.02  ? 763  MET A HA   1 
ATOM   7915  H  HB2  . MET A 1 555 ? -18.156 51.953 60.514 1.00 49.29  ? 763  MET A HB2  1 
ATOM   7916  H  HB3  . MET A 1 555 ? -19.269 51.110 61.268 1.00 49.29  ? 763  MET A HB3  1 
ATOM   7917  H  HG2  . MET A 1 555 ? -19.629 53.696 60.215 1.00 54.61  ? 763  MET A HG2  1 
ATOM   7918  H  HG3  . MET A 1 555 ? -20.280 52.370 59.636 1.00 54.61  ? 763  MET A HG3  1 
ATOM   7919  H  HE1  . MET A 1 555 ? -22.893 51.456 62.194 1.00 66.19  ? 763  MET A HE1  1 
ATOM   7920  H  HE2  . MET A 1 555 ? -22.294 51.074 60.773 1.00 66.19  ? 763  MET A HE2  1 
ATOM   7921  H  HE3  . MET A 1 555 ? -21.414 50.887 62.082 1.00 66.19  ? 763  MET A HE3  1 
ATOM   7922  N  N    . ASP A 1 556 ? -16.338 52.005 63.601 1.00 42.80  ? 764  ASP A N    1 
ATOM   7923  C  CA   . ASP A 1 556 ? -15.418 51.116 64.294 1.00 44.84  ? 764  ASP A CA   1 
ATOM   7924  C  C    . ASP A 1 556 ? -15.800 50.987 65.764 1.00 47.07  ? 764  ASP A C    1 
ATOM   7925  O  O    . ASP A 1 556 ? -16.419 51.881 66.350 1.00 49.57  ? 764  ASP A O    1 
ATOM   7926  C  CB   . ASP A 1 556 ? -13.981 51.626 64.166 1.00 46.95  ? 764  ASP A CB   1 
ATOM   7927  C  CG   . ASP A 1 556 ? -13.396 51.380 62.786 1.00 49.12  ? 764  ASP A CG   1 
ATOM   7928  O  OD1  . ASP A 1 556 ? -13.571 50.260 62.260 1.00 50.11  ? 764  ASP A OD1  1 
ATOM   7929  O  OD2  . ASP A 1 556 ? -12.768 52.304 62.225 1.00 48.13  ? 764  ASP A OD2  1 
ATOM   7930  H  H    . ASP A 1 556 ? -16.058 52.815 63.529 1.00 51.36  ? 764  ASP A H    1 
ATOM   7931  H  HA   . ASP A 1 556 ? -15.463 50.234 63.891 1.00 53.81  ? 764  ASP A HA   1 
ATOM   7932  H  HB2  . ASP A 1 556 ? -13.969 52.582 64.332 1.00 56.35  ? 764  ASP A HB2  1 
ATOM   7933  H  HB3  . ASP A 1 556 ? -13.424 51.169 64.815 1.00 56.35  ? 764  ASP A HB3  1 
ATOM   7934  N  N    . GLU A 1 557 ? -15.424 49.853 66.359 1.00 45.09  ? 765  GLU A N    1 
ATOM   7935  C  CA   . GLU A 1 557 ? -15.739 49.534 67.749 1.00 46.80  ? 765  GLU A CA   1 
ATOM   7936  C  C    . GLU A 1 557 ? -14.446 49.556 68.555 1.00 42.62  ? 765  GLU A C    1 
ATOM   7937  O  O    . GLU A 1 557 ? -13.749 48.532 68.651 1.00 37.67  ? 765  GLU A O    1 
ATOM   7938  C  CB   . GLU A 1 557 ? -16.423 48.168 67.851 1.00 54.08  ? 765  GLU A CB   1 
ATOM   7939  C  CG   . GLU A 1 557 ? -17.719 48.066 67.058 1.00 60.15  ? 765  GLU A CG   1 
ATOM   7940  C  CD   . GLU A 1 557 ? -18.276 46.654 67.024 1.00 66.86  ? 765  GLU A CD   1 
ATOM   7941  O  OE1  . GLU A 1 557 ? -17.709 45.772 67.703 1.00 69.15  ? 765  GLU A OE1  1 
ATOM   7942  O  OE2  . GLU A 1 557 ? -19.278 46.425 66.314 1.00 70.33  ? 765  GLU A OE2  1 
ATOM   7943  H  H    . GLU A 1 557 ? -14.974 49.237 65.963 1.00 54.11  ? 765  GLU A H    1 
ATOM   7944  H  HA   . GLU A 1 557 ? -16.338 50.207 68.109 1.00 56.17  ? 765  GLU A HA   1 
ATOM   7945  H  HB2  . GLU A 1 557 ? -15.816 47.490 67.515 1.00 64.90  ? 765  GLU A HB2  1 
ATOM   7946  H  HB3  . GLU A 1 557 ? -16.630 47.992 68.782 1.00 64.90  ? 765  GLU A HB3  1 
ATOM   7947  H  HG2  . GLU A 1 557 ? -18.385 48.642 67.466 1.00 72.19  ? 765  GLU A HG2  1 
ATOM   7948  H  HG3  . GLU A 1 557 ? -17.554 48.346 66.144 1.00 72.19  ? 765  GLU A HG3  1 
ATOM   7949  N  N    . PRO A 1 558 ? -14.079 50.688 69.156 1.00 39.36  ? 766  PRO A N    1 
ATOM   7950  C  CA   . PRO A 1 558 ? -12.750 50.799 69.766 1.00 36.88  ? 766  PRO A CA   1 
ATOM   7951  C  C    . PRO A 1 558 ? -12.620 49.977 71.038 1.00 37.57  ? 766  PRO A C    1 
ATOM   7952  O  O    . PRO A 1 558 ? -13.599 49.702 71.736 1.00 39.02  ? 766  PRO A O    1 
ATOM   7953  C  CB   . PRO A 1 558 ? -12.621 52.298 70.061 1.00 39.49  ? 766  PRO A CB   1 
ATOM   7954  C  CG   . PRO A 1 558 ? -14.019 52.768 70.224 1.00 42.04  ? 766  PRO A CG   1 
ATOM   7955  C  CD   . PRO A 1 558 ? -14.854 51.935 69.289 1.00 42.80  ? 766  PRO A CD   1 
ATOM   7956  H  HA   . PRO A 1 558 ? -12.063 50.533 69.135 1.00 44.26  ? 766  PRO A HA   1 
ATOM   7957  H  HB2  . PRO A 1 558 ? -12.116 52.429 70.879 1.00 47.39  ? 766  PRO A HB2  1 
ATOM   7958  H  HB3  . PRO A 1 558 ? -12.193 52.744 69.315 1.00 47.39  ? 766  PRO A HB3  1 
ATOM   7959  H  HG2  . PRO A 1 558 ? -14.301 52.633 71.143 1.00 50.45  ? 766  PRO A HG2  1 
ATOM   7960  H  HG3  . PRO A 1 558 ? -14.075 53.706 69.985 1.00 50.45  ? 766  PRO A HG3  1 
ATOM   7961  H  HD2  . PRO A 1 558 ? -15.722 51.753 69.682 1.00 51.36  ? 766  PRO A HD2  1 
ATOM   7962  H  HD3  . PRO A 1 558 ? -14.938 52.375 68.429 1.00 51.36  ? 766  PRO A HD3  1 
ATOM   7963  N  N    . VAL A 1 559 ? -11.376 49.606 71.339 1.00 36.87  ? 767  VAL A N    1 
ATOM   7964  C  CA   . VAL A 1 559 ? -11.029 48.791 72.497 1.00 37.08  ? 767  VAL A CA   1 
ATOM   7965  C  C    . VAL A 1 559 ? -10.039 49.570 73.354 1.00 34.92  ? 767  VAL A C    1 
ATOM   7966  O  O    . VAL A 1 559 ? -9.091  50.162 72.831 1.00 35.30  ? 767  VAL A O    1 
ATOM   7967  C  CB   . VAL A 1 559 ? -10.424 47.437 72.067 1.00 40.40  ? 767  VAL A CB   1 
ATOM   7968  C  CG1  . VAL A 1 559 ? -10.084 46.584 73.281 1.00 39.50  ? 767  VAL A CG1  1 
ATOM   7969  C  CG2  . VAL A 1 559 ? -11.375 46.699 71.133 1.00 43.43  ? 767  VAL A CG2  1 
ATOM   7970  H  H    . VAL A 1 559 ? -10.691 49.825 70.866 1.00 44.24  ? 767  VAL A H    1 
ATOM   7971  H  HA   . VAL A 1 559 ? -11.825 48.620 73.024 1.00 44.50  ? 767  VAL A HA   1 
ATOM   7972  H  HB   . VAL A 1 559 ? -9.600  47.603 71.582 1.00 48.48  ? 767  VAL A HB   1 
ATOM   7973  H  HG11 . VAL A 1 559 ? -9.707  45.743 72.980 1.00 47.40  ? 767  VAL A HG11 1 
ATOM   7974  H  HG12 . VAL A 1 559 ? -9.440  47.059 73.829 1.00 47.40  ? 767  VAL A HG12 1 
ATOM   7975  H  HG13 . VAL A 1 559 ? -10.894 46.422 73.789 1.00 47.40  ? 767  VAL A HG13 1 
ATOM   7976  H  HG21 . VAL A 1 559 ? -10.974 45.854 70.877 1.00 52.11  ? 767  VAL A HG21 1 
ATOM   7977  H  HG22 . VAL A 1 559 ? -12.213 46.541 71.596 1.00 52.11  ? 767  VAL A HG22 1 
ATOM   7978  H  HG23 . VAL A 1 559 ? -11.529 47.244 70.345 1.00 52.11  ? 767  VAL A HG23 1 
ATOM   7979  N  N    . GLY A 1 560 ? -10.255 49.560 74.667 1.00 33.72  ? 768  GLY A N    1 
ATOM   7980  C  CA   . GLY A 1 560 ? -9.372  50.239 75.601 1.00 33.21  ? 768  GLY A CA   1 
ATOM   7981  C  C    . GLY A 1 560 ? -8.467  49.247 76.308 1.00 34.50  ? 768  GLY A C    1 
ATOM   7982  O  O    . GLY A 1 560 ? -8.928  48.220 76.811 1.00 35.62  ? 768  GLY A O    1 
ATOM   7983  H  H    . GLY A 1 560 ? -10.916 49.160 75.044 1.00 40.46  ? 768  GLY A H    1 
ATOM   7984  H  HA2  . GLY A 1 560 ? -8.821  50.881 75.126 1.00 39.85  ? 768  GLY A HA2  1 
ATOM   7985  H  HA3  . GLY A 1 560 ? -9.897  50.712 76.266 1.00 39.85  ? 768  GLY A HA3  1 
ATOM   7986  N  N    . MET A 1 561 ? -7.172  49.566 76.337 1.00 33.57  ? 769  MET A N    1 
ATOM   7987  C  CA   . MET A 1 561 ? -6.162  48.716 76.953 1.00 36.42  ? 769  MET A CA   1 
ATOM   7988  C  C    . MET A 1 561 ? -5.382  49.492 78.005 1.00 39.12  ? 769  MET A C    1 
ATOM   7989  O  O    . MET A 1 561 ? -5.126  50.692 77.858 1.00 37.90  ? 769  MET A O    1 
ATOM   7990  C  CB   . MET A 1 561 ? -5.181  48.159 75.907 1.00 38.69  ? 769  MET A CB   1 
ATOM   7991  C  CG   . MET A 1 561 ? -3.977  47.429 76.508 1.00 41.61  ? 769  MET A CG   1 
ATOM   7992  S  SD   . MET A 1 561 ? -2.544  48.483 76.866 1.00 42.43  ? 769  MET A SD   1 
ATOM   7993  C  CE   . MET A 1 561 ? -1.808  48.645 75.238 1.00 42.22  ? 769  MET A CE   1 
ATOM   7994  H  H    . MET A 1 561 ? -6.850  50.288 75.998 1.00 40.28  ? 769  MET A H    1 
ATOM   7995  H  HA   . MET A 1 561 ? -6.602  47.964 77.379 1.00 43.70  ? 769  MET A HA   1 
ATOM   7996  H  HB2  . MET A 1 561 ? -5.654  47.532 75.339 1.00 46.43  ? 769  MET A HB2  1 
ATOM   7997  H  HB3  . MET A 1 561 ? -4.844  48.895 75.373 1.00 46.43  ? 769  MET A HB3  1 
ATOM   7998  H  HG2  . MET A 1 561 ? -4.252  47.015 77.341 1.00 49.93  ? 769  MET A HG2  1 
ATOM   7999  H  HG3  . MET A 1 561 ? -3.689  46.745 75.884 1.00 49.93  ? 769  MET A HG3  1 
ATOM   8000  H  HE1  . MET A 1 561 ? -1.016  49.200 75.304 1.00 50.67  ? 769  MET A HE1  1 
ATOM   8001  H  HE2  . MET A 1 561 ? -1.569  47.763 74.911 1.00 50.67  ? 769  MET A HE2  1 
ATOM   8002  H  HE3  . MET A 1 561 ? -2.452  49.056 74.640 1.00 50.67  ? 769  MET A HE3  1 
ATOM   8003  N  N    . GLN A 1 562 ? -4.996  48.785 79.066 1.00 40.21  ? 770  GLN A N    1 
ATOM   8004  C  CA   . GLN A 1 562 ? -4.156  49.333 80.120 1.00 43.45  ? 770  GLN A CA   1 
ATOM   8005  C  C    . GLN A 1 562 ? -3.034  48.351 80.421 1.00 44.37  ? 770  GLN A C    1 
ATOM   8006  O  O    . GLN A 1 562 ? -3.236  47.133 80.378 1.00 44.73  ? 770  GLN A O    1 
ATOM   8007  C  CB   . GLN A 1 562 ? -4.965  49.619 81.396 1.00 46.26  ? 770  GLN A CB   1 
ATOM   8008  C  CG   . GLN A 1 562 ? -6.173  50.526 81.187 1.00 46.92  ? 770  GLN A CG   1 
ATOM   8009  C  CD   . GLN A 1 562 ? -7.400  49.773 80.702 1.00 46.17  ? 770  GLN A CD   1 
ATOM   8010  O  OE1  . GLN A 1 562 ? -7.631  48.625 81.086 1.00 45.64  ? 770  GLN A OE1  1 
ATOM   8011  N  NE2  . GLN A 1 562 ? -8.192  50.415 79.852 1.00 44.44  ? 770  GLN A NE2  1 
ATOM   8012  H  H    . GLN A 1 562 ? -5.216  47.964 79.198 1.00 48.25  ? 770  GLN A H    1 
ATOM   8013  H  HA   . GLN A 1 562 ? -3.761  50.165 79.816 1.00 52.14  ? 770  GLN A HA   1 
ATOM   8014  H  HB2  . GLN A 1 562 ? -5.287  48.777 81.754 1.00 55.52  ? 770  GLN A HB2  1 
ATOM   8015  H  HB3  . GLN A 1 562 ? -4.383  50.048 82.043 1.00 55.52  ? 770  GLN A HB3  1 
ATOM   8016  H  HG2  . GLN A 1 562 ? -6.397  50.954 82.028 1.00 56.30  ? 770  GLN A HG2  1 
ATOM   8017  H  HG3  . GLN A 1 562 ? -5.952  51.198 80.522 1.00 56.30  ? 770  GLN A HG3  1 
ATOM   8018  H  HE21 . GLN A 1 562 ? -7.998  51.216 79.605 1.00 53.33  ? 770  GLN A HE21 1 
ATOM   8019  H  HE22 . GLN A 1 562 ? -8.899  50.031 79.548 1.00 53.33  ? 770  GLN A HE22 1 
ATOM   8020  N  N    . LYS A 1 563 ? -1.851  48.888 80.716 1.00 44.05  ? 771  LYS A N    1 
ATOM   8021  C  CA   . LYS A 1 563 ? -0.667  48.099 81.033 1.00 46.60  ? 771  LYS A CA   1 
ATOM   8022  C  C    . LYS A 1 563 ? -0.235  48.415 82.458 1.00 47.42  ? 771  LYS A C    1 
ATOM   8023  O  O    . LYS A 1 563 ? -0.170  49.588 82.843 1.00 44.14  ? 771  LYS A O    1 
ATOM   8024  C  CB   . LYS A 1 563 ? 0.467   48.400 80.048 1.00 50.11  ? 771  LYS A CB   1 
ATOM   8025  C  CG   . LYS A 1 563 ? 1.725   47.568 80.253 1.00 54.18  ? 771  LYS A CG   1 
ATOM   8026  C  CD   . LYS A 1 563 ? 2.828   48.013 79.302 1.00 56.38  ? 771  LYS A CD   1 
ATOM   8027  C  CE   . LYS A 1 563 ? 4.084   47.170 79.457 1.00 59.07  ? 771  LYS A CE   1 
ATOM   8028  N  NZ   . LYS A 1 563 ? 5.264   48.003 79.822 1.00 62.20  ? 771  LYS A NZ   1 
ATOM   8029  H  H    . LYS A 1 563 ? -1.708  49.736 80.739 1.00 52.87  ? 771  LYS A H    1 
ATOM   8030  H  HA   . LYS A 1 563 ? -0.881  47.155 80.978 1.00 55.92  ? 771  LYS A HA   1 
ATOM   8031  H  HB2  . LYS A 1 563 ? 0.147   48.232 79.148 1.00 60.13  ? 771  LYS A HB2  1 
ATOM   8032  H  HB3  . LYS A 1 563 ? 0.715   49.333 80.137 1.00 60.13  ? 771  LYS A HB3  1 
ATOM   8033  H  HG2  . LYS A 1 563 ? 2.041   47.681 81.163 1.00 65.02  ? 771  LYS A HG2  1 
ATOM   8034  H  HG3  . LYS A 1 563 ? 1.526   46.635 80.077 1.00 65.02  ? 771  LYS A HG3  1 
ATOM   8035  H  HD2  . LYS A 1 563 ? 2.515   47.925 78.388 1.00 67.65  ? 771  LYS A HD2  1 
ATOM   8036  H  HD3  . LYS A 1 563 ? 3.057   48.936 79.490 1.00 67.65  ? 771  LYS A HD3  1 
ATOM   8037  H  HE2  . LYS A 1 563 ? 3.945   46.516 80.160 1.00 70.88  ? 771  LYS A HE2  1 
ATOM   8038  H  HE3  . LYS A 1 563 ? 4.275   46.724 78.617 1.00 70.88  ? 771  LYS A HE3  1 
ATOM   8039  H  HZ1  . LYS A 1 563 ? 5.985   47.488 79.907 1.00 74.65  ? 771  LYS A HZ1  1 
ATOM   8040  H  HZ2  . LYS A 1 563 ? 5.415   48.610 79.189 1.00 74.65  ? 771  LYS A HZ2  1 
ATOM   8041  H  HZ3  . LYS A 1 563 ? 5.114   48.421 80.594 1.00 74.65  ? 771  LYS A HZ3  1 
ATOM   8042  N  N    . TRP A 1 564 ? 0.071   47.375 83.233 1.00 49.01  ? 772  TRP A N    1 
ATOM   8043  C  CA   . TRP A 1 564 ? 0.283   47.514 84.666 1.00 49.52  ? 772  TRP A CA   1 
ATOM   8044  C  C    . TRP A 1 564 ? 1.628   46.936 85.076 1.00 51.50  ? 772  TRP A C    1 
ATOM   8045  O  O    . TRP A 1 564 ? 2.121   45.973 84.484 1.00 51.20  ? 772  TRP A O    1 
ATOM   8046  C  CB   . TRP A 1 564 ? -0.827  46.812 85.459 1.00 47.38  ? 772  TRP A CB   1 
ATOM   8047  C  CG   . TRP A 1 564 ? -2.190  47.254 85.063 1.00 44.43  ? 772  TRP A CG   1 
ATOM   8048  C  CD1  . TRP A 1 564 ? -3.014  46.655 84.157 1.00 43.95  ? 772  TRP A CD1  1 
ATOM   8049  C  CD2  . TRP A 1 564 ? -2.893  48.401 85.550 1.00 41.74  ? 772  TRP A CD2  1 
ATOM   8050  N  NE1  . TRP A 1 564 ? -4.190  47.356 84.052 1.00 44.29  ? 772  TRP A NE1  1 
ATOM   8051  C  CE2  . TRP A 1 564 ? -4.141  48.434 84.897 1.00 42.42  ? 772  TRP A CE2  1 
ATOM   8052  C  CE3  . TRP A 1 564 ? -2.589  49.404 86.476 1.00 40.88  ? 772  TRP A CE3  1 
ATOM   8053  C  CZ2  . TRP A 1 564 ? -5.085  49.428 85.141 1.00 41.29  ? 772  TRP A CZ2  1 
ATOM   8054  C  CZ3  . TRP A 1 564 ? -3.528  50.391 86.717 1.00 40.82  ? 772  TRP A CZ3  1 
ATOM   8055  C  CH2  . TRP A 1 564 ? -4.760  50.396 86.052 1.00 40.47  ? 772  TRP A CH2  1 
ATOM   8056  H  H    . TRP A 1 564 ? 0.161   46.569 82.945 1.00 58.81  ? 772  TRP A H    1 
ATOM   8057  H  HA   . TRP A 1 564 ? 0.273   48.455 84.900 1.00 59.43  ? 772  TRP A HA   1 
ATOM   8058  H  HB2  . TRP A 1 564 ? -0.766  45.855 85.307 1.00 56.86  ? 772  TRP A HB2  1 
ATOM   8059  H  HB3  . TRP A 1 564 ? -0.711  47.005 86.402 1.00 56.86  ? 772  TRP A HB3  1 
ATOM   8060  H  HD1  . TRP A 1 564 ? -2.809  45.883 83.681 1.00 52.74  ? 772  TRP A HD1  1 
ATOM   8061  H  HE1  . TRP A 1 564 ? -4.850  47.152 83.540 1.00 53.16  ? 772  TRP A HE1  1 
ATOM   8062  H  HE3  . TRP A 1 564 ? -1.772  49.407 86.921 1.00 49.06  ? 772  TRP A HE3  1 
ATOM   8063  H  HZ2  . TRP A 1 564 ? -5.905  49.434 84.702 1.00 49.55  ? 772  TRP A HZ2  1 
ATOM   8064  H  HZ3  . TRP A 1 564 ? -3.337  51.064 87.331 1.00 48.99  ? 772  TRP A HZ3  1 
ATOM   8065  H  HH2  . TRP A 1 564 ? -5.373  51.072 86.235 1.00 48.56  ? 772  TRP A HH2  1 
ATOM   8066  N  N    . GLY A 1 565 ? 2.214   47.542 86.111 1.00 53.84  ? 773  GLY A N    1 
ATOM   8067  C  CA   . GLY A 1 565 ? 3.382   47.000 86.766 1.00 57.19  ? 773  GLY A CA   1 
ATOM   8068  C  C    . GLY A 1 565 ? 3.003   46.176 87.989 1.00 61.59  ? 773  GLY A C    1 
ATOM   8069  O  O    . GLY A 1 565 ? 1.845   46.082 88.387 1.00 60.25  ? 773  GLY A O    1 
ATOM   8070  H  H    . GLY A 1 565 ? 1.940   48.282 86.452 1.00 64.62  ? 773  GLY A H    1 
ATOM   8071  H  HA2  . GLY A 1 565 ? 3.868   46.433 86.148 1.00 68.63  ? 773  GLY A HA2  1 
ATOM   8072  H  HA3  . GLY A 1 565 ? 3.963   47.724 87.047 1.00 68.63  ? 773  GLY A HA3  1 
ATOM   8073  N  N    . LYS A 1 566 ? 4.023   45.568 88.589 1.00 67.28  ? 774  LYS A N    1 
ATOM   8074  C  CA   . LYS A 1 566 ? 3.806   44.721 89.752 1.00 71.28  ? 774  LYS A CA   1 
ATOM   8075  C  C    . LYS A 1 566 ? 3.377   45.557 90.954 1.00 75.81  ? 774  LYS A C    1 
ATOM   8076  O  O    . LYS A 1 566 ? 3.757   46.722 91.099 1.00 75.79  ? 774  LYS A O    1 
ATOM   8077  C  CB   . LYS A 1 566 ? 5.076   43.939 90.085 1.00 71.53  ? 774  LYS A CB   1 
ATOM   8078  H  H    . LYS A 1 566 ? 4.844   45.630 88.342 1.00 80.74  ? 774  LYS A H    1 
ATOM   8079  H  HA   . LYS A 1 566 ? 3.100   44.085 89.557 1.00 85.54  ? 774  LYS A HA   1 
ATOM   8080  N  N    . GLY A 1 567 ? 2.572   44.946 91.821 1.00 79.35  ? 775  GLY A N    1 
ATOM   8081  C  CA   . GLY A 1 567 ? 2.096   45.608 93.013 1.00 82.54  ? 775  GLY A CA   1 
ATOM   8082  C  C    . GLY A 1 567 ? 0.838   44.971 93.569 1.00 82.71  ? 775  GLY A C    1 
ATOM   8083  O  O    . GLY A 1 567 ? 0.306   44.005 93.014 1.00 79.73  ? 775  GLY A O    1 
ATOM   8084  H  H    . GLY A 1 567 ? 2.288   44.139 91.733 1.00 95.22  ? 775  GLY A H    1 
ATOM   8085  H  HA2  . GLY A 1 567 ? 2.784   45.575 93.696 1.00 99.04  ? 775  GLY A HA2  1 
ATOM   8086  H  HA3  . GLY A 1 567 ? 1.907   46.537 92.812 1.00 99.04  ? 775  GLY A HA3  1 
ATOM   8087  N  N    . PRO A 1 568 ? 0.339   45.501 94.682 1.00 86.43  ? 776  PRO A N    1 
ATOM   8088  C  CA   . PRO A 1 568 ? -0.878  44.945 95.284 1.00 88.15  ? 776  PRO A CA   1 
ATOM   8089  C  C    . PRO A 1 568 ? -2.088  45.151 94.387 1.00 87.87  ? 776  PRO A C    1 
ATOM   8090  O  O    . PRO A 1 568 ? -2.132  46.052 93.547 1.00 87.45  ? 776  PRO A O    1 
ATOM   8091  C  CB   . PRO A 1 568 ? -1.024  45.725 96.597 1.00 89.67  ? 776  PRO A CB   1 
ATOM   8092  C  CG   . PRO A 1 568 ? 0.307   46.374 96.828 1.00 90.60  ? 776  PRO A CG   1 
ATOM   8093  C  CD   . PRO A 1 568 ? 0.883   46.616 95.473 1.00 88.65  ? 776  PRO A CD   1 
ATOM   8094  H  HA   . PRO A 1 568 ? -0.766  44.000 95.474 1.00 105.78 ? 776  PRO A HA   1 
ATOM   8095  H  HB2  . PRO A 1 568 ? -1.719  46.395 96.502 1.00 107.61 ? 776  PRO A HB2  1 
ATOM   8096  H  HB3  . PRO A 1 568 ? -1.235  45.112 97.318 1.00 107.61 ? 776  PRO A HB3  1 
ATOM   8097  H  HG2  . PRO A 1 568 ? 0.181   47.212 97.300 1.00 108.72 ? 776  PRO A HG2  1 
ATOM   8098  H  HG3  . PRO A 1 568 ? 0.875   45.777 97.339 1.00 108.72 ? 776  PRO A HG3  1 
ATOM   8099  H  HD2  . PRO A 1 568 ? 0.576   47.465 95.120 1.00 106.38 ? 776  PRO A HD2  1 
ATOM   8100  H  HD3  . PRO A 1 568 ? 1.852   46.570 95.503 1.00 106.38 ? 776  PRO A HD3  1 
ATOM   8101  N  N    . ASN A 1 569 ? -3.088  44.296 94.584 1.00 87.99  ? 777  ASN A N    1 
ATOM   8102  C  CA   . ASN A 1 569 ? -4.300  44.386 93.782 1.00 85.32  ? 777  ASN A CA   1 
ATOM   8103  C  C    . ASN A 1 569 ? -5.014  45.704 94.060 1.00 84.67  ? 777  ASN A C    1 
ATOM   8104  O  O    . ASN A 1 569 ? -5.036  46.193 95.193 1.00 88.50  ? 777  ASN A O    1 
ATOM   8105  C  CB   . ASN A 1 569 ? -5.224  43.199 94.069 1.00 85.49  ? 777  ASN A CB   1 
ATOM   8106  C  CG   . ASN A 1 569 ? -5.839  43.251 95.454 1.00 87.96  ? 777  ASN A CG   1 
ATOM   8107  O  OD1  . ASN A 1 569 ? -5.220  42.845 96.438 1.00 89.78  ? 777  ASN A OD1  1 
ATOM   8108  N  ND2  . ASN A 1 569 ? -7.072  43.739 95.534 1.00 88.52  ? 777  ASN A ND2  1 
ATOM   8109  H  H    . ASN A 1 569 ? -3.089  43.663 95.167 1.00 105.59 ? 777  ASN A H    1 
ATOM   8110  H  HA   . ASN A 1 569 ? -4.062  44.364 92.842 1.00 102.38 ? 777  ASN A HA   1 
ATOM   8111  H  HB2  . ASN A 1 569 ? -5.946  43.197 93.421 1.00 102.60 ? 777  ASN A HB2  1 
ATOM   8112  H  HB3  . ASN A 1 569 ? -4.713  42.377 93.999 1.00 102.60 ? 777  ASN A HB3  1 
ATOM   8113  H  HD21 . ASN A 1 569 ? -7.466  43.788 96.297 1.00 106.22 ? 777  ASN A HD21 1 
ATOM   8114  H  HD22 . ASN A 1 569 ? -7.474  44.010 94.824 1.00 106.22 ? 777  ASN A HD22 1 
ATOM   8115  N  N    . VAL A 1 570 ? -5.593  46.288 93.008 1.00 79.70  ? 778  VAL A N    1 
ATOM   8116  C  CA   . VAL A 1 570 ? -6.235  47.595 93.095 1.00 77.07  ? 778  VAL A CA   1 
ATOM   8117  C  C    . VAL A 1 570 ? -7.414  47.622 92.132 1.00 71.40  ? 778  VAL A C    1 
ATOM   8118  O  O    . VAL A 1 570 ? -7.523  46.794 91.225 1.00 68.81  ? 778  VAL A O    1 
ATOM   8119  C  CB   . VAL A 1 570 ? -5.238  48.742 92.782 1.00 78.14  ? 778  VAL A CB   1 
ATOM   8120  C  CG1  . VAL A 1 570 ? -5.058  48.930 91.271 1.00 76.08  ? 778  VAL A CG1  1 
ATOM   8121  C  CG2  . VAL A 1 570 ? -5.678  50.038 93.446 1.00 80.29  ? 778  VAL A CG2  1 
ATOM   8122  H  H    . VAL A 1 570 ? -5.626  45.939 92.222 1.00 95.65  ? 778  VAL A H    1 
ATOM   8123  H  HA   . VAL A 1 570 ? -6.574  47.725 93.994 1.00 92.48  ? 778  VAL A HA   1 
ATOM   8124  H  HB   . VAL A 1 570 ? -4.373  48.505 93.150 1.00 93.77  ? 778  VAL A HB   1 
ATOM   8125  H  HG11 . VAL A 1 570 ? -4.431  49.653 91.116 1.00 91.30  ? 778  VAL A HG11 1 
ATOM   8126  H  HG12 . VAL A 1 570 ? -4.715  48.106 90.890 1.00 91.30  ? 778  VAL A HG12 1 
ATOM   8127  H  HG13 . VAL A 1 570 ? -5.917  49.146 90.875 1.00 91.30  ? 778  VAL A HG13 1 
ATOM   8128  H  HG21 . VAL A 1 570 ? -5.037  50.734 93.233 1.00 96.35  ? 778  VAL A HG21 1 
ATOM   8129  H  HG22 . VAL A 1 570 ? -6.555  50.281 93.112 1.00 96.35  ? 778  VAL A HG22 1 
ATOM   8130  H  HG23 . VAL A 1 570 ? -5.714  49.903 94.406 1.00 96.35  ? 778  VAL A HG23 1 
ATOM   8131  N  N    . THR A 1 571 ? -8.303  48.594 92.336 1.00 68.88  ? 779  THR A N    1 
ATOM   8132  C  CA   . THR A 1 571 ? -9.463  48.805 91.480 1.00 63.02  ? 779  THR A CA   1 
ATOM   8133  C  C    . THR A 1 571 ? -9.461  50.246 90.990 1.00 58.34  ? 779  THR A C    1 
ATOM   8134  O  O    . THR A 1 571 ? -9.104  51.161 91.737 1.00 60.12  ? 779  THR A O    1 
ATOM   8135  C  CB   . THR A 1 571 ? -10.769 48.502 92.232 1.00 63.65  ? 779  THR A CB   1 
ATOM   8136  O  OG1  . THR A 1 571 ? -10.720 47.171 92.762 1.00 64.45  ? 779  THR A OG1  1 
ATOM   8137  C  CG2  . THR A 1 571 ? -11.973 48.629 91.306 1.00 62.11  ? 779  THR A CG2  1 
ATOM   8138  H  H    . THR A 1 571 ? -8.251  49.158 92.982 1.00 82.66  ? 779  THR A H    1 
ATOM   8139  H  HA   . THR A 1 571 ? -9.408  48.218 90.710 1.00 75.63  ? 779  THR A HA   1 
ATOM   8140  H  HB   . THR A 1 571 ? -10.876 49.134 92.960 1.00 76.39  ? 779  THR A HB   1 
ATOM   8141  H  HG1  . THR A 1 571 ? -11.432 46.999 93.174 1.00 77.34  ? 779  THR A HG1  1 
ATOM   8142  H  HG21 . THR A 1 571 ? -12.788 48.435 91.795 1.00 74.54  ? 779  THR A HG21 1 
ATOM   8143  H  HG22 . THR A 1 571 ? -12.025 49.530 90.952 1.00 74.54  ? 779  THR A HG22 1 
ATOM   8144  H  HG23 . THR A 1 571 ? -11.891 48.004 90.569 1.00 74.54  ? 779  THR A HG23 1 
ATOM   8145  N  N    . VAL A 1 572 ? -9.858  50.446 89.731 1.00 52.47  ? 780  VAL A N    1 
ATOM   8146  C  CA   . VAL A 1 572 ? -9.844  51.762 89.099 1.00 49.07  ? 780  VAL A CA   1 
ATOM   8147  C  C    . VAL A 1 572 ? -11.131 51.951 88.303 1.00 49.06  ? 780  VAL A C    1 
ATOM   8148  O  O    . VAL A 1 572 ? -11.871 51.003 88.035 1.00 48.38  ? 780  VAL A O    1 
ATOM   8149  C  CB   . VAL A 1 572 ? -8.617  51.956 88.182 1.00 46.31  ? 780  VAL A CB   1 
ATOM   8150  C  CG1  . VAL A 1 572 ? -7.328  51.897 88.991 1.00 46.85  ? 780  VAL A CG1  1 
ATOM   8151  C  CG2  . VAL A 1 572 ? -8.609  50.911 87.070 1.00 44.11  ? 780  VAL A CG2  1 
ATOM   8152  H  H    . VAL A 1 572 ? -10.145 49.821 89.214 1.00 62.96  ? 780  VAL A H    1 
ATOM   8153  H  HA   . VAL A 1 572 ? -9.815  52.444 89.789 1.00 58.89  ? 780  VAL A HA   1 
ATOM   8154  H  HB   . VAL A 1 572 ? -8.670  52.832 87.767 1.00 55.58  ? 780  VAL A HB   1 
ATOM   8155  H  HG11 . VAL A 1 572 ? -6.575  52.021 88.393 1.00 56.22  ? 780  VAL A HG11 1 
ATOM   8156  H  HG12 . VAL A 1 572 ? -7.342  52.602 89.657 1.00 56.22  ? 780  VAL A HG12 1 
ATOM   8157  H  HG13 . VAL A 1 572 ? -7.268  51.032 89.425 1.00 56.22  ? 780  VAL A HG13 1 
ATOM   8158  H  HG21 . VAL A 1 572 ? -7.831  51.054 86.509 1.00 52.93  ? 780  VAL A HG21 1 
ATOM   8159  H  HG22 . VAL A 1 572 ? -8.572  50.027 87.469 1.00 52.93  ? 780  VAL A HG22 1 
ATOM   8160  H  HG23 . VAL A 1 572 ? -9.418  51.004 86.544 1.00 52.93  ? 780  VAL A HG23 1 
ATOM   8161  N  N    . THR A 1 573 ? -11.376 53.200 87.908 1.00 47.83  ? 781  THR A N    1 
ATOM   8162  C  CA   . THR A 1 573 ? -12.564 53.589 87.159 1.00 45.13  ? 781  THR A CA   1 
ATOM   8163  C  C    . THR A 1 573 ? -12.150 54.114 85.790 1.00 46.00  ? 781  THR A C    1 
ATOM   8164  O  O    . THR A 1 573 ? -11.243 54.947 85.693 1.00 45.47  ? 781  THR A O    1 
ATOM   8165  C  CB   . THR A 1 573 ? -13.354 54.664 87.912 1.00 45.68  ? 781  THR A CB   1 
ATOM   8166  O  OG1  . THR A 1 573 ? -13.655 54.203 89.235 1.00 48.51  ? 781  THR A OG1  1 
ATOM   8167  C  CG2  . THR A 1 573 ? -14.650 54.998 87.182 1.00 44.47  ? 781  THR A CG2  1 
ATOM   8168  H  H    . THR A 1 573 ? -10.849 53.859 88.070 1.00 57.40  ? 781  THR A H    1 
ATOM   8169  H  HA   . THR A 1 573 ? -13.137 52.816 87.033 1.00 54.16  ? 781  THR A HA   1 
ATOM   8170  H  HB   . THR A 1 573 ? -12.821 55.472 87.968 1.00 54.82  ? 781  THR A HB   1 
ATOM   8171  H  HG1  . THR A 1 573 ? -14.114 53.500 89.196 1.00 58.22  ? 781  THR A HG1  1 
ATOM   8172  H  HG21 . THR A 1 573 ? -15.139 55.679 87.670 1.00 53.37  ? 781  THR A HG21 1 
ATOM   8173  H  HG22 . THR A 1 573 ? -14.453 55.327 86.291 1.00 53.37  ? 781  THR A HG22 1 
ATOM   8174  H  HG23 . THR A 1 573 ? -15.203 54.204 87.109 1.00 53.37  ? 781  THR A HG23 1 
ATOM   8175  N  N    . VAL A 1 574 ? -12.827 53.643 84.742 1.00 45.47  ? 782  VAL A N    1 
ATOM   8176  C  CA   . VAL A 1 574 ? -12.547 54.039 83.364 1.00 45.64  ? 782  VAL A CA   1 
ATOM   8177  C  C    . VAL A 1 574 ? -13.726 54.850 82.842 1.00 46.11  ? 782  VAL A C    1 
ATOM   8178  O  O    . VAL A 1 574 ? -14.887 54.475 83.045 1.00 44.73  ? 782  VAL A O    1 
ATOM   8179  C  CB   . VAL A 1 574 ? -12.289 52.814 82.465 1.00 45.18  ? 782  VAL A CB   1 
ATOM   8180  C  CG1  . VAL A 1 574 ? -11.852 53.255 81.074 1.00 42.55  ? 782  VAL A CG1  1 
ATOM   8181  C  CG2  . VAL A 1 574 ? -11.249 51.887 83.093 1.00 44.24  ? 782  VAL A CG2  1 
ATOM   8182  H  H    . VAL A 1 574 ? -13.470 53.075 84.808 1.00 54.56  ? 782  VAL A H    1 
ATOM   8183  H  HA   . VAL A 1 574 ? -11.758 54.602 83.346 1.00 54.77  ? 782  VAL A HA   1 
ATOM   8184  H  HB   . VAL A 1 574 ? -13.115 52.314 82.372 1.00 54.22  ? 782  VAL A HB   1 
ATOM   8185  H  HG11 . VAL A 1 574 ? -11.696 52.469 80.528 1.00 51.06  ? 782  VAL A HG11 1 
ATOM   8186  H  HG12 . VAL A 1 574 ? -12.553 53.798 80.681 1.00 51.06  ? 782  VAL A HG12 1 
ATOM   8187  H  HG13 . VAL A 1 574 ? -11.035 53.773 81.150 1.00 51.06  ? 782  VAL A HG13 1 
ATOM   8188  H  HG21 . VAL A 1 574 ? -11.108 51.127 82.506 1.00 53.09  ? 782  VAL A HG21 1 
ATOM   8189  H  HG22 . VAL A 1 574 ? -10.419 52.376 83.207 1.00 53.09  ? 782  VAL A HG22 1 
ATOM   8190  H  HG23 . VAL A 1 574 ? -11.576 51.584 83.955 1.00 53.09  ? 782  VAL A HG23 1 
ATOM   8191  N  N    . ILE A 1 575 ? -13.429 55.954 82.155 1.00 45.01  ? 783  ILE A N    1 
ATOM   8192  C  CA   . ILE A 1 575 ? -14.448 56.872 81.652 1.00 44.09  ? 783  ILE A CA   1 
ATOM   8193  C  C    . ILE A 1 575 ? -14.138 57.213 80.200 1.00 43.03  ? 783  ILE A C    1 
ATOM   8194  O  O    . ILE A 1 575 ? -13.014 57.617 79.879 1.00 42.54  ? 783  ILE A O    1 
ATOM   8195  C  CB   . ILE A 1 575 ? -14.525 58.157 82.499 1.00 44.55  ? 783  ILE A CB   1 
ATOM   8196  C  CG1  . ILE A 1 575 ? -14.803 57.813 83.965 1.00 47.67  ? 783  ILE A CG1  1 
ATOM   8197  C  CG2  . ILE A 1 575 ? -15.613 59.085 81.964 1.00 44.29  ? 783  ILE A CG2  1 
ATOM   8198  C  CD1  . ILE A 1 575 ? -14.642 58.980 84.909 1.00 49.50  ? 783  ILE A CD1  1 
ATOM   8199  H  H    . ILE A 1 575 ? -12.626 56.197 81.964 1.00 54.01  ? 783  ILE A H    1 
ATOM   8200  H  HA   . ILE A 1 575 ? -15.314 56.436 81.684 1.00 52.91  ? 783  ILE A HA   1 
ATOM   8201  H  HB   . ILE A 1 575 ? -13.672 58.615 82.445 1.00 53.46  ? 783  ILE A HB   1 
ATOM   8202  H  HG12 . ILE A 1 575 ? -15.715 57.492 84.043 1.00 57.20  ? 783  ILE A HG12 1 
ATOM   8203  H  HG13 . ILE A 1 575 ? -14.186 57.118 84.245 1.00 57.20  ? 783  ILE A HG13 1 
ATOM   8204  H  HG21 . ILE A 1 575 ? -15.642 59.886 82.511 1.00 53.15  ? 783  ILE A HG21 1 
ATOM   8205  H  HG22 . ILE A 1 575 ? -15.404 59.319 81.046 1.00 53.15  ? 783  ILE A HG22 1 
ATOM   8206  H  HG23 . ILE A 1 575 ? -16.466 58.626 82.002 1.00 53.15  ? 783  ILE A HG23 1 
ATOM   8207  H  HD11 . ILE A 1 575 ? -14.834 58.683 85.813 1.00 59.41  ? 783  ILE A HD11 1 
ATOM   8208  H  HD12 . ILE A 1 575 ? -13.731 59.307 84.855 1.00 59.41  ? 783  ILE A HD12 1 
ATOM   8209  H  HD13 . ILE A 1 575 ? -15.262 59.681 84.652 1.00 59.41  ? 783  ILE A HD13 1 
ATOM   8210  N  N    . TRP A 1 576 ? -15.140 57.072 79.332 1.00 42.33  ? 784  TRP A N    1 
ATOM   8211  C  CA   . TRP A 1 576 ? -15.030 57.393 77.913 1.00 42.14  ? 784  TRP A CA   1 
ATOM   8212  C  C    . TRP A 1 576 ? -15.814 58.668 77.623 1.00 42.33  ? 784  TRP A C    1 
ATOM   8213  O  O    . TRP A 1 576 ? -17.009 58.744 77.924 1.00 43.65  ? 784  TRP A O    1 
ATOM   8214  C  CB   . TRP A 1 576 ? -15.565 56.246 77.050 1.00 42.29  ? 784  TRP A CB   1 
ATOM   8215  C  CG   . TRP A 1 576 ? -14.752 54.982 77.116 1.00 42.73  ? 784  TRP A CG   1 
ATOM   8216  C  CD1  . TRP A 1 576 ? -14.519 54.213 78.217 1.00 45.28  ? 784  TRP A CD1  1 
ATOM   8217  C  CD2  . TRP A 1 576 ? -14.082 54.334 76.026 1.00 39.56  ? 784  TRP A CD2  1 
ATOM   8218  N  NE1  . TRP A 1 576 ? -13.739 53.131 77.884 1.00 42.30  ? 784  TRP A NE1  1 
ATOM   8219  C  CE2  . TRP A 1 576 ? -13.457 53.183 76.545 1.00 40.54  ? 784  TRP A CE2  1 
ATOM   8220  C  CE3  . TRP A 1 576 ? -13.947 54.619 74.663 1.00 38.26  ? 784  TRP A CE3  1 
ATOM   8221  C  CZ2  . TRP A 1 576 ? -12.708 52.316 75.749 1.00 37.47  ? 784  TRP A CZ2  1 
ATOM   8222  C  CZ3  . TRP A 1 576 ? -13.201 53.759 73.876 1.00 38.14  ? 784  TRP A CZ3  1 
ATOM   8223  C  CH2  . TRP A 1 576 ? -12.591 52.621 74.422 1.00 37.68  ? 784  TRP A CH2  1 
ATOM   8224  H  H    . TRP A 1 576 ? -15.918 56.781 79.553 1.00 50.80  ? 784  TRP A H    1 
ATOM   8225  H  HA   . TRP A 1 576 ? -14.100 57.543 77.685 1.00 50.57  ? 784  TRP A HA   1 
ATOM   8226  H  HB2  . TRP A 1 576 ? -16.465 56.032 77.342 1.00 50.75  ? 784  TRP A HB2  1 
ATOM   8227  H  HB3  . TRP A 1 576 ? -15.582 56.537 76.125 1.00 50.75  ? 784  TRP A HB3  1 
ATOM   8228  H  HD1  . TRP A 1 576 ? -14.840 54.395 79.071 1.00 54.33  ? 784  TRP A HD1  1 
ATOM   8229  H  HE1  . TRP A 1 576 ? -13.472 52.521 78.428 1.00 50.77  ? 784  TRP A HE1  1 
ATOM   8230  H  HE3  . TRP A 1 576 ? -14.346 55.373 74.294 1.00 45.91  ? 784  TRP A HE3  1 
ATOM   8231  H  HZ2  . TRP A 1 576 ? -12.302 51.560 76.109 1.00 44.97  ? 784  TRP A HZ2  1 
ATOM   8232  H  HZ3  . TRP A 1 576 ? -13.104 53.939 72.969 1.00 45.77  ? 784  TRP A HZ3  1 
ATOM   8233  H  HH2  . TRP A 1 576 ? -12.097 52.060 73.869 1.00 45.22  ? 784  TRP A HH2  1 
ATOM   8234  N  N    . VAL A 1 577 ? -15.148 59.653 77.020 1.00 42.91  ? 785  VAL A N    1 
ATOM   8235  C  CA   . VAL A 1 577 ? -15.725 60.970 76.763 1.00 42.69  ? 785  VAL A CA   1 
ATOM   8236  C  C    . VAL A 1 577 ? -15.643 61.254 75.269 1.00 42.35  ? 785  VAL A C    1 
ATOM   8237  O  O    . VAL A 1 577 ? -14.575 61.108 74.664 1.00 43.35  ? 785  VAL A O    1 
ATOM   8238  C  CB   . VAL A 1 577 ? -14.999 62.070 77.560 1.00 43.40  ? 785  VAL A CB   1 
ATOM   8239  C  CG1  . VAL A 1 577 ? -15.701 63.407 77.391 1.00 43.37  ? 785  VAL A CG1  1 
ATOM   8240  C  CG2  . VAL A 1 577 ? -14.908 61.693 79.032 1.00 45.87  ? 785  VAL A CG2  1 
ATOM   8241  H  H    . VAL A 1 577 ? -14.337 59.579 76.744 1.00 51.49  ? 785  VAL A H    1 
ATOM   8242  H  HA   . VAL A 1 577 ? -16.659 60.969 77.024 1.00 51.23  ? 785  VAL A HA   1 
ATOM   8243  H  HB   . VAL A 1 577 ? -14.096 62.161 77.219 1.00 52.09  ? 785  VAL A HB   1 
ATOM   8244  H  HG11 . VAL A 1 577 ? -15.225 64.080 77.902 1.00 52.04  ? 785  VAL A HG11 1 
ATOM   8245  H  HG12 . VAL A 1 577 ? -15.703 63.645 76.450 1.00 52.04  ? 785  VAL A HG12 1 
ATOM   8246  H  HG13 . VAL A 1 577 ? -16.612 63.329 77.715 1.00 52.04  ? 785  VAL A HG13 1 
ATOM   8247  H  HG21 . VAL A 1 577 ? -14.448 62.400 79.511 1.00 55.05  ? 785  VAL A HG21 1 
ATOM   8248  H  HG22 . VAL A 1 577 ? -15.805 61.583 79.385 1.00 55.05  ? 785  VAL A HG22 1 
ATOM   8249  H  HG23 . VAL A 1 577 ? -14.416 60.862 79.115 1.00 55.05  ? 785  VAL A HG23 1 
ATOM   8250  N  N    . ASP A 1 578 ? -16.763 61.685 74.678 1.00 41.73  ? 786  ASP A N    1 
ATOM   8251  C  CA   . ASP A 1 578 ? -16.811 61.915 73.237 1.00 41.52  ? 786  ASP A CA   1 
ATOM   8252  C  C    . ASP A 1 578 ? -16.464 63.368 72.917 1.00 42.24  ? 786  ASP A C    1 
ATOM   8253  O  O    . ASP A 1 578 ? -16.273 64.178 73.835 1.00 41.15  ? 786  ASP A O    1 
ATOM   8254  C  CB   . ASP A 1 578 ? -18.185 61.517 72.682 1.00 44.73  ? 786  ASP A CB   1 
ATOM   8255  C  CG   . ASP A 1 578 ? -19.153 62.684 72.567 1.00 49.24  ? 786  ASP A CG   1 
ATOM   8256  O  OD1  . ASP A 1 578 ? -19.092 63.623 73.390 1.00 50.92  ? 786  ASP A OD1  1 
ATOM   8257  O  OD2  . ASP A 1 578 ? -20.001 62.643 71.649 1.00 49.92  ? 786  ASP A OD2  1 
ATOM   8258  H  H    . ASP A 1 578 ? -17.501 61.849 75.089 1.00 50.08  ? 786  ASP A H    1 
ATOM   8259  H  HA   . ASP A 1 578 ? -16.146 61.353 72.810 1.00 49.82  ? 786  ASP A HA   1 
ATOM   8260  H  HB2  . ASP A 1 578 ? -18.068 61.139 71.796 1.00 53.68  ? 786  ASP A HB2  1 
ATOM   8261  H  HB3  . ASP A 1 578 ? -18.583 60.857 73.272 1.00 53.68  ? 786  ASP A HB3  1 
ATOM   8262  N  N    . PRO A 1 579 ? -16.375 63.737 71.636 1.00 41.75  ? 787  PRO A N    1 
ATOM   8263  C  CA   . PRO A 1 579 ? -15.796 65.047 71.285 1.00 42.84  ? 787  PRO A CA   1 
ATOM   8264  C  C    . PRO A 1 579 ? -16.555 66.254 71.817 1.00 44.08  ? 787  PRO A C    1 
ATOM   8265  O  O    . PRO A 1 579 ? -15.964 67.338 71.884 1.00 43.39  ? 787  PRO A O    1 
ATOM   8266  C  CB   . PRO A 1 579 ? -15.795 65.026 69.750 1.00 42.43  ? 787  PRO A CB   1 
ATOM   8267  C  CG   . PRO A 1 579 ? -15.774 63.576 69.394 1.00 41.24  ? 787  PRO A CG   1 
ATOM   8268  C  CD   . PRO A 1 579 ? -16.615 62.912 70.440 1.00 41.52  ? 787  PRO A CD   1 
ATOM   8269  H  HA   . PRO A 1 579 ? -14.879 65.094 71.596 1.00 51.41  ? 787  PRO A HA   1 
ATOM   8270  H  HB2  . PRO A 1 579 ? -16.600 65.452 69.415 1.00 50.91  ? 787  PRO A HB2  1 
ATOM   8271  H  HB3  . PRO A 1 579 ? -15.002 65.474 69.415 1.00 50.91  ? 787  PRO A HB3  1 
ATOM   8272  H  HG2  . PRO A 1 579 ? -16.158 63.449 68.513 1.00 49.49  ? 787  PRO A HG2  1 
ATOM   8273  H  HG3  . PRO A 1 579 ? -14.863 63.244 69.424 1.00 49.49  ? 787  PRO A HG3  1 
ATOM   8274  H  HD2  . PRO A 1 579 ? -17.552 62.942 70.191 1.00 49.82  ? 787  PRO A HD2  1 
ATOM   8275  H  HD3  . PRO A 1 579 ? -16.314 62.002 70.590 1.00 49.82  ? 787  PRO A HD3  1 
ATOM   8276  N  N    . VAL A 1 580 ? -17.831 66.125 72.182 1.00 47.34  ? 788  VAL A N    1 
ATOM   8277  C  CA   . VAL A 1 580 ? -18.572 67.264 72.721 1.00 49.83  ? 788  VAL A CA   1 
ATOM   8278  C  C    . VAL A 1 580 ? -18.874 67.034 74.197 1.00 48.48  ? 788  VAL A C    1 
ATOM   8279  O  O    . VAL A 1 580 ? -19.856 67.564 74.731 1.00 49.97  ? 788  VAL A O    1 
ATOM   8280  C  CB   . VAL A 1 580 ? -19.866 67.532 71.926 1.00 53.88  ? 788  VAL A CB   1 
ATOM   8281  C  CG1  . VAL A 1 580 ? -19.535 68.034 70.527 1.00 54.99  ? 788  VAL A CG1  1 
ATOM   8282  C  CG2  . VAL A 1 580 ? -20.736 66.289 71.858 1.00 53.71  ? 788  VAL A CG2  1 
ATOM   8283  H  H    . VAL A 1 580 ? -18.285 65.396 72.128 1.00 56.81  ? 788  VAL A H    1 
ATOM   8284  H  HA   . VAL A 1 580 ? -18.016 68.056 72.654 1.00 59.80  ? 788  VAL A HA   1 
ATOM   8285  H  HB   . VAL A 1 580 ? -20.373 68.224 72.377 1.00 64.66  ? 788  VAL A HB   1 
ATOM   8286  H  HG11 . VAL A 1 580 ? -20.361 68.196 70.046 1.00 65.99  ? 788  VAL A HG11 1 
ATOM   8287  H  HG12 . VAL A 1 580 ? -19.027 68.858 70.600 1.00 65.99  ? 788  VAL A HG12 1 
ATOM   8288  H  HG13 . VAL A 1 580 ? -19.009 67.361 70.066 1.00 65.99  ? 788  VAL A HG13 1 
ATOM   8289  H  HG21 . VAL A 1 580 ? -21.538 66.492 71.352 1.00 64.45  ? 788  VAL A HG21 1 
ATOM   8290  H  HG22 . VAL A 1 580 ? -20.239 65.580 71.420 1.00 64.45  ? 788  VAL A HG22 1 
ATOM   8291  H  HG23 . VAL A 1 580 ? -20.972 66.019 72.759 1.00 64.45  ? 788  VAL A HG23 1 
ATOM   8292  N  N    . ASN A 1 581 ? -18.023 66.255 74.867 1.00 47.07  ? 789  ASN A N    1 
ATOM   8293  C  CA   . ASN A 1 581 ? -18.058 66.016 76.310 1.00 50.42  ? 789  ASN A CA   1 
ATOM   8294  C  C    . ASN A 1 581 ? -19.218 65.131 76.757 1.00 54.60  ? 789  ASN A C    1 
ATOM   8295  O  O    . ASN A 1 581 ? -19.503 65.062 77.960 1.00 55.82  ? 789  ASN A O    1 
ATOM   8296  C  CB   . ASN A 1 581 ? -18.089 67.332 77.101 1.00 50.86  ? 789  ASN A CB   1 
ATOM   8297  C  CG   . ASN A 1 581 ? -16.699 67.838 77.446 1.00 50.60  ? 789  ASN A CG   1 
ATOM   8298  O  OD1  . ASN A 1 581 ? -15.694 67.289 76.993 1.00 49.46  ? 789  ASN A OD1  1 
ATOM   8299  N  ND2  . ASN A 1 581 ? -16.637 68.891 78.250 1.00 51.91  ? 789  ASN A ND2  1 
ATOM   8300  H  H    . ASN A 1 581 ? -17.381 65.832 74.482 1.00 56.49  ? 789  ASN A H    1 
ATOM   8301  H  HA   . ASN A 1 581 ? -17.240 65.556 76.556 1.00 60.50  ? 789  ASN A HA   1 
ATOM   8302  H  HB2  . ASN A 1 581 ? -18.533 68.011 76.569 1.00 61.03  ? 789  ASN A HB2  1 
ATOM   8303  H  HB3  . ASN A 1 581 ? -18.572 67.192 77.931 1.00 61.03  ? 789  ASN A HB3  1 
ATOM   8304  H  HD21 . ASN A 1 581 ? -15.873 69.216 78.475 1.00 62.30  ? 789  ASN A HD21 1 
ATOM   8305  H  HD22 . ASN A 1 581 ? -17.361 69.249 78.547 1.00 62.30  ? 789  ASN A HD22 1 
ATOM   8306  N  N    . VAL A 1 582 ? -19.887 64.435 75.837 1.00 55.20  ? 790  VAL A N    1 
ATOM   8307  C  CA   . VAL A 1 582 ? -20.872 63.435 76.232 1.00 54.18  ? 790  VAL A CA   1 
ATOM   8308  C  C    . VAL A 1 582 ? -20.147 62.226 76.808 1.00 50.80  ? 790  VAL A C    1 
ATOM   8309  O  O    . VAL A 1 582 ? -19.244 61.664 76.174 1.00 49.15  ? 790  VAL A O    1 
ATOM   8310  C  CB   . VAL A 1 582 ? -21.752 63.039 75.036 1.00 54.94  ? 790  VAL A CB   1 
ATOM   8311  C  CG1  . VAL A 1 582 ? -22.663 61.870 75.395 1.00 54.50  ? 790  VAL A CG1  1 
ATOM   8312  C  CG2  . VAL A 1 582 ? -22.574 64.227 74.567 1.00 58.19  ? 790  VAL A CG2  1 
ATOM   8313  H  H    . VAL A 1 582 ? -19.790 64.524 74.987 1.00 66.25  ? 790  VAL A H    1 
ATOM   8314  H  HA   . VAL A 1 582 ? -21.445 63.804 76.923 1.00 65.02  ? 790  VAL A HA   1 
ATOM   8315  H  HB   . VAL A 1 582 ? -21.181 62.760 74.303 1.00 65.93  ? 790  VAL A HB   1 
ATOM   8316  H  HG11 . VAL A 1 582 ? -23.205 61.644 74.623 1.00 65.40  ? 790  VAL A HG11 1 
ATOM   8317  H  HG12 . VAL A 1 582 ? -22.117 61.111 75.651 1.00 65.40  ? 790  VAL A HG12 1 
ATOM   8318  H  HG13 . VAL A 1 582 ? -23.234 62.131 76.135 1.00 65.40  ? 790  VAL A HG13 1 
ATOM   8319  H  HG21 . VAL A 1 582 ? -23.121 63.955 73.813 1.00 69.83  ? 790  VAL A HG21 1 
ATOM   8320  H  HG22 . VAL A 1 582 ? -23.141 64.526 75.296 1.00 69.83  ? 790  VAL A HG22 1 
ATOM   8321  H  HG23 . VAL A 1 582 ? -21.974 64.941 74.301 1.00 69.83  ? 790  VAL A HG23 1 
ATOM   8322  N  N    . ILE A 1 583 ? -20.542 61.815 78.009 1.00 49.29  ? 791  ILE A N    1 
ATOM   8323  C  CA   . ILE A 1 583 ? -19.931 60.658 78.657 1.00 48.10  ? 791  ILE A CA   1 
ATOM   8324  C  C    . ILE A 1 583 ? -20.621 59.397 78.151 1.00 49.04  ? 791  ILE A C    1 
ATOM   8325  O  O    . ILE A 1 583 ? -21.823 59.205 78.363 1.00 49.76  ? 791  ILE A O    1 
ATOM   8326  C  CB   . ILE A 1 583 ? -20.013 60.772 80.186 1.00 49.28  ? 791  ILE A CB   1 
ATOM   8327  C  CG1  . ILE A 1 583 ? -19.321 62.066 80.633 1.00 51.82  ? 791  ILE A CG1  1 
ATOM   8328  C  CG2  . ILE A 1 583 ? -19.391 59.538 80.845 1.00 47.76  ? 791  ILE A CG2  1 
ATOM   8329  C  CD1  . ILE A 1 583 ? -19.093 62.195 82.129 1.00 54.40  ? 791  ILE A CD1  1 
ATOM   8330  H  H    . ILE A 1 583 ? -21.162 62.190 78.472 1.00 59.15  ? 791  ILE A H    1 
ATOM   8331  H  HA   . ILE A 1 583 ? -18.995 60.611 78.408 1.00 57.73  ? 791  ILE A HA   1 
ATOM   8332  H  HB   . ILE A 1 583 ? -20.948 60.818 80.441 1.00 59.13  ? 791  ILE A HB   1 
ATOM   8333  H  HG12 . ILE A 1 583 ? -18.454 62.116 80.201 1.00 62.18  ? 791  ILE A HG12 1 
ATOM   8334  H  HG13 . ILE A 1 583 ? -19.866 62.818 80.355 1.00 62.18  ? 791  ILE A HG13 1 
ATOM   8335  H  HG21 . ILE A 1 583 ? -19.453 59.631 81.809 1.00 57.32  ? 791  ILE A HG21 1 
ATOM   8336  H  HG22 . ILE A 1 583 ? -19.874 58.748 80.556 1.00 57.32  ? 791  ILE A HG22 1 
ATOM   8337  H  HG23 . ILE A 1 583 ? -18.460 59.474 80.579 1.00 57.32  ? 791  ILE A HG23 1 
ATOM   8338  H  HD11 . ILE A 1 583 ? -18.652 63.041 82.309 1.00 65.28  ? 791  ILE A HD11 1 
ATOM   8339  H  HD12 . ILE A 1 583 ? -19.950 62.165 82.582 1.00 65.28  ? 791  ILE A HD12 1 
ATOM   8340  H  HD13 . ILE A 1 583 ? -18.534 61.461 82.428 1.00 65.28  ? 791  ILE A HD13 1 
ATOM   8341  N  N    . ALA A 1 584 ? -19.855 58.530 77.487 1.00 48.63  ? 792  ALA A N    1 
ATOM   8342  C  CA   . ALA A 1 584 ? -20.416 57.383 76.784 1.00 48.81  ? 792  ALA A CA   1 
ATOM   8343  C  C    . ALA A 1 584 ? -20.489 56.125 77.639 1.00 51.80  ? 792  ALA A C    1 
ATOM   8344  O  O    . ALA A 1 584 ? -21.396 55.308 77.437 1.00 52.84  ? 792  ALA A O    1 
ATOM   8345  C  CB   . ALA A 1 584 ? -19.592 57.087 75.527 1.00 45.48  ? 792  ALA A CB   1 
ATOM   8346  H  H    . ALA A 1 584 ? -18.999 58.588 77.430 1.00 58.36  ? 792  ALA A H    1 
ATOM   8347  H  HA   . ALA A 1 584 ? -21.318 57.602 76.502 1.00 58.57  ? 792  ALA A HA   1 
ATOM   8348  H  HB1  . ALA A 1 584 ? -19.976 56.322 75.071 1.00 54.58  ? 792  ALA A HB1  1 
ATOM   8349  H  HB2  . ALA A 1 584 ? -19.612 57.864 74.947 1.00 54.58  ? 792  ALA A HB2  1 
ATOM   8350  H  HB3  . ALA A 1 584 ? -18.678 56.892 75.788 1.00 54.58  ? 792  ALA A HB3  1 
ATOM   8351  N  N    . ALA A 1 585 ? -19.563 55.936 78.577 1.00 51.52  ? 793  ALA A N    1 
ATOM   8352  C  CA   . ALA A 1 585 ? -19.550 54.717 79.375 1.00 50.91  ? 793  ALA A CA   1 
ATOM   8353  C  C    . ALA A 1 585 ? -18.639 54.903 80.579 1.00 49.60  ? 793  ALA A C    1 
ATOM   8354  O  O    . ALA A 1 585 ? -17.698 55.704 80.545 1.00 46.99  ? 793  ALA A O    1 
ATOM   8355  C  CB   . ALA A 1 585 ? -19.090 53.511 78.545 1.00 50.30  ? 793  ALA A CB   1 
ATOM   8356  H  H    . ALA A 1 585 ? -18.936 56.493 78.768 1.00 61.83  ? 793  ALA A H    1 
ATOM   8357  H  HA   . ALA A 1 585 ? -20.447 54.538 79.699 1.00 61.10  ? 793  ALA A HA   1 
ATOM   8358  H  HB1  . ALA A 1 585 ? -19.095 52.721 79.107 1.00 60.36  ? 793  ALA A HB1  1 
ATOM   8359  H  HB2  . ALA A 1 585 ? -19.699 53.391 77.799 1.00 60.36  ? 793  ALA A HB2  1 
ATOM   8360  H  HB3  . ALA A 1 585 ? -18.193 53.679 78.216 1.00 60.36  ? 793  ALA A HB3  1 
ATOM   8361  N  N    . THR A 1 586 ? -18.929 54.149 81.639 1.00 50.36  ? 794  THR A N    1 
ATOM   8362  C  CA   . THR A 1 586 ? -18.130 54.164 82.857 1.00 53.37  ? 794  THR A CA   1 
ATOM   8363  C  C    . THR A 1 586 ? -18.190 52.782 83.491 1.00 53.28  ? 794  THR A C    1 
ATOM   8364  O  O    . THR A 1 586 ? -19.252 52.155 83.517 1.00 54.32  ? 794  THR A O    1 
ATOM   8365  C  CB   . THR A 1 586 ? -18.632 55.215 83.856 1.00 59.20  ? 794  THR A CB   1 
ATOM   8366  O  OG1  . THR A 1 586 ? -18.723 56.494 83.214 1.00 60.81  ? 794  THR A OG1  1 
ATOM   8367  C  CG2  . THR A 1 586 ? -17.687 55.317 85.049 1.00 59.68  ? 794  THR A CG2  1 
ATOM   8368  H  H    . THR A 1 586 ? -19.599 53.611 81.674 1.00 60.43  ? 794  THR A H    1 
ATOM   8369  H  HA   . THR A 1 586 ? -17.207 54.363 82.636 1.00 64.05  ? 794  THR A HA   1 
ATOM   8370  H  HB   . THR A 1 586 ? -19.508 54.956 84.183 1.00 71.05  ? 794  THR A HB   1 
ATOM   8371  H  HG1  . THR A 1 586 ? -18.997 57.070 83.760 1.00 72.97  ? 794  THR A HG1  1 
ATOM   8372  H  HG21 . THR A 1 586 ? -18.012 55.984 85.674 1.00 71.61  ? 794  THR A HG21 1 
ATOM   8373  H  HG22 . THR A 1 586 ? -17.631 54.461 85.501 1.00 71.61  ? 794  THR A HG22 1 
ATOM   8374  H  HG23 . THR A 1 586 ? -16.800 55.573 84.748 1.00 71.61  ? 794  THR A HG23 1 
ATOM   8375  N  N    . TYR A 1 587 ? -17.053 52.315 84.005 1.00 51.44  ? 795  TYR A N    1 
ATOM   8376  C  CA   . TYR A 1 587 ? -17.007 51.006 84.643 1.00 51.23  ? 795  TYR A CA   1 
ATOM   8377  C  C    . TYR A 1 587 ? -15.741 50.880 85.477 1.00 53.28  ? 795  TYR A C    1 
ATOM   8378  O  O    . TYR A 1 587 ? -14.731 51.534 85.205 1.00 52.60  ? 795  TYR A O    1 
ATOM   8379  C  CB   . TYR A 1 587 ? -17.068 49.879 83.606 1.00 46.51  ? 795  TYR A CB   1 
ATOM   8380  C  CG   . TYR A 1 587 ? -16.064 50.013 82.484 1.00 43.41  ? 795  TYR A CG   1 
ATOM   8381  C  CD1  . TYR A 1 587 ? -14.770 49.524 82.619 1.00 42.15  ? 795  TYR A CD1  1 
ATOM   8382  C  CD2  . TYR A 1 587 ? -16.413 50.617 81.284 1.00 41.71  ? 795  TYR A CD2  1 
ATOM   8383  C  CE1  . TYR A 1 587 ? -13.851 49.640 81.592 1.00 40.68  ? 795  TYR A CE1  1 
ATOM   8384  C  CE2  . TYR A 1 587 ? -15.503 50.738 80.253 1.00 40.77  ? 795  TYR A CE2  1 
ATOM   8385  C  CZ   . TYR A 1 587 ? -14.224 50.247 80.413 1.00 40.58  ? 795  TYR A CZ   1 
ATOM   8386  O  OH   . TYR A 1 587 ? -13.316 50.366 79.390 1.00 38.70  ? 795  TYR A OH   1 
ATOM   8387  H  H    . TYR A 1 587 ? -16.302 52.734 83.998 1.00 61.73  ? 795  TYR A H    1 
ATOM   8388  H  HA   . TYR A 1 587 ? -17.770 50.913 85.234 1.00 61.48  ? 795  TYR A HA   1 
ATOM   8389  H  HB2  . TYR A 1 587 ? -16.900 49.035 84.053 1.00 55.81  ? 795  TYR A HB2  1 
ATOM   8390  H  HB3  . TYR A 1 587 ? -17.953 49.869 83.209 1.00 55.81  ? 795  TYR A HB3  1 
ATOM   8391  H  HD1  . TYR A 1 587 ? -14.517 49.114 83.414 1.00 50.58  ? 795  TYR A HD1  1 
ATOM   8392  H  HD2  . TYR A 1 587 ? -17.275 50.948 81.173 1.00 50.06  ? 795  TYR A HD2  1 
ATOM   8393  H  HE1  . TYR A 1 587 ? -12.988 49.311 81.697 1.00 48.81  ? 795  TYR A HE1  1 
ATOM   8394  H  HE2  . TYR A 1 587 ? -15.751 51.147 79.455 1.00 48.92  ? 795  TYR A HE2  1 
ATOM   8395  H  HH   . TYR A 1 587 ? -13.671 50.752 78.734 1.00 46.45  ? 795  TYR A HH   1 
ATOM   8396  N  N    . ASP A 1 588 ? -15.814 50.030 86.496 1.00 55.09  ? 796  ASP A N    1 
ATOM   8397  C  CA   . ASP A 1 588 ? -14.674 49.696 87.336 1.00 56.29  ? 796  ASP A CA   1 
ATOM   8398  C  C    . ASP A 1 588 ? -14.071 48.366 86.895 1.00 56.82  ? 796  ASP A C    1 
ATOM   8399  O  O    . ASP A 1 588 ? -14.734 47.533 86.270 1.00 58.08  ? 796  ASP A O    1 
ATOM   8400  C  CB   . ASP A 1 588 ? -15.086 49.618 88.810 1.00 58.80  ? 796  ASP A CB   1 
ATOM   8401  C  CG   . ASP A 1 588 ? -15.513 50.962 89.374 1.00 61.33  ? 796  ASP A CG   1 
ATOM   8402  O  OD1  . ASP A 1 588 ? -15.293 51.995 88.706 1.00 60.98  ? 796  ASP A OD1  1 
ATOM   8403  O  OD2  . ASP A 1 588 ? -16.070 50.984 90.493 1.00 63.55  ? 796  ASP A OD2  1 
ATOM   8404  H  H    . ASP A 1 588 ? -16.536 49.623 86.726 1.00 66.11  ? 796  ASP A H    1 
ATOM   8405  H  HA   . ASP A 1 588 ? -13.996 50.383 87.245 1.00 67.55  ? 796  ASP A HA   1 
ATOM   8406  H  HB2  . ASP A 1 588 ? -15.833 49.006 88.897 1.00 70.56  ? 796  ASP A HB2  1 
ATOM   8407  H  HB3  . ASP A 1 588 ? -14.333 49.299 89.332 1.00 70.56  ? 796  ASP A HB3  1 
ATOM   8408  N  N    . ILE A 1 589 ? -12.798 48.172 87.231 1.00 57.68  ? 797  ILE A N    1 
ATOM   8409  C  CA   . ILE A 1 589 ? -12.084 46.949 86.876 1.00 60.03  ? 797  ILE A CA   1 
ATOM   8410  C  C    . ILE A 1 589 ? -11.078 46.631 87.973 1.00 62.21  ? 797  ILE A C    1 
ATOM   8411  O  O    . ILE A 1 589 ? -10.393 47.520 88.485 1.00 61.92  ? 797  ILE A O    1 
ATOM   8412  C  CB   . ILE A 1 589 ? -11.386 47.071 85.504 1.00 60.69  ? 797  ILE A CB   1 
ATOM   8413  C  CG1  . ILE A 1 589 ? -10.681 48.425 85.380 1.00 60.56  ? 797  ILE A CG1  1 
ATOM   8414  C  CG2  . ILE A 1 589 ? -12.395 46.869 84.382 1.00 62.98  ? 797  ILE A CG2  1 
ATOM   8415  C  CD1  . ILE A 1 589 ? -9.887  48.593 84.101 1.00 60.25  ? 797  ILE A CD1  1 
ATOM   8416  H  H    . ILE A 1 589 ? -12.322 48.739 87.669 1.00 69.22  ? 797  ILE A H    1 
ATOM   8417  H  HA   . ILE A 1 589 ? -12.717 46.215 86.827 1.00 72.04  ? 797  ILE A HA   1 
ATOM   8418  H  HB   . ILE A 1 589 ? -10.716 46.373 85.440 1.00 72.83  ? 797  ILE A HB   1 
ATOM   8419  H  HG12 . ILE A 1 589 ? -11.349 49.128 85.409 1.00 72.67  ? 797  ILE A HG12 1 
ATOM   8420  H  HG13 . ILE A 1 589 ? -10.068 48.526 86.125 1.00 72.67  ? 797  ILE A HG13 1 
ATOM   8421  H  HG21 . ILE A 1 589 ? -11.939 46.950 83.530 1.00 75.58  ? 797  ILE A HG21 1 
ATOM   8422  H  HG22 . ILE A 1 589 ? -12.787 45.986 84.466 1.00 75.58  ? 797  ILE A HG22 1 
ATOM   8423  H  HG23 . ILE A 1 589 ? -13.086 47.546 84.454 1.00 75.58  ? 797  ILE A HG23 1 
ATOM   8424  H  HD11 . ILE A 1 589 ? -9.474  49.471 84.099 1.00 72.30  ? 797  ILE A HD11 1 
ATOM   8425  H  HD12 . ILE A 1 589 ? -9.204  47.906 84.061 1.00 72.30  ? 797  ILE A HD12 1 
ATOM   8426  H  HD13 . ILE A 1 589 ? -10.487 48.508 83.343 1.00 72.30  ? 797  ILE A HD13 1 
ATOM   8427  N  N    . LEU A 1 590 ? -10.996 45.351 88.327 1.00 63.57  ? 798  LEU A N    1 
ATOM   8428  C  CA   . LEU A 1 590 ? -10.054 44.874 89.330 1.00 64.96  ? 798  LEU A CA   1 
ATOM   8429  C  C    . LEU A 1 590 ? -8.715  44.573 88.668 1.00 60.93  ? 798  LEU A C    1 
ATOM   8430  O  O    . LEU A 1 590 ? -8.660  43.857 87.663 1.00 58.90  ? 798  LEU A O    1 
ATOM   8431  C  CB   . LEU A 1 590 ? -10.597 43.621 90.020 1.00 69.78  ? 798  LEU A CB   1 
ATOM   8432  C  CG   . LEU A 1 590 ? -9.723  42.972 91.099 1.00 70.30  ? 798  LEU A CG   1 
ATOM   8433  C  CD1  . LEU A 1 590 ? -9.809  43.744 92.405 1.00 70.37  ? 798  LEU A CD1  1 
ATOM   8434  C  CD2  . LEU A 1 590 ? -10.122 41.516 91.302 1.00 70.59  ? 798  LEU A CD2  1 
ATOM   8435  H  H    . LEU A 1 590 ? -11.486 44.728 87.992 1.00 76.29  ? 798  LEU A H    1 
ATOM   8436  H  HA   . LEU A 1 590 ? -9.918  45.562 90.001 1.00 77.95  ? 798  LEU A HA   1 
ATOM   8437  H  HB2  . LEU A 1 590 ? -11.441 43.852 90.439 1.00 83.74  ? 798  LEU A HB2  1 
ATOM   8438  H  HB3  . LEU A 1 590 ? -10.754 42.948 89.339 1.00 83.74  ? 798  LEU A HB3  1 
ATOM   8439  H  HG   . LEU A 1 590 ? -8.799  42.988 90.804 1.00 84.36  ? 798  LEU A HG   1 
ATOM   8440  H  HD11 . LEU A 1 590 ? -9.246  43.309 93.066 1.00 84.45  ? 798  LEU A HD11 1 
ATOM   8441  H  HD12 . LEU A 1 590 ? -9.502  44.652 92.256 1.00 84.45  ? 798  LEU A HD12 1 
ATOM   8442  H  HD13 . LEU A 1 590 ? -10.730 43.751 92.708 1.00 84.45  ? 798  LEU A HD13 1 
ATOM   8443  H  HD21 . LEU A 1 590 ? -9.556  41.128 91.988 1.00 84.71  ? 798  LEU A HD21 1 
ATOM   8444  H  HD22 . LEU A 1 590 ? -11.051 41.479 91.579 1.00 84.71  ? 798  LEU A HD22 1 
ATOM   8445  H  HD23 . LEU A 1 590 ? -10.006 41.038 90.467 1.00 84.71  ? 798  LEU A HD23 1 
ATOM   8446  N  N    . ILE A 1 591 ? -7.644  45.121 89.230 1.00 60.30  ? 799  ILE A N    1 
ATOM   8447  C  CA   . ILE A 1 591 ? -6.290  44.893 88.740 1.00 59.39  ? 799  ILE A CA   1 
ATOM   8448  C  C    . ILE A 1 591 ? -5.603  43.990 89.757 1.00 60.49  ? 799  ILE A C    1 
ATOM   8449  O  O    . ILE A 1 591 ? -5.121  44.459 90.793 1.00 60.21  ? 799  ILE A O    1 
ATOM   8450  C  CB   . ILE A 1 591 ? -5.516  46.202 88.545 1.00 56.95  ? 799  ILE A CB   1 
ATOM   8451  C  CG1  . ILE A 1 591 ? -6.394  47.264 87.871 1.00 54.16  ? 799  ILE A CG1  1 
ATOM   8452  C  CG2  . ILE A 1 591 ? -4.254  45.946 87.729 1.00 54.33  ? 799  ILE A CG2  1 
ATOM   8453  C  CD1  . ILE A 1 591 ? -6.929  46.865 86.510 1.00 51.95  ? 799  ILE A CD1  1 
ATOM   8454  H  H    . ILE A 1 591 ? -7.677  45.642 89.914 1.00 72.37  ? 799  ILE A H    1 
ATOM   8455  H  HA   . ILE A 1 591 ? -6.327  44.428 87.890 1.00 71.27  ? 799  ILE A HA   1 
ATOM   8456  H  HB   . ILE A 1 591 ? -5.253  46.533 89.418 1.00 68.34  ? 799  ILE A HB   1 
ATOM   8457  H  HG12 . ILE A 1 591 ? -7.155  47.446 88.444 1.00 65.00  ? 799  ILE A HG12 1 
ATOM   8458  H  HG13 . ILE A 1 591 ? -5.870  48.072 87.756 1.00 65.00  ? 799  ILE A HG13 1 
ATOM   8459  H  HG21 . ILE A 1 591 ? -3.777  46.784 87.616 1.00 65.20  ? 799  ILE A HG21 1 
ATOM   8460  H  HG22 . ILE A 1 591 ? -3.696  45.309 88.202 1.00 65.20  ? 799  ILE A HG22 1 
ATOM   8461  H  HG23 . ILE A 1 591 ? -4.505  45.588 86.864 1.00 65.20  ? 799  ILE A HG23 1 
ATOM   8462  H  HD11 . ILE A 1 591 ? -7.469  47.590 86.159 1.00 62.34  ? 799  ILE A HD11 1 
ATOM   8463  H  HD12 . ILE A 1 591 ? -6.181  46.692 85.916 1.00 62.34  ? 799  ILE A HD12 1 
ATOM   8464  H  HD13 . ILE A 1 591 ? -7.469  46.065 86.605 1.00 62.34  ? 799  ILE A HD13 1 
ATOM   8465  N  N    . GLU A 1 592 ? -5.553  42.695 89.466 1.00 63.95  ? 800  GLU A N    1 
ATOM   8466  C  CA   . GLU A 1 592 ? -4.942  41.748 90.385 1.00 71.91  ? 800  GLU A CA   1 
ATOM   8467  C  C    . GLU A 1 592 ? -3.422  41.909 90.385 1.00 71.45  ? 800  GLU A C    1 
ATOM   8468  O  O    . GLU A 1 592 ? -2.819  42.406 89.430 1.00 68.85  ? 800  GLU A O    1 
ATOM   8469  C  CB   . GLU A 1 592 ? -5.336  40.320 90.009 1.00 78.89  ? 800  GLU A CB   1 
ATOM   8470  C  CG   . GLU A 1 592 ? -6.844  40.110 89.950 1.00 83.60  ? 800  GLU A CG   1 
ATOM   8471  C  CD   . GLU A 1 592 ? -7.229  38.689 89.593 1.00 88.06  ? 800  GLU A CD   1 
ATOM   8472  O  OE1  . GLU A 1 592 ? -6.369  37.950 89.070 1.00 89.10  ? 800  GLU A OE1  1 
ATOM   8473  O  OE2  . GLU A 1 592 ? -8.395  38.311 89.835 1.00 90.64  ? 800  GLU A OE2  1 
ATOM   8474  H  H    . GLU A 1 592 ? -5.865  42.341 88.747 1.00 76.74  ? 800  GLU A H    1 
ATOM   8475  H  HA   . GLU A 1 592 ? -5.264  41.924 91.282 1.00 86.30  ? 800  GLU A HA   1 
ATOM   8476  H  HB2  . GLU A 1 592 ? -4.971  40.112 89.135 1.00 94.67  ? 800  GLU A HB2  1 
ATOM   8477  H  HB3  . GLU A 1 592 ? -4.975  39.709 90.672 1.00 94.67  ? 800  GLU A HB3  1 
ATOM   8478  H  HG2  . GLU A 1 592 ? -7.225  40.314 90.819 1.00 100.32 ? 800  GLU A HG2  1 
ATOM   8479  H  HG3  . GLU A 1 592 ? -7.218  40.700 89.278 1.00 100.32 ? 800  GLU A HG3  1 
ATOM   8480  N  N    . SER A 1 593 ? -2.801  41.475 91.486 1.00 72.85  ? 801  SER A N    1 
ATOM   8481  C  CA   . SER A 1 593 ? -1.374  41.708 91.682 1.00 73.81  ? 801  SER A CA   1 
ATOM   8482  C  C    . SER A 1 593 ? -0.518  41.057 90.603 1.00 74.85  ? 801  SER A C    1 
ATOM   8483  O  O    . SER A 1 593 ? 0.642   41.449 90.432 1.00 73.89  ? 801  SER A O    1 
ATOM   8484  C  CB   . SER A 1 593 ? -0.946  41.198 93.059 1.00 75.95  ? 801  SER A CB   1 
ATOM   8485  O  OG   . SER A 1 593 ? -1.156  39.803 93.176 1.00 77.87  ? 801  SER A OG   1 
ATOM   8486  H  H    . SER A 1 593 ? -3.183  41.048 92.127 1.00 87.43  ? 801  SER A H    1 
ATOM   8487  H  HA   . SER A 1 593 ? -1.208  42.663 91.655 1.00 88.58  ? 801  SER A HA   1 
ATOM   8488  H  HB2  . SER A 1 593 ? -0.002  41.386 93.185 1.00 91.14  ? 801  SER A HB2  1 
ATOM   8489  H  HB3  . SER A 1 593 ? -1.467  41.653 93.739 1.00 91.14  ? 801  SER A HB3  1 
ATOM   8490  H  HG   . SER A 1 593 ? -0.916  39.539 93.936 1.00 93.45  ? 801  SER A HG   1 
ATOM   8491  N  N    . THR A 1 594 ? -1.052  40.078 89.874 1.00 77.01  ? 802  THR A N    1 
ATOM   8492  C  CA   . THR A 1 594 ? -0.321  39.437 88.789 1.00 77.90  ? 802  THR A CA   1 
ATOM   8493  C  C    . THR A 1 594 ? -0.662  40.008 87.419 1.00 75.12  ? 802  THR A C    1 
ATOM   8494  O  O    . THR A 1 594 ? 0.034   39.697 86.446 1.00 73.69  ? 802  THR A O    1 
ATOM   8495  C  CB   . THR A 1 594 ? -0.594  37.927 88.785 1.00 81.37  ? 802  THR A CB   1 
ATOM   8496  O  OG1  . THR A 1 594 ? -2.007  37.691 88.728 1.00 82.77  ? 802  THR A OG1  1 
ATOM   8497  C  CG2  . THR A 1 594 ? -0.016  37.273 90.034 1.00 84.35  ? 802  THR A CG2  1 
ATOM   8498  H  H    . THR A 1 594 ? -1.845  39.766 89.992 1.00 92.41  ? 802  THR A H    1 
ATOM   8499  H  HA   . THR A 1 594 ? 0.629   39.566 88.935 1.00 93.48  ? 802  THR A HA   1 
ATOM   8500  H  HB   . THR A 1 594 ? -0.171  37.527 88.008 1.00 97.64  ? 802  THR A HB   1 
ATOM   8501  H  HG1  . THR A 1 594 ? -2.160  36.865 88.726 1.00 99.33  ? 802  THR A HG1  1 
ATOM   8502  H  HG21 . THR A 1 594 ? -0.194  36.319 90.021 1.00 101.22 ? 802  THR A HG21 1 
ATOM   8503  H  HG22 . THR A 1 594 ? 0.943   37.414 90.069 1.00 101.22 ? 802  THR A HG22 1 
ATOM   8504  H  HG23 . THR A 1 594 ? -0.421  37.658 90.827 1.00 101.22 ? 802  THR A HG23 1 
ATOM   8505  N  N    . ALA A 1 595 ? -1.701  40.834 87.318 1.00 74.43  ? 803  ALA A N    1 
ATOM   8506  C  CA   . ALA A 1 595 ? -2.126  41.352 86.024 1.00 70.67  ? 803  ALA A CA   1 
ATOM   8507  C  C    . ALA A 1 595 ? -1.036  42.211 85.396 1.00 66.81  ? 803  ALA A C    1 
ATOM   8508  O  O    . ALA A 1 595 ? -0.401  43.032 86.066 1.00 65.92  ? 803  ALA A O    1 
ATOM   8509  C  CB   . ALA A 1 595 ? -3.410  42.167 86.178 1.00 69.55  ? 803  ALA A CB   1 
ATOM   8510  H  H    . ALA A 1 595 ? -2.174  41.108 87.982 1.00 89.32  ? 803  ALA A H    1 
ATOM   8511  H  HA   . ALA A 1 595 ? -2.307  40.609 85.428 1.00 84.81  ? 803  ALA A HA   1 
ATOM   8512  H  HB1  . ALA A 1 595 ? -3.677  42.503 85.308 1.00 83.46  ? 803  ALA A HB1  1 
ATOM   8513  H  HB2  . ALA A 1 595 ? -4.105  41.596 86.540 1.00 83.46  ? 803  ALA A HB2  1 
ATOM   8514  H  HB3  . ALA A 1 595 ? -3.243  42.908 86.782 1.00 83.46  ? 803  ALA A HB3  1 
ATOM   8515  N  N    . GLU A 1 596 ? -0.825  42.017 84.097 1.00 63.31  ? 804  GLU A N    1 
ATOM   8516  C  CA   . GLU A 1 596 ? 0.110   42.815 83.312 1.00 60.86  ? 804  GLU A CA   1 
ATOM   8517  C  C    . GLU A 1 596 ? -0.576  43.654 82.247 1.00 52.17  ? 804  GLU A C    1 
ATOM   8518  O  O    . GLU A 1 596 ? -0.145  44.778 81.980 1.00 47.89  ? 804  GLU A O    1 
ATOM   8519  C  CB   . GLU A 1 596 ? 1.150   41.902 82.649 1.00 66.77  ? 804  GLU A CB   1 
ATOM   8520  C  CG   . GLU A 1 596 ? 1.945   41.059 83.641 1.00 73.83  ? 804  GLU A CG   1 
ATOM   8521  C  CD   . GLU A 1 596 ? 2.934   40.123 82.968 1.00 77.38  ? 804  GLU A CD   1 
ATOM   8522  O  OE1  . GLU A 1 596 ? 2.607   39.576 81.892 1.00 77.16  ? 804  GLU A OE1  1 
ATOM   8523  O  OE2  . GLU A 1 596 ? 4.041   39.936 83.516 1.00 79.62  ? 804  GLU A OE2  1 
ATOM   8524  H  H    . GLU A 1 596 ? -1.225  41.411 83.635 1.00 75.97  ? 804  GLU A H    1 
ATOM   8525  H  HA   . GLU A 1 596 ? 0.582   43.419 83.907 1.00 73.03  ? 804  GLU A HA   1 
ATOM   8526  H  HB2  . GLU A 1 596 ? 0.694   41.297 82.044 1.00 80.13  ? 804  GLU A HB2  1 
ATOM   8527  H  HB3  . GLU A 1 596 ? 1.778   42.451 82.155 1.00 80.13  ? 804  GLU A HB3  1 
ATOM   8528  H  HG2  . GLU A 1 596 ? 2.444   41.650 84.227 1.00 88.59  ? 804  GLU A HG2  1 
ATOM   8529  H  HG3  . GLU A 1 596 ? 1.329   40.520 84.162 1.00 88.59  ? 804  GLU A HG3  1 
ATOM   8530  N  N    . PHE A 1 597 ? -1.637  43.131 81.633 1.00 47.76  ? 805  PHE A N    1 
ATOM   8531  C  CA   . PHE A 1 597 ? -2.433  43.864 80.659 1.00 44.20  ? 805  PHE A CA   1 
ATOM   8532  C  C    . PHE A 1 597 ? -3.906  43.612 80.938 1.00 44.54  ? 805  PHE A C    1 
ATOM   8533  O  O    . PHE A 1 597 ? -4.294  42.499 81.304 1.00 44.53  ? 805  PHE A O    1 
ATOM   8534  C  CB   . PHE A 1 597 ? -2.112  43.444 79.216 1.00 41.56  ? 805  PHE A CB   1 
ATOM   8535  C  CG   . PHE A 1 597 ? -0.766  43.905 78.721 1.00 39.55  ? 805  PHE A CG   1 
ATOM   8536  C  CD1  . PHE A 1 597 ? 0.383   43.183 79.011 1.00 40.56  ? 805  PHE A CD1  1 
ATOM   8537  C  CD2  . PHE A 1 597 ? -0.654  45.049 77.946 1.00 37.84  ? 805  PHE A CD2  1 
ATOM   8538  C  CE1  . PHE A 1 597 ? 1.620   43.602 78.548 1.00 39.28  ? 805  PHE A CE1  1 
ATOM   8539  C  CE2  . PHE A 1 597 ? 0.579   45.472 77.479 1.00 37.21  ? 805  PHE A CE2  1 
ATOM   8540  C  CZ   . PHE A 1 597 ? 1.719   44.748 77.782 1.00 38.17  ? 805  PHE A CZ   1 
ATOM   8541  H  H    . PHE A 1 597 ? -1.920  42.331 81.770 1.00 57.31  ? 805  PHE A H    1 
ATOM   8542  H  HA   . PHE A 1 597 ? -2.260  44.815 80.749 1.00 53.05  ? 805  PHE A HA   1 
ATOM   8543  H  HB2  . PHE A 1 597 ? -2.129  42.475 79.163 1.00 49.88  ? 805  PHE A HB2  1 
ATOM   8544  H  HB3  . PHE A 1 597 ? -2.786  43.816 78.626 1.00 49.88  ? 805  PHE A HB3  1 
ATOM   8545  H  HD1  . PHE A 1 597 ? 0.323   42.411 79.527 1.00 48.67  ? 805  PHE A HD1  1 
ATOM   8546  H  HD2  . PHE A 1 597 ? -1.416  45.541 77.740 1.00 45.41  ? 805  PHE A HD2  1 
ATOM   8547  H  HE1  . PHE A 1 597 ? 2.384   43.112 78.753 1.00 47.13  ? 805  PHE A HE1  1 
ATOM   8548  H  HE2  . PHE A 1 597 ? 0.642   46.244 76.964 1.00 44.65  ? 805  PHE A HE2  1 
ATOM   8549  H  HZ   . PHE A 1 597 ? 2.548   45.031 77.470 1.00 45.81  ? 805  PHE A HZ   1 
ATOM   8550  N  N    . THR A 1 598 ? -4.718  44.654 80.774 1.00 41.35  ? 806  THR A N    1 
ATOM   8551  C  CA   . THR A 1 598 ? -6.167  44.542 80.824 1.00 41.31  ? 806  THR A CA   1 
ATOM   8552  C  C    . THR A 1 598 ? -6.751  45.266 79.621 1.00 39.47  ? 806  THR A C    1 
ATOM   8553  O  O    . THR A 1 598 ? -6.172  46.233 79.120 1.00 36.87  ? 806  THR A O    1 
ATOM   8554  C  CB   . THR A 1 598 ? -6.759  45.131 82.120 1.00 42.57  ? 806  THR A CB   1 
ATOM   8555  O  OG1  . THR A 1 598 ? -6.282  46.469 82.310 1.00 42.86  ? 806  THR A OG1  1 
ATOM   8556  C  CG2  . THR A 1 598 ? -6.383  44.279 83.326 1.00 42.53  ? 806  THR A CG2  1 
ATOM   8557  H  H    . THR A 1 598 ? -4.442  45.455 80.629 1.00 49.62  ? 806  THR A H    1 
ATOM   8558  H  HA   . THR A 1 598 ? -6.420  43.607 80.771 1.00 49.58  ? 806  THR A HA   1 
ATOM   8559  H  HB   . THR A 1 598 ? -7.726  45.145 82.050 1.00 51.09  ? 806  THR A HB   1 
ATOM   8560  H  HG1  . THR A 1 598 ? -6.512  46.951 81.662 1.00 51.43  ? 806  THR A HG1  1 
ATOM   8561  H  HG21 . THR A 1 598 ? -6.762  44.662 84.133 1.00 51.04  ? 806  THR A HG21 1 
ATOM   8562  H  HG22 . THR A 1 598 ? -6.725  43.378 83.214 1.00 51.04  ? 806  THR A HG22 1 
ATOM   8563  H  HG23 . THR A 1 598 ? -5.418  44.241 83.418 1.00 51.04  ? 806  THR A HG23 1 
ATOM   8564  N  N    . HIS A 1 599 ? -7.899  44.785 79.152 1.00 39.64  ? 807  HIS A N    1 
ATOM   8565  C  CA   . HIS A 1 599 ? -8.544  45.410 78.007 1.00 42.17  ? 807  HIS A CA   1 
ATOM   8566  C  C    . HIS A 1 599 ? -10.028 45.087 78.034 1.00 46.13  ? 807  HIS A C    1 
ATOM   8567  O  O    . HIS A 1 599 ? -10.460 44.100 78.636 1.00 46.30  ? 807  HIS A O    1 
ATOM   8568  C  CB   . HIS A 1 599 ? -7.915  44.956 76.685 1.00 40.80  ? 807  HIS A CB   1 
ATOM   8569  C  CG   . HIS A 1 599 ? -8.283  43.562 76.283 1.00 42.63  ? 807  HIS A CG   1 
ATOM   8570  N  ND1  . HIS A 1 599 ? -7.666  42.447 76.808 1.00 43.79  ? 807  HIS A ND1  1 
ATOM   8571  C  CD2  . HIS A 1 599 ? -9.201  43.102 75.399 1.00 42.51  ? 807  HIS A CD2  1 
ATOM   8572  C  CE1  . HIS A 1 599 ? -8.190  41.361 76.268 1.00 43.76  ? 807  HIS A CE1  1 
ATOM   8573  N  NE2  . HIS A 1 599 ? -9.123  41.731 75.410 1.00 43.85  ? 807  HIS A NE2  1 
ATOM   8574  H  H    . HIS A 1 599 ? -8.319  44.108 79.475 1.00 47.57  ? 807  HIS A H    1 
ATOM   8575  H  HA   . HIS A 1 599 ? -8.444  46.373 78.073 1.00 50.60  ? 807  HIS A HA   1 
ATOM   8576  H  HB2  . HIS A 1 599 ? -8.206  45.554 75.979 1.00 48.96  ? 807  HIS A HB2  1 
ATOM   8577  H  HB3  . HIS A 1 599 ? -6.949  44.994 76.770 1.00 48.96  ? 807  HIS A HB3  1 
ATOM   8578  H  HD2  . HIS A 1 599 ? -9.777  43.619 74.883 1.00 51.01  ? 807  HIS A HD2  1 
ATOM   8579  H  HE1  . HIS A 1 599 ? -7.944  40.485 76.460 1.00 52.51  ? 807  HIS A HE1  1 
ATOM   8580  H  HE2  . HIS A 1 599 ? -9.605  41.200 74.935 1.00 52.63  ? 807  HIS A HE2  1 
ATOM   8581  N  N    . TYR A 1 600 ? -10.804 45.941 77.371 1.00 48.66  ? 808  TYR A N    1 
ATOM   8582  C  CA   . TYR A 1 600 ? -12.250 45.796 77.341 1.00 49.86  ? 808  TYR A CA   1 
ATOM   8583  C  C    . TYR A 1 600 ? -12.806 46.644 76.208 1.00 47.39  ? 808  TYR A C    1 
ATOM   8584  O  O    . TYR A 1 600 ? -12.293 47.731 75.929 1.00 46.90  ? 808  TYR A O    1 
ATOM   8585  C  CB   . TYR A 1 600 ? -12.875 46.210 78.678 1.00 53.01  ? 808  TYR A CB   1 
ATOM   8586  C  CG   . TYR A 1 600 ? -14.380 46.100 78.706 1.00 55.73  ? 808  TYR A CG   1 
ATOM   8587  C  CD1  . TYR A 1 600 ? -15.005 44.861 78.663 1.00 57.97  ? 808  TYR A CD1  1 
ATOM   8588  C  CD2  . TYR A 1 600 ? -15.177 47.233 78.780 1.00 57.63  ? 808  TYR A CD2  1 
ATOM   8589  C  CE1  . TYR A 1 600 ? -16.381 44.755 78.690 1.00 60.24  ? 808  TYR A CE1  1 
ATOM   8590  C  CE2  . TYR A 1 600 ? -16.555 47.137 78.809 1.00 59.63  ? 808  TYR A CE2  1 
ATOM   8591  C  CZ   . TYR A 1 600 ? -17.151 45.896 78.763 1.00 61.17  ? 808  TYR A CZ   1 
ATOM   8592  O  OH   . TYR A 1 600 ? -18.522 45.795 78.791 1.00 63.24  ? 808  TYR A OH   1 
ATOM   8593  H  H    . TYR A 1 600 ? -10.511 46.617 76.928 1.00 58.39  ? 808  TYR A H    1 
ATOM   8594  H  HA   . TYR A 1 600 ? -12.478 44.869 77.170 1.00 59.83  ? 808  TYR A HA   1 
ATOM   8595  H  HB2  . TYR A 1 600 ? -12.523 45.638 79.378 1.00 63.61  ? 808  TYR A HB2  1 
ATOM   8596  H  HB3  . TYR A 1 600 ? -12.642 47.134 78.859 1.00 63.61  ? 808  TYR A HB3  1 
ATOM   8597  H  HD1  . TYR A 1 600 ? -14.487 44.090 78.613 1.00 69.57  ? 808  TYR A HD1  1 
ATOM   8598  H  HD2  . TYR A 1 600 ? -14.777 48.072 78.811 1.00 69.15  ? 808  TYR A HD2  1 
ATOM   8599  H  HE1  . TYR A 1 600 ? -16.787 43.918 78.659 1.00 72.29  ? 808  TYR A HE1  1 
ATOM   8600  H  HE2  . TYR A 1 600 ? -17.076 47.906 78.858 1.00 71.56  ? 808  TYR A HE2  1 
ATOM   8601  H  HH   . TYR A 1 600 ? -18.866 46.560 78.836 1.00 75.89  ? 808  TYR A HH   1 
ATOM   8602  N  N    . LYS A 1 601 ? -13.856 46.139 75.565 1.00 45.85  ? 809  LYS A N    1 
ATOM   8603  C  CA   . LYS A 1 601 ? -14.502 46.828 74.454 1.00 48.06  ? 809  LYS A CA   1 
ATOM   8604  C  C    . LYS A 1 601 ? -15.912 47.234 74.866 1.00 46.57  ? 809  LYS A C    1 
ATOM   8605  O  O    . LYS A 1 601 ? -16.828 46.396 74.843 1.00 45.90  ? 809  LYS A O    1 
ATOM   8606  C  CB   . LYS A 1 601 ? -14.543 45.927 73.217 1.00 52.41  ? 809  LYS A CB   1 
ATOM   8607  C  CG   . LYS A 1 601 ? -15.004 46.632 71.955 1.00 57.31  ? 809  LYS A CG   1 
ATOM   8608  C  CD   . LYS A 1 601 ? -14.856 45.737 70.737 1.00 60.91  ? 809  LYS A CD   1 
ATOM   8609  C  CE   . LYS A 1 601 ? -15.977 44.721 70.647 1.00 64.64  ? 809  LYS A CE   1 
ATOM   8610  N  NZ   . LYS A 1 601 ? -15.639 43.624 69.699 1.00 66.44  ? 809  LYS A NZ   1 
ATOM   8611  H  H    . LYS A 1 601 ? -14.219 45.384 75.759 1.00 55.02  ? 809  LYS A H    1 
ATOM   8612  H  HA   . LYS A 1 601 ? -14.002 47.630 74.235 1.00 57.68  ? 809  LYS A HA   1 
ATOM   8613  H  HB2  . LYS A 1 601 ? -13.651 45.581 73.054 1.00 62.89  ? 809  LYS A HB2  1 
ATOM   8614  H  HB3  . LYS A 1 601 ? -15.154 45.193 73.386 1.00 62.89  ? 809  LYS A HB3  1 
ATOM   8615  H  HG2  . LYS A 1 601 ? -15.940 46.872 72.045 1.00 68.77  ? 809  LYS A HG2  1 
ATOM   8616  H  HG3  . LYS A 1 601 ? -14.466 47.427 71.816 1.00 68.77  ? 809  LYS A HG3  1 
ATOM   8617  H  HD2  . LYS A 1 601 ? -14.877 46.283 69.935 1.00 73.10  ? 809  LYS A HD2  1 
ATOM   8618  H  HD3  . LYS A 1 601 ? -14.015 45.257 70.794 1.00 73.10  ? 809  LYS A HD3  1 
ATOM   8619  H  HE2  . LYS A 1 601 ? -16.126 44.331 71.523 1.00 77.57  ? 809  LYS A HE2  1 
ATOM   8620  H  HE3  . LYS A 1 601 ? -16.782 45.159 70.332 1.00 77.57  ? 809  LYS A HE3  1 
ATOM   8621  H  HZ1  . LYS A 1 601 ? -16.308 43.038 69.660 1.00 79.73  ? 809  LYS A HZ1  1 
ATOM   8622  H  HZ2  . LYS A 1 601 ? -15.499 43.957 68.886 1.00 79.73  ? 809  LYS A HZ2  1 
ATOM   8623  H  HZ3  . LYS A 1 601 ? -14.902 43.204 69.970 1.00 79.73  ? 809  LYS A HZ3  1 
ATOM   8624  N  N    . PRO A 1 602 ? -16.150 48.492 75.246 1.00 44.88  ? 810  PRO A N    1 
ATOM   8625  C  CA   . PRO A 1 602 ? -17.485 48.867 75.705 1.00 46.84  ? 810  PRO A CA   1 
ATOM   8626  C  C    . PRO A 1 602 ? -18.493 48.768 74.575 1.00 47.73  ? 810  PRO A C    1 
ATOM   8627  O  O    . PRO A 1 602 ? -18.163 49.036 73.407 1.00 45.85  ? 810  PRO A O    1 
ATOM   8628  C  CB   . PRO A 1 602 ? -17.303 50.322 76.174 1.00 46.03  ? 810  PRO A CB   1 
ATOM   8629  C  CG   . PRO A 1 602 ? -16.149 50.825 75.395 1.00 45.14  ? 810  PRO A CG   1 
ATOM   8630  C  CD   . PRO A 1 602 ? -15.233 49.645 75.217 1.00 44.15  ? 810  PRO A CD   1 
ATOM   8631  H  HA   . PRO A 1 602 ? -17.765 48.312 76.450 1.00 56.21  ? 810  PRO A HA   1 
ATOM   8632  H  HB2  . PRO A 1 602 ? -18.103 50.834 75.974 1.00 55.24  ? 810  PRO A HB2  1 
ATOM   8633  H  HB3  . PRO A 1 602 ? -17.111 50.339 77.125 1.00 55.24  ? 810  PRO A HB3  1 
ATOM   8634  H  HG2  . PRO A 1 602 ? -16.455 51.152 74.535 1.00 54.17  ? 810  PRO A HG2  1 
ATOM   8635  H  HG3  . PRO A 1 602 ? -15.704 51.530 75.891 1.00 54.17  ? 810  PRO A HG3  1 
ATOM   8636  H  HD2  . PRO A 1 602 ? -14.780 49.695 74.361 1.00 52.98  ? 810  PRO A HD2  1 
ATOM   8637  H  HD3  . PRO A 1 602 ? -14.601 49.593 75.951 1.00 52.98  ? 810  PRO A HD3  1 
ATOM   8638  N  N    . PRO A 1 603 ? -19.742 48.381 74.873 1.00 50.23  ? 811  PRO A N    1 
ATOM   8639  C  CA   . PRO A 1 603 ? -20.756 48.295 73.813 1.00 49.68  ? 811  PRO A CA   1 
ATOM   8640  C  C    . PRO A 1 603 ? -21.354 49.652 73.483 1.00 50.13  ? 811  PRO A C    1 
ATOM   8641  O  O    . PRO A 1 603 ? -22.335 50.071 74.105 1.00 52.83  ? 811  PRO A O    1 
ATOM   8642  C  CB   . PRO A 1 603 ? -21.801 47.351 74.416 1.00 50.81  ? 811  PRO A CB   1 
ATOM   8643  C  CG   . PRO A 1 603 ? -21.727 47.627 75.881 1.00 51.33  ? 811  PRO A CG   1 
ATOM   8644  C  CD   . PRO A 1 603 ? -20.282 47.965 76.181 1.00 51.03  ? 811  PRO A CD   1 
ATOM   8645  H  HA   . PRO A 1 603 ? -20.381 47.898 73.012 1.00 59.62  ? 811  PRO A HA   1 
ATOM   8646  H  HB2  . PRO A 1 603 ? -22.681 47.564 74.066 1.00 60.97  ? 811  PRO A HB2  1 
ATOM   8647  H  HB3  . PRO A 1 603 ? -21.565 46.430 74.224 1.00 60.97  ? 811  PRO A HB3  1 
ATOM   8648  H  HG2  . PRO A 1 603 ? -22.303 48.377 76.097 1.00 61.60  ? 811  PRO A HG2  1 
ATOM   8649  H  HG3  . PRO A 1 603 ? -22.000 46.837 76.373 1.00 61.60  ? 811  PRO A HG3  1 
ATOM   8650  H  HD2  . PRO A 1 603 ? -20.232 48.697 76.815 1.00 61.24  ? 811  PRO A HD2  1 
ATOM   8651  H  HD3  . PRO A 1 603 ? -19.813 47.181 76.505 1.00 61.24  ? 811  PRO A HD3  1 
ATOM   8652  N  N    . LEU A 1 604 ? -20.776 50.347 72.509 1.00 48.95  ? 812  LEU A N    1 
ATOM   8653  C  CA   . LEU A 1 604 ? -21.186 51.702 72.167 1.00 48.64  ? 812  LEU A CA   1 
ATOM   8654  C  C    . LEU A 1 604 ? -22.025 51.686 70.897 1.00 48.79  ? 812  LEU A C    1 
ATOM   8655  O  O    . LEU A 1 604 ? -21.595 51.151 69.870 1.00 47.58  ? 812  LEU A O    1 
ATOM   8656  C  CB   . LEU A 1 604 ? -19.968 52.607 71.980 1.00 46.95  ? 812  LEU A CB   1 
ATOM   8657  C  CG   . LEU A 1 604 ? -18.983 52.642 73.150 1.00 46.51  ? 812  LEU A CG   1 
ATOM   8658  C  CD1  . LEU A 1 604 ? -17.815 53.558 72.829 1.00 45.58  ? 812  LEU A CD1  1 
ATOM   8659  C  CD2  . LEU A 1 604 ? -19.676 53.080 74.434 1.00 48.74  ? 812  LEU A CD2  1 
ATOM   8660  H  H    . LEU A 1 604 ? -20.131 50.049 72.024 1.00 58.75  ? 812  LEU A H    1 
ATOM   8661  H  HA   . LEU A 1 604 ? -21.728 52.064 72.886 1.00 58.37  ? 812  LEU A HA   1 
ATOM   8662  H  HB2  . LEU A 1 604 ? -19.479 52.305 71.199 1.00 56.34  ? 812  LEU A HB2  1 
ATOM   8663  H  HB3  . LEU A 1 604 ? -20.279 53.514 71.836 1.00 56.34  ? 812  LEU A HB3  1 
ATOM   8664  H  HG   . LEU A 1 604 ? -18.631 51.749 73.291 1.00 55.82  ? 812  LEU A HG   1 
ATOM   8665  H  HD11 . LEU A 1 604 ? -17.204 53.566 73.582 1.00 54.70  ? 812  LEU A HD11 1 
ATOM   8666  H  HD12 . LEU A 1 604 ? -17.362 53.225 72.038 1.00 54.70  ? 812  LEU A HD12 1 
ATOM   8667  H  HD13 . LEU A 1 604 ? -18.152 54.453 72.666 1.00 54.70  ? 812  LEU A HD13 1 
ATOM   8668  H  HD21 . LEU A 1 604 ? -19.026 53.092 75.155 1.00 58.49  ? 812  LEU A HD21 1 
ATOM   8669  H  HD22 . LEU A 1 604 ? -20.045 53.968 74.307 1.00 58.49  ? 812  LEU A HD22 1 
ATOM   8670  H  HD23 . LEU A 1 604 ? -20.386 52.452 74.639 1.00 58.49  ? 812  LEU A HD23 1 
ATOM   8671  N  N    . ASN A 1 605 ? -23.214 52.277 70.971 1.00 51.64  ? 813  ASN A N    1 
ATOM   8672  C  CA   . ASN A 1 605 ? -24.067 52.385 69.797 1.00 52.82  ? 813  ASN A CA   1 
ATOM   8673  C  C    . ASN A 1 605 ? -23.365 53.187 68.706 1.00 48.22  ? 813  ASN A C    1 
ATOM   8674  O  O    . ASN A 1 605 ? -22.594 54.111 68.979 1.00 43.68  ? 813  ASN A O    1 
ATOM   8675  C  CB   . ASN A 1 605 ? -25.398 53.042 70.163 1.00 57.38  ? 813  ASN A CB   1 
ATOM   8676  C  CG   . ASN A 1 605 ? -26.210 52.211 71.137 1.00 62.68  ? 813  ASN A CG   1 
ATOM   8677  O  OD1  . ASN A 1 605 ? -26.266 50.986 71.031 1.00 64.23  ? 813  ASN A OD1  1 
ATOM   8678  N  ND2  . ASN A 1 605 ? -26.843 52.875 72.096 1.00 65.33  ? 813  ASN A ND2  1 
ATOM   8679  H  H    . ASN A 1 605 ? -23.547 52.622 71.685 1.00 61.97  ? 813  ASN A H    1 
ATOM   8680  H  HA   . ASN A 1 605 ? -24.250 51.497 69.451 1.00 63.38  ? 813  ASN A HA   1 
ATOM   8681  H  HB2  . ASN A 1 605 ? -25.223 53.903 70.575 1.00 68.86  ? 813  ASN A HB2  1 
ATOM   8682  H  HB3  . ASN A 1 605 ? -25.924 53.160 69.357 1.00 68.86  ? 813  ASN A HB3  1 
ATOM   8683  H  HD21 . ASN A 1 605 ? -27.317 52.449 72.674 1.00 78.39  ? 813  ASN A HD21 1 
ATOM   8684  H  HD22 . ASN A 1 605 ? -26.780 53.732 72.139 1.00 78.39  ? 813  ASN A HD22 1 
ATOM   8685  N  N    . LEU A 1 606 ? -23.641 52.823 67.461 1.00 48.86  ? 814  LEU A N    1 
ATOM   8686  C  CA   . LEU A 1 606 ? -22.995 53.404 66.298 1.00 47.76  ? 814  LEU A CA   1 
ATOM   8687  C  C    . LEU A 1 606 ? -23.965 54.283 65.519 1.00 47.42  ? 814  LEU A C    1 
ATOM   8688  O  O    . LEU A 1 606 ? -25.185 54.120 65.619 1.00 51.47  ? 814  LEU A O    1 
ATOM   8689  C  CB   . LEU A 1 606 ? -22.459 52.297 65.378 1.00 46.30  ? 814  LEU A CB   1 
ATOM   8690  C  CG   . LEU A 1 606 ? -21.529 51.285 66.046 1.00 45.95  ? 814  LEU A CG   1 
ATOM   8691  C  CD1  . LEU A 1 606 ? -21.169 50.172 65.072 1.00 44.47  ? 814  LEU A CD1  1 
ATOM   8692  C  CD2  . LEU A 1 606 ? -20.275 51.968 66.576 1.00 44.17  ? 814  LEU A CD2  1 
ATOM   8693  H  H    . LEU A 1 606 ? -24.221 52.220 67.260 1.00 58.64  ? 814  LEU A H    1 
ATOM   8694  H  HA   . LEU A 1 606 ? -22.248 53.952 66.585 1.00 57.31  ? 814  LEU A HA   1 
ATOM   8695  H  HB2  . LEU A 1 606 ? -23.214 51.806 65.017 1.00 55.56  ? 814  LEU A HB2  1 
ATOM   8696  H  HB3  . LEU A 1 606 ? -21.966 52.712 64.654 1.00 55.56  ? 814  LEU A HB3  1 
ATOM   8697  H  HG   . LEU A 1 606 ? -21.991 50.883 66.799 1.00 55.15  ? 814  LEU A HG   1 
ATOM   8698  H  HD11 . LEU A 1 606 ? -20.579 49.543 65.516 1.00 53.37  ? 814  LEU A HD11 1 
ATOM   8699  H  HD12 . LEU A 1 606 ? -21.981 49.724 64.791 1.00 53.37  ? 814  LEU A HD12 1 
ATOM   8700  H  HD13 . LEU A 1 606 ? -20.721 50.560 64.303 1.00 53.37  ? 814  LEU A HD13 1 
ATOM   8701  H  HD21 . LEU A 1 606 ? -19.706 51.303 66.993 1.00 53.00  ? 814  LEU A HD21 1 
ATOM   8702  H  HD22 . LEU A 1 606 ? -19.808 52.387 65.836 1.00 53.00  ? 814  LEU A HD22 1 
ATOM   8703  H  HD23 . LEU A 1 606 ? -20.533 52.639 67.228 1.00 53.00  ? 814  LEU A HD23 1 
ATOM   8704  N  N    . PRO A 1 607 ? -23.455 55.242 64.730 1.00 45.74  ? 815  PRO A N    1 
ATOM   8705  C  CA   . PRO A 1 607 ? -22.037 55.600 64.591 1.00 44.80  ? 815  PRO A CA   1 
ATOM   8706  C  C    . PRO A 1 607 ? -21.508 56.474 65.728 1.00 48.10  ? 815  PRO A C    1 
ATOM   8707  O  O    . PRO A 1 607 ? -22.279 57.164 66.398 1.00 51.01  ? 815  PRO A O    1 
ATOM   8708  C  CB   . PRO A 1 607 ? -22.004 56.366 63.267 1.00 42.96  ? 815  PRO A CB   1 
ATOM   8709  C  CG   . PRO A 1 607 ? -23.357 56.962 63.149 1.00 45.36  ? 815  PRO A CG   1 
ATOM   8710  C  CD   . PRO A 1 607 ? -24.299 55.966 63.763 1.00 46.74  ? 815  PRO A CD   1 
ATOM   8711  H  HA   . PRO A 1 607 ? -21.492 54.801 64.516 1.00 53.77  ? 815  PRO A HA   1 
ATOM   8712  H  HB2  . PRO A 1 607 ? -21.324 57.057 63.305 1.00 51.55  ? 815  PRO A HB2  1 
ATOM   8713  H  HB3  . PRO A 1 607 ? -21.832 55.752 62.536 1.00 51.55  ? 815  PRO A HB3  1 
ATOM   8714  H  HG2  . PRO A 1 607 ? -23.385 57.802 63.634 1.00 54.44  ? 815  PRO A HG2  1 
ATOM   8715  H  HG3  . PRO A 1 607 ? -23.570 57.101 62.213 1.00 54.44  ? 815  PRO A HG3  1 
ATOM   8716  H  HD2  . PRO A 1 607 ? -25.022 56.423 64.221 1.00 56.10  ? 815  PRO A HD2  1 
ATOM   8717  H  HD3  . PRO A 1 607 ? -24.635 55.358 63.086 1.00 56.10  ? 815  PRO A HD3  1 
ATOM   8718  N  N    . LEU A 1 608 ? -20.193 56.437 65.935 1.00 47.99  ? 816  LEU A N    1 
ATOM   8719  C  CA   . LEU A 1 608 ? -19.553 57.289 66.926 1.00 46.38  ? 816  LEU A CA   1 
ATOM   8720  C  C    . LEU A 1 608 ? -19.397 58.701 66.378 1.00 44.36  ? 816  LEU A C    1 
ATOM   8721  O  O    . LEU A 1 608 ? -19.089 58.893 65.199 1.00 43.09  ? 816  LEU A O    1 
ATOM   8722  C  CB   . LEU A 1 608 ? -18.182 56.730 67.308 1.00 43.86  ? 816  LEU A CB   1 
ATOM   8723  C  CG   . LEU A 1 608 ? -18.140 55.281 67.797 1.00 42.65  ? 816  LEU A CG   1 
ATOM   8724  C  CD1  . LEU A 1 608 ? -16.697 54.830 67.968 1.00 42.95  ? 816  LEU A CD1  1 
ATOM   8725  C  CD2  . LEU A 1 608 ? -18.908 55.117 69.098 1.00 42.75  ? 816  LEU A CD2  1 
ATOM   8726  H  H    . LEU A 1 608 ? -19.650 55.924 65.510 1.00 57.59  ? 816  LEU A H    1 
ATOM   8727  H  HA   . LEU A 1 608 ? -20.103 57.328 67.724 1.00 55.66  ? 816  LEU A HA   1 
ATOM   8728  H  HB2  . LEU A 1 608 ? -17.605 56.786 66.529 1.00 52.63  ? 816  LEU A HB2  1 
ATOM   8729  H  HB3  . LEU A 1 608 ? -17.817 57.283 68.016 1.00 52.63  ? 816  LEU A HB3  1 
ATOM   8730  H  HG   . LEU A 1 608 ? -18.555 54.711 67.131 1.00 51.18  ? 816  LEU A HG   1 
ATOM   8731  H  HD11 . LEU A 1 608 ? -16.689 53.911 68.278 1.00 51.54  ? 816  LEU A HD11 1 
ATOM   8732  H  HD12 . LEU A 1 608 ? -16.243 54.895 67.113 1.00 51.54  ? 816  LEU A HD12 1 
ATOM   8733  H  HD13 . LEU A 1 608 ? -16.262 55.403 68.619 1.00 51.54  ? 816  LEU A HD13 1 
ATOM   8734  H  HD21 . LEU A 1 608 ? -18.860 54.190 69.378 1.00 51.30  ? 816  LEU A HD21 1 
ATOM   8735  H  HD22 . LEU A 1 608 ? -18.510 55.688 69.773 1.00 51.30  ? 816  LEU A HD22 1 
ATOM   8736  H  HD23 . LEU A 1 608 ? -19.833 55.372 68.952 1.00 51.30  ? 816  LEU A HD23 1 
ATOM   8737  N  N    . ARG A 1 609 ? -19.612 59.688 67.240 1.00 45.68  ? 817  ARG A N    1 
ATOM   8738  C  CA   . ARG A 1 609 ? -19.456 61.075 66.828 1.00 46.35  ? 817  ARG A CA   1 
ATOM   8739  C  C    . ARG A 1 609 ? -18.000 61.331 66.441 1.00 44.21  ? 817  ARG A C    1 
ATOM   8740  O  O    . ARG A 1 609 ? -17.093 60.993 67.214 1.00 42.50  ? 817  ARG A O    1 
ATOM   8741  C  CB   . ARG A 1 609 ? -19.883 62.020 67.950 1.00 48.77  ? 817  ARG A CB   1 
ATOM   8742  C  CG   . ARG A 1 609 ? -19.741 63.496 67.602 1.00 50.71  ? 817  ARG A CG   1 
ATOM   8743  C  CD   . ARG A 1 609 ? -20.509 64.391 68.567 1.00 54.62  ? 817  ARG A CD   1 
ATOM   8744  N  NE   . ARG A 1 609 ? -21.947 64.400 68.288 1.00 56.89  ? 817  ARG A NE   1 
ATOM   8745  C  CZ   . ARG A 1 609 ? -22.886 63.863 69.065 1.00 58.67  ? 817  ARG A CZ   1 
ATOM   8746  N  NH1  . ARG A 1 609 ? -22.574 63.264 70.208 1.00 58.24  ? 817  ARG A NH1  1 
ATOM   8747  N  NH2  . ARG A 1 609 ? -24.159 63.937 68.697 1.00 60.02  ? 817  ARG A NH2  1 
ATOM   8748  H  H    . ARG A 1 609 ? -19.846 59.583 68.060 1.00 54.82  ? 817  ARG A H    1 
ATOM   8749  H  HA   . ARG A 1 609 ? -20.015 61.247 66.053 1.00 55.62  ? 817  ARG A HA   1 
ATOM   8750  H  HB2  . ARG A 1 609 ? -20.815 61.854 68.161 1.00 58.52  ? 817  ARG A HB2  1 
ATOM   8751  H  HB3  . ARG A 1 609 ? -19.334 61.846 68.731 1.00 58.52  ? 817  ARG A HB3  1 
ATOM   8752  H  HG2  . ARG A 1 609 ? -18.804 63.743 67.641 1.00 60.85  ? 817  ARG A HG2  1 
ATOM   8753  H  HG3  . ARG A 1 609 ? -20.089 63.647 66.709 1.00 60.85  ? 817  ARG A HG3  1 
ATOM   8754  H  HD2  . ARG A 1 609 ? -20.380 64.067 69.472 1.00 65.54  ? 817  ARG A HD2  1 
ATOM   8755  H  HD3  . ARG A 1 609 ? -20.181 65.300 68.488 1.00 65.54  ? 817  ARG A HD3  1 
ATOM   8756  H  HE   . ARG A 1 609 ? -22.206 64.782 67.562 1.00 68.28  ? 817  ARG A HE   1 
ATOM   8757  H  HH11 . ARG A 1 609 ? -21.752 63.211 70.456 1.00 69.89  ? 817  ARG A HH11 1 
ATOM   8758  H  HH12 . ARG A 1 609 ? -23.193 62.924 70.699 1.00 69.89  ? 817  ARG A HH12 1 
ATOM   8759  H  HH21 . ARG A 1 609 ? -24.371 64.325 67.959 1.00 72.03  ? 817  ARG A HH21 1 
ATOM   8760  H  HH22 . ARG A 1 609 ? -24.771 63.595 69.195 1.00 72.03  ? 817  ARG A HH22 1 
ATOM   8761  N  N    . PRO A 1 610 ? -17.729 61.907 65.270 1.00 44.51  ? 818  PRO A N    1 
ATOM   8762  C  CA   . PRO A 1 610 ? -16.332 62.114 64.873 1.00 43.39  ? 818  PRO A CA   1 
ATOM   8763  C  C    . PRO A 1 610 ? -15.676 63.201 65.706 1.00 40.64  ? 818  PRO A C    1 
ATOM   8764  O  O    . PRO A 1 610 ? -16.334 64.112 66.214 1.00 40.19  ? 818  PRO A O    1 
ATOM   8765  C  CB   . PRO A 1 610 ? -16.430 62.529 63.398 1.00 45.22  ? 818  PRO A CB   1 
ATOM   8766  C  CG   . PRO A 1 610 ? -17.845 62.261 62.989 1.00 46.59  ? 818  PRO A CG   1 
ATOM   8767  C  CD   . PRO A 1 610 ? -18.655 62.393 64.234 1.00 46.50  ? 818  PRO A CD   1 
ATOM   8768  H  HA   . PRO A 1 610 ? -15.827 61.290 64.950 1.00 52.07  ? 818  PRO A HA   1 
ATOM   8769  H  HB2  . PRO A 1 610 ? -16.223 63.473 63.311 1.00 54.27  ? 818  PRO A HB2  1 
ATOM   8770  H  HB3  . PRO A 1 610 ? -15.816 61.995 62.869 1.00 54.27  ? 818  PRO A HB3  1 
ATOM   8771  H  HG2  . PRO A 1 610 ? -18.123 62.916 62.330 1.00 55.91  ? 818  PRO A HG2  1 
ATOM   8772  H  HG3  . PRO A 1 610 ? -17.915 61.363 62.630 1.00 55.91  ? 818  PRO A HG3  1 
ATOM   8773  H  HD2  . PRO A 1 610 ? -18.887 63.321 64.393 1.00 55.81  ? 818  PRO A HD2  1 
ATOM   8774  H  HD3  . PRO A 1 610 ? -19.443 61.829 64.189 1.00 55.81  ? 818  PRO A HD3  1 
ATOM   8775  N  N    . GLY A 1 611 ? -14.356 63.095 65.840 1.00 40.40  ? 819  GLY A N    1 
ATOM   8776  C  CA   . GLY A 1 611 ? -13.558 64.041 66.585 1.00 41.23  ? 819  GLY A CA   1 
ATOM   8777  C  C    . GLY A 1 611 ? -12.622 63.328 67.531 1.00 40.34  ? 819  GLY A C    1 
ATOM   8778  O  O    . GLY A 1 611 ? -12.423 62.111 67.456 1.00 39.80  ? 819  GLY A O    1 
ATOM   8779  H  H    . GLY A 1 611 ? -13.893 62.458 65.494 1.00 48.49  ? 819  GLY A H    1 
ATOM   8780  H  HA2  . GLY A 1 611 ? -13.034 64.581 65.974 1.00 49.48  ? 819  GLY A HA2  1 
ATOM   8781  H  HA3  . GLY A 1 611 ? -14.137 64.624 67.100 1.00 49.48  ? 819  GLY A HA3  1 
ATOM   8782  N  N    . VAL A 1 612 ? -12.036 64.098 68.440 1.00 39.14  ? 820  VAL A N    1 
ATOM   8783  C  CA   . VAL A 1 612 ? -11.072 63.576 69.402 1.00 41.87  ? 820  VAL A CA   1 
ATOM   8784  C  C    . VAL A 1 612 ? -11.821 63.128 70.651 1.00 41.66  ? 820  VAL A C    1 
ATOM   8785  O  O    . VAL A 1 612 ? -12.443 63.945 71.341 1.00 41.27  ? 820  VAL A O    1 
ATOM   8786  C  CB   . VAL A 1 612 ? -10.006 64.629 69.744 1.00 43.02  ? 820  VAL A CB   1 
ATOM   8787  C  CG1  . VAL A 1 612 ? -9.023  64.087 70.781 1.00 41.78  ? 820  VAL A CG1  1 
ATOM   8788  C  CG2  . VAL A 1 612 ? -9.268  65.061 68.485 1.00 41.43  ? 820  VAL A CG2  1 
ATOM   8789  H  H    . VAL A 1 612 ? -12.183 64.941 68.522 1.00 46.97  ? 820  VAL A H    1 
ATOM   8790  H  HA   . VAL A 1 612 ? -10.626 62.804 69.021 1.00 50.25  ? 820  VAL A HA   1 
ATOM   8791  H  HB   . VAL A 1 612 ? -10.441 65.410 70.121 1.00 51.63  ? 820  VAL A HB   1 
ATOM   8792  H  HG11 . VAL A 1 612 ? -8.363  64.771 70.977 1.00 50.14  ? 820  VAL A HG11 1 
ATOM   8793  H  HG12 . VAL A 1 612 ? -9.510  63.856 71.587 1.00 50.14  ? 820  VAL A HG12 1 
ATOM   8794  H  HG13 . VAL A 1 612 ? -8.586  63.300 70.420 1.00 50.14  ? 820  VAL A HG13 1 
ATOM   8795  H  HG21 . VAL A 1 612 ? -8.601  65.724 68.722 1.00 49.72  ? 820  VAL A HG21 1 
ATOM   8796  H  HG22 . VAL A 1 612 ? -8.838  64.286 68.089 1.00 49.72  ? 820  VAL A HG22 1 
ATOM   8797  H  HG23 . VAL A 1 612 ? -9.905  65.441 67.860 1.00 49.72  ? 820  VAL A HG23 1 
ATOM   8798  N  N    . TRP A 1 613 ? -11.768 61.830 70.930 1.00 38.35  ? 821  TRP A N    1 
ATOM   8799  C  CA   . TRP A 1 613 ? -12.295 61.244 72.154 1.00 38.79  ? 821  TRP A CA   1 
ATOM   8800  C  C    . TRP A 1 613 ? -11.222 61.231 73.240 1.00 39.32  ? 821  TRP A C    1 
ATOM   8801  O  O    . TRP A 1 613 ? -10.024 61.318 72.964 1.00 38.89  ? 821  TRP A O    1 
ATOM   8802  C  CB   . TRP A 1 613 ? -12.777 59.814 71.900 1.00 38.20  ? 821  TRP A CB   1 
ATOM   8803  C  CG   . TRP A 1 613 ? -14.063 59.703 71.138 1.00 38.49  ? 821  TRP A CG   1 
ATOM   8804  C  CD1  . TRP A 1 613 ? -14.319 60.170 69.881 1.00 38.66  ? 821  TRP A CD1  1 
ATOM   8805  C  CD2  . TRP A 1 613 ? -15.264 59.057 71.578 1.00 40.15  ? 821  TRP A CD2  1 
ATOM   8806  N  NE1  . TRP A 1 613 ? -15.610 59.865 69.516 1.00 39.39  ? 821  TRP A NE1  1 
ATOM   8807  C  CE2  . TRP A 1 613 ? -16.211 59.182 70.542 1.00 40.17  ? 821  TRP A CE2  1 
ATOM   8808  C  CE3  . TRP A 1 613 ? -15.632 58.391 72.752 1.00 41.39  ? 821  TRP A CE3  1 
ATOM   8809  C  CZ2  . TRP A 1 613 ? -17.501 58.664 70.643 1.00 41.08  ? 821  TRP A CZ2  1 
ATOM   8810  C  CZ3  . TRP A 1 613 ? -16.915 57.879 72.851 1.00 41.97  ? 821  TRP A CZ3  1 
ATOM   8811  C  CH2  . TRP A 1 613 ? -17.833 58.019 71.803 1.00 41.60  ? 821  TRP A CH2  1 
ATOM   8812  H  H    . TRP A 1 613 ? -11.416 61.248 70.404 1.00 46.02  ? 821  TRP A H    1 
ATOM   8813  H  HA   . TRP A 1 613 ? -13.046 61.771 72.468 1.00 46.55  ? 821  TRP A HA   1 
ATOM   8814  H  HB2  . TRP A 1 613 ? -12.096 59.344 71.394 1.00 45.84  ? 821  TRP A HB2  1 
ATOM   8815  H  HB3  . TRP A 1 613 ? -12.906 59.376 72.756 1.00 45.84  ? 821  TRP A HB3  1 
ATOM   8816  H  HD1  . TRP A 1 613 ? -13.711 60.631 69.351 1.00 46.40  ? 821  TRP A HD1  1 
ATOM   8817  H  HE1  . TRP A 1 613 ? -15.980 60.069 68.767 1.00 47.28  ? 821  TRP A HE1  1 
ATOM   8818  H  HE3  . TRP A 1 613 ? -15.028 58.295 73.452 1.00 49.68  ? 821  TRP A HE3  1 
ATOM   8819  H  HZ2  . TRP A 1 613 ? -18.114 58.756 69.950 1.00 49.29  ? 821  TRP A HZ2  1 
ATOM   8820  H  HZ3  . TRP A 1 613 ? -17.171 57.435 73.626 1.00 50.37  ? 821  TRP A HZ3  1 
ATOM   8821  H  HH2  . TRP A 1 613 ? -18.687 57.665 71.898 1.00 49.92  ? 821  TRP A HH2  1 
ATOM   8822  N  N    . THR A 1 614 ? -11.669 61.096 74.489 1.00 40.76  ? 822  THR A N    1 
ATOM   8823  C  CA   . THR A 1 614 ? -10.774 61.006 75.635 1.00 42.70  ? 822  THR A CA   1 
ATOM   8824  C  C    . THR A 1 614 ? -11.174 59.827 76.512 1.00 44.39  ? 822  THR A C    1 
ATOM   8825  O  O    . THR A 1 614 ? -12.364 59.548 76.688 1.00 44.52  ? 822  THR A O    1 
ATOM   8826  C  CB   . THR A 1 614 ? -10.794 62.300 76.463 1.00 45.19  ? 822  THR A CB   1 
ATOM   8827  O  OG1  . THR A 1 614 ? -10.494 63.416 75.616 1.00 45.50  ? 822  THR A OG1  1 
ATOM   8828  C  CG2  . THR A 1 614 ? -9.769  62.239 77.589 1.00 45.47  ? 822  THR A CG2  1 
ATOM   8829  H  H    . THR A 1 614 ? -12.502 61.054 74.699 1.00 48.91  ? 822  THR A H    1 
ATOM   8830  H  HA   . THR A 1 614 ? -9.867  60.859 75.322 1.00 51.25  ? 822  THR A HA   1 
ATOM   8831  H  HB   . THR A 1 614 ? -11.673 62.419 76.855 1.00 54.23  ? 822  THR A HB   1 
ATOM   8832  H  HG1  . THR A 1 614 ? -10.503 64.127 76.063 1.00 54.60  ? 822  THR A HG1  1 
ATOM   8833  H  HG21 . THR A 1 614 ? -9.792  63.061 78.103 1.00 54.56  ? 822  THR A HG21 1 
ATOM   8834  H  HG22 . THR A 1 614 ? -9.967  61.494 78.177 1.00 54.56  ? 822  THR A HG22 1 
ATOM   8835  H  HG23 . THR A 1 614 ? -8.879  62.123 77.221 1.00 54.56  ? 822  THR A HG23 1 
ATOM   8836  N  N    . VAL A 1 615 ? -10.174 59.134 77.052 1.00 44.96  ? 823  VAL A N    1 
ATOM   8837  C  CA   . VAL A 1 615 ? -10.380 58.036 77.992 1.00 44.24  ? 823  VAL A CA   1 
ATOM   8838  C  C    . VAL A 1 615 ? -9.623  58.373 79.268 1.00 43.99  ? 823  VAL A C    1 
ATOM   8839  O  O    . VAL A 1 615 ? -8.412  58.627 79.228 1.00 43.65  ? 823  VAL A O    1 
ATOM   8840  C  CB   . VAL A 1 615 ? -9.916  56.688 77.416 1.00 42.38  ? 823  VAL A CB   1 
ATOM   8841  C  CG1  . VAL A 1 615 ? -10.073 55.576 78.451 1.00 42.26  ? 823  VAL A CG1  1 
ATOM   8842  C  CG2  . VAL A 1 615 ? -10.700 56.351 76.154 1.00 41.15  ? 823  VAL A CG2  1 
ATOM   8843  H  H    . VAL A 1 615 ? -9.345  59.287 76.885 1.00 53.96  ? 823  VAL A H    1 
ATOM   8844  H  HA   . VAL A 1 615 ? -11.324 57.968 78.206 1.00 53.09  ? 823  VAL A HA   1 
ATOM   8845  H  HB   . VAL A 1 615 ? -8.977  56.749 77.180 1.00 50.86  ? 823  VAL A HB   1 
ATOM   8846  H  HG11 . VAL A 1 615 ? -9.774  54.739 78.063 1.00 50.71  ? 823  VAL A HG11 1 
ATOM   8847  H  HG12 . VAL A 1 615 ? -9.536  55.791 79.229 1.00 50.71  ? 823  VAL A HG12 1 
ATOM   8848  H  HG13 . VAL A 1 615 ? -11.008 55.509 78.703 1.00 50.71  ? 823  VAL A HG13 1 
ATOM   8849  H  HG21 . VAL A 1 615 ? -10.391 55.499 75.808 1.00 49.39  ? 823  VAL A HG21 1 
ATOM   8850  H  HG22 . VAL A 1 615 ? -11.643 56.297 76.373 1.00 49.39  ? 823  VAL A HG22 1 
ATOM   8851  H  HG23 . VAL A 1 615 ? -10.553 57.048 75.495 1.00 49.39  ? 823  VAL A HG23 1 
ATOM   8852  N  N    . LYS A 1 616 ? -10.332 58.365 80.393 1.00 43.18  ? 824  LYS A N    1 
ATOM   8853  C  CA   . LYS A 1 616 ? -9.771  58.738 81.681 1.00 45.08  ? 824  LYS A CA   1 
ATOM   8854  C  C    . LYS A 1 616 ? -9.809  57.557 82.641 1.00 45.05  ? 824  LYS A C    1 
ATOM   8855  O  O    . LYS A 1 616 ? -10.739 56.748 82.626 1.00 46.28  ? 824  LYS A O    1 
ATOM   8856  C  CB   . LYS A 1 616 ? -10.532 59.927 82.287 1.00 49.23  ? 824  LYS A CB   1 
ATOM   8857  C  CG   . LYS A 1 616 ? -10.076 61.272 81.749 1.00 52.08  ? 824  LYS A CG   1 
ATOM   8858  C  CD   . LYS A 1 616 ? -11.095 62.365 82.005 1.00 56.59  ? 824  LYS A CD   1 
ATOM   8859  C  CE   . LYS A 1 616 ? -10.575 63.710 81.523 1.00 57.55  ? 824  LYS A CE   1 
ATOM   8860  N  NZ   . LYS A 1 616 ? -11.322 64.849 82.114 1.00 60.73  ? 824  LYS A NZ   1 
ATOM   8861  H  H    . LYS A 1 616 ? -11.161 58.141 80.434 1.00 51.82  ? 824  LYS A H    1 
ATOM   8862  H  HA   . LYS A 1 616 ? -8.845  59.001 81.562 1.00 54.10  ? 824  LYS A HA   1 
ATOM   8863  H  HB2  . LYS A 1 616 ? -11.476 59.830 82.087 1.00 59.08  ? 824  LYS A HB2  1 
ATOM   8864  H  HB3  . LYS A 1 616 ? -10.397 59.929 83.248 1.00 59.08  ? 824  LYS A HB3  1 
ATOM   8865  H  HG2  . LYS A 1 616 ? -9.247  61.524 82.184 1.00 62.50  ? 824  LYS A HG2  1 
ATOM   8866  H  HG3  . LYS A 1 616 ? -9.942  61.202 80.791 1.00 62.50  ? 824  LYS A HG3  1 
ATOM   8867  H  HD2  . LYS A 1 616 ? -11.913 62.163 81.524 1.00 67.91  ? 824  LYS A HD2  1 
ATOM   8868  H  HD3  . LYS A 1 616 ? -11.269 62.427 82.957 1.00 67.91  ? 824  LYS A HD3  1 
ATOM   8869  H  HE2  . LYS A 1 616 ? -9.643  63.798 81.776 1.00 69.07  ? 824  LYS A HE2  1 
ATOM   8870  H  HE3  . LYS A 1 616 ? -10.665 63.758 80.559 1.00 69.07  ? 824  LYS A HE3  1 
ATOM   8871  H  HZ1  . LYS A 1 616 ? -10.992 65.618 81.811 1.00 72.88  ? 824  LYS A HZ1  1 
ATOM   8872  H  HZ2  . LYS A 1 616 ? -12.182 64.796 81.892 1.00 72.88  ? 824  LYS A HZ2  1 
ATOM   8873  H  HZ3  . LYS A 1 616 ? -11.250 64.832 83.001 1.00 72.88  ? 824  LYS A HZ3  1 
ATOM   8874  N  N    . ILE A 1 617 ? -8.783  57.482 83.480 1.00 41.52  ? 825  ILE A N    1 
ATOM   8875  C  CA   . ILE A 1 617 ? -8.675  56.479 84.532 1.00 41.59  ? 825  ILE A CA   1 
ATOM   8876  C  C    . ILE A 1 617 ? -8.569  57.201 85.864 1.00 41.56  ? 825  ILE A C    1 
ATOM   8877  O  O    . ILE A 1 617 ? -7.725  58.089 86.028 1.00 40.14  ? 825  ILE A O    1 
ATOM   8878  C  CB   . ILE A 1 617 ? -7.463  55.552 84.336 1.00 41.15  ? 825  ILE A CB   1 
ATOM   8879  C  CG1  . ILE A 1 617 ? -7.560  54.795 83.011 1.00 41.40  ? 825  ILE A CG1  1 
ATOM   8880  C  CG2  . ILE A 1 617 ? -7.366  54.562 85.496 1.00 40.35  ? 825  ILE A CG2  1 
ATOM   8881  C  CD1  . ILE A 1 617 ? -6.312  53.998 82.709 1.00 41.81  ? 825  ILE A CD1  1 
ATOM   8882  H  H    . ILE A 1 617 ? -8.113  58.020 83.458 1.00 49.83  ? 825  ILE A H    1 
ATOM   8883  H  HA   . ILE A 1 617 ? -9.478  55.935 84.541 1.00 49.91  ? 825  ILE A HA   1 
ATOM   8884  H  HB   . ILE A 1 617 ? -6.659  56.094 84.324 1.00 49.39  ? 825  ILE A HB   1 
ATOM   8885  H  HG12 . ILE A 1 617 ? -8.308  54.179 83.052 1.00 49.68  ? 825  ILE A HG12 1 
ATOM   8886  H  HG13 . ILE A 1 617 ? -7.692  55.431 82.291 1.00 49.68  ? 825  ILE A HG13 1 
ATOM   8887  H  HG21 . ILE A 1 617 ? -6.598  53.987 85.356 1.00 48.43  ? 825  ILE A HG21 1 
ATOM   8888  H  HG22 . ILE A 1 617 ? -7.263  55.057 86.324 1.00 48.43  ? 825  ILE A HG22 1 
ATOM   8889  H  HG23 . ILE A 1 617 ? -8.177  54.031 85.526 1.00 48.43  ? 825  ILE A HG23 1 
ATOM   8890  H  HD11 . ILE A 1 617 ? -6.428  53.540 81.861 1.00 50.17  ? 825  ILE A HD11 1 
ATOM   8891  H  HD12 . ILE A 1 617 ? -5.556  54.603 82.658 1.00 50.17  ? 825  ILE A HD12 1 
ATOM   8892  H  HD13 . ILE A 1 617 ? -6.172  53.351 83.418 1.00 50.17  ? 825  ILE A HD13 1 
ATOM   8893  N  N    . LEU A 1 618 ? -9.397  56.796 86.822 1.00 45.70  ? 826  LEU A N    1 
ATOM   8894  C  CA   . LEU A 1 618 ? -9.404  57.395 88.144 1.00 50.07  ? 826  LEU A CA   1 
ATOM   8895  C  C    . LEU A 1 618 ? -9.253  56.328 89.208 1.00 53.36  ? 826  LEU A C    1 
ATOM   8896  O  O    . LEU A 1 618 ? -9.572  55.156 89.006 1.00 51.35  ? 826  LEU A O    1 
ATOM   8897  C  CB   . LEU A 1 618 ? -10.684 58.154 88.434 1.00 53.01  ? 826  LEU A CB   1 
ATOM   8898  C  CG   . LEU A 1 618 ? -11.227 58.997 87.296 1.00 55.06  ? 826  LEU A CG   1 
ATOM   8899  C  CD1  . LEU A 1 618 ? -12.666 59.224 87.596 1.00 58.31  ? 826  LEU A CD1  1 
ATOM   8900  C  CD2  . LEU A 1 618 ? -10.477 60.295 87.217 1.00 55.43  ? 826  LEU A CD2  1 
ATOM   8901  H  H    . LEU A 1 618 ? -9.973  56.164 86.725 1.00 54.85  ? 826  LEU A H    1 
ATOM   8902  H  HA   . LEU A 1 618 ? -8.659  58.012 88.221 1.00 60.09  ? 826  LEU A HA   1 
ATOM   8903  H  HB2  . LEU A 1 618 ? -11.372 57.513 88.673 1.00 63.61  ? 826  LEU A HB2  1 
ATOM   8904  H  HB3  . LEU A 1 618 ? -10.524 58.749 89.184 1.00 63.61  ? 826  LEU A HB3  1 
ATOM   8905  H  HG   . LEU A 1 618 ? -11.143 58.523 86.454 1.00 66.07  ? 826  LEU A HG   1 
ATOM   8906  H  HD11 . LEU A 1 618 ? -13.054 59.762 86.888 1.00 69.97  ? 826  LEU A HD11 1 
ATOM   8907  H  HD12 . LEU A 1 618 ? -13.116 58.366 87.645 1.00 69.97  ? 826  LEU A HD12 1 
ATOM   8908  H  HD13 . LEU A 1 618 ? -12.742 59.687 88.444 1.00 69.97  ? 826  LEU A HD13 1 
ATOM   8909  H  HD21 . LEU A 1 618 ? -10.835 60.822 86.486 1.00 66.52  ? 826  LEU A HD21 1 
ATOM   8910  H  HD22 . LEU A 1 618 ? -10.586 60.773 88.054 1.00 66.52  ? 826  LEU A HD22 1 
ATOM   8911  H  HD23 . LEU A 1 618 ? -9.538  60.108 87.062 1.00 66.52  ? 826  LEU A HD23 1 
ATOM   8912  N  N    . HIS A 1 619 ? -8.805  56.776 90.369 1.00 61.92  ? 827  HIS A N    1 
ATOM   8913  C  CA   . HIS A 1 619 ? -8.729  55.935 91.555 1.00 71.30  ? 827  HIS A CA   1 
ATOM   8914  C  C    . HIS A 1 619 ? -9.525  56.624 92.657 1.00 74.12  ? 827  HIS A C    1 
ATOM   8915  O  O    . HIS A 1 619 ? -9.053  57.588 93.265 1.00 71.72  ? 827  HIS A O    1 
ATOM   8916  C  CB   . HIS A 1 619 ? -7.282  55.704 91.961 1.00 77.58  ? 827  HIS A CB   1 
ATOM   8917  C  CG   . HIS A 1 619 ? -7.104  54.550 92.895 1.00 83.43  ? 827  HIS A CG   1 
ATOM   8918  N  ND1  . HIS A 1 619 ? -8.112  53.652 93.158 1.00 85.36  ? 827  HIS A ND1  1 
ATOM   8919  C  CD2  . HIS A 1 619 ? -6.041  54.149 93.631 1.00 85.37  ? 827  HIS A CD2  1 
ATOM   8920  C  CE1  . HIS A 1 619 ? -7.681  52.747 94.016 1.00 86.51  ? 827  HIS A CE1  1 
ATOM   8921  N  NE2  . HIS A 1 619 ? -6.427  53.026 94.321 1.00 86.16  ? 827  HIS A NE2  1 
ATOM   8922  H  H    . HIS A 1 619 ? -8.532  57.581 90.500 1.00 74.30  ? 827  HIS A H    1 
ATOM   8923  H  HA   . HIS A 1 619 ? -9.138  55.076 91.371 1.00 85.56  ? 827  HIS A HA   1 
ATOM   8924  H  HB2  . HIS A 1 619 ? -6.758  55.525 91.164 1.00 93.10  ? 827  HIS A HB2  1 
ATOM   8925  H  HB3  . HIS A 1 619 ? -6.949  56.500 92.403 1.00 93.10  ? 827  HIS A HB3  1 
ATOM   8926  H  HD2  . HIS A 1 619 ? -5.208  54.559 93.666 1.00 102.45 ? 827  HIS A HD2  1 
ATOM   8927  H  HE1  . HIS A 1 619 ? -8.176  52.033 94.349 1.00 103.81 ? 827  HIS A HE1  1 
ATOM   8928  H  HE2  . HIS A 1 619 ? -5.932  52.575 94.860 1.00 103.40 ? 827  HIS A HE2  1 
ATOM   8929  N  N    . HIS A 1 620 ? -10.731 56.132 92.921 1.00 78.57  ? 828  HIS A N    1 
ATOM   8930  C  CA   . HIS A 1 620 ? -11.610 56.739 93.920 1.00 84.43  ? 828  HIS A CA   1 
ATOM   8931  C  C    . HIS A 1 620 ? -11.676 58.258 93.737 1.00 86.05  ? 828  HIS A C    1 
ATOM   8932  O  O    . HIS A 1 620 ? -11.447 59.040 94.660 1.00 88.77  ? 828  HIS A O    1 
ATOM   8933  C  CB   . HIS A 1 620 ? -11.156 56.361 95.332 1.00 90.08  ? 828  HIS A CB   1 
ATOM   8934  C  CG   . HIS A 1 620 ? -11.242 54.890 95.627 1.00 95.17  ? 828  HIS A CG   1 
ATOM   8935  N  ND1  . HIS A 1 620 ? -12.439 54.211 95.702 1.00 97.24  ? 828  HIS A ND1  1 
ATOM   8936  C  CD2  . HIS A 1 620 ? -10.277 53.973 95.879 1.00 96.35  ? 828  HIS A CD2  1 
ATOM   8937  C  CE1  . HIS A 1 620 ? -12.207 52.940 95.981 1.00 97.72  ? 828  HIS A CE1  1 
ATOM   8938  N  NE2  . HIS A 1 620 ? -10.903 52.769 96.092 1.00 96.77  ? 828  HIS A NE2  1 
ATOM   8939  H  H    . HIS A 1 620 ? -11.068 55.442 92.532 1.00 94.29  ? 828  HIS A H    1 
ATOM   8940  H  HA   . HIS A 1 620 ? -12.506 56.389 93.797 1.00 101.32 ? 828  HIS A HA   1 
ATOM   8941  H  HB2  . HIS A 1 620 ? -10.232 56.632 95.447 1.00 108.10 ? 828  HIS A HB2  1 
ATOM   8942  H  HB3  . HIS A 1 620 ? -11.717 56.824 95.974 1.00 108.10 ? 828  HIS A HB3  1 
ATOM   8943  H  HD2  . HIS A 1 620 ? -9.360  54.130 95.900 1.00 115.62 ? 828  HIS A HD2  1 
ATOM   8944  H  HE1  . HIS A 1 620 ? -12.853 52.278 96.080 1.00 117.26 ? 828  HIS A HE1  1 
ATOM   8945  H  HE2  . HIS A 1 620 ? -10.509 52.025 96.270 1.00 116.13 ? 828  HIS A HE2  1 
ATOM   8946  N  N    . TRP A 1 621 ? -12.018 58.665 92.519 1.00 85.13  ? 829  TRP A N    1 
ATOM   8947  C  CA   . TRP A 1 621 ? -12.141 60.036 92.020 1.00 89.10  ? 829  TRP A CA   1 
ATOM   8948  C  C    . TRP A 1 621 ? -10.819 60.732 91.825 1.00 77.80  ? 829  TRP A C    1 
ATOM   8949  O  O    . TRP A 1 621 ? -10.796 61.833 91.284 1.00 69.98  ? 829  TRP A O    1 
ATOM   8950  C  CB   . TRP A 1 621 ? -13.008 60.944 92.906 1.00 107.97 ? 829  TRP A CB   1 
ATOM   8951  C  CG   . TRP A 1 621 ? -14.308 60.947 92.354 1.00 126.96 ? 829  TRP A CG   1 
ATOM   8952  C  CD1  . TRP A 1 621 ? -14.819 61.834 91.462 1.00 133.92 ? 829  TRP A CD1  1 
ATOM   8953  C  CD2  . TRP A 1 621 ? -15.294 59.952 92.567 1.00 138.21 ? 829  TRP A CD2  1 
ATOM   8954  N  NE1  . TRP A 1 621 ? -16.096 61.460 91.117 1.00 139.63 ? 829  TRP A NE1  1 
ATOM   8955  C  CE2  . TRP A 1 621 ? -16.412 60.302 91.787 1.00 142.56 ? 829  TRP A CE2  1 
ATOM   8956  C  CE3  . TRP A 1 621 ? -15.345 58.797 93.356 1.00 143.62 ? 829  TRP A CE3  1 
ATOM   8957  C  CZ2  . TRP A 1 621 ? -17.582 59.539 91.780 1.00 147.21 ? 829  TRP A CZ2  1 
ATOM   8958  C  CZ3  . TRP A 1 621 ? -16.497 58.038 93.353 1.00 147.69 ? 829  TRP A CZ3  1 
ATOM   8959  C  CH2  . TRP A 1 621 ? -17.605 58.409 92.566 1.00 149.09 ? 829  TRP A CH2  1 
ATOM   8960  H  H    . TRP A 1 621 ? -12.204 58.099 91.899 1.00 102.16 ? 829  TRP A H    1 
ATOM   8961  H  HA   . TRP A 1 621 ? -12.570 59.997 91.151 1.00 106.92 ? 829  TRP A HA   1 
ATOM   8962  H  HB2  . TRP A 1 621 ? -13.048 60.590 93.809 1.00 129.57 ? 829  TRP A HB2  1 
ATOM   8963  H  HB3  . TRP A 1 621 ? -12.658 61.848 92.900 1.00 129.57 ? 829  TRP A HB3  1 
ATOM   8964  H  HD1  . TRP A 1 621 ? -14.373 62.580 91.132 1.00 160.70 ? 829  TRP A HD1  1 
ATOM   8965  H  HE1  . TRP A 1 621 ? -16.614 61.884 90.577 1.00 167.56 ? 829  TRP A HE1  1 
ATOM   8966  H  HE3  . TRP A 1 621 ? -14.615 58.546 93.876 1.00 172.34 ? 829  TRP A HE3  1 
ATOM   8967  H  HZ2  . TRP A 1 621 ? -18.316 59.785 91.264 1.00 176.65 ? 829  TRP A HZ2  1 
ATOM   8968  H  HZ3  . TRP A 1 621 ? -16.542 57.269 93.874 1.00 177.23 ? 829  TRP A HZ3  1 
ATOM   8969  H  HH2  . TRP A 1 621 ? -18.372 57.883 92.583 1.00 178.92 ? 829  TRP A HH2  1 
ATOM   8970  N  N    . VAL A 1 622 ? -9.730  60.172 92.293 1.00 72.53  ? 830  VAL A N    1 
ATOM   8971  C  CA   . VAL A 1 622 ? -8.430  60.805 92.081 1.00 68.75  ? 830  VAL A CA   1 
ATOM   8972  C  C    . VAL A 1 622 ? -7.979  60.544 90.646 1.00 67.24  ? 830  VAL A C    1 
ATOM   8973  O  O    . VAL A 1 622 ? -7.879  59.372 90.239 1.00 65.05  ? 830  VAL A O    1 
ATOM   8974  C  CB   . VAL A 1 622 ? -7.415  60.292 93.091 1.00 74.26  ? 830  VAL A CB   1 
ATOM   8975  C  CG1  . VAL A 1 622 ? -6.038  60.820 92.784 1.00 74.72  ? 830  VAL A CG1  1 
ATOM   8976  C  CG2  . VAL A 1 622 ? -7.832  60.726 94.483 1.00 77.87  ? 830  VAL A CG2  1 
ATOM   8977  H  H    . VAL A 1 622 ? -9.703  59.434 92.733 1.00 87.03  ? 830  VAL A H    1 
ATOM   8978  H  HA   . VAL A 1 622 ? -8.519  61.764 92.202 1.00 82.50  ? 830  VAL A HA   1 
ATOM   8979  H  HB   . VAL A 1 622 ? -7.389  59.323 93.063 1.00 89.11  ? 830  VAL A HB   1 
ATOM   8980  H  HG11 . VAL A 1 622 ? -5.415  60.476 93.443 1.00 89.67  ? 830  VAL A HG11 1 
ATOM   8981  H  HG12 . VAL A 1 622 ? -5.777  60.526 91.897 1.00 89.67  ? 830  VAL A HG12 1 
ATOM   8982  H  HG13 . VAL A 1 622 ? -6.056  61.789 92.820 1.00 89.67  ? 830  VAL A HG13 1 
ATOM   8983  H  HG21 . VAL A 1 622 ? -7.182  60.397 95.124 1.00 93.44  ? 830  VAL A HG21 1 
ATOM   8984  H  HG22 . VAL A 1 622 ? -7.867  61.695 94.515 1.00 93.44  ? 830  VAL A HG22 1 
ATOM   8985  H  HG23 . VAL A 1 622 ? -8.707  60.356 94.680 1.00 93.44  ? 830  VAL A HG23 1 
ATOM   8986  N  N    . PRO A 1 623 ? -7.714  61.591 89.855 1.00 65.44  ? 831  PRO A N    1 
ATOM   8987  C  CA   . PRO A 1 623 ? -7.117  61.384 88.532 1.00 61.51  ? 831  PRO A CA   1 
ATOM   8988  C  C    . PRO A 1 623 ? -5.902  60.482 88.614 1.00 59.72  ? 831  PRO A C    1 
ATOM   8989  O  O    . PRO A 1 623 ? -5.075  60.604 89.520 1.00 60.39  ? 831  PRO A O    1 
ATOM   8990  C  CB   . PRO A 1 623 ? -6.712  62.793 88.104 1.00 61.61  ? 831  PRO A CB   1 
ATOM   8991  C  CG   . PRO A 1 623 ? -7.644  63.669 88.774 1.00 63.54  ? 831  PRO A CG   1 
ATOM   8992  C  CD   . PRO A 1 623 ? -7.952  63.023 90.109 1.00 66.64  ? 831  PRO A CD   1 
ATOM   8993  H  HA   . PRO A 1 623 ? -7.765  61.019 87.909 1.00 73.82  ? 831  PRO A HA   1 
ATOM   8994  H  HB2  . PRO A 1 623 ? -5.803  62.974 88.392 1.00 73.93  ? 831  PRO A HB2  1 
ATOM   8995  H  HB3  . PRO A 1 623 ? -6.792  62.878 87.141 1.00 73.93  ? 831  PRO A HB3  1 
ATOM   8996  H  HG2  . PRO A 1 623 ? -7.234  64.539 88.904 1.00 76.26  ? 831  PRO A HG2  1 
ATOM   8997  H  HG3  . PRO A 1 623 ? -8.451  63.750 88.241 1.00 76.26  ? 831  PRO A HG3  1 
ATOM   8998  H  HD2  . PRO A 1 623 ? -7.346  63.351 90.792 1.00 79.97  ? 831  PRO A HD2  1 
ATOM   8999  H  HD3  . PRO A 1 623 ? -8.879  63.174 90.352 1.00 79.97  ? 831  PRO A HD3  1 
ATOM   9000  N  N    . VAL A 1 624 ? -5.781  59.590 87.641 1.00 56.61  ? 832  VAL A N    1 
ATOM   9001  C  CA   . VAL A 1 624 ? -4.589  58.768 87.478 1.00 56.68  ? 832  VAL A CA   1 
ATOM   9002  C  C    . VAL A 1 624 ? -3.888  59.064 86.147 1.00 54.01  ? 832  VAL A C    1 
ATOM   9003  O  O    . VAL A 1 624 ? -2.749  59.535 86.126 1.00 53.67  ? 832  VAL A O    1 
ATOM   9004  C  CB   . VAL A 1 624 ? -4.923  57.266 87.625 1.00 57.63  ? 832  VAL A CB   1 
ATOM   9005  C  CG1  . VAL A 1 624 ? -3.728  56.445 87.252 1.00 56.15  ? 832  VAL A CG1  1 
ATOM   9006  C  CG2  . VAL A 1 624 ? -5.319  56.986 89.069 1.00 60.47  ? 832  VAL A CG2  1 
ATOM   9007  H  H    . VAL A 1 624 ? -6.388  59.439 87.050 1.00 67.93  ? 832  VAL A H    1 
ATOM   9008  H  HA   . VAL A 1 624 ? -3.966  58.994 88.187 1.00 68.02  ? 832  VAL A HA   1 
ATOM   9009  H  HB   . VAL A 1 624 ? -5.662  57.032 87.043 1.00 69.16  ? 832  VAL A HB   1 
ATOM   9010  H  HG11 . VAL A 1 624 ? -3.949  55.505 87.348 1.00 67.38  ? 832  VAL A HG11 1 
ATOM   9011  H  HG12 . VAL A 1 624 ? -3.489  56.637 86.332 1.00 67.38  ? 832  VAL A HG12 1 
ATOM   9012  H  HG13 . VAL A 1 624 ? -2.992  56.674 87.841 1.00 67.38  ? 832  VAL A HG13 1 
ATOM   9013  H  HG21 . VAL A 1 624 ? -5.529  56.043 89.161 1.00 72.56  ? 832  VAL A HG21 1 
ATOM   9014  H  HG22 . VAL A 1 624 ? -4.578  57.219 89.650 1.00 72.56  ? 832  VAL A HG22 1 
ATOM   9015  H  HG23 . VAL A 1 624 ? -6.096  57.522 89.293 1.00 72.56  ? 832  VAL A HG23 1 
ATOM   9016  N  N    . ALA A 1 625 ? -4.562  58.813 85.029 1.00 53.36  ? 833  ALA A N    1 
ATOM   9017  C  CA   . ALA A 1 625 ? -3.975  59.084 83.723 1.00 53.18  ? 833  ALA A CA   1 
ATOM   9018  C  C    . ALA A 1 625 ? -5.103  59.237 82.717 1.00 53.27  ? 833  ALA A C    1 
ATOM   9019  O  O    . ALA A 1 625 ? -6.270  58.976 83.017 1.00 51.43  ? 833  ALA A O    1 
ATOM   9020  C  CB   . ALA A 1 625 ? -3.010  57.971 83.304 1.00 51.34  ? 833  ALA A CB   1 
ATOM   9021  H  H    . ALA A 1 625 ? -5.358  58.488 84.999 1.00 64.03  ? 833  ALA A H    1 
ATOM   9022  H  HA   . ALA A 1 625 ? -3.482  59.918 83.759 1.00 63.82  ? 833  ALA A HA   1 
ATOM   9023  H  HB1  . ALA A 1 625 ? -2.640  58.186 82.433 1.00 61.61  ? 833  ALA A HB1  1 
ATOM   9024  H  HB2  . ALA A 1 625 ? -2.298  57.907 83.959 1.00 61.61  ? 833  ALA A HB2  1 
ATOM   9025  H  HB3  . ALA A 1 625 ? -3.495  57.132 83.260 1.00 61.61  ? 833  ALA A HB3  1 
ATOM   9026  N  N    . GLU A 1 626 ? -4.739  59.666 81.511 1.00 53.47  ? 834  GLU A N    1 
ATOM   9027  C  CA   . GLU A 1 626 ? -5.701  59.780 80.425 1.00 53.12  ? 834  GLU A CA   1 
ATOM   9028  C  C    . GLU A 1 626 ? -4.984  59.579 79.099 1.00 47.46  ? 834  GLU A C    1 
ATOM   9029  O  O    . GLU A 1 626 ? -3.767  59.750 78.996 1.00 46.70  ? 834  GLU A O    1 
ATOM   9030  C  CB   . GLU A 1 626 ? -6.414  61.138 80.435 1.00 58.89  ? 834  GLU A CB   1 
ATOM   9031  C  CG   . GLU A 1 626 ? -5.491  62.328 80.212 1.00 63.34  ? 834  GLU A CG   1 
ATOM   9032  C  CD   . GLU A 1 626 ? -6.242  63.579 79.804 1.00 67.10  ? 834  GLU A CD   1 
ATOM   9033  O  OE1  . GLU A 1 626 ? -7.371  63.788 80.296 1.00 68.67  ? 834  GLU A OE1  1 
ATOM   9034  O  OE2  . GLU A 1 626 ? -5.703  64.347 78.978 1.00 67.36  ? 834  GLU A OE2  1 
ATOM   9035  H  H    . GLU A 1 626 ? -3.939  59.898 81.299 1.00 64.17  ? 834  GLU A H    1 
ATOM   9036  H  HA   . GLU A 1 626 ? -6.371  59.084 80.517 1.00 63.75  ? 834  GLU A HA   1 
ATOM   9037  H  HB2  . GLU A 1 626 ? -7.081  61.145 79.730 1.00 70.67  ? 834  GLU A HB2  1 
ATOM   9038  H  HB3  . GLU A 1 626 ? -6.846  61.257 81.295 1.00 70.67  ? 834  GLU A HB3  1 
ATOM   9039  H  HG2  . GLU A 1 626 ? -5.015  62.519 81.035 1.00 76.01  ? 834  GLU A HG2  1 
ATOM   9040  H  HG3  . GLU A 1 626 ? -4.861  62.112 79.506 1.00 76.01  ? 834  GLU A HG3  1 
ATOM   9041  N  N    . THR A 1 627 ? -5.760  59.214 78.080 1.00 44.90  ? 835  THR A N    1 
ATOM   9042  C  CA   . THR A 1 627 ? -5.266  59.145 76.713 1.00 43.99  ? 835  THR A CA   1 
ATOM   9043  C  C    . THR A 1 627 ? -6.371  59.616 75.775 1.00 42.48  ? 835  THR A C    1 
ATOM   9044  O  O    . THR A 1 627 ? -7.536  59.743 76.165 1.00 41.93  ? 835  THR A O    1 
ATOM   9045  C  CB   . THR A 1 627 ? -4.790  57.728 76.350 1.00 44.21  ? 835  THR A CB   1 
ATOM   9046  O  OG1  . THR A 1 627 ? -4.221  57.729 75.034 1.00 44.02  ? 835  THR A OG1  1 
ATOM   9047  C  CG2  . THR A 1 627 ? -5.941  56.724 76.409 1.00 44.55  ? 835  THR A CG2  1 
ATOM   9048  H  H    . THR A 1 627 ? -6.589  58.998 78.159 1.00 53.88  ? 835  THR A H    1 
ATOM   9049  H  HA   . THR A 1 627 ? -4.513  59.749 76.618 1.00 52.79  ? 835  THR A HA   1 
ATOM   9050  H  HB   . THR A 1 627 ? -4.114  57.448 76.987 1.00 53.05  ? 835  THR A HB   1 
ATOM   9051  H  HG1  . THR A 1 627 ? -3.960  56.957 74.833 1.00 52.83  ? 835  THR A HG1  1 
ATOM   9052  H  HG21 . THR A 1 627 ? -5.621  55.838 76.177 1.00 53.46  ? 835  THR A HG21 1 
ATOM   9053  H  HG22 . THR A 1 627 ? -6.315  56.700 77.304 1.00 53.46  ? 835  THR A HG22 1 
ATOM   9054  H  HG23 . THR A 1 627 ? -6.637  56.981 75.783 1.00 53.46  ? 835  THR A HG23 1 
ATOM   9055  N  N    . LYS A 1 628 ? -5.990  59.891 74.529 1.00 41.37  ? 836  LYS A N    1 
ATOM   9056  C  CA   . LYS A 1 628 ? -6.909  60.389 73.516 1.00 38.48  ? 836  LYS A CA   1 
ATOM   9057  C  C    . LYS A 1 628 ? -6.810  59.521 72.270 1.00 38.31  ? 836  LYS A C    1 
ATOM   9058  O  O    . LYS A 1 628 ? -5.819  58.818 72.057 1.00 38.68  ? 836  LYS A O    1 
ATOM   9059  C  CB   . LYS A 1 628 ? -6.612  61.850 73.148 1.00 36.24  ? 836  LYS A CB   1 
ATOM   9060  C  CG   . LYS A 1 628 ? -6.811  62.851 74.280 1.00 39.14  ? 836  LYS A CG   1 
ATOM   9061  C  CD   . LYS A 1 628 ? -6.471  64.263 73.818 1.00 40.46  ? 836  LYS A CD   1 
ATOM   9062  C  CE   . LYS A 1 628 ? -6.472  65.256 74.967 1.00 44.35  ? 836  LYS A CE   1 
ATOM   9063  N  NZ   . LYS A 1 628 ? -7.840  65.528 75.488 1.00 47.40  ? 836  LYS A NZ   1 
ATOM   9064  H  H    . LYS A 1 628 ? -5.185  59.794 74.243 1.00 49.64  ? 836  LYS A H    1 
ATOM   9065  H  HA   . LYS A 1 628 ? -7.818  60.337 73.853 1.00 46.17  ? 836  LYS A HA   1 
ATOM   9066  H  HB2  . LYS A 1 628 ? -5.688  61.914 72.859 1.00 43.48  ? 836  LYS A HB2  1 
ATOM   9067  H  HB3  . LYS A 1 628 ? -7.199  62.111 72.420 1.00 43.48  ? 836  LYS A HB3  1 
ATOM   9068  H  HG2  . LYS A 1 628 ? -7.738  62.836 74.564 1.00 46.97  ? 836  LYS A HG2  1 
ATOM   9069  H  HG3  . LYS A 1 628 ? -6.227  62.621 75.019 1.00 46.97  ? 836  LYS A HG3  1 
ATOM   9070  H  HD2  . LYS A 1 628 ? -5.587  64.263 73.419 1.00 48.56  ? 836  LYS A HD2  1 
ATOM   9071  H  HD3  . LYS A 1 628 ? -7.130  64.552 73.168 1.00 48.56  ? 836  LYS A HD3  1 
ATOM   9072  H  HE2  . LYS A 1 628 ? -5.939  64.899 75.695 1.00 53.22  ? 836  LYS A HE2  1 
ATOM   9073  H  HE3  . LYS A 1 628 ? -6.095  66.096 74.660 1.00 53.22  ? 836  LYS A HE3  1 
ATOM   9074  H  HZ1  . LYS A 1 628 ? -8.350  65.865 74.842 1.00 56.88  ? 836  LYS A HZ1  1 
ATOM   9075  H  HZ2  . LYS A 1 628 ? -8.208  64.774 75.785 1.00 56.88  ? 836  LYS A HZ2  1 
ATOM   9076  H  HZ3  . LYS A 1 628 ? -7.799  66.113 76.158 1.00 56.88  ? 836  LYS A HZ3  1 
ATOM   9077  N  N    . PHE A 1 629 ? -7.855  59.574 71.445 1.00 38.46  ? 837  PHE A N    1 
ATOM   9078  C  CA   . PHE A 1 629 ? -7.848  58.884 70.163 1.00 36.52  ? 837  PHE A CA   1 
ATOM   9079  C  C    . PHE A 1 629 ? -8.816  59.583 69.220 1.00 34.33  ? 837  PHE A C    1 
ATOM   9080  O  O    . PHE A 1 629 ? -9.724  60.300 69.649 1.00 36.81  ? 837  PHE A O    1 
ATOM   9081  C  CB   . PHE A 1 629 ? -8.200  57.396 70.311 1.00 36.62  ? 837  PHE A CB   1 
ATOM   9082  C  CG   . PHE A 1 629 ? -9.637  57.134 70.682 1.00 38.04  ? 837  PHE A CG   1 
ATOM   9083  C  CD1  . PHE A 1 629 ? -10.595 56.942 69.701 1.00 36.07  ? 837  PHE A CD1  1 
ATOM   9084  C  CD2  . PHE A 1 629 ? -10.021 57.052 72.011 1.00 38.59  ? 837  PHE A CD2  1 
ATOM   9085  C  CE1  . PHE A 1 629 ? -11.911 56.690 70.037 1.00 37.01  ? 837  PHE A CE1  1 
ATOM   9086  C  CE2  . PHE A 1 629 ? -11.337 56.798 72.353 1.00 38.08  ? 837  PHE A CE2  1 
ATOM   9087  C  CZ   . PHE A 1 629 ? -12.281 56.617 71.365 1.00 38.38  ? 837  PHE A CZ   1 
ATOM   9088  H  H    . PHE A 1 629 ? -8.581  60.004 71.608 1.00 46.16  ? 837  PHE A H    1 
ATOM   9089  H  HA   . PHE A 1 629 ? -6.959  58.944 69.778 1.00 43.82  ? 837  PHE A HA   1 
ATOM   9090  H  HB2  . PHE A 1 629 ? -8.027  56.950 69.467 1.00 43.95  ? 837  PHE A HB2  1 
ATOM   9091  H  HB3  . PHE A 1 629 ? -7.641  57.011 71.004 1.00 43.95  ? 837  PHE A HB3  1 
ATOM   9092  H  HD1  . PHE A 1 629 ? -10.351 56.990 68.805 1.00 43.29  ? 837  PHE A HD1  1 
ATOM   9093  H  HD2  . PHE A 1 629 ? -9.388  57.173 72.681 1.00 46.31  ? 837  PHE A HD2  1 
ATOM   9094  H  HE1  . PHE A 1 629 ? -12.546 56.568 69.369 1.00 44.42  ? 837  PHE A HE1  1 
ATOM   9095  H  HE2  . PHE A 1 629 ? -11.584 56.751 73.248 1.00 45.70  ? 837  PHE A HE2  1 
ATOM   9096  H  HZ   . PHE A 1 629 ? -13.167 56.448 71.593 1.00 46.06  ? 837  PHE A HZ   1 
ATOM   9097  N  N    . LEU A 1 630 ? -8.609  59.364 67.923 1.00 30.45  ? 838  LEU A N    1 
ATOM   9098  C  CA   . LEU A 1 630 ? -9.330  60.078 66.876 1.00 34.86  ? 838  LEU A CA   1 
ATOM   9099  C  C    . LEU A 1 630 ? -10.297 59.140 66.167 1.00 32.89  ? 838  LEU A C    1 
ATOM   9100  O  O    . LEU A 1 630 ? -9.884  58.111 65.620 1.00 31.96  ? 838  LEU A O    1 
ATOM   9101  C  CB   . LEU A 1 630 ? -8.357  60.685 65.864 1.00 36.52  ? 838  LEU A CB   1 
ATOM   9102  C  CG   . LEU A 1 630 ? -9.004  61.320 64.627 1.00 35.58  ? 838  LEU A CG   1 
ATOM   9103  C  CD1  . LEU A 1 630 ? -9.858  62.522 65.018 1.00 36.84  ? 838  LEU A CD1  1 
ATOM   9104  C  CD2  . LEU A 1 630 ? -7.945  61.709 63.614 1.00 34.92  ? 838  LEU A CD2  1 
ATOM   9105  H  H    . LEU A 1 630 ? -8.043  58.792 67.620 1.00 36.54  ? 838  LEU A H    1 
ATOM   9106  H  HA   . LEU A 1 630 ? -9.842  60.799 67.275 1.00 41.84  ? 838  LEU A HA   1 
ATOM   9107  H  HB2  . LEU A 1 630 ? -7.841  61.375 66.310 1.00 43.82  ? 838  LEU A HB2  1 
ATOM   9108  H  HB3  . LEU A 1 630 ? -7.761  59.985 65.554 1.00 43.82  ? 838  LEU A HB3  1 
ATOM   9109  H  HG   . LEU A 1 630 ? -9.587  60.666 64.210 1.00 42.70  ? 838  LEU A HG   1 
ATOM   9110  H  HD11 . LEU A 1 630 ? -10.253 62.902 64.217 1.00 44.21  ? 838  LEU A HD11 1 
ATOM   9111  H  HD12 . LEU A 1 630 ? -10.555 62.230 65.625 1.00 44.21  ? 838  LEU A HD12 1 
ATOM   9112  H  HD13 . LEU A 1 630 ? -9.294  63.181 65.453 1.00 44.21  ? 838  LEU A HD13 1 
ATOM   9113  H  HD21 . LEU A 1 630 ? -8.378  62.107 62.843 1.00 41.91  ? 838  LEU A HD21 1 
ATOM   9114  H  HD22 . LEU A 1 630 ? -7.339  62.348 64.021 1.00 41.91  ? 838  LEU A HD22 1 
ATOM   9115  H  HD23 . LEU A 1 630 ? -7.457  60.914 63.347 1.00 41.91  ? 838  LEU A HD23 1 
ATOM   9116  N  N    . VAL A 1 631 ? -11.574 59.504 66.172 1.00 35.09  ? 839  VAL A N    1 
ATOM   9117  C  CA   . VAL A 1 631 ? -12.569 58.933 65.271 1.00 37.68  ? 839  VAL A CA   1 
ATOM   9118  C  C    . VAL A 1 631 ? -12.703 59.908 64.108 1.00 37.96  ? 839  VAL A C    1 
ATOM   9119  O  O    . VAL A 1 631 ? -13.247 61.007 64.267 1.00 40.97  ? 839  VAL A O    1 
ATOM   9120  C  CB   . VAL A 1 631 ? -13.913 58.704 65.976 1.00 40.81  ? 839  VAL A CB   1 
ATOM   9121  C  CG1  . VAL A 1 631 ? -14.968 58.214 64.986 1.00 42.19  ? 839  VAL A CG1  1 
ATOM   9122  C  CG2  . VAL A 1 631 ? -13.749 57.712 67.119 1.00 40.22  ? 839  VAL A CG2  1 
ATOM   9123  H  H    . VAL A 1 631 ? -11.898 60.098 66.703 1.00 42.11  ? 839  VAL A H    1 
ATOM   9124  H  HA   . VAL A 1 631 ? -12.249 58.084 64.928 1.00 45.22  ? 839  VAL A HA   1 
ATOM   9125  H  HB   . VAL A 1 631 ? -14.220 59.544 66.350 1.00 48.97  ? 839  VAL A HB   1 
ATOM   9126  H  HG11 . VAL A 1 631 ? -15.805 58.078 65.458 1.00 50.63  ? 839  VAL A HG11 1 
ATOM   9127  H  HG12 . VAL A 1 631 ? -15.084 58.882 64.292 1.00 50.63  ? 839  VAL A HG12 1 
ATOM   9128  H  HG13 . VAL A 1 631 ? -14.669 57.378 64.594 1.00 50.63  ? 839  VAL A HG13 1 
ATOM   9129  H  HG21 . VAL A 1 631 ? -14.608 57.582 67.550 1.00 48.27  ? 839  VAL A HG21 1 
ATOM   9130  H  HG22 . VAL A 1 631 ? -13.427 56.869 66.761 1.00 48.27  ? 839  VAL A HG22 1 
ATOM   9131  H  HG23 . VAL A 1 631 ? -13.109 58.067 67.756 1.00 48.27  ? 839  VAL A HG23 1 
ATOM   9132  N  N    . ALA A 1 632 ? -12.203 59.517 62.940 1.00 35.83  ? 840  ALA A N    1 
ATOM   9133  C  CA   . ALA A 1 632 ? -12.102 60.453 61.826 1.00 37.26  ? 840  ALA A CA   1 
ATOM   9134  C  C    . ALA A 1 632 ? -13.378 60.443 60.986 1.00 38.06  ? 840  ALA A C    1 
ATOM   9135  O  O    . ALA A 1 632 ? -13.967 59.380 60.765 1.00 37.57  ? 840  ALA A O    1 
ATOM   9136  C  CB   . ALA A 1 632 ? -10.914 60.102 60.935 1.00 37.79  ? 840  ALA A CB   1 
ATOM   9137  H  H    . ALA A 1 632 ? -11.917 58.725 62.768 1.00 43.00  ? 840  ALA A H    1 
ATOM   9138  H  HA   . ALA A 1 632 ? -11.970 61.350 62.171 1.00 44.71  ? 840  ALA A HA   1 
ATOM   9139  H  HB1  . ALA A 1 632 ? -10.870 60.737 60.204 1.00 45.35  ? 840  ALA A HB1  1 
ATOM   9140  H  HB2  . ALA A 1 632 ? -10.101 60.145 61.462 1.00 45.35  ? 840  ALA A HB2  1 
ATOM   9141  H  HB3  . ALA A 1 632 ? -11.036 59.204 60.587 1.00 45.35  ? 840  ALA A HB3  1 
ATOM   9142  N  N    . PRO A 1 633 ? -13.829 61.600 60.503 1.00 39.94  ? 841  PRO A N    1 
ATOM   9143  C  CA   . PRO A 1 633 ? -14.901 61.602 59.504 1.00 41.73  ? 841  PRO A CA   1 
ATOM   9144  C  C    . PRO A 1 633 ? -14.371 61.146 58.156 1.00 44.36  ? 841  PRO A C    1 
ATOM   9145  O  O    . PRO A 1 633 ? -13.218 61.401 57.797 1.00 45.17  ? 841  PRO A O    1 
ATOM   9146  C  CB   . PRO A 1 633 ? -15.350 63.066 59.467 1.00 41.41  ? 841  PRO A CB   1 
ATOM   9147  C  CG   . PRO A 1 633 ? -14.132 63.833 59.847 1.00 40.36  ? 841  PRO A CG   1 
ATOM   9148  C  CD   . PRO A 1 633 ? -13.375 62.966 60.823 1.00 39.07  ? 841  PRO A CD   1 
ATOM   9149  H  HA   . PRO A 1 633 ? -15.637 61.036 59.783 1.00 50.08  ? 841  PRO A HA   1 
ATOM   9150  H  HB2  . PRO A 1 633 ? -15.640 63.299 58.571 1.00 49.69  ? 841  PRO A HB2  1 
ATOM   9151  H  HB3  . PRO A 1 633 ? -16.063 63.209 60.110 1.00 49.69  ? 841  PRO A HB3  1 
ATOM   9152  H  HG2  . PRO A 1 633 ? -13.595 64.001 59.056 1.00 48.43  ? 841  PRO A HG2  1 
ATOM   9153  H  HG3  . PRO A 1 633 ? -14.392 64.668 60.265 1.00 48.43  ? 841  PRO A HG3  1 
ATOM   9154  H  HD2  . PRO A 1 633 ? -12.420 63.047 60.677 1.00 46.89  ? 841  PRO A HD2  1 
ATOM   9155  H  HD3  . PRO A 1 633 ? -13.615 63.196 61.735 1.00 46.89  ? 841  PRO A HD3  1 
ATOM   9156  N  N    . LEU A 1 634 ? -15.225 60.457 57.408 1.00 44.00  ? 842  LEU A N    1 
ATOM   9157  C  CA   . LEU A 1 634 ? -14.831 59.845 56.148 1.00 40.67  ? 842  LEU A CA   1 
ATOM   9158  C  C    . LEU A 1 634 ? -15.181 60.751 54.976 1.00 39.70  ? 842  LEU A C    1 
ATOM   9159  O  O    . LEU A 1 634 ? -16.256 61.357 54.942 1.00 42.92  ? 842  LEU A O    1 
ATOM   9160  C  CB   . LEU A 1 634 ? -15.508 58.485 55.973 1.00 38.48  ? 842  LEU A CB   1 
ATOM   9161  C  CG   . LEU A 1 634 ? -15.277 57.474 57.100 1.00 37.29  ? 842  LEU A CG   1 
ATOM   9162  C  CD1  . LEU A 1 634 ? -15.693 56.082 56.643 1.00 35.81  ? 842  LEU A CD1  1 
ATOM   9163  C  CD2  . LEU A 1 634 ? -13.825 57.473 57.577 1.00 36.26  ? 842  LEU A CD2  1 
ATOM   9164  H  H    . LEU A 1 634 ? -16.051 60.329 57.613 1.00 52.80  ? 842  LEU A H    1 
ATOM   9165  H  HA   . LEU A 1 634 ? -13.871 59.707 56.148 1.00 48.80  ? 842  LEU A HA   1 
ATOM   9166  H  HB2  . LEU A 1 634 ? -16.465 58.626 55.903 1.00 46.18  ? 842  LEU A HB2  1 
ATOM   9167  H  HB3  . LEU A 1 634 ? -15.180 58.084 55.153 1.00 46.18  ? 842  LEU A HB3  1 
ATOM   9168  H  HG   . LEU A 1 634 ? -15.835 57.716 57.855 1.00 44.74  ? 842  LEU A HG   1 
ATOM   9169  H  HD11 . LEU A 1 634 ? -15.541 55.454 57.367 1.00 42.97  ? 842  LEU A HD11 1 
ATOM   9170  H  HD12 . LEU A 1 634 ? -16.634 56.096 56.409 1.00 42.97  ? 842  LEU A HD12 1 
ATOM   9171  H  HD13 . LEU A 1 634 ? -15.162 55.832 55.871 1.00 42.97  ? 842  LEU A HD13 1 
ATOM   9172  H  HD21 . LEU A 1 634 ? -13.727 56.820 58.288 1.00 43.52  ? 842  LEU A HD21 1 
ATOM   9173  H  HD22 . LEU A 1 634 ? -13.249 57.241 56.832 1.00 43.52  ? 842  LEU A HD22 1 
ATOM   9174  H  HD23 . LEU A 1 634 ? -13.601 58.357 57.906 1.00 43.52  ? 842  LEU A HD23 1 
ATOM   9175  N  N    . THR A 1 635 ? -14.258 60.840 54.019 1.00 37.55  ? 843  THR A N    1 
ATOM   9176  C  CA   . THR A 1 635 ? -14.478 61.571 52.779 1.00 37.64  ? 843  THR A CA   1 
ATOM   9177  C  C    . THR A 1 635 ? -14.839 60.660 51.613 1.00 40.46  ? 843  THR A C    1 
ATOM   9178  O  O    . THR A 1 635 ? -15.179 61.164 50.537 1.00 38.89  ? 843  THR A O    1 
ATOM   9179  C  CB   . THR A 1 635 ? -13.227 62.382 52.411 1.00 35.52  ? 843  THR A CB   1 
ATOM   9180  O  OG1  . THR A 1 635 ? -12.078 61.525 52.414 1.00 36.63  ? 843  THR A OG1  1 
ATOM   9181  C  CG2  . THR A 1 635 ? -13.011 63.516 53.402 1.00 35.16  ? 843  THR A CG2  1 
ATOM   9182  H  H    . THR A 1 635 ? -13.480 60.477 54.069 1.00 45.06  ? 843  THR A H    1 
ATOM   9183  H  HA   . THR A 1 635 ? -15.210 62.194 52.908 1.00 45.17  ? 843  THR A HA   1 
ATOM   9184  H  HB   . THR A 1 635 ? -13.341 62.765 51.527 1.00 42.62  ? 843  THR A HB   1 
ATOM   9185  H  HG1  . THR A 1 635 ? -11.391 61.965 52.213 1.00 43.96  ? 843  THR A HG1  1 
ATOM   9186  H  HG21 . THR A 1 635 ? -12.219 64.021 53.160 1.00 42.20  ? 843  THR A HG21 1 
ATOM   9187  H  HG22 . THR A 1 635 ? -13.778 64.111 53.397 1.00 42.20  ? 843  THR A HG22 1 
ATOM   9188  H  HG23 . THR A 1 635 ? -12.896 63.158 54.296 1.00 42.20  ? 843  THR A HG23 1 
ATOM   9189  N  N    . PHE A 1 636 ? -14.769 59.344 51.795 1.00 41.49  ? 844  PHE A N    1 
ATOM   9190  C  CA   . PHE A 1 636 ? -15.085 58.385 50.748 1.00 41.41  ? 844  PHE A CA   1 
ATOM   9191  C  C    . PHE A 1 636 ? -16.216 57.469 51.196 1.00 41.74  ? 844  PHE A C    1 
ATOM   9192  O  O    . PHE A 1 636 ? -16.357 57.162 52.384 1.00 42.41  ? 844  PHE A O    1 
ATOM   9193  C  CB   . PHE A 1 636 ? -13.858 57.536 50.372 1.00 37.64  ? 844  PHE A CB   1 
ATOM   9194  C  CG   . PHE A 1 636 ? -12.763 58.320 49.706 1.00 35.98  ? 844  PHE A CG   1 
ATOM   9195  C  CD1  . PHE A 1 636 ? -12.794 58.555 48.341 1.00 36.14  ? 844  PHE A CD1  1 
ATOM   9196  C  CD2  . PHE A 1 636 ? -11.706 58.827 50.445 1.00 33.58  ? 844  PHE A CD2  1 
ATOM   9197  C  CE1  . PHE A 1 636 ? -11.791 59.279 47.724 1.00 33.42  ? 844  PHE A CE1  1 
ATOM   9198  C  CE2  . PHE A 1 636 ? -10.701 59.554 49.834 1.00 31.35  ? 844  PHE A CE2  1 
ATOM   9199  C  CZ   . PHE A 1 636 ? -10.743 59.779 48.471 1.00 29.42  ? 844  PHE A CZ   1 
ATOM   9200  H  H    . PHE A 1 636 ? -14.535 58.976 52.536 1.00 49.79  ? 844  PHE A H    1 
ATOM   9201  H  HA   . PHE A 1 636 ? -15.377 58.862 49.956 1.00 49.69  ? 844  PHE A HA   1 
ATOM   9202  H  HB2  . PHE A 1 636 ? -13.491 57.142 51.179 1.00 45.18  ? 844  PHE A HB2  1 
ATOM   9203  H  HB3  . PHE A 1 636 ? -14.136 56.837 49.761 1.00 45.18  ? 844  PHE A HB3  1 
ATOM   9204  H  HD1  . PHE A 1 636 ? -13.499 58.221 47.833 1.00 43.37  ? 844  PHE A HD1  1 
ATOM   9205  H  HD2  . PHE A 1 636 ? -11.673 58.679 51.363 1.00 40.30  ? 844  PHE A HD2  1 
ATOM   9206  H  HE1  . PHE A 1 636 ? -11.822 59.430 46.807 1.00 40.11  ? 844  PHE A HE1  1 
ATOM   9207  H  HE2  . PHE A 1 636 ? -9.995  59.888 50.339 1.00 37.62  ? 844  PHE A HE2  1 
ATOM   9208  H  HZ   . PHE A 1 636 ? -10.067 60.266 48.058 1.00 35.31  ? 844  PHE A HZ   1 
ATOM   9209  N  N    . SER A 1 637 ? -17.023 57.044 50.226 1.00 41.85  ? 845  SER A N    1 
ATOM   9210  C  CA   . SER A 1 637 ? -18.078 56.057 50.442 1.00 41.87  ? 845  SER A CA   1 
ATOM   9211  C  C    . SER A 1 637 ? -18.005 55.066 49.290 1.00 42.29  ? 845  SER A C    1 
ATOM   9212  O  O    . SER A 1 637 ? -18.235 55.439 48.135 1.00 39.42  ? 845  SER A O    1 
ATOM   9213  C  CB   . SER A 1 637 ? -19.456 56.719 50.516 1.00 44.92  ? 845  SER A CB   1 
ATOM   9214  O  OG   . SER A 1 637 ? -20.476 55.754 50.699 1.00 45.75  ? 845  SER A OG   1 
ATOM   9215  H  H    . SER A 1 637 ? -16.977 57.320 49.413 1.00 50.22  ? 845  SER A H    1 
ATOM   9216  H  HA   . SER A 1 637 ? -17.916 55.582 51.272 1.00 50.25  ? 845  SER A HA   1 
ATOM   9217  H  HB2  . SER A 1 637 ? -19.469 57.336 51.265 1.00 53.91  ? 845  SER A HB2  1 
ATOM   9218  H  HB3  . SER A 1 637 ? -19.620 57.199 49.689 1.00 53.91  ? 845  SER A HB3  1 
ATOM   9219  H  HG   . SER A 1 637 ? -21.226 56.131 50.737 1.00 54.91  ? 845  SER A HG   1 
ATOM   9220  N  N    . ASN A 1 638 ? -17.675 53.811 49.597 1.00 48.79  ? 846  ASN A N    1 
ATOM   9221  C  CA   . ASN A 1 638 ? -17.408 52.807 48.566 1.00 55.27  ? 846  ASN A CA   1 
ATOM   9222  C  C    . ASN A 1 638 ? -16.354 53.312 47.583 1.00 51.10  ? 846  ASN A C    1 
ATOM   9223  O  O    . ASN A 1 638 ? -16.463 53.131 46.369 1.00 48.43  ? 846  ASN A O    1 
ATOM   9224  C  CB   . ASN A 1 638 ? -18.692 52.417 47.835 1.00 68.32  ? 846  ASN A CB   1 
ATOM   9225  C  CG   . ASN A 1 638 ? -19.695 51.739 48.745 1.00 78.75  ? 846  ASN A CG   1 
ATOM   9226  O  OD1  . ASN A 1 638 ? -19.331 50.908 49.577 1.00 80.99  ? 846  ASN A OD1  1 
ATOM   9227  N  ND2  . ASN A 1 638 ? -20.965 52.096 48.597 1.00 84.27  ? 846  ASN A ND2  1 
ATOM   9228  H  H    . ASN A 1 638 ? -17.599 53.514 50.400 1.00 58.55  ? 846  ASN A H    1 
ATOM   9229  H  HA   . ASN A 1 638 ? -17.057 52.009 48.991 1.00 66.33  ? 846  ASN A HA   1 
ATOM   9230  H  HB2  . ASN A 1 638 ? -19.106 53.216 47.473 1.00 81.98  ? 846  ASN A HB2  1 
ATOM   9231  H  HB3  . ASN A 1 638 ? -18.474 51.801 47.117 1.00 81.98  ? 846  ASN A HB3  1 
ATOM   9232  H  HD21 . ASN A 1 638 ? -21.572 51.740 49.091 1.00 101.13 ? 846  ASN A HD21 1 
ATOM   9233  H  HD22 . ASN A 1 638 ? -21.181 52.682 48.005 1.00 101.13 ? 846  ASN A HD22 1 
ATOM   9234  N  N    . ARG A 1 639 ? -15.320 53.960 48.122 1.00 51.27  ? 847  ARG A N    1 
ATOM   9235  C  CA   . ARG A 1 639 ? -14.205 54.521 47.366 1.00 53.95  ? 847  ARG A CA   1 
ATOM   9236  C  C    . ARG A 1 639 ? -14.627 55.680 46.473 1.00 56.18  ? 847  ARG A C    1 
ATOM   9237  O  O    . ARG A 1 639 ? -13.848 56.099 45.605 1.00 54.47  ? 847  ARG A O    1 
ATOM   9238  C  CB   . ARG A 1 639 ? -13.505 53.457 46.511 1.00 56.32  ? 847  ARG A CB   1 
ATOM   9239  C  CG   . ARG A 1 639 ? -13.347 52.104 47.191 1.00 56.43  ? 847  ARG A CG   1 
ATOM   9240  C  CD   . ARG A 1 639 ? -12.655 52.203 48.541 1.00 57.17  ? 847  ARG A CD   1 
ATOM   9241  N  NE   . ARG A 1 639 ? -12.585 50.899 49.197 1.00 57.92  ? 847  ARG A NE   1 
ATOM   9242  C  CZ   . ARG A 1 639 ? -13.572 50.360 49.908 1.00 58.54  ? 847  ARG A CZ   1 
ATOM   9243  N  NH1  . ARG A 1 639 ? -14.718 51.009 50.069 1.00 59.07  ? 847  ARG A NH1  1 
ATOM   9244  N  NH2  . ARG A 1 639 ? -13.413 49.165 50.462 1.00 58.02  ? 847  ARG A NH2  1 
ATOM   9245  H  H    . ARG A 1 639 ? -15.243 54.091 48.969 1.00 61.52  ? 847  ARG A H    1 
ATOM   9246  H  HA   . ARG A 1 639 ? -13.551 54.863 47.995 1.00 64.75  ? 847  ARG A HA   1 
ATOM   9247  H  HB2  . ARG A 1 639 ? -14.021 53.321 45.701 1.00 67.59  ? 847  ARG A HB2  1 
ATOM   9248  H  HB3  . ARG A 1 639 ? -12.618 53.777 46.283 1.00 67.59  ? 847  ARG A HB3  1 
ATOM   9249  H  HG2  . ARG A 1 639 ? -14.225 51.716 47.331 1.00 67.71  ? 847  ARG A HG2  1 
ATOM   9250  H  HG3  . ARG A 1 639 ? -12.815 51.525 46.623 1.00 67.71  ? 847  ARG A HG3  1 
ATOM   9251  H  HD2  . ARG A 1 639 ? -11.751 52.530 48.415 1.00 68.60  ? 847  ARG A HD2  1 
ATOM   9252  H  HD3  . ARG A 1 639 ? -13.155 52.806 49.114 1.00 68.60  ? 847  ARG A HD3  1 
ATOM   9253  H  HE   . ARG A 1 639 ? -11.856 50.450 49.117 1.00 69.51  ? 847  ARG A HE   1 
ATOM   9254  H  HH11 . ARG A 1 639 ? -14.827 51.784 49.711 1.00 70.88  ? 847  ARG A HH11 1 
ATOM   9255  H  HH12 . ARG A 1 639 ? -15.351 50.655 50.530 1.00 70.88  ? 847  ARG A HH12 1 
ATOM   9256  H  HH21 . ARG A 1 639 ? -12.672 48.740 50.362 1.00 69.63  ? 847  ARG A HH21 1 
ATOM   9257  H  HH22 . ARG A 1 639 ? -14.050 48.817 50.923 1.00 69.63  ? 847  ARG A HH22 1 
ATOM   9258  N  N    . GLN A 1 640 ? -15.840 56.213 46.659 1.00 59.54  ? 848  GLN A N    1 
ATOM   9259  C  CA   . GLN A 1 640 ? -16.339 57.364 45.929 1.00 61.76  ? 848  GLN A CA   1 
ATOM   9260  C  C    . GLN A 1 640 ? -16.476 58.556 46.874 1.00 53.96  ? 848  GLN A C    1 
ATOM   9261  O  O    . GLN A 1 640 ? -16.743 58.372 48.066 1.00 49.31  ? 848  GLN A O    1 
ATOM   9262  C  CB   . GLN A 1 640 ? -17.706 57.074 45.297 1.00 71.52  ? 848  GLN A CB   1 
ATOM   9263  C  CG   . GLN A 1 640 ? -17.773 55.792 44.475 1.00 80.49  ? 848  GLN A CG   1 
ATOM   9264  C  CD   . GLN A 1 640 ? -17.662 56.043 42.984 1.00 89.28  ? 848  GLN A CD   1 
ATOM   9265  O  OE1  . GLN A 1 640 ? -18.625 56.458 42.339 1.00 93.36  ? 848  GLN A OE1  1 
ATOM   9266  N  NE2  . GLN A 1 640 ? -16.484 55.787 42.428 1.00 91.30  ? 848  GLN A NE2  1 
ATOM   9267  H  H    . GLN A 1 640 ? -16.407 55.905 47.228 1.00 71.45  ? 848  GLN A H    1 
ATOM   9268  H  HA   . GLN A 1 640 ? -15.715 57.598 45.225 1.00 74.11  ? 848  GLN A HA   1 
ATOM   9269  H  HB2  . GLN A 1 640 ? -18.366 57.003 46.005 1.00 85.83  ? 848  GLN A HB2  1 
ATOM   9270  H  HB3  . GLN A 1 640 ? -17.938 57.811 44.710 1.00 85.83  ? 848  GLN A HB3  1 
ATOM   9271  H  HG2  . GLN A 1 640 ? -17.041 55.211 44.736 1.00 96.59  ? 848  GLN A HG2  1 
ATOM   9272  H  HG3  . GLN A 1 640 ? -18.621 55.353 44.643 1.00 96.59  ? 848  GLN A HG3  1 
ATOM   9273  H  HE21 . GLN A 1 640 ? -15.834 55.498 42.911 1.00 109.56 ? 848  GLN A HE21 1 
ATOM   9274  H  HE22 . GLN A 1 640 ? -16.370 55.913 41.585 1.00 109.56 ? 848  GLN A HE22 1 
ATOM   9275  N  N    . PRO A 1 641 ? -16.297 59.783 46.388 1.00 50.58  ? 849  PRO A N    1 
ATOM   9276  C  CA   . PRO A 1 641 ? -16.530 60.948 47.251 1.00 49.27  ? 849  PRO A CA   1 
ATOM   9277  C  C    . PRO A 1 641 ? -17.911 60.881 47.886 1.00 48.23  ? 849  PRO A C    1 
ATOM   9278  O  O    . PRO A 1 641 ? -18.911 60.610 47.218 1.00 48.31  ? 849  PRO A O    1 
ATOM   9279  C  CB   . PRO A 1 641 ? -16.395 62.132 46.288 1.00 50.23  ? 849  PRO A CB   1 
ATOM   9280  C  CG   . PRO A 1 641 ? -15.481 61.630 45.219 1.00 50.13  ? 849  PRO A CG   1 
ATOM   9281  C  CD   . PRO A 1 641 ? -15.841 60.181 45.045 1.00 49.83  ? 849  PRO A CD   1 
ATOM   9282  H  HA   . PRO A 1 641 ? -15.852 61.007 47.941 1.00 59.13  ? 849  PRO A HA   1 
ATOM   9283  H  HB2  . PRO A 1 641 ? -17.264 62.360 45.922 1.00 60.28  ? 849  PRO A HB2  1 
ATOM   9284  H  HB3  . PRO A 1 641 ? -16.004 62.890 46.751 1.00 60.28  ? 849  PRO A HB3  1 
ATOM   9285  H  HG2  . PRO A 1 641 ? -15.636 62.123 44.398 1.00 60.16  ? 849  PRO A HG2  1 
ATOM   9286  H  HG3  . PRO A 1 641 ? -14.559 61.723 45.507 1.00 60.16  ? 849  PRO A HG3  1 
ATOM   9287  H  HD2  . PRO A 1 641 ? -16.560 60.085 44.401 1.00 59.80  ? 849  PRO A HD2  1 
ATOM   9288  H  HD3  . PRO A 1 641 ? -15.060 59.667 44.787 1.00 59.80  ? 849  PRO A HD3  1 
ATOM   9289  N  N    . ILE A 1 642 ? -17.961 61.116 49.198 1.00 48.82  ? 850  ILE A N    1 
ATOM   9290  C  CA   . ILE A 1 642 ? -19.196 60.910 49.941 1.00 52.19  ? 850  ILE A CA   1 
ATOM   9291  C  C    . ILE A 1 642 ? -20.185 62.018 49.607 1.00 58.27  ? 850  ILE A C    1 
ATOM   9292  O  O    . ILE A 1 642 ? -19.803 63.175 49.384 1.00 55.59  ? 850  ILE A O    1 
ATOM   9293  C  CB   . ILE A 1 642 ? -18.912 60.844 51.452 1.00 48.30  ? 850  ILE A CB   1 
ATOM   9294  C  CG1  . ILE A 1 642 ? -20.175 60.422 52.206 1.00 48.01  ? 850  ILE A CG1  1 
ATOM   9295  C  CG2  . ILE A 1 642 ? -18.397 62.185 51.962 1.00 50.94  ? 850  ILE A CG2  1 
ATOM   9296  C  CD1  . ILE A 1 642 ? -19.934 60.064 53.656 1.00 50.01  ? 850  ILE A CD1  1 
ATOM   9297  H  H    . ILE A 1 642 ? -17.300 61.391 49.673 1.00 58.59  ? 850  ILE A H    1 
ATOM   9298  H  HA   . ILE A 1 642 ? -19.590 60.065 49.673 1.00 62.63  ? 850  ILE A HA   1 
ATOM   9299  H  HB   . ILE A 1 642 ? -18.227 60.175 51.605 1.00 57.96  ? 850  ILE A HB   1 
ATOM   9300  H  HG12 . ILE A 1 642 ? -20.811 61.155 52.184 1.00 57.61  ? 850  ILE A HG12 1 
ATOM   9301  H  HG13 . ILE A 1 642 ? -20.555 59.645 51.768 1.00 57.61  ? 850  ILE A HG13 1 
ATOM   9302  H  HG21 . ILE A 1 642 ? -18.226 62.116 52.915 1.00 61.12  ? 850  ILE A HG21 1 
ATOM   9303  H  HG22 . ILE A 1 642 ? -17.577 62.407 51.494 1.00 61.12  ? 850  ILE A HG22 1 
ATOM   9304  H  HG23 . ILE A 1 642 ? -19.068 62.865 51.795 1.00 61.12  ? 850  ILE A HG23 1 
ATOM   9305  H  HD11 . ILE A 1 642 ? -20.777 59.809 54.062 1.00 60.01  ? 850  ILE A HD11 1 
ATOM   9306  H  HD12 . ILE A 1 642 ? -19.308 59.323 53.697 1.00 60.01  ? 850  ILE A HD12 1 
ATOM   9307  H  HD13 . ILE A 1 642 ? -19.565 60.835 54.114 1.00 60.01  ? 850  ILE A HD13 1 
ATOM   9308  N  N    . LYS A 1 643 ? -21.466 61.664 49.567 1.00 68.96  ? 851  LYS A N    1 
ATOM   9309  C  CA   . LYS A 1 643 ? -22.536 62.583 49.218 1.00 79.79  ? 851  LYS A CA   1 
ATOM   9310  C  C    . LYS A 1 643 ? -23.195 63.146 50.469 1.00 79.23  ? 851  LYS A C    1 
ATOM   9311  O  O    . LYS A 1 643 ? -23.089 62.568 51.555 1.00 76.83  ? 851  LYS A O    1 
ATOM   9312  C  CB   . LYS A 1 643 ? -23.585 61.871 48.358 1.00 89.37  ? 851  LYS A CB   1 
ATOM   9313  C  CG   . LYS A 1 643 ? -23.047 61.365 47.029 1.00 96.78  ? 851  LYS A CG   1 
ATOM   9314  C  CD   . LYS A 1 643 ? -24.129 60.672 46.214 1.00 106.81 ? 851  LYS A CD   1 
ATOM   9315  C  CE   . LYS A 1 643 ? -23.577 60.124 44.907 1.00 114.16 ? 851  LYS A CE   1 
ATOM   9316  N  NZ   . LYS A 1 643 ? -22.957 61.189 44.070 1.00 118.78 ? 851  LYS A NZ   1 
ATOM   9317  H  H    . LYS A 1 643 ? -21.745 60.870 49.745 1.00 82.76  ? 851  LYS A H    1 
ATOM   9318  H  HA   . LYS A 1 643 ? -22.171 63.322 48.706 1.00 95.75  ? 851  LYS A HA   1 
ATOM   9319  H  HB2  . LYS A 1 643 ? -23.926 61.107 48.850 1.00 107.25 ? 851  LYS A HB2  1 
ATOM   9320  H  HB3  . LYS A 1 643 ? -24.307 62.490 48.170 1.00 107.25 ? 851  LYS A HB3  1 
ATOM   9321  H  HG2  . LYS A 1 643 ? -22.712 62.116 46.514 1.00 116.14 ? 851  LYS A HG2  1 
ATOM   9322  H  HG3  . LYS A 1 643 ? -22.335 60.727 47.194 1.00 116.14 ? 851  LYS A HG3  1 
ATOM   9323  H  HD2  . LYS A 1 643 ? -24.491 59.932 46.726 1.00 128.17 ? 851  LYS A HD2  1 
ATOM   9324  H  HD3  . LYS A 1 643 ? -24.830 61.310 46.004 1.00 128.17 ? 851  LYS A HD3  1 
ATOM   9325  H  HE2  . LYS A 1 643 ? -22.898 59.459 45.102 1.00 137.00 ? 851  LYS A HE2  1 
ATOM   9326  H  HE3  . LYS A 1 643 ? -24.301 59.723 44.400 1.00 137.00 ? 851  LYS A HE3  1 
ATOM   9327  H  HZ1  . LYS A 1 643 ? -22.645 60.837 43.314 1.00 142.54 ? 851  LYS A HZ1  1 
ATOM   9328  H  HZ2  . LYS A 1 643 ? -23.563 61.810 43.871 1.00 142.54 ? 851  LYS A HZ2  1 
ATOM   9329  H  HZ3  . LYS A 1 643 ? -22.285 61.570 44.511 1.00 142.54 ? 851  LYS A HZ3  1 
ATOM   9330  N  N    . PRO A 1 644 ? -23.891 64.281 50.351 1.00 80.66  ? 852  PRO A N    1 
ATOM   9331  C  CA   . PRO A 1 644 ? -24.504 64.889 51.548 1.00 79.28  ? 852  PRO A CA   1 
ATOM   9332  C  C    . PRO A 1 644 ? -25.373 63.934 52.352 1.00 75.88  ? 852  PRO A C    1 
ATOM   9333  O  O    . PRO A 1 644 ? -25.223 63.847 53.578 1.00 75.33  ? 852  PRO A O    1 
ATOM   9334  C  CB   . PRO A 1 644 ? -25.316 66.051 50.960 1.00 83.34  ? 852  PRO A CB   1 
ATOM   9335  C  CG   . PRO A 1 644 ? -24.609 66.403 49.698 1.00 84.14  ? 852  PRO A CG   1 
ATOM   9336  C  CD   . PRO A 1 644 ? -24.084 65.109 49.148 1.00 82.44  ? 852  PRO A CD   1 
ATOM   9337  H  HA   . PRO A 1 644 ? -23.813 65.249 52.127 1.00 95.14  ? 852  PRO A HA   1 
ATOM   9338  H  HB2  . PRO A 1 644 ? -26.222 65.759 50.777 1.00 100.01 ? 852  PRO A HB2  1 
ATOM   9339  H  HB3  . PRO A 1 644 ? -25.312 66.800 51.576 1.00 100.01 ? 852  PRO A HB3  1 
ATOM   9340  H  HG2  . PRO A 1 644 ? -25.235 66.808 49.077 1.00 100.96 ? 852  PRO A HG2  1 
ATOM   9341  H  HG3  . PRO A 1 644 ? -23.880 67.012 49.893 1.00 100.96 ? 852  PRO A HG3  1 
ATOM   9342  H  HD2  . PRO A 1 644 ? -24.738 64.702 48.559 1.00 98.93  ? 852  PRO A HD2  1 
ATOM   9343  H  HD3  . PRO A 1 644 ? -23.238 65.252 48.697 1.00 98.93  ? 852  PRO A HD3  1 
ATOM   9344  N  N    . GLU A 1 645 ? -26.285 63.213 51.696 1.00 73.29  ? 853  GLU A N    1 
ATOM   9345  C  CA   . GLU A 1 645 ? -27.178 62.317 52.423 1.00 70.64  ? 853  GLU A CA   1 
ATOM   9346  C  C    . GLU A 1 645 ? -26.405 61.235 53.168 1.00 67.65  ? 853  GLU A C    1 
ATOM   9347  O  O    . GLU A 1 645 ? -26.829 60.800 54.245 1.00 65.84  ? 853  GLU A O    1 
ATOM   9348  C  CB   . GLU A 1 645 ? -28.184 61.687 51.459 1.00 69.64  ? 853  GLU A CB   1 
ATOM   9349  H  H    . GLU A 1 645 ? -26.403 63.225 50.844 1.00 87.95  ? 853  GLU A H    1 
ATOM   9350  H  HA   . GLU A 1 645 ? -27.675 62.832 53.078 1.00 84.77  ? 853  GLU A HA   1 
ATOM   9351  N  N    . GLU A 1 646 ? -25.274 60.791 52.619 1.00 66.34  ? 854  GLU A N    1 
ATOM   9352  C  CA   . GLU A 1 646 ? -24.465 59.787 53.302 1.00 64.77  ? 854  GLU A CA   1 
ATOM   9353  C  C    . GLU A 1 646 ? -23.699 60.390 54.474 1.00 63.68  ? 854  GLU A C    1 
ATOM   9354  O  O    . GLU A 1 646 ? -23.637 59.790 55.553 1.00 61.78  ? 854  GLU A O    1 
ATOM   9355  C  CB   . GLU A 1 646 ? -23.497 59.134 52.314 1.00 61.55  ? 854  GLU A CB   1 
ATOM   9356  H  H    . GLU A 1 646 ? -24.958 61.052 51.863 1.00 79.61  ? 854  GLU A H    1 
ATOM   9357  H  HA   . GLU A 1 646 ? -25.049 59.095 53.650 1.00 77.72  ? 854  GLU A HA   1 
ATOM   9358  N  N    . ALA A 1 647 ? -23.122 61.579 54.285 1.00 64.76  ? 855  ALA A N    1 
ATOM   9359  C  CA   . ALA A 1 647 ? -22.308 62.187 55.332 1.00 65.02  ? 855  ALA A CA   1 
ATOM   9360  C  C    . ALA A 1 647 ? -23.140 62.519 56.564 1.00 69.92  ? 855  ALA A C    1 
ATOM   9361  O  O    . ALA A 1 647 ? -22.670 62.368 57.698 1.00 67.20  ? 855  ALA A O    1 
ATOM   9362  C  CB   . ALA A 1 647 ? -21.624 63.445 54.796 1.00 63.12  ? 855  ALA A CB   1 
ATOM   9363  H  H    . ALA A 1 647 ? -23.187 62.047 53.566 1.00 77.72  ? 855  ALA A H    1 
ATOM   9364  H  HA   . ALA A 1 647 ? -21.616 61.560 55.598 1.00 78.03  ? 855  ALA A HA   1 
ATOM   9365  H  HB1  . ALA A 1 647 ? -21.088 63.837 55.503 1.00 75.75  ? 855  ALA A HB1  1 
ATOM   9366  H  HB2  . ALA A 1 647 ? -21.059 63.202 54.047 1.00 75.75  ? 855  ALA A HB2  1 
ATOM   9367  H  HB3  . ALA A 1 647 ? -22.304 64.074 54.508 1.00 75.75  ? 855  ALA A HB3  1 
ATOM   9368  N  N    . LEU A 1 648 ? -24.378 62.978 56.364 1.00 76.94  ? 856  LEU A N    1 
ATOM   9369  C  CA   . LEU A 1 648 ? -25.209 63.372 57.497 1.00 84.10  ? 856  LEU A CA   1 
ATOM   9370  C  C    . LEU A 1 648 ? -25.597 62.166 58.344 1.00 77.46  ? 856  LEU A C    1 
ATOM   9371  O  O    . LEU A 1 648 ? -25.656 62.260 59.576 1.00 75.41  ? 856  LEU A O    1 
ATOM   9372  C  CB   . LEU A 1 648 ? -26.455 64.108 57.003 1.00 98.28  ? 856  LEU A CB   1 
ATOM   9373  C  CG   . LEU A 1 648 ? -27.449 64.560 58.077 1.00 110.02 ? 856  LEU A CG   1 
ATOM   9374  C  CD1  . LEU A 1 648 ? -26.770 65.426 59.130 1.00 112.58 ? 856  LEU A CD1  1 
ATOM   9375  C  CD2  . LEU A 1 648 ? -28.608 65.308 57.440 1.00 116.48 ? 856  LEU A CD2  1 
ATOM   9376  H  H    . LEU A 1 648 ? -24.752 63.069 55.595 1.00 92.33  ? 856  LEU A H    1 
ATOM   9377  H  HA   . LEU A 1 648 ? -24.705 63.981 58.059 1.00 100.92 ? 856  LEU A HA   1 
ATOM   9378  H  HB2  . LEU A 1 648 ? -26.169 64.901 56.523 1.00 117.94 ? 856  LEU A HB2  1 
ATOM   9379  H  HB3  . LEU A 1 648 ? -26.934 63.521 56.397 1.00 117.94 ? 856  LEU A HB3  1 
ATOM   9380  H  HG   . LEU A 1 648 ? -27.808 63.777 58.522 1.00 132.03 ? 856  LEU A HG   1 
ATOM   9381  H  HD11 . LEU A 1 648 ? -27.428 65.693 59.791 1.00 135.09 ? 856  LEU A HD11 1 
ATOM   9382  H  HD12 . LEU A 1 648 ? -26.065 64.913 59.554 1.00 135.09 ? 856  LEU A HD12 1 
ATOM   9383  H  HD13 . LEU A 1 648 ? -26.396 66.211 58.700 1.00 135.09 ? 856  LEU A HD13 1 
ATOM   9384  H  HD21 . LEU A 1 648 ? -29.225 65.586 58.136 1.00 139.78 ? 856  LEU A HD21 1 
ATOM   9385  H  HD22 . LEU A 1 648 ? -28.264 66.086 56.974 1.00 139.78 ? 856  LEU A HD22 1 
ATOM   9386  H  HD23 . LEU A 1 648 ? -29.058 64.719 56.815 1.00 139.78 ? 856  LEU A HD23 1 
ATOM   9387  N  N    . LYS A 1 649 ? -25.863 61.024 57.708 1.00 73.50  ? 857  LYS A N    1 
ATOM   9388  C  CA   . LYS A 1 649 ? -26.246 59.831 58.452 1.00 70.11  ? 857  LYS A CA   1 
ATOM   9389  C  C    . LYS A 1 649 ? -25.070 59.208 59.194 1.00 65.26  ? 857  LYS A C    1 
ATOM   9390  O  O    . LYS A 1 649 ? -25.284 58.484 60.172 1.00 64.59  ? 857  LYS A O    1 
ATOM   9391  C  CB   . LYS A 1 649 ? -26.864 58.800 57.506 1.00 70.74  ? 857  LYS A CB   1 
ATOM   9392  C  CG   . LYS A 1 649 ? -27.379 57.551 58.201 1.00 71.76  ? 857  LYS A CG   1 
ATOM   9393  H  H    . LYS A 1 649 ? -25.830 60.918 56.855 1.00 88.20  ? 857  LYS A H    1 
ATOM   9394  H  HA   . LYS A 1 649 ? -26.917 60.073 59.109 1.00 84.13  ? 857  LYS A HA   1 
ATOM   9395  H  HB2  . LYS A 1 649 ? -27.612 59.210 57.043 1.00 84.89  ? 857  LYS A HB2  1 
ATOM   9396  H  HB3  . LYS A 1 649 ? -26.192 58.524 56.863 1.00 84.89  ? 857  LYS A HB3  1 
ATOM   9397  N  N    . LEU A 1 650 ? -23.838 59.483 58.762 1.00 60.81  ? 858  LEU A N    1 
ATOM   9398  C  CA   . LEU A 1 650 ? -22.659 58.833 59.319 1.00 56.97  ? 858  LEU A CA   1 
ATOM   9399  C  C    . LEU A 1 650 ? -21.929 59.674 60.358 1.00 53.07  ? 858  LEU A C    1 
ATOM   9400  O  O    . LEU A 1 650 ? -21.242 59.106 61.214 1.00 50.09  ? 858  LEU A O    1 
ATOM   9401  C  CB   . LEU A 1 650 ? -21.677 58.478 58.193 1.00 55.58  ? 858  LEU A CB   1 
ATOM   9402  C  CG   . LEU A 1 650 ? -20.424 57.688 58.581 1.00 56.01  ? 858  LEU A CG   1 
ATOM   9403  C  CD1  . LEU A 1 650 ? -20.800 56.312 59.101 1.00 57.02  ? 858  LEU A CD1  1 
ATOM   9404  C  CD2  . LEU A 1 650 ? -19.469 57.573 57.401 1.00 54.41  ? 858  LEU A CD2  1 
ATOM   9405  H  H    . LEU A 1 650 ? -23.660 60.050 58.140 1.00 72.98  ? 858  LEU A H    1 
ATOM   9406  H  HA   . LEU A 1 650 ? -22.932 58.006 59.747 1.00 68.37  ? 858  LEU A HA   1 
ATOM   9407  H  HB2  . LEU A 1 650 ? -22.154 57.951 57.533 1.00 66.70  ? 858  LEU A HB2  1 
ATOM   9408  H  HB3  . LEU A 1 650 ? -21.377 59.305 57.783 1.00 66.70  ? 858  LEU A HB3  1 
ATOM   9409  H  HG   . LEU A 1 650 ? -19.964 58.160 59.293 1.00 67.21  ? 858  LEU A HG   1 
ATOM   9410  H  HD11 . LEU A 1 650 ? -19.991 55.834 59.340 1.00 68.43  ? 858  LEU A HD11 1 
ATOM   9411  H  HD12 . LEU A 1 650 ? -21.367 56.414 59.882 1.00 68.43  ? 858  LEU A HD12 1 
ATOM   9412  H  HD13 . LEU A 1 650 ? -21.277 55.832 58.406 1.00 68.43  ? 858  LEU A HD13 1 
ATOM   9413  H  HD21 . LEU A 1 650 ? -18.687 57.069 57.676 1.00 65.30  ? 858  LEU A HD21 1 
ATOM   9414  H  HD22 . LEU A 1 650 ? -19.920 57.115 56.674 1.00 65.30  ? 858  LEU A HD22 1 
ATOM   9415  H  HD23 . LEU A 1 650 ? -19.207 58.464 57.119 1.00 65.30  ? 858  LEU A HD23 1 
ATOM   9416  N  N    . HIS A 1 651 ? -22.066 60.999 60.315 1.00 52.18  ? 859  HIS A N    1 
ATOM   9417  C  CA   . HIS A 1 651 ? -21.227 61.896 61.098 1.00 50.61  ? 859  HIS A CA   1 
ATOM   9418  C  C    . HIS A 1 651 ? -21.994 62.663 62.169 1.00 51.87  ? 859  HIS A C    1 
ATOM   9419  O  O    . HIS A 1 651 ? -21.436 63.589 62.767 1.00 50.83  ? 859  HIS A O    1 
ATOM   9420  C  CB   . HIS A 1 651 ? -20.521 62.884 60.165 1.00 48.84  ? 859  HIS A CB   1 
ATOM   9421  C  CG   . HIS A 1 651 ? -19.600 62.233 59.181 1.00 45.42  ? 859  HIS A CG   1 
ATOM   9422  N  ND1  . HIS A 1 651 ? -19.233 62.832 57.995 1.00 46.34  ? 859  HIS A ND1  1 
ATOM   9423  C  CD2  . HIS A 1 651 ? -18.963 61.038 59.210 1.00 44.69  ? 859  HIS A CD2  1 
ATOM   9424  C  CE1  . HIS A 1 651 ? -18.415 62.032 57.333 1.00 43.87  ? 859  HIS A CE1  1 
ATOM   9425  N  NE2  . HIS A 1 651 ? -18.236 60.937 58.048 1.00 43.53  ? 859  HIS A NE2  1 
ATOM   9426  H  H    . HIS A 1 651 ? -22.649 61.406 59.830 1.00 62.62  ? 859  HIS A H    1 
ATOM   9427  H  HA   . HIS A 1 651 ? -20.543 61.372 61.544 1.00 60.74  ? 859  HIS A HA   1 
ATOM   9428  H  HB2  . HIS A 1 651 ? -21.192 63.373 59.663 1.00 58.61  ? 859  HIS A HB2  1 
ATOM   9429  H  HB3  . HIS A 1 651 ? -19.996 63.499 60.700 1.00 58.61  ? 859  HIS A HB3  1 
ATOM   9430  H  HD1  . HIS A 1 651 ? -19.498 63.605 57.726 1.00 55.60  ? 859  HIS A HD1  1 
ATOM   9431  H  HD2  . HIS A 1 651 ? -19.012 60.402 59.887 1.00 53.63  ? 859  HIS A HD2  1 
ATOM   9432  H  HE1  . HIS A 1 651 ? -18.032 62.211 56.505 1.00 52.65  ? 859  HIS A HE1  1 
ATOM   9433  N  N    . ASN A 1 652 ? -23.247 62.302 62.440 1.00 54.18  ? 860  ASN A N    1 
ATOM   9434  C  CA   . ASN A 1 652 ? -24.078 63.057 63.369 1.00 58.75  ? 860  ASN A CA   1 
ATOM   9435  C  C    . ASN A 1 652 ? -24.300 62.332 64.691 1.00 57.31  ? 860  ASN A C    1 
ATOM   9436  O  O    . ASN A 1 652 ? -25.175 62.733 65.464 1.00 56.97  ? 860  ASN A O    1 
ATOM   9437  C  CB   . ASN A 1 652 ? -25.426 63.382 62.722 1.00 63.73  ? 860  ASN A CB   1 
ATOM   9438  C  CG   . ASN A 1 652 ? -26.035 64.662 63.258 1.00 70.54  ? 860  ASN A CG   1 
ATOM   9439  O  OD1  . ASN A 1 652 ? -25.636 65.162 64.309 1.00 71.79  ? 860  ASN A OD1  1 
ATOM   9440  N  ND2  . ASN A 1 652 ? -27.011 65.199 62.535 1.00 74.77  ? 860  ASN A ND2  1 
ATOM   9441  H  H    . ASN A 1 652 ? -23.639 61.618 62.096 1.00 65.01  ? 860  ASN A H    1 
ATOM   9442  H  HA   . ASN A 1 652 ? -23.636 63.898 63.566 1.00 70.50  ? 860  ASN A HA   1 
ATOM   9443  H  HB2  . ASN A 1 652 ? -25.301 63.486 61.766 1.00 76.48  ? 860  ASN A HB2  1 
ATOM   9444  H  HB3  . ASN A 1 652 ? -26.046 62.657 62.899 1.00 76.48  ? 860  ASN A HB3  1 
ATOM   9445  H  HD21 . ASN A 1 652 ? -27.389 65.926 62.796 1.00 89.72  ? 860  ASN A HD21 1 
ATOM   9446  H  HD22 . ASN A 1 652 ? -27.263 64.821 61.805 1.00 89.72  ? 860  ASN A HD22 1 
ATOM   9447  N  N    . GLY A 1 653 ? -23.534 61.282 64.977 1.00 53.78  ? 861  GLY A N    1 
ATOM   9448  C  CA   . GLY A 1 653 ? -23.678 60.563 66.221 1.00 52.35  ? 861  GLY A CA   1 
ATOM   9449  C  C    . GLY A 1 653 ? -24.558 59.338 66.081 1.00 53.38  ? 861  GLY A C    1 
ATOM   9450  O  O    . GLY A 1 653 ? -25.128 59.070 65.019 1.00 56.00  ? 861  GLY A O    1 
ATOM   9451  H  H    . GLY A 1 653 ? -22.922 60.971 64.459 1.00 64.54  ? 861  GLY A H    1 
ATOM   9452  H  HA2  . GLY A 1 653 ? -22.805 60.280 66.533 1.00 62.82  ? 861  GLY A HA2  1 
ATOM   9453  H  HA3  . GLY A 1 653 ? -24.069 61.148 66.888 1.00 62.82  ? 861  GLY A HA3  1 
ATOM   9454  N  N    . PRO A 1 654 ? -24.697 58.578 67.166 1.00 53.01  ? 862  PRO A N    1 
ATOM   9455  C  CA   . PRO A 1 654 ? -25.343 57.263 67.071 1.00 57.74  ? 862  PRO A CA   1 
ATOM   9456  C  C    . PRO A 1 654 ? -26.771 57.347 66.551 1.00 68.91  ? 862  PRO A C    1 
ATOM   9457  O  O    . PRO A 1 654 ? -27.441 58.379 66.643 1.00 68.06  ? 862  PRO A O    1 
ATOM   9458  C  CB   . PRO A 1 654 ? -25.303 56.738 68.513 1.00 52.84  ? 862  PRO A CB   1 
ATOM   9459  C  CG   . PRO A 1 654 ? -25.060 57.938 69.368 1.00 51.02  ? 862  PRO A CG   1 
ATOM   9460  C  CD   . PRO A 1 654 ? -24.260 58.885 68.538 1.00 50.09  ? 862  PRO A CD   1 
ATOM   9461  H  HA   . PRO A 1 654 ? -24.826 56.673 66.500 1.00 69.29  ? 862  PRO A HA   1 
ATOM   9462  H  HB2  . PRO A 1 654 ? -26.154 56.327 68.734 1.00 63.42  ? 862  PRO A HB2  1 
ATOM   9463  H  HB3  . PRO A 1 654 ? -24.580 56.098 68.608 1.00 63.42  ? 862  PRO A HB3  1 
ATOM   9464  H  HG2  . PRO A 1 654 ? -25.909 58.336 69.616 1.00 61.23  ? 862  PRO A HG2  1 
ATOM   9465  H  HG3  . PRO A 1 654 ? -24.563 57.676 70.160 1.00 61.23  ? 862  PRO A HG3  1 
ATOM   9466  H  HD2  . PRO A 1 654 ? -24.477 59.803 68.765 1.00 60.12  ? 862  PRO A HD2  1 
ATOM   9467  H  HD3  . PRO A 1 654 ? -23.311 58.707 68.639 1.00 60.12  ? 862  PRO A HD3  1 
ATOM   9468  N  N    . LEU A 1 655 ? -27.228 56.225 65.987 1.00 78.37  ? 863  LEU A N    1 
ATOM   9469  C  CA   . LEU A 1 655 ? -28.596 56.129 65.486 1.00 86.21  ? 863  LEU A CA   1 
ATOM   9470  C  C    . LEU A 1 655 ? -29.591 56.584 66.547 1.00 94.55  ? 863  LEU A C    1 
ATOM   9471  O  O    . LEU A 1 655 ? -30.411 57.477 66.312 1.00 95.85  ? 863  LEU A O    1 
ATOM   9472  C  CB   . LEU A 1 655 ? -28.888 54.692 65.045 1.00 83.95  ? 863  LEU A CB   1 
ATOM   9473  H  H    . LEU A 1 655 ? -26.765 55.508 65.884 1.00 94.04  ? 863  LEU A H    1 
ATOM   9474  H  HA   . LEU A 1 655 ? -28.693 56.707 64.713 1.00 103.45 ? 863  LEU A HA   1 
ATOM   9475  N  N    . ARG A 1 656 ? -29.534 55.967 67.724 1.00 100.64 ? 864  ARG A N    1 
ATOM   9476  C  CA   . ARG A 1 656 ? -30.234 56.507 68.875 1.00 108.29 ? 864  ARG A CA   1 
ATOM   9477  C  C    . ARG A 1 656 ? -29.489 57.736 69.394 1.00 114.99 ? 864  ARG A C    1 
ATOM   9478  O  O    . ARG A 1 656 ? -28.375 58.049 68.966 1.00 116.12 ? 864  ARG A O    1 
ATOM   9479  C  CB   . ARG A 1 656 ? -30.360 55.450 69.972 1.00 108.33 ? 864  ARG A CB   1 
ATOM   9480  H  H    . ARG A 1 656 ? -29.100 55.241 67.878 1.00 120.77 ? 864  ARG A H    1 
ATOM   9481  H  HA   . ARG A 1 656 ? -31.126 56.780 68.610 1.00 129.94 ? 864  ARG A HA   1 
ATOM   9482  N  N    . ASN A 1 657 ? -30.116 58.439 70.330 1.00 120.77 ? 865  ASN A N    1 
ATOM   9483  C  CA   . ASN A 1 657 ? -29.517 59.639 70.898 1.00 124.50 ? 865  ASN A CA   1 
ATOM   9484  C  C    . ASN A 1 657 ? -28.505 59.335 71.999 1.00 118.47 ? 865  ASN A C    1 
ATOM   9485  O  O    . ASN A 1 657 ? -28.032 60.270 72.654 1.00 124.77 ? 865  ASN A O    1 
ATOM   9486  C  CB   . ASN A 1 657 ? -30.611 60.561 71.445 1.00 133.26 ? 865  ASN A CB   1 
ATOM   9487  H  H    . ASN A 1 657 ? -30.888 58.243 70.652 1.00 144.93 ? 865  ASN A H    1 
ATOM   9488  H  HA   . ASN A 1 657 ? -29.051 60.118 70.194 1.00 149.40 ? 865  ASN A HA   1 
ATOM   9489  N  N    . ALA A 1 658 ? -28.154 58.067 72.211 1.00 105.32 ? 866  ALA A N    1 
ATOM   9490  C  CA   . ALA A 1 658 ? -27.293 57.683 73.319 1.00 95.58  ? 866  ALA A CA   1 
ATOM   9491  C  C    . ALA A 1 658 ? -26.378 56.542 72.900 1.00 80.99  ? 866  ALA A C    1 
ATOM   9492  O  O    . ALA A 1 658 ? -26.717 55.736 72.030 1.00 80.82  ? 866  ALA A O    1 
ATOM   9493  C  CB   . ALA A 1 658 ? -28.115 57.265 74.545 1.00 99.27  ? 866  ALA A CB   1 
ATOM   9494  H  H    . ALA A 1 658 ? -28.405 57.407 71.720 1.00 126.38 ? 866  ALA A H    1 
ATOM   9495  H  HA   . ALA A 1 658 ? -26.739 58.439 73.569 1.00 114.70 ? 866  ALA A HA   1 
ATOM   9496  H  HB1  . ALA A 1 658 ? -27.510 57.017 75.261 1.00 119.13 ? 866  ALA A HB1  1 
ATOM   9497  H  HB2  . ALA A 1 658 ? -28.669 58.011 74.823 1.00 119.13 ? 866  ALA A HB2  1 
ATOM   9498  H  HB3  . ALA A 1 658 ? -28.674 56.509 74.306 1.00 119.13 ? 866  ALA A HB3  1 
ATOM   9499  N  N    . TYR A 1 659 ? -25.210 56.482 73.542 1.00 77.71  ? 867  TYR A N    1 
ATOM   9500  C  CA   . TYR A 1 659 ? -24.252 55.418 73.266 1.00 70.21  ? 867  TYR A CA   1 
ATOM   9501  C  C    . TYR A 1 659 ? -24.616 54.123 73.982 1.00 81.25  ? 867  TYR A C    1 
ATOM   9502  O  O    . TYR A 1 659 ? -24.315 53.035 73.477 1.00 80.29  ? 867  TYR A O    1 
ATOM   9503  C  CB   . TYR A 1 659 ? -22.847 55.869 73.668 1.00 63.40  ? 867  TYR A CB   1 
ATOM   9504  C  CG   . TYR A 1 659 ? -22.284 56.960 72.783 1.00 58.39  ? 867  TYR A CG   1 
ATOM   9505  C  CD1  . TYR A 1 659 ? -21.729 56.655 71.548 1.00 55.14  ? 867  TYR A CD1  1 
ATOM   9506  C  CD2  . TYR A 1 659 ? -22.304 58.293 73.182 1.00 58.72  ? 867  TYR A CD2  1 
ATOM   9507  C  CE1  . TYR A 1 659 ? -21.212 57.641 70.731 1.00 55.82  ? 867  TYR A CE1  1 
ATOM   9508  C  CE2  . TYR A 1 659 ? -21.786 59.291 72.369 1.00 58.79  ? 867  TYR A CE2  1 
ATOM   9509  C  CZ   . TYR A 1 659 ? -21.241 58.955 71.144 1.00 56.88  ? 867  TYR A CZ   1 
ATOM   9510  O  OH   . TYR A 1 659 ? -20.721 59.930 70.321 1.00 54.65  ? 867  TYR A OH   1 
ATOM   9511  H  H    . TYR A 1 659 ? -24.951 57.044 74.139 1.00 93.25  ? 867  TYR A H    1 
ATOM   9512  H  HA   . TYR A 1 659 ? -24.247 55.240 72.313 1.00 84.25  ? 867  TYR A HA   1 
ATOM   9513  H  HB2  . TYR A 1 659 ? -22.874 56.208 74.576 1.00 76.08  ? 867  TYR A HB2  1 
ATOM   9514  H  HB3  . TYR A 1 659 ? -22.247 55.108 73.618 1.00 76.08  ? 867  TYR A HB3  1 
ATOM   9515  H  HD1  . TYR A 1 659 ? -21.707 55.770 71.264 1.00 66.17  ? 867  TYR A HD1  1 
ATOM   9516  H  HD2  . TYR A 1 659 ? -22.670 58.518 74.006 1.00 70.46  ? 867  TYR A HD2  1 
ATOM   9517  H  HE1  . TYR A 1 659 ? -20.844 57.418 69.906 1.00 66.98  ? 867  TYR A HE1  1 
ATOM   9518  H  HE2  . TYR A 1 659 ? -21.805 60.178 72.647 1.00 70.56  ? 867  TYR A HE2  1 
ATOM   9519  H  HH   . TYR A 1 659 ? -20.798 60.683 70.684 1.00 65.58  ? 867  TYR A HH   1 
ATOM   9520  N  N    . MET A 1 660 ? -25.257 54.216 75.146 1.00 91.66  ? 868  MET A N    1 
ATOM   9521  C  CA   . MET A 1 660 ? -25.741 53.049 75.868 1.00 99.13  ? 868  MET A CA   1 
ATOM   9522  C  C    . MET A 1 660 ? -27.097 53.376 76.474 1.00 104.20 ? 868  MET A C    1 
ATOM   9523  O  O    . MET A 1 660 ? -27.465 54.543 76.628 1.00 106.52 ? 868  MET A O    1 
ATOM   9524  C  CB   . MET A 1 660 ? -24.769 52.611 76.974 1.00 100.60 ? 868  MET A CB   1 
ATOM   9525  C  CG   . MET A 1 660 ? -23.319 52.510 76.533 1.00 100.98 ? 868  MET A CG   1 
ATOM   9526  S  SD   . MET A 1 660 ? -22.326 51.456 77.610 1.00 102.84 ? 868  MET A SD   1 
ATOM   9527  C  CE   . MET A 1 660 ? -22.646 52.188 79.214 1.00 106.77 ? 868  MET A CE   1 
ATOM   9528  H  H    . MET A 1 660 ? -25.426 54.960 75.543 1.00 109.99 ? 868  MET A H    1 
ATOM   9529  H  HA   . MET A 1 660 ? -25.840 52.311 75.246 1.00 118.96 ? 868  MET A HA   1 
ATOM   9530  H  HB2  . MET A 1 660 ? -24.812 53.256 77.698 1.00 120.73 ? 868  MET A HB2  1 
ATOM   9531  H  HB3  . MET A 1 660 ? -25.039 51.738 77.298 1.00 120.73 ? 868  MET A HB3  1 
ATOM   9532  H  HG2  . MET A 1 660 ? -23.288 52.138 75.637 1.00 121.18 ? 868  MET A HG2  1 
ATOM   9533  H  HG3  . MET A 1 660 ? -22.926 53.397 76.536 1.00 121.18 ? 868  MET A HG3  1 
ATOM   9534  H  HE1  . MET A 1 660 ? -22.155 51.695 79.889 1.00 128.12 ? 868  MET A HE1  1 
ATOM   9535  H  HE2  . MET A 1 660 ? -22.355 53.113 79.202 1.00 128.12 ? 868  MET A HE2  1 
ATOM   9536  H  HE3  . MET A 1 660 ? -23.598 52.142 79.397 1.00 128.12 ? 868  MET A HE3  1 
ATOM   9537  N  N    . GLU A 1 661 ? -27.846 52.325 76.815 1.00 104.55 ? 869  GLU A N    1 
ATOM   9538  C  CA   . GLU A 1 661 ? -29.118 52.529 77.501 1.00 106.49 ? 869  GLU A CA   1 
ATOM   9539  C  C    . GLU A 1 661 ? -28.915 53.301 78.798 1.00 106.52 ? 869  GLU A C    1 
ATOM   9540  O  O    . GLU A 1 661 ? -29.671 54.231 79.104 1.00 107.47 ? 869  GLU A O    1 
ATOM   9541  C  CB   . GLU A 1 661 ? -29.787 51.182 77.774 1.00 108.16 ? 869  GLU A CB   1 
ATOM   9542  H  H    . GLU A 1 661 ? -27.644 51.503 76.664 1.00 125.46 ? 869  GLU A H    1 
ATOM   9543  H  HA   . GLU A 1 661 ? -29.706 53.047 76.930 1.00 127.79 ? 869  GLU A HA   1 
ATOM   9544  N  N    . GLN A 1 662 ? -27.895 52.933 79.567 1.00 106.08 ? 870  GLN A N    1 
ATOM   9545  C  CA   . GLN A 1 662 ? -27.574 53.646 80.795 1.00 106.69 ? 870  GLN A CA   1 
ATOM   9546  C  C    . GLN A 1 662 ? -26.972 55.009 80.472 1.00 104.42 ? 870  GLN A C    1 
ATOM   9547  O  O    . GLN A 1 662 ? -26.162 55.147 79.551 1.00 103.35 ? 870  GLN A O    1 
ATOM   9548  C  CB   . GLN A 1 662 ? -26.600 52.819 81.634 1.00 106.15 ? 870  GLN A CB   1 
ATOM   9549  C  CG   . GLN A 1 662 ? -26.196 53.453 82.952 1.00 106.81 ? 870  GLN A CG   1 
ATOM   9550  C  CD   . GLN A 1 662 ? -25.191 52.608 83.709 1.00 106.29 ? 870  GLN A CD   1 
ATOM   9551  O  OE1  . GLN A 1 662 ? -24.861 51.496 83.295 1.00 104.73 ? 870  GLN A OE1  1 
ATOM   9552  N  NE2  . GLN A 1 662 ? -24.695 53.134 84.822 1.00 107.81 ? 870  GLN A NE2  1 
ATOM   9553  H  H    . GLN A 1 662 ? -27.372 52.271 79.398 1.00 127.29 ? 870  GLN A H    1 
ATOM   9554  H  HA   . GLN A 1 662 ? -28.384 53.782 81.310 1.00 128.03 ? 870  GLN A HA   1 
ATOM   9555  H  HB2  . GLN A 1 662 ? -27.014 51.965 81.835 1.00 127.39 ? 870  GLN A HB2  1 
ATOM   9556  H  HB3  . GLN A 1 662 ? -25.792 52.676 81.118 1.00 127.39 ? 870  GLN A HB3  1 
ATOM   9557  H  HG2  . GLN A 1 662 ? -25.794 54.318 82.778 1.00 128.17 ? 870  GLN A HG2  1 
ATOM   9558  H  HG3  . GLN A 1 662 ? -26.983 53.557 83.509 1.00 128.17 ? 870  GLN A HG3  1 
ATOM   9559  H  HE21 . GLN A 1 662 ? -24.949 53.914 85.079 1.00 129.37 ? 870  GLN A HE21 1 
ATOM   9560  H  HE22 . GLN A 1 662 ? -24.120 52.694 85.286 1.00 129.37 ? 870  GLN A HE22 1 
ATOM   9561  N  N    . SER A 1 663 ? -27.373 56.021 81.237 1.00 102.56 ? 871  SER A N    1 
ATOM   9562  C  CA   . SER A 1 663 ? -26.920 57.389 81.036 1.00 97.37  ? 871  SER A CA   1 
ATOM   9563  C  C    . SER A 1 663 ? -25.965 57.805 82.148 1.00 90.91  ? 871  SER A C    1 
ATOM   9564  O  O    . SER A 1 663 ? -25.945 57.222 83.235 1.00 90.49  ? 871  SER A O    1 
ATOM   9565  C  CB   . SER A 1 663 ? -28.105 58.357 80.983 1.00 100.27 ? 871  SER A CB   1 
ATOM   9566  O  OG   . SER A 1 663 ? -27.654 59.698 80.908 1.00 100.06 ? 871  SER A OG   1 
ATOM   9567  H  H    . SER A 1 663 ? -27.921 55.935 81.894 1.00 123.08 ? 871  SER A H    1 
ATOM   9568  H  HA   . SER A 1 663 ? -26.445 57.446 80.192 1.00 116.84 ? 871  SER A HA   1 
ATOM   9569  H  HB2  . SER A 1 663 ? -28.641 58.159 80.199 1.00 120.33 ? 871  SER A HB2  1 
ATOM   9570  H  HB3  . SER A 1 663 ? -28.638 58.248 81.786 1.00 120.33 ? 871  SER A HB3  1 
ATOM   9571  H  HG   . SER A 1 663 ? -28.311 60.220 80.879 1.00 120.08 ? 871  SER A HG   1 
ATOM   9572  N  N    . PHE A 1 664 ? -25.168 58.843 81.859 1.00 85.89  ? 872  PHE A N    1 
ATOM   9573  C  CA   . PHE A 1 664 ? -24.173 59.328 82.810 1.00 82.72  ? 872  PHE A CA   1 
ATOM   9574  C  C    . PHE A 1 664 ? -24.153 60.853 82.906 1.00 79.86  ? 872  PHE A C    1 
ATOM   9575  O  O    . PHE A 1 664 ? -23.137 61.423 83.321 1.00 75.49  ? 872  PHE A O    1 
ATOM   9576  C  CB   . PHE A 1 664 ? -22.778 58.813 82.430 1.00 80.77  ? 872  PHE A CB   1 
ATOM   9577  C  CG   . PHE A 1 664 ? -22.695 57.316 82.326 1.00 80.94  ? 872  PHE A CG   1 
ATOM   9578  C  CD1  . PHE A 1 664 ? -22.467 56.542 83.451 1.00 82.03  ? 872  PHE A CD1  1 
ATOM   9579  C  CD2  . PHE A 1 664 ? -22.853 56.683 81.104 1.00 79.41  ? 872  PHE A CD2  1 
ATOM   9580  C  CE1  . PHE A 1 664 ? -22.393 55.164 83.360 1.00 80.93  ? 872  PHE A CE1  1 
ATOM   9581  C  CE2  . PHE A 1 664 ? -22.780 55.306 81.007 1.00 78.18  ? 872  PHE A CE2  1 
ATOM   9582  C  CZ   . PHE A 1 664 ? -22.550 54.546 82.137 1.00 78.61  ? 872  PHE A CZ   1 
ATOM   9583  H  H    . PHE A 1 664 ? -25.187 59.279 81.118 1.00 103.07 ? 872  PHE A H    1 
ATOM   9584  H  HA   . PHE A 1 664 ? -24.388 58.979 83.690 1.00 99.27  ? 872  PHE A HA   1 
ATOM   9585  H  HB2  . PHE A 1 664 ? -22.532 59.185 81.568 1.00 96.92  ? 872  PHE A HB2  1 
ATOM   9586  H  HB3  . PHE A 1 664 ? -22.144 59.100 83.105 1.00 96.92  ? 872  PHE A HB3  1 
ATOM   9587  H  HD1  . PHE A 1 664 ? -22.360 56.954 84.278 1.00 98.43  ? 872  PHE A HD1  1 
ATOM   9588  H  HD2  . PHE A 1 664 ? -23.008 57.190 80.340 1.00 95.30  ? 872  PHE A HD2  1 
ATOM   9589  H  HE1  . PHE A 1 664 ? -22.238 54.655 84.122 1.00 97.12  ? 872  PHE A HE1  1 
ATOM   9590  H  HE2  . PHE A 1 664 ? -22.886 54.892 80.181 1.00 93.82  ? 872  PHE A HE2  1 
ATOM   9591  H  HZ   . PHE A 1 664 ? -22.501 53.620 82.073 1.00 94.33  ? 872  PHE A HZ   1 
ATOM   9592  N  N    . GLN A 1 665 ? -25.249 61.525 82.538 1.00 81.22  ? 873  GLN A N    1 
ATOM   9593  C  CA   . GLN A 1 665 ? -25.287 62.985 82.570 1.00 81.00  ? 873  GLN A CA   1 
ATOM   9594  C  C    . GLN A 1 665 ? -24.966 63.543 83.953 1.00 81.90  ? 873  GLN A C    1 
ATOM   9595  O  O    . GLN A 1 665 ? -24.452 64.661 84.066 1.00 82.98  ? 873  GLN A O    1 
ATOM   9596  C  CB   . GLN A 1 665 ? -26.660 63.474 82.106 1.00 81.38  ? 873  GLN A CB   1 
ATOM   9597  H  H    . GLN A 1 665 ? -25.978 61.158 82.267 1.00 97.46  ? 873  GLN A H    1 
ATOM   9598  H  HA   . GLN A 1 665 ? -24.624 63.329 81.951 1.00 97.20  ? 873  GLN A HA   1 
ATOM   9599  N  N    . SER A 1 666 ? -25.254 62.788 85.013 1.00 81.70  ? 874  SER A N    1 
ATOM   9600  C  CA   . SER A 1 666 ? -24.971 63.267 86.366 1.00 82.51  ? 874  SER A CA   1 
ATOM   9601  C  C    . SER A 1 666 ? -23.477 63.375 86.654 1.00 77.24  ? 874  SER A C    1 
ATOM   9602  O  O    . SER A 1 666 ? -23.100 63.971 87.666 1.00 77.27  ? 874  SER A O    1 
ATOM   9603  C  CB   . SER A 1 666 ? -25.615 62.356 87.415 1.00 86.68  ? 874  SER A CB   1 
ATOM   9604  O  OG   . SER A 1 666 ? -24.774 61.256 87.727 1.00 87.34  ? 874  SER A OG   1 
ATOM   9605  H  H    . SER A 1 666 ? -25.609 62.005 84.978 1.00 98.04  ? 874  SER A H    1 
ATOM   9606  H  HA   . SER A 1 666 ? -25.356 64.152 86.468 1.00 99.01  ? 874  SER A HA   1 
ATOM   9607  H  HB2  . SER A 1 666 ? -25.774 62.869 88.223 1.00 104.02 ? 874  SER A HB2  1 
ATOM   9608  H  HB3  . SER A 1 666 ? -26.456 62.020 87.067 1.00 104.02 ? 874  SER A HB3  1 
ATOM   9609  H  HG   . SER A 1 666 ? -24.041 61.532 88.031 1.00 104.81 ? 874  SER A HG   1 
ATOM   9610  N  N    . LEU A 1 667 ? -22.620 62.793 85.825 1.00 72.01  ? 875  LEU A N    1 
ATOM   9611  C  CA   . LEU A 1 667 ? -21.181 62.895 86.056 1.00 67.63  ? 875  LEU A CA   1 
ATOM   9612  C  C    . LEU A 1 667 ? -20.524 64.109 85.418 1.00 66.40  ? 875  LEU A C    1 
ATOM   9613  O  O    . LEU A 1 667 ? -19.402 64.447 85.805 1.00 63.73  ? 875  LEU A O    1 
ATOM   9614  C  CB   . LEU A 1 667 ? -20.444 61.654 85.549 1.00 62.79  ? 875  LEU A CB   1 
ATOM   9615  C  CG   . LEU A 1 667 ? -20.647 60.359 86.331 1.00 61.60  ? 875  LEU A CG   1 
ATOM   9616  C  CD1  . LEU A 1 667 ? -19.515 59.461 85.947 1.00 59.71  ? 875  LEU A CD1  1 
ATOM   9617  C  CD2  . LEU A 1 667 ? -20.673 60.558 87.837 1.00 62.24  ? 875  LEU A CD2  1 
ATOM   9618  H  H    . LEU A 1 667 ? -22.840 62.337 85.130 1.00 86.42  ? 875  LEU A H    1 
ATOM   9619  H  HA   . LEU A 1 667 ? -21.029 62.953 87.012 1.00 81.16  ? 875  LEU A HA   1 
ATOM   9620  H  HB2  . LEU A 1 667 ? -20.730 61.485 84.637 1.00 75.35  ? 875  LEU A HB2  1 
ATOM   9621  H  HB3  . LEU A 1 667 ? -19.493 61.845 85.555 1.00 75.35  ? 875  LEU A HB3  1 
ATOM   9622  H  HG   . LEU A 1 667 ? -21.479 59.941 86.059 1.00 73.93  ? 875  LEU A HG   1 
ATOM   9623  H  HD11 . LEU A 1 667 ? -19.603 58.620 86.423 1.00 71.66  ? 875  LEU A HD11 1 
ATOM   9624  H  HD12 . LEU A 1 667 ? -19.547 59.305 84.990 1.00 71.66  ? 875  LEU A HD12 1 
ATOM   9625  H  HD13 . LEU A 1 667 ? -18.678 59.890 86.185 1.00 71.66  ? 875  LEU A HD13 1 
ATOM   9626  H  HD21 . LEU A 1 667 ? -20.804 59.699 88.267 1.00 74.69  ? 875  LEU A HD21 1 
ATOM   9627  H  HD22 . LEU A 1 667 ? -19.828 60.943 88.119 1.00 74.69  ? 875  LEU A HD22 1 
ATOM   9628  H  HD23 . LEU A 1 667 ? -21.402 61.157 88.064 1.00 74.69  ? 875  LEU A HD23 1 
ATOM   9629  N  N    . ASN A 1 668 ? -21.152 64.766 84.453 1.00 69.20  ? 876  ASN A N    1 
ATOM   9630  C  CA   . ASN A 1 668 ? -20.465 65.884 83.816 1.00 72.80  ? 876  ASN A CA   1 
ATOM   9631  C  C    . ASN A 1 668 ? -20.020 66.928 84.838 1.00 77.96  ? 876  ASN A C    1 
ATOM   9632  O  O    . ASN A 1 668 ? -18.862 67.377 84.752 1.00 75.97  ? 876  ASN A O    1 
ATOM   9633  C  CB   . ASN A 1 668 ? -21.339 66.494 82.713 1.00 73.34  ? 876  ASN A CB   1 
ATOM   9634  C  CG   . ASN A 1 668 ? -21.388 65.635 81.462 1.00 72.16  ? 876  ASN A CG   1 
ATOM   9635  O  OD1  . ASN A 1 668 ? -22.075 64.618 81.426 1.00 72.44  ? 876  ASN A OD1  1 
ATOM   9636  N  ND2  . ASN A 1 668 ? -20.658 66.049 80.427 1.00 70.45  ? 876  ASN A ND2  1 
ATOM   9637  H  H    . ASN A 1 668 ? -21.942 64.596 84.158 1.00 83.04  ? 876  ASN A H    1 
ATOM   9638  H  HA   . ASN A 1 668 ? -19.663 65.542 83.389 1.00 87.36  ? 876  ASN A HA   1 
ATOM   9639  H  HB2  . ASN A 1 668 ? -22.245 66.591 83.045 1.00 88.01  ? 876  ASN A HB2  1 
ATOM   9640  H  HB3  . ASN A 1 668 ? -20.980 67.361 82.468 1.00 88.01  ? 876  ASN A HB3  1 
ATOM   9641  H  HD21 . ASN A 1 668 ? -20.653 65.597 79.696 1.00 84.54  ? 876  ASN A HD21 1 
ATOM   9642  H  HD22 . ASN A 1 668 ? -20.190 66.768 80.491 1.00 84.54  ? 876  ASN A HD22 1 
ATOM   9643  N  N    . PRO A 1 669 ? -20.831 67.328 85.826 1.00 84.76  ? 877  PRO A N    1 
ATOM   9644  C  CA   . PRO A 1 669 ? -20.341 68.342 86.775 1.00 87.82  ? 877  PRO A CA   1 
ATOM   9645  C  C    . PRO A 1 669 ? -19.260 67.822 87.709 1.00 86.60  ? 877  PRO A C    1 
ATOM   9646  O  O    . PRO A 1 669 ? -18.279 68.531 87.961 1.00 84.78  ? 877  PRO A O    1 
ATOM   9647  C  CB   . PRO A 1 669 ? -21.616 68.744 87.540 1.00 91.41  ? 877  PRO A CB   1 
ATOM   9648  C  CG   . PRO A 1 669 ? -22.730 68.365 86.623 1.00 92.00  ? 877  PRO A CG   1 
ATOM   9649  C  CD   . PRO A 1 669 ? -22.260 67.062 86.046 1.00 88.70  ? 877  PRO A CD   1 
ATOM   9650  H  HA   . PRO A 1 669 ? -20.002 69.113 86.294 1.00 105.39 ? 877  PRO A HA   1 
ATOM   9651  H  HB2  . PRO A 1 669 ? -21.670 68.249 88.372 1.00 109.69 ? 877  PRO A HB2  1 
ATOM   9652  H  HB3  . PRO A 1 669 ? -21.613 69.700 87.704 1.00 109.69 ? 877  PRO A HB3  1 
ATOM   9653  H  HG2  . PRO A 1 669 ? -23.551 68.249 87.126 1.00 110.40 ? 877  PRO A HG2  1 
ATOM   9654  H  HG3  . PRO A 1 669 ? -22.835 69.037 85.931 1.00 110.40 ? 877  PRO A HG3  1 
ATOM   9655  H  HD2  . PRO A 1 669 ? -22.380 66.342 86.684 1.00 106.44 ? 877  PRO A HD2  1 
ATOM   9656  H  HD3  . PRO A 1 669 ? -22.708 66.879 85.205 1.00 106.44 ? 877  PRO A HD3  1 
ATOM   9657  N  N    . VAL A 1 670 ? -19.411 66.610 88.248 1.00 87.01  ? 878  VAL A N    1 
ATOM   9658  C  CA   . VAL A 1 670 ? -18.412 66.096 89.183 1.00 86.78  ? 878  VAL A CA   1 
ATOM   9659  C  C    . VAL A 1 670 ? -17.032 66.086 88.530 1.00 86.37  ? 878  VAL A C    1 
ATOM   9660  O  O    . VAL A 1 670 ? -16.026 66.431 89.160 1.00 87.02  ? 878  VAL A O    1 
ATOM   9661  C  CB   . VAL A 1 670 ? -18.809 64.694 89.684 1.00 85.77  ? 878  VAL A CB   1 
ATOM   9662  H  H    . VAL A 1 670 ? -20.068 66.077 88.093 1.00 104.41 ? 878  VAL A H    1 
ATOM   9663  H  HA   . VAL A 1 670 ? -18.371 66.686 89.952 1.00 104.13 ? 878  VAL A HA   1 
ATOM   9664  N  N    . LEU A 1 671 ? -16.964 65.684 87.263 1.00 85.28  ? 879  LEU A N    1 
ATOM   9665  C  CA   . LEU A 1 671 ? -15.713 65.594 86.520 1.00 83.68  ? 879  LEU A CA   1 
ATOM   9666  C  C    . LEU A 1 671 ? -15.338 66.872 85.777 1.00 82.57  ? 879  LEU A C    1 
ATOM   9667  O  O    . LEU A 1 671 ? -14.341 66.878 85.045 1.00 78.40  ? 879  LEU A O    1 
ATOM   9668  C  CB   . LEU A 1 671 ? -15.788 64.454 85.517 1.00 81.10  ? 879  LEU A CB   1 
ATOM   9669  C  CG   . LEU A 1 671 ? -15.968 63.131 86.240 1.00 80.45  ? 879  LEU A CG   1 
ATOM   9670  C  CD1  . LEU A 1 671 ? -16.565 62.130 85.299 1.00 79.17  ? 879  LEU A CD1  1 
ATOM   9671  C  CD2  . LEU A 1 671 ? -14.620 62.688 86.755 1.00 79.23  ? 879  LEU A CD2  1 
ATOM   9672  H  H    . LEU A 1 671 ? -17.651 65.451 86.801 1.00 102.33 ? 879  LEU A H    1 
ATOM   9673  H  HA   . LEU A 1 671 ? -14.996 65.394 87.142 1.00 100.42 ? 879  LEU A HA   1 
ATOM   9674  H  HB2  . LEU A 1 671 ? -16.547 64.589 84.929 1.00 97.32  ? 879  LEU A HB2  1 
ATOM   9675  H  HB3  . LEU A 1 671 ? -14.965 64.416 85.007 1.00 97.32  ? 879  LEU A HB3  1 
ATOM   9676  H  HG   . LEU A 1 671 ? -16.567 63.248 86.994 1.00 96.54  ? 879  LEU A HG   1 
ATOM   9677  H  HD11 . LEU A 1 671 ? -16.678 61.287 85.765 1.00 95.00  ? 879  LEU A HD11 1 
ATOM   9678  H  HD12 . LEU A 1 671 ? -17.426 62.458 84.994 1.00 95.00  ? 879  LEU A HD12 1 
ATOM   9679  H  HD13 . LEU A 1 671 ? -15.969 62.013 84.543 1.00 95.00  ? 879  LEU A HD13 1 
ATOM   9680  H  HD21 . LEU A 1 671 ? -14.722 61.843 87.219 1.00 95.08  ? 879  LEU A HD21 1 
ATOM   9681  H  HD22 . LEU A 1 671 ? -14.015 62.582 86.004 1.00 95.08  ? 879  LEU A HD22 1 
ATOM   9682  H  HD23 . LEU A 1 671 ? -14.278 63.361 87.363 1.00 95.08  ? 879  LEU A HD23 1 
ATOM   9683  N  N    . SER A 1 672 ? -16.088 67.949 85.941 1.00 83.73  ? 880  SER A N    1 
ATOM   9684  C  CA   . SER A 1 672 ? -15.829 69.188 85.208 1.00 81.93  ? 880  SER A CA   1 
ATOM   9685  C  C    . SER A 1 672 ? -15.724 68.920 83.704 1.00 80.90  ? 880  SER A C    1 
ATOM   9686  O  O    . SER A 1 672 ? -14.692 69.135 83.070 1.00 80.16  ? 880  SER A O    1 
ATOM   9687  C  CB   . SER A 1 672 ? -14.566 69.882 85.736 1.00 79.35  ? 880  SER A CB   1 
ATOM   9688  O  OG   . SER A 1 672 ? -14.421 69.686 87.136 1.00 79.41  ? 880  SER A OG   1 
ATOM   9689  H  H    . SER A 1 672 ? -16.761 67.993 86.475 1.00 100.48 ? 880  SER A H    1 
ATOM   9690  H  HA   . SER A 1 672 ? -16.575 69.792 85.348 1.00 98.32  ? 880  SER A HA   1 
ATOM   9691  H  HB2  . SER A 1 672 ? -13.791 69.513 85.284 1.00 95.22  ? 880  SER A HB2  1 
ATOM   9692  H  HB3  . SER A 1 672 ? -14.631 70.833 85.557 1.00 95.22  ? 880  SER A HB3  1 
ATOM   9693  H  HG   . SER A 1 672 ? -13.727 70.071 87.409 1.00 95.29  ? 880  SER A HG   1 
ATOM   9694  N  N    . LEU A 1 673 ? -16.829 68.437 83.140 1.00 80.57  ? 881  LEU A N    1 
ATOM   9695  C  CA   . LEU A 1 673 ? -16.944 68.174 81.704 1.00 77.97  ? 881  LEU A CA   1 
ATOM   9696  C  C    . LEU A 1 673 ? -18.241 68.778 81.181 1.00 80.03  ? 881  LEU A C    1 
ATOM   9697  O  O    . LEU A 1 673 ? -19.128 68.069 80.695 1.00 79.39  ? 881  LEU A O    1 
ATOM   9698  C  CB   . LEU A 1 673 ? -16.888 66.673 81.429 1.00 75.51  ? 881  LEU A CB   1 
ATOM   9699  C  CG   . LEU A 1 673 ? -15.520 66.007 81.566 1.00 72.93  ? 881  LEU A CG   1 
ATOM   9700  C  CD1  . LEU A 1 673 ? -15.674 64.496 81.638 1.00 72.24  ? 881  LEU A CD1  1 
ATOM   9701  C  CD2  . LEU A 1 673 ? -14.617 66.402 80.404 1.00 70.03  ? 881  LEU A CD2  1 
ATOM   9702  H  H    . LEU A 1 673 ? -17.544 68.249 83.579 1.00 96.68  ? 881  LEU A H    1 
ATOM   9703  H  HA   . LEU A 1 673 ? -16.203 68.596 81.241 1.00 93.57  ? 881  LEU A HA   1 
ATOM   9704  H  HB2  . LEU A 1 673 ? -17.487 66.229 82.048 1.00 90.61  ? 881  LEU A HB2  1 
ATOM   9705  H  HB3  . LEU A 1 673 ? -17.193 66.520 80.521 1.00 90.61  ? 881  LEU A HB3  1 
ATOM   9706  H  HG   . LEU A 1 673 ? -15.101 66.307 82.388 1.00 87.51  ? 881  LEU A HG   1 
ATOM   9707  H  HD11 . LEU A 1 673 ? -14.795 64.093 81.725 1.00 86.69  ? 881  LEU A HD11 1 
ATOM   9708  H  HD12 . LEU A 1 673 ? -16.218 64.271 82.409 1.00 86.69  ? 881  LEU A HD12 1 
ATOM   9709  H  HD13 . LEU A 1 673 ? -16.103 64.183 80.827 1.00 86.69  ? 881  LEU A HD13 1 
ATOM   9710  H  HD21 . LEU A 1 673 ? -13.756 65.968 80.512 1.00 84.03  ? 881  LEU A HD21 1 
ATOM   9711  H  HD22 . LEU A 1 673 ? -15.029 66.117 79.573 1.00 84.03  ? 881  LEU A HD22 1 
ATOM   9712  H  HD23 . LEU A 1 673 ? -14.505 67.365 80.405 1.00 84.03  ? 881  LEU A HD23 1 
ATOM   9713  N  N    . PRO A 1 674 ? -18.389 70.098 81.274 1.00 81.45  ? 882  PRO A N    1 
ATOM   9714  C  CA   . PRO A 1 674 ? -19.644 70.723 80.841 1.00 83.14  ? 882  PRO A CA   1 
ATOM   9715  C  C    . PRO A 1 674 ? -19.836 70.605 79.337 1.00 81.47  ? 882  PRO A C    1 
ATOM   9716  O  O    . PRO A 1 674 ? -18.882 70.697 78.559 1.00 77.37  ? 882  PRO A O    1 
ATOM   9717  C  CB   . PRO A 1 674 ? -19.483 72.184 81.277 1.00 84.61  ? 882  PRO A CB   1 
ATOM   9718  C  CG   . PRO A 1 674 ? -18.006 72.405 81.304 1.00 83.58  ? 882  PRO A CG   1 
ATOM   9719  C  CD   . PRO A 1 674 ? -17.394 71.091 81.716 1.00 81.57  ? 882  PRO A CD   1 
ATOM   9720  H  HA   . PRO A 1 674 ? -20.401 70.327 81.300 1.00 99.77  ? 882  PRO A HA   1 
ATOM   9721  H  HB2  . PRO A 1 674 ? -19.907 72.769 80.630 1.00 101.53 ? 882  PRO A HB2  1 
ATOM   9722  H  HB3  . PRO A 1 674 ? -19.867 72.308 82.159 1.00 101.53 ? 882  PRO A HB3  1 
ATOM   9723  H  HG2  . PRO A 1 674 ? -17.700 72.661 80.420 1.00 100.30 ? 882  PRO A HG2  1 
ATOM   9724  H  HG3  . PRO A 1 674 ? -17.794 73.096 81.951 1.00 100.30 ? 882  PRO A HG3  1 
ATOM   9725  H  HD2  . PRO A 1 674 ? -16.551 70.952 81.257 1.00 97.89  ? 882  PRO A HD2  1 
ATOM   9726  H  HD3  . PRO A 1 674 ? -17.286 71.055 82.679 1.00 97.89  ? 882  PRO A HD3  1 
ATOM   9727  N  N    . ILE A 1 675 ? -21.085 70.397 78.933 1.00 84.26  ? 883  ILE A N    1 
ATOM   9728  C  CA   . ILE A 1 675 ? -21.443 70.296 77.523 1.00 85.25  ? 883  ILE A CA   1 
ATOM   9729  C  C    . ILE A 1 675 ? -21.771 71.693 77.013 1.00 87.47  ? 883  ILE A C    1 
ATOM   9730  O  O    . ILE A 1 675 ? -22.735 72.319 77.465 1.00 88.30  ? 883  ILE A O    1 
ATOM   9731  C  CB   . ILE A 1 675 ? -22.623 69.332 77.318 1.00 85.45  ? 883  ILE A CB   1 
ATOM   9732  C  CG1  . ILE A 1 675 ? -22.182 67.898 77.634 1.00 84.15  ? 883  ILE A CG1  1 
ATOM   9733  C  CG2  . ILE A 1 675 ? -23.162 69.424 75.888 1.00 84.45  ? 883  ILE A CG2  1 
ATOM   9734  C  CD1  . ILE A 1 675 ? -23.316 66.889 77.672 1.00 85.06  ? 883  ILE A CD1  1 
ATOM   9735  H  H    . ILE A 1 675 ? -21.754 70.310 79.467 1.00 101.11 ? 883  ILE A H    1 
ATOM   9736  H  HA   . ILE A 1 675 ? -20.684 69.958 77.023 1.00 102.31 ? 883  ILE A HA   1 
ATOM   9737  H  HB   . ILE A 1 675 ? -23.333 69.579 77.932 1.00 102.54 ? 883  ILE A HB   1 
ATOM   9738  H  HG12 . ILE A 1 675 ? -21.554 67.610 76.953 1.00 100.99 ? 883  ILE A HG12 1 
ATOM   9739  H  HG13 . ILE A 1 675 ? -21.751 67.890 78.502 1.00 100.99 ? 883  ILE A HG13 1 
ATOM   9740  H  HG21 . ILE A 1 675 ? -23.904 68.807 75.790 1.00 101.34 ? 883  ILE A HG21 1 
ATOM   9741  H  HG22 . ILE A 1 675 ? -23.463 70.332 75.722 1.00 101.34 ? 883  ILE A HG22 1 
ATOM   9742  H  HG23 . ILE A 1 675 ? -22.453 69.192 75.268 1.00 101.34 ? 883  ILE A HG23 1 
ATOM   9743  H  HD11 . ILE A 1 675 ? -22.952 66.014 77.877 1.00 102.07 ? 883  ILE A HD11 1 
ATOM   9744  H  HD12 . ILE A 1 675 ? -23.950 67.153 78.357 1.00 102.07 ? 883  ILE A HD12 1 
ATOM   9745  H  HD13 . ILE A 1 675 ? -23.752 66.873 76.806 1.00 102.07 ? 883  ILE A HD13 1 
ATOM   9746  N  N    . ASN A 1 676 ? -20.971 72.177 76.070 1.00 88.44  ? 884  ASN A N    1 
ATOM   9747  C  CA   . ASN A 1 676 ? -21.141 73.523 75.538 1.00 91.30  ? 884  ASN A CA   1 
ATOM   9748  C  C    . ASN A 1 676 ? -22.206 73.519 74.447 1.00 93.13  ? 884  ASN A C    1 
ATOM   9749  O  O    . ASN A 1 676 ? -22.034 72.833 73.434 1.00 91.61  ? 884  ASN A O    1 
ATOM   9750  C  CB   . ASN A 1 676 ? -19.820 74.038 74.977 1.00 90.42  ? 884  ASN A CB   1 
ATOM   9751  C  CG   . ASN A 1 676 ? -19.895 75.487 74.524 1.00 91.74  ? 884  ASN A CG   1 
ATOM   9752  O  OD1  . ASN A 1 676 ? -20.961 75.987 74.168 1.00 93.50  ? 884  ASN A OD1  1 
ATOM   9753  N  ND2  . ASN A 1 676 ? -18.754 76.166 74.534 1.00 91.11  ? 884  ASN A ND2  1 
ATOM   9754  H  H    . ASN A 1 676 ? -20.318 71.742 75.719 1.00 106.13 ? 884  ASN A H    1 
ATOM   9755  H  HA   . ASN A 1 676 ? -21.428 74.119 76.247 1.00 109.56 ? 884  ASN A HA   1 
ATOM   9756  H  HB2  . ASN A 1 676 ? -19.138 73.973 75.664 1.00 108.51 ? 884  ASN A HB2  1 
ATOM   9757  H  HB3  . ASN A 1 676 ? -19.570 73.497 74.211 1.00 108.51 ? 884  ASN A HB3  1 
ATOM   9758  H  HD21 . ASN A 1 676 ? -18.742 76.990 74.287 1.00 109.33 ? 884  ASN A HD21 1 
ATOM   9759  H  HD22 . ASN A 1 676 ? -18.028 75.783 74.789 1.00 109.33 ? 884  ASN A HD22 1 
ATOM   9760  N  N    . PRO A 1 677 ? -23.307 74.263 74.601 1.00 96.56  ? 885  PRO A N    1 
ATOM   9761  C  CA   . PRO A 1 677 ? -24.300 74.309 73.512 1.00 96.69  ? 885  PRO A CA   1 
ATOM   9762  C  C    . PRO A 1 677 ? -23.713 74.753 72.183 1.00 93.20  ? 885  PRO A C    1 
ATOM   9763  O  O    . PRO A 1 677 ? -24.135 74.261 71.128 1.00 91.65  ? 885  PRO A O    1 
ATOM   9764  C  CB   . PRO A 1 677 ? -25.345 75.304 74.037 1.00 100.17 ? 885  PRO A CB   1 
ATOM   9765  C  CG   . PRO A 1 677 ? -25.205 75.261 75.518 1.00 101.33 ? 885  PRO A CG   1 
ATOM   9766  C  CD   . PRO A 1 677 ? -23.749 75.024 75.784 1.00 99.72  ? 885  PRO A CD   1 
ATOM   9767  H  HA   . PRO A 1 677 ? -24.715 73.439 73.402 1.00 116.03 ? 885  PRO A HA   1 
ATOM   9768  H  HB2  . PRO A 1 677 ? -25.151 76.192 73.698 1.00 120.20 ? 885  PRO A HB2  1 
ATOM   9769  H  HB3  . PRO A 1 677 ? -26.233 75.020 73.767 1.00 120.20 ? 885  PRO A HB3  1 
ATOM   9770  H  HG2  . PRO A 1 677 ? -25.486 76.109 75.896 1.00 121.60 ? 885  PRO A HG2  1 
ATOM   9771  H  HG3  . PRO A 1 677 ? -25.739 74.535 75.874 1.00 121.60 ? 885  PRO A HG3  1 
ATOM   9772  H  HD2  . PRO A 1 677 ? -23.273 75.867 75.840 1.00 119.66 ? 885  PRO A HD2  1 
ATOM   9773  H  HD3  . PRO A 1 677 ? -23.633 74.495 76.589 1.00 119.66 ? 885  PRO A HD3  1 
ATOM   9774  N  N    . ALA A 1 678 ? -22.745 75.673 72.203 1.00 91.44  ? 886  ALA A N    1 
ATOM   9775  C  CA   . ALA A 1 678 ? -22.154 76.160 70.960 1.00 90.69  ? 886  ALA A CA   1 
ATOM   9776  C  C    . ALA A 1 678 ? -21.435 75.040 70.218 1.00 90.82  ? 886  ALA A C    1 
ATOM   9777  O  O    . ALA A 1 678 ? -21.621 74.859 69.009 1.00 90.83  ? 886  ALA A O    1 
ATOM   9778  C  CB   . ALA A 1 678 ? -21.193 77.311 71.254 1.00 90.08  ? 886  ALA A CB   1 
ATOM   9779  H  H    . ALA A 1 678 ? -22.418 76.025 72.916 1.00 109.73 ? 886  ALA A H    1 
ATOM   9780  H  HA   . ALA A 1 678 ? -22.859 76.496 70.385 1.00 108.84 ? 886  ALA A HA   1 
ATOM   9781  H  HB1  . ALA A 1 678 ? -20.810 77.623 70.420 1.00 108.10 ? 886  ALA A HB1  1 
ATOM   9782  H  HB2  . ALA A 1 678 ? -21.685 78.030 71.682 1.00 108.10 ? 886  ALA A HB2  1 
ATOM   9783  H  HB3  . ALA A 1 678 ? -20.491 76.994 71.843 1.00 108.10 ? 886  ALA A HB3  1 
ATOM   9784  N  N    . GLN A 1 679 ? -20.601 74.277 70.930 1.00 91.34  ? 887  GLN A N    1 
ATOM   9785  C  CA   . GLN A 1 679 ? -19.859 73.195 70.291 1.00 89.55  ? 887  GLN A CA   1 
ATOM   9786  C  C    . GLN A 1 679 ? -20.791 72.110 69.768 1.00 87.54  ? 887  GLN A C    1 
ATOM   9787  O  O    . GLN A 1 679 ? -20.493 71.475 68.750 1.00 86.58  ? 887  GLN A O    1 
ATOM   9788  C  CB   . GLN A 1 679 ? -18.851 72.602 71.274 1.00 88.91  ? 887  GLN A CB   1 
ATOM   9789  H  H    . GLN A 1 679 ? -20.451 74.365 71.772 1.00 109.61 ? 887  GLN A H    1 
ATOM   9790  H  HA   . GLN A 1 679 ? -19.366 73.554 69.537 1.00 107.46 ? 887  GLN A HA   1 
ATOM   9791  N  N    . VAL A 1 680 ? -21.919 71.881 70.444 1.00 86.10  ? 888  VAL A N    1 
ATOM   9792  C  CA   . VAL A 1 680 ? -22.868 70.875 69.977 1.00 82.66  ? 888  VAL A CA   1 
ATOM   9793  C  C    . VAL A 1 680 ? -23.495 71.308 68.658 1.00 81.30  ? 888  VAL A C    1 
ATOM   9794  O  O    . VAL A 1 680 ? -23.659 70.497 67.738 1.00 79.57  ? 888  VAL A O    1 
ATOM   9795  C  CB   . VAL A 1 680 ? -23.937 70.607 71.053 1.00 82.47  ? 888  VAL A CB   1 
ATOM   9796  C  CG1  . VAL A 1 680 ? -25.001 69.646 70.530 1.00 81.88  ? 888  VAL A CG1  1 
ATOM   9797  C  CG2  . VAL A 1 680 ? -23.292 70.045 72.308 1.00 82.05  ? 888  VAL A CG2  1 
ATOM   9798  H  H    . VAL A 1 680 ? -22.153 72.288 71.164 1.00 103.32 ? 888  VAL A H    1 
ATOM   9799  H  HA   . VAL A 1 680 ? -22.392 70.044 69.820 1.00 99.20  ? 888  VAL A HA   1 
ATOM   9800  H  HB   . VAL A 1 680 ? -24.372 71.443 71.284 1.00 98.97  ? 888  VAL A HB   1 
ATOM   9801  H  HG11 . VAL A 1 680 ? -25.660 69.496 71.226 1.00 98.25  ? 888  VAL A HG11 1 
ATOM   9802  H  HG12 . VAL A 1 680 ? -25.426 70.040 69.752 1.00 98.25  ? 888  VAL A HG12 1 
ATOM   9803  H  HG13 . VAL A 1 680 ? -24.578 68.808 70.288 1.00 98.25  ? 888  VAL A HG13 1 
ATOM   9804  H  HG21 . VAL A 1 680 ? -23.981 69.884 72.971 1.00 98.46  ? 888  VAL A HG21 1 
ATOM   9805  H  HG22 . VAL A 1 680 ? -22.844 69.213 72.087 1.00 98.46  ? 888  VAL A HG22 1 
ATOM   9806  H  HG23 . VAL A 1 680 ? -22.650 70.687 72.647 1.00 98.46  ? 888  VAL A HG23 1 
ATOM   9807  N  N    . GLU A 1 681 ? -23.862 72.586 68.544 1.00 80.71  ? 889  GLU A N    1 
ATOM   9808  C  CA   . GLU A 1 681 ? -24.427 73.084 67.294 1.00 77.49  ? 889  GLU A CA   1 
ATOM   9809  C  C    . GLU A 1 681 ? -23.421 72.957 66.157 1.00 73.38  ? 889  GLU A C    1 
ATOM   9810  O  O    . GLU A 1 681 ? -23.759 72.501 65.059 1.00 72.40  ? 889  GLU A O    1 
ATOM   9811  C  CB   . GLU A 1 681 ? -24.875 74.537 67.462 1.00 78.31  ? 889  GLU A CB   1 
ATOM   9812  H  H    . GLU A 1 681 ? -23.795 73.176 69.166 1.00 96.85  ? 889  GLU A H    1 
ATOM   9813  H  HA   . GLU A 1 681 ? -25.207 72.553 67.066 1.00 92.99  ? 889  GLU A HA   1 
ATOM   9814  N  N    . GLN A 1 682 ? -22.169 73.350 66.407 1.00 72.62  ? 890  GLN A N    1 
ATOM   9815  C  CA   . GLN A 1 682 ? -21.148 73.277 65.367 1.00 72.83  ? 890  GLN A CA   1 
ATOM   9816  C  C    . GLN A 1 682 ? -20.892 71.836 64.937 1.00 64.87  ? 890  GLN A C    1 
ATOM   9817  O  O    . GLN A 1 682 ? -20.648 71.567 63.755 1.00 63.10  ? 890  GLN A O    1 
ATOM   9818  C  CB   . GLN A 1 682 ? -19.854 73.927 65.858 1.00 76.91  ? 890  GLN A CB   1 
ATOM   9819  C  CG   . GLN A 1 682 ? -18.738 73.944 64.823 1.00 80.53  ? 890  GLN A CG   1 
ATOM   9820  C  CD   . GLN A 1 682 ? -19.141 74.649 63.542 1.00 88.70  ? 890  GLN A CD   1 
ATOM   9821  O  OE1  . GLN A 1 682 ? -20.035 75.495 63.540 1.00 94.83  ? 890  GLN A OE1  1 
ATOM   9822  N  NE2  . GLN A 1 682 ? -18.487 74.296 62.442 1.00 89.57  ? 890  GLN A NE2  1 
ATOM   9823  H  H    . GLN A 1 682 ? -21.891 73.657 67.161 1.00 87.15  ? 890  GLN A H    1 
ATOM   9824  H  HA   . GLN A 1 682 ? -21.455 73.770 64.590 1.00 87.39  ? 890  GLN A HA   1 
ATOM   9825  H  HB2  . GLN A 1 682 ? -20.041 74.846 66.105 1.00 92.30  ? 890  GLN A HB2  1 
ATOM   9826  H  HB3  . GLN A 1 682 ? -19.533 73.438 66.631 1.00 92.30  ? 890  GLN A HB3  1 
ATOM   9827  H  HG2  . GLN A 1 682 ? -17.971 74.408 65.193 1.00 96.63  ? 890  GLN A HG2  1 
ATOM   9828  H  HG3  . GLN A 1 682 ? -18.499 73.030 64.601 1.00 96.63  ? 890  GLN A HG3  1 
ATOM   9829  H  HE21 . GLN A 1 682 ? -17.869 73.700 62.481 1.00 107.49 ? 890  GLN A HE21 1 
ATOM   9830  H  HE22 . GLN A 1 682 ? -18.680 74.667 61.690 1.00 107.49 ? 890  GLN A HE22 1 
ATOM   9831  N  N    . ALA A 1 683 ? -20.933 70.893 65.881 1.00 58.43  ? 891  ALA A N    1 
ATOM   9832  C  CA   . ALA A 1 683 ? -20.734 69.494 65.521 1.00 54.53  ? 891  ALA A CA   1 
ATOM   9833  C  C    . ALA A 1 683 ? -21.838 69.011 64.589 1.00 54.67  ? 891  ALA A C    1 
ATOM   9834  O  O    . ALA A 1 683 ? -21.591 68.202 63.686 1.00 51.14  ? 891  ALA A O    1 
ATOM   9835  C  CB   . ALA A 1 683 ? -20.670 68.627 66.779 1.00 52.34  ? 891  ALA A CB   1 
ATOM   9836  H  H    . ALA A 1 683 ? -21.072 71.036 66.718 1.00 70.12  ? 891  ALA A H    1 
ATOM   9837  H  HA   . ALA A 1 683 ? -19.889 69.406 65.054 1.00 65.44  ? 891  ALA A HA   1 
ATOM   9838  H  HB1  . ALA A 1 683 ? -20.538 67.702 66.519 1.00 62.81  ? 891  ALA A HB1  1 
ATOM   9839  H  HB2  . ALA A 1 683 ? -19.930 68.925 67.330 1.00 62.81  ? 891  ALA A HB2  1 
ATOM   9840  H  HB3  . ALA A 1 683 ? -21.504 68.718 67.267 1.00 62.81  ? 891  ALA A HB3  1 
ATOM   9841  N  N    . ARG A 1 684 ? -23.066 69.501 64.788 1.00 54.21  ? 892  ARG A N    1 
ATOM   9842  C  CA   . ARG A 1 684 ? -24.158 69.158 63.883 1.00 54.50  ? 892  ARG A CA   1 
ATOM   9843  C  C    . ARG A 1 684 ? -23.955 69.801 62.517 1.00 57.05  ? 892  ARG A C    1 
ATOM   9844  O  O    . ARG A 1 684 ? -24.245 69.184 61.485 1.00 59.14  ? 892  ARG A O    1 
ATOM   9845  C  CB   . ARG A 1 684 ? -25.495 69.590 64.487 1.00 56.47  ? 892  ARG A CB   1 
ATOM   9846  H  H    . ARG A 1 684 ? -23.286 70.027 65.432 1.00 65.06  ? 892  ARG A H    1 
ATOM   9847  H  HA   . ARG A 1 684 ? -24.179 68.196 63.763 1.00 65.41  ? 892  ARG A HA   1 
ATOM   9848  N  N    . ARG A 1 685 ? -23.462 71.041 62.492 1.00 56.30  ? 893  ARG A N    1 
ATOM   9849  C  CA   . ARG A 1 685 ? -23.110 71.680 61.227 1.00 55.10  ? 893  ARG A CA   1 
ATOM   9850  C  C    . ARG A 1 685 ? -22.048 70.875 60.488 1.00 53.93  ? 893  ARG A C    1 
ATOM   9851  O  O    . ARG A 1 685 ? -22.179 70.603 59.288 1.00 53.71  ? 893  ARG A O    1 
ATOM   9852  C  CB   . ARG A 1 685 ? -22.621 73.105 61.484 1.00 56.62  ? 893  ARG A CB   1 
ATOM   9853  H  H    . ARG A 1 685 ? -23.323 71.528 63.187 1.00 67.57  ? 893  ARG A H    1 
ATOM   9854  H  HA   . ARG A 1 685 ? -23.899 71.727 60.665 1.00 66.12  ? 893  ARG A HA   1 
ATOM   9855  N  N    . ASN A 1 686 ? -20.982 70.484 61.192 1.00 53.35  ? 894  ASN A N    1 
ATOM   9856  C  CA   . ASN A 1 686 ? -19.931 69.690 60.566 1.00 51.67  ? 894  ASN A CA   1 
ATOM   9857  C  C    . ASN A 1 686 ? -20.489 68.396 59.985 1.00 51.45  ? 894  ASN A C    1 
ATOM   9858  O  O    . ASN A 1 686 ? -20.035 67.931 58.933 1.00 49.86  ? 894  ASN A O    1 
ATOM   9859  C  CB   . ASN A 1 686 ? -18.830 69.384 61.583 1.00 51.19  ? 894  ASN A CB   1 
ATOM   9860  C  CG   . ASN A 1 686 ? -18.040 70.617 61.982 1.00 52.92  ? 894  ASN A CG   1 
ATOM   9861  O  OD1  . ASN A 1 686 ? -17.969 71.592 61.235 1.00 53.27  ? 894  ASN A OD1  1 
ATOM   9862  N  ND2  . ASN A 1 686 ? -17.433 70.574 63.162 1.00 53.24  ? 894  ASN A ND2  1 
ATOM   9863  H  H    . ASN A 1 686 ? -20.848 70.665 62.022 1.00 64.02  ? 894  ASN A H    1 
ATOM   9864  H  HA   . ASN A 1 686 ? -19.537 70.200 59.841 1.00 62.01  ? 894  ASN A HA   1 
ATOM   9865  H  HB2  . ASN A 1 686 ? -19.234 69.015 62.384 1.00 61.43  ? 894  ASN A HB2  1 
ATOM   9866  H  HB3  . ASN A 1 686 ? -18.212 68.744 61.197 1.00 61.43  ? 894  ASN A HB3  1 
ATOM   9867  H  HD21 . ASN A 1 686 ? -16.972 71.248 63.433 1.00 63.89  ? 894  ASN A HD21 1 
ATOM   9868  H  HD22 . ASN A 1 686 ? -17.504 69.874 63.657 1.00 63.89  ? 894  ASN A HD22 1 
ATOM   9869  N  N    . ALA A 1 687 ? -21.484 67.807 60.652 1.00 52.95  ? 895  ALA A N    1 
ATOM   9870  C  CA   . ALA A 1 687 ? -22.020 66.523 60.211 1.00 53.86  ? 895  ALA A CA   1 
ATOM   9871  C  C    . ALA A 1 687 ? -22.623 66.602 58.813 1.00 54.44  ? 895  ALA A C    1 
ATOM   9872  O  O    . ALA A 1 687 ? -22.688 65.587 58.111 1.00 49.51  ? 895  ALA A O    1 
ATOM   9873  C  CB   . ALA A 1 687 ? -23.067 66.027 61.209 1.00 56.09  ? 895  ALA A CB   1 
ATOM   9874  H  H    . ALA A 1 687 ? -21.861 68.128 61.355 1.00 63.54  ? 895  ALA A H    1 
ATOM   9875  H  HA   . ALA A 1 687 ? -21.299 65.874 60.188 1.00 64.63  ? 895  ALA A HA   1 
ATOM   9876  H  HB1  . ALA A 1 687 ? -23.414 65.174 60.903 1.00 67.32  ? 895  ALA A HB1  1 
ATOM   9877  H  HB2  . ALA A 1 687 ? -22.650 65.923 62.078 1.00 67.32  ? 895  ALA A HB2  1 
ATOM   9878  H  HB3  . ALA A 1 687 ? -23.785 66.677 61.261 1.00 67.32  ? 895  ALA A HB3  1 
ATOM   9879  N  N    . ALA A 1 688 ? -23.070 67.783 58.392 1.00 58.15  ? 896  ALA A N    1 
ATOM   9880  C  CA   . ALA A 1 688 ? -23.724 67.945 57.100 1.00 61.77  ? 896  ALA A CA   1 
ATOM   9881  C  C    . ALA A 1 688 ? -22.769 68.363 55.988 1.00 64.88  ? 896  ALA A C    1 
ATOM   9882  O  O    . ALA A 1 688 ? -23.202 68.490 54.838 1.00 66.14  ? 896  ALA A O    1 
ATOM   9883  C  CB   . ALA A 1 688 ? -24.852 68.978 57.208 1.00 62.73  ? 896  ALA A CB   1 
ATOM   9884  H  H    . ALA A 1 688 ? -23.004 68.513 58.843 1.00 69.78  ? 896  ALA A H    1 
ATOM   9885  H  HA   . ALA A 1 688 ? -24.121 67.098 56.844 1.00 74.12  ? 896  ALA A HA   1 
ATOM   9886  H  HB1  . ALA A 1 688 ? -25.276 69.073 56.341 1.00 75.28  ? 896  ALA A HB1  1 
ATOM   9887  H  HB2  . ALA A 1 688 ? -25.499 68.670 57.861 1.00 75.28  ? 896  ALA A HB2  1 
ATOM   9888  H  HB3  . ALA A 1 688 ? -24.476 69.827 57.488 1.00 75.28  ? 896  ALA A HB3  1 
ATOM   9889  N  N    . SER A 1 689 ? -21.492 68.572 56.291 1.00 66.95  ? 897  SER A N    1 
ATOM   9890  C  CA   . SER A 1 689 ? -20.567 69.122 55.313 1.00 69.57  ? 897  SER A CA   1 
ATOM   9891  C  C    . SER A 1 689 ? -20.035 68.036 54.385 1.00 68.81  ? 897  SER A C    1 
ATOM   9892  O  O    . SER A 1 689 ? -19.966 66.855 54.741 1.00 68.98  ? 897  SER A O    1 
ATOM   9893  C  CB   . SER A 1 689 ? -19.399 69.817 56.012 1.00 71.11  ? 897  SER A CB   1 
ATOM   9894  O  OG   . SER A 1 689 ? -18.594 68.884 56.713 1.00 70.41  ? 897  SER A OG   1 
ATOM   9895  H  H    . SER A 1 689 ? -21.138 68.404 57.057 1.00 80.35  ? 897  SER A H    1 
ATOM   9896  H  HA   . SER A 1 689 ? -21.031 69.780 54.772 1.00 83.49  ? 897  SER A HA   1 
ATOM   9897  H  HB2  . SER A 1 689 ? -18.854 70.264 55.345 1.00 85.33  ? 897  SER A HB2  1 
ATOM   9898  H  HB3  . SER A 1 689 ? -19.750 70.466 56.641 1.00 85.33  ? 897  SER A HB3  1 
ATOM   9899  H  HG   . SER A 1 689 ? -19.054 68.489 57.295 1.00 84.49  ? 897  SER A HG   1 
ATOM   9900  N  N    . THR A 1 690 ? -19.657 68.455 53.178 1.00 66.79  ? 898  THR A N    1 
ATOM   9901  C  CA   . THR A 1 690 ? -19.053 67.576 52.189 1.00 65.01  ? 898  THR A CA   1 
ATOM   9902  C  C    . THR A 1 690 ? -18.002 68.366 51.421 1.00 58.26  ? 898  THR A C    1 
ATOM   9903  O  O    . THR A 1 690 ? -17.804 69.563 51.649 1.00 55.77  ? 898  THR A O    1 
ATOM   9904  C  CB   . THR A 1 690 ? -20.106 66.995 51.235 1.00 71.77  ? 898  THR A CB   1 
ATOM   9905  O  OG1  . THR A 1 690 ? -20.855 68.061 50.635 1.00 74.85  ? 898  THR A OG1  1 
ATOM   9906  C  CG2  . THR A 1 690 ? -21.055 66.065 51.977 1.00 74.36  ? 898  THR A CG2  1 
ATOM   9907  H  H    . THR A 1 690 ? -19.745 69.266 52.906 1.00 80.15  ? 898  THR A H    1 
ATOM   9908  H  HA   . THR A 1 690 ? -18.612 66.839 52.640 1.00 78.02  ? 898  THR A HA   1 
ATOM   9909  H  HB   . THR A 1 690 ? -19.662 66.485 50.539 1.00 86.12  ? 898  THR A HB   1 
ATOM   9910  H  HG1  . THR A 1 690 ? -21.432 67.748 50.111 1.00 89.82  ? 898  THR A HG1  1 
ATOM   9911  H  HG21 . THR A 1 690 ? -21.714 65.705 51.363 1.00 89.23  ? 898  THR A HG21 1 
ATOM   9912  H  HG22 . THR A 1 690 ? -20.558 65.331 52.371 1.00 89.23  ? 898  THR A HG22 1 
ATOM   9913  H  HG23 . THR A 1 690 ? -21.512 66.550 52.682 1.00 89.23  ? 898  THR A HG23 1 
ATOM   9914  N  N    . GLY A 1 691 ? -17.315 67.682 50.511 1.00 54.42  ? 899  GLY A N    1 
ATOM   9915  C  CA   . GLY A 1 691 ? -16.383 68.358 49.623 1.00 52.65  ? 899  GLY A CA   1 
ATOM   9916  C  C    . GLY A 1 691 ? -15.326 69.138 50.380 1.00 52.89  ? 899  GLY A C    1 
ATOM   9917  O  O    . GLY A 1 691 ? -14.648 68.616 51.272 1.00 47.94  ? 899  GLY A O    1 
ATOM   9918  H  H    . GLY A 1 691 ? -17.372 66.833 50.390 1.00 65.30  ? 899  GLY A H    1 
ATOM   9919  H  HA2  . GLY A 1 691 ? -15.939 67.704 49.062 1.00 63.18  ? 899  GLY A HA2  1 
ATOM   9920  H  HA3  . GLY A 1 691 ? -16.869 68.974 49.052 1.00 63.18  ? 899  GLY A HA3  1 
ATOM   9921  N  N    . THR A 1 692 ? -15.185 70.415 50.017 1.00 57.88  ? 900  THR A N    1 
ATOM   9922  C  CA   . THR A 1 692 ? -14.109 71.238 50.561 1.00 59.72  ? 900  THR A CA   1 
ATOM   9923  C  C    . THR A 1 692 ? -14.265 71.441 52.063 1.00 56.30  ? 900  THR A C    1 
ATOM   9924  O  O    . THR A 1 692 ? -13.288 71.349 52.815 1.00 51.92  ? 900  THR A O    1 
ATOM   9925  C  CB   . THR A 1 692 ? -14.076 72.590 49.848 1.00 66.36  ? 900  THR A CB   1 
ATOM   9926  O  OG1  . THR A 1 692 ? -14.413 72.413 48.466 1.00 69.48  ? 900  THR A OG1  1 
ATOM   9927  C  CG2  . THR A 1 692 ? -12.694 73.215 49.948 1.00 67.04  ? 900  THR A CG2  1 
ATOM   9928  H  H    . THR A 1 692 ? -15.698 70.825 49.461 1.00 69.45  ? 900  THR A H    1 
ATOM   9929  H  HA   . THR A 1 692 ? -13.261 70.794 50.405 1.00 71.67  ? 900  THR A HA   1 
ATOM   9930  H  HB   . THR A 1 692 ? -14.716 73.190 50.262 1.00 79.64  ? 900  THR A HB   1 
ATOM   9931  H  HG1  . THR A 1 692 ? -14.397 73.153 48.069 1.00 83.38  ? 900  THR A HG1  1 
ATOM   9932  H  HG21 . THR A 1 692 ? -12.684 74.072 49.493 1.00 80.45  ? 900  THR A HG21 1 
ATOM   9933  H  HG22 . THR A 1 692 ? -12.458 73.350 50.879 1.00 80.45  ? 900  THR A HG22 1 
ATOM   9934  H  HG23 . THR A 1 692 ? -12.036 72.632 49.538 1.00 80.45  ? 900  THR A HG23 1 
ATOM   9935  N  N    . ALA A 1 693 ? -15.485 71.735 52.519 1.00 57.39  ? 901  ALA A N    1 
ATOM   9936  C  CA   . ALA A 1 693 ? -15.702 71.975 53.942 1.00 57.19  ? 901  ALA A CA   1 
ATOM   9937  C  C    . ALA A 1 693 ? -15.375 70.735 54.766 1.00 53.16  ? 901  ALA A C    1 
ATOM   9938  O  O    . ALA A 1 693 ? -14.782 70.837 55.846 1.00 48.51  ? 901  ALA A O    1 
ATOM   9939  C  CB   . ALA A 1 693 ? -17.145 72.415 54.186 1.00 60.15  ? 901  ALA A CB   1 
ATOM   9940  H  H    . ALA A 1 693 ? -16.191 71.800 52.032 1.00 68.86  ? 901  ALA A H    1 
ATOM   9941  H  HA   . ALA A 1 693 ? -15.117 72.691 54.234 1.00 68.63  ? 901  ALA A HA   1 
ATOM   9942  H  HB1  . ALA A 1 693 ? -17.272 72.570 55.135 1.00 72.18  ? 901  ALA A HB1  1 
ATOM   9943  H  HB2  . ALA A 1 693 ? -17.312 73.233 53.691 1.00 72.18  ? 901  ALA A HB2  1 
ATOM   9944  H  HB3  . ALA A 1 693 ? -17.744 71.716 53.881 1.00 72.18  ? 901  ALA A HB3  1 
ATOM   9945  N  N    . LEU A 1 694 ? -15.752 69.554 54.271 1.00 52.19  ? 902  LEU A N    1 
ATOM   9946  C  CA   . LEU A 1 694 ? -15.466 68.323 54.997 1.00 50.08  ? 902  LEU A CA   1 
ATOM   9947  C  C    . LEU A 1 694 ? -13.968 68.043 55.038 1.00 47.54  ? 902  LEU A C    1 
ATOM   9948  O  O    . LEU A 1 694 ? -13.445 67.579 56.058 1.00 45.07  ? 902  LEU A O    1 
ATOM   9949  C  CB   . LEU A 1 694 ? -16.221 67.157 54.356 1.00 51.21  ? 902  LEU A CB   1 
ATOM   9950  C  CG   . LEU A 1 694 ? -15.917 65.753 54.885 1.00 49.92  ? 902  LEU A CG   1 
ATOM   9951  C  CD1  . LEU A 1 694 ? -16.111 65.674 56.394 1.00 50.53  ? 902  LEU A CD1  1 
ATOM   9952  C  CD2  . LEU A 1 694 ? -16.797 64.733 54.176 1.00 49.86  ? 902  LEU A CD2  1 
ATOM   9953  H  H    . LEU A 1 694 ? -16.167 69.443 53.526 1.00 62.63  ? 902  LEU A H    1 
ATOM   9954  H  HA   . LEU A 1 694 ? -15.778 68.416 55.911 1.00 60.10  ? 902  LEU A HA   1 
ATOM   9955  H  HB2  . LEU A 1 694 ? -17.171 67.309 54.481 1.00 61.46  ? 902  LEU A HB2  1 
ATOM   9956  H  HB3  . LEU A 1 694 ? -16.020 67.155 53.407 1.00 61.46  ? 902  LEU A HB3  1 
ATOM   9957  H  HG   . LEU A 1 694 ? -14.992 65.537 54.690 1.00 59.90  ? 902  LEU A HG   1 
ATOM   9958  H  HD11 . LEU A 1 694 ? -15.910 64.773 56.691 1.00 60.63  ? 902  LEU A HD11 1 
ATOM   9959  H  HD12 . LEU A 1 694 ? -15.512 66.306 56.822 1.00 60.63  ? 902  LEU A HD12 1 
ATOM   9960  H  HD13 . LEU A 1 694 ? -17.032 65.895 56.605 1.00 60.63  ? 902  LEU A HD13 1 
ATOM   9961  H  HD21 . LEU A 1 694 ? -16.595 63.849 54.519 1.00 59.83  ? 902  LEU A HD21 1 
ATOM   9962  H  HD22 . LEU A 1 694 ? -17.728 64.949 54.344 1.00 59.83  ? 902  LEU A HD22 1 
ATOM   9963  H  HD23 . LEU A 1 694 ? -16.616 64.768 53.223 1.00 59.83  ? 902  LEU A HD23 1 
ATOM   9964  N  N    . GLU A 1 695 ? -13.261 68.322 53.941 1.00 47.80  ? 903  GLU A N    1 
ATOM   9965  C  CA   . GLU A 1 695 ? -11.815 68.131 53.923 1.00 47.49  ? 903  GLU A CA   1 
ATOM   9966  C  C    . GLU A 1 695 ? -11.131 69.024 54.953 1.00 46.96  ? 903  GLU A C    1 
ATOM   9967  O  O    . GLU A 1 695 ? -10.197 68.591 55.638 1.00 44.09  ? 903  GLU A O    1 
ATOM   9968  C  CB   . GLU A 1 695 ? -11.273 68.406 52.519 1.00 50.97  ? 903  GLU A CB   1 
ATOM   9969  C  CG   . GLU A 1 695 ? -9.759  68.296 52.391 1.00 52.40  ? 903  GLU A CG   1 
ATOM   9970  C  CD   . GLU A 1 695 ? -9.287  68.408 50.951 1.00 55.81  ? 903  GLU A CD   1 
ATOM   9971  O  OE1  . GLU A 1 695 ? -9.930  67.808 50.063 1.00 57.23  ? 903  GLU A OE1  1 
ATOM   9972  O  OE2  . GLU A 1 695 ? -8.277  69.101 50.706 1.00 57.28  ? 903  GLU A OE2  1 
ATOM   9973  H  H    . GLU A 1 695 ? -13.592 68.619 53.204 1.00 57.36  ? 903  GLU A H    1 
ATOM   9974  H  HA   . GLU A 1 695 ? -11.615 67.208 54.146 1.00 57.00  ? 903  GLU A HA   1 
ATOM   9975  H  HB2  . GLU A 1 695 ? -11.667 67.768 51.905 1.00 61.16  ? 903  GLU A HB2  1 
ATOM   9976  H  HB3  . GLU A 1 695 ? -11.525 69.306 52.261 1.00 61.16  ? 903  GLU A HB3  1 
ATOM   9977  H  HG2  . GLU A 1 695 ? -9.346  69.011 52.900 1.00 62.88  ? 903  GLU A HG2  1 
ATOM   9978  H  HG3  . GLU A 1 695 ? -9.474  67.435 52.735 1.00 62.88  ? 903  GLU A HG3  1 
ATOM   9979  N  N    . GLY A 1 696 ? -11.584 70.273 55.079 1.00 48.88  ? 904  GLY A N    1 
ATOM   9980  C  CA   . GLY A 1 696 ? -11.015 71.156 56.085 1.00 49.48  ? 904  GLY A CA   1 
ATOM   9981  C  C    . GLY A 1 696 ? -11.265 70.666 57.499 1.00 48.11  ? 904  GLY A C    1 
ATOM   9982  O  O    . GLY A 1 696 ? -10.400 70.787 58.370 1.00 47.51  ? 904  GLY A O    1 
ATOM   9983  H  H    . GLY A 1 696 ? -12.207 70.623 54.602 1.00 58.66  ? 904  GLY A H    1 
ATOM   9984  H  HA2  . GLY A 1 696 ? -10.057 71.226 55.949 1.00 59.38  ? 904  GLY A HA2  1 
ATOM   9985  H  HA3  . GLY A 1 696 ? -11.404 72.040 55.994 1.00 59.38  ? 904  GLY A HA3  1 
ATOM   9986  N  N    . TRP A 1 697 ? -12.452 70.108 57.747 1.00 48.52  ? 905  TRP A N    1 
ATOM   9987  C  CA   . TRP A 1 697 ? -12.755 69.549 59.062 1.00 48.00  ? 905  TRP A CA   1 
ATOM   9988  C  C    . TRP A 1 697 ? -11.857 68.356 59.366 1.00 43.79  ? 905  TRP A C    1 
ATOM   9989  O  O    . TRP A 1 697 ? -11.275 68.261 60.453 1.00 40.76  ? 905  TRP A O    1 
ATOM   9990  C  CB   . TRP A 1 697 ? -14.229 69.144 59.122 1.00 48.84  ? 905  TRP A CB   1 
ATOM   9991  C  CG   . TRP A 1 697 ? -14.668 68.598 60.449 1.00 44.71  ? 905  TRP A CG   1 
ATOM   9992  C  CD1  . TRP A 1 697 ? -14.157 68.907 61.678 1.00 44.80  ? 905  TRP A CD1  1 
ATOM   9993  C  CD2  . TRP A 1 697 ? -15.707 67.639 60.678 1.00 41.20  ? 905  TRP A CD2  1 
ATOM   9994  N  NE1  . TRP A 1 697 ? -14.817 68.203 62.656 1.00 44.03  ? 905  TRP A NE1  1 
ATOM   9995  C  CE2  . TRP A 1 697 ? -15.772 67.416 62.067 1.00 41.26  ? 905  TRP A CE2  1 
ATOM   9996  C  CE3  . TRP A 1 697 ? -16.590 66.949 59.841 1.00 40.49  ? 905  TRP A CE3  1 
ATOM   9997  C  CZ2  . TRP A 1 697 ? -16.687 66.534 62.639 1.00 37.43  ? 905  TRP A CZ2  1 
ATOM   9998  C  CZ3  . TRP A 1 697 ? -17.496 66.073 60.411 1.00 39.73  ? 905  TRP A CZ3  1 
ATOM   9999  C  CH2  . TRP A 1 697 ? -17.537 65.874 61.797 1.00 38.37  ? 905  TRP A CH2  1 
ATOM   10000 H  H    . TRP A 1 697 ? -13.091 70.041 57.176 1.00 58.23  ? 905  TRP A H    1 
ATOM   10001 H  HA   . TRP A 1 697 ? -12.599 70.226 59.739 1.00 57.61  ? 905  TRP A HA   1 
ATOM   10002 H  HB2  . TRP A 1 697 ? -14.774 69.924 58.931 1.00 58.61  ? 905  TRP A HB2  1 
ATOM   10003 H  HB3  . TRP A 1 697 ? -14.391 68.460 58.454 1.00 58.61  ? 905  TRP A HB3  1 
ATOM   10004 H  HD1  . TRP A 1 697 ? -13.463 69.508 61.830 1.00 53.77  ? 905  TRP A HD1  1 
ATOM   10005 H  HE1  . TRP A 1 697 ? -14.655 68.247 63.499 1.00 52.84  ? 905  TRP A HE1  1 
ATOM   10006 H  HE3  . TRP A 1 697 ? -16.570 67.077 58.921 1.00 48.59  ? 905  TRP A HE3  1 
ATOM   10007 H  HZ2  . TRP A 1 697 ? -16.716 66.398 63.559 1.00 44.91  ? 905  TRP A HZ2  1 
ATOM   10008 H  HZ3  . TRP A 1 697 ? -18.088 65.609 59.865 1.00 47.68  ? 905  TRP A HZ3  1 
ATOM   10009 H  HH2  . TRP A 1 697 ? -18.157 65.278 62.152 1.00 46.04  ? 905  TRP A HH2  1 
ATOM   10010 N  N    . LEU A 1 698 ? -11.738 67.428 58.414 1.00 40.17  ? 906  LEU A N    1 
ATOM   10011 C  CA   . LEU A 1 698 ? -10.878 66.264 58.602 1.00 36.74  ? 906  LEU A CA   1 
ATOM   10012 C  C    . LEU A 1 698 ? -9.434  66.685 58.852 1.00 35.52  ? 906  LEU A C    1 
ATOM   10013 O  O    . LEU A 1 698 ? -8.826  66.307 59.859 1.00 36.84  ? 906  LEU A O    1 
ATOM   10014 C  CB   . LEU A 1 698 ? -10.965 65.348 57.378 1.00 34.91  ? 906  LEU A CB   1 
ATOM   10015 C  CG   . LEU A 1 698 ? -10.028 64.137 57.375 1.00 36.53  ? 906  LEU A CG   1 
ATOM   10016 C  CD1  . LEU A 1 698 ? -10.382 63.184 58.508 1.00 38.06  ? 906  LEU A CD1  1 
ATOM   10017 C  CD2  . LEU A 1 698 ? -10.073 63.416 56.033 1.00 37.67  ? 906  LEU A CD2  1 
ATOM   10018 H  H    . LEU A 1 698 ? -12.143 67.450 57.656 1.00 48.21  ? 906  LEU A H    1 
ATOM   10019 H  HA   . LEU A 1 698 ? -11.184 65.765 59.375 1.00 44.08  ? 906  LEU A HA   1 
ATOM   10020 H  HB2  . LEU A 1 698 ? -11.872 65.011 57.314 1.00 41.89  ? 906  LEU A HB2  1 
ATOM   10021 H  HB3  . LEU A 1 698 ? -10.760 65.873 56.589 1.00 41.89  ? 906  LEU A HB3  1 
ATOM   10022 H  HG   . LEU A 1 698 ? -9.119  64.443 57.518 1.00 43.84  ? 906  LEU A HG   1 
ATOM   10023 H  HD11 . LEU A 1 698 ? -9.776  62.427 58.484 1.00 45.67  ? 906  LEU A HD11 1 
ATOM   10024 H  HD12 . LEU A 1 698 ? -10.294 63.652 59.353 1.00 45.67  ? 906  LEU A HD12 1 
ATOM   10025 H  HD13 . LEU A 1 698 ? -11.296 62.880 58.390 1.00 45.67  ? 906  LEU A HD13 1 
ATOM   10026 H  HD21 . LEU A 1 698 ? -9.471  62.656 56.062 1.00 45.21  ? 906  LEU A HD21 1 
ATOM   10027 H  HD22 . LEU A 1 698 ? -10.979 63.114 55.867 1.00 45.21  ? 906  LEU A HD22 1 
ATOM   10028 H  HD23 . LEU A 1 698 ? -9.796  64.031 55.336 1.00 45.21  ? 906  LEU A HD23 1 
ATOM   10029 N  N    . ASP A 1 699 ? -8.863  67.462 57.930 1.00 34.85  ? 907  ASP A N    1 
ATOM   10030 C  CA   . ASP A 1 699 ? -7.450  67.806 58.032 1.00 38.40  ? 907  ASP A CA   1 
ATOM   10031 C  C    . ASP A 1 699 ? -7.164  68.615 59.291 1.00 39.89  ? 907  ASP A C    1 
ATOM   10032 O  O    . ASP A 1 699 ? -6.064  68.528 59.848 1.00 38.98  ? 907  ASP A O    1 
ATOM   10033 C  CB   . ASP A 1 699 ? -7.008  68.563 56.777 1.00 43.37  ? 907  ASP A CB   1 
ATOM   10034 C  CG   . ASP A 1 699 ? -6.983  67.675 55.536 1.00 45.03  ? 907  ASP A CG   1 
ATOM   10035 O  OD1  . ASP A 1 699 ? -7.420  66.505 55.627 1.00 42.87  ? 907  ASP A OD1  1 
ATOM   10036 O  OD2  . ASP A 1 699 ? -6.518  68.141 54.472 1.00 43.87  ? 907  ASP A OD2  1 
ATOM   10037 H  H    . ASP A 1 699 ? -9.266  67.797 57.248 1.00 41.83  ? 907  ASP A H    1 
ATOM   10038 H  HA   . ASP A 1 699 ? -6.932  66.988 58.082 1.00 46.08  ? 907  ASP A HA   1 
ATOM   10039 H  HB2  . ASP A 1 699 ? -7.627  69.292 56.612 1.00 52.05  ? 907  ASP A HB2  1 
ATOM   10040 H  HB3  . ASP A 1 699 ? -6.113  68.912 56.916 1.00 52.05  ? 907  ASP A HB3  1 
ATOM   10041 N  N    . SER A 1 700 ? -8.141  69.394 59.761 1.00 41.34  ? 908  SER A N    1 
ATOM   10042 C  CA   . SER A 1 700 ? -8.000  70.067 61.047 1.00 41.96  ? 908  SER A CA   1 
ATOM   10043 C  C    . SER A 1 700 ? -7.831  69.061 62.180 1.00 41.80  ? 908  SER A C    1 
ATOM   10044 O  O    . SER A 1 700 ? -7.018  69.267 63.089 1.00 41.62  ? 908  SER A O    1 
ATOM   10045 C  CB   . SER A 1 700 ? -9.215  70.961 61.300 1.00 46.01  ? 908  SER A CB   1 
ATOM   10046 O  OG   . SER A 1 700 ? -9.400  71.185 62.686 1.00 49.46  ? 908  SER A OG   1 
ATOM   10047 H  H    . SER A 1 700 ? -8.885  69.546 59.358 1.00 49.61  ? 908  SER A H    1 
ATOM   10048 H  HA   . SER A 1 700 ? -7.211  70.631 61.025 1.00 50.36  ? 908  SER A HA   1 
ATOM   10049 H  HB2  . SER A 1 700 ? -9.076  71.813 60.859 1.00 55.22  ? 908  SER A HB2  1 
ATOM   10050 H  HB3  . SER A 1 700 ? -10.005 70.527 60.942 1.00 55.22  ? 908  SER A HB3  1 
ATOM   10051 H  HG   . SER A 1 700 ? -10.070 71.677 62.810 1.00 59.36  ? 908  SER A HG   1 
ATOM   10052 N  N    . LEU A 1 701 ? -8.586  67.961 62.141 1.00 40.62  ? 909  LEU A N    1 
ATOM   10053 C  CA   . LEU A 1 701 ? -8.487  66.960 63.200 1.00 36.19  ? 909  LEU A CA   1 
ATOM   10054 C  C    . LEU A 1 701 ? -7.195  66.163 63.090 1.00 36.25  ? 909  LEU A C    1 
ATOM   10055 O  O    . LEU A 1 701 ? -6.535  65.897 64.102 1.00 34.67  ? 909  LEU A O    1 
ATOM   10056 C  CB   . LEU A 1 701 ? -9.693  66.023 63.149 1.00 34.30  ? 909  LEU A CB   1 
ATOM   10057 C  CG   . LEU A 1 701 ? -11.059 66.648 63.430 1.00 37.97  ? 909  LEU A CG   1 
ATOM   10058 C  CD1  . LEU A 1 701 ? -12.154 65.651 63.107 1.00 38.31  ? 909  LEU A CD1  1 
ATOM   10059 C  CD2  . LEU A 1 701 ? -11.165 67.109 64.876 1.00 38.56  ? 909  LEU A CD2  1 
ATOM   10060 H  H    . LEU A 1 701 ? -9.153  67.774 61.523 1.00 48.74  ? 909  LEU A H    1 
ATOM   10061 H  HA   . LEU A 1 701 ? -8.491  67.408 64.060 1.00 43.43  ? 909  LEU A HA   1 
ATOM   10062 H  HB2  . LEU A 1 701 ? -9.733  65.630 62.263 1.00 41.17  ? 909  LEU A HB2  1 
ATOM   10063 H  HB3  . LEU A 1 701 ? -9.558  65.321 63.805 1.00 41.17  ? 909  LEU A HB3  1 
ATOM   10064 H  HG   . LEU A 1 701 ? -11.177 67.421 62.857 1.00 45.57  ? 909  LEU A HG   1 
ATOM   10065 H  HD11 . LEU A 1 701 ? -13.015 66.059 63.289 1.00 45.98  ? 909  LEU A HD11 1 
ATOM   10066 H  HD12 . LEU A 1 701 ? -12.094 65.409 62.169 1.00 45.98  ? 909  LEU A HD12 1 
ATOM   10067 H  HD13 . LEU A 1 701 ? -12.037 64.863 63.660 1.00 45.98  ? 909  LEU A HD13 1 
ATOM   10068 H  HD21 . LEU A 1 701 ? -12.042 67.499 65.018 1.00 46.27  ? 909  LEU A HD21 1 
ATOM   10069 H  HD22 . LEU A 1 701 ? -11.044 66.345 65.461 1.00 46.27  ? 909  LEU A HD22 1 
ATOM   10070 H  HD23 . LEU A 1 701 ? -10.477 67.771 65.047 1.00 46.27  ? 909  LEU A HD23 1 
ATOM   10071 N  N    . VAL A 1 702 ? -6.823  65.760 61.872 1.00 37.94  ? 910  VAL A N    1 
ATOM   10072 C  CA   . VAL A 1 702 ? -5.602  64.981 61.689 1.00 36.50  ? 910  VAL A CA   1 
ATOM   10073 C  C    . VAL A 1 702 ? -4.387  65.803 62.095 1.00 39.91  ? 910  VAL A C    1 
ATOM   10074 O  O    . VAL A 1 702 ? -3.467  65.298 62.750 1.00 37.47  ? 910  VAL A O    1 
ATOM   10075 C  CB   . VAL A 1 702 ? -5.496  64.490 60.231 1.00 32.39  ? 910  VAL A CB   1 
ATOM   10076 C  CG1  . VAL A 1 702 ? -4.144  63.827 59.972 1.00 31.76  ? 910  VAL A CG1  1 
ATOM   10077 C  CG2  . VAL A 1 702 ? -6.629  63.523 59.913 1.00 30.58  ? 910  VAL A CG2  1 
ATOM   10078 H  H    . VAL A 1 702 ? -7.255  65.924 61.147 1.00 45.53  ? 910  VAL A H    1 
ATOM   10079 H  HA   . VAL A 1 702 ? -5.639  64.200 62.263 1.00 43.81  ? 910  VAL A HA   1 
ATOM   10080 H  HB   . VAL A 1 702 ? -5.575  65.252 59.635 1.00 38.87  ? 910  VAL A HB   1 
ATOM   10081 H  HG11 . VAL A 1 702 ? -4.110  63.530 59.049 1.00 38.11  ? 910  VAL A HG11 1 
ATOM   10082 H  HG12 . VAL A 1 702 ? -3.439  64.471 60.140 1.00 38.11  ? 910  VAL A HG12 1 
ATOM   10083 H  HG13 . VAL A 1 702 ? -4.046  63.067 60.568 1.00 38.11  ? 910  VAL A HG13 1 
ATOM   10084 H  HG21 . VAL A 1 702 ? -6.542  63.228 58.992 1.00 36.70  ? 910  VAL A HG21 1 
ATOM   10085 H  HG22 . VAL A 1 702 ? -6.572  62.762 60.511 1.00 36.70  ? 910  VAL A HG22 1 
ATOM   10086 H  HG23 . VAL A 1 702 ? -7.477  63.978 60.036 1.00 36.70  ? 910  VAL A HG23 1 
ATOM   10087 N  N    . GLY A 1 703 ? -4.365  67.083 61.718 1.00 38.70  ? 911  GLY A N    1 
ATOM   10088 C  CA   . GLY A 1 703 ? -3.246  67.940 62.062 1.00 39.52  ? 911  GLY A CA   1 
ATOM   10089 C  C    . GLY A 1 703 ? -3.055  68.119 63.551 1.00 40.22  ? 911  GLY A C    1 
ATOM   10090 O  O    . GLY A 1 703 ? -1.943  68.429 63.992 1.00 40.72  ? 911  GLY A O    1 
ATOM   10091 H  H    . GLY A 1 703 ? -4.985  67.471 61.265 1.00 46.44  ? 911  GLY A H    1 
ATOM   10092 H  HA2  . GLY A 1 703 ? -2.431  67.564 61.694 1.00 47.43  ? 911  GLY A HA2  1 
ATOM   10093 H  HA3  . GLY A 1 703 ? -3.382  68.816 61.667 1.00 47.43  ? 911  GLY A HA3  1 
ATOM   10094 N  N    . GLY A 1 704 ? -4.114  67.934 64.339 1.00 39.92  ? 912  GLY A N    1 
ATOM   10095 C  CA   . GLY A 1 704 ? -4.001  67.998 65.783 1.00 38.93  ? 912  GLY A CA   1 
ATOM   10096 C  C    . GLY A 1 704 ? -3.524  66.724 66.444 1.00 39.35  ? 912  GLY A C    1 
ATOM   10097 O  O    . GLY A 1 704 ? -3.141  66.759 67.617 1.00 42.56  ? 912  GLY A O    1 
ATOM   10098 H  H    . GLY A 1 704 ? -4.909  67.770 64.056 1.00 47.90  ? 912  GLY A H    1 
ATOM   10099 H  HA2  . GLY A 1 704 ? -3.381  68.706 66.018 1.00 46.72  ? 912  GLY A HA2  1 
ATOM   10100 H  HA3  . GLY A 1 704 ? -4.867  68.222 66.157 1.00 46.72  ? 912  GLY A HA3  1 
ATOM   10101 N  N    . MET A 1 705 ? -3.535  65.601 65.721 1.00 36.08  ? 913  MET A N    1 
ATOM   10102 C  CA   . MET A 1 705 ? -3.118  64.316 66.264 1.00 35.94  ? 913  MET A CA   1 
ATOM   10103 C  C    . MET A 1 705 ? -1.921  63.709 65.545 1.00 34.82  ? 913  MET A C    1 
ATOM   10104 O  O    . MET A 1 705 ? -1.369  62.714 66.035 1.00 32.86  ? 913  MET A O    1 
ATOM   10105 C  CB   . MET A 1 705 ? -4.285  63.316 66.212 1.00 36.88  ? 913  MET A CB   1 
ATOM   10106 C  CG   . MET A 1 705 ? -5.506  63.740 67.026 1.00 41.59  ? 913  MET A CG   1 
ATOM   10107 S  SD   . MET A 1 705 ? -5.281  63.562 68.810 1.00 46.46  ? 913  MET A SD   1 
ATOM   10108 C  CE   . MET A 1 705 ? -5.334  61.779 68.994 1.00 48.94  ? 913  MET A CE   1 
ATOM   10109 H  H    . MET A 1 705 ? -3.785  65.563 64.899 1.00 43.29  ? 913  MET A H    1 
ATOM   10110 H  HA   . MET A 1 705 ? -2.883  64.441 67.197 1.00 43.13  ? 913  MET A HA   1 
ATOM   10111 H  HB2  . MET A 1 705 ? -4.566  63.212 65.290 1.00 44.26  ? 913  MET A HB2  1 
ATOM   10112 H  HB3  . MET A 1 705 ? -3.980  62.463 66.560 1.00 44.26  ? 913  MET A HB3  1 
ATOM   10113 H  HG2  . MET A 1 705 ? -5.697  64.673 66.841 1.00 49.91  ? 913  MET A HG2  1 
ATOM   10114 H  HG3  . MET A 1 705 ? -6.262  63.191 66.765 1.00 49.91  ? 913  MET A HG3  1 
ATOM   10115 H  HE1  . MET A 1 705 ? -5.222  61.556 69.931 1.00 58.73  ? 913  MET A HE1  1 
ATOM   10116 H  HE2  . MET A 1 705 ? -6.192  61.455 68.676 1.00 58.73  ? 913  MET A HE2  1 
ATOM   10117 H  HE3  . MET A 1 705 ? -4.618  61.387 68.471 1.00 58.73  ? 913  MET A HE3  1 
ATOM   10118 N  N    . TRP A 1 706 ? -1.503  64.269 64.411 1.00 33.44  ? 914  TRP A N    1 
ATOM   10119 C  CA   . TRP A 1 706 ? -0.384  63.748 63.641 1.00 31.96  ? 914  TRP A CA   1 
ATOM   10120 C  C    . TRP A 1 706 ? 0.514   64.900 63.220 1.00 33.67  ? 914  TRP A C    1 
ATOM   10121 O  O    . TRP A 1 706 ? 0.047   66.021 63.006 1.00 27.34  ? 914  TRP A O    1 
ATOM   10122 C  CB   . TRP A 1 706 ? -0.853  62.993 62.392 1.00 33.37  ? 914  TRP A CB   1 
ATOM   10123 C  CG   . TRP A 1 706 ? -1.543  61.706 62.686 1.00 31.12  ? 914  TRP A CG   1 
ATOM   10124 C  CD1  . TRP A 1 706 ? -2.829  61.544 63.104 1.00 30.36  ? 914  TRP A CD1  1 
ATOM   10125 C  CD2  . TRP A 1 706 ? -0.986  60.389 62.576 1.00 31.66  ? 914  TRP A CD2  1 
ATOM   10126 N  NE1  . TRP A 1 706 ? -3.110  60.209 63.264 1.00 30.22  ? 914  TRP A NE1  1 
ATOM   10127 C  CE2  . TRP A 1 706 ? -1.995  59.478 62.948 1.00 30.80  ? 914  TRP A CE2  1 
ATOM   10128 C  CE3  . TRP A 1 706 ? 0.266   59.894 62.201 1.00 30.28  ? 914  TRP A CE3  1 
ATOM   10129 C  CZ2  . TRP A 1 706 ? -1.791  58.100 62.955 1.00 32.30  ? 914  TRP A CZ2  1 
ATOM   10130 C  CZ3  . TRP A 1 706 ? 0.469   58.524 62.210 1.00 30.46  ? 914  TRP A CZ3  1 
ATOM   10131 C  CH2  . TRP A 1 706 ? -0.555  57.643 62.584 1.00 31.79  ? 914  TRP A CH2  1 
ATOM   10132 H  H    . TRP A 1 706 ? -1.863  64.968 64.063 1.00 40.12  ? 914  TRP A H    1 
ATOM   10133 H  HA   . TRP A 1 706 ? 0.133   63.140 64.192 1.00 38.35  ? 914  TRP A HA   1 
ATOM   10134 H  HB2  . TRP A 1 706 ? -1.473  63.556 61.902 1.00 40.04  ? 914  TRP A HB2  1 
ATOM   10135 H  HB3  . TRP A 1 706 ? -0.081  62.796 61.839 1.00 40.04  ? 914  TRP A HB3  1 
ATOM   10136 H  HD1  . TRP A 1 706 ? -3.429  62.237 63.258 1.00 36.43  ? 914  TRP A HD1  1 
ATOM   10137 H  HE1  . TRP A 1 706 ? -3.863  59.885 63.523 1.00 36.26  ? 914  TRP A HE1  1 
ATOM   10138 H  HE3  . TRP A 1 706 ? 0.949   60.473 61.951 1.00 36.34  ? 914  TRP A HE3  1 
ATOM   10139 H  HZ2  . TRP A 1 706 ? -2.468  57.513 63.203 1.00 38.76  ? 914  TRP A HZ2  1 
ATOM   10140 H  HZ3  . TRP A 1 706 ? 1.298   58.183 61.962 1.00 36.55  ? 914  TRP A HZ3  1 
ATOM   10141 H  HH2  . TRP A 1 706 ? -0.391  56.727 62.580 1.00 38.15  ? 914  TRP A HH2  1 
ATOM   10142 N  N    . THR A 1 707 ? 1.807   64.608 63.093 1.00 33.99  ? 915  THR A N    1 
ATOM   10143 C  CA   . THR A 1 707 ? 2.797   65.582 62.653 1.00 36.65  ? 915  THR A CA   1 
ATOM   10144 C  C    . THR A 1 707 ? 3.465   65.079 61.383 1.00 34.40  ? 915  THR A C    1 
ATOM   10145 O  O    . THR A 1 707 ? 3.888   63.917 61.315 1.00 30.15  ? 915  THR A O    1 
ATOM   10146 C  CB   . THR A 1 707 ? 3.857   65.834 63.733 1.00 38.99  ? 915  THR A CB   1 
ATOM   10147 O  OG1  . THR A 1 707 ? 3.225   66.289 64.936 1.00 34.41  ? 915  THR A OG1  1 
ATOM   10148 C  CG2  . THR A 1 707 ? 4.864   66.885 63.271 1.00 42.86  ? 915  THR A CG2  1 
ATOM   10149 H  H    . THR A 1 707 ? 2.140   63.833 63.259 1.00 40.79  ? 915  THR A H    1 
ATOM   10150 H  HA   . THR A 1 707 ? 2.356   66.423 62.455 1.00 43.98  ? 915  THR A HA   1 
ATOM   10151 H  HB   . THR A 1 707 ? 4.336   65.010 63.913 1.00 46.79  ? 915  THR A HB   1 
ATOM   10152 H  HG1  . THR A 1 707 ? 3.803   66.428 65.529 1.00 41.29  ? 915  THR A HG1  1 
ATOM   10153 H  HG21 . THR A 1 707 ? 5.528   67.034 63.963 1.00 51.44  ? 915  THR A HG21 1 
ATOM   10154 H  HG22 . THR A 1 707 ? 5.312   66.583 62.465 1.00 51.44  ? 915  THR A HG22 1 
ATOM   10155 H  HG23 . THR A 1 707 ? 4.409   67.721 63.085 1.00 51.44  ? 915  THR A HG23 1 
ATOM   10156 N  N    . ALA A 1 708 ? 3.548   65.950 60.379 1.00 31.49  ? 916  ALA A N    1 
ATOM   10157 C  CA   . ALA A 1 708 ? 4.339   65.682 59.184 1.00 32.90  ? 916  ALA A CA   1 
ATOM   10158 C  C    . ALA A 1 708 ? 5.802   65.940 59.520 1.00 34.13  ? 916  ALA A C    1 
ATOM   10159 O  O    . ALA A 1 708 ? 6.228   67.095 59.633 1.00 31.25  ? 916  ALA A O    1 
ATOM   10160 C  CB   . ALA A 1 708 ? 3.877   66.556 58.022 1.00 33.82  ? 916  ALA A CB   1 
ATOM   10161 H  H    . ALA A 1 708 ? 3.150   66.712 60.369 1.00 37.79  ? 916  ALA A H    1 
ATOM   10162 H  HA   . ALA A 1 708 ? 4.239   64.751 58.929 1.00 39.48  ? 916  ALA A HA   1 
ATOM   10163 H  HB1  . ALA A 1 708 ? 4.419   66.357 57.243 1.00 40.58  ? 916  ALA A HB1  1 
ATOM   10164 H  HB2  . ALA A 1 708 ? 2.944   66.365 57.835 1.00 40.58  ? 916  ALA A HB2  1 
ATOM   10165 H  HB3  . ALA A 1 708 ? 3.980   67.489 58.269 1.00 40.58  ? 916  ALA A HB3  1 
ATOM   10166 N  N    . MET A 1 709 ? 6.570   64.863 59.681 1.00 32.38  ? 917  MET A N    1 
ATOM   10167 C  CA   . MET A 1 709 ? 7.944   64.973 60.152 1.00 34.39  ? 917  MET A CA   1 
ATOM   10168 C  C    . MET A 1 709 ? 8.895   65.426 59.053 1.00 34.92  ? 917  MET A C    1 
ATOM   10169 O  O    . MET A 1 709 ? 9.873   66.129 59.336 1.00 34.02  ? 917  MET A O    1 
ATOM   10170 C  CB   . MET A 1 709 ? 8.408   63.627 60.714 1.00 37.18  ? 917  MET A CB   1 
ATOM   10171 C  CG   . MET A 1 709 ? 7.550   63.100 61.860 1.00 40.03  ? 917  MET A CG   1 
ATOM   10172 S  SD   . MET A 1 709 ? 7.630   64.133 63.339 1.00 45.82  ? 917  MET A SD   1 
ATOM   10173 C  CE   . MET A 1 709 ? 9.340   63.909 63.806 1.00 47.54  ? 917  MET A CE   1 
ATOM   10174 H  H    . MET A 1 709 ? 6.316   64.057 59.524 1.00 38.85  ? 917  MET A H    1 
ATOM   10175 H  HA   . MET A 1 709 ? 7.974   65.620 60.874 1.00 41.27  ? 917  MET A HA   1 
ATOM   10176 H  HB2  . MET A 1 709 ? 8.387   62.968 60.002 1.00 44.62  ? 917  MET A HB2  1 
ATOM   10177 H  HB3  . MET A 1 709 ? 9.315   63.723 61.044 1.00 44.62  ? 917  MET A HB3  1 
ATOM   10178 H  HG2  . MET A 1 709 ? 6.625   63.065 61.570 1.00 48.04  ? 917  MET A HG2  1 
ATOM   10179 H  HG3  . MET A 1 709 ? 7.856   62.211 62.099 1.00 48.04  ? 917  MET A HG3  1 
ATOM   10180 H  HE1  . MET A 1 709 ? 9.517   64.425 64.608 1.00 57.05  ? 917  MET A HE1  1 
ATOM   10181 H  HE2  . MET A 1 709 ? 9.500   62.968 63.976 1.00 57.05  ? 917  MET A HE2  1 
ATOM   10182 H  HE3  . MET A 1 709 ? 9.907   64.216 63.082 1.00 57.05  ? 917  MET A HE3  1 
ATOM   10183 N  N    . ASP A 1 710 ? 8.634   65.037 57.809 1.00 33.83  ? 918  ASP A N    1 
ATOM   10184 C  CA   . ASP A 1 710 ? 9.525   65.356 56.703 1.00 33.38  ? 918  ASP A CA   1 
ATOM   10185 C  C    . ASP A 1 710 ? 8.867   64.884 55.415 1.00 31.42  ? 918  ASP A C    1 
ATOM   10186 O  O    . ASP A 1 710 ? 7.929   64.081 55.434 1.00 29.56  ? 918  ASP A O    1 
ATOM   10187 C  CB   . ASP A 1 710 ? 10.901  64.699 56.884 1.00 34.01  ? 918  ASP A CB   1 
ATOM   10188 C  CG   . ASP A 1 710 ? 12.001  65.414 56.116 1.00 35.91  ? 918  ASP A CG   1 
ATOM   10189 O  OD1  . ASP A 1 710 ? 11.703  66.392 55.398 1.00 35.85  ? 918  ASP A OD1  1 
ATOM   10190 O  OD2  . ASP A 1 710 ? 13.172  64.998 56.238 1.00 35.82  ? 918  ASP A OD2  1 
ATOM   10191 H  H    . ASP A 1 710 ? 7.940   64.585 57.579 1.00 40.60  ? 918  ASP A H    1 
ATOM   10192 H  HA   . ASP A 1 710 ? 9.647   66.317 56.652 1.00 40.06  ? 918  ASP A HA   1 
ATOM   10193 H  HB2  . ASP A 1 710 ? 11.136  64.712 57.825 1.00 40.81  ? 918  ASP A HB2  1 
ATOM   10194 H  HB3  . ASP A 1 710 ? 10.859  63.784 56.566 1.00 40.81  ? 918  ASP A HB3  1 
ATOM   10195 N  N    . ILE A 1 711 ? 9.370   65.399 54.297 1.00 31.04  ? 919  ILE A N    1 
ATOM   10196 C  CA   . ILE A 1 711 ? 8.903   65.000 52.974 1.00 31.09  ? 919  ILE A CA   1 
ATOM   10197 C  C    . ILE A 1 711 ? 10.081  65.093 52.013 1.00 33.31  ? 919  ILE A C    1 
ATOM   10198 O  O    . ILE A 1 711 ? 10.887  66.024 52.091 1.00 35.10  ? 919  ILE A O    1 
ATOM   10199 C  CB   . ILE A 1 711 ? 7.711   65.870 52.516 1.00 32.14  ? 919  ILE A CB   1 
ATOM   10200 C  CG1  . ILE A 1 711 ? 7.255   65.468 51.110 1.00 29.56  ? 919  ILE A CG1  1 
ATOM   10201 C  CG2  . ILE A 1 711 ? 8.075   67.351 52.579 1.00 33.66  ? 919  ILE A CG2  1 
ATOM   10202 C  CD1  . ILE A 1 711 ? 5.929   66.095 50.694 1.00 31.28  ? 919  ILE A CD1  1 
ATOM   10203 H  H    . ILE A 1 711 ? 9.993   65.992 54.279 1.00 37.25  ? 919  ILE A H    1 
ATOM   10204 H  HA   . ILE A 1 711 ? 8.609   64.076 53.005 1.00 37.31  ? 919  ILE A HA   1 
ATOM   10205 H  HB   . ILE A 1 711 ? 6.973   65.715 53.127 1.00 38.57  ? 919  ILE A HB   1 
ATOM   10206 H  HG12 . ILE A 1 711 ? 7.929   65.748 50.471 1.00 35.48  ? 919  ILE A HG12 1 
ATOM   10207 H  HG13 . ILE A 1 711 ? 7.151   64.504 51.078 1.00 35.48  ? 919  ILE A HG13 1 
ATOM   10208 H  HG21 . ILE A 1 711 ? 7.312   67.875 52.288 1.00 40.40  ? 919  ILE A HG21 1 
ATOM   10209 H  HG22 . ILE A 1 711 ? 8.305   67.580 53.493 1.00 40.40  ? 919  ILE A HG22 1 
ATOM   10210 H  HG23 . ILE A 1 711 ? 8.832   67.515 51.996 1.00 40.40  ? 919  ILE A HG23 1 
ATOM   10211 H  HD11 . ILE A 1 711 ? 5.706   65.797 49.798 1.00 37.54  ? 919  ILE A HD11 1 
ATOM   10212 H  HD12 . ILE A 1 711 ? 5.239   65.816 51.317 1.00 37.54  ? 919  ILE A HD12 1 
ATOM   10213 H  HD13 . ILE A 1 711 ? 6.018   67.061 50.709 1.00 37.54  ? 919  ILE A HD13 1 
ATOM   10214 N  N    . CYS A 1 712 ? 10.186  64.116 51.113 1.00 30.32  ? 920  CYS A N    1 
ATOM   10215 C  CA   . CYS A 1 712 ? 11.292  64.030 50.170 1.00 30.37  ? 920  CYS A CA   1 
ATOM   10216 C  C    . CYS A 1 712 ? 10.759  63.760 48.769 1.00 32.29  ? 920  CYS A C    1 
ATOM   10217 O  O    . CYS A 1 712 ? 9.624   63.310 48.588 1.00 33.70  ? 920  CYS A O    1 
ATOM   10218 C  CB   . CYS A 1 712 ? 12.287  62.923 50.567 1.00 32.54  ? 920  CYS A CB   1 
ATOM   10219 S  SG   . CYS A 1 712 ? 11.574  61.245 50.587 1.00 34.43  ? 920  CYS A SG   1 
ATOM   10220 H  H    . CYS A 1 712 ? 9.615   63.478 51.031 1.00 36.38  ? 920  CYS A H    1 
ATOM   10221 H  HA   . CYS A 1 712 ? 11.767  64.876 50.157 1.00 36.44  ? 920  CYS A HA   1 
ATOM   10222 H  HB2  . CYS A 1 712 ? 13.022  62.924 49.934 1.00 39.05  ? 920  CYS A HB2  1 
ATOM   10223 H  HB3  . CYS A 1 712 ? 12.622  63.112 51.458 1.00 39.05  ? 920  CYS A HB3  1 
ATOM   10224 N  N    . ALA A 1 713 ? 11.602  64.034 47.775 1.00 33.11  ? 921  ALA A N    1 
ATOM   10225 C  CA   . ALA A 1 713 ? 11.290  63.782 46.374 1.00 33.81  ? 921  ALA A CA   1 
ATOM   10226 C  C    . ALA A 1 713 ? 12.072  62.571 45.880 1.00 33.66  ? 921  ALA A C    1 
ATOM   10227 O  O    . ALA A 1 713 ? 13.254  62.415 46.198 1.00 35.85  ? 921  ALA A O    1 
ATOM   10228 C  CB   . ALA A 1 713 ? 11.621  64.999 45.507 1.00 34.43  ? 921  ALA A CB   1 
ATOM   10229 H  H    . ALA A 1 713 ? 12.382  64.376 47.893 1.00 39.74  ? 921  ALA A H    1 
ATOM   10230 H  HA   . ALA A 1 713 ? 10.343  63.591 46.285 1.00 40.57  ? 921  ALA A HA   1 
ATOM   10231 H  HB1  . ALA A 1 713 ? 12.567  65.195 45.588 1.00 41.32  ? 921  ALA A HB1  1 
ATOM   10232 H  HB2  . ALA A 1 713 ? 11.402  64.797 44.584 1.00 41.32  ? 921  ALA A HB2  1 
ATOM   10233 H  HB3  . ALA A 1 713 ? 11.098  65.756 45.814 1.00 41.32  ? 921  ALA A HB3  1 
ATOM   10234 N  N    . THR A 1 714 ? 11.407  61.716 45.097 1.00 33.30  ? 922  THR A N    1 
ATOM   10235 C  CA   . THR A 1 714 ? 12.054  60.518 44.572 1.00 38.72  ? 922  THR A CA   1 
ATOM   10236 C  C    . THR A 1 714 ? 12.848  60.787 43.302 1.00 42.88  ? 922  THR A C    1 
ATOM   10237 O  O    . THR A 1 714 ? 13.768  60.025 42.991 1.00 43.70  ? 922  THR A O    1 
ATOM   10238 C  CB   . THR A 1 714 ? 11.016  59.426 44.292 1.00 38.27  ? 922  THR A CB   1 
ATOM   10239 O  OG1  . THR A 1 714 ? 10.080  59.888 43.311 1.00 40.09  ? 922  THR A OG1  1 
ATOM   10240 C  CG2  . THR A 1 714 ? 10.274  59.052 45.568 1.00 37.85  ? 922  THR A CG2  1 
ATOM   10241 H  H    . THR A 1 714 ? 10.586  61.809 44.858 1.00 39.96  ? 922  THR A H    1 
ATOM   10242 H  HA   . THR A 1 714 ? 12.670  60.178 45.240 1.00 46.47  ? 922  THR A HA   1 
ATOM   10243 H  HB   . THR A 1 714 ? 11.466  58.634 43.958 1.00 45.92  ? 922  THR A HB   1 
ATOM   10244 H  HG1  . THR A 1 714 ? 9.509   59.291 43.156 1.00 48.11  ? 922  THR A HG1  1 
ATOM   10245 H  HG21 . THR A 1 714 ? 9.620   58.361 45.380 1.00 45.42  ? 922  THR A HG21 1 
ATOM   10246 H  HG22 . THR A 1 714 ? 10.900  58.721 46.231 1.00 45.42  ? 922  THR A HG22 1 
ATOM   10247 H  HG23 . THR A 1 714 ? 9.817   59.829 45.925 1.00 45.42  ? 922  THR A HG23 1 
ATOM   10248 N  N    . GLY A 1 715 ? 12.510  61.842 42.565 1.00 46.01  ? 923  GLY A N    1 
ATOM   10249 C  CA   . GLY A 1 715 ? 13.252  62.232 41.390 1.00 43.96  ? 923  GLY A CA   1 
ATOM   10250 C  C    . GLY A 1 715 ? 13.564  63.716 41.411 1.00 42.45  ? 923  GLY A C    1 
ATOM   10251 O  O    . GLY A 1 715 ? 13.621  64.339 42.476 1.00 41.44  ? 923  GLY A O    1 
ATOM   10252 H  H    . GLY A 1 715 ? 11.840  62.354 42.735 1.00 55.22  ? 923  GLY A H    1 
ATOM   10253 H  HA2  . GLY A 1 715 ? 14.086  61.739 41.350 1.00 52.75  ? 923  GLY A HA2  1 
ATOM   10254 H  HA3  . GLY A 1 715 ? 12.734  62.034 40.594 1.00 52.75  ? 923  GLY A HA3  1 
ATOM   10255 N  N    . PRO A 1 716 ? 13.774  64.318 40.240 1.00 41.62  ? 924  PRO A N    1 
ATOM   10256 C  CA   . PRO A 1 716 ? 14.051  65.758 40.206 1.00 43.14  ? 924  PRO A CA   1 
ATOM   10257 C  C    . PRO A 1 716 ? 12.877  66.557 40.752 1.00 42.98  ? 924  PRO A C    1 
ATOM   10258 O  O    . PRO A 1 716 ? 11.715  66.168 40.615 1.00 42.67  ? 924  PRO A O    1 
ATOM   10259 C  CB   . PRO A 1 716 ? 14.286  66.043 38.718 1.00 44.26  ? 924  PRO A CB   1 
ATOM   10260 C  CG   . PRO A 1 716 ? 13.592  64.940 38.003 1.00 43.94  ? 924  PRO A CG   1 
ATOM   10261 C  CD   . PRO A 1 716 ? 13.720  63.738 38.887 1.00 41.79  ? 924  PRO A CD   1 
ATOM   10262 H  HA   . PRO A 1 716 ? 14.853  65.966 40.710 1.00 51.77  ? 924  PRO A HA   1 
ATOM   10263 H  HB2  . PRO A 1 716 ? 13.899  66.901 38.483 1.00 53.11  ? 924  PRO A HB2  1 
ATOM   10264 H  HB3  . PRO A 1 716 ? 15.237  66.030 38.528 1.00 53.11  ? 924  PRO A HB3  1 
ATOM   10265 H  HG2  . PRO A 1 716 ? 12.659  65.172 37.876 1.00 52.73  ? 924  PRO A HG2  1 
ATOM   10266 H  HG3  . PRO A 1 716 ? 14.025  64.783 37.149 1.00 52.73  ? 924  PRO A HG3  1 
ATOM   10267 H  HD2  . PRO A 1 716 ? 12.943  63.165 38.795 1.00 50.15  ? 924  PRO A HD2  1 
ATOM   10268 H  HD3  . PRO A 1 716 ? 14.541  63.259 38.691 1.00 50.15  ? 924  PRO A HD3  1 
ATOM   10269 N  N    . THR A 1 717 ? 13.196  67.687 41.382 1.00 42.35  ? 925  THR A N    1 
ATOM   10270 C  CA   . THR A 1 717 ? 12.194  68.539 42.007 1.00 41.40  ? 925  THR A CA   1 
ATOM   10271 C  C    . THR A 1 717 ? 12.590  69.999 41.845 1.00 40.87  ? 925  THR A C    1 
ATOM   10272 O  O    . THR A 1 717 ? 13.773  70.328 41.720 1.00 39.62  ? 925  THR A O    1 
ATOM   10273 C  CB   . THR A 1 717 ? 12.030  68.217 43.501 1.00 42.23  ? 925  THR A CB   1 
ATOM   10274 O  OG1  . THR A 1 717 ? 11.085  69.122 44.089 1.00 40.27  ? 925  THR A OG1  1 
ATOM   10275 C  CG2  . THR A 1 717 ? 13.367  68.340 44.231 1.00 44.24  ? 925  THR A CG2  1 
ATOM   10276 H  H    . THR A 1 717 ? 13.999  67.984 41.460 1.00 50.82  ? 925  THR A H    1 
ATOM   10277 H  HA   . THR A 1 717 ? 11.339  68.403 41.569 1.00 49.69  ? 925  THR A HA   1 
ATOM   10278 H  HB   . THR A 1 717 ? 11.709  67.307 43.601 1.00 50.67  ? 925  THR A HB   1 
ATOM   10279 H  HG1  . THR A 1 717 ? 10.340  69.047 43.709 1.00 48.32  ? 925  THR A HG1  1 
ATOM   10280 H  HG21 . THR A 1 717 ? 13.251  68.135 45.172 1.00 53.10  ? 925  THR A HG21 1 
ATOM   10281 H  HG22 . THR A 1 717 ? 14.010  67.722 43.850 1.00 53.10  ? 925  THR A HG22 1 
ATOM   10282 H  HG23 . THR A 1 717 ? 13.709  69.244 44.144 1.00 53.10  ? 925  THR A HG23 1 
ATOM   10283 N  N    . ALA A 1 718 ? 11.583  70.873 41.852 1.00 40.61  ? 926  ALA A N    1 
ATOM   10284 C  CA   . ALA A 1 718 ? 11.794  72.313 41.807 1.00 39.72  ? 926  ALA A CA   1 
ATOM   10285 C  C    . ALA A 1 718 ? 11.742  72.964 43.183 1.00 40.49  ? 926  ALA A C    1 
ATOM   10286 O  O    . ALA A 1 718 ? 11.981  74.170 43.289 1.00 40.88  ? 926  ALA A O    1 
ATOM   10287 C  CB   . ALA A 1 718 ? 10.756  72.971 40.890 1.00 40.43  ? 926  ALA A CB   1 
ATOM   10288 H  H    . ALA A 1 718 ? 10.753  70.648 41.885 1.00 48.73  ? 926  ALA A H    1 
ATOM   10289 H  HA   . ALA A 1 718 ? 12.671  72.486 41.432 1.00 47.67  ? 926  ALA A HA   1 
ATOM   10290 H  HB1  . ALA A 1 718 ? 10.912  73.928 40.872 1.00 48.52  ? 926  ALA A HB1  1 
ATOM   10291 H  HB2  . ALA A 1 718 ? 10.847  72.604 39.996 1.00 48.52  ? 926  ALA A HB2  1 
ATOM   10292 H  HB3  . ALA A 1 718 ? 9.868   72.786 41.235 1.00 48.52  ? 926  ALA A HB3  1 
ATOM   10293 N  N    . CYS A 1 719 ? 11.433  72.208 44.232 1.00 38.96  ? 927  CYS A N    1 
ATOM   10294 C  CA   . CYS A 1 719 ? 11.430  72.754 45.587 1.00 42.15  ? 927  CYS A CA   1 
ATOM   10295 C  C    . CYS A 1 719 ? 12.854  72.741 46.136 1.00 43.79  ? 927  CYS A C    1 
ATOM   10296 O  O    . CYS A 1 719 ? 13.438  71.659 46.281 1.00 45.06  ? 927  CYS A O    1 
ATOM   10297 C  CB   . CYS A 1 719 ? 10.499  71.944 46.482 1.00 45.50  ? 927  CYS A CB   1 
ATOM   10298 S  SG   . CYS A 1 719 ? 10.433  72.449 48.228 1.00 45.98  ? 927  CYS A SG   1 
ATOM   10299 H  H    . CYS A 1 719 ? 11.221  71.376 44.187 1.00 46.76  ? 927  CYS A H    1 
ATOM   10300 H  HA   . CYS A 1 719 ? 11.117  73.672 45.566 1.00 50.58  ? 927  CYS A HA   1 
ATOM   10301 H  HB2  . CYS A 1 719 ? 9.599   72.013 46.128 1.00 54.60  ? 927  CYS A HB2  1 
ATOM   10302 H  HB3  . CYS A 1 719 ? 10.784  71.017 46.460 1.00 54.60  ? 927  CYS A HB3  1 
ATOM   10303 N  N    . PRO A 1 720 ? 13.451  73.899 46.447 1.00 43.43  ? 928  PRO A N    1 
ATOM   10304 C  CA   . PRO A 1 720 ? 14.886  73.914 46.787 1.00 45.10  ? 928  PRO A CA   1 
ATOM   10305 C  C    . PRO A 1 720 ? 15.221  73.274 48.123 1.00 47.30  ? 928  PRO A C    1 
ATOM   10306 O  O    . PRO A 1 720 ? 16.378  72.888 48.326 1.00 51.74  ? 928  PRO A O    1 
ATOM   10307 C  CB   . PRO A 1 720 ? 15.235  75.412 46.801 1.00 44.76  ? 928  PRO A CB   1 
ATOM   10308 C  CG   . PRO A 1 720 ? 14.071  76.113 46.191 1.00 45.45  ? 928  PRO A CG   1 
ATOM   10309 C  CD   . PRO A 1 720 ? 12.884  75.259 46.452 1.00 44.38  ? 928  PRO A CD   1 
ATOM   10310 H  HA   . PRO A 1 720 ? 15.398  73.476 46.089 1.00 54.12  ? 928  PRO A HA   1 
ATOM   10311 H  HB2  . PRO A 1 720 ? 15.368  75.705 47.716 1.00 53.71  ? 928  PRO A HB2  1 
ATOM   10312 H  HB3  . PRO A 1 720 ? 16.037  75.563 46.275 1.00 53.71  ? 928  PRO A HB3  1 
ATOM   10313 H  HG2  . PRO A 1 720 ? 13.962  76.982 46.608 1.00 54.54  ? 928  PRO A HG2  1 
ATOM   10314 H  HG3  . PRO A 1 720 ? 14.216  76.211 45.237 1.00 54.54  ? 928  PRO A HG3  1 
ATOM   10315 H  HD2  . PRO A 1 720 ? 12.501  75.464 47.319 1.00 53.26  ? 928  PRO A HD2  1 
ATOM   10316 H  HD3  . PRO A 1 720 ? 12.232  75.357 45.740 1.00 53.26  ? 928  PRO A HD3  1 
ATOM   10317 N  N    . VAL A 1 721 ? 14.263  73.167 49.048 1.00 46.41  ? 929  VAL A N    1 
ATOM   10318 C  CA   . VAL A 1 721 ? 14.543  72.613 50.369 1.00 46.80  ? 929  VAL A CA   1 
ATOM   10319 C  C    . VAL A 1 721 ? 14.235  71.126 50.454 1.00 45.91  ? 929  VAL A C    1 
ATOM   10320 O  O    . VAL A 1 721 ? 14.430  70.521 51.519 1.00 43.20  ? 929  VAL A O    1 
ATOM   10321 C  CB   . VAL A 1 721 ? 13.748  73.365 51.456 1.00 48.30  ? 929  VAL A CB   1 
ATOM   10322 C  CG1  . VAL A 1 721 ? 14.189  74.821 51.521 1.00 49.27  ? 929  VAL A CG1  1 
ATOM   10323 C  CG2  . VAL A 1 721 ? 12.246  73.265 51.198 1.00 48.52  ? 929  VAL A CG2  1 
ATOM   10324 H  H    . VAL A 1 721 ? 13.445  73.407 48.933 1.00 55.70  ? 929  VAL A H    1 
ATOM   10325 H  HA   . VAL A 1 721 ? 15.486  72.730 50.560 1.00 56.16  ? 929  VAL A HA   1 
ATOM   10326 H  HB   . VAL A 1 721 ? 13.931  72.959 52.318 1.00 57.96  ? 929  VAL A HB   1 
ATOM   10327 H  HG11 . VAL A 1 721 ? 13.679  75.275 52.209 1.00 59.13  ? 929  VAL A HG11 1 
ATOM   10328 H  HG12 . VAL A 1 721 ? 15.135  74.854 51.733 1.00 59.13  ? 929  VAL A HG12 1 
ATOM   10329 H  HG13 . VAL A 1 721 ? 14.029  75.237 50.659 1.00 59.13  ? 929  VAL A HG13 1 
ATOM   10330 H  HG21 . VAL A 1 721 ? 11.773  73.745 51.896 1.00 58.23  ? 929  VAL A HG21 1 
ATOM   10331 H  HG22 . VAL A 1 721 ? 12.047  73.656 50.333 1.00 58.23  ? 929  VAL A HG22 1 
ATOM   10332 H  HG23 . VAL A 1 721 ? 11.986  72.330 51.206 1.00 58.23  ? 929  VAL A HG23 1 
ATOM   10333 N  N    . MET A 1 722 ? 13.767  70.515 49.370 1.00 43.87  ? 930  MET A N    1 
ATOM   10334 C  CA   . MET A 1 722 ? 13.381  69.112 49.381 1.00 43.27  ? 930  MET A CA   1 
ATOM   10335 C  C    . MET A 1 722 ? 14.602  68.238 49.132 1.00 43.68  ? 930  MET A C    1 
ATOM   10336 O  O    . MET A 1 722 ? 15.313  68.416 48.138 1.00 43.82  ? 930  MET A O    1 
ATOM   10337 C  CB   . MET A 1 722 ? 12.311  68.843 48.323 1.00 42.67  ? 930  MET A CB   1 
ATOM   10338 C  CG   . MET A 1 722 ? 11.713  67.453 48.399 1.00 42.94  ? 930  MET A CG   1 
ATOM   10339 S  SD   . MET A 1 722 ? 9.942   67.477 48.715 1.00 46.46  ? 930  MET A SD   1 
ATOM   10340 C  CE   . MET A 1 722 ? 9.335   68.231 47.211 1.00 49.15  ? 930  MET A CE   1 
ATOM   10341 H  H    . MET A 1 722 ? 13.662  70.898 48.607 1.00 52.65  ? 930  MET A H    1 
ATOM   10342 H  HA   . MET A 1 722 ? 13.007  68.894 50.249 1.00 51.92  ? 930  MET A HA   1 
ATOM   10343 H  HB2  . MET A 1 722 ? 11.591  69.482 48.436 1.00 51.20  ? 930  MET A HB2  1 
ATOM   10344 H  HB3  . MET A 1 722 ? 12.708  68.947 47.444 1.00 51.20  ? 930  MET A HB3  1 
ATOM   10345 H  HG2  . MET A 1 722 ? 11.861  66.998 47.555 1.00 51.53  ? 930  MET A HG2  1 
ATOM   10346 H  HG3  . MET A 1 722 ? 12.140  66.964 49.119 1.00 51.53  ? 930  MET A HG3  1 
ATOM   10347 H  HE1  . MET A 1 722 ? 9.727   69.114 47.121 1.00 58.98  ? 930  MET A HE1  1 
ATOM   10348 H  HE2  . MET A 1 722 ? 9.589   67.678 46.456 1.00 58.98  ? 930  MET A HE2  1 
ATOM   10349 H  HE3  . MET A 1 722 ? 8.369   68.301 47.261 1.00 58.98  ? 930  MET A HE3  1 
ATOM   10350 N  N    . GLN A 1 723 ? 14.841  67.300 50.041 1.00 45.34  ? 931  GLN A N    1 
ATOM   10351 C  CA   . GLN A 1 723 ? 15.925  66.345 49.899 1.00 47.99  ? 931  GLN A CA   1 
ATOM   10352 C  C    . GLN A 1 723 ? 15.482  65.175 49.023 1.00 39.53  ? 931  GLN A C    1 
ATOM   10353 O  O    . GLN A 1 723 ? 14.289  64.898 48.870 1.00 36.78  ? 931  GLN A O    1 
ATOM   10354 C  CB   . GLN A 1 723 ? 16.364  65.850 51.279 1.00 60.49  ? 931  GLN A CB   1 
ATOM   10355 C  CG   . GLN A 1 723 ? 17.704  65.139 51.313 1.00 71.75  ? 931  GLN A CG   1 
ATOM   10356 C  CD   . GLN A 1 723 ? 18.146  64.818 52.731 1.00 79.82  ? 931  GLN A CD   1 
ATOM   10357 O  OE1  . GLN A 1 723 ? 17.337  64.813 53.661 1.00 81.22  ? 931  GLN A OE1  1 
ATOM   10358 N  NE2  . GLN A 1 723 ? 19.437  64.556 52.904 1.00 83.46  ? 931  GLN A NE2  1 
ATOM   10359 H  H    . GLN A 1 723 ? 14.381  67.198 50.760 1.00 54.41  ? 931  GLN A H    1 
ATOM   10360 H  HA   . GLN A 1 723 ? 16.682  66.777 49.474 1.00 57.59  ? 931  GLN A HA   1 
ATOM   10361 H  HB2  . GLN A 1 723 ? 16.423  66.613 51.875 1.00 72.59  ? 931  GLN A HB2  1 
ATOM   10362 H  HB3  . GLN A 1 723 ? 15.695  65.230 51.610 1.00 72.59  ? 931  GLN A HB3  1 
ATOM   10363 H  HG2  . GLN A 1 723 ? 17.634  64.305 50.822 1.00 86.10  ? 931  GLN A HG2  1 
ATOM   10364 H  HG3  . GLN A 1 723 ? 18.377  65.709 50.909 1.00 86.10  ? 931  GLN A HG3  1 
ATOM   10365 H  HE21 . GLN A 1 723 ? 19.973  64.570 52.232 1.00 100.16 ? 931  GLN A HE21 1 
ATOM   10366 H  HE22 . GLN A 1 723 ? 19.737  64.369 53.689 1.00 100.16 ? 931  GLN A HE22 1 
ATOM   10367 N  N    . THR A 1 724 ? 16.460  64.491 48.435 1.00 35.71  ? 932  THR A N    1 
ATOM   10368 C  CA   . THR A 1 724 ? 16.178  63.300 47.643 1.00 34.77  ? 932  THR A CA   1 
ATOM   10369 C  C    . THR A 1 724 ? 15.965  62.105 48.567 1.00 33.74  ? 932  THR A C    1 
ATOM   10370 O  O    . THR A 1 724 ? 16.723  61.898 49.520 1.00 32.91  ? 932  THR A O    1 
ATOM   10371 C  CB   . THR A 1 724 ? 17.322  63.021 46.669 1.00 34.27  ? 932  THR A CB   1 
ATOM   10372 O  OG1  . THR A 1 724 ? 17.589  64.195 45.893 1.00 39.10  ? 932  THR A OG1  1 
ATOM   10373 C  CG2  . THR A 1 724 ? 16.968  61.876 45.728 1.00 34.12  ? 932  THR A CG2  1 
ATOM   10374 H  H    . THR A 1 724 ? 17.294  64.696 48.480 1.00 42.85  ? 932  THR A H    1 
ATOM   10375 H  HA   . THR A 1 724 ? 15.366  63.440 47.131 1.00 41.73  ? 932  THR A HA   1 
ATOM   10376 H  HB   . THR A 1 724 ? 18.118  62.776 47.166 1.00 41.12  ? 932  THR A HB   1 
ATOM   10377 H  HG1  . THR A 1 724 ? 18.217  64.048 45.356 1.00 46.92  ? 932  THR A HG1  1 
ATOM   10378 H  HG21 . THR A 1 724 ? 17.702  61.711 45.117 1.00 40.94  ? 932  THR A HG21 1 
ATOM   10379 H  HG22 . THR A 1 724 ? 16.796  61.069 46.239 1.00 40.94  ? 932  THR A HG22 1 
ATOM   10380 H  HG23 . THR A 1 724 ? 16.175  62.100 45.216 1.00 40.94  ? 932  THR A HG23 1 
ATOM   10381 N  N    . CYS A 1 725 ? 14.926  61.313 48.277 1.00 33.06  ? 933  CYS A N    1 
ATOM   10382 C  CA   . CYS A 1 725 ? 14.518  60.263 49.207 1.00 35.87  ? 933  CYS A CA   1 
ATOM   10383 C  C    . CYS A 1 725 ? 15.640  59.259 49.448 1.00 34.16  ? 933  CYS A C    1 
ATOM   10384 O  O    . CYS A 1 725 ? 15.813  58.772 50.571 1.00 37.91  ? 933  CYS A O    1 
ATOM   10385 C  CB   . CYS A 1 725 ? 13.265  59.551 48.689 1.00 36.00  ? 933  CYS A CB   1 
ATOM   10386 S  SG   . CYS A 1 725 ? 11.759  60.571 48.676 1.00 43.57  ? 933  CYS A SG   1 
ATOM   10387 H  H    . CYS A 1 725 ? 14.452  61.364 47.562 1.00 39.67  ? 933  CYS A H    1 
ATOM   10388 H  HA   . CYS A 1 725 ? 14.297  60.669 50.060 1.00 43.05  ? 933  CYS A HA   1 
ATOM   10389 H  HB2  . CYS A 1 725 ? 13.430  59.258 47.779 1.00 43.20  ? 933  CYS A HB2  1 
ATOM   10390 H  HB3  . CYS A 1 725 ? 13.092  58.780 49.253 1.00 43.20  ? 933  CYS A HB3  1 
ATOM   10391 N  N    . SER A 1 726 ? 16.413  58.933 48.410 1.00 34.83  ? 934  SER A N    1 
ATOM   10392 C  CA   . SER A 1 726 ? 17.482  57.952 48.564 1.00 38.54  ? 934  SER A CA   1 
ATOM   10393 C  C    . SER A 1 726 ? 18.594  58.442 49.484 1.00 39.57  ? 934  SER A C    1 
ATOM   10394 O  O    . SER A 1 726 ? 19.391  57.625 49.960 1.00 39.13  ? 934  SER A O    1 
ATOM   10395 C  CB   . SER A 1 726 ? 18.067  57.590 47.199 1.00 40.13  ? 934  SER A CB   1 
ATOM   10396 O  OG   . SER A 1 726 ? 18.816  58.668 46.664 1.00 41.77  ? 934  SER A OG   1 
ATOM   10397 H  H    . SER A 1 726 ? 16.340  59.262 47.619 1.00 41.80  ? 934  SER A H    1 
ATOM   10398 H  HA   . SER A 1 726 ? 17.111  57.144 48.952 1.00 46.25  ? 934  SER A HA   1 
ATOM   10399 H  HB2  . SER A 1 726 ? 18.649  56.821 47.299 1.00 48.16  ? 934  SER A HB2  1 
ATOM   10400 H  HB3  . SER A 1 726 ? 17.341  57.379 46.591 1.00 48.16  ? 934  SER A HB3  1 
ATOM   10401 H  HG   . SER A 1 726 ? 19.131  58.455 45.915 1.00 50.12  ? 934  SER A HG   1 
ATOM   10402 N  N    . GLN A 1 727 ? 18.662  59.744 49.750 1.00 37.35  ? 935  GLN A N    1 
ATOM   10403 C  CA   . GLN A 1 727 ? 19.701  60.320 50.592 1.00 37.80  ? 935  GLN A CA   1 
ATOM   10404 C  C    . GLN A 1 727 ? 19.234  60.582 52.017 1.00 33.79  ? 935  GLN A C    1 
ATOM   10405 O  O    . GLN A 1 727 ? 20.012  61.100 52.822 1.00 34.48  ? 935  GLN A O    1 
ATOM   10406 C  CB   . GLN A 1 727 ? 20.210  61.627 49.973 1.00 44.41  ? 935  GLN A CB   1 
ATOM   10407 C  CG   . GLN A 1 727 ? 20.630  61.491 48.519 1.00 52.63  ? 935  GLN A CG   1 
ATOM   10408 C  CD   . GLN A 1 727 ? 21.774  60.515 48.332 1.00 61.10  ? 935  GLN A CD   1 
ATOM   10409 O  OE1  . GLN A 1 727 ? 22.918  60.811 48.676 1.00 65.08  ? 935  GLN A OE1  1 
ATOM   10410 N  NE2  . GLN A 1 727 ? 21.470  59.340 47.787 1.00 63.26  ? 935  GLN A NE2  1 
ATOM   10411 H  H    . GLN A 1 727 ? 18.104  60.325 49.447 1.00 44.82  ? 935  GLN A H    1 
ATOM   10412 H  HA   . GLN A 1 727 ? 20.447  59.701 50.634 1.00 45.36  ? 935  GLN A HA   1 
ATOM   10413 H  HB2  . GLN A 1 727 ? 19.504  62.290 50.017 1.00 53.29  ? 935  GLN A HB2  1 
ATOM   10414 H  HB3  . GLN A 1 727 ? 20.981  61.932 50.477 1.00 53.29  ? 935  GLN A HB3  1 
ATOM   10415 H  HG2  . GLN A 1 727 ? 19.875  61.172 48.000 1.00 63.16  ? 935  GLN A HG2  1 
ATOM   10416 H  HG3  . GLN A 1 727 ? 20.918  62.357 48.190 1.00 63.16  ? 935  GLN A HG3  1 
ATOM   10417 H  HE21 . GLN A 1 727 ? 20.659  59.168 47.560 1.00 75.91  ? 935  GLN A HE21 1 
ATOM   10418 H  HE22 . GLN A 1 727 ? 22.085  58.752 47.661 1.00 75.91  ? 935  GLN A HE22 1 
ATOM   10419 N  N    . THR A 1 728 ? 17.990  60.257 52.344 1.00 33.60  ? 936  THR A N    1 
ATOM   10420 C  CA   . THR A 1 728 ? 17.502  60.394 53.705 1.00 36.14  ? 936  THR A CA   1 
ATOM   10421 C  C    . THR A 1 728 ? 17.828  59.138 54.506 1.00 36.26  ? 936  THR A C    1 
ATOM   10422 O  O    . THR A 1 728 ? 18.304  58.134 53.974 1.00 32.63  ? 936  THR A O    1 
ATOM   10423 C  CB   . THR A 1 728 ? 15.992  60.638 53.720 1.00 36.18  ? 936  THR A CB   1 
ATOM   10424 O  OG1  . THR A 1 728 ? 15.317  59.480 53.213 1.00 34.80  ? 936  THR A OG1  1 
ATOM   10425 C  CG2  . THR A 1 728 ? 15.626  61.846 52.871 1.00 38.62  ? 936  THR A CG2  1 
ATOM   10426 H  H    . THR A 1 728 ? 17.406  59.952 51.790 1.00 40.33  ? 936  THR A H    1 
ATOM   10427 H  HA   . THR A 1 728 ? 17.938  61.150 54.129 1.00 43.37  ? 936  THR A HA   1 
ATOM   10428 H  HB   . THR A 1 728 ? 15.703  60.806 54.631 1.00 43.42  ? 936  THR A HB   1 
ATOM   10429 H  HG1  . THR A 1 728 ? 15.565  59.325 52.426 1.00 41.77  ? 936  THR A HG1  1 
ATOM   10430 H  HG21 . THR A 1 728 ? 14.667  61.987 52.892 1.00 46.34  ? 936  THR A HG21 1 
ATOM   10431 H  HG22 . THR A 1 728 ? 16.069  62.638 53.214 1.00 46.34  ? 936  THR A HG22 1 
ATOM   10432 H  HG23 . THR A 1 728 ? 15.905  61.702 51.953 1.00 46.34  ? 936  THR A HG23 1 
ATOM   10433 N  N    . ALA A 1 729 ? 17.555  59.202 55.807 1.00 38.12  ? 937  ALA A N    1 
ATOM   10434 C  CA   . ALA A 1 729 ? 17.697  58.046 56.680 1.00 39.49  ? 937  ALA A CA   1 
ATOM   10435 C  C    . ALA A 1 729 ? 16.393  57.291 56.893 1.00 35.85  ? 937  ALA A C    1 
ATOM   10436 O  O    . ALA A 1 729 ? 16.432  56.134 57.325 1.00 36.13  ? 937  ALA A O    1 
ATOM   10437 C  CB   . ALA A 1 729 ? 18.249  58.480 58.043 1.00 42.00  ? 937  ALA A CB   1 
ATOM   10438 H  H    . ALA A 1 729 ? 17.283  59.912 56.210 1.00 45.75  ? 937  ALA A H    1 
ATOM   10439 H  HA   . ALA A 1 729 ? 18.334  57.432 56.283 1.00 47.39  ? 937  ALA A HA   1 
ATOM   10440 H  HB1  . ALA A 1 729 ? 18.337  57.699 58.611 1.00 50.41  ? 937  ALA A HB1  1 
ATOM   10441 H  HB2  . ALA A 1 729 ? 19.115  58.896 57.915 1.00 50.41  ? 937  ALA A HB2  1 
ATOM   10442 H  HB3  . ALA A 1 729 ? 17.633  59.114 58.445 1.00 50.41  ? 937  ALA A HB3  1 
ATOM   10443 N  N    . TRP A 1 730 ? 15.247  57.909 56.592 1.00 30.98  ? 938  TRP A N    1 
ATOM   10444 C  CA   . TRP A 1 730 ? 13.947  57.343 56.927 1.00 29.99  ? 938  TRP A CA   1 
ATOM   10445 C  C    . TRP A 1 730 ? 13.165  56.811 55.735 1.00 28.70  ? 938  TRP A C    1 
ATOM   10446 O  O    . TRP A 1 730 ? 12.241  56.017 55.934 1.00 30.29  ? 938  TRP A O    1 
ATOM   10447 C  CB   . TRP A 1 730 ? 13.083  58.394 57.636 1.00 31.38  ? 938  TRP A CB   1 
ATOM   10448 C  CG   . TRP A 1 730 ? 12.982  59.689 56.879 1.00 29.53  ? 938  TRP A CG   1 
ATOM   10449 C  CD1  . TRP A 1 730 ? 13.793  60.779 57.013 1.00 30.94  ? 938  TRP A CD1  1 
ATOM   10450 C  CD2  . TRP A 1 730 ? 12.022  60.026 55.869 1.00 28.80  ? 938  TRP A CD2  1 
ATOM   10451 N  NE1  . TRP A 1 730 ? 13.395  61.776 56.153 1.00 28.84  ? 938  TRP A NE1  1 
ATOM   10452 C  CE2  . TRP A 1 730 ? 12.309  61.339 55.440 1.00 28.39  ? 938  TRP A CE2  1 
ATOM   10453 C  CE3  . TRP A 1 730 ? 10.946  59.347 55.288 1.00 30.27  ? 938  TRP A CE3  1 
ATOM   10454 C  CZ2  . TRP A 1 730 ? 11.562  61.983 54.456 1.00 29.13  ? 938  TRP A CZ2  1 
ATOM   10455 C  CZ3  . TRP A 1 730 ? 10.201  59.992 54.312 1.00 30.93  ? 938  TRP A CZ3  1 
ATOM   10456 C  CH2  . TRP A 1 730 ? 10.514  61.296 53.907 1.00 30.77  ? 938  TRP A CH2  1 
ATOM   10457 H  H    . TRP A 1 730 ? 15.200  58.667 56.189 1.00 37.18  ? 938  TRP A H    1 
ATOM   10458 H  HA   . TRP A 1 730 ? 14.080  56.606 57.543 1.00 35.99  ? 938  TRP A HA   1 
ATOM   10459 H  HB2  . TRP A 1 730 ? 12.186  58.042 57.746 1.00 37.65  ? 938  TRP A HB2  1 
ATOM   10460 H  HB3  . TRP A 1 730 ? 13.470  58.586 58.505 1.00 37.65  ? 938  TRP A HB3  1 
ATOM   10461 H  HD1  . TRP A 1 730 ? 14.510  60.840 57.603 1.00 37.14  ? 938  TRP A HD1  1 
ATOM   10462 H  HE1  . TRP A 1 730 ? 13.767  62.547 56.074 1.00 34.61  ? 938  TRP A HE1  1 
ATOM   10463 H  HE3  . TRP A 1 730 ? 10.731  58.482 55.554 1.00 36.32  ? 938  TRP A HE3  1 
ATOM   10464 H  HZ2  . TRP A 1 730 ? 11.767  62.849 54.186 1.00 34.96  ? 938  TRP A HZ2  1 
ATOM   10465 H  HZ3  . TRP A 1 730 ? 9.483   59.551 53.919 1.00 37.12  ? 938  TRP A HZ3  1 
ATOM   10466 H  HH2  . TRP A 1 730 ? 9.999   61.704 53.249 1.00 36.92  ? 938  TRP A HH2  1 
ATOM   10467 N  N    . SER A 1 731 ? 13.493  57.228 54.517 1.00 28.93  ? 939  SER A N    1 
ATOM   10468 C  CA   . SER A 1 731 ? 12.674  56.874 53.367 1.00 25.49  ? 939  SER A CA   1 
ATOM   10469 C  C    . SER A 1 731 ? 12.768  55.382 53.059 1.00 24.28  ? 939  SER A C    1 
ATOM   10470 O  O    . SER A 1 731 ? 13.785  54.735 53.316 1.00 24.85  ? 939  SER A O    1 
ATOM   10471 C  CB   . SER A 1 731 ? 13.106  57.677 52.144 1.00 27.47  ? 939  SER A CB   1 
ATOM   10472 O  OG   . SER A 1 731 ? 12.427  57.231 50.985 1.00 28.30  ? 939  SER A OG   1 
ATOM   10473 H  H    . SER A 1 731 ? 14.179  57.712 54.331 1.00 34.72  ? 939  SER A H    1 
ATOM   10474 H  HA   . SER A 1 731 ? 11.747  57.086 53.558 1.00 30.59  ? 939  SER A HA   1 
ATOM   10475 H  HB2  . SER A 1 731 ? 12.899  58.613 52.291 1.00 32.97  ? 939  SER A HB2  1 
ATOM   10476 H  HB3  . SER A 1 731 ? 14.061  57.565 52.013 1.00 32.97  ? 939  SER A HB3  1 
ATOM   10477 H  HG   . SER A 1 731 ? 11.598  57.322 51.086 1.00 33.97  ? 939  SER A HG   1 
ATOM   10478 N  N    . SER A 1 732 ? 11.685  54.838 52.497 1.00 26.60  ? 940  SER A N    1 
ATOM   10479 C  CA   . SER A 1 732 ? 11.709  53.467 51.994 1.00 25.91  ? 940  SER A CA   1 
ATOM   10480 C  C    . SER A 1 732 ? 12.604  53.321 50.772 1.00 27.63  ? 940  SER A C    1 
ATOM   10481 O  O    . SER A 1 732 ? 12.883  52.191 50.358 1.00 27.81  ? 940  SER A O    1 
ATOM   10482 C  CB   . SER A 1 732 ? 10.288  52.995 51.663 1.00 26.66  ? 940  SER A CB   1 
ATOM   10483 O  OG   . SER A 1 732 ? 9.677   53.802 50.666 1.00 27.96  ? 940  SER A OG   1 
ATOM   10484 H  H    . SER A 1 732 ? 10.931  55.240 52.396 1.00 31.92  ? 940  SER A H    1 
ATOM   10485 H  HA   . SER A 1 732 ? 12.059  52.887 52.688 1.00 31.09  ? 940  SER A HA   1 
ATOM   10486 H  HB2  . SER A 1 732 ? 10.330  52.081 51.342 1.00 31.99  ? 940  SER A HB2  1 
ATOM   10487 H  HB3  . SER A 1 732 ? 9.750   53.036 52.470 1.00 31.99  ? 940  SER A HB3  1 
ATOM   10488 H  HG   . SER A 1 732 ? 9.629   54.598 50.930 1.00 33.55  ? 940  SER A HG   1 
ATOM   10489 N  N    . PHE A 1 733 ? 13.063  54.434 50.199 1.00 26.48  ? 941  PHE A N    1 
ATOM   10490 C  CA   . PHE A 1 733 ? 14.036  54.429 49.116 1.00 28.16  ? 941  PHE A CA   1 
ATOM   10491 C  C    . PHE A 1 733 ? 15.477  54.497 49.610 1.00 29.11  ? 941  PHE A C    1 
ATOM   10492 O  O    . PHE A 1 733 ? 16.396  54.307 48.809 1.00 30.63  ? 941  PHE A O    1 
ATOM   10493 C  CB   . PHE A 1 733 ? 13.775  55.610 48.169 1.00 32.52  ? 941  PHE A CB   1 
ATOM   10494 C  CG   . PHE A 1 733 ? 12.477  55.510 47.415 1.00 33.99  ? 941  PHE A CG   1 
ATOM   10495 C  CD1  . PHE A 1 733 ? 11.295  55.970 47.975 1.00 33.05  ? 941  PHE A CD1  1 
ATOM   10496 C  CD2  . PHE A 1 733 ? 12.439  54.958 46.144 1.00 36.22  ? 941  PHE A CD2  1 
ATOM   10497 C  CE1  . PHE A 1 733 ? 10.103  55.878 47.288 1.00 34.46  ? 941  PHE A CE1  1 
ATOM   10498 C  CE2  . PHE A 1 733 ? 11.247  54.865 45.449 1.00 38.19  ? 941  PHE A CE2  1 
ATOM   10499 C  CZ   . PHE A 1 733 ? 10.077  55.324 46.022 1.00 37.92  ? 941  PHE A CZ   1 
ATOM   10500 H  H    . PHE A 1 733 ? 12.817  55.225 50.430 1.00 31.77  ? 941  PHE A H    1 
ATOM   10501 H  HA   . PHE A 1 733 ? 13.934  53.610 48.607 1.00 33.80  ? 941  PHE A HA   1 
ATOM   10502 H  HB2  . PHE A 1 733 ? 13.753  56.429 48.689 1.00 39.02  ? 941  PHE A HB2  1 
ATOM   10503 H  HB3  . PHE A 1 733 ? 14.493  55.653 47.518 1.00 39.02  ? 941  PHE A HB3  1 
ATOM   10504 H  HD1  . PHE A 1 733 ? 11.305  56.342 48.828 1.00 39.66  ? 941  PHE A HD1  1 
ATOM   10505 H  HD2  . PHE A 1 733 ? 13.224  54.646 45.755 1.00 43.47  ? 941  PHE A HD2  1 
ATOM   10506 H  HE1  . PHE A 1 733 ? 9.317   56.189 47.675 1.00 41.35  ? 941  PHE A HE1  1 
ATOM   10507 H  HE2  . PHE A 1 733 ? 11.233  54.492 44.597 1.00 45.83  ? 941  PHE A HE2  1 
ATOM   10508 H  HZ   . PHE A 1 733 ? 9.274   55.263 45.556 1.00 45.51  ? 941  PHE A HZ   1 
ATOM   10509 N  N    . SER A 1 734 ? 15.702  54.768 50.895 1.00 30.95  ? 942  SER A N    1 
ATOM   10510 C  CA   . SER A 1 734 ? 17.056  54.849 51.416 1.00 31.04  ? 942  SER A CA   1 
ATOM   10511 C  C    . SER A 1 734 ? 17.676  53.453 51.508 1.00 32.47  ? 942  SER A C    1 
ATOM   10512 O  O    . SER A 1 734 ? 16.964  52.447 51.506 1.00 32.66  ? 942  SER A O    1 
ATOM   10513 C  CB   . SER A 1 734 ? 17.062  55.519 52.788 1.00 29.91  ? 942  SER A CB   1 
ATOM   10514 O  OG   . SER A 1 734 ? 16.399  54.719 53.750 1.00 32.51  ? 942  SER A OG   1 
ATOM   10515 H  H    . SER A 1 734 ? 15.087  54.908 51.480 1.00 37.14  ? 942  SER A H    1 
ATOM   10516 H  HA   . SER A 1 734 ? 17.599  55.383 50.815 1.00 37.25  ? 942  SER A HA   1 
ATOM   10517 H  HB2  . SER A 1 734 ? 17.980  55.653 53.069 1.00 35.89  ? 942  SER A HB2  1 
ATOM   10518 H  HB3  . SER A 1 734 ? 16.608  56.374 52.723 1.00 35.89  ? 942  SER A HB3  1 
ATOM   10519 H  HG   . SER A 1 734 ? 15.601  54.594 53.519 1.00 39.02  ? 942  SER A HG   1 
ATOM   10520 N  N    . PRO A 1 735 ? 19.006  53.368 51.599 1.00 34.25  ? 943  PRO A N    1 
ATOM   10521 C  CA   . PRO A 1 735 ? 19.665  52.052 51.549 1.00 35.04  ? 943  PRO A CA   1 
ATOM   10522 C  C    . PRO A 1 735 ? 19.337  51.183 52.757 1.00 32.80  ? 943  PRO A C    1 
ATOM   10523 O  O    . PRO A 1 735 ? 19.285  51.657 53.895 1.00 30.31  ? 943  PRO A O    1 
ATOM   10524 C  CB   . PRO A 1 735 ? 21.158  52.401 51.510 1.00 34.94  ? 943  PRO A CB   1 
ATOM   10525 C  CG   . PRO A 1 735 ? 21.222  53.839 51.104 1.00 37.51  ? 943  PRO A CG   1 
ATOM   10526 C  CD   . PRO A 1 735 ? 19.985  54.468 51.650 1.00 36.67  ? 943  PRO A CD   1 
ATOM   10527 H  HA   . PRO A 1 735 ? 19.421  51.582 50.737 1.00 42.05  ? 943  PRO A HA   1 
ATOM   10528 H  HB2  . PRO A 1 735 ? 21.545  52.277 52.390 1.00 41.92  ? 943  PRO A HB2  1 
ATOM   10529 H  HB3  . PRO A 1 735 ? 21.606  51.841 50.856 1.00 41.92  ? 943  PRO A HB3  1 
ATOM   10530 H  HG2  . PRO A 1 735 ? 22.012  54.250 51.488 1.00 45.02  ? 943  PRO A HG2  1 
ATOM   10531 H  HG3  . PRO A 1 735 ? 21.239  53.903 50.136 1.00 45.02  ? 943  PRO A HG3  1 
ATOM   10532 H  HD2  . PRO A 1 735 ? 20.126  54.755 52.565 1.00 44.00  ? 943  PRO A HD2  1 
ATOM   10533 H  HD3  . PRO A 1 735 ? 19.700  55.203 51.084 1.00 44.00  ? 943  PRO A HD3  1 
ATOM   10534 N  N    . ASP A 1 736 ? 19.148  49.887 52.498 1.00 32.80  ? 944  ASP A N    1 
ATOM   10535 C  CA   . ASP A 1 736 ? 18.786  48.911 53.528 1.00 30.86  ? 944  ASP A CA   1 
ATOM   10536 C  C    . ASP A 1 736 ? 19.538  47.609 53.261 1.00 30.19  ? 944  ASP A C    1 
ATOM   10537 O  O    . ASP A 1 736 ? 18.940  46.580 52.925 1.00 28.94  ? 944  ASP A O    1 
ATOM   10538 C  CB   . ASP A 1 736 ? 17.271  48.690 53.542 1.00 29.93  ? 944  ASP A CB   1 
ATOM   10539 C  CG   . ASP A 1 736 ? 16.809  47.832 54.708 1.00 29.83  ? 944  ASP A CG   1 
ATOM   10540 O  OD1  . ASP A 1 736 ? 17.574  47.687 55.688 1.00 29.27  ? 944  ASP A OD1  1 
ATOM   10541 O  OD2  . ASP A 1 736 ? 15.674  47.304 54.639 1.00 29.52  ? 944  ASP A OD2  1 
ATOM   10542 H  H    . ASP A 1 736 ? 19.227  49.542 51.714 1.00 39.36  ? 944  ASP A H    1 
ATOM   10543 H  HA   . ASP A 1 736 ? 19.054  49.246 54.398 1.00 37.03  ? 944  ASP A HA   1 
ATOM   10544 H  HB2  . ASP A 1 736 ? 16.828  49.550 53.609 1.00 35.91  ? 944  ASP A HB2  1 
ATOM   10545 H  HB3  . ASP A 1 736 ? 17.009  48.246 52.721 1.00 35.91  ? 944  ASP A HB3  1 
ATOM   10546 N  N    . PRO A 1 737 ? 20.865  47.620 53.418 1.00 29.51  ? 945  PRO A N    1 
ATOM   10547 C  CA   . PRO A 1 737 ? 21.676  46.471 52.966 1.00 32.46  ? 945  PRO A CA   1 
ATOM   10548 C  C    . PRO A 1 737 ? 21.353  45.144 53.642 1.00 30.81  ? 945  PRO A C    1 
ATOM   10549 O  O    . PRO A 1 737 ? 21.638  44.094 53.052 1.00 32.82  ? 945  PRO A O    1 
ATOM   10550 C  CB   . PRO A 1 737 ? 23.112  46.913 53.278 1.00 34.59  ? 945  PRO A CB   1 
ATOM   10551 C  CG   . PRO A 1 737 ? 23.054  48.400 53.328 1.00 35.54  ? 945  PRO A CG   1 
ATOM   10552 C  CD   . PRO A 1 737 ? 21.707  48.742 53.872 1.00 33.89  ? 945  PRO A CD   1 
ATOM   10553 H  HA   . PRO A 1 737 ? 21.584  46.363 52.006 1.00 38.95  ? 945  PRO A HA   1 
ATOM   10554 H  HB2  . PRO A 1 737 ? 23.387  46.551 54.135 1.00 41.51  ? 945  PRO A HB2  1 
ATOM   10555 H  HB3  . PRO A 1 737 ? 23.707  46.616 52.572 1.00 41.51  ? 945  PRO A HB3  1 
ATOM   10556 H  HG2  . PRO A 1 737 ? 23.752  48.732 53.914 1.00 42.65  ? 945  PRO A HG2  1 
ATOM   10557 H  HG3  . PRO A 1 737 ? 23.160  48.759 52.433 1.00 42.65  ? 945  PRO A HG3  1 
ATOM   10558 H  HD2  . PRO A 1 737 ? 21.732  48.775 54.842 1.00 40.67  ? 945  PRO A HD2  1 
ATOM   10559 H  HD3  . PRO A 1 737 ? 21.391  49.577 53.495 1.00 40.67  ? 945  PRO A HD3  1 
ATOM   10560 N  N    . LYS A 1 738 ? 20.787  45.138 54.851 1.00 33.90  ? 946  LYS A N    1 
ATOM   10561 C  CA   . LYS A 1 738 ? 20.515  43.869 55.522 1.00 34.70  ? 946  LYS A CA   1 
ATOM   10562 C  C    . LYS A 1 738 ? 19.425  43.060 54.827 1.00 35.45  ? 946  LYS A C    1 
ATOM   10563 O  O    . LYS A 1 738 ? 19.331  41.849 55.058 1.00 32.24  ? 946  LYS A O    1 
ATOM   10564 C  CB   . LYS A 1 738 ? 20.128  44.106 56.985 1.00 34.13  ? 946  LYS A CB   1 
ATOM   10565 C  CG   . LYS A 1 738 ? 18.743  44.704 57.199 1.00 34.87  ? 946  LYS A CG   1 
ATOM   10566 C  CD   . LYS A 1 738 ? 18.520  45.056 58.665 1.00 35.98  ? 946  LYS A CD   1 
ATOM   10567 C  CE   . LYS A 1 738 ? 17.133  45.637 58.914 1.00 35.92  ? 946  LYS A CE   1 
ATOM   10568 N  NZ   . LYS A 1 738 ? 16.887  46.884 58.140 1.00 36.07  ? 946  LYS A NZ   1 
ATOM   10569 H  H    . LYS A 1 738 ? 20.556  45.838 55.294 1.00 40.68  ? 946  LYS A H    1 
ATOM   10570 H  HA   . LYS A 1 738 ? 21.325  43.336 55.515 1.00 41.64  ? 946  LYS A HA   1 
ATOM   10571 H  HB2  . LYS A 1 738 ? 20.154  43.256 57.453 1.00 40.96  ? 946  LYS A HB2  1 
ATOM   10572 H  HB3  . LYS A 1 738 ? 20.773  44.714 57.380 1.00 40.96  ? 946  LYS A HB3  1 
ATOM   10573 H  HG2  . LYS A 1 738 ? 18.659  45.515 56.673 1.00 41.85  ? 946  LYS A HG2  1 
ATOM   10574 H  HG3  . LYS A 1 738 ? 18.070  44.059 56.933 1.00 41.85  ? 946  LYS A HG3  1 
ATOM   10575 H  HD2  . LYS A 1 738 ? 18.612  44.254 59.202 1.00 43.18  ? 946  LYS A HD2  1 
ATOM   10576 H  HD3  . LYS A 1 738 ? 19.177  45.716 58.937 1.00 43.18  ? 946  LYS A HD3  1 
ATOM   10577 H  HE2  . LYS A 1 738 ? 16.465  44.984 58.651 1.00 43.10  ? 946  LYS A HE2  1 
ATOM   10578 H  HE3  . LYS A 1 738 ? 17.042  45.846 59.856 1.00 43.10  ? 946  LYS A HE3  1 
ATOM   10579 H  HZ1  . LYS A 1 738 ? 16.070  47.192 58.311 1.00 43.29  ? 946  LYS A HZ1  1 
ATOM   10580 H  HZ2  . LYS A 1 738 ? 17.483  47.505 58.366 1.00 43.29  ? 946  LYS A HZ2  1 
ATOM   10581 H  HZ3  . LYS A 1 738 ? 16.958  46.720 57.268 1.00 43.29  ? 946  LYS A HZ3  1 
ATOM   10582 N  N    . SER A 1 739 ? 18.602  43.689 53.986 1.00 37.25  ? 947  SER A N    1 
ATOM   10583 C  CA   . SER A 1 739 ? 17.536  42.987 53.278 1.00 33.94  ? 947  SER A CA   1 
ATOM   10584 C  C    . SER A 1 739 ? 17.729  43.003 51.767 1.00 29.49  ? 947  SER A C    1 
ATOM   10585 O  O    . SER A 1 739 ? 16.836  42.557 51.034 1.00 27.76  ? 947  SER A O    1 
ATOM   10586 C  CB   . SER A 1 739 ? 16.174  43.588 53.636 1.00 35.63  ? 947  SER A CB   1 
ATOM   10587 O  OG   . SER A 1 739 ? 16.016  44.873 53.066 1.00 35.08  ? 947  SER A OG   1 
ATOM   10588 H  H    . SER A 1 739 ? 18.642  44.530 53.809 1.00 44.71  ? 947  SER A H    1 
ATOM   10589 H  HA   . SER A 1 739 ? 17.533  42.060 53.564 1.00 40.73  ? 947  SER A HA   1 
ATOM   10590 H  HB2  . SER A 1 739 ? 15.475  43.006 53.298 1.00 42.75  ? 947  SER A HB2  1 
ATOM   10591 H  HB3  . SER A 1 739 ? 16.105  43.660 54.601 1.00 42.75  ? 947  SER A HB3  1 
ATOM   10592 H  HG   . SER A 1 739 ? 15.265  45.188 53.271 1.00 42.10  ? 947  SER A HG   1 
ATOM   10593 N  N    . GLU A 1 740 ? 18.867  43.487 51.282 1.00 29.92  ? 948  GLU A N    1 
ATOM   10594 C  CA   . GLU A 1 740 ? 19.136  43.594 49.855 1.00 31.33  ? 948  GLU A CA   1 
ATOM   10595 C  C    . GLU A 1 740 ? 19.927  42.381 49.374 1.00 30.14  ? 948  GLU A C    1 
ATOM   10596 O  O    . GLU A 1 740 ? 20.840  41.908 50.056 1.00 29.87  ? 948  GLU A O    1 
ATOM   10597 C  CB   . GLU A 1 740 ? 19.891  44.894 49.554 1.00 32.01  ? 948  GLU A CB   1 
ATOM   10598 C  CG   . GLU A 1 740 ? 18.999  46.126 49.707 1.00 37.30  ? 948  GLU A CG   1 
ATOM   10599 C  CD   . GLU A 1 740 ? 19.764  47.443 49.747 1.00 41.87  ? 948  GLU A CD   1 
ATOM   10600 O  OE1  . GLU A 1 740 ? 20.998  47.435 49.554 1.00 42.82  ? 948  GLU A OE1  1 
ATOM   10601 O  OE2  . GLU A 1 740 ? 19.115  48.488 49.979 1.00 42.01  ? 948  GLU A OE2  1 
ATOM   10602 H  H    . GLU A 1 740 ? 19.515  43.767 51.774 1.00 35.90  ? 948  GLU A H    1 
ATOM   10603 H  HA   . GLU A 1 740 ? 18.294  43.615 49.374 1.00 37.60  ? 948  GLU A HA   1 
ATOM   10604 H  HB2  . GLU A 1 740 ? 20.634  44.981 50.172 1.00 38.41  ? 948  GLU A HB2  1 
ATOM   10605 H  HB3  . GLU A 1 740 ? 20.217  44.869 48.641 1.00 38.41  ? 948  GLU A HB3  1 
ATOM   10606 H  HG2  . GLU A 1 740 ? 18.387  46.163 48.955 1.00 44.76  ? 948  GLU A HG2  1 
ATOM   10607 H  HG3  . GLU A 1 740 ? 18.499  46.049 50.534 1.00 44.76  ? 948  GLU A HG3  1 
ATOM   10608 N  N    . LEU A 1 741 ? 19.560  41.877 48.197 1.00 29.24  ? 949  LEU A N    1 
ATOM   10609 C  CA   . LEU A 1 741 ? 20.113  40.646 47.647 1.00 35.52  ? 949  LEU A CA   1 
ATOM   10610 C  C    . LEU A 1 741 ? 20.911  40.971 46.391 1.00 37.15  ? 949  LEU A C    1 
ATOM   10611 O  O    . LEU A 1 741 ? 20.359  41.503 45.422 1.00 38.65  ? 949  LEU A O    1 
ATOM   10612 C  CB   . LEU A 1 741 ? 18.997  39.651 47.328 1.00 36.02  ? 949  LEU A CB   1 
ATOM   10613 C  CG   . LEU A 1 741 ? 18.058  39.310 48.487 1.00 37.99  ? 949  LEU A CG   1 
ATOM   10614 C  CD1  . LEU A 1 741 ? 16.855  38.535 47.983 1.00 38.76  ? 949  LEU A CD1  1 
ATOM   10615 C  CD2  . LEU A 1 741 ? 18.793  38.520 49.559 1.00 41.64  ? 949  LEU A CD2  1 
ATOM   10616 H  H    . LEU A 1 741 ? 18.974  42.244 47.686 1.00 35.09  ? 949  LEU A H    1 
ATOM   10617 H  HA   . LEU A 1 741 ? 20.711  40.241 48.295 1.00 42.62  ? 949  LEU A HA   1 
ATOM   10618 H  HB2  . LEU A 1 741 ? 18.454  40.019 46.614 1.00 43.22  ? 949  LEU A HB2  1 
ATOM   10619 H  HB3  . LEU A 1 741 ? 19.403  38.821 47.030 1.00 43.22  ? 949  LEU A HB3  1 
ATOM   10620 H  HG   . LEU A 1 741 ? 17.739  40.134 48.887 1.00 45.59  ? 949  LEU A HG   1 
ATOM   10621 H  HD11 . LEU A 1 741 ? 16.275  38.330 48.733 1.00 46.52  ? 949  LEU A HD11 1 
ATOM   10622 H  HD12 . LEU A 1 741 ? 16.379  39.077 47.335 1.00 46.52  ? 949  LEU A HD12 1 
ATOM   10623 H  HD13 . LEU A 1 741 ? 17.160  37.714 47.567 1.00 46.52  ? 949  LEU A HD13 1 
ATOM   10624 H  HD21 . LEU A 1 741 ? 18.176  38.318 50.280 1.00 49.97  ? 949  LEU A HD21 1 
ATOM   10625 H  HD22 . LEU A 1 741 ? 19.129  37.698 49.170 1.00 49.97  ? 949  LEU A HD22 1 
ATOM   10626 H  HD23 . LEU A 1 741 ? 19.531  39.054 49.894 1.00 49.97  ? 949  LEU A HD23 1 
ATOM   10627 N  N    . GLY A 1 742 ? 22.198  40.632 46.403 1.00 38.20  ? 950  GLY A N    1 
ATOM   10628 C  CA   . GLY A 1 742 ? 23.074  40.956 45.294 1.00 41.30  ? 950  GLY A CA   1 
ATOM   10629 C  C    . GLY A 1 742 ? 23.679  39.748 44.609 1.00 42.70  ? 950  GLY A C    1 
ATOM   10630 O  O    . GLY A 1 742 ? 23.039  38.696 44.494 1.00 43.50  ? 950  GLY A O    1 
ATOM   10631 H  H    . GLY A 1 742 ? 22.585  40.212 47.046 1.00 45.85  ? 950  GLY A H    1 
ATOM   10632 H  HA2  . GLY A 1 742 ? 22.575  41.459 44.632 1.00 49.56  ? 950  GLY A HA2  1 
ATOM   10633 H  HA3  . GLY A 1 742 ? 23.799  41.514 45.615 1.00 49.56  ? 950  GLY A HA3  1 
ATOM   10634 N  N    . ALA A 1 743 ? 24.920  39.888 44.152 1.00 41.52  ? 951  ALA A N    1 
ATOM   10635 C  CA   . ALA A 1 743 ? 25.575  38.836 43.392 1.00 40.23  ? 951  ALA A CA   1 
ATOM   10636 C  C    . ALA A 1 743 ? 26.127  37.756 44.315 1.00 42.06  ? 951  ALA A C    1 
ATOM   10637 O  O    . ALA A 1 743 ? 26.526  38.020 45.454 1.00 43.21  ? 951  ALA A O    1 
ATOM   10638 C  CB   . ALA A 1 743 ? 26.705  39.414 42.541 1.00 41.62  ? 951  ALA A CB   1 
ATOM   10639 H  H    . ALA A 1 743 ? 25.405  40.588 44.271 1.00 49.83  ? 951  ALA A H    1 
ATOM   10640 H  HA   . ALA A 1 743 ? 24.929  38.423 42.798 1.00 48.28  ? 951  ALA A HA   1 
ATOM   10641 H  HB1  . ALA A 1 743 ? 27.126  38.695 42.044 1.00 49.95  ? 951  ALA A HB1  1 
ATOM   10642 H  HB2  . ALA A 1 743 ? 26.334  40.068 41.927 1.00 49.95  ? 951  ALA A HB2  1 
ATOM   10643 H  HB3  . ALA A 1 743 ? 27.354  39.839 43.124 1.00 49.95  ? 951  ALA A HB3  1 
ATOM   10644 N  N    . VAL A 1 744 ? 26.154  36.524 43.802 1.00 39.47  ? 952  VAL A N    1 
ATOM   10645 C  CA   . VAL A 1 744 ? 26.671  35.399 44.569 1.00 43.20  ? 952  VAL A CA   1 
ATOM   10646 C  C    . VAL A 1 744 ? 28.181  35.529 44.711 1.00 49.81  ? 952  VAL A C    1 
ATOM   10647 O  O    . VAL A 1 744 ? 28.890  35.874 43.755 1.00 51.60  ? 952  VAL A O    1 
ATOM   10648 C  CB   . VAL A 1 744 ? 26.287  34.070 43.895 1.00 40.72  ? 952  VAL A CB   1 
ATOM   10649 C  CG1  . VAL A 1 744 ? 26.832  32.886 44.687 1.00 40.01  ? 952  VAL A CG1  1 
ATOM   10650 C  CG2  . VAL A 1 744 ? 24.774  33.964 43.749 1.00 40.64  ? 952  VAL A CG2  1 
ATOM   10651 H  H    . VAL A 1 744 ? 25.878  36.318 43.014 1.00 47.36  ? 952  VAL A H    1 
ATOM   10652 H  HA   . VAL A 1 744 ? 26.281  35.412 45.457 1.00 51.85  ? 952  VAL A HA   1 
ATOM   10653 H  HB   . VAL A 1 744 ? 26.676  34.041 43.007 1.00 48.87  ? 952  VAL A HB   1 
ATOM   10654 H  HG11 . VAL A 1 744 ? 26.576  32.064 44.242 1.00 48.01  ? 952  VAL A HG11 1 
ATOM   10655 H  HG12 . VAL A 1 744 ? 27.799  32.954 44.729 1.00 48.01  ? 952  VAL A HG12 1 
ATOM   10656 H  HG13 . VAL A 1 744 ? 26.460  32.908 45.583 1.00 48.01  ? 952  VAL A HG13 1 
ATOM   10657 H  HG21 . VAL A 1 744 ? 24.557  33.120 43.323 1.00 48.77  ? 952  VAL A HG21 1 
ATOM   10658 H  HG22 . VAL A 1 744 ? 24.369  34.004 44.630 1.00 48.77  ? 952  VAL A HG22 1 
ATOM   10659 H  HG23 . VAL A 1 744 ? 24.458  34.701 43.205 1.00 48.77  ? 952  VAL A HG23 1 
ATOM   10660 N  N    . LYS A 1 745 ? 28.681  35.233 45.903 1.00 54.07  ? 953  LYS A N    1 
ATOM   10661 C  CA   . LYS A 1 745 ? 30.083  35.420 46.239 1.00 58.58  ? 953  LYS A CA   1 
ATOM   10662 C  C    . LYS A 1 745 ? 30.885  34.153 45.976 1.00 62.95  ? 953  LYS A C    1 
ATOM   10663 O  O    . LYS A 1 745 ? 30.320  33.064 45.822 1.00 62.92  ? 953  LYS A O    1 
ATOM   10664 C  CB   . LYS A 1 745 ? 30.210  35.826 47.703 1.00 58.54  ? 953  LYS A CB   1 
ATOM   10665 C  CG   . LYS A 1 745 ? 29.679  37.218 47.988 1.00 59.31  ? 953  LYS A CG   1 
ATOM   10666 C  CD   . LYS A 1 745 ? 29.111  37.335 49.391 1.00 63.09  ? 953  LYS A CD   1 
ATOM   10667 C  CE   . LYS A 1 745 ? 30.099  36.864 50.442 1.00 70.01  ? 953  LYS A CE   1 
ATOM   10668 N  NZ   . LYS A 1 745 ? 29.645  37.226 51.812 1.00 73.55  ? 953  LYS A NZ   1 
ATOM   10669 H  H    . LYS A 1 745 ? 28.214  34.914 46.551 1.00 64.89  ? 953  LYS A H    1 
ATOM   10670 H  HA   . LYS A 1 745 ? 30.451  36.132 45.692 1.00 70.29  ? 953  LYS A HA   1 
ATOM   10671 H  HB2  . LYS A 1 745 ? 29.710  35.199 48.248 1.00 70.25  ? 953  LYS A HB2  1 
ATOM   10672 H  HB3  . LYS A 1 745 ? 31.147  35.807 47.954 1.00 70.25  ? 953  LYS A HB3  1 
ATOM   10673 H  HG2  . LYS A 1 745 ? 30.402  37.859 47.900 1.00 71.18  ? 953  LYS A HG2  1 
ATOM   10674 H  HG3  . LYS A 1 745 ? 28.972  37.424 47.357 1.00 71.18  ? 953  LYS A HG3  1 
ATOM   10675 H  HD2  . LYS A 1 745 ? 28.895  38.263 49.572 1.00 75.70  ? 953  LYS A HD2  1 
ATOM   10676 H  HD3  . LYS A 1 745 ? 28.313  36.787 49.458 1.00 75.70  ? 953  LYS A HD3  1 
ATOM   10677 H  HE2  . LYS A 1 745 ? 30.183  35.899 50.395 1.00 84.01  ? 953  LYS A HE2  1 
ATOM   10678 H  HE3  . LYS A 1 745 ? 30.959  37.285 50.285 1.00 84.01  ? 953  LYS A HE3  1 
ATOM   10679 H  HZ1  . LYS A 1 745 ? 28.857  36.849 51.981 1.00 88.26  ? 953  LYS A HZ1  1 
ATOM   10680 H  HZ2  . LYS A 1 745 ? 30.237  36.943 52.413 1.00 88.26  ? 953  LYS A HZ2  1 
ATOM   10681 H  HZ3  . LYS A 1 745 ? 29.564  38.110 51.881 1.00 88.26  ? 953  LYS A HZ3  1 
ATOM   10682 N  N    . PRO A 1 746 ? 32.216  34.266 45.916 1.00 65.10  ? 954  PRO A N    1 
ATOM   10683 C  CA   . PRO A 1 746 ? 33.048  33.081 45.649 1.00 64.30  ? 954  PRO A CA   1 
ATOM   10684 C  C    . PRO A 1 746 ? 32.736  31.888 46.535 1.00 57.54  ? 954  PRO A C    1 
ATOM   10685 O  O    . PRO A 1 746 ? 32.873  30.744 46.084 1.00 55.70  ? 954  PRO A O    1 
ATOM   10686 C  CB   . PRO A 1 746 ? 34.470  33.604 45.890 1.00 69.08  ? 954  PRO A CB   1 
ATOM   10687 C  CG   . PRO A 1 746 ? 34.390  35.052 45.557 1.00 69.69  ? 954  PRO A CG   1 
ATOM   10688 C  CD   . PRO A 1 746 ? 33.019  35.502 45.976 1.00 67.35  ? 954  PRO A CD   1 
ATOM   10689 H  HA   . PRO A 1 746 ? 32.961  32.816 44.720 1.00 77.17  ? 954  PRO A HA   1 
ATOM   10690 H  HB2  . PRO A 1 746 ? 34.714  33.477 46.820 1.00 82.90  ? 954  PRO A HB2  1 
ATOM   10691 H  HB3  . PRO A 1 746 ? 35.092  33.148 45.303 1.00 82.90  ? 954  PRO A HB3  1 
ATOM   10692 H  HG2  . PRO A 1 746 ? 35.072  35.536 46.049 1.00 83.63  ? 954  PRO A HG2  1 
ATOM   10693 H  HG3  . PRO A 1 746 ? 34.510  35.172 44.601 1.00 83.63  ? 954  PRO A HG3  1 
ATOM   10694 H  HD2  . PRO A 1 746 ? 33.039  35.848 46.881 1.00 80.83  ? 954  PRO A HD2  1 
ATOM   10695 H  HD3  . PRO A 1 746 ? 32.673  36.159 45.351 1.00 80.83  ? 954  PRO A HD3  1 
ATOM   10696 N  N    . ASP A 1 747 ? 32.327  32.112 47.782 1.00 54.60  ? 955  ASP A N    1 
ATOM   10697 C  CA   . ASP A 1 747 ? 31.985  31.011 48.673 1.00 52.88  ? 955  ASP A CA   1 
ATOM   10698 C  C    . ASP A 1 747 ? 30.578  30.474 48.437 1.00 49.32  ? 955  ASP A C    1 
ATOM   10699 O  O    . ASP A 1 747 ? 30.146  29.578 49.170 1.00 46.69  ? 955  ASP A O    1 
ATOM   10700 C  CB   . ASP A 1 747 ? 32.133  31.450 50.134 1.00 51.44  ? 955  ASP A CB   1 
ATOM   10701 C  CG   . ASP A 1 747 ? 31.214  32.606 50.497 1.00 51.47  ? 955  ASP A CG   1 
ATOM   10702 O  OD1  . ASP A 1 747 ? 30.538  33.145 49.596 1.00 51.86  ? 955  ASP A OD1  1 
ATOM   10703 O  OD2  . ASP A 1 747 ? 31.166  32.974 51.689 1.00 53.89  ? 955  ASP A OD2  1 
ATOM   10704 H  H    . ASP A 1 747 ? 32.239  32.891 48.134 1.00 65.52  ? 955  ASP A H    1 
ATOM   10705 H  HA   . ASP A 1 747 ? 32.608  30.283 48.519 1.00 63.46  ? 955  ASP A HA   1 
ATOM   10706 H  HB2  . ASP A 1 747 ? 31.916  30.701 50.712 1.00 61.73  ? 955  ASP A HB2  1 
ATOM   10707 H  HB3  . ASP A 1 747 ? 33.047  31.734 50.288 1.00 61.73  ? 955  ASP A HB3  1 
ATOM   10708 N  N    . GLY A 1 748 ? 29.860  30.988 47.439 1.00 49.06  ? 956  GLY A N    1 
ATOM   10709 C  CA   . GLY A 1 748 ? 28.516  30.533 47.147 1.00 50.14  ? 956  GLY A CA   1 
ATOM   10710 C  C    . GLY A 1 748 ? 27.435  31.130 48.019 1.00 47.80  ? 956  GLY A C    1 
ATOM   10711 O  O    . GLY A 1 748 ? 26.308  30.623 48.012 1.00 46.45  ? 956  GLY A O    1 
ATOM   10712 H  H    . GLY A 1 748 ? 30.139  31.609 46.913 1.00 58.88  ? 956  GLY A H    1 
ATOM   10713 H  HA2  . GLY A 1 748 ? 28.306  30.744 46.224 1.00 60.17  ? 956  GLY A HA2  1 
ATOM   10714 H  HA3  . GLY A 1 748 ? 28.482  29.569 47.249 1.00 60.17  ? 956  GLY A HA3  1 
ATOM   10715 N  N    . ARG A 1 749 ? 27.736  32.194 48.755 1.00 47.70  ? 957  ARG A N    1 
ATOM   10716 C  CA   . ARG A 1 749 ? 26.822  32.779 49.723 1.00 46.08  ? 957  ARG A CA   1 
ATOM   10717 C  C    . ARG A 1 749 ? 26.395  34.175 49.285 1.00 42.93  ? 957  ARG A C    1 
ATOM   10718 O  O    . ARG A 1 749 ? 26.988  34.790 48.394 1.00 42.22  ? 957  ARG A O    1 
ATOM   10719 C  CB   . ARG A 1 749 ? 27.481  32.844 51.104 1.00 50.41  ? 957  ARG A CB   1 
ATOM   10720 C  CG   . ARG A 1 749 ? 27.841  31.485 51.695 1.00 56.56  ? 957  ARG A CG   1 
ATOM   10721 C  CD   . ARG A 1 749 ? 26.678  30.898 52.473 1.00 60.21  ? 957  ARG A CD   1 
ATOM   10722 N  NE   . ARG A 1 749 ? 26.267  31.787 53.556 1.00 62.29  ? 957  ARG A NE   1 
ATOM   10723 C  CZ   . ARG A 1 749 ? 25.127  31.683 54.230 1.00 62.30  ? 957  ARG A CZ   1 
ATOM   10724 N  NH1  . ARG A 1 749 ? 24.256  30.720 53.943 1.00 60.55  ? 957  ARG A NH1  1 
ATOM   10725 N  NH2  . ARG A 1 749 ? 24.854  32.555 55.191 1.00 61.18  ? 957  ARG A NH2  1 
ATOM   10726 H  H    . ARG A 1 749 ? 28.489  32.606 48.707 1.00 57.24  ? 957  ARG A H    1 
ATOM   10727 H  HA   . ARG A 1 749 ? 26.028  32.225 49.790 1.00 55.30  ? 957  ARG A HA   1 
ATOM   10728 H  HB2  . ARG A 1 749 ? 28.299  33.360 51.034 1.00 60.49  ? 957  ARG A HB2  1 
ATOM   10729 H  HB3  . ARG A 1 749 ? 26.871  33.280 51.719 1.00 60.49  ? 957  ARG A HB3  1 
ATOM   10730 H  HG2  . ARG A 1 749 ? 28.067  30.873 50.978 1.00 67.88  ? 957  ARG A HG2  1 
ATOM   10731 H  HG3  . ARG A 1 749 ? 28.592  31.587 52.300 1.00 67.88  ? 957  ARG A HG3  1 
ATOM   10732 H  HD2  . ARG A 1 749 ? 25.923  30.773 51.877 1.00 72.25  ? 957  ARG A HD2  1 
ATOM   10733 H  HD3  . ARG A 1 749 ? 26.946  30.050 52.860 1.00 72.25  ? 957  ARG A HD3  1 
ATOM   10734 H  HE   . ARG A 1 749 ? 26.802  32.424 53.773 1.00 74.75  ? 957  ARG A HE   1 
ATOM   10735 H  HH11 . ARG A 1 749 ? 24.430  30.155 53.318 1.00 72.66  ? 957  ARG A HH11 1 
ATOM   10736 H  HH12 . ARG A 1 749 ? 23.520  30.661 54.384 1.00 72.66  ? 957  ARG A HH12 1 
ATOM   10737 H  HH21 . ARG A 1 749 ? 25.416  33.178 55.378 1.00 73.42  ? 957  ARG A HH21 1 
ATOM   10738 H  HH22 . ARG A 1 749 ? 24.118  32.492 55.632 1.00 73.42  ? 957  ARG A HH22 1 
ATOM   10739 N  N    . LEU A 1 750 ? 25.340  34.671 49.934 1.00 42.35  ? 958  LEU A N    1 
ATOM   10740 C  CA   . LEU A 1 750 ? 24.916  36.056 49.794 1.00 44.25  ? 958  LEU A CA   1 
ATOM   10741 C  C    . LEU A 1 750 ? 25.179  36.889 51.038 1.00 45.19  ? 958  LEU A C    1 
ATOM   10742 O  O    . LEU A 1 750 ? 25.158  38.121 50.952 1.00 43.26  ? 958  LEU A O    1 
ATOM   10743 C  CB   . LEU A 1 750 ? 23.416  36.129 49.468 1.00 42.24  ? 958  LEU A CB   1 
ATOM   10744 C  CG   . LEU A 1 750 ? 22.982  35.522 48.132 1.00 41.80  ? 958  LEU A CG   1 
ATOM   10745 C  CD1  . LEU A 1 750 ? 21.467  35.420 48.057 1.00 37.88  ? 958  LEU A CD1  1 
ATOM   10746 C  CD2  . LEU A 1 750 ? 23.518  36.345 46.973 1.00 42.67  ? 958  LEU A CD2  1 
ATOM   10747 H  H    . LEU A 1 750 ? 24.848  34.213 50.470 1.00 50.82  ? 958  LEU A H    1 
ATOM   10748 H  HA   . LEU A 1 750 ? 25.402  36.459 49.058 1.00 53.10  ? 958  LEU A HA   1 
ATOM   10749 H  HB2  . LEU A 1 750 ? 22.930  35.663 50.166 1.00 50.69  ? 958  LEU A HB2  1 
ATOM   10750 H  HB3  . LEU A 1 750 ? 23.152  37.062 49.460 1.00 50.69  ? 958  LEU A HB3  1 
ATOM   10751 H  HG   . LEU A 1 750 ? 23.347  34.