data_6EKL
# 
_entry.id   6EKL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.299 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6EKL         
WWPDB D_1200006758 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6EKL 
_pdbx_database_status.recvd_initial_deposition_date   2017-09-26 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Huber, F.'       1 ? 
'Tropia, L.'      2 ? 
'Emamzadah, S.'   3 ? 
'Halazonetis, T.' 4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Crystal structure of mammalian Rev7 in complex with Champ1' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Huber, F.'       1 ? 
primary 'Tropia, L.'      2 ? 
primary 'Emamzadah, S.'   3 ? 
primary 'Halazonetis, T.' 4 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6EKL 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     47.280 
_cell.length_a_esd                 ? 
_cell.length_b                     51.840 
_cell.length_b_esd                 ? 
_cell.length_c                     126.180 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6EKL 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Mitotic spindle assembly checkpoint protein MAD2B' 24438.271 1  ? 'F11S, G12A, V132K, C133V, A135K' ? ? 
2 polymer man 'Chromosome alignment-maintaining phosphoprotein 1' 2931.365  1  ? ?                                 
'UNP residues 328-355' ? 
3 water   nat water                                               18.015    33 ? ?                                 ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Mitotic arrest deficient 2-like protein 2,MAD2-like protein 2' 
2 'Zinc finger protein 828'                                       
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MTTLTRQDLNSAQVVADVLSEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDV
EKVVVVILDKEHRPVEKFVFEITQPPLLSINSDSLLSHVEQLLRAFILKISKVDKVLDHNPPGCTFTVLVHTREAATRNM
EKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKNS
;
;MTTLTRQDLNSAQVVADVLSEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDV
EKVVVVILDKEHRPVEKFVFEITQPPLLSINSDSLLSHVEQLLRAFILKISKVDKVLDHNPPGCTFTVLVHTREAATRNM
EKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKNS
;
A ? 
2 'polypeptide(L)' no no MSASSGPWKPAKPAPSVSPGPWKPIPSVS MSASSGPWKPAKPAPSVSPGPWKPIPSVS B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   THR n 
1 4   LEU n 
1 5   THR n 
1 6   ARG n 
1 7   GLN n 
1 8   ASP n 
1 9   LEU n 
1 10  ASN n 
1 11  SER n 
1 12  ALA n 
1 13  GLN n 
1 14  VAL n 
1 15  VAL n 
1 16  ALA n 
1 17  ASP n 
1 18  VAL n 
1 19  LEU n 
1 20  SER n 
1 21  GLU n 
1 22  PHE n 
1 23  LEU n 
1 24  GLU n 
1 25  VAL n 
1 26  ALA n 
1 27  VAL n 
1 28  HIS n 
1 29  LEU n 
1 30  ILE n 
1 31  LEU n 
1 32  TYR n 
1 33  VAL n 
1 34  ARG n 
1 35  GLU n 
1 36  VAL n 
1 37  TYR n 
1 38  PRO n 
1 39  VAL n 
1 40  GLY n 
1 41  ILE n 
1 42  PHE n 
1 43  GLN n 
1 44  LYS n 
1 45  ARG n 
1 46  LYS n 
1 47  LYS n 
1 48  TYR n 
1 49  ASN n 
1 50  VAL n 
1 51  PRO n 
1 52  VAL n 
1 53  GLN n 
1 54  MET n 
1 55  SER n 
1 56  CYS n 
1 57  HIS n 
1 58  PRO n 
1 59  GLU n 
1 60  LEU n 
1 61  ASN n 
1 62  GLN n 
1 63  TYR n 
1 64  ILE n 
1 65  GLN n 
1 66  ASP n 
1 67  THR n 
1 68  LEU n 
1 69  HIS n 
1 70  CYS n 
1 71  VAL n 
1 72  LYS n 
1 73  PRO n 
1 74  LEU n 
1 75  LEU n 
1 76  GLU n 
1 77  LYS n 
1 78  ASN n 
1 79  ASP n 
1 80  VAL n 
1 81  GLU n 
1 82  LYS n 
1 83  VAL n 
1 84  VAL n 
1 85  VAL n 
1 86  VAL n 
1 87  ILE n 
1 88  LEU n 
1 89  ASP n 
1 90  LYS n 
1 91  GLU n 
1 92  HIS n 
1 93  ARG n 
1 94  PRO n 
1 95  VAL n 
1 96  GLU n 
1 97  LYS n 
1 98  PHE n 
1 99  VAL n 
1 100 PHE n 
1 101 GLU n 
1 102 ILE n 
1 103 THR n 
1 104 GLN n 
1 105 PRO n 
1 106 PRO n 
1 107 LEU n 
1 108 LEU n 
1 109 SER n 
1 110 ILE n 
1 111 ASN n 
1 112 SER n 
1 113 ASP n 
1 114 SER n 
1 115 LEU n 
1 116 LEU n 
1 117 SER n 
1 118 HIS n 
1 119 VAL n 
1 120 GLU n 
1 121 GLN n 
1 122 LEU n 
1 123 LEU n 
1 124 ARG n 
1 125 ALA n 
1 126 PHE n 
1 127 ILE n 
1 128 LEU n 
1 129 LYS n 
1 130 ILE n 
1 131 SER n 
1 132 LYS n 
1 133 VAL n 
1 134 ASP n 
1 135 LYS n 
1 136 VAL n 
1 137 LEU n 
1 138 ASP n 
1 139 HIS n 
1 140 ASN n 
1 141 PRO n 
1 142 PRO n 
1 143 GLY n 
1 144 CYS n 
1 145 THR n 
1 146 PHE n 
1 147 THR n 
1 148 VAL n 
1 149 LEU n 
1 150 VAL n 
1 151 HIS n 
1 152 THR n 
1 153 ARG n 
1 154 GLU n 
1 155 ALA n 
1 156 ALA n 
1 157 THR n 
1 158 ARG n 
1 159 ASN n 
1 160 MET n 
1 161 GLU n 
1 162 LYS n 
1 163 ILE n 
1 164 GLN n 
1 165 VAL n 
1 166 ILE n 
1 167 LYS n 
1 168 ASP n 
1 169 PHE n 
1 170 PRO n 
1 171 TRP n 
1 172 ILE n 
1 173 LEU n 
1 174 ALA n 
1 175 ASP n 
1 176 GLU n 
1 177 GLN n 
1 178 ASP n 
1 179 VAL n 
1 180 HIS n 
1 181 MET n 
1 182 HIS n 
1 183 ASP n 
1 184 PRO n 
1 185 ARG n 
1 186 LEU n 
1 187 ILE n 
1 188 PRO n 
1 189 LEU n 
1 190 LYS n 
1 191 THR n 
1 192 MET n 
1 193 THR n 
1 194 SER n 
1 195 ASP n 
1 196 ILE n 
1 197 LEU n 
1 198 LYS n 
1 199 MET n 
1 200 GLN n 
1 201 LEU n 
1 202 TYR n 
1 203 VAL n 
1 204 GLU n 
1 205 GLU n 
1 206 ARG n 
1 207 ALA n 
1 208 HIS n 
1 209 LYS n 
1 210 ASN n 
1 211 SER n 
2 1   MET n 
2 2   SER n 
2 3   ALA n 
2 4   SER n 
2 5   SER n 
2 6   GLY n 
2 7   PRO n 
2 8   TRP n 
2 9   LYS n 
2 10  PRO n 
2 11  ALA n 
2 12  LYS n 
2 13  PRO n 
2 14  ALA n 
2 15  PRO n 
2 16  SER n 
2 17  VAL n 
2 18  SER n 
2 19  PRO n 
2 20  GLY n 
2 21  PRO n 
2 22  TRP n 
2 23  LYS n 
2 24  PRO n 
2 25  ILE n 
2 26  PRO n 
2 27  SER n 
2 28  VAL n 
2 29  SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 211 Mouse ? 'Mad2l2, Mad2b, Rev7'                            ? ? ? ? ? ? 'Mus musculus' 10090 ? 
? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 29  Human ? 'CHAMP1, C13orf8, CAMP, CHAMP, KIAA1802, ZNF828' ? ? ? ? ? ? 'Homo sapiens' 9606  ? 
? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP MD2L2_MOUSE Q9D752 ? 1 
;MTTLTRQDLNFGQVVADVLSEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDV
EKVVVVILDKEHRPVEKFVFEITQPPLLSINSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNM
EKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKNS
;
1   
2 UNP CHAP1_HUMAN Q96JM3 ? 2 SASSGPWKPAKPAPSVSPGPWKPIPSVS 328 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6EKL A 1 ? 211 ? Q9D752 1   ? 211 ? 1   211 
2 2 6EKL B 2 ? 29  ? Q96JM3 328 ? 355 ? 328 355 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6EKL SER A 11  ? UNP Q9D752 PHE 11  'engineered mutation'   11  1 
1 6EKL ALA A 12  ? UNP Q9D752 GLY 12  'engineered mutation'   12  2 
1 6EKL LYS A 132 ? UNP Q9D752 VAL 132 'engineered mutation'   132 3 
1 6EKL VAL A 133 ? UNP Q9D752 CYS 133 'engineered mutation'   133 4 
1 6EKL LYS A 135 ? UNP Q9D752 ALA 135 'engineered mutation'   135 5 
2 6EKL MET B 1   ? UNP Q96JM3 ?   ?   'initiating methionine' 327 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6EKL 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.82 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.40 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;1.5 
M ammonium sulfate, 0.1 M Tris-Bicine pH 8.5, 0.15 M lithium sulfate, 0.02 M sodium nitrate, 0.02 
M sodium phosphate dibasic, 1.5% v/v MPD, 1.5% PEG 1000, 1.5% w/v PEG 3350
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 2M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-09-19 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97853 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97853 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6EKL 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.6 
_reflns.d_resolution_low                 70 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       41402 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.2 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  8.9 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.101 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.6 
_reflns_shell.d_res_low                   1.69 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           5971 
_reflns_shell.percent_possible_all        99.2 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6EKL 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.6 
_refine.ls_d_res_low                             23.41 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     41348 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.2 
_refine.ls_percent_reflns_R_free                 5 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       0.2408 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.233 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5O8K 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1802 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             33 
_refine_hist.number_atoms_total               1835 
_refine_hist.d_res_high                       1.6 
_refine_hist.d_res_low                        23.41 
# 
_struct.entry_id                     6EKL 
_struct.title                        
'Crystal structure of mammalian Rev7 in complex with human Chromosome alignment-maintaining phosphoprotein 1' 
_struct.pdbx_descriptor              
'Mitotic spindle assembly checkpoint protein MAD2B, DNA polymerase zeta catalytic subunit (E.C.2.7.7.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6EKL 
_struct_keywords.text            
'Rev7, Mad2L2, DNA replication, REPLICATION, Chromosome Alignment Maintaining Phosphoprotein 1, Champ1' 
_struct_keywords.pdbx_keywords   REPLICATION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 THR A 5   ? ASP A 8   ? THR A 5   ASP A 8   5 ? 4  
HELX_P HELX_P2 AA2 LEU A 9   ? ARG A 34  ? LEU A 9   ARG A 34  1 ? 26 
HELX_P HELX_P3 AA3 PRO A 38  ? GLY A 40  ? PRO A 38  GLY A 40  5 ? 3  
HELX_P HELX_P4 AA4 HIS A 57  ? CYS A 70  ? HIS A 57  CYS A 70  1 ? 14 
HELX_P HELX_P5 AA5 VAL A 71  ? ASN A 78  ? VAL A 71  ASN A 78  1 ? 8  
HELX_P HELX_P6 AA6 HIS A 118 ? LYS A 132 ? HIS A 118 LYS A 132 1 ? 15 
HELX_P HELX_P7 AA7 VAL A 133 ? VAL A 136 ? VAL A 133 VAL A 136 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           6 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            332 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    7 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     333 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.30 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA2 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 42  ? LYS A 47  ? PHE A 42  LYS A 47  
AA1 2 VAL A 50  ? SER A 55  ? VAL A 50  SER A 55  
AA2 1 ILE A 163 ? ILE A 166 ? ILE A 163 ILE A 166 
AA2 2 PHE A 169 ? LEU A 173 ? PHE A 169 LEU A 173 
AA2 3 SER B 5   ? PRO B 10  ? SER B 331 PRO B 336 
AA2 4 THR A 145 ? THR A 152 ? THR A 145 THR A 152 
AA2 5 VAL A 80  ? LEU A 88  ? VAL A 80  LEU A 88  
AA2 6 PRO A 94  ? THR A 103 ? PRO A 94  THR A 103 
AA2 7 LYS A 198 ? GLU A 205 ? LYS A 198 GLU A 205 
AA2 8 ARG A 185 ? THR A 193 ? ARG A 185 THR A 193 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLN A 43  ? N GLN A 43  O MET A 54  ? O MET A 54  
AA2 1 2 N GLN A 164 ? N GLN A 164 O TRP A 171 ? O TRP A 171 
AA2 2 3 N ILE A 172 ? N ILE A 172 O LYS B 9   ? O LYS B 335 
AA2 3 4 O SER B 5   ? O SER B 331 N THR A 152 ? N THR A 152 
AA2 4 5 O LEU A 149 ? O LEU A 149 N VAL A 84  ? N VAL A 84  
AA2 5 6 N ILE A 87  ? N ILE A 87  O GLU A 96  ? O GLU A 96  
AA2 6 7 N GLU A 101 ? N GLU A 101 O GLN A 200 ? O GLN A 200 
AA2 7 8 O LEU A 201 ? O LEU A 201 N LYS A 190 ? N LYS A 190 
# 
_atom_sites.entry_id                    6EKL 
_atom_sites.fract_transf_matrix[1][1]   0.021151 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019290 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007925 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . THR A 1 2   ? 11.973  39.875  -29.863 1.00 28.91 ?  2   THR A N   1 
ATOM   2    C CA  . THR A 1 2   ? 12.127  38.680  -28.981 1.00 27.60 ?  2   THR A CA  1 
ATOM   3    C C   . THR A 1 2   ? 11.680  37.415  -29.702 1.00 26.20 ?  2   THR A C   1 
ATOM   4    O O   . THR A 1 2   ? 10.593  37.371  -30.275 1.00 24.61 ?  2   THR A O   1 
ATOM   5    C CB  . THR A 1 2   ? 11.294  38.827  -27.697 1.00 28.89 ?  2   THR A CB  1 
ATOM   6    O OG1 . THR A 1 2   ? 11.698  40.013  -26.999 1.00 33.41 ?  2   THR A OG1 1 
ATOM   7    C CG2 . THR A 1 2   ? 11.497  37.624  -26.791 1.00 31.84 ?  2   THR A CG2 1 
ATOM   8    N N   . THR A 1 3   ? 12.522  36.387  -29.662 1.00 23.54 ?  3   THR A N   1 
ATOM   9    C CA  . THR A 1 3   ? 12.223  35.115  -30.312 1.00 23.10 ?  3   THR A CA  1 
ATOM   10   C C   . THR A 1 3   ? 11.587  34.153  -29.315 1.00 23.47 ?  3   THR A C   1 
ATOM   11   O O   . THR A 1 3   ? 12.078  33.990  -28.198 1.00 23.26 ?  3   THR A O   1 
ATOM   12   C CB  . THR A 1 3   ? 13.507  34.493  -30.898 1.00 23.51 ?  3   THR A CB  1 
ATOM   13   O OG1 . THR A 1 3   ? 14.054  35.385  -31.882 1.00 24.63 ?  3   THR A OG1 1 
ATOM   14   C CG2 . THR A 1 3   ? 13.212  33.152  -31.549 1.00 24.89 ?  3   THR A CG2 1 
ATOM   15   N N   . LEU A 1 4   ? 10.495  33.513  -29.722 1.00 21.30 ?  4   LEU A N   1 
ATOM   16   C CA  . LEU A 1 4   ? 9.792   32.596  -28.834 1.00 23.46 ?  4   LEU A CA  1 
ATOM   17   C C   . LEU A 1 4   ? 10.003  31.117  -29.124 1.00 23.21 ?  4   LEU A C   1 
ATOM   18   O O   . LEU A 1 4   ? 10.228  30.710  -30.267 1.00 25.39 ?  4   LEU A O   1 
ATOM   19   C CB  . LEU A 1 4   ? 8.288   32.882  -28.865 1.00 23.01 ?  4   LEU A CB  1 
ATOM   20   C CG  . LEU A 1 4   ? 7.806   34.303  -28.575 1.00 26.44 ?  4   LEU A CG  1 
ATOM   21   C CD1 . LEU A 1 4   ? 6.286   34.295  -28.480 1.00 27.17 ?  4   LEU A CD1 1 
ATOM   22   C CD2 . LEU A 1 4   ? 8.411   34.813  -27.276 1.00 26.65 ?  4   LEU A CD2 1 
ATOM   23   N N   . THR A 1 5   ? 9.936   30.323  -28.061 1.00 22.70 ?  5   THR A N   1 
ATOM   24   C CA  . THR A 1 5   ? 10.054  28.874  -28.151 1.00 22.46 ?  5   THR A CA  1 
ATOM   25   C C   . THR A 1 5   ? 8.622   28.400  -27.915 1.00 19.89 ?  5   THR A C   1 
ATOM   26   O O   . THR A 1 5   ? 7.765   29.194  -27.521 1.00 19.53 ?  5   THR A O   1 
ATOM   27   C CB  . THR A 1 5   ? 10.964  28.303  -27.044 1.00 24.00 ?  5   THR A CB  1 
ATOM   28   O OG1 . THR A 1 5   ? 10.383  28.576  -25.765 1.00 28.16 ?  5   THR A OG1 1 
ATOM   29   C CG2 . THR A 1 5   ? 12.352  28.934  -27.112 1.00 27.97 ?  5   THR A CG2 1 
ATOM   30   N N   . ARG A 1 6   ? 8.355   27.121  -28.146 1.00 19.48 ?  6   ARG A N   1 
ATOM   31   C CA  . ARG A 1 6   ? 7.001   26.610  -27.959 1.00 18.80 ?  6   ARG A CA  1 
ATOM   32   C C   . ARG A 1 6   ? 6.429   26.937  -26.582 1.00 19.35 ?  6   ARG A C   1 
ATOM   33   O O   . ARG A 1 6   ? 5.298   27.405  -26.468 1.00 18.93 ?  6   ARG A O   1 
ATOM   34   C CB  . ARG A 1 6   ? 6.965   25.096  -28.168 1.00 19.48 ?  6   ARG A CB  1 
ATOM   35   C CG  . ARG A 1 6   ? 5.549   24.524  -28.165 1.00 18.77 ?  6   ARG A CG  1 
ATOM   36   C CD  . ARG A 1 6   ? 5.558   23.004  -28.252 1.00 16.44 ?  6   ARG A CD  1 
ATOM   37   N NE  . ARG A 1 6   ? 4.255   22.470  -28.641 1.00 16.25 ?  6   ARG A NE  1 
ATOM   38   C CZ  . ARG A 1 6   ? 3.184   22.429  -27.851 1.00 15.96 ?  6   ARG A CZ  1 
ATOM   39   N NH1 . ARG A 1 6   ? 3.252   22.887  -26.609 1.00 17.49 1  6   ARG A NH1 1 
ATOM   40   N NH2 . ARG A 1 6   ? 2.035   21.946  -28.314 1.00 16.75 ?  6   ARG A NH2 1 
ATOM   41   N N   . GLN A 1 7   ? 7.215   26.698  -25.540 1.00 20.58 ?  7   GLN A N   1 
ATOM   42   C CA  . GLN A 1 7   ? 6.761   26.952  -24.178 1.00 23.43 ?  7   GLN A CA  1 
ATOM   43   C C   . GLN A 1 7   ? 6.405   28.411  -23.905 1.00 23.32 ?  7   GLN A C   1 
ATOM   44   O O   . GLN A 1 7   ? 5.634   28.700  -22.989 1.00 25.26 ?  7   GLN A O   1 
ATOM   45   C CB  . GLN A 1 7   ? 7.819   26.480  -23.179 1.00 25.83 ?  7   GLN A CB  1 
ATOM   46   C CG  . GLN A 1 7   ? 9.170   27.146  -23.345 1.00 30.83 ?  7   GLN A CG  1 
ATOM   47   C CD  . GLN A 1 7   ? 10.224  26.535  -22.447 1.00 34.90 ?  7   GLN A CD  1 
ATOM   48   O OE1 . GLN A 1 7   ? 10.074  26.513  -21.223 1.00 35.95 ?  7   GLN A OE1 1 
ATOM   49   N NE2 . GLN A 1 7   ? 11.298  26.032  -23.049 1.00 35.57 ?  7   GLN A NE2 1 
ATOM   50   N N   . ASP A 1 8   ? 6.955   29.330  -24.695 1.00 22.95 ?  8   ASP A N   1 
ATOM   51   C CA  . ASP A 1 8   ? 6.668   30.753  -24.512 1.00 23.17 ?  8   ASP A CA  1 
ATOM   52   C C   . ASP A 1 8   ? 5.282   31.148  -25.010 1.00 21.87 ?  8   ASP A C   1 
ATOM   53   O O   . ASP A 1 8   ? 4.784   32.226  -24.685 1.00 23.76 ?  8   ASP A O   1 
ATOM   54   C CB  . ASP A 1 8   ? 7.706   31.621  -25.236 1.00 24.67 ?  8   ASP A CB  1 
ATOM   55   C CG  . ASP A 1 8   ? 9.089   31.522  -24.623 1.00 26.84 ?  8   ASP A CG  1 
ATOM   56   O OD1 . ASP A 1 8   ? 9.191   31.481  -23.377 1.00 28.27 ?  8   ASP A OD1 1 
ATOM   57   O OD2 . ASP A 1 8   ? 10.077  31.503  -25.388 1.00 28.98 -1 8   ASP A OD2 1 
ATOM   58   N N   . LEU A 1 9   ? 4.662   30.286  -25.808 1.00 21.33 ?  9   LEU A N   1 
ATOM   59   C CA  . LEU A 1 9   ? 3.336   30.576  -26.348 1.00 20.88 ?  9   LEU A CA  1 
ATOM   60   C C   . LEU A 1 9   ? 2.265   30.487  -25.267 1.00 20.42 ?  9   LEU A C   1 
ATOM   61   O O   . LEU A 1 9   ? 2.224   29.523  -24.497 1.00 20.61 ?  9   LEU A O   1 
ATOM   62   C CB  . LEU A 1 9   ? 2.997   29.592  -27.470 1.00 20.86 ?  9   LEU A CB  1 
ATOM   63   C CG  . LEU A 1 9   ? 3.989   29.485  -28.634 1.00 21.92 ?  9   LEU A CG  1 
ATOM   64   C CD1 . LEU A 1 9   ? 3.597   28.317  -29.530 1.00 23.48 ?  9   LEU A CD1 1 
ATOM   65   C CD2 . LEU A 1 9   ? 4.003   30.795  -29.419 1.00 24.14 ?  9   LEU A CD2 1 
ATOM   66   N N   . ASN A 1 10  ? 1.397   31.492  -25.205 1.00 21.28 ?  10  ASN A N   1 
ATOM   67   C CA  . ASN A 1 10  ? 0.329   31.482  -24.219 1.00 21.87 ?  10  ASN A CA  1 
ATOM   68   C C   . ASN A 1 10  ? -0.506  30.224  -24.417 1.00 21.20 ?  10  ASN A C   1 
ATOM   69   O O   . ASN A 1 10  ? -0.889  29.564  -23.452 1.00 21.41 ?  10  ASN A O   1 
ATOM   70   C CB  . ASN A 1 10  ? -0.566  32.712  -24.371 1.00 26.77 ?  10  ASN A CB  1 
ATOM   71   C CG  . ASN A 1 10  ? -1.655  32.765  -23.316 1.00 28.82 ?  10  ASN A CG  1 
ATOM   72   O OD1 . ASN A 1 10  ? -1.373  32.923  -22.127 1.00 34.27 ?  10  ASN A OD1 1 
ATOM   73   N ND2 . ASN A 1 10  ? -2.904  32.621  -23.743 1.00 32.95 ?  10  ASN A ND2 1 
ATOM   74   N N   . SER A 1 11  ? -0.776  29.889  -25.675 1.00 20.32 ?  11  SER A N   1 
ATOM   75   C CA  . SER A 1 11  ? -1.568  28.708  -25.994 1.00 20.78 ?  11  SER A CA  1 
ATOM   76   C C   . SER A 1 11  ? -0.956  27.417  -25.469 1.00 21.59 ?  11  SER A C   1 
ATOM   77   O O   . SER A 1 11  ? -1.680  26.515  -25.039 1.00 19.00 ?  11  SER A O   1 
ATOM   78   C CB  . SER A 1 11  ? -1.777  28.603  -27.504 1.00 23.75 ?  11  SER A CB  1 
ATOM   79   O OG  . SER A 1 11  ? -2.646  29.626  -27.949 1.00 29.45 ?  11  SER A OG  1 
ATOM   80   N N   . ALA A 1 12  ? 0.371   27.324  -25.502 1.00 18.47 ?  12  ALA A N   1 
ATOM   81   C CA  . ALA A 1 12  ? 1.047   26.124  -25.014 1.00 19.14 ?  12  ALA A CA  1 
ATOM   82   C C   . ALA A 1 12  ? 0.867   26.001  -23.507 1.00 19.87 ?  12  ALA A C   1 
ATOM   83   O O   . ALA A 1 12  ? 0.751   24.899  -22.971 1.00 18.28 ?  12  ALA A O   1 
ATOM   84   C CB  . ALA A 1 12  ? 2.533   26.175  -25.358 1.00 17.87 ?  12  ALA A CB  1 
ATOM   85   N N   . GLN A 1 13  ? 0.856   27.142  -22.826 1.00 19.15 ?  13  GLN A N   1 
ATOM   86   C CA  . GLN A 1 13  ? 0.697   27.164  -21.382 1.00 18.83 ?  13  GLN A CA  1 
ATOM   87   C C   . GLN A 1 13  ? -0.735  26.823  -20.988 1.00 19.41 ?  13  GLN A C   1 
ATOM   88   O O   . GLN A 1 13  ? -0.960  26.123  -20.001 1.00 19.27 ?  13  GLN A O   1 
ATOM   89   C CB  . GLN A 1 13  ? 1.099   28.538  -20.845 1.00 19.93 ?  13  GLN A CB  1 
ATOM   90   C CG  . GLN A 1 13  ? 2.563   28.846  -21.132 1.00 22.12 ?  13  GLN A CG  1 
ATOM   91   C CD  . GLN A 1 13  ? 2.930   30.298  -20.909 1.00 25.83 ?  13  GLN A CD  1 
ATOM   92   O OE1 . GLN A 1 13  ? 4.010   30.740  -21.306 1.00 29.38 ?  13  GLN A OE1 1 
ATOM   93   N NE2 . GLN A 1 13  ? 2.042   31.046  -20.272 1.00 26.08 ?  13  GLN A NE2 1 
ATOM   94   N N   . VAL A 1 14  ? -1.698  27.301  -21.767 1.00 18.71 ?  14  VAL A N   1 
ATOM   95   C CA  . VAL A 1 14  ? -3.101  27.022  -21.481 1.00 19.48 ?  14  VAL A CA  1 
ATOM   96   C C   . VAL A 1 14  ? -3.409  25.544  -21.706 1.00 19.88 ?  14  VAL A C   1 
ATOM   97   O O   . VAL A 1 14  ? -4.103  24.918  -20.901 1.00 19.34 ?  14  VAL A O   1 
ATOM   98   C CB  . VAL A 1 14  ? -4.040  27.876  -22.361 1.00 20.85 ?  14  VAL A CB  1 
ATOM   99   C CG1 . VAL A 1 14  ? -5.489  27.464  -22.132 1.00 22.84 ?  14  VAL A CG1 1 
ATOM   100  C CG2 . VAL A 1 14  ? -3.856  29.353  -22.028 1.00 23.96 ?  14  VAL A CG2 1 
ATOM   101  N N   . VAL A 1 15  ? -2.893  24.984  -22.795 1.00 18.46 ?  15  VAL A N   1 
ATOM   102  C CA  . VAL A 1 15  ? -3.130  23.577  -23.086 1.00 18.18 ?  15  VAL A CA  1 
ATOM   103  C C   . VAL A 1 15  ? -2.476  22.707  -22.016 1.00 18.46 ?  15  VAL A C   1 
ATOM   104  O O   . VAL A 1 15  ? -3.050  21.703  -21.583 1.00 18.37 ?  15  VAL A O   1 
ATOM   105  C CB  . VAL A 1 15  ? -2.593  23.190  -24.481 1.00 18.73 ?  15  VAL A CB  1 
ATOM   106  C CG1 . VAL A 1 15  ? -2.670  21.682  -24.674 1.00 18.34 ?  15  VAL A CG1 1 
ATOM   107  C CG2 . VAL A 1 15  ? -3.419  23.888  -25.554 1.00 18.33 ?  15  VAL A CG2 1 
ATOM   108  N N   . ALA A 1 16  ? -1.284  23.100  -21.579 1.00 18.00 ?  16  ALA A N   1 
ATOM   109  C CA  . ALA A 1 16  ? -0.580  22.356  -20.543 1.00 18.28 ?  16  ALA A CA  1 
ATOM   110  C C   . ALA A 1 16  ? -1.418  22.377  -19.267 1.00 18.77 ?  16  ALA A C   1 
ATOM   111  O O   . ALA A 1 16  ? -1.487  21.381  -18.541 1.00 17.79 ?  16  ALA A O   1 
ATOM   112  C CB  . ALA A 1 16  ? 0.789   22.977  -20.284 1.00 19.59 ?  16  ALA A CB  1 
ATOM   113  N N   . ASP A 1 17  ? -2.053  23.516  -18.997 1.00 19.15 ?  17  ASP A N   1 
ATOM   114  C CA  . ASP A 1 17  ? -2.899  23.656  -17.810 1.00 20.75 ?  17  ASP A CA  1 
ATOM   115  C C   . ASP A 1 17  ? -4.110  22.742  -17.914 1.00 19.20 ?  17  ASP A C   1 
ATOM   116  O O   . ASP A 1 17  ? -4.449  22.027  -16.971 1.00 19.02 ?  17  ASP A O   1 
ATOM   117  C CB  . ASP A 1 17  ? -3.395  25.099  -17.649 1.00 21.88 ?  17  ASP A CB  1 
ATOM   118  C CG  . ASP A 1 17  ? -2.339  26.025  -17.081 1.00 27.96 ?  17  ASP A CG  1 
ATOM   119  O OD1 . ASP A 1 17  ? -1.346  25.524  -16.511 1.00 30.79 ?  17  ASP A OD1 1 
ATOM   120  O OD2 . ASP A 1 17  ? -2.514  27.258  -17.190 1.00 29.68 -1 17  ASP A OD2 1 
ATOM   121  N N   . VAL A 1 18  ? -4.764  22.778  -19.069 1.00 17.97 ?  18  VAL A N   1 
ATOM   122  C CA  . VAL A 1 18  ? -5.946  21.964  -19.312 1.00 16.86 ?  18  VAL A CA  1 
ATOM   123  C C   . VAL A 1 18  ? -5.649  20.467  -19.241 1.00 16.95 ?  18  VAL A C   1 
ATOM   124  O O   . VAL A 1 18  ? -6.389  19.707  -18.615 1.00 15.93 ?  18  VAL A O   1 
ATOM   125  C CB  . VAL A 1 18  ? -6.553  22.292  -20.698 1.00 19.08 ?  18  VAL A CB  1 
ATOM   126  C CG1 . VAL A 1 18  ? -7.715  21.360  -21.005 1.00 20.28 ?  18  VAL A CG1 1 
ATOM   127  C CG2 . VAL A 1 18  ? -7.023  23.741  -20.718 1.00 20.26 ?  18  VAL A CG2 1 
ATOM   128  N N   . LEU A 1 19  ? -4.557  20.044  -19.869 1.00 16.92 ?  19  LEU A N   1 
ATOM   129  C CA  . LEU A 1 19  ? -4.204  18.630  -19.873 1.00 15.89 ?  19  LEU A CA  1 
ATOM   130  C C   . LEU A 1 19  ? -3.744  18.138  -18.502 1.00 14.75 ?  19  LEU A C   1 
ATOM   131  O O   . LEU A 1 19  ? -4.028  17.003  -18.125 1.00 14.15 ?  19  LEU A O   1 
ATOM   132  C CB  . LEU A 1 19  ? -3.118  18.359  -20.916 1.00 18.17 ?  19  LEU A CB  1 
ATOM   133  C CG  . LEU A 1 19  ? -2.851  16.888  -21.239 1.00 25.12 ?  19  LEU A CG  1 
ATOM   134  C CD1 . LEU A 1 19  ? -4.128  16.220  -21.732 1.00 26.33 ?  19  LEU A CD1 1 
ATOM   135  C CD2 . LEU A 1 19  ? -1.762  16.796  -22.299 1.00 28.40 ?  19  LEU A CD2 1 
ATOM   136  N N   . SER A 1 20  ? -3.039  18.983  -17.755 1.00 14.69 ?  20  SER A N   1 
ATOM   137  C CA  . SER A 1 20  ? -2.578  18.587  -16.429 1.00 14.47 ?  20  SER A CA  1 
ATOM   138  C C   . SER A 1 20  ? -3.791  18.400  -15.517 1.00 14.43 ?  20  SER A C   1 
ATOM   139  O O   . SER A 1 20  ? -3.835  17.462  -14.709 1.00 14.99 ?  20  SER A O   1 
ATOM   140  C CB  . SER A 1 20  ? -1.627  19.642  -15.845 1.00 17.03 ?  20  SER A CB  1 
ATOM   141  O OG  . SER A 1 20  ? -2.279  20.881  -15.668 1.00 25.73 ?  20  SER A OG  1 
ATOM   142  N N   . GLU A 1 21  ? -4.781  19.280  -15.654 1.00 15.43 ?  21  GLU A N   1 
ATOM   143  C CA  . GLU A 1 21  ? -5.993  19.170  -14.841 1.00 16.33 ?  21  GLU A CA  1 
ATOM   144  C C   . GLU A 1 21  ? -6.755  17.908  -15.227 1.00 15.93 ?  21  GLU A C   1 
ATOM   145  O O   . GLU A 1 21  ? -7.321  17.227  -14.371 1.00 14.87 ?  21  GLU A O   1 
ATOM   146  C CB  . GLU A 1 21  ? -6.901  20.385  -15.028 1.00 19.45 ?  21  GLU A CB  1 
ATOM   147  C CG  . GLU A 1 21  ? -8.220  20.239  -14.282 1.00 23.74 ?  21  GLU A CG  1 
ATOM   148  C CD  . GLU A 1 21  ? -9.125  21.440  -14.434 1.00 27.92 ?  21  GLU A CD  1 
ATOM   149  O OE1 . GLU A 1 21  ? -9.434  21.814  -15.586 1.00 29.41 ?  21  GLU A OE1 1 
ATOM   150  O OE2 . GLU A 1 21  ? -9.531  22.000  -13.394 1.00 30.66 -1 21  GLU A OE2 1 
ATOM   151  N N   . PHE A 1 22  ? -6.781  17.606  -16.521 1.00 13.38 ?  22  PHE A N   1 
ATOM   152  C CA  . PHE A 1 22  ? -7.454  16.405  -16.996 1.00 13.52 ?  22  PHE A CA  1 
ATOM   153  C C   . PHE A 1 22  ? -6.805  15.177  -16.367 1.00 13.18 ?  22  PHE A C   1 
ATOM   154  O O   . PHE A 1 22  ? -7.492  14.263  -15.907 1.00 12.21 ?  22  PHE A O   1 
ATOM   155  C CB  . PHE A 1 22  ? -7.351  16.288  -18.516 1.00 13.66 ?  22  PHE A CB  1 
ATOM   156  C CG  . PHE A 1 22  ? -7.671  14.914  -19.034 1.00 12.64 ?  22  PHE A CG  1 
ATOM   157  C CD1 . PHE A 1 22  ? -8.983  14.454  -19.062 1.00 13.57 ?  22  PHE A CD1 1 
ATOM   158  C CD2 . PHE A 1 22  ? -6.650  14.059  -19.455 1.00 12.99 ?  22  PHE A CD2 1 
ATOM   159  C CE1 . PHE A 1 22  ? -9.280  13.164  -19.500 1.00 14.78 ?  22  PHE A CE1 1 
ATOM   160  C CE2 . PHE A 1 22  ? -6.935  12.767  -19.892 1.00 14.98 ?  22  PHE A CE2 1 
ATOM   161  C CZ  . PHE A 1 22  ? -8.251  12.316  -19.916 1.00 15.74 ?  22  PHE A CZ  1 
ATOM   162  N N   . LEU A 1 23  ? -5.475  15.146  -16.367 1.00 12.56 ?  23  LEU A N   1 
ATOM   163  C CA  . LEU A 1 23  ? -4.778  14.008  -15.780 1.00 11.41 ?  23  LEU A CA  1 
ATOM   164  C C   . LEU A 1 23  ? -5.114  13.888  -14.294 1.00 10.96 ?  23  LEU A C   1 
ATOM   165  O O   . LEU A 1 23  ? -5.215  12.779  -13.773 1.00 12.34 ?  23  LEU A O   1 
ATOM   166  C CB  . LEU A 1 23  ? -3.264  14.145  -15.991 1.00 11.81 ?  23  LEU A CB  1 
ATOM   167  C CG  . LEU A 1 23  ? -2.874  13.942  -17.459 1.00 11.57 ?  23  LEU A CG  1 
ATOM   168  C CD1 . LEU A 1 23  ? -1.419  14.344  -17.665 1.00 13.46 ?  23  LEU A CD1 1 
ATOM   169  C CD2 . LEU A 1 23  ? -3.098  12.481  -17.859 1.00 14.56 ?  23  LEU A CD2 1 
ATOM   170  N N   . GLU A 1 24  ? -5.305  15.020  -13.618 1.00 11.73 ?  24  GLU A N   1 
ATOM   171  C CA  . GLU A 1 24  ? -5.654  14.987  -12.194 1.00 11.39 ?  24  GLU A CA  1 
ATOM   172  C C   . GLU A 1 24  ? -7.030  14.338  -12.024 1.00 10.86 ?  24  GLU A C   1 
ATOM   173  O O   . GLU A 1 24  ? -7.229  13.475  -11.167 1.00 12.26 ?  24  GLU A O   1 
ATOM   174  C CB  . GLU A 1 24  ? -5.692  16.401  -11.619 1.00 12.36 ?  24  GLU A CB  1 
ATOM   175  C CG  . GLU A 1 24  ? -6.008  16.440  -10.134 1.00 14.23 ?  24  GLU A CG  1 
ATOM   176  C CD  . GLU A 1 24  ? -6.169  17.848  -9.599  1.00 16.22 ?  24  GLU A CD  1 
ATOM   177  O OE1 . GLU A 1 24  ? -6.916  18.646  -10.214 1.00 17.90 ?  24  GLU A OE1 1 
ATOM   178  O OE2 . GLU A 1 24  ? -5.555  18.151  -8.555  1.00 17.28 -1 24  GLU A OE2 1 
ATOM   179  N N   . VAL A 1 25  ? -7.984  14.778  -12.834 1.00 11.48 ?  25  VAL A N   1 
ATOM   180  C CA  . VAL A 1 25  ? -9.335  14.223  -12.787 1.00 12.15 ?  25  VAL A CA  1 
ATOM   181  C C   . VAL A 1 25  ? -9.295  12.722  -13.082 1.00 11.09 ?  25  VAL A C   1 
ATOM   182  O O   . VAL A 1 25  ? -9.933  11.925  -12.396 1.00 13.17 ?  25  VAL A O   1 
ATOM   183  C CB  . VAL A 1 25  ? -10.253 14.908  -13.821 1.00 13.47 ?  25  VAL A CB  1 
ATOM   184  C CG1 . VAL A 1 25  ? -11.628 14.241  -13.834 1.00 14.38 ?  25  VAL A CG1 1 
ATOM   185  C CG2 . VAL A 1 25  ? -10.383 16.389  -13.491 1.00 14.56 ?  25  VAL A CG2 1 
ATOM   186  N N   . ALA A 1 26  ? -8.528  12.340  -14.096 1.00 11.09 ?  26  ALA A N   1 
ATOM   187  C CA  . ALA A 1 26  ? -8.417  10.937  -14.480 1.00 12.21 ?  26  ALA A CA  1 
ATOM   188  C C   . ALA A 1 26  ? -7.756  10.083  -13.400 1.00 11.04 ?  26  ALA A C   1 
ATOM   189  O O   . ALA A 1 26  ? -8.183  8.955   -13.150 1.00 13.26 ?  26  ALA A O   1 
ATOM   190  C CB  . ALA A 1 26  ? -7.645  10.820  -15.790 1.00 10.51 ?  26  ALA A CB  1 
ATOM   191  N N   . VAL A 1 27  ? -6.717  10.610  -12.757 1.00 10.89 ?  27  VAL A N   1 
ATOM   192  C CA  . VAL A 1 27  ? -6.048  9.856   -11.708 1.00 10.41 ?  27  VAL A CA  1 
ATOM   193  C C   . VAL A 1 27  ? -7.017  9.619   -10.551 1.00 11.41 ?  27  VAL A C   1 
ATOM   194  O O   . VAL A 1 27  ? -7.121  8.505   -10.053 1.00 12.04 ?  27  VAL A O   1 
ATOM   195  C CB  . VAL A 1 27  ? -4.780  10.582  -11.197 1.00 10.63 ?  27  VAL A CB  1 
ATOM   196  C CG1 . VAL A 1 27  ? -4.251  9.896   -9.942  1.00 12.05 ?  27  VAL A CG1 1 
ATOM   197  C CG2 . VAL A 1 27  ? -3.711  10.554  -12.285 1.00 12.55 ?  27  VAL A CG2 1 
ATOM   198  N N   . HIS A 1 28  ? -7.733  10.661  -10.137 1.00 12.13 ?  28  HIS A N   1 
ATOM   199  C CA  . HIS A 1 28  ? -8.701  10.512  -9.053  1.00 11.29 ?  28  HIS A CA  1 
ATOM   200  C C   . HIS A 1 28  ? -9.724  9.438   -9.424  1.00 11.40 ?  28  HIS A C   1 
ATOM   201  O O   . HIS A 1 28  ? -10.043 8.565   -8.611  1.00 11.78 ?  28  HIS A O   1 
ATOM   202  C CB  . HIS A 1 28  ? -9.453  11.826  -8.804  1.00 11.30 ?  28  HIS A CB  1 
ATOM   203  C CG  . HIS A 1 28  ? -8.778  12.766  -7.850  1.00 10.93 ?  28  HIS A CG  1 
ATOM   204  N ND1 . HIS A 1 28  ? -7.616  13.447  -8.148  1.00 14.27 ?  28  HIS A ND1 1 
ATOM   205  C CD2 . HIS A 1 28  ? -9.164  13.201  -6.627  1.00 10.04 ?  28  HIS A CD2 1 
ATOM   206  C CE1 . HIS A 1 28  ? -7.319  14.264  -7.149  1.00 10.04 ?  28  HIS A CE1 1 
ATOM   207  N NE2 . HIS A 1 28  ? -8.243  14.133  -6.214  1.00 17.63 ?  28  HIS A NE2 1 
ATOM   208  N N   . LEU A 1 29  ? -10.233 9.501   -10.655 1.00 11.17 ?  29  LEU A N   1 
ATOM   209  C CA  . LEU A 1 29  ? -11.243 8.544   -11.103 1.00 12.04 ?  29  LEU A CA  1 
ATOM   210  C C   . LEU A 1 29  ? -10.729 7.110   -11.136 1.00 11.68 ?  29  LEU A C   1 
ATOM   211  O O   . LEU A 1 29  ? -11.429 6.180   -10.731 1.00 12.89 ?  29  LEU A O   1 
ATOM   212  C CB  . LEU A 1 29  ? -11.778 8.945   -12.477 1.00 12.68 ?  29  LEU A CB  1 
ATOM   213  C CG  . LEU A 1 29  ? -13.020 8.174   -12.927 1.00 13.94 ?  29  LEU A CG  1 
ATOM   214  C CD1 . LEU A 1 29  ? -14.138 8.339   -11.901 1.00 15.86 ?  29  LEU A CD1 1 
ATOM   215  C CD2 . LEU A 1 29  ? -13.464 8.693   -14.279 1.00 14.96 ?  29  LEU A CD2 1 
ATOM   216  N N   . ILE A 1 30  ? -9.509  6.929   -11.625 1.00 11.53 ?  30  ILE A N   1 
ATOM   217  C CA  . ILE A 1 30  ? -8.904  5.603   -11.673 1.00 12.30 ?  30  ILE A CA  1 
ATOM   218  C C   . ILE A 1 30  ? -8.785  5.043   -10.258 1.00 12.03 ?  30  ILE A C   1 
ATOM   219  O O   . ILE A 1 30  ? -9.126  3.885   -10.011 1.00 14.23 ?  30  ILE A O   1 
ATOM   220  C CB  . ILE A 1 30  ? -7.508  5.667   -12.329 1.00 11.12 ?  30  ILE A CB  1 
ATOM   221  C CG1 . ILE A 1 30  ? -7.668  5.939   -13.824 1.00 12.32 ?  30  ILE A CG1 1 
ATOM   222  C CG2 . ILE A 1 30  ? -6.735  4.370   -12.081 1.00 13.24 ?  30  ILE A CG2 1 
ATOM   223  C CD1 . ILE A 1 30  ? -6.370  6.270   -14.533 1.00 12.84 ?  30  ILE A CD1 1 
ATOM   224  N N   . LEU A 1 31  ? -8.317  5.865   -9.320  1.00 10.95 ?  31  LEU A N   1 
ATOM   225  C CA  . LEU A 1 31  ? -8.174  5.406   -7.941  1.00 12.10 ?  31  LEU A CA  1 
ATOM   226  C C   . LEU A 1 31  ? -9.530  4.989   -7.367  1.00 13.14 ?  31  LEU A C   1 
ATOM   227  O O   . LEU A 1 31  ? -9.610  4.049   -6.577  1.00 14.44 ?  31  LEU A O   1 
ATOM   228  C CB  . LEU A 1 31  ? -7.539  6.505   -7.077  1.00 12.57 ?  31  LEU A CB  1 
ATOM   229  C CG  . LEU A 1 31  ? -6.115  6.895   -7.499  1.00 12.63 ?  31  LEU A CG  1 
ATOM   230  C CD1 . LEU A 1 31  ? -5.588  8.009   -6.601  1.00 14.77 ?  31  LEU A CD1 1 
ATOM   231  C CD2 . LEU A 1 31  ? -5.204  5.673   -7.428  1.00 15.35 ?  31  LEU A CD2 1 
ATOM   232  N N   . TYR A 1 32  ? -10.588 5.679   -7.783  1.00 13.54 ?  32  TYR A N   1 
ATOM   233  C CA  . TYR A 1 32  ? -11.939 5.376   -7.321  1.00 12.72 ?  32  TYR A CA  1 
ATOM   234  C C   . TYR A 1 32  ? -12.488 4.089   -7.929  1.00 15.15 ?  32  TYR A C   1 
ATOM   235  O O   . TYR A 1 32  ? -12.899 3.172   -7.208  1.00 15.54 ?  32  TYR A O   1 
ATOM   236  C CB  . TYR A 1 32  ? -12.887 6.531   -7.670  1.00 14.04 ?  32  TYR A CB  1 
ATOM   237  C CG  . TYR A 1 32  ? -14.353 6.233   -7.418  1.00 15.30 ?  32  TYR A CG  1 
ATOM   238  C CD1 . TYR A 1 32  ? -14.903 6.364   -6.145  1.00 17.60 ?  32  TYR A CD1 1 
ATOM   239  C CD2 . TYR A 1 32  ? -15.185 5.814   -8.455  1.00 18.74 ?  32  TYR A CD2 1 
ATOM   240  C CE1 . TYR A 1 32  ? -16.251 6.086   -5.910  1.00 18.59 ?  32  TYR A CE1 1 
ATOM   241  C CE2 . TYR A 1 32  ? -16.536 5.532   -8.231  1.00 17.74 ?  32  TYR A CE2 1 
ATOM   242  C CZ  . TYR A 1 32  ? -17.058 5.670   -6.959  1.00 20.91 ?  32  TYR A CZ  1 
ATOM   243  O OH  . TYR A 1 32  ? -18.387 5.387   -6.727  1.00 23.48 ?  32  TYR A OH  1 
ATOM   244  N N   . VAL A 1 33  ? -12.489 4.011   -9.257  1.00 15.17 ?  33  VAL A N   1 
ATOM   245  C CA  . VAL A 1 33  ? -13.044 2.837   -9.928  1.00 16.69 ?  33  VAL A CA  1 
ATOM   246  C C   . VAL A 1 33  ? -12.250 1.548   -9.758  1.00 17.07 ?  33  VAL A C   1 
ATOM   247  O O   . VAL A 1 33  ? -12.799 0.456   -9.924  1.00 19.72 ?  33  VAL A O   1 
ATOM   248  C CB  . VAL A 1 33  ? -13.275 3.098   -11.437 1.00 15.64 ?  33  VAL A CB  1 
ATOM   249  C CG1 . VAL A 1 33  ? -14.174 4.305   -11.616 1.00 19.36 ?  33  VAL A CG1 1 
ATOM   250  C CG2 . VAL A 1 33  ? -11.958 3.287   -12.156 1.00 16.80 ?  33  VAL A CG2 1 
ATOM   251  N N   . ARG A 1 34  ? -10.967 1.657   -9.430  1.00 14.99 ?  34  ARG A N   1 
ATOM   252  C CA  . ARG A 1 34  ? -10.159 0.462   -9.221  1.00 16.56 ?  34  ARG A CA  1 
ATOM   253  C C   . ARG A 1 34  ? -10.010 0.189   -7.727  1.00 17.58 ?  34  ARG A C   1 
ATOM   254  O O   . ARG A 1 34  ? -9.321  -0.742  -7.318  1.00 19.34 ?  34  ARG A O   1 
ATOM   255  C CB  . ARG A 1 34  ? -8.784  0.611   -9.881  1.00 16.74 ?  34  ARG A CB  1 
ATOM   256  C CG  . ARG A 1 34  ? -8.862  0.885   -11.384 1.00 15.85 ?  34  ARG A CG  1 
ATOM   257  C CD  . ARG A 1 34  ? -9.849  -0.054  -12.080 1.00 17.34 ?  34  ARG A CD  1 
ATOM   258  N NE  . ARG A 1 34  ? -9.437  -1.454  -12.020 1.00 19.06 ?  34  ARG A NE  1 
ATOM   259  C CZ  . ARG A 1 34  ? -10.284 -2.472  -11.905 1.00 21.73 ?  34  ARG A CZ  1 
ATOM   260  N NH1 . ARG A 1 34  ? -11.588 -2.243  -11.827 1.00 23.00 1  34  ARG A NH1 1 
ATOM   261  N NH2 . ARG A 1 34  ? -9.828  -3.719  -11.886 1.00 22.21 ?  34  ARG A NH2 1 
ATOM   262  N N   . GLU A 1 35  ? -10.675 1.017   -6.926  1.00 18.71 ?  35  GLU A N   1 
ATOM   263  C CA  . GLU A 1 35  ? -10.668 0.904   -5.471  1.00 19.51 ?  35  GLU A CA  1 
ATOM   264  C C   . GLU A 1 35  ? -9.284  0.864   -4.829  1.00 19.23 ?  35  GLU A C   1 
ATOM   265  O O   . GLU A 1 35  ? -9.038  0.087   -3.901  1.00 19.11 ?  35  GLU A O   1 
ATOM   266  C CB  . GLU A 1 35  ? -11.483 -0.322  -5.040  1.00 24.62 ?  35  GLU A CB  1 
ATOM   267  C CG  . GLU A 1 35  ? -12.938 -0.265  -5.490  1.00 29.43 ?  35  GLU A CG  1 
ATOM   268  C CD  . GLU A 1 35  ? -13.774 -1.412  -4.947  1.00 33.28 ?  35  GLU A CD  1 
ATOM   269  O OE1 . GLU A 1 35  ? -13.944 -1.497  -3.712  1.00 36.30 ?  35  GLU A OE1 1 
ATOM   270  O OE2 . GLU A 1 35  ? -14.260 -2.226  -5.758  1.00 37.13 -1 35  GLU A OE2 1 
ATOM   271  N N   . VAL A 1 36  ? -8.378  1.706   -5.319  1.00 16.00 ?  36  VAL A N   1 
ATOM   272  C CA  . VAL A 1 36  ? -7.037  1.778   -4.754  1.00 15.92 ?  36  VAL A CA  1 
ATOM   273  C C   . VAL A 1 36  ? -7.169  2.415   -3.371  1.00 15.87 ?  36  VAL A C   1 
ATOM   274  O O   . VAL A 1 36  ? -6.427  2.085   -2.447  1.00 18.99 ?  36  VAL A O   1 
ATOM   275  C CB  . VAL A 1 36  ? -6.103  2.621   -5.644  1.00 16.02 ?  36  VAL A CB  1 
ATOM   276  C CG1 . VAL A 1 36  ? -4.695  2.624   -5.068  1.00 16.76 ?  36  VAL A CG1 1 
ATOM   277  C CG2 . VAL A 1 36  ? -6.093  2.050   -7.054  1.00 17.87 ?  36  VAL A CG2 1 
ATOM   278  N N   . TYR A 1 37  ? -8.114  3.345   -3.257  1.00 15.70 ?  37  TYR A N   1 
ATOM   279  C CA  . TYR A 1 37  ? -8.433  4.003   -1.994  1.00 16.44 ?  37  TYR A CA  1 
ATOM   280  C C   . TYR A 1 37  ? -9.926  3.743   -1.819  1.00 15.45 ?  37  TYR A C   1 
ATOM   281  O O   . TYR A 1 37  ? -10.650 3.562   -2.799  1.00 16.31 ?  37  TYR A O   1 
ATOM   282  C CB  . TYR A 1 37  ? -8.144  5.509   -2.052  1.00 15.18 ?  37  TYR A CB  1 
ATOM   283  C CG  . TYR A 1 37  ? -6.663  5.833   -2.042  1.00 15.17 ?  37  TYR A CG  1 
ATOM   284  C CD1 . TYR A 1 37  ? -5.986  6.070   -0.847  1.00 14.64 ?  37  TYR A CD1 1 
ATOM   285  C CD2 . TYR A 1 37  ? -5.933  5.860   -3.225  1.00 13.67 ?  37  TYR A CD2 1 
ATOM   286  C CE1 . TYR A 1 37  ? -4.610  6.327   -0.836  1.00 14.52 ?  37  TYR A CE1 1 
ATOM   287  C CE2 . TYR A 1 37  ? -4.566  6.108   -3.225  1.00 14.88 ?  37  TYR A CE2 1 
ATOM   288  C CZ  . TYR A 1 37  ? -3.909  6.340   -2.031  1.00 13.44 ?  37  TYR A CZ  1 
ATOM   289  O OH  . TYR A 1 37  ? -2.551  6.577   -2.045  1.00 16.86 ?  37  TYR A OH  1 
ATOM   290  N N   . PRO A 1 38  ? -10.406 3.713   -0.570  1.00 18.01 ?  38  PRO A N   1 
ATOM   291  C CA  . PRO A 1 38  ? -11.815 3.463   -0.245  1.00 19.50 ?  38  PRO A CA  1 
ATOM   292  C C   . PRO A 1 38  ? -12.807 4.457   -0.837  1.00 17.82 ?  38  PRO A C   1 
ATOM   293  O O   . PRO A 1 38  ? -12.518 5.643   -0.943  1.00 17.18 ?  38  PRO A O   1 
ATOM   294  C CB  . PRO A 1 38  ? -11.830 3.506   1.285   1.00 19.97 ?  38  PRO A CB  1 
ATOM   295  C CG  . PRO A 1 38  ? -10.431 3.156   1.664   1.00 23.13 ?  38  PRO A CG  1 
ATOM   296  C CD  . PRO A 1 38  ? -9.621  3.920   0.655   1.00 19.74 ?  38  PRO A CD  1 
ATOM   297  N N   . VAL A 1 39  ? -13.989 3.965   -1.196  1.00 17.04 ?  39  VAL A N   1 
ATOM   298  C CA  . VAL A 1 39  ? -15.031 4.818   -1.758  1.00 18.44 ?  39  VAL A CA  1 
ATOM   299  C C   . VAL A 1 39  ? -15.349 5.959   -0.796  1.00 17.20 ?  39  VAL A C   1 
ATOM   300  O O   . VAL A 1 39  ? -15.690 7.067   -1.212  1.00 18.60 ?  39  VAL A O   1 
ATOM   301  C CB  . VAL A 1 39  ? -16.332 4.017   -2.012  1.00 20.62 ?  39  VAL A CB  1 
ATOM   302  C CG1 . VAL A 1 39  ? -17.452 4.955   -2.442  1.00 25.84 ?  39  VAL A CG1 1 
ATOM   303  C CG2 . VAL A 1 39  ? -16.088 2.964   -3.081  1.00 23.31 ?  39  VAL A CG2 1 
ATOM   304  N N   . GLY A 1 40  ? -15.226 5.678   0.494   1.00 18.77 ?  40  GLY A N   1 
ATOM   305  C CA  . GLY A 1 40  ? -15.520 6.677   1.501   1.00 17.94 ?  40  GLY A CA  1 
ATOM   306  C C   . GLY A 1 40  ? -14.768 7.993   1.418   1.00 17.63 ?  40  GLY A C   1 
ATOM   307  O O   . GLY A 1 40  ? -15.281 9.016   1.874   1.00 18.03 ?  40  GLY A O   1 
ATOM   308  N N   . ILE A 1 41  ? -13.565 7.998   0.850   1.00 16.16 ?  41  ILE A N   1 
ATOM   309  C CA  . ILE A 1 41  ? -12.831 9.259   0.781   1.00 15.71 ?  41  ILE A CA  1 
ATOM   310  C C   . ILE A 1 41  ? -13.200 10.110  -0.427  1.00 15.44 ?  41  ILE A C   1 
ATOM   311  O O   . ILE A 1 41  ? -12.792 11.264  -0.515  1.00 15.90 ?  41  ILE A O   1 
ATOM   312  C CB  . ILE A 1 41  ? -11.285 9.055   0.774   1.00 18.13 ?  41  ILE A CB  1 
ATOM   313  C CG1 . ILE A 1 41  ? -10.821 8.517   -0.576  1.00 17.49 ?  41  ILE A CG1 1 
ATOM   314  C CG2 . ILE A 1 41  ? -10.873 8.102   1.891   1.00 17.98 ?  41  ILE A CG2 1 
ATOM   315  C CD1 . ILE A 1 41  ? -9.321  8.660   -0.792  1.00 19.12 ?  41  ILE A CD1 1 
ATOM   316  N N   . PHE A 1 42  ? -13.988 9.553   -1.343  1.00 14.50 ?  42  PHE A N   1 
ATOM   317  C CA  . PHE A 1 42  ? -14.375 10.277  -2.555  1.00 14.34 ?  42  PHE A CA  1 
ATOM   318  C C   . PHE A 1 42  ? -15.747 10.930  -2.501  1.00 15.48 ?  42  PHE A C   1 
ATOM   319  O O   . PHE A 1 42  ? -16.643 10.468  -1.789  1.00 16.00 ?  42  PHE A O   1 
ATOM   320  C CB  . PHE A 1 42  ? -14.361 9.324   -3.756  1.00 14.42 ?  42  PHE A CB  1 
ATOM   321  C CG  . PHE A 1 42  ? -13.001 8.784   -4.092  1.00 14.61 ?  42  PHE A CG  1 
ATOM   322  C CD1 . PHE A 1 42  ? -12.172 9.465   -4.976  1.00 13.47 ?  42  PHE A CD1 1 
ATOM   323  C CD2 . PHE A 1 42  ? -12.554 7.589   -3.534  1.00 14.78 ?  42  PHE A CD2 1 
ATOM   324  C CE1 . PHE A 1 42  ? -10.912 8.963   -5.307  1.00 15.48 ?  42  PHE A CE1 1 
ATOM   325  C CE2 . PHE A 1 42  ? -11.297 7.075   -3.856  1.00 14.96 ?  42  PHE A CE2 1 
ATOM   326  C CZ  . PHE A 1 42  ? -10.476 7.763   -4.746  1.00 14.10 ?  42  PHE A CZ  1 
ATOM   327  N N   . GLN A 1 43  ? -15.907 12.005  -3.270  1.00 14.07 ?  43  GLN A N   1 
ATOM   328  C CA  . GLN A 1 43  ? -17.191 12.685  -3.369  1.00 14.23 ?  43  GLN A CA  1 
ATOM   329  C C   . GLN A 1 43  ? -17.462 12.988  -4.836  1.00 14.38 ?  43  GLN A C   1 
ATOM   330  O O   . GLN A 1 43  ? -16.565 13.389  -5.577  1.00 13.94 ?  43  GLN A O   1 
ATOM   331  C CB  . GLN A 1 43  ? -17.214 14.001  -2.597  1.00 13.65 ?  43  GLN A CB  1 
ATOM   332  C CG  . GLN A 1 43  ? -18.622 14.598  -2.549  1.00 18.21 ?  43  GLN A CG  1 
ATOM   333  C CD  . GLN A 1 43  ? -18.645 16.104  -2.677  1.00 24.96 ?  43  GLN A CD  1 
ATOM   334  O OE1 . GLN A 1 43  ? -18.031 16.815  -1.896  1.00 19.18 ?  43  GLN A OE1 1 
ATOM   335  N NE2 . GLN A 1 43  ? -19.362 16.599  -3.681  1.00 30.14 ?  43  GLN A NE2 1 
ATOM   336  N N   . LYS A 1 44  ? -18.702 12.785  -5.257  1.00 14.73 ?  44  LYS A N   1 
ATOM   337  C CA  . LYS A 1 44  ? -19.073 13.061  -6.634  1.00 14.78 ?  44  LYS A CA  1 
ATOM   338  C C   . LYS A 1 44  ? -19.017 14.566  -6.909  1.00 15.55 ?  44  LYS A C   1 
ATOM   339  O O   . LYS A 1 44  ? -19.481 15.371  -6.104  1.00 16.75 ?  44  LYS A O   1 
ATOM   340  C CB  . LYS A 1 44  ? -20.487 12.527  -6.904  1.00 18.72 ?  44  LYS A CB  1 
ATOM   341  C CG  . LYS A 1 44  ? -20.968 12.744  -8.332  1.00 22.90 ?  44  LYS A CG  1 
ATOM   342  C CD  . LYS A 1 44  ? -22.285 12.026  -8.603  1.00 29.07 ?  44  LYS A CD  1 
ATOM   343  C CE  . LYS A 1 44  ? -22.123 10.509  -8.543  1.00 32.15 ?  44  LYS A CE  1 
ATOM   344  N NZ  . LYS A 1 44  ? -23.390 9.793   -8.884  1.00 36.12 1  44  LYS A NZ  1 
ATOM   345  N N   . ARG A 1 45  ? -18.416 14.943  -8.034  1.00 14.55 ?  45  ARG A N   1 
ATOM   346  C CA  . ARG A 1 45  ? -18.335 16.341  -8.440  1.00 15.73 ?  45  ARG A CA  1 
ATOM   347  C C   . ARG A 1 45  ? -18.613 16.356  -9.941  1.00 15.83 ?  45  ARG A C   1 
ATOM   348  O O   . ARG A 1 45  ? -18.859 15.308  -10.536 1.00 17.03 ?  45  ARG A O   1 
ATOM   349  C CB  . ARG A 1 45  ? -16.944 16.931  -8.155  1.00 16.07 ?  45  ARG A CB  1 
ATOM   350  C CG  . ARG A 1 45  ? -16.575 17.046  -6.672  1.00 14.63 ?  45  ARG A CG  1 
ATOM   351  C CD  . ARG A 1 45  ? -17.507 17.997  -5.915  1.00 18.51 ?  45  ARG A CD  1 
ATOM   352  N NE  . ARG A 1 45  ? -17.218 18.052  -4.481  1.00 18.21 ?  45  ARG A NE  1 
ATOM   353  C CZ  . ARG A 1 45  ? -16.348 18.881  -3.906  1.00 21.56 ?  45  ARG A CZ  1 
ATOM   354  N NH1 . ARG A 1 45  ? -15.664 19.749  -4.637  1.00 20.70 1  45  ARG A NH1 1 
ATOM   355  N NH2 . ARG A 1 45  ? -16.162 18.840  -2.589  1.00 19.01 ?  45  ARG A NH2 1 
ATOM   356  N N   . LYS A 1 46  ? -18.601 17.536  -10.548 1.00 18.38 ?  46  LYS A N   1 
ATOM   357  C CA  . LYS A 1 46  ? -18.848 17.627  -11.979 1.00 20.82 ?  46  LYS A CA  1 
ATOM   358  C C   . LYS A 1 46  ? -17.656 18.248  -12.700 1.00 20.96 ?  46  LYS A C   1 
ATOM   359  O O   . LYS A 1 46  ? -17.078 19.234  -12.239 1.00 21.13 ?  46  LYS A O   1 
ATOM   360  C CB  . LYS A 1 46  ? -20.113 18.449  -12.255 1.00 24.78 ?  46  LYS A CB  1 
ATOM   361  C CG  . LYS A 1 46  ? -20.568 18.388  -13.710 1.00 28.61 ?  46  LYS A CG  1 
ATOM   362  C CD  . LYS A 1 46  ? -21.845 19.188  -13.954 1.00 33.72 ?  46  LYS A CD  1 
ATOM   363  C CE  . LYS A 1 46  ? -21.609 20.681  -13.792 1.00 35.54 ?  46  LYS A CE  1 
ATOM   364  N NZ  . LYS A 1 46  ? -22.824 21.468  -14.139 1.00 39.22 1  46  LYS A NZ  1 
ATOM   365  N N   . LYS A 1 47  ? -17.289 17.646  -13.825 1.00 19.90 ?  47  LYS A N   1 
ATOM   366  C CA  . LYS A 1 47  ? -16.179 18.116  -14.645 1.00 22.04 ?  47  LYS A CA  1 
ATOM   367  C C   . LYS A 1 47  ? -16.512 17.754  -16.088 1.00 19.43 ?  47  LYS A C   1 
ATOM   368  O O   . LYS A 1 47  ? -16.951 16.636  -16.363 1.00 18.82 ?  47  LYS A O   1 
ATOM   369  C CB  . LYS A 1 47  ? -14.877 17.427  -14.225 1.00 23.67 ?  47  LYS A CB  1 
ATOM   370  C CG  . LYS A 1 47  ? -13.740 18.357  -13.820 1.00 34.08 ?  47  LYS A CG  1 
ATOM   371  C CD  . LYS A 1 47  ? -13.249 19.224  -14.967 1.00 35.09 ?  47  LYS A CD  1 
ATOM   372  C CE  . LYS A 1 47  ? -14.123 20.451  -15.173 1.00 37.38 ?  47  LYS A CE  1 
ATOM   373  N NZ  . LYS A 1 47  ? -14.088 21.359  -13.993 1.00 41.53 1  47  LYS A NZ  1 
ATOM   374  N N   . TYR A 1 48  ? -16.299 18.696  -17.004 1.00 21.54 ?  48  TYR A N   1 
ATOM   375  C CA  . TYR A 1 48  ? -16.597 18.476  -18.418 1.00 21.40 ?  48  TYR A CA  1 
ATOM   376  C C   . TYR A 1 48  ? -18.072 18.116  -18.568 1.00 22.96 ?  48  TYR A C   1 
ATOM   377  O O   . TYR A 1 48  ? -18.461 17.397  -19.491 1.00 24.62 ?  48  TYR A O   1 
ATOM   378  C CB  . TYR A 1 48  ? -15.730 17.348  -18.989 1.00 21.31 ?  48  TYR A CB  1 
ATOM   379  C CG  . TYR A 1 48  ? -14.266 17.446  -18.618 1.00 18.44 ?  48  TYR A CG  1 
ATOM   380  C CD1 . TYR A 1 48  ? -13.548 18.625  -18.819 1.00 18.76 ?  48  TYR A CD1 1 
ATOM   381  C CD2 . TYR A 1 48  ? -13.601 16.356  -18.056 1.00 19.64 ?  48  TYR A CD2 1 
ATOM   382  C CE1 . TYR A 1 48  ? -12.202 18.717  -18.465 1.00 17.87 ?  48  TYR A CE1 1 
ATOM   383  C CE2 . TYR A 1 48  ? -12.261 16.434  -17.701 1.00 19.00 ?  48  TYR A CE2 1 
ATOM   384  C CZ  . TYR A 1 48  ? -11.568 17.614  -17.906 1.00 19.33 ?  48  TYR A CZ  1 
ATOM   385  O OH  . TYR A 1 48  ? -10.248 17.692  -17.540 1.00 20.30 ?  48  TYR A OH  1 
ATOM   386  N N   . ASN A 1 49  ? -18.879 18.614  -17.637 1.00 24.33 ?  49  ASN A N   1 
ATOM   387  C CA  . ASN A 1 49  ? -20.320 18.374  -17.626 1.00 27.50 ?  49  ASN A CA  1 
ATOM   388  C C   . ASN A 1 49  ? -20.711 16.912  -17.438 1.00 26.42 ?  49  ASN A C   1 
ATOM   389  O O   . ASN A 1 49  ? -21.785 16.487  -17.864 1.00 28.43 ?  49  ASN A O   1 
ATOM   390  C CB  . ASN A 1 49  ? -20.954 18.923  -18.909 1.00 30.25 ?  49  ASN A CB  1 
ATOM   391  C CG  . ASN A 1 49  ? -20.912 20.437  -18.972 1.00 35.09 ?  49  ASN A CG  1 
ATOM   392  O OD1 . ASN A 1 49  ? -21.365 21.118  -18.050 1.00 39.35 ?  49  ASN A OD1 1 
ATOM   393  N ND2 . ASN A 1 49  ? -20.372 20.973  -20.060 1.00 39.15 ?  49  ASN A ND2 1 
ATOM   394  N N   . VAL A 1 50  ? -19.840 16.144  -16.792 1.00 23.76 ?  50  VAL A N   1 
ATOM   395  C CA  . VAL A 1 50  ? -20.102 14.733  -16.533 1.00 23.12 ?  50  VAL A CA  1 
ATOM   396  C C   . VAL A 1 50  ? -19.725 14.443  -15.083 1.00 21.97 ?  50  VAL A C   1 
ATOM   397  O O   . VAL A 1 50  ? -18.917 15.158  -14.493 1.00 21.18 ?  50  VAL A O   1 
ATOM   398  C CB  . VAL A 1 50  ? -19.273 13.832  -17.482 1.00 25.60 ?  50  VAL A CB  1 
ATOM   399  C CG1 . VAL A 1 50  ? -19.407 12.368  -17.094 1.00 29.26 ?  50  VAL A CG1 1 
ATOM   400  C CG2 . VAL A 1 50  ? -19.748 14.027  -18.908 1.00 26.59 ?  50  VAL A CG2 1 
ATOM   401  N N   . PRO A 1 51  ? -20.332 13.414  -14.475 1.00 22.32 ?  51  PRO A N   1 
ATOM   402  C CA  . PRO A 1 51  ? -19.966 13.136  -13.087 1.00 20.77 ?  51  PRO A CA  1 
ATOM   403  C C   . PRO A 1 51  ? -18.575 12.530  -12.946 1.00 19.62 ?  51  PRO A C   1 
ATOM   404  O O   . PRO A 1 51  ? -18.169 11.679  -13.739 1.00 19.97 ?  51  PRO A O   1 
ATOM   405  C CB  . PRO A 1 51  ? -21.066 12.184  -12.620 1.00 24.38 ?  51  PRO A CB  1 
ATOM   406  C CG  . PRO A 1 51  ? -21.489 11.498  -13.884 1.00 25.03 ?  51  PRO A CG  1 
ATOM   407  C CD  . PRO A 1 51  ? -21.519 12.635  -14.870 1.00 24.53 ?  51  PRO A CD  1 
ATOM   408  N N   . VAL A 1 52  ? -17.843 12.991  -11.942 1.00 16.44 ?  52  VAL A N   1 
ATOM   409  C CA  . VAL A 1 52  ? -16.513 12.471  -11.669 1.00 15.06 ?  52  VAL A CA  1 
ATOM   410  C C   . VAL A 1 52  ? -16.427 12.224  -10.163 1.00 15.05 ?  52  VAL A C   1 
ATOM   411  O O   . VAL A 1 52  ? -17.372 12.522  -9.425  1.00 15.27 ?  52  VAL A O   1 
ATOM   412  C CB  . VAL A 1 52  ? -15.401 13.463  -12.133 1.00 14.66 ?  52  VAL A CB  1 
ATOM   413  C CG1 . VAL A 1 52  ? -15.472 13.644  -13.655 1.00 15.58 ?  52  VAL A CG1 1 
ATOM   414  C CG2 . VAL A 1 52  ? -15.549 14.799  -11.442 1.00 15.53 ?  52  VAL A CG2 1 
ATOM   415  N N   . GLN A 1 53  ? -15.319 11.654  -9.706  1.00 15.02 ?  53  GLN A N   1 
ATOM   416  C CA  . GLN A 1 53  ? -15.141 11.372  -8.286  1.00 13.21 ?  53  GLN A CA  1 
ATOM   417  C C   . GLN A 1 53  ? -13.885 12.066  -7.790  1.00 14.06 ?  53  GLN A C   1 
ATOM   418  O O   . GLN A 1 53  ? -12.791 11.856  -8.326  1.00 14.73 ?  53  GLN A O   1 
ATOM   419  C CB  . GLN A 1 53  ? -15.021 9.868   -8.055  1.00 15.30 ?  53  GLN A CB  1 
ATOM   420  C CG  . GLN A 1 53  ? -16.315 9.093   -8.275  1.00 16.52 ?  53  GLN A CG  1 
ATOM   421  C CD  . GLN A 1 53  ? -17.380 9.408   -7.232  1.00 18.21 ?  53  GLN A CD  1 
ATOM   422  O OE1 . GLN A 1 53  ? -17.069 9.779   -6.098  1.00 19.36 ?  53  GLN A OE1 1 
ATOM   423  N NE2 . GLN A 1 53  ? -18.643 9.232   -7.607  1.00 22.95 ?  53  GLN A NE2 1 
ATOM   424  N N   . MET A 1 54  ? -14.041 12.890  -6.763  1.00 12.51 ?  54  MET A N   1 
ATOM   425  C CA  . MET A 1 54  ? -12.911 13.628  -6.227  1.00 12.96 ?  54  MET A CA  1 
ATOM   426  C C   . MET A 1 54  ? -12.530 13.168  -4.826  1.00 13.08 ?  54  MET A C   1 
ATOM   427  O O   . MET A 1 54  ? -13.369 13.117  -3.924  1.00 13.00 ?  54  MET A O   1 
ATOM   428  C CB  . MET A 1 54  ? -13.242 15.123  -6.201  1.00 13.59 ?  54  MET A CB  1 
ATOM   429  C CG  . MET A 1 54  ? -12.073 16.024  -5.833  1.00 15.70 ?  54  MET A CG  1 
ATOM   430  S SD  . MET A 1 54  ? -12.584 17.723  -5.547  1.00 18.07 ?  54  MET A SD  1 
ATOM   431  C CE  . MET A 1 54  ? -13.207 17.576  -3.860  1.00 20.38 ?  54  MET A CE  1 
ATOM   432  N N   . SER A 1 55  ? -11.264 12.814  -4.642  1.00 12.25 ?  55  SER A N   1 
ATOM   433  C CA  . SER A 1 55  ? -10.798 12.416  -3.318  1.00 11.63 ?  55  SER A CA  1 
ATOM   434  C C   . SER A 1 55  ? -10.878 13.627  -2.398  1.00 12.42 ?  55  SER A C   1 
ATOM   435  O O   . SER A 1 55  ? -10.615 14.758  -2.808  1.00 12.66 ?  55  SER A O   1 
ATOM   436  C CB  . SER A 1 55  ? -9.342  11.928  -3.370  1.00 11.70 ?  55  SER A CB  1 
ATOM   437  O OG  . SER A 1 55  ? -8.658  12.247  -2.161  1.00 13.75 ?  55  SER A OG  1 
ATOM   438  N N   . CYS A 1 56  ? -11.266 13.387  -1.152  1.00 12.81 ?  56  CYS A N   1 
ATOM   439  C CA  . CYS A 1 56  ? -11.339 14.455  -0.178  1.00 13.97 ?  56  CYS A CA  1 
ATOM   440  C C   . CYS A 1 56  ? -10.273 14.242  0.889   1.00 16.36 ?  56  CYS A C   1 
ATOM   441  O O   . CYS A 1 56  ? -10.365 14.775  1.993   1.00 17.41 ?  56  CYS A O   1 
ATOM   442  C CB  . CYS A 1 56  ? -12.731 14.518  0.446   1.00 14.81 ?  56  CYS A CB  1 
ATOM   443  S SG  . CYS A 1 56  ? -13.961 15.117  -0.730  1.00 17.12 ?  56  CYS A SG  1 
ATOM   444  N N   . HIS A 1 57  ? -9.261  13.445  0.555   1.00 13.84 ?  57  HIS A N   1 
ATOM   445  C CA  . HIS A 1 57  ? -8.159  13.208  1.480   1.00 14.54 ?  57  HIS A CA  1 
ATOM   446  C C   . HIS A 1 57  ? -7.129  14.257  1.067   1.00 15.37 ?  57  HIS A C   1 
ATOM   447  O O   . HIS A 1 57  ? -6.551  14.181  -0.015  1.00 14.33 ?  57  HIS A O   1 
ATOM   448  C CB  . HIS A 1 57  ? -7.612  11.790  1.298   1.00 15.50 ?  57  HIS A CB  1 
ATOM   449  C CG  . HIS A 1 57  ? -6.628  11.386  2.348   1.00 17.34 ?  57  HIS A CG  1 
ATOM   450  N ND1 . HIS A 1 57  ? -5.414  12.018  2.510   1.00 21.11 ?  57  HIS A ND1 1 
ATOM   451  C CD2 . HIS A 1 57  ? -6.685  10.428  3.303   1.00 18.53 ?  57  HIS A CD2 1 
ATOM   452  C CE1 . HIS A 1 57  ? -4.767  11.466  3.521   1.00 22.82 ?  57  HIS A CE1 1 
ATOM   453  N NE2 . HIS A 1 57  ? -5.516  10.499  4.019   1.00 20.26 ?  57  HIS A NE2 1 
ATOM   454  N N   . PRO A 1 58  ? -6.890  15.261  1.921   1.00 15.12 ?  58  PRO A N   1 
ATOM   455  C CA  . PRO A 1 58  ? -5.928  16.319  1.596   1.00 16.49 ?  58  PRO A CA  1 
ATOM   456  C C   . PRO A 1 58  ? -4.513  15.891  1.210   1.00 15.53 ?  58  PRO A C   1 
ATOM   457  O O   . PRO A 1 58  ? -3.934  16.450  0.281   1.00 15.91 ?  58  PRO A O   1 
ATOM   458  C CB  . PRO A 1 58  ? -5.957  17.209  2.840   1.00 17.68 ?  58  PRO A CB  1 
ATOM   459  C CG  . PRO A 1 58  ? -6.331  16.253  3.936   1.00 24.84 ?  58  PRO A CG  1 
ATOM   460  C CD  . PRO A 1 58  ? -7.408  15.420  3.291   1.00 17.60 ?  58  PRO A CD  1 
ATOM   461  N N   . GLU A 1 59  ? -3.959  14.914  1.920   1.00 15.73 ?  59  GLU A N   1 
ATOM   462  C CA  . GLU A 1 59  ? -2.607  14.432  1.637   1.00 17.30 ?  59  GLU A CA  1 
ATOM   463  C C   . GLU A 1 59  ? -2.514  13.808  0.248   1.00 16.01 ?  59  GLU A C   1 
ATOM   464  O O   . GLU A 1 59  ? -1.598  14.101  -0.518  1.00 15.57 ?  59  GLU A O   1 
ATOM   465  C CB  . GLU A 1 59  ? -2.181  13.404  2.690   1.00 23.40 ?  59  GLU A CB  1 
ATOM   466  C CG  . GLU A 1 59  ? -1.853  13.975  4.067   1.00 32.24 ?  59  GLU A CG  1 
ATOM   467  C CD  . GLU A 1 59  ? -3.004  14.734  4.699   1.00 37.51 ?  59  GLU A CD  1 
ATOM   468  O OE1 . GLU A 1 59  ? -4.124  14.179  4.776   1.00 38.66 ?  59  GLU A OE1 1 
ATOM   469  O OE2 . GLU A 1 59  ? -2.784  15.888  5.132   1.00 40.10 -1 59  GLU A OE2 1 
ATOM   470  N N   . LEU A 1 60  ? -3.460  12.935  -0.071  1.00 13.25 ?  60  LEU A N   1 
ATOM   471  C CA  . LEU A 1 60  ? -3.477  12.303  -1.386  1.00 13.08 ?  60  LEU A CA  1 
ATOM   472  C C   . LEU A 1 60  ? -3.658  13.369  -2.465  1.00 11.28 ?  60  LEU A C   1 
ATOM   473  O O   . LEU A 1 60  ? -3.016  13.321  -3.518  1.00 11.53 ?  60  LEU A O   1 
ATOM   474  C CB  . LEU A 1 60  ? -4.624  11.289  -1.469  1.00 13.41 ?  60  LEU A CB  1 
ATOM   475  C CG  . LEU A 1 60  ? -4.849  10.664  -2.848  1.00 13.51 ?  60  LEU A CG  1 
ATOM   476  C CD1 . LEU A 1 60  ? -3.587  9.925   -3.304  1.00 14.14 ?  60  LEU A CD1 1 
ATOM   477  C CD2 . LEU A 1 60  ? -6.040  9.716   -2.777  1.00 16.13 ?  60  LEU A CD2 1 
ATOM   478  N N   . ASN A 1 61  ? -4.539  14.332  -2.209  1.00 11.60 ?  61  ASN A N   1 
ATOM   479  C CA  . ASN A 1 61  ? -4.788  15.384  -3.190  1.00 11.48 ?  61  ASN A CA  1 
ATOM   480  C C   . ASN A 1 61  ? -3.540  16.200  -3.472  1.00 11.84 ?  61  ASN A C   1 
ATOM   481  O O   . ASN A 1 61  ? -3.267  16.546  -4.616  1.00 13.31 ?  61  ASN A O   1 
ATOM   482  C CB  . ASN A 1 61  ? -5.917  16.305  -2.716  1.00 11.55 ?  61  ASN A CB  1 
ATOM   483  C CG  . ASN A 1 61  ? -7.265  15.614  -2.730  1.00 13.16 ?  61  ASN A CG  1 
ATOM   484  O OD1 . ASN A 1 61  ? -7.368  14.452  -3.123  1.00 13.88 ?  61  ASN A OD1 1 
ATOM   485  N ND2 . ASN A 1 61  ? -8.305  16.321  -2.302  1.00 14.18 ?  61  ASN A ND2 1 
ATOM   486  N N   . GLN A 1 62  ? -2.786  16.508  -2.420  1.00 12.30 ?  62  GLN A N   1 
ATOM   487  C CA  . GLN A 1 62  ? -1.563  17.284  -2.570  1.00 13.50 ?  62  GLN A CA  1 
ATOM   488  C C   . GLN A 1 62  ? -0.515  16.481  -3.333  1.00 14.51 ?  62  GLN A C   1 
ATOM   489  O O   . GLN A 1 62  ? 0.222   17.023  -4.157  1.00 14.38 ?  62  GLN A O   1 
ATOM   490  C CB  . GLN A 1 62  ? -1.016  17.676  -1.194  1.00 15.87 ?  62  GLN A CB  1 
ATOM   491  C CG  . GLN A 1 62  ? 0.147   18.658  -1.265  1.00 19.64 ?  62  GLN A CG  1 
ATOM   492  C CD  . GLN A 1 62  ? -0.260  20.000  -1.851  1.00 22.83 ?  62  GLN A CD  1 
ATOM   493  O OE1 . GLN A 1 62  ? -1.144  20.679  -1.322  1.00 28.91 ?  62  GLN A OE1 1 
ATOM   494  N NE2 . GLN A 1 62  ? 0.382   20.389  -2.947  1.00 26.53 ?  62  GLN A NE2 1 
ATOM   495  N N   . TYR A 1 63  ? -0.453  15.181  -3.060  1.00 12.85 ?  63  TYR A N   1 
ATOM   496  C CA  . TYR A 1 63  ? 0.503   14.304  -3.727  1.00 12.39 ?  63  TYR A CA  1 
ATOM   497  C C   . TYR A 1 63  ? 0.245   14.274  -5.233  1.00 12.36 ?  63  TYR A C   1 
ATOM   498  O O   . TYR A 1 63  ? 1.175   14.390  -6.037  1.00 12.37 ?  63  TYR A O   1 
ATOM   499  C CB  . TYR A 1 63  ? 0.401   12.885  -3.161  1.00 12.30 ?  63  TYR A CB  1 
ATOM   500  C CG  . TYR A 1 63  ? 1.364   11.911  -3.797  1.00 11.63 ?  63  TYR A CG  1 
ATOM   501  C CD1 . TYR A 1 63  ? 2.710   11.886  -3.422  1.00 13.11 ?  63  TYR A CD1 1 
ATOM   502  C CD2 . TYR A 1 63  ? 0.937   11.031  -4.793  1.00 12.62 ?  63  TYR A CD2 1 
ATOM   503  C CE1 . TYR A 1 63  ? 3.603   11.012  -4.023  1.00 15.92 ?  63  TYR A CE1 1 
ATOM   504  C CE2 . TYR A 1 63  ? 1.824   10.150  -5.401  1.00 14.47 ?  63  TYR A CE2 1 
ATOM   505  C CZ  . TYR A 1 63  ? 3.157   10.147  -5.011  1.00 14.37 ?  63  TYR A CZ  1 
ATOM   506  O OH  . TYR A 1 63  ? 4.039   9.285   -5.615  1.00 15.20 ?  63  TYR A OH  1 
ATOM   507  N N   . ILE A 1 64  ? -1.021  14.112  -5.610  1.00 13.09 ?  64  ILE A N   1 
ATOM   508  C CA  . ILE A 1 64  ? -1.379  14.070  -7.022  1.00 11.70 ?  64  ILE A CA  1 
ATOM   509  C C   . ILE A 1 64  ? -1.082  15.405  -7.703  1.00 12.34 ?  64  ILE A C   1 
ATOM   510  O O   . ILE A 1 64  ? -0.565  15.431  -8.821  1.00 13.06 ?  64  ILE A O   1 
ATOM   511  C CB  . ILE A 1 64  ? -2.866  13.692  -7.190  1.00 10.75 ?  64  ILE A CB  1 
ATOM   512  C CG1 . ILE A 1 64  ? -3.072  12.255  -6.701  1.00 13.71 ?  64  ILE A CG1 1 
ATOM   513  C CG2 . ILE A 1 64  ? -3.290  13.832  -8.655  1.00 13.80 ?  64  ILE A CG2 1 
ATOM   514  C CD1 . ILE A 1 64  ? -4.524  11.860  -6.533  1.00 14.04 ?  64  ILE A CD1 1 
ATOM   515  N N   . GLN A 1 65  ? -1.405  16.515  -7.043  1.00 12.85 ?  65  GLN A N   1 
ATOM   516  C CA  . GLN A 1 65  ? -1.131  17.825  -7.630  1.00 14.66 ?  65  GLN A CA  1 
ATOM   517  C C   . GLN A 1 65  ? 0.368   18.056  -7.761  1.00 14.83 ?  65  GLN A C   1 
ATOM   518  O O   . GLN A 1 65  ? 0.831   18.556  -8.781  1.00 16.29 ?  65  GLN A O   1 
ATOM   519  C CB  . GLN A 1 65  ? -1.732  18.951  -6.786  1.00 18.85 ?  65  GLN A CB  1 
ATOM   520  C CG  . GLN A 1 65  ? -3.236  18.963  -6.744  1.00 23.13 ?  65  GLN A CG  1 
ATOM   521  C CD  . GLN A 1 65  ? -3.800  20.371  -6.717  1.00 25.14 ?  65  GLN A CD  1 
ATOM   522  O OE1 . GLN A 1 65  ? -3.172  21.299  -6.197  1.00 27.35 ?  65  GLN A OE1 1 
ATOM   523  N NE2 . GLN A 1 65  ? -4.995  20.535  -7.269  1.00 23.71 ?  65  GLN A NE2 1 
ATOM   524  N N   . ASP A 1 66  ? 1.126   17.699  -6.725  1.00 13.12 ?  66  ASP A N   1 
ATOM   525  C CA  . ASP A 1 66  ? 2.575   17.882  -6.759  1.00 15.06 ?  66  ASP A CA  1 
ATOM   526  C C   . ASP A 1 66  ? 3.175   17.097  -7.915  1.00 14.31 ?  66  ASP A C   1 
ATOM   527  O O   . ASP A 1 66  ? 4.051   17.588  -8.626  1.00 16.46 ?  66  ASP A O   1 
ATOM   528  C CB  . ASP A 1 66  ? 3.228   17.416  -5.450  1.00 15.24 ?  66  ASP A CB  1 
ATOM   529  C CG  . ASP A 1 66  ? 2.986   18.370  -4.291  1.00 18.01 ?  66  ASP A CG  1 
ATOM   530  O OD1 . ASP A 1 66  ? 2.537   19.519  -4.518  1.00 18.68 ?  66  ASP A OD1 1 
ATOM   531  O OD2 . ASP A 1 66  ? 3.264   17.970  -3.141  1.00 19.73 -1 66  ASP A OD2 1 
ATOM   532  N N   . THR A 1 67  ? 2.701   15.870  -8.096  1.00 12.73 ?  67  THR A N   1 
ATOM   533  C CA  . THR A 1 67  ? 3.200   15.009  -9.161  1.00 13.72 ?  67  THR A CA  1 
ATOM   534  C C   . THR A 1 67  ? 2.900   15.588  -10.541 1.00 14.19 ?  67  THR A C   1 
ATOM   535  O O   . THR A 1 67  ? 3.794   15.731  -11.383 1.00 14.49 ?  67  THR A O   1 
ATOM   536  C CB  . THR A 1 67  ? 2.564   13.605  -9.059  1.00 13.80 ?  67  THR A CB  1 
ATOM   537  O OG1 . THR A 1 67  ? 2.969   12.988  -7.834  1.00 14.96 ?  67  THR A OG1 1 
ATOM   538  C CG2 . THR A 1 67  ? 2.981   12.730  -10.233 1.00 15.76 ?  67  THR A CG2 1 
ATOM   539  N N   . LEU A 1 68  ? 1.641   15.935  -10.771 1.00 12.57 ?  68  LEU A N   1 
ATOM   540  C CA  . LEU A 1 68  ? 1.243   16.465  -12.062 1.00 14.79 ?  68  LEU A CA  1 
ATOM   541  C C   . LEU A 1 68  ? 1.775   17.862  -12.359 1.00 15.85 ?  68  LEU A C   1 
ATOM   542  O O   . LEU A 1 68  ? 1.917   18.236  -13.522 1.00 17.52 ?  68  LEU A O   1 
ATOM   543  C CB  . LEU A 1 68  ? -0.286  16.418  -12.189 1.00 15.77 ?  68  LEU A CB  1 
ATOM   544  C CG  . LEU A 1 68  ? -0.804  14.977  -12.179 1.00 17.76 ?  68  LEU A CG  1 
ATOM   545  C CD1 . LEU A 1 68  ? -2.325  14.966  -12.267 1.00 18.19 ?  68  LEU A CD1 1 
ATOM   546  C CD2 . LEU A 1 68  ? -0.188  14.199  -13.347 1.00 20.47 ?  68  LEU A CD2 1 
ATOM   547  N N   . HIS A 1 69  ? 2.080   18.630  -11.318 1.00 16.49 ?  69  HIS A N   1 
ATOM   548  C CA  . HIS A 1 69  ? 2.620   19.971  -11.510 1.00 19.29 ?  69  HIS A CA  1 
ATOM   549  C C   . HIS A 1 69  ? 3.958   19.857  -12.241 1.00 19.52 ?  69  HIS A C   1 
ATOM   550  O O   . HIS A 1 69  ? 4.362   20.770  -12.961 1.00 19.54 ?  69  HIS A O   1 
ATOM   551  C CB  . HIS A 1 69  ? 2.815   20.659  -10.154 1.00 22.78 ?  69  HIS A CB  1 
ATOM   552  C CG  . HIS A 1 69  ? 3.229   22.095  -10.250 1.00 28.10 ?  69  HIS A CG  1 
ATOM   553  N ND1 . HIS A 1 69  ? 2.518   23.029  -10.972 1.00 31.44 ?  69  HIS A ND1 1 
ATOM   554  C CD2 . HIS A 1 69  ? 4.263   22.764  -9.687  1.00 30.81 ?  69  HIS A CD2 1 
ATOM   555  C CE1 . HIS A 1 69  ? 3.094   24.212  -10.848 1.00 32.12 ?  69  HIS A CE1 1 
ATOM   556  N NE2 . HIS A 1 69  ? 4.155   24.079  -10.073 1.00 32.27 ?  69  HIS A NE2 1 
ATOM   557  N N   . CYS A 1 70  ? 4.633   18.723  -12.058 1.00 16.86 ?  70  CYS A N   1 
ATOM   558  C CA  . CYS A 1 70  ? 5.928   18.471  -12.695 1.00 16.52 ?  70  CYS A CA  1 
ATOM   559  C C   . CYS A 1 70  ? 5.794   18.078  -14.161 1.00 17.77 ?  70  CYS A C   1 
ATOM   560  O O   . CYS A 1 70  ? 6.761   18.149  -14.924 1.00 19.44 ?  70  CYS A O   1 
ATOM   561  C CB  . CYS A 1 70  ? 6.679   17.361  -11.953 1.00 16.17 ?  70  CYS A CB  1 
ATOM   562  S SG  . CYS A 1 70  ? 7.027   17.740  -10.233 1.00 17.61 ?  70  CYS A SG  1 
ATOM   563  N N   . VAL A 1 71  ? 4.598   17.654  -14.555 1.00 15.85 ?  71  VAL A N   1 
ATOM   564  C CA  . VAL A 1 71  ? 4.355   17.256  -15.934 1.00 15.51 ?  71  VAL A CA  1 
ATOM   565  C C   . VAL A 1 71  ? 4.008   18.476  -16.794 1.00 16.77 ?  71  VAL A C   1 
ATOM   566  O O   . VAL A 1 71  ? 4.258   18.489  -18.001 1.00 16.76 ?  71  VAL A O   1 
ATOM   567  C CB  . VAL A 1 71  ? 3.206   16.218  -16.014 1.00 16.14 ?  71  VAL A CB  1 
ATOM   568  C CG1 . VAL A 1 71  ? 2.929   15.853  -17.462 1.00 20.07 ?  71  VAL A CG1 1 
ATOM   569  C CG2 . VAL A 1 71  ? 3.581   14.965  -15.221 1.00 18.86 ?  71  VAL A CG2 1 
ATOM   570  N N   . LYS A 1 72  ? 3.457   19.507  -16.160 1.00 16.82 ?  72  LYS A N   1 
ATOM   571  C CA  . LYS A 1 72  ? 3.061   20.726  -16.862 1.00 18.20 ?  72  LYS A CA  1 
ATOM   572  C C   . LYS A 1 72  ? 4.160   21.320  -17.743 1.00 19.47 ?  72  LYS A C   1 
ATOM   573  O O   . LYS A 1 72  ? 3.929   21.593  -18.919 1.00 19.04 ?  72  LYS A O   1 
ATOM   574  C CB  . LYS A 1 72  ? 2.573   21.777  -15.855 1.00 21.25 ?  72  LYS A CB  1 
ATOM   575  C CG  . LYS A 1 72  ? 1.389   21.324  -15.025 1.00 26.76 ?  72  LYS A CG  1 
ATOM   576  C CD  . LYS A 1 72  ? 1.009   22.366  -13.980 1.00 30.59 ?  72  LYS A CD  1 
ATOM   577  C CE  . LYS A 1 72  ? -0.047  21.827  -13.019 1.00 33.57 ?  72  LYS A CE  1 
ATOM   578  N NZ  . LYS A 1 72  ? -0.388  22.806  -11.941 1.00 35.27 1  72  LYS A NZ  1 
ATOM   579  N N   . PRO A 1 73  ? 5.369   21.538  -17.192 1.00 18.61 ?  73  PRO A N   1 
ATOM   580  C CA  . PRO A 1 73  ? 6.432   22.106  -18.030 1.00 20.65 ?  73  PRO A CA  1 
ATOM   581  C C   . PRO A 1 73  ? 6.789   21.214  -19.218 1.00 19.61 ?  73  PRO A C   1 
ATOM   582  O O   . PRO A 1 73  ? 7.148   21.704  -20.290 1.00 20.43 ?  73  PRO A O   1 
ATOM   583  C CB  . PRO A 1 73  ? 7.593   22.292  -17.048 1.00 21.73 ?  73  PRO A CB  1 
ATOM   584  C CG  . PRO A 1 73  ? 7.304   21.294  -15.960 1.00 22.47 ?  73  PRO A CG  1 
ATOM   585  C CD  . PRO A 1 73  ? 5.821   21.390  -15.797 1.00 19.63 ?  73  PRO A CD  1 
ATOM   586  N N   . LEU A 1 74  ? 6.694   19.904  -19.031 1.00 18.03 ?  74  LEU A N   1 
ATOM   587  C CA  . LEU A 1 74  ? 6.985   18.983  -20.118 1.00 18.95 ?  74  LEU A CA  1 
ATOM   588  C C   . LEU A 1 74  ? 5.931   19.131  -21.203 1.00 18.03 ?  74  LEU A C   1 
ATOM   589  O O   . LEU A 1 74  ? 6.233   19.050  -22.391 1.00 19.85 ?  74  LEU A O   1 
ATOM   590  C CB  . LEU A 1 74  ? 6.987   17.544  -19.618 1.00 21.94 ?  74  LEU A CB  1 
ATOM   591  C CG  . LEU A 1 74  ? 8.128   17.061  -18.736 1.00 23.76 ?  74  LEU A CG  1 
ATOM   592  C CD1 . LEU A 1 74  ? 7.882   15.593  -18.397 1.00 25.32 ?  74  LEU A CD1 1 
ATOM   593  C CD2 . LEU A 1 74  ? 9.453   17.231  -19.461 1.00 25.80 ?  74  LEU A CD2 1 
ATOM   594  N N   . LEU A 1 75  ? 4.684   19.337  -20.791 1.00 16.84 ?  75  LEU A N   1 
ATOM   595  C CA  . LEU A 1 75  ? 3.600   19.499  -21.749 1.00 17.96 ?  75  LEU A CA  1 
ATOM   596  C C   . LEU A 1 75  ? 3.803   20.775  -22.563 1.00 17.94 ?  75  LEU A C   1 
ATOM   597  O O   . LEU A 1 75  ? 3.638   20.765  -23.779 1.00 18.86 ?  75  LEU A O   1 
ATOM   598  C CB  . LEU A 1 75  ? 2.249   19.532  -21.028 1.00 17.71 ?  75  LEU A CB  1 
ATOM   599  C CG  . LEU A 1 75  ? 1.799   18.185  -20.455 1.00 18.76 ?  75  LEU A CG  1 
ATOM   600  C CD1 . LEU A 1 75  ? 0.568   18.370  -19.579 1.00 20.88 ?  75  LEU A CD1 1 
ATOM   601  C CD2 . LEU A 1 75  ? 1.503   17.223  -21.603 1.00 21.90 ?  75  LEU A CD2 1 
ATOM   602  N N   . GLU A 1 76  ? 4.172   21.868  -21.898 1.00 18.48 ?  76  GLU A N   1 
ATOM   603  C CA  . GLU A 1 76  ? 4.393   23.134  -22.600 1.00 18.40 ?  76  GLU A CA  1 
ATOM   604  C C   . GLU A 1 76  ? 5.477   22.991  -23.661 1.00 18.48 ?  76  GLU A C   1 
ATOM   605  O O   . GLU A 1 76  ? 5.367   23.556  -24.752 1.00 17.23 ?  76  GLU A O   1 
ATOM   606  C CB  . GLU A 1 76  ? 4.805   24.239  -21.621 1.00 18.57 ?  76  GLU A CB  1 
ATOM   607  C CG  . GLU A 1 76  ? 3.839   24.447  -20.473 1.00 21.98 ?  76  GLU A CG  1 
ATOM   608  C CD  . GLU A 1 76  ? 4.269   25.566  -19.544 1.00 25.26 ?  76  GLU A CD  1 
ATOM   609  O OE1 . GLU A 1 76  ? 5.491   25.733  -19.335 1.00 27.25 ?  76  GLU A OE1 1 
ATOM   610  O OE2 . GLU A 1 76  ? 3.384   26.269  -19.013 1.00 24.91 -1 76  GLU A OE2 1 
ATOM   611  N N   . LYS A 1 77  ? 6.523   22.232  -23.337 1.00 18.76 ?  77  LYS A N   1 
ATOM   612  C CA  . LYS A 1 77  ? 7.642   22.019  -24.255 1.00 20.52 ?  77  LYS A CA  1 
ATOM   613  C C   . LYS A 1 77  ? 7.413   20.864  -25.229 1.00 19.72 ?  77  LYS A C   1 
ATOM   614  O O   . LYS A 1 77  ? 8.246   20.605  -26.100 1.00 21.19 ?  77  LYS A O   1 
ATOM   615  C CB  . LYS A 1 77  ? 8.926   21.745  -23.466 1.00 22.12 ?  77  LYS A CB  1 
ATOM   616  C CG  . LYS A 1 77  ? 9.316   22.844  -22.493 1.00 26.96 ?  77  LYS A CG  1 
ATOM   617  C CD  . LYS A 1 77  ? 10.540  22.448  -21.686 1.00 32.27 ?  77  LYS A CD  1 
ATOM   618  C CE  . LYS A 1 77  ? 10.882  23.510  -20.653 1.00 33.26 ?  77  LYS A CE  1 
ATOM   619  N NZ  . LYS A 1 77  ? 12.042  23.112  -19.812 1.00 37.85 1  77  LYS A NZ  1 
ATOM   620  N N   . ASN A 1 78  ? 6.289   20.172  -25.079 1.00 18.11 ?  78  ASN A N   1 
ATOM   621  C CA  . ASN A 1 78  ? 5.965   19.028  -25.923 1.00 18.47 ?  78  ASN A CA  1 
ATOM   622  C C   . ASN A 1 78  ? 7.034   17.947  -25.756 1.00 19.71 ?  78  ASN A C   1 
ATOM   623  O O   . ASN A 1 78  ? 7.527   17.376  -26.733 1.00 20.35 ?  78  ASN A O   1 
ATOM   624  C CB  . ASN A 1 78  ? 5.852   19.457  -27.393 1.00 18.60 ?  78  ASN A CB  1 
ATOM   625  C CG  . ASN A 1 78  ? 5.345   18.344  -28.290 1.00 18.99 ?  78  ASN A CG  1 
ATOM   626  O OD1 . ASN A 1 78  ? 4.629   17.446  -27.841 1.00 19.13 ?  78  ASN A OD1 1 
ATOM   627  N ND2 . ASN A 1 78  ? 5.696   18.409  -29.574 1.00 19.41 ?  78  ASN A ND2 1 
ATOM   628  N N   . ASP A 1 79  ? 7.384   17.667  -24.502 1.00 17.27 ?  79  ASP A N   1 
ATOM   629  C CA  . ASP A 1 79  ? 8.390   16.660  -24.195 1.00 17.55 ?  79  ASP A CA  1 
ATOM   630  C C   . ASP A 1 79  ? 7.847   15.454  -23.437 1.00 17.85 ?  79  ASP A C   1 
ATOM   631  O O   . ASP A 1 79  ? 8.623   14.666  -22.907 1.00 18.17 ?  79  ASP A O   1 
ATOM   632  C CB  . ASP A 1 79  ? 9.543   17.272  -23.394 1.00 19.66 ?  79  ASP A CB  1 
ATOM   633  C CG  . ASP A 1 79  ? 10.404  18.201  -24.226 1.00 24.65 ?  79  ASP A CG  1 
ATOM   634  O OD1 . ASP A 1 79  ? 10.529  17.968  -25.448 1.00 26.47 ?  79  ASP A OD1 1 
ATOM   635  O OD2 . ASP A 1 79  ? 10.968  19.154  -23.651 1.00 28.48 -1 79  ASP A OD2 1 
ATOM   636  N N   . VAL A 1 80  ? 6.524   15.317  -23.369 1.00 15.91 ?  80  VAL A N   1 
ATOM   637  C CA  . VAL A 1 80  ? 5.922   14.168  -22.695 1.00 16.99 ?  80  VAL A CA  1 
ATOM   638  C C   . VAL A 1 80  ? 5.345   13.225  -23.732 1.00 16.18 ?  80  VAL A C   1 
ATOM   639  O O   . VAL A 1 80  ? 4.587   13.650  -24.606 1.00 17.71 ?  80  VAL A O   1 
ATOM   640  C CB  . VAL A 1 80  ? 4.753   14.560  -21.766 1.00 18.66 ?  80  VAL A CB  1 
ATOM   641  C CG1 . VAL A 1 80  ? 4.142   13.306  -21.145 1.00 17.56 ?  80  VAL A CG1 1 
ATOM   642  C CG2 . VAL A 1 80  ? 5.226   15.463  -20.688 1.00 22.10 ?  80  VAL A CG2 1 
ATOM   643  N N   . GLU A 1 81  ? 5.707   11.949  -23.640 1.00 15.71 ?  81  GLU A N   1 
ATOM   644  C CA  . GLU A 1 81  ? 5.184   10.952  -24.560 1.00 15.42 ?  81  GLU A CA  1 
ATOM   645  C C   . GLU A 1 81  ? 4.068   10.160  -23.894 1.00 14.84 ?  81  GLU A C   1 
ATOM   646  O O   . GLU A 1 81  ? 3.048   9.872   -24.518 1.00 14.77 ?  81  GLU A O   1 
ATOM   647  C CB  . GLU A 1 81  ? 6.289   9.997   -25.016 1.00 19.48 ?  81  GLU A CB  1 
ATOM   648  C CG  . GLU A 1 81  ? 7.326   10.647  -25.909 1.00 24.56 ?  81  GLU A CG  1 
ATOM   649  C CD  . GLU A 1 81  ? 8.271   9.640   -26.541 1.00 27.60 ?  81  GLU A CD  1 
ATOM   650  O OE1 . GLU A 1 81  ? 9.184   10.069  -27.278 1.00 30.78 ?  81  GLU A OE1 1 
ATOM   651  O OE2 . GLU A 1 81  ? 8.101   8.423   -26.306 1.00 29.52 -1 81  GLU A OE2 1 
ATOM   652  N N   . LYS A 1 82  ? 4.257   9.806   -22.627 1.00 14.38 ?  82  LYS A N   1 
ATOM   653  C CA  . LYS A 1 82  ? 3.244   9.039   -21.912 1.00 15.04 ?  82  LYS A CA  1 
ATOM   654  C C   . LYS A 1 82  ? 3.230   9.320   -20.420 1.00 14.82 ?  82  LYS A C   1 
ATOM   655  O O   . LYS A 1 82  ? 4.263   9.618   -19.824 1.00 14.34 ?  82  LYS A O   1 
ATOM   656  C CB  . LYS A 1 82  ? 3.487   7.535   -22.080 1.00 20.38 ?  82  LYS A CB  1 
ATOM   657  C CG  . LYS A 1 82  ? 3.611   7.055   -23.504 1.00 26.80 ?  82  LYS A CG  1 
ATOM   658  C CD  . LYS A 1 82  ? 3.928   5.569   -23.545 1.00 31.90 ?  82  LYS A CD  1 
ATOM   659  C CE  . LYS A 1 82  ? 4.203   5.113   -24.972 1.00 33.68 ?  82  LYS A CE  1 
ATOM   660  N NZ  . LYS A 1 82  ? 4.503   3.658   -25.048 1.00 40.48 1  82  LYS A NZ  1 
ATOM   661  N N   . VAL A 1 83  ? 2.041   9.230   -19.835 1.00 12.85 ?  83  VAL A N   1 
ATOM   662  C CA  . VAL A 1 83  ? 1.860   9.363   -18.395 1.00 12.87 ?  83  VAL A CA  1 
ATOM   663  C C   . VAL A 1 83  ? 1.116   8.075   -18.064 1.00 14.50 ?  83  VAL A C   1 
ATOM   664  O O   . VAL A 1 83  ? 0.080   7.774   -18.661 1.00 14.42 ?  83  VAL A O   1 
ATOM   665  C CB  . VAL A 1 83  ? 1.008   10.586  -18.004 1.00 12.60 ?  83  VAL A CB  1 
ATOM   666  C CG1 . VAL A 1 83  ? 0.754   10.576  -16.494 1.00 14.29 ?  83  VAL A CG1 1 
ATOM   667  C CG2 . VAL A 1 83  ? 1.733   11.866  -18.399 1.00 15.25 ?  83  VAL A CG2 1 
ATOM   668  N N   . VAL A 1 84  ? 1.668   7.303   -17.138 1.00 12.98 ?  84  VAL A N   1 
ATOM   669  C CA  . VAL A 1 84  ? 1.085   6.023   -16.774 1.00 14.73 ?  84  VAL A CA  1 
ATOM   670  C C   . VAL A 1 84  ? 0.735   5.900   -15.301 1.00 14.49 ?  84  VAL A C   1 
ATOM   671  O O   . VAL A 1 84  ? 1.538   6.228   -14.431 1.00 15.69 ?  84  VAL A O   1 
ATOM   672  C CB  . VAL A 1 84  ? 2.058   4.872   -17.117 1.00 15.24 ?  84  VAL A CB  1 
ATOM   673  C CG1 . VAL A 1 84  ? 1.375   3.529   -16.895 1.00 14.84 ?  84  VAL A CG1 1 
ATOM   674  C CG2 . VAL A 1 84  ? 2.538   4.999   -18.552 1.00 14.98 ?  84  VAL A CG2 1 
ATOM   675  N N   . VAL A 1 85  ? -0.480  5.448   -15.018 1.00 12.65 ?  85  VAL A N   1 
ATOM   676  C CA  . VAL A 1 85  ? -0.878  5.226   -13.639 1.00 13.32 ?  85  VAL A CA  1 
ATOM   677  C C   . VAL A 1 85  ? -0.726  3.721   -13.460 1.00 14.37 ?  85  VAL A C   1 
ATOM   678  O O   . VAL A 1 85  ? -1.428  2.933   -14.103 1.00 13.80 ?  85  VAL A O   1 
ATOM   679  C CB  . VAL A 1 85  ? -2.332  5.633   -13.380 1.00 13.95 ?  85  VAL A CB  1 
ATOM   680  C CG1 . VAL A 1 85  ? -2.692  5.344   -11.926 1.00 15.60 ?  85  VAL A CG1 1 
ATOM   681  C CG2 . VAL A 1 85  ? -2.515  7.112   -13.680 1.00 15.37 ?  85  VAL A CG2 1 
ATOM   682  N N   . VAL A 1 86  ? 0.210   3.331   -12.602 1.00 13.17 ?  86  VAL A N   1 
ATOM   683  C CA  . VAL A 1 86  ? 0.486   1.926   -12.357 1.00 15.55 ?  86  VAL A CA  1 
ATOM   684  C C   . VAL A 1 86  ? -0.117  1.490   -11.032 1.00 14.92 ?  86  VAL A C   1 
ATOM   685  O O   . VAL A 1 86  ? 0.096   2.128   -10.005 1.00 15.56 ?  86  VAL A O   1 
ATOM   686  C CB  . VAL A 1 86  ? 2.012   1.662   -12.311 1.00 16.74 ?  86  VAL A CB  1 
ATOM   687  C CG1 . VAL A 1 86  ? 2.285   0.182   -12.096 1.00 16.51 ?  86  VAL A CG1 1 
ATOM   688  C CG2 . VAL A 1 86  ? 2.666   2.130   -13.602 1.00 18.01 ?  86  VAL A CG2 1 
ATOM   689  N N   . ILE A 1 87  ? -0.882  0.408   -11.061 1.00 16.14 ?  87  ILE A N   1 
ATOM   690  C CA  . ILE A 1 87  ? -1.477  -0.108  -9.840  1.00 17.68 ?  87  ILE A CA  1 
ATOM   691  C C   . ILE A 1 87  ? -0.688  -1.362  -9.487  1.00 19.36 ?  87  ILE A C   1 
ATOM   692  O O   . ILE A 1 87  ? -0.566  -2.267  -10.311 1.00 18.38 ?  87  ILE A O   1 
ATOM   693  C CB  . ILE A 1 87  ? -2.965  -0.460  -10.048 1.00 16.86 ?  87  ILE A CB  1 
ATOM   694  C CG1 . ILE A 1 87  ? -3.752  0.808   -10.411 1.00 19.90 ?  87  ILE A CG1 1 
ATOM   695  C CG2 . ILE A 1 87  ? -3.529  -1.102  -8.785  1.00 17.63 ?  87  ILE A CG2 1 
ATOM   696  C CD1 . ILE A 1 87  ? -5.244  0.591   -10.596 1.00 21.38 ?  87  ILE A CD1 1 
ATOM   697  N N   . LEU A 1 88  ? -0.125  -1.404  -8.282  1.00 20.28 ?  88  LEU A N   1 
ATOM   698  C CA  . LEU A 1 88  ? 0.655   -2.567  -7.864  1.00 23.37 ?  88  LEU A CA  1 
ATOM   699  C C   . LEU A 1 88  ? 0.026   -3.271  -6.668  1.00 25.16 ?  88  LEU A C   1 
ATOM   700  O O   . LEU A 1 88  ? -0.606  -2.636  -5.825  1.00 24.20 ?  88  LEU A O   1 
ATOM   701  C CB  . LEU A 1 88  ? 2.087   -2.160  -7.508  1.00 26.31 ?  88  LEU A CB  1 
ATOM   702  C CG  . LEU A 1 88  ? 2.899   -1.435  -8.585  1.00 27.85 ?  88  LEU A CG  1 
ATOM   703  C CD1 . LEU A 1 88  ? 2.558   0.040   -8.541  1.00 27.64 ?  88  LEU A CD1 1 
ATOM   704  C CD2 . LEU A 1 88  ? 4.385   -1.631  -8.347  1.00 28.91 ?  88  LEU A CD2 1 
ATOM   705  N N   . ASP A 1 89  ? 0.201   -4.587  -6.599  1.00 26.20 ?  89  ASP A N   1 
ATOM   706  C CA  . ASP A 1 89  ? -0.349  -5.359  -5.492  1.00 28.78 ?  89  ASP A CA  1 
ATOM   707  C C   . ASP A 1 89  ? 0.563   -5.217  -4.279  1.00 30.23 ?  89  ASP A C   1 
ATOM   708  O O   . ASP A 1 89  ? 1.605   -4.564  -4.353  1.00 28.26 ?  89  ASP A O   1 
ATOM   709  C CB  . ASP A 1 89  ? -0.508  -6.834  -5.894  1.00 30.22 ?  89  ASP A CB  1 
ATOM   710  C CG  . ASP A 1 89  ? 0.807   -7.488  -6.292  1.00 32.52 ?  89  ASP A CG  1 
ATOM   711  O OD1 . ASP A 1 89  ? 0.762   -8.572  -6.914  1.00 34.92 ?  89  ASP A OD1 1 
ATOM   712  O OD2 . ASP A 1 89  ? 1.882   -6.934  -5.982  1.00 33.54 -1 89  ASP A OD2 1 
ATOM   713  N N   . LYS A 1 90  ? 0.170   -5.819  -3.161  1.00 31.78 ?  90  LYS A N   1 
ATOM   714  C CA  . LYS A 1 90  ? 0.968   -5.731  -1.943  1.00 35.62 ?  90  LYS A CA  1 
ATOM   715  C C   . LYS A 1 90  ? 2.364   -6.332  -2.099  1.00 37.35 ?  90  LYS A C   1 
ATOM   716  O O   . LYS A 1 90  ? 3.260   -6.044  -1.303  1.00 38.26 ?  90  LYS A O   1 
ATOM   717  C CB  . LYS A 1 90  ? 0.229   -6.399  -0.779  1.00 36.95 ?  90  LYS A CB  1 
ATOM   718  C CG  . LYS A 1 90  ? -0.191  -7.833  -1.036  1.00 38.64 ?  90  LYS A CG  1 
ATOM   719  C CD  . LYS A 1 90  ? -0.988  -8.386  0.134   1.00 41.71 ?  90  LYS A CD  1 
ATOM   720  C CE  . LYS A 1 90  ? -1.448  -9.809  -0.133  1.00 42.09 ?  90  LYS A CE  1 
ATOM   721  N NZ  . LYS A 1 90  ? -2.246  -10.345 1.002   1.00 45.46 1  90  LYS A NZ  1 
ATOM   722  N N   . GLU A 1 91  ? 2.551   -7.163  -3.122  1.00 38.58 ?  91  GLU A N   1 
ATOM   723  C CA  . GLU A 1 91  ? 3.854   -7.771  -3.369  1.00 40.44 ?  91  GLU A CA  1 
ATOM   724  C C   . GLU A 1 91  ? 4.681   -6.869  -4.279  1.00 40.49 ?  91  GLU A C   1 
ATOM   725  O O   . GLU A 1 91  ? 5.736   -7.264  -4.776  1.00 41.70 ?  91  GLU A O   1 
ATOM   726  C CB  . GLU A 1 91  ? 3.702   -9.154  -4.014  1.00 42.18 ?  91  GLU A CB  1 
ATOM   727  C CG  . GLU A 1 91  ? 3.033   -10.198 -3.128  1.00 45.51 ?  91  GLU A CG  1 
ATOM   728  C CD  . GLU A 1 91  ? 1.545   -10.331 -3.391  1.00 47.79 ?  91  GLU A CD  1 
ATOM   729  O OE1 . GLU A 1 91  ? 0.827   -9.313  -3.315  1.00 48.97 ?  91  GLU A OE1 1 
ATOM   730  O OE2 . GLU A 1 91  ? 1.092   -11.462 -3.674  1.00 50.12 -1 91  GLU A OE2 1 
ATOM   731  N N   . HIS A 1 92  ? 4.186   -5.653  -4.491  1.00 39.79 ?  92  HIS A N   1 
ATOM   732  C CA  . HIS A 1 92  ? 4.853   -4.665  -5.331  1.00 40.07 ?  92  HIS A CA  1 
ATOM   733  C C   . HIS A 1 92  ? 4.939   -5.073  -6.797  1.00 38.29 ?  92  HIS A C   1 
ATOM   734  O O   . HIS A 1 92  ? 5.830   -4.634  -7.522  1.00 38.96 ?  92  HIS A O   1 
ATOM   735  C CB  . HIS A 1 92  ? 6.253   -4.364  -4.789  1.00 42.69 ?  92  HIS A CB  1 
ATOM   736  C CG  . HIS A 1 92  ? 6.246   -3.670  -3.464  1.00 45.56 ?  92  HIS A CG  1 
ATOM   737  N ND1 . HIS A 1 92  ? 5.748   -4.256  -2.320  1.00 47.06 ?  92  HIS A ND1 1 
ATOM   738  C CD2 . HIS A 1 92  ? 6.652   -2.429  -3.104  1.00 46.95 ?  92  HIS A CD2 1 
ATOM   739  C CE1 . HIS A 1 92  ? 5.848   -3.406  -1.313  1.00 47.57 ?  92  HIS A CE1 1 
ATOM   740  N NE2 . HIS A 1 92  ? 6.393   -2.290  -1.762  1.00 47.98 ?  92  HIS A NE2 1 
ATOM   741  N N   . ARG A 1 93  ? 4.008   -5.917  -7.227  1.00 36.64 ?  93  ARG A N   1 
ATOM   742  C CA  . ARG A 1 93  ? 3.960   -6.361  -8.613  1.00 35.43 ?  93  ARG A CA  1 
ATOM   743  C C   . ARG A 1 93  ? 2.878   -5.583  -9.356  1.00 32.64 ?  93  ARG A C   1 
ATOM   744  O O   . ARG A 1 93  ? 1.769   -5.417  -8.853  1.00 29.85 ?  93  ARG A O   1 
ATOM   745  C CB  . ARG A 1 93  ? 3.647   -7.858  -8.698  1.00 38.54 ?  93  ARG A CB  1 
ATOM   746  C CG  . ARG A 1 93  ? 4.845   -8.772  -8.501  1.00 41.78 ?  93  ARG A CG  1 
ATOM   747  C CD  . ARG A 1 93  ? 4.515   -10.192 -8.946  1.00 44.46 ?  93  ARG A CD  1 
ATOM   748  N NE  . ARG A 1 93  ? 5.707   -11.030 -9.044  1.00 48.05 ?  93  ARG A NE  1 
ATOM   749  C CZ  . ARG A 1 93  ? 5.713   -12.276 -9.511  1.00 48.62 ?  93  ARG A CZ  1 
ATOM   750  N NH1 . ARG A 1 93  ? 4.586   -12.840 -9.927  1.00 49.24 1  93  ARG A NH1 1 
ATOM   751  N NH2 . ARG A 1 93  ? 6.848   -12.959 -9.566  1.00 49.67 ?  93  ARG A NH2 1 
ATOM   752  N N   . PRO A 1 94  ? 3.194   -5.080  -10.559 1.00 30.53 ?  94  PRO A N   1 
ATOM   753  C CA  . PRO A 1 94  ? 2.203   -4.326  -11.333 1.00 28.34 ?  94  PRO A CA  1 
ATOM   754  C C   . PRO A 1 94  ? 1.049   -5.232  -11.757 1.00 26.70 ?  94  PRO A C   1 
ATOM   755  O O   . PRO A 1 94  ? 1.276   -6.310  -12.310 1.00 27.49 ?  94  PRO A O   1 
ATOM   756  C CB  . PRO A 1 94  ? 3.007   -3.834  -12.535 1.00 28.60 ?  94  PRO A CB  1 
ATOM   757  C CG  . PRO A 1 94  ? 4.403   -3.727  -11.991 1.00 32.01 ?  94  PRO A CG  1 
ATOM   758  C CD  . PRO A 1 94  ? 4.525   -4.989  -11.182 1.00 30.79 ?  94  PRO A CD  1 
ATOM   759  N N   . VAL A 1 95  ? -0.184  -4.806  -11.494 1.00 22.25 ?  95  VAL A N   1 
ATOM   760  C CA  . VAL A 1 95  ? -1.350  -5.598  -11.872 1.00 22.69 ?  95  VAL A CA  1 
ATOM   761  C C   . VAL A 1 95  ? -2.134  -4.933  -13.001 1.00 21.11 ?  95  VAL A C   1 
ATOM   762  O O   . VAL A 1 95  ? -2.758  -5.610  -13.817 1.00 20.89 ?  95  VAL A O   1 
ATOM   763  C CB  . VAL A 1 95  ? -2.299  -5.835  -10.673 1.00 24.11 ?  95  VAL A CB  1 
ATOM   764  C CG1 . VAL A 1 95  ? -1.637  -6.758  -9.659  1.00 26.72 ?  95  VAL A CG1 1 
ATOM   765  C CG2 . VAL A 1 95  ? -2.661  -4.512  -10.023 1.00 24.59 ?  95  VAL A CG2 1 
ATOM   766  N N   . GLU A 1 96  ? -2.104  -3.605  -13.039 1.00 18.30 ?  96  GLU A N   1 
ATOM   767  C CA  . GLU A 1 96  ? -2.797  -2.851  -14.077 1.00 19.67 ?  96  GLU A CA  1 
ATOM   768  C C   . GLU A 1 96  ? -2.029  -1.577  -14.359 1.00 17.05 ?  96  GLU A C   1 
ATOM   769  O O   . GLU A 1 96  ? -1.436  -0.988  -13.457 1.00 17.38 ?  96  GLU A O   1 
ATOM   770  C CB  . GLU A 1 96  ? -4.207  -2.444  -13.639 1.00 20.69 ?  96  GLU A CB  1 
ATOM   771  C CG  . GLU A 1 96  ? -5.141  -3.569  -13.258 1.00 24.88 ?  96  GLU A CG  1 
ATOM   772  C CD  . GLU A 1 96  ? -6.549  -3.066  -13.008 1.00 25.02 ?  96  GLU A CD  1 
ATOM   773  O OE1 . GLU A 1 96  ? -6.703  -1.954  -12.449 1.00 22.57 ?  96  GLU A OE1 1 
ATOM   774  O OE2 . GLU A 1 96  ? -7.507  -3.784  -13.359 1.00 28.08 -1 96  GLU A OE2 1 
ATOM   775  N N   . LYS A 1 97  ? -2.039  -1.154  -15.616 1.00 15.80 ?  97  LYS A N   1 
ATOM   776  C CA  . LYS A 1 97  ? -1.378  0.083   -16.001 1.00 15.02 ?  97  LYS A CA  1 
ATOM   777  C C   . LYS A 1 97  ? -2.317  0.851   -16.916 1.00 15.43 ?  97  LYS A C   1 
ATOM   778  O O   . LYS A 1 97  ? -2.741  0.332   -17.951 1.00 17.14 ?  97  LYS A O   1 
ATOM   779  C CB  . LYS A 1 97  ? -0.073  -0.193  -16.752 1.00 16.04 ?  97  LYS A CB  1 
ATOM   780  C CG  . LYS A 1 97  ? 1.030   -0.799  -15.905 1.00 18.87 ?  97  LYS A CG  1 
ATOM   781  C CD  . LYS A 1 97  ? 2.261   -1.038  -16.760 1.00 21.14 ?  97  LYS A CD  1 
ATOM   782  C CE  . LYS A 1 97  ? 3.393   -1.647  -15.958 1.00 25.70 ?  97  LYS A CE  1 
ATOM   783  N NZ  . LYS A 1 97  ? 4.596   -1.834  -16.823 1.00 30.65 1  97  LYS A NZ  1 
ATOM   784  N N   . PHE A 1 98  ? -2.670  2.070   -16.519 1.00 11.95 ?  98  PHE A N   1 
ATOM   785  C CA  . PHE A 1 98  ? -3.520  2.918   -17.343 1.00 12.45 ?  98  PHE A CA  1 
ATOM   786  C C   . PHE A 1 98  ? -2.545  3.833   -18.068 1.00 12.12 ?  98  PHE A C   1 
ATOM   787  O O   . PHE A 1 98  ? -1.934  4.720   -17.470 1.00 13.38 ?  98  PHE A O   1 
ATOM   788  C CB  . PHE A 1 98  ? -4.498  3.724   -16.479 1.00 11.72 ?  98  PHE A CB  1 
ATOM   789  C CG  . PHE A 1 98  ? -5.643  2.909   -15.964 1.00 14.89 ?  98  PHE A CG  1 
ATOM   790  C CD1 . PHE A 1 98  ? -5.453  1.985   -14.943 1.00 15.86 ?  98  PHE A CD1 1 
ATOM   791  C CD2 . PHE A 1 98  ? -6.906  3.033   -16.536 1.00 16.55 ?  98  PHE A CD2 1 
ATOM   792  C CE1 . PHE A 1 98  ? -6.512  1.186   -14.497 1.00 19.06 ?  98  PHE A CE1 1 
ATOM   793  C CE2 . PHE A 1 98  ? -7.969  2.240   -16.097 1.00 20.13 ?  98  PHE A CE2 1 
ATOM   794  C CZ  . PHE A 1 98  ? -7.766  1.317   -15.078 1.00 18.44 ?  98  PHE A CZ  1 
ATOM   795  N N   . VAL A 1 99  ? -2.401  3.595   -19.364 1.00 12.32 ?  99  VAL A N   1 
ATOM   796  C CA  . VAL A 1 99  ? -1.453  4.334   -20.186 1.00 12.15 ?  99  VAL A CA  1 
ATOM   797  C C   . VAL A 1 99  ? -2.066  5.458   -20.995 1.00 12.17 ?  99  VAL A C   1 
ATOM   798  O O   . VAL A 1 99  ? -2.936  5.217   -21.829 1.00 13.13 ?  99  VAL A O   1 
ATOM   799  C CB  . VAL A 1 99  ? -0.740  3.383   -21.171 1.00 10.89 ?  99  VAL A CB  1 
ATOM   800  C CG1 . VAL A 1 99  ? 0.315   4.147   -21.968 1.00 13.13 ?  99  VAL A CG1 1 
ATOM   801  C CG2 . VAL A 1 99  ? -0.103  2.226   -20.407 1.00 13.04 ?  99  VAL A CG2 1 
ATOM   802  N N   . PHE A 1 100 ? -1.605  6.682   -20.745 1.00 12.54 ?  100 PHE A N   1 
ATOM   803  C CA  . PHE A 1 100 ? -2.084  7.849   -21.489 1.00 11.59 ?  100 PHE A CA  1 
ATOM   804  C C   . PHE A 1 100 ? -0.978  8.299   -22.439 1.00 12.98 ?  100 PHE A C   1 
ATOM   805  O O   . PHE A 1 100 ? -0.013  8.936   -22.019 1.00 13.45 ?  100 PHE A O   1 
ATOM   806  C CB  . PHE A 1 100 ? -2.418  9.024   -20.553 1.00 12.47 ?  100 PHE A CB  1 
ATOM   807  C CG  . PHE A 1 100 ? -3.557  8.760   -19.600 1.00 11.68 ?  100 PHE A CG  1 
ATOM   808  C CD1 . PHE A 1 100 ? -3.364  7.993   -18.456 1.00 12.43 ?  100 PHE A CD1 1 
ATOM   809  C CD2 . PHE A 1 100 ? -4.819  9.304   -19.841 1.00 14.08 ?  100 PHE A CD2 1 
ATOM   810  C CE1 . PHE A 1 100 ? -4.413  7.768   -17.556 1.00 14.91 ?  100 PHE A CE1 1 
ATOM   811  C CE2 . PHE A 1 100 ? -5.877  9.088   -18.948 1.00 12.23 ?  100 PHE A CE2 1 
ATOM   812  C CZ  . PHE A 1 100 ? -5.671  8.317   -17.804 1.00 14.52 ?  100 PHE A CZ  1 
ATOM   813  N N   . GLU A 1 101 ? -1.105  7.954   -23.717 1.00 13.46 ?  101 GLU A N   1 
ATOM   814  C CA  . GLU A 1 101 ? -0.115  8.374   -24.697 1.00 13.44 ?  101 GLU A CA  1 
ATOM   815  C C   . GLU A 1 101 ? -0.552  9.740   -25.180 1.00 13.72 ?  101 GLU A C   1 
ATOM   816  O O   . GLU A 1 101 ? -1.728  9.953   -25.485 1.00 14.61 ?  101 GLU A O   1 
ATOM   817  C CB  . GLU A 1 101 ? -0.064  7.413   -25.878 1.00 13.69 ?  101 GLU A CB  1 
ATOM   818  C CG  . GLU A 1 101 ? 0.256   5.996   -25.486 1.00 16.38 ?  101 GLU A CG  1 
ATOM   819  C CD  . GLU A 1 101 ? 0.621   5.155   -26.683 1.00 20.40 ?  101 GLU A CD  1 
ATOM   820  O OE1 . GLU A 1 101 ? -0.133  5.185   -27.682 1.00 20.94 ?  101 GLU A OE1 1 
ATOM   821  O OE2 . GLU A 1 101 ? 1.663   4.468   -26.618 1.00 22.68 -1 101 GLU A OE2 1 
ATOM   822  N N   . ILE A 1 102 ? 0.399   10.659  -25.253 1.00 12.64 ?  102 ILE A N   1 
ATOM   823  C CA  . ILE A 1 102 ? 0.103   12.019  -25.663 1.00 14.93 ?  102 ILE A CA  1 
ATOM   824  C C   . ILE A 1 102 ? 1.018   12.510  -26.772 1.00 14.80 ?  102 ILE A C   1 
ATOM   825  O O   . ILE A 1 102 ? 2.210   12.239  -26.756 1.00 16.24 ?  102 ILE A O   1 
ATOM   826  C CB  . ILE A 1 102 ? 0.282   12.976  -24.463 1.00 15.53 ?  102 ILE A CB  1 
ATOM   827  C CG1 . ILE A 1 102 ? -0.689  12.593  -23.346 1.00 18.77 ?  102 ILE A CG1 1 
ATOM   828  C CG2 . ILE A 1 102 ? 0.077   14.427  -24.903 1.00 17.95 ?  102 ILE A CG2 1 
ATOM   829  C CD1 . ILE A 1 102 ? -0.398  13.282  -22.016 1.00 20.79 ?  102 ILE A CD1 1 
ATOM   830  N N   . THR A 1 103 ? 0.447   13.189  -27.759 1.00 15.12 ?  103 THR A N   1 
ATOM   831  C CA  . THR A 1 103 ? 1.263   13.809  -28.800 1.00 15.72 ?  103 THR A CA  1 
ATOM   832  C C   . THR A 1 103 ? 0.673   15.196  -28.988 1.00 15.42 ?  103 THR A C   1 
ATOM   833  O O   . THR A 1 103 ? -0.538  15.388  -28.884 1.00 18.38 ?  103 THR A O   1 
ATOM   834  C CB  . THR A 1 103 ? 1.245   13.074  -30.163 1.00 18.31 ?  103 THR A CB  1 
ATOM   835  O OG1 . THR A 1 103 ? -0.043  13.194  -30.765 1.00 25.05 ?  103 THR A OG1 1 
ATOM   836  C CG2 . THR A 1 103 ? 1.614   11.618  -29.992 1.00 20.22 ?  103 THR A CG2 1 
ATOM   837  N N   . GLN A 1 104 ? 1.538   16.166  -29.238 1.00 14.22 ?  104 GLN A N   1 
ATOM   838  C CA  . GLN A 1 104 ? 1.108   17.544  -29.440 1.00 14.66 ?  104 GLN A CA  1 
ATOM   839  C C   . GLN A 1 104 ? 1.850   18.116  -30.634 1.00 15.63 ?  104 GLN A C   1 
ATOM   840  O O   . GLN A 1 104 ? 2.947   17.671  -30.959 1.00 16.20 ?  104 GLN A O   1 
ATOM   841  C CB  . GLN A 1 104 ? 1.449   18.402  -28.220 1.00 14.42 ?  104 GLN A CB  1 
ATOM   842  C CG  . GLN A 1 104 ? 0.736   18.038  -26.934 1.00 15.24 ?  104 GLN A CG  1 
ATOM   843  C CD  . GLN A 1 104 ? 1.221   18.888  -25.778 1.00 15.41 ?  104 GLN A CD  1 
ATOM   844  O OE1 . GLN A 1 104 ? 2.242   18.590  -25.149 1.00 18.54 ?  104 GLN A OE1 1 
ATOM   845  N NE2 . GLN A 1 104 ? 0.503   19.971  -25.505 1.00 13.96 ?  104 GLN A NE2 1 
ATOM   846  N N   . PRO A 1 105 ? 1.256   19.108  -31.312 1.00 16.13 ?  105 PRO A N   1 
ATOM   847  C CA  . PRO A 1 105 ? 1.951   19.691  -32.462 1.00 17.36 ?  105 PRO A CA  1 
ATOM   848  C C   . PRO A 1 105 ? 3.165   20.485  -31.980 1.00 17.90 ?  105 PRO A C   1 
ATOM   849  O O   . PRO A 1 105 ? 3.206   20.933  -30.836 1.00 17.59 ?  105 PRO A O   1 
ATOM   850  C CB  . PRO A 1 105 ? 0.880   20.575  -33.100 1.00 17.08 ?  105 PRO A CB  1 
ATOM   851  C CG  . PRO A 1 105 ? 0.013   20.964  -31.922 1.00 18.26 ?  105 PRO A CG  1 
ATOM   852  C CD  . PRO A 1 105 ? -0.102  19.660  -31.172 1.00 17.43 ?  105 PRO A CD  1 
ATOM   853  N N   . PRO A 1 106 ? 4.169   20.673  -32.851 1.00 17.97 ?  106 PRO A N   1 
ATOM   854  C CA  . PRO A 1 106 ? 5.391   21.413  -32.516 1.00 18.93 ?  106 PRO A CA  1 
ATOM   855  C C   . PRO A 1 106 ? 5.152   22.883  -32.197 1.00 19.75 ?  106 PRO A C   1 
ATOM   856  O O   . PRO A 1 106 ? 6.014   23.557  -31.632 1.00 21.71 ?  106 PRO A O   1 
ATOM   857  C CB  . PRO A 1 106 ? 6.267   21.210  -33.752 1.00 20.20 ?  106 PRO A CB  1 
ATOM   858  C CG  . PRO A 1 106 ? 5.270   21.079  -34.849 1.00 19.86 ?  106 PRO A CG  1 
ATOM   859  C CD  . PRO A 1 106 ? 4.213   20.188  -34.241 1.00 19.19 ?  106 PRO A CD  1 
ATOM   860  N N   . LEU A 1 107 ? 3.980   23.380  -32.571 1.00 18.78 ?  107 LEU A N   1 
ATOM   861  C CA  . LEU A 1 107 ? 3.619   24.756  -32.296 1.00 20.28 ?  107 LEU A CA  1 
ATOM   862  C C   . LEU A 1 107 ? 2.108   24.873  -32.206 1.00 17.31 ?  107 LEU A C   1 
ATOM   863  O O   . LEU A 1 107 ? 1.382   23.969  -32.617 1.00 18.60 ?  107 LEU A O   1 
ATOM   864  C CB  . LEU A 1 107 ? 4.163   25.687  -33.390 1.00 24.03 ?  107 LEU A CB  1 
ATOM   865  C CG  . LEU A 1 107 ? 3.819   25.401  -34.853 1.00 27.83 ?  107 LEU A CG  1 
ATOM   866  C CD1 . LEU A 1 107 ? 2.355   25.700  -35.137 1.00 29.36 ?  107 LEU A CD1 1 
ATOM   867  C CD2 . LEU A 1 107 ? 4.708   26.267  -35.739 1.00 31.53 ?  107 LEU A CD2 1 
ATOM   868  N N   . LEU A 1 108 ? 1.651   25.979  -31.631 1.00 17.47 ?  108 LEU A N   1 
ATOM   869  C CA  . LEU A 1 108 ? 0.236   26.273  -31.501 1.00 18.26 ?  108 LEU A CA  1 
ATOM   870  C C   . LEU A 1 108 ? 0.065   27.694  -32.024 1.00 18.53 ?  108 LEU A C   1 
ATOM   871  O O   . LEU A 1 108 ? 1.006   28.488  -31.991 1.00 19.90 ?  108 LEU A O   1 
ATOM   872  C CB  . LEU A 1 108 ? -0.210  26.179  -30.039 1.00 19.60 ?  108 LEU A CB  1 
ATOM   873  C CG  . LEU A 1 108 ? -0.267  24.755  -29.478 1.00 18.97 ?  108 LEU A CG  1 
ATOM   874  C CD1 . LEU A 1 108 ? -0.522  24.808  -27.983 1.00 20.34 ?  108 LEU A CD1 1 
ATOM   875  C CD2 . LEU A 1 108 ? -1.366  23.964  -30.184 1.00 18.93 ?  108 LEU A CD2 1 
ATOM   876  N N   . SER A 1 109 ? -1.126  28.011  -32.508 1.00 18.87 ?  109 SER A N   1 
ATOM   877  C CA  . SER A 1 109 ? -1.387  29.336  -33.065 1.00 19.75 ?  109 SER A CA  1 
ATOM   878  C C   . SER A 1 109 ? -1.265  30.500  -32.085 1.00 20.01 ?  109 SER A C   1 
ATOM   879  O O   . SER A 1 109 ? -1.604  30.369  -30.907 1.00 22.29 ?  109 SER A O   1 
ATOM   880  C CB  . SER A 1 109 ? -2.782  29.361  -33.688 1.00 20.13 ?  109 SER A CB  1 
ATOM   881  O OG  . SER A 1 109 ? -3.064  30.640  -34.226 1.00 22.83 ?  109 SER A OG  1 
ATOM   882  N N   . ILE A 1 110 ? -0.776  31.640  -32.575 1.00 19.73 ?  110 ILE A N   1 
ATOM   883  C CA  . ILE A 1 110 ? -0.671  32.827  -31.734 1.00 21.85 ?  110 ILE A CA  1 
ATOM   884  C C   . ILE A 1 110 ? -2.023  33.538  -31.777 1.00 25.05 ?  110 ILE A C   1 
ATOM   885  O O   . ILE A 1 110 ? -2.242  34.525  -31.073 1.00 26.58 ?  110 ILE A O   1 
ATOM   886  C CB  . ILE A 1 110 ? 0.443   33.803  -32.202 1.00 20.18 ?  110 ILE A CB  1 
ATOM   887  C CG1 . ILE A 1 110 ? 0.197   34.256  -33.642 1.00 18.95 ?  110 ILE A CG1 1 
ATOM   888  C CG2 . ILE A 1 110 ? 1.800   33.138  -32.065 1.00 20.10 ?  110 ILE A CG2 1 
ATOM   889  C CD1 . ILE A 1 110 ? 1.151   35.354  -34.101 1.00 17.90 ?  110 ILE A CD1 1 
ATOM   890  N N   . ASN A 1 111 ? -2.916  33.034  -32.627 1.00 28.05 ?  111 ASN A N   1 
ATOM   891  C CA  . ASN A 1 111 ? -4.272  33.568  -32.749 1.00 32.43 ?  111 ASN A CA  1 
ATOM   892  C C   . ASN A 1 111 ? -5.072  32.669  -31.801 1.00 35.36 ?  111 ASN A C   1 
ATOM   893  O O   . ASN A 1 111 ? -5.824  31.800  -32.240 1.00 36.18 ?  111 ASN A O   1 
ATOM   894  C CB  . ASN A 1 111 ? -4.805  33.409  -34.184 1.00 32.63 ?  111 ASN A CB  1 
ATOM   895  C CG  . ASN A 1 111 ? -3.899  34.043  -35.239 1.00 33.39 ?  111 ASN A CG  1 
ATOM   896  O OD1 . ASN A 1 111 ? -3.683  35.257  -35.254 1.00 30.41 ?  111 ASN A OD1 1 
ATOM   897  N ND2 . ASN A 1 111 ? -3.375  33.215  -36.136 1.00 33.05 ?  111 ASN A ND2 1 
ATOM   898  N N   . SER A 1 112 ? -4.875  32.882  -30.501 1.00 39.57 ?  112 SER A N   1 
ATOM   899  C CA  . SER A 1 112 ? -5.508  32.104  -29.431 1.00 42.55 ?  112 SER A CA  1 
ATOM   900  C C   . SER A 1 112 ? -7.002  31.810  -29.553 1.00 43.96 ?  112 SER A C   1 
ATOM   901  O O   . SER A 1 112 ? -7.540  31.002  -28.794 1.00 43.09 ?  112 SER A O   1 
ATOM   902  C CB  . SER A 1 112 ? -5.251  32.787  -28.085 1.00 44.07 ?  112 SER A CB  1 
ATOM   903  O OG  . SER A 1 112 ? -3.862  32.949  -27.851 1.00 47.30 ?  112 SER A OG  1 
ATOM   904  N N   . ASP A 1 113 ? -7.672  32.460  -30.495 1.00 45.33 ?  113 ASP A N   1 
ATOM   905  C CA  . ASP A 1 113 ? -9.102  32.255  -30.686 1.00 47.23 ?  113 ASP A CA  1 
ATOM   906  C C   . ASP A 1 113 ? -9.443  30.807  -31.035 1.00 46.69 ?  113 ASP A C   1 
ATOM   907  O O   . ASP A 1 113 ? -8.763  30.176  -31.847 1.00 48.10 ?  113 ASP A O   1 
ATOM   908  C CB  . ASP A 1 113 ? -9.614  33.182  -31.788 1.00 49.71 ?  113 ASP A CB  1 
ATOM   909  C CG  . ASP A 1 113 ? -9.314  34.638  -31.505 1.00 51.34 ?  113 ASP A CG  1 
ATOM   910  O OD1 . ASP A 1 113 ? -9.840  35.170  -30.504 1.00 53.11 ?  113 ASP A OD1 1 
ATOM   911  O OD2 . ASP A 1 113 ? -8.544  35.248  -32.278 1.00 53.59 -1 113 ASP A OD2 1 
ATOM   912  N N   . SER A 1 114 ? -10.497 30.292  -30.409 1.00 45.00 ?  114 SER A N   1 
ATOM   913  C CA  . SER A 1 114 ? -10.970 28.930  -30.646 1.00 42.97 ?  114 SER A CA  1 
ATOM   914  C C   . SER A 1 114 ? -9.973  27.841  -30.254 1.00 40.96 ?  114 SER A C   1 
ATOM   915  O O   . SER A 1 114 ? -10.044 26.719  -30.758 1.00 41.25 ?  114 SER A O   1 
ATOM   916  C CB  . SER A 1 114 ? -11.349 28.762  -32.120 1.00 43.53 ?  114 SER A CB  1 
ATOM   917  O OG  . SER A 1 114 ? -12.355 29.687  -32.499 1.00 44.80 ?  114 SER A OG  1 
ATOM   918  N N   . LEU A 1 115 ? -9.054  28.165  -29.352 1.00 38.25 ?  115 LEU A N   1 
ATOM   919  C CA  . LEU A 1 115 ? -8.050  27.200  -28.912 1.00 35.94 ?  115 LEU A CA  1 
ATOM   920  C C   . LEU A 1 115 ? -8.665  25.938  -28.309 1.00 35.05 ?  115 LEU A C   1 
ATOM   921  O O   . LEU A 1 115 ? -8.394  24.828  -28.765 1.00 34.20 ?  115 LEU A O   1 
ATOM   922  C CB  . LEU A 1 115 ? -7.109  27.841  -27.885 1.00 33.89 ?  115 LEU A CB  1 
ATOM   923  C CG  . LEU A 1 115 ? -6.027  26.926  -27.295 1.00 33.45 ?  115 LEU A CG  1 
ATOM   924  C CD1 . LEU A 1 115 ? -5.093  26.452  -28.398 1.00 32.78 ?  115 LEU A CD1 1 
ATOM   925  C CD2 . LEU A 1 115 ? -5.248  27.672  -26.227 1.00 33.65 ?  115 LEU A CD2 1 
ATOM   926  N N   . LEU A 1 116 ? -9.496  26.115  -27.286 1.00 34.49 ?  116 LEU A N   1 
ATOM   927  C CA  . LEU A 1 116 ? -10.125 24.990  -26.599 1.00 34.30 ?  116 LEU A CA  1 
ATOM   928  C C   . LEU A 1 116 ? -11.525 24.655  -27.111 1.00 36.18 ?  116 LEU A C   1 
ATOM   929  O O   . LEU A 1 116 ? -12.293 23.972  -26.435 1.00 35.95 ?  116 LEU A O   1 
ATOM   930  C CB  . LEU A 1 116 ? -10.188 25.290  -25.102 1.00 33.05 ?  116 LEU A CB  1 
ATOM   931  C CG  . LEU A 1 116 ? -8.850  25.664  -24.458 1.00 31.68 ?  116 LEU A CG  1 
ATOM   932  C CD1 . LEU A 1 116 ? -9.083  26.135  -23.035 1.00 32.69 ?  116 LEU A CD1 1 
ATOM   933  C CD2 . LEU A 1 116 ? -7.910  24.465  -24.487 1.00 31.25 ?  116 LEU A CD2 1 
ATOM   934  N N   . SER A 1 117 ? -11.840 25.129  -28.311 1.00 37.16 ?  117 SER A N   1 
ATOM   935  C CA  . SER A 1 117 ? -13.143 24.911  -28.938 1.00 39.21 ?  117 SER A CA  1 
ATOM   936  C C   . SER A 1 117 ? -13.871 23.600  -28.625 1.00 38.67 ?  117 SER A C   1 
ATOM   937  O O   . SER A 1 117 ? -14.931 23.607  -27.997 1.00 40.96 ?  117 SER A O   1 
ATOM   938  C CB  . SER A 1 117 ? -13.009 25.050  -30.457 1.00 39.15 ?  117 SER A CB  1 
ATOM   939  O OG  . SER A 1 117 ? -14.226 24.727  -31.106 1.00 43.68 ?  117 SER A OG  1 
ATOM   940  N N   . HIS A 1 118 ? -13.307 22.481  -29.068 1.00 37.82 ?  118 HIS A N   1 
ATOM   941  C CA  . HIS A 1 118 ? -13.931 21.174  -28.870 1.00 36.35 ?  118 HIS A CA  1 
ATOM   942  C C   . HIS A 1 118 ? -13.153 20.285  -27.895 1.00 33.10 ?  118 HIS A C   1 
ATOM   943  O O   . HIS A 1 118 ? -13.343 19.069  -27.872 1.00 31.20 ?  118 HIS A O   1 
ATOM   944  C CB  . HIS A 1 118 ? -14.037 20.465  -30.226 1.00 40.05 ?  118 HIS A CB  1 
ATOM   945  C CG  . HIS A 1 118 ? -15.066 19.379  -30.274 1.00 43.80 ?  118 HIS A CG  1 
ATOM   946  N ND1 . HIS A 1 118 ? -16.420 19.637  -30.302 1.00 45.82 ?  118 HIS A ND1 1 
ATOM   947  C CD2 . HIS A 1 118 ? -14.939 18.031  -30.326 1.00 45.63 ?  118 HIS A CD2 1 
ATOM   948  C CE1 . HIS A 1 118 ? -17.083 18.495  -30.371 1.00 45.99 ?  118 HIS A CE1 1 
ATOM   949  N NE2 . HIS A 1 118 ? -16.207 17.506  -30.387 1.00 46.69 ?  118 HIS A NE2 1 
ATOM   950  N N   . VAL A 1 119 ? -12.292 20.889  -27.082 1.00 30.29 ?  119 VAL A N   1 
ATOM   951  C CA  . VAL A 1 119 ? -11.479 20.123  -26.140 1.00 28.26 ?  119 VAL A CA  1 
ATOM   952  C C   . VAL A 1 119 ? -12.280 19.382  -25.069 1.00 27.42 ?  119 VAL A C   1 
ATOM   953  O O   . VAL A 1 119 ? -11.981 18.232  -24.746 1.00 24.15 ?  119 VAL A O   1 
ATOM   954  C CB  . VAL A 1 119 ? -10.433 21.023  -25.440 1.00 28.82 ?  119 VAL A CB  1 
ATOM   955  C CG1 . VAL A 1 119 ? -11.114 21.954  -24.447 1.00 30.94 ?  119 VAL A CG1 1 
ATOM   956  C CG2 . VAL A 1 119 ? -9.393  20.158  -24.744 1.00 27.19 ?  119 VAL A CG2 1 
ATOM   957  N N   . GLU A 1 120 ? -13.297 20.034  -24.517 1.00 26.44 ?  120 GLU A N   1 
ATOM   958  C CA  . GLU A 1 120 ? -14.108 19.410  -23.479 1.00 27.58 ?  120 GLU A CA  1 
ATOM   959  C C   . GLU A 1 120 ? -14.785 18.123  -23.952 1.00 25.26 ?  120 GLU A C   1 
ATOM   960  O O   . GLU A 1 120 ? -14.857 17.146  -23.206 1.00 23.33 ?  120 GLU A O   1 
ATOM   961  C CB  . GLU A 1 120 ? -15.147 20.408  -22.959 1.00 31.23 ?  120 GLU A CB  1 
ATOM   962  C CG  . GLU A 1 120 ? -16.037 20.998  -24.035 1.00 38.25 ?  120 GLU A CG  1 
ATOM   963  C CD  . GLU A 1 120 ? -16.769 22.242  -23.570 1.00 41.86 ?  120 GLU A CD  1 
ATOM   964  O OE1 . GLU A 1 120 ? -17.377 22.202  -22.478 1.00 44.55 ?  120 GLU A OE1 1 
ATOM   965  O OE2 . GLU A 1 120 ? -16.740 23.258  -24.300 1.00 44.47 -1 120 GLU A OE2 1 
ATOM   966  N N   . GLN A 1 121 ? -15.277 18.111  -25.188 1.00 24.81 ?  121 GLN A N   1 
ATOM   967  C CA  . GLN A 1 121 ? -15.926 16.913  -25.711 1.00 23.73 ?  121 GLN A CA  1 
ATOM   968  C C   . GLN A 1 121 ? -14.927 15.763  -25.805 1.00 22.18 ?  121 GLN A C   1 
ATOM   969  O O   . GLN A 1 121 ? -15.274 14.597  -25.599 1.00 20.60 ?  121 GLN A O   1 
ATOM   970  C CB  . GLN A 1 121 ? -16.532 17.181  -27.096 1.00 28.27 ?  121 GLN A CB  1 
ATOM   971  C CG  . GLN A 1 121 ? -17.732 18.120  -27.082 1.00 33.61 ?  121 GLN A CG  1 
ATOM   972  C CD  . GLN A 1 121 ? -17.356 19.574  -27.293 1.00 37.21 ?  121 GLN A CD  1 
ATOM   973  O OE1 . GLN A 1 121 ? -16.454 20.099  -26.642 1.00 39.06 ?  121 GLN A OE1 1 
ATOM   974  N NE2 . GLN A 1 121 ? -18.058 20.238  -28.207 1.00 39.42 ?  121 GLN A NE2 1 
ATOM   975  N N   . LEU A 1 122 ? -13.681 16.098  -26.115 1.00 21.68 ?  122 LEU A N   1 
ATOM   976  C CA  . LEU A 1 122 ? -12.637 15.091  -26.235 1.00 20.12 ?  122 LEU A CA  1 
ATOM   977  C C   . LEU A 1 122 ? -12.281 14.516  -24.869 1.00 19.26 ?  122 LEU A C   1 
ATOM   978  O O   . LEU A 1 122 ? -12.276 13.301  -24.680 1.00 18.53 ?  122 LEU A O   1 
ATOM   979  C CB  . LEU A 1 122 ? -11.397 15.698  -26.898 1.00 20.57 ?  122 LEU A CB  1 
ATOM   980  C CG  . LEU A 1 122 ? -10.224 14.757  -27.180 1.00 19.26 ?  122 LEU A CG  1 
ATOM   981  C CD1 . LEU A 1 122 ? -9.434  15.287  -28.369 1.00 20.96 ?  122 LEU A CD1 1 
ATOM   982  C CD2 . LEU A 1 122 ? -9.336  14.625  -25.950 1.00 20.35 ?  122 LEU A CD2 1 
ATOM   983  N N   . LEU A 1 123 ? -12.001 15.391  -23.909 1.00 18.39 ?  123 LEU A N   1 
ATOM   984  C CA  . LEU A 1 123 ? -11.641 14.938  -22.566 1.00 17.21 ?  123 LEU A CA  1 
ATOM   985  C C   . LEU A 1 123 ? -12.793 14.160  -21.936 1.00 17.98 ?  123 LEU A C   1 
ATOM   986  O O   . LEU A 1 123 ? -12.584 13.155  -21.255 1.00 16.68 ?  123 LEU A O   1 
ATOM   987  C CB  . LEU A 1 123 ? -11.272 16.140  -21.696 1.00 17.73 ?  123 LEU A CB  1 
ATOM   988  C CG  . LEU A 1 123 ? -10.121 16.994  -22.245 1.00 17.49 ?  123 LEU A CG  1 
ATOM   989  C CD1 . LEU A 1 123 ? -9.849  18.156  -21.305 1.00 17.77 ?  123 LEU A CD1 1 
ATOM   990  C CD2 . LEU A 1 123 ? -8.868  16.138  -22.416 1.00 18.71 ?  123 LEU A CD2 1 
ATOM   991  N N   . ARG A 1 124 ? -14.014 14.631  -22.169 1.00 17.17 ?  124 ARG A N   1 
ATOM   992  C CA  . ARG A 1 124 ? -15.199 13.973  -21.635 1.00 18.56 ?  124 ARG A CA  1 
ATOM   993  C C   . ARG A 1 124 ? -15.274 12.513  -22.075 1.00 17.18 ?  124 ARG A C   1 
ATOM   994  O O   . ARG A 1 124 ? -15.646 11.637  -21.291 1.00 17.48 ?  124 ARG A O   1 
ATOM   995  C CB  . ARG A 1 124 ? -16.449 14.735  -22.089 1.00 19.71 ?  124 ARG A CB  1 
ATOM   996  C CG  . ARG A 1 124 ? -17.774 14.082  -21.753 1.00 26.64 ?  124 ARG A CG  1 
ATOM   997  C CD  . ARG A 1 124 ? -18.890 15.109  -21.892 1.00 30.39 ?  124 ARG A CD  1 
ATOM   998  N NE  . ARG A 1 124 ? -18.855 15.782  -23.186 1.00 38.09 ?  124 ARG A NE  1 
ATOM   999  C CZ  . ARG A 1 124 ? -19.368 16.987  -23.416 1.00 39.30 ?  124 ARG A CZ  1 
ATOM   1000 N NH1 . ARG A 1 124 ? -19.955 17.661  -22.436 1.00 42.15 1  124 ARG A NH1 1 
ATOM   1001 N NH2 . ARG A 1 124 ? -19.296 17.519  -24.629 1.00 39.46 ?  124 ARG A NH2 1 
ATOM   1002 N N   . ALA A 1 125 ? -14.913 12.248  -23.327 1.00 16.55 ?  125 ALA A N   1 
ATOM   1003 C CA  . ALA A 1 125 ? -14.947 10.889  -23.857 1.00 16.96 ?  125 ALA A CA  1 
ATOM   1004 C C   . ALA A 1 125 ? -14.039 9.945   -23.080 1.00 17.04 ?  125 ALA A C   1 
ATOM   1005 O O   . ALA A 1 125 ? -14.395 8.793   -22.831 1.00 18.10 ?  125 ALA A O   1 
ATOM   1006 C CB  . ALA A 1 125 ? -14.559 10.890  -25.333 1.00 19.02 ?  125 ALA A CB  1 
ATOM   1007 N N   . PHE A 1 126 ? -12.859 10.428  -22.700 1.00 15.87 ?  126 PHE A N   1 
ATOM   1008 C CA  . PHE A 1 126 ? -11.930 9.596   -21.946 1.00 15.01 ?  126 PHE A CA  1 
ATOM   1009 C C   . PHE A 1 126 ? -12.443 9.325   -20.534 1.00 15.81 ?  126 PHE A C   1 
ATOM   1010 O O   . PHE A 1 126 ? -12.331 8.211   -20.029 1.00 16.23 ?  126 PHE A O   1 
ATOM   1011 C CB  . PHE A 1 126 ? -10.544 10.253  -21.879 1.00 13.57 ?  126 PHE A CB  1 
ATOM   1012 C CG  . PHE A 1 126 ? -9.785  10.200  -23.178 1.00 13.34 ?  126 PHE A CG  1 
ATOM   1013 C CD1 . PHE A 1 126 ? -10.103 11.056  -24.228 1.00 16.41 ?  126 PHE A CD1 1 
ATOM   1014 C CD2 . PHE A 1 126 ? -8.764  9.276   -23.355 1.00 13.66 ?  126 PHE A CD2 1 
ATOM   1015 C CE1 . PHE A 1 126 ? -9.408  10.990  -25.438 1.00 16.54 ?  126 PHE A CE1 1 
ATOM   1016 C CE2 . PHE A 1 126 ? -8.065  9.201   -24.559 1.00 15.78 ?  126 PHE A CE2 1 
ATOM   1017 C CZ  . PHE A 1 126 ? -8.387  10.058  -25.600 1.00 17.57 ?  126 PHE A CZ  1 
ATOM   1018 N N   . ILE A 1 127 ? -13.000 10.350  -19.898 1.00 14.79 ?  127 ILE A N   1 
ATOM   1019 C CA  . ILE A 1 127 ? -13.531 10.199  -18.549 1.00 16.08 ?  127 ILE A CA  1 
ATOM   1020 C C   . ILE A 1 127 ? -14.661 9.172   -18.539 1.00 16.66 ?  127 ILE A C   1 
ATOM   1021 O O   . ILE A 1 127 ? -14.739 8.333   -17.644 1.00 17.27 ?  127 ILE A O   1 
ATOM   1022 C CB  . ILE A 1 127 ? -14.054 11.549  -18.006 1.00 16.51 ?  127 ILE A CB  1 
ATOM   1023 C CG1 . ILE A 1 127 ? -12.891 12.533  -17.845 1.00 16.49 ?  127 ILE A CG1 1 
ATOM   1024 C CG2 . ILE A 1 127 ? -14.789 11.336  -16.692 1.00 17.11 ?  127 ILE A CG2 1 
ATOM   1025 C CD1 . ILE A 1 127 ? -11.759 12.022  -16.963 1.00 17.00 ?  127 ILE A CD1 1 
ATOM   1026 N N   . LEU A 1 128 ? -15.529 9.226   -19.544 1.00 16.93 ?  128 LEU A N   1 
ATOM   1027 C CA  . LEU A 1 128 ? -16.635 8.283   -19.615 1.00 18.42 ?  128 LEU A CA  1 
ATOM   1028 C C   . LEU A 1 128 ? -16.140 6.847   -19.760 1.00 18.05 ?  128 LEU A C   1 
ATOM   1029 O O   . LEU A 1 128 ? -16.716 5.925   -19.182 1.00 19.88 ?  128 LEU A O   1 
ATOM   1030 C CB  . LEU A 1 128 ? -17.563 8.655   -20.773 1.00 20.34 ?  128 LEU A CB  1 
ATOM   1031 C CG  . LEU A 1 128 ? -18.292 9.983   -20.562 1.00 23.64 ?  128 LEU A CG  1 
ATOM   1032 C CD1 . LEU A 1 128 ? -19.066 10.361  -21.817 1.00 25.56 ?  128 LEU A CD1 1 
ATOM   1033 C CD2 . LEU A 1 128 ? -19.229 9.865   -19.361 1.00 25.00 ?  128 LEU A CD2 1 
ATOM   1034 N N   . LYS A 1 129 ? -15.065 6.651   -20.518 1.00 17.30 ?  129 LYS A N   1 
ATOM   1035 C CA  . LYS A 1 129 ? -14.520 5.309   -20.696 1.00 18.16 ?  129 LYS A CA  1 
ATOM   1036 C C   . LYS A 1 129 ? -13.927 4.792   -19.388 1.00 17.51 ?  129 LYS A C   1 
ATOM   1037 O O   . LYS A 1 129 ? -14.109 3.631   -19.028 1.00 18.34 ?  129 LYS A O   1 
ATOM   1038 C CB  . LYS A 1 129 ? -13.447 5.298   -21.790 1.00 19.96 ?  129 LYS A CB  1 
ATOM   1039 C CG  . LYS A 1 129 ? -13.994 5.396   -23.208 1.00 23.40 ?  129 LYS A CG  1 
ATOM   1040 C CD  . LYS A 1 129 ? -14.787 4.152   -23.585 1.00 26.20 ?  129 LYS A CD  1 
ATOM   1041 C CE  . LYS A 1 129 ? -15.325 4.247   -25.005 1.00 28.61 ?  129 LYS A CE  1 
ATOM   1042 N NZ  . LYS A 1 129 ? -16.079 3.021   -25.390 1.00 30.25 1  129 LYS A NZ  1 
ATOM   1043 N N   . ILE A 1 130 ? -13.206 5.655   -18.679 1.00 16.28 ?  130 ILE A N   1 
ATOM   1044 C CA  . ILE A 1 130 ? -12.608 5.263   -17.408 1.00 16.20 ?  130 ILE A CA  1 
ATOM   1045 C C   . ILE A 1 130 ? -13.707 4.909   -16.405 1.00 15.98 ?  130 ILE A C   1 
ATOM   1046 O O   . ILE A 1 130 ? -13.593 3.939   -15.655 1.00 15.28 ?  130 ILE A O   1 
ATOM   1047 C CB  . ILE A 1 130 ? -11.742 6.406   -16.815 1.00 15.78 ?  130 ILE A CB  1 
ATOM   1048 C CG1 . ILE A 1 130 ? -10.516 6.643   -17.694 1.00 15.78 ?  130 ILE A CG1 1 
ATOM   1049 C CG2 . ILE A 1 130 ? -11.298 6.041   -15.401 1.00 15.43 ?  130 ILE A CG2 1 
ATOM   1050 C CD1 . ILE A 1 130 ? -9.721  7.882   -17.311 1.00 16.54 ?  130 ILE A CD1 1 
ATOM   1051 N N   . SER A 1 131 ? -14.778 5.694   -16.413 1.00 17.71 ?  131 SER A N   1 
ATOM   1052 C CA  . SER A 1 131 ? -15.897 5.487   -15.495 1.00 19.81 ?  131 SER A CA  1 
ATOM   1053 C C   . SER A 1 131 ? -16.498 4.084   -15.512 1.00 21.09 ?  131 SER A C   1 
ATOM   1054 O O   . SER A 1 131 ? -17.005 3.613   -14.492 1.00 22.43 ?  131 SER A O   1 
ATOM   1055 C CB  . SER A 1 131 ? -17.000 6.504   -15.784 1.00 19.86 ?  131 SER A CB  1 
ATOM   1056 O OG  . SER A 1 131 ? -16.537 7.826   -15.580 1.00 25.72 ?  131 SER A OG  1 
ATOM   1057 N N   . LYS A 1 132 ? -16.448 3.415   -16.660 1.00 21.57 ?  132 LYS A N   1 
ATOM   1058 C CA  . LYS A 1 132 ? -17.017 2.073   -16.770 1.00 23.45 ?  132 LYS A CA  1 
ATOM   1059 C C   . LYS A 1 132 ? -15.992 0.985   -17.064 1.00 23.75 ?  132 LYS A C   1 
ATOM   1060 O O   . LYS A 1 132 ? -16.350 -0.118  -17.477 1.00 22.80 ?  132 LYS A O   1 
ATOM   1061 C CB  . LYS A 1 132 ? -18.091 2.048   -17.861 1.00 27.97 ?  132 LYS A CB  1 
ATOM   1062 C CG  . LYS A 1 132 ? -19.317 2.891   -17.557 1.00 33.14 ?  132 LYS A CG  1 
ATOM   1063 C CD  . LYS A 1 132 ? -20.423 2.616   -18.568 1.00 37.02 ?  132 LYS A CD  1 
ATOM   1064 C CE  . LYS A 1 132 ? -21.695 3.381   -18.232 1.00 38.61 ?  132 LYS A CE  1 
ATOM   1065 N NZ  . LYS A 1 132 ? -22.801 3.058   -19.181 1.00 40.29 1  132 LYS A NZ  1 
ATOM   1066 N N   . VAL A 1 133 ? -14.719 1.279   -16.830 1.00 22.46 ?  133 VAL A N   1 
ATOM   1067 C CA  . VAL A 1 133 ? -13.668 0.312   -17.114 1.00 23.15 ?  133 VAL A CA  1 
ATOM   1068 C C   . VAL A 1 133 ? -13.738 -0.940  -16.236 1.00 25.57 ?  133 VAL A C   1 
ATOM   1069 O O   . VAL A 1 133 ? -13.203 -1.988  -16.595 1.00 24.02 ?  133 VAL A O   1 
ATOM   1070 C CB  . VAL A 1 133 ? -12.266 0.970   -16.975 1.00 21.47 ?  133 VAL A CB  1 
ATOM   1071 C CG1 . VAL A 1 133 ? -11.894 1.124   -15.506 1.00 21.04 ?  133 VAL A CG1 1 
ATOM   1072 C CG2 . VAL A 1 133 ? -11.229 0.155   -17.729 1.00 22.80 ?  133 VAL A CG2 1 
ATOM   1073 N N   . ASP A 1 134 ? -14.409 -0.835  -15.093 1.00 27.02 ?  134 ASP A N   1 
ATOM   1074 C CA  . ASP A 1 134 ? -14.524 -1.972  -14.189 1.00 32.29 ?  134 ASP A CA  1 
ATOM   1075 C C   . ASP A 1 134 ? -15.291 -3.126  -14.827 1.00 32.96 ?  134 ASP A C   1 
ATOM   1076 O O   . ASP A 1 134 ? -15.216 -4.262  -14.361 1.00 33.99 ?  134 ASP A O   1 
ATOM   1077 C CB  . ASP A 1 134 ? -15.216 -1.549  -12.889 1.00 34.95 ?  134 ASP A CB  1 
ATOM   1078 C CG  . ASP A 1 134 ? -16.623 -1.029  -13.118 1.00 37.79 ?  134 ASP A CG  1 
ATOM   1079 O OD1 . ASP A 1 134 ? -16.778 -0.016  -13.833 1.00 39.98 ?  134 ASP A OD1 1 
ATOM   1080 O OD2 . ASP A 1 134 ? -17.575 -1.635  -12.580 1.00 42.38 -1 134 ASP A OD2 1 
ATOM   1081 N N   . LYS A 1 135 ? -16.017 -2.831  -15.900 1.00 33.41 ?  135 LYS A N   1 
ATOM   1082 C CA  . LYS A 1 135 ? -16.808 -3.837  -16.596 1.00 36.65 ?  135 LYS A CA  1 
ATOM   1083 C C   . LYS A 1 135 ? -15.975 -4.731  -17.511 1.00 36.65 ?  135 LYS A C   1 
ATOM   1084 O O   . LYS A 1 135 ? -16.424 -5.807  -17.909 1.00 38.08 ?  135 LYS A O   1 
ATOM   1085 C CB  . LYS A 1 135 ? -17.910 -3.160  -17.415 1.00 38.72 ?  135 LYS A CB  1 
ATOM   1086 C CG  . LYS A 1 135 ? -18.861 -2.307  -16.587 1.00 41.92 ?  135 LYS A CG  1 
ATOM   1087 C CD  . LYS A 1 135 ? -19.929 -1.663  -17.455 1.00 43.95 ?  135 LYS A CD  1 
ATOM   1088 C CE  . LYS A 1 135 ? -20.884 -0.825  -16.620 1.00 44.78 ?  135 LYS A CE  1 
ATOM   1089 N NZ  . LYS A 1 135 ? -21.949 -0.206  -17.455 1.00 47.33 1  135 LYS A NZ  1 
ATOM   1090 N N   . VAL A 1 136 ? -14.766 -4.288  -17.843 1.00 35.19 ?  136 VAL A N   1 
ATOM   1091 C CA  . VAL A 1 136 ? -13.890 -5.059  -18.720 1.00 34.86 ?  136 VAL A CA  1 
ATOM   1092 C C   . VAL A 1 136 ? -12.603 -5.508  -18.031 1.00 34.17 ?  136 VAL A C   1 
ATOM   1093 O O   . VAL A 1 136 ? -11.715 -6.073  -18.668 1.00 33.46 ?  136 VAL A O   1 
ATOM   1094 C CB  . VAL A 1 136 ? -13.514 -4.250  -19.983 1.00 35.39 ?  136 VAL A CB  1 
ATOM   1095 C CG1 . VAL A 1 136 ? -14.765 -3.939  -20.792 1.00 35.96 ?  136 VAL A CG1 1 
ATOM   1096 C CG2 . VAL A 1 136 ? -12.801 -2.965  -19.589 1.00 35.34 ?  136 VAL A CG2 1 
ATOM   1097 N N   . LEU A 1 137 ? -12.510 -5.258  -16.729 1.00 32.37 ?  137 LEU A N   1 
ATOM   1098 C CA  . LEU A 1 137 ? -11.331 -5.638  -15.961 1.00 32.53 ?  137 LEU A CA  1 
ATOM   1099 C C   . LEU A 1 137 ? -11.697 -6.527  -14.780 1.00 33.31 ?  137 LEU A C   1 
ATOM   1100 O O   . LEU A 1 137 ? -12.784 -6.411  -14.217 1.00 34.73 ?  137 LEU A O   1 
ATOM   1101 C CB  . LEU A 1 137 ? -10.620 -4.390  -15.430 1.00 27.38 ?  137 LEU A CB  1 
ATOM   1102 C CG  . LEU A 1 137 ? -10.060 -3.370  -16.420 1.00 25.99 ?  137 LEU A CG  1 
ATOM   1103 C CD1 . LEU A 1 137 ? -9.508  -2.178  -15.642 1.00 24.84 ?  137 LEU A CD1 1 
ATOM   1104 C CD2 . LEU A 1 137 ? -8.965  -4.002  -17.266 1.00 26.57 ?  137 LEU A CD2 1 
ATOM   1105 N N   . ASP A 1 138 ? -10.780 -7.413  -14.404 1.00 37.41 ?  138 ASP A N   1 
ATOM   1106 C CA  . ASP A 1 138 ? -11.001 -8.292  -13.264 1.00 38.66 ?  138 ASP A CA  1 
ATOM   1107 C C   . ASP A 1 138 ? -10.718 -7.499  -11.992 1.00 38.96 ?  138 ASP A C   1 
ATOM   1108 O O   . ASP A 1 138 ? -9.974  -6.520  -12.019 1.00 36.97 ?  138 ASP A O   1 
ATOM   1109 C CB  . ASP A 1 138 ? -10.076 -9.510  -13.334 1.00 42.17 ?  138 ASP A CB  1 
ATOM   1110 C CG  . ASP A 1 138 ? -10.518 -10.519 -14.375 1.00 44.26 ?  138 ASP A CG  1 
ATOM   1111 O OD1 . ASP A 1 138 ? -11.660 -11.014 -14.269 1.00 46.43 ?  138 ASP A OD1 1 
ATOM   1112 O OD2 . ASP A 1 138 ? -9.728  -10.819 -15.296 1.00 45.93 -1 138 ASP A OD2 1 
ATOM   1113 N N   . HIS A 1 139 ? -11.316 -7.922  -10.884 1.00 38.79 ?  139 HIS A N   1 
ATOM   1114 C CA  . HIS A 1 139 ? -11.130 -7.243  -9.607  1.00 39.51 ?  139 HIS A CA  1 
ATOM   1115 C C   . HIS A 1 139 ? -9.682  -7.330  -9.137  1.00 38.21 ?  139 HIS A C   1 
ATOM   1116 O O   . HIS A 1 139 ? -9.070  -8.395  -9.192  1.00 39.35 ?  139 HIS A O   1 
ATOM   1117 C CB  . HIS A 1 139 ? -12.039 -7.864  -8.544  1.00 42.34 ?  139 HIS A CB  1 
ATOM   1118 C CG  . HIS A 1 139 ? -13.491 -7.854  -8.907  1.00 45.26 ?  139 HIS A CG  1 
ATOM   1119 N ND1 . HIS A 1 139 ? -14.200 -6.690  -9.110  1.00 47.04 ?  139 HIS A ND1 1 
ATOM   1120 C CD2 . HIS A 1 139 ? -14.368 -8.868  -9.104  1.00 46.61 ?  139 HIS A CD2 1 
ATOM   1121 C CE1 . HIS A 1 139 ? -15.451 -6.987  -9.416  1.00 47.26 ?  139 HIS A CE1 1 
ATOM   1122 N NE2 . HIS A 1 139 ? -15.579 -8.301  -9.419  1.00 47.80 ?  139 HIS A NE2 1 
ATOM   1123 N N   . ASN A 1 140 ? -9.132  -6.208  -8.679  1.00 36.12 ?  140 ASN A N   1 
ATOM   1124 C CA  . ASN A 1 140 ? -7.760  -6.197  -8.183  1.00 34.27 ?  140 ASN A CA  1 
ATOM   1125 C C   . ASN A 1 140 ? -7.729  -6.774  -6.775  1.00 33.57 ?  140 ASN A C   1 
ATOM   1126 O O   . ASN A 1 140 ? -8.720  -6.711  -6.047  1.00 33.56 ?  140 ASN A O   1 
ATOM   1127 C CB  . ASN A 1 140 ? -7.192  -4.773  -8.127  1.00 32.59 ?  140 ASN A CB  1 
ATOM   1128 C CG  . ASN A 1 140 ? -6.891  -4.203  -9.496  1.00 31.00 ?  140 ASN A CG  1 
ATOM   1129 O OD1 . ASN A 1 140 ? -6.521  -4.929  -10.418 1.00 29.77 ?  140 ASN A OD1 1 
ATOM   1130 N ND2 . ASN A 1 140 ? -7.020  -2.887  -9.626  1.00 28.97 ?  140 ASN A ND2 1 
ATOM   1131 N N   . PRO A 1 141 ? -6.584  -7.345  -6.373  1.00 33.74 ?  141 PRO A N   1 
ATOM   1132 C CA  . PRO A 1 141 ? -6.457  -7.920  -5.033  1.00 34.64 ?  141 PRO A CA  1 
ATOM   1133 C C   . PRO A 1 141 ? -6.393  -6.796  -4.002  1.00 34.17 ?  141 PRO A C   1 
ATOM   1134 O O   . PRO A 1 141 ? -6.014  -5.671  -4.325  1.00 34.11 ?  141 PRO A O   1 
ATOM   1135 C CB  . PRO A 1 141 ? -5.151  -8.700  -5.121  1.00 33.30 ?  141 PRO A CB  1 
ATOM   1136 C CG  . PRO A 1 141 ? -4.339  -7.865  -6.063  1.00 34.97 ?  141 PRO A CG  1 
ATOM   1137 C CD  . PRO A 1 141 ? -5.343  -7.534  -7.146  1.00 33.68 ?  141 PRO A CD  1 
ATOM   1138 N N   . PRO A 1 142 ? -6.777  -7.081  -2.750  1.00 33.75 ?  142 PRO A N   1 
ATOM   1139 C CA  . PRO A 1 142 ? -6.744  -6.059  -1.701  1.00 32.07 ?  142 PRO A CA  1 
ATOM   1140 C C   . PRO A 1 142 ? -5.328  -5.567  -1.410  1.00 30.43 ?  142 PRO A C   1 
ATOM   1141 O O   . PRO A 1 142 ? -4.355  -6.289  -1.629  1.00 30.41 ?  142 PRO A O   1 
ATOM   1142 C CB  . PRO A 1 142 ? -7.350  -6.782  -0.497  1.00 33.80 ?  142 PRO A CB  1 
ATOM   1143 C CG  . PRO A 1 142 ? -8.276  -7.782  -1.133  1.00 34.43 ?  142 PRO A CG  1 
ATOM   1144 C CD  . PRO A 1 142 ? -7.436  -8.307  -2.267  1.00 34.14 ?  142 PRO A CD  1 
ATOM   1145 N N   . GLY A 1 143 ? -5.221  -4.330  -0.931  1.00 27.29 ?  143 GLY A N   1 
ATOM   1146 C CA  . GLY A 1 143 ? -3.927  -3.775  -0.581  1.00 26.10 ?  143 GLY A CA  1 
ATOM   1147 C C   . GLY A 1 143 ? -3.074  -3.195  -1.692  1.00 23.94 ?  143 GLY A C   1 
ATOM   1148 O O   . GLY A 1 143 ? -1.860  -3.070  -1.533  1.00 23.66 ?  143 GLY A O   1 
ATOM   1149 N N   . CYS A 1 144 ? -3.689  -2.836  -2.813  1.00 23.24 ?  144 CYS A N   1 
ATOM   1150 C CA  . CYS A 1 144 ? -2.929  -2.262  -3.919  1.00 22.31 ?  144 CYS A CA  1 
ATOM   1151 C C   . CYS A 1 144 ? -2.594  -0.800  -3.655  1.00 20.55 ?  144 CYS A C   1 
ATOM   1152 O O   . CYS A 1 144 ? -3.264  -0.123  -2.873  1.00 21.69 ?  144 CYS A O   1 
ATOM   1153 C CB  . CYS A 1 144 ? -3.714  -2.357  -5.229  1.00 20.40 ?  144 CYS A CB  1 
ATOM   1154 S SG  . CYS A 1 144 ? -3.799  -4.004  -5.956  1.00 26.61 ?  144 CYS A SG  1 
ATOM   1155 N N   . THR A 1 145 ? -1.544  -0.328  -4.313  1.00 18.36 ?  145 THR A N   1 
ATOM   1156 C CA  . THR A 1 145 ? -1.108  1.061   -4.198  1.00 18.41 ?  145 THR A CA  1 
ATOM   1157 C C   . THR A 1 145 ? -0.905  1.525   -5.634  1.00 17.00 ?  145 THR A C   1 
ATOM   1158 O O   . THR A 1 145 ? -1.125  0.755   -6.567  1.00 16.74 ?  145 THR A O   1 
ATOM   1159 C CB  . THR A 1 145 ? 0.230   1.175   -3.454  1.00 19.21 ?  145 THR A CB  1 
ATOM   1160 O OG1 . THR A 1 145 ? 1.236   0.445   -4.167  1.00 21.66 ?  145 THR A OG1 1 
ATOM   1161 C CG2 . THR A 1 145 ? 0.104   0.604   -2.045  1.00 22.44 ?  145 THR A CG2 1 
ATOM   1162 N N   . PHE A 1 146 ? -0.513  2.778   -5.825  1.00 15.56 ?  146 PHE A N   1 
ATOM   1163 C CA  . PHE A 1 146 ? -0.269  3.252   -7.181  1.00 13.81 ?  146 PHE A CA  1 
ATOM   1164 C C   . PHE A 1 146 ? 0.982   4.107   -7.267  1.00 14.92 ?  146 PHE A C   1 
ATOM   1165 O O   . PHE A 1 146 ? 1.478   4.626   -6.265  1.00 15.08 ?  146 PHE A O   1 
ATOM   1166 C CB  . PHE A 1 146 ? -1.462  4.058   -7.726  1.00 12.93 ?  146 PHE A CB  1 
ATOM   1167 C CG  . PHE A 1 146 ? -1.488  5.498   -7.284  1.00 11.20 ?  146 PHE A CG  1 
ATOM   1168 C CD1 . PHE A 1 146 ? -1.847  5.836   -5.986  1.00 13.82 ?  146 PHE A CD1 1 
ATOM   1169 C CD2 . PHE A 1 146 ? -1.157  6.517   -8.176  1.00 12.65 ?  146 PHE A CD2 1 
ATOM   1170 C CE1 . PHE A 1 146 ? -1.881  7.168   -5.577  1.00 12.06 ?  146 PHE A CE1 1 
ATOM   1171 C CE2 . PHE A 1 146 ? -1.186  7.855   -7.775  1.00 11.92 ?  146 PHE A CE2 1 
ATOM   1172 C CZ  . PHE A 1 146 ? -1.550  8.177   -6.470  1.00 12.33 ?  146 PHE A CZ  1 
ATOM   1173 N N   . THR A 1 147 ? 1.490   4.228   -8.485  1.00 14.67 ?  147 THR A N   1 
ATOM   1174 C CA  . THR A 1 147 ? 2.658   5.038   -8.781  1.00 18.24 ?  147 THR A CA  1 
ATOM   1175 C C   . THR A 1 147 ? 2.327   5.705   -10.109 1.00 17.06 ?  147 THR A C   1 
ATOM   1176 O O   . THR A 1 147 ? 1.422   5.264   -10.820 1.00 17.53 ?  147 THR A O   1 
ATOM   1177 C CB  . THR A 1 147 ? 3.928   4.171   -8.971  1.00 21.77 ?  147 THR A CB  1 
ATOM   1178 O OG1 . THR A 1 147 ? 4.153   3.373   -7.800  1.00 27.93 ?  147 THR A OG1 1 
ATOM   1179 C CG2 . THR A 1 147 ? 5.138   5.055   -9.206  1.00 26.95 ?  147 THR A CG2 1 
ATOM   1180 N N   . VAL A 1 148 ? 3.029   6.783   -10.429 1.00 14.35 ?  148 VAL A N   1 
ATOM   1181 C CA  . VAL A 1 148 ? 2.828   7.465   -11.698 1.00 14.54 ?  148 VAL A CA  1 
ATOM   1182 C C   . VAL A 1 148 ? 4.159   7.440   -12.434 1.00 15.84 ?  148 VAL A C   1 
ATOM   1183 O O   . VAL A 1 148 ? 5.198   7.805   -11.871 1.00 17.07 ?  148 VAL A O   1 
ATOM   1184 C CB  . VAL A 1 148 ? 2.393   8.934   -11.506 1.00 13.89 ?  148 VAL A CB  1 
ATOM   1185 C CG1 . VAL A 1 148 ? 2.279   9.633   -12.868 1.00 15.27 ?  148 VAL A CG1 1 
ATOM   1186 C CG2 . VAL A 1 148 ? 1.061   8.982   -10.782 1.00 16.32 ?  148 VAL A CG2 1 
ATOM   1187 N N   . LEU A 1 149 ? 4.129   6.980   -13.679 1.00 13.87 ?  149 LEU A N   1 
ATOM   1188 C CA  . LEU A 1 149 ? 5.324   6.915   -14.505 1.00 14.41 ?  149 LEU A CA  1 
ATOM   1189 C C   . LEU A 1 149 ? 5.207   7.936   -15.616 1.00 15.21 ?  149 LEU A C   1 
ATOM   1190 O O   . LEU A 1 149 ? 4.138   8.116   -16.192 1.00 14.72 ?  149 LEU A O   1 
ATOM   1191 C CB  . LEU A 1 149 ? 5.474   5.538   -15.149 1.00 17.04 ?  149 LEU A CB  1 
ATOM   1192 C CG  . LEU A 1 149 ? 5.517   4.309   -14.251 1.00 20.55 ?  149 LEU A CG  1 
ATOM   1193 C CD1 . LEU A 1 149 ? 5.712   3.077   -15.127 1.00 21.72 ?  149 LEU A CD1 1 
ATOM   1194 C CD2 . LEU A 1 149 ? 6.643   4.439   -13.249 1.00 20.74 ?  149 LEU A CD2 1 
ATOM   1195 N N   . VAL A 1 150 ? 6.308   8.605   -15.929 1.00 13.19 ?  150 VAL A N   1 
ATOM   1196 C CA  . VAL A 1 150 ? 6.297   9.581   -17.004 1.00 13.84 ?  150 VAL A CA  1 
ATOM   1197 C C   . VAL A 1 150 ? 7.407   9.244   -17.993 1.00 14.54 ?  150 VAL A C   1 
ATOM   1198 O O   . VAL A 1 150 ? 8.561   9.084   -17.603 1.00 14.58 ?  150 VAL A O   1 
ATOM   1199 C CB  . VAL A 1 150 ? 6.513   11.012  -16.467 1.00 12.76 ?  150 VAL A CB  1 
ATOM   1200 C CG1 . VAL A 1 150 ? 6.561   11.997  -17.628 1.00 15.28 ?  150 VAL A CG1 1 
ATOM   1201 C CG2 . VAL A 1 150 ? 5.390   11.385  -15.494 1.00 14.89 ?  150 VAL A CG2 1 
ATOM   1202 N N   . HIS A 1 151 ? 7.037   9.101   -19.263 1.00 14.11 ?  151 HIS A N   1 
ATOM   1203 C CA  . HIS A 1 151 ? 7.995   8.808   -20.326 1.00 17.03 ?  151 HIS A CA  1 
ATOM   1204 C C   . HIS A 1 151 ? 8.160   10.109  -21.092 1.00 17.45 ?  151 HIS A C   1 
ATOM   1205 O O   . HIS A 1 151 ? 7.175   10.715  -21.509 1.00 17.25 ?  151 HIS A O   1 
ATOM   1206 C CB  . HIS A 1 151 ? 7.461   7.733   -21.278 1.00 18.07 ?  151 HIS A CB  1 
ATOM   1207 C CG  . HIS A 1 151 ? 7.356   6.369   -20.670 1.00 21.85 ?  151 HIS A CG  1 
ATOM   1208 N ND1 . HIS A 1 151 ? 6.399   6.038   -19.736 1.00 24.25 ?  151 HIS A ND1 1 
ATOM   1209 C CD2 . HIS A 1 151 ? 8.081   5.244   -20.880 1.00 24.09 ?  151 HIS A CD2 1 
ATOM   1210 C CE1 . HIS A 1 151 ? 6.535   4.768   -19.398 1.00 24.09 ?  151 HIS A CE1 1 
ATOM   1211 N NE2 . HIS A 1 151 ? 7.549   4.263   -20.078 1.00 26.60 ?  151 HIS A NE2 1 
ATOM   1212 N N   . THR A 1 152 ? 9.396   10.546  -21.283 1.00 18.48 ?  152 THR A N   1 
ATOM   1213 C CA  . THR A 1 152 ? 9.625   11.795  -21.992 1.00 21.39 ?  152 THR A CA  1 
ATOM   1214 C C   . THR A 1 152 ? 10.227  11.576  -23.369 1.00 23.07 ?  152 THR A C   1 
ATOM   1215 O O   . THR A 1 152 ? 10.530  10.450  -23.762 1.00 24.38 ?  152 THR A O   1 
ATOM   1216 C CB  . THR A 1 152 ? 10.574  12.710  -21.208 1.00 24.83 ?  152 THR A CB  1 
ATOM   1217 O OG1 . THR A 1 152 ? 11.889  12.147  -21.224 1.00 29.46 ?  152 THR A OG1 1 
ATOM   1218 C CG2 . THR A 1 152 ? 10.111  12.846  -19.761 1.00 24.83 ?  152 THR A CG2 1 
ATOM   1219 N N   . ARG A 1 153 ? 10.388  12.673  -24.097 1.00 26.01 ?  153 ARG A N   1 
ATOM   1220 C CA  . ARG A 1 153 ? 10.988  12.640  -25.422 1.00 31.36 ?  153 ARG A CA  1 
ATOM   1221 C C   . ARG A 1 153 ? 12.467  12.319  -25.219 1.00 34.35 ?  153 ARG A C   1 
ATOM   1222 O O   . ARG A 1 153 ? 13.088  12.810  -24.276 1.00 35.09 ?  153 ARG A O   1 
ATOM   1223 C CB  . ARG A 1 153 ? 10.843  14.010  -26.087 1.00 31.87 ?  153 ARG A CB  1 
ATOM   1224 C CG  . ARG A 1 153 ? 11.602  14.163  -27.393 1.00 33.43 ?  153 ARG A CG  1 
ATOM   1225 C CD  . ARG A 1 153 ? 11.705  15.632  -27.779 1.00 34.85 ?  153 ARG A CD  1 
ATOM   1226 N NE  . ARG A 1 153 ? 10.399  16.226  -28.048 1.00 36.01 ?  153 ARG A NE  1 
ATOM   1227 C CZ  . ARG A 1 153 ? 9.664   15.960  -29.124 1.00 36.75 ?  153 ARG A CZ  1 
ATOM   1228 N NH1 . ARG A 1 153 ? 10.107  15.108  -30.040 1.00 37.11 1  153 ARG A NH1 1 
ATOM   1229 N NH2 . ARG A 1 153 ? 8.487   16.547  -29.285 1.00 35.45 ?  153 ARG A NH2 1 
ATOM   1230 N N   . GLU A 1 154 ? 13.027  11.489  -26.091 1.00 38.79 ?  154 GLU A N   1 
ATOM   1231 C CA  . GLU A 1 154 ? 14.434  11.127  -25.979 1.00 43.39 ?  154 GLU A CA  1 
ATOM   1232 C C   . GLU A 1 154 ? 15.289  12.259  -26.536 1.00 44.92 ?  154 GLU A C   1 
ATOM   1233 O O   . GLU A 1 154 ? 15.585  12.297  -27.732 1.00 46.56 ?  154 GLU A O   1 
ATOM   1234 C CB  . GLU A 1 154 ? 14.713  9.835   -26.749 1.00 44.55 ?  154 GLU A CB  1 
ATOM   1235 C CG  . GLU A 1 154 ? 16.106  9.262   -26.529 1.00 47.87 ?  154 GLU A CG  1 
ATOM   1236 C CD  . GLU A 1 154 ? 16.357  8.866   -25.084 1.00 48.61 ?  154 GLU A CD  1 
ATOM   1237 O OE1 . GLU A 1 154 ? 16.445  9.765   -24.220 1.00 50.37 ?  154 GLU A OE1 1 
ATOM   1238 O OE2 . GLU A 1 154 ? 16.463  7.651   -24.811 1.00 50.56 -1 154 GLU A OE2 1 
ATOM   1239 N N   . MET A 1 160 ? 20.890  13.031  -17.358 1.00 62.22 ?  160 MET A N   1 
ATOM   1240 C CA  . MET A 1 160 ? 21.929  12.050  -17.073 1.00 60.50 ?  160 MET A CA  1 
ATOM   1241 C C   . MET A 1 160 ? 21.943  11.696  -15.585 1.00 58.25 ?  160 MET A C   1 
ATOM   1242 O O   . MET A 1 160 ? 22.545  10.702  -15.179 1.00 58.39 ?  160 MET A O   1 
ATOM   1243 C CB  . MET A 1 160 ? 23.295  12.602  -17.488 1.00 61.60 ?  160 MET A CB  1 
ATOM   1244 C CG  . MET A 1 160 ? 24.320  11.533  -17.824 1.00 62.49 ?  160 MET A CG  1 
ATOM   1245 S SD  . MET A 1 160 ? 23.832  10.566  -19.266 1.00 65.04 ?  160 MET A SD  1 
ATOM   1246 C CE  . MET A 1 160 ? 24.467  11.593  -20.593 1.00 64.04 ?  160 MET A CE  1 
ATOM   1247 N N   . GLU A 1 161 ? 21.276  12.518  -14.779 1.00 55.22 ?  161 GLU A N   1 
ATOM   1248 C CA  . GLU A 1 161 ? 21.202  12.299  -13.338 1.00 52.43 ?  161 GLU A CA  1 
ATOM   1249 C C   . GLU A 1 161 ? 20.094  11.303  -13.001 1.00 49.93 ?  161 GLU A C   1 
ATOM   1250 O O   . GLU A 1 161 ? 18.989  11.388  -13.537 1.00 49.61 ?  161 GLU A O   1 
ATOM   1251 C CB  . GLU A 1 161 ? 20.941  13.625  -12.618 1.00 53.44 ?  161 GLU A CB  1 
ATOM   1252 C CG  . GLU A 1 161 ? 22.062  14.645  -12.756 1.00 54.56 ?  161 GLU A CG  1 
ATOM   1253 C CD  . GLU A 1 161 ? 23.305  14.258  -11.976 1.00 56.23 ?  161 GLU A CD  1 
ATOM   1254 O OE1 . GLU A 1 161 ? 24.326  14.972  -12.085 1.00 56.38 ?  161 GLU A OE1 1 
ATOM   1255 O OE2 . GLU A 1 161 ? 23.259  13.242  -11.250 1.00 56.75 -1 161 GLU A OE2 1 
ATOM   1256 N N   . LYS A 1 162 ? 20.397  10.365  -12.108 1.00 46.57 ?  162 LYS A N   1 
ATOM   1257 C CA  . LYS A 1 162 ? 19.437  9.343   -11.696 1.00 43.26 ?  162 LYS A CA  1 
ATOM   1258 C C   . LYS A 1 162 ? 18.325  9.939   -10.836 1.00 40.32 ?  162 LYS A C   1 
ATOM   1259 O O   . LYS A 1 162 ? 17.230  9.383   -10.744 1.00 37.74 ?  162 LYS A O   1 
ATOM   1260 C CB  . LYS A 1 162 ? 20.159  8.239   -10.918 1.00 45.22 ?  162 LYS A CB  1 
ATOM   1261 C CG  . LYS A 1 162 ? 21.304  7.590   -11.687 1.00 47.23 ?  162 LYS A CG  1 
ATOM   1262 C CD  . LYS A 1 162 ? 22.090  6.608   -10.825 1.00 48.57 ?  162 LYS A CD  1 
ATOM   1263 C CE  . LYS A 1 162 ? 21.236  5.427   -10.391 1.00 49.34 ?  162 LYS A CE  1 
ATOM   1264 N NZ  . LYS A 1 162 ? 22.020  4.443   -9.590  1.00 49.68 1  162 LYS A NZ  1 
ATOM   1265 N N   . ILE A 1 163 ? 18.622  11.068  -10.201 1.00 37.50 ?  163 ILE A N   1 
ATOM   1266 C CA  . ILE A 1 163 ? 17.660  11.757  -9.349  1.00 34.50 ?  163 ILE A CA  1 
ATOM   1267 C C   . ILE A 1 163 ? 17.449  13.170  -9.884  1.00 34.28 ?  163 ILE A C   1 
ATOM   1268 O O   . ILE A 1 163 ? 18.391  13.958  -9.968  1.00 32.20 ?  163 ILE A O   1 
ATOM   1269 C CB  . ILE A 1 163 ? 18.155  11.837  -7.880  1.00 35.95 ?  163 ILE A CB  1 
ATOM   1270 C CG1 . ILE A 1 163 ? 18.228  10.434  -7.264  1.00 37.10 ?  163 ILE A CG1 1 
ATOM   1271 C CG2 . ILE A 1 163 ? 17.213  12.703  -7.056  1.00 35.20 ?  163 ILE A CG2 1 
ATOM   1272 C CD1 . ILE A 1 163 ? 19.310  9.540   -7.846  1.00 40.34 ?  163 ILE A CD1 1 
ATOM   1273 N N   . GLN A 1 164 ? 16.208  13.477  -10.251 1.00 31.59 ?  164 GLN A N   1 
ATOM   1274 C CA  . GLN A 1 164 ? 15.852  14.785  -10.795 1.00 32.96 ?  164 GLN A CA  1 
ATOM   1275 C C   . GLN A 1 164 ? 14.821  15.478  -9.911  1.00 31.29 ?  164 GLN A C   1 
ATOM   1276 O O   . GLN A 1 164 ? 13.776  14.905  -9.612  1.00 30.75 ?  164 GLN A O   1 
ATOM   1277 C CB  . GLN A 1 164 ? 15.263  14.621  -12.198 1.00 34.32 ?  164 GLN A CB  1 
ATOM   1278 C CG  . GLN A 1 164 ? 16.236  14.135  -13.258 1.00 38.84 ?  164 GLN A CG  1 
ATOM   1279 C CD  . GLN A 1 164 ? 17.156  15.233  -13.743 1.00 41.00 ?  164 GLN A CD  1 
ATOM   1280 O OE1 . GLN A 1 164 ? 16.700  16.300  -14.155 1.00 43.67 ?  164 GLN A OE1 1 
ATOM   1281 N NE2 . GLN A 1 164 ? 18.457  14.977  -13.705 1.00 42.85 ?  164 GLN A NE2 1 
ATOM   1282 N N   . VAL A 1 165 ? 15.109  16.707  -9.492  1.00 29.86 ?  165 VAL A N   1 
ATOM   1283 C CA  . VAL A 1 165 ? 14.167  17.450  -8.663  1.00 26.93 ?  165 VAL A CA  1 
ATOM   1284 C C   . VAL A 1 165 ? 13.508  18.555  -9.482  1.00 27.77 ?  165 VAL A C   1 
ATOM   1285 O O   . VAL A 1 165 ? 14.159  19.514  -9.902  1.00 26.92 ?  165 VAL A O   1 
ATOM   1286 C CB  . VAL A 1 165 ? 14.848  18.075  -7.434  1.00 28.21 ?  165 VAL A CB  1 
ATOM   1287 C CG1 . VAL A 1 165 ? 13.821  18.837  -6.609  1.00 26.34 ?  165 VAL A CG1 1 
ATOM   1288 C CG2 . VAL A 1 165 ? 15.487  16.984  -6.588  1.00 26.90 ?  165 VAL A CG2 1 
ATOM   1289 N N   . ILE A 1 166 ? 12.206  18.405  -9.699  1.00 23.16 ?  166 ILE A N   1 
ATOM   1290 C CA  . ILE A 1 166 ? 11.420  19.353  -10.477 1.00 25.21 ?  166 ILE A CA  1 
ATOM   1291 C C   . ILE A 1 166 ? 10.372  19.982  -9.570  1.00 21.71 ?  166 ILE A C   1 
ATOM   1292 O O   . ILE A 1 166 ? 9.663   19.272  -8.869  1.00 20.73 ?  166 ILE A O   1 
ATOM   1293 C CB  . ILE A 1 166 ? 10.692  18.630  -11.628 1.00 26.56 ?  166 ILE A CB  1 
ATOM   1294 C CG1 . ILE A 1 166 ? 11.669  17.706  -12.359 1.00 30.46 ?  166 ILE A CG1 1 
ATOM   1295 C CG2 . ILE A 1 166 ? 10.091  19.653  -12.582 1.00 28.39 ?  166 ILE A CG2 1 
ATOM   1296 C CD1 . ILE A 1 166 ? 11.030  16.845  -13.430 1.00 34.40 ?  166 ILE A CD1 1 
ATOM   1297 N N   . LYS A 1 167 ? 10.272  21.309  -9.579  1.00 22.29 ?  167 LYS A N   1 
ATOM   1298 C CA  . LYS A 1 167 ? 9.290   21.994  -8.742  1.00 24.29 ?  167 LYS A CA  1 
ATOM   1299 C C   . LYS A 1 167 ? 9.348   21.477  -7.301  1.00 23.48 ?  167 LYS A C   1 
ATOM   1300 O O   . LYS A 1 167 ? 8.315   21.176  -6.697  1.00 24.42 ?  167 LYS A O   1 
ATOM   1301 C CB  . LYS A 1 167 ? 7.882   21.777  -9.304  1.00 25.26 ?  167 LYS A CB  1 
ATOM   1302 C CG  . LYS A 1 167 ? 7.729   22.124  -10.779 1.00 28.44 ?  167 LYS A CG  1 
ATOM   1303 C CD  . LYS A 1 167 ? 7.982   23.598  -11.047 1.00 29.52 ?  167 LYS A CD  1 
ATOM   1304 C CE  . LYS A 1 167 ? 7.750   23.929  -12.518 1.00 33.34 ?  167 LYS A CE  1 
ATOM   1305 N NZ  . LYS A 1 167 ? 8.018   25.362  -12.823 1.00 34.63 1  167 LYS A NZ  1 
ATOM   1306 N N   . ASP A 1 168 ? 10.563  21.367  -6.768  1.00 23.28 ?  168 ASP A N   1 
ATOM   1307 C CA  . ASP A 1 168 ? 10.799  20.894  -5.400  1.00 23.45 ?  168 ASP A CA  1 
ATOM   1308 C C   . ASP A 1 168 ? 10.334  19.462  -5.141  1.00 23.81 ?  168 ASP A C   1 
ATOM   1309 O O   . ASP A 1 168 ? 10.221  19.052  -3.989  1.00 23.92 ?  168 ASP A O   1 
ATOM   1310 C CB  . ASP A 1 168 ? 10.104  21.799  -4.374  1.00 25.79 ?  168 ASP A CB  1 
ATOM   1311 C CG  . ASP A 1 168 ? 10.608  23.227  -4.402  1.00 25.28 ?  168 ASP A CG  1 
ATOM   1312 O OD1 . ASP A 1 168 ? 11.755  23.459  -4.836  1.00 26.50 ?  168 ASP A OD1 1 
ATOM   1313 O OD2 . ASP A 1 168 ? 9.851   24.119  -3.963  1.00 30.10 -1 168 ASP A OD2 1 
ATOM   1314 N N   . PHE A 1 169 ? 10.079  18.703  -6.200  1.00 21.19 ?  169 PHE A N   1 
ATOM   1315 C CA  . PHE A 1 169 ? 9.591   17.325  -6.068  1.00 20.03 ?  169 PHE A CA  1 
ATOM   1316 C C   . PHE A 1 169 ? 10.607  16.370  -6.702  1.00 19.64 ?  169 PHE A C   1 
ATOM   1317 O O   . PHE A 1 169 ? 10.899  16.471  -7.890  1.00 19.34 ?  169 PHE A O   1 
ATOM   1318 C CB  . PHE A 1 169 ? 8.241   17.227  -6.790  1.00 19.67 ?  169 PHE A CB  1 
ATOM   1319 C CG  . PHE A 1 169 ? 7.377   16.076  -6.358  1.00 16.70 ?  169 PHE A CG  1 
ATOM   1320 C CD1 . PHE A 1 169 ? 6.848   16.018  -5.071  1.00 17.06 ?  169 PHE A CD1 1 
ATOM   1321 C CD2 . PHE A 1 169 ? 7.018   15.088  -7.271  1.00 17.08 ?  169 PHE A CD2 1 
ATOM   1322 C CE1 . PHE A 1 169 ? 5.968   14.996  -4.707  1.00 16.55 ?  169 PHE A CE1 1 
ATOM   1323 C CE2 . PHE A 1 169 ? 6.141   14.066  -6.918  1.00 17.11 ?  169 PHE A CE2 1 
ATOM   1324 C CZ  . PHE A 1 169 ? 5.613   14.019  -5.635  1.00 15.49 ?  169 PHE A CZ  1 
ATOM   1325 N N   . PRO A 1 170 ? 11.150  15.420  -5.919  1.00 18.64 ?  170 PRO A N   1 
ATOM   1326 C CA  . PRO A 1 170 ? 12.137  14.473  -6.450  1.00 19.18 ?  170 PRO A CA  1 
ATOM   1327 C C   . PRO A 1 170 ? 11.592  13.342  -7.322  1.00 16.84 ?  170 PRO A C   1 
ATOM   1328 O O   . PRO A 1 170 ? 10.594  12.708  -6.977  1.00 17.50 ?  170 PRO A O   1 
ATOM   1329 C CB  . PRO A 1 170 ? 12.809  13.947  -5.184  1.00 19.27 ?  170 PRO A CB  1 
ATOM   1330 C CG  . PRO A 1 170 ? 11.657  13.883  -4.226  1.00 19.98 ?  170 PRO A CG  1 
ATOM   1331 C CD  . PRO A 1 170 ? 10.935  15.202  -4.475  1.00 20.56 ?  170 PRO A CD  1 
ATOM   1332 N N   . TRP A 1 171 ? 12.264  13.100  -8.446  1.00 16.80 ?  171 TRP A N   1 
ATOM   1333 C CA  . TRP A 1 171 ? 11.903  12.031  -9.372  1.00 16.27 ?  171 TRP A CA  1 
ATOM   1334 C C   . TRP A 1 171 ? 13.109  11.112  -9.545  1.00 17.98 ?  171 TRP A C   1 
ATOM   1335 O O   . TRP A 1 171 ? 14.255  11.559  -9.451  1.00 21.05 ?  171 TRP A O   1 
ATOM   1336 C CB  . TRP A 1 171 ? 11.505  12.591  -10.746 1.00 17.22 ?  171 TRP A CB  1 
ATOM   1337 C CG  . TRP A 1 171 ? 10.187  13.310  -10.757 1.00 15.34 ?  171 TRP A CG  1 
ATOM   1338 C CD1 . TRP A 1 171 ? 9.922   14.552  -10.255 1.00 15.32 ?  171 TRP A CD1 1 
ATOM   1339 C CD2 . TRP A 1 171 ? 8.940   12.798  -11.243 1.00 14.40 ?  171 TRP A CD2 1 
ATOM   1340 N NE1 . TRP A 1 171 ? 8.582   14.845  -10.394 1.00 15.40 ?  171 TRP A NE1 1 
ATOM   1341 C CE2 . TRP A 1 171 ? 7.957   13.784  -10.996 1.00 14.48 ?  171 TRP A CE2 1 
ATOM   1342 C CE3 . TRP A 1 171 ? 8.556   11.599  -11.863 1.00 15.59 ?  171 TRP A CE3 1 
ATOM   1343 C CZ2 . TRP A 1 171 ? 6.610   13.609  -11.346 1.00 14.69 ?  171 TRP A CZ2 1 
ATOM   1344 C CZ3 . TRP A 1 171 ? 7.213   11.422  -12.213 1.00 14.93 ?  171 TRP A CZ3 1 
ATOM   1345 C CH2 . TRP A 1 171 ? 6.257   12.426  -11.951 1.00 14.41 ?  171 TRP A CH2 1 
ATOM   1346 N N   . ILE A 1 172 ? 12.850  9.831   -9.783  1.00 16.61 ?  172 ILE A N   1 
ATOM   1347 C CA  . ILE A 1 172 ? 13.917  8.859   -9.992  1.00 18.36 ?  172 ILE A CA  1 
ATOM   1348 C C   . ILE A 1 172 ? 13.531  7.918   -11.128 1.00 19.95 ?  172 ILE A C   1 
ATOM   1349 O O   . ILE A 1 172 ? 12.362  7.834   -11.509 1.00 18.78 ?  172 ILE A O   1 
ATOM   1350 C CB  . ILE A 1 172 ? 14.187  8.018   -8.715  1.00 18.98 ?  172 ILE A CB  1 
ATOM   1351 C CG1 . ILE A 1 172 ? 12.900  7.338   -8.253  1.00 19.19 ?  172 ILE A CG1 1 
ATOM   1352 C CG2 . ILE A 1 172 ? 14.768  8.902   -7.615  1.00 20.66 ?  172 ILE A CG2 1 
ATOM   1353 C CD1 . ILE A 1 172 ? 13.092  6.411   -7.062  1.00 25.06 ?  172 ILE A CD1 1 
ATOM   1354 N N   . LEU A 1 173 ? 14.511  7.220   -11.689 1.00 23.08 ?  173 LEU A N   1 
ATOM   1355 C CA  . LEU A 1 173 ? 14.225  6.282   -12.765 1.00 25.38 ?  173 LEU A CA  1 
ATOM   1356 C C   . LEU A 1 173 ? 13.501  5.061   -12.219 1.00 28.51 ?  173 LEU A C   1 
ATOM   1357 O O   . LEU A 1 173 ? 13.887  4.503   -11.188 1.00 29.59 ?  173 LEU A O   1 
ATOM   1358 C CB  . LEU A 1 173 ? 15.517  5.840   -13.456 1.00 28.69 ?  173 LEU A CB  1 
ATOM   1359 C CG  . LEU A 1 173 ? 16.134  6.839   -14.435 1.00 29.40 ?  173 LEU A CG  1 
ATOM   1360 C CD1 . LEU A 1 173 ? 17.458  6.297   -14.958 1.00 31.13 ?  173 LEU A CD1 1 
ATOM   1361 C CD2 . LEU A 1 173 ? 15.166  7.082   -15.584 1.00 29.97 ?  173 LEU A CD2 1 
ATOM   1362 N N   . ALA A 1 174 ? 12.437  4.654   -12.900 1.00 28.46 ?  174 ALA A N   1 
ATOM   1363 C CA  . ALA A 1 174 ? 11.683  3.484   -12.480 1.00 32.66 ?  174 ALA A CA  1 
ATOM   1364 C C   . ALA A 1 174 ? 12.488  2.258   -12.892 1.00 35.00 ?  174 ALA A C   1 
ATOM   1365 O O   . ALA A 1 174 ? 13.352  2.342   -13.763 1.00 34.05 ?  174 ALA A O   1 
ATOM   1366 C CB  . ALA A 1 174 ? 10.315  3.467   -13.151 1.00 32.26 ?  174 ALA A CB  1 
ATOM   1367 N N   . ASP A 1 175 ? 12.207  1.125   -12.263 1.00 40.40 ?  175 ASP A N   1 
ATOM   1368 C CA  . ASP A 1 175 ? 12.914  -0.111  -12.575 1.00 44.74 ?  175 ASP A CA  1 
ATOM   1369 C C   . ASP A 1 175 ? 11.954  -1.165  -13.114 1.00 47.49 ?  175 ASP A C   1 
ATOM   1370 O O   . ASP A 1 175 ? 10.769  -1.158  -12.786 1.00 46.73 ?  175 ASP A O   1 
ATOM   1371 C CB  . ASP A 1 175 ? 13.613  -0.638  -11.321 1.00 46.86 ?  175 ASP A CB  1 
ATOM   1372 C CG  . ASP A 1 175 ? 12.689  -0.690  -10.120 1.00 48.39 ?  175 ASP A CG  1 
ATOM   1373 O OD1 . ASP A 1 175 ? 11.640  -1.362  -10.202 1.00 50.80 ?  175 ASP A OD1 1 
ATOM   1374 O OD2 . ASP A 1 175 ? 13.012  -0.058  -9.092  1.00 51.18 -1 175 ASP A OD2 1 
ATOM   1375 N N   . GLU A 1 176 ? 12.469  -2.068  -13.945 1.00 50.82 ?  176 GLU A N   1 
ATOM   1376 C CA  . GLU A 1 176 ? 11.649  -3.129  -14.522 1.00 53.98 ?  176 GLU A CA  1 
ATOM   1377 C C   . GLU A 1 176 ? 11.072  -4.017  -13.427 1.00 55.41 ?  176 GLU A C   1 
ATOM   1378 O O   . GLU A 1 176 ? 10.251  -4.895  -13.693 1.00 55.90 ?  176 GLU A O   1 
ATOM   1379 C CB  . GLU A 1 176 ? 12.476  -3.984  -15.488 1.00 55.15 ?  176 GLU A CB  1 
ATOM   1380 C CG  . GLU A 1 176 ? 12.618  -3.406  -16.891 1.00 57.06 ?  176 GLU A CG  1 
ATOM   1381 C CD  . GLU A 1 176 ? 13.351  -2.080  -16.921 1.00 58.24 ?  176 GLU A CD  1 
ATOM   1382 O OE1 . GLU A 1 176 ? 12.837  -1.095  -16.347 1.00 59.78 ?  176 GLU A OE1 1 
ATOM   1383 O OE2 . GLU A 1 176 ? 14.444  -2.022  -17.524 1.00 59.29 -1 176 GLU A OE2 1 
ATOM   1384 N N   . GLN A 1 177 ? 11.511  -3.782  -12.196 1.00 57.51 ?  177 GLN A N   1 
ATOM   1385 C CA  . GLN A 1 177 ? 11.046  -4.555  -11.053 1.00 59.56 ?  177 GLN A CA  1 
ATOM   1386 C C   . GLN A 1 177 ? 9.625   -4.145  -10.680 1.00 59.89 ?  177 GLN A C   1 
ATOM   1387 O O   . GLN A 1 177 ? 8.945   -4.844  -9.929  1.00 60.86 ?  177 GLN A O   1 
ATOM   1388 C CB  . GLN A 1 177 ? 11.981  -4.336  -9.860  1.00 60.51 ?  177 GLN A CB  1 
ATOM   1389 C CG  . GLN A 1 177 ? 11.670  -5.200  -8.649  1.00 62.80 ?  177 GLN A CG  1 
ATOM   1390 C CD  . GLN A 1 177 ? 11.866  -6.679  -8.922  1.00 63.50 ?  177 GLN A CD  1 
ATOM   1391 O OE1 . GLN A 1 177 ? 12.963  -7.117  -9.272  1.00 64.40 ?  177 GLN A OE1 1 
ATOM   1392 N NE2 . GLN A 1 177 ? 10.801  -7.457  -8.762  1.00 64.54 ?  177 GLN A NE2 1 
ATOM   1393 N N   . ASP A 1 178 ? 9.182   -3.009  -11.211 1.00 60.45 ?  178 ASP A N   1 
ATOM   1394 C CA  . ASP A 1 178 ? 7.843   -2.505  -10.926 1.00 60.56 ?  178 ASP A CA  1 
ATOM   1395 C C   . ASP A 1 178 ? 7.166   -1.940  -12.170 1.00 59.87 ?  178 ASP A C   1 
ATOM   1396 O O   . ASP A 1 178 ? 6.167   -1.227  -12.072 1.00 59.35 ?  178 ASP A O   1 
ATOM   1397 C CB  . ASP A 1 178 ? 7.910   -1.419  -9.849  1.00 62.14 ?  178 ASP A CB  1 
ATOM   1398 C CG  . ASP A 1 178 ? 8.527   -1.916  -8.555  1.00 62.89 ?  178 ASP A CG  1 
ATOM   1399 O OD1 . ASP A 1 178 ? 7.979   -2.869  -7.960  1.00 63.29 ?  178 ASP A OD1 1 
ATOM   1400 O OD2 . ASP A 1 178 ? 9.560   -1.353  -8.134  1.00 63.59 -1 178 ASP A OD2 1 
ATOM   1401 N N   . VAL A 1 179 ? 7.709   -2.258  -13.340 1.00 58.79 ?  179 VAL A N   1 
ATOM   1402 C CA  . VAL A 1 179 ? 7.143   -1.773  -14.593 1.00 57.79 ?  179 VAL A CA  1 
ATOM   1403 C C   . VAL A 1 179 ? 7.211   -2.839  -15.681 1.00 57.03 ?  179 VAL A C   1 
ATOM   1404 O O   . VAL A 1 179 ? 7.277   -2.521  -16.869 1.00 57.81 ?  179 VAL A O   1 
ATOM   1405 C CB  . VAL A 1 179 ? 7.883   -0.510  -15.091 1.00 58.01 ?  179 VAL A CB  1 
ATOM   1406 C CG1 . VAL A 1 179 ? 7.834   0.576   -14.028 1.00 58.15 ?  179 VAL A CG1 1 
ATOM   1407 C CG2 . VAL A 1 179 ? 9.323   -0.850  -15.441 1.00 58.05 ?  179 VAL A CG2 1 
ATOM   1408 N N   . HIS A 1 180 ? 7.194   -4.103  -15.273 1.00 55.31 ?  180 HIS A N   1 
ATOM   1409 C CA  . HIS A 1 180 ? 7.261   -5.200  -16.229 1.00 53.79 ?  180 HIS A CA  1 
ATOM   1410 C C   . HIS A 1 180 ? 6.107   -6.185  -16.094 1.00 52.61 ?  180 HIS A C   1 
ATOM   1411 O O   . HIS A 1 180 ? 5.810   -6.671  -15.003 1.00 52.19 ?  180 HIS A O   1 
ATOM   1412 C CB  . HIS A 1 180 ? 8.587   -5.952  -16.081 1.00 54.84 ?  180 HIS A CB  1 
ATOM   1413 C CG  . HIS A 1 180 ? 8.688   -7.172  -16.943 1.00 55.31 ?  180 HIS A CG  1 
ATOM   1414 N ND1 . HIS A 1 180 ? 8.574   -7.125  -18.316 1.00 55.47 ?  180 HIS A ND1 1 
ATOM   1415 C CD2 . HIS A 1 180 ? 8.882   -8.474  -16.626 1.00 55.64 ?  180 HIS A CD2 1 
ATOM   1416 C CE1 . HIS A 1 180 ? 8.694   -8.346  -18.808 1.00 55.76 ?  180 HIS A CE1 1 
ATOM   1417 N NE2 . HIS A 1 180 ? 8.881   -9.183  -17.804 1.00 55.90 ?  180 HIS A NE2 1 
ATOM   1418 N N   . MET A 1 181 ? 5.461   -6.469  -17.219 1.00 50.92 ?  181 MET A N   1 
ATOM   1419 C CA  . MET A 1 181 ? 4.353   -7.412  -17.264 1.00 49.86 ?  181 MET A CA  1 
ATOM   1420 C C   . MET A 1 181 ? 4.608   -8.352  -18.434 1.00 48.79 ?  181 MET A C   1 
ATOM   1421 O O   . MET A 1 181 ? 4.721   -7.912  -19.578 1.00 49.71 ?  181 MET A O   1 
ATOM   1422 C CB  . MET A 1 181 ? 3.025   -6.683  -17.473 1.00 49.86 ?  181 MET A CB  1 
ATOM   1423 C CG  . MET A 1 181 ? 2.718   -5.625  -16.432 1.00 50.27 ?  181 MET A CG  1 
ATOM   1424 S SD  . MET A 1 181 ? 1.059   -4.942  -16.629 1.00 51.82 ?  181 MET A SD  1 
ATOM   1425 C CE  . MET A 1 181 ? 0.225   -5.700  -15.259 1.00 48.36 ?  181 MET A CE  1 
ATOM   1426 N N   . HIS A 1 182 ? 4.705   -9.644  -18.144 1.00 47.91 ?  182 HIS A N   1 
ATOM   1427 C CA  . HIS A 1 182 ? 4.959   -10.638 -19.179 1.00 46.50 ?  182 HIS A CA  1 
ATOM   1428 C C   . HIS A 1 182 ? 3.728   -10.844 -20.059 1.00 44.65 ?  182 HIS A C   1 
ATOM   1429 O O   . HIS A 1 182 ? 2.710   -11.366 -19.605 1.00 43.92 ?  182 HIS A O   1 
ATOM   1430 C CB  . HIS A 1 182 ? 5.366   -11.966 -18.533 1.00 48.25 ?  182 HIS A CB  1 
ATOM   1431 C CG  . HIS A 1 182 ? 5.948   -12.955 -19.495 1.00 50.05 ?  182 HIS A CG  1 
ATOM   1432 N ND1 . HIS A 1 182 ? 5.266   -13.410 -20.602 1.00 50.97 ?  182 HIS A ND1 1 
ATOM   1433 C CD2 . HIS A 1 182 ? 7.148   -13.584 -19.508 1.00 50.78 ?  182 HIS A CD2 1 
ATOM   1434 C CE1 . HIS A 1 182 ? 6.019   -14.275 -21.257 1.00 51.58 ?  182 HIS A CE1 1 
ATOM   1435 N NE2 . HIS A 1 182 ? 7.167   -14.399 -20.614 1.00 52.27 ?  182 HIS A NE2 1 
ATOM   1436 N N   . ASP A 1 183 ? 3.831   -10.424 -21.318 1.00 42.52 ?  183 ASP A N   1 
ATOM   1437 C CA  . ASP A 1 183 ? 2.743   -10.560 -22.283 1.00 40.06 ?  183 ASP A CA  1 
ATOM   1438 C C   . ASP A 1 183 ? 1.387   -10.250 -21.648 1.00 37.02 ?  183 ASP A C   1 
ATOM   1439 O O   . ASP A 1 183 ? 0.535   -11.128 -21.504 1.00 38.06 ?  183 ASP A O   1 
ATOM   1440 C CB  . ASP A 1 183 ? 2.743   -11.977 -22.866 1.00 42.45 ?  183 ASP A CB  1 
ATOM   1441 C CG  . ASP A 1 183 ? 1.757   -12.140 -24.005 1.00 44.02 ?  183 ASP A CG  1 
ATOM   1442 O OD1 . ASP A 1 183 ? 1.789   -11.312 -24.939 1.00 45.80 ?  183 ASP A OD1 1 
ATOM   1443 O OD2 . ASP A 1 183 ? 0.957   -13.099 -23.971 1.00 46.00 -1 183 ASP A OD2 1 
ATOM   1444 N N   . PRO A 1 184 ? 1.171   -8.983  -21.261 1.00 34.50 ?  184 PRO A N   1 
ATOM   1445 C CA  . PRO A 1 184 ? -0.081  -8.557  -20.635 1.00 30.72 ?  184 PRO A CA  1 
ATOM   1446 C C   . PRO A 1 184 ? -1.233  -8.402  -21.621 1.00 29.14 ?  184 PRO A C   1 
ATOM   1447 O O   . PRO A 1 184 ? -1.027  -8.300  -22.832 1.00 28.84 ?  184 PRO A O   1 
ATOM   1448 C CB  . PRO A 1 184 ? 0.301   -7.228  -20.001 1.00 31.53 ?  184 PRO A CB  1 
ATOM   1449 C CG  . PRO A 1 184 ? 1.228   -6.660  -21.029 1.00 32.91 ?  184 PRO A CG  1 
ATOM   1450 C CD  . PRO A 1 184 ? 2.112   -7.852  -21.362 1.00 33.38 ?  184 PRO A CD  1 
ATOM   1451 N N   . ARG A 1 185 ? -2.447  -8.390  -21.084 1.00 25.74 ?  185 ARG A N   1 
ATOM   1452 C CA  . ARG A 1 185 ? -3.645  -8.218  -21.888 1.00 24.79 ?  185 ARG A CA  1 
ATOM   1453 C C   . ARG A 1 185 ? -3.748  -6.721  -22.158 1.00 24.17 ?  185 ARG A C   1 
ATOM   1454 O O   . ARG A 1 185 ? -3.587  -5.910  -21.245 1.00 22.22 ?  185 ARG A O   1 
ATOM   1455 C CB  . ARG A 1 185 ? -4.870  -8.700  -21.102 1.00 26.51 ?  185 ARG A CB  1 
ATOM   1456 C CG  . ARG A 1 185 ? -6.210  -8.513  -21.804 1.00 29.78 ?  185 ARG A CG  1 
ATOM   1457 C CD  . ARG A 1 185 ? -7.356  -8.749  -20.826 1.00 32.36 ?  185 ARG A CD  1 
ATOM   1458 N NE  . ARG A 1 185 ? -8.653  -8.353  -21.372 1.00 36.18 ?  185 ARG A NE  1 
ATOM   1459 C CZ  . ARG A 1 185 ? -9.702  -8.014  -20.628 1.00 37.68 ?  185 ARG A CZ  1 
ATOM   1460 N NH1 . ARG A 1 185 ? -9.610  -8.020  -19.303 1.00 37.93 1  185 ARG A NH1 1 
ATOM   1461 N NH2 . ARG A 1 185 ? -10.843 -7.660  -21.205 1.00 39.30 ?  185 ARG A NH2 1 
ATOM   1462 N N   . LEU A 1 186 ? -3.987  -6.354  -23.412 1.00 21.43 ?  186 LEU A N   1 
ATOM   1463 C CA  . LEU A 1 186 ? -4.116  -4.951  -23.777 1.00 21.63 ?  186 LEU A CA  1 
ATOM   1464 C C   . LEU A 1 186 ? -5.583  -4.646  -24.032 1.00 21.22 ?  186 LEU A C   1 
ATOM   1465 O O   . LEU A 1 186 ? -6.241  -5.322  -24.827 1.00 20.60 ?  186 LEU A O   1 
ATOM   1466 C CB  . LEU A 1 186 ? -3.289  -4.640  -25.028 1.00 20.05 ?  186 LEU A CB  1 
ATOM   1467 C CG  . LEU A 1 186 ? -1.777  -4.816  -24.884 1.00 22.29 ?  186 LEU A CG  1 
ATOM   1468 C CD1 . LEU A 1 186 ? -1.095  -4.523  -26.213 1.00 24.80 ?  186 LEU A CD1 1 
ATOM   1469 C CD2 . LEU A 1 186 ? -1.255  -3.882  -23.798 1.00 24.27 ?  186 LEU A CD2 1 
ATOM   1470 N N   . ILE A 1 187 ? -6.094  -3.633  -23.340 1.00 19.09 ?  187 ILE A N   1 
ATOM   1471 C CA  . ILE A 1 187 ? -7.484  -3.231  -23.476 1.00 18.53 ?  187 ILE A CA  1 
ATOM   1472 C C   . ILE A 1 187 ? -7.568  -1.788  -23.949 1.00 18.79 ?  187 ILE A C   1 
ATOM   1473 O O   . ILE A 1 187 ? -7.349  -0.859  -23.171 1.00 17.94 ?  187 ILE A O   1 
ATOM   1474 C CB  . ILE A 1 187 ? -8.237  -3.326  -22.131 1.00 19.70 ?  187 ILE A CB  1 
ATOM   1475 C CG1 . ILE A 1 187 ? -8.124  -4.738  -21.552 1.00 21.70 ?  187 ILE A CG1 1 
ATOM   1476 C CG2 . ILE A 1 187 ? -9.692  -2.947  -22.327 1.00 21.09 ?  187 ILE A CG2 1 
ATOM   1477 C CD1 . ILE A 1 187 ? -6.796  -5.033  -20.888 1.00 24.81 ?  187 ILE A CD1 1 
ATOM   1478 N N   . PRO A 1 188 ? -7.885  -1.577  -25.234 1.00 17.61 ?  188 PRO A N   1 
ATOM   1479 C CA  . PRO A 1 188 ? -7.985  -0.208  -25.742 1.00 18.54 ?  188 PRO A CA  1 
ATOM   1480 C C   . PRO A 1 188 ? -9.206  0.460   -25.126 1.00 18.12 ?  188 PRO A C   1 
ATOM   1481 O O   . PRO A 1 188 ? -10.252 -0.178  -24.977 1.00 20.59 ?  188 PRO A O   1 
ATOM   1482 C CB  . PRO A 1 188 ? -8.163  -0.402  -27.248 1.00 18.49 ?  188 PRO A CB  1 
ATOM   1483 C CG  . PRO A 1 188 ? -7.612  -1.777  -27.510 1.00 20.20 ?  188 PRO A CG  1 
ATOM   1484 C CD  . PRO A 1 188 ? -8.077  -2.556  -26.315 1.00 18.76 ?  188 PRO A CD  1 
ATOM   1485 N N   . LEU A 1 189 ? -9.080  1.729   -24.758 1.00 17.64 ?  189 LEU A N   1 
ATOM   1486 C CA  . LEU A 1 189 ? -10.213 2.447   -24.191 1.00 17.91 ?  189 LEU A CA  1 
ATOM   1487 C C   . LEU A 1 189 ? -10.665 3.577   -25.109 1.00 18.68 ?  189 LEU A C   1 
ATOM   1488 O O   . LEU A 1 189 ? -11.841 3.658   -25.472 1.00 18.57 ?  189 LEU A O   1 
ATOM   1489 C CB  . LEU A 1 189 ? -9.870  3.005   -22.802 1.00 18.49 ?  189 LEU A CB  1 
ATOM   1490 C CG  . LEU A 1 189 ? -9.636  1.984   -21.681 1.00 19.45 ?  189 LEU A CG  1 
ATOM   1491 C CD1 . LEU A 1 189 ? -9.467  2.727   -20.363 1.00 22.23 ?  189 LEU A CD1 1 
ATOM   1492 C CD2 . LEU A 1 189 ? -10.818 1.021   -21.588 1.00 22.83 ?  189 LEU A CD2 1 
ATOM   1493 N N   . LYS A 1 190 ? -9.736  4.440   -25.511 1.00 16.94 ?  190 LYS A N   1 
ATOM   1494 C CA  . LYS A 1 190 ? -10.105 5.555   -26.372 1.00 17.07 ?  190 LYS A CA  1 
ATOM   1495 C C   . LYS A 1 190 ? -8.906  6.217   -27.033 1.00 16.63 ?  190 LYS A C   1 
ATOM   1496 O O   . LYS A 1 190 ? -7.878  6.429   -26.390 1.00 17.16 ?  190 LYS A O   1 
ATOM   1497 C CB  . LYS A 1 190 ? -10.851 6.611   -25.551 1.00 18.02 ?  190 LYS A CB  1 
ATOM   1498 C CG  . LYS A 1 190 ? -11.527 7.698   -26.379 1.00 20.57 ?  190 LYS A CG  1 
ATOM   1499 C CD  . LYS A 1 190 ? -12.754 7.131   -27.080 1.00 25.61 ?  190 LYS A CD  1 
ATOM   1500 C CE  . LYS A 1 190 ? -13.539 8.202   -27.812 1.00 30.06 ?  190 LYS A CE  1 
ATOM   1501 N NZ  . LYS A 1 190 ? -14.794 7.637   -28.390 1.00 32.74 1  190 LYS A NZ  1 
ATOM   1502 N N   . THR A 1 191 ? -9.046  6.534   -28.317 1.00 15.40 ?  191 THR A N   1 
ATOM   1503 C CA  . THR A 1 191 ? -8.004  7.230   -29.067 1.00 15.74 ?  191 THR A CA  1 
ATOM   1504 C C   . THR A 1 191 ? -8.693  8.329   -29.863 1.00 16.86 ?  191 THR A C   1 
ATOM   1505 O O   . THR A 1 191 ? -9.592  8.058   -30.661 1.00 17.84 ?  191 THR A O   1 
ATOM   1506 C CB  . THR A 1 191 ? -7.267  6.309   -30.060 1.00 16.87 ?  191 THR A CB  1 
ATOM   1507 O OG1 . THR A 1 191 ? -6.693  5.203   -29.355 1.00 20.28 ?  191 THR A OG1 1 
ATOM   1508 C CG2 . THR A 1 191 ? -6.153  7.084   -30.768 1.00 17.17 ?  191 THR A CG2 1 
ATOM   1509 N N   . MET A 1 192 ? -8.279  9.570   -29.643 1.00 16.28 ?  192 MET A N   1 
ATOM   1510 C CA  . MET A 1 192 ? -8.880  10.690  -30.351 1.00 16.83 ?  192 MET A CA  1 
ATOM   1511 C C   . MET A 1 192 ? -7.834  11.694  -30.794 1.00 17.11 ?  192 MET A C   1 
ATOM   1512 O O   . MET A 1 192 ? -6.748  11.780  -30.216 1.00 16.59 ?  192 MET A O   1 
ATOM   1513 C CB  . MET A 1 192 ? -9.911  11.382  -29.459 1.00 19.36 ?  192 MET A CB  1 
ATOM   1514 C CG  . MET A 1 192 ? -11.088 10.509  -29.089 1.00 19.61 ?  192 MET A CG  1 
ATOM   1515 S SD  . MET A 1 192 ? -12.242 11.365  -28.005 1.00 22.52 ?  192 MET A SD  1 
ATOM   1516 C CE  . MET A 1 192 ? -13.096 12.388  -29.192 1.00 23.24 ?  192 MET A CE  1 
ATOM   1517 N N   . THR A 1 193 ? -8.165  12.455  -31.831 1.00 17.31 ?  193 THR A N   1 
ATOM   1518 C CA  . THR A 1 193 ? -7.255  13.467  -32.340 1.00 18.33 ?  193 THR A CA  1 
ATOM   1519 C C   . THR A 1 193 ? -7.954  14.815  -32.433 1.00 19.63 ?  193 THR A C   1 
ATOM   1520 O O   . THR A 1 193 ? -9.178  14.889  -32.531 1.00 21.02 ?  193 THR A O   1 
ATOM   1521 C CB  . THR A 1 193 ? -6.719  13.101  -33.741 1.00 19.84 ?  193 THR A CB  1 
ATOM   1522 O OG1 . THR A 1 193 ? -7.797  13.102  -34.687 1.00 22.95 ?  193 THR A OG1 1 
ATOM   1523 C CG2 . THR A 1 193 ? -6.075  11.725  -33.718 1.00 22.77 ?  193 THR A CG2 1 
ATOM   1524 N N   . SER A 1 194 ? -7.156  15.875  -32.380 1.00 19.17 ?  194 SER A N   1 
ATOM   1525 C CA  . SER A 1 194 ? -7.644  17.243  -32.485 1.00 20.69 ?  194 SER A CA  1 
ATOM   1526 C C   . SER A 1 194 ? -6.460  18.084  -32.937 1.00 21.99 ?  194 SER A C   1 
ATOM   1527 O O   . SER A 1 194 ? -5.336  17.587  -33.013 1.00 21.59 ?  194 SER A O   1 
ATOM   1528 C CB  . SER A 1 194 ? -8.166  17.749  -31.137 1.00 20.81 ?  194 SER A CB  1 
ATOM   1529 O OG  . SER A 1 194 ? -7.108  17.937  -30.214 1.00 23.72 ?  194 SER A OG  1 
ATOM   1530 N N   . ASP A 1 195 ? -6.707  19.356  -33.231 1.00 22.74 ?  195 ASP A N   1 
ATOM   1531 C CA  . ASP A 1 195 ? -5.652  20.251  -33.694 1.00 24.98 ?  195 ASP A CA  1 
ATOM   1532 C C   . ASP A 1 195 ? -4.587  20.538  -32.646 1.00 23.45 ?  195 ASP A C   1 
ATOM   1533 O O   . ASP A 1 195 ? -3.464  20.904  -32.987 1.00 25.01 ?  195 ASP A O   1 
ATOM   1534 C CB  . ASP A 1 195 ? -6.258  21.582  -34.155 1.00 28.87 ?  195 ASP A CB  1 
ATOM   1535 C CG  . ASP A 1 195 ? -7.115  21.435  -35.395 1.00 33.80 ?  195 ASP A CG  1 
ATOM   1536 O OD1 . ASP A 1 195 ? -7.849  22.392  -35.723 1.00 37.18 ?  195 ASP A OD1 1 
ATOM   1537 O OD2 . ASP A 1 195 ? -7.050  20.372  -36.047 1.00 35.95 -1 195 ASP A OD2 1 
ATOM   1538 N N   . ILE A 1 196 ? -4.932  20.371  -31.374 1.00 21.84 ?  196 ILE A N   1 
ATOM   1539 C CA  . ILE A 1 196 ? -3.986  20.659  -30.306 1.00 20.44 ?  196 ILE A CA  1 
ATOM   1540 C C   . ILE A 1 196 ? -3.455  19.424  -29.594 1.00 19.48 ?  196 ILE A C   1 
ATOM   1541 O O   . ILE A 1 196 ? -2.497  19.515  -28.829 1.00 17.97 ?  196 ILE A O   1 
ATOM   1542 C CB  . ILE A 1 196 ? -4.620  21.578  -29.240 1.00 23.55 ?  196 ILE A CB  1 
ATOM   1543 C CG1 . ILE A 1 196 ? -5.786  20.860  -28.556 1.00 23.03 ?  196 ILE A CG1 1 
ATOM   1544 C CG2 . ILE A 1 196 ? -5.117  22.862  -29.893 1.00 25.19 ?  196 ILE A CG2 1 
ATOM   1545 C CD1 . ILE A 1 196 ? -6.379  21.624  -27.388 1.00 28.24 ?  196 ILE A CD1 1 
ATOM   1546 N N   . LEU A 1 197 ? -4.055  18.269  -29.856 1.00 19.12 ?  197 LEU A N   1 
ATOM   1547 C CA  . LEU A 1 197 ? -3.622  17.064  -29.169 1.00 19.37 ?  197 LEU A CA  1 
ATOM   1548 C C   . LEU A 1 197 ? -4.158  15.769  -29.744 1.00 18.32 ?  197 LEU A C   1 
ATOM   1549 O O   . LEU A 1 197 ? -5.249  15.722  -30.304 1.00 19.63 ?  197 LEU A O   1 
ATOM   1550 C CB  . LEU A 1 197 ? -4.061  17.151  -27.704 1.00 22.61 ?  197 LEU A CB  1 
ATOM   1551 C CG  . LEU A 1 197 ? -4.229  15.850  -26.912 1.00 25.83 ?  197 LEU A CG  1 
ATOM   1552 C CD1 . LEU A 1 197 ? -2.924  15.510  -26.224 1.00 23.20 ?  197 LEU A CD1 1 
ATOM   1553 C CD2 . LEU A 1 197 ? -5.338  16.009  -25.882 1.00 27.28 ?  197 LEU A CD2 1 
ATOM   1554 N N   . LYS A 1 198 ? -3.355  14.720  -29.611 1.00 16.55 ?  198 LYS A N   1 
ATOM   1555 C CA  . LYS A 1 198 ? -3.754  13.383  -30.010 1.00 15.68 ?  198 LYS A CA  1 
ATOM   1556 C C   . LYS A 1 198 ? -3.494  12.617  -28.721 1.00 14.79 ?  198 LYS A C   1 
ATOM   1557 O O   . LYS A 1 198 ? -2.439  12.776  -28.101 1.00 15.00 ?  198 LYS A O   1 
ATOM   1558 C CB  . LYS A 1 198 ? -2.871  12.828  -31.126 1.00 17.53 ?  198 LYS A CB  1 
ATOM   1559 C CG  . LYS A 1 198 ? -2.978  13.580  -32.440 1.00 21.84 ?  198 LYS A CG  1 
ATOM   1560 C CD  . LYS A 1 198 ? -2.331  12.781  -33.560 1.00 25.94 ?  198 LYS A CD  1 
ATOM   1561 C CE  . LYS A 1 198 ? -2.372  13.534  -34.878 1.00 27.60 ?  198 LYS A CE  1 
ATOM   1562 N NZ  . LYS A 1 198 ? -1.811  12.713  -35.984 1.00 32.46 1  198 LYS A NZ  1 
ATOM   1563 N N   . MET A 1 199 ? -4.457  11.816  -28.291 1.00 13.67 ?  199 MET A N   1 
ATOM   1564 C CA  . MET A 1 199 ? -4.271  11.065  -27.063 1.00 14.02 ?  199 MET A CA  1 
ATOM   1565 C C   . MET A 1 199 ? -4.835  9.665   -27.206 1.00 15.03 ?  199 MET A C   1 
ATOM   1566 O O   . MET A 1 199 ? -5.861  9.462   -27.850 1.00 13.91 ?  199 MET A O   1 
ATOM   1567 C CB  . MET A 1 199 ? -4.939  11.800  -25.891 1.00 14.67 ?  199 MET A CB  1 
ATOM   1568 C CG  . MET A 1 199 ? -4.752  11.124  -24.533 1.00 14.47 ?  199 MET A CG  1 
ATOM   1569 S SD  . MET A 1 199 ? -5.025  12.260  -23.149 1.00 18.13 ?  199 MET A SD  1 
ATOM   1570 C CE  . MET A 1 199 ? -6.778  12.642  -23.366 1.00 18.32 ?  199 MET A CE  1 
ATOM   1571 N N   . GLN A 1 200 ? -4.142  8.697   -26.616 1.00 13.22 ?  200 GLN A N   1 
ATOM   1572 C CA  . GLN A 1 200 ? -4.576  7.314   -26.666 1.00 14.34 ?  200 GLN A CA  1 
ATOM   1573 C C   . GLN A 1 200 ? -4.489  6.728   -25.272 1.00 13.65 ?  200 GLN A C   1 
ATOM   1574 O O   . GLN A 1 200 ? -3.427  6.746   -24.646 1.00 14.85 ?  200 GLN A O   1 
ATOM   1575 C CB  . GLN A 1 200 ? -3.692  6.509   -27.620 1.00 15.19 ?  200 GLN A CB  1 
ATOM   1576 C CG  . GLN A 1 200 ? -4.063  5.038   -27.694 1.00 18.49 ?  200 GLN A CG  1 
ATOM   1577 C CD  . GLN A 1 200 ? -3.424  4.348   -28.886 1.00 21.40 ?  200 GLN A CD  1 
ATOM   1578 O OE1 . GLN A 1 200 ? -2.218  4.116   -28.910 1.00 23.39 ?  200 GLN A OE1 1 
ATOM   1579 N NE2 . GLN A 1 200 ? -4.234  4.035   -29.892 1.00 22.52 ?  200 GLN A NE2 1 
ATOM   1580 N N   . LEU A 1 201 ? -5.614  6.216   -24.791 1.00 11.93 ?  201 LEU A N   1 
ATOM   1581 C CA  . LEU A 1 201 ? -5.677  5.612   -23.471 1.00 12.71 ?  201 LEU A CA  1 
ATOM   1582 C C   . LEU A 1 201 ? -5.992  4.132   -23.585 1.00 13.51 ?  201 LEU A C   1 
ATOM   1583 O O   . LEU A 1 201 ? -6.932  3.742   -24.278 1.00 13.94 ?  201 LEU A O   1 
ATOM   1584 C CB  . LEU A 1 201 ? -6.766  6.282   -22.625 1.00 13.84 ?  201 LEU A CB  1 
ATOM   1585 C CG  . LEU A 1 201 ? -7.079  5.600   -21.287 1.00 13.20 ?  201 LEU A CG  1 
ATOM   1586 C CD1 . LEU A 1 201 ? -5.858  5.636   -20.370 1.00 13.67 ?  201 LEU A CD1 1 
ATOM   1587 C CD2 . LEU A 1 201 ? -8.257  6.306   -20.630 1.00 15.41 ?  201 LEU A CD2 1 
ATOM   1588 N N   . TYR A 1 202 ? -5.183  3.309   -22.929 1.00 12.48 ?  202 TYR A N   1 
ATOM   1589 C CA  . TYR A 1 202 ? -5.424  1.878   -22.917 1.00 13.78 ?  202 TYR A CA  1 
ATOM   1590 C C   . TYR A 1 202 ? -4.943  1.323   -21.595 1.00 15.65 ?  202 TYR A C   1 
ATOM   1591 O O   . TYR A 1 202 ? -4.233  1.995   -20.847 1.00 14.38 ?  202 TYR A O   1 
ATOM   1592 C CB  . TYR A 1 202 ? -4.722  1.162   -24.083 1.00 14.22 ?  202 TYR A CB  1 
ATOM   1593 C CG  . TYR A 1 202 ? -3.210  1.209   -24.084 1.00 15.03 ?  202 TYR A CG  1 
ATOM   1594 C CD1 . TYR A 1 202 ? -2.522  2.263   -24.686 1.00 16.42 ?  202 TYR A CD1 1 
ATOM   1595 C CD2 . TYR A 1 202 ? -2.465  0.176   -23.515 1.00 17.14 ?  202 TYR A CD2 1 
ATOM   1596 C CE1 . TYR A 1 202 ? -1.124  2.280   -24.723 1.00 17.53 ?  202 TYR A CE1 1 
ATOM   1597 C CE2 . TYR A 1 202 ? -1.072  0.184   -23.547 1.00 18.36 ?  202 TYR A CE2 1 
ATOM   1598 C CZ  . TYR A 1 202 ? -0.409  1.237   -24.154 1.00 18.37 ?  202 TYR A CZ  1 
ATOM   1599 O OH  . TYR A 1 202 ? 0.970   1.236   -24.208 1.00 22.10 ?  202 TYR A OH  1 
ATOM   1600 N N   . VAL A 1 203 ? -5.359  0.100   -21.295 1.00 14.35 ?  203 VAL A N   1 
ATOM   1601 C CA  . VAL A 1 203 ? -4.971  -0.544  -20.059 1.00 16.32 ?  203 VAL A CA  1 
ATOM   1602 C C   . VAL A 1 203 ? -4.168  -1.800  -20.341 1.00 18.24 ?  203 VAL A C   1 
ATOM   1603 O O   . VAL A 1 203 ? -4.457  -2.532  -21.289 1.00 18.15 ?  203 VAL A O   1 
ATOM   1604 C CB  . VAL A 1 203 ? -6.211  -0.951  -19.227 1.00 16.99 ?  203 VAL A CB  1 
ATOM   1605 C CG1 . VAL A 1 203 ? -5.775  -1.618  -17.930 1.00 19.68 ?  203 VAL A CG1 1 
ATOM   1606 C CG2 . VAL A 1 203 ? -7.070  0.266   -18.943 1.00 20.50 ?  203 VAL A CG2 1 
ATOM   1607 N N   . GLU A 1 204 ? -3.135  -2.019  -19.537 1.00 18.64 ?  204 GLU A N   1 
ATOM   1608 C CA  . GLU A 1 204 ? -2.331  -3.225  -19.639 1.00 21.88 ?  204 GLU A CA  1 
ATOM   1609 C C   . GLU A 1 204 ? -2.703  -3.974  -18.373 1.00 23.48 ?  204 GLU A C   1 
ATOM   1610 O O   . GLU A 1 204 ? -2.587  -3.437  -17.270 1.00 23.30 ?  204 GLU A O   1 
ATOM   1611 C CB  . GLU A 1 204 ? -0.834  -2.916  -19.634 1.00 21.75 ?  204 GLU A CB  1 
ATOM   1612 C CG  . GLU A 1 204 ? -0.353  -2.130  -20.835 1.00 29.65 ?  204 GLU A CG  1 
ATOM   1613 C CD  . GLU A 1 204 ? 1.136   -2.293  -21.075 1.00 32.81 ?  204 GLU A CD  1 
ATOM   1614 O OE1 . GLU A 1 204 ? 1.919   -2.110  -20.121 1.00 35.86 ?  204 GLU A OE1 1 
ATOM   1615 O OE2 . GLU A 1 204 ? 1.523   -2.603  -22.222 1.00 37.73 -1 204 GLU A OE2 1 
ATOM   1616 N N   . GLU A 1 205 ? -3.175  -5.203  -18.527 1.00 23.37 ?  205 GLU A N   1 
ATOM   1617 C CA  . GLU A 1 205 ? -3.575  -5.990  -17.374 1.00 24.92 ?  205 GLU A CA  1 
ATOM   1618 C C   . GLU A 1 205 ? -2.735  -7.254  -17.275 1.00 26.89 ?  205 GLU A C   1 
ATOM   1619 O O   . GLU A 1 205 ? -2.528  -7.953  -18.270 1.00 24.55 ?  205 GLU A O   1 
ATOM   1620 C CB  . GLU A 1 205 ? -5.060  -6.336  -17.483 1.00 26.51 ?  205 GLU A CB  1 
ATOM   1621 C CG  . GLU A 1 205 ? -5.602  -7.159  -16.332 1.00 29.74 ?  205 GLU A CG  1 
ATOM   1622 C CD  . GLU A 1 205 ? -7.071  -7.483  -16.502 1.00 32.45 ?  205 GLU A CD  1 
ATOM   1623 O OE1 . GLU A 1 205 ? -7.442  -8.000  -17.577 1.00 34.16 ?  205 GLU A OE1 1 
ATOM   1624 O OE2 . GLU A 1 205 ? -7.854  -7.225  -15.563 1.00 32.61 -1 205 GLU A OE2 1 
ATOM   1625 N N   . ARG A 1 206 ? -2.242  -7.533  -16.071 1.00 26.67 ?  206 ARG A N   1 
ATOM   1626 C CA  . ARG A 1 206 ? -1.420  -8.710  -15.830 1.00 30.37 ?  206 ARG A CA  1 
ATOM   1627 C C   . ARG A 1 206 ? -2.167  -9.967  -16.255 1.00 31.18 ?  206 ARG A C   1 
ATOM   1628 O O   . ARG A 1 206 ? -3.349  -10.131 -15.950 1.00 30.46 ?  206 ARG A O   1 
ATOM   1629 C CB  . ARG A 1 206 ? -1.047  -8.800  -14.348 1.00 32.05 ?  206 ARG A CB  1 
ATOM   1630 C CG  . ARG A 1 206 ? -0.241  -10.033 -13.989 1.00 37.36 ?  206 ARG A CG  1 
ATOM   1631 C CD  . ARG A 1 206 ? 0.146   -10.042 -12.517 1.00 40.25 ?  206 ARG A CD  1 
ATOM   1632 N NE  . ARG A 1 206 ? 0.802   -11.294 -12.145 1.00 45.27 ?  206 ARG A NE  1 
ATOM   1633 C CZ  . ARG A 1 206 ? 1.269   -11.566 -10.931 1.00 46.47 ?  206 ARG A CZ  1 
ATOM   1634 N NH1 . ARG A 1 206 ? 1.158   -10.671 -9.958  1.00 48.06 1  206 ARG A NH1 1 
ATOM   1635 N NH2 . ARG A 1 206 ? 1.842   -12.737 -10.688 1.00 47.83 ?  206 ARG A NH2 1 
ATOM   1636 N N   . ALA A 1 207 ? -1.470  -10.849 -16.964 1.00 33.54 ?  207 ALA A N   1 
ATOM   1637 C CA  . ALA A 1 207 ? -2.063  -12.092 -17.437 1.00 35.61 ?  207 ALA A CA  1 
ATOM   1638 C C   . ALA A 1 207 ? -1.127  -13.266 -17.173 1.00 36.41 ?  207 ALA A C   1 
ATOM   1639 O O   . ALA A 1 207 ? 0.072   -13.081 -16.960 1.00 39.25 ?  207 ALA A O   1 
ATOM   1640 C CB  . ALA A 1 207 ? -2.369  -11.988 -18.928 1.00 35.75 ?  207 ALA A CB  1 
ATOM   1641 N N   . SER B 2 4   ? 12.468  6.647   -25.921 1.00 47.24 ?  330 SER B N   1 
ATOM   1642 C CA  . SER B 2 4   ? 12.052  7.715   -25.019 1.00 47.25 ?  330 SER B CA  1 
ATOM   1643 C C   . SER B 2 4   ? 12.862  7.688   -23.725 1.00 46.19 ?  330 SER B C   1 
ATOM   1644 O O   . SER B 2 4   ? 13.489  6.681   -23.394 1.00 47.39 ?  330 SER B O   1 
ATOM   1645 C CB  . SER B 2 4   ? 10.559  7.582   -24.697 1.00 47.88 ?  330 SER B CB  1 
ATOM   1646 O OG  . SER B 2 4   ? 10.273  6.344   -24.068 1.00 50.59 ?  330 SER B OG  1 
ATOM   1647 N N   . SER B 2 5   ? 12.847  8.802   -23.000 1.00 44.26 ?  331 SER B N   1 
ATOM   1648 C CA  . SER B 2 5   ? 13.572  8.906   -21.740 1.00 40.85 ?  331 SER B CA  1 
ATOM   1649 C C   . SER B 2 5   ? 12.713  8.426   -20.578 1.00 38.22 ?  331 SER B C   1 
ATOM   1650 O O   . SER B 2 5   ? 11.508  8.678   -20.530 1.00 35.12 ?  331 SER B O   1 
ATOM   1651 C CB  . SER B 2 5   ? 14.003  10.352  -21.495 1.00 43.07 ?  331 SER B CB  1 
ATOM   1652 O OG  . SER B 2 5   ? 14.568  10.504  -20.203 1.00 45.22 ?  331 SER B OG  1 
ATOM   1653 N N   . GLY B 2 6   ? 13.345  7.732   -19.639 1.00 35.09 ?  332 GLY B N   1 
ATOM   1654 C CA  . GLY B 2 6   ? 12.623  7.223   -18.492 1.00 31.87 ?  332 GLY B CA  1 
ATOM   1655 C C   . GLY B 2 6   ? 12.352  5.739   -18.621 1.00 30.18 ?  332 GLY B C   1 
ATOM   1656 O O   . GLY B 2 6   ? 13.128  5.021   -19.256 1.00 30.95 ?  332 GLY B O   1 
ATOM   1657 N N   . PRO B 2 7   ? 11.238  5.250   -18.055 1.00 27.26 ?  333 PRO B N   1 
ATOM   1658 C CA  . PRO B 2 7   ? 10.260  6.062   -17.323 1.00 24.78 ?  333 PRO B CA  1 
ATOM   1659 C C   . PRO B 2 7   ? 10.753  6.618   -15.992 1.00 22.07 ?  333 PRO B C   1 
ATOM   1660 O O   . PRO B 2 7   ? 11.618  6.032   -15.335 1.00 22.93 ?  333 PRO B O   1 
ATOM   1661 C CB  . PRO B 2 7   ? 9.090   5.103   -17.142 1.00 26.09 ?  333 PRO B CB  1 
ATOM   1662 C CG  . PRO B 2 7   ? 9.777   3.785   -16.984 1.00 28.16 ?  333 PRO B CG  1 
ATOM   1663 C CD  . PRO B 2 7   ? 10.824  3.836   -18.080 1.00 27.58 ?  333 PRO B CD  1 
ATOM   1664 N N   . TRP B 2 8   ? 10.194  7.760   -15.612 1.00 17.26 ?  334 TRP B N   1 
ATOM   1665 C CA  . TRP B 2 8   ? 10.525  8.417   -14.354 1.00 16.53 ?  334 TRP B CA  1 
ATOM   1666 C C   . TRP B 2 8   ? 9.346   8.289   -13.402 1.00 16.05 ?  334 TRP B C   1 
ATOM   1667 O O   . TRP B 2 8   ? 8.193   8.310   -13.833 1.00 15.61 ?  334 TRP B O   1 
ATOM   1668 C CB  . TRP B 2 8   ? 10.786  9.908   -14.564 1.00 17.07 ?  334 TRP B CB  1 
ATOM   1669 C CG  . TRP B 2 8   ? 11.950  10.202  -15.416 1.00 17.83 ?  334 TRP B CG  1 
ATOM   1670 C CD1 . TRP B 2 8   ? 11.976  10.285  -16.778 1.00 20.26 ?  334 TRP B CD1 1 
ATOM   1671 C CD2 . TRP B 2 8   ? 13.288  10.427  -14.971 1.00 19.61 ?  334 TRP B CD2 1 
ATOM   1672 N NE1 . TRP B 2 8   ? 13.254  10.549  -17.209 1.00 21.10 ?  334 TRP B NE1 1 
ATOM   1673 C CE2 . TRP B 2 8   ? 14.079  10.640  -16.120 1.00 20.39 ?  334 TRP B CE2 1 
ATOM   1674 C CE3 . TRP B 2 8   ? 13.898  10.467  -13.708 1.00 21.20 ?  334 TRP B CE3 1 
ATOM   1675 C CZ2 . TRP B 2 8   ? 15.455  10.891  -16.045 1.00 22.67 ?  334 TRP B CZ2 1 
ATOM   1676 C CZ3 . TRP B 2 8   ? 15.264  10.716  -13.634 1.00 23.11 ?  334 TRP B CZ3 1 
ATOM   1677 C CH2 . TRP B 2 8   ? 16.026  10.925  -14.798 1.00 22.32 ?  334 TRP B CH2 1 
ATOM   1678 N N   . LYS B 2 9   ? 9.631   8.173   -12.110 1.00 14.65 ?  335 LYS B N   1 
ATOM   1679 C CA  . LYS B 2 9   ? 8.570   8.077   -11.111 1.00 14.00 ?  335 LYS B CA  1 
ATOM   1680 C C   . LYS B 2 9   ? 8.932   8.938   -9.908  1.00 14.98 ?  335 LYS B C   1 
ATOM   1681 O O   . LYS B 2 9   ? 10.102  9.261   -9.695  1.00 14.22 ?  335 LYS B O   1 
ATOM   1682 C CB  . LYS B 2 9   ? 8.372   6.624   -10.657 1.00 14.82 ?  335 LYS B CB  1 
ATOM   1683 C CG  . LYS B 2 9   ? 9.525   6.065   -9.829  1.00 17.68 ?  335 LYS B CG  1 
ATOM   1684 C CD  . LYS B 2 9   ? 9.200   4.680   -9.278  1.00 21.21 ?  335 LYS B CD  1 
ATOM   1685 C CE  . LYS B 2 9   ? 10.336  4.165   -8.407  1.00 26.06 ?  335 LYS B CE  1 
ATOM   1686 N NZ  . LYS B 2 9   ? 10.020  2.837   -7.804  1.00 27.91 1  335 LYS B NZ  1 
ATOM   1687 N N   . PRO B 2 10  ? 7.931   9.353   -9.119  1.00 14.11 ?  336 PRO B N   1 
ATOM   1688 C CA  . PRO B 2 10  ? 8.248   10.174  -7.946  1.00 13.55 ?  336 PRO B CA  1 
ATOM   1689 C C   . PRO B 2 10  ? 9.074   9.354   -6.960  1.00 12.67 ?  336 PRO B C   1 
ATOM   1690 O O   . PRO B 2 10  ? 8.832   8.164   -6.789  1.00 14.31 ?  336 PRO B O   1 
ATOM   1691 C CB  . PRO B 2 10  ? 6.874   10.496  -7.367  1.00 14.72 ?  336 PRO B CB  1 
ATOM   1692 C CG  . PRO B 2 10  ? 5.997   10.543  -8.595  1.00 13.51 ?  336 PRO B CG  1 
ATOM   1693 C CD  . PRO B 2 10  ? 6.479   9.338   -9.379  1.00 15.13 ?  336 PRO B CD  1 
ATOM   1694 N N   . ALA B 2 11  ? 10.042  9.994   -6.310  1.00 15.22 ?  337 ALA B N   1 
ATOM   1695 C CA  . ALA B 2 11  ? 10.850  9.296   -5.314  1.00 15.55 ?  337 ALA B CA  1 
ATOM   1696 C C   . ALA B 2 11  ? 9.970   9.108   -4.075  1.00 16.69 ?  337 ALA B C   1 
ATOM   1697 O O   . ALA B 2 11  ? 10.161  8.171   -3.289  1.00 17.69 ?  337 ALA B O   1 
ATOM   1698 C CB  . ALA B 2 11  ? 12.083  10.118  -4.966  1.00 15.91 ?  337 ALA B CB  1 
ATOM   1699 N N   . LYS B 2 12  ? 8.997   10.004  -3.915  1.00 15.12 ?  338 LYS B N   1 
ATOM   1700 C CA  . LYS B 2 12  ? 8.059   9.951   -2.796  1.00 14.51 ?  338 LYS B CA  1 
ATOM   1701 C C   . LYS B 2 12  ? 6.914   9.010   -3.182  1.00 15.09 ?  338 LYS B C   1 
ATOM   1702 O O   . LYS B 2 12  ? 6.281   9.192   -4.225  1.00 15.84 ?  338 LYS B O   1 
ATOM   1703 C CB  . LYS B 2 12  ? 7.504   11.353  -2.521  1.00 12.91 ?  338 LYS B CB  1 
ATOM   1704 C CG  . LYS B 2 12  ? 6.556   11.445  -1.332  1.00 14.05 ?  338 LYS B CG  1 
ATOM   1705 C CD  . LYS B 2 12  ? 5.909   12.826  -1.220  1.00 13.91 ?  338 LYS B CD  1 
ATOM   1706 C CE  . LYS B 2 12  ? 6.932   13.951  -1.149  1.00 13.84 ?  338 LYS B CE  1 
ATOM   1707 N NZ  . LYS B 2 12  ? 6.277   15.280  -0.942  1.00 16.16 1  338 LYS B NZ  1 
ATOM   1708 N N   . PRO B 2 13  ? 6.646   7.981   -2.361  1.00 15.02 ?  339 PRO B N   1 
ATOM   1709 C CA  . PRO B 2 13  ? 5.561   7.051   -2.683  1.00 15.54 ?  339 PRO B CA  1 
ATOM   1710 C C   . PRO B 2 13  ? 4.216   7.682   -2.349  1.00 14.21 ?  339 PRO B C   1 
ATOM   1711 O O   . PRO B 2 13  ? 4.147   8.611   -1.542  1.00 15.84 ?  339 PRO B O   1 
ATOM   1712 C CB  . PRO B 2 13  ? 5.869   5.852   -1.795  1.00 16.83 ?  339 PRO B CB  1 
ATOM   1713 C CG  . PRO B 2 13  ? 6.408   6.513   -0.558  1.00 18.02 ?  339 PRO B CG  1 
ATOM   1714 C CD  . PRO B 2 13  ? 7.337   7.573   -1.121  1.00 16.19 ?  339 PRO B CD  1 
ATOM   1715 N N   . ALA B 2 14  ? 3.150   7.190   -2.974  1.00 15.82 ?  340 ALA B N   1 
ATOM   1716 C CA  . ALA B 2 14  ? 1.825   7.725   -2.697  1.00 15.01 ?  340 ALA B CA  1 
ATOM   1717 C C   . ALA B 2 14  ? 1.532   7.516   -1.218  1.00 14.85 ?  340 ALA B C   1 
ATOM   1718 O O   . ALA B 2 14  ? 1.921   6.502   -0.626  1.00 16.65 ?  340 ALA B O   1 
ATOM   1719 C CB  . ALA B 2 14  ? 0.778   7.018   -3.542  1.00 15.09 ?  340 ALA B CB  1 
ATOM   1720 N N   . PRO B 2 15  ? 0.838   8.474   -0.601  1.00 15.66 ?  341 PRO B N   1 
ATOM   1721 C CA  . PRO B 2 15  ? 0.519   8.355   0.820   1.00 15.89 ?  341 PRO B CA  1 
ATOM   1722 C C   . PRO B 2 15  ? -0.521  7.294   1.114   1.00 17.60 ?  341 PRO B C   1 
ATOM   1723 O O   . PRO B 2 15  ? -1.441  7.071   0.329   1.00 18.26 ?  341 PRO B O   1 
ATOM   1724 C CB  . PRO B 2 15  ? 0.026   9.751   1.176   1.00 15.93 ?  341 PRO B CB  1 
ATOM   1725 C CG  . PRO B 2 15  ? -0.676  10.174  -0.087  1.00 16.96 ?  341 PRO B CG  1 
ATOM   1726 C CD  . PRO B 2 15  ? 0.289   9.720   -1.167  1.00 15.67 ?  341 PRO B CD  1 
ATOM   1727 N N   . SER B 2 16  ? -0.355  6.619   2.242   1.00 17.03 ?  342 SER B N   1 
ATOM   1728 C CA  . SER B 2 16  ? -1.332  5.629   2.657   1.00 18.94 ?  342 SER B CA  1 
ATOM   1729 C C   . SER B 2 16  ? -2.413  6.420   3.396   1.00 20.53 ?  342 SER B C   1 
ATOM   1730 O O   . SER B 2 16  ? -2.216  7.595   3.718   1.00 20.95 ?  342 SER B O   1 
ATOM   1731 C CB  . SER B 2 16  ? -0.684  4.585   3.575   1.00 19.44 ?  342 SER B CB  1 
ATOM   1732 O OG  . SER B 2 16  ? 0.201   5.183   4.499   1.00 24.03 ?  342 SER B OG  1 
ATOM   1733 N N   . VAL B 2 17  ? -3.555  5.785   3.640   1.00 21.18 ?  343 VAL B N   1 
ATOM   1734 C CA  . VAL B 2 17  ? -4.675  6.418   4.330   1.00 24.27 ?  343 VAL B CA  1 
ATOM   1735 C C   . VAL B 2 17  ? -4.194  7.180   5.562   1.00 23.96 ?  343 VAL B C   1 
ATOM   1736 O O   . VAL B 2 17  ? -4.578  8.333   5.797   1.00 23.74 ?  343 VAL B O   1 
ATOM   1737 C CB  . VAL B 2 17  ? -5.707  5.355   4.755   1.00 25.63 ?  343 VAL B CB  1 
ATOM   1738 C CG1 . VAL B 2 17  ? -6.942  6.024   5.309   1.00 30.05 ?  343 VAL B CG1 1 
ATOM   1739 C CG2 . VAL B 2 17  ? -6.055  4.476   3.565   1.00 31.23 ?  343 VAL B CG2 1 
ATOM   1740 N N   . SER B 2 18  ? -3.367  6.511   6.356   1.00 23.80 ?  344 SER B N   1 
ATOM   1741 C CA  . SER B 2 18  ? -2.764  7.098   7.548   1.00 25.63 ?  344 SER B CA  1 
ATOM   1742 C C   . SER B 2 18  ? -1.265  7.061   7.245   1.00 24.68 ?  344 SER B C   1 
ATOM   1743 O O   . SER B 2 18  ? -0.786  6.123   6.609   1.00 25.50 ?  344 SER B O   1 
ATOM   1744 C CB  . SER B 2 18  ? -3.081  6.250   8.783   1.00 26.71 ?  344 SER B CB  1 
ATOM   1745 O OG  . SER B 2 18  ? -4.481  6.152   8.983   1.00 31.66 ?  344 SER B OG  1 
ATOM   1746 N N   . PRO B 2 19  ? -0.502  8.071   7.699   1.00 25.89 ?  345 PRO B N   1 
ATOM   1747 C CA  . PRO B 2 19  ? 0.943   8.105   7.436   1.00 25.06 ?  345 PRO B CA  1 
ATOM   1748 C C   . PRO B 2 19  ? 1.707   6.799   7.648   1.00 24.60 ?  345 PRO B C   1 
ATOM   1749 O O   . PRO B 2 19  ? 1.494   6.089   8.633   1.00 23.29 ?  345 PRO B O   1 
ATOM   1750 C CB  . PRO B 2 19  ? 1.439   9.232   8.348   1.00 27.01 ?  345 PRO B CB  1 
ATOM   1751 C CG  . PRO B 2 19  ? 0.406   9.275   9.449   1.00 29.89 ?  345 PRO B CG  1 
ATOM   1752 C CD  . PRO B 2 19  ? -0.876  9.107   8.676   1.00 27.04 ?  345 PRO B CD  1 
ATOM   1753 N N   . GLY B 2 20  ? 2.603   6.503   6.708   1.00 22.72 ?  346 GLY B N   1 
ATOM   1754 C CA  . GLY B 2 20  ? 3.407   5.297   6.775   1.00 22.31 ?  346 GLY B CA  1 
ATOM   1755 C C   . GLY B 2 20  ? 4.499   5.357   7.828   1.00 22.94 ?  346 GLY B C   1 
ATOM   1756 O O   . GLY B 2 20  ? 4.633   6.358   8.533   1.00 22.26 ?  346 GLY B O   1 
ATOM   1757 N N   . PRO B 2 21  ? 5.311   4.295   7.946   1.00 22.53 ?  347 PRO B N   1 
ATOM   1758 C CA  . PRO B 2 21  ? 6.404   4.199   8.918   1.00 22.71 ?  347 PRO B CA  1 
ATOM   1759 C C   . PRO B 2 21  ? 7.659   4.986   8.557   1.00 21.82 ?  347 PRO B C   1 
ATOM   1760 O O   . PRO B 2 21  ? 7.807   5.477   7.437   1.00 22.63 ?  347 PRO B O   1 
ATOM   1761 C CB  . PRO B 2 21  ? 6.670   2.700   8.968   1.00 23.62 ?  347 PRO B CB  1 
ATOM   1762 C CG  . PRO B 2 21  ? 6.491   2.310   7.543   1.00 25.68 ?  347 PRO B CG  1 
ATOM   1763 C CD  . PRO B 2 21  ? 5.228   3.064   7.137   1.00 24.76 ?  347 PRO B CD  1 
ATOM   1764 N N   . TRP B 2 22  ? 8.567   5.087   9.523   1.00 20.84 ?  348 TRP B N   1 
ATOM   1765 C CA  . TRP B 2 22  ? 9.828   5.791   9.324   1.00 20.54 ?  348 TRP B CA  1 
ATOM   1766 C C   . TRP B 2 22  ? 10.840  4.869   8.662   1.00 20.71 ?  348 TRP B C   1 
ATOM   1767 O O   . TRP B 2 22  ? 11.340  3.935   9.292   1.00 23.95 ?  348 TRP B O   1 
ATOM   1768 C CB  . TRP B 2 22  ? 10.393  6.265   10.663  1.00 17.91 ?  348 TRP B CB  1 
ATOM   1769 C CG  . TRP B 2 22  ? 11.650  7.061   10.500  1.00 17.70 ?  348 TRP B CG  1 
ATOM   1770 C CD1 . TRP B 2 22  ? 12.937  6.619   10.643  1.00 17.30 ?  348 TRP B CD1 1 
ATOM   1771 C CD2 . TRP B 2 22  ? 11.736  8.425   10.093  1.00 16.02 ?  348 TRP B CD2 1 
ATOM   1772 N NE1 . TRP B 2 22  ? 13.822  7.634   10.346  1.00 15.95 ?  348 TRP B NE1 1 
ATOM   1773 C CE2 . TRP B 2 22  ? 13.108  8.753   10.005  1.00 16.96 ?  348 TRP B CE2 1 
ATOM   1774 C CE3 . TRP B 2 22  ? 10.783  9.408   9.794   1.00 17.34 ?  348 TRP B CE3 1 
ATOM   1775 C CZ2 . TRP B 2 22  ? 13.549  10.026  9.628   1.00 15.83 ?  348 TRP B CZ2 1 
ATOM   1776 C CZ3 . TRP B 2 22  ? 11.220  10.670  9.422   1.00 16.82 ?  348 TRP B CZ3 1 
ATOM   1777 C CH2 . TRP B 2 22  ? 12.591  10.968  9.341   1.00 15.02 ?  348 TRP B CH2 1 
ATOM   1778 N N   . LYS B 2 23  ? 11.141  5.133   7.393   1.00 21.97 ?  349 LYS B N   1 
ATOM   1779 C CA  . LYS B 2 23  ? 12.103  4.327   6.644   1.00 23.21 ?  349 LYS B CA  1 
ATOM   1780 C C   . LYS B 2 23  ? 12.702  5.155   5.505   1.00 21.47 ?  349 LYS B C   1 
ATOM   1781 O O   . LYS B 2 23  ? 12.289  5.032   4.345   1.00 20.30 ?  349 LYS B O   1 
ATOM   1782 C CB  . LYS B 2 23  ? 11.415  3.084   6.075   1.00 26.03 ?  349 LYS B CB  1 
ATOM   1783 C CG  . LYS B 2 23  ? 12.360  2.105   5.396   1.00 29.41 ?  349 LYS B CG  1 
ATOM   1784 C CD  . LYS B 2 23  ? 13.294  1.453   6.400   1.00 33.87 ?  349 LYS B CD  1 
ATOM   1785 C CE  . LYS B 2 23  ? 14.184  0.414   5.732   1.00 36.61 ?  349 LYS B CE  1 
ATOM   1786 N NZ  . LYS B 2 23  ? 15.019  -0.314  6.729   1.00 38.70 1  349 LYS B NZ  1 
ATOM   1787 N N   . PRO B 2 24  ? 13.689  6.010   5.823   1.00 21.62 ?  350 PRO B N   1 
ATOM   1788 C CA  . PRO B 2 24  ? 14.352  6.872   4.835   1.00 21.21 ?  350 PRO B CA  1 
ATOM   1789 C C   . PRO B 2 24  ? 15.051  6.128   3.698   1.00 23.83 ?  350 PRO B C   1 
ATOM   1790 O O   . PRO B 2 24  ? 15.112  6.628   2.576   1.00 24.34 ?  350 PRO B O   1 
ATOM   1791 C CB  . PRO B 2 24  ? 15.347  7.674   5.679   1.00 22.70 ?  350 PRO B CB  1 
ATOM   1792 C CG  . PRO B 2 24  ? 14.731  7.684   7.035   1.00 20.88 ?  350 PRO B CG  1 
ATOM   1793 C CD  . PRO B 2 24  ? 14.210  6.278   7.175   1.00 20.06 ?  350 PRO B CD  1 
ATOM   1794 N N   . ILE B 2 25  ? 15.595  4.951   3.988   1.00 25.04 ?  351 ILE B N   1 
ATOM   1795 C CA  . ILE B 2 25  ? 16.282  4.179   2.959   1.00 28.84 ?  351 ILE B CA  1 
ATOM   1796 C C   . ILE B 2 25  ? 15.778  2.741   2.899   1.00 29.53 ?  351 ILE B C   1 
ATOM   1797 O O   . ILE B 2 25  ? 15.076  2.412   1.919   1.00 33.59 ?  351 ILE B O   1 
ATOM   1798 C CB  . ILE B 2 25  ? 17.810  4.176   3.198   1.00 29.53 ?  351 ILE B CB  1 
ATOM   1799 C CG1 . ILE B 2 25  ? 18.323  5.620   3.245   1.00 30.71 ?  351 ILE B CG1 1 
ATOM   1800 C CG2 . ILE B 2 25  ? 18.518  3.408   2.081   1.00 30.73 ?  351 ILE B CG2 1 
ATOM   1801 C CD1 . ILE B 2 25  ? 19.824  5.746   3.359   1.00 32.50 ?  351 ILE B CD1 1 
HETATM 1802 O O   . HOH C 3 .   ? -21.605 15.672  -4.398  1.00 19.83 ?  301 HOH A O   1 
HETATM 1803 O O   . HOH C 3 .   ? 3.639   5.149   -4.941  1.00 24.89 ?  302 HOH A O   1 
HETATM 1804 O O   . HOH C 3 .   ? -18.265 8.882   -3.968  1.00 25.66 ?  303 HOH A O   1 
HETATM 1805 O O   . HOH C 3 .   ? -9.098  20.010  -17.950 1.00 18.44 ?  304 HOH A O   1 
HETATM 1806 O O   . HOH C 3 .   ? -0.823  22.268  -5.543  1.00 27.97 ?  305 HOH A O   1 
HETATM 1807 O O   . HOH C 3 .   ? 8.757   12.754  -5.096  1.00 20.72 ?  306 HOH A O   1 
HETATM 1808 O O   . HOH C 3 .   ? -6.873  -1.588  -6.749  1.00 27.40 ?  307 HOH A O   1 
HETATM 1809 O O   . HOH C 3 .   ? 4.230   7.599   -7.704  1.00 27.06 ?  308 HOH A O   1 
HETATM 1810 O O   . HOH C 3 .   ? 4.292   19.479  -1.144  1.00 26.23 ?  309 HOH A O   1 
HETATM 1811 O O   . HOH C 3 .   ? -0.760  21.232  -27.650 1.00 15.53 ?  310 HOH A O   1 
HETATM 1812 O O   . HOH C 3 .   ? 3.720   15.510  -2.060  1.00 20.88 ?  311 HOH A O   1 
HETATM 1813 O O   . HOH C 3 .   ? -5.302  16.336  -6.532  1.00 13.84 ?  312 HOH A O   1 
HETATM 1814 O O   . HOH C 3 .   ? -12.494 12.007  -11.044 1.00 14.22 ?  313 HOH A O   1 
HETATM 1815 O O   . HOH C 3 .   ? 2.158   -1.990  -3.286  1.00 28.74 ?  314 HOH A O   1 
HETATM 1816 O O   . HOH C 3 .   ? -16.396 7.735   -24.403 1.00 27.81 ?  315 HOH A O   1 
HETATM 1817 O O   . HOH C 3 .   ? -18.598 9.661   -15.647 1.00 28.87 ?  316 HOH A O   1 
HETATM 1818 O O   . HOH C 3 .   ? -21.396 18.470  -3.883  1.00 19.54 ?  317 HOH A O   1 
HETATM 1819 O O   . HOH C 3 .   ? 4.185   16.302  -25.307 1.00 17.84 ?  318 HOH A O   1 
HETATM 1820 O O   . HOH C 3 .   ? 4.288   15.125  -29.327 1.00 18.89 ?  319 HOH A O   1 
HETATM 1821 O O   . HOH C 3 .   ? 1.059   22.620  -24.881 1.00 18.24 ?  320 HOH A O   1 
HETATM 1822 O O   . HOH C 3 .   ? -9.406  0.632   -1.106  1.00 26.35 ?  321 HOH A O   1 
HETATM 1823 O O   . HOH C 3 .   ? -13.065 3.218   -4.327  1.00 23.27 ?  322 HOH A O   1 
HETATM 1824 O O   . HOH C 3 .   ? -18.317 8.122   -0.639  1.00 27.09 ?  323 HOH A O   1 
HETATM 1825 O O   . HOH C 3 .   ? 9.683   25.192  -25.549 1.00 25.89 ?  324 HOH A O   1 
HETATM 1826 O O   . HOH C 3 .   ? 4.852   13.072  -27.626 1.00 18.94 ?  325 HOH A O   1 
HETATM 1827 O O   . HOH C 3 .   ? -0.243  31.486  -28.093 1.00 26.19 ?  326 HOH A O   1 
HETATM 1828 O O   . HOH C 3 .   ? -10.987 4.963   -29.927 1.00 21.26 ?  327 HOH A O   1 
HETATM 1829 O O   . HOH C 3 .   ? -15.652 3.117   1.966   1.00 26.58 ?  328 HOH A O   1 
HETATM 1830 O O   . HOH C 3 .   ? -20.519 11.189  -3.496  1.00 22.34 ?  329 HOH A O   1 
HETATM 1831 O O   . HOH C 3 .   ? 8.013   20.138  -30.369 1.00 27.14 ?  330 HOH A O   1 
HETATM 1832 O O   . HOH D 3 .   ? 16.290  6.846   0.181   1.00 26.06 ?  401 HOH B O   1 
HETATM 1833 O O   . HOH D 3 .   ? 6.559   6.578   -6.951  1.00 25.18 ?  402 HOH B O   1 
HETATM 1834 O O   . HOH D 3 .   ? 16.228  3.702   6.569   1.00 28.47 ?  403 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   THR 2   2   2   THR THR A . n 
A 1 3   THR 3   3   3   THR THR A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   ARG 6   6   6   ARG ARG A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   ASP 8   8   8   ASP ASP A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  ASN 10  10  10  ASN ASN A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  GLN 13  13  13  GLN GLN A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  ASP 17  17  17  ASP ASP A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  SER 20  20  20  SER SER A . n 
A 1 21  GLU 21  21  21  GLU GLU A . n 
A 1 22  PHE 22  22  22  PHE PHE A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  GLU 24  24  24  GLU GLU A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  HIS 28  28  28  HIS HIS A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  ILE 30  30  30  ILE ILE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  TYR 32  32  32  TYR TYR A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  ARG 34  34  34  ARG ARG A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  TYR 37  37  37  TYR TYR A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  ILE 41  41  41  ILE ILE A . n 
A 1 42  PHE 42  42  42  PHE PHE A . n 
A 1 43  GLN 43  43  43  GLN GLN A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  LYS 47  47  47  LYS LYS A . n 
A 1 48  TYR 48  48  48  TYR TYR A . n 
A 1 49  ASN 49  49  49  ASN ASN A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  GLN 53  53  53  GLN GLN A . n 
A 1 54  MET 54  54  54  MET MET A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  CYS 56  56  56  CYS CYS A . n 
A 1 57  HIS 57  57  57  HIS HIS A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  GLN 62  62  62  GLN GLN A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  GLN 65  65  65  GLN GLN A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  THR 67  67  67  THR THR A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  HIS 69  69  69  HIS HIS A . n 
A 1 70  CYS 70  70  70  CYS CYS A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  LYS 72  72  72  LYS LYS A . n 
A 1 73  PRO 73  73  73  PRO PRO A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  GLU 76  76  76  GLU GLU A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  ASN 78  78  78  ASN ASN A . n 
A 1 79  ASP 79  79  79  ASP ASP A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  VAL 83  83  83  VAL VAL A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  VAL 86  86  86  VAL VAL A . n 
A 1 87  ILE 87  87  87  ILE ILE A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  ASP 89  89  89  ASP ASP A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  HIS 92  92  92  HIS HIS A . n 
A 1 93  ARG 93  93  93  ARG ARG A . n 
A 1 94  PRO 94  94  94  PRO PRO A . n 
A 1 95  VAL 95  95  95  VAL VAL A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  PHE 98  98  98  PHE PHE A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 PHE 100 100 100 PHE PHE A . n 
A 1 101 GLU 101 101 101 GLU GLU A . n 
A 1 102 ILE 102 102 102 ILE ILE A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 GLN 104 104 104 GLN GLN A . n 
A 1 105 PRO 105 105 105 PRO PRO A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 ILE 110 110 110 ILE ILE A . n 
A 1 111 ASN 111 111 111 ASN ASN A . n 
A 1 112 SER 112 112 112 SER SER A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 SER 114 114 114 SER SER A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 LEU 116 116 116 LEU LEU A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 HIS 118 118 118 HIS HIS A . n 
A 1 119 VAL 119 119 119 VAL VAL A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 GLN 121 121 121 GLN GLN A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 ARG 124 124 124 ARG ARG A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 PHE 126 126 126 PHE PHE A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 ILE 130 130 130 ILE ILE A . n 
A 1 131 SER 131 131 131 SER SER A . n 
A 1 132 LYS 132 132 132 LYS LYS A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 LYS 135 135 135 LYS LYS A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 ASP 138 138 138 ASP ASP A . n 
A 1 139 HIS 139 139 139 HIS HIS A . n 
A 1 140 ASN 140 140 140 ASN ASN A . n 
A 1 141 PRO 141 141 141 PRO PRO A . n 
A 1 142 PRO 142 142 142 PRO PRO A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 CYS 144 144 144 CYS CYS A . n 
A 1 145 THR 145 145 145 THR THR A . n 
A 1 146 PHE 146 146 146 PHE PHE A . n 
A 1 147 THR 147 147 147 THR THR A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 HIS 151 151 151 HIS HIS A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 ARG 153 153 153 ARG ARG A . n 
A 1 154 GLU 154 154 154 GLU GLU A . n 
A 1 155 ALA 155 155 ?   ?   ?   A . n 
A 1 156 ALA 156 156 ?   ?   ?   A . n 
A 1 157 THR 157 157 ?   ?   ?   A . n 
A 1 158 ARG 158 158 ?   ?   ?   A . n 
A 1 159 ASN 159 159 ?   ?   ?   A . n 
A 1 160 MET 160 160 160 MET MET A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 LYS 162 162 162 LYS LYS A . n 
A 1 163 ILE 163 163 163 ILE ILE A . n 
A 1 164 GLN 164 164 164 GLN GLN A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 LYS 167 167 167 LYS LYS A . n 
A 1 168 ASP 168 168 168 ASP ASP A . n 
A 1 169 PHE 169 169 169 PHE PHE A . n 
A 1 170 PRO 170 170 170 PRO PRO A . n 
A 1 171 TRP 171 171 171 TRP TRP A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 ALA 174 174 174 ALA ALA A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLU 176 176 176 GLU GLU A . n 
A 1 177 GLN 177 177 177 GLN GLN A . n 
A 1 178 ASP 178 178 178 ASP ASP A . n 
A 1 179 VAL 179 179 179 VAL VAL A . n 
A 1 180 HIS 180 180 180 HIS HIS A . n 
A 1 181 MET 181 181 181 MET MET A . n 
A 1 182 HIS 182 182 182 HIS HIS A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 PRO 184 184 184 PRO PRO A . n 
A 1 185 ARG 185 185 185 ARG ARG A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 PRO 188 188 188 PRO PRO A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 LYS 190 190 190 LYS LYS A . n 
A 1 191 THR 191 191 191 THR THR A . n 
A 1 192 MET 192 192 192 MET MET A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 SER 194 194 194 SER SER A . n 
A 1 195 ASP 195 195 195 ASP ASP A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 LYS 198 198 198 LYS LYS A . n 
A 1 199 MET 199 199 199 MET MET A . n 
A 1 200 GLN 200 200 200 GLN GLN A . n 
A 1 201 LEU 201 201 201 LEU LEU A . n 
A 1 202 TYR 202 202 202 TYR TYR A . n 
A 1 203 VAL 203 203 203 VAL VAL A . n 
A 1 204 GLU 204 204 204 GLU GLU A . n 
A 1 205 GLU 205 205 205 GLU GLU A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 HIS 208 208 ?   ?   ?   A . n 
A 1 209 LYS 209 209 ?   ?   ?   A . n 
A 1 210 ASN 210 210 ?   ?   ?   A . n 
A 1 211 SER 211 211 ?   ?   ?   A . n 
B 2 1   MET 1   327 ?   ?   ?   B . n 
B 2 2   SER 2   328 ?   ?   ?   B . n 
B 2 3   ALA 3   329 ?   ?   ?   B . n 
B 2 4   SER 4   330 330 SER SER B . n 
B 2 5   SER 5   331 331 SER SER B . n 
B 2 6   GLY 6   332 332 GLY GLY B . n 
B 2 7   PRO 7   333 333 PRO PRO B . n 
B 2 8   TRP 8   334 334 TRP TRP B . n 
B 2 9   LYS 9   335 335 LYS LYS B . n 
B 2 10  PRO 10  336 336 PRO PRO B . n 
B 2 11  ALA 11  337 337 ALA ALA B . n 
B 2 12  LYS 12  338 338 LYS LYS B . n 
B 2 13  PRO 13  339 339 PRO PRO B . n 
B 2 14  ALA 14  340 340 ALA ALA B . n 
B 2 15  PRO 15  341 341 PRO PRO B . n 
B 2 16  SER 16  342 342 SER SER B . n 
B 2 17  VAL 17  343 343 VAL VAL B . n 
B 2 18  SER 18  344 344 SER SER B . n 
B 2 19  PRO 19  345 345 PRO PRO B . n 
B 2 20  GLY 20  346 346 GLY GLY B . n 
B 2 21  PRO 21  347 347 PRO PRO B . n 
B 2 22  TRP 22  348 348 TRP TRP B . n 
B 2 23  LYS 23  349 349 LYS LYS B . n 
B 2 24  PRO 24  350 350 PRO PRO B . n 
B 2 25  ILE 25  351 351 ILE ILE B . n 
B 2 26  PRO 26  352 ?   ?   ?   B . n 
B 2 27  SER 27  353 ?   ?   ?   B . n 
B 2 28  VAL 28  354 ?   ?   ?   B . n 
B 2 29  SER 29  355 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  301 41 HOH TIP A . 
C 3 HOH 2  302 47 HOH TIP A . 
C 3 HOH 3  303 50 HOH TIP A . 
C 3 HOH 4  304 36 HOH TIP A . 
C 3 HOH 5  305 62 HOH TIP A . 
C 3 HOH 6  306 43 HOH TIP A . 
C 3 HOH 7  307 56 HOH TIP A . 
C 3 HOH 8  308 61 HOH TIP A . 
C 3 HOH 9  309 65 HOH TIP A . 
C 3 HOH 10 310 35 HOH TIP A . 
C 3 HOH 11 311 42 HOH TIP A . 
C 3 HOH 12 312 34 HOH TIP A . 
C 3 HOH 13 313 33 HOH TIP A . 
C 3 HOH 14 314 64 HOH TIP A . 
C 3 HOH 15 315 60 HOH TIP A . 
C 3 HOH 16 316 63 HOH TIP A . 
C 3 HOH 17 317 37 HOH TIP A . 
C 3 HOH 18 318 38 HOH TIP A . 
C 3 HOH 19 319 40 HOH TIP A . 
C 3 HOH 20 320 44 HOH TIP A . 
C 3 HOH 21 321 57 HOH TIP A . 
C 3 HOH 22 322 48 HOH TIP A . 
C 3 HOH 23 323 53 HOH TIP A . 
C 3 HOH 24 324 51 HOH TIP A . 
C 3 HOH 25 325 39 HOH TIP A . 
C 3 HOH 26 326 59 HOH TIP A . 
C 3 HOH 27 327 46 HOH TIP A . 
C 3 HOH 28 328 49 HOH TIP A . 
C 3 HOH 29 329 45 HOH TIP A . 
C 3 HOH 30 330 52 HOH TIP A . 
D 3 HOH 1  401 55 HOH TIP B . 
D 3 HOH 2  402 54 HOH TIP B . 
D 3 HOH 3  403 58 HOH TIP B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1960  ? 
1 MORE         -14   ? 
1 'SSA (A^2)'  12590 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2018-10-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? CNS     ? ? ? . 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALA   ? ? ? . 3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? . 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 112 ? ? -45.11  -10.94 
2 1 VAL A 179 ? ? -141.75 27.85  
3 1 LYS B 349 ? ? -155.38 80.10  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 155 ? A ALA 155 
3  1 Y 1 A ALA 156 ? A ALA 156 
4  1 Y 1 A THR 157 ? A THR 157 
5  1 Y 1 A ARG 158 ? A ARG 158 
6  1 Y 1 A ASN 159 ? A ASN 159 
7  1 Y 1 A HIS 208 ? A HIS 208 
8  1 Y 1 A LYS 209 ? A LYS 209 
9  1 Y 1 A ASN 210 ? A ASN 210 
10 1 Y 1 A SER 211 ? A SER 211 
11 1 Y 1 B MET 327 ? B MET 1   
12 1 Y 1 B SER 328 ? B SER 2   
13 1 Y 1 B ALA 329 ? B ALA 3   
14 1 Y 1 B PRO 352 ? B PRO 26  
15 1 Y 1 B SER 353 ? B SER 27  
16 1 Y 1 B VAL 354 ? B VAL 28  
17 1 Y 1 B SER 355 ? B SER 29  
# 
_pdbx_audit_support.funding_organization   'Swiss National Science Foundation' 
_pdbx_audit_support.country                Switzerland 
_pdbx_audit_support.grant_number           160322 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   immunoprecipitation 
_pdbx_struct_assembly_auth_evidence.details                ? 
#